4KVAA

Gtpase domain of septin 10 from schistosoma mansoni in complex with gtp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
246
Chain Sequence
FVFNILCVGETGIGKSTLLETLFNQKFDFPKLKAVTYDLKKLKLTVVETCGYGDENNIKPVVDYIDNQFENYLQEELKMKRSMQAFHDTRVHVCLYFIAPTGHSLKSIDLVAMKKLENKVNVIPVIAKSDTITKSELQKFKARILSEIQSNEIGIYQFPTDDEAVSETNSVMNQHIPFAVVGSSEEVKTVRVRQYPWGSVQVENENHCDFVRLREMLLRVNMEDLRERTHGVHYETYRRQRLIEMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Schistosoma mansoni Septin Reveals the Phenomenon of Strand Slippage in Septins Dependent on the Nature of the Bound Nucleotide.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Hydrolase
molecule keywords Septin
total genus 89
structure length 246
sequence length 267
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00735 Septin Septin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4kvaA00
1XXHA 3FB4A 3BOSA 2O8FB 4BQSA 4FCVA 1ZU5A 4RD2A 3G82C 2RHDA 1OF1A 2QA5A 4JVNA 5AUNB 5G53C 5JZVA 4KLNA 1P62B 2E9SA 4EPTA 2ZUCA 1Z6TA 3IGFA 2ONJA 1AJEA 5C46F 3PJRA 2ZJ8A 4TL7A 2QE7D 2NOAA 4KITB 3P20A 4HB0A 4B2LA 3RVBA 3OIUA 1ZUIA 2OCBA 1P9NA 1T5IA 2EYQA 4X8MA 3ZIAD 2ZEJA 5B58C 3H4MA 2HF9A 5HZHA 1X86B 5HKKD 2X2FA 2PX0A 1ZC4A 2RGDA 3ETLA 2DR3A 1IY0A 4LV8B 1HT2E 2C5LA 1X1RA 2GHIA 1DO2A 2GCNA 2H8KA 1FMJA 1N0VC 2ZRAA 4RZXA 1NLZA 3J81k 2XSZA 4EPXA 2ASEA 4JLBA 1V43A 1SGWA 2BIFA 1G4AE 5IHPA 2IS4A 1M7BA 2GXAA 5HE8A 3UANA 5CB8A 2ZANA 3PEUA 2QQEA 2FV8A 3PV0A 2ZI3A 1R8SA 1ESMA 4OHYA 4WXRA 1OXSC 3BRWD 3MG9A 5IDVA 1GNPA 4Q9LA 4IJMA 3MJHA 5DI3B 3OE7D 4BLSA 3KQHA 1ZNYA 3E5HA 1IM2A 2ZSAA 4B32A 2BDTA 2BEKA 1P7CA 4IEIA 4UNPA 3ONWA 1ZYUA 2A5FA 1CKEA 1DVRA 1OLOA 2LCFA 4HZUB 2GXQA 3TGPA 3I5XA 1X3SA 4HUTA 4ARZB 4D6PA 2ZRHA 1VCNA 3C14C 3HR8A 4NCNA 3SEAA 3U7EB 2VHJA 1UKZA 2XZOA 2B92A 2W2TA 4HUQB 1RJ9B 2ANCA 4I1OA 2BBWA 3Q7PA 5E7MA 2ZYWX 2OCYC 3FHCB 3ADDA 3C5HA 2WZQA 4DLTA 1G7RA 1GL7A 1LF0A 1Z0AA 3EZ6A 4K46A 1ZNWA 4PC7A 1YQTA 2R6DA 4QJ5A 2WPDD 3MWLA 4DCNA 2V6JA 2R6CA 4LJYA 2VRWA 3KXLA 3TE6A 3QJYA 3HU1A 2AK3A 1KO8A 1N0UA 2A2ZA 2G1JA 2V1UA 4DDUA 4KYUA 3REFA 4US2R 2YWGA 2ZRFA 4OK3A 1FQKA 1KI7A 1Z6GA 4EUNA 5FTNA 4ITRC 2RGCA 5GJWC 5JHGB 1E99A 2GJSA 1DPFA 1GG2A 3GD7A 4PR0A 2P3SA 4NP6A 2W83A 4WZAE 3K70B 5CLLA 1UF9A 4IDQA 5IRCD 4TQUS 5JLJA 1K5DA 1XNJA 1E2JA 4TSFA 3FHOA 1CJMA 2IHBA 4V03A 3W5IA 2WJHA 4Q47A 2BJWA 3SBDA 2XNDA 3AKYA 2YWEA 4B3FX 1N2CE 3ZD6A 1XWIA 4JLPA 2CCJA 2J7PA 3MWJA 1RZ3A 4JT2A 1SKQA 1U81A 2J45A 1AS3A 4TLCA 2IA5A 2FGJA 3C16C 1HQYE 2O0KA 2FDCA 1US8A 4OK5A 2Z4SA 3ZGXA 2BBTA 1E0SA 3AB3A 3CRVA 3GLGA 3QE0A 4D0GA 3U7HB 1BOFA 2QMHA 1A5TA 3DVLA 2QNRA 4ZDJA 1IN7A 1I4LD 4UNNA 1J2JA 5G41A 1KNQA 3LWNA 4P31A 3EX7C 3BK7A 2GBLA 1CJUC 4L16A 1F6BA 4GOXA 1W1WA 4O25A 5FBRB 1EGAA 4D4KA 3O8RA 3FFBA 4BRWA 1CR4A 2J0QA 1KAOA 1MO3A 1S96A 3ZVLA 1TQDA 2ZJBA 1XCPA 1EX6A 2V9PA 3QVVA 5TXGA 2VO1A 4Z54A 1DG3A 2AR7A 3FVQA 3FYHA 4L8GA 2Q9BA 1LS1A 1SQ5A 1XMJA 3RSOA 1U0LA 3AVPA 4IDHA 2ZREA 5JHHB 1MR3F 3NKVA 4EFLA 1NSFA 4GRAA 1TUIA 2GILA 1S9DA 4KBFA 1F2TA 1NF3A 1KI4A 1K6MA 4YMVA 1OT3A 2DFLA 1CS4C 1DBSA 1AN0A 3BORA 3EPJA 1KSGA 1A1VA 3PITA 2OESA 5KU1A 1Q44A 4YLGA 4FMBB 4Y0AA 4EFMA 1GKYA 4G5OA 3PUVA 2FOLA 4UNSA 4W9MC 2XSZD 2QU8A 1OFHA 3WMGA 2Z6VA 3QKRB 4U00A 3QG1A 3PIRA 3I32A 4CT4B 2KBEA 2C03A 3B82A 4LHWA 1EFHA 1EFTA 5FL3A 3AVYA 4HAVA 1JPNA 2E1RA 4PHTA 4Z8YA 2VQSA 4OKSA 2G0NA 2IYYA 1G5PA 4RCYA 2WJYA 3L0IB 2C04A 3NVAA 2GBLC 3RANA 2EU8A 2I4IA 1ZP6A 4A82A 3WNCA 1E2NA 3BFVA 3EIHA 1WB9A 4LC0A 1D2MA 4GI7A 4C3ZA 1RC8A 1NLFA 3U3RA 1T9HA 1QHSA 5AUOB 2DPXA 3K70D 1QZXA 3A4LA 2IK8A 3D7MA 1KDPA 5A0FA 3E2IA 5EE9A 1NP6A 4XIGS 4NYJR 4OHVA 1W47A 2Q0HA 3HDTA 4AY2A 4C9BA 3F5FA 1S0UA 3B1ZA 3L0PA 3BIFA 4MH0R 1RKBA 1R5OA 1XTQA 3WHKA 5DGXA 4EDHA 2QP3A 2WWGA 3LY5A 1Z6AA 1NVXQ 3A1WA 4I1SA 5J4HA 1IONA 5B57C 3CNOA 4PHFA 2J1LA 1YZNA 2C9CA 1XXHE 3QUSA 4RZ3A 5FUWA 3QNUA 1LFDB 3GFPA 3SJCA 4ZKEA 1X6VA 3WBKA 4A6XA 4BZPA 3DPUA 1T3SA 5FR2A 1A2BA 3FFAA 5DIFA 4Q1DA 4MKIA 3A1TA 2HCBA 1IJEA 2XEXA 3UKDA 2O5VA 5L3SB 2Q6TA 3BB1A 3UIEA 1XPUA 3WRYC 8OHMA 4XTCS 3CRRA 3GEHA 4P32A 4I1UA 2IUUA 1G8FA 2QSYA 4DJTA 2OFWA 4Q66C 2FPLA 3TSWA 2BHRA 3CUEF 3T1VA 4MQBA 3BXZA 1DAIA 4OJKA 3PEWA 4LPSA 2QTHA 4HAUA 2PZGA 2CL7X 3QKSA 5EE0A 4QGHA 3LXXA 1EFUA 1S4QA 5FUVA 2OCAA 3U44B 4ZI2A 1PUJA 2QN6A 5JI2E 1NMZA 3BJIC 3GEEA 5GADl 1XPRA 4U02A 1BMFA 3R8CA 3I62A 4X8HA 2O8EB 3DMNA 1QHYA 3LDAA 1OXVA 3NBXX 3TR5A 4DEYA 3RS7A 1GSIA 2ZSBA 1II9A 2ZS8A 4FWIB 4II7A 4KO8A 2V8OA 5GVRA 1NMXA 3L0OA 4EJSA 3VMFA 1Q1QA 4M22A 3ZS9A 4ZCIA 1E32A 2QGNA 3GJ3A 5DHFA 5CDFE 3CX8A 2WPDA 3LFUA 4RD0A 1HE1C 5K8LA 1XEXB 4Q4HA 4Q7MB 4BFVA 1NN1A 2RH5A 5LPNA 1E79A 1F2UB 2VBCA 4N1AA 1OYWA 2VHTA 2A30A 1XX6A 1Q22A 2IYWA 4P4SB 2IBMA 4CIDA 4Q9JA 1E9DA 4P33A 1OB5A 2I3BA 4M1SA 2VIIA 4MGYR 5EXXA 2C8VA 1ZAKA 4JLVA 2FWRA 1Q0UA 3VR3A 4L5BA 3QBTA 4BLRA 3VU9A 4GZMA 3EW9A 4PO8A 4Z8XA 1OH6A 4XWKA 2VP0A 2FU5C 4JBXA 1E9CA 4G5RA 1OPXA 1IY1A 1QG2A 1VKJA 1I2DA 2PMKA 1B0UA 3BC1A 3DKVA 3IO5A 2AD1A 1EK0A 3L0SA 4FMCB 4XVRA 4C0KA 4DLZA 4HZUA 3H84A 4ZPXA 4LRWA 4ARZA 2VLIA 2WKQA 3K0AA 2HYIC 1KMQA 3CW2A 2RGBA 3SQXA 4KJZA 4AKHA 4GOJA 4TYQA 5JCPA 2BC9A 1AKYA 1G9XA 3W6OA 3CRW1 1ZIPA 3HJNA 1NBMA 1QF9A 1JNYA 4NH0A 4BE7B 1LW7A 3NDPA 1XRJA 2EFEB 1E1RA 2HXYA 1EFRA 1GKUB 1QHXA 2H5EA 1XJ0A 1NY5A 1PJRA 4CEIB 1U90A 1WQ1R 3LBHA 1A7JA 4AG5A 4PZYA 2CJWB 4NYIQ 2ZVQX 5DYGA 1GITA 4NBSA 2W0SA 4EKDA 5FTJA 2OE2A 1JALA 4P4UA 4M1MA 4DLUA 3T12A 2XNSA 3KUDA 1JI0A 2JAQA 1VIYA 1T4GA 3WXMA 2ATXA 3RRNA 2F55A 1JR3A 3NEJA 4IXNA 3RS2A 4GNKA 4IHQA 1W5SA 1U9IA 3A8TA 4A15A 3HPRA 4TMWA 1YZGA 4MYTA 5DI9A 1RYFA 3CF6R 4JS0A 1N6NA 5EUQB 2FE4A 3T35A 4B44A 3MCAA 4DB4A 2P0EA 1KHTA 1W0JD 2IYXA 3FKQA 2KJQA 1OKKD 3QF4A 5DN6A 2JLZA 4QGAA 4J0QA 2WJGA 2VTKA 1UDWA 1W0KD 2PJZA 3FGNA 4JT4A 3NDBB 2ZITA 4P0TA 4LBZA 3TSOA 4AD8A 2CL0X 4WZ6A 1RRGA 4W5HA 1KNXA 5FL7A 3OZXA 3QSYA 2O8DA 4KAXA 2VSXA 1F3OA 1XXHB 2BMEA 3SBEA 2F1RA 4Q9IA 1E9EA 3VNVA 2H1LA 2DBYA 3SE0A 4PPNA 1N5IA 3ZZUA 4F92B 3LBNA 2GCOA 1UPTA 3H0KA 1I2MA 4TTPA 4FXPA 4US1R 2ANBA 1G8GA 2V7QA 5JWRA 4W5WA 2F1HA 1XTIA 5DHAA 4CGZA 4OQXA 5FPSA 1CJVC 3CH5A 3CO5A 3DM9B 3GQBA 4R98A 1IN6A 3NBFA 1SXJD 1UEIA 2Y8EA 4DCSA 1MV5A 1SVMA 3EG5A 4OBEA 5FTLA 5TB5A 2JCSA 3SJAA 2XOKD 1M2OB 1J70A 1WF3A 5JI3E 2ZTSA 2ZRBA 4B74A 4FD2A 1E2DA 4MKHA 4JJKA 2ZI7A 3THXB 5LD2B 1C4OA 2DCUA 5FPKA 1Z3IX 1PV4A 2W6IA 3KB2A 4OHXA 5AJWA 3IDQA 1Q20A 4Q1FA 2J0VA 5EXTA 4HYYA 1W46A 3IO3A 2HDNB 1AA9A 3ZDQA 5FOXA 2NO7A 3FOZA 3CLVA 4W7SA 3DDCA 1NIJA 1Z0JA 2AD5A 4JLOA 4D4LA 4DDWA 2ZUDA 1G18A 2D2FA 1OXTA 3WYGA 3K0SA 1CF4A 2WSMA 4Q9HA 3K0CC 4S2EA 4PXAA 2VHCA 4NTZA 5ANRB 2FN4A 2QENA 4Q21A 3I8SA 2YINC 3OIYA 1GNRA 2O8FA 3NH9A 3AF4A 5EP1A 2QL6A 3RABA 4M1TA 4NONA 4HUQA 5FPTA 2IW3A 2OM2A 5JS7A 1Q3TA 3SYNA 4A6PA 1G3IA 1Z83A 2XOKA 1FOEB 1MKYA 5HE9A 3VHLB 5CB6A 1SXJA 4E22A 3GLIA 2VEDA 4I1VA 5HCIA 4Q1BA 4KFTA 5L8VA 3A1SA 1D2EA 2V7QD 3IHLA 3OEHA 3ZQ6A 1ZVQA 2IUTA 1BMFD 1Z07A 2F9MA 3VR1A 1KAGA 3ZD7A 5TV2A 2GJ9A 3AVUA 1E2KA 4JMPA 2OUKA 4KV9A 4ZI3A 3PENA 3TW8B 3THYB 3BH7A 3D31A 3KUCA 3P26A 2CL6X 3N5CA 1FX0B 5JEEA 1XMSA 5FI1B 4ACBA 1YZUA 2QT0A 4RKEA 1DEKA 3U6BA 3UPUA 1WBBA 1MO4A 4TMKA 3ICEA 4PC6A 5LB2A 2O52A 3R9XA 3NH6A 4BLPA 5C18A 1NVVR 1B23P 4Q7JB 1P61B 1CR0A 2B7CA 4JJZA 3EZ7A 3T5GA 1XD2A 2D7CA 4URVR 1E4YA 2VPPA 2A5YB 5JJLA 1C1YA 2W00A 1NMYA 3LA6A 1E0AA 3SOPA 1TEVA 3F8TA 4PQRA 3GLFA 4GP7A 5TARA 1JR3D 1HT1E 2V54A 1LV7A 2WOOA 1WE2A 3X1DA 5JMTA 3NWJA 1L4YA 1XTRA 1KSHA 1MOZA 1N6RA 4HAYA 5CIWA 5L3RA 4A0GA 3GJ4A 2J46A 3DEFA 3FMPB 2XZPA 4F4JA 3VQTA 1TL7C 2FMXA 5AUQA 3MMPA 3Q85A 2C2HA 2F3TA 3I3SR 1W2HA 1V5WA 3D8BA 2ZRCA 2YC4C 1E1QD 1Q3HA 2BM0A 2DWOA 4BFSA 1QRAA 2JDIA 3SFVA 3KXIA 2DHRA 2R6FA 5FPHA 4EJSB 1Z28A 2GAAA 5C4GB 5F98A 3R8FA 3TUIC 3EZ2A 1AGRA 2QP9X 3EC2A 3IIJA 1NBMD 4UJ3A 4KFRA 1FQJA 5KUTA 2A3RA 4DSUA 3ZVNA 1S1CA 2PLRA 2FA9A 1COWA 1T5LA 4P3YA 3IIMA 4RVCA 3LVRE 4L9WA 2IF2A 3QBVA 2OLKA 4A4DA 2CHVA 3IKJA 5C4MA 2QPTA 3WYAA 4X8LA 2JJ2A 4OQNA 2G88A 2JJ1D 5DE3A 2KB0A 1X1SA 4FWTA 1OH5A 3A6PC 4AWXA 4UKDA 2IUSA 3LBIA 2JIZA 2ZR7A 5GJBA 4DT1B 3RWMB 2MMGA 2LKDA 2YVUA 1KY2A 3RC3A 4QHTA 1UKYA 2BMJA 1CEEA 5FOUA 4Q9KA 1CULC 3TJZA 1PLJA 3UWOA 1AIPA 2FFHA 1SZPA 3K0CA 1FNNA 1QHHA 2NPIA 5HPYB 3UG7A 3IQWA 1ZW6A 3T5DA 4M2LA 4DSNA 5D3MA 5E3HA 3TSZA 2F43A 1OE0A 3K0AB 1ZM4A 621PA 1QBKC 4OHWA 2CK3D 2ODWA 3O47A 4LBYA 3AF1A 3PVSA 5EJEA 2GWHA 4LGMA 1MT0A 1SXJC 4ZKDA 1VPLA 2XB2A 2IWHA 2D2EA 4DZZA 3KQLA 2G83A 5CIQA 1GIAA 3K9GA 3CWQA 3BS4A 5K8UA 1ZIOA 4PZLA 3MWKA 2B21A 3K53A 4D82A 4CF7A 1U0JA 3CIOA 3LX8A 2CLCX 1KMHA 4RSGA 4KBGA 2F6RA 4NCKA 5HCNA 4ZV4A 1RE0A 1E2QA 3QF7A 4B71A 2HXSA 5BQ5A 4C0QC 1RVDA 1KO1A 2IYUA 5CYOA 4OHZA 2ONKA 1Z0KA 2CJWA 4PSKA 2QUZA 2V3CC 1ZM7A 2X77A 2CXXA 4A2QA 3EAQA 1ANKA 1VG8A 3ICQB 4UNQA 1E0JA 4TLAA 1W2GA 2N42A 4HAXA 3SU8A 2MSCB 2N1BA 5EE5B 1E2HA 2WWYA 1JXMA 1KI1A 1N6OA 4B3CA 4EAQA 4LJ4A 2NO1A 3SN6A 2P6RA 4ESHA 1UBCA 4BPBA 5J4YA 2CNWD 1E2PA 3PFIA 2ZSFA 2P2LA 3AKCA 3ZYCA 4DCVA 2ZE6A 1DARA 4Q01A 1KI8A 2OILA 5G40A 4BFZA 3NBYC 2YNMA 4G5GA 4TL9A 1JQLB 2EFGA 3HPQA 2IHYA 1TQ6A 2XGJA 2QPAA 5E95A 5FOSA 4ZDWA 2IXFA 4DVGA 1D5CA 5FBWB 3SS8A 3WY9A 5KDOA 1UAAA 4O2LA 4EFNA 1SXJE 4GL2A 1DO0A 1KJZA 2O8DB 3CPJB 4V0KA 1AS0A 4LJ7A 3DZ8A 3KKOA 4JIMA 5DSZA 1ZNXA 4TZ0A 4LDJA 4I99A 2ZRJA 2F7SA 2RKOA 1YKSA 5J47A 3SC3A 3AUYA 1YVDA 2ZR9A 5KO2A 4MKFA 1GM5A 1GDDA 4TMTA 1FTNA 5G3ZA 4C0JA 4A36A 1TEXA 4ON9A 4UXIA 5AR1A 1KI9A 1A82A 4URWR 1JAIA 2FG5A 4Q4HB 4BZXA 3UG6A 4A8JA 2OLJA 4LUCA 2HUPA 4LYFA 4PC1A 4QL3A 2J3EA 5A4JA 2GESA 3DM5A 3TAHA 2ZJOA 1Y3AA 4YONB 5L3SA 1L8QA 1N5JA 4Q4LA 3X1ZA 1PVOA 3SYKA 4RD4A 2G3YA 1IN5A 1Y63A 3C5CA 2ZETA 2ZYTX 3OE7A 4KHZA 1W36C 2D3WA 4HB3A 1HURA 3PUXA 5H70A 3KX2A 4B6EA 2JJ1A 4R9UC 5KDDA 2P5TB 5JSZB 4LBWA 2JJ2D 2FZ4A 2H17A 1TMKA 3TKLA 2ZRNA 2GAOA 2ATVA 4OYHA 4V02A 3GCGA 2O0JA 3K09A 3LAWA 2J0SA 2Q9AA 1X8JA 1PUIA 3FMOB 4JKIA 4URXR 1H8EA 4MYHA 3U44A 4C0SA 1EWRA 1XD8A 2OV2A 2PEYA 3IILA 4RKFA 3DKPA 2AWNA 4HDCA 5FI0B 1KJWA 1PLLA 4WW0A 2GVDC 3RS5A 2V1XA 3ZIAA 5L3QA 1KI6A 1XZQA 1Z0DA 4IVRA 4AG6A 4DLWA 1ZM9A 1OIWA 1R5BA 1XB2A 1XTJA 4HLDA 4M0LA 4TLBA 4JL6A 4DDTA 1IBRA 2FSIA 2IF0A 5EZ5A 1ZMXA 2J87A 3DOFA 3CBQA 5IK2A 4LBVA 1D6JA 2ZS7A 4EPWA 3NXSA 2DY1A 1OFIA 2F3RA 3GLIB 2XXAA 1T91A 1G5RA 4HLUC 4NCIA 1WDTA 4Q19A 5KOYA 1HEIA 3M0EA 2CMKA 5K8TA 3FMIA 4QBFA 3KJEA 2DFNA 2CCKA 2OFOA 1J7KA 4NZYA 4HLQB 1Z6YA 2IYTA 4MRNA 3BH0A 1XEXA 1R8QA 1TPZA 3A4NA 3VR4A 5CK4A 4C4PA 4XVUA 4CYMA 3FTQA 1JQJC 4XWAA 2CDNA 3IHWA 4BWYA 3CKLA 3CX7A 2CNWA 4WA7A 3VR2A 1FX0A 4RD6A 4G5SA 4YDSA 2WICA 1KDRA 3KJGA 4MRPA 3W90A 1G6OA 4QRHA 4NMMA 1G21E 2EFHB 2R62A 3A37A 3EIEA 1MRSA 2PEZA 4BFWA 1EESA 2PJRA 2QMOA 1CLUA 1U99A 1ZD8A 4C7OB 3AF2A 1XFAA 4JBYA 1DAHA 1NSTA 2WHXA 3LQRA 5TVKA 1U2RA 1TADA 2BM1A 3TRFA 4OI2A 4RJLA 1VG0B 3QF4B 1IY2A 4CZ2A 5EP3A 5UKDA 2DWQA 1X8LA 1C9KA 1WMSA 3TK1A 2GK7A 3WNBA 3BFXA 6Q21A 4IW3B 1AM4D 1XMIA 3OIVA 4PZZA 2FSGA 1G8HA 3B9QA 5DLQC 4AK9A 3X2SA 4KFSA 2ORWA 3ECCA 3C8UA 3OEHD 3HWSA 3RNLA 3KTAB 4JVLA 3W8NA 5JBQA 3AVQA 2R2AA 4PPFA 4RCZA 2VL7A 4XVQA 1GAJA 4G01B 4GBMA 4TWZA 4M8NE 1IOZA 1VCMA 2A5DA 4XTRA 5CITA 2WTUA 2ZJZA 3KB1A 1TF7A 3OAAA 4HATA 4NYJQ 3U61B 1GUAA 1EX7A 4K81B 4MGIR 4DHEA 4JLKA 3GJ7A 4NHOA 2NZ8A 4WXPA 4Z51A 4DCUA 4PSAA 1TQ4A 2H92A 2K5UA 2ZJAA 1D2NA 2IC5A 4KVGA 4QGFA 1LTQA 1H65A 2IYLD 2JIZD 5FUYA 4QNMA 1KKLA 1KOFA 2OBNA 4A92A 2V4ZA 1TQ2A 3QEJA 2Q21A 2DYKA 5AWFC 5SZKB 2NGRA 4YMUA 2REXB 2IEZA 4XOIA 3W9YA 3UXMA 3RS4A 1CR2A 1TNDA 3MAAC 2ZM5A 5DISB 3V9PA 1M6NA 1TU4A 2A5GA 1CIPA 1MO5A 3TUZC 3CWZA 3ASZA 4LJ5A 4DT1A 1COWD 2EVWX 5CK5A 5AJZA 5KSPA 3T1OA 1ZJ6A 1XEWY 5FOVA 5J4VA 3EIQA 2ZR0A 3B85A 2JLRA 2DFTA 1XMVA 2P6NA 2JLWA 3W6PA 1E96A 2RGEA 2B8TA 3GJ6A 3QXSA 4TL6A 1HUQA 4QOSA 2JA1A 1N5LA 2W2VA 2FGKA 2ZJ5A 3ADCA 4D26A 1FUUA 3O8BA 5JS8A 2KSQA 2EQBA 2BEJA 4FMCF 3F3YA 3NTUA 3SZRA 1G1MA 3K8YA 4L9SA 1FNMA 2GCOB 1J99A 4YXWD 1G7CA 2W6JA 1U94A 4XD7A 3PUWA 4JLMA 2GKSA 1NVUQ 1RFLA 1P75A 1UDXA 4C2TA 4B3GA 5CJPA 1BH2A 1YZQA 3WMEA 4AKEA 3KQUA 1E0KA 2EFDB 2OAP1 4IOLA 4PFSA 4D2IA 4EQ6A 1G3MA 1FUKA 3K9LA 2W2XA 2AKAB 3K0FB 5HTKA 3N2IA 2LWIA 3OF5A 5FOTA 4LHVA 3FWYA 4ESVA 2KI5A 1J8YF 2VF7A 1XEWX 2D4HA 2JLVA 2CHGA 1FL9A 3U5ZB 4CEHB 4IVPA 3U7GA 5TDHA 2XAUA 4XSHA 4HAWA 2P67A 4Q1AA 3AVOA 2GJKA 1SHKA 3I73A 4IFEA 4P4TA 4TQ9A 3LH5A 3LRPA 4G5QA 5BN5A 5IT5A 3U4QB 1VYVA 1G8PA 3N70A 4FCTA 3KKNA 1R7RA 3ZZTA 5JEDA 1QHGA 1JJVA 2QAGC 2IX3A 3VFDA 2REBA 3QVUA 2UZIR 5HZKA 2ZVPX 2WMNB 1KYIA 1XD9A 2QSZA 1XDBA 1OJLA 1UM8A 4QNRA 4TSFD 2O8BA 2YOGA 3THOA 5K8IA 4LV6A 2CCGA 1N0WA 4ERNA 1ZBDA 4IOKA 1VDZA 1NKSA 5JFGA 2YWHA 4GPTA 4PAOA 3KJHA 3GPLA 2IYZA 2QEQA 3PUYA 3VKGA 2OAQ1 2WM9B 4RZUA 4TYPA 4IDNA 1DE0A 2ZSEA 3TNFA 4GZLA 1XF9A 4JL5A 1DAFA 2IS6A 1T8UA 1XJCA 4F7WA 2QROA 3NC1C 3V00A 2GETA 2XJ9A 3T1QA 4ZCMA 2B7BA 3N2EA 2OZEA 3RYTC 1WP9A 3GLIE 3RSLA 3RRYA 4FCWA 3VR5A 4B3DA 2XZLA 4B3BA 1ZCAA 4MYCA 2GXUA 4KI0A 2VP9A 5J5CA 2ZUBA 5EQTA 4DB2A 4DRZA 2YOFA 4Q5IA 4O3MA 2WSSD 3F0TA 1GKIA 5KSOA 3L8YA 4OI4A 2ZRLA 1U8AA 2ZRDA 4URZR 4E09A 5G3YA 3P4XA 5GJCA 3WNDA 4JLNA 5EP2A 3A1VA 2WJIA 4FI3C 5D3QA 3LNCA 1HTWA 2ZI9A 3I1FA 2QRNA 3JVUA 2HT1A 2W58A 4D81A 1II0A 1NN3A 2OXRA 4A8JB 5BN3A 1UBGA 4M4SA 3CONA 1EFCA 4A1FA 2C78A 2C99A 2Z5FA 4EIWA 1II8A 2W6ID 3ZJYA 2OBMA 1I4TD 4OQMA 1N6IA 3VX3A 4Q4AA 4AYWA 2YZ2A 2Z43A 4WVFA 1BYUA 1UKVY 1G3QA 2FNAA 1CJTC 3ADKA 2J0UB 3O8DA 5GJVC 4A2WA 1SVSA 3HP1A 3QPVA 5FBLB 3K9NA 3H2YA 3MSXA 4IVQA 3EARA 1S9HA 3B13B 2NQ2C 4IEEA 1M1YE 4TT3A 4LHZA 1E2FA 3DZDA 1ZRHA 2WSSA 1ETUA 3QXJA 1YZLA 2WWIA 5HKKA 2J41A 2JEOA 1JEDA 3LLUA 3GJ8A 2ZQ5A 4QHYA 2HJVA 5FR1A 3KKPA 3HYTA 2GF0A 5D3MB 4H1UA 1RW4A 4BFXA 2JDID 3W5JA 2PX3A 5CM8B 4I4LA 1BIFA 2ZPTX 1KI3A 1JXOA 2WBLC 3B9PA 2ZRPA 3THWB 2CLSA 5AJYA 1UKEA 5JJKA 2OT3B 4MA4A 1W4BA 4US0R 3R20A 4JLJA 3EPLA 4XSGA 3IBGA 1XU4A 3GLHB 3BERA 1T8TA 4HB2A 4MRVA 2XXAB 2FZLA 2HJGA 2BMDA 4DLXA 3LD9A 2VH5R 1ZNZA 1FPMA 4V0MA 5E4FA 2BV3A 3GEIA 4G0NA 1P9WA 3Q5EA 4X8OA 2D06A 2AWOA 3M1IA 2VA8A 2ZJYA 4MYUA 1XTKA 4GP6A 4BRUA 4TQAA 3KJIA 5AJXA 4NCJA 3GJ5A 1HY3A 3AVWA 1W36B 4V0NA 3BH6A 2OEPA 2I1VB 2ZJ2A 2JLYA 3BGWA 4IFBA 1Q1BA 2CVFA 4B2IA 3LW7A 1KTVA 2ZRIA 4NCHA 4C7OA 3K1JA 2F1JA 3KKQA 4DSTA 4FN5A 3CF2A 2WOJA 4JBWA 4HLCA 3A4MA 4V0ME 5CJ2A 3TIFA 4A0FA 3AM1A 2CEAA 3G5UA 2FSHA 1QHHB 5SZIA 1QHIA 1NG1A 1T6NA 2GK6A 3FKSA 4G1UC 5AJVB 1R0WA 3MUFA 4D4MA 2QBYB 2J5XA 4D80A 1P4SA 4BZQA 4ACAA 1VG1A 5SZHB 1T3LA 2F43B 3SFZA 4MGZR 1VG9B 3CPHA 3IBYA 1U8YA 1XTSA 1GWNA 2QAGA 3DO6A 3G0HA 3CR8A 2N46A 1GRQA 1WBDA 1SXJB 3GJXC 3P32A 1EWQA 3B2EA 1VECA 3SDZA 2QTFA 5AUPB 2A78A 2O0HA 3AF3A 4LJ6A 1E9RA 1IHUA 1MABB 1KMHB 1AZSC 1QG4A 4H9GA 4PAQA 1E2IA 1Z5ZA 1G8YA 2PZFA 5KHOC 2A9KA 2H16A 1OHHD 1S3SA 1E3MA 2IS2A 1QHNA 1O87A 1P73A 2GDJA 1OB2A 1Z22A 5TY0A 3B6EA 3SJZA 1SHZA 4IDPA 4Z1MA 4FIDA 3X1WA 1ZINA 5KNDA 1ELOA 4WZBE 4Q1CA 2ZYVX 1Z06A 4RFSA 2QMEA 3WP1B 3CX6A 2IYQA 2ZS9A 4FW9A 3AUXA 3FHTA 1XEFA 2WV9A 3HYRA 4IOMA 4KSCA 1IXSB 2IYRA 3RRZA 3TBKA 1P2UA 5LB4A 4YMSA 1E79D 2I1QA 4JL8A 4OQFA 5BWMA 4TT3D 3KXKA 2PL3A 5FBQB 4JLAA 1TF2A 1AK2A 1XD2B 4RFVA 5E7JA 2GZHA 2ODEA 2D7DA 4ZIRA 1K8RA 3IPXA 2WWHA 3UATA 4BFUA 4CEJB 2CBZA 3VHXA 3AH8A 4F4IA 1KDOA 4NYMQ 4DLRA 2C9OA 4RY2A 2ZU6A 1UADA 2J7KA 3EWAA 4D4JA 1P9RA 2XB4A 4TL8A 5LDDC 1GNQA 1GP2A 3D6TB 1NLYA 1CR1A 3DHWC 3CH4B 1YZKA 2RAPA 4MKGA 1ZD1A 4ABYA 3TH5A 2B6HA 1E4VA 1MO6A 2QQ0A 4Q02A 3MLEA 1S2MA 2ZIAA 1T3HA 3M4YA 4MUAA 4CRWB 1XCMA 4PC2A 2D62A 4NKRA 3W34A 2FH5B 3WP0A 1YR7A 4A9AA 4M21A 1KK0A 4B6FA 2O8CA 5LBIA 3KQNA 4QGGA 1G3RA 2IWRA 4C0AC 2HCJB 2ZRGA 3K0FA 1NJGA 4ZDIA 1OKKA 1W0JA 4F4CA 3UMSA 1KY3A 4Q18A 5HR5A 5JJIA 2A7QA 2ZI4A 3HR7A 4EPYA 5KSZA 4QC2A 1KK1A 2YKGA 1ONBA 3GJ0A 4M9SA 3VNUA 4M1KA 3LXRA 3I61A 1G20E 4RD3A 1JEEA 2PLFA 3QXCA 4M53A 3KL4A 3CM0A 5H1YA 1FMLA 2BMFA 2YV5A 1U0HC 1TUEA 1E69A 4NU0A 5JSZA 1TAGA 4M9QA 4PO1A 4M9ZA 2Z83A 2DFKB 3W3AA 4LC1A 1GL6A 2HEIA 2GTPA 3SI7A 2UZ3A 3Q9LA 4E03A 2C77A 5J4KA 1Q12A 5IK2D 2EFCB 3EPKA 3P4YA 3A36A 5FUXA 1E1RD 2AHOA 3X1YA 2ERYA 4DSOA 2RCNA 2WWXA 4AIIA 4FMDB 2AK2A 4TN1A 1GFIA 2WWWA 2QI9C 2BWJA 1RJ9A 1ZD9A 5L3QB 2QM8A 3QI2A 4PTLA 4AURA 3KTAA 1Z6XA 2AX4A 1NI3A 4KLZA 3KFXA 2ZRMA 1U9IC 4RZ2A 2YC2C 2RGGA 2BKEA 2CE2X 3EA5A 2HF8A 4XH9B 4KFUA 3DMDA 2XX3A 4LWZA 1A4RA 1R4AA 3W6NA 1DAKA 4DEXA 3L82B 1IN8A 2PMDA 4QJ3A 4QG7A 4CW7A 3OFND 1R0ZA 4PPGA 3AKEA 5CM9C 1S8FA 4XD7D 1CBUA 2VYFA 5M04A 4GDFA 4YXWA 2F9LA 1N5KA 3T06B 4B47A 5KSYA 3KFVA 1E2MA 3GLFE 4N0EA 3UWKA 4B75A 5BN4A 2IYVA 1AQUA 3UMFA 3T15A 2VP6A 4B3XA 4BLTA 4JLDA 1GVNB 1E2GA 4HSEA 2ZAOA 1DELA 2BVNA 2QP4A 2VP2A 4GT1A 2XTZA 4QFMA 3AVVA 3P1JA 4MGKR 4Q4AB 3QPUA 2RGNA 3AP2A 5F9HA 2PCLA 4ZCLA 4MDEA 3AVXA 5SZJA 4WIAA 4AYTA 2EWVA 4HI0E 3IIKA 4YDHB 1SVIA 1LB1B 4GOKA 1KKMA 1KIMA 2JLXA 1N3BA 3O8CA 3SJBA 3EC1A 3LLMA 4NDZA 3L8ZA 2QZ4A 3RDPA 1J90A 1JBKA 4FMDF 3U3JA 4QKQA 4QM7A 1IAQA 4LYAA 4U5XA 2NO6A 1NJFA 3B1VA 4M9XA 3I92A 4DKXA 2IL1A 3GLGB 2ZROA 3HU3A 2CVHA 4TLDA 4O0MA 1DADA 2QRZA 5JRJA 1HQCA 1VYUA 3E1SA 1VYTA 4Q4JB 2FF7A 2GZAA 1VHLA 3UK6A 3LQQA 2QG6A 3S1AB 2RB4A 3UMRA 1IN4A 1T0HB 4UXJA 1M7GA 2WMOB 1Z2CA 1L4UA 1P3JA 1VTKA 1GRNA 2X8AA 3NHAA 5EUMA 5FFMA 5J40A 4B76A 2PBRA 1SULA 1WA5A 1O3YA 2D74A 3ND9A 4TLEA 3WYFA 3OAAD 1K5GA 1E9AA 4F91B 2NTYC 3MFYA 3QXXA 3MWYW 2QGZA 4GMDA 4A0RA 2GXSA 2RGAA 3U7FB 2QTVB 1JR3E 1SVLA 2PCJA 4B33A 3BBPA 3R7WA 3WMFA 4C0BA 4PPQA 5JECA 3KDSE 1IXRC 3IUYA 4MUBA 3PR1A 3EWSA 1ZCBA 2GF9A 5F3WB 2X2EA 2XNDD 4R71A 4B43A 2G0TA 4TTQA 3VAAA 4W5JA 4LI0A 3IEUA 1YR6A 1PLKA 2WWFA 3LW8A 4D0LB 3OESA 4DLSA 1DG1G 3DL0A 4AKIA 4DXAA 1G6HA 2HYDA 4A2PA 5ELXA 4PC3A 1F60A 3IPYA 3EA0A 1R2QA 1W48A 1P60A 5DI3A 4YMTA 2ODBA 4TYWA 3VR6A 1E2EA 1E6CA 3QXHA 5FH9A 2IS1A 4GFDA 1OYYA 5DYIA 4GMXA 3B7GA 3KKMA 2NIPA 2Q9CA 3ZVMA 3MGCA 3T1TA 2AL7A 4Y0VA 1WCV1 4DUGA 1BKDR 3EXAA 4TTRA 1DOAA 2BBOA 1QVAA 1KSJA 2AKYA 4LOAA 1OXUA 2YHSA 1KI6B 4OL0A 3JVVA 1VMAA 1XP8A 5B30A 1HYQA 3QY0A 4N0DA 5KNCA 5L3VA 3TMKA 2YYZA 3AKDA 3C15C 5C1BA 3KQKA 1OXXK 4DDVA 5FPYA 3K9HA 1VIAA 2OO7A 5EP4A 2VP5A 1N6LA 4EQ6B 1D9ZA 2C95A 3B1WA 2A5JA 3AGQA 1E94E 4JZKA 121PA 1Z8FA 3W3ZB 2GEDA 2AFHE 2V55B 3Q3JB 1VHTA 1H8HD 3TAUA 3DOEA 1E98A 3RWOA 3TUJC 4MITA 3ADBA 2YOHA 2WKRA 4LY6A 3PEVA 4DBLC 5BYKA 5KPDA 1ZUNB 3IQXA 3B5JA 3LV8A 5KTYA 1AGPA 3K70C 1CU1A 5BYJA 2EW1A 1Z63A 3T34A 1H8ED 2NO0A 3VKWA 3L43A 1DTSA 2GJ8A 4A0HA 2IEYA 2PT5A 2IXGA 5F2EA 5H68A 4B73A 4UXHA 4TZ6A 1Q57A 3A58B 3CZPA 1AZTA 1FW6A 2R9VA 4OI0A 2O8BB 3QG5A 2ZE8A 1XBTA 2ZSDA 2C96A 1LY1A 1TX4B 2FX3A 1G19A 3E70C 4BGDA 4BLQA 4E5UA 2VHUA 3SHWA 3GLHE 1LVGA 2G9NA 2C98A 1W4CA 2R44A 3CRMA 2IXEA 4UQOA 1M7HA 1UEJA 3AF0A 1Q21A 3AV0B 3MJRA 4DIEA 5FTMA 2H18A 3SR0A 1OW3B 4LYJA 2GJAA 4Z1MD 5BW8A 1FZQA 4ZO4A 2R65A 3MRSA 4WAUA 1Q1ZA 2ZRKA 1Z0IA 1CRQA 2ECKA 3FDIA 3PCRB 3EZFA 2P5SA 1G3UA 1OHHA 3Q8XB 2JGNA 1UFQA 2JASA 2QAJA 2O8EA 1TU3A 4UNRA 4EPVA 2JLUA 3R9WA 3WRXC 4YC7A 2HT6A 4E07A 2WKPA 4IKEA 3QOFA 3QENA 2GCPA 1AKEA 2UKDA 1MH1A 2VSOA 3EASA 3LX5A 2FJUA 3H1TA 1D8TA 2REOA 1GILA 2BCGY 4WBSA 3RRMA 721PA 4OJQA 1W7AA 1G41A 1HV8A 4CT5A 4NE2A 2R6AA 2ZXUA 5KPJA 3RHFA 1GL9B 1HA3A 3REGA 2WIBA 2WVJA 1RRPA 1KO4A 2XITA 4O2RA 3PXGA 4QBGB 2Q3FA 4C0LA 1I4DD 4DCTA 1ZM2A 4V0LA 2BKUA 5JWHA 1KJYA 1Z0FA 2KBFA 1JECA 3ND8A 2J7PD 2GEUA 3WBJA 2QM7A 3OEEA 1TTTA 1GOTA 4PAMA 4UJ5A 1YR8A 4KODA 1DAMA 2AXNA 2KWIA 2ZI6A 1MRNA 1BO6A 3EZ9A 3U2QA 2IYSA 3B1XA 2MSEB 3CF0A 4D0NA 4XWOA 1NN0A 1NVWQ 3QKRA 5JWOA 1W49A 4AI6A 3ASYA 1JJ7A 2GVZC 2CLDX 1G291 4OQLA 5EZ6B 2P65A 3NHBA 2OSBA 5EE1A 5DNYB 3ZZ0A 4BFTA 3TLXA 3VU9B 3FPAA 1US8B 4C30A 4C0HA 3RC8A 4IDOA 2RGXA 4JSTA 1VCOA 3MD0A 1OFTA 1YRAA 4TMZA 3LVQE 1Z47A 1JR6A 1OIVA 3TVTA 1LNZA 3VTKA 2RHMA 4CVNA 2Q3HA 1LS6A 1W44A 2VP4A 1RYHA 4JYBA 4LJ8A 1YU9A 2JLSA 3CPEA 1UBFA 1GTVA 4LHYA 2BCJQ 4JYCA 1SKYB 2ZE5A 3C7KA 1P72A 4HDQB 4LHXA 821PA 2QY9A 4DLYA 3B78A 4KYIB 5IF9A 2J9RA 2OG2A 1OH8A 1U8ZA 2H57A 5FTKA 3B1YA 5FBVB 3Q5DA 1OV4A 3K0EA 4IOJA 5EXSA 5KDLA 2FPMA 4M1WA 2DWPA 3D3QA 1MABA 4D25A 1OFUX 2BOVA 3U3OA 5H8WA 4CEIA 1F2TB 4LYHA 3FE2A 2X1VA 221PA 4YMWA 1YE8A 2TMKA 3SQWA 4CEHA 2X19A 2VSFA 3I5YA 2PZEA 4URYR 1IXZA 3OHMA 1HH4A 2CK3A 2WAYA 1CP2A 3A1UA 1XCGB 2H7VA 4H1VA 4QBHA 1W36D 3NC0C 5DH9A 3AP3A 1XJQA 2GNOA 2OCPA 2DB3A 1OIXA 4R2IA 5JRZA 3U4QA 4HEJA 4PQYA 4DIDA 2HLDD 1S3GA 3QIAA 2CE7A 4L4UA 5B2ZA 2YWFA 1YHNA 2IT1A 1NVVQ 3BB4A 4LZZA 4KCGA 2ZAMA 4LK2A 3BFKA 2ORVA 1G64A 3CNLA 3TQCA 4NPHA 4JSYA 4CDGA 3GP8A 2ORIA 4C2UA 2EWWA 2LKCA 3NG1A 4URUR 4I81A 4B48A 1UBEA 4BFYA 1NNEA 4Q48A 2FPKA 2PT7A 3I4LA 3RS3A 1CTQA 4DWJA 4F38A 4MDFA 4CEJA 2WAXA 2QBYA 1GZSA 1SVKA 5TMPA 3OFNA 1KGDA 1FP6A 2QMUA 3KZ1E 4FINA 1CJKC 3AP1A 4MRRA 3QQ5A 2NPFA 3QKSB 3I8XA 1SVWA 1NN5A 1NIPA 1NL3A 2V6IA 4PO9A 2P6UA 1N6KA 3JZMA 2QE7A 3QPWA 3ZVRA 4QM6A 3CRQA 4WOPA 2CHQA 1P6XA 4Q4JA 5BXQC 2QAGB 1L7VC 3C4JA 2AFIE 1N6PA 3U60B 1P5ZB 2Z4RA 3ZS8A 3AEZA 2VF8A 3S1AA 4QBIA 4R2HA 1E9BA 2HV8A 5FL7D 1RRFA 3T61A 1M8PA 1X8KA 3W8RA 2JLQA 4LJ9A 4HB4A 1R0XA 2Q3MA 3SYLA 3V4RA 5E7IA 4POAA 3C41J 1W0KA 2JATA 4LPKA 5F9FA 4TYYA 1F5NA 1N6HA 4PSVA 2O8CB 2ODNA 1G5TA 4JKYA 5DN6D 4M1YA 1E1QA 3SNHA 2NMVA 1JB1A 3GMTA 2AXPA 4PQFA 3U3MA 3CZQA 1UJ2A 1M74A 3R7WB 3IEVA 1AQYA 2J59A 4RD1A 4YQFA 1F2UA 4Q1EA 2ERXA 3BB3A 3JZAA 1II8B 2NG1A 4QJ4A 2RMKA 3FKSD 1R5NA 1ESNA 4KU4A 3ZQJA 2NO9A 2J0UA 2JJ8A 1S1MA 3OIWA 2WJVA 3LO5A 1G4UR 4Q7KA 3QKTA 3BE4A 4TMVA 4OI1A 3NIBA 2YJTD 2FSFA 1W5TA 1W4AA 1WRBA 2ZE7A 3I72A 3BWDD 3VX4A 1NY6A 4ZIRB 2VHQA 5KYKA 1AS2A 3H86A 3OEED 4TYNA 3GFOA 1EFRD 4L15A 1KK3A 1P2TA 4JVMA 5DO9A 3R9IA 1WXQA 5AK0A 1F48A 3VKHA 4K8OA 4KXFB 1J8MF 3U6KA 5FOWA 4LCBA 2FFQA 2R6GA 4Q03A 1CRPA 2C9YA 1NRJB 1VCIA 4PX9A 5GVSA 1YZTA 3THWA 3TW4A 3EPHA 4B34A 2QPOA 1ODFA 1E2LA 2FFAA 3CNNA 1RIFA 1ZM3A 4AYXA 4R7ZA 4BLOA 2G1KA 3WHLA 1DS6A 1D9XA 1U98A 4N3NA 1XZPA 2EYUA 1JAHA 2OHFA 2MMCA 4ASUA 3GLHA 3SHFA 1DAGA 1RPZA 4TMXA 2W6JD 4LV5B 4XJXA 1P2VA 1Z08A 2AN9A 1R0YA 2OBLA 2BJVA 1R6BX 3QKUA 1FP7A 1Z2AA 2ZI5A 1LF5A 4JVSB 1KI2A 4HAZA 1FFHA 3THYA 2QT1A 1XPOA 1QDEA 2Z0MA 4LX0A 4MRSA 4BEBA 1KSFX 4B2PA 4P4SA 4V0OA 1IQPA 521PA 4HLUA 5EXPA 2ZU0C 2UVQA 1DAEA 2HLDA 2GZDA 3ZH9B 1RRCA 5CDFA 2GRJA 3PG5A 3Q72A 5C2JB 1KDTA 2RGNC 1YRBA 4BEJA 3BD9A 1G17A 4BECA 1N25A 3M6AA 4LJAA 5EE3A 4NL4H 1TF5A 2FEMA 1R10A 1L2TA 4NYMR 2MSDB 3NBZC 4AKGA 4DC9A 1M34E 2WJJA 3TQFA 3V4FA 1GRRA 3PUZA 2XTMA 3B60A 3CB4A 1G16A 3AQ4A 3K09C 3GLFB 1BYIA 3FMFA 1W4RA 2F1IA 4OK6A 3RAPR 5KNBA 1G7TA 1SKYE 3RLFA 1E9SA 1KK2A 2G77B 4Q7LA 4AC9A 4ASUD 1H8HA 3ZLJA 4QHSA 1IJFA 4G3XA 1KO5A 4QXAA 4ZDKA 4PHGA 3GLGE 4Q00A 1KZGB 4KSBA 1ZC3A 4EPRA 2NZJA 1A2KC 2OFXA 2QORA 3L2OB 1NKTA 1SVOA 1ZU4A 4LSGA 4S35A 1EG7A 3BAFA 3P27A 4GSYA 1ZUHA 4F93B 2W0MA 1OSNA 3NEYA 1CXZA 1G7SA 1Z29A 3B8HA 5LD2C 3HU2A 4A8JC 4IRUB 1KO7A 1Q1EA 4HDOB 2KE5A 4DUGD 5A5GA 5P21A 1PZNA 2XJ4A 4EJSC 2L0XA 1NBME 3GFTA 2G6BA 1E9FA 4NYIR 4RFSB 1YJ5A 3PQCA 1KZ7B 2ZYUX 3THXA 4BASA 5JCZA 5B64A 3TVDA 3PEYA 1QVRA 2WIAA 2B8WA 4PANA 4PHHA 4B35A 2XTNA 5J4LA 2GA8A 5CYPA 1HE8B 4HZIA 4KVAA 2PH1A 1FTSA 4U7DA 4DLVA 2BBSA 3CR7A 3X1XA 1EXMA 1JPJA 2E87A 2FEOA 4IXMA 3RS0A 3TR0A 421PA 4BUJA 2GEVA 2SHKA 4ILEA 2OXCA 5CLQA 3AGPA 1OH7A 1BS1A 1T0JB 1YR9A 1NG9A 3AVTA 2FFBA 3U3KA 3QEOA 4M1OA 3Q7QA 1P2SA 2R8RA
chains in the Genus database with same CATH superfamily
1UPCA 3IEXA 3RAGA 5CAEA 2JGEA 1XXHA 3NPAA 4AS1A 5F33A 5FA5A 6AT1A 2HEGA 4FCVA 1M2GA 2G8LA 3AY0A 3DLHA 4RD2A 2RHDA 1LPAB 2N47A 5E6RB 4ZVPA 2HJSA 2QN7A 6REQB 4XGQA 4DBZA 2ONJA 1PTJC 2UYYA 3DUFB 4RJKA 2XE8A 1NAIA 1N7IA 1OYOA 2SKEA 2ZUEA 1HMPA 1N3YA 2CB0A 5FWAA 5CDHA 2NOAA 1D1QA 3TLAA 4HB0A 4JP8A 4N03A 4O0LA 4BVBA 3GQBB 1PVDA 3EPPA 4XQCA 5JD6A 1CUBA 1P9NA 1T5IA 3ZIAD 5B58C 2R85A 2BRUA 2GKOA 4AZ3A 3JSAA 3SQMA 2QTVA 3G2MA 1X86B 2GM9A 5HKKD 1T5HX 1AUVA 2IYPA 2PX0A 1EFDN 2RGDA 2X2FA 3C8HA 3CB2A 2X9QA 2DR3A 4YMHA 4MMXB 1AUOA 2AJDA 1C30A 1X39A 2C5LA 2JVKA 2NU9A 2H8KA 3GMSA 3DULA 5IABA 2ZRAA 3CEPB 4XIIA 4CM9A 3ZK7A 3MVEA 3PICA 4EPXA 3UAOA 2BIFA 4J3NA 4UARA 5DM0A 3VDQA 1U2PA 4CKEB 1T5DX 3BSSA 3EGDA 3PV0A 1M9NA 1R8SA 2PZBA 2X8JA 3EEBA 5CFNA 4JLSA 2Z8YM 5ITWA 1BCSB 4OHYA 5D5HA 2H9AA 1OXSC 4UULA 4Q9LA 2WDZA 1GPLA 3E53A 3G68A 4FGLA 1UK6A 4YS6A 4E88A 1PBNA 1Y7TA 1QNFA 4E46A 3E7XA 1IM2A 4B32A 2BDTA 1LZLA 1RPNA 2OL4A 1P7CA 4IEIA 4WLFA 3KC2A 2C2ZA 4LXXA 1G55A 1ZYUA 2LCFA 1CKEA 1OLOA 3BCHA 3IJ5A 4PZ0A 3DB2A 1RC0A 4ARZB 4C3OB 4LNHA 4HGYA 4LW8A 4NCNA 3A1CA 4PYLA 1IWOA 1TUBA 3NXKA 4G1VA 4GGMX 4A1OA 5K9ZA 3OC6A 1GGFA 5DZSA 2A7XA 3DDSA 2AE1A 1WPQA 4L0DA 5E7MA 1JHZA 2VQ3A 3HWX1 4MIOA 3TQRA 4ITUA 5C52B 2BGRA 3RIYA 3C5HA 4J6FA 1U5BB 2WZQA 1OTHA 2G71A 1GL7A 1BN6A 4QJ5A 1YQTA 3F3KA 4K9KA 2WPDD 4DCNA 2EJVA 2IXBA 5BMOA 3PQ4A 5THXA 1XTVA 3UBTA 2AK3A 2FMKA 3DVAB 4LXUA 2A2ZA 2G1JA 2Q9UA 4GP9A 3QX3A 2JJQA 3REFA 2YWGA 2YIDA 1N77A 1CP3A 3LIPA 1W94A 3E0XA 4IIXA 4ALLA 2HA6A 3H05A 2P0AA 3GD7A 1EGQA 1L7RA 2P3SA 1LBHA 4Y98A 3SSOA 2EP7A 3K70B 4DVJA 1UF9A 5H3HA 4IDQA 2W2LA 1IBLB 1PAUA 4FGJA 2IXAA 4H7EA 1E2JA 4Y6LA 5KEIA 3CY6A 1V1MA 5LZ9A 1Y8CA 1CJMA 3JASA 1E63A 3BRCA 5HIJA 3TCKA 3ACBA 4MX8A 2BJWA 4C29A 3SBDA 3AKYA 3Q6NA 2Q29A 6GPBA 1TKAA 2OOKA 4Z3OA 2JHFA 4EI9A 1XWIA 2HCFA 1WUJS 2J7PA 3MWJA 3A06A 4WLNA 4ETMA 3NJ8A 1SKQA 3B6IA 1A4IA 5J5CA 3S4YA 3ZC3A 2EHJA 4KR6A 3F4BA 3UJHA 4BMDA 4JBHA 4IX1A 4MA0A 5HDBB 5A0VA 3V1NA 3JARA 1T2UA 3LWDA 4OK5A 4REQA 1CK4A 4UUPA 5IWCA 3SR4A 3WYEA 2DETA 2EC5A 1DUVG 2E2WA 3AB3A 3OZWA 3IDZA 4OSPA 4WVLA 4Z3DA 4B6QA 3O4IA 3PUHA 2O2YA 3DP7A 3U7HB 1VE7A 1BOFA 2QMHA 4KUHA 2X3YA 1B1AA 4JI5B 3VISA 4ZJPA 4O1HA 3DHNA 3R3VA 2QR3A 3H17A 5T6BA 4UNNA 2RBKA 3AEUB 1J2JA 1VIDA 3TX2A 1CNEA 1LTKA 1Z9BA 3M82A 4P31A 1R4NB 3IDAA 2H6EA 1XLTA 2E4VA 4OFXA 1IDOA 3RBXA 4KL8S 3ZDDA 4GOXA 5EKTA 3L07A 5FBRB 2JS7A 4D4KA 5JSQA 3FLBA 4KPGA 2J0QA 2O50A 4Z53A 1KAOA 1QFYA 3DE3X 3OFSA 4Q4DA 1S96A 1ZGCA 2J3QA 2Y1FA 4GZ3A 1R0RE 1QFZA 2HMWA 3QVVA 1VSBA 4Z54A 3FVQA 1VJ5A 4RY9A 1U0LA 4FDAA 1PZXA 2YN0A 4R3NA 3ZWXA 4BX9A 1MR3F 3AHHA 3VBCA 5JHHB 3U19A 4J0CA 4XIYA 5ALDA 1NF3A 2C7PA 2AZ4A 3CJTA 2PUBA 1Y1RA 3AHCA 1A9RA 4OLFA 3PC8A 2I8LA 1V16A 1Q17A 2WTAA 1OT3A 2DFLA 3IH5A 1CY6A 4XKJA 1ZK4A 2PWBA 4RF5A 3V2UA 4CUKA 3QU2A 3WYDA 3BAZA 5DGHA 3F47A 4HRAA 2GRUA 2IW1A 4G8JA 3WKAA 4Z7QB 2NAFA 1FSSA 2Y1WA 2PA3A 4DR3B 4DQDA 3C85A 4E5DA 2EKDA 1V37A 3GBVA 2GZRA 4CM9D 1PU2A 5CDSA 5EQDA 3QG1A 5CD9A 1VL0A 4XSVA 3ZEIA 1YGYA 3RSFA 1HGXA 4B3HA 4BQQA 4KXLA 2XYHA 3AVYA 1TCCA 3G7NA 5JZ9A 4PHTA 5FJJA 4Z8YA 3E23A 4Q3DA 1DKNA 2IYYA 2D54A 4RCYA 1T0IA 1L9KA 3ISJA 1TB4A 5K3SA 3RANA 1F1BA 2EU8A 4A82A 3DYVA 4FOSA 1NP7A 1Z2DA 3CJRA 1E2NA 2PZKA 1L5ZA 4DS3A 4F9GA 3S70A 1GEGA 4C3ZA 4DAOA 3H65A 1NLFA 4U2CA 1T9HA 1PGNA 4XCXA 3BHIA 3EF0A 4A16A 1TMOA 2A86A 3R7SA 5AUOB 4RXUA 2DPXA 1DEOA 1E3DA 2W4QA 5ECWA 4R51A 3R0VA 4UZFA 2AUMA 1A0OA 3FWKA 1MJGA 1RKQA 2QTNA 1KDPA 2JFYA 1Y6JA 4JOCA 4CMJA 5EE9A 5JZBA 1KEKA 1IB0A 1RI3A 3KEQA 2YY7A 3I05A 3UB3A 3TLMA 1GPNA 1W47A 2FWMX 1J7JA 4FFSA 4RORA 4X63A 2C57A 4F06A 3P9CA 1P7ZA 1U1GA 4C22A 5AVTA 5EJGA 4MH0R 1EHYA 1DMRA 1P8AA 5EJ8A 1R5OA 2R751 3A6LA 1XTQA 3OWOA 4CWAA 1VDMA 4KPUA 2WWGA 4QYWA 3LY5A 1WXXA 1Z6AA 4M0FA 3IXQA 3P2OA 3WWZA 4EGFA 2PGOA 2ZWPA 4XQ9A 2BGUA 1MB4A 1D7AA 3DFIA 3H11B 3TW8A 2Z9CA 1X0VA 4QYIB 3CNOA 4PHFA 1A77A 1YZNA 2J1LA 3OETA 3QA9A 3RVJA 3AOGA 3BF7A 1XDGA 3V1YA 2WDPA 3K1YA 2NTJA 2JHPA 2H4YA 1KZ9A 2ORYA 3WO1A 1G8SA 1SB8A 4IIDA 5EPUA 4WEOA 2IELA 3FDFA 3PDJA 3ZIUA 4H15A 2C3OA 1EDOA 2CLFB 2HI0A 4MKIA 3G7UA 3E05A 4GO1A 4BAUA 4TVBA 1N92A 2XEXA 3UKDA 2J9FB 5BOSA 2BZ0A 1LLFA 3CG4A 1D6SA 4RGQA 4W1PA 3OQ1A 3UIEA 2P3QA 2Q4OA 5DBIA 4XVCA 2IFTA 3GEHA 1PRYA 1JDBB 3DOUA 4EK9A 1VB5A 4Y67A 4F2HA 2PX8A 4OSEA 1G8FA 1CDZA 2G70A 5C7LO 3QUCA 3UWMA 3VR4D 3BXPA 4Q66C 9LDBA 2FPLA 3TSWA 2BHRA 3CUEF 1U28A 3N1UA 1HF3A 3JWPA 3PEWA 1CZLA 4LPSA 4HAUA 2PZGA 2R4UA 2CL7X 2Y77A 1E0DA 1Y8RA 4JB2A 1Z4PX 1CUHA 5EE0A 4QGHA 4TOIA 2Q07A 4BWFB 2L2QA 1S4QA 2AQIA 4OIFA 2GX6A 3AESB 3JZIA 1RYMA 2QN6A 4KE8A 5CW1A 5ES3A 1NMZA 1VJGA 3BJIC 3NBMA 5I9MA 5JI2E 3UMMA 5GM2A 1XPRA 3I62A 3DMNA 2QUIA 4L3WA 2C59A 4Y9TA 3RSCA 1GPUA 1DT3A 3GN1A 3PK0A 4YVFA 1RZVA 2ZS8A 4FWIB 4II7A 5DGCA 4KO8A 5GM1A 5HBRA 2ZTVA 3ZLVA 3EHEA 2COUA 4AJNA 5J2TA 1YA4A 2I76A 2JFGA 1FP4B 2QTLA 2VP3A 3MBIA 4EJSA 1MC8A 3X44A 3TRKA 2H2IA 1GNVA 3RF6A 5C8XA 3T41A 3ZS9A 1K6XA 4ZCIA 4B4OA 1U8UA 2QGNA 1M8KA 4YMIA 2D1RA 3LQ2A 4E21A 5GIPE 5FPPA 4GX1A 1YL7A 5K8LA 4BFVA 4KYTA 1ZSNA 4ME6A 3V8QA 3U16A 1XGKA 3CNQS 1FXUA 3LWBA 4JC8A 1E79A 1F2UB 3WO0A 5JH7B 4N1AA 1X7YB 3ZWMA 4PLCA 4KO1S 3J7AC 1H2WA 2QLNA 2V97A 1MHTA 4P4SB 4A5SA 1X7ZA 2IBMA 4Q9JA 4RVFA 4BNTA 3CLKA 4PFJA 2F1OA 2ZTLA 4ENUA 4YRNA 3V8PA 1Y1QA 1KEEB 1BFKA 1C1HA 3P8ZA 3UV7A 2CV2A 1JH8A 4RETA 4MGYR 4HCJA 5DOZA 2XCQA 1WP4A 1O1YA 1G8AA 3ETEA 1GGEA 1NJ6A 1RXUA 3O0DA 3UJPA 1EKXA 1JFLA 1ZHHA 1LRKA 3OHPA 4JXJA 4KN8A 2F64A 2HRQA 2XQKA 4YQEA 4BLRA 4EEZA 1HFEL 2FMFA 1YH3A 3EW9A 1IJBA 4GZMA 4LQ4A 3UHOA 3GJTA 4JBLA 3ZBQA 4EENA 3DLPX 4XWKA 1OH6A 2DCMA 4G5RA 4KQ2A 1GDTA 3O4FA 1VKJA 3H3JA 4FMCB 5JC8A 2QLJA 5EPOA 3BZUA 1WAMA 4HWGA 4BX8A 5A3VA 1HWYA 5KVVA 4RA9B 2VLIA 1MF7A 3ED5A 3DDOA 3ETNA 4P3OA 3BJMA 5F7XA 1FRQA 3UOGA 2A9PA 2CXUA 3C3EA 2HYIC 1PGPA 4P7JA 4QBKA 1NW8A 2PYZA 4O8CA 2O2HA 2FSPA 3CW2A 3R41A 2ZKIA 4LDZA 2KQUA 4AKHA 4IIJF 1THGA 4N4AA 4ZQBA 5L3ZA 5B3LA 1BA2A 2G06A 2Q0QA 3LL7A 2B8EA 2NVWA 4NOKA 3DHVA 3BK2A 3D3WA 3WLTA 1ECGA 1NBMA 3QPCA 1QF9A 1NXVA 3OQBA 4LNUB 4YP1A 5KYXB 1NBHA 1C9YA 1V6CA 3D7RA 5FLYA 1LW7A 3UO8B 4TV8F 2GN6A 1E1RA 2V9ZA 4NF2A 2H5EA 2VAVA 1YS2X 4BOYA 1U90A 1WQ1R 3T7SA 5FFNA 3CUYA 3LBHA 4NJMA 3W8FA 5JO9A 2I7VA 1MNQA 2CJWB 3HA2A 1WKVA 2XGMA 4PZYA 2V45A 5DYGA 4ZO9A 3HCFA 3ZUPA 4NZ9A 4G2TA 1GFZA 1YB5A 1I9CA 5KOIA 1JALA 4P4UA 2VKQA 1WUYA 3INYA 3Q2IA 4H3HB 4KUEA 5FI3A 2XNSA 2PSHA 3T12A 2GTIA 4KXUA 1JI0A 2WB4A 1SU8A 3WXMA 2P5UA 3IELA 1M1NA 1YCHA 3NEPX 4OQYA 4WXYB 1ESZA 4I4IA 1YZHA 1W5SA 2Q0SA 5FLEX 4CMKA 3AV3A 5T67A 1AK1A 2JI7A 1R0KA 3E22B 1QHFA 2GERA 1YZGA 2OP0A 1RYFA 3OCUA 4N39A 2PKWA 4TUYB 3UTDA 5CHYA 3HKCA 4CLRA 1N6NA 4FX2A 4IYRA 4B4VA 1L6RA 3R9KA 2PUWA 3E3LA 2W71A 5LOVA 2JFFA 1ECBA 1KHTA 1N2HA 2IYXA 4NMWA 3N59A 5CVEA 3MJEA 1D8AA 2WJGA 4JT4A 1B2LA 5AICA 1NX6A 3IVGA 4JXKA 4X24A 1QF6A 4JUCA 4RA6A 1U1EA 3TSOA 3AUFA 4AD8A 1NE7A 3GDHA 4UM5A 1QUFA 3QY9A 1RRGA 4W5HA 5JSUA 1KNXA 1X1EA 5FL7A 2Q99A 5BSUA 2VSXA 4PWZA 1WZIA 1Y4DE 3WGOA 1XCOA 4YI5A 4Q9IA 3MRXA 1M6YA 5DWDA 3QVLA 3SE0A 4ALIA 2GBIA 3GAZA 3KALA 4RUKA 1G5IA 2ZDHA 3CW8X 3H0KA 4LMRA 5T5QA 4TTPA 4EHIA 1ZR4A 2ANBA 5HGXA 4GWGA 4ZEOA 4BKOA 5JATA 2IEAA 3CXUA 5JWRA 4J2HA 1G6Q1 1W30A 3NWPA 1E6LA 4CF6A 4IGKA 3WV5A 1GA1A 5FPSA 1CJVC 3VYVA 4HMOA 3DM9B 3CO5A 3K31A 4PO3X 5KIAA 4R98A 1SXJD 4FYIA 4FGZA 2VTDA 4MVJP 4OBEA 4BO7A 3K8OE 1FDUA 1Q0SA 3JPYA 3SJAA 5C3MA 5LQNA 1M2OB 2AGVA 1J70A 3ASUA 1AY0A 5IAKA 4K40A 1U3DA 5CG1A 5FWYA 3I09A 3MT7A 1YI8A 5CPFA 2XF8A 2PXHA 4BNMA 1CCWA 2WMYA 4GKBA 2XHZA 4X7PA 3H2IA 3PA6A 3PQ6A 2ZI7A 5H80A 1C4OA 2DCUA 5JCJA 5FPKA 3WTBA 1Z3IX 1PV4A 4HAIA 3HZZA 5AVVA 3AEKB 2W6IA 1TGYA 3CU5A 6LDHA 1SURA 3O03A 5JQWA 2QNIA 5COQA 3EDYA 2HDNB 3S6JA 3LPCA 2QX9A 4XB6B 1RRVA 1ORVA 5LOVB 3CLVA 2FK7A 3F5QA 4L76A 1J2RA 1YVRA 2ETVA 1CZRA 1O0BA 1NIJA 4D4LA 4QQKA 4DDWA 5F23A 3CE6A 4BB9A 5KNDD 4ER6A 3PNYA 1G18A 4PXSA 3DMHA 1CF4A 3Q87B 4MLDA 3T9EA 1FDIA 3EVEA 4JBIA 5BRAA 4NTZA 5ANRB 2XUZA 2VBFA 2FZWA 1OU0A 2QDKA 3E5MA 3FI9A 3OIYA 5E2IA 4ITVA 3TPCA 4WASA 2AOTB 1RYNA 2OV4A 3HGQA 5EP1A 3USCS 3MINB 4D0RA 4EA7A 3ZGZA 4FFNA 4QVGA 2XBMA 1MVNA 3VVCA 1Q3TA 4HDMB 4A6PA 4UM9B 4JCCA 4PCAA 1MKYA 5HE9A 2TMDA 3SBXA 3E4CA 3DL7A 1BG6A 3PDCA 4KAAA 4LSWA 1B0ZA 1UP4A 2PNJA 3RE1A 2X1HA 3KB6A 4GD3Q 4KQHA 4D3ZA 2D2XA 3GLIA 4Q1BA 4CTNA 5AM3A 4YO7A 1WHTA 1XK7A 1D07A 1T1IA 1D2EA 1W87A 2X3UA 3VH2A 4C1BA 4YRMA 3LXMA 4KPEC 2COKA 4OQQA 4KHPB 3IHLA 3RV4A 2BR5A 3ZQ6A 5COAA 4B3TB 1BMFD 4XWYA 4V0RA 3VR1A 3ZD7A 4ZEWA 2ZULA 4BJ6A 1QOZA 3ZXIA 1SG6A 4JMPA 5KNCH 4GLJA 5JC1A 3GPIA 1JEAA 3FMVA 4MO9A 1Z5OA 2PGAA 5DYNA 3THYB 1XNQB 5E6SB 4A7PA 3D31A 3P26A 1Z16A 1L8OA 1T1EA 1FX0B 1LD3A 1G8JA 1KP2A 4YBZA 3II6X 3REQA 5J5VA 4UUQA 3TOCA 2PMEA 1QFSA 4QUHA 5D6OA 4F11A 5FI1B 5BURA 2QOEA 4ACBA 1ZS9A 2F62A 3QWAA 1V1JA 1XUOA 1TI7A 2QT0A 3NX4A 4RKEA 2VCHA 1EVIA 3L7LA 3TO5A 2AOUB 1A9OA 1X19A 1MO4A 1A95A 3EUAA 4TMKA 4NBUA 2Y66A 4DANA 4UZSA 2SKCA 5FWNA 2B98A 5DGTA 2ZB3A 1PW5A 4ND2A 2AG8A 4BLPA 3C1AA 4FBGA 3ZU3A 2YW9A 3PQFA 4RY8A 2WTBA 4FZJA 3TQOA 3UV6A 1KJIA 1YACA 3UEOA 1F8FA 3T1YB 5JJLA 3T5CA 2FCAA 3X1KA 5G4LA 4F4DA 3NNDA 3HA7A 1TEVA 2Q3LA 4JKOA 2NZVG 3T6KA 3O1LA 1EG2A 2FRDC 1THTA 1SY7A 3A1EA 3C3MA 3DMGA 1JR3D 1H2RS 1HT1E 5TPWA 1ADYA 2G5TA 3FWZA 2H5JA 1SIBE 2YWBA 3RJ9A 2I1LA 3HY6A 3CLTC 3HP7A 3KJNA 3LOUA 3RARA 3FNGA 4TTSA 1XTRA 2VUTA 3W8EA 1CZKA 2Y1GA 3OOJA 1DJOA 1MOZA 1WXHA 3A6EA 3AZQA 5CIWA 5L3RA 3OKFA 3GK3A 3HLKA 1NYLA 3DEFA 3FYTA 3PJGA 3VQTA 1J56A 3IKTA 4HH0A 3WYNA 1RHQA 2E89A 2F3TA 3DZBA 3NKLA 1V5WA 4FGSA 3TLYA 1KMNA 1HNXB 1E1QD 2BM0A 2DWOA 3L9WA 3U7QB 1QRAA 3DE0X 1EINA 2DHRA 1JEQA 1FU7A 1VHQA 2H4WA 4JNCA 5C4GB 3R8FA 2PSFA 3TUIC 1PG5A 1SBCA 3WQBA 2QP9X 2H1IA 3O74A 3EC2A 3BKXA 1YIAA 3PFCA 2X14A 4KFRA 4LYYA 1SB9A 2B4RO 3IE1A 4RENA 4ZCSA 4UBOA 4E51A 2PLRA 2FA9A 4N54A 2Q6OA 1ZJJA 3KBOA 3VZDA 2HHLA 3LF2A 4RVCA 3LVRE 7ABPA 3FYDA 5MN6A 1UPXA 3QBVA 1OXBB 1ST2A 4MXDA 4OHKA 4A4DA 5C4MA 3RK4A 2C5SA 3EVBA 4B3SB 4NFYA 5IVPA 3C6BA 2NZUG 4MV1A 4TS9A 4BB0A 2Y1LA 4O8ZA 2CMFA 2G88A 1D4OA 2B6NA 2J9GA 2V74B 5DE3A 3W5HA 4CG2A 2R2GA 3ORRA 4UKDA 2Y6VA 3WFJA 2MSKA 4DEVA 4EUKA 1PQUA 5I5EA 4F4HA 4G67A 2C0CA 2GZ1A 3LBIA 1EDZA 4HRYA 4R1QA 3DAFA 5HUJA 4KN9S 4X6LA 2LKDA 5DMXA 3AFHA 3E3MA 3RC3A 5C8VA 3G5LA 3VVLA 5I6DA 4M46A 5FOUA 1CEEA 3NAMA 1NPDA 2NZWA 1PLJA 3UWOA 1AIPA 1QE0A 3OKAA 2FFHA 1SZPA 4OGGA 5ALMA 2P6PA 3TNJA 1F51E 3G9UA 4Y6PA 4UTNA 3IQWA 1ZW6A 1S89A 1FVFA 5ADUS 1DJLA 2VYQA 1UM9B 4M2LA 2EL9A 5CT9A 5D3MA 5HJEA 2PGNA 3CISA 3I9V6 4NBKA 1DBVO 1IUNA 1FIUA 2IHNA 1OE0A 3BZWA 3IPRA 621PA 1OWOA 3AJDA 2CK3D 4ZOCA 3O2NA 2VCEA 4GQBA 1RHMA 2DGDA 4GF5A 1GSAA 3DHEA 3ND5A 4HGRA 1GTL1 2R60A 2IYOA 3F1LA 4XASA 2H2DA 4RIFA 4G41A 2D2EA 1H5UA 2G83A 1I3LA 5CIQA 4R0MA 4FJ0A 1P5HA 3R3UA 3BS4A 1X9GA 3OCWA 2GDZA 3VJKA 3PF8A 2B21A 2Q1SA 7REQB 1P1BA 3FNHA 2JANA 3GUZA 2CLCX 2X7JA 2XH8A 2I2BA 3DV0A 2WINI 3ME5A 4RSGA 5EGNA 4YJHB 4LCEA 1QQ6A 3RRBA 1MGOA 5TQ2A 2ZIUB 4Y1RA 1GEEA 1TJPB 3KL2A 1PK8A 3E61A 3FZNA 4OUKX 4OHZA 2ONKA 4PSKA 2QUZA 2X77A 1R6UA 3KWFA 2YRXA 3E84A 3GZNB 3QNWA 1T6BY 4A2QA 3O3MB 3FDZA 4BV2A 3MQ2A 4UFNA 1UBLS 2AEJA 2ZJ6A 3ICQB 1XA4A 4FJ1A 3L1JA 5IBQA 1DIGA 3SU8A 2MSCB 2N1BA 2JI8A 3HN2A 1YJ8A 3I5MA 4FFBA 1H2ZA 4C03A 1N6OA 1KI1A 3QWFA 1UMCB 3FR7A 5AI8A 5JQGA 2W22A 4EAQA 5KC8A 1MEOA 3RLIA 2FVXA 4IKPA 9LDTA 4TM8A 4ZVMA 3SFTA 1MJGM 5F5LA 1PJ2A 5J4YA 2CNWD 3BGIA 1P2BA 3D8HA 4WCFA 3VZSA 3O84A 4BX3A 3GOHA 2ZSFA 4W5NA 3ZYCA 3EB9A 4CG0A 3FROA 4Q01A 2OORA 2XRMA 3PGMA 3UJBA 3WWEA 2PYDA 2YNMA 4HV4A 5CH8A 2WHRA 5IN4A 2X1LA 1SBNE 4EQ6A 5AK3A 2XW6A 4PSUA 2XGJA 1GPKA 1KJNA 2EW2A 3D5QA 4E15A 1B6RA 2ZVJA 1O0CA 3SX0A 2OA0A 3IR7A 3KHSA 1VXRA 1C3OA 1D5CA 2ZTMA 3H9JA 4PXYA 5FBWB 2G9RA 4CM7A 2Q6KA 5KDOA 4O2LA 1WL8A 4R1UA 3FNQA 2C88A 2OQRA 4EFNA 2HWWA 3DEJA 3OPXA 5I7FA 5JPDA 2HWKA 1X38A 5CXQA 1DO0A 4GL2A 2PUDA 1M2JA 5LQUA 4ZQHA 5K01A 2X9NA 4V0KA 4EVIA 1AS0A 4ENSA 4UMFA 2MOKA 2YHUA 3TR6A 2ADFA 4JIMA 5DSZA 1ZNXA 3UJ9A 1QIGA 4LDJA 3ROKA 4QE3A 1UXJA 1XRQA 2F7SA 5LXTB 1KA9H 1ZI8A 3BG5A 2E48A 3SC3A 2AX3A 3N7AA 4WNAA 2ZWVA 3L7MA 1PSWA 4PPYA 4Y2JA 4CFSA 2E4ZA 5KO2A 4MKFA 3U9LA 2CBXA 2IDJA 4RJJA 1MAHA 2CJFA 4TMTA 2XUOA 4DSZA 4MVXA 2X2PA 4A36A 1O96A 1TEXA 5ER6A 3IUQA 2IH4A 1KI9A 2EBUA 1RQRA 2NVUA 4OQDA 1N1EA 2B9VA 4IDGA 4Q4HB 3W8DA 1N2IA 1VKZA 4J4TA 2BL4A 1BVUA 3HV2A 3NCTA 2Y4OA 3BA6A 3UG6A 1N9KA 3GZJA 1GUFA 4LUCA 3PC2A 4LYFA 3V8EA 3IAHA 1N7JA 3FRIA 2Q2WA 3NUQA 4HT3B 1XE3A 3VKUA 3DM5A 5DKFA 3TAHA 4TUYF 1EFVB 2ZJOA 1Y3AA 4YONB 3KXDA 5FORA 1L8QA 3X1ZA 2XWBF 4HN4B 1PJSA 3RU7A 5HEKA 2ZYTX 1EK2A 4KHZA 4FOPA 1CUIA 2XLBA 1Z7GA 2WT4A 3PUXA 1OV6A 2QX4A 5GZ6A 3O75A 2C3YA 3RAJA 4CM6A 4BO1A 4HP8A 4YCDA 4B6EA 5KDDA 1GTSA 2P5TB 4LYEA 3HGTA 2J5RA 3AEYA 4NCAA 4MR7A 2H17A 3AB8A 4KACA 3JQ8A 3R6DA 1D0SA 4LRYA 4X65B 1U0OC 1RLMA 1JPVA 1WQ3A 2RHWA 2WTMA 3IDOA 4P5DA 4YACA 4YFYA 5H3CA 1C9NA 5T4BA 4J76A 3TM5A 2ZAGA 4ENPA 1AKUA 1CQZA 4URXR 1H8EA 3B2QA 3ML1A 1E7WA 2FPPA 2NXWA 4C0SA 3U44A 2BLLA 2ZBGA 3Q6IA 4JBGA 3ELBA 3B1JA 5CDTA 4AB1A 2PEYA 1U0BB 2P40A 3E58A 2E4WA 4MKZA 2V1XA 4XX1A 2F3SA 1KI6A 1NXQA 4M0LA 1XB2A 4PNZA 5IM4F 1IBRA 4XJVA 2FSIA 2E85A 4KQXA 3CBQA 5LZ7A 3C70A 1D6JA 2ZS7A 3AI3A 4LBVA 3SX2A 4EPWA 1OFIA 2XXAA 1CS0B 2P5YA 3AJAA 4HLUC 2E55A 2HBYA 2YY5A 4ZGWA 5KOYA 1GAXA 5E1DA 4D9JA 4F1JA 1H2YA 5K8TA 3OOEA 1W9HA 1IPFA 3HJFA 1TCUA 1JLSA 3BH0A 1XEXA 4I8DA 4MRNA 2IUFA 1E60A 4P36A 1QYCA 3KLNA 2BTEA 4UASA 5CK4A 1DIBA 3TRHA 2PPLA 4RVHA 2XTJA 3PYXA 4YRFA 1ONOA 1SCAA 3EG9B 3CKLA 3G8BA 3E9NA 5LN1A 4WA7A 4WKPA 5BN4B 4D9NA 1XRLA 2V7XA 4P2GA 4MRPA 1B15A 5IKPA 1VL2A 2AN5A 3AT1A 2IQ5A 4QRHA 2X3FA 2JBAA 5KJEA 3OTIA 4HPWA 3OQIA 1DZ3A 1WSAA 2EFHB 2FDXA 2R62A 4UU0A 1UMDB 1YQDA 1EESA 1W59A 2LDBA 2XODA 5KQGA 1WNFA 4BKQA 3HB9A 1J0DA 4R1PA 5EWLB 2EDCA 1CLUA 1MCZA 1NURA 2HRDA 2QMOA 4L6IA 1FMTA 4Z9AA 3DOOA 4IM7A 1NSTA 5TVKA 1A9QA 1G5QA 2VNAA 3LQRA 4R16A 1ULBA 4PRZA 2Y2UA 3RGWS 3GQVA 3UKOA 4J0HA 2BHTA 1TADA 3BULA 5DDIP 2VJBA 1Z6QA 3QF4B 5IDYA 5JDIA 3L4EA 1TE2A 2VDWB 2UVPA 2DWQA 1A3CA 1NPTO 4LY0A 4D9HA 4RK5A 1TYDE 2V7UA 3ZR4B 4HTFA 4Q93A 2VF5X 4AJOA 1AM4D 1XMIA 4PZZA 1GCUA 4G8BA 1B76A 5LA6A 1ZH4A 3OEHD 1UBUS 1KVUA 3LKDA 1K7XB 2H2FA 1E3WB 3G13A 5C5DA 1MTZA 4YRTA 4LQDA 4Y3UA 4DQLA 2YASA 4R2JA 4WD3A 4CL3A 2QLBA 4GBMA 1E7SA 1QJCA 3OJOA 3AW9A 1SUPA 2FUG1 1KVSA 2ZWMA 3OOHA 4DIFA 1JU9A 2ZJZA 3KB1A 1TF7A 3N8KA 3OAAA 4TKVB 2WTUA 1GUAA 4MGIR 4RV5A 5CTAA 1LPSA 2JNWA 3GJ7A 5ILGA 5CX1B 2INGX 3ZZNA 1NFFA 2SNIE 1ZXXA 1V9CA 5H16A 1PEYA 4ZVTA 4AECA 4KR2A 3ZU6A 2R25B 4KVGA 1SCIA 3DZHA 4LE0A 2IYLD 3OICA 4M9RA 4G09A 4RAOA 1YBMA 2OBNA 3CQ9A 1QK5A 4OXRA 4XIJA 2V4ZA 4K03A 4CQMD 1OZFA 2VJNA 4FHDA 4KE6A 1FFWA 2DYKA 2Q21A 4KXXA 4QYXA 3WGYA 4PYMA 5HFJA 1E62A 2REXB 2FR1A 3SWWA 4EBFA 1MH9A 2ZUWA 3JQGB 3L4SO 1BAPA 3M5DA 3QVTA 3SAJA 4W5RA 4CMGA 4CI9A 4PVDA 1TNDA 4V1CB 2NVOA 3L02A 3OU6A 5I8PA 2WP0A 1CIPA 4H6XA 3CWZA 3GJYA 4LJ5A 4KR9A 3ZNQA 4PLWA 4CIYA 2XKKA 2B1RA 2WI8A 3TE7A 4F5DA 2AB0A 4XR9A 3EZLA 4MQEA 3EIQA 1KQNA 2IGTA 3OFJA 3B85A 3TJMA 4JJAA 3FN4A 2R68A 3IQDB 1XMVA 1FFBA 2JLWA 5FB3A 1E1MA 4N0QA 5JYCA 3RVRA 1CW2B 3W6UA 1DC5A 3FHLA 4QOGA 1F2VA 3AETB 4C7BA 4QOSA 3PTZA 3L7NA 2Z57A 1S02A 2B2XA 4KUGA 4XYGA 2ZJ5A 1O08A 4X1KA 1A5ZA 1JL3A 2X7HA 4B9EA 4MV6A 3ADCA 3O8BA 5CB4A 1C9DB 1CZOA 2FKAA 2Z5VA 2NP7A 4OQ4A 3E81A 3JAMA 3IUBA 3K8YA 4L9SA 3E9CA 1BX0A 4OB7A 3Q1LA 1JIQA 4YT4A 4FEYA 3DDNA 2GKSA 4S12A 4WKCA 1PQ4A 3ZI7A 2ZTHA 4HXEB 1IC6A 1XWWA 3QW4B 5CJPA 1OI7A 2Q3DA 3F1KA 3U0BA 5A06A 1L5OA 1RWKA 1E0KA 4Z7JA 3GWGA 3EMKA 1LQTA 4PFSA 1I5EA 4KR0A 4Z9XA 4D92A 2GUGA 4R9VA 3GX1A 5LXTF 3LUHA 4Y2GA 3UTCA 3ZCQA 1WPGA 1W5EA 3RNOA 5HTKA 1I7NA 3N2IA 8ABPA 1U7TA 4ZMBA 3A3KA 1ESCA 4DQVA 1NASA 1FUIA 4WLEA 2O0MA 3MTBA 3U5ZB 5B1EA 5L40A 3U7GA 4XSHA 1NVBA 2R5NA 5BSRA 2XZDA 4YJ2F 3AVOA 1ZA2A 2R8ZA 4QICA 4P4TA 5AI5A 4TQ9A 2PL9A 3LRPA 5BN5A 3S81A 2QLFA 2P3OA 1ZRNA 4HN2A 4Q3LA 1G8PA 2A9VA 1MX9A 3KKNA 1C4WA 3WFIA 3TEFA 3A1FA 5JEDA 4R31A 3LK6A 2XEDA 3QLEA 4NFSA 2ZVPX 1ZMOA 4P93A 4WXEA 4BAGA 1KYIA 4YCLA 1XD9A 1TZKA 1K5HA 1KOJA 1XDBA 3EVGA 4HNHA 2E82A 4ONEA 3OECA 1A04A 1FU8A 3EXEB 4A6DA 4DREA 3GRVA 4EITA 3KPJA 3CGGA 1NVKA 2OZLB 4I50A 4LV6A 2RCYA 3SLGA 1YMQA 3ICOA 3UB2A 4EGSA 1CE8A 5IC4A 4YJ2A 3DLBA 4GPIB 3T7AA 4DUZB 4PLHA 4N9WA 4IOKA 2YWHA 4G1CA 5TE9A 4BUCA 3T8YA 1KYVA 3L41A 3GPLA 2J3HA 3AL3A 1DP4A 2WM9B 5AHOA 1JQ3A 2IHUA 1CVLA 3JQ7A 1DE0A 4IDNA 4P5PA 5B6JA 1N1GA 1A9ZA 5JFOA 1N2CB 4R54A 1L3CA 2GETA 1N2OA 4EMUA 2II6A 5DMHA 3HJCA 3T1QA 4Q0MA 3ZTTA 4K6KA 1GADO 4JQYA 1X1TA 3VR5A 1SHJA 5LJLA 2CL5A 1AV7A 2VC2B 4MYCA 4KI0A 2VP9A 5JNVA 1C9JA 5J1SB 4DB2A 2NTNA 5JO0A 1N0IA 3BWVA 4O3MA 3SKXA 4RGBA 4V3CA 3DFZA 3EH1A 1VFPA 3COVA 1JN0A 5IN5A 3P9IA 3I2YX 1RZRA 5B7PA 1JZQA 2WJIA 3A1VA 4FI3C 5D3QA 3RADC 4AJKA 4W9NC 1HTWA 2ZI9A 1VRVA 2PGXA 3O38A 4MVJI 4YK7A 3EOZA 1WQ4A 5T4HA 1H2EA 1RLTA 3K9WA 3UHPA 1RI5A 4TS4A 5I7OA 1TYCA 5CGZA 1SQFA 4J3JA 4D81A 5LP6F 5BN3A 8ATCA 1UBGA 2FEAA 2C78A 2C99A 4NJEA 4H6PA 5FHRA 1GZVA 1L4LA 2OBMA 5FULA 4Y2HA 5T41A 1JG7A 5BR8B 2CB9A 1BYUA 1G3QA 3UT5A 5GJVC 1W4ZA 3PFWO 1SVSA 2D5IA 3HP1A 3OZTA 5AKXA 3NORA 3JR3A 3BCRA 1Y8QB 2JCXA 1WHSB 4DA7A 4E94A 1CDDA 4IMJB 1U4NA 1ZH6A 3OZIA 4TT3A 3LLVA 4LHZA 4ZU6X 4LAFA 2BCEA 3A9TA 1S2IA 4LVNA 1C9MA 2JCVA 3MF4A 2VBGA 2Y1CA 2J41A 3DZIA 1JEDA 4FJ2A 2XAAA 5HKKA 3GJ8A 4MPTA 2ZQ5A 3BIXA 4U9HS 3LP6A 1PQWA 3DVQX 4C4TA 1F2DA 5FR1A 1Y81A 1ZD5A 2GF0A 4BFXA 4RVNA 1V9SA 4NBWA 1SCUB 1JXOA 3JWHA 2E6UX 4NU5A 5FX2A 3I37X 4AF6A 2BAGA 2CLSA 4DM3A 1IVSA 1AUQA 5C9ZA 3VAZA 1Y4AE 1U6JA 5JU6A 2PUJA 4MWZA 3VZBA 2OT3B 1RWPA 4Z1OA 2JIRA 1T13A 2C1EA 4JX8A 4MCIA 1XQ6A 3MWEB 2RI6A 3NBAA 4JODA 4MA4A 4QOEA 3VZQA 2B8NA 4LGYA 4JLJA 5KINB 2NO5A 1XU4A 1WXDA 4XPZA 1T8TA 4MRVA 1XDZA 4KN6A 2HJGA 2P69A 4KRXA 3RC1A