4KVAA

Gtpase domain of septin 10 from schistosoma mansoni in complex with gtp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
246
Chain Sequence
FVFNILCVGETGIGKSTLLETLFNQKFDFPKLKAVTYDLKKLKLTVVETCGYGDENNIKPVVDYIDNQFENYLQEELKMKRSMQAFHDTRVHVCLYFIAPTGHSLKSIDLVAMKKLENKVNVIPVIAKSDTITKSELQKFKARILSEIQSNEIGIYQFPTDDEAVSETNSVMNQHIPFAVVGSSEEVKTVRVRQYPWGSVQVENENHCDFVRLREMLLRVNMEDLRERTHGVHYETYRRQRLIEMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Schistosoma mansoni Septin Reveals the Phenomenon of Strand Slippage in Septins Dependent on the Nature of the Bound Nucleotide.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Hydrolase
molecule keywords Septin
total genus 89
structure length 246
sequence length 267
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00735 Septin Septin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4kvaA00
1DADA 3EPKA 4MGYR 1Q20A 2X8AA 4MH0R 6Q21A 3BGWA 3SYKA 2IBMA 3AV0B 2C99A 4XWAA 2ZRNA 1QHHA 2HLDD 2FNAA 3RAPR 3CH4B 4BZPA 1NVVR 4OQNA 4UXIA 4OHXA 3SZRA 3IO5A 3MD0A 3K0FA 4KLZA 4RFVA 2WJIA 5J47A 4HDCA 3ADBA 2XJ9A 1E2QA 3IIKA 2RGXA 3K0AB 3U3MA 1GZSA 3GJ3A 2QQEA 5J4LA 1NN0A 2D06A 3T1OA 1LS1A 1YZGA 5HE8A 4LJ4A 4TMVA 3O47A 2QM7A 4MYUA 2JIZA 2D7DA 1ZCAA 3UIEA 2WJGA 3NH9A 2X19A 3GLIE 4BZQA 4TT3A 3HR8A 1G8YA 4MGIR 3GEEA 5G3ZA 2IS1A 4IDNA 1S96A 4L9SA 1JJ7A 1OE0A 3LH5A 3OIWA 4PSKA 3KXIA 4FMBB 4B6EA 4Z8YA 3CWZA 4R2IA 3SEAA 3VQTA 4JBYA 3KFVA 2GK7A 3LX8A 4UJ5A 3FOZA 2JDIA 3ONWA 2YC4C 4JLVA 1ZU5A 1IXSB 3DL0A 3NC0C 2IX3A 1KI8A 3BH6A 5FPHA 2D2FA 4TLCA 2FFAA 5EE9A 3GLFB 2FSFA 3N2EA 3I72A 2XSZD 1BKDR 3B2EA 1AIPA 4L16A 1R5OA 3TJZA 2J5XA 4YMVA 1WP9A 1O87A 2ZJAA 3AEZA 1N6KA 3AVPA 4P4UA 1F2UA 1M7HA 2P67A 4WZBE 3KJGA 3EPLA 1R0YA 1OH5A 1S3SA 1CTQA 5KYKA 2BWJA 2ZJOA 4QGGA 4MRSA 3SQXA 4QGHA 1GFIA 5TMPA 5B30A 3UKDA 3DO6A 3IHLA 3M6AA 4KCGA 1CU1A 2PT7A 2DWQA 2QSYA 1R5BA 4BFWA 1K5DA 1S1MA 1OXTA 1KAGA 3S1AA 2HUPA 4KLNA 1FPMA 4Q4HA 1AZTA 1KSFX 2I1QA 1QG2A 4GP6A 4OL0A 3WXMA 1FX0B 4HUQA 4F38A 5J4VA 1EFCA 1Z0AA 4WVFA 3A4NA 2O8DB 4BRWA 3VMFA 1JR3A 1IONA 2JCSA 1YZQA 3VKHA 4G5QA 2JEOA 1CLUA 4UXJA 3FGNA 1YR7A 3EC2A 5LD2B 1E0AA 5FOVA 3C15C 4C0KA 1TU3A 2WJVA 2C03A 4A92A 2XNDA 4TLBA 2CDNA 1JEDA 1IOZA 4JVLA 1KI1A 3BAFA 1RE0A 3CPJB 5GVRA 5HZKA 1I4TD 1KDRA 4O3MA 1KY3A 2O8DA 1LY1A 4XVRA 2QENA 4Q47A 4YDHB 2OEPA 5LPNA 2ZJBA 4WBSA 4DUGA 2A78A 1M1YE 3ZVRA 2YWEA 3QI2A 5EZ5A 2ZSAA 3THXB 2JLUA 1F5NA 2XTNA 2F43B 1OYYA 3LD9A 2C9OA 3CZPA 2KBFA 4MITA 1JBKA 2DFTA 2WSSD 4XIGS 4CT4B 3B1XA 1RZ3A 2FV8A 4NCKA 1ZCBA 2P6RA 1TEVA 3LFUA 2CNWD 1NMXA 1TF5A 1CF4A 1XD2A 1EWQA 2QTHA 2XNSA 3EX7C 2JATA 3QPWA 1FUKA 3A58B 3EW9A 2AD5A 5JSZA 2I1VB 1MABA 1WDTA 3CKLA 5JZVA 2ZSDA 3O8DA 3NHBA 4G5SA 1XPOA 2K5UA 4ZIRA 1E3MA 2ZRMA 1E2LA 4IFBA 1XEXB 1VPLA 2OFOA 2JLWA 4W5WA 1ESNA 3PEUA 5GADl 1TQ2A 1T8UA 3TMKA 4DLRA 1XJ0A 3FHOA 3QE0A 1E4VA 4H1UA 3OIYA 4LHVA 4LPKA 4PPGA 4URZR 5FPYA 3LBNA 2CJWA 4NYMR 1P7CA 3K9NA 1CEEA 1D9ZA 2QUZA 4B3CA 4Z51A 4N0DA 3WNDA 4BLRA 5IT5A 2O52A 4PAOA 4Q4LA 2PCLA 5AUQA 5CDFE 4DLYA 1KDPA 2UZ3A 4LBVA 3B60A 4TL6A 4IHQA 4HZUA 1LW7A 1HEIA 1XEXA 4QBIA 4JLAA 3QKSA 3UMRA 3OEHA 2OAP1 4FCVA 1E0SA 2ZXUA 4QHTA 3EPJA 4NE2A 2P0EA 1G19A 1X1RA 1XD2B 2CHQA 4A8JC 2C8VA 2Q3FA 1DAGA 1N6NA 2BM1A 1XEFA 5FUXA 3VHXA 4BFUA 2IYTA 3LAWA 821PA 2WHXA 3QXXA 5EXTA 4AY2A 5FTMA 2HF9A 2VQSA 1OB2A 2OHFA 1KY2A 3TSOA 3ZJYA 4TL8A 4HLUA 1COWA 2A5DA 4PHTA 2BCGY 4HUTA 2C78A 1IBRA 1J70A 4P4SB 4FWTA 3H1TA 4D80A 5E4FA 3QF4B 1YR8A 1Z6XA 3BWDD 4IW3B 3T1QA 2OLJA 3ZD6A 1XJQA 3X1ZA 1G21E 2BMJA 3AKEA 1GILA 1E99A 1XBTA 2C04A 1XD8A 2JLVA 3IUYA 2AL7A 2NPIA 2IYUA 4EQ6A 1SVOA 2GCPA 3NBZC 4FMDB 1ZM7A 2WWFA 4B74A 1W48A 3GLIA 2IYRA 5TARA 1R8SA 1DO2A 4D26A 1SXJD 3P32A 3P4YA 1VCMA 5LB4A 3ZIAA 3SYNA 4QNRA 4M1OA 1P2VA 4IOMA 1RKBA 2NIPA 2GZHA 1EX7A 1ZD1A 2IHYA 3OEED 4AD8A 3K8YA 1U0HC 1XEWY 3SJBA 3EIHA 1OKKA 2A5JA 2QP9X 1E2IA 1OPXA 3RS2A 3U3RA 1G8FA 1T5LA 2YOHA 4DCTA 4TT3D 1DVRA 2Z4RA 1YE8A 3RS0A 2CVFA 2CK3D 2QA5A 1Q44A 1MO5A 4JZKA 1AS3A 1E9AA 4C7OB 2ANCA 3EZ9A 2E87A 3QENA 1CJVC 1J2JA 4F91B 3K0AA 2BMDA 4RFSB 1D6JA 4V02A 5F9HA 2J59A 1N6LA 2V9PA 4OJQA 1F2UB 2E9SA 4OI4A 2PX3A 3AUYA 3PV0A 2SHKA 3ICEA 4US1R 4RD0A 3D3QA 2D62A 1V5WA 1QZXA 1Z6AA 1H8EA 1Y63A 3SBEA 2W00A 1MT0A 1TAGA 3IBYA 5AUOB 3NBYC 3TKLA 1PZNA 1ZD9A 3WRXC 4LWZA 4I1OA 2XX3A 4TMTA 4TYQA 2ZSEA 3VKWA 2ZRPA 2GDJA 2HYDA 2IYWA 4CYMA 2AFIE 1SVMA 4DIEA 3CB4A 1A1VA 1ZINA 1E2HA 2WM9B 1E94E 4DT1B 3TVDA 3BB1A 1HT1E 4C0BA 3K09C 1P9NA 3RWOA 1XTRA 4B35A 1NNEA 2DBYA 4BWYA 4C30A 2CNWA 2DWPA 2VPPA 2FMXA 5G3YA 4US2R 3OEEA 2EYQA 3OAAD 3Q5EA 4RD3A 1ZYUA 4PO1A 1BMFD 4YDSA 5DLQC 4C0QC 4TZ6A 3H4MA 4MKHA 1U98A 3H84A 2QSZA 3IPYA 3GJ8A 1S4QA 4N3NA 2ZYTX 2X2EA 4WA7A 4LHWA 2V1UA 4MYHA 5D3MB 3UANA 2NZ8A 3U3JA 2NO6A 2CLCX 1N3BA 1G3RA 1KO1A 5JEEA 4NYJQ 3REFA 1UAAA 1RC8A 1VDZA 2XZLA 2WIAA 2BBOA 1XF9A 4B3GA 3X1WA 2RHDA 1GL6A 3AP2A 1OIWA 3KKQA 4NCJA 3THYB 2QN6A 1LB1B 4B43A 3NG1A 4LV8B 4QC2A 1WF3A 1M6NA 4I99A 2GXUA 4BFVA 3L82B 3Q8XB 1ELOA 2R44A 3OF5A 2ZE7A 1AQYA 2O5VA 1A4RA 1IXRC 2HCJB 3HU3A 5BQ5A 4EPRA 3GPLA 2FFHA 3FMIA 4JYCA 4OHWA 1U99A 3K70C 5EP4A 1HUQA 3UPUA 3GLHA 1E2MA 2BJWA 4TMKA 2O8EA 5J4KA 1IQPA 1UBFA 3HJNA 4PO9A 1EK0A 2OCPA 3P20A 1R5NA 2CL7X 3A37A 4JL6A 4Q9KA 3I5XA 1KMQA 1NJFA 1DPFA 2GBLC 1E9RA 1RJ9B 1K5GA 3I3SR 4LYJA 3OZXA 1SGWA 4URYR 2VHTA 3WYFA 2FN4A 1OIXA 1ZAKA 3AQ4A 5CIQA 2ZI3A 2RGCA 1G7TA 1W36B 2WOJA 5EJEA 2XAUA 2VA8A 1XMSA 5IDVA 3O8BA 4X8MA 1M74A 4DEYA 4RZXA 4XOIA 4IOJA 1UBEA 4DLSA 2AFHE 4B44A 3E2IA 1G3QA 4UQOA 3CX7A 5FOWA 1DAEA 2QMOA 1Z5ZA 1DS6A 1UKYA 2NO1A 4KITB 4RJLA 2GJKA 2W2XA 3UATA 4Q1EA 4TTPA 2QMEA 1P9WA 1ZM2A 4PHGA 4NONA 2G88A 4JVMA 5JJLA 4C0LA 2ZTSA 1WRBA 5FPTA 2F3RA 1ZMXA 3U4QA 2NG1A 2LKCA 2HF8A 5A4JA 1P5ZB 3LQRA 2PH1A 3ND9A 1N0VC 2F3TA 2BMFA 4GZLA 5AJYA 1LV7A 3TUIC 3IILA 4MKGA 3EAQA 1AN0A 1QHXA 4MYCA 1L8QA 3ZQJA 3F8TA 5B58C 2WWXA 3VU9B 4JKYA 3NIBA 4ZO4A 1NIPA 1OHHD 4TYPA 2G1KA 3CO5A 4BFSA 1B23P 4OI2A 2EYUA 2IEYA 1Z29A 4YQFA 3AF1A 1W2HA 1OHHA 4TYWA 3GEIA 2JJ1D 2FA9A 4LV6A 4ZKDA 1K8RA 2H1LA 2ZQ5A 4A15A 4CEHB 1AJEA 3ADKA 4GT1A 5FPSA 1N6IA 1KMHB 4TLEA 4W7SA 2X2FA 1W0JA 3CPHA 4LDJA 1CXZA 1Z63A 5TDHA 1FMLA 3TRFA 1AQUA 1R2QA 5GJWC 2QP3A 1OXXK 4QGFA 4AYTA 4CT5A 4BPBA 3B9QA 1TEXA 1Z0IA 1ZC4A 2GJAA 2Z6VA 2R65A 3IGFA 3K0SA 4LC0A 4IEIA 1CR4A 4GOKA 2YWFA 3EZ6A 3IIJA 2GEUA 4I4LA 4JLMA 2C9YA 4ON9A 3SN6A 5F3WB 1XPUA 1IY1A 3EWAA 1F2TA 4M1YA 4MKIA 4AKIA 3KX2A 3A8TA 1Q1QA 4CEJA 1XXHB 5EZ6B 1KNXA 1ZJ6A 3GJ6A 3D8BA 1G3MA 1RW4A 4IVPA 2R8RA 1YU9A 4HZIA 4PC6A 3QEJA 1DEKA 2OILA 4LJ9A 2R6AA 4JLNA 3KQHA 2QBYB 2J46A 3H0KA 4OYHA 5CK5A 4I1VA 3RABA 1XTSA 1I4LD 4AK9A 2C5LA 3X1XA 5AK0A 3ZZ0A 3AB3A 4XVUA 4F7WA 1OB5A 2J0QA 1KI7A 4M1KA 1RRPA 2OESA 5DE3A 1DO0A 2PZFA 1Q1EA 2CK3A 4YMWA 1GTVA 1IAQA 1VCIA 3ZQ6A 1XRJA 3CH5A 3RRMA 1DG3A 5JECA 5DI9A 1QHYA 2VIIA 4JBXA 4LYFA 3REGA 3TNFA 4KAXA 4JJZA 3WRYC 4QHYA 1LNZA 4ILEA 1J8YF 1UEIA 3BD9A 1GL9B 1SKQA 3DPUA 1X8LA 1HTWA 4IJMA 1IN8A 1NVWQ 1EFRA 5EE3A 3I92A 1E9DA 3LWNA 3IO3A 3WHKA 4CVNA 3E5HA 4UXHA 5DIFA 3FPAA 2GVZC 2B7BA 3ASZA 4Q9IA 2QGZA 2VO1A 2Q9CA 2ZI9A 1II0A 1YVDA 1T8TA 4FD2A 1T3HA 4GPTA 5FTLA 2RB4A 4FWIB 4DB4A 4EFMA 2D2EA 2EWWA 3SJZA 2GWHA 4DHEA 3AVYA 1FQJA 4DIDA 3GP8A 3NEJA 3MWYW 4IDPA 3W8NA 4KU4A 4A0RA 4B34A 1US8B 1VCOA 2MSCB 3U61B 2C96A 3FMFA 4PAQA 1M2OB 3T15A 3A6PC 2GCNA 3PCRB 4Q02A 4M21A 2XB2A 1WE2A 4TYNA 2O8EB 1CP2A 2GKSA 1KOFA 4DCUA 1MO3A 1E79D 1EFUA 5JJKA 1E2JA 3VTKA 1Y3AA 3DM5A 2HEIA 2FSGA 4Q66C 3UK6A 4JLOA 5JI3E 3FDIA 3K9HA 1G64A 2BBTA 2J45A 5E7IA 3CLVA 1WXQA 3SI7A 2ZI7A 4I1UA 521PA 3SU8A 2C2HA 2CHVA 3AF2A 4Q1FA 4PC1A 1E2NA 2HXYA 1U0LA 5KO2A 2P65A 3TR5A 4EIWA 5IF9A 1Z2CA 1DAMA 1OFHA 4DDVA 2OZEA 4HZUB 3KQUA 5EUQB 5JWOA 3MWLA 4KXFB 3ZH9B 4YMUA 1C1YA 4ZV4A 2QAJA 4U7DA 1UDXA 3U6BA 4M4SA 3K0FB 3RSLA 4ESHA 3SS8A 4CEJB 2H16A 4TL7A 3LVQE 4BLQA 1G8GA 1XTJA 4Z1MD 2WJJA 4XSGA 2IUUA 1T3SA 3E1SA 3DMDA 2BKEA 1KHTA 4A0GA 3KTAB 1A5TA 3KZ1E 4JVNA 2WJYA 2GZAA 3KDSE 3L0OA 2QPOA 3X2SA 1SKYB 2G6BA 1NLZA 1HV8A 4IXNA 3LA6A 3F0TA 4O2LA 2IF0A 5HCIA 4ZIRB 2IHBA 1S9DA 5HR5A 2W0MA 1JEEA 1QVAA 4LI0A 1N0UA 4EFNA 2GF9A 2IYZA 2GHIA 2ZYWX 2RGGA 4JLPA 3FVQA 1KIMA 3FYHA 5FI1B 4LX0A 4MRVA 4TMZA 5DISB 4S35A 4ZDKA 1GIAA 2VYFA 3AVOA 4OI1A 1PUIA 5J4YA 3OEHD 4GMDA 4U5XA 3CR7A 2AHOA 1E2PA 4HLQB 1FTSA 3AF4A 1OFUX 1W36D 4Q9HA 1GM5A 1IN7A 1W5SA 1EESA 2V1XA 3SJAA 1N6OA 1G9XA 1G5RA 1L4YA 3BB4A 3RS4A 3SR0A 3WYAA 1IN5A 3SYLA 4QFMA 1XMIA 3DMNA 3MRSA 3W6OA 4KBGA 3TR0A 2QY9A 1D8TA 1F48A 2BJVA 2VP9A 4PSVA 3THWA 2O8CA 2PJRA 1V43A 4QNMA 1JB1A 1KJYA 2F6RA 3C5HA 1SXJA 1UFQA 1VTKA 1Z08A 4V0OA 2QBYA 1K6MA 1KZ7B 3WMGA 4M9ZA 4P32A 4GZMA 3RRYA 5AJXA 2IF2A 2VSOA 1Z0KA 1ZUNB 1G8HA 4KODA 4F4CA 2R2AA 4KSBA 1U9IA 2OCYC 2VHCA 4ZI2A 4JYBA 4LV5B 5AWFC 3N70A 3K9GA 3WBJA 1Q3TA 2F1HA 3SOPA 3EXAA 3GLIB 3TAHA 3I8XA 4DJTA 2JJ2D 3MLEA 3RANA 4Q4AA 1Z6TA 4M1TA 1E2FA 1U8ZA 2GA8A 2H5EA 1MO4A 2PT5A 4ZKEA 3HYTA 3M1IA 1TL7C 1R4AA 2HLDA 2VRWA 4PQFA 4IXMA 5C2JB 2XXAA 5FUWA 4LC1A 4L8GA 1T4GA 1KI2A 1OXUA 3V9PA 5KPDA 3OIUA 2D3WA 3AGPA 1I4DD 5J4HA 1P62B 3SC3A 5FOUA 5A0FA 5FBVB 1OFIA 4R9UC 3C41J 2F7SA 1ZM3A 4OI0A 3AVUA 1NLFA 5KSYA 1EGAA 2FFBA 1KO7A 3PQCA 3RDPA 1Z22A 4JLKA 3PUZA 4BFTA 4GI7A 5IK2D 3TE6A 3CNOA 3KB1A 4ZDWA 2QAGA 2PX0A 5KSPA 1VIYA 2HDNB 3MMPA 4Q1BA 3CNLA 1ZP6A 4FMCB 3RS7A 4TYYA 2BDTA 1Z06A 1KI9A 4N1AA 5SZHB 4DDWA 1NBME 4MA4A 2OXCA 5GVSA 4LK2A 3QUSA 1CRQA 1T5IA 1MRNA 2WWGA 5AJVB 4LHXA 4RD1A 8OHMA 2XJ4A 2B8WA 2R62A 3N2IA 3U7EB 2F1JA 2CVHA 4HB4A 2OAQ1 2RAPA 2ZRHA 4D2IA 4R71A 5ELXA 2WSSA 4LHYA 1CR1A 3BJIC 4KVGA 1F6BA 2ZI5A 3HDTA 1ZIPA 1KKMA 3BC1A 1UPTA 3KKPA 3E70C 5DN6D 5AUPB 1D2EA 1G17A 4US0R 4GBMA 1CR0A 1SQ5A 4DVGA 4KO8A 3ZVLA 1GITA 3BFXA 3QXSA 1G41A 3F3YA 4XD7A 4AURA 3I32A 2LWIA 4LZZA 4C2UA 1QHHB 2F43A 5KPJA 2F55A 2PL3A 2VP4A 5K8TA 1VKJA 4O0MA 4RZ2A 4NBSA 3QKRB 3GLFE 2VP6A 1R7RA 4FIDA 4HAWA 4JLDA 4Q7LA 1LVGA 5B57C 1DOAA 3AUXA 2HJVA 2J3EA 3NKVA 2ZJ8A 2GTPA 3FWYA 3K1JA 4NYMQ 3BK7A 1FW6A 3U3OA 5L8VA 5L3SA 2PLRA 3THXA 1DARA 1P72A 3CM0A 3KTAA 2QRNA 1SVIA 1DTSA 1D5CA 1E2GA 4DKXA 5C1BA 2ZRCA 3B1VA 4LY6A 3FHCB 1NRJB 4HAVA 4POAA 2EVWX 2YC2C 5FR2A 5DN6A 4D4JA 621PA 4CF7A 3CRW1 4ASUA 2ZS8A 2Z0MA 2BM0A 3JZAA 5CYOA 3RYTC 3TLXA 4JS0A 4DCVA 1VG8A 3GLGA 5DH9A 3BH7A 2JJ8A 2JJ2A 3A36A 3IKJA 3MG9A 2IK8A 2PEYA 4E5UA 2FU5C 4MGKR 3TUJC 2V7QD 1E0KA 3A4LA 4RFSA 1E9CA 2J7PD 3BB3A 2P5TB 1RIFA 2WBLC 5CIWA 2BKUA 2W2VA 1COWD 3KJIA 4BFYA 2IWHA 3FMOB 2GEVA 4WXRA 1ZUHA 4QKQA 4B2PA 4JL5A 1KK0A 5FFMA 1LS6A 2EQBA 2ZSFA 4TWZA 1HH4A 5L3QB 2FG5A 3UMSA 2XTZA 4A2PA 3EASA 2GCOA 2QG6A 3WP0A 2GRJA 2O8CB 1A82A 1WB9A 2G1JA 2NO9A 2ZRJA 2P2LA 4I1SA 1Q0UA 3W5IA 4ZCMA 2IUSA 1HY3A 4U02A 4LHZA 3SHFA 2WJHA 3BFVA 4D0NA 2YVUA 1US8A 3LW7A 3MCAA 2GF0A 3QEOA 1GKUB 3BH0A 4NCHA 2L0XA 1X6VA 3QOFA 4OQXA 4MRRA 2IC5A 2GAAA 4B3FX 1HQCA 1JXMA 2DHRA 1F3OA 3C4JA 2QROA 1P2UA 1CJMA 3CW2A 1PUJA 2ZSBA 4X8OA 1QHGA 2RGNC 3LRPA 3T1VA 3GLHE 4JBWA 5K8UA 1E69A 1Q1BA 3T61A 5HE9A 3QF4A 2UVQA 5C4MA 2V6IA 4CDGA 1VYVA 1SHZA 1TQDA 4M1SA 3C8UA 4DDTA 1YRAA 3WP1B 2J0UA 1S9HA 2BV3A 4Q1DA 4F4IA 3CNNA 3ZZTA 3K70D 1CIPA 5DSZA 1AM4D 1E1RD 1YR6A 2RH5A 2ZS7A 1KTVA 3OAAA 2XTMA 2ODBA 1W47A 4MUAA 2ZRAA 2QRZA 2OO7A 4QM6A 4NYIQ 1L7VC 2E1RA 3VX3A 4UNRA 3QVUA 2VBCA 1N25A 2IS4A 4CRWB 3P4XA 1NN3A 1LFDB 2Z43A 2IS2A 1R6BX 4PZYA 4NL4H 3A1SA 3AKCA 3L2OB 4GOXA 2IEZA 1F60A 1W0JD 4IDHA 2REOA 1EXMA 4PFSA 2ZU6A 4OHYA 1P2SA 3B1ZA 4IKEA 4Q9JA 2OE2A 4CW7A 4Q7KA 4P4TA 5JHGB 4PR0A 2F1IA 1AKEA 2BBSA 1UKZA 2AXNA 2BBWA 3IHWA 3TVTA 1W4AA 1YZKA 4EFLA 3VR5A 1F2TB 2F1RA 3CX6A 3GFPA 4P3YA 4D81A 1G20E 2WAXA 3D6TB 4G01B 4KYIB 1L2TA 5EE1A 5G53C 1A2KC 2QQ0A 3QNUA 2DY1A 2ZRBA 3QPVA 3WNBA 1XWIA 3H2YA 1Z47A 3IQXA 5FOSA 1W0KD 4FMCF 1GG2A 2PMDA 4KVAA 2KJQA 2ZRFA 4B2LA 4EPWA 5SZKB 2ZVQX 1RYFA 4EJSC 1JI0A 3KXKA 1G291 5LBIA 4HI0E 5GJBA 1YHNA 2Q9AA 1UDWA 4W5HA 2VF8A 1ZNXA 3VX4A 2O0KA 3HPRA 1SVLA 2OFWA 4ARZA 4DUGD 2DFLA 4HLUC 4LPSA 2WIBA 4P33A 5BYJA 1MR3F 2J7PA 1E96A 4W9MC 1VIAA 2FEMA 2ONKA 3FE2A 1AS2A 3NHAA 2GXSA 2QM8A 4O2RA 1S1CA 4LOAA 2EW1A 4V03A 2OT3B 5FBLB 4B71A 1CRPA 5J5CA 1MOZA 3D7MA 5P21A 4IDOA 4Q4AB 1TADA 2ZU0C 2I3BA 3B78A 3EZFA 2ZRIA 2RGEA 4NDZA 2JDID 2IS6A 3KUDA 3U7GA 1JAIA 1EFRD 3P26A 1G6HA 4GRAA 3R7WA 1QHSA 2Z4SA 3N5CA 1R10A 3L8YA 3QKSB 4M9QA 4BFXA 5DHAA 1TX4B 2UZIR 2ATVA 3K53A 3QKUA 1J8MF 4M8NE 2AR7A 2OCBA 3CR8A 3L0IB 5KDDA 4B2IA 5TVKA 3B7GA 721PA 3ZVMA 1D9XA 3U2QA 1JALA 3GLGB 5JWRA 3SFZA 5JMTA 1H65A 2ZJ2A 4Q48A 3W8RA 1E2KA 2AN9A 2ERXA 4TMXA 4DWJA 1IN6A 1XCPA 1P9RA 4DSTA 1HE8B 3A1UA 4G0NA 3W3AA 5CDFA 3AM1A 2ZYUX 3VNVA 3PEVA 1VG9B 1NVUQ 4UNNA 5EXXA 2DWOA 1UBCA 1X8KA 4A2QA 5JS8A 1QHIA 3PIRA 4TTRA 4D82A 3B82A 1U94A 3AKDA 1W44A 4C0AC 2PZGA 1Q12A 3HYRA 2C98A 1VHLA 4AKEA 3FKSA 3WMFA 4PANA 4ZDIA 1KMHA 2RGNA 1E1RA 1P61B 1N6HA 2IYSA 3EZ2A 5IK2A 1M7BA 3CF2A 4GMXA 5JLJA 2IXEA 1YKSA 5C4GB 4LYHA 3T35A 3NDPA 2B8TA 4NYIR 1RJ9A 1NBMD 1J7KA 1Z07A 4NTZA 1N5LA 1UADA 4HYYA 5FTKA 4KV9A 2V4ZA 2P3SA 4FCWA 4AWXA 4LJYA 4D4MA 1KI6A 2REBA 5HKKA 2GESA 4XTRA 3NBXX 2HV8A 2GNOA 4NP6A 3QIAA 1HA3A 1N5JA 1G4UR 2KWIA 3THOA 2G9NA 3A1WA 1KKLA 2YJTD 4FI3C 4A36A 4C3ZA 1TQ4A 3K9LA 2EWVA 1ZU4A 4NKRA 5LD2C 4W5JA 3KQLA 2JAQA 1BOFA 3QXHA 2EFHB 4WZAE 1DBSA 1P75A 2GAOA 2H7VA 2VH5R 4HB0A 5TXGA 3U44B 4LSGA 1M34E 2V8OA 3Q7QA 2XITA 3J81k 2FPLA 3DOFA 4V0ME 4MGZR 4OQLA 1J90A 4Q4JA 4Q1AA 2ZUCA 3I61A 1PVOA 1LF0A 3LDAA 2QAGB 4LGMA 3MWKA 3UXMA 3QSYA 4KSCA 1CULC 2BOVA 3GJ5A 1II8A 2P5SA 4F92B 4RCZA 2JA1A 2TMKA 5G41A 1ZRHA 1S3GA 2F9LA 5DYIA 4P0TA 4Q4HB 1D2NA 2VP2A 1ZIOA 3M4YA 3UG7A 1NSTA 2Q9BA 1DAHA 1H8HA 3GMTA 4EJSA 3R20A 4AKGA 4GOJA 5KDOA 2WSMA 4TSFA 3EIEA 2WKRA 2QMHA 3CUEF 1G3IA 1ZNZA 1GP2A 1H8ED 4TLDA 4B47A 5TY0A 3TQCA 4XWKA 2WWYA 2OG2A 5JWHA 1W0KA 3AP1A 4D6PA 4TL9A 1TQ6A 5DHFA 4GFDA 5M04A 1KZGB 3ASYA 4X8HA 5L3RA 4A2WA 4RD6A 5UKDA 2V6JA 4AYWA 2YYZA 1NIJA 3CONA 2HT6A 3PUWA 4DZZA 2CMKA 2OBMA 3CBQA 3GLHB 3QG1A 2YNMA 3WBKA 2LKDA 1T9HA 1G6OA 4BZXA 1OIVA 4YC7A 3T1TA 2QEQA 3IQWA 1OV4A 4IOKA 4L9WA 2CLDX 3SHWA 2I4IA 4G5GA 2FH5B 3KB2A 4DLWA 4JT4A 3V4RA 4MYTA 4HATA 5KUTA 4PX9A 5FTNA 2IYYA 4E07A 1NMZA 4PQRA 4QJ4A 3B8HA 4B76A 1Z6GA 4NZYA 3K0EA 1BO6A 2ORWA 2C77A 4JSTA 2GXAA 2G83A 4K81B 4EJSB 3FFBA 2A5YB 3IPXA 1Z0DA 1DG1G 2IXGA 3VKGA 1CJUC 3DDCA 2FSHA 2XEXA 3B6EA 4OBEA 2X1VA 4IRUB 1Z83A 3G0HA 4M0LA 1WBBA 3FKQA 5H1YA 1GRRA 2VSXA 2FE4A 5H70A 3QBTA 5GJCA 2ZRDA 2RKOA 3B5JA 1Q22A 2HJGA 3NWJA 3IIMA 4ACBA 3KXLA 4JSYA 1SVSA 5EE0A 4D4KA 3I4LA 3TSZA 4Z54A 3RS5A 2DFKB 1UF9A 3DZ8A 2A3RA 4PO8A 5L3SB 3KQKA 2WV9A 3UWKA 5LDDC 5KNDA 3GD7A 1XXHA 2XB4A 2ZAMA 5CM8B 1W1WA 4HAZA 2GVDC 5GJVC 2YWGA 2BVNA 4ASUD 1XXHE 5JRJA 4MRPA 5FTJA 2EU8A 1XCGB 1FQKA 2ODEA 4Q18A 3QKRA 5EXPA 2J9RA 2ORIA 2UKDA 2YOGA 2ZI4A 1ZM9A 3MUFA 4DLVA 4ABYA 4ERNA 3QVVA 4HB2A 4KFTA 2FEOA 3FFAA 4Q19A 3GFOA 1N6RA 3SQWA 1R0ZA 2V54A 2VP0A 5AJWA 2GK6A 2CCKA 2CCGA 2WWIA 1DAKA 2HT1A 2P6NA 1XZQA 2HXSA 4ARZB 1MH1A 3TAUA 2J0SA 2ZJ5A 3NVAA 4RD2A 2VHQA 3U6KA 2HYIC 3L43A 5DYGA 1JAHA 2P6UA 2ZS9A 2O8FB 3UG6A 221PA 1U9IC 5E7JA 3W9YA 1E2DA 4NCIA 5H68A 1AK2A 1HURA 4HSEA 2J1LA 5TB5A 3CWQA 2W6JD 2VHJA 3H86A 4A0FA 1G8PA 2H17A 4DLZA 1W7AA 1KK3A 2MMCA 4F93B 4OK6A 4OJKA 2NO7A 3A1TA 2CJWB 3SNHA 2B21A 4LBZA 2G0TA 4FCTA 2C9CA 3Q9LA 4L4UA 1LTQA 2O0JA 3DZDA 4V0MA 4JMPA 4B6FA 3HWSA 4AC9A 5CM9C 4LUCA 3V00A 1FUUA 1DAIA 2A30A 3ZDQA 1T0JB 1KI4A 2QI9C 3QG5A 1JQJC 1Q1ZA 3T34A 3DVLA 2PBRA 4OK3A 3R7WB 4NU0A 3I73A 4YXWD 4QJ3A 3B1WA 4FN5A 5AJZA 5C18A 3Q85A 1ZM4A 4NYJR 1DE0A 2OSBA 3U7HB 1NP6A 1PJRA 3ZGXA 3HR7A 4H1VA 5FL3A 4LBWA 2BEJA 1W5TA 4DDUA 2CHGA 1G5PA 4OHVA 4ZCIA 3CF6R 2HCBA 1NSFA 1S2MA 3HP1A 3LXRA 3PUYA 3L0PA 2IYXA 5JS7A 4C2TA 1NVXQ 1MRSA 5HCNA 1N5IA 1HQYE 2GXQA 2R6GA 1XJCA 4UNPA 2RHMA 1RYHA 4Q4JB 1Z2AA 5HZHA 5KHOC 2ZANA 3BIFA 3NC1C 4M1MA 4Y0AA 1RPZA 4RKFA 2JLXA 4WIAA 1W2GA 2WKQA 2H18A 5B64A 4E09A 1Z8FA 1GRNA 4M53A 5TV2A 5FL7D 2ERYA 1S0UA 1UEJA 4HEJA 5EUMA 5E95A 2KB0A 2YINC 1C4OA 2J87A 2OBLA 4AG5A 2Q21A 3BOSA 2IWRA 2OXRA 2ECKA 4BLSA 4CGZA 1XMJA 2WVJA 1NF3A 3KJEA 5EE5B 1XTIA 4LCBA 1E32A 3EC1A 1XZPA 4DLUA 3K0CA 4Q21A 2QT1A 1FP6A 2GILA 5DGXA 4AIIA 4BUJA 5L3QA 4EDHA 1ZBDA 4X8LA 1KO8A 2A7QA 4MQBA 4NPHA 1T6NA 3U3KA 3R9IA 1NJGA 1P2TA 3C5CA 5JSZB 4A82A 5JCPA 2CXXA 5BYKA 2CBZA 1J99A 1FOEB 3PJRA 1CJKC 3MJRA 4DC9A 1W49A 4JIMA 4II7A 4QJ5A 1ANKA 1KK1A 2WWHA 1G16A 1WQ1R 2OUKA 2RGBA 5D3MA 4JKIA 3K09A 2J0UB 4G3XA 1Q21A 2IYQA 1OYWA 2A2ZA 5HTKA 3WNCA 4K8OA 3DKPA 3C16C 1EG7A 4B48A 1Z0FA 3WHLA 1JR3D 4NHOA 2J0VA 2XGJA 3RSOA 1TPZA 1OJLA 4URXR 3QY0A 1WBDA 2IA5A 3OHMA 3KKMA 4LJ6A 3NXSA 5DI3B 5CB8A 2FX3A 4Q1CA 4B73A 1XNJA 4NMMA 4DT1A 1QBKC 2QNRA 3QBVA 1M7GA 1GRQA 1AGPA 3PITA 2WMNB 4AG6A 4V0NA 1L4UA 1BYUA 3RRNA 4UJ3A 1G7CA 3AH8A 3Q3JB 3EWSA 3K0CC 3Q72A 2ASEA 5EP1A 1MKYA 4KFRA 3GJXC 3G5UA 1G3UA 4DEXA 1SZPA 4BLPA 4C0SA 2FWRA 2ZE5A 4OK5A 3ECCA 1NL3A 1IY0A 5F2EA 4Q00A 3I62A 1EX6A 3NEYA 1G18A 2ZIAA 1WMSA 3ADDA 3UWOA 2BHRA 3ZYCA 1X8JA 3GLGE 4RZ3A 3MAAC 1SKYE 2OLKA 1N6PA 2WPDD 3R8FA 3QF7A 4FINA 3U5ZB 2JLRA 2ZJZA 4FMDF 5D3QA 4UKDA 3TGPA 1NG9A 2YWHA 2ANBA 1P6XA 3O8RA 1P73A 1OXSC 3CX8A 1CJTC 3BXZA 4JJKA 2QPAA 3EA0A 5AUNB 3DHWC 5C46F 5JJIA 4HDOB 4OQFA 2YV5A 4B3XA 2YZ2A 4DSUA 2AKYA 2CE2X 1CR2A 3C14C 3M0EA 2ZRLA 4KYUA 3TH5A 4BQSA 4PPFA 1KDOA 3B13B 5FUYA 4DSNA 1BS1A 4PZZA 3MSXA 1XCMA 2ZR7A 1OH6A 2Q6TA 2XOKA 1SHKA 4Q03A 3RS3A 1Z28A 5FL7A 4IOLA 1KJZA 3GJ0A 1BH2A 4G5RA 4YMSA 5J40A 2WKPA 3U60B 4P4SA 4MRNA 3UMFA 1R0WA 1X3SA 2D4HA 2ZPTX 5SZJA 3LX5A 3PUVA 3LVRE 2GCOB 4PC3A 3HU2A 2WPDA 2CL6X 2MSDB 2ZRKA 3HPQA 3RHFA 5BWMA 3PEWA 1E98A 2GZDA 4XWOA 4E22A 5BXQC 1A7JA 4D0GA 2WZQA 4BASA 2DB3A 5HPYB 3W3ZB 1UJ2A 1VHTA 1KI3A 4JL8A 2OV2A 5KSZA 1IHUA 4IFEA 2REXB 4TZ0A 2KE5A 2WWWA 2BEKA 2QL6A 4XSHA 3TW4A 3TK1A 1QF9A 2VP5A 5FH9A 3U7FB 1ZC3A 4YLGA 4BLOA 2QE7A 2FOLA 1II8B 1N0WA 2A5GA 3LQQA 3T06B 1OSNA 3LLMA 4URVR 2JLYA 1T3LA 2Q0HA 4V0LA 1U2RA 2JIZD 3FB4A 1A2BA 1XTQA 2W0SA 2B6HA 4Y0VA 5FBRB 2OFXA 4KBFA 2QZ4A 3HU1A 2JGNA 3QXCA 4RCYA 3QKTA 4U00A 3VR2A 4MDFA 3JVUA 4QBHA 4Q5IA 2PCJA 1Z0JA 2AD1A 3OFND 2AK3A 5KNBA 2QPTA 3BE4A 3X1YA 1VMAA 4DSOA 4B75A 3THWB 5F9FA 5CJPA 1GUAA 1AZSC 3ZD7A 1RFLA 4A1FA 1FTNA 2FPKA 3IEUA 2R9VA 4Z8XA 2C95A 4QRHA 1YZLA 4CEIB 1IJFA 3FKSD 5EQTA 5FBQB 4PC2A 3OIVA 2ORVA 2QT0A 4D4LA 3ZS8A 1OF1A 1VYTA 2NTYC 3W5JA 5JI2E 4IEEA 4KJZA 2WAYA 4KI0A 4FW9A 5FR1A 1FMJA 1QG4A 1PLJA 4H9GA 4LYAA 1JPJA 5JCZA 3D31A 4QOSA 3VNUA 4PXAA 5H8WA 3NDBB 1JPNA 2IL1A 5EP2A 1JNYA 2FDCA 1ESMA 1XTKA 4A6XA 1KDTA 1G5TA 3RLFA 1ODFA 1GWNA 4XH9B 3ZZUA 1NKSA 2VSFA 2FGKA 4DCSA 4M2LA 4OHZA 4JT2A 2B92A 1ETUA 3LXXA 3FMPB 2CEAA 4MUBA 4WOPA 2AX4A 3KUCA 2QGNA 3GFTA 3LLUA 2ODNA 3AP3A 2H92A 4QBGB 4N0EA 1G1MA 1E2EA 2B7CA 2KBEA 2ZITA 4Q01A 4QGAA 1HYQA 3CRMA 2ZYVX 4BLTA 1EFHA 2NPFA 3SFVA 2BIFA 1KO4A 1PLKA 1SXJB 4DB2A 1NG1A 1QVRA 1JR6A 2R6CA 3EZ7A 2KI5A 3BERA 4YMTA 2PZEA 3R8CA 2BCJQ 3T12A 1VCNA 2N42A 4AKHA 2JJ1A 4EPXA 4I81A 4HLCA 4L15A 3TBKA 1JJVA 1FX0A 2Q3MA 4HUQB 4RSGA 4HAYA 3I5YA 1P4SA 3KKOA 3TW8B 2ZREA 2Y8EA 4ACAA 1XMVA 3BBPA 2BC9A 2JLQA 4RZUA 3S1AB 1ZW6A 4Q7MB 3WYGA 1G7RA 2VF7A 4DLTA 1KO5A 3MJHA 2AXPA 2BMEA 2W6ID 3A4MA 4A4DA 3RC3A 2VTKA 3ZS9A 1R0XA 3A1VA 3OE7A 3TIFA 1XFAA 3TSWA 1SVWA 1ZVQA 3RRZA 4P31A 2V3CC 1N5KA 1GKYA 4WXPA 1YRBA 1CS4C 2IXFA 2ZR0A 1WCV1 4NCNA 1DAFA 1NN1A 2XSZA 1G7SA 2G0NA 3EARA 4RVCA 5EXSA 4WZ6A 1BMFA 5KDLA 1TF2A 1E79A 3LBHA 3ZVNA 1II9A 2EFDB 1TF7A 4BGDA 5JHHB 4NH0A 2ZEJA 5FOTA 4IDQA 4UNSA 3SJCA 2VHUA 1Q3HA 4Z1MA 5JBQA 2DFNA 3ICQB 1OKKD 2WMOB 3MFYA 3THYA 3VAAA 1TUIA 1ZNWA 3P1JA 5JRZA 2YHSA 3CRRA 3CRVA 2QAGC 2N46A 1RRCA 3ZLJA 3AVWA 1KSGA 1QDEA 3GJ4A 4EPTA 3EG5A 3GQBA 3CPEA 1KK2A 3DM9B 1OFTA 1CBUA 5ANRB 5FUVA 2O8FA 4LJAA 1JQLB 2R6FA 4M1WA 2ZJYA 4A0HA 2PMKA 4EUNA 3O8CA 2JASA 3EA5A 3KKNA 1XEWX 3CRQA 1BIFA 1SULA 2CL0X 2ZETA 2IYVA 3RC8A 1NI3A 3GJ7A 2QP4A 2VL7A 3DOEA 4F4JA 4RY2A 4QG7A 5KTYA 1OH7A 1Z6YA 2XZOA 4PZLA 1W46A 3PVSA 4G1UC 3TUZC 1HE1C 4JLBA 1IXZA 1HT2E 4JVSB 1P3JA 2W83A 1NY6A 1U8YA 4JLJA 5FBWB 2ATXA 3U44A 1EFTA 1E1QD 2JLSA 1KYIA 2GJ9A 2ZE6A 3P27A 2MSEB 3B9PA 2A9KA 3LV8A 4XJXA 3DEFA 1B0UA 4TN1A 121PA 2NO0A 5SZIA 3BS4A 4LJ5A 2X77A 4G5OA 4EAQA 2DPXA 3R9XA 2IW3A 4GSYA 1RRFA 3Q7PA 3CZQA 1KGDA 2W58A 3GCGA 1KI6B 1W4RA 2ZVPX 1FL9A 2RCNA 4XVQA 3Q5DA 2GJ8A 2WTUA 4PSAA 4MKFA 3L8ZA 4LRWA 2PEZA 2F9MA 4WW0A 3VFDA 4LBYA 5A5GA 1I2MA 3VHLB 3PENA 4TQUS 2ZUDA 1EWRA 2CCJA 3PG5A 2ZR9A 1S8FA 4PPQA 4CZ2A 3VR1A 3AVVA 1RRGA 2OBNA 3LW8A 4ZPXA 3B1YA 2DR3A 2R6DA 2YKGA 4R98A 4A8JA 5HKKD 2O8BB 1XDBA 1E9BA 3L0SA 4DXAA 3BORA 4WAUA 1E4YA 2FFQA 1O3YA 4YXWA 4PHHA 1DELA 2DCUA 3LBIA 1I2DA 1U8AA 3SE0A 4DLXA 4TMWA 4BECA 4EPYA 2NQ2C 2WICA 2YOFA 2ONJA 5CLQA 4B32A 3AVQA 1FNNA 4C0HA 5KU1A 2N1BA 2W6IA 1GSIA 4LJ7A 4DRZA 4PPNA 1M8PA 5FOXA 4M9XA 1TMKA 1QHNA 4B33A 5DNYB 3AVXA 4OQMA 1E9FA 3VR3A 3WY9A 1WA5A 2PJZA 3KFXA 4RD4A 4QL3A 1IY2A 4LJ8A 4D0LB 2WOOA 1XU4A 2NOAA 3X1DA 3PEYA 4C4PA 4HAUA 1H8HD 2GEDA 1IJEA 3AF3A 4ZI3A 2AKAB 5KSOA 1OH8A 1T91A 4BEBA 1UBGA 1FP7A 2CLSA 4TTQA 1NKTA 2Q3HA 4PAMA 4EPVA 1TTTA 1VYUA 1MO6A 4B3DA 1OW3B 1VECA 4UNQA 3KJHA 4CEIA 1XB2A 5DI3A 5BW8A 4GNKA 4A9AA 3EIQA 4KHZA 3NTUA 1SXJE 4TQ9A 3B85A 4BRUA 5CK4A 1ZUIA 2RMKA 1NY5A 3ETLA 3RVBA 1FNMA 1VG0B 2G77B 1QRAA 2V7QA 3QQ5A 5CITA 1VG1A 4RKEA 2OCAA 4BE7B 2J7KA 4GL2A 1YZUA 2QTVB 3V4FA 4URUR 3OE7D 1IN4A 4HAXA 4TLAA 4HB3A 1RVDA 3TQFA 1JR3E 1GVNB 2J41A 4ITRC 1GDDA 4GDFA 2ZUBA 1KAOA 4YONB 3EPHA 1Z3IX 2O0HA 4ZDJA 1P60A 3QXJA 4R7ZA 2RGDA 3LO5A 4V0KA 2FF7A 3AKYA 5B2ZA 5KNCA 1UKVY 5CYPA 3W6PA 4DBLC 3T5GA 1E1QA 2ZAOA 3C7KA 1OT3A 2JLZA 3DKVA 1GNRA 1GL7A 2QU8A 2Z83A 5CJ2A 1E0JA 3W6NA 2FSIA 1YJ5A 1AKYA 1X1SA 4Q7JB 4PTLA 2ZI6A 1T0HB 1OXVA 1NVVQ 1ZD8A 2D74A 1SXJC 2NGRA 3BRWD 5F98A 4O25A 3IEVA 1GKIA 2FPMA 4C0JA 4M9SA 1JECA 1FFHA 2IYLD 2W2TA 4C9BA 1R8QA 3QJYA 3QPUA 5AR1A 2AWOA 3NBFA 4DCNA 2EFGA 1AGRA 3PXGA 1MABB 3AGQA 3I8SA 2FJUA 2RGAA 4OKSA 1GOTA 2CE7A 2H57A 4QHSA 3KQNA 2KSQA 4E03A 1W4BA 3AF0A 4CIDA 4IVRA 1UKEA 1GAJA 1W4CA 2ODWA 3KL4A 5FPKA 1NN5A 2ZROA 4ESVA 4IVQA 5CB6A 4CEHA 4XTCS 3SDZA 1U81A 2ZE8A 4PHFA 3NH6A 5CLLA 2VEDA 4XD7D 2IT1A 2D7CA 3F5FA 2AWNA 2W6JA 2NZJA 2XZPA 1BYIA 2FZ4A 1JXOA 1G4AE 2QORA 3OESA 1Q57A 2LCFA 5BN5A 1N2CE 5JFGA 2MMGA 4QM7A 4BEJA 2G3YA 1PV4A 1NBMA 4D25A 3BFKA 2Z5FA 4HLDA 1KSJA 1C9KA 3W90A 3PFIA 5KOYA 3VU9A 4MDEA 1IM2A 1XD9A 2H8KA 2XXAB 1TUEA 1AS0A 5IHPA 3SBDA 1U0JA 2V55B 3MWJA 3VR4A 4URWR 4QBFA 2AK2A 1YQTA 1CKEA 3RWMB 5EP3A 1TU4A 2EFCB 3U4QB 1YR9A 3MGCA 1GNPA 2ZRGA 4QXAA 4K46A 1E9EA 2DYKA 5BN3A 2ZM5A 2IUTA 1U90A 1YZTA 5G40A 2XNDD 3T5DA 3K70B 4KFUA 3OFNA 3IDQA 3ADCA 5IRCD 1MV5A 3LNCA 5JEDA 4HDQB 5K8LA 2QMUA 3PUXA 4ZCLA 4R2HA 3VR6A 3GEHA 1PLLA 1XPRA 1ZNYA 3FTQA 3IBGA 1X86B 3G82C 3JVVA 3ND8A 4PQYA 4S2EA 4C7OA 4BFZA 1SVKA 1D2MA 2EFEB 4B3BA 4M22A 5K8IA 2OM2A 1LF5A 1NMYA 2A5FA 3PR1A 4FXPA 5FI0B 4A6PA 3JZMA 4EKDA 5E3HA 3R9WA 421PA 2FGJA 4A8JB 3W34A 1W36C 2NMVA 3CF0A 3AVTA 4J0QA 3CIOA 5LB2A 1XP8A 3GLFA 4Q9LA 2GETA 4AYXA 2VLIA 1OLOA 1E9SA 4GP7A 2O8BA 1KNQA 1UM8A 4L5BA 1NLYA 1FZQA 3FHTA 2QE7D 5BN4A 3WMEA 2FZLA 1ONBA 4TSFD 2QTFA 2PLFA 1KJWA 1E6CA 3RNLA 4EQ6B 3LY5A 4KFSA 1GNQA 1YZNA 5DO9A 4AI6A 2GJSA 4TQAA 1KSHA 1XX6A 2GBLA 5E7MA 4PC7A 3ZIAD 5L3VA 3I1FA 1TNDA 1AA9A 2XOKD
chains in the Genus database with same CATH superfamily
4QULA 2H4FA 4PO3X 4E3WA 1Y80A 5EIWA 4MLCA 6Q21A 3Q2IA 4MZDA 3BGWA 4S0XA 4N8EA 1VPVA 2Y67A 2C99A 3QE9Y 2V96A 1L7AA 3EXFB 1F0PA 4JOQA 4F21A 1N32B 1B1CA 4IIXA 4EGAA 5JQGF 4JAVC 3E3MA 2BEWB 2WQZA 1CDEA 4BZPA 4OQNA 1PHRA 4H15A 1MD9A 2OAGA 3SZRA 3K7EA 2C4NA 2PKYX 1EDZA 3IO5A 3KZOA 5TQVA 2IYOA 2WJIA 3U9LA 5ICEA 5I9NA 5IWCA 3ADBA 1VSBA 1E2QA 1S7GA 2FMUA 2JFOA 2VK2A 2VVTA 1GZSA 2XMSA 3CCFA 3K0AB 1NN0A 3RASA 3U49A 4A3SA 3ZZ1A 4QDXA 4C4AA 4JGGA 3PJFA 3MRXA 1DU4A 4DQDA 4JQOA 2ZYGA 3KPYA 3O47A 4R6WA 4EHKA 3OFSA 3FWZA 4MYUA 5TQ2B 3GQBB 4D1YA 1ZCAA 4FN4A 1JFFA 1U1GA 3ROKA 5JQGB 3NBKA 3MS7A 4BJ1A 1ISMA 4IQ4A 2CVOA 2V7WA 5G3ZA 2CV1A 1L7DA 1SUPA 3NZEA 1YJAA 2AB0A 1ZUWA 1OE0A 2H29A 4XX0A 2X0EA 4AIRA 1MOSA 4AQYB 3RF7A 4L6CA 5LFAA 1U0RA 1C9EA 3ZBUA 1K27A 3L3BA 2H08A 1PSZA 4NPCA 5DBFA 5LBUA 4AZTA 1SCAA 3FLAA 1F0KA 1JIUA 4LWQA 4MV0A 4ZI7A 2JDIA 3QU4A 4QYXA 1THZA 1Z6QA 3H1EA 1SA0A 4WFQA 1OROA 3UH1A 2CFOA 1GU0A 2O19A 1ZX1A 3COWA 4QVKA 1WXWA 4XGNA 3DL0A 3NC0C 3AEQA 3HFGA 3KQSA 2FK7A 1CUCA 4MVXA 2IX3A 3AUJB 1ARZA 2FQ1A 3A9TA 2D2FA 4IYJA 4TLCA 4IEFB 1U2GA 3T5CA 3ABSB 3GLFB 1ZD5A 4L08A 4JI8B 4UHCA 1XPRA 1V35A 4YMVA 1R5OA 1U7OA 1KYXA 1WP9A 4CF5A 4P4UA 2ZJAA 1WUKS 3K9CA 4JMLA 3E27A 5AIBA 2IH2A 4X20A 3OI7A 4O4LF 3X44A 4BXOA 2GJ4A 4AMGA 1UK7A 1BE6A 1B74A 1T35A 1X2BA 1JHXA 3MELA 4GAEA 3DYBA 3U19A 4WK0B 3UKDA 2A4KA 3DO6A 3IHLA 3ZWCA 2ORYA 3HY3A 2WTEA 1FYEA 5LZ8A 1QYWA 1R5BA 3PYLA 4BFWA 4ZN6A 1S1MA 5LLTA 3NHMA 4G1FA 1OYVA 4TZTA 3S1AA 2D0IA 4L02A 1RYDA 1YBHA 4YJ3B 3ZE8A 4HEQA 2UYOA 4Z7NB 2I1QA 3CXUA 3DXZA 4L9RA 1MVNA 4QM6A 4UBLA 4GP6A 2HPZA 2H11A 2ZYAA 5LQAA 3CZ4A 2JCBA 3P0RA 1H6AA 2DLNA 2GASA 1Y5IA 5LVAA 2EZ8A 3A4NA 3QWIA 4I4NA 1AN9A 3ZW9A 4BRWA 2VQ6A 3OQJA 1Y8CA 3QUCA 1R3UA 3F78A 1DQZA 5BWLA 1RAFA 3VKHA 3KE9A 2MTBA 4RPJA 3EC2A 5LD2B 5C3MA 2FW6A 4YUAA 2AW5A 1VHQA 3KSAC 2WJVA 5BR1A 2WWTA 4WE3A 1YGYA 2VWPA 1NBHA 1RKQA 3EG9B 4JC5A 3VOBA 1OLSB 1Z36A 3EF0A 4D4IA 4JQCA 3EODA 1RE0A 3DSRA 3CWCA 2B25A 2ACWA 1N7IA 1Z4PX 3TOZA 2QENA 2XUPA 2ZYHA 2H00A 4MS4A 4URFA 2C1EA 4WBSA 4DUGA 4I14A 5LPNA 4BN4A 3ZVRA 4FGJA 4BGEA 3QI2A 3OCJA 5LKAA 1MXHA 2VZ0A 3UUGA 4BWVA 2ZSAA 4NBNA 2B98A 1F5NA 1MX9A 2JFZA 3FCXA 3GFSA 4GE3A 5HFNA 2OA0A 3T7TA 2JH3A 2C2MA 1OYYA 4G5HA 3EA4A 4WACA 2IE0A 2DFTA 4MITA 5EMNA 1XA4A 3VVCA 2C4HA 3F71A 2QLFA 2Y77A 1RZ3A 4PNEA 4NCKA 3PEFA 1V1RA 4KIUA 5HDQA 1U5BB 2POQX 1LI5A 1LVHA 1AO0A 1E4EA 1WXGA 4XEHA 2XT9A 2VDQB 2GKGA 2XWBF 5ILOA 1EWQA 3WGZA 1O96A 2FRXA 1J9ZA 2XNSA 2HDWA 3EIOA 2UXCB 4EW6A 5DW0A 1JTFA 1MABA 1Y5MA 2A0FA 2E4VA 2O0MA 4R83A 1L5ZA 4G5SA 2B0CA 5JZVA 2P1ZA 1M2KA 3BHMA 2NXNA 4G2NA 4L5CA 5F1KA 4JBLA 2E5LB 1UC8A 1SUIA 2JLWA 3D3KA 1O4VA 5AW1A 1U4OA 3GFBA 1P2GA 2VPQA 2A6PA 2X7HA 3QUAA 1GTZA 1V48A 2JS7A 3BWXA 1OMOA 5AHWA 5JJCA 1YE3A 2ZG6A 3PTLA 4F5EA 3L7CA 3B20A 1JSCA 1C1HA 5H3LA 3CLSD 3KT3A 3D2BA 3LUAA 1VE7A 1Y1PA 3NUZA 2I7VA 4H1UA 4PPGA 3BL5A 2O59A 3MQ2A 2B4YA 4NYMR 1P7CA 2PRSA 3LBYA 1R12A 3LCVB 3PC3A 1D9ZA 3BGDA 4GPD1 2X9QA 4B3CA 4Z51A 2QX8A 1IG3A 1ZRMA 5TIIA 4MW5A 2JK0A 3NETA 4M9RA 4CL2A 1JPUA 3PC4A 1H3FA 1ZRNA 2YJ3A 3KPUA 2XGSA 1E3LA 3HY6A 3AFOA 3DT9A 1MJGA 4C7BA 1KJQA 4TL6A 4OIFA 1L7OA 4HZUA 4IHQA 4N7MA 4E5KA 3UWPA 2H2FA 2PO5A 4EHNA 4IMRA 3H3FA 5IANA 1M5RA 3OLVA 3FY4A 1E0SA 1OVMA 1RXSA 4HNGA 3FTCA 3BJEA 4OTZA 4D4GA 3WWYA 1XN4A 4UHFA 1ZWKA 1CSEE 4KRGA 4W9RA 4KR0A 5FT9A 5LOVA 3O4GA 1JQ3A 1PRYA 3DTVD 5CCXA 1FE8A 1N6NA 3HCDA 3ANTA 4EMSA 3HHPA 4AJPA 5EXTA 3B6IA 1P29A 2FUEA 1PNQA 2OHFA 4LHSA 5T6BA 3RE1A 4BMSA 4ZICA 5BMVF 4HFMA 3G5MA 1J70A 1DKQA 3H1TA 1OV6A 3H2KA 3QF4B 1YR8A 4S1PA 2B6NA 2IXBA 1ZGHA 2AE1A 3BGVA 2EKLA 3KK0A 5EPEA 4PGHA 1U7ZA 5L9AA 2OLJA 1CFZA 2ZT6A 4ZAFA 2HK7A 2ZVDA 3SLKA 2J32A 4CLXA 2AN3A 1E99A 1SPXA 1XCLA 2NSJA 3GH1A 3VSAA 1BROA 2YIDA 3F6RA 1P7ZA 1UJNA 2Z1DA 3OKFA 4YRJA 1OAKA 2FZ5A 4A91A 1GUDA 3OTOB 3TLAA 1BWQA 4BKUA 3B3AA 1G9SA 3LPLA 4RACA 5T67A 1Z12A 3ZLUA 1M6HA 2IU0A 4K6MA 1SXJD 2OECA 2Z8XA 3GJZA 3P32A 3P4YA 4GR4A 4WKCA 2OO3A 5DNVA 5BMOA 3OP4A 4DL9A 4R8VA 3BRQA 3HMKA 1SUFA 4M1OA 2F8SA 1K8YB 1PCXA 1W94A 1EX7A 4I4CA 4AD8A 4UBMA 1U0HC 4BFCA 4EHJA 3CMMA 3SXUA 1CP3A 2BH9A 1KAEA 2Y1DA 5CBPB 1XMOB 2QP9X 1JX6A 3FG9A 3A3KA 3RS2A 3GVXA 1DCFA 2CJXA 4K1LA 1DVRA 2J4DA 4XJVA 3ZKAA 1ML4A 3RS0A 3L7MA 3EXIB 4FYVA 1YDFA 1YQEA 5CB4F 2QA5A 3C1UA 3F96A 1IEXA 1Q44A 3GRZA 4JZKA 3KHKA 5EEGA 2NU8B 2XQJA 1IU9A 2O5RA 4CPDA 5CVTA 3DQPA 5E0KB 3EZ9A 3GUCA 5JAIA 1J2JA 3HL4A 3RJMA 2ILTA 3EUAA 1J1UA 4RFSB 1D6JA 3S2EA 5CXUA 4X20B 3H6HA 1IWOA 3R4VA 4PZ0A 5HF5A 4KQ6A 5IVDA 1S8NA 2Q07A 3PC7A 4R01A 1NBAA 2F1OA 5IAOA 3AUYA 4U7HA 3R3ZA 3EIUA 1ESZA 3S3TA 5BWCA 3N7TA 1Z7BA 3AEKA 3V4LA 5K0SA 1ZCFA 2D62A 4O0LA 3BBLA 3RODA 1Z6AA 5I9IA 1Y63A 3OZTA 1YAJA 2W00A 1Q15A 3SBEA 3WJ2A 4DMUB 1V45E 1PZNA 1T9KA 1CQIA 2BGRA 5CH5A 2VHYA 4LWZA 2YMLA 5E8JA 3WRVA 2G28A 2XX3A 1KPHA 4ZJUA 1JHAA 3VKWA 3UN1A 2Y1WA 1B8PA 5M34A 1XNQB 2HYDA 2IYWA 5DOVA 2AFIE 1SVMA 2WTMA 4MLPA 1ZINA 1E2HA 2RI6A 2FSUA 4M3NA 4OREX 4C0BA 1M9NA 2XIJA 1KU0A 5IM4F 3K09C 2ZTVA 4WFKA 2VYNA 3RWOA 1U8TA 2WFMA 4M7PA 4C7VA 4BWYA 4GXQA 2HPHA 3D0QA 4D9JA 3MA0A 2DWPA 3MAGA 3QTLA 4MK4A 4US2R 1DC3A 3ZLVA 3G8YA 3A9SA 3ZGNA 4PO1A 4C0QC 1DKNA 2GTIA 3MK31 3UEOA 4ENUA 2H9YA 4FIZA 2FQQA 8GPBA 1S4QA 1X1CA 1Z25A 4JYMA 1T36B 1ZK3A 2X2EA 5JAZA 3GDHA 4MWTA 3SX0A 5CFNA 2VSYA 3KYCA 4RA9B 4J0GA 4NABA 4L6AA 1N3BA 4X64B 5EYPB 4EG1A 2C2ZA 2DPYA 3REFA 5JEEA 1ILWA 4BJ5A 1VDZA 5BSFA 3ZR4B 2UUAB 3OWOA 1I51A 3D1LA 3B52X 4P3KA 3CINA 4WKNA 3V3TA 1XF9A 2HAEA 3RARA 4AKTA 4DMCA 1ZKDA 2AIRA 3AP2A 3KKQA 4LV8B 3HGTA 4RK6A 3QEMB 2NYVA 1V3TA 2JIQA 2NYUA 5L4LA 1ELOA 4EHLA 5D86A 1TLFA 4MRAA 4YALA 4LG1A 1AQYA 4O8CA 1QR2A 3UCXA 1ZGAA 1A4RA 4EPRA 5BQ5A 3GCDA 2HDOA 2VN8A 3OTIA 4KZPA 2FFHA 4EY5A 2WD9A 1E7SA 1TIKA 1S3IA 1GKKA 1HUQA 1U3TA 3QITA 3WXBA 1O6FA 5JUWA 3K70C 3DMFA 2W2KB 4LXGA 1WABA 5A7GA 4GPIB 1X9GA 5DP1A 1UBFA 3HJNA 3UW3A 2OCPA 3P20A 4QE3A 1R5NA 4QXRA 1LK0A 2GD0A 3A37A 5AW7A 2XVYA 3I5XA 4AKSA 1NVBA 1GR1A 1D4FA 1M8JA 3GZNA 5DM70 3FZGA 2GBLC 2X1HA 1H6BA 1E9RA 1TQHA 5CA1F 2PUWA 4RPHA 1DX4A 1A88A 1NP7A 1ZLYA 4WLFA 1K5GA 5IJ0A 3PQ7A 3FNHA 5IAGA 3G9XA 3EBPA 3A3OA 4ZXPA 3ER9A 1N8SA 2VYQA 2ZI3A 1QYDA 2RGCA 3IQZA 2XE4A 1L1FA 4X1IA 5EJEA 4G4GA 2D5AA 3JAKB 4HUJA 4GYKA 5IDVA 4WESB 1MVOA 2IVFA 4WKOA 3EWNA 3UJ8A 3M6XA 4WWHA 5KOHB 1Z4JA 2V7VA 3WGHA 3GUYA 4PCAA 4Y2JA 1NZDA 4II2A 5I9TA 4IOJA 3JQEA 2R79A 4JUIA 4DLSA 4B44A 3E2IA 3EDMA 3CX7A 3P2MA 4E5VA 3ICVA 3RYHA 2BFNA 4IKOA 5BRAA 3DJYA 2BGMA 1UKYA 1ZMOA 2QDXA 5DYTA 2PD3A 4B8WA 3I4FA 4UUOA 3YASA 3LHDA 1YKFA 1UOOA 4HL6A 3GIDA 5H0IA 5HS6A 4NONA 3QEAZ 2XYGA 4XPIA 1NJ6A 1T6BY 3V3KA 5D7BA 4PLWA 3U4QA 4FYJA 5CFOA 3OZVA 3WLQA 3AB8A 2DJ5A 4NFSA 1QMGA 4B87A 4B2YA 3TD6A 5A4JA 5B4VA 2PH1A 2C9DA 2SKDA 1BWPA 3ND9A 4FGZA 1F51E 1OI7A 4NPAA 2ZKLA 3TUIC 2WG0A 4MKGA 3UB2A 3EAQA 2OTCA 1HEUA 1P7VA 1QHXA 4MYCA 1L8QA 2A88A 4RENA 1SKAA 3DMTC 3F8TA 1QO0D 2VRBA 1CF9A 5LCXA 2VOEA 2WWXA 3VU9B 4O8ZA 3EIFA 3RYCA 3LE8A 3NIBA 2I4TA 4JP8A 2LRHA 4QT0A 4ZOQI 1NIPA 2PMEA 4TYPA 4BS9A 3CO5A 1UINA 1WU7A 4OUDB 3H2BA 4BFSA 3KYDA 3QBJA 2IEYA 1LBIA 1O8BA 2CXRA 4GPAA 4EGSA 3G8DA 1HO3A 3V4ZA 1Z29A 1OLUB 3E22B 1OHHA 4TYWA 3GEIA 3OT4A 2JIDA 2CLMB 1DXHA 3I2GA 1L5MA 2Y1CA 3NIFB 2VXBA 2AJLI 3LUPA 4DTCA 4Q0MA 1EQUA 5DWDA 1GU1A 3MCTA 3LC7O 4G8CA 5FPSA 3V4OA 1WPXA 2IPLA 3M3DA 3TOVA 1HLPA 5MGBA 4Q16A 3WFJA 3ZWOA 3CPHA 2IFTA 3HN2A 3KYBA 3MYYA 4LDJA 5BRJA 3G0OA 5CT9A 4QD3A 1I7QB 3IHTA 5TDHA 2FSSA 5BT8A 1Z63A 4A8HA 4S3MA 3TRFA 1TD1A 3GWGA 4QTZA 3QV1A 1RWVA 3Q2OA 3RHTA 5K1ZA 4N65A 4AYTA 4KTVE 4D8XA 2YBEA 1BFDA 3B9QA 1TEXA 2FEWB 3FZNA 1E9VA 1ZC4A 4BNHA 5HX7A 2R65A 3EEQA 3IGFA 4V0RA 5JIBA 4YRZA 3DOUA 2H2GA 4JYPA 4MHSA 4LC0A 4EGQA 1QXSA 4G41A 3QWHA 3K3PA 4IEIA 1JI3A 1E7WA 4CM3A 2YWFA 4N49A 4Q9NA 4U39A 3PRKE 4OAQA 5A71A 2O50A 2QX7A 4EYEA 3FOBA 3SN6A 4ON9A 3WSVA 4IBOA 5C0OE 5F3WB 1H2BA 5DRTA 3KB6A 4C6TB 1OC4A 1Y6JA 2WR8A 1YRHA 3BRCA 5FFNA 5AXDA 1MV8A 4JR2A 3IOEA 4C0XA 5KU7A 1QE3A 3RKRA 1C9JA 3WGYA 1Q1QA 4A10A 1XXHB 4CEJA 1ZUNA 1YOVA 3UGTA 3VJKA 2PO7A 5AVRA 4KLCA 3T9EA 4HZIA 4PC6A 1DEKA 1CRZA 1ORIA 5ABPA 2QBYB 1MIOB 2PNFA 2J46A 3ABOB 4OFWA 3ZHYA 4OYHA 4CETA 2VAVA 5IN5A 3WB1A 1I4LD 3P2OA 4AK9A 3TVYA 3AB3A 4F7WA 3QMVA 2XMDA 2PX5A 1JG7A 5FEMA 1KOGA 3CZAA 3RRMA 4RJ2A 1DG3A 2EJVA 3JAKA 5IVHA 4RVDA 1COZA 1X7XB 2CJPA 4LYFA 3HKDA 4JBXA 4UE6A 3TNFA 4EMUA 5K0BA 4JJZA 3INTA 4ZJZA 4QHYA 3UHJA 3VR5H 1LNZA 3O4IA 1UEIA 3BD9A 2PLAA 2BEVB 3DPUA 3JTMA 2RG7A 5F1YA 1HTWA 1NVWQ 4NE9A 1EFRA 5FA5A 3IO3A 1F7VA 1O1YA 1SQGA 4CQMB 2ENWA 1SBTA 5F5LA 2GVZC 5F77A 1DXYA 1JYEA 3NNDA 4QVGA 2DWCA 2GYVA 4MWCA 4R3NA 2Q9CA 5DXJA 5DCLA 3N0WA 4FSDA 2RB4A 4DA0A 4MUXA 4ZOAA 1PQ4A 4INAA 9LDTA 1GEGA 1YQDA 1G38A 4YRQA 4G0XA 4KDFA 2EWWA 2NZUG 4TRRA 2OO5A 2GWHA 4DHEA 5LLDA 1W87A 2YNMD 5EZYA 2W7TA 1GPH1 2HA4A 3JAWB 1Y1QA 3PHIA 4IDPA 3D43A 4MVJA 3OJWA 4XE5A 2HA5A 2MSCB 2Y6VA 2X6QA 4AJIA 2P27A 1M2OB 5KJ1A 1RIIA 3FBGA 3A6PC 5FUQA 2J6IA 1W88B 2IX9A 4I1IA 1WE2A 2DR2A 4H17A 1QAOA 1KOFA 1YZ3A 1ZZEA 1MO3A 2I8AA 3D4PA 3FCCA 3GF4A 4EJMA 5HIMA 1QH8A 5EJGA 5JJKA 3R9XB 1AKWA 1XG5A 2EXXA 3GROA 3FTFA 1ULAA 2J4CA 5E7IA 1ZMBA 4UUAA 4CLDA 3SI7A 1JDBC 2PAFA 1P2DA 2VH1A 3LUHA 4IKPA 5TF0A 2XUAA 3JZFA 1V16A 2Z2IA 2BGNA 4PC1A 1U0LA 2WP8J 3ZWWA 1FLDA 3OY7A 4FHZA 3EF1A 1IUPA 1EPUA 4FNGA 4YLEA 2A8YA 1MW8X 1ORVA 1LPOA 5LP6A 3NORA 4UUQA 3I6BA 1QKJA 2OZKA 4F11A 2Q1XA 1TU0A 2H1IA 4L7VA 1C1YA 2BKVA 2SKCA 2ZAYA 1N0IA 1RTTA 4OY3A 2E48A 1T9BA 3FCUB 2WVAA 2FFRA 4BCDA 3K0FB 3OWXA 5GOTA 4BQNA 1A9YA 1ZRSA 4ZVKA 1H2XA 2NU6B 4PXSA 4XQGA 4MUGA 4OLAA 4HR7A 4CEJB 5JBNA 3TLKA 1N5RA 3GRVA 2CXQA 1V8ZA 1NQTA 2JZCA 3A2NA 1F9EA 1I1NA 4IDEA 1HM5A 1NJ8A 1UOQA 3OZEA 1NXVA 2RJ3A 1Z2EA 1GPBA 3OF3A 2WJJA 4OP1A 4AJLA 5G2OA 1C3VA 4BCCA 3E1SA 1U31A 3KVVA 4H7EA 1A5TA 2DXIA 1MLDA 1S2DA 4FYYA 2QPOA 4QUJA 3X2SA 5EHGA 3SYMA 5I7VA 3K73O 4WZZA 2HIGA 3GFGA 1OWNA 1CB0A 3RCBA 1L4GA 4X3CA 3I5UA 1PVDA 3K9BA 5HTOA 2R8PA 5E4YA 2PFSA 7AT1A 2XMCA 1I7SB 1QK3A 4X0EA 2VDUE 3KVOA 1GPKA 3LHKA 3LZ6A 1RLJA 3L41A 5FWYB 2GF9A 1GG9A 1KVRA 3WKCA 2RGGA 2YZ7A 2FZWA 3FYHA 1EU1A 5FI1B 5DISB 3ID6C 3ZQKA 3AVOA 2AE2A 2P5YA 3Q40A 5CCDA 3CR7A 4M86A 1VBNA 5HF9A 3RFUA 2BDEA 1JLLB 1V11B 3EUEA 3TSYA 1FTSA 1YB5A 1IM5A 1NNUA 1EFPA 1OFUX 5DLPA 4U2BA 1IN7A 3TIVA 1GZ5A 4J16C 3OQBA 3P9CA 4F1KA 2P2DA 1H93A 5CBPA 2V1XA 1CDDA 3R3VA 4X6LA 1G9XA 2I7TA 4RK5A 3SR0A 4OX9B 2DF8A 3WYAA 2Q6VA 3V7NA 1N2ZA 3DKKA 3L1KA 1UK6A 4EA9A 4DANA 1F48A 1KS2A 1ZK1A 4KYTA 2OQ2A 4XM2A 4DCCA 3MTJA 1X80A 1KEVA 3IVAA 1C8VB 4HWRA 3MSCA 4KIWA 1TVMA 2F6RA 3C5HA 1SXJA 4GBED 4I1YA 4BNDB 3TECE 1PFKA 1F9AA 2QNIA 1K6MA 1BU8A 2A9JA 4M9ZA 4Z7OB 1Q2XA 5CFZA 5DT2A 2XQGA 1Z0KA 1ZUNB 2WDPA 1SWVA 4F96A 1BS2A 1P5HA 1H69A 2RAFA 1QIDA 3VKVA 3N70A 3R3YA 4BNJA 1G66A 4CF4A 1SY7A 1G20A 3EXAA 3TAHA 3MLEA 4Q4AA 5GMOA 3BRWA 4D98A 1FTGA 3HYTA 4PQFA 4ZKEA 1R4AA 3A1NA 1H2FA 5EWMA 5LU9A 2HJWA 2XXAA 4L8GA 3RUPA 1QAQA 2IV3A 5KPDA 2D3WA 4WCFC 5DTQA 1WKCA 2XTJA 3MWEA 1Z0ZA 5TNXA 4E08A 4A8TA 4OGLA 1Y1KE 1OD6A 4X7BA 3U80A 4OG2A 3C41J 1GNTA 4ZK6A 4I5IA 2MSWA 3IUQA 3MOSA 1ZM3A 2PL5A 3GPCA 4IMPA 4L4XA 4KXVA 4UVDA 5IC5A 3WGVA 4D3YA 4OI0A 2AT1A 3IOCA 1LWOA 2REQA 2D5IA 5FXMA 3MUOA 3TE6A 4GOOD 2SICE 2QY6A 3NEAA 5KKAA 2QL5A 3U1BA 3RW9A 3CNOA 3FYSA 4JQYA 4NESA 4OLJA 4JB2A 1JSZA 4BLVA 2EL9A 4TT8A 3VTAA 1NURA 4HWKA 4TYYA 2BDTA 3U7QB 2H4YA 3QU5A 1XK6A 2V0CA 3RAJA 4MA4A 2JAHA 2ZUUA 1E6KA 3PE6A 4S04A 2PRYA 1LI4A 5GVSA 4AW9A 4XJSA 5JD4A 1ABEA 4G0QA 5AJVB 3C8MA 4LHXA 3T7EA 8OHMA 1FRNA 2B8WA 2QLBA 5MN5A 1E6UA 3VISA 2PR7A 4Z4CA 4ECEA 5TX7A 2ID9A 5JFOA 4D6YA 4J1TA 5I9BA 4DHWA 4M8LA 1E77A 1GAXA 3DYIA 2FPWA 2M1ZA 4IJ5A 1K75A 2DPHA 3GXBA 3REOA 4LHYA 1CR1A 1DCKA 1CUZA 3BJIC 1KYTA 2ZFUA 1NQUA 1U6IA 4MTLA 3VDQA 1AUQA 2Q27A 3BC1A 4Y1GA 3KKPA 3E70C 5CVVA 3H99A 2XUQA 1G17A 2DUUA 1YSCA 2IKQA 3OBIA 4US0R 4ARBA 4RPIA 4PAWA 4Z0TA 4DQKA 1KAMA 5ARCA 2XTAA 1QE0A 3KLMX 1QHFA 4ETIA 1MORA 4AURA 2VZEA 4CM8B 2OYSA 2Z9BA 2HWWA 3O2SB 3I32A 4D3XA 2PPVA 4O4HF 4BX0A 1I14A 1Q0HA 2RBEA 2VZ9A 2X0NA 2C1XA 1R8XA 2IIVA 2F55A 4YCMA 4C3UA 4L1KA 1W35A 4WESA 4KDEA 1TTHA 3AI3A 4RZ2A 1Y0BA 4Y67A 4CF6A 4CEIA 2VP6A 4Q7LA 3BQMB 4RS3A 4AUMA 1M2VA 3KEFA 5SV2A 1FPQA 3MJSA 3AUXA 3ABRB 2HJVA 4XDYA 3OT1B 5BO5A 4RX1A 3L18A 3UMGA 4XCQA 2GTPA 4D0SA 5K8VA 3JQ7B 1OFUA 5L3SA 3HGMA 1RI5A 1DARA 2V6MA 3FRIA 4MQUA 2P69A 5TGDA 4MPTA 4CKCB 2GM4A 3O8QB 4MB2A 3EHDA 3ZEIA 3MOIA 4TKMA 4KXNA 1NRJB 4PLGA 5LQSA 2GVNA 3WZMA 1YUNA 1DHRA 3L6CA 2VDWA 4NAHA 3SZ3A 3KTFA 5HK9A 3ZGLA 4B80A 2AMLA 5FWXB 2P1RA 4X91A 3JZAA 2Z0MA 5CYOA 4UREA 3TLXA 3GLGA 4BVBA 4CIWA 2AUMA 5DH9A 1BZYA 1KFKB 3VGPA 2J5BA 2JJ2A 1CHNA 1R74A 1VHJA 2A59A 3A36A 4IZHA 4YAUA 4E5UA 1UPAA 2HA2A 2IK8A 2PEYA 3DBIA 3D7SA 5SY4A 4A5SA 3DVAA 4RF5A 1H9BA 1ADYA 1WUIS 3HDGA 3A4LA 1AUOA 4RFSA 4YDQA 4RGVA 5I48A 3QMMA 2J7PD 2P5TB 1RIFA 2W2VA 2NTVA 4ND6A 3AUUA 5F9MA 2XUKA 1B0AA 2NX2A 3JSXA 1CZLA 3GLVA 3QELB 2VYVD 5H5JA 2VRNA 4JL5A 1PU2A 1W76A 5FFMA 5J5VA 2ZSFA 1E4OA 4H1WA 3FJOA 2AQIA 2V0NA 4DNXA 3P9XA 3WP0A 2GRJA 4AM8A 2VHVA 1I0ZA 3IUBA 1U2SA 1UOPA 1KVTA 1WB9A 2ZPAA 1A9QA 4R9SA 3GW8A 4KIFA 1ZGJA 2G1JA 4GOLD 1XVAA 4ZCMA 4XEUA 3VC2A 3LMKA 1ZGZA 2CNDA 4FDTA 3R8XA 2WJHA 1QUFA 1SUWA 2C0QA 3BFVA 4P93A 4BAGA 4DLAA 4EG4A 4A6DA 2YVUA 1YIOA 2FPGA 3PGJA 5GINE 1IB0A 5KI6A 2LGJA 3DLBA 3ZJVA 5A0TA 4N5DA 4I55F 2E85A 3A6LA 3BH0A 3K6RA 2L0XA 2ARKA 1YV9A 3ENKA 4RTPA 4UEWA 5J59A 4JFRA 3JQDA 3V8RA 1HQCA 1IBMB 3WGOA 3JQ7A 2XB6A 1YL7A 4O02B 2ZWPA 4HDMB 2K7FA 1CJMA 4XUCA 3EVZA 1PUJA 4CTNA 4EMBA 1E1NA 2IP1A 4X8OA 1SN7A 2Z2JA 4TGLA 5CW2A 1J9EA 1U1FA 4ZHSA 4P5EA 4JBWA 5K8UA 3T61A 2R8ZA 3QF4A 1WDWB 2UVQA 3M8KA 1C3EA 1J1ZA 5C4MA 4RDCA 5JVDB 3DZJA 4NCXA 2L19A 4L8VA 1SHZA 1TQDA 3FVVA 3K2BA 4M1SA 1U1EA 4BIIA 4F60A 1XGKA 2G9RA 4RV5A 3WP1B 2C5BA 2J0UA 3IV6A 1S9HA 3L6RA 3NCHA 2JC3A 4KQJA 2QVLA 4GPBA 1CIPA 3K70D 4ZARA 3ZCSA 4D3SA 3OAAA 3PZBA 4OAPA 2ODBA 2ZRAA 4MEBA 1IDOA 2GA9A 4PNPA 2OO7A 4HNAB 2PQ2A 3IUEA 4YAOA 4ZVSA 1IPHA 3WWOA 4NYIQ 2E2WA 3AESB 3H3XA 4EYOA 1XP5A 5FYQA 5ICCA 4F1WA 3UW1A 2HF2A 3R0XA 1U5CA 3T4XA 2AJTA 2Z43A 1R6BX 4PZYA 3A9CA 3ZGOA 3RIXA 3DLTA 1U0SY 4HNAA 1G8AA 4GOXA 1GCAA 3MCVA 1XTZA 4TS9A 4KE9A 5CHYA 1ADCA 1EE1A 2CGEA 3VU1A 2KQUA 3FSEA 4GYYA 4MDYA 4B0PA 3AW8A 1TJ3A 1EXMA 1XZFA 2ZU6A 4CM5A 2IU6A 1RMTA 2X8JA 4IKEA 3C1OA 1SIOA 5E8RA 3STXA 2FPIA 5ESWA 3GG9A 4UD6A 5JHGB 1QYRA 2YXNA 2F1IA 1AKEA 1DRUA 2W2NA 2X3UA 2BBWA 1DKRA 3SS7X 2V9ZA 4LWOA 1YZKA 2NTEA 3EZLA 2Q7DA 3RIYA 1F2TB 3VR5A 3KUUA 1AH2A 2JLCA 4D81A 2QQ5A 3OP1A 3RSSA 1YE5A 1Q0QA 2WRZA 3FNGA 5I6DA 5ITZB 3VPXA 2ONYA 1L2TA 3EFBA 5GV7A 2UUCB 1R27A 1Y98A 2R751 3QNUA 3UJHA 5TEVA 1MC4A 2ZRBA 3QPVA 1XWIA 2DPGA 3RK1A 3HB1A 1IK4A 1YASA 2EARA 1GG2A 2PMDA 3PQ3A 4H0FA 4WPGA 4ESEA 4ZO6A 2R96A 3A6JA 4DM4A 1IH8A 1N5OX 4KE6A 4EJSC 5C5IA 3UK2A 1ACLA 1G291 3T9BA 3E4CA 5D6NA 4HI0E 4EG7A 1YHNA 3KJZA 4TV8B 3GEGA 3WGJA 1GSAA 3JR3A 4RIGA 1ZNXA 3F3SA 5I45A 3M6WA 3FVWA 5IFKA 3HPRA 4NXNB 2OFWA 4A26A 4DUGD 1QVZA 2DFLA 3FAZA 2CNNA 2M6RA 4OHOA 4YJFA 5EOVA 3SEQA 1VIAA 1EP2B 1EHYA 2GXSA 1GLNA 1VRWA 3FUWA 4O2RA 3V1YA 1CRPA 3OZGA 3GEPA 5P21A 5K0EA 4B3MB 4IDOA 2Z6QA 2ZU0C 2P9HA 2C4WA 2R66A 1QHEA 2I3BA 3K94A 2NZVG 4EZEA 5ECGC 2PKEA 3VSBA 1YVEI 4YRAA 5MN6A 3OJOA 2JDID 2IS6A 1AV7A 1ZMRA 3P26A 4RYLA 4EO7A 4UZFA 3N5CA 1R10A 3QKSB 4M9QA 1YHZA 4BFXA 1XCJA 1TK9A 2WJAA 1J7JA 1RADA 2HQSA 1RLOA 1UXHA 1LZKA 1RYZA 3V2GA 1X19A 5ALIA 2J9FB 1CF2O 1MEOA 2GM3A 3U2QA 3GLGB 3ZE1B 2C7QA 3SFZA 3WL7A 1YL5A 3CLTD 1RQ2A 2ZJ2A 1I3NA 1PWXA 5JE8A 4PS0A 3R2JA 1AKNA 4WLEA 1HYHA 3TL3A 4L4SA 1LDEA 3ERCA 3E6AA 2YHUA 4EYKA 1XCPA 1G63A 1CYDA 2UVPA 4J76A 3A1UA 4G0NA 4IJVA 2JGAA 1ACMA 5CDFA 2ZYUX 3ZJ4A 4EYGA 3VNVA 1DJNA 1NU8A 3K1AB 4UNNA 2DWOA 3N3AC 4G9BA 5EXXA 3HUDA 4Q3DA 2ZBRA 1I8TA 3L4BA 4TTRA 5JH7B 4UU0A 1U94A 4JWKA 2PS9A 3K8OE 1B42A 5DW3A 2PU5A 3LWDA 1ZOOA 2C98A 3B3JA 1YBAA 4YV1A 3EFOB 3RJZA 2CLEB 1KMHA 2RGNA 1E1RA 3TGWA 3N53A 3LGSA 2PJDA 4FDMA 2WWVD 2ZUVA 1Z2PX 1TTQB 1M7BA 3CF2A 3AWDA 1WY7A 5DOZA 2AXEA 4GMXA 1PIWA 1TFRA 5C4GB 4LYHA 1YS1X 4FOTA 5T4EA 4X95A 3T35A 2ISSD 3LSYA 4NYIR 4BQQA 1CEQA 3DB1A 3GVPA 1Z07A 2O2ZA 3WLLA 4HYYA 5JATA 3RAEC 1YVPA 2Q3BA 3A3NA 1B41A 3OOJA 1GGFA 3BXEA 3FW1A 1NF9A 2P3SA 4E51A 2BSQA 5C51B 1FFYA 1LQTA 1KI6A 2JCVA 3HB5X 5HKKA 2B1RA 2HV8A 4R1MA 2O8NA 1WZNA 2GNOA 2QUKA 2NQTA 3D3JA 3QIAA 1G4UR 4UHBA 4MS4B 5DLEA 1FTQA 1PJ4A 3ZY2A 1DX9A 2NO4A 2QLTA 1KKLA 1WDLA 4IS3A 4FI3C 2WZDA 1PW7A 1TQ4A 3C8ZA 3K9LA 4NICA 2RH4A 3B7PA 3SS9X 3EHEA 3ESAA 3U0BA 1BOFA 5JJBA 2Q4BA 3QHPA 2A0WA 1KP2A 2NXWA 4AWAA 4Y2QA 4YFVA 1PF7E 1M1XB 1KKUA 3EE6A 1IBKB 1R6DA 1ZGBA 1MNQA 1G21B 3O21A 1M34E 2BONA 3I34X 1N4AA 4MUKA 1JFFB 2PS0A 3Q7QA 1RJGA 2XITA 3EDRA 3RB8A 2FPLA 3DOFA 5IUJC 3I05A 2GTHA 3WLJA 4Q4JA 4P0PB 2CFRA 3C5WP 3OPMA 1VIMA 3Q7EA 4C2BA 1HX7A 3LDAA 1QX4A 5A0VA 4BRZA 1ISRA 3BMQA 1HWYA 1Z17A 4KSCA 2IZ6A 3BMXA 3D6HA 4M87A 4WECA 2JA1A 3DV0A 3RRBA 2J48A 1CLEA 2R8BA 1O89A 5DYIA 2JHPA 1LSOA 1NQXA 3I45A 3VVMA 1D2NA 2VP2A 2C7PA 1NSTA 1H8HA 5EFZA 1O95D 5C1PA 3R20A 2R4QA 3BULA 1O7JA 4X24A 5LYJA 4A5OA 1R4MA 2WSMA 3HDJA 5IN4A 3ZWBA 3EIEA 1ZQ9A 3GJRA 2WKRA 5B37A 1FMFA 2NSYA 1XZEA 1AK9A 1R1DA 2Z1MA 3CVWA 2EJTA 1P0CA 1YHYA 3GLQA 1G3IA 1ZNZA 5A5FA 5L4SA 1KWKA 4B47A 4TLDA 4GKAA 3L40A 4FGKA 3C6ZA 2OG2A 2FKNA 1FCJA 1EBUA 5JWHA 4ILKA 3ACDA 5KX5B 4KYVA 4DCPA 3AIIA 4TSRA 5HOEA 1W0KA 3AP1A 3F9RA 1JSRA 5IAAA 2JI9A 3D2LA 2FUKA 3ASYA 4X8HA 5L3RA 2E6KA 2YYZA 4EG6A 1KFBB 1NIJA 2EWMA 5G02A 3NOVA 3PPXA 4XB1A 2KLHA 4H7DA 1SUEA 4W4TA 2LKDA 2QRMA 3ZUGA 4C7MA 3R0VA 1EP9A 3IQEA 2NAPA 4YC7A 3V8MA 3O9MA 1JEJA 1FNBA 1OV4A 4I5DA 5PGMA 2QJOA 3SZUA 3ZWXA 4DRYA 4P4NA 4E70A 4OD0A 2Q3JA 4GPZA 5EMJA 3MHTA 3QLVC 4HATA 4B8YA 5FTNA 1I2ZA 3V80A 3HKDB 1BKYA 2WZBA 4YRSA 4MVJF 2GN6A 4QJ4A 5T57A 1Z6GA 1K3FA 1ZN9A 1MNAA 1BO6A 4NZYA