4KVAA

Gtpase domain of septin 10 from schistosoma mansoni in complex with gtp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
246
Chain Sequence
FVFNILCVGETGIGKSTLLETLFNQKFDFPKLKAVTYDLKKLKLTVVETCGYGDENNIKPVVDYIDNQFENYLQEELKMKRSMQAFHDTRVHVCLYFIAPTGHSLKSIDLVAMKKLENKVNVIPVIAKSDTITKSELQKFKARILSEIQSNEIGIYQFPTDDEAVSETNSVMNQHIPFAVVGSSEEVKTVRVRQYPWGSVQVENENHCDFVRLREMLLRVNMEDLRERTHGVHYETYRRQRLIEMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Septin
publication title Crystal Structure of a Schistosoma mansoni Septin Reveals the Phenomenon of Strand Slippage in Septins Dependent on the Nature of the Bound Nucleotide.
pubmed doi rcsb
source organism Schistosoma mansoni
total genus 89
structure length 246
sequence length 267
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00735 Septin Septin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4kvaA00
4MYTA 3L0SA 4B3CA 4FN5A 1E3MA 3SOPA 2QBYB 2IHBA 2TMKA 1E1RA 1GL6A 2A30A 3K0CA 1NMXA 4PZZA 4IW3B 1XEXA 4D0NA 1NJFA 2QMHA 4URUR 2YKGA 5L8VA 4TYQA 4I81A 4NDZA 2IUUA 2VSXA 4EJSA 3TUJC 4ARZB 4BZQA 2OFXA 4HAYA 3U4QA 2P2LA 2ZRAA 4CEHB 5HCNA 2V1UA 2V6IA 3AVPA 2D74A 3U3MA 1WXQA 4WVFA 1G6OA 3EZ7A 2QTFA 3GD7A 1FQKA 3FB4A 2R44A 4HUQA 2ZS7A 3WHLA 2XJ4A 3P26A 4PQYA 5C4GB 4H1VA 3ZH9B 2J7PD 2WWFA 1AA9A 2C5LA 2J3EA 3P32A 4ZCMA 3C5HA 4Y0AA 3IIMA 2YWHA 2JDIA 3U7GA 3AP3A 2JJ2D 4M4SA 4TL6A 2WPDD 1KDPA 1W4AA 4K8OA 4M1OA 5GVSA 4QHTA 3NXSA 1SVSA 3BD9A 1KHTA 3KQHA 2R8RA 5F9HA 1TAGA 3EW9A 1NG9A 1KI7A 3RNLA 2XB2A 3NEJA 4ESHA 2CK3A 2GK7A 1ETUA 3UATA 4AKEA 2GXQA 1JBKA 1ZIPA 2GDJA 2ZE7A 5BXQC 1OKKA 2ZETA 1X8KA 1OXUA 3LFUA 2WSSD 2V3CC 2ZVQX 4O0MA 4DWJA 5TVKA 2VO1A 5H1YA 1AN0A 1FX0A 2IEYA 4UKDA 4U7DA 1NJGA 4JYCA 3LNCA 2A3RA 3QKRA 2Z43A 2KB0A 2IYTA 3LX5A 4YONB 1OH5A 4QGAA 5B58C 2OZEA 3EXAA 3PIRA 1IOZA 4IDPA 3BFVA 3QXXA 2IYQA 1ZUHA 1U81A 2AXNA 2RHDA 3SHFA 2VYFA 4EPTA 5JEDA 1YR7A 2RGDA 2VF8A 4TMZA 5TXGA 2W58A 5AJWA 2YJTD 1G6HA 2IF0A 2XITA 3T15A 1PUJA 1S1CA 2ZJZA 4M1TA 2C98A 1UBEA 2RB4A 4P4TA 4R7ZA 1RC8A 1U90A 4QHSA 4A2QA 2AKAB 2FFQA 2D7DA 1HE8B 4AG6A 4BZXA 2IXGA 1ZIOA 1OIWA 3PJRA 3GEHA 1S0UA 3WRYC 1J7KA 2JLQA 4NU0A 4C9BA 4EUNA 4ZV4A 1DVRA 4PPQA 3DDCA 4I1SA 1T3SA 3I8SA 3B9PA 4YMTA 4HYYA 3MJRA 3RSLA 2FV8A 4LUCA 4NP6A 5GVRA 4Q4AA 2GXUA 1E2LA 1E1QD 3K53A 3CF2A 1Z07A 1A7JA 2H57A 3TNFA 5M04A 2ZRFA 3U44B 3N5CA 2QP4A 2AK3A 1C4OA 2J9RA 3D7MA 4ITRC 4QFMA 4GMDA 2P67A 2ZI7A 3M1IA 5HZKA 1HTWA 1XJQA 2A5FA 2D4HA 5EP1A 2ZI9A 1IN8A 2PEZA 3A58B 1FZQA 1G3QA 1ZBDA 2YWFA 4YMWA 2CEAA 2QM8A 1TQ4A 2F3TA 1WBDA 3QBTA 3O8CA 1U0LA 2YC2C 3ND9A 1TEXA 1VYTA 1XFAA 4PC7A 4ZCLA 2D2FA 1UKVY 2PH1A 1ZUIA 2HYIC 5JHGB 4NHOA 2GJ8A 1E9AA 4B2IA 3LH5A 2ZI4A 4TTRA 5TARA 2HJVA 3B1ZA 4XIGS 3BS4A 2BBTA 5LPNA 3ADCA 3CRVA 2E1RA 4Q1AA 1WQ1R 4DXAA 1G16A 1IN4A 5FR2A 1Z63A 2ZRBA 1VKJA 1YRBA 3GMTA 2UKDA 5AK0A 2GJSA 2NZ8A 1IBRA 1KKLA 3PG5A 1K5GA 1Y3AA 4BFUA 4XWAA 3IHLA 4IHQA 1UKEA 1GRRA 3CF0A 5FBRB 1X86B 2ODBA 2F43B 1JNYA 2OFWA 2REXB 1QZXA 1OLOA 2NO9A 1EFCA 3K9NA 1QRAA 3B2EA 4Q7MB 3REFA 5J40A 4DKXA 2JATA 2WKRA 3K0FB 3NHBA 4NPHA 4LC1A 1ZNYA 5F9FA 4B35A 3W5JA 4E22A 3TRFA 1E2JA 1RJ9A 5AUNB 4XWOA 4AK9A 4FINA 4DDWA 2HYDA 1X8LA 2IYRA 1HT2E 4TMWA 2CBZA 1JR3E 4BWYA 3W8RA 3RC8A 1J99A 4JLAA 4DIEA 4QNRA 1ZRHA 3KX2A 4OKSA 3P4YA 2X2FA 1B23P 2IC5A 1MKYA 1G8PA 2W6ID 2Q9CA 2YWEA 4CVNA 5FTKA 4Q47A 5FL3A 1AZSC 4P32A 3T5DA 4XWKA 1N6RA 3CRW1 3TBKA 1F3OA 3B1WA 4GFDA 3IQXA 2QT1A 1N6HA 1VYUA 4IXMA 2FDCA 3LWNA 5FL7A 3LDAA 2EW1A 2GBLC 3P20A 2R9VA 3AGPA 2G77B 1F5NA 4LYAA 3F5FA 4BASA 2WZQA 2VSOA 3CBQA 2ZRCA 2ZUDA 4DLSA 3LQQA 3BH0A 1NRJB 2J0SA 1X1RA 2ZYUX 4ESVA 1F2TA 1AIPA 1L4UA 2JASA 4KFRA 4LHYA 3MSXA 4Y0VA 4YC7A 1U0JA 3M6AA 5HKKD 2BBWA 2GRJA 4WXPA 2CDNA 5G40A 5GJCA 1XMJA 4KSCA 5SZKB 3VX4A 1ZINA 1M2OB 1M7GA 3BOSA 1KGDA 3SZRA 1WRBA 4TL8A 3VNUA 5BYJA 5SZHB 1BO6A 1KI8A 1XU4A 3OIVA 4TLAA 4URYR 2IT1A 1QVAA 4NE2A 2Z6VA 3CRQA 4JBWA 1KDTA 2KWIA 5B30A 4FMCF 4JS0A 3WRXC 3T1TA 2WMNB 3EA5A 4DLRA 1DAEA 2ZRKA 3MG9A 2YHSA 2QAGB 2DR3A 1G7CA 4CEJA 1N6IA 3LLMA 4M53A 5E7IA 1Z08A 5L3QB 4CRWB 3EWSA 4LHXA 3C5CA 4NYMR 4US0R 3X1YA 3ZLJA 1M7BA 4F38A 1VDZA 4LV6A 2G1JA 4HUTA 2IEZA 3BGWA 1R8QA 4HLDA 3M0EA 3B5JA 1XXHA 4OK6A 2IWHA 3WXMA 2P5TB 3GPLA 3FDIA 2W0MA 3TSWA 4DLTA 4EFMA 4AY2A 3ADKA 2IYVA 1XTJA 1G5PA 4Q02A 5FBLB 1Q0UA 2CL7X 5FFMA 2VL7A 2WJHA 4TSFD 2PT5A 3GLFA 1XB2A 4W9MC 4RKEA 3AF0A 4HZUB 4Q19A 2BCGY 1B0UA 2OUKA 3ZD6A 1ZD1A 3K09C 4PPNA 2A5JA 5DE3A 4JLVA 1W4BA 3CPEA 2A5DA 1ZC3A 2ZAOA 4Z54A 4M1SA 3K0SA 2P6RA 1CR1A 3DPUA 4ON9A 5G3ZA 1T8UA 2MSEB 2DYKA 4IDQA 3L0IB 2H7VA 3Q85A 4ZDIA 1UBGA 3GEEA 4HDCA 4GL2A 1XMVA 4MYHA 4M1KA 1IXRC 1US8A 4HLCA 1RIFA 3PEUA 4JVSB 4KHZA 4HB2A 2O8EB 1W1WA 3NBYC 1KKMA 4XD7A 3FMOB 4AURA 1GKUB 2AWNA 2QORA 2OAP1 4OI2A 2JGNA 3DZDA 4JSYA 4V03A 1V43A 2X1VA 5AJXA 2NO7A 1M7HA 1P5ZB 2FG5A 4NTZA 4Q21A 5JWRA 1W36D 5BN4A 1S3SA 4JL6A 4M8NE 2FGJA 2VP0A 1ZP6A 4Q5IA 5KSOA 4BUJA 1FMJA 1LB1B 4G5RA 5FUXA 2XOKD 4D4JA 5FPSA 2OEPA 3NWJA 4HZIA 3IGFA 1AK2A 3GLIB 3LW7A 2N46A 3Q72A 1FQJA 1G9XA 1W5SA 4TT3D 5UKDA 2PMKA 4C3ZA 3HU1A 3FMIA 2AHOA 3FWYA 4TL9A 2BC9A 1SKYB 1R0XA 2A5YB 3T34A 4U00A 4B3XA 1RZ3A 2ANBA 4Q9LA 3CPHA 1DOAA 1LF5A 3OZXA 2OBLA 2C99A 2NGRA 2QTHA 4MUBA 4PC1A 4RD1A 1E9CA 2C78A 1DAIA 1BMFD 3K1JA 5J5CA 2O8DB 4IVPA 1JXOA 4P4SA 1A5TA 1IY0A 3R9WA 1ZM3A 1XEFA 3KXKA 5ANRB 4E5UA 4LI0A 1VTKA 2ZANA 3GJ7A 4LPKA 1II0A 2W00A 1KMHA 2FE4A 2E87A 5FBWB 2GESA 2XZPA 5GJBA 2GCPA 4ZKEA 4LYHA 1W0JD 1OF1A 3CPJB 721PA 2JA1A 1G8FA 4HAXA 3ZD7A 3EPLA 4H9GA 3FHOA 2XEXA 1QHHA 1NNEA 1XTRA 1SXJB 4MITA 4N3NA 1G41A 3ONWA 2GJKA 1XX6A 4DVGA 2NIPA 2G0TA 2GCOB 3DM9B 1CBUA 4ZDJA 2W6JA 2PBRA 1OYYA 3AM1A 1OH8A 4AC9A 2FSFA 4WW0A 3BFXA 2BVNA 1R5NA 3WMFA 1CEEA 4B2LA 1HEIA 1IY2A 1LS6A 1N2CE 3E2IA 3QVUA 1S1MA 4LV8B 1E2PA 4DHEA 2GF9A 2PX0A 3QNUA 1KY2A 1R6BX 2FWRA 3U2QA 1PZNA 2CCKA 5KNCA 3H4MA 3QIAA 3DZ8A 3TUZC 5DIFA 1Z6GA 3REGA 3QG1A 3AVYA 4FCVA 1QHGA 3R7WA 3SJCA 4IFBA 1SHKA 5CJPA 6Q21A 5D3MA 4KO8A 1Q21A 1JPJA 4QM7A 4N1AA 4EPYA 4A2PA 3KKPA 4FMDF 4BFXA 5EP4A 4O25A 3RRYA 2NTYC 2BJWA 4IVQA 1NLFA 4B71A 2E9SA 2G83A 3Q5EA 3KQUA 4LSGA 4A9AA 1NKSA 3UKDA 2CVHA 2V7QD 4S2EA 1N6OA 2QGNA 4GI7A 4ZIRA 3FKSD 1D8TA 1AS3A 1FTNA 1GOTA 1N6PA 4LRWA 4PO9A 3SC3A 5KPDA 4K81B 2GZHA 2ATVA 3ZZUA 3OEED 3VR4A 2OLJA 1I4TD 1R0ZA 2NMVA 2GKSA 1S2MA 4MGZR 1H65A 4BRWA 2WWYA 5J4KA 3N2EA 1Z0AA 3AVTA 4Q1CA 2OSBA 4Q00A 3AB3A 5DHAA 1ZNWA 2OE2A 4EQ6B 2OXRA 3HDTA 1XTKA 4IEEA 3CZPA 4RD2A 4YLGA 1CR4A 1YZTA 4DCSA 1XEWY 4DBLC 2GAOA 2A5GA 5CK4A 2IS1A 4OYHA 2XSZD 4JL8A 3S1AB 1ESNA 1KI9A 2OESA 3ZDQA 2ZYVX 1E2DA 4HLUA 4JMPA 1E0JA 3T12A 1N0WA 1ZM2A 2ERXA 2JLXA 2EU8A 4EAQA 2IUTA 2QT0A 2VP4A 3UWOA 1GNRA 1MOZA 5KDDA 2AWOA 4IXNA 4QJ4A 5JCPA 5JS8A 1XZQA 1JR3A 3IDQA 1OPXA 3CB4A 3NTUA 1ZMXA 5BN3A 2CL6X 1MT0A 4Q1DA 1Z6AA 1RE0A 1M1YE 1G8GA 3ZVNA 4ARZA 5JEEA 4B48A 4TLBA 4TN1A 4CEHA 1GZSA 2HLDD 2ZJYA 2XB4A 3DMDA 4DT1B 5KNBA 1GFIA 2C96A 2CCJA 4N0DA 2Q9BA 3LXRA 3PITA 3BFKA 4NH0A 2GEDA 4TLEA 2CNWD 1ZYUA 2ONKA 4ASUD 4DUGA 2VP9A 4V0NA 3NG1A 1ZNXA 1E9RA 2EYUA 5AUPB 4TLCA 2ZRJA 3RABA 1LY1A 3PEYA 4LV5B 3QPWA 2CJWB 4QG7A 4UQOA 5E4FA 1RFLA 3ZIAD 3GLIE 1E2IA 2HUPA 2O8BB 1IONA 3TKLA 5J4LA 1UADA 1QG2A 2OBMA 5DISB 5LDDC 1NY5A 2R6AA 3IBYA 3TSOA 3PUVA 1SKYE 3D3QA 1F2UB 1NF3A 2WBLC 4XSHA 1T91A 4PO8A 1NBMA 1XJCA 1NI3A 1G8HA 4IDHA 1Z0IA 1ANKA 2ANCA 2FNAA 2QPTA 4KVGA 3RSOA 3EPHA 4Q7JB 1Q3TA 2FEMA 4X8MA 2IL1A 1W2GA 1XJ0A 3THOA 4AG5A 1N6LA 1NLYA 2AD5A 1CRPA 3A1SA 1BKDR 5CDFA 5KSZA 4RSGA 1W36B 2BCJQ 2GCNA 2V8OA 3MWYW 3P27A 4NCJA 3WNDA 4D4KA 3A37A 3K9HA 4RCYA 1HQCA 1KDOA 4CF7A 4B6EA 2A78A 4M1WA 3AVUA 1V5WA 2Q6TA 2VEDA 4C7OB 4K46A 5EJEA 4A6PA 5JSZB 1ZU5A 1TX4B 3A4MA 1UKYA 2WKPA 3RRZA 4ILEA 4M22A 5FH9A 1DADA 4Q01A 4BFWA 2F55A 4RFVA 3H1TA 3QF7A 4UNRA 1IXSB 2J5XA 4B75A 1K5DA 2P6UA 4M21A 3KL4A 5FBVB 4KJZA 2WHXA 4YXWA 1VPLA 3Q8XB 4EPXA 2QE7D 3OE7D 1R10A 1SKQA 2GETA 3EZFA 4D82A 5KTYA 3NEYA 2R6CA 4L9WA 2BMJA 3HWSA 2WTUA 2RHMA 3TW4A 2WWXA 2CVFA 1G64A 4M9SA 4WZBE 2F9MA 1E2MA 4KYIB 2YWGA 1PLLA 1GRNA 3RS3A 3A4LA 3B1VA 3X1DA 1J70A 3U44A 4LCBA 1E9FA 2GHIA 2H92A 4IOLA 4Q4JB 3TH5A 2V1XA 1NIJA 2I1QA 3KTAB 4B74A 1JQJC 3BB4A 1ZM7A 3LD9A 3Q5DA 3VR1A 4FMDB 4WAUA 1XD8A 4Z1MA 2EQBA 2Z4SA 3R9IA 2VQSA 2ZE6A 3X1XA 4OQXA 1J2JA 5CB6A 4AKIA 1FUKA 4Z8XA 3KJGA 4LC0A 3U7EB 1DBSA 4NCIA 4PAMA 5KNDA 3I32A 2Q3HA 1G7RA 5JHHB 1JEEA 1W44A 1GAJA 3QG5A 4NBSA 1U2RA 1ZCBA 2GTPA 4TYPA 1E2GA 3SJBA 1SVWA 3QY0A 4O2RA 2ZUBA 1UKZA 3K0AB 1YZQA 4Q7KA 3X1WA 4C0HA 3FKQA 3TUIC 2JLSA 2G1KA 2RGAA 4R98A 2ECKA 2BMDA 3G0HA 3K8YA 2GBLA 2D06A 2H18A 3AF2A 3D6TB 4L4UA 3QEJA 4TL7A 2ZI6A 1OH7A 4MKGA 5AUOB 2FZLA 3HR7A 1GKYA 3RWOA 2X2EA 1VCIA 3L43A 4DDTA 3B1XA 2IX3A 1W0KA 2VH5R 4US2R 3OAAA 4JT2A 8OHMA 3FMPB 3TR5A 2O8CA 1W48A 4ERNA 4OQFA 4JLPA 1IY1A 1G18A 4WIAA 2BV3A 2WKQA 1CULC 3AEZA 4P3YA 1KY3A 4XSGA 4G5SA 3FFAA 3QKSA 5CM9C 2AR7A 2RGGA 3SEAA 3QKTA 1N25A 1VYVA 1XMIA 2EVWX 2CLDX 2REBA 3C14C 3EZ9A 4JLJA 1MABA 1Z28A 2R6FA 5CJ2A 3KQKA 1XCPA 2WAXA 3W3AA 3CM0A 3BAFA 4OHXA 2EFDB 1COWD 1OB5A 5BWMA 4E03A 2KJQA 3AUYA 2JLWA 5FTNA 3W34A 1M6NA 3BE4A 4A0HA 4ZI3A 2YNMA 3C4JA 1I2DA 4HLUC 4OQLA 3I73A 1J8MF 1KJYA 5E7JA 2BDTA 3A1WA 3THXB 3WMEA 2ZYWX 2MSDB 4CEIB 2F6RA 1XZPA 3THWA 3U5ZB 1X8JA 4LHWA 2ZE8A 2JAQA 3DL0A 2PT7A 3TGPA 4M2LA 1G5RA 2VPPA 4RFSA 2ZREA 3OEHD 1TTTA 2RGNA 4C0LA 1L4YA 1MH1A 2N42A 3CO5A 3B13B 4B3BA 3Q7PA 1GNQA 2HCJB 2IYWA 4FI3C 3N2IA 1IN5A 1GUAA 1MO3A 1OB2A 1JECA 3CX6A 2GVZC 2KBEA 1U98A 4GOXA 3QF4B 3T1QA 3PCRB 2YOGA 5KDOA 3TIFA 3V4RA 3GLHB 5H70A 3AVWA 5KYKA 3EPJA 4RD0A 1EX6A 2Z5FA 1U99A 1KO1A 1XD2B 1KJZA 3K09A 4AYWA 1A4RA 1XTSA 4A0GA 1F48A 4F93B 1XNJA 1E0KA 2XNDD 3SU8A 1E98A 3O8BA 5CIWA 3ICQB 2GJAA 2Q21A 2WJIA 5DO9A 4TMXA 5CYPA 4N0EA 2VBCA 1KI3A 1FPMA 3QBVA 1KSHA 5CYOA 4QGHA 3RVBA 2B7BA 4H1UA 2XGJA 2ZS9A 1G5TA 3HJNA 3FTQA 4JZKA 2QROA 2J7PA 3RS7A 5KU1A 3NBXX 3OFND 5L3QA 2P65A 3RDPA 2J7KA 1Z06A 5HCIA 3W9YA 2EFHB 1H8HD 2QM7A 4MGYR 4DEXA 3I1FA 4IOKA 2J41A 2O0KA 1LS1A 4B6FA 4A1FA 1BS1A 1Z0DA 4DC9A 1E79D 1DAFA 2RGBA 2IHYA 4R71A 5DI3A 2JJ1D 2CE2X 1XRJA 2G6BA 1G19A 2DWPA 3E5HA 2CE7A 2N1BA 3DEFA 4HAUA 2FEOA 2XAUA 2MMGA 2JCSA 1LW7A 2WSSA 3ZZ0A 4B34A 1FP7A 1G3UA 2J0UA 2WJJA 3A8TA 5EZ5A 4RVCA 5F3WB 1E94E 3WYAA 1P73A 1HURA 4HZUA 4LDJA 3VHLB 3KDSE 2BOVA 5HE9A 1SXJD 1MO4A 1D2MA 2IBMA 4DSTA 4DDUA 4QJ5A 3IPXA 3PV0A 2Q3FA 4B44A 3CUEF 1X3SA 3KB2A 2ZVPX 3KJEA 4PHHA 4A92A 3T06B 3EC1A 3TW8B 2RMKA 4KBFA 2OAQ1 4LBVA 1TU4A 4J0QA 2C03A 4IDNA 4I4LA 2CCGA 1YR6A 2IYSA 2QG6A 2O8EA 3AP2A 5AJYA 1XEXB 4MDFA 2ZAMA 2D3WA 1NVXQ 1KSJA 1XD9A 3CRMA 1DS6A 2W0SA 4LJ6A 2W2VA 4EJSB 3KUCA 3W3ZB 3VU9A 2IYUA 3LBIA 4A36A 3U4QB 2IW3A 2WICA 1R0YA 3EASA 3CW2A 1K8RA 4F7WA 2H16A 1GL7A 2QU8A 4BZPA 4QNMA 3TQFA 2ZYTX 1U8ZA 2R65A 2R62A 4LZZA 3EIEA 3WYGA 4QJ3A 1QHSA 4KV9A 1O87A 3G82C 1OHHA 3AQ4A 1S96A 3FVQA 4DCUA 3GP8A 4PC3A 2AX4A 4YMVA 1RRFA 4B3DA 1E4YA 1SGWA 3PVSA 2QY9A 3MWJA 1W4CA 3ASZA 3KQNA 4P0TA 1NVWQ 1XWIA 2JLRA 5DN6A 5C18A 3IO3A 2FPKA 3KJHA 4URWR 1DO0A 1FX0B 3ND8A 5FOUA 4C0QC 3QKRB 3X2SA 1II8B 4B76A 1D9XA 3SYNA 2IYLD 3IIJA 5A0FA 5KHOC 4QBHA 3THYB 1T9HA 3GQBA 1YR9A 3TJZA 4QHYA 3FYHA 1PJRA 4L5BA 3W5IA 1TF2A 1UBCA 3SJZA 2ZU0C 4MUAA 1J8YF 5IK2D 4M9ZA 1QG4A 4HI0E 5FBQB 4OHVA 2BEKA 1FNNA 2KBFA 5B57C 1VIAA 4YQFA 3LAWA 2HF8A 4OHZA 2DBYA 3U7HB 4MRVA 3MJHA 4URZR 3VR5A 5FOXA 4D81A 3CX8A 2DFLA 2FN4A 1F6BA 1DAKA 2OHFA 4LJYA 1P2VA 2DB3A 2BBSA 5EE9A 2O0HA 4LJAA 3TSZA 3AF1A 4JIMA 2JLYA 4BFZA 2H8KA 4OBEA 4TTQA 3AGQA 2DFNA 3C16C 4F4CA 1MRSA 5KSYA 4QM6A 4Q4LA 1AKEA 4G5QA 4Q1EA 3LO5A 3H2YA 2VRWA 3MCAA 5IRCD 1W5TA 3EWAA 3D8BA 2ZJ8A 2RGNC 1P62B 3GLHE 2PCLA 3T35A 3H86A 3HU3A 3UK6A 2IXEA 2O52A 5DNYB 5D3QA 3C8UA 5K8TA 4FWTA 1KOFA 1PLJA 2YOFA 4IKEA 4BGDA 1CP2A 2QP9X 2FPMA 2DWQA 2X77A 2W6IA 1EWRA 3A1UA 3QJYA 2EFGA 121PA 5EP3A 4Q18A 3VHXA 3NKVA 1E0SA 5DHFA 4I99A 5FI0B 4BFVA 2PZGA 5KDLA 1NMZA 3EX7C 2OO7A 1CLUA 1FL9A 1VHTA 4KXFB 3DM5A 1DELA 4RD6A 4MQBA 3HR8A 4WOPA 5JCZA 4LHZA 4CT5A 1C9KA 4JBYA 5DLQC 1OV4A 2KSQA 1A2BA 2CHQA 2V55B 4GPTA 2FFBA 1AKYA 1P9WA 1VCOA 2GXSA 1P9RA 3B82A 3LBNA 3LRPA 1G4UR 4TMVA 3WYFA 3U3JA 2QAGC 4BLTA 4RJLA 1JPNA 1CIPA 1HV8A 3EC2A 3GJ8A 3SFZA 3K9LA 4RZXA 3V4FA 1G7TA 3CLVA 5EP2A 4PHTA 2PZFA 2PEYA 2W6JD 3QXCA 3U3RA 4BFYA 2RGXA 3RLFA 4FMBB 2GNOA 1T8TA 4WZAE 4DZZA 3LBHA 1OXVA 1QHIA 1U8AA 2A2ZA 4NYIR 2QSYA 4GP6A 4EPVA 4F92B 1YQTA 1S8FA 2BBOA 2FSGA 3PEVA 521PA 1OT3A 1KIMA 3AF3A 2CL0X 3BXZA 2RGCA 4IRUB 4Q4HB 4ZPXA 1MO5A 3SDZA 4URVR 3P1JA 4NONA 1M34E 2MMCA 2GAAA 3AKCA 2PJRA 3SNHA 1VG9B 4PXAA 3RS5A 1Q57A 3IEVA 2WOJA 4HATA 1RJ9B 3EPKA 1DARA 3F3YA 2VHUA 5EE0A 4PHFA 3QI2A 1YVDA 2FMXA 4CZ2A 3UPUA 1P2UA 4DT1A 3UG6A 1EFHA 1G7SA 4GMXA 1E2HA 4GT1A 2B8TA 1WB9A 1Z22A 3CNOA 1GRQA 3R9XA 3A4NA 3N70A 3VTKA 5P21A 1KMQA 2QP3A 4TSFA 1W7AA 1P4SA 4UNPA 4Q03A 1N5LA 4YMUA 2J0QA 3SQWA 1JR6A 2CJWA 4BE7B 4EPRA 1NN5A 2AFHE 2H17A 2F3RA 1WP9A 2F9LA 3A1VA 1ZUNB 4HAVA 2ZRNA 4LGMA 5K8LA 5JJLA 4QKQA 1RKBA 4PAQA 1E0AA 5JRJA 1KZ7B 1UEIA 4QBGB 3B60A 1GKIA 2OCYC 3I62A 4E07A 3PUXA 4A2WA 1PLKA 3WBJA 1F2UA 1UF9A 2ZSBA 4DDVA 4KI0A 2O8FB 2RCNA 3CR7A 1H8ED 1ESMA 1WF3A 2PJZA 3RANA 4QRHA 5HR5A 4LYFA 1E2NA 4A15A 1L8QA 2JIZA 1ZD8A 1YE8A 1UM8A 2ZRDA 3OIYA 4OJQA 2GZDA 2QI9C 1Z47A 3VMFA 3L8ZA 4DSOA 2QL6A 1P72A 5A5GA 1YHNA 3BB1A 3LLUA 3VAAA 1R7RA 1MO6A 4BECA 2J87A 4LY6A 1OXXK 4C0SA 1EFRA 3NVAA 3DKPA 2JLUA 3RRNA 4WXRA 2XOKA 5J4HA 2HT6A 1YZUA 5JWHA 4C7OA 1G1MA 2Z0MA 4RKFA 1OE0A 5G41A 1PVOA 4EFNA 1ONBA 2QMUA 3UMSA 3HU2A 3UMFA 4TT3A 4FCTA 3NH9A 1RRPA 4LBYA 1Z6XA 4QOSA 1NN3A 2XNSA 5H8WA 1NIPA 4TWZA 4FWIB 2G9NA 3O8RA 4MKHA 3QE0A 4YDSA 1SXJC 2VA8A 2ZJAA 2EWWA 5BYKA 1XTQA 3FHTA 2X8AA 1BMFA 2WWWA 4DUGD 4D26A 4JLBA 4A82A 3B1YA 4A8JB 4IJMA 1CJVC 1NVVR 1IN6A 1E2QA 5L3SB 3GLFB 1SQ5A 4W5JA 1N6KA 4UNQA 4Q4JA 5TY0A 1Q22A 4FIDA 3KTAA 2WWHA 1VIYA 1W0JA 5GJWC 1DAMA 1W2HA 4LHVA 4LBZA 4NZYA 5FPHA 2ZR0A 4JJKA 3TQCA 1VG1A 1QBKC 2GK6A 5FTJA 3TAHA 2B8WA 5DGXA 1NBMD 2DPXA 2IYXA 2ZRMA 3B78A 2ZI3A 1FNMA 1XCGB 4KSBA 1US8B 4OJKA 2GXAA 1YRAA 5CITA 1DO2A 2YC4C 4Q66C 4JKYA 3HPQA 2VP2A 5J47A 2ODWA 3BORA 2F7SA 2BM1A 4F4IA 2DFTA 1CRQA 4W7SA 3IBGA 2QBYA 4M9XA 5JFGA 1E99A 4V0LA 4UXJA 2RKOA 4HAWA 5E3HA 2LCFA 2RGEA 4GOKA 5AJVB 4DLYA 1DG3A 3FGNA 1XCMA 3BBPA 2NQ2C 2P0EA 5JJKA 1KO5A 2FFHA 2NO6A 3JVUA 3Q7QA 3ZQ6A 2J45A 4DLXA 3K9GA 3NH6A 1JJ7A 3QSYA 1O3YA 1UEJA 3KB1A 2XZLA 4NCKA 1D5CA 2UZ3A 1M8PA 4GOJA 4KVAA 4JLNA 1G17A 1E9EA 5L3VA 3K70B 1WDTA 2W2TA 3CR8A 2QTVB 2QMOA 1FOEB 3ZGXA 1HY3A 3CRRA 4LK2A 1KI4A 4RZUA 5KO2A 4Q9JA 3GCGA 2ZEJA 2C9YA 1KAOA 4P4SB 3M4YA 2I1VB 2P3SA 3SE0A 1UJ2A 5GADl 1XPOA 3VKGA 3CIOA 1RYHA 1SHZA 4BLSA 4V0OA 1N0UA 2R6GA 3T61A 4E09A 4G5OA 1KMHB 2V7QA 3ECCA 3ZS9A 2ZJOA 1GG2A 1D2EA 1TU3A 1NN1A 3FKSA 4HAZA 5FUYA 4HB3A 2BIFA 1L7VC 2Y8EA 2ZRIA 2ZSAA 5FOTA 1W4RA 3BH7A 1WA5A 2AXPA 3OEEA 4Z1MD 4A0RA 1W49A 1HUQA 1T5LA 4RZ2A 2YZ2A 4X8OA 3NDBB 1KI2A 2NO1A 1IAQA 2WAYA 1QHHB 1EK0A 1XP8A 3QOFA 4AI6A 4ACAA 3B6EA 1ELOA 1QVRA 4D6PA 4LJ7A 4RD4A 3I4LA 3GJ3A 3OHMA 1OYWA 3WHKA 4JBXA 4KFUA 2XX3A 3GJ6A 3TVDA 5EQTA 3ADDA 3QF4A 5J4VA 4EIWA 1ZM4A 1E1RD 3ZJYA 2IYZA 4DB4A 1SXJE 3OF5A 4TLDA 3GLHA 5JMTA 4P31A 1F60A 1N5JA 1Z2AA 2V9PA 5JECA 1N5KA 1SZPA 1ZU4A 4JVMA 2QGZA 2PLRA 4PSKA 4TZ6A 2XZOA 2GEVA 3TK1A 1XD2A 3V00A 4DRZA 2PZEA 1KSFX 4G3XA 3VR6A 4NYMQ 1I4DD 3GFOA 2F1RA 3TAUA 3BK7A 3U3KA 2YOHA 2C2HA 3E1SA 2ERYA 1LVGA 2ZR7A 1WCV1 2WOOA 4V0ME 1XPRA 2HLDA 1KI1A 1DPFA 1HT1E 1NL3A 2JDID 5EXXA 2ZJBA 3PUZA 2D2EA 1DEKA 4LBWA 4ASUA 2ZXUA 2XJ9A 3RRMA 1G3MA 1A82A 1CXZA 3NBFA 1K6MA 2CK3D 1IXZA 3EARA 4IOJA 3ETLA 1OKKD 1EFUA 3EIQA 3R20A 4PZLA 1E32A 2QA5A 1Q1QA 2R2AA 4TMTA 3LVQE 1TEVA 3NHAA 3ZIAA 3PXGA 2K5UA 3L2OB 3NDPA 1W36C 5FUVA 3AVQA 2PL3A 3AV0B 3IILA 3NC0C 3LX8A 5EXTA 3C41J 1CU1A 4EFLA 3KKQA 3AP1A 2CMKA 4OI1A 3B85A 4MKIA 5TMPA 1RRGA 1QDEA 4PAOA 3DVLA 1KO4A 2Q3MA 4W5HA 1I4LD 2ONJA 4D80A 3AVXA 2DFKB 2RAPA 4Q48A 3BJIC 3GLFE 3HPRA 4G5GA 1VG8A 1SVMA 1DAGA 1GILA 4O2LA 3O47A 3QENA 1SVIA 4GBMA 4BFSA 4NYIQ 3O8DA 5JBQA 2HEIA 1E2KA 5JLJA 3EIHA 3MFYA 3BC1A 2R6DA 4HDOB 4NCNA 2XXAB 4C2UA 2F43A 5FI1B 3U3OA 4HB0A 3Q3JB 1G3IA 5KPJA 3B9QA 4KU4A 5J4YA 1N0VC 3VX3A 1TNDA 4AKHA 3K0FA 5AR1A 4DSNA 1PV4A 2ZSEA 3U6BA 1GL9B 2QE7A 3OE7A 2VHTA 1Z0JA 4CDGA 5EE1A 4DEYA 1JI0A 4XVRA 4A4DA 4Q9IA 5IF9A 4NKRA 4WZ6A 3W6OA 4LYJA 4RCZA 5EE5B 4M1MA 1Z2CA 2J1LA 3KKOA 1CTQA 3VNVA 5CIQA 3FPAA 4PSAA 4O3MA 2FSHA 1L2TA 2UZIR 2FGKA 4MKFA 1YU9A 2C04A 3C7KA 4GZLA 2NPIA 3B7GA 2REOA 1KK1A 1ZAKA 1MRNA 4LOAA 3MD0A 3WY9A 5JRZA 4EPWA 1UAAA 1C1YA 4L16A 1P6XA 2ZM5A 3OIUA 3G5UA 5CM8B 4GNKA 4PHGA 3CWQA 4II7A 3PEWA 1Z0FA 1T5IA 1KK0A 1Q1EA 1Q1BA 1FUUA 5DSZA 4GSYA 1II8A 4YMSA 3GLGB 4Q9KA 3RHFA 5ELXA 1R0WA 4DCNA 1OXSC 4PFSA 1TF7A 1UBFA 5KSPA 4AKGA 2FH5B 3THYA 4TZ0A 1NN0A 2ZSDA 4CT4B 2AK2A 2ZR9A 4HSEA 2FPLA 1W47A 3KFVA 1N5IA 1OFUX 2ASEA 2QRZA 1TPZA 2J46A 2VTKA 4ZCIA 1CKEA 3W6NA 2GEUA 4FXPA 2H1LA 2Q9AA 2WWGA 1P2SA 1KI6B 1GWNA 4B33A 5FPKA 3IO5A 4BLRA 3UIEA 4OQNA 5EXPA 4JLOA 2ODNA 2SHKA 2LWIA 1JAIA 1NKTA 4AYTA 1OFHA 2ORVA 1LFDB 1QHXA 2QAGA 4KITB 3SS8A 2P5SA 2WIAA 1E9BA 2ZITA 4G01B 4I1OA 4L9SA 1VCNA 4DLVA 1Z6YA 1RYFA 2MSCB 1YZGA 1XEWX 4IVRA 1ZC4A 1YKSA 2JJ2A 3VQTA 2AKYA 3I3SR 1U0HC 1KYIA 1S9DA 2IUSA 1KNQA 2WPDA 2CXXA 3MAAC 1OSNA 1QHNA 2G0NA 4GP7A 1XBTA 4PANA 1S9HA 1JXMA 3BIFA 3CKLA 4C4PA 4IDOA 5B2ZA 2VHQA 5JWOA 5EUQB 1IJFA 4PPFA 3IUYA 4C30A 1COWA 5E95A 5G53C 4ZDWA 2G3YA 5CLLA 2B21A 1AQYA 4QBIA 4MRNA 1OHHD 1FFHA 1ZJ6A 4AIIA 1AS2A 1NVVQ 4JLDA 1CJTC 1TL7C 3LQRA 2FU5C 5FL7D 4L15A 2IWRA 3T5GA 4UXIA 2VP6A 4C0KA 1N3BA 4BFTA 4C0BA 4NYJR 1UPTA 5DN6D 1Z5ZA 2ORWA 5HTKA 3ZVMA 1A2KC 3KJIA 1WMSA 5FOSA 1RPZA 1NP6A 1ZD9A 4ACBA 3OEHA 2QEQA 4US1R 2L0XA 2JEOA 2HF9A 3WNBA 2EFEB 3W90A 1KO8A 3CX7A 1KDRA 4D0LB 1TUIA 1LNZA 4NCHA 4MDEA 1MV5A 4NMMA 1ODFA 4A6XA 1S4QA 1VCMA 2ZU6A 3SI7A 1II9A 2BHRA 3R8CA 1NMYA 5SZJA 1Z3IX 3LW8A 4CIDA 2PCJA 5JZVA 2OCAA 1E9DA 2ZRLA 3GJXC 4TQUS 5DH9A 4DSUA 3F8TA 1G20E 2HV8A 1T4GA 5BN5A 4OHYA 1JEDA 1G4AE 2XNDA 1Y63A 3GFPA 2P6NA 3PUYA 4HUQB 3QPVA 4C0AC 4ABYA 4V02A 3VR3A 2IXFA 3GJ0A 1E69A 4BQSA 2O8CB 2IK8A 1DE0A 5EZ6B 1XTIA 2ZTSA 1P9NA 1E1QA 2H5EA 3QKSB 4Q4HA 4XOIA 5FPTA 3GLIA 4Z8YA 3WNCA 4XVUA 4CYMA 3W6PA 1SVLA 1TQ2A 2GILA 3T1OA 2GZAA 5K8UA 1KAGA 4IFEA 1KK2A 1MABB 3QQ5A 3SFVA 1IHUA 3OFNA 2FSIA 4WBSA 2IS6A 2VF7A 2BMEA 4L8GA 1JB1A 1TQ6A 1H8HA 3L0PA 4GDFA 4M1YA 3SQXA 3D31A 2O8DA 1SULA 4B47A 3FHCB 2PMDA 5G3YA 4PC2A 3U60B 5SZIA 1E79A 1CS4C 2JJ1A 2D62A 3FE2A 3VR2A 3EA0A 3GFTA 4DLZA 3EG5A 5LD2B 2A7QA 3THWB 4TYWA 3JZMA 1PUIA 2Z83A 1GNPA 3K0CC 4RFSB 4KAXA 4LWZA 1VMAA 1IQPA 2V6JA 1FTSA 1TUEA 2QRNA 2C9CA 1R5OA 4X8HA 2WSMA 1R8SA 4XH9B 1Q1ZA 4MH0R 5EXSA 1SXJA 1OW3B 4R2HA 4EJSC 4OK3A 4QGFA 4M0LA 3HYTA 4XVQA 5IHPA 2OM2A 2GCOA 4WA7A 4B2PA 4RY2A 1GIAA 4UXHA 3H0KA 2OCBA 5KUTA 4XD7D 3RS4A 4JLMA 1LV7A 2O8FA 3BH6A 3WBKA 3AVOA 3W8NA 1NLZA 2AL7A 1BYUA 2ZI5A 4PQFA 3RAPR 1A1VA 4LJ5A 4MGKR 1Z83A 4V0MA 1OFTA 1OIXA 3OIWA 2ZIAA 2LKDA 1NBME 4B3FX 1CJMA 2GJ9A 1NVUQ 1UDWA 4Q4AB 3GLGE 3QPUA 2F1IA 4PQRA 3I8XA 2ZPTX 2IYYA 5H68A 3ZS8A 4AYXA 5JS7A 1HE1C 2XTZA 3CNLA 3H84A 2PX3A 3QKUA 2I3BA 2YV5A 4LJ9A 3DMNA 5GJVC 3K70D 3CH5A 3TE6A 3RS2A 5CDFE 4X8LA 1VHLA 1Z0KA 3QXHA 4QC2A 5LD2C 3QUSA 5LB2A 3I5XA 3UWKA 5HPYB 4M9QA 4B73A 4PO1A 2I4IA 1LTQA 1N6NA 2VIIA 2VHCA 4GRAA 1EG7A 4XJXA 2J59A 4URXR 2IF2A 2OV2A 3AF4A 5DI3B 4ZO4A 1VECA 3ADBA 1OH6A 2ZS8A 5FPYA 2OXCA 1FMLA 2G88A 1W46A 2DWOA 2QUZA 4TQ9A 4P4UA 3KKNA 4PPGA 4BLPA 2FZ4A 1U9IA 4ZI2A 2JJ8A 3SHWA 4A8JA 2J0UB 4PC6A 3IQWA 3VKHA 5FOWA 3RC3A 2VLIA 5L3SA 1G21E 3NIBA 4PSVA 4PX9A 1UFQA 3BRWD 5HKKA 3UMRA 4D0GA 1P61B 4Q9HA 2EWVA 2CHGA 3FOZA 2OFOA 1XMSA 3F0TA 3TLXA 4EQ6A 3ZQJA 1U8YA 3AH8A 3V9PA 1NY6A 4DCVA 2WWIA 4ZDKA 2B7CA 4XTRA 1I2MA 3NBZC 4HEJA 4MRSA 3AKEA 4QXAA 1RW4A 821PA 4G0NA 2BKUA 2IA5A 3EZ2A 3MMPA 4I1VA 4RD3A 5B64A 5IK2A 4DIDA 3S1AA 3E70C 2OCPA 2FOLA 3IHWA 4JSTA 4EDHA 5C2JB 4UNNA 621PA 4TYYA 5K8IA 4QL3A 2F1JA 1G3RA 1EGAA 4LJ4A 1T0JB 2JIZD 3MLEA 3RYTC 4R9UC 4MGIR 4I1UA 4B43A 2NG1A 2Z4RA 5JJIA 1NSTA 1G291 1QF9A 221PA 2DCUA 5AWFC 3RWMB 3VU9B 4JYBA 3AUXA 1Q20A 3L8YA 2ZRGA 2NOAA 3KUDA 2V54A 5AUQA 3I92A 3UG7A 1EXMA 1RVDA 1EFRD 1Q3HA 3GEIA 3EZ6A 3ICEA 1AJEA 2QPOA 4KODA 1AQUA 3LXXA 1JAHA 2ODEA 1CJUC 4B3GA 5BQ5A 3DOEA 3QVVA 5FUWA 4LJ8A 4Z51A 2WMOB 4D4MA 1P7CA 5TDHA 3PUWA 2C8VA 2AN9A 2XTMA 2QQ0A 3QEOA 5F98A 3T1VA 1GP2A 2O8BA 3MWLA 4LPSA 2QQEA 5HE8A 3CZQA 2HT1A 4D4LA 2BKEA 4KLZA 1F2TB 3LA6A 4OL0A 1CR0A 1DTSA 1DG1G 2ORIA 4FW9A 3DOFA 3TVTA 2OG2A 3A6PC 5AJZA 4KBGA 2RH5A 2OBNA 2GA8A 1U94A 1JALA 4JLKA 5F2EA 2ZRPA 2BEJA 3A36A 1KO7A 3BWDD 3MWKA 4UJ5A 2ZUCA 1P3JA 2CHVA 2CLSA 3BERA 2BMFA 2FA9A 2KI5A 2O0JA 5CLQA 5HZHA 4PR0A 2UVQA 1NG1A 3SN6A 2FF7A 1GM5A 4PTLA 3HP1A 1OFIA 2W83A 1ZCAA 1P2TA 1GSIA 1T3HA 4CEJB 4MRRA 1J90A 1JR3D 4JVLA 5JSZA 3IEUA 2EFCB 1Z6TA 2GVDC 1P75A 5EE3A 3KXIA 1AS0A 5L3RA 3CH4B 2DY1A 1GDDA 1HQYE 3MUFA 1YJ5A 4S35A 5C1BA 4IOMA 1XDBA 3CWZA 1QHYA 1SVKA 3J81k 1ZM9A 5E7MA 3L82B 1AGPA 3SYKA 3WP0A 1M74A 1XXHB 3MRSA 3GJ5A 1Z8FA 2FFAA 4GZMA 4IEIA 3CNNA 4FMCB 1AGRA 2QENA 4TQAA 1T6NA 4TMKA 1EWQA 2A9KA 4OI4A 1IJEA 5JI2E 4KYUA 2WJVA 5DYIA 2HXSA 4P33A 1YZKA 2QN6A 4V0KA 2VP5A 3JZAA 5FR1A 3OESA 1SVOA 2HDNB 4G1UC 3WP1B 3I72A 4BLQA 4JKIA 2FJUA 4NYJQ 1TMKA 4JT4A 5EUMA 2WM9B 2IS4A 5JI3E 1RRCA 1R5BA 3AKYA 2QZ4A 4HDQB 4YDHB 3SBEA 1MR3F 2QNRA 3U7FB 4BPBA 1UDXA 3PENA 5KOYA 3SBDA 3TR0A 2PLFA 2VHJA 2WJGA 2WJYA 5TB5A 3A1TA 1E9SA 1VG0B 2LKCA 3KQLA 3K0AA 2WIBA 4OK5A 3AVVA 4JL5A 1H8EA 1OXTA 1EX7A 2J0VA 3PFIA 1HA3A 1KNXA 2DHRA 4Q7LA 3LV8A 5LBIA 5FOVA 3DHWC 3SYLA 1BIFA 3KFXA 4F91B 2QPAA 4HB4A 2FX3A 4OQMA 1DAHA 2BJVA 2YINC 2F1HA 3UANA 3JVVA 5C4MA 2X19A 2AD1A 2QMEA 3ZYCA 1E2EA 1U9IC 5DI9A 4D25A 3MGCA 2Q0HA 3Q9LA 4A8JC 2JLZA 2XXAA 4AD8A 3I61A 4NL4H 4YXWD 1ZW6A 4KFTA 4POAA 4A0FA 2ZQ5A 4C0JA 1Q12A 2QAJA 1KTVA 4MRPA 3DO6A 4B32A 1GVNB 3R8FA 4TTPA 1EFTA 4C2TA 1CR2A 2WVJA 2KE5A 3CONA 4JVNA 3PQCA 2GWHA 1LF0A 1JQLB 1YR8A 2CLCX 3DKVA 3IIKA 4KLNA 1CF4A 2OILA 1R4AA 3FMFA 5BW8A 2ZROA 3CF6R 1S3GA 5TV2A 1CJKC 4KCGA 3SR0A 5IDVA 3ZVLA 2BM0A 2C77A 5DYGA 1Z29A 3THXA 3KXLA 4DJTA 2ZJ5A 4CEIA 4D2IA 3PR1A 4Q1FA 2NZJA 1GTVA 2W2XA 2ZSFA 4HLQB 1E4VA 1WE2A 1WBBA 3GJ4A 1G8YA 4DLUA 1KSGA 2ZRHA 4QBFA 3EAQA 3NC1C 4MYUA 1E2FA 4KFSA 3IKJA 2XSZA 4RZ3A 3FFBA 2YVUA 3LVRE 4MA4A 4Q1BA 4DLWA 1NSFA 1GITA 3I5YA 3UXMA 1Q44A 2OLKA 4XTCS 4UNSA 3GLGA 3RS0A 1AM4D 4W5WA 3L0OA 3K70C 1IN7A 3ZZTA 3AKDA 4FD2A 1T0HB 2JLVA 4DB2A 2QSZA 1TADA 1X6VA 1HYQA 3X1ZA 1W0KD 2HJGA 2HXYA 5A4JA 3OAAD 1KK3A 3QXSA 2XTNA 1XF9A 1BOFA 1FP6A 3B8HA 4U02A 4AWXA 2NO0A 5LB4A 4BEBA 4U5XA 1KI6A 4OHWA 5FTLA 1HH4A 2B92A 3R7WB 4BLOA 1X1SA 3LY5A 1TQDA 1YZNA 1E96A 1XPUA 4UJ3A 5D3MB 3HYRA 2V4ZA 4F4JA 5CK5A 2C9OA 3SJAA 2CNWA 3K0EA 1TF5A 4JJZA 2ZE5A 1R2QA 4CW7A 1D2NA 1FW6A 3KKMA 1IM2A 3BB3A 3VFDA 1D6JA 1KJWA 2EYQA 421PA 4DCTA 4ZIRB 4CGZA 1BH2A 2VSFA 3ZVRA 4TYNA 4QGGA 4FCWA 1OIVA 4PZYA 4LX0A 5FTMA 1BYIA 4EKDA 2B6HA 2BWJA 3VKWA 1KZGB 1P60A 2YYZA 3U61B 1E6CA 1OJLA 3QXJA 5CB8A 4ZKDA 4MYCA 2HCBA 1AZTA 1XXHE 1JJVA 1ZNZA 3IPYA 5C46F 2AFIE 3TMKA 5IT5A 2IS2A 1ZVQA 4BEJA 3ASYA 3C15C 2D7CA 1YZLA 2WV9A 3P4XA 1EESA 2OT3B 1D9ZA 3U6KA 2ATXA 2O5VA 2C95A 4OI0A 3KZ1E 1T3LA 3WMGA 4BRUA 2NPFA 4R2IA 2ZJ2A 2GF0A
chains in the Genus database with same CATH superfamily
4Q3AA 2X8BA 3RAEC 1V3VA 4MP3A 1KQGA 1R4ZA 1RI2A 3L0SA 1L7QA 4INOA 4M0MA 3CZ5A 1FDOA 4OH7A 3TZBA 3UMBA 1O8CA 2TMKA 4ZPJA 5B5SA 2YJ3A 3GFGA 2QZPA 1WPXA 1XEXA 4GMHA 2QMHA 4URUR 4NZOA 2YKGA 2CKDA 1YH3A 4I81A 2VC2B 4ZEWA 2JH8A 4KQEA 4EJSA 1FE8A 2O48X 5T4BA 1Z3CA 2WYWA 3KJXA 5B7GA 2P2LA 1KU0A 2VH1A 2ZRAA 4CIYA 3U3MA 2RFLA 3PXCX 4O5OA 3KS9A 3ENZA 3EZ7A 2RHWA 1U4NA 2QTFA 3GD7A 1BROA 1BQ3A 4JR0A 4Y1FA 1QIKA 5C4GB 4ECEA 3MTDA 1YQEA 3KR9A 4C20A 1LSUA 2WWFA 5FLEX 3IVXA 3NM5A 1BJTA 1Y3DE 3M5DA 3WQRA 2IU4A 5IARA 4KR2A 2O6HA 4RQAA 1GCIA 2JDIA 2YWHA 3WA6A 2NZYA 3AP3A 2NYUA 3EY4A 4D41A 4DCOA 5GIPE 2NV0A 1VHDA 2BTEA 5FV7A 1W4AA 1QH1B 1XOIA 4QHTA 3N5KA 2I2BA 1VJ1A 5IPFA 5F9HA 3EW9A 1NG9A 3T3NA 2XB2A 4L07A 1MA3A 4BX8A 3INGA 2CUZA 2LXNA 3P5BA 3UATA 1JBKA 1ZIPA 2ZE7A 4PONA 1OKKA 5C8XA 2BH2A 1VHWA 2HFJA 1QGED 4X44A 1TEZA 4N9QA 2ZVQX 3PKZA 1OI2A 1Y42X 2B36A 2VO1A 2YHIB 1FX0A 4UKDA 1EZZA 2P4EA 5IW8A 3WWOA 5IZCC 4U7DA 3LNCA 2YXDA 3IESA 1RR6A 2Z43A 3LF2A 5AW2A 4ZXPA 4B84A 1KBZA 4PBSA 1DWQA 2DBRA 2WFMA 4BIMA 2G04A 5B58C 3NV9A 3BFVA 4Q6WA 1ZH2A 5B4VA 5MN6A 2VQDA 3KPJA 4BQIA 3RBVA 1RRVA 4ND7A 2IYQA 3DKKA 3G49A 3T7AA 3EGXA 3SHFA 5EMNA 5L3ZA 2AUNA 4QXPA 4TMZA 5TXGA 3VZQA 2HSJA 4L73A 3UMYA 4CQLA 2XITA 5ADUS 1I13A 4H77A 3OM1A 2Q3LA 1JG1A 3I2GA 3M3HA 1IZZA 4XM0A 4MLDA 4PF1A 1OBVA 1HO3A 1GU0A 2OBYA 4MTCA 2WILA 3BL8A 4BQFA 2AJ8A 4OHMA 4F1WA 1N7GA 2RB4A 1HKHA 1GSHA 2JHPA 4QHSA 3F7TA 1GFWA 2FFQA 2BR3A 1ZIOA 3TRIA 3MJSA 5DPMA 1S0UA 2AV6A 1WW2A 2XQFA 3D1LA 3IUPA 3JQAD 3KC2A 4GRIA 3TLKA 4PPQA 4A8PA 4MW6A 3N8HA 2K6GA 4L74A 1ULSA 3KOWA 4OGKA 3I8SA 3B9PA 5TQVA 5BRJA 1JEYB 4Z4HA 2FV8A 4LUCA 1UP6A 3BHIA 4Q4AA 1GARA 1RWOA 4B4WA 1A8UA 4RPHA 1VPEA 1A7JA 5CPBA 4RVUA 2H57A 2XUPA 1BDMA 1YDEA 4G1VA 1ZK3A 2YJZA 3UJ8A 4DIBA 3IP7A 2J9RA 3D7MA 4QFMA 4YALA 1FP4A 3ISJA 3MBKA 2OL4A 4U2GA 3JAKB 3WJ7A 2ZI7A 1A9ZA 1XJQA 3DC7A 4L50A 2P3OA 4S04A 3TZHA 2GA9A 1WHSB 1XVAA 3OCJA 4U6NA 4D8VA 4BX9A 1E59A 1PI3A 1PL8A 2BEUB 2I8LA 2ZI9A 4YR7A 3I76A 2YWFA 3GUZA 4XCXA 2FSVA 1GPJA 4OM7A 3FPHA 4DNPA 3PFCA 3BL6A 2Z2JA 2L18A 3KT6A 3B2QA 4EI2A 1SIBE 4ZODA 1U0LA 2YC2C 1Z36A 4R05A 1VYTA 4MVCA 3TLGB 4EYQA 5B1IA 4ZJYA 3K9FC 4U7JA 1O94A 4E5NA 1UKVY 3UCFA 3B1KA 3BREA 4ZYUA 3HJUA 1Q95A 1ATIA 4MIYA 1GZ4A 2AMLA 4GS5A 4XIGS 5FWAA 4DFDA 1P29A 2BBTA 4FYYA 1PWZA 5JCOA 1X80A 3CLKA 3CRVA 4B6SA 3ADCA 4Q1AA 1CIVA 1OD6A 5HF5A 4DXAA 3FXAA 3DEYX 1CETA 4R1TA 2RE8A 2EZ4A 1EVYA 3V9AA 4GI3A 1JN0A 2PXAA 2R6R1 1KFEB 3TBFA 4E4RA 4XIYA 4FNAA 4RSRA 3VR5D 1IBRA 2H4YA 3PG5A 1DJMA 4Z6KA 4XWAA 2PRKA 2VPYA 4IYJA 1L6IA 1UKEA 3CS3A 3R3ZA 3FBGA 5FBRB 1IJBA 1PFGA 1T5TA 1X86B 2ODBA 1J49A 4JJEA 4JGIA 3L06A 1VE3A 1GPDG 5A9TA 2YV3A 3X1KA 3K9NA 3ACBA 1K6XA 4Q7MB 2VPWA 3BCSA 3F7NA 5EKSA 3MZ0A 4XUEA 2FPWA 4B34A 3OKPA 5HGJA 3L0DA 3W5JA 1USKA 4B35A 4L9RA 4AY6A 5AUNB 1KYXA 2IVFA 1KF0A 1BXRB 1KPGA 1PX2A 1UBJS 1YU6A 2JD1A 3DOUA 4GC9A 4H17A 4AK9A 5AIAA 4TMWA 2C83A 4TV9A 5LP1A 4J0DA 2CBZA 1JR3E 2QAIA 3HBJA 1D07A 5IAJA 1J99A 2V6GA 1XO1A 4INJA 3I37X 4JLAA 2H2WA 3DE2X 4ICIA 1ZRHA 3KX2A 3LHKA 3OLYA 1L7MA 3RIGA 3V42A 1W76A 3F7MA 3L84A 3JQEA 3P4YA 2X2FA 3SHQA 2EKZA 2WC1A 4GX1A 1MKYA 3ANMA 2Q9CA 3LS2A 5HMMA 5FTWA 5K0ZA 2VDOB 4ENQA 3T5DA 4P32A 4PG5A 2A4MA 1F3OA 3SLRA 3GFRA 4ARIA 1PT6A 1VYUA 1YD7A 3UT6A 1BD3A 1SCNE 4ZD6A 3TRHA 2EW1A 5HKLA 3AGPA 2G77B 3L8EA 4RKYA 4H16A 5FV4A 1HQKA 3JAMA 3GI1A 3SXJA 3DOCA 2WZQA 5HDQA 1VIMA 4EHKA 2OECA 2ZWOA 4FT2A 1M54A 2FPRA 2LVBA 1J24A 1BHJA 3LIIA 1X1RA 5DYYA 2J4CA 5JH7F 2EOAA 4ESVA 1AIPA 4HDNA 3FZQA 3M6AA 4DV3B 1AQIA 3K94A 1ST3A 2BBWA 2GRJA 2X4IA 3T8YA 4X91A 1MHPA 2QX7A 4YRFA 5IXJA 2VJMA 5I4CA 1GGEA 1XMJA 3MB8A 4FR5A 5SZKB 2AOWA 1M2OB 3BWVA 3CGWA 3PQ4A 1M7GA 1MAUA 1YRLA 4GX2A 4U3JB 3N28A 4HQRA 1JLLB 4EB6B 4XLTA 4AZ3A 1NWCA 2O6LA 1KI8A 3W4JA 1XU4A 2PQMA 2QMZA 1I2ZA 4URYR 4AULA 1VJGA 1ORRA 5CTJA 3W78A 4ZEVA 1IQUA 1HF3A 1HFEL 1BX3A 4WN9B 4JBWA 4G2NA 1I7PA 4WGFA 1KDTA 5AVOA 1YFKA 4ZV7A 1PF7E 1YMVA 3D2CA 4IHAA 3WRXC 3LTNC 5JH7A 2RBKA 1JWAB 2OUIA 3FR7A 1DAEA 4KIWA 4K0KB 1GEGA 3LOQA 3TLBA 4E6EA 5E7IA 4U0KA 3BWXA 1FNCA 3LQ4A 2E82A 4NQZA 3TLAA 1K8YB 4LQLA 1QWSA 2GBIA 3H1PA 2O2YA 4NSNA 4HG2A 4LHXA 3C5CA 4US0R 1M7BA 4DMLA 1RVV1 2H3HA 5G0WA 4WNAB 3ZHCA 3MUEA 2IWHA 2A0FA 1LLDA 4KIUA 3D7SA 5EYPB 1CZRA 2W0MA 2CWDA 2G07A 1KEEB 4DLTA 1KTIA 2H0QA 3ADKA 1I5EA 5DX8A 2O06A 4FBMA 3KHUA 3Q40A 2CL7X 3ILVA 5FFMA 2WJHA 3IOBA 1PBNA 2PT5A 4B80A 3PDIA 2IU0A 3ZLTA 2CVQA 5C8VA 3AF0A 1V3UA 2G76A 2UDPA 1IY8A 2UV8A 3H2ZA 1K08A 4BVAA 4WKNA 7REQA 3WAGA 3GMIA 2VBGA 2A5JA 4W4TA 5DE3A 4O4HA 4D9CA 2VZ0A 5JANA 3R8XA 4M1SA 4C2BA 1CR1A 4ON9A 1EK2A 4GI5A 1AA6A 4HWOA 2XNCA 1XU7A 1JF8A 2GT1A 3U7QA 3E7DA 3L02A 3L05A 2AQ8A 4R5HA 4E2FA 3AR7A 4HDCA 4JEMA 4WOBA 3UJPA 1MIOA 3AX6A 4TKLA 1US8A 3H42B 4KHZA 3UJCA 2QL9A 4NI5A 4XDZA 1GZHB 4MW5A 2OMKA 4XD7A 1NT4A 2AWNA 4AURA 2QORA 4MPPA 2W8BB 3R3YA 4OI2A 2AJTA 2JGNA 3DZDA 4MYRA 4QOEA 4AP6A 3EQ9A 4X0EA 3I6MA 4CNBA 1HWYA 1YA4A 1V43A 1GPNA 2VNAA 3BF7A 2NO7A 4DA7A 4DM4A 3NFRA 5JWRA 3VGPA 5DASA 4G07A 3FSEA 3RF6A 3C3YA 4FLFA 2FGJA 4NC9A 2FSVC 5KYGA 4G5RA 1K06A 4PINA 2XOKD 3KYBA 4LTDA 2PBLA 3T52A 1TZKA 1J0CA 2OEPA 4WCFB 5FPSA 3RTCA 4QARA 1CUCA 1DBIA 2FVXA 1AK2A 1TM7E 2PLAA 5I7UA 5TE9A 4DR2B 1JFTA 3OWOA 1W5SA 3VKVA 5JPIA 3K5HA 4KGZA 3S7TA 1RZVA 3HU1A 1EXNA 4XIIA 1MD9A 4C4ZA 4EP1A 2AHOA 1PTJA 4MK4A 1IWBB 4WNYA 4QSHA 3KB6A 1A5SB 4MVJE 4MKXA 4U7PB 3BFPA 2A5YB 3U0VA 4M0DA 4GOOD 4I8DA 1RZ3A 2ANBA 1U7OA 3CPHA 3OZXA 4POOA 5BVHA 1Y80A 2C99A 3BXPA 4FZVA 3RTGA 2G4VA 4L6CA 1BMFD 1EUDB 2RH4A 3K1JA 4IVPA 5LXTF 1VXOA 1A5TA 2NP6A 2ZPUA 2VTBB 3R9WA 1JE0A 2AN3A 1XEFA 3BWEA 5A02A 1ZA1A 4E5UA 1UJMA 2EG5A 4LPKA 1M76A 1ILWA 1P44A 4HXFB 5F7XA 1B26A 1P4GA 4QO8A 2GZRA 3QVSA 4TTJA 3RB8A 2C7PA 2Q99A 3DONA 3GGPA 1WLSA 2RJ3A 3T7TA 1M0WA 2J4FA 1SKUA 4XGQA 4UATA 3TOCA 1G8FA 2WRZA 1QZZA 1F14A 1MEOA 2Z09A 3GD5A 1VZ3A 1YVRA 5AP9A 3FHOA 1QH8B 4UAUA 4ZU6X 1THZA 2BZ0A 3WGQA 4BNZA 1G41A 2EJTA 4GW3A 2GJKA 4RGQA 1O0BA 1YI8A 3P8ZA 2G0TA 2LPMA 4BLUA 1RRKA 2FXVA 1AF4A 4NG4A 1GUBA 5MFPA 4N5HX 2RKWA 2C4HA 3RJZA 4PZAA 2NQTA 4ZVQA 1V8OA 2FSFA 5F64A 3ZDZB 1GQRA 3PXUA 2V7TA 1JQAA 3CRNA 1ZQ9A 4LXYA 1HEIA 3TINA 1LS6A 1N2CE 2B3TA 5BNZA 2HA4A 1S1MA 4JD5A 4JZYA 1B74A 4F0JA 2MOKA 4MQ6A 2GF9A 2AC7A 1OLUA 5LZ7A 4FZ5A 3N7AA 2PX0A 2R6JA 4F1KA 2C5SA 1KY2A 3ICCA 3JW8A 1L7XA 4CTJA 3MN1A 4F12A 2D1YA 3U2QA 1PZNA 4UUNA 4KFCA 1TRHA 5EJ2A 5JSQA 2X14A 1PR6A 1GLGA 3ASUA 3DGFC 3SDBA 3V2IA 1DT5A 3HZHA 1CUXA 2WT9A 1Z6GA 5EJIA 1GNVA 3QG1A 2FWMX 4ZTBA 4E5YA 3ASVA 3NU1A 1MO2A 4HVTA 4WK0B 3RD5A 2NSLA 3ZU2A 3R7WA 4OJNA 2XVYA 3BXOA 4IHKA 4ND4A 3V1NA 4DQUA 5CA1B 4NFSA 5BSEA 5D3MA 4HGNA 4G0OA 4KO8A 2Q7DA 3BGIA 5CVDA 3ZZNA 4GM4A 3P2OA 4EPYA 1MJNA 3KKPA 4FMDF 4A2PA 1AKVA 1ZXLA 4CUKA 5EP4A 4O25A 3QYPA 4JEUA 2BJWA 3BBLA 3S29A 1BA2A 4CBVA 2G82A 1PDOA 4OF4A 3KQUA 4DNQA 2WV7A 2UYHA 2H85A 4UEWA 2V7QD 1VIVA 4P93A 2BMVA 3E61A 4ZIRA 5KJFA 1AH2A 5K45A 3FKSD 1GZ7A 2XVZA 1FTNA 3QLEA 2YW9A 1N6PA 3GCWA 2BDUA 4WADA 5F52A 2C3YA 3SC3A 2H4HA 3Q4GA 2IPMA 1I4TD 3V8PA 1E64A 2NMVA 3PUKA 1MC1A 3GWZA 2GKSA 1S2MA 4MGZR 4BRWA 5I51A 1VKNA 3N2EA 1EH5A 3KTFA 4LZWA 4MJXA 2DETA 1RHQA 1ZMBA 4CFSA 1J07A 2OSBA 3ETDA 1G55A 5DMXA 2VPZA 1IEQA 2OE2A 3TYXA 2OXRA 5CVVA 5KC8A 1E9VA 3HDTA 1NR7A 5M7EA 3GJTA 3L7CA 4TM7A 5GOTA 4N4AA 3P96A 5CK4A 2IS1A 1GDTA 5IAEA 3VKFA 1EXWA 4RCVA 1EFVA 3PUJA 4JL8A 1CFJA 1KI9A 2NZUG 3RGGA 2FPPB 2PX5A 2ZYVX 1E2DA 3HH8A 4HLUA 4UE3S 5DEOA 3RUPA 4AJPA 1GXSA 2ZW9A 1P1CA 3SHTA 3HB5X 2VP4A 3BTOA 1U2PA 3PUHA 1LZKA 5JOQA 1DRUA 1U4OA 4EKIA 1BXZA 1MOZA 3KQYA 4KZKA 3HSKA 4WBXC 1N8NA 3RNOA 3MWFA 5JCPA 5LKRA 3IDQA 2V9ZA 2D5AA 2X1HA 3IQFA 2QTWB 2Q2NA 4HDSB 2EQAA 1CW2B 4Q1DA 1M1YE 1Y1KE 3FCXA 3ZVNA 1KJ9A 1I2AA 5HSGA 1V11B 5F73A 1T2FA 4C0XA 2R1VB 4FFBB 3DMDA 4TT8A 2QRMA 1V8BA 1TKBA 1FIUA 2Q9BA 3FOCA 3AESB 3P9PA 3TOSA 5IG2A 5EJ6A 4O2BB 4NH0A 3Q3VA 2IYPA 4MW1A 4TLEA 2W9XA 2X0EA 3M1LA 3D5TA 4RELA 4CMKA 2Q8PA 1GL3A 3CBGA 1ZNXA 3TWOA 4AU1A 3IL2A 1E9RA 2OBFA 2NTEA 3VNRA 5AFSA 4H6XA 2CB0A 2JCVA 3Q3CA 3UK2A 3QPCA 1SXHA 2VJPA 5GONB 8ABPA 1N1MA 3P19A 1VFNA 2X2OA 3CVJA 1LWOA 1PE0A 2CJWB 4OA8A 3RVNA 4CM8B 3PEYA 4ITVA 5CLJA 4FGWA 4IKPA 5K1ZA 1ZK4A 3WKDA 5ALKA 2ZRQA 3ON5A 3CURA 1FU8A 1T9CA 1UPFA 4RPKA 4GR5A 5CGZA 3EDMA 5BOSB 4C3UA 2WU0A 3DNPA 3WYCA 3GEMA 2QXUA 3PUVA 3WHIA 3D3QA 1W8DA 4LRUA 1N77A 1K3FA 5IKMA 3Q1KA 3LQYA 3D4BA 4LXGA 4BU1A 5AHWA 4O4JA 1NI3A 5DM60 5EFZA 4IDHA 2BPOA 3DHNA 1EWYA 3B7WA 2ZJ7A 1L5MA 3PSAA 4JA0A 1GZDA 4NPCA 1WOYA 2IL1A 2QV0A 2GD1O 3THOA 1EJ6A 2H5JA 3MBIA 3WFJA 1NLYA 2MINA 2OMEA 4AG5A 4X7RA 2AD5A 1U7WA 4QWWA 4TWAA 3OA0A 4OHUA 4EM6A 2WU4A 4W63A 1ODIA 3I83A 3JWPA 5CDFA 1W36B 2BCJQ 2GCNA 3T54A 1XN4A 2V58A 2W6PA 3CE9A 3A37A 4WKPA 3W79A 4ROTA 3UAGA 4M9CA 3I34X 4ARUA 3DMYA 3ICWA 4DJAA 2BN4A 1CF9A 4J91A 1L5SA 1F5SA 5YASA 2A78A 4DDKA 2JGIA 3DE6X 2DKOA 1QS0B 2JNWA 4KDFA 4UBIA 1FLVA 3DUFA 5E2AA 4A6PA 1R37A 3H18A 2QJTA 3HJBA 3PGMA 4CKCB 2WKPA 3RRZA 2I66A 2ZSKA 3K92A 4OA5A 4TZKA 3HNPA 1ADFA 3IA2A 1DADA 3N87A 4Q01A 4BFWA 4LWQA 1IXSB 1JEQA 3HUFA 2NXCA 1DV1A 1FLNA 4ZAFA 2WHXA 1RLOA 3NYWA 3Q8XB 3T7KA 5FBVB 4ER7A 4WCDA 2A8YA 2I6TA 4KN9S 4D82A 5KTYA 3PXBA 3QNMA 5CA0B 1JH9A 1XP5A 2AG5A 3HWSA 1WDWB 1MQAA 3P9NA 5HRCA 2GKGA 2WWXA 3AZOA 3IULA 3M4XA 3CV3A 4ZVKA 3GIDA 2F9MA 4RETA 3RS3A 3X1DA 4RK5A 2BYTA 4PR3A 2COEA 1IUNA 3ZI7A 3L8FA 3I01M 1ECBA 1NIJA 1LPNA 1NKVA 2I1QA 3U3ZA 5JS6A 1ZM7A 1T15A 3Q5DA 3GT7A 5AH0A 3A7EA 1JMVA 3PHIA 3VR1A 4WAUA 3Q98A 1XD8A 1JJFA 4Z1MA 3TNJA 2P6OA 4UBNA 2HA7A 2P5YA 4CIVA 4D56A 3U19A 4JI7B 2C20A 5IXSA 2P9BA 3KJGA 4TROA 1CEXA 1CUZA 1GVHA 3HXTA 1WR8A 4J9UE 1KOLA 5JNLA 4NZZA 5F76A 1G7RA 1KERA 3E81A 1J2UA 1I9GA 1JEEA 1OGJA 1RMTA 2GFHA 3FWHA 4N7BA 2WFLB 3F6BX 5KYYA 3W5UA 1D3AA 3P97A 4RMNA 5KBYA 3LI2A 2PUDA 1KGSA 1IWPB 4IBOA 3CCBA 3VNAA 2ZUBA 3K0AB 4ZOAA 4H6PA 3X1WA 4MRAA 3FKQA 3HZZA 1R4NB 3EMDA 5EXEA 2G1KA 2RGAA 5KB3A 1T1RA 2V3WA 3K1ZA 4PG6A 2GBLA 1BE1A 1NF9A 3D6TB 4TL7A 3QEJA 3EDYA 3P9QA 1ARZA 2CC2A 3HBMA 2R1ZA 3VSEA 2ZI6A 1YL5A 2UYGA 4KLCA 3ROQA 1C7EA 1PHRA 1EB8A 1K27A 3RWOA 3I28A 2E85A 1GTL1 1FVHA 3QU4A 4RVNA 5EZYB 3QFTA 5KYXA 3BYZA 3B1XA 4UCWA 1GZVA 5DV9A 1YK1A 1YZ3A 3M6VA 2Q4TA 3OAAA 4MW2A 3WYDA 5BUQA 4U6QA 4BQEA 3RO7A 2CXQA 4CL0A 4GPZA 2YV2A 4RHEA 2XUZA 4ERNA 5JFOA 1G18A 4AJ4A 1CULC 1JFLA 1KY3A 1SH7A 1D2RA 5CM9C 2NUTA 4TVKA 1GA1A 4NAVA 1X74A 2B69A 5AJTA 2N1MA 4CQNA 3YASA 1B3BA 4RZSA 5B2FA 1XMIA 2REBA 1NU6A 4DV2B 1IBKB 5GQSA 2PUAA 4YI3A 2ZZNA 3CVWA 1A95A 1DC3A 1F51E 1XCPA 3KVNA 4FR2A 3W2IA 3JPYA 3K96A 1GGMA 4C0WA 4DC1A 3G0DA 1ULHA 2R66A 3BAFA 3VHQA 4FHEA 2HH9A 1YRHA 1UAGA 4S1TA 2Q29A 3RUAA 1GEEA 3SEQA 4EARA 1FUIA 1NXVA 2TMGA 2Y2UA 3GEGA 4K9OA 1B8OA 3LG2A 2C29D 5FTNA 2I4LA 3AM4A 5KYWA 1MNQA 2LRHA 2YNMA 3EIXA 3C4JA 4HT3B 4HLUC 7AT1A 1QP4A 3TD2A 1NVFA 1GTSA 4UVDA 5DM0A 1WWKA 2BISA 1YBVA 2K2QB 2MSDB 3G2NA 4MEAA 3ZHTA 3I9FA 1XZPA 3CN9A 1KJ8A 3MQFA 4ZI7B 3A3NA 4MHOA 3U5ZB 1X8JA 3HDYA 2JAQA 4UTVA 1R0CA 1YC5A 3TGPA 2BE9A 4XX0B 1G5RA 4IV0A 3QLJA 4RFSA 1DQYA 1JB9A 1VBFA 4GEKA 5AI9A 1P2BA 3OQ1A 2DBZA 1DJPA 3FGPA 2H1FA 1WPGA 4G1FA 5JD5A 1OAAA 3GBSA 4BL5A 1OB2A 1H2BA 3A6LA 4DANA 3CX6A 4KH1A 2GVZC 4HEHA 3AW9A 4CR6A 2PD4A 3AEXA 2IZOA 4E2ZA 2JCBA 1EGVB 3TIFA 5ITVA 3G0CA 2TMYA 4I1PA 3AVWA 1ADGA 1XCBA 5KYKA 4RA6A 4AUMA 3HY6A 1AY0A 2I80A 4UULA 1KO1A 4E08A 4OFWA 1XD2B 2OCIA 1VP3A 1JH8A 1NBAA 1KMMA 2EKLA 3HUTA 1XNJA 4QYXA 1Z12A 4E6PA 2XNDD 5DWDA 1E98A 7MDHA 4CMGA 3O8BA 4GYYA 2F90A 4ABTA 1PWYE 1V1RA 1GGHA 1WSBA 2JIOA 3R6WA 3DR5A 5CYPA 4QYWA 4YQZA 2PKQP 4N0EA 4YA6A 5MGNA 1KI3A 1FPMA 3PJEA 5JNTA 2QZJA 2ZKIA 3FY4A 3QBVA 5CYOA 1QKJA 4QGHA 2B7BA 1C7JA 2AXEA 3JS5A 2ZS9A 3AU9A 3DP9A 2OKGA 1KJNA 2AUTA 4H1UA 5H3LA 1O97D 3T7DA 1XGKA 2A0YA 3F46A 5U4QA 1J39A 5KU1A 4X65B 5LC1A 5L3QA 4IKOA 1U0FA 3I04A 4CU2A 1Z06A 5T41A 5L4SA 2JW5A 3AR2A 1JDPA 5DNAA 1Q50A 1IIRA 1ZK2A 3BCHA 3GGOA 4N40A 3SWWA 4U8GA 4WE3A 2PZMA 2VK1A 4KQCA 1VE6A 4Y1RA 2RGBA 4PNEA 2I3AA 2JIRA 2Z5LA 2CE2X 3E5HA 2N1BA 4E94A 1Y7IA 2FDXA 2FEOA 4D92A 4FGZA 5HK9A 1HLFA 1LW7A 1J56A 4OMCA 2HM7A 4MP8A 4ZOEA 4DHWA 3A8TA 4YCAA 1SB9A 1AKTA 1JDUA 4RVCA 1D1QA 1J5EB 4HZGA 1LBEA 1XI2A 1P73A 4HZUA 5HIJA 3V8EA 4EK9A 1NQXA 1JUDA 1I0ZA 4R1MA 4RDXA 5E0KB 5LQNA 4KUGA 4DDUA 4QJ5A 2V7UA 4WJZA 3A14A 5AYVA 2ZUEA 2CFIA 5DRYA 3JALB 5EMJA 4ISBA 4HH4A 3HJRA 3BJMA 1X3SA 4UDXX 4A92A 5IVHA 3SZOA 1YV9A 1GGFA 3PS9A 3T06B 3T7CA 4WFKA 1K66A 1U2GA 2RMKA 1KEPA 4R5MA 1M2NA 4FYIA 3QFSA 1TU4A 4CQMD 3CH7A 2PMBA 3DTVD 1OFVA 4HJXA 1FFWA 2ZWIA 5DWVA 1GZ6A 2CCGA 1YR6A 1RACA 2JC3A 4G65A 5KAPA 2O8EA 1XEXB 1KSJA 3CRMA 1DS6A 1QFYA 1VA4A 5K0SA 3OT1A 2W2VA 2Z2YA 4EJSB 2R7KA 3H5TA 3W3ZB 3LBIA 4BNKA 4TRMA 1P2DA 3G2KA 2WICA 3GRFA 4N3CA 1AXRA 4KGDA 3CW2A 3G9TA 4QDZA 3RAJA 3RC9A 3M1AA 2W6CX 3STVA 2DUUA 1DBQA 5FI5A 2H16A 4P4NA 2Z6UA 4I55A 1JLHA 4EHAA 5EIAA 2F3PA 3LECA 4K0RA 3TQFA 3DCYA 4BO4A 1NZFA 2K87A 5A4AA 4MVYA 5JC1A 3ERCA 1U8ZA 4AJHA 1C9YA 2FZGA 2VAWA 4UOEA 1I94B 4FOTA 4HEA1 3E05A 1O87A 2DBVO 2HZBA 3RTEA 2B9VA 2RKBA 1P4JA 3GP8A 2F2TA 3KCQA 1MB3A 3UXEA 4L22A 2O2DA 4C3VA 3LZCA 5KOHA 1ID8A 2Q6KA 2CHUA 2X9GA 4BO8A 1SGWA 3N6XA 3BULA 1YACA 3K5WA 3RVSA 5CG2A 3WQSB 2QY9A 1TK9A 2D1FA 1W5EA 1PD0A 2LV8A 4E4YA 2J3LA 3TF5A 4P3NA 4B17A 4LCEA 3KJHA 2FPKA 3RI3A 1PZHA 2BT4A 1FX0B 4NBNA 2OQVA 4C4XA 1O6ZA 1OX5A 4CMBA 1IDOA 4G4SP 4F46A 5FEMA 1II8B 4AP9A 4F6CA 1CX9B 3SYNA 2IYLD 1RADA 3RT7A 3AUKA 4EO4A 4FGKA 2R1TA 3L7MA 5HFAA 1C2YA 5EHXA 1CQJA 1T9DA 5AW8A 3GQBA 4PZEA 4YCDA 2VYNA 4YLYA 3TJZA 4GAEA 1T2CA 5TPZD 1HRDA 2B34A 1DCKA 3JQDA 3QMVA 3F9RA 2X8JA 2Q27A 3EGXB 3P0EA 4MLZA 5G02A 4MUAA 3AR9A 3QOYA 3C7AA 3A9UA 3R77A 1QG4A 5FBQB 4QQKA 4CQLB 1BEZA 2HU5A 3W77A 1UKBA 2O2HA 3O84A 5I7HA 1VIAA 3LPMA 1R3DA 3A1DA 5FLYA 1BRTA 1NV9A 2VHVA 3HDQA 3PD0A 3MJHA 4KTTE 4C6SA 3AR3A 4EW2A 2CV0A 5B53A 2AMFA 3HHEA 2YNMC 3PPYA 1TM3E 3EIFA 2OHFA 4IEFB 4P7KA 1P2VA 4TLMB 5HFJA 3KU4A 5LBUA 1D7AA 2M2IA 4LJAA 4XFJA 5I47A 4WZBA 4OHOA 5KSYA 1WL8A 1YVPA 1L5LA 4G37A 4Q4LA 1W34A 2GOYA 5LIRA 3NOOA 3C87A 1ZRSA 3DF7A 3PC3A 4YAGA 4NBVA 3PX7A 3D8BA 2ZJ8A 3GLHE 3O8QA 3EMKA 4QXRA 3TDNA 4D4GA 2PCLA 4KB5A 4HN4B 2QGFA 3HU3A 3UK6A 1TE2A 4MOWA 3DZIA 3T99A 5DNYB 2VDRB 3C8UA 4JYPA 4NEHB 2I7XA 4GKBA 1C0EA 2AE1A 3H2KA 1W52X 4EMUA 4FJ2A 4XYEA 2QD5A 1FP4B 3G1UA 4IKEA 2CNKA 1CP2A 4G8JA 2QP9X 5MDHA 4UAVA 4C06A 1PGJA 4UMEA 3WYBA 4EG6A 2Y6VA 4CKXA 3D0OA 2XWPA 2X77A 1X1AA 1D04A 2W6IA 4IQGA 3W6UA 1BGWA 1WY7A 1WZIA 4FDAA 5KAMA 2WTMA 3IPCA 6GPBA 2H1IA 1WPRA 5DHFA 3TX6A 4I99A 4BFVA 1LI5A 1NMZA 3RUHA 2OO7A 2V7WA 2V8BA 3FN4A 4P22A 1FL9A 4KXFB 4N5MA 2Q5LA 1DUVG 4L3WA 2WTXA 1A50B 4H0CA 1H6CA 4MQBA 4GVPA 3FIUA 3O92A 1QE3A 1M33A 3OBIA 1P4RA 1M9NA 2Y1GA 5K3SA 2XUIA 3S8MA 4B5KA 5ADVA 4GPTA 1AKYA 1VCOA 1P9WA 2CMFA 2FFBA 3DZFA 3LRPA 3WYFA 3Q88A 3F6RA 3DLAA 1XUOA 2QAGC 2UUPA 4RU1A 4HDRA 1CIPA 3GJ8A 3QHAA 3LC0A 4ETIA 3VOSA 2GO7A 3M9XA 3NNSA 2CLIB 5KJ1A 2ZM6B 4BDSA 2PMWB 2PZFA 2JJMA 1IPHA 3G1TA 3HP4A 1IMOA 4FMBB 3JWHA 2VPQA 1NX9A 5ADWA 1SD5A 4WZAE 3NNNA 5IUJC 2X0IA 4R9SA 2W6ZA 4COKA 4D79A 4GP6A 3R5HA 3D2BA 3T7RA 2JJYA 3IP8A 4YJ2A 5C8YA 2H7CA 4XRRA 2RGCA 4CETA 5EEGA 1RYMA 1WEKA 3T4UA 2YWXA 1MO5A 3O73A 1I33A 1VSQA 2RHTA 4URVR 5IN4A 5EJMA 3D8NA 1V6AA 3QFCA 3IR5A 2WF5A 4PRYA 1S8OA 4EI8A 2GAAA 1UM9B 3VVCA 3DSRA 3LCJA 4RY0A 3VTAA 1NW7A 4OKIA 3RS5A 1Q57A 1I7LA 3PD1A 3QVGA 4R9VA 3IEVA 1GCOA 3EPKA 1MXFA 1DARA 3F3YA 2EBWA 3G6KA 4D0RA 1YVDA 2HU7A 4Q37A 4TV9B 5IH3A 3PRKE 3PD7A 2ZB2A 3NTLA 4CZ2A 5JVDA 3S44A 4BKOA 1IULA 2GERA 1RWBA 1SUWA 1VPVA 3UG6A 1GPH1 3U4IA 3BN3A 3ISTA 5THQA 1BN6A 1XDDA 2GD2A 1E2HA 2P2NA 4GMXA 5CCEA 2B8TA 3U62A 1Z22A 1Q15A 4OGGA 3A4NA 5BQOA 4MDYA 2PQ6A 3GJZA 5ITZA 3K72B 3N70A 4RXUA 2CUTA 2QP3A 4C04A 1F12A 4HNRA 4ND8A 1N5LA 3V8MA 3SQWA 3GH1A 4OMUA 4EPRA 2AZDA 4FFRA 1EYZA 5K8LA 3BA1A 4QKQA 3VR4D 3DDZX 1U2DA 1P5RA 3B60A 2KHZA 3NUQA 3DHYA 4WNCA 4QUBA 2C3UA 2OCYC 1YAJA 2VPIA 3VI4B 4E07A 4UPVA 2II6A 1EAMA 1NT2A 4DDVA 4KI0A 3FLMA 4YUXA 2RCNA 3CR7A 1JSXA 2YQ4A 2NP7A 1EU1A 4LYFA 3QVXA 4ZMRA 3GYGA 1ISGA 2D8AA 4BTEA 2OD7A 1SOWA 2YW2A 1ZBQA 4LVCA 2JIZA 2D54A 2JFBA 4YTEA 1O97C 2VQFB 3TQOA 2Z3ZA 2OCXA 2PK3A 4AZ3B 3IKTA 1NNI1 4KYTA 1C41A 1ML3A 4JLSA 2IHKA 2QL6A 1C1XA 1I30A 5HF8A 4EG0A 2ETXA 1ZH4A 4D3DA 5A5GA 1YHNA 3BB1A 3AUUA 2VZ9A 1GNSA 1QO0D 4QX6A 3UK7A 4YRZA 5L53A 1E8NA 5TRTA 4C0SA 3W6ZA 3NVAA 4FFSA 3E7WA 4HEQA 5BYAA 1K7SN 4ODIA 1FU4A 4M76B 1YZUA 1PAUA 3N2ZB 4MLCA 3COVA 4ZANA 5G41A 1ZSNA 4N5IX 1PVOA 4EFNA 5H9VA 4BAUA 2QMUA 3UMSA 3GVPA 3C43A 2HJHA 3A6KA 4TT3A 4BNJA 2Q5EA 1C7IA 4FCTA 4BV2A 3IPLA 1GSAA 3VPXA 1DXOA 4MMZB 1FPQA 3O31A 3DULA 4QOSA 5H8WA 2YQ5A 2I6QA 3O8RA 2GK3A 3IOYA 4MKHA 4BNLA 3GB9A 4AY3A 4HVLA 1XU9A 4NICA 1JS1X 5L9AA 1M0EA 2GZ2A 1A27A 1A5ZA 1PWEA 1ZKDA 4O1MA 4ZOCA 1OCEA 4QU5A 3QLVA 1M5TA 3UAZA 2EZUA 2HJRA 4IJMA 1UBSB 1IN6A 1Y1RA 1FS6A 3FDZB 1SK9A 3H3JA 3QMWA 4J49A 5FNVB 4AZWA 1LJLA 3PDIB 1DP4A 2FQQA 1N5RA 2O7VA 1REQA 2JEZA 3G9QA 4Q4JA 1J6UA 2Q5OA 4ALMA 5LWQA 1Y5LA 3KTAA 4CKEA 1U3WA 2PKRA 2HMWA 2A9VA 2DY0A 3D43A 3K16A 5LLSA 1CRWG 5A71A 3NAMA 3UBTA 1X2EA 3KKLA 2FN8A 4E2WA 4JITA 4MVJM 1NUUA 1U6IA 5AKLA 3H2GA 3OZDA 2ZR0A 3E0XA 4FFNA 4JJKA 4LGVA 3Q5GA 1OAKA 1QBKC 5D51S 5K3DA 5IDQA 1S4MA 3GOQA 5BRNA 3TAHA 3WLAA 2IYEA 2QRHA 2ZWPA 2DPXA 3M83A 4UZFA 4ZOLF 5DGXA 3B78A 3KO8A 5DRTA 3UM9A 3DOIA 4QVGA 3J80A 3UT5A 3EAGA 1US8B 3HB7A 4ZOBA 1KVTA 2PGDA 4D3ZA 5CITA 5CHEA 2WSYB 2JZNA 5K6RA 4FHDA 5JISA 4JKYA 4IDCA 3BF8A 3UB2A 2FK7A 5J47A 2EGGA 5JDIC 4B85A 2ODWA 1I5OA 3STUA 4H3SA 5IKXA 3GAFA 2R8YA 1BKYA 4M49A 4LWOA 1YR3A 2DFTA 3G7UA 3VPCA 4F4IA 2XXBA 2SCUA 2YBDA 3IBGA 4F96A 5FDFA 1BVHA 2RKOA 1TU0A 4A10A 3GPDG 3IFSA 5E3HA 2LCFA 3EUEA 1SUAA 1T8RA 1JKJB 1X7WA 2B8EA 3R9KA 2Z1MA 2ZKLA 3BBPA 3MD9A 4B81A 2GPYA 5JR3A 1YAHA 1ZXBA 5JJKA 1DPGA 4KWCA 2YJ5A 4Q4DA 3REQA 4MEJA 4F9TA 5A