4KVAA

Gtpase domain of septin 10 from schistosoma mansoni in complex with gtp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
246
Chain Sequence
FVFNILCVGETGIGKSTLLETLFNQKFDFPKLKAVTYDLKKLKLTVVETCGYGDENNIKPVVDYIDNQFENYLQEELKMKRSMQAFHDTRVHVCLYFIAPTGHSLKSIDLVAMKKLENKVNVIPVIAKSDTITKSELQKFKARILSEIQSNEIGIYQFPTDDEAVSETNSVMNQHIPFAVVGSSEEVKTVRVRQYPWGSVQVENENHCDFVRLREMLLRVNMEDLRERTHGVHYETYRRQRLIEMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Septin
publication title Crystal Structure of a Schistosoma mansoni Septin Reveals the Phenomenon of Strand Slippage in Septins Dependent on the Nature of the Bound Nucleotide.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Hydrolase
total genus 89
structure length 246
sequence length 267
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00735 Septin Septin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4kvaA00
1YRBA 2PLFA 5L3VA 1W4AA 4NYJR 3THWB 4JLBA 3SBEA 1SVOA 1DADA 3I61A 5G53C 1MRSA 3EWAA 4C0QC 1PLLA 3ZVLA 5D3MA 5GJVC 2RGAA 3PUYA 1G7TA 4NYIR 4Z1MA 2IS6A 3QPUA 4JZKA 4ZCLA 1E79D 2AK2A 2IYWA 3WMGA 3WYGA 3U4QA 4TMWA 1F60A 2QGZA 2F3TA 2WKRA 3VNUA 1KI9A 2VHCA 3O8DA 2W83A 3SDZA 2MMGA 3AVPA 3NIBA 1XMVA 1BO6A 1VIAA 2SHKA 4AYTA 4PHHA 2QENA 4QXAA 4KI0A 1P5ZB 3ZZTA 4Q03A 5DSZA 3Q85A 3DPUA 4CRWB 3ASZA 1Z8FA 3K9NA 2J9RA 3LLMA 3MJHA 4HDQB 1ZC4A 2ZXUA 5JJLA 3GLHB 4BFVA 2GESA 2P0EA 3GJXC 4DLTA 1N2CE 4TT3A 2ATXA 4K46A 2CE2X 3R8FA 4TLCA 2REOA 2WKPA 4HLCA 4EKDA 3VMFA 2O8FA 5GVSA 1JECA 4RSGA 1SXJA 2BBWA 2QORA 4M4SA 1QHNA 2KE5A 2YINC 1ZMXA 3OIYA 2Q3HA 1J8YF 1WA5A 3DMNA 5E7JA 2FSHA 3GLGA 1K5GA 2WOJA 3BIFA 4DDTA 5FOWA 5KTYA 1ZIPA 3VQTA 4TLBA 3WNCA 3FPAA 3ZGXA 2AD1A 3B78A 3N70A 3MG9A 3FKSA 1DARA 5DYIA 2ANCA 2HT1A 2C9YA 3EZ2A 1PLJA 1OB5A 1HQCA 1CS4C 1W4CA 1XBTA 4KBFA 4N0DA 1MO3A 3VX4A 1QHGA 1A4RA 2YWEA 3UANA 1IONA 2EU8A 2PZFA 1OLOA 4TMTA 4IDNA 1TAGA 3B5JA 5F3WB 1N6KA 3TVTA 2ZI9A 1BYIA 1ODFA 5J4HA 4CT4B 5AUOB 2N1BA 3C16C 2H8KA 3RNLA 3EPLA 4KXFB 2QY9A 5LB2A 2ZRKA 2AX4A 3LX8A 1OIVA 4IVRA 4XTCS 4TMVA 1I2DA 4HAXA 3VKGA 4AURA 4B3FX 2ZAMA 1NMZA 1KSFX 2AWOA 4I81A 5C1BA 3EPJA 4AKGA 1OSNA 1IBRA 1G64A 1GL9B 3FHOA 4KFTA 4QC2A 3LXRA 2LKDA 4IDOA 3WHLA 2PCJA 3WYAA 4A0FA 1U0HC 1FL9A 1EX6A 1QG2A 2B8WA 2ZI6A 4HI0E 3I32A 3QBVA 2IX3A 1UDWA 4LJ9A 2WZQA 2JLQA 2OAP1 3FOZA 4G1UC 1O3YA 1FMJA 2G1JA 2DPXA 1NBMD 4QL3A 4URVR 2ODWA 4ILEA 1PLKA 1XX6A 1NY5A 2ZETA 4TYQA 2IUTA 4Q00A 5UKDA 3IHWA 3DOEA 4DCSA 1XD8A 3SHWA 4NDZA 1AA9A 1UBGA 2P6NA 1GVNB 4KFUA 3RRNA 1US8A 3AF0A 1OFHA 1GL6A 1P9RA 1T4GA 2FF7A 3LBIA 1XXHA 2E1RA 4Q1BA 2R6CA 1EFCA 3QE0A 3NWJA 4ZDKA 2QSZA 1E2PA 4EPTA 1Y63A 3ZDQA 4UNRA 4Q66C 1D6JA 4Q1FA 2GCPA 4Q4AB 4F38A 1EFHA 1TTTA 4ZDIA 4LJ4A 1QHYA 2H1LA 4LC1A 1Z47A 1TUIA 2NO0A 4LHWA 1U8ZA 3GMTA 3NBXX 3X1XA 4BASA 1XF9A 3A4LA 4TQ9A 2QMUA 1AK2A 4B75A 1EFTA 2XTMA 1W36B 1T6NA 1N25A 4GOKA 4XWAA 1X3SA 2XNDA 1LV7A 3UG6A 4G0NA 4KCGA 5JS7A 1XU4A 2GNOA 1Z0AA 2OCPA 4EJSB 2J45A 1DPFA 4O3MA 3OEED 2HEIA 4ZIRB 4BUJA 2C77A 2VP0A 3LXXA 3QEOA 2V8OA 4JYCA 3RDPA 1XPUA 1YVDA 2ZSAA 3IIMA 4OI4A 4B2PA 2CBZA 4CGZA 4Q21A 1XTRA 2WPDA 3VFDA 4L9SA 4EPWA 4U5XA 4YMUA 4GT1A 2VIIA 4CVNA 3S1AA 3GJ4A 3AF4A 3BGWA 4Q19A 3R20A 1VCMA 2RGNA 3CBQA 1U8AA 4BFZA 1ZD1A 1VCOA 3WBKA 2IXFA 1G8FA 1AKYA 1FTNA 5JRJA 2BV3A 2QPTA 2DR3A 1N6HA 1ONBA 1TADA 2QTVB 3QXJA 4MDFA 1VHTA 3DVLA 4ZI2A 4X8LA 4QRHA 2IL1A 1ZUIA 3LA6A 4PSKA 4OK5A 2VHQA 3NDBB 2J5XA 1N6NA 2REBA 2QRNA 2IC5A 3HPRA 2VEDA 4LJ8A 5EUQB 1D2MA 2OXCA 1Y3AA 3RS2A 5SZHB 1XEXA 1XMJA 4DB2A 3JVVA 1IXSB 2GXAA 1D9XA 1SXJC 1SKQA 1W4RA 3CF6R 4BFUA 2IYZA 2ZJ8A 3THXA 4KFRA 1IN7A 2N46A 3OIUA 1A1VA 1FTSA 3SS8A 1S4QA 3I73A 2K5UA 1ZNYA 1CIPA 3NVAA 2REXB 4W5WA 5KOYA 1Z08A 4FWIB 4EPXA 2DWQA 2MSEB 1DE0A 3OE7D 1DAGA 4Q9KA 1QHHB 2ZSFA 4JL6A 3RLFA 1DO2A 4BLQA 1P2SA 1EFUA 3CO5A 1NVWQ 2O5VA 2ZU6A 3SN6A 2O8EB 1E2QA 3W5IA 3DM5A 2V6JA 3MFYA 4BEJA 5FL3A 1VCIA 5JZVA 1JXOA 1YQTA 1NG1A 4RD6A 5FFMA 3CF0A 1ZM9A 4Q9JA 1U2RA 1JR3D 2OHFA 4Q4LA 5EXTA 2F3RA 4MGKR 1JEEA 3A1UA 2ZRCA 2IEYA 5FUXA 2BIFA 3BWDD 1HT2E 4N1AA 3SR0A 3U6BA 4XSHA 2DBYA 4DCNA 2IYUA 1XEWX 1CKEA 2H18A 1JEDA 4CYMA 1GOTA 4KODA 4PTLA 4D80A 5G40A 1RJ9A 2GAOA 3IPXA 1QVRA 3B85A 1KSGA 3CR7A 4YMWA 3GFOA 4NYMQ 5KSYA 1GRNA 4OJQA 4OI2A 4IRUB 4Q47A 5EXPA 2CHGA 1ZP6A 1F48A 4WZ6A 2ZRAA 4EIWA 3FGNA 1N6PA 2VP2A 1MO5A 3RS7A 2AL7A 4L16A 1R10A 3PQCA 4Z8YA 3ICEA 1E2LA 1QBKC 3VR3A 2EYUA 3TQCA 4FXPA 3GJ7A 3ZZUA 3G82C 1F2UA 1SULA 4BZQA 4F93B 1E2KA 1P62B 2OXRA 1GM5A 2MSCB 4DDUA 1BKDR 1CJTC 1Z6YA 1I4LD 1PUJA 1KJZA 2OCAA 4Q4JB 5AWFC 5DNYB 4KAXA 1N6IA 1OFTA 4PO1A 3FMIA 3P1JA 3QKSA 4JL8A 2NO7A 3K0FA 3NH9A 3KQHA 2AFIE 3TUIC 4B48A 2IWRA 4S35A 4GRAA 3ICQB 1KO7A 4V02A 4E22A 1R0ZA 1CXZA 1L4UA 2NQ2C 4KFSA 1NBMA 4BECA 1FPMA 4ZKEA 2C8VA 2HUPA 5C46F 3HYRA 2H16A 4I1OA 3UIEA 4DLXA 1JALA 1XCMA 3TR0A 4URWR 5FBRB 4IOLA 1YZQA 1NLFA 2ONKA 4PAMA 2OBLA 4LOAA 4A2PA 1A5TA 3SC3A 2BMDA 2J1LA 2ZYWX 1WBBA 3W8RA 5TARA 2ZJBA 5JJKA 3ND9A 4HDCA 2AN9A 4L4UA 4C0HA 1KKMA 1EXMA 2BJWA 2DFNA 1E1RD 3IQXA 1OJLA 2ORVA 4DVGA 2CCKA 2WWWA 4MRSA 1YZNA 2D2FA 1FUUA 3BBPA 4DWJA 3MLEA 2FSGA 2W2XA 1KI7A 5H70A 4EUNA 1DTSA 1W0KD 2FMXA 2WOOA 3I5YA 4HATA 1S0UA 3RRYA 4AK9A 2BJVA 3DOFA 3FVQA 1OH6A 1VMAA 1RRCA 1XD9A 3OESA 4HAWA 1M6NA 2ZITA 2OEPA 4M2LA 2QMOA 2ZJYA 2XTZA 3H2YA 1OXVA 4JLOA 3A4NA 4AYXA 2GHIA 4DLSA 1NF3A 2B7BA 4XSGA 1W48A 1ZVQA 1BOFA 4JLJA 2JLWA 1K6MA 1TU4A 1P72A 3T06B 4M1WA 1OYYA 1H8EA 3EASA 4JKIA 3V4RA 2BEKA 1KI3A 3P4XA 1R7RA 3KQLA 3FWYA 3IDQA 1Z63A 4DSTA 4DDWA 4Q7JB 5FBVB 4FIDA 1II8B 2RGXA 1IJEA 3U6KA 2J59A 1XTJA 3T1TA 2EFEB 521PA 3G0HA 1S2MA 5DHAA 5CB6A 3EIEA 1G5RA 4B74A 4TYWA 4US2R 721PA 3TH5A 5M04A 1EGAA 5FPHA 3FDIA 4HUTA 4QJ3A 1CRPA 2GZAA 3CM0A 2GVZC 3AEZA 2FOLA 3CF2A 2X2FA 2J41A 2GCOA 2GILA 1D8TA 5TMPA 2NMVA 4D82A 4I99A 4US1R 5AJYA 3BERA 4L5BA 5LD2B 4HB0A 5EZ5A 4NONA 2WIBA 3B1VA 3B9QA 4AKEA 2ZJZA 3KKQA 4ACAA 5FBLB 4B44A 3DL0A 1KI1A 1YR7A 3CPJB 3WBJA 1RE0A 5SZJA 3SEAA 4BE7B 1JAIA 2WICA 1NLZA 1Q1ZA 5LB4A 5BXQC 1CR2A 5JSZA 4JS0A 1GDDA 3W6NA 2CK3D 1VIYA 2KBFA 2CXXA 1VG0B 3Q9LA 3FMFA 4HUQB 5HTKA 3VHXA 1OE0A 1U8YA 2RHDA 3LVRE 5DI3A 4A2QA 3LW7A 1OT3A 3I92A 1Z29A 1MO6A 3MWJA 4Q7LA 3L0PA 2OM2A 2CLDX 1Z3IX 2D74A 2ZRPA 2VBCA 1N6OA 3EXAA 4QOSA 1HEIA 1Q12A 4TN1A 3CH5A 3IBGA 2C03A 4JVLA 3HWSA 4DZZA 2XJ4A 3TGPA 2FZLA 1ZAKA 1ZW6A 2ZI7A 1XCGB 1JR3A 3BXZA 3CRRA 2ZRJA 4I1UA 5JFGA 1UPTA 2I4IA 4K8OA 2FPKA 4ZCIA 1S8FA 2JJ2A 2MSDB 1YZGA 4BLPA 4TL6A 2QI9C 5KPJA 3K0EA 4ZDJA 4FINA 1CJMA 4IXNA 4LJ5A 2W2TA 3BOSA 3K53A 2NZ8A 3QIAA 4RFSB 3KKMA 4BLSA 3VNVA 1KZGB 4MYHA 2NPIA 2QAGA 2HXYA 4EFMA 4F7WA 2J0SA 2VHTA 1CR0A 1KZ7B 1RRFA 3TIFA 1IHUA 2F6RA 2ATVA 4TT3D 4XIGS 3U7EB 3HYTA 3RVBA 3OZXA 1P75A 4TL9A 4JLPA 3QG1A 5GJWC 2P67A 3AVUA 2PMKA 1XZPA 4EPRA 3DHWC 1SXJD 1SXJE 4YMVA 1ZBDA 3B1WA 2OSBA 4TZ6A 2GZDA 3UMFA 1E2MA 3RS0A 1J70A 4LCBA 3O47A 1TMKA 1KK0A 4ASUD 2CL0X 3GLGE 1P9WA 4J0QA 4DLVA 3CRW1 1G4AE 1MABA 2PT5A 2ZRMA 3H86A 1OKKA 3TBKA 4TLEA 4BFTA 3GLFA 1I4DD 2H92A 4IKEA 4NE2A 4US0R 5F2EA 2OE2A 4TTRA 1FNMA 3T1QA 3RS4A 3BB4A 2ZYTX 2XJ9A 3AKDA 4FMCF 4LK2A 4Q18A 1U0LA 1E1QD 2HYDA 1K8RA 1KMHB 2J0VA 3ADBA 4M0LA 1AZTA 1KKLA 4IDHA 1Z06A 2QP9X 3WRXC 1XTQA 2ZRGA 5ANRB 2GXUA 4CZ2A 1WRBA 4QHSA 3WXMA 2VSXA 2A5YB 4HDOB 4QBIA 2CE7A 3K9HA 3TW4A 2XZPA 4Z51A 4TLAA 4RFVA 3A6PC 1W5TA 3CH4B 4JVSB 1AS3A 1ELOA 2QP4A 3IHLA 2WAYA 4JBXA 4NMMA 1G3QA 2FE4A 2QRZA 1UEIA 2IT1A 3GJ8A 4YC7A 3L82B 4D4LA 3IQWA 1XB2A 2VLIA 1LY1A 2FSFA 2FSIA 3CWQA 4PZZA 4ARZA 1E1RA 3AVOA 4KVAA 2GEDA 1L7VC 5HPYB 4LPKA 2NGRA 2TMKA 4QKQA 3WMFA 5SZKB 2R9VA 1ZM7A 2W0MA 2ZE6A 4N0EA 4NPHA 3AGQA 5DHFA 2XXAB 4XWOA 5FTKA 2GK6A 621PA 4URZR 2C98A 1U98A 1G8YA 1HT1E 2R6DA 1XNJA 2YHSA 1NN5A 2J46A 4WBSA 5K8IA 1XXHE 3AVQA 3AQ4A 3W90A 4GL2A 2OBMA 3TAUA 3X2SA 4YXWD 4MRNA 2Q3MA 3HP1A 3U3RA 1G7RA 1NL3A 5L3SA 2DWPA 5B30A 5IK2D 3CNOA 3DMDA 1T91A 4QBFA 4PC2A 3PJRA 4FMDB 1GKIA 5C4MA 3U61B 4CEIB 2CCJA 4C7OA 4D2IA 3AP3A 4Q7KA 4GFDA 1E2FA 5CK5A 4MGYR 4I1VA 1EX7A 1F2TA 2J0UA 4M22A 3VHLB 2IYSA 2JATA 5EE9A 1CP2A 2X77A 3BFVA 3B82A 4YDSA 1AGRA 2XNDD 1P2VA 2QE7A 3U5ZB 2EFGA 3PIRA 4L9WA 2FFHA 3A1TA 4IDPA 1Q3TA 2D4HA 3M1IA 2D7CA 5DN6A 2GA8A 1CJKC 2ZS7A 2YWFA 4RD1A 5K8UA 1IN5A 1T3HA 2WBLC 2OZEA 2YC4C 3IO5A 3ZS9A 1E9AA 3PV0A 3AVYA 1QZXA 1L2TA 1IXZA 4PANA 4Q01A 1G1MA 5EE1A 3X1ZA 4P32A 3W3ZB 2VQSA 2WPDD 3P26A 1ZCBA 4XVQA 5DLQC 3QPVA 3UWKA 3W3AA 2B7CA 3QI2A 2VRWA 1KJWA 1ZM3A 4BLTA 1E9DA 1W1WA 1Q1QA 4R2IA 5FOSA 3TUJC 1E0SA 4U02A 4GP6A 3ZD7A 2Q21A 5KSOA 3RSLA 1N5IA 1FFHA 4RZUA 3ZQJA 3K70B 2VP5A 3ONWA 1HV8A 3KJHA 4KVGA 2WMOB 5IRCD 1LW7A 3E2IA 2V4ZA 3QKRA 3SJZA 1IJFA 2CK3A 2CL6X 4D4MA 4BPBA 4DBLC 4NZYA 4LZZA 1Q1EA 3NC1C 1RKBA 3HU3A 2QGNA 1N5JA 3IILA 5CJ2A 5BQ5A 2RCNA 5KYKA 2YKGA 4BLOA 2PL3A 5CDFA 1TL7C 2DWOA 1DS6A 2AK3A 2ZS9A 4PPFA 4IFBA 1AGPA 2GJSA 3DDCA 3AH8A 1UEJA 2RGDA 4FCWA 4BEBA 1KTVA 3NBFA 3OHMA 2Z5FA 4EQ6B 1N5KA 4B32A 1KSJA 2AFHE 3TW8B 4DLRA 1EWQA 4XH9B 4XJXA 2Z43A 2EWVA 3B1XA 2ERXA 2C04A 1E0JA 1S3GA 3X1WA 1HURA 1NI3A 1L8QA 3FFAA 1J99A 5JCPA 5KPDA 1MV5A 3GCGA 4ZCMA 2OV2A 2W6ID 1OH7A 3U4QB 4PO8A 1SVMA 2G83A 821PA 5A0FA 1ZU4A 3LBHA 4WXPA 2WHXA 3QXXA 4Q4HA 4NL4H 2E9SA 3NHBA 4IJMA 1G21E 1XJQA 3LV8A 1DEKA 4FCTA 5IT5A 3P27A 4FMCB 3Q5EA 4ASUA 4OL0A 4XOIA 3GLIB 4WZAE 2F9LA 5CB8A 2O8FB 4DCUA 4IEIA 1TF7A 3IBYA 1E9BA 3KTAA 4GMXA 2ZPTX 4OJKA 5DO9A 3P20A 4R98A 3R7WA 4Y0AA 2QM7A 3AKYA 3LWNA 5JHHB 1GITA 1RPZA 4M1OA 1QVAA 3GLGB 4TL7A 1Z0DA 4NYJQ 2I1VB 1OFIA 1E1QA 1G8HA 1G6OA 1KK3A 4TQUS 5B64A 3CZPA 2RB4A 2O0JA 1F3OA 3MJRA 3MUFA 3VKWA 1XWIA 1J90A 1XPOA 3LW8A 4DT1B 3F0TA 4UNSA 3UMSA 1AJEA 3A8TA 3D31A 4BFSA 3RWOA 4JLVA 2GJAA 3C5CA 3I8XA 3WP0A 3R9WA 4HAZA 3NEYA 4D4JA 4EAQA 4LJ6A 1VTKA 3A4MA 3I4LA 5E4FA 3AGPA 3FMPB 5KDOA 4LPSA 1E4VA 4FMBB 3TSWA 4Q1CA 4CW7A 3ZQ6A 5E95A 2B92A 4G5QA 1Z0KA 2NO6A 3RAPR 4NU0A 3CONA 1X8JA 4AI6A 2IYTA 2D06A 4A0HA 1U81A 4URUR 3Q7PA 2A78A 4AWXA 1KAOA 3U60B 5CITA 1NBME 1XTSA 2R65A 3DZ8A 3EC2A 5CLLA 5AR1A 2O8BA 3AKEA 4XTRA 2P5SA 2V55B 3R8CA 2VH5R 2GJ8A 1GFIA 2NO1A 3RRMA 1NSTA 1TPZA 3LAWA 2QTFA 1UBFA 2H5EA 1Z83A 4YDHB 4DC9A 1F5NA 3AVXA 1D2EA 1JI0A 4B2IA 2GEUA 2OBNA 2P6RA 3CX7A 2C5LA 4YXWA 1VECA 4MGZR 3TUZC 3D3QA 4B47A 2ODNA 4QHYA 1FX0B 1Z2CA 4CDGA 5IK2A 2BMEA 3CRMA 2LKCA 4TMKA 3LY5A 1G7SA 1US8B 1II9A 4QFMA 2PX0A 4S2EA 2ZROA 3BC1A 1G8PA 1XXHB 1KO8A 1G41A 3KQUA 4QBHA 1Z07A 1D2NA 4HYYA 1G6HA 2ZRLA 5EE5B 2CMKA 3Q8XB 4XVUA 1OXUA 3AV0B 1CRQA 1VYVA 3KB1A 4V0NA 4AKIA 2ZM5A 4TTPA 4O25A 1Z5ZA 2GAAA 2WJYA 5G41A 4HB4A 1TQ6A 1QF9A 1ZUHA 1EESA 3UG7A 4HAVA 4C0LA 1JBKA 3KDSE 4DEYA 2IF2A 1FNNA 3RWMB 1QG4A 1I4TD 5EXXA 1H8ED 1TUEA 2A5JA 3EA5A 3AP1A 4MKFA 3JVUA 4LV8B 3QKUA 4GSYA 4ON9A 1ZYUA 1E9SA 2ZE5A 2WSSD 4HSEA 1MRNA 1NIPA 1IQPA 4ERNA 1VG8A 5J47A 5AK0A 2B6HA 5EJEA 4GPTA 2CLSA 4TSFA 4DLWA 2WIAA 2CL7X 4A2WA 2HXSA 2FFAA 4G3XA 1CR4A 1CULC 2A2ZA 3MRSA 4GOXA 4P4SA 3S1AB 5KU1A 5J4YA 1E69A 3HDTA 4D81A 2DB3A 1NY6A 2QG6A 4GMDA 1NRJB 4V0LA 3CW2A 1XJCA 4E07A 1CJVC 2FPMA 3NDPA 2HJVA 3EA0A 3LFUA 1XP8A 5JLJA 1PVOA 3RS3A 5FTLA 2JEOA 2QROA 4MRRA 4IOJA 2BHRA 4OQFA 2ZAOA 2WJHA 2KWIA 2Z83A 4XD7A 2ZR7A 2QBYA 5FR1A 6Q21A 3VR5A 1WE2A 1XFAA 1GNRA 3D6TB 3BAFA 1GZSA 3UMRA 4HZUB 5C18A 1FOEB 3F8TA 4QGAA 3TK1A 1R5OA 4PHGA 4DUGA 5JWHA 4AY2A 1XEXB 1ZU5A 4NYMR 3AM1A 4OKSA 2FX3A 4X8OA 3U3MA 4E09A 3FTQA 2IK8A 3AKCA 3THXB 4BRUA 3A1SA 4JL5A 2JA1A 2W6IA 3O8BA 3LBNA 1NP6A 2ZYUX 4F4JA 4R2HA 4X8MA 1PV4A 1Z6XA 2JJ8A 3I62A 1OH5A 1E2IA 1QHHA 4HLDA 4YQFA 3C8UA 3U44A 2DFTA 1JJ7A 1XMIA 3NBYC 2ZE7A 1QHIA 4IVPA 3DEFA 4I4LA 2O8EA 4KO8A 3NTUA 1JR3E 1R0WA 4NKRA 5FL7A 1RYFA 1DAKA 2EQBA 1E99A 2JJ2D 2GF0A 3MWLA 1CTQA 1E2NA 4NTZA 4JJZA 2D62A 1OHHA 5J5CA 3VR6A 4F4CA 1M34E 4KHZA 2BDTA 2VA8A 3QXCA 4G01B 1GKUB 3EIHA 5GJCA 3SJBA 5EP4A 3IPYA 4DLUA 4JYBA 3ZIAA 4Q1DA 1M7HA 1JXMA 3T12A 2V1UA 2OO7A 5GADl 1K5DA 3VTKA 1KGDA 1R2QA 1ZD9A 4RZXA 3PUZA 2IEZA 3B1ZA 3IIKA 4A8JA 1E2DA 4DEXA 3B7GA 1YRAA 5FOTA 1RJ9B 3BE4A 5JBQA 3VU9A 3GEIA 1RFLA 4Q1AA 4BQSA 3AUXA 1KDTA 1ESMA 1CU1A 5JECA 3QF4A 3Q5DA 1P2UA 5A4JA 2IWHA 2P6UA 2QM8A 4C0AC 1AN0A 1DG3A 3BFXA 1JPJA 2G88A 1GRRA 4OHWA 4HAUA 4M8NE 1HYQA 2AD5A 2ZRBA 4QGFA 1R5BA 1KIMA 1OKKD 1NVVQ 3GLFE 4E5UA 1TEXA 2XITA 4C0BA 1BIFA 2HJGA 4M9ZA 1W47A 4OQXA 2ZREA 2BVNA 1F2UB 3FHTA 2QUZA 4QNRA 2HCBA 1GWNA 3U7HB 4RJLA 1XTIA 2R6GA 4HLUA 2VL7A 1DAFA 4EPYA 2HV8A 2QPOA 3HPQA 1B23P 5TV2A 4BFXA 1GAJA 1KI6A 2QNRA 3QKSB 1D5CA 4RZ3A 3K0FB 2XGJA 4FW9A 1S3SA 2F1IA 4JIMA 4RKEA 5AJZA 3M0EA 4PQYA 1X86B 4LBZA 2BC9A 5EP1A 5EQTA 2A5GA 2GVDC 2X8AA 4ITRC 1XPRA 5J4LA 1T5IA 2E87A 4P31A 1Z6GA 2G77B 4AG6A 4ESHA 1DG1G 1ZINA 5P21A 3RYTC 3KUCA 5CM8B 1P61B 5JCZA 4RD2A 1T8UA 3L0OA 4FI3C 4F91B 3QVUA 4KJZA 5FBQB 1DOAA 4M9SA 4OBEA 1WCV1 2GXSA 4HB3A 4MITA 2GETA 4EJSC 4HZIA 2QT1A 4D0LB 2P3SA 1COWA 2PH1A 4JLAA 4IDQA 1U90A 1IN4A 2ANBA 2G0NA 3QJYA 3VKHA 4H1VA 3ZZ0A 1OXTA 3VAAA 3QY0A 3U2QA 2C99A 4A0GA 2ZUBA 4MA4A 5FPKA 3A1VA 1N6LA 2KI5A 1IAQA 3CR8A 3A58B 1VYTA 3P32A 4MUBA 5IF9A 3TSOA 5KNBA 4LYHA 3FHCB 3EZ7A 4OHVA 1KDRA 4Q7MB 5BN3A 2ZVQX 3KFVA 1BS1A 4HEJA 1N3BA 2AWNA 2RKOA 5GVRA 4C3ZA 3B6EA 2LCFA 3ECCA 2V9PA 3QNUA 3KKPA 4LJAA 2QMEA 2WSSA 421PA 1XMSA 5E7IA 1S9DA 2IS1A 2ZI5A 4DIEA 1SKYE 1G18A 3Q72A 1E2HA 1R6BX 1ZCAA 3LDAA 2QE7D 2B8TA 2RGCA 3IUYA 3JZAA 1KNQA 4QNMA 3T61A 1NJGA 1AS0A 2RHMA 5DN6D 4FMDF 2ODBA 4NCIA 5CYOA 1NSFA 5J4KA 3KB2A 3QUSA 1RRPA 1F6BA 3UPUA 1KO5A 4TQAA 1MO4A 1SVWA 1G3UA 4AIIA 2FV8A 4B33A 1XZQA 4PZYA 2ZRDA 1SZPA 4PC6A 3DO6A 4CEJA 4PR0A 3LO5A 4JLNA 4R9UC 4AKHA 1JR6A 3THYA 2ZS8A 4B3GA 1Z0FA 1SHZA 2GCOB 3PUWA 2PJRA 3V9PA 5IHPA 1X8LA 2FFBA 4LV5B 3THOA 4WW0A 4R71A 3QKTA 4MYCA 4PHFA 1PUIA 3W8NA 4QM6A 5TVKA 3QVVA 3U3KA 4OK3A 4JSTA 5L3QB 1NN3A 3FMOB 3L0IB 4V0KA 5AUQA 1NIJA 2V7QD 2OFXA 2O0HA 1G19A 1GRQA 4HUQA 5K8TA 2BKUA 4BRWA 4A8JC 1SQ5A 5CDFE 5JSZB 3OAAD 4IHQA 3K0CA 1R4AA 2BKEA 2VSFA 3Q3JB 2YZ2A 4L15A 5DI3B 3ZVNA 2J3EA 3K09C 2EFHB 1QDEA 4OI0A 1NVXQ 4C0JA 1Z6AA 1JNYA 1AM4D 2F43A 2R44A 4L8GA 2FU5C 4BFWA 1UM8A 3LQQA 5BN4A 4NCJA 1W7AA 1UFQA 2BBTA 1GNQA 3T34A 3PR1A 4CEHA 2KJQA 1I2MA 1C1YA 4A36A 3SBDA 1T5LA 3ZVMA 5JI3E 2QP3A 2ASEA 4B3XA 5KUTA 4HLUC 1T3LA 1OB2A 3W5JA 2FFQA 4HLQB 3OFNA 1GNPA 5F9HA 1KMQA 3PXGA 1ZM4A 1Z6TA 2VF8A 2OAQ1 1NLYA 5HZHA 1E32A 1MKYA 2QAGB 2JIZA 5EZ6B 2WWHA 3ZH9B 3GPLA 4LGMA 4RKFA 3K0SA 1X8KA 2DFKB 1EFRD 4CIDA 4G5GA 2YWHA 1S96A 1E9CA 4GI7A 3O8CA 1HA3A 1TF2A 2WTUA 3Q7QA 5K8LA 2NTYC 1TX4B 2ONJA 4RCZA 2WMNB 2ZUDA 4DCVA 1CJUC 2UKDA 4Z8XA 2ODEA 3HU2A 4IOMA 2ERYA 3X1YA 5FPYA 4V0MA 4URXR 2HLDA 1MABB 3GLFB 2XSZA 3QENA 2WJIA 2CHVA 1SHKA 1KY3A 2W0SA 2FA9A 2R6AA 3SZRA 2WAXA 2WWFA 3ZVRA 3WNDA 1CBUA 1KMHA 1DAEA 5B58C 3NG1A 1GSIA 3QXHA 3GJ0A 4IFEA 4LBWA 4ACBA 1XD2A 4LX0A 3VX3A 3T1OA 1E3MA 2O8DA 1KY2A 1RRGA 1WB9A 2JGNA 1LS1A 3RANA 3CNNA 1HTWA 1WDTA 3BD9A 4JJKA 4LUCA 3EC1A 5KSPA 4RZ2A 3T1VA 4GBMA 4UXIA 1U9IC 1Q3HA 2XNSA 3PVSA 221PA 2CHQA 2IBMA 3CX6A 2DHRA 2C2HA 1JQLB 2QQ0A 3RC3A 3KXIA 4JT2A 2J7KA 4MH0R 1G9XA 3EIQA 3FKQA 2P2LA 4KLNA 3GQBA 2G9NA 2WV9A 2Q9AA 4DRZA 3W6OA 3P4YA 3VR1A 2HYIC 4PSAA 4JT4A 1II0A 1N5LA 1LS6A 4OYHA 3TE6A 1EK0A 2ZSEA 2JLXA 2FWRA 2QEQA 4B76A 2FJUA 1FP7A 2C9CA 1Z28A 1NKSA 4P33A 4DB4A 4LSGA 3PCRB 2W00A 4KLZA 2O8CB 5FUVA 2YYZA 1Q44A 3N5CA 4B2LA 5KHOC 1HE8B 1Q57A 4YLGA 1E2JA 1H8HA 4JBYA 2ORWA 2QZ4A 2ZANA 1UADA 4GNKA 3MWYW 3PEUA 4MKIA 2ZRNA 2A30A 4LI0A 1UF9A 3N2IA 3BH0A 4H9GA 4B34A 4A1FA 4C2UA 3B60A 2WWIA 5BYJA 2ZJ5A 1ZUNB 4BFYA 1LF5A 2BMJA 1AKEA 5CM9C 1SKYB 1F2TB 2FEMA 2QA5A 3SNHA 3LD9A 1B0UA 2JLUA 4LYJA 5F98A 1TEVA 1TQ2A 5CK4A 1HE1C 3K0AA 1AQUA 1P6XA 1FZQA 3C41J 3L0SA 3K0CC 3M6AA 4Q5IA 4B3BA 4PAQA 5AJVB 4M1SA 3OIVA 3I72A 2GKSA 2JJ1A 3RABA 5AJXA 2NG1A 4XWKA 4TTQA 2YOGA 4TSFD 5EE0A 2JLRA 5DISB 2JDIA 2CDNA 4TZ0A 3GFPA 1E9FA 2BMFA 3TR5A 1OV4A 1ESNA 1J8MF 2WWXA 2Z4RA 3C15C 1UDXA 2ZRIA 3A36A 3QG5A 5JHGB 3ADCA 1RC8A 2QAGC 2X2EA 5FI1B 3T35A 3PEYA 4W5HA 4DDVA 4FN5A 2V7QA 2XB2A 5HZKA 2CJWA 3BH7A 4MRVA 3OAAA 2W58A 3QKRB 4M1MA 4NH0A 1C9KA 2YOHA 3FE2A 4XD7D 4Z54A 2VHJA 4LHXA 3K8YA 5DH9A 5E3HA 3THWA 3RRZA 2V3CC 4M9XA 4PPQA 2B21A 4KSCA 3A37A 4DSUA 1JJVA 4AD8A 3DKVA 1ANKA 4DUGD 3C5HA 2FH5B 2ZJAA 5D3MB 3ZS8A 1AIPA 3TQFA 1VDZA 121PA 1H65A 2FGJA 3KUDA 5C4GB 1DAIA 3AVTA 5HE8A 4JSYA 1IY0A 5HKKA 5JWOA 5C2JB 1G5PA 5EP3A 1Z22A 2V6IA 3NC0C 4U00A 1QHXA 4LYFA 4PC7A 1Q0UA 2ZJ2A 4XVRA 5CLQA 1Z2AA 2ECKA 4JLDA 3CZQA 3C7KA 4LC0A 5H68A 1P7CA 3QQ5A 2NO9A 2Q9CA 2XOKA 3BS4A 3CRQA 2O52A 3OF5A 1OYWA 4UNPA 5FR2A 5TXGA 2G1KA 1NKTA 4TYNA 3GLHA 2HDNB 2ZEJA 5L3RA 8OHMA 5FL7D 4O2LA 2FNAA 1YJ5A 2FDCA 1FP6A 4Q4HB 2ZTSA 3GD7A 2EYQA 1EFRA 3KKNA 4LDJA 1IY1A 1P9NA 2PZEA 4UNNA 4MKGA 1E0AA 3RS5A 1OHHD 3RC8A 5JJIA 2RGEA 1SXJB 4BWYA 2OLJA 1P4SA 4MQBA 1M2OB 4MRPA 2WKQA 3OEHD 1YKSA 3ZIAD 3GLIA 3QF7A 2QPAA 4QGHA 1IN8A 1GG2A 3PEWA 4LJYA 1NMYA 2QL6A 1X6VA 1A82A 4LHZA 3M4YA 3KTAB 1GL7A 1YE8A 2AXNA 3NEJA 1G5TA 5CIWA 4DIDA 3R7WB 4NYIQ 3VR2A 4TMZA 2QU8A 5HE9A 5FOUA 1OFUX 1LTQA 4LBVA 2X1VA 3UK6A 2AKAB 2KBEA 5J4VA 2JLVA 5TDHA 2ZU0C 2C96A 3FFBA 4LYAA 3SYKA 3HR7A 3AVWA 2PEYA 2J7PD 4DT1A 1GIAA 3JZMA 1VG9B 2H57A 2IHYA 1PJRA 2WJJA 1KI8A 4W9MC 5LBIA 4FD2A 1WP9A 3ADKA 1SVKA 1DAHA 4QM7A 1YZLA 3EZ9A 1CEEA 1ZM2A 1UKYA 5TY0A 3LX5A 4DSNA 4HAYA 4I1SA 4CT5A 4BLRA 3LLUA 1ZIOA 1MH1A 1T3SA 1YR8A 2R8RA 2YNMA 2ZUCA 2FN4A 2YJTD 2BBSA 3AUYA 1S1CA 1U0JA 1Q20A 4OQMA 2IXGA 4UXHA 4D0GA 3PUXA 1C4OA 3REGA 4A6XA 1BH2A 4B71A 2ZI4A 5FBWB 2O8BB 4QGGA 2W2VA 1W0JA 1G7CA 5FPSA 2Z4SA 5JI2E 3WRYC 3B9PA 3HU1A 3SQWA 5D3QA 4TYPA 1EWRA 2NIPA 5G3ZA 1VYUA 1UAAA 3AF3A 3SOPA 4B73A 4PFSA 1COWD 1GILA 2XZLA 2PZGA 4RD4A 1Z0JA 4Q4AA 1FX0A 4OHZA 3VR4A 3ZD6A 5KNCA 3U7GA 3QOFA 4QJ5A 1Z0IA 4HB2A 3WYFA 4YONB 1UKZA 1G291 1A7JA 3BFKA 4ZI3A 3SYLA 1LF0A 4PSVA 4M53A 4OHYA 4LRWA 4PX9A 1G3RA 2D3WA 2IXEA 4D25A 4D0NA 4JMPA 1CF4A 3G5UA 3K70C 1G16A 1KI2A 3L8YA 3UWOA 4V03A 4LJ7A 2GTPA 2Q6TA 3BJIC 1XDBA 3KL4A 4G5OA 2OT3B 2VP9A 4TWZA 4EJSA 3U3JA 3AF1A 2Z6VA 2CNWD 1N0UA 4ZIRA 4QJ4A 4MDEA 1E2GA 1KK1A 2ZSDA 5EE3A 5FOXA 3TKLA 3AVVA 4OK6A 5IDVA 4ZO4A 4DLYA 4YMTA 4KSBA 4D26A 1FMLA 1ZJ6A 3T5DA 1Q22A 1GUAA 3F3YA 3SU8A 1AS2A 3B8HA 3H84A 1YU9A 3KQKA 2J0QA 4WZBE 4PAOA 5DGXA 3KZ1E 1W2HA 2A7QA 3ETLA 4WVFA 4DKXA 3LQRA 2OLKA 4M1KA 1JB1A 1RVDA 2N42A 4EPVA 2IF0A 2Q9BA 5BW8A 4RD0A 1W49A 4P4SB 5JEDA 2V1XA 2D7DA 2DYKA 3QXSA 3TAHA 1J2JA 3EG5A 5ELXA 4IW3B 2C78A 1KNXA 3U7FB 3LRPA 1V5WA 1OH8A 1QRAA 3F5FA 4LY6A 2OFOA 4D4KA 1T0HB 3WP1B 4JLMA 5H8WA 5F9FA 1G17A 3BH6A 3CUEF 2C9OA 5TB5A 3B13B 1T8TA 1KSHA 3CPEA 2NOAA 4C30A 3E1SA 3TRFA 2QBYB 3NXSA 4HZUA 4JKYA 4Q9LA 3GJ5A 3EWSA 1W5SA 4WXRA 1VKJA 3UATA 1ZD8A 4PC1A 3KFXA 1D9ZA 2J87A 3K9LA 4EFNA 2ZYVX 3EZ6A 4Q9IA 4PO9A 5KNDA 2BM0A 1QHSA 2CLCX 2YC2C 4G5RA 1WXQA 4JVMA 2IYXA 4II7A 1E79A 4P4UA 1KO1A 1N0VC 1G4UR 1PZNA 2XEXA 2OILA 4FCVA 4YMSA 1RW4A 1MOZA 1NG9A 4Q02A 4A6PA 1NVVR 1J7KA 1UBEA 2QSYA 2O0KA 2ZVPX 3SYNA 2OCYC 1E98A 2BBOA 4ABYA 3U44B 2JLZA 3MD0A 2XAUA 4LHVA 5JS8A 2R62A 2ZJOA 1ZC3A 2OG2A 3OEHA 1ZNZA 2F55A 2OCBA 1SVSA 3MAAC 1GTVA 3KJGA 3AB3A 1XRJA 3OFND 2WWYA 3KJIA 2RGBA 4ZV4A 2XZOA 1SVIA 4MYUA 2IYYA 2PMDA 4M1TA 3V4FA 3K09A 3NKVA 5BN5A 3CPHA 1WMSA 3RSOA 1VHLA 2JIZD 1E9EA 3GJ6A 5AJWA 2CCGA 3CWZA 2G0TA 2IYRA 3SJCA 1BYUA 1UBCA 3IEUA 4P0TA 3AP2A 4A8JB 1ZNXA 1TQ4A 4RCYA 4DXAA 2GWHA 1G8GA 3VU9B 2IHBA 4H1UA 1UKVY 2J7PA 4KYUA 3QF4B 1FW6A 4E03A 4AG5A 4QHTA 4O2RA 1FUKA 1BMFD 4Q4JA 1VCNA 3DKPA 2EW1A 4LHYA 5KO2A 2RH5A 3BB1A 4BZXA 2HLDD 4V0ME 4UJ3A 4KBGA 4OHXA 3U3OA 1KDOA 3L43A 1P3JA 5EUMA 2XSZD 1WF3A 3CKLA 4PXAA 4BGDA 2IS4A 4EDHA 2L0XA 1YZUA 4NBSA 5FTMA 4TLDA 1W4BA 2A3RA 1CR1A 3I3SR 5JMTA 2NZJA 5DE3A 5E7MA 1Q21A 5HR5A 3SFVA 4UQOA 4GOJA 1KI6B 1XEFA 2VHUA 3IGFA 4QBGB 3SI7A 1E6CA 2WVJA 2VF7A 4UKDA 2I3BA 3PEVA 5CYPA 4OQNA 1KK2A 3WHKA 1W36C 1RZ3A 2P5TB 1OIWA 1YZTA 1LVGA 3TMKA 4B35A 1R8SA 2ZE8A 5H1YA 5EXSA 1RIFA 1TU3A 2VSOA 3CX8A 2ZR9A 1T9HA 3J81k 1DAMA 3MMPA 1TNDA 1LB1B 1LFDB 3MSXA 2VYFA 3W9YA 3FYHA 2QQEA 4C4PA 4IVQA 1JAHA 3GEEA 1V43A 1XTKA 2JLYA 4X8HA 4B6EA 1G3MA 4DSOA 3C4JA 4WAUA 3EPHA 3EZFA 2PX3A 4WA7A 4PPNA 1N6RA 4OQLA 4PC3A 2JASA 1L4YA 3IKJA 4QG7A 2Q3FA 3IIJA 3MWKA 2ZSBA 4C2TA 4UXJA 1U9IA 3QEJA 4U7DA 4ESVA 2ZRFA 3TVDA 2HF9A 1ZRHA 2RGNC 2XX3A 2CNWA 2H17A 3C14C 5G3YA 1KOFA 5CJPA 4AYWA 4URYR 1H8HD 5BYKA 3GJ3A 5LDDC 4F4IA 1NJFA 3MGCA 4NCHA 2EFCB 2P65A 3NHAA 3O8RA 5FPTA 1II8A 4ZKDA 3OEEA 4N3NA 3EARA 5HCIA 1OW3B 3EAQA 1W44A 2A9KA 1W2GA 1HQYE 1S1MA 3X1DA 2GCNA 2ORIA 4Q9HA 1IOZA 1KAGA 4B3DA 3CRVA 3I1FA 2CEAA 4P4TA 1P73A 3D7MA 3KXKA 3ZLJA 4Q48A 3GFTA 2QT0A 2PCLA 1O87A 5KSZA 3ASYA 3QBTA 2QMHA 2RAPA 2R6FA 2GK7A 2PBRA 2JJ1D 2JCSA 2VO1A 2JLSA 4PZLA 4M1YA 2AKYA 2JDID 4GDFA 4DLZA 4IEEA 1MR3F 4CEJB 5L8VA 2D2EA 2DCUA 5FI0B 3THYB 1NN0A 1DVRA 1E9RA 4B43A 2FPLA 5FTJA 1RYHA 2HF8A 3K70D 4RVCA 1NN1A 2PLRA 2ZR0A 2EFDB 3QPWA 1X1SA 4A9AA 2RMKA 1GKYA 4ZDWA 2YV5A 4UNQA 2GEVA 5L3QA 3GP8A 3AF2A 1N0WA 4TYYA 1G20E 1R8QA 2F1HA 3E70C 3TJZA 3TLXA 2I1QA 3B1YA 2W6JD 2MMCA 3BB3A 4AC9A 4NCKA 4LV6A 2IA5A 1TF5A 3PG5A 4B3CA 3OE7A 3ZJYA 1IXRC 2IW3A 2GF9A 3ZYCA 2JAQA 2F43B 3RHFA 5HKKD 2DFLA 3NH6A 2VPPA 2AR7A 1OF1A 5CIQA 2GJKA 2DY1A 1MT0A 1M7GA 2A5DA 4UJ5A 4Z1MD 1IY2A 3BORA 2KB0A 3UKDA 2AXPA 2GBLA 4CEHB 1DBSA 2XOKD 4RFSA 1M1YE 3BRWD 1SGWA 4NP6A 5EP2A 4EQ6A 2CVFA 3EW9A 1OIXA 2YVUA 3GLHE 5B2ZA 1S9HA 2WSMA 2HT6A 1FQJA 3EX7C 2R2AA 1LNZA 2IYLD 1X1RA 5FUYA 1CLUA 4O0MA 2WJVA 2ZIAA 3R9XA 4C9BA 2GXQA 3K1JA 3EPKA 5LPNA 2WWGA 3I8SA 3GLIE 3WY9A 3WMEA 5FOVA 1WQ1R 1BMFA 1R0YA 1YR9A 1U99A 2H7VA 3K9GA 3T5GA 3TSZA 3H4MA 4JVNA 4W7SA 1EG7A 2X19A 3KKOA 4C0KA 3B2EA 2FG5A 5J40A 2UZ3A 2NPFA 1XJ0A 2BCJQ 5JWRA 1IN6A 2EWWA 4RY2A 3KXLA 2PEZA 3HJNA 1YHNA 4POAA 5JRZA 1OXSC 4GZLA 4PPGA 1AQYA 2FGKA 4M9QA 4W5JA 2F1RA 3KX2A 1KJYA 2F9MA 4LBYA 4V0OA 3V00A 4Q1EA 2IS2A 3FKSD 1A2KC 4JLKA 2IYQA 3LH5A 2OUKA 4WOPA 4TL8A 1WBDA 1TQDA 4BZPA 5JEEA 5AUPB 3NBZC 2PT7A 4KITB 3QSYA 3R9IA 2V54A 3CB4A 1JPNA 3KQNA 4DCTA 2GJ9A 2BEJA 2OESA 3PFIA 1XD2B 3SJAA 2Z0MA 3SFZA 3W34A 2O8DB 2WJGA 2CVHA 4A92A 3PENA 1NMXA 2G3YA 3HR8A 3N2EA 3ADDA 4TMXA 1FQKA 2ZRHA 4PQFA 3WNBA 5A5GA 1W46A 3SE0A 2UZIR 2WM9B 1OPXA 3CLVA 1YZKA 4IXMA 4P3YA 4ARZB 1T0JB 4GZMA 3SQXA 4LWZA 2IYVA 3KJEA 4A15A 3TNFA 1R0XA 1M8PA 5FUWA 2QTHA 4KYIB 3PITA 2XXAA 3GEHA 1JQJC 5FH9A 1W0JD 4G5SA 2QN6A 4A82A 2XB4A 3D8BA 5KDLA 1XEWY 3T15A 1OXXK 1M74A 1W0KA 2G6BA 3W6PA 1KYIA 4C0SA 1Q1BA 1U94A 4RD3A 2BCGY 1ETUA 3FB4A 2GDJA 2A5FA 3PUVA 2VP4A 2PJZA 1UJ2A 5LD2C 4NCNA 2QAJA 5L3SB 3IO3A 5FTNA 2O8CA 4KV9A 2FEOA 4FWTA 4MKHA 2BM1A 4CF7A 4CEIA 5DIFA 2VP6A 2IUUA 4NHOA 1AZSC 2Y8EA 3I5XA 3LNCA 4C7OB 2BWJA 2HCJB 1W36D 3BK7A 2FZ4A 3CIOA 5HCNA 2J0UB 2IUSA 1HUQA 3DZDA 1HH4A 3IEVA 1KO4A 1KI4A 1E94E 5AUNB 1YR6A 4GP7A 2GRJA 4A0RA 4DHEA 1XCPA 3SHFA 2YOFA 4MUAA 5SZIA 3A1WA 2LWIA 4B6FA 1A2BA 5BWMA 1KDPA 5DYGA 4MGIR 1E4YA 1SVLA 5KDDA 2KSQA 1GP2A 3ND8A 4K81B 3OIWA 2ZQ5A 4IOKA 1ZNWA 3K0AB 3L2OB 3CNLA 4ZPXA 1P60A 2AHOA 2UVQA 4JBWA 3LVQE 4A4DA 4DJTA 1VG1A 2OFWA 2Q0HA 5DI9A 1G3IA 1NVUQ 1E96A 2RGGA 2ZI3A 3H0KA 1P2TA 3E5HA 4MYTA 1DO0A 1R5NA 3DM9B 1NNEA 2GBLC 5GJBA 1E0KA 2YWGA 4M21A 5B57C 3MCAA 1HY3A 4D6PA 1IM2A 4F92B 4Y0VA 3REFA 2XTNA 2GZHA 4PHTA 1E2EA 4EFLA 1UKEA 1M7BA 2W6JA 2BOVA 4PQRA 4WIAA 3UXMA 4KU4A 3L8ZA 2CJWB 1KHTA 1DELA 4R7ZA 3H1TA 2C95A 2VTKA 4OI1A 2F1JA 1VPLA 2F7SA 2EVWX
chains in the Genus database with same CATH superfamily
1NDUA 1YRBA 2PLFA 4D9FA 1O95A 2IOHA 1W4AA 3NVKI 3SX4A 3FDZA 2DBZA 1DADA 3FYUA 2NUTB 1IBCA 1MRSA 2XRZA 4K9RA 2FUEA 4C0QC 4KJXA 5D3MA 1TVKB 4B4WA 4BTVA 3JTEA 3KLNA 1XAGA 4LVCA 1D4OA 1L6RA 1KEKA 1CEYA 2AG1A 4OYRA 4XKJA 2AK2A 1A27A 3U4QA 4TMWA 2WKRA 3EQ2A 3VNUA 2PRSA 1YZHA 3QE9Y 4I55A 1YFLA 4BVFA 4DQKA 1BO6A 1A96A 4AYTA 3RHTA 2Z30A 4KI0A 5C5CA 4RUKA 1P5ZB 5EXEA 5DSZA 1JIQA 1U8FO 3JCZA 5ICFA 1OZ0A 1XRQA 3AFIA 3MJHA 1Y8CA 4JQCA 4BNKA 1QLHA 1DKMA 1PWYE 2VCEA 1L5LA 2QZ9A 3WNQA 4H7FA 3PFGA 4O4JF 5EZYA 4YUZA 1I3NA 4FSHA 3DL7A 3G5MA 1BGWA 1T8YA 1JRLA 1ORHA 2ID9A 4EKDA 4UARA 3RYFA 3WB0A 4OQEA 1GQOA 3NHYA 1EZZA 4RSGA 5A06A 2X3YA 1QHEA 3L18A 4YCJA 3N0WA 2QORA 4M4SA 2YINC 1EJ2A 1ZMXA 3OIYA 1J8YF 2VN8A 2VDUE 3C6BA 3KLBA 4KMMA 5E7JA 3WYDA 5M5BA 4MROA 5LOVF 3GLGA 5DHRA 4UTOA 4DDTA 5HKAA 1UC8A 3TLGA 1M0SA 4FFBA 3BHNA 2CJPA 1CUUA 3TR6A 2V5AA 2WD8A 1NBAA 2JFUA 3MCUA 2GFIA 4TLBA 5DHUA 3DV9A 5EL0A 5I5GA 3RUFA 4LJSA 1S2IA 5JC8A 1RYEA 2AD1A 3B78A 4MWDA 2DPMA 3MG9A 5H9VA 2RI6A 4CF6A 2HK9A 1LLDA 1TUGA 3Q6IA 4JBLA 1OB5A 3L8EA 2GWRA 3JVEA 4MQ6A 5CHYA 1XBTA 4KBFA 1AC5A 2WFLA 3HXLA 5AXDA 3ZJTA 2W42A 4C7KA 5EAIA 3NZEA 1QZUA 2YWEA 1RQ7A 3HUTA 4ND7A 3ZUPA 4F3TA 2PZFA 1RWQA 4BDSA 2VJMA 2QG9A 4TMTA 4DPKA 4IZHA 4A10A 1DUSA 3TVTA 1R4NA 4AG3A 3PFFA 2SICE 5AUOB 3C16C 4K86A 3WICA 4D79A 5LB2A 1SPXA 2AX4A 5JZBA 1JVSA 4GH5A 4E21A 5H16A 2IEBA 4HAXA 4F3CA 3D7RA 2XWQA 2OCGA 2DJ5A 1RD4A 3S2EA 1KSFX 4GPD1 3IQIX 4KNYA 4L7VA 4ZQGA 1FDOA 3NT2A 2UAGA 1ISRA 3A9TA 1P4JA 3BQ9A 3WKAA 4EO9A 1U0HC 3ANSA 4QO7A 3ZE7A 1EX6A 2ZI6A 3CU5A 3DNFA 1NI4A 4HI0E 3G0BA 4A23A 3QBVA 2IX3A 2PK3A 1UDWA 1QC5A 1RAFA 1LGYA 4QUEA 2JLQA 2CYAA 3K05A 3W4IA 4UHJA 4KV7A 3FOZA 4LYDA 5ALGA 1FMJA 5EA2A 4O6VA 2AMVA 1T36A 3VYRB 2QZJA 1ZUWA 3L7LA 3IHWA 5IAGA 2QD4A 2PSFA 3TIVA 4JAVC 1QGOA 1UBGA 2P6NA 1J25A 1V7PC 5AKIA 3K8OE 4Z7JA 1DFIA 2FRDA 3AF0A 1LRKA 1EMDA 3C4VA 1P9RA 3FPKA 3HKEA 1RABA 1K7FB 1T4GA 3JQQA 1TCVA 5A3JA 4Q1BA 4DIOA 1CIVA 2R6CA 2RH8A 3ZGYA 4I4TA 1A5ZA 1H2FA 2DUNA 2OK7A 1AZWA 1E2PA 4FEEA 2WSBA 1Y63A 2ZVDA 5F73A 1WDWB 4TX1A 4TQGA 1MPTA 4FGWA 4Q1FA 4F38A 1TTTA 2I7DA 4R01A 2ZUTA 1FXUA 1QHYA 2H1LA 2BFMA 5F1KA 3ZU6A 2P5YA 3IUEA 3S1SA 3IV6A 3BE8A 1UK9A 2NO0A 3IUJA 3OG9A 4LHWA 4FGJA 4WFQA 1H5NA 3OBIA 3TZKA 1XF9A 3A4LA 4O4IF 1N77A 4PM4A 5I4KA 1CUAA 2AW5A 2C2BA 1EFTA 1NP7A 2QMUA 2PQ6A 3NNDA 4MJ7A 1W36B 1T6NA 1N25A 4GOKA 5KKAA 5E6RB 2FRXA 4OXRA 3ESYA 4XWAA 4XCQA 4IIFA 3BYZA 2B0CA 3W1VA 3PS9A 1XKTA 4HT3B 3BJMA 1CUYA 3SDSA 5CTAA 3ANYB 2CFTA 1DPFA 1OVMA 3BGVA 3IAS1 2OQVA 2HEIA 3ZE0B 4ZIRB 2ZWPA 1TKCA 2C77A 4JYCA 5JD5A 4P3OA 1CETA 3IIMA 4BJ6A 4CGZA 1PE0A 2O3SA 3ILYA 4BMPB 4ZMBA 3TQQA 2WPDA 2CLKB 4GQIA 4Y2SA 1D0IA 1TJYA 2ZYRA 5KVQA 4PRYA 1LZLA 2CZGA 5EOVA 4CVNA 2I4RA 4O5AA 2YTZA 4WY2A 1YUBA 3TLAA 4MHSA 5JNVA 4HDKB 5TSDA 4UOEA 4J4TA 3PX7A 4A8TA 4MI3A 1TM5E 1VCMA 2RGNA 3WL4A 4ER0A 4M76B 4WOKA 1WLSA 2RIRA 4ZI7F 1DFHA 1QCCA 1ZD1A 3QBJA 4OHCA 4TM7A 2A9RA 5AP9A 3QUQA 5AXAA 1LU9A 2QN9A 4QQKA 5BP7A 2BV3A 1FSSA 1SBHA 4R8VA 5CHEA 3K9QO 4BQFA 2QPTA 4RGQA 4NY1A 3WYNA 1Z62A 1TADA 1ZVVA 2QG4A 1ST3A 1IOWA 2QTVB 3QXJA 4TV8A 4PCUA 2B4TO 4Y18A 5B3JA 2XYRA 2ET6A 2IL1A 1ZUIA 3DKRA 3S55A 2VK4A 3ZK7A 4PSKA 1SBQA 1Z7BA 2OBYA 2VHQA 1FJXA 3EGCA 2QW8A 5JYCA 2REBA 3QMWA 2QDKA 3RAGA 3TWOA 3RS2A 1U2TA 1Y3AA 2F3PA 3EOBI 3MAJA 1PK8A 4HYQA 5SZHB 3FVWA 4PN3A 4DMMA 4F56A 1UBJS 5EXDA 4JDPA 1W4RA 1GUFA 2VUUA 3C3CA 2IYZA 1ZH6A 2XADA 3THXA 1IN7A 1VRWA 1A1VA 2Z5LA 4J3FA 1S4QA 1UBUS 4ML3A 4Y9UA 3PL5A 4D0RA 3F97A 2K5UA 2CFCA 2ACKA 4KACA 5GZ6A 2FK8A 5HF6A 1HWYA 4ZZ0A 2OD7A 2QLTA 3NVAA 1L7QA 3AOGA 3V97A 4W5WA 5CDUA 5KOYA 2FQXA 2ACWA 4GXRA 1JQBA 3IUSA 1CZNA 2DWQA 4FWIB 4HMQA 4NZZA 5GV7A 4CNBA 4Z53A 3J7AC 1OILA 3KZCA 1MJFA 2P4SA 2ZSFA 2FMFA 2R6R1 4JL6A 4ZV7A 1DO2A 4GLBA 3FSRA 3BL6A 3IULA 2J3DA 3RLFA 3W1WA 5MF6A 3L7DA 1P2SA 3ZR4B 1S7GA 4XX0B 1YCGA 4DTIA 1YMVA 1Q0TA 4QSHA 5IJ9B 1LZKA 2V6JA 1TZJA 3MFYA 3PTLA 3R2JA 3OX4A 4MQUA 1XC7A 3PUKA 2Q4EA 1NG1A 3C97A 4YCCA 1MV8A 3CF0A 4ZTBA 4I8XA 1YU6A 5EC8A 1ZM9A 2XUDA 1U2RA 4Q9JA 4B3TB 4ND2A 3T0GA 1K63A 2ZRCA 4N5NA 5KU7A 2MYPA 1LPAB 1HT2E 5AHKA 4D8UA 2OCIA 4MUGA 4P08A 4DARA 1TIPA 2IYUA 3PDJA 1CKEA 1E3IA 1JEDA 2W8BB 2OL4A 4PTLA 3DFUA 3WLPA 3A2KA 1RJ9A 5FYQA 3A6JA 2NSLA 4RK4A 1X70A 3WK8A 1QVRA 5JAHA 3CMCO 3DF9A 3B8EA 1V8PA 3RKRA 3LQ1A 4CKZA 1L5OA 2BEWB 4OL9A 3WGUA 1GRNA 1TLLA 2JCBA 3ABSB 5DTQA 1LBEA 1LTKA 5AKKA 4CMJA 3U09A 2JVKA 2YCBA 4KQ6A 4Q47A 1XHLA 1XR3A 4H7EA 1XF1A 1L0BA 4CM5A 5CA1A 3DDSA 4MV9A 3UK0A 1JQ5A 2ZRAA 3MOIA 4KR7A 5A5DA 3LUBA 4JMLA 3RS7A 3VDRA 4EIWA 3BIOA 1Y98A 2QMYA 7AT1A 2PZLA 3L6UA 1R10A 2JVJA 1E2LA 1QBKC 4O1IA 3VR3A 4JB2A 3TQCA 3G2HA 1GZ5A 4BZQA 3G82C 1SULA 5KYGA 1IZZA 3ICWA 5GONA 2JLXA 1CJTC 1PUJA 2OCAA 1KJZA 5AWFC 4YJ3F 1N6IA 5A1TA 1PS9A 2CN1A 1ECPA 4D5EA 3UJPA 1P1CA 3LC2O 5DP2A 3QKSA 2X1MA 1TA9A 2NO7A 1J06A 5I4CA 3STYA 3A2NA 3HZZA 1EVQA 2IVFA 1GJRA 3OVMA 3TUIC 2CXOA 2Z2ZA 4B48A 2OOSA 1CQJB 1MD9A 1QIJA 3HY3A 1VYHA 5LQUA 2G1PA 4GRAA 5CBKA 2C3YA 1M6YA 3IMKA 4Y6QA 5FTWA 3L6RA 3P5BA 3KCNA 2BN4A 2C4WA 5BW6B 5KTTA 1I6LA 3NRCA 1CXZA 1L4UA 3H5RA 1QFZA 1P1JA 2XGGA 3NHSA 4BO8A 2XMCA 4OH1A 4BECA 4KVZA 3ZC3A 4NEGA 4YR7A 2W2OA 3EAFA 1A9ZA 3QBEA 4NV1A 1NE2A 2R87A 3Q12A 5AI8A 2EV9A 1NLFA 2HA4A 4MP6A 1EFPA 4PAMA 5D1HA 3LQKA 3I01M 2OMKA 5GIOE 3CGGA 3E2PA 1I3CA 2J1LA 5HZGA 1OY1A 1WBBA 3FSEA 5TARA 8AT1A 2G36A 4IGAA 4HDCA 1HZJA 2QZSA 3WIVA 1ETHA 5EZSA 3WRVA 2ZT6A 3COVA 3GGSA 2OBBA 3PKIA 4WLEA 1DIOB 1OJLA 1RAGA 3FVVA 4XIJA 1MHPA 2RK6A 4ZOCA 4N0QA 4WGFA 3HBAA 3SC2A 2YY5A 1MZPA 1VBKA 2A58A 4MZDA 1EA5A 1Z34A 3QU4A 3GPDG 1DTSA 4CM3A 1ZCFA 3HR4A 2DKOA 5JZSA 1I2AA 2HU8A 4WXMA 4AK9A 4XVHA 1OH6A 4J3NA 1B0ZA 1JDZA 4HAWA 2FTKE 3OOEA 2IDZA 4EJMA 3O93A 1NM5A 2QMOA 4L27A 1HORA 3TM4A 2Q0SA 1GPNA 4JLOA 3I05A 4C7BA 2BISA 2OO5A 3A4NA 4DLSA 3E5MA 2P4HX 1EFVA 1KL7A 4CGYA 1ZVQA 4TVSA 1PKXA 1SXGA 2XLCA 1VPEA 4JLJA 5ETJA 3R5TA 3HJFA 1TKRA 5CCXA 1CUCA 1VKZA 3EASA 5E3IA 2BP7B 2BEKA 3P4XA 3H1EA 5E2BA 3TLKA 3EXIA 3EXFB 1P0PA 3OLXA 2P9HA 3IDQA 1EWKA 1Z63A 3H1PA 4DDWA 1L4KA 2XE4A 1AUQA 3FNEA 3HCDA 4FIDA 4DMGA 1BHO1 4K05A 3BXOA 3TB4A 1IJEA 3DTYA 4Y1RA 4KR9A 5HWSA 3WQQA 2EFEB 4D6YA 1T6ZA 1S2MA 3BE5A 3R5KA 4BO6A 4TYWA 2XGMA 4US2R 2W37A 3Q87B 4HADA 3TH5A 3A4VA 4OAPA 3R5XA 3FDIA 4HUTA 3VOSA 2EQAA 4HWSA 2CMGA 1XA0A 1G9TA 2HA5A 4UM5A 2C3PA 3ZWXA 4E0BA 2X2FA 1VHWA 4UUBA 2GILA 4M8KA 5F7ZA 1YMUA 3QQPA 4WN9B 4US1R 4BN5A 3BERA 3I9KA 4EZIA 4L5BA 4TXJA 1QKKA 4H7DA 3W6UA 3B1VA 5EYPA 4AKEA 3KKQA 3ZCTA 4K40A 4K0KB 1CX9B 3LRTA 3AYZB 5DP1A 3AHFA 3S29A 5AVUA 3I9NA 4HP8A 1DB3A 3WBJA 5JJ5A 4MMXB 4D3DA 2DUMA 5T6MA 4BE7B 3I2JA 4YV1A 4AX8A 1MDBA 3W4JA 2WICA 2CFSA 4AMGA 4BGVA 1Q1ZA 2I6TA 3P2EA 1DIHA 5AHRA 5LB4A 1J8DA 5BXQC 1T6XA 4B4KA 3WHIA 1YUNA 4IO0A 3VHXA 1OE0A 1U8YA 2RHDA 3K31A 4GI1A 5DI3A 3OPVA 3LW7A 4BO0A 1OT3A 1SURA 2MR5A 3L9WA 3PGXA 1NUAA 1U2QA 4J7UA 4MVJH 5HKLA 2D74A 4GOOD 2Y1OA 3TRDA 1T4MA 3JQFC 2YXEA 4D3XA 3BWVA 5BN4B 2AQ8A 4HAIA 2IIQA 4TTSA 2RI1A 3WLFA 5KINB 3CZRA 3CH5A 3IBGA 5CP8A 3B6MA 3LC0A 2G1UA 4JK3A 3O1LA 1ZAKA 1ZW6A 1QIGA 4UM7A 4AY6A 4JYZA 1F4VA 2NYRA 2ZRJA 5K3FA 1NOIA 2FPKA 3OJCA 5ER9A 3ACCA 5AKZA 5JAIA 3CE6A 2A1UB 4E2WA 2HK6A 4YI5A 1I33A 3MT8A 4RA9B 4IXNA 1W88B 2IE8A 4ITUA 3VO9A 3K53A 4EA8A 3ZWNA 3QIAA 1EX1A 4JYMA 1G6KA 3AJAA 4B31A 1Z0SA 1N1MA 2NPIA 4DNXA 2D1YA 2VHTA 1GD1O 4MZXA 4O08A 3OTQA 5TGTA 3WKBA 1BVYF 1JYEA 3RC7A 3U7EB 2IPMA 3RRJA 4R41A 4TLLB 3HUDA 3FGZA 4JLPA 3SBXA 4GP9A 2P67A 3N8GA 4DJEC 4BQPA 5B3AA 1R6XA 1XZPA 3EFBA 1RWOA 3IODA 4IIUA 5J5VA 4HYEA 4Z0TA 1ZBDA 3RIHA 2TMGA 5LYJF 2B1GA 3V4VB 4N76A 1IY9A 1KK0A 1PWZA 1TMKA 2AA3A 3GLGE 4DLVA 1NXOA 3GMDA 4KXQA 1N9KA 1KMCA 2Q1TA 2V7PA 3TZ6A 4WCDA 4CE6A 2ZRMA 3H86A 1OKKA 3A3OA 3QVWA 3TBKA 1I4DD 1K6EA 1RYYA 2H92A 3FSGA 3LHDA 4YP6A 4N65A 5AI4A 1Z8DA 2QUKA 3JQPA 3ROQA 1PT6A 1I5OA 4JITA 4FHFA 4UBOA 1BOOA 2CLEB 3HRIA 2UXCB 1FLDA 4P5DA 5ED4A 4RPHA 2H0QA 3AKDA 1PS8A 4RLSA 4ETMA 4Q18A 3T3NA 2GT1A 5FHRA 2J0VA 3ADBA 2BFNA 2IITA 3K73O 1M1UA 2I76A 3E6AA 1KKLA 2HA0A 2R79A 3D6UA 3EIWA 3NU1A 2WQZA 4AWBA 1ZONA 1NX6A 1Z06A 2ZIEA 3HFGA 4N12A 3SXUB 2OPBA 2EKBA 5IH3A 3BTUA 2GXUA 4JJ8A 3QH4A 1TIKA 1C2TA 1NFRA 4FJ1A 4NJOA 1Y6FA 4CQJA 4IGKA 2A5YB 4JB3A 1JYFA 3UV6A 2XWBF 2CE7A 4O8CA 3K9HA 4D97A 2XQGA 5DGHA 2XZPA 2JFBA 3TW4A 5LDHA 3WSVA 4X91A 1P17A 3OPQA 3CH4B 4TTVA 1Y5IA 3DBHA 1G3QA 2FE4A 3I64A 1UEIA 3NNNA 3GRYA 4NBTA 3HSYA 4NMMA 2X0EA 1QIHA 3HJCA 4D4LA 3P5SA 2ES4A 1Y8RA 2ECOA 3RF7A 1E1RA 4Y2RA 5CR9A 1M1ZA 3OOJA 4DV1B 2SCUA 4KVAA 3ZKWA 4TTPA 5B1EA 3F6BX 3AW8A 1I13A 4QDKA 5SZKB 3CLUC 2ZE6A 3JATB 1PL0A 2H07A 4V1CB 4EHIA 4NPHA 4OXXA 5DHFA 3IUMA 4K9LA 3DZGA 5FTKA 3ZWPA 2NUPA 2B35A 1PW7A 3CN9A 2IOQA 2C98A 4JU8A 3BEOA 3IOCA 2YHSA 1YE5A 3HBJA 4LZNA 4R3UC 3O95A 4BNYA 4C7MA 1T2EA 3HLTA 4R3WA 2OXFA 3DHYA 3NGLA 3FZNA 4I5FA 3TLBA 5A2GA 4GL2A 3GT3A 4INPA 5FNVF 1K8YB 2OBMA 1O1YA 2ZBDA 3PNSA 3RVDA 5ITWA 3L7JA 4MRNA 2PXAA 4KNWA 3VPCA 1MBZA 1ORWA 5B30A 1FFXB 1MVLA 1XTUA 1Q95A 2EJBA 3QX7A 4O29A 3DGFC 2VUTA 3DP9A 3V1KA 1RLUA 1ZD5A 9MHTA 5DB4A 3U61B 4AZVA 1X77A 4D5GA 1SKUA 3AP3A 1YJBA 2D1SA 2NNLD 3PICA 4RE5A 3JQAB 3H5WA 3UK1A 2A9JA 2XYGA 4JN6B 1JU4A 4I1VA 1K0UA 3VHLB 1FDVA 1CP2A 2X77A 3C87A 4QTUB 3N5KA 2OC4A 4YDSA 1AGRA 5CYGA 1KYQA 5K01A 3S2UA 3DCIA 1D2AA 2V6MA 4KAJA 1Q3TA 4PX2A 5JG7A 4JCCA 4N7MA 3LK6A 2WIGA 5DN6A 1TLFA 1YK1A 4PLTA 1PJ4A 5IT5A 2WBLC 3IO5A 1E9AA 2O2DA 3G0CA 1QZXA 4PINA 1G1MA 2VTBA 4M99A 4RKQA 2OUIA 4UD2A 5F78A 2VQSA 3P26A 1ZCBA 5EHGA 5DLQC 1QUEA 3QPVA 2D2IA 3W3AA 1OJ7A 2VRWA 1KJWA 1WS6A 2G5TA 3KU1A 1H23A 3GRRA 1NQWA 4GM1A 4KNVA 2D54A 1JLMA 4M1QA 1FXWF 3N6XA 2HH9A 4R2IA 4CQMD 2P9QA 4U02A 2WABA 5JVDB 3SIRA 2BKAA 2LTAA 4JC4A 3ZQJA 4QXRA 5K7SA 1JIJA 3H8JA 3KJHA 1NF9A 3G1WA 3OJXA 4QYTA 5DEIA 5EIHA 1LW7A 1PN3A 1U7TA 2JGEA 3WAJA 1BVHA 1L7OA 2BUBA 2R85A 4I8IA 1HK7A 4D4MA 2CK3A 1CYDA 2VNIA 3TZLA 3O91A 3Q41A 4UPDA 4NZYA 3WLMA 4DBLC 4LZZA 1Q1EA 3DZFA 1ZBQA 2NSYA 1YRLA 4ZGWA 5HX7A 3NC1C 1H1LB 4LDZA 3HNPA 4HH0A 3RSQA 3WMRA 1KC3A 2RCNA 2OZKA 4LRTB 4MVJP 2AK3A 3GHHA 4RPCA 5ALNA 5AOBA 2XR1A 3EEQA 4GLOA 3DDCA 4D6XA 1JKIA 2PD6A 1L5WA 1F38A 1SCUB 2H9AA 1DBQA 1QJ4A 2FETA 2OZLA 2WILA 3GJZA 3KELA 4DCOA 4TV9B 3OHMA 4WESB 3IOMA 1UC5B 5FWXA 4Z6KA 5F23A 1H9AA 2FRVA 1EWQA 1MLDA 4XJXA 5C80A 3X1WA 1U7ZA 3B1XA 1W30A 2C04A 1R00A 1E0JA 1L7RA 3T7JA 4BB9A 1H5UA 4ZAGA 3WGMA 5FXMA 2NPOA 3FFAA 5AI0A 3MTGA 5J63A 3RVKA 5JCPA 2GX6A 2OO3A 3ZCXA 1GKKA 3BWEA 5FLEX 4P84A 3ETJA 1OH7A 1E3SA 2AI1A 2X6TA 5C9ZA 4PO8A 3UAXA 2Q29A 5I7VA 5HNKA 5CBPB 3LZCA 2B4YA 3JQBC 4BGUA 1O6FA 3LT5A 4ROTA 5ERGB 2WHXA 2HWYA 2PU5A 3T6KA 4B3IA 2E9SA 4OGGA 1E4EB 1B4DA 2KYRA 4YUXA 1XJQA 4IXTA 4YAOA 2C5GA 2W2LA 4NENA 3E3NA 1L5QA 1LLFA 1O0BA 1SUWA 4KQGA 2L19A 4H59A 4ASUA 1OAKA 2H31A 1NR1A 2OHVA 3DLPX 3GLIB 1X9HA 3OQVA 1M5TA 2NV2B 1X8XA 2FY8A 2WHPA 1Q7TA 4XDZA 3JWJA 4GVLA 1XU7A 3Q2KA 3RWBA 4DCUA 2HQ1A 4IEIA 3WDSA 3DLAA 4ZTZB 4K03A 1I3LA 4NZPA 2V7GA 5DO9A 2I67A 3P20A 1JQKA 2DTDA 3WBFA 3TMYA 2QM7A 2ZJ6A 1S2OA 1GITA 2XW6A 4QTTB 4WLFA 2WY2D 4RTOA 3E3MA 2CGEA 5CT6A 1Z0DA 1EHIA 1Y7HA 2XDAA 3E4DA 3TPZA 1I7LA 2VJDA 3B48A 3MWDB 1ABEA 1FNSA 4LSWA 4UASA 1ILEA 2RB4A 3MUFA 1F3OA 3WC4A 3BTSA 5JR3A 4P54A 4R8SA 3UMSA 4KDCA 1ULSA 1H4SA 4BFSA 5JFOA 4JLVA 2AOWA 5GZ1A 3WP0A 4PY2A 1O6ZA 3LKDA 1BHJA 3NEYA 4I9HA 4D4JA 4X93A 2Z3WA 5CFOA 3IQDB 3A4MA 3NT5A 3WX0A 3AGPA 1UMBA 1XI2A 2E37A 2VJLA 4IMIB 1N5DA 2XHZA 5LQMA 4FMBB 3KT3A 4XB1A 2DVMA 2UZ4A 1IUOA 3WB9A 1E9VA 2ZBUA 4BVAA 5E95A 5LWQA 5KVAA 3OT1A 5K0SA 2J3QA 4AECA 2NO6A 3H5OA 1XTZA 2F00A 4NABA 3RAPR 1GAQA 4AI6A 1AB5A 2OLEA 2D06A 4HRXA 2YY7A 2PUGA 1DTWB 3OQPA 3OJWA 5BQPA 2X2PA 1A8QA 2VTEA 4CI9A 1YBMA 5AR1A 5CAEA 2G4CA 3AKEA 3PHCA 5H3CA 5BRAA 2V55B 4QFCA 1GAWA 2GHQA 5CT5A 3R8CA 3QVSA 4CTOA 2MINB 1WQ3A 1BROA 5CCDA 4A6DA 3W2EA 1PT9A 1TPZA 1R9NA 1DKRA 2A94A 3LAWA 2H5LA 1UBFA 2BR4A 2H5EA 2ZYGA 3B9RA 1F5NA 2JI6A 1MXHA 3OI7A 1XNQB 3AVXA 1PEYA 1UMKA 4QATA 1VMIA 1XZCA 2CUNA 3VU8A 5ITZB 4B2IA 2OBNA 3R76A 4RAQA 5HM6A 1Z45A 4B3JA 4RWEA 1BWSA 1KBOA 5F3RA 3OQ6A 4OFZA 4HGOA 3D3QA 2B8JA 1IY8A 3NHPA 3HB9A 4F4HA 1FX0B 4G5HA 3TTVA 3CRMA 2VZLA 2A35A 1RMQA 2LKCA 2X2OA 1G7SA 4KW7A 4TMKA 4RV9A 4PAGA 2ZROA 4MVJF 4S2EA 4BVKA 4HVCA 5HRUA 1U0OC 4CFSA 1DFGA 1U2ZA 3D3JA 4BN4A 4C0XA 3FF4A 1EB8A 3F5MA 3WGJA 2ZRLA 1A4IA 1VJ5A 3E8SA 3WAKA 3VHQA 3ZCRA 4Z0HO 2WUWE 4BNDB 3DOCA 4IJVA 1K7SN 1CRQA 1VYVA 4V0NA 1IPHA 1JEYA 4IIVA 1WD7A 4BMYA 5BSGA 3QVGB 5G41A 1TQ6A 1ZUHA 2EG9A 1EESA 9GPBA 5KSWB 2GB4A 4IMRA 3HCAA 2OV1A 3PBKA 2IF2A 4AY3A 1EXVA 1IUPA 4UNIA 1YH3A 1QG4A 2Z5GA 1I4TD 3IAUA 3NIWA 4MYRA 2A5JA 2ONCA 3AP1A 3EA5A 1YOVA 4GWLA 4HN9A 4GBED 1NUQA 4MLZA 4GO1A 4GSYA 2I29A 1TVEA 4B83A 1SOWA 4Q3DA 1Y7IA 4OM8A 3JAMA 1E9SA 2ZE5A 2O1EA 3CLKA 3FLEA 4YJ2B 3KLOA 1D2HA 1MRNA 2B1IA 3FM9A 3NGMA 4H7KA 4HSEA 1IQPA 2ISCA 2P6OA 5I8ZA 1THZA 4EJ6A 4Z7OB 4CKWB 1HPLA 3KPUA 3PHLA 5HILA 3P96A 4CTJA 1AQLA 1VIVA 2NZVG 5EJEA 4GPTA 3I0NA 1J2TA 1U11A 2JIOA 4DLWA 2WIAA 3NPAA 3O5AA 3T9DA 3M89A 2QAIA 5FBKA 3FY4A 4ZGBA 1HDEA 4EX6A 2OGZA 1CW2B 4EF6A 3FWZA 2G1AA 1WO8A 4U3JA 4GMKA 1WLYA 5AJHA 1IUNA 4AZ3A 3FZGA 2HJ9A 3CW2A 1XJCA 1AO3A 1XNGA 3EY9A 1CJVC 3EW7A 3MTIA 2HJVA 3NDPA 4IRMA 4NJEA 5JQGB 2Q8NA 1PVOA 2JW5A 2ORYA 4J7AA 3RS3A 2EERA 4FPXA 4M38A 4NFLA 3HB0A 3VZDA 5C51B 2BHRA 1A88A 3ORSA 1V2GA 4PSDA 3FHJA 2YBEA 2QBYA 4PG8A 5FR1A 4U63A 3F46A 1VOTA 1O54A 1K2VN 1C9YA 1GNRA 2PS1A 4HWRA 3BAFA 3C45A 5BSHA 4K9QA 4ZC1A 4HZUB 2Y4NA 2X0RA 4JI4B 1GNTA 2VNSA 1X7ZA 2C3MA 4G56A 4ZEXA 1XGKA 3B38A 3GN2A 4ZT2A 3PNYA 3EZNA 4AY2A 2E7ZA 1RQGA 3AM1A 2IYPA 2FX3A 4X8OA 4DV7B 1BS9A 1BDMA 1AUVA 4NARA 4Y6PA 1LX7A 4XGNA 4ZV9A 1HT3A 4B5KA 3A1SA 1JI3A 1SXPA 1KEZA 2AFHB 4G89A 5IH7A 3O8BA 3LBNA 4MX8A 4ZJYA 1NP6A 3ZDXB 3NMUF 2ZYUX 3CVUA 3EQZA 2Q28A 4Z2YA 1U3VA 1X7HA 1Z6XA 2JJ8A 1PV4A 2ERCA 3I62A 1U1EA 3UO8B 1QHHA 4CKEB 3QEAZ 1RJWA 2XZTA 3U44A 2JD2A 4QGSA 2CT8A 3EZLA 2JFYA 2VT2A 2ZE7A 4IVPA 2EFYA 1JDBB 3X0DA 3ECSA 3OWXA 2JRCA 4I4LA 3NTUA 4KO8A 1FYFA 1TCBA 3RK1A 5FL7A 4B5LA 3IAM6 4QA9A 4L8LA 5AQ1A 1DAKA 4D98A 2EJWA 2GF0A 4CLRA 3NEPX 3WGNA 3ZY2A 3H83A 3SMVA 2PE5A 3AL0C 1G21B 4MPDA 4JJZA 4NCBA 5DCLA 2Q07A 2BDTA 4KO3S 1K89A 3PDCA 3VPBA 3EIHA 2BTQB 4RQTA 4ZXPA 1JN0A 3SJBA 4OP2A 5EP4A 4JYBA 2TSYB 3AR5A 3O8NA 1E1KA 1FP2A 1LD3A 2W8ZA 3Q8WA 4PBTA 3VTKA 3GDGA 1U28A 1ZD9A 4AF8A 1TAUA 2HBRA 2IEZA 3IIKA 1NVEA 3ML1A 4OGFA 1XVTA 3WK4A 4F1KA 4OVKA 4XB2A 1GKLA 5FOTA 4BJ3A 2A1TR 5MFPA 4LKRA 3LCJA 4BMNA 3IUPA 4DNQA 1ZMBA 3GEIA 1RFLA 1NUPA 2UUPA 4NMLA 1SFRA 1ESMA 1CU1A 3QF4A 2VNHA 1Y6ZA 3NP9A 2YNMC 1YF3A 3QE4A 4OHWA 1WKBA 1QR6A 1HYQA 3I8OA 1YHZA 5ENDA 2Z2IA 2JGMA 2PYDA 1D2RA 4N5MA 1NVVQ 4ITVA 4O3FA 4O2AF 1HL3A 4JXXA 1TEXA 2FUNB 2HF2A 3IAEA 1TOAA 1MIOB 2Q6IA 5EQJB 1W47A 4EECA 5LP1A 2BVNA 3FHTA 2Z8XA 3L6CA 2HCBA 3FCCA 3GMSA 5EHXA 1E4OA 1HRDA 2AF3C 4RMGA 1XTIA 3U7HB 4JQZA 5L4LA 1BD3A 4GKJB 1DAFA 1WDLA 1Y7LA 1SKMA 3HUEA 1B23P 1TT7A 2H2WA 2AVNA 2ABWA 3F9IA 3CF4A 3DZJA 4V0SA 5TV2A 2DHQA 1HYBA 1KJ8A 2Q46A 1QYXA 1B1CA 2RC5A 5K6TA 2G06A 2R751 2O2IA 3GPBA 4V24A 2D2XA 3X43A 1V39A 3EIXA 5EIFA 4JP3A 4RKEA 3WFIA 1DIRA 4PQYA 1SCIA 1PWHA 5EP1A 3E9NA 3NHKA 3UH0A 4AKSA 1T5IA 1PUXA 2E87A 1VJDA 4P7KA 2WT4A 4Q6WA 1LSUA 4AG6A 2CF5A 5P21A 3MMZA 2WW8A 2BI8A 3IJRA 3IHTA 4BNXA 3FI9A 4OB7A 4FYVA 3L0OA 3NOVA 2JCGA 3I12A 4KJZA 3T94A 1YE3A 1K5PA 1RI5A 2GM9A 3F47A 3Q3EA 3VAYA 4FU0A 4PNPA 1T1GA 4GQBA 3RO7A 1DRJA 1NASA 2VH1A 2Q4OA 5GINE 2QT1A 3HTXA 2K4MA 3AZOA 3A11A 2AJ8A 5E4JA 4JLAA 3WOHA 2ANBA 1V4VA 2G0NA 2IU4A 2J07A 1IMOA 3U3XA 1MNQA 4H1VA 1WEKA 4WTOA 1DKUA 1CJBA 8ATCA 3EUWA 2A59A 4HN4B 4D0SA 2NO5A 3D0QA 1DG9A 2A9FA 1LPPA 5DHSA 4ARCA 1UJCA 3PUIA 2XT9A 4A0GA 1NW8A 2KM1A 2Q3JA 4MA4A 1QR2A 4WMLA 1E1YA 1RSZA 1VYTA 4YAEA 1C4WA 5IN5A 2W6PA 3DE6X 3BCRA 4J49A 3LGAA 3TSOA 4LYHA 2HREA 5LQRA 1RCUA 4N8EA 3EZ7A 3GMIA 5ADUS 1A9OA 2ZVQX 3C7AA 2BGUA 1KAEA 3W78A 4F3YA 5D3KA 3AWDA 4HEJA 4UUMA 4ZMSA 1CWUA 1ML3A 4L8YA 5GVRA 5EJ8A 4ZEMA 2LCFA 3GFGA 2XEDA 2P77A 3KQMA 5H82A 2V9PA 2WSSA 4MIYA 5AHOA 1H9BA 2IS1A 5DBOA 2JI7A 3STUA 4YYEA 3VR6H 1EGVB 3AR8A 3RHSA 3LDAA 4YVFA 1T1RA 2QE7D 1JLHA 1BEUB 2D1TA 1J0EA 1XEAA 3IUYA 5ESXA 1KNQA 2I1LA 3IEKA 3AUAA 4XI9A 4MMZB 3L04A 1AS0A 2BAGA 2FMKA 3LT1A 4NX2A 4WZBA 4NCIA 1A8PA 5EKSA 5BO5A 5CYOA 1K88A 1NSFA 3FRIA 3KB2A 1IC6A 3PCXA 3UPUA 1BFDA 1VJ0A 1QX3A 4G1BA 1SVWA 1M8FA 4D9NA 1G3UA 1QGAA 4ER7A 4E6EA 2BR5A 4AF6A 5LP6B 4PZYA 3LOPA 1SVNA 2BKXA 4GYKA 4CEJA 3KKEA 3W5UA 3UT6A 3F49S 4AKHA 1XCBA 1JR6A 4EW2A 5DIZA 3KTDA 4JV5B 3MJCA 1ADCA 1YCDA 4MVWA 1WXIA 2CMFA 2WUVA 3V9PA 5ERXA 4NBUA 2HMYB 1LQUA 3GF4A 4TXHA 3THOA 3W7AA 2X15A 3A9RA 3LUJA 4ZOLA 2NADA 3C7TA 2R6HA 5IVPA 4UCWA 1D0VA 2BCEA 5DX8A 4QM6A 3EVZA 4D9JA 3T5AA 4C29A 1WXXA 5F5NA 3W5DA 1HTBA 4JSTA 3UJCA 5L3QB 4NQZA 3L0IB 4V0KA 1L4GA 1SB9A 2OFXA 2O0HA 3O9ZA 3MCTA 4OU5A 3L0CA 4FFDA 1GRQA 1F7UA 2BKUA 1SQ5A 3G6KA 4AY4A 4EGAA 2P9EA 2Q2WA 3P9YA 4ZAXA 1OLUB 1F8GA 2BKEA 1TZCA 1KXJA 3TFOA 1SG6A 2IKSA 5JXGA 4KAFA 3ZVNA 2X6QA 3GLRA 3H9BA 2AZMA 4OI0A 3CO0S 2VT3A 3Q6MA 4UHCA 4D41A 1GARA 10MHA 2R44A 4BFWA 1NWHA 2ALJA 2G08A 1R64A 3O94A 2FG7C 2P8JA 4PXYA 4PIVA 1LJUA 2IE0A 4NCJA 4ZVRA 5BUCA 3D6NB 3JYLA 5BRNA 2KHZA 4QDTA 4JBIA 4QU0A 4X1KB 3T9FA 1YR3A 3LI2A 3KUKA 1GNQA 3U7QB 2QQGA 3OQIA 3PX2A 3E0QA 4CEHA 3KHUA 2P6PA 3KZMA 4ZZ1A 2Z6AA 2PS9A 4A36A 5CM2Z 3D59A 1DRUA 3ZBUA 2ZYHA 5IT0A 3A9UA 3FYDA 3HDQA 5CU7A 3BZUA 1POXA 4NU6A 5AESA 5I9TA 4AROA 4QD3A 3RREA 4RETA 3HXQA 3K2BA 4DCCA 2I3ZA 2OGTA 2E4AA 1L1RA 1P5JA 2DFPA 4BNUA 1KMQA 2KS6A 1ZM4A 3HGQA 5DGCA 3OOHA 4DKJA 3QLTA 5JXWA 1GGKA 1VJRA 2QAGB 1TYEB 1JU9A 2PFGA 2JIZA 2WI8A 3MMNA 3GPLA 5CT9A 5ALTA 1XE3A 5PGMA 1PZHA 3I23A 1XXLA 3EBLA 4HC4A 5EIBD 3M2TA 1JF8A 1F0YA 4Y6LA 1RCTE 4NV3A 4WDQA 1E3TA 2YWHA 2COKA 4RSHA 3HXOA 3MMSA 4DF3A 3Q7QA 3HYLA 3VH3A 1TK9A 4Q93A