4KVAA

Gtpase domain of septin 10 from schistosoma mansoni in complex with gtp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
267
structure length
246
Chain Sequence
b'FVFNILCVGETGIGKSTLLETLFNQKFDFPKLKAVTYDLKKLKLTVVETCGYGDENNIKPVVDYIDNQFENYLQEELKMKRSMQAFHDTRVHVCLYFIAPTGHSLKSIDLVAMKKLENKVNVIPVIAKSDTITKSELQKFKARILSEIQSNEIGIYQFPTDDEAVSETNSVMNQHIPFAVVGSSEEVKTVRVRQYPWGSVQVENENHCDFVRLREMLLRVNMEDLRERTHGVHYETYRRQRLIEMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Septin
publication title Crystal Structure of a Schistosoma mansoni Septin Reveals the Phenomenon of Strand Slippage in Septins Dependent on the Nature of the Bound Nucleotide.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Hydrolase
total genus 89
structure length 246
sequence length 267
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00735 Septin Septin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4kvaA00
1RW4A 1S0UA 3GJ6A 3RLFA 2BWJA 2XITA 3MWJA 1RZ3A 3KKPA 5L8VA 3A4LA 3FE2A 1IXZA 3CF0A 2ZSDA 4ZDKA 3WNDA 2MMGA 4OK6A 1CR2A 1E2LA 1U8YA 2BC9A 3L0OA 3BD9A 3S1AA 4MRRA 2IK8A 4Q9IA 3U3OA 4US1R 1WMSA 1NN1A 1W4BA 3QF7A 3VR2A 1RVDA 4C0LA 2WOJA 3CRMA 1AIPA 2HXSA 4FMBB 3EZ9A 3A1WA 1E0JA 2WWGA 5IDVA 3QPUA 2RGGA 3Q7PA 3KKMA 1P9RA 4Y0VA 1NRJB 1FZQA 5BW8A 1FW6A 5J40A 4HDOB 4HLDA 1G6HA 1F2TA 4DLYA 5KDOA 4Q4AA 5CLQA 4TLCA 1DAGA 2EWWA 5AJXA 3V4FA 2CNWD 2VA8A 4Q9HA 3QE0A 5JHGB 1EWQA 1LF5A 4HI0E 5KPJA 4TLEA 3ZGXA 1VCOA 1YZKA 3QXSA 4AIIA 4L5BA 4NYJR 5IK2A 2ZJ2A 1DADA 3CUEF 4P4SB 5CJPA 4B75A 1KK0A 2VYFA 3F8TA 4FWTA 2ATXA 2EFGA 3EXAA 3NTUA 1ZUNB 2D62A 2J7PD 3U3JA 2QSZA 3I4LA 4AYXA 4MYTA 1W4CA 5J4YA 1P9NA 3KUDA 4XH9B 2O8CA 3SHWA 3H1TA 2ZETA 2FE4A 1BH2A 1OXSC 4LC1A 3KKNA 4N0EA 2FZ4A 2ZYUX 4L8GA 1IJFA 3HJNA 2BEJA 1R10A 4IHQA 4LJ6A 1CULC 4RFSB 3TNFA 2A5DA 4KSCA 1IY0A 3TLXA 4YDHB 1N2CE 5B64A 4NYIR 2ZJOA 1ESNA 3A1TA 5G40A 3OFNA 3DVLA 1IOZA 1LB1B 1NG9A 1TTTA 1AZTA 2BJVA 4JYCA 4PO9A 2O8BB 1G3QA 3QXXA 4C0BA 4A36A 3I61A 3L43A 2ODEA 1N0UA 2CCJA 3DL0A 3HR7A 3SOPA 1G4UR 3BERA 1E1QD 3D6TB 1XEFA 4KV9A 1XRJA 3VAAA 4MYHA 3K70D 4KODA 2W0MA 1NG1A 4X8LA 1D9XA 621PA 3JVVA 3V00A 1OXTA 3KKQA 4JIMA 4ASUA 4Z1MA 3EZ6A 2PZEA 1R8QA 3B1XA 1XP8A 1E2IA 1JJVA 3BH6A 4G3XA 2ZI3A 2X1VA 1OB5A 3B1YA 4NP6A 1P5ZB 1Z6YA 4CW7A 1E4YA 1PVOA 1VYTA 2AK2A 1KI1A 4PPGA 1F3OA 5FOVA 3FGNA 1KTVA 2ATVA 1NP6A 4GRAA 1C9KA 3U3KA 1R6BX 1U98A 2A78A 1F60A 2REOA 5TXGA 3ND9A 4JVMA 4A2PA 3RC8A 4LWZA 1KI3A 5G3YA 3AV0B 1YJ5A 4B3GA 1SHZA 4TYNA 3QKUA 3UWOA 4ZDWA 4KFSA 1PUJA 1JPNA 1HURA 1KZGB 2QN6A 1Z0KA 5SZJA 2G83A 3X2SA 3THWA 1MR3F 2OUKA 4HAYA 2QT0A 2GF9A 3TH5A 1VYUA 2PMKA 1GL9B 1TEVA 5SZHB 1GG2A 2IYWA 4G5QA 1KDPA 3CNOA 1UDXA 4I99A 4JL6A 4DLTA 2DWQA 3CRRA 3T61A 3A8TA 4LHVA 2EU8A 1JJ7A 4GL2A 3K9HA 3DKPA 3TIFA 3WXMA 1VTKA 4DCNA 4C2TA 1OH7A 4NE2A 3C7KA 1U94A 4YMSA 3TUJC 3KKOA 4KFTA 2GEUA 2IYVA 4Q21A 1OKKA 2KSQA 4X8HA 1RC8A 2WICA 4B3XA 2N42A 1E0KA 1X3SA 3R9IA 1MO4A 1PZNA 3N70A 3O8CA 5B58C 4JLKA 3CBQA 4HB2A 4Q1DA 6Q21A 2MMCA 4XWOA 2PMDA 3OAAD 3CPEA 5TY0A 4JLMA 5L3QA 1S3SA 1G41A 4M22A 4ESVA 1YR8A 3THYB 2QBYB 3JZMA 4C9BA 4BUJA 4HEJA 4LJ7A 1QVRA 2LCFA 1NVUQ 2CHGA 1E2PA 1Q0UA 3M1IA 1S3GA 4PSVA 1BKDR 2V54A 2B7BA 4HAVA 2VSOA 4C30A 1A2BA 2BBOA 3T5GA 4ZV4A 3LWNA 5FPKA 1EFHA 2GF0A 4EQ6B 1M7BA 1W49A 3RSOA 1AKYA 3ADKA 4URUR 4YXWD 5CM9C 2ZS8A 1E2EA 4JKIA 1DAHA 2GXSA 2VBCA 3CR8A 4PPNA 5D3MB 4EFLA 2Z5FA 1Z63A 3LX8A 2RGDA 2PJRA 2XOKA 3EIQA 1E1RA 2C9OA 2J59A 2H16A 3MFYA 4QNMA 5F9FA 1VHLA 3HWSA 1KI2A 3C5HA 1ZM4A 1CJVC 1NVVQ 4GI7A 4FW9A 4LJ9A 1S1CA 1E94E 4FI3C 4KFUA 2YOFA 4TMVA 4TSFA 3QIAA 5FUVA 1XJCA 4A1FA 3CX8A 4S2EA 1MABB 1G5RA 1U9IC 2Q21A 3HPQA 4NPHA 1TQ2A 3X1DA 4P4UA 3SQXA 1KAOA 4LBYA 1G5TA 1VG1A 1UBFA 2FX3A 3AQ4A 1G7RA 1WF3A 3B2EA 1E9DA 3CLVA 3IQWA 4JLVA 4A82A 2QA5A 4P4SA 1CR4A 2CVHA 2GXUA 4Y0AA 3TJZA 3L0PA 1UKEA 1NLZA 1WDTA 2BMDA 1EESA 2J1LA 4Q4HB 5LD2B 3DZ8A 1LFDB 2ZR0A 4OQMA 2Q6TA 1G3MA 2NIPA 5FL7D 1IJEA 2QSYA 5EXTA 1QHXA 1S4QA 4NYJQ 4B32A 4M2LA 2XNDA 4PXAA 3NEJA 4AWXA 3MRSA 3TR5A 1F5NA 3AM1A 3FMFA 3ADDA 4A0HA 2F1HA 2FSIA 1II0A 2AFIE 3ZVLA 1MO5A 2BBSA 2ZRAA 2Q9CA 1J8YF 3AVQA 2D2FA 2G77B 3K0EA 4OKSA 4FCTA 2YC2C 1KO5A 1XJQA 2H1LA 1ZM3A 1G7CA 4B48A 1OT3A 2LKDA 3VU9A 4B3FX 3ICQB 4NYIQ 2RHMA 2D06A 3RSLA 1YR7A 1JR3A 3U6BA 3ZIAD 2BM0A 2R6DA 3L8YA 4DCVA 2EYUA 2F6RA 3CWZA 2GZHA 3QPVA 5KYKA 5KSPA 4P33A 4LCBA 3OE7A 3I62A 1E2MA 4Z8YA 2YOHA 1R0ZA 5CIWA 4RZUA 2R6AA 2WWYA 1KZ7B 5AUPB 5EE3A 3B1VA 1DG3A 4JJZA 4Q4LA 3MGCA 2ZREA 2D4HA 3NC0C 4BE7B 4E22A 1JR6A 3B1ZA 3PVSA 2YWEA 2BV3A 1ZP6A 4TTPA 4B73A 3KDSE 4LC0A 1US8B 3KJIA 2AXNA 1RIFA 2ZI4A 2JIZA 1XTQA 2IXFA 4ACBA 2J0QA 1NBMD 2GTPA 1GL7A 1W47A 5FPYA 2H17A 3WP0A 1C1YA 1HYQA 3QEJA 4L9SA 4B3BA 1XMVA 5DSZA 2L0XA 2YWHA 3ZQ6A 1PLKA 1T0HB 2W6JA 4BLSA 2VHUA 3K0SA 4LBVA 5HPYB 1KIMA 2NO0A 4M1TA 1A7JA 2ORVA 2CE7A 4PQYA 2B6HA 2J45A 3DM5A 4AYTA 2ZXUA 5EXXA 2WM9B 4OHVA 2PZGA 4JLNA 3KXKA 1G3RA 1P4SA 3EW9A 2ZSFA 1GNPA 3N2IA 5J4HA 4IFBA 4B34A 1X1RA 1XEWX 1BMFD 4JZKA 5E3HA 5DO9A 3L0SA 5DN6D 2OLKA 4ZDJA 3EPLA 1DOAA 4Q7KA 2IYRA 3RRZA 3B60A 5LD2C 3A1UA 3LNCA 4Q1BA 3KQHA 5GJWC 4BLPA 1OH8A 2CEAA 5KNDA 1QHSA 1W36C 1N0WA 2WBLC 1GILA 4LJAA 1JR3E 4HZUA 4D4LA 3GPLA 4A8JB 3THYA 2QBYA 1YZNA 1Y3AA 1QHHB 1W44A 3T1OA 4NONA 1CP2A 1UKZA 2ODWA 3LVQE 1OXVA 2ODNA 2KBEA 3BB4A 1KNXA 2JDIA 3C14C 1II8B 2PT7A 4IOLA 1W0JD 1GKYA 2ZQ5A 4NKRA 3U7EB 2P5SA 5G53C 1N5IA 1E2JA 1UKYA 3W90A 2ZEJA 1XWIA 4Q01A 4EQ6A 3CH4B 3AF3A 3KUCA 3SYNA 5LB4A 1YU9A 5JBQA 2D2EA 1HE8B 2JATA 3VR6A 5UKDA 5AUQA 2ZJYA 5FTKA 4TMZA 5D3MA 1KMHB 2QMHA 2JJ1A 4HSEA 5SZKB 4A0FA 4B44A 1NMXA 1YHNA 3L82B 3CRVA 2XX3A 2WWXA 2UZ3A 4Q47A 5BXQC 1KHTA 1RYHA 5EP3A 4F92B 1BYIA 1DARA 1GZSA 4OHWA 4EAQA 5KPDA 4BEJA 5BN4A 4LBWA 2GA8A 4PPQA 2X8AA 2ERXA 1P2TA 5M04A 2O8FB 2JEOA 1DEKA 2PEYA 1T6NA 2EFEB 2FSFA 2V55B 2V6IA 5FBRB 4Q03A 2BBTA 4MA4A 4NH0A 1Y63A 2X77A 2ZYWX 2DB3A 3RVBA 1TADA 4M9ZA 4OL0A 5JMTA 2VHJA 1Z2CA 1GSIA 5E7MA 3CZQA 1RKBA 4V03A 4HAUA 3EARA 1DO2A 3CF2A 4EPTA 4HLUC 3FPAA 1OIXA 1NKTA 2QQ0A 3SN6A 5KOYA 3ZVRA 4Q4HA 4PC1A 4M53A 4O0MA 2BMJA 5EP4A 3RRNA 1Z6XA 1KO4A 4PPFA 2Q3FA 2Z4RA 3MWLA 3QXJA 3K70C 1Z07A 4XVQA 2HYDA 2RGNC 1U90A 1AZSC 2OO7A 3IIJA 5FOWA 2IWHA 2QRZA 4QOSA 2QP3A 3LX5A 1X1SA 1OLOA 3I32A 2JLUA 2QAGC 2ZUBA 4GBMA 1VYVA 3B1WA 4M0LA 2ZSBA 2CNWA 4R71A 4DJTA 1A4RA 2D74A 3S1AB 1G3IA 3GLGA 4BLOA 3NHBA 1CF4A 4HAXA 4WXPA 1GRQA 1KJYA 1NLYA 3NC1C 3O8RA 3G82C 3LQRA 1QRAA 1YKSA 1VCMA 2DWOA 3Q8XB 2P3SA 3EWSA 2QNRA 2QGNA 2B21A 2RGEA 1NI3A 4WA7A 1OF1A 1Z0DA 4PFSA 1PLLA 2QG6A 3WY9A 1WCV1 2OILA 1AS0A 2OEPA 3B6EA 3GLHE 4NDZA 3DZDA 3ZVMA 2GETA 2ZE6A 1F2TB 3KFXA 2ZI5A 1SXJB 2REBA 3QQ5A 4LJ5A 4BEBA 3L0IB 1XF9A 4OI4A 4NCIA 4Q9JA 2IC5A 2F55A 2ZJAA 3H4MA 4TZ6A 1OPXA 3NH6A 4KBFA 1Z6GA 2QM8A 1T0JB 2Z0MA 5GJBA 4LYFA 5BN5A 4JVLA 4F4CA 4J0QA 1ZM2A 1DTSA 5FBQB 3FYHA 4M1YA 1BO6A 2DR3A 2C2HA 2FH5B 1N6KA 2J5XA 2XB2A 3GJ5A 421PA 1WXQA 2HJGA 2GEVA 3SDZA 4DLRA 2ZE5A 4HLUA 2FGKA 1US8A 5J47A 3K0CC 3IBGA 1ZIPA 5JWRA 1H65A 3UG6A 5TVKA 1OHHD 2V7QA 3LRPA 1KSGA 1SHKA 4RZXA 4XD7D 2AK3A 4RZ3A 4W5HA 3OIVA 4CF7A 3HPRA 2VRWA 1XJ0A 1WP9A 2RGNA 3L8ZA 3U6KA 2A9KA 1OYYA 3ND8A 1FL9A 2W58A 4LV5B 1QHNA 3K0AA 2F1IA 2FPKA 4DLXA 2GESA 4BFYA 1GRNA 3GJ7A 2A7QA 4LYAA 4URVR 2GEDA 2JLYA 2QAGA 3W8RA 5CYPA 1M1YE 3REGA 1QBKC 1KJWA 2AD5A 4EKDA 4JVNA 1Z6TA 3BFXA 5G41A 1KO1A 4FIDA 2KB0A 3GLGE 1JBKA 4CZ2A 4OI2A 4QHYA 3H86A 5HE9A 2CDNA 5L3SA 4KO8A 3MSXA 3QXHA 3KX2A 2HT1A 4PANA 5EXPA 4XWAA 2FV8A 1B23P 3G5UA 3GP8A 3D7MA 2REXB 4D25A 2P6RA 2IHBA 3OZXA 1GAJA 1XTSA 2IF2A 1P2UA 3FWYA 4UNQA 2A5YB 5EZ6B 1TQDA 3HU3A 4ITRC 4LOAA 4IW3B 1II8A 4DIEA 3ZH9B 3SJAA 3ICEA 1DVRA 1FP7A 2GBLC 2W6ID 3BH0A 1XEXB 2XZPA 3RDPA 1CKEA 1OFHA 5BQ5A 4GZLA 2UKDA 4BFUA 1GITA 3A4NA 1KMHA 3VHXA 2JASA 3SJBA 5CK5A 2F9LA 3K0CA 4F91B 4YMTA 3R9XA 5JLJA 3AKEA 3THWB 2RGCA 1YVDA 2GZAA 3PEUA 4HUQA 1W0KD 1YZUA 3EPJA 521PA 1DAKA 2EFCB 2IEZA 5C4GB 1KO8A 3WBJA 2OM2A 2DFNA 3EZFA 2R62A 4CYMA 2O8FA 3QEOA 2GAOA 2BVNA 1U0HC 2CCGA 3EAQA 4MGKR 5FOXA 4IDHA 1P73A 4M1WA 1MRSA 4HYYA 5CYOA 2QE7A 5FUYA 2WOOA 4AKEA 1S9DA 2GJSA 2V3CC 4UNNA 4DHEA 3ZVNA 2GZDA 2QUZA 4WOPA 3BFKA 3BFVA 3PG5A 1CJMA 2P5TB 4I1VA 5DIFA 1E9CA 4TWZA 1XX6A 4DEYA 4FWIB 2ORIA 5HZKA 1UPTA 5JWHA 1XXHA 4XVUA 2DHRA 4A0GA 1HT1E 1GL6A 4GOJA 3RAPR 3WRXC 2A5JA 1X86B 3UATA 5E4FA 2ZJ8A 3L2OB 3WMEA 3HP1A 1NVVR 5IF9A 1UF9A 3WYGA 3V4RA 4AYWA 4GDFA 3VNVA 4M9QA 1E9AA 3TE6A 4YMWA 4D0NA 3OHMA 2CE2X 2FNAA 5TV2A 1AS2A 1N5KA 2BKEA 3SJCA 3U4QB 3LY5A 1N6HA 3PEVA 4HB4A 1G16A 4DSTA 2GBLA 2CHQA 2O0HA 4M1MA 1R0WA 1TU4A 2R6FA 2XEXA 4V0MA 1OFTA 2YOGA 5SZIA 2IYQA 2H7VA 3THXA 3D31A 2A3RA 3ZJYA 1E99A 2VF8A 3BIFA 4V0NA 3SQWA 4TZ0A 2ECKA 2ZITA 3I5XA 1T3LA 2V1XA 5F3WB 4DKXA 2QP9X 1R5OA 1FPMA 3IO3A 2NTYC 1TF7A 2WSSD 3FKSA 1Z83A 2FSHA 1G291 1R8SA 2OFWA 1SXJA 4H1UA 2HJVA 1KNQA 3UG7A 4XVRA 4YONB 4XSGA 1QG2A 5K8TA 5KHOC 5JI3E 3KL4A 4CT5A 2VP2A 4G5SA 1D6JA 3ZLJA 1P9WA 1FX0A 1TUEA 4JVSB 2JA1A 5IRCD 4PR0A 1Q20A 3SJZA 2G3YA 1HH4A 3A1VA 5BYJA 3P20A 4KCGA 1AN0A 3GJ4A 1O87A 1SVKA 5FTNA 1HA3A 3CRW1 3O8DA 4LV6A 4Q7LA 4Z8XA 1TPZA 4PAOA 5JZVA 2SHKA 4YDSA 2J46A 1KGDA 1UFQA 1JQLB 2WMNB 2OV2A 1W5SA 3D3QA 2ANBA 5E95A 3UPUA 2V9PA 3PCRB 4DWJA 2G0TA 2OT3B 2GAAA 3OEED 5ELXA 1XXHE 3KQNA 4PHTA 2J0UA 1G7TA 5CIQA 2VF7A 2IHYA 3CPHA 4JMPA 4QBIA 1DAIA 4P31A 5HKKD 1KAGA 2KJQA 4C3ZA 2N1BA 1ZU5A 1S9HA 2V4ZA 3VU9B 4BLRA 3B5JA 4M9XA 4OK5A 4TYPA 1WQ1R 1XB2A 3QPWA 2OCBA 3LW8A 3TQFA 1FUKA 2ZRFA 3H0KA 1G6OA 1KK3A 1S1MA 5DHAA 2IL1A 3IILA 4V0ME 4D4JA 3FTQA 4LHZA 4US2R 2JJ2A 2TMKA 1W46A 1E98A 4GOKA 2NZJA 3EPHA 1GP2A 2PT5A 3GEEA 2J0SA 3FFAA 2YKGA 4DCUA 4K46A 2ZUDA 3K9GA 1R0YA 3AKDA 1SXJE 1E79A 2FFAA 3A37A 3W6NA 3T06B 2H8KA 1D2MA 2OLJA 5DYIA 1K8RA 1ZC4A 1ZD8A 4JBXA 1EFRD 3GFTA 4DDVA 1XEXA 3AVOA 2W0SA 4Q19A 1TUIA 5EXSA 4OQXA 1QHIA 4OI0A 2FEOA 2ZRLA 3G0HA 2IT1A 4EIWA 4MUAA 4WIAA 4XJXA 2A5GA 1GFIA 2VTKA 2YWFA 1U81A 3C16C 1BMFA 2VPPA 4G1UC 4OHZA 3P26A 2WKQA 2OFOA 2GXAA 2QPAA 3VNUA 1CR0A 3MG9A 1XTRA 1EX6A 1CEEA 5AJVB 3WYAA 1LW7A 4EPYA 5HZHA 1AGRA 1FTNA 2K5UA 3AVWA 2ZS7A 1OXXK 1ZYUA 4ACAA 3GMTA 5DH9A 1FUUA 5KDLA 1BOFA 2QROA 4KLNA 2ZI7A 3R8CA 5JS8A 2C8VA 2HLDD 1IY2A 1IY1A 4WW0A 4KSBA 2WWIA 4PQFA 5J4LA 5F9HA 5FTLA 1G20E 4A0RA 1WBBA 4NMMA 121PA 5LPNA 1FQKA 2HT6A 3FOZA 3I8SA 2ZRHA 4Q5IA 5KNCA 1XPOA 2XZOA 4UXJA 1OIWA 1XMIA 4RD2A 3EPKA 4TMWA 2QENA 4HZUB 3U60B 3BH7A 3PIRA 4KVGA 2P0EA 4X8OA 3R9WA 3IBYA 3AVUA 1VECA 3KQLA 4DB2A 1XD2B 2WVJA 1Z8FA 3E5HA 3PFIA 1L7VC 2AKYA 4FN5A 1KI6A 2PX0A 1NBME 3VKGA 4C0QC 4U5XA 2IUUA 4TT3D 4FINA 2OESA 3QJYA 2RKOA 4XTCS 1R0XA 4UNRA 1E2KA 1SULA 3LVRE 3VX4A 4AY2A 1HEIA 1MKYA 3U4QA 1FTSA 3PEYA 4HAZA 1XZPA 5CK4A 1I2DA 1E32A 3EA5A 1T8UA 1J70A 2YC4C 4I4LA 3UK6A 4DRZA 1DBSA 1IAQA 1WA5A 2QY9A 3GLHB 5KDDA 1H8HD 2ZIAA 2XJ9A 4OQNA 5JRJA 2GWHA 3QKSB 5FPHA 3VFDA 4E07A 1T5LA 3SYLA 4C0KA 5LB2A 3SFZA 5B57C 4ARZB 1RJ9A 1COWD 1ZC3A 4MRSA 4QGGA 1NKSA 3W8NA 1OE0A 1NVWQ 3CKLA 3VR4A 4ZPXA 1KKMA 2V6JA 3OESA 5EP2A 3C5CA 1NN3A 721PA 3GJ0A 3MLEA 2CL0X 3QNUA 2X19A 4HZIA 1XU4A 4ZO4A 5JHHB 1G1MA 1A1VA 4MYUA 3RS2A 3PXGA 1L2TA 4QHSA 4W5JA 4AG5A 4WAUA 2BHRA 4BGDA 4G5GA 3UIEA 4EPXA 5DHFA 4WZ6A 2IEYA 4PAMA 1DE0A 5BYKA 2CLSA 1CLUA 2QQEA 3VX3A 1W36B 2ZRKA 2EYQA 2QP4A 1J7KA 3UANA 2RAPA 3AF1A 3DOEA 3LFUA 4LHYA 5FFMA 2IS4A 3ADCA 4TYYA 3EZ2A 2DFLA 4D82A 1D2NA 4KYIB 1HUQA 1LVGA 3LXRA 3U7HB 1ZNWA 5AJZA 5FBVB 2OXCA 3IPYA 5FR1A 2B8WA 2ZTSA 4TQUS 1ESMA 5LBIA 3RNLA 3Q5EA 3RHFA 2A30A 3GLGB 4LBZA 4LYJA 2XB4A 3IUYA 3TSOA 1VHTA 4BLTA 1RRPA 4OK3A 1XNJA 3U5ZB 3DHWC 2FMXA 5JJLA 5AWFC 2FWRA 2XXAB 2CK3A 4BZXA 1OV4A 1D8TA 3IIMA 4O3MA 1R7RA 5IK2D 3UMFA 4H9GA 4XSHA 4D4MA 2ZSEA 1X8KA 3K09C 1BS1A 3W3ZB 1PJRA 2DPXA 2QTFA 2I3BA 3QUSA 4JLOA 1U9IA 2NZ8A 4A4DA 1GDDA 4QHTA 4B2LA 3J81k 4MDEA 2PLFA 4TL7A 2JLSA 2JAQA 2GNOA 1XZQA 3KTAB 3W3AA 3FHOA 1KYIA 2J7KA 2ZRBA 4AK9A 1H8EA 1NY6A 3GEHA 4LYHA 2O0JA 3R20A 4WZAE 4OQLA 2NPIA 1VMAA 1FQJA 1UBGA 1KK1A 1JAIA 1Z0AA 2WPDA 5D3QA 1CRQA 1KJZA 4IKEA 1N6RA 1T91A 1M2OB 4AD8A 2JLRA 2W2XA 2JLXA 3BJIC 4Q9KA 2ZAMA 1JB1A 3K70B 3AVTA 2JLVA 3DDCA 1P60A 2FU5C 2RGXA 2Q9BA 3AGQA 2H57A 4MGIR 3K0AB 3WNCA 2GXQA 3IGFA 5FTMA 2FFQA 4G01B 1QF9A 4ON9A 2QPOA 2QAGB 3LLMA 3ZQJA 2ZRMA 2IS1A 2VP9A 3NBZC 3EASA 4ASUD 2NO7A 3ONWA 3K1JA 5TMPA 1FNMA 1AM4D 1CTQA 2ODBA 1CU1A 4Q00A 4YC7A 2ONJA 4PZLA 2ZRJA 4URYR 3GJ8A 4TMTA 1P61B 2HUPA 2CCKA 3PV0A 2R6CA 3CW2A 2G6BA 4KAXA 1IN8A 5L3SB 3U7GA 1ZNXA 1J99A 2W6IA 3DMDA 4JLDA 1IN6A 2I4IA 3FMPB 2C98A 3ZDQA 3IHWA 1MV5A 3P32A 5JRZA 2BJWA 3TAUA 2VO1A 3AKCA 2GDJA 1XBTA 4RKEA 1G8HA 5EJEA 2GJAA 5A0FA 2HXYA 4GMXA 1O3YA 5CJ2A 3EX7C 1XD2A 3OIWA 2ZANA 3C15C 1RYFA 2GVDC 2VP4A 4GSYA 2GHIA 2XNSA 3FHCB 3MD0A 3WNBA 4IDOA 3GJ3A 3AP3A 5JFGA 1T5IA 2ZRDA 5CM8B 4BZPA 3TUZC 4LI0A 4DCSA 1IHUA 5E7IA 4M1OA 2QZ4A 5TB5A 2I1QA 2HF8A 1SVSA 4FD2A 4NCKA 3GLHA 1J8MF 1T4GA 2ZYVX 3AUYA 4HUQB 5F2EA 2IYXA 1MO3A 1Q3HA 3QKSA 4HDCA 4IXNA 4ZCMA 5IHPA 4L9WA 1F2UA 3LBIA 1T9HA 3PUWA 3QOFA 3BGWA 1YZQA 3BB3A 4QNRA 3RWMB 2BCGY 1AGPA 1K6MA 4D6PA 2O52A 1U8ZA 4ARZA 2Q3HA 4BRWA 3BS4A 4BWYA 3HDTA 3NBYC 5FUWA 1UJ2A 4PC7A 3RS5A 3OF5A 1JXMA 1CS4C 2PCJA 4MRNA 4V0LA 1A2KC 3AP2A 4R2IA 1OFUX 3GFOA 1ODFA 5AJWA 3CH5A 1E2FA 1Q1BA 2FGJA 2Z6VA 4BRUA 5EZ5A 5KO2A 2KBFA 3QKTA 3W6OA 3FDIA 1QHGA 4E03A 3RRYA 4B6EA 3MWKA 3IEVA 1IQPA 4C0SA 1KDRA 5DLQC 1WRBA 2FFHA 2OHFA 2WKRA 2IXEA 3LO5A 1NJGA 3ZYCA 2A2ZA 1XXHB 2C9YA 4QKQA 5A4JA 2QGZA 4QJ4A 3NEYA 3N2EA 4AC9A 1E1RD 3P1JA 4I1SA 3AKYA 4A6XA 2GJ8A 2CL6X 4QGHA 3GLFB 3HYTA 3RWOA 2ZU6A 3CR7A 1T3HA 3I3SR 4E09A 4KU4A 3AF0A 5CB8A 1HE1C 1GWNA 4B2PA 1TEXA 2AXPA 1JALA 4C7OA 4CVNA 4TSFD 4QJ5A 4KVAA 1B0UA 5EE9A 2YWGA 1SKYB 3QXCA 3OIUA 2R6GA 4LDJA 3GQBA 2J9RA 1YRAA 1SGWA 3THXB 4RCZA 4G5OA 3CX7A 4OJKA 4Q48A 4IVQA 5CLLA 1G64A 1CBUA 1PUIA 4EPVA 5FBWB 1EGAA 3TGPA 2J7PA 2G1KA 4NHOA 4ILEA 4JSYA 1D2EA 2AR7A 2XJ4A 4FMCF 3R7WA 1JEDA 1Z29A 3JZAA 4JBWA 2WSMA 3Q85A 4BECA 4C2UA 5EQTA 2AFHE 3T1QA 2NQ2C 1Z28A 3CM0A 3B85A 4B76A 1ZAKA 1HT2E 1S96A 1Z0FA 1YZTA 1IN4A 3RANA 4BASA 5KUTA 1FX0B 2ZE7A 3KTAA 3OEEA 4W5WA 1QG4A 4TYQA 2B7CA 1U99A 2XNDD 1JAHA 5FOTA 2DY1A 2J0VA 1U2RA 4DUGD 2WTUA 2JLWA 4BLQA 1T3SA 3OEHD 4N1AA 1HQCA 4TTQA 2OCAA 1VPLA 1P7CA 4FMDF 221PA 4JT2A 1DS6A 3AVYA 3IKJA 4B2IA 1ETUA 3SNHA 3LAWA 1N3BA 4JLBA 1II9A 4MRVA 5HR5A 1XCGB 1KSJA 3X1XA 3QBVA 1E1QA 1ZINA 2RMKA 2WJIA 1CR1A 1A82A 3GEIA 3F5FA 1LF0A 1CIPA 4JLJA 4HDQB 4JJKA 4LUCA 3U3MA 5DGXA 2J0UB 2KI5A 3AF4A 3VTKA 1JR3D 1ZD9A 2G88A 4AKIA 4Q9LA 2MSEB 5AJYA 3VHLB 2HDNB 3I1FA 4RD6A 4O2LA 4BPBA 4OBEA 3U44A 2J41A 4URZR 2H92A 1N6OA 2NO6A 3QG1A 4FMCB 3OE7D 2IWRA 5JEEA 2CBZA 3SI7A 4NCHA 1SVMA 2FSGA 2VSFA 4NYMR 2A5FA 1N5JA 1ZJ6A 2RHDA 4A6PA 5HCIA 3CRQA 2FJUA 2CMKA 1DO0A 4DLSA 2V1UA 5B2ZA 1NSFA 1LNZA 4C4PA 5KTYA 5AR1A 1ZNYA 4FMDB 4GZMA 4BFWA 3TAHA 4IRUB 3X1ZA 4HAWA 4QGFA 4C0AC 4DZZA 4QM7A 2JIZD 4LX0A 3LV8A 3NBFA 5EUMA 4TLAA 3ETLA 2GJ9A 1P72A 2QRNA 1ZCBA 1NN0A 1S8FA 2E9SA 2GKSA 2F7SA 3PR1A 4R9UC 5HCNA 1WB9A 5EE0A 2HV8A 2QL6A 1EFUA 4V0KA 5IT5A 3TVTA 4UKDA 2R2AA 4UJ3A 2PLRA 2E1RA 1NL3A 1IXRC 3W5JA 3NVAA 4OQFA 1N6PA 4RSGA 1E2NA 4I1OA 4O2RA 4C0JA 3C8UA 2C03A 3EIEA 2H18A 5GJVC 3PJRA 4Q1AA 2OFXA 3CO5A 1TQ6A 3AEZA 1NNEA 3O8BA 3BBPA 1RPZA 1NIPA 3OAAA 4B6FA 5FH9A 1Q3TA 2QU8A 4Q18A 4QGAA 3IO5A 3BXZA 4A2QA 3E70C 1E3MA 1W4RA 2FPLA 5HE8A 2C77A 4ABYA 2UVQA 4MKFA 3X1YA 4QG7A 4PC2A 1EXMA 1U8AA 2DYKA 4OHXA 3VQTA 1VCIA 4F4IA 2Q0HA 4A2WA 3QF4A 5C46F 3BAFA 5C2JB 1IM2A 2CL7X 4CIDA 1W4AA 1DAMA 4UXIA 1Q1ZA 1YE8A 4LHWA 2WWHA 4RFVA 2JDID 1ZUHA 4YXWA 4ZKDA 4TN1A 4DDTA 3B13B 4MITA 2C96A 1E4VA 1E9FA 2F3RA 4LJ8A 2ZR9A 4ZCLA 4DLWA 1E9SA 1S2MA 1E9EA 3QVVA 3AGPA 4HLQB 1YQTA 4TLBA 1OSNA 4KXFB 5JECA 2ZM5A 3RRMA 5C4MA 3RC3A 1ZVQA 3MJRA 2QI9C 1ZU4A 3HU1A 5FBLB 3TMKA 1NMZA 2WJVA 4ZDIA 4QBFA 2JJ1D 1GM5A 1I4TD 2ZI9A 2GK6A 2BCJQ 1KI6B 4LGMA 2PL3A 3WP1B 4PZYA 3SZRA 1FOEB 2IYZA 5KNBA 5FTJA 3GLFA 1GNRA 3KJEA 5P21A 2VQSA 2HEIA 1N6NA 5E7JA 4BFSA 2IX3A 3KJGA 4R7ZA 2Q3MA 3RYTC 1TU3A 1GRRA 3PUVA 1P62B 2R44A 4QL3A 4QJ3A 1M34E 4PX9A 4YMUA 5C18A 3TBKA 1L8QA 2CJWA 1KY2A 2NOAA 2GJKA 1R5BA 4LRWA 4QM6A 1UADA 1ZMXA 4AURA 4KITB 4Z54A 3FB4A 1G8YA 2ZVPX 4XWKA 3U3RA 2IS6A 2ZI6A 4IEIA 5FL7A 4M9SA 2GK7A 4Q7JB 3SBDA 4DCTA 1U0JA 4LSGA 3DKVA 3EC2A 1RJ9B 2ZPTX 1VG8A 3CPJB 1T8TA 1GNQA 1XCMA 1X6VA 2WIAA 2KE5A 4L15A 4CRWB 1ZBDA 1JI0A 2JCSA 4GP7A 1D9ZA 2FA9A 3W6PA 1A5TA 4JSTA 1W36D 3I5YA 4D81A 2XGJA 1CRPA 4YLGA 4R98A 1TAGA 2VHQA 4MKHA 2XAUA 1BYUA 4HLCA 3UMRA 1MH1A 1SVOA 1ZNZA 1E69A 3SS8A 1YZGA 2WKPA 4RZ2A 1SQ5A 2ZROA 2FOLA 4EJSB 3TUIC 1GKUB 1JQJC 2NO1A 2XXAA 4NCNA 2UZIR 1VG9B 3UKDA 2F43A 2P65A 1RRFA 4PQRA 2AWOA 2QT1A 3ZIAA 4ESHA 4CEIA 5LDDC 3RS4A 3IHLA 4LHXA 2OBLA 1BIFA 2VIIA 3AUXA 4B3CA 2ZR7A 2W00A 5DE3A 3D8BA 4IOKA 3GLFE 1KY3A 1W5TA 2F1JA 1TF2A 1EWRA 4UQOA 5DYGA 3DOFA 4FCVA 5KSOA 1LS6A 3A4MA 4Q1CA 2NPFA 2PH1A 3W9YA 1JXOA 2AN9A 4LJ4A 3DEFA 2ZS9A 3GJXC 3IIKA 1SKYE 2VP6A 3VR1A 4GNKA 5BWMA 2HCJB 5FPSA 5KSZA 2YV5A 4MRPA 2ZRCA 3I72A 2Z4SA 3SU8A 2CLCX 4EPRA 2FEMA 1GOTA 4POAA 1NF3A 4V02A 3ZZUA 3NWJA 2VP0A 4ZKEA 1WBDA 4Q4JB 4NCJA 1Q22A 1ELOA 2EFDB 1KI4A 1NBMA 2O8EB 1KMQA 3A1SA 5H1YA 4NBSA 3PUXA 4CEHA 4LZZA 4WVFA 1FFHA 2IF0A 2OAQ1 2QM7A 2ZU0C 3DM9B 3QENA 4NYMQ 1VKJA 2OCYC 2OE2A 3THOA 2YINC 2BBWA 4HB3A 5JSZA 4PHHA 2V7QD 1UEJA 3GD7A 3W34A 5JJIA 4G0NA 4TLDA 4JL8A 2ZVQX 3NHAA 3IDQA 4B3DA 1E0AA 2RGAA 1Z47A 5EE1A 1K5GA 5JCPA 1Z2AA 4M21A 3UMSA 2JGNA 3M6AA 2HYIC 3R8FA 1Q44A 1W1WA 1AJEA 3QBTA 5DN6A 3Q7QA 1MRNA 3E2IA 4EFMA 4PC6A 2ZAOA 3M4YA 2Z43A 1AQYA 2VLIA 3LW7A 3GLIA 4QC2A 3B82A 1G3UA 1UEIA 4Q02A 1E9BA 1G5PA 2KWIA 2C78A 4IFEA 1LY1A 1R2QA 2VP5A 2O8DB 2I1VB 4B35A 4O25A 4MDFA 1Q21A 1EK0A 2AKAB 3LA6A 3Q9LA 1Q12A 4NZYA 1XPRA 3U7FB 2PCLA 1ZCAA 1ZW6A 2CLDX 5KU1A 1I4LD 2OSBA 5DI3B 3ZZ0A 1W0JA 3H2YA 3AB3A 3C4JA 2QAJA 1KK2A 1XMSA 4TTRA 3TSWA 3CX6A 1LTQA 2B8TA 4F7WA 3LH5A 3U2QA 3CZPA 3BB1A 3QG5A 4EJSC 1GTVA 3LD9A 1M7GA 1GUAA 2G0NA 2PJZA 5KSYA 1XTIA 1YR9A 3CNLA 2ZE8A 2XSZD 3TR0A 4PAQA 1GVNB 3EC1A 5CDFA 2HF9A 4KLZA 2IYTA 4D26A 4DDUA 1AKEA 2D7CA 1Z0IA 2CXXA 1JEEA 2C95A 3BRWD 4LV8B 3W5IA 3F3YA 1ZIOA 4K8OA 4DDWA 1D5CA 2ZJBA 1Z08A 5FUXA 3T35A 5EUQB 3A58B 5K8LA 3GFPA 1PLJA 1W48A 1OB2A 3RS0A 3ASZA 4RD4A 4D4KA 1OH6A 1HY3A 3B7GA 3K9NA 4XTRA 2CVFA 3K0FB 2FN4A 4ZIRA 5H68A 1N5LA 1UKVY 4EDHA 3CWQA 4BZQA 2QE7D 1Q1QA 4KYUA 3BE4A 3MCAA 4MQBA 4AKHA 4US0R 1MO6A 4HB0A 1MOZA 1IXSB 3TSZA 1NY5A 2BOVA 1F2UB 1P2VA 4Q1EA 1LS1A 3A6PC 4LY6A 2DCUA 1G8PA 3CF6R 4PO1A 3WHLA 3GLIE 3TW8B 2FPMA 1GIAA 3MWYW 4MYCA 4IDQA 3E1SA 3FMIA 4D0LB 4DIDA 2QORA 1MT0A 2VHCA 4RKFA 3T34A 3ZD7A 1FMJA 4V0OA 4X8MA 3KFVA 1L4YA 3RABA 3TW4A 4DEXA 1KI9A 1X8LA 3EG5A 4KI0A 3EA0A 4PSAA 3WYFA 5JEDA 1VG0B 2PBRA 4CEJB 1CXZA 4JL5A 4QBHA 4DBLC 2FG5A 2FDCA 1R4AA 2EVWX 4PHGA 1W2GA 3HYRA 1QZXA 2D7DA 2WMOB 4NL4H 3REFA 4EJSA 4WBSA 1IBRA 1Q57A 5DISB 1W7AA 5J4VA 1ZM7A 2X2FA 1VDZA 3CB4A 2AHOA 4A92A 1UDWA 3V9PA 1VIAA 4L4UA 3ASYA 2O5VA 4N0DA 4PC3A 4ZI3A 1YR6A 5CDFE 2E87A 2O0KA 3ADBA 4C7OB 3KB2A 3DMNA 5FOSA 1LV7A 3FKSD 4ERNA 4BQSA 5J5CA 2GCOB 1IN7A 1SXJD 2GILA 2EFHB 3LQQA 4JS0A 8OHMA 2J3EA 2NGRA 3B9QA 3BOSA 3CIOA 3H84A 3NH9A 4II7A 2BMEA 1ONBA 2DBYA 2W83A 4DUGA 4RFSA 1SVWA 3TK1A 3VMFA 1E96A 3OEHA 3FFBA 4Q7MB 5J4KA 1G21E 3T1TA 4PO8A 4NU0A 4RD3A 3FMOB 3R7WB 2QMOA 3KQKA 4Q4JA 1Z6AA 1OHHA 4BFVA 3QVUA 1FP6A 2RCNA 3KB1A 4CDGA 2O8EA 2O8BA 4XD7A 2RH5A 4DC9A 3VR3A 2BM1A 3AVPA 1AK2A 1J2JA 1DAFA 1R5NA 2AX4A 4AG6A 4OYHA 1RRCA 4R2HA 2G1JA 4M8NE 1G8GA 1Z0JA 1HQYE 1WE2A 1I4DD 5H8WA 1E2GA 3OFND 2YHSA 2WAXA 2FZLA 4RD0A 3LBHA 5B30A 4GMDA 5DI9A 1OW3B 2OZEA 1VCNA 3F0TA 3B78A 3B9PA 1AS3A 4IOMA 3K53A 3MUFA 2GVZC 3WRYC 2V8OA 4OHYA 1Z3IX 3SR0A 1NJFA 2ZJZA 4B74A 2WZQA 4DSNA 3CONA 4Q66C 4NTZA 3CNNA 3VKWA 4UXHA 2IW3A 3QI2A 1KKLA 1NSTA 2O8DA 5TDHA 2JJ2D 1XCPA 2ANCA 4DLVA 4Z1MD 3U44B 5AUOB 2P2LA 2JJ8A 3PUZA 4KJZA 5FI0B 3PITA 4E5UA 5DI3A 2PX3A 2LWIA 3HR8A 1XDBA 2C04A 2IUTA 3NDBB 2R9VA 2X2EA 4CT4B 1E79D 4BFZA 1AQUA 4IDPA 2BEKA 1E2QA 4KFRA 1GKIA 1N6IA 4LPSA 2YVUA 4P4TA 2JLQA 2IS2A 1KSHA 2N46A 5GJCA 3ZS9A 3K09A 2OAP1 4K81B 2WWWA 3M0EA 1OH5A 3TVDA 1FNNA 1M7HA 1W0KA 3U61B 2ZUCA 4JYBA 1SKQA 4LJYA 5GADl 2ZRGA 1P75A 1Q1EA 2VL7A 3GCGA 5AUNB 1FMLA 1OXUA 4KHZA 3SHFA 2CHVA 3NDPA 4JT4A 3KJHA 5JI2E 1G7SA 2IBMA 1P2SA 4DVGA 2WHXA 1UM8A 3PUYA 2VHTA 3K0FA 1UBEA 4TL6A 2WJJA 1V5WA 1DPFA 1P3JA 2P6NA 4P32A 2YNMA 3QKRB 5TARA 5K8UA 3NIBA 4DT1B 3WBKA 3K8YA 1Z5ZA 1TF5A 2F9MA 2ZJ5A 3KXIA 1OKKD 4FXPA 5DNYB 4URXR 4F93B 3NG1A 3N5CA 3Q5DA 4BFTA 4Q1FA 5GVRA 1E6CA 1XTJA 2RGBA 4YMVA 3WHKA 5JS7A 1XPUA 3EWAA 1PV4A 2FF7A 4KBGA 3QF4B 1C4OA 4IDNA 3IPXA 4GOXA 3I8XA 4DLZA 3QSYA 2C5LA 3SE0A 2DFKB 821PA 3SC3A 3NBXX 1XD8A 3UWKA 4F38A 4CEJA 4TL8A 5JWOA 1MABA 4B33A 4MKIA 1I2MA 1JPJA 2Y8EA 2EWVA 1L4UA 2BMFA 2NMVA 5FPTA 2ZYTX 2QTVB 1X8JA 2VH5R 4PZZA 3DO6A 1E9RA 1ZM9A 1SVLA 1ANKA 3T1VA 2XOKD 4RJLA 3IQXA 1QHYA 2IYSA 4MKGA 2XTMA 4RVCA 5GVSA 1M8PA 4FCWA 4B43A 2WSSA 4B71A 2GCPA 3AVVA 4IJMA 4I1UA 2ZRIA 2OXRA 2QEQA 4TMKA 1F48A 2ASEA 1SVIA 2R65A 4IOJA 2W2TA 3MMPA 1AA9A 2XTNA 2EW1A 4TMXA 4A15A 4QBGB 2F3TA 2GCOA 1CJKC 2EQBA 3SYKA 3EZ7A 2CJWB 4IVPA 4B47A 2IXGA 2WAYA 3ZD6A 4G5RA 4RD1A 3T5DA 1TMKA 4ZCIA 5ANRB 1G17A 3T15A 3FVQA 5FR2A 1NMYA 4EFNA 2WJYA 4UNPA 4I81A 1NIJA 1NVXQ 3Q72A 3HU2A 3A36A 2AL7A 3P4YA 2ZRPA 2ZSAA 2GRJA 3NXSA 4YQFA 4URWR 5FOUA 3K9LA 5C1BA 2ONKA 1EFTA 1M74A 3AP1A 4DXAA 2MSCB 2JLZA 5FL3A 3ZS8A 2YYZA 1DELA 4PHFA 5HKKA 4CGZA 2GCNA 3RS3A 3QY0A 2DFTA 4HUTA 5JCZA 4U7DA 4W7SA 4A8JC 4AI6A 4IVRA 4Q4AB 3FHTA 2VSXA 5HTKA 2J87A 4H1VA 1KO7A 3LXXA 2Q9AA 3WMFA 2H5EA 4MGYR 1Z06A 1CJUC 1N6LA 4XIGS 4F4JA 1UBCA 4TYWA 2F43B 1ZUIA 2YJTD 3BC1A 1NLFA 4LK2A 4AKGA 1KI8A 2C99A 2PZFA 4U00A 3BWDD 4WZBE 4D80A 4M1SA 2AWNA 4CEIB 1TNDA 1G4AE 2CK3D 4JLPA 2IYUA 4BFXA 3SFVA 2BIFA 2OBMA 1J90A 2O8CB 4LPKA 2QPTA 3EIHA 3ZZTA 5CITA 4EUNA 1IN5A 1VIYA 1ZD1A 3IEUA 2F1RA 1OFIA 4N3NA 3TKLA 4QRHA 2G9NA 5FI1B 3RS7A 2Z83A 4A9AA 4TQ9A 5EE5B 1EFRA 2IYYA 1CJTC 2HCBA 1OIVA 4P0TA 3BK7A 4OI1A 1H8ED 3B8HA 1RFLA 3KZ1E 2B92A 2R8RA 3VKHA 2IUSA 2IA5A 2ORWA 5AK0A 1M6NA 2QMUA 3ECCA 4MGZR 2ZRNA 1NN5A 4UNSA 4CEHB 2AD1A 1HTWA 2VEDA 2WPDD 3AF2A 1G9XA 3FKQA 4DSOA 3UXMA 5JSZB 5G3ZA 5L3VA 2W2VA 1SZPA 2WV9A 1DAEA 1Z22A 4D2IA 1OJLA 2FFBA 3O47A 1EFCA 1E0SA 1RRGA 1OYWA 3WMGA 4GPTA 3VR5A 1UAAA 2MSDB 4M1KA 4QFMA 4DSUA 1XD9A 1P6XA 1ZRHA 2W6JD 3C41J 3PQCA 4L16A 4PTLA 2HLDA 1E2DA 4IXMA 3I92A 4XOIA 5H70A 4DLUA 4MH0R 1G19A 5BN3A 4RCYA 3SBEA 4A8JA 1XMJA 3X1WA 1QHHA 2OCPA 1EG7A 1W2HA 1KDTA 5A5GA 3QKRA 3SEAA 4DT1A 4Z51A 4OJQA 3GLIB 3KQUA 4QXAA 2BKUA 4IEEA 4GT1A 1N0VC 4D0GA 3LBNA 4ZI2A 1TL7C 3T12A 2QMEA 4M4SA 3NKVA 4DB4A 1V43A 2XSZA 1TQ4A 3JVUA 4TL9A 1XEWY 1RE0A 4JLAA 2NO9A 3DPUA 2C9CA 2RB4A 1KDOA 3OIYA 1QVAA 4WXRA 2P67A 1TX4B 1JNYA 5JJKA 1G18A 2BDTA 1EX7A 4JBYA 4P3YA 2WWFA 4TT3A 3TQCA 3P27A 5L3RA 3BORA 1U0LA 4MUBA 3I73A 3AVXA 1SXJC 2ERYA 1YRBA 3MAAC 5F98A 4UJ5A 2WJHA 4U02A 1YZLA 3TRFA 3PEWA 1KOFA 1XTKA 2YZ2A 1DG1G 3LDAA 2LKCA 2XTZA 1E2HA 1H8HA 1QDEA 4PSKA 2P6UA 1F6BA 2DWPA 1K5DA 1IONA 2PEZA 1KI7A 4GP6A 3LLUA 3AH8A 2OG2A 2OBNA 2D3WA 1HV8A 2QTHA 5CB6A 2NG1A 3Q3JB 4HATA 3PENA 4C0HA 1XFAA 1COWA 1G8FA 1KSFX 4JKYA 5L3QB 2XZLA 4RY2A 2WIBA 4ZIRB 4W9MC 4S35A 1N25A 5K8IA 2WJGA 5EP1A 3MJHA 4TQAA 4EPWA 3P4XA 2IYLD 4GFDA 1JECA 3KXLA
chains in the Genus database with same CATH superfamily
4N3GA 2O2XA 2YZGA 4C01A 2C7QA 1JFFB 1JRLA 1Y8QB 2G17A 3EWIA 3OKCA 4A5SA 1RZ3A 4G07A 4E2WA 4BWVA 5SY9A 3FGPA 3DDSA 4ENTA 1JKXA 3A4LA 4CKEA 4RQUA 3MTJA 1V25A 4WNAA 5F2NA 3SJUA 3GIDA 2RGUA 4ZDKA 5A03A 1QKJA 4DWOA 4OK6A 1CR2A 1DBQA 3BD9A 4BRSA 5K7SA 2XWJI 1Z7WA 3R44A 3RYIA 3SC6A 5C1PA 3U3OA 4NC9A 1WQ3A 4US1R 2C0PA 2W7TA 1WMSA 2C61A 3VR2A 2GN8A 2WOJA 4KXWA 1ZK3A 3BCHA 4OO3A 2HTEA 5BYBA 2WNIA 3RS9A 2DAPA 3SP1A 3H19A 4KPYA 2ZJ1A 1U0EA 4PQGA 2PMEA 1MG0A 1NRJB 1A1SA 1P2FA 2WUFA 4J7XA 2OGSA 4JJ7A 5J40A 1KR5A 4JQSA 1MJFA 1O6GA 1U0OC 1M6EX 1MPTA 2AJ8A 4KH0A 5TEWA 4DLYA 1IUKA 1D6MA 2H54A 2CNWD 2VA8A 3DTYA 2AG5A 4RACA 4Q9HA 5KQRA 4A2CA 3AUJB 1Y7PA 2CN1A 1X87A 3CSDA 3QYPA 4CMJA 4ZOQI 3D2LA 1VLQA 1WB5A 2J5RA 4COOA 5DEOA 2WF9A 4GYJA 3DLHA 5C35A 3WGLA 1Y4UA 4P4SB 3JVEA 1TB4A 1KK0A 1PG5A 2W2NA 3F8TA 3BGOS 3AW9A 2ATXA 4KIJA 1SB8A 3IUQA 1CUZA 4L3OA 2CW5A 2RH9B 3FPHA 4R1TA 4W6ZA 4YREA 1KY4A 3M4XA 5K03A 2QSZA 3HV2A 3I4LA 1F4VA 3EDMA 4GIBA 4NXMB 4BHTA 1Y8AA 1F0PA 4C6SA 4XH9B 1Z0UA 3SHWA 1CUJA 1YVRA 1BH2A 1OXSC 3AWDA 3KKNA 4N0EA 2FZ4A 1XZEA 3RRBA 4LWOA 3LCCA 3VPCA 3KC2A 4PIMA 1CULC 1ORHA 2DLNA 1JG3A 3PU6A 4KSCA 4TPKA 3TNFA 3GGJA 2DT8A 1SY7A 4EGSA 1ZOPA 1WBJB 4KX5A 1RXSA 5TVGA 3DONA 2B1GA 2CYAA 3LMKA 4YCNA 3DVLA 4TWBA 1I7SB 1BXGB 1B6SA 1IZ8A 4MRAA 2FEWB 2WFMA 2WVHA 1WXFA 1AKVA 4NV3A 4Y0NA 1AZTA 2FRVA 4L73A 3ZLBA 1TTTA 4GPAA 2MDTA 1FC0A 4JYCA 2CUKA 1TDJA 4WFIA 3WKCA 1G3QA 2W5UA 3JY6A 4L5IA 3SYMA 2AR0A 5EWMB 1EHCA 1YZYA 4F96A 1NGSA 3AEXA 4L5YA 5C3UA 2O3TA 4EG8A 3DTTA 2FK8A 1SURA 3NHFA 1JJBA 1G4UR 3ZEAA 2HBQA 3U0VA 4DA4A 4DV4B 1ZR4A 2ZIUB 4FFNA 4KODA 1NG1A 1DFHA 2FP3A 1AT1A 2EATA 1TUGA 3LO8A 1H93A 3KUXA 4P84A 4WSOA 3NBUA 5DGTA 5H3CA 1OXTA 2UYQA 3KKQA 4ASUA 4Z1MA 3EZ6A 2PZEA 3C3JA 3ZJTA 4WRRA 3MAGA 3KR9A 1YB7A 1XROA 2ZI3A 4BBPA 4NBNA 4YP7A 4O6VA 3NGMA 4GEKA 4AULA 1P5ZB 4BFCA 1E4YA 2W22A 2B35A 2AK2A 1ONOA 5ILGA 5DTJA 1E9VA 4JYZA 1BVUA 1DOHA 2XE6A 2ATVA 3FGNA 3OM9A 3P0EA 4GRAA 3J81A 2GN4A 4YR7A 1H3FA 3U4GA 3U4CA 2Q9UA 4RTQA 1N8TA 1BEEA 3DAFA 5TXGA 3JR7A 4JVMA 5DOZA 4A2PA 4QAQA 5LM3A 3QKUA 1CQZA 4ZDWA 3ZK7A 5LDHA 2XMQA 1NW6A 2IHUA 2O8FB 2EZTA 3JS5A 4FGSA 3AHHA 3TLYA 2XF8A 1W59A 1Z0KA 2FPIA 2JEYA 4M60A 5SZJA 2VYQA 4MR8A 1CX9B 2AOWA 3OIFA 2WJ4A 3NJ4A 4HAYA 3G9ZA 2GF9A 2XXBA 3EDQA 2ZAGA 3FNBA 4I9NA 5E6SB 1GL9B 2J9GA 3BL6A 4G25A 4IIHA 4NZZA 2VAMA 2DUJA 1GG2A 4XCVA 3F71A 4ZQHA 4KQ2A 4YJHB 4BNFA 1AQIA 1UDXA 2DSNA 1JBEA 2DWQA 4JL6A 5I4IA 4ZO9A 4LDZA 5SYAA 3HY3A 5ABPA 2VSQA 5LZ8A 1USGA 2EU8A 1QYXA 2XMZA 3F5DA 4YHBA 3VYWA 1GO2A 2DLCX 3ZG6A 2LPMA 4PLVA 4TUYB 4V24A 5LL6P 4C2TA 4NE2A 4IYRA 2GD2A 2Z58A 3BMQB 3EA4A 3LC2O 3OOYA 2CVPA 2MTBA 2IXBA 1X7ZA 1ONSA 1OKKA 2A9JA 2RCYA 3QMPA 1NRWA 3JAMA 4FKMA 1X3SA 4NNJA 1A7KA 1Q15A 2FEXA 1MO4A 1PZNA 4O59O 2QV0A 1WPGA 1TFUA 3L06A 1GTZA 5EJIA 4QGSA 3O8CA 2G9UA 2N1MA 4HB2A 4YFYA 1FPQA 1EJ6A 1WV1A 3DEJA 5T4FA 4EUSA 6Q21A 3JD4A 2YWCA 4DREA 3OAAD 4OAOA 2IXDA 3VPHA 4C5AA 1NVFA 1KOGA 5T8KA 3AL2A 4HXFB 1T35A 2WA1A 2P2GA 2P8SA 4BPRA 4REMA 4OVKA 3GAZA 4NBUA 2OLEA 4N7BA 5LSAA 2HR1A 1QVRA 2LCFA 1NVUQ 1E2PA 1Q0UA 5B1SA 3KM0A 1V5FA 4RIIA 1S3GA 1AKQA 2OO5A 2HREA 1BKSB 4PSVA 3IE1A 3TL2A 4ZV4A 1JFFA 4DCMA 1Y8QA 2VSOA 3T5GA 1A2BA 5FPKA 4RK4A 4NQRA 3WNQA 1H9BA 2GF0A 4YALA 1M7BA 1W49A 1FMFA 3CLRD 4URUR 5CM9C 2C7VA 4C2AA 1E2EA 2GXSA 1Z63A 1JX6A 4LZPA 1DTEA 1IPHA 1MN6A 1RAAA 2O3JA 1EBUA 2Y77A 3LX8A 1LBIA 2I2XB 3NM5A 4Y9DA 3WFJA 1M2FA 1RSZA 2POCA 3E3NA 4NOMA 3SPXA 4XB2A 4KVFA 4WOCA 4Z4QA 5THKA 2WJAA 4EEKA 1I94B 2BFOA 4R7TA 4FW9A 3UAVA 2V9ZA 4M46A 2X76A 4X84A 3UPTA 4L5JA 2C0QA 1XNRB 4KN9S 4TMVA 3EGWA 4DFDA 2A8YA 4G5XA 4RF4A 4RX1A 4DMLA 4A1FA 2R6R1 1HOXA 1W96A 3E8MA 5KNBD 3AO0B 3EEOA 1APBA 4DYDA 4I4NA 1AUXA 4WZBB 1OI7A 1KAOA 2QVLA 5TT1A 4PLFA 1G5TA 4IJVA 5BSKA 1N7GA 4KWIA 3RPEA 2OV1A 1WY7A 5BP7A 4EO9A 1G7RA 4R9SA 3AU9A 3B9BA 1GXSB 4G6ZA 4JLVA 4BVLA 3V8QA 4ZMSA 3FWHA 4P4SA 1UPXA 1FF9A 1UBLS 2Y2UA 2NSJA 2IXAA 1MC5A 3GZJA 3JSXA 4QTUB 4YRDA 4BDTA 1E3LA 5EHXA 4OXNA 3C3KA 2Q2NA 4UZSA 4BP1A 2G5CA 2ZR0A 4J07A 4C03A 2Q6TA 1F7VA 1G3MA 2NIPA 2VXOA 3L1KA 4N7MA 5EXTA 3WYGA 1S4QA 3WAKA 3FTDA 3LI2A 1M73E 4J7UA 1U0NA 4KBYA 3W5UA 1JZSA 3OQOA 3VH3A 2F2TA 1QX3A 1N77A 4ARUA 4JB3A 2ZUSA 4ETWA 3QVMA 4PR3A 3TR5A 5DLYA 2OUIA 2P9QA 3ID6C 2F1HA 4JODA 3RK4A 1PJCA 3FTFA 1QPGA 2FSIA 1EZZA 2PM8A 2AFIE 4PGGA 3CNBA 4W4TA 1BXGA 4CV2A 3U13A 4KDEA 3U62A 1A9SA 4OKSA 3LY7A 2DJIA 1HLDA 4AFNA 4O02B 3IYLW 1G7CA 3M6UA 4QO7A 2PA3A 4B48A 3QEBZ 4MUJA 4AMUA 3LCUA 3O7MA 4GP9A 4UTZA 4K3UA 1NQXA 1X1AA 4B3FX 5LWQA 2VH1A 3PNYA 3ICQB 4ZVMA 3TOVA 2AQ8A 2D06A 2V6MA 4N3AA 1L3BA 4UAUA 3I2KA 3RSLA 4E11A 2CSXA 2C54A 1D4ZA 2DUNA 3SS9X 2F6RA 3OX3A 3VR5H 2N3ZA 4YACA 3QVTA 4BAZA 2IDJA 1KMCA 3HCOA 4CL0A 2FETA 3QPVA 5CB0A 4L6CA 1KFKB 3JD1A 4JC4A 1PU2A 3V46A 3OE7A 3ESDA 4UARA 2OA0A 4W9NA 2IPAB 2VHEA 2YOHA 3AY0A 3MT0A 3UMJA 5LZ2A 4CMAA 3L92A 4NZ9A 3BL5A 3C3WA 1KZ7B 2YS6A 3DV2A 3IQDB 3L7KA 5AXDA 4YIKA 1DWUA 5BN5B 3B1VA 4JJZA 6PFKA 4Q4LA 2ABWA 2GO7A 2EFYA 4WDRA 1LRJA 2EX0A 4RKYA 1E59A 1P31A 2VYND 4WMLA 4WK6A 3B1ZA 1I4WA 1JKJB 1FA9A 2GYUA 3PVSA 4D57A 2GYYA 2ZBQA 1I7QB 2BV3A 1ZP6A 5A04A 3KDSE 4J1TC 2N75A 5IARA 3R5HA 1V1MA 3H17A 2AXNA 2P9ZA 3IDZA 4B0OA 5JG7A 4I3GA 3T9CA 1U0RA 1XTQA 2IXFA 3QX7A 4OH1A 4E88A 1AUQA 3N75A 5EMHA 4F72A 2J0QA 1W47A 4P54A 3BMNB 5JD6A 2H1RA 1XMVA 3NV7A 2OGWA 5ALTA 5AW3A 2L0XA 4GPIB 1YT5A 3FRHA 1PLKA 5E6SA 2CXSA 4RWZA 1G5HA 1L4NA 2VHUA 1HFJA 4YJHA 4Q16A 2NO0A 4KIUA 5EIBD 5J2TB 1MAWA 2CE7A 2BT4A 4MS1B 3V7YA 1T4MA 3TM4A 2FVXA 2J45A 4AYTA 2ZXUA 1U63A 1N3YA 3NP9A 4HWRA 3DCYA 2WM9B 1O95D 3IAEA 2PZGA 4HNAB 4OUDB 3KXKA 1P4SA 4TUYA 2Z4TA 1VHDA 1Y34E 2CJXA 2GVNA 2OK8A 4MKRA 4U7WA 3BMQA 4B34A 1X1RA 2P9HA 4LKOA 5CVTA 1FNCA 5E3HA 5DO9A 3DS8A 4OLAA 2OLKA 4XJSA 1OZGA 1H2AS 1RFGE 2ZIVB 3FWKA 3H97A 2QLTA 4BNYA 3JSAA 1WOMA 2X9QA 3FI0A 3H11B 4MV3A 3TX6A 4C89A 4WLUA 3EF0A 2DWUA 1MOSA 2QRGA 1QTRA 3JD3A 4RHYA 4XWGA 1OH8A 1C7ZA 1R4MA 2CDAA 3UAGA 1QIHA 3LU1A 1N0WA 9ATCA 2BFNA 1JR3E 4GLJA 3TD2A 1YRYE 1URPA 1PWZA 2VJMB 1Y3AA 1QHHB 1W44A 4NONA 1HMPA 3V97A 1UKZA 3CF4A 1UIMA 1SG6A 3BPSA 2V7WA 3FETA 3RBVA 2VRNA 4XSVA 4DIFA 1M0TA 4HF7A 4COKA 1KNXA 1II8B 1N7HA 4IOLA 1JIUA 2ZQ5A 4JC8A 2P91A 3DZIA 4YY3B 2VOJA 1UKYA 1T13A 3P0HA 4WACA 2HSEA 3TRHA 2G9VA 4OAQA 2D2EA 2HWWA 3VSCA 3GFFA 3VR6A 5UKDA 2X9GA 2ZJYA 4NI5A 3RFTA 1FSPA 1UDAA 4J7AA 4AJ2A 3C85A 4G8BA 4NICA 1PBNA 4F3RA 1IPFA 1O08A 2HGZA 2JJ1A 5KYUB 2PBFA 1L5VA 3NT5A 3OA0A 5SZKB 4X3CA 2IE0A 4Y1RB 4X7BA 3R9XB 3RYCB 3DZCA 3CRVA 3MXOA 3ZY6A 3ZDRA 1UWCA 5BXQC 1W35A 4RDCA 1D8AA 3WLRA 4OHMA 5EP3A 4F92B 4J0HA 5IBPA 5LJIA 1CZOA 4NS4A 4BEJA 2CNBA 3CKKA 3M3HA 3R40A 1Q14A 3E7XA 4G1CA 2AMFA 2GI4A 1ZZEA 5JQGB 2X8AA 3C8HA 2XIJA 5M04A 1ZD3A 3N8KA 3F6CA 3PD1A 4HNGA 5EIAA 1DEKA 4ZT4A 2EFEB 2ECFA 4WZBA 3OMWA 4E70A 5SY4A 4Q03A 1NONA 1QIIA 1S3FA 2BBTA 4JK3A 4MA4A 5LA6F 4ZV9A 3IURA 5B7QA 4C0XA 2X2PA 1V6AA 2X41A 4OU4A 3SHTA 4BP9A 3K94A 1EA7A 4OL0A 4P9NA 4WEOA 5JMTA 5BV7A 2OP1A 1QHFA 1WPXA 1RKBA 1VJTA 3I9LA 4NG4A 3KKEA 2Q49A 5LMZA 1DO2A 2BHTA 2R11A 3UFXB 4JQZA 3F2VA 4HLUC 2GM5A 1PFKA 1NKTA 3BJEA 3SN6A 3WL7A 1YHYA 4AQ7A 1AHIA 2IFTA 2HSZA 2PSSA 1YRQA 3FHJA 1ULBA 1G8AA 4LYGA 1VDMA 4IP0A 4PC1A 5EQFA 1SCJA 5KC9A 5LZ9A 3HZHA 5EP4A 2PUWA 3RRNA 4BE4A 4PPFA 2Q3FA 4Y2GA 4TTAA 3K70C 2BONA 1U9ZA 1Z07A 4KR6A 3RJ9A 1UBRS 2V6FA 3FOCA 2PV7A 2C42A 2OO7A 4BGIA 4Y30A 4EYEA 4YHHB 3G02A 1RI5A 3TB6A 1X1SA 2Y93A 1SOWA 2Q8NA 1OOEA 4O2BA 4PRLA 3EY9A 2L19A 3AFMA 5HW0A 5AOCA 4R2JA 2WTBA 4F4FA 1YMUA 1VYVA 4AS3A 3RC7A 1T9KA 4M0LA 3V42A 5C8ZA 1ZFNA 4R71A 1GGMA 1HNXB 1PZFA 3KLNA 1CF4A 2OKCA 5IT9A 4WXPA 5DBGA 1DP4A 4ZVSA 1DKOA 3UJPA 5K3DA 4G23A 5HOEA 3KPYA 2WM3A 1YB6A 3O8RA 1U2SA 3LQRA 2Y1CA 1KYQA 1SC1A 4EKYA 3QLVA 2H6EA 3A4VA 3DEKA 1LJ8A 2DWOA 3Q8XB 4NAVA 4ZK2A 1XV5A 3RFXA 3RRJA 2NVOA 2PUDA 2QNRA 3ZJ4A 2B21A 2NUTB 4WA7A 1K89A 1OF1A 2ZB8A 3JRXA 4PFSA 5ALZA 3IDSA 4M3NA 1AS0A 4MVJA 1IOVA 3TLCA 1VI6A 1E3TA 2BKAA 2ZI5A 1SXJB 4IGEA 3R7WA 1GU1A 5KQPA 1CHNA 1ZIDA 4QIHA 1M6WA 4F71A 1UT5A 1RAEA 2IC5A 4NCIA 4Q9JA 4FSHA 3AG6A 4F9GA 4TZ6A 4EG3A 4MUHA 1FXSA 4RW0A 3V1UA 1H9CA 1HTTA 2QM8A 2Z0MA 3OBBA 3RG8A 5BN5A 4V1CB 1T1GA 4JVLA 4F4CA 3L8CA 5KKCA 1A9TA 3PC8A 3WIEA 4REOA 2GCEA 2VPQA 2JH3A 2ATIA 5JSYA 4CDMA 2B1IA 2J5XA 2PRYA 1T2EA 1JKJA 2V0CA 4JELA 1WXQA 1GPDG 1E7WA 421PA 3OZIA 1NXOA 2GEVA 5F1YA 4DLRA 3HY4A 4DMKA 5IX8A 4HRYA 4DV3B 3K0CC 3TZBA 4EX6A 4X44A 2K2WA 4KEAA 2W43A 3ROQA 1WU7A 3ECAA 4MB2A 5I47A 3F4KA 4UNIA 1NUQA 1OHHD 1IOLA 1M1NB 4CFZA 5CFLA 4RZXA 2PAAA 4FBGA 4XIYA 3OTGA 1OBCA 2C1EA 1PT8A 3A26A 3Q11A 1WP9A 2RGNA 1GPAA 1CEQA 1OYYA 2ZGVA 1FL9A 1VHQA 2W58A 5F1KA 3H2HA 1H4QA 3K0AA 1FJGB 2GESA 4BFYA 5J2TA 1EXNA 1NW5A 3HYCA 1HFEL 4LYAA 4MWSA 3NTRA 4MS1A 1X1QA 2VWPA 4X6UA 5F5LA 4CMCA 2VJKA 1IQRA 5TNXA 3HJTA 4HNAA 1RWNA 4OUDA 2QN1A 3GV0A 3SM3A 4EKDA 1KO1A 5J59A 1NAHA 5BQPA 1K7CA 3ROFA 2B7LA 2ZT5A 4F85A 2KB0A 3QK7A 2B78A 2JGDB 3RH0A 3UA3A 3IOEA 4BNKA 4L76A 1DC5A 5A5DA 1PZMA 4J4TA 3H11A 4KO8A 2P9GA 4M55A 5CHYA 4A91A 3M6FA 3ZCUA 4EUKA 4GI3A 4ENQA 1D5WA 1QONA 4Q93A 5TT0A 5DVZA 1K4YA 3G5UA 4G85A 2JI4A 1MJGA 3HVKA 3ZV6A 4C05A 4CFYA 4S04A 1MXHA 4Y7DA 4EA9A 5IAKA 4ND2A 4QRIA 5K0GA 2A9OA 1SCIA 1TM5E 2P6MA 1ZKMA 4UNQA 2A5YB 2JW5A 2F3UA 1GTRA 2IZ6A 2ZTHA 2CFOA 4GUDA 1VL5A 1II8A 4IW3B 1TA9A 1FUEA 1FJXA 5EAIA 3ICEA 1JG2A 1ULZA 5DK6A 2X3FA 1ULHA 1L4HA 2LCQA 3R0ZA 3BWEA 1L7QA 5GOZA 2XZPA 3RDPA 4F1JA 5K8VA 3GRKA 4DV1B 2WAAA 5CEFA 3IULA 3ZQ4A 4F46A 2I91A 2HADA 3A4NA 4DS3A 4TXNA 5KYUA 5EEHA 3SJBA 3K71B 4B6GA 2F9LA 5EI5A 3R9XA 3BRWA 3RYCA 1FTYA 5L6LB 1ZG3A 1I2ZA 1YVDA 1BX1A 1SU7A 3LT2A 4HUQA 1YZUA 4RE5A 1W34A 3TF5A 1XZDA 1UDRA 1A04A 4DSZA 2CFCA 2Q28A 5GZ6A 3VVLA 1EFLA 1NQUA 3EIOA 1WNTA 2GZ1A 1HI9A 3OEYA 3SCZA 2C5AA 3WWPA 1KO8A 2ZJ0A 3QOWA 4MRMB 1UP4A 5B7GA 3DKRA 3DTVA 3MTGA 1DQYA 4CYMA 5I45A 4ZOEA 2O8FA 1VB3A 5HK8A 4KDCA 5AK5A 5FOXA 3GPIA 5CNIA 4HCJA 4S2UA 1MRSA 2D7JA 2P4EA 2JFNA 3TGLA 2H48A 2WOOA 2UUCB 1DJQA 1S9DA 3DFFA 2NXNA 5C5IA 2JGJA 2Q3EA 4UNNA 1VRWA 3C6KA 1IAVA 6GPBA 1XMQB 2J9FB 1J24A 3JALB 4K6HA 4XM2A 1ODCA 5ERGB 4YPFA 4WT7A 1TRHA 1KMMA 5F77A 3ZYZA 3DP9A 4PLWA 4F11A 1B76A 5DT2A 1J5EB 3UFXA 1U04A 4Z7NB 2QTLA 3KQMA 1PL0A 4EEXA 1ZITA 1CJMA 1MF7A 2Q5LA 4I1VA 1RNLA 2NQ8A 5LC1A 3ST7A 5JDIC 1GPJA 2O14A 1UT6A 1XAIA 2DFDA 5HZKA 1R12A 4I50F 5JWHA 1TK3A 2DHRA 2QZ9A 1I1NA 4WASA 3M4NA 2AFIB 2A5JA 5DOVA 4DM4A 2QLBA 2OV6A 2O2GA 4KRXA 2WR8A 3G8YA 4ZOCA 3SXJA 5LU9A 1MVOA 1EXWA 2M32A 2W2LD 4AYWA 4BGVA 3LBAA 5JC8A 4YMWA 4YRZA 3MM4A 3VAYA 5TV2A 2VUHB 4QDOA 3LY5A 2OHXA 1G16A 1T2DA 4ZEVA 1C0LA 2GBLA 1GPYA 2EBUA 5E4JA 4NX2A 2O0HA 5CURA 1TU4A 5K05A 1OFTA 2WTMA 3CURA 5CW1A 2IYQA 3ZGYA 1T8YA 3D31A 3ZJYA 2BLLA 3W1EA 2I66A 4JGIA 1N78A 3BIFA 1JZTA 1ZJYA 2D4AA 1J9EA 2ECKA 5G4KA 4CM9A 2H65A 1PE0A 2V1XA 1U28C 4UHEA 1IZ9A 1TMYA 3SQMA 2NTYC 3PKZA 2P30A 3H2SA 2WSSD 1JH9A 3W2IA 4HEA1 3BXHA 4EHHA 1Z4NA 1HG0A 1RCFA 1SXJA 2OFWA 5ILOA 2IH4A 5I7FA 4J91A 2J8ZA 4KLAA 4H7JA 3I9OA 4U7JA 5IVKA 4ZVVA 3VDNB 1NF2A 1QG2A 3RVNA 5K8TA 1JFTA 2BM8A 2VP2A 3OOWA 3F4BA 4QARA 4WKBA 1EI9A 1P9WA 1XL0A 1TUEA 2VEOA 4JVSB 3CCBA 2ZYIA 2ECQA 3IVXA 4YDQA 3A1VA 2AX3A 4LQ4A 3ZCXA 1DHRA 4ZCQA 2ZB2A 2DBZA 3MJDA 3ROKA 4EG5A 1EX1A 2BR4A 4IEFB 2H4FA 3CRW1 3IALA 3N0TA 1DKQA 4LV6A 2X5KO 4MPPA 3ESYA 1RYEA 1MD9A 2QD4A 2SHKA 4YDSA 4KO3S 2J46A 1UFQA 3HA7A 1JFRA 3U7RA 1LGYA 2CNLA 2XI4A 1M1NA 4TM8A 3PEFA 2JFQA 3TLKA 1VE6A 3C4QA 3X1MA 4L75A 1OZ0A 3LKVA 3ILYA 2WIGA 2OT3B 2GAAA 3G1WA 3N59A 4S1WA 7ADHA 4WBNB 1IE3A 2O2CA 4FOSA 5CIQA 5AESA 4L08A 4JMPA 1WD5A 1BTOA 1M5UA 2Q45A 4Q9AA 3FPSA 4P31A 1W4ZA 4A3SA 1W93A 4AJ1A 4FN4A 1KAGA 1CJBA 2JRCA 3IV6A 1GU7A 4NJEB 4HC4A 4XYGA 3ONVA 2HRDA 3FZGA 3UOGA 1UOEA 3QX3A 5TR9A 4MVYA 1R6AA 1WQ1R 3T1HB 2XRZA 1FUKA 4X1OA 5TLSA 2NSLA 2RJNA 3A2MA 3I9FA 4HVAA 5L3ZA 4NSNA 1DIAA 4DMRA 1E6LA 3LX6A 3OD5A 5JCJD 3HTXA 2ODPA 3M49A 5JADA 5DTEA 4ZCSA 4U2FA 4M0EA 1JE0A 3W1VA 1RT9A 4O8ZA 2QXTA 5BV0A 1H0HA 3MIIA 4UAGA 4YRKA 5BR1A 4FGLA 4RIFA 5EY5B 4KL8S 3QE4A 4V3CA 4HYQA 2J0SA 1YVEI 4XPZA 3M7IA 3JWGA 3URKA 3OU7A 2C7PA 2O23A 4XW2A 4XPIB 4JXKA 2CLKB 2FFAA 2XUIA 3WB1A 4I55B 4FGWA 4HQRA 3BICA 2C2BA 2INGX 1SC6A 1ZQ1A 3CA8A 3GN1A 1D2MA 3AX6A 2W37A 3LQYA 1EE2A 3PRYA 1MB9A 1ZC4A 4GBJA 5A3QA 2KLHA 1ZD8A 1MNQA 1Y5NA 2EGGA 4RLHA 1V96A 1FJ2A 5BYAA 2FEOA 2ZRLA 4F9EA 3IKMB 4MUAA 5HOQA 4XJXA 2A5GA 2VTKA 1O6CA 1U81A 2YWFA 4AY5A 3K05A 1JNXX 1UMDB 3P26A 2WKQA 1J42A 1Z36A 2OFOA 3EFEA 2QPAA 4BVEA 2GXAA 5ALEA 1JVNA 1LUAA 3VNUA 4K9OA 4POOA 5FAXA 1CEEA 1MQ8B 3FJ1A 1NYTA 1X7GA 1W76A 2XUPA 2Z9BA 4U39A 4WZZA 3OOHA 1ORDA 3UMCA 2VXYA 1YK1A 2ZS7A 5JBIA 4LRTB 1FTWA 4RMIA 5I7VA 2H3EA 1OLXA 1VM6A 3GMTA 3O8OB 5AIAA 4X6XA 5DH9A 5J2UF 1FUUA 1FU7A 5KDLA 4H7KA 1BOFA 1A5BB 1VXOA 3H83A 3R8CA 2QSUA 5JS8A 1ENPA 5KQLA 4CE6A 2I2DA 2QLLA 3BHJA 4B7CA 4H7HA 1Z8DA 2E49A 1KU0A 2FP4B 1KBZA 1QF7A 4UATA 5FTLA 3TI9A 3H2ZA 3I1IA 3JALA 1WBBA 121PA 2H9AA 4MUEA 5LPNA 1KAHA 2EEZA 2V3WA 1XDUA 3E5MA 5HKBA 3HUEA 3V4VB 4E2FA 4Q5IA 2H4JA 5K3CA 3HXTA 1SZJG 1PR3A 2XIQA 2A4KA 1C3EA 4QVGA 2KW5A 2FMUA 3LUGA 3F67A 2FZKA 2QENA 3L1UA 1E2UA 4HZUB 4KC0A 2ZYRA 3BH7A 4KVGA 3KYDB 4RHTA 4NBRA 1M8GA 4I5GA 5BQXA 1A8UA 3DDZX 3CX3A 2GBIA 4TTTS 3OQ1A 1BRMA 3FVTA 3KQLA 1HE5A 4G8JA 4LHYA 1Z8FA 4CV1A 2DHDA 3KWLA 1L7VC 4MS3B 1LK7A 3BGIA 3VKGA 4L4SA 1E5XA 4FYPA 3H5IA 4JBGA 4DXDA 4DR1B 3AFIA 4TT3D 1VLHA 2CXPA 1Z2DA 3QJYA 1FXUA 4J0JA 4XTCS 2P78A 1E2KA 1G6KA 3LPLA 5K8JB 2X6QA 4MV1A 1MHTA 3E82A 4AY2A 1Z7BA 2D0IA 2PS3A 3KZXA 1FTSA 3C39A 4YRTA 3GYBA 3G85A 1KORA 4ZAXA 3TQRA 4QVKA 1C0KA 4YS6A 5AW8A 2Q6KA 3EA5A 1T8UA 1TLFA 1YOVB 1QB8A 2WJ6A 3JWEA 3KUKA 5C80A 2YC4C 1ZJWA 4G84A 4ZQGA 3AFNA 4RJJA 1XSEA 1WA5A 2R1VB 2XR1A 4XDYA 5EKXA 3ZX5A 5IXJA 4U9UA 1CQIA 1GZ5A 2XJ9A 4LYEA 1GCIA 2NACA 4N82A 4RH1A 4LOIA 4TQGA 4ZYXA 3QKSB 2H31A 2VJPA 4O29A 3JZIA 5SICE 3S40A 5BN4B 3H16A 3OLYA 1NZJA 1ZXBA 5LB2A 1VE7A 2OYCA 2XYQA 4ARZB 1HE2A 3OE1A 1GYPA 1NKSA 1KIFA 2NT4A 1OE0A 3PQEA 1F20A 1Y81A 2BFFB 1QH1B 3IUSA 4WZAA 2V6JA 2JD0A 2ZDGA 3T3IA 3KALA 1XCLA 1L5HB 4CM1A 1EGVB 3M8KA 3TECE 4UDNA 3PGXA 2IUYA 4ZO4A 4XUCA 1V9SA 2IYAA 3Q9NA 1G1MA 3EUAA 1RZRD 3UYKA 1YA4A 1A1VA 4QE3A 4W1PA 2B0JA 3KNZA 2K4MA 3PXGA 4EMUA 1JUDA 4UTRA 5KJ1A 4QHSA 1BFKA 1N1MA 3ZNPA 3IUBA 5EFZA 2F00A 1P4GA 4G5GA 4GKBA 3UIEA 5KYTA 3I83A 3P9KA 2IEYA 1UJ5A 4YCDA 4YQEA 2D1SA 2WHRA 2Y4NA 2ZRKA 3CR3C 5AM0A 2EYQA 3ETCA 4QU0A 1RBYA 1HE3A 1ZCJA 2H3HA 2G5PA 2RAPA 3LFUA 4ID3A 4IIJA 3GEPA 3AEKB 2QZPA 3C97A 3DA8A 3PQ4A 4TYMA 5FFMA 1FDOA 4FZJA 3ROTA 4E08A 3H3JA 3ADCA 1NKVA 2DFLA 2WKSA 3HLTA 1ZIXA 1PW7A 1YIDA 2O7QA 3CW8X 4RSMA 5DM2A 1R6TA 1TGYA 1IM5A 2OXCA 5FR1A 5A3SA 1HNWB 3IEIA 3WQHA 1ESMA 3Q5EA 2JCBA 2A4MA 4ILKA 1HKUA 4LBZA 1A7UA 2D13A 4NJEA 3WWYA 1UDCA 4CG3A 1YI1A 3TINA 1ZJZA 4BJ5A 4NFHA 1FNDA 3GHHA 2O4UX 4ZOLB 1DC6A 1RLJA 1I0LA 3DHWC 3LUAA 5JJLA 5AWFC 4UAVA 1OJ7A 1AUPA 3FR7A 3GDGA 4O3MA 3I6IA 1AGNA 3OCYA 1R7RA 3NNSA 2YXPX 5FPQA 5LP6B 2VDJA 1QLJA 2RDMA 1H2FA 5PNTA 2EF1A 2GAFA 4H9GA 4UUMA 4XSHA 5IKPA 3KSUA 3WGUA 1Y8RA 1ML3A 2ZSEA 3W3ZB 2DPXA 4NU6A 2QTFA 3GFSA 4N6GA 2I3BA 4NOLA 4BZWA 1K2VN 1U9IA 2BFCB 2NZ8A 4A4DA 4B80A 4EZEA 5A4IS 5KQGA 3K9FC 1D4FA 4V0QA 4Z9XA 3J81k 4MDEA 3OTHA 4TL7A 1PWHA 2PUJA 4S3MA 2Q7DA 4DIMA 2JLSA 2ORYA 3D4IA 3HSYA 4MVCA 4XPIA 5DHSA 4AIRA 4XLLA 4D9IA 2J7KA 2X1LA 4PF1A 2ZTLA 3PNVA 1NY6A 1NV8A 2ZBRA 4V2UA 5CVJA 4QXRA 2V97A 3ZWQA 4YO8A 3LECA 4AN1A 1T36A 2C3MA 4QXOA 4A6DA 1VMAA 1PKEA 4OJMX 2YIJA 5IJ0B 1UXHA 1ULTA 1KK1A 1LTHR 1JAIA 1NXTA 1SUIA 1D2AA 5D3QA 1CRQA 1KJZA 4IKEA 1ZRNA 1T91A 5AI4A 4FFDA 5D8DA 4AD8A 4I4TB 2C07A 3BJIC 1UMDA 2ZAMA 4KQFA 3CEHA 2FPSA 3HVHA 4WXEA 2CUTA 4L0CA 1WTCA 3V1LA 3I9KA 3HCAA 1FNSA 3SJ7A 2YCBA 2VT6A 1OX6A 2PGOA 3ZWPA 3LTNC 4BB5A 5AJZA 4RVDA 4KWHA 4G01B 3WO1A 4JJFA 4ON9A 2QAGB 4Q9NA 1M6YA 1J22A 2IS1A 3CLTC 5LJLA 4D4IA 3TVYA 1W6RA 3ONWA 1DNPA 1CTQA 3C0KA 4B6JA 2JLCA 1XYYA 2FP4A 1NMEA 4Q00A 4EOGA 4URYR 3GELA 5DPMA 4TMTA 4R1MA 1HDXA 1KKUA 1SHJA 2R6CA 4YWHA 4HKTA 3A1NA 1YH3A 3PS9A 4K2HA 4YJ2A 3KPVA 4GNRA 2AC2A 3WV5A 4KQIA 3U7GA 2ATCA 2G04A 2VWQA 2VYVD 3Q1KA 1IH8A 5C37A 2YYAA 2C98A 4GR5A 3IHWA 3TW6A 3TN7A 5JRZA 1TKAA 3TAUA 2FW1A 1XBTA 1G8HA 3OFSA 1L3IA 4CM5A 1LBTA 3FWZA 3KYDA 5A4KA 1V3VA 3MMSA 3CY6A 1U11A 3OZEA 4XI9A 4JASB 1EUYA 4DPLA 1XTTA 5KTKA 2G7ZA 3EX7C 1L1FA 3JQEA 1FFAA 1ST3A 1IUOA 2FWMX 2WB2A 1IRIA 2GEBA 2GHIA 2IGBA 2J30A 1BX3A 4D99A 2QLNA 2R8PA 1JVBA 4UEKA 4BFLA 3UBTA 4IDOA 4RGVA 3GJ3A 3QFHA 1AVTA 3B3GA 1JWBB 3RFUA 4KIWA 5JFGA 2XD9A 3T9AA 2BFMA 2VDLB 4NFSA 4FE4A 1SRQA 1M0EA 1VZ3A 2QRKA 3ENKA 5EIEA 3QMVA 2D6FA 3F78A 1IHUA 1YOVA 4AN4A 1GTJ1 3GPDG 1O4WA 3WLEA 4QPJC 5TB5A 2QZ4A 2I1QA 5KMGB 4RF3A 1QH9A 4KGVA 1O58A 1PZHA 4EHFA 3WFIA 2R1VA 4F5YA 3VO8A 1XZMA 4PBRA 3OO0A 1U7XA 5KI6A 5ILQA 4BN0A 5DCYA 4ZCMA 1ZH2A 3QKSA 5IHPA 4C3VA 5BVGA 1X14A 4OFBA 3QEAZ 3LBIA 3WGMA 1E2BA 3KOYA 4OFXA 3B3QA 1U65A 4DA6A 4D3SA 5M2QA 1B16A 1YZQA 2ADMA 2BSAA 2QUHA 2WTNA 4QNRA 3RWMB 5HSGA 4QEKA 4ND8B 1U8ZA 5DBFA 1HPLA 4ARZA 4L3VA 3ELYA 3BS4A 1BW9B 3HDTA 3QNWA 1BE8A 5FUWA 5GOTA 5B7NA 1WMBA 2P11A 4PC7A 1QH1A 1TMGE 1P17A 2QG4A 1AXRA 2ZQYA 3NTXA 3OF5A 1CS4C 4V0LA 1DBVO 1L5HA 3MS7A 5TEVA 4CF4A 1XQXA 4R2IA 4P5EA 1LDMA 2Z8YM 5DNWA 3BWBA 3I2IA 1OFUX 1EB8A 2O6HA 3GFOA 4XQGA 4ZV7A 4IUCS 2JNWA 1C2YA 1Q1BA 4I9HA 2FGJA 4J16C 5EZ5A 3HUFA 3QKTA 3B6KA 4E03A 4B6EA 2WD7A 1IQPA 2A84A 2VYCA 1I2BA 5DLQC 2P79A 2G70A 2J3DA 2OHFA 2WKRA 2X1MA 3DD1A 4ZI7B 2VQFB 3O4IA 4GMGA 1A50B 4U1RA 2VRCA 4OBWA 5MN6A 1MB0A 2QGZA 3H6KA 4ZK6A 1U2DA 2F8MA 3N2EA 3GARA 3I2GA 3PUIA 1X7XB 3NO4A 1E1RD 5C53B 2O2IA 3KWFA 2O5EA 3AEKA 5JUWA 1FP4B 3SZ3A 2WTEA 3H6HA 2ZU6A 4JC0A 1T3HA 2Z56A 3M1AA 3GB9A 4WOBA 3I3SR 5K0SA 3BN3A 4MX8A 1KDYA 4DMGA 5ITVA 4MYRA 2CF6A 1RP7A 2EG5A 2PZBA 4B2PA 3Q8LA 1IK4A 1OWNA 4TSFD 3RIXA 2Q7XA 1B0UA 2YWGA 3EGI