5M3BA

Structure of cobinamide-bound btuf mutant w66l, the periplasmic vitamin b12 binding protein in e.coli
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
244
structure length
228
Chain Sequence
APRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTLQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Vitamin B12-binding protein
publication title Conformational Change of a Tryptophan Residue in BtuF Facilitates Binding and Transport of Cobinamide by the Vitamin B12 Transporter BtuCD-F.
pubmed doi rcsb
source organism Escherichia coli
total genus 78
structure length 228
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5m3bA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5m3bA02
3HH8A 1QH8A 3ZTTA 1G21A 3AEKA 1ESZA 3LHSA 3PSHA 1QGUB 3AESB 4FILA 5M34A 2PHZA 4M7OA 5GGXA 3MINA 1TOAA 2PS9A 4OVKA 1MIOA 4UDNA 5CX1B 3CX3A 2WI8A 4HMPA 4HN9A 3MWFA 4FKMA 5JJ5A 2XH8A 2ETVA 1K7SN 3AEUB 3LI2A 2AFHB 5M2QA 5KOHB 3AETB 3EIWA 5CX1A 3HJTA 4NNOA 3ZK7A 2XDQA 4H59A 4WZAA 5HDQA 4FI3F 3ZK8A 3ZKAA 1FP4A 2O1EA 3AEUA 4G09A 1KAEA 1KAHA 1M1YB 4WESA 2AFHA 5B58T 2MINB 1M34B 2OV3A 4UTOA 1N4DA 1QH1A 3TNYA 2YNMC 3K1AB 4WN9B 2QI9F 2PS0A 4WZBB 4TKVA 1N2CB 4FNAA 2MINA 1M1NB 4LS3A 5JPDA 1H1LB 1QGUA 3AESA 3MD9A 3NU1A 4TKUB 5HX7A 3BE6A 3PSAA 5JG7A 2R7AA 3MWGA 4WN9A 4WZBA 4WNAB 4MDYA 2R79A 1N2CA 5CR9A 4TKUA 3U7QB 2OGWA 4N01A 5GGYA 3MFQA 4PAGA 5M3BA 5M29A 3AERB 1K75A 4CL2A 3AETA 3HXPA 5KOHA 1K0FA 3TLKA 4UTPA 2PS3A 1EFDN 5BVHB 5BVGB 1L5HB 4XPIB 2PRSA 4OXRA 1M1YA 2XQVA 4UDOA 1G20B 2XUZA 1XVLA 4B8YA 5I4KA 2OSVA 3PDIB 4MO9A 1M34A 3R5TA 3EIXA 4GICA 4K3VA 2YNMD 4XPIA 1QH8B 2WHYA 1G21B 2AFIB 3K1AA 4MX8A 3G9QA 4HMOA 1G20A 3AEQB 4ND8B 3MINB 5KOJB 1M1NA 1H1LA 1MIOB 4BBPA 2XV1A 2Q8QA 2AFIA 1PSZA 2OV1A 5KHLB 4WNAA 3ZK9A 1K2VN 3AEQA 4ND8A 3R5SA 5KOJA 4G07A 1KARA 2Q8PA 4LJSA 3U7QA 2XDQB 4WZAB 4HMQA 3AERA 2M6LA 3UJPA 1FP4B 2M6KA 5AFSA 4INOA 3BE5A 5BVHA 4WESB 4NNPA 5FLYA 1L5HA 2X4LA 3TEFA 5BVGA 1PQ4A 3AEKB 4OXQA 1N4AA 4INPA 4PM4A 4DBLE 2XY4A 1QH1B 2RG7A 3PDIA 3GI1A 1N2ZA 4TKVB 4H0FA 4IRMA 4MLZA 5JOQA
chains in the Genus database with same CATH superfamily
3ETEA 4O2RA 2ZYVX 4QBHA 4EO7A 4KBFA 4QGHA 4A6PA 2GCEA 1Z2EA 1NSFA 2TMDA 2VNAA 4M46A 3RASA 3L8CA 3FKSD 1H4TA 3FPJA 3AF3A 3ZV7A 4ZQHA 3RUIA 1OMOA 4IXTA 4AMVA 1KU6A 5FBLB 1SXJE 2EZ9A 1D5CA 1NUHA 3MWFA 1JNYA 2TECE 4B3IA 2CXHA 2H59A 4K88A 4D82A 3DLBA 4EJ0A 1WETA 4KGZA 3LK7A 3OU6A 1M2JA 1T1RA 3SC2A 4PZUA 1E2JA 1X1SA 2FVXA 4QA9A 2QRGA 3WGVA 4FZ3A 1VA4A 4BVBA 4JOQA 2C7RA 5JJLA 2WF7A 3SU8A 1RQLA 2CVPA 3MLAA 1NVVR 1V4NA 2AV6A 1WF6A 3DA8A 4E07A 2XVZA 5D3ZA 2DH5A 3KYIB 2ZTVA 2ZYIA 4LZWA 2BMEA 2RI1A 5JSKA 4MTLA 1NN5A 3H9JA 3PQDA 4XUGB 4BNIA 3F9IA 1BO6A 2TMKA 3MAAC 5EIOA 4P4SB 3D6FA 3E53A 3OO1A 2BC9A 5C35A 2H2IA 3GXOA 2OCYC 3QKSB 1TIBA 3VYRB 1R5OA 2B1RA 4WERA 3IV6A 3LQRA 1G2QA 3M81A 4D74A 2FOIA 5E6RB 1JFFB 2JCVA 4N0DA 4XPZA 2Z30A 5FO1A 1VJRA 1D2EA 3QEMB 4CLOA 3CW9A 1QRSA 5DRTA 2IP2A 2I2CA 2WQ7A 3K0SA 2GASA 1E1CA 3IQDB 3QVXA 1T3LA 1MOZA 3CE9A 4GMKA 3U2QA 3RUPA 1Z12A 2O8DB 2GESA 3H97A 4LW8A 3DMYA 4S1WA 4NK5A 5AHWA 3VPDA 1OB2A 1VBFA 4IIEA 3AF6A 1FS4A 1BCRA 1XRPA 4XYBA 2UYHA 4H0CA 5T8KC 2YNMA 5E2IA 2NWQA 1JEYB 1OZGA 2I6XA 1ZIDA 2IYAA 2JDID 2JS7A 1GZHB 2G04A 2N46A 2WSLA 2A2ZA 2H18A 3OT1B 3WLAA 4AT1A 2HQRA 2WD9A 2XQVA 4P35A 3FCEA 2ZYUX 3N05A 1Z33A 2Z2XA 2OVFA 3ZCPA 5AWFC 4NCXA 4LXGA 1EA5A 5C1IA 3W34A 1IUNA 3O26A 4LRWA 4XSVA 1JALA 1U3GA 4L5AA 1QRUA 3JASB 4D41A 4AJJA 1HYEA 1QHXA 1TAHA 2FG6C 1NJ1A 5DWVA 4N7MA 4DJAA 4JJZA 2WY2D 1XD2A 4RHXA 4FONA 4YDHB 1AF7A 4ZREA 1GUAA 1P7WA 2ATVA 4UVGA 2XZTA 2JI6A 3QPBA 1KI6B 3CEPB 1REQB 3EZXA 3DF7A 3KZKA 2VJDA 1H0HA 3HE3A 3OPNA 1ZH0A 2Q5FA 5C8YA 1NQTA 2XCOA 5DX8A 1D2AA 1QZ3A 2VNKA 4HGZA 2H7VA 2A9QA 2CB9A 1S4QA 1L1EA 4JUCA 1VPTA 1NXXA 1OIXA 3HM2A 3KIPA 4KH0A 1SKAA 2Q50A 1P9RA 1G8FA 3M9LA 1H3EA 4EA7A 3ITNA 4ZVSA 2X3UA 3SC6A 3ACDA 4FKBA 2ZVPX 3ZY4A 1FW6A 1C0IA 1XCPA 1NFRA 1DQZA 3CWCA 3BDVA 1LDEA 2VZEA 4PGMA 3AU9A 4INPA 2C5GA 3TXAA 1QRDA 3OZFA 1JQLB 1RCFA 3DMPA 4R01A 1TCAA 5EE0A 4BV8A 4B82A 2ECQA 1OOEA 2X3YA 3IUEA 1JVSA 4TT3A 4UDXX 3A31A 4FSXA 3VUFA 4A2CA 1Y82A 3RSSA 1DPGA 4OA5A 5AXCA 4B6QA 5DX0A 2Y93A 4I5GA 1ODCA 4TVBA 3JVVA 3QE4A 1R8SA 5HE9A 4C9BA 1U6KA 3K0CA 1NBMA 1XNQB 2O2YA 5HG0A 1NMSA 5K0TA 5FNVF 1YAHA 5CIQA 2D0DA 3GFQA 3TLJA 4DHWA 5ALIA 4V1CA 1XNRB 1KVQA 2O52A 1Y5IA 4AW9A 1VI6A 4KO1S 5C52B 1Z18A 1N78A 4N1AA 2WKQA 2X9LA 4LQCA 1I4EB 3ZQJA 1T0JB 3GJSA 2C1EA 3KQKA 3KEGA 4H7JA 2XNCA 1YA6A 3A4MA 4K9MA 4KR2A 1LQUA 4FWTA 3RT7A 3OZRA 4MGKR 1AB5A 3MWYW 4JJEA 4E5KA 4HG2A 5L3VA 4ZXFA 3FHTA 3DZGA 3K31A 5IM4A 4J1QA 2YJ4A 4HSEA 1PR5A 4DCGA 1YIDA 4Z4GA 3RBVA 2H1IA 1U2QA 1R64A 4EL0A 1KEVA 3GWZA 4CLOB 4X61A 1CW2B 1GCIA 4DYHA 2HK6A 4P7BA 1ULSA 4EX7A 1E1CB 4CIXA 3FFAA 5DVZA 1E8NA 4KQCA 1E1LA 2XE8A 3T61A 2JH9A 3L0BA 4L9AA 4A73A 1I94B 1Z4JA 4KMSA 3DOFA 2I8CA 2JG3A 1NDQA 4WN9A 3WGOA 2JJ1D 1K6JA 2GHIA 5EWMA 2BFWA 1AS2A 1W2HA 2J9RA 1BCRB 3TINA 1B14A 1RBMA 2W48A 1X7WA 2YRXA 1YIAA 3ICVA 1ZBDA 1VP3A 5AJWA 2CHQA 5FORA 1RYZA 3U80A 3W9YA 3ECAA 3F6PA 3BS4A 4O02B 5IZCA 1P45A 4LJ6A 2C88A 1EDBA 1JKIA 1Z4NA 2A5JA 1ZHFA 3KQOA 4CLDA 2Q6LA 2O19A 1IM2A 2H0AA 3O91A 4FEGA 5CT6A 1BOOA 1RPNA 2ZXFA 3W8FA 3NBZC 1JSCA 2DG2A 2X5JO 3OA0A 4N5DA 3H2IA 4XQGA 1NQUA 4D9HA 3P2IA 1RWPA 5JYBA 2H7XA 3IH5A 1G41A 1XD2B 2BGMA 2SBTA 3PEYA 3FHJA 4L8WB 4JODA 1R88A 2CJWA 2CKMA 4Y2UA 4ANFA 4M1OA 4M0CA 2VQFB 1ESNA 1TL7C 4I1RA 2Z2KA 4GBJA 1P4SA 3VH4A 1HFWA 4ITUA 4XLTA 1WMFA 2H57A 2BAGA 4WHMA 4L2IA 1LPAB 1OAAA 1JS1X 1X1CA 2WTAA 4QL3A 1TUIA 3GJQA 4WK0B 5E1BA 4BEWA 3G2LA 1CULC 1DQRA 3EARA 1IEWA 2FWIA 4GI7A 3VVCA 3CG0A 5JDCC 5ICMA 3R9XA 2IELA 2Y1OA 4FLEA 1SIOA 1YQQA 3DMTC 2X58A 3BWDD 3V4FA 4PFKA 1D3AA 4BYGA 1UXJA 5HSGA 1DAPA 2M6SA 2CK3A 4BQOA 2C83A 3NPAA 1OAOC 1Y7TA 3IUNA 3KLNA 3LCJA 3TZHA 3MWEB 3Q7IA 5FBQB 3LUCA 1G4AE 4K9DA 2IUUA 5AW2A 3J81k 1AXGA 1WCIA 3KXDA 4KYTA 5EKTA 1JSLA 1EX1A 2D62A 5HCNA 3VO9A 1IZ8A 3D7RA 4MGEA 1YOVB 2IYEA 4O8ZA 2C61A 3GP5A 1NQVA 1JP7A 3K16A 4PHFA 4EW1A 4RZIA 1ZM2A 3Q7TA 4OB6A 3TR6A 3FYUA 3NHYA 2J33A 4AO6A 3KJNA 5J4HA 3E5NA 4OMCA 2PHZA 4K9QA 3VSAA 4FB4A 4OHBA 1SHUX 1VGRA 2LRHA 4QD3A 2PUAA 2HF8A 1YVPA 4LOKA 4JUIA 1RAGA 3EIQA 3R4VA 5CB0A 1G3UA 1UOEA 1IZ9A 1KAOA 4KQGA 3RABA 4AQDA 3EN0A 3RNOA 3VKHA 1BHO1 2DULA 4FOTA 3OCXA 3I0MA 2CMHA 1IY0A 1P81A 2NO9A 1Z29A 1MO2A 2V7PA 3PF9A 4QEDA 1T13A 3LBAA 4LMBA 4OX9B 4U7GA 3DZDA 4EY3A 1ZD2P 1ZH4A 1AQLA 4YCMA 1VJ0A 1UKVY 4C4AA 2XDYA 2O2GA 5TMBA 4UC0A 3OEHA 3TSCA 4XB2A 3CLRD 1FCJA 4KE8A 4FFNA 4DMGA 1Z8NA 2PZEA 3ZDAA 3V2HA 2P9CA 1WP9A 4UD2A 1JHOA 1XMJA 1KC1A 3LA6A 4U3JA 3JZMA 4QPCA 4WN9B 4UUAA 5EWMB 3JQRA 3AR6A 1GD1O 4DV2B 4BFVA 1O03A 1X7WB 5CM2Z 2PWBA 3UHOA 5IAAA 1IPHA 2B69A 3EVEA 3GHYA 4PO1A 2I55A 3AY6A 5FJJA 5H68A 4OHUA 2QRUA 2QY6A 3O8OA 5AUQA 5TJ9A 4BGVA 4NY1A 4DCTA 1N8KA 2G0AA 4LC1A 1QHYA 16PKA 4ZZ0A 3P4XA 3CLSD 5BSUA 3ZDDA 4ZVOA 3NC1C 4GM1A 2FSFA 2JLWA 1E6LA 3FYHA 4DJ5X 4KB5A 1MD9A 4BFSA 1FU7A 3SG0A 4G5HA 1DRWA 1SXJD 1MABA 1NXOA 3ERCA 3I04M 4HADA 3P96A 1F17A 3LQQA 3OZSA 5HEKA 3ZE9A 4Y2PA 2CMFA 3BGDA 1MQ8B 1XTVA 2G80A 2HF9A 1EP2B 2WT9A 2I6TA 1S2NA 1PJ4A 2HPVA 2K6GA 4HYQA 4KFUA 3A4NA 3V6MA 1ZDMA 3PC8C 1BS2A 4I8DA 4FFMA 3PA6A 2YN0A 2C4TA 1SURA 1NYRA 2OP0A 1MVLA 2FCRA 3CZMA 3FMVA 2Y66A 4HGYA 4I4TA 2NZ8A 3MGKA 4GWKA 2O2HA 1TVCA 5AI0A 3VM6A 1RYNA 1TE2A 2PX8A 3FKJA 3TNFA 1H93A 1L7EA 2WM3A 3EXHC 4F4JA 3C7KA 1L7NA 4UFPA 3SYTA 1XZPA 4K26A 4WCDA 3C43A 5K6TA 1JIUA 4O59O 4LY6A 4KQ1A 3ZDZB 4GP9A 4PYNA 4UZEA 4LE1A 1VKHA 2X0RA 4FFRA 1VI2A 1LBQA 4JI5B 3VR6H 3ZLTA 3BA1A 4GZ5A 4Z0PA 4E11A 3P97A 4MDHA 1G5HA 2XZOA 3VPGA 7ADHA 4B84A 1A7KA 4ZC1A 4DCJA 1CUDA 1JR3A 5JO0A 1U7DA 4GL2A 1VKJA 5HQJA 1JU4A 1KXZA 3HNOA 1J0BA 1GZVA 2C2OA 3FYUB 4ALIA 4ZZ1A 3JXEA 5K09A 2WHQA 3DHNA 3FDIA 1MVNA 5G1NA 4JN6B 3SYMA 5DV9A 5BSVA 3MLEA 1J8FA 1OZAA 3HVJA 2JHAA 1T9BA 2MSCB 4OGGA 1DS6A 5G02A 3DYVA 4C0SA 4D0NA 1U8ZA 3ELBA 2ONYA 3R7FA 3UQZA 2XMBA 2GHQA 3R6WA 1VKNA 4HNGA 1E2DA 3DDOA 2JIQA 1IN1A 1I7LA 1Z0KA 3P9YA 3BH6A 1SPBS 2HUNA 3TDKA 5A5DA 4NE2A 1EQAA 3A36A 1COWA 3DW3X 4J49A 4M8KA 4OGFA 5GV8A 4B6FA 2VF8A 3LZCA 4KJXA 4DEXA 4LHSA 2AC7A 1EJ0A 2NZVG 4GXTA 2ZIVB 4Y1RA 4UNNA 1TK3A 2ZBUA 1P91A 3L77A 4LJ4A 4NOLA 5M2QA 2O8FA 4GE3A 1H42A 2XX3A 4QELA 1X7YB 1AZSC 1K3FA 1L6RA 2D7JA 2PBLA 3Q9SA 4HVTA 4NJOA 4R05A 2IXAA 4OH7A 4M1EA 5EIXA 3AEUA 4FD2A 4BWFB 4D9KA 4YA6A 5CK4A 1LPBB 3HCBA 1DBWA 4YAOA 2XEDA 3FPLA 1KO4A 1GPBA 4KEAA 2P0EA 5BMVF 4IWNA 1QFSA 4C6SA 4O4LF 5IKMA 1ISSA 5KKAA 2Z9CA 4DV5B 3KJGA 3KQWA 2X0JA 2R44A 4QBFA 3H2ZA 1QIKA 1O6ZA 3O8OB 4W7HA 3PEWA 2Z8ZA 3ADPA 3EXG2 4WFIA 3PKIA 5DXFA 4CCAA 2Q3FA 1TA4A 2B36A 4PIMA 4DSZA 5FWXA 4GOND 2C5SA 3OMXA 4Y9DA 5DM2A 2OCXA 3DOCA 4B71A 3JQFC 3I83A 4M8NE 2IPMA 4UTVA 5AVSA 4CTKA 5FV4A 4X20B 1ML4A 4DUGA 5JQWA 4W8HA 1MABB 2B4RO 1AHIA 4WRRA 4YRSA 4R9SA 5BQPA 4FT2A 1JYSA 1CLUA 2I87A 1NFQA 5HTOA 2P2LA 3GUHA 4XGQA 1VKZA 1P33A 3G6WA 4IFBA 2IU0A 4B48A 4Q48A 8ATCA 2IPOA 4BO0A 1OFVA 2BR3A 2WIJA 1V41E 2PO5A 4IHJB 3CM0A 4TMTA 4HB3A 2PWZA 3Q3EA 2RIRA 4EZIA 5ELXA 5LNK6 5JU6A 2BPOA 1P4RA 3C48A 4P4UA 2C5LA 1H6AA 3UW3A 3NEJA 2CNKA 3KBOA 3OJWA 3FF4A 2WNHA 3UYKA 3ZS9A 4DDTA 4J1NA 5FIUA 4JJAA 5JHGB 1JFTA 5F1PA 3QW4B 1P9OA 3B52X 4I4TB 3SR4A 5EJFA 5DM4A 3REFA 3V4LA 7ABPA 2AEMA 2HIAA 3C16C 3WLRA 3RFVA 3Q7RA 2NO1A 1QMPA 3H2HA 4FT4A 3HUUA 3TWOA 4YT5A 3GNQA 4QUKA 4UCXA 2QTAA 1K6EA 3LHKA 2OGTA 1US8B 1X1QA 2C5EA 2ESRA 2H4FA 2PL3A 1EGVB 3F1LA 3S2IA 4AX4A 5GWXA 1JFLA 3EPHA 5KDDA 3E3NA 2FZVA 3O8NA 1IQRA 1ACMA 4NJEB 4MR8A 5JMTA 1GPWB 3KAPA 5DBIA 2ZJAA 3ZEAA 4XASA 5KSPA 1FE8A 1IULA 3NZEA 2Q5CA 1ZN8A 3RIMA 1JIJA 1JSRA 1WV1A 3S8EA 1T24A 1ZUHA 3P4UA 1PT7A 4FKZA 1UXOA 2UYOA 3HXLA 5K0EA 1IM8A 1W94A 1K06A 3TG8A 1E99A 4OFBA 4BO2A 2BFEA 4I19A 1SUWA 4KQKA 1S7CA 4UHEA 1DKUA 3UWMA 2YBEA 4KHPB 3WA7A 4HZUA 1W4LA 1M10A 1JHYA 3ZEIA 1XCLA 4IZIA 1QYRA 4PQFA 4DMHA 5DNUA 1XI2A 1RRGA 1Z8DA 4URFA 3IAHA 2EXXA 4IG4A 3OQNA 1BHQ1 3U44A 2FH5B 4XI9A 4ZALA 1UMDB 1BVHA 5ADVA 2FPXA 4B4DA 3CPJB 3KDSE 3MJCA 1N2GA 4H4EA 3CZ9A 4S24A 4TQAA 2PKYX 3UAZA 5A03A 1F9EA 1E7RA 5I7SA 4XVQA 1J22A 2FUKA 4B9EA 4Y1RB 2EL9A 4JQSA 5KYUA 5IYZA 1XMSA 4YXFA 2GPWA 1QGYA 1MIOA 1OI2A 3KXPA 3FBWA 3LUAA 3P19A 3DBLA 4BO5A 5K8CA 2VZ8A 2GN4A 3T7EA 4G0VA 1U2DA 2BONA 5DO9A 3AEUB 4QODA 4F4DA 1EXNA 4CIWA 1K2WA 1SUIA 1TVMA 3DKRA 1NAHA 3H7AA 1DB3A 5DEIA 4HH3C 3ZVRA 4ZRNA 1S8FA 2EBFX 1VM6A 1IUKA 4FHGA 3IAFA 1RJGA 3QBEA 3NOVA 3H2JA 1Z6GA 4EVSA 2AFHA 2WG0A 3KUUA 4DWVA 2GK6A 5I8ZA 1P2DA 4M9CA 1NXSA 2P69A 1FTSA 3TRKA 4ZJUA 3TTSA 2VHWA 5JFOA 3F98A 4JH0A 4A8PA 5FWXB 5IK2A 3IAM6 1ZD1A 3IOYA 1PL6A 5DFAA 4JI1B 1NL3A 4N5IX 3NWJA 1ZCAA 3W5HA 4KE7A 4G23A 4D6YA 5D5PA 2P9QA 2H2GA 1E3MA 1EFPA 2H11A 4CIDA 4PLZA 4RE6A 4I8IA 1Z6XA 4PWZA 1DAKA 2VPPA 1CY6A 3BHJA 5LXTF 5J58A 2BFCB 2IKQA 1VB5A 2P1RA 5DLEA 4B2YA 5CVJA 1RNLA 3U7HB 2PRZA 2K2WA 3QMWA 1RBZA 4DIMA 1YHYA 5DI9A 3NJ4A 2GYYA 1W25A 3N87A 1GCGA 3ABSB 5SYAA 1V8OA 1HNWB 4GP6A 1GU0A 1ZUNA 3BTSA 3WWZA 5BUQA 2AN3A 1YMQA 2PS3A 3GFFA 3TTWA 4B6SA 2B37A 2CDNA 4IVQA 4RKEA 4HTFA 5DKFA 2HBRA 1FK8A 2H2WA 2VA8A 3FUVA 3I6QA 4L7VA 2R4TA 4MHSA 4PGHA 4EJFA 4Z3KA 4C3UA 3ASUA 5TGDA 2ZYDA 3O4GA 1YE3A 1YB4A 4ENTA 3ZHVA 1XAIA 2BSXA 2I76A 2JIBA 2ZOSA 3DC7A 3EPKA 1G5RA 1WKCA 3DOHA 1RLIA 1QH8B 2Q8NA 3THYB 1PZHA 4J0KA 4MR8B 1G8HA 2XYGA 5B6JA 5CT4A 4JHLA 5CNKA 3WSWA 3THWA 1JLLB 1ZGBA 2GVDC 1MEOA 2P0YA 1A9PA 3K7EA 2I4MA 3IIIA 2XIQA 3DE0X 4HDCA 1P7CA 2M6RA 1R50A 5D1NA 4ITRC 5ESDA 3TQOA 4EPTA 4WNAA 1FX1A 4I3GA 4YJ2A 1M5UA 3CEMA 1UBJS 4JC4A 3T34A 3HXMA 3EZ6A 5D86A 4QECA 1CEXA 3T1VA 4KPYA 3FPFA 4KO8A 1DHRA 4DARA 3K9QO 1UZNA 3VH3A 1O3YA 4X1YA 3W5CA 1FP4B 3GCDA 1PZFA 2ZTHA 1UR5A 4H1TA 3CW2A 1F5SA 1U8AA 1MC4A 4E4TA 2VNSA 1ZH2A 2WMOB 4RA6A 1S2LA 1QCCA 3C2QA 1NPYA 1ZK0A 3CPEA 1DT3A 1KMHB 4C2UA 2ZWIA 3N2ZB 2IODA 4R0VA 2B4TO 2IHUA 3ZOKA 2VQSA 3N28A 2P2NA 4ZFNA 1MVOA 3WB9A 5BT9A 1TMYA 2O2EA 4KYIB 2NPFA 1PK9A 5ALKA 3R6LA 1CE8B 5ENDA 3NOXA 4MQFA 4TXNA 4BJ5A 1PG0A 3BMNB 3G2IA 4OQQA 3OQ6A 5GADl 3U6KA 2VRBA 5BWBA 3L84A 2DJIA 4KAFA 2AK3A 1NXVA 1DIHA 3MOGA 1NXQA 4HWOA 4P32A 4PYRA 4X6LA 3CXUA 1J2YA 3CLSC 1K7SN 4JI2B 2ZI4A 4P98A 3ND6A 3VPXA 4BO9A 4CEJB 1AKTA 3I2HA 1OT3A 2AFHB 2F1JA 4MGYR 1SXJC 4NNOA 2Y77A 1RLTA 3CJTA 4GEGA 3PUZA 1K7FB 3KL4A 1QQ5A 1XZQA 4F5EA 4IDHA 3QTTA 3TB6A 2FB9A 3G0BA 4RU1A 3GU3A 2DR0A 2F17A 3HP7A 4BNKA 2YHAA 1EFPB 1NN1A 1JQ3A 3CMMA 4ZVVA 2RH5A 3GNTA 3N86A 5CFZA 3Q7EA 3VR4D 3U1BA 4Q3CA 4LF6B 1WUTA 2QROA 3FMIA 3NALA 4FYXA 4BMNA 3L7JA 5JBNA 1HH4A 5IVPA 4JKYA 3SZRA 4DNQA 5AK0A 2BTQB 2Q9BA 3AMVA 4LXIA 1SBCA 3ZYCA 1UXHA 1ZUNB 4RD1A 5HKOA 2VYCA 3EIHA 4U9UA 2C59A 1LX6A 4UBLA 3NH9A 2ZR8A 3VR2A 4B17A 1BQ3A 2N75A 2BLNA 2EHDA 2RB5A 4PG4A 5DOZA 5JNRA 4EGQA 4YJ3A 1QPBA 3GVHA 4B35A 3TVDA 5D01A 3CZCA 4BB9A 2I2BA 1QK3A 2YFKA 4IXDA 5J2TB 1PS0A 1BMFD 4XW2A 2WM8A 1CYDA 2I65A 3SLRA 1RWKA 5CG1A 2C07A 4L8FA 3T95A 3WBBA 3K1ZA 5BSEA 3P45A 2VH2A 2X6TA 4YPOA 1EM8B 5J4LA 1ODTC 3W5UA 4HAWA 1GAEO 2JB9A 3VNRA 2ZW9A 3BN3A 3SJCA 1J0AA 1UOOA 2DFLA 2IFTA 4LDAA 3NHKA 1WDMA 3DFZA 3L0DA 3S2UA 4YJ2B 1ZLXA 2JJ2D 3PHHA 3K8QA 4F3CA 4MMZB 1Q92A 1DTWA 2HRCA 2LIPA 1YJCA 3DWFA 4YMHA 4HD8A 5KNBD 4OD0A 3A0UA 3RD5A 3TIFA 4BFZA 2WJ4A 4OSOA 5HUJA 2GVNA 2RG1A 3T0FA 3GLHA 3MBKA 2GPTA 2ZT5A 3I3OA 1PIWA 3O0DA 4FEAA 4X1YB 1W4CA 4YP6A 1VLZA 5SV2A 3TD9A 4IVPA 4BFCA 1S89A 4W5JA 4XEHA 5DM1A 3IHKA 1P9NA 1JR3E 3FSEA 4R8SA 5SZHB 3CMCO 4NP6A 2W11A 3P0IA 2DR2A 2OG1A 3DBVO 1T6NA 4OUKX 1TKCA 4JJ7A 3QF7A 2XWQA 3FOZA 5DYWA 4XWTA 3VHRA 4DRXA 1ZRHA 2CFTA 3IE2A 2PLAA 4OM8A 3IPYA 3FNGA 4MQFB 4PM4A 4Q9LA 5TVKA 3SQDA 2J5KA 3UUWA 3V55A 5FLKA 4DLWA 5JXGA 3RU3A 5DE3A 4XDYA 5A3SA 1R10A 2W22A 1XK6A 2A92A 3NUZA 5LZ4A 1VPDA 1ECJA 3NHWA 1LLFA 2Q62A 3K6RA 3LPDA 3JU3A 3ANYB 5BPHA 4BGIA 5AVXA 2X6RA 4NXMB 2JD2A 2H7YA 3PKJA 4I1UA 4RF3A 3BXGA 2H7CA 3QYAA 1H3NA 3QH4A 3U7EB 5DTIA 3FCYA 4CNBA 4POOA 2KMLA 4GQAA 4D3YA 1T2UA 3KXLA 1QM5A 1VBMA 2H4XA 4R2IA 3ZDQA 1LK0A 1PKXA 2FPIA 3LKVA 4D9BA 5EXTA 3JRXA 4WOBA 5G4LA 2OCAA 4YECA 2XDQA 2XA1A 3G9TA 4UEWA 3UK2A 1ECPA 4HWPA 3R7NA 2GKGA 2OC9A 3CNOA 4ZYTA 1SN7A 3NAZA 9LDBA 2OQ2A 2N47A 4ABYA 3ZVKA 1TGYA 4JZKA 1UKBA 4JEUA 1OJ7A 2VNIA 3RJ5A 4H60A 1TFRA 1QRTA 1ORDA 4UTOA 1GSOA 3IERA 5LD2B 3TRJA 1IDN1 2R5NA 2YWBA 3PQFA 2HK9A 4Y9UA 5ICFA 1IVNA 2QAGB 3R9KA 5K6AA 4QNNA 5D3MB 2ZQZA 3W5IA 5ALJA 3AI3A 4QLOA 5LLSA 1TJ4A 1N57A 3RB8A 4FOOA 1TEZA 2WHPA 1U63A 3SHOA 2CVFA 3H87A 4YJ3B 4HT3B 2BEVB 1OX6A 2Z9DA 1H3FA 4UNPA 1RW4A 4NHOA 3EZ2A 1W0JA 3VZSA 2GYUA 2YDXA 2H31A 4GP7A 3F6SA 3GN2A 3I30X 2EWMA 5JY6A 1LH0A 3HTXA 2I2WA 3DMFA 3IDQA 4HDMA 5AI9A 1RP1A 2ZB8A 1XXLA 3Q72A 2R8OA 2P3OA 3IVAA 3ORSA 2C4KA 3SJ7A 5JSZA 1GQOA 3AT1A 5JXJA 4S04A 2JJMA 4YJFA 4DR6B 1EH5A 4TV8F 3GQBA 6REQB 3H75A 3GRKA 3SJBA 5KNBH 2VK2A 2AD5A 5C8YF 3TS1A 5L7WA 2CFSA 3L8MA 4L0QA 3U61B 1W75A 3E4DA 2C94A 2I7VA 3F9RA 2OYCA 3QPAA 4RULA 5KYGA 1RFGE 2IZ5A 3DPIA 3EZNA 4DG5A 1N5IA 2HTEA 1Y7LA 1DLIA 3D8HA 4EZBA 1U28A 2A9JA 2C57A 4L4RA 4KSCA 4WCVA 4YO7A 3R8FA 2VQ3A 2ZVJA 5JVDF 3RVOA 1ZRSA 3D1VA 4QNMA 3ZJVA 1F7UA 2FF5A 1E94E 4L1KA 1X7XA 3LFHA 3NV9A 2VP6A 5E3JA 5L6MB 1P18A 3EIFA 3KKZA 4CGZA 1W73A 5LLDA 2UVPB 2YV3A 4WKNA 2A0UA 3CTMA 1YB1A 3MILA 4CN8A 2QRHA 3N0VA 1NBIA 3VNVA 4MW0A 4D8UA 1X14A 1ZIPA 2CVOA 3AILA 2RGWA 3QE3A 4OH1A 3DHEA 4L8VA 5FLEX 4JOCA 1N5LA 1ISGA 4PQYA 2QRQA 4DA8A 3AF1A 2ODWA 4YRNA 4C0HA 3DUWA 3L4BA 3PRYA 2E55A 2WU1A 3MWLA 3ET4A 3FUXA 4L5YA 1UDRA 3FGOA 3O4HA 1H94A 5DPMA 3FCXA 3L41A 3ZGOA 4EQ6A 2H1VA 2F9FA 1O4WA 3GRYA 3EVAA 2O2JA 1CB7A 4HQKA 4I66A 1KZ6A 1MT0A 1UC5B 2DUJA 2LD4A 3QUQA 4JOSA 2P8JA 3AKDA 2R6AA 3U7JA 4YUAA 2OCDA 2AOXA 1HORA 4R51A 3I62A 2FPIB 2HQBA 2EJCA 3GEGA 1E2GA 5AHOA 2AC2A 2V98A 5LQMA 5AIAA 1VMAA 3VZRA 5IM4F 1SWVA 3WL3A 1JEQB 2NXWA 4GE0A 3L6RA 4PONA 3I92A 3MTAA 3L6DA 3EWNA 3VC3A 1Z7BA 2P2SA 821PA 2BP7A 5I45A 5JAPA 3GBVA 3NLLA 1C1HA 3CNBA 4J9VA 4ZYYA 2DPXA 5JAZA 3GBPA 2JCSA 2VBIA 3NDIA 3NNSA 4J0EA 2AFHE 3MMPA 3TMAA 1OFIA 4WZAA 4FI3F 3ZK8A 2GBCA 4QYSA 2FN9A 4GSKA 1NJ2A 2FFBA 1XU7A 2PUWA 3KE9A 3PNBA 3KOWA 3LH5A 5BO5A 2AC4A 2CJPA 1RXIA 1EG7A 1L7VC 2IL1A 3HA3A 5B1SA 2BR5A 2I0FA 5BNWA 1NTOA 4UEQA 2HFKA 2JNWA 2WHPB 5ED4A 2H4WA 1L5WA 1F8GA 1XZIA 1RJDA 2ETXA 2JAXA 2VDUE 2H0RA 5T4EA 1MKYA 4ZCSA 1KRXA 3ETHA 4QOSA 3GG2A 1K92A 5FDFA 2NZ2A 2PFKA 1MXFA 2JBAA 5F64A 1FPQA 1Q11A 3HLYA 4LZJA 3WWPA 4YV0A 2AF3C 2REBA 4WKGA 1SUPA 1U0FA 5HFJA 4CF4A 1FS5A 1UK6A 3EEIA 4YRKA 2D2EA 2CVQA 3MGAA 2EJVA 1WKVA 5A02A 2BFDA 4YJFB 3FIUA 1TZKA 2QX8A 3HHPA 3A1UA 4N03A 1ZI9A 5EJ5A 1RWVA 3GLRA 2D1TA 4CM3A 4F96A 1Y7IA 3D2BA 3OZUA 3BIXA 3TQFA 4E13A 1Q16A 2GUGA 1Z56C 3GDFA 3VMMA 1EP1B 3W5JA 6NULA 4E5DA 2QGNA 4HO1X 1CY1A 4XTCS 4EM6A 3TMKA 2FWNA 1RD4A 4KXMA 2Z95A 3DHYA 1CY4A 2A57A 1OGIA 4RHCA 2H1CA 4Q4HA 3ND5A 1A8IA 4FYYA 2BE9A 4NG4A 4N3AA 3ZV4A 3E23A 1XN1A 1KDRA 4PG7A 1X7XB 4JJFA 4X1IA 3FX2A 1N2XA 1Z2NX 4DTCA 1RKVA 2AVDA 1IB6A 3T4UA 2AN4A 2IOFK 5AUOB 3N58A 2XB9A 4DMFA 5FJIA 2Y9PB 2XUKA 5EPEA 4F11A 4HNTA 3D8TA 2YV4A 3NBUA 4MAMA 3WLFA 2Z83A 4MUNA 1XZJA 2VCEA 3BWBA 1LDBA 3RPEA 5A5EA 4RY9A 3DZBA 2J09A 2LCQA 5I51A 2Q8PA 3N7TA 1N32B 2UYYA 2O5CA 4F56A 3LUPA 4LWPA 1AKYA 3GVIA 2IU3A 3ZNNA 5AW4A 3IBTA 2P6PA 2XVMA 5A4FS 4EQ6B 2VO1A 4K6FA 2HJVA 3HA5A 1GNSA 3VX4A 4R71A 1JQEA 4Q39A 5JSHA 1P1KA 4Z9FA 3VVMA 5BR8B 1WSDA 1W47A 3FZYA 1UDBA 3EVCA 4TYPA 1DIAA 4FFLA 5EESA 3ZUPA 4DN6A 3F9CA 4OREX 3VU3A 3T5GA 1C50A 3ZGNA 1RE0A 4MPJA 4X54A 4JC0A 5GZ3A 3P2KA 3HKBA 2HR1A 2YJNA 1F8FA 1Q7CA 2BP7B 3EGDA 4YMVA 1H1DA 4XIYA 1Y9EA 1FC0A 2QUBA 3DF9A 1SUDA 1AK2A 4HVLA 1EK5A 2EG9A 1Z28A 1GPKA 1YSCA 2DY0A 2PJUA 3GEPA 2WJHA 1NXWA 2EFDB 3OAAA 4HN9A 5FA6A 3FTEA 1Y6FA 4MVJM 2WE8A 4ZCMA 1GKUB 4I4CA 2AZ4A 4IPTA 1OGYA 5KSZA 1X74A 1XJ0A 2VDMB 3DLTA 4GXRA 4OJYA 3RTAA 5CX1A 4LTNA 1PFUA 2YMQA 4NZNA 5I4CA 3P0RA 3KE8A 3WYBA 2ONZA 3RIXA 2G4VA 4M0UA 4BNLA 1E5DA 4M2LA 2ISSD 1AXRA 1THZA 3LBNA 1MPTA 2HNKA 3D5QA 1MA0A 1R4NB 1W19A 5B4TA 1YBHA 1UJ4A 3BTOA 3SIWA 5JCZA 4PTLA 1KO8A 1UIRA 3L05A 1KKLA 3CX7A 4PC1A 3V33A 5JCOC 2YFQA 5AR1A 4YT8A 4NKRA 4NOMA 3FYDA 3SIRA 4D9MA 2J87A 1QGUA 3KB6A 2OFPA 2AG6A 2BFDB 5K9ZA 2VPZA 3PSAA 3W3AA 3SF0A 5IF9A 1T5IA 3H3JA 4YGYA 4R1PA 1Q91A 4FEYA 1HRKA 4MDYA 5DBGA 5DMXA 3ZQUA 2CF5A 4EJSB 2ARKA 1SOVA 1LF5A 1GOTA 2Q1YA 4EZEA 1GPNA 2IYLD 9ABPA 3ETJA 4US2R 4OLAA 3HCCA 6LDHA 4JXZA 5EJ9A 3DZCA 2O0JA 5K8VA 4DB4A 2CXSA 1MDBA 2ORIA 2EGGA 1C1XA 3KLOA 5CDFE 5E2AA 1LZKA 3ZHYA 2V7GA 4Q4HB 1IYZA 2PQ6A 2AQ8A 1QO7A 3HA7A 5CFLA 1BDMA 4RF5A 4FDTA 5CNJA 2J5QA 3IQFA 2EEZA 4PVCA 1DXQA 3LAWA 1P2SA 3R5KA 4E6PA 4EDHA 3U9TA 1AF4A 2W9XA 4ZT7A 3WWCA 3HY6A 4OP3A 3D6MA 4X1KB 3REQA 1A2KC 1OBHA 3GJYA 3BFKA 3SWWA 2FE4A 4ID3A 4C14A 3A58B 1PJSA 4OV6B 1I9CA 3UPTA 1JQJC 1I6LA 5HF5A 4ZOLB 1SQ5A 1X1AA 4PSDA 2I80A 4TM7A 1I51A 3WLNA 5KYXB 2QUKA 3PKZA 4WINA 4C0WA 4JP3A 4H3VA 3LUHA 5JATA 1D2NA 1QKKA 1PZMA 1RC1A 3FA2A 1QH9A 2IF0A 3RKUA 4WZZA 4FNMA 5FWAA 2C84A 2AX3A 3HZRA 1FUYB 2HWWA 3BMQB 2X9QA 5BWNA 5HVNA 4N8EA 4UMEA 1MZPA 2JRCA 3HKBB 1NXTA 4GPTA 3OJXA 1IU9A 2AUTA 3TIGA 1F7VA 1U6IA 2P2DA 4R8MA 4BWYA 1ZQ9A 3R4CA 4Q9KA 4F2HA 4FFWA 1JIQA 2J0EA 2WZDA 3PFCA 3IQHX 4GX2A 1WB9A 1FLDA 1BWSA 3TUZC 1KI1A 3S2YA 2AE1A 3A6KA 4GMXA 4IKOA 5CX1B 3CX3A 3SQMA 3UUGA 2BMVA 4EKYA 2H3EA 5FPYA 2NVOA 4G0OA 3LSYA 521PA 4HX2A 3K32A 4QGFA 2ADFA 2ODPA 2QL6A 2QUZA 1ID8A 4NNJA 4YAKA 1X1EA 3VR0A 1P31A 3LVQE 1NV8A 1BXZA 1HUQA 2F8TA 1RABA 1ACLA 1C8BA 2EKZA 2GB4A 3DV9A 1H8HD 1PT9A 2P78A 2WD7B 3JSXA 4V2IA 4XTRA 1GNPA 4Y2GA 3SQNA 1Z2AA 5IT9A 4D5EA 4QE3A 5J43A 1KKMA 1OH6A 2JA1A 3W0LB 1JJ7A 5B58T 4OL9A 1CIJA 1NLFA 4IY1A 3RBAA 1M34B 4KXVA 1PQPA 1SXHA 3N2KA 1OH8A 3TCNA 3OZWA 1I2MA 3C70A 4QPNA 1V37A 3ZGYA 2WPNA 1YQUA 2GZRA 5IKEA 4M38A 4P2GA 1JEDA 1FXSA 1UBEA 4CHGA 3B1VA 5A3QA 4E94A 1T3GA 2AB0A 4BMYA 3I6YA 3VZDA 3UATA 3F96A 1C1XB 1SHJA 1YBVA 5I6DA 4FGZA 1T3HA 2XXBA 4QDZA 1GYQA 1ODJA 1SU7A 3FPSA 3F8TA 4FOPA 2C9OA 4HYYA 1E69A 1TM2A 1XTKA 5BV0A 4E70A 5CB6A 4RH3A 2Q6IA 2UZ0A 3WSVA 4TYNA 2EDAA 4UTPA 4TWJA 1KZ1A 3PP8A 3EC7A 1BE0A 3TLEA 5BR1A 2VYND 1T4CB 1R0SA 2GF2A 2XYPA 3NANA 1JH8A 2GWRA 4LJLA 4QFBA 3G5TA 1K5DA 1FA9A 4KITB 2Y6UA 1F4PA 1EGQA 3EG9A 4X6UA 2C5HA 4B8YA 2WJ6A 1QHHA 1JECA 4P3NA 5EA2A 4B47A 1TU3A 5LOVB 4MZXA 2XQJA 3D0KA 3GH3A 4B31A 2GN6A 1V8ZA 1MGOA 1JG2A 4Q12A 3DO8A 2AXPA 3F71A 3ESQA 4HMOA 4UMVA 5BR4A 3M3HA 2F90A 1SC4A 2VBGA 1FP2A 4REOA 5EXEA 4E46A 4TYQA 1ZFNA 2EIXA 1H1TA 3QMMA 5A0TA 1H9CA 4ZO6A 3OIVA 3PE3A 2ZBQA 1GPUA 1HZJA 1A2QA 1IBRA 1JPVA 2GEUA 3EYWA 4FR2A 3GPIA 2Q7OE 3TOCA 4IHQA 3ZU2A 5CD9A 1J8VA 1I7QB 3CUEF 3QEAZ 5KOJA 4GR4A 4FXPA 4A8JA 3PYMA 1VE5A 3PLRA 1ZD5A 2YDYA 1TFUA 4YP0A 1C4OA 3PQCA 2DX7A 3JQEA 3CWZA 4QQRA 5FTJA 1TD1A 5H9VA 5IYZF 4TYMA 2FDCA 1NR1A 5C1BA 3AR3A 3AEZA 4Q3AA 4C6RA 2C20A 1R4MB 2QTHA 2PKWA 5ECGC 4J1TA 4AECA 2RGDA 1AGNA 1DG3A 1RC0A 1Z4MA 5H81A 4BP9A 1RMQA 3SZMA 1B7GO 1U9IC 1XAJA 2VDOB 2GJSA 1HDYA 1CV2A 2HMSA 1B4DA 4RVCA 2X14A 4EUFA 4B3GA 2OTCA 4RPIA 2FCAA 2JIPA 1EX6A 3M5CA 3QLUC 3WYFA 2MWMA 3LVFO 1KMCA 3QUSA 1PFVA 4HF7A 5H7XA 1ND6A 3EIOA 5E0OA 1V47A 1DTEA 3LUDA 3ZHQA 3OFND 4JR0A 1G7TA 3WK5A 2X9GA 4LVOA 2VRWA 3WRWA 2ETVA 3M6FA 2I6SA 2EGHA 3C45A 1DJPA 1B26A 2QUJA 4OHRA 3OZXA 5AJZA 3ZZMA 4F7DA 4MPTA 3WYGA 4MMXB 2GCPA 4MINA 3NC4A 4OYHA 4FMDF 4IAOA 4C29A 3A05A 3OUZA 5IJ0A 1K8QA 2BGNA 2I4TA 2PY6A 2XQFA 1YE5A 2I7TA 2IIVA 4QT0A 3N2KB 1CUWA 3HEMA 2CW5A 5ALNA 2JVIA 2G5GX 3B3GA 1PJTA 3UC5A 5L95A 1Y4UA 4GI1A 1X3SA 3TAUA 4EITA 2PH5A 1S8NA 4JT8A 5L4LA 3GXBA 2YYAA 4EFLA 4GKBA 3QKTA 3GVCA 3KAJA 3UENA 2XOEA 3UJ8A 1D2CA 2AE2A 4J0HA 2ZJ8A 2H65A 2QI9F 1PX2A 1ODFA 4QBIA 3VDQA 1AGXA 3DTVA 4JGGA 3KYJB 2RAVA 4LE2A 3R7DA 1M1NB 3B6MA 2NQTA 3GLQA 2IGBA 3CRW1 1Y7PA 2OPBA 5L4NA 4X3PA 2Q27A 2Q4DA 3I52A 4ZVLA 4ER5A 2QSUA 3GNSA 5CCXA 1PGPA 2DC1A 4KBGA 5HPYB 1MU0A 3TQQA 3A9RA 5DGTA 1QYVA 1TTHA 2CXOA 1HT0A 3QPDA 3JQPA 4JX8A 5JHHB 1OWLA 5FWDA 4LRYA 3UKJA 4AM8A 3TPFA 1CUCA 1TRKA 2O0KA 2P6MA 3KT3A 4WXEA 1V3TA 5J1TB 4AN1A 3CXRA 4ZI2A 1NYQA 3F74A 3CKYA 4I3HA 3W7AA 4GECA 2HPAA 3PFIA 4QICA 1Y8RB 3U19A 5AVOA 4X66B 2H2AA 1WPXA 2O2SA 3I1FA 1QDLB 4EKNB 4CG2A 3FE2A 1ORHA 2VG8A 4L8YA 1U1EA 4C22A 4DLVA 4IVNA 3K09A 3NDRA 3F8SA 2DTEA 3UJ6A 1OXSC 5BN5B 4PBSA 4BVFA 1SG6A 4JI3B 2QPTA 2IYTA 1LSSA 2IYUA 2O9JA 1T0IA 2VP5A 2PS1A 1FPMA 3Q9NA 5B7QA 5KOJB 3FXAA 3EAFA 4RS3A 4QXQA 1IVSA 4EF6A 2KBEA 1NJ8A 2ZBRA 4IOKA 4OX9Y 1GTZA 2YXPX 3FVRA 2PV7A 5KPJA 3CTPA 1RAHA 1RXEA 4IIHA 4D8YA 1ICIA 1F12A 1I4OA 3QVUA 5DASA 4DA9A 2UUPA 2P2GA 2W6MA 2FQYA 2XE6A 3B9RA 4O2AA 5AHKA 3N6VA 4K9SA 3C6ZA 3H1FA 4M0FA 621PA 5LWHA 3C3DA 3OU2A 2Y0EA 3AB8A 3FLMA 2OXIA 3AFHA 2JGDB 3OD5A 3W8NA 3ZHSA 4B85A 1GLNA 4EA9A 3DO6A 3ZE6A 3QVOA 1N2OA 2QTBA 3TI9A 3MAGA 1S3IA 3GLSA 1P44A 5FYQA 1S1CA 4Y3UA 3EPLA 3HKDA 2PAFA 3WRXA 4OM7A 2B21A 3JQDA 3PU6A 4W5OA 4F2WA 4PXAA 3K9FC 3ELWA 3OX4A 8MHTA 1Y81A 4RANA 1DOZA 2JFPA 4QTXA 2ONKA 5CVEA 2PU7A 3NC0C 1ZN7A 1Z3IX 4IKEA 3UB4A 5TLSA 4D43A 2GERA 2C54A 3B12A 4M1WA 3UXHA 5AIBA 4WECA 3RVBA 3HDTA 1XU4A 2EF1A 2QM0A 4J75A 5IJ0B 4Y7CA 2V97A 3E5RA 1S8OA 1WXDA 4MVJD 4Y9TA 3EPRA 3RRFA 2F3TA 2YIDA 1ABEA 4N3NA 4Q3EA 3HJUA 2OVBA 3RRYA 5TMPA 1FDVA 1T4GA 1XXHB 2IYFA 1SG9A 1OC2A 2NYVA 2NAPA 3TZEA 5BQOA 4YUXA 1YONA 4XWKA 3O1IC 3T54A 1JDPA 2V6BA 5KYNA 1ZM3A 3CZ5A 4PTYA 2CBGA 3VR1A 1D4FA 3K15A 4GLLA 1E9VA 1EJ6A 2BHNA 2IA5A 4QUGA 2F2TA 2O3QA 4WXYB 2FG5A 1FNNA 1CQWA 4P1ZA 2OKCA 1M34E 5KX5F 1DUIA 1ZJWA 1H0RA 1T25A 3RKRA 2NTVA 1DIBA 3WGUA 3CVWA 1KP3A 1U8UA 4EMSA 3WK7A 5BSRA 2PXCA 1GA6A 2D5AA 2JAWA 2Z0MA 4R1QA 1JDTA 4TS3A 4UE3S 5IM5A 4CIYA 3I64A 2D74A 1TAQA 4ASUA 1UWVA 2ZM6B 1UM9B 1NXPA 4MWTA 1D4AA 1W0KA 4KIFA 4TL9A 1E9SA 3QI2A 3PNVA 1CUUA 3NCHA 1D9ZA 2O48X 5IUKC 4R68A 4YS6A 1OKKA 1V5IA 1U8XX 1B8OA 5FOTA 3PL5A 4FYMA 4JQOA 1IJFA 3E8XA 1JN0A 3OCUA 1VKRA 5CA0B 1MHPA 4KH1A 1ZX1A 1NKTA 4J6EA 3JWHA 4G4IA 4CKCA 2A3RA 3RTGA 1I0IA 3EFOA 5CH3A 5GZ1A 4MO2A 1STOA 3P2YA 3CYFA 2NU8A 4WCFA 4P7FA 2WYUA 3KJFA 3O5AA 5ARBA 1XTPA 1LC3A 2I7DA 3UGTA 1GTVA 2QN3A 3HJFA 3WIOA 2AD1A 4O4HB 4JZYA 3JAMA 2DKFA 1MJGA 5DGXA 1HYGA 2QPLA 1K7YA 3AP1A 3D0QA 3KPJA 5LJIA 1GDHA 1CR6A 1UBCA 3L49A 2YWXA 3HGMA 4KX3A 1KJYA 1T8TA 3U7GA 1AMNA 1ADYA 1NTRA 3LQ1A 2YJ6A 1K3TA 4D3SA 4BJ6A 5FAKA 5IN5A 4FINA 3ZH9B 5MGNA 1SCAA 2HMAA 4LKRA 4XQCA 4PCLA 2Q8QA 1GTJ1 3A4TA 1MX3A 1D6SA 1ZY2A 4KDRA 4B8ZA 4UXIA 5KSYA 2D0IA 2Z4SA 4QREA 4IIFA 3ZK9A 3PI7A 4ZVRA 4C0BA 4ZJYA 3IUQA 4P80A 4BAUA 4CKEA 1W4RA 3KPUA 4V0MA 2PZ8A 1CQXA 3UMFA 1TB4A 2I67A 2ZIGA 5LQCA 5CB8A 3DXYA 2PWPA 3DAGA 1JR4A 3TGLA 4TN1A 1L1FA 2M6LA 2YH2A 1E2LA 1H5NA 3ONNA 2F4NA 3HA2A 5A3VA 1W87A 3WKDA 1KU0A 3HKDB 1RQ2A 5BVHA 2B6HA 1EDEA 3RC7A 4HUTA 2HJSA 3OE7D 1XYGA 2NACA 3LU1A 4FIDA 4UBJA 1TMGE 2GCIA 3LPCA 4G63A 4TL8A 1NX6A 4LV6A 4Q00A 1R15A 2PKEA 4MVJH 3ROFA 1TGVA 2R62A 1YMVA 3NRBA 4N8SA 2X1MA 4FHDA 4W9NA 3HN2A 5TRTA 1N5KA 4XWOA 1YASA 3D6TB 4MIEA 3M2TA 4MUYA 3G02A 2PYDA 1USWA 3DL4A 4FOLA 3R5FA 4L95C 5KNCD 2I33A 2X8WA 3AL3A 3U56A 2ET6A 4OMDA 4V1CI 1RVDA 1DC4A 1FRFS 3GARA 3RTCA 2DWPA 2XUJA 5E7QA 1KYWA 1FQJA 4TZTA 1X42A 1LVGA 3FFBA 2H5LA 3SOPA 5LLTA 2PBFA 3OICA 4CIAA 3JAWA 4O2BB 1SUCA 1DMRA 4AJPA 4CXMA 4KO2S 2GHRA 3PQ6A 2PMKA 3SGLA 1QOZA 4RORA 1U2DC 5EUQB 2XOKA 4R0NA 1PTJC 4BO3A 2IHBA 1Q14A 3FBGA 1WPRA 2F67A 2G8NA 4MWDA 1KDYA 4DY6A 2DVMA 3VTKA 4XUDA 2NVBA 3MJSA 4RD0A 4WZ6A 1J1ZA 2DPGA 4RK7A 2VS1A 1V3UA 3AXSA 4CT5A 3DVLA 2PJZA 5K3SA 4L8GA 5TPWB 4JP8A 5D3QA 3I9NA 2HCRA 4IJVA 2DFDA 3EZGA 1DO2A 1I5RA 5KYTA 3GDWA 3CRMA 4N4AA 2JW5A 2VJAA 3ELDA 1C4XA 3UH1A 1GZDA 3HVHA 2BMAA 3K9CA 3G5AA 4HEA6 1XEXA 1SQGA 1AQ6A 1XMVA 3ZQKA 4D9GA 4AUNA 3KK0A 4XLLA 1DKMA 2OGUA 3NDPA 1J4AA 1K68A 4IOMA 3UV6A 1GLGA 1E2PA 4OI4A 3Q2IA 5E9WA 1GNLA 2CUZA 2Y4NA 5M04A 1EB9A 5B36A 4YAWA 1GR0A 3E05A 5DGIA 3OLYA 3R40A 2XMDA 3JSAA 2TYSB 4EY4A 4RUKA 4WE3A 3EFOB 1UJBA 2XVYA 2NU8B 4DVJA 4NICA 5EZQA 4YQYA 1FZTA 2UUCB 3RO7A 2V7XA 4Q9HA 3OQIA 4OHWA 4JS0A 4U2GA 5H80A 5DNDA 1C3JA 3COPA 2PRSA 1ZNYA 2VLBA 2MSKA 3BXFA 3V7NA 2HKIA 1IXZA 1U9CA 2FZ5A 3V8RA 2M9MA 3OESA 1SXQA 3D6JA 5DK4A 1IAVA 4MWEA 5WRFA 3GJXC 2EBUA 5LP1A 1OQAA 1PHPA 1AU9A 1VBKA 4CG0A 3P9SA 3AVUA 1SJ9A 1E9CA 2A5FA 4KXXA 5BYJA 4EO9A 5KS2A 1DO0A 2VDPB 3DYBA 3UWSA 1UXKA 4D44A 5JLAA 1EZ1A 4JLNA 2VVTA 1OBVA 3BSFA 1JE0A 3GFGA 3NT2A 4JVMA 4X95A 3TTUA 1ZOOA 4YPFA 2HMYB 1GUFA 5CPFA 1E1MA 1MTOA 3A6ZA 4CKEB 3KZNA 4EHJA 1UMKA 2AN9A 3DR3A 3UCFA 1MB3A 1WUKS 3QXXA 4KMOA 3N59A 4BEJA 3X1WA 4CEIA 5AJUA 3E82A 5DNVA 4MITA 2VZLA 3QFHA 4P4GA 2HTFA 1I1QB 4JJKA 4CT4B 4RIHA 3RRXA 3ZNQA 1Z63A 1HOXA 5JD5A 4C78A 4ZEXA 2B0JA 4HDOB 3A25A 1DX6A 3BFXA 2CWWA 3DEJA 1P2FA 3H5LA 3MQ2A 4H31A 4J7AA 2ZROA 4MV7A 1E6UA 4OQEA 4UUPA 2FHPA 2YQ5A 4J2HA 5KNCH 3NRJA 2IXFA 4MR7A 4PINA 2VCHA 3NYRA 3ROXA 2Q41A 1RXYA 4NU0A 4YRCA 2VSXA 3NPMA 4WNCA 1Z5VA 3KJXA 2DWOA 5GVSA 4O63O 2H5EA 3A6EA 2ANCA 2VK8A 2JIOA 4IIJA 5AQ1A 1KR5A 1WP4A 3TLGA 3VU9A 3RGWS 2OZEA 3MD0A 4IQ4A 2ZFUA 4CIVA 4C2BA 1E2BA 1KYIA 1KQ3A 1O58A 2GXUA 3H4IA 4HNAB 3A2LA 3JAWB 1ODSA 4KQEA 4H1UA 4MR9A 4Q3DA 3OZAA 3W2HA 3VC1A 4GGOA 4F4UA 4DEYA 2RK3A 1DADA 3B51X 3HNRA 1V6CA 4LV5B 4XCVA 3TO5A 2B7CA 2SKDA 1ST3A 3UHAA 5JALA 2R6CA 1D6NA 3ZLJA 1M6VA 3Q3VA 4JKOA 2OPHA 3UGKA 3GEMA 3HJHA 1TZCA 5H4HA 4HLQB 4MEAA 3MIIA 1GLVA 2C5AA 2J9ZB 3E81A 3QXGA 2HU5A 5LQSA 4E0BA 1XVVA 3IS3A 2BN4A 4LQ4A 5HDQA 4HFRA 4OQ4A 3IJ5A 4Z3OA 2RHRA 2QMYA 2B99A 2IUTA 3GT0A 1XXHE 4LXQA 2IZZA 2ISCA 2GRAA 3DQZA 4IWXA 4BO7A 4N18A 2CFRA 2GUWA 4A7PA 3G5UA 1AT1A 1VIDA 5ALZA 3T4XA 1CDEA 3TNYA 2B8EA 2RIPA 2ZYGA 3F3KA 1KY4A 3KR2A 2RJ3A 3NBFA 4KL8S 3VBCA 4F46A 4ZCIA 1DEKA 1Z2DA 4HNQA 2GZ3A 1A5SB 1P7ZA 3QOYA 4KLZA 1CEQA 2MINA 3PQ8A 1L4YA 3UAOA 2B83A 1J9GA 1Z37A 4KGXA 4RK6A 4LEIA 4ZAWA 3IEMA 1ZD9A 4YIHA 1QXSA 2AZTA 3O03A 3IODA 5AM5A 1F0YA 1F8YA 3HCNA 3V4VB 1E66A 1RIIA 3BUSA 3OQIB 4N5LA 2QAGC 4LDPA 4NMLA 5HF8A 3ROTA 4P86A 3WLJA 3OOSA 3L7LA 1VCIA 4G5YA 2HLHA 3T7RA 4E2XA 1O9BA 4L9SA 4NFLA 4XJSA 2PSDA 1G18A 4HPXB 1GN9A 2ZUBA 4LGMA 2XECA 2B4AA 1ZUWA 1IOVA 1U7TA 3MTQA 4IJWA 3F5MA 2YS7A 1GGKA 4EPRA 1Q1BA 3LWNA 3FNHA 4I9HA 1CUZA 1NUTA 2JANA 4RM2A 4H17A 3PPYA 2QP9X 2R6GA 3F49S 2I1WA 2G6TA 1QIEA 2P8SA 1IRIA 4HLDA 5FULA 3ZZNA 4EO4A 4IIDA 3BD8A 1QGDA 2KM1A 1DHTA 1DC6A 2UVDA 2X4GA 3DV2A 3GEBA 4LK3A 1QFJA 5HF6A 5ALEA 3K8OE 1RHJA 2FKAA 1E59A 3DKKA 4UTZA 5FUBA 1AS0A 4J2TA 3R8CA 2FEAA 4DUZB 3LQ4A 2FSVC 3VI3B 1BE6A 3WS7A 2RC5A 4BMOB 3FF1A 4PYQA 1T36B 1E4YA 1TQDA 3FGPA 3L3BA 3U4IA 4MSUA 4LBZA 4D56A 2QN9A 3U3DA 1HE2A 2WPDD 3ANSA 5T6BA 4YCSA 2B8JA 2H1WA 5FEUA 2XVAA 4R8KA 4G0MA 2BSAA 4MR7B 5IRCD 3PFNA 4L8LA 2LE0A 1KS9A 1N0VC 4AL4A 4K86A 2CCJA 2PE5A 4RD4A 3CF4A 3O2JA 1G3QA 4U6SA 4MQLA 4B45A 3IYLW 4IQ0A 4CCYA 3RWOA 3RIHA 3TLGB 1U3UA 3LYLA 3TW0A 4U02A 4D57A 1QKIA 1O9GA 3VOTA 1A04A 3C3XA 4RVUA 4AQYB 4L07A 2O1WA 1GFSA 4R7TA 2NUAB 2J4DA 3M1LA 5HZKA 1BQ4A 1ZOPA 5TY0A 1J70A 3AU8A 2WFZA 1OUMA 3WQRA 2CUKA 1MJGM 4EI8A 1M9NA 2W43A 4JQYA 3FPEA 1M6VB 1ST2A 4G0PA 1CRPA 1C3OA 1D6MA 4JVNA 2Q3CA 3NWPA 4IMRA 4CKYA 1VLVA 5MN5A 3GX1A 1CP2A 3DDNA 3NX4A 3VJRA 3TM5A 1OBCA 4G97A 3B1XA 4DLYA 4BP1A 1QLHA 2A33A 3TBFA 4ZYWA 3AOEA 4YMLA 1WKBA 4DXHA 2P4EA 2XMQA 1U8YA 2XR1A 3LIPA 5LB2A 2ZQYA 3R09A 5C8DA 3GRCA 3PQ7A 2VAXA 3I9OA 3WA6A 2PIDA 2BFNA 2ECFA 3M4JA 5DM60 4W5QA 2C5BA 2QN6A 4GOMD 3I0ZA 5EYPA 2O07A 2EYQA 4KPFC 3HRHA 4LJRA 4TS9A 4A15A 3INTA 4PN3A 1HEIA 4FGUA 5EE9A 4KVZA 2MINB 1IG3A 3G8CA 1GQRA 3V32A 5HRUA 4WLOA 1IG0A 1N4DA 4D4JA 1NC3A 1UDWA 2ASVA 2AOTB 2B7LA 2H6EA 2JGJA 2XQIA 3DE3X 3I05A 3O8LA 10MHA 1DEOA 1RQXA 3S40A 5DMHA 3BM5A 3ORHA 3AJEA 3QX3A 4MV6A 4XAQA 1FMLA 1GEEA 3KXIA 4BNDB 5JMOA 4DAEA 3H5RA 4FZRA 4DCNA 2HRBA 4WIAA 1M0WA 3AGQA 4IDGA 4LXTA 3D7NA 4PXSA 1J0CA 2WTBA 4W1SA 1Y1PA 4BNNA 3NTOA 4GOLD 3O73A 1ZESA 2ODBA 1VSTA 4J7XA 5G2OA 4C0XA 2VF2A 3RJZA 5LZ5A 3GYBA 1EVEA 2ZIZA 2ZBEA 4ETMA 3A4LA 1R8JA 4X64B 5DSTA 1W8IA 5K2MA 2WG2A 3ZHRA 2XCQA 3Q85A 4G9GA 3RT1A 4CUKA 1Y6RA 5ILOA 4LXHA 1FJXA 4GLFA 1Y5NA 2B98A 4QTZA 4LWZA 4RFLA 5ALUA 5C5DA 3F6RA 1PVOA 2B3TA 1SIBE 4L3VA 2GVZC 2AJLI 4WKCA 1AK1A 3DVRX 3BJRA 5DP1A 1M2NA 2AR7A 3NVMB 3WMRA 4BN0A 3UPUA 3EXEA 5FL3A 1CZHA 3K30A 3OM9A 3IBSA 3KJHA 3UH0A 1AKWA 1E0DA 5DNYB 1LWOA 1X2EA 3E8MA 3FPKA 1QVVA 3LVBA 3QELA 2P5TB 4OFWA 3SLKA 4AVYA 3S1LA 1T3ZA 1HFEL 4LRSB 3LGXA 1EWKA 1U9ZA 4UM8B 4EKDA 1UJ5A 4Y1GA 1M66A 1TMOA 2OWDA 4WDQA 1E2FA 1H2XA 1ZOSA 1H6CA 4P8RA 4J29A 1BHSA 4RQTA 4CCYB 2ZQ5A 2H92A 2CV2A 1B00A 4BMPB 2ZXEA 2JLQA 4RF4A 1N34B 2WMDA 2E37A 2FW7A 1ISJA 3WLIA 2GN2A 4CL0A 4URVR 3FCCA 2QRZA 2EQ5A 2I54A 5CRIA 4NZYA 3ONVA 1EGAA 1TF7A 3M4NA 4C3VA 1C3OB 1Z73A 4M6WA 4EOGA 3JD4A 1KYQA 3C3AA 4H35A 1QBGA 1B1CA 1BNCA 3PZRA 2AEJA 1A1VA 1RI2A 1TI7A 3LHSA 2J3HA 3OUUA 2OFXA 4BIMA 4YRFA 1L3IA 3S99A 3C97A 3SSNA 1NP6A 1TM5E 1PR0A 4COOA 1TOAA 2LWIA 1ZVJA 3IMCA 3EAQA 2YKGA 2P30A 5FADA 4D02A 3D5TA 1E4EA 4BDSA 4W5RA 3ZU3A 1PFQA 1JFSA 2IYQA 1VPWA 2ZBVA 2CLIB 1OFHA 1ONNA 2Q2OA 2WJ3A 5EHNA 4D2IA 4GX1A 2CWDA 1KYXA 3B1WA 4E4YA 1MBZA 5JWHA 2IYYA 4WK4B 4DQUA 4ZQBA 5JJCA 2WWYA 2DE0X 4DLBA 4XRRA 2VZ9A 3ZKAA 1Z15A 3UHFA 5SYNA 3R0QA 2BBOA 3IP9A 4BP3A 4NS1A 3UMBA 2PT5A 2FW1A 1NR7A 1SZPA 2HGZA 2I71A 3KETA 4GI3A 3SBXA 1J2TA 3S55A 4CF3A 4QYMA 4E15A 1NUQA 2OQVA 1P1RA 1S02A 4R41A 4H6WA 1WOMA 4TSFD 1XDBA 3P0JA 1OHHD 1VPEA 2X8LA 3DL2A 3QXJA 4JUDX 3KOOA 1ADCA 4FNAA 4LHVA 5CLJA 2H5JA 3W1WA 1EMDA 1U3FA 4LVUA 3VOBA 5DLDA 3Q3JB 3PRHA 1P0MA 3WLOA 4CV2A 1QH0A 3USES 4M21A 4BNJA 4OJNA 3IB3A 5TSDA 3VOAA 1MB9A 2X15A 1E9FA 3LYAA 4OGWA 5THQA 5C3MA 5A7FA 5JMWA 3VU1A 4URXR 5EEGA 5GGYA 4JLSA 5DYIA 1K75A 3DULA 2JLZA 1Z4LA 1KFEB 5AKKA 1PN3A 3Q7PA 3F5FA 4I1PA 1PEYA 3AKYA 1XBTA 1WSAA 2QHXA 2WJPA 4P7KA 3JAKB 3VGJA 3ZYZA 1K9SA 3ITEA 1R9JA 3LXRA 3AUSA 3PQ3A 3U31A 4EJSC 1V1JA 3LF2A 2FQ1A 1WZ2A 4RKFA 3LTEA 1JIIA 2E4WA 2JAHA 2PRIA 1SA0A 4FN4A 4ALLA 1KBQA 2VQEB 2P3LA 3GGSA 4HR7A 1IOLA 1Z7EA 1K97A 2XUDA 2ID4A 3IV7A 3MBOA 4RK4A 1W48A 3PC7A 2G8LA 3N76A 3UT0A 4HTAA 3V8BA 4F6RB 1KP9A 2QXUA 4MV9A 1NVEA 2VJPA 5G40A 5CJJA 4U5XA 2QTMA 3LP6A 2CNWD 2JJQA 2NAFA 1L6IA 1DQSA 4IUCS 4UE6A 1LWNA 2H1LA 4Y8VA 4N47A 3WOVA 2CF6A 4HQOA 3ZG6A 3H6HA 4MQ5A 3B2QA 4G36A 4JLDA 5EMJA 1GAWA 2FX2A 2ACWA 2H1SA 4H27A 4WY2A 4EIWA 1DCMA 1JA0A 2LVBA 4WW0A 3ANNA 5TNXA 4H1WA 1JI0A 1T8SA 2R25B 2QLTA 2Y92A 5JH7A 3T3DA 1YFJA 3PVSA 3PXUA 4JJ4A 3NT4A 2VYVD 1JGTA 1M1UA 3L2OB 5F12A 2Q3MA 4XKJA 5AVRA 1NHWA 2J4CA 4Q7KA 4X8LA 4F97A 4ZC8A 2PMDA 2ZR9A 3WMXA 4DJEC 1VQ1A 3WP1B 2IW3A 3ED1A 4KV9A 1LU9A 3R8XA 3TRDA 5BQ5A 2GETA 4AJ2A 1TTTA 2WIKA 4OG2A 2P6NA 2XA2A 3E5HA 3MGBA 4LXXA 4UUMA 1PQ4A 4EFMA 5BSMA 1NW4A 2XJ9A 2CZGA 3VYWA 5B6IA 1L5FA 3MW8A 5GOTA 3ONEA 4XWGA 1GQ2A 2F1IA 4ACAA 3ORQA 4MLZA 5IDVA 2NM0A 1DUVG 4ND2A 1XDDA 4X6YA 4CM6A 2JI8A 4R2KA 1E4EB 3AH8A 5DYTA 4LFCB 3G8YA 3GB9A 1UP4A 3C6XA 4I9UA 4IIGA 4UU1A 5J2UA 5DGCA 3HYNA 5HFAA 1XQ9A 1L5VA 5KU1A 1E5VA 3AEXA 3O90A 3PFHA 2J3LA 1G5IA 3DVQX 2Z1MA 3PHLA 3H2YA 2PL1A 2JLAA 2JIZD 3OIUA 5DYYA 3NDJA 1Z4PX 3RFFA 2OBBA 4P3KA 4HNUA 1SB8A 3H1GA 2CNBA 2PFGA 4NTZA 1RZUA 1WW3A 3V2UA 3TUIC 5JUWA 2E21A 4GGPA 1KMQA 1M8PA 2PPVA 3MCZA 3PWKA 1E1NA 2BWJA 4J91A 4CRWB 4ETIA 2PRKA 3NHPA 3N7AA 5C5CA 2N1MA 2VJQA 2B34A 5G3YA 2ZCJA 3C6BA 1RR6A 4RO0A 4RELA 5J59A 3TRHA 3C6QA 1NG1A 1MAWA 1HE1C 5T4BA 4KMRA 1N6NA 5A7GA 3RIYA 3IAAA 1R0ZA 3LQKA 2ZT7A 1PJ8A 2MYTA 1JDNA 1TADA 1ENPA 4F5WA 4PCAA 4QFDA 2V6JA 1S4MA 1U98A 4PG5A 3JWIA 3GEEA 1WVGA 1YWGO 1VIYA 1MJNA 3EHEA 4UU7A 5KCMA 4BRWA 9GPBA 5JNVA 4Q3KA 3BHNA 2G5PA 3H5AA 3CX4A 5BP7A 2Y1KA 5M3BA 4O4IA 3BJEA 1M8GA 1SA0B 3NHAA 2FPWA 3D7LA 4TGLA 5A4JA 1PV4A 2VH1A 3BAFA 1YR6A 1C7QA 1KDZA 2DU8A 5BUSA 1I6MA 4F92B 5REQA 5JPIA 4U63A 2PYZA 2MMGA 3CH7A 4QPDA 3EUFA 8GPBA 1G60A 2TMGA 4B73A 2HXSA 4GEKA 4OXRA 1OREA 2XCRB 5ADUS 2CXTA 1JBQA 5TS3A 3W6NA 3IPAA 3A37A 4DR3B 5LA6B 1TF2A 1WULS 4H2DA 1RTTA 3DDHA 4B5KA 4C6HA 3EC1A 3O3CA 1CZUA 5HXAA 4YJHA 1FJGB 2V59A 4KG7A 2H2FA 1H2EA 4QBGB 4DWWA 1XG5A 4DPMA 4QDUA 1E64A 3QLEA 3D7MA 3LW7A 5IASA 5LQUA 3NW9A 5BYBA 3S81A 5I5EA 2IT1A 3GF4A 1MN6A 2HIHA 2PT6A 4KYVA 1P1CA 1NGSA 4LECA 1F4VA 4RY8A 1J97A 4QQKA 2QM7A 1JTEA 3H0KA 3SFTA 5FWNA 4DCPA 4GDMA 1KGSA 3R5SA 2Q5IA 4QJ5A 1YZTA 2VDKB 2R1VA 3A4YA 2FEXA 3CEHA 1NT4A 2QR3A 3LECA 3V1UA 1YR3A 8ABPA 4MGZR 1RQGA 1A96A 1ZAKA 3FGNA 2BSQA 3D2CA 5DX1A 1QIGA 3K35A 2HO5A 2Q3EA 4DMKA 2B92A 3QQ5A 5HQTA 2QSYA 3BG5A 4DQLA 3INNA 1OVGA 4PFQA 3UTCA 3N2YA 1IUPA 1V5FA 1NJGA 3DFKA 5JANA 2R86A 4QHTA 5J2UB 2AMYA 4A4DA 1K8XB 4DYVA 3T94A 1N0UA 2DKOA 1NRIA 5CG2A 2FRDA 3RIGA 3C14C 1QR2A 2G83A 4BWVA 3PA8A 1CEYA 1QE5A 4U0JA 4Z3DA 3GP8A 4QTYA 1U2ZA 1A5TA 3FR8A 2XF8A 1GGHA 5DGHA 4RKWA 4YHHB 2H07A 3HL4A 1EU1A 2XB4A 1QO9A 2WI8A 2VPIA 4TZ6A 2C3MA 5JJ5A 1OI7A 4V0KA 1VJCA 2BVNA 3LGAA 3OM8A 1XRSB 5LUBA 1QOPB 1QAOA 4AY3A 3BB1A 1YCHA 2IRWA 1R0WA 2M1XA 1C9KA 1HT2E 5CVDA 1MEEA 1KAGA 5JCJA 4Q7EA 1BE8A 4HLUA 1KAEA 2V58A 4IMIB 4NCIA 3EEQA 2GFHA 4KQIA 4RFSB 2FZKA 4M0KA 2IQIA 4RE5A 5A4AA 1TA0A 4OJKA 3L0YA 3L82B 4YRDA 1Y3AA 3C5HA 3DKIA 4TTIA 3BRWA 3TEJA 1MAVA 1QGAA 2JFXA 3U9SA 4ZICA 4Z4FA 4KUGA 1JXMA 1K5GA 5IAEA 4P82A 4WBNB 2OYRA 1LV7A 3IHLA 4JLUA 1S3SA 3AJDA 1R16A 3BKWA 2EZ8A 3CHYA 4XLZA 3K0AA 5J5AA 3ZDYB 2ZYHA 2NN3C 1QVAA 1VRVA 2NT4A 3KEOA 1Q0PA 2R7AA 1Q12A 2PD6A 3KCNA 3LY9A 1P5JA 4YJDA 2G07A 2QS9A 1XKXA 3FJOA 1T0BA 3AYXB 3JW8A 5REQB 4HOYA 2G0NA 2F3SA 3L1HA 5F7XA 2RGGA 3PNYA 3QSGA 4QIHA 1MOSA 1GL3A 1ZNZA 2GAIA 3AERB 3P71T 5JNLA 1GQSA 1XJQA 3AP3A 5BQXA 1OAKA 1IHUA 4P4NA 9ATCA 3J7AC 5HIKA 3MCUA 2H29A 2AMLA 3SYRA 2GNPA 2W58A 3R3SA 3IFSA 4JJGA 4YJHB 4PYJA 3MB5A 4UDOA 1K63A 4ZPXA 1Y4DE 4FHEA 4EATA 1OB5A 1C2YA 1DWPA 1V5GA 4EKIA 3JY6A 3CPSA 4K5QA 1UMBB 2AFRA 3HBAA 4HDNA 4I1IA 4PZPA 2Q1UA 3RVMA 2RHBA 4KLAA 2ZGVA 4BNTA 3R5JA 4LF8B 1SBHA 2PO7A 3VVBA 4KK4A 3LDGA 1GCAA 3JD0A 2VP2A 3R75A 4PQRA 1KEZA 3BWVA 3MS7A 4WOPA 2IHVA 2QLBA 3N0TA 3P2JA 5CVTA 3WFIA 4RZ2A 3QIVA 4U7FA 5EP4A 3GFBA 4KP7A 3KG2A 1CQJA 2Z6QA 1U7XA 2M98A 4RGVA 1KGDA 2FG7C 4PO9A 1EBBA 3N6XA 3OCJA 1Y34E 1PU2A 3LQ2A 2FU5C 4NULA 1KJQA 2Y27A 5EQDA 5BQFA 4V24A 3LT4A 2R66A 4NBTA 4P0PB 1II8A 2QA5A 1VP9A 1GN8A 3UGQA 1ELOA 2DLNA 2GHTA 2ZJZA 2P4SA 3D64A 4OXQA 4OP1A 3UM9A 4BQRA 3L7OA 2JFHA 2ZJ1A 3OKFA 1BVUA 4WI1A 1G5TA 3GJ0A 3ZU5A 5ALFA 1X7HA 4OFXA 2F64A 5FCDA 1G21A 4MVJG 4EUHA 2E2WA 5HUQA 3WDSA 2XTAA 1XPRA 3K72B 3BWYA 2IBTA 3TSWA 4U4AA 2QRVB 1UZUA 5JRJA 1J5XA 4YMWA 4HJRA 1UQTA 2PM8A 3NJ8A 4TV9A 4RW0A 4Y1FA 1BXKA 2G5TA 2E82A 4B3TB 5DHSA 4F4IA 4TTPA 3IIEA 1SR8A 4EY6A 1BYIA 4AO7A 2Y1FA 5HJ5A 1IEXA 2XRZA 3DHWC 1O5OA 3QOXA 3ZWOA 1P5FA 1HKUA 5I3CA 1PD1A 2BEUA 2VL7A 1M3SA 4RLSA 1GAQA 4TLLB 2RHWA 3ZCUA 2I29A 5IJWA 1FYXA 1CPYA 4B87A 5AW1A 4RSMA 1NW6A 4DG9A 1AZTA 2OV3A 1OFTA 1V7ZA 3A70A 4M1QA 3UA3A 2Q45A 1L0BA 1T4BA 4DQ0A 4ZAYA 1ZOLA 1H6BA 2R8YA 2RGCA 3ASVA 4JKIA 3MTDA 2V7QD 5GIOE 4ARIA 2VNJA 4Z49A 4IGFA 1HR0B 2VN8A 4OUDA 4JP5A 5I4BA 1RYMA 1BH6A 1MRNA 3QVGA 4MQEA 3EDQA 5G0SA 1O6GA 2RHCA 3LPLA 4DR7B 4CTMA 1Q1EA 2E5WA 5EIBD 4HHEA 4ZOEA 4ND1A 2YXNA 2QJWA 1EUQA 1KDPA 3FTCA 2F3RA 2ZSEA 3OPMA 5IT0A 3OTOB 3V3KA 1LPPA 4N6GA 1SXPA 3L5KA 1C4KA 1OLUA 2JJ8A 3GD5A 2HMUA 4UEKA 3HYSA 5H3HA 2G25A 3KUDA 5IFLA 3A9UA 1DAGA 2WZQA 5KQLA 4ENRA 5JZSA 1Q3HA 3SY8A 3LMKA 1UAGA 1M54A 3MN1A 4QUEA 3AX6A 3LLMA 5G3ZA 3RAJA 3PDIB 1OA1A 1HE5A 1D2GA 3SIPA 1NATA 1R5BA 3NHSA 3O9MA 3OQPA 4TQ9A 5CHEA 3QKIA 1E3DA 3RYHB 4JDPA 3QRWA 3UW1A 4KN6A 3WLEA 1W96A 3N75A 1C7JA 4JYMA 3DD5A 4TZ0A 2FUCA 3Q6IA 1ZGZA 1T1SA 2QZ4A 1G1MA 1PZXA 3WBKA 2X3FA 4PGGA 5CIYA 1KY3A 4JV5B 3H65A 4IIJF 1TXGA 2EFGA 3Q8KA 3H2KA 3NJRA 3C5CA 1H2HA 2YYYA 4MWCA 1KQGA 4NH0A 4D4IA 3TB4A 5GJVC 3ED5A 4EY8A 4G56A 2O0HA 1ULZA 1II8B 3AY0A 4ZA2A 4ARZA 2YJZA 1T6XA 4I1SA 1KY2A 1UBOS 1TC2A 3U7QA 4DT1B 2Z56A 5BN3A 2OXEA 1ZIOA 2V9CA 1GG5A 2Z5FA 4M99A 4Z8XA 3FI0A 3PVZA 4NG5A 3LV8A 3MS2A 1VL0A 4ZAGA 5EUBA 2FKNA 4ZO4A 4ZIRA 4RTQA 5BVGA 9LDTA 3IEIA 1JDJA 2IUSA 4LDQA 4KRYA 1G6OA 4IHJF 4BO4A 1JHMA 1Q0ZA 4F3YA 4F6LA 2IW1A 2AOUA 5TB5A 2QTVA 4OQYA 1E1RA 2J3QA 3TZKA 3RSCA 3IUBA 4ERNA 5KQMA 3JQ9C 4TKVB 3NHZA 3H5VA 1J8MF 2Q4EA 1MOQA 3QTLA 1DV1A 2Q2QA 3JQ7B 4KAAA 3WGMA 5LVAA 3FPAA 5F35A 4FFSA 1OXTA 4HATA 4IDOA 4M7OA 5K8UA 3C7CB 7REQB 5EZYB 3PXGA 2FPLA 3QE2A 1QGED 4Q9JA 4Y9RA 3V97A 2PL9A 1YZLA 4DEVA 7YASA 5JV5A 3HEAA 1XA4A 2FQQA 2H1HA 3DE2X 3DL7A 3HQ4O 5H82A 2C8VA 1WDKA 3ZWXA 4V03A 4PFJA 1ZW6A 2YHBA 2BZ0A 3I8SA 3JZIA 3GMIA 4NYIQ 5L3ZA 4OTZA 3DM9B 5EWLB 3ZV6A 4EVRA 3GLKA 5JXIA 1KOGA 5BUZA 2VOEA 1D4ZA 5IUJC 3H4VA 1C14A 1C7ZA 2WV9A 4G85A 3ZWDA 1EM6A 3PK0A 1JUDA 1SVSA 2R8RA 3L7YA 3QVGB 1MP0A 4FJ0A 1Y1LA 4KVAA 4LOJA 2OSBA 3G2QA 4AJIA 1LV8A 3EY9A 3M9WA 5KVCA 3I9FA 4KN8A 3FSRA 3T1QA 3L1IA 4ZZ3A 2BHSA 1V1RA 2XODA 1U4OA 4EHBA 2PJDA 1DNPA 4S05A 2HV8A 2HNAA 1DIOB 4K6KA 4LYHA 4TRMA 5EJAA 4Y2YA 3DEFA 5LYJA 1YQWA 1OLUB 2B82A 2O0MA 1NVUQ 2GTIA 4HDAA 1AHPA 2JVKA 3PNKA 4LE0A 4BNUA 1KFJB 5D00A 5JTTA 1ZWKA 4BNFA 3QYFA 4OLFA 4M55A 4NEGA 5AICA 4D4HA 2BGWA 2NNWB 3CUSA 4NIMA 1E63A 3C1AA 1K3UB 4KE9A 4CLRA 1K4MA 3IEUA 4PX9A 2M1ZA 4X8MA 2RHHA 3NM4A 3Q3HA 4IINA 4JSRA 4M3NA 2JZOA 5HZHA 5CVVA 1EHCA 3I9V1 4CQMA 4E5VA 2V5AA 1SQ0A 4MQUA 3NM5A 1B41A 3OD1A 4EFNA 5HRCA 4MLPA 2O8CA 1JBEA 1FVFA 3U9LA 1XNJA 1P0FA 5TQVA 4A3SA 4GBED 5KTMA 4TPKA 2O6HA 4ZAVA 3HABA 4LYGA 4DGQA 2AR9A 2DFPA 2I34A 3SF8B 2ATXA 2JATA 2H85A 2CZCA 4EGFA 2ZBDA 2C95A 4MGHA 2MSDB 1E60A 3JRWA 2JK1A 2DT5A 3N2GA 3PFKA 1Q57A 4Z99A 3ROKA 4ZDJA 5JS8A 4HXGA 1Z6AA 5BN3B 4I55F 3O4FA 4PZ0A 1WNTA 2GKSA 3G85A 1SCUB 1RPAA 1U0OC 1Z5OA 5DTMA 2QUIA 2J67A 4JL6A 4ZIRB 4DXDA 4M9SA 4WKOA 3HSKA 3L1JA 4EDFA 3TFOA 2PUHA 3MJRA 4ZWNA 5IAJA 1Q7GA 3HRKA 1UPFA 2P9TA 4B09A 5A6SA 3HDJA 1NOIA 2MYNA 4Z0TA 3RLFA 1W46A 1ZJ4A 1F38A 3EGVA 3T7AA 3L9WA 3PICA 2OUKA 1GAXA 1Z6TA 1JXAA 1RZVA 1QZTA 3F7TA 4B0OA 1CUXA 1JKFA 1SVLA 1WE2A 2GXQA 2J07A 4L28A 4MQ6A 4DDUA 4ZI7F 1RZ3A 4HRVA 5JRDS 2PKQP 3NDBB 1T9KA 2ZWVA 3O9ZA 4RETA 1E98A 1V48A 3C8DA 4R1UA 3ACBA 1X87A 4MNTA 2P5UA 1GGVA 1XRMA 4DUPA 3QVWA 1IHOA 1EEXB 2VT3A 1OU0A 1VE7A 4NZ9A 3ZDFA 3BGIA 1M6EX 1IBKB 4PYIA 4JLPA 4RKRA 5BWCA 3WFJA 5I7HA 1R9GA 4YUWA 4JBLA 1E0SA 1UBFA 2FX5A 2WDZA 3DVAA 4FDLA 5GINE 5JZOA 2IDJA 1UZLA 1MJFA 1W5BA 2AK2A 3ELYA 3V3TA 2D5CA 4DA7A 5F76A 2JASA 1SCJA 2FLKA 3I23A 5GJWC 1VSBA 4R5MA 4PTZA 5IJZA 2HB6A 1AD2A 2WD8A 3CZAA 4TZKA 3VPAA 1CETA 3KVYA 3KVOA 2FMFA 1O9HA 3F7OA 4LTMA 2HGSA 3T5TA 4BN4A 2CUNA 3HWX1 1SOAA 4DLLA 4RH0A 4P81A 2IEGA 5AI4A 1NM5C 1THMA 3W2IA 4Z9XA 2BDEA 4EW6A 1HQKA 3EISA 2ZRQA 2ONJA 2FN7A 1RWWA 1WUIS 1FSSA 3LW8A 4RTKA 3SOZA 3HUDA 3N0WA 2HPZA 3ZY2A 2YMPA 3G1TA 3VKVA 3WYNA 3AVTA 2ZBFA 1NPTO 1R7RA 4KZKA 4NE7A 3AJRA 2CNNA 4WXHA 2NU9A 3JARA 3ZXYA 3G89A 3VV3A 4BQEA 5A4KA 2NV2B 2F59A 2DFKB 4U5QA 1EUCA 4IS2A 3NU1A 3NTLA 5D6OA 1UPCA 3VJKA 2W6OA 5F1YA 1E3QA 1MO5A 4FGSA 5CA1B 4PO8A 5KJ6A 5EWJA 4N3BA 3UB3A 4CLRB 3OHSX 4JP1A 5E6UA 2SCUA 1BXGA 3HXTA 4KR7A 2V6MA 1PDVA 3EGOA 3QZUA 2EFYA 5ILGA 1C4WA 3PNMA 4RZHA 2ZT6A 4CKXA 4CQMB 3AHDA 1YHZA 5GPBA 3MCVA 1N7GA 2EW1A 4PHCA 4LMPA 1J49A 2ZRLA 2J9GA 1L5OA 3CT4A 1GILA 3LDFA 2O8CB 4GO1A 4MZDA