5M3BA

Structure of cobinamide-bound btuf mutant w66l, the periplasmic vitamin b12 binding protein in e.coli
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
244
structure length
228
Chain Sequence
APRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTLQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vitamin B12-binding protein
publication title Conformational Change of a Tryptophan Residue in BtuF Facilitates Binding and Transport of Cobinamide by the Vitamin B12 Transporter BtuCD-F.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 78
structure length 228
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5m3bA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5m3bA02
4FNAA 1QH1A 3UJPA 1K0FA 3G9QA 1KAHA 1H1LA 3AEQB 4WZAA 2X4LA 3ZK7A 3BE6A 5KOJA 4INPA 2OV3A 3AETB 4GICA 1G20A 4WESB 4WZBA 3PDIA 2Q8QA 3R5TA 3MWFA 5GGXA 1QGUB 1K75A 3U7QB 4FKMA 3AEUA 2R79A 4WN9A 2XUZA 3AERB 4H0FA 3ZKAA 5JJ5A 5M3BA 2RG7A 1ESZA 1QH8B 3GI1A 3R5SA 4XPIA 1M1NA 4NNPA 5BVGB 2AFHA 1FP4B 2MINA 2M6KA 4TKVA 1QH1B 3HXPA 2PRSA 4WNAA 4HMPA 4OXRA 2AFIA 4UDOA 4IRMA 3K1AB 1M34B 4G09A 4HMOA 1N4DA 2WHYA 5M29A 3HJTA 4HN9A 5KOHA 3MWGA 2OGWA 3PSHA 1EFDN 1N2CA 4TKUB 3ZK8A 3TLKA 2XQVA 2O1EA 3HH8A 4WZBB 4NNOA 1XVLA 5HDQA 3MINA 1L5HA 4OVKA 4WN9B 4ND8B 1M1YA 4UDNA 3AESA 3BE5A 1G21B 5JG7A 3TNYA 4FI3F 5CX1B 3EIWA 2Q8PA 1MIOB 3LHSA 5B58T 4N01A 5BVHB 4UTPA 5FLYA 2XDQA 4DBLE 5JOQA 3AEQA 4OXQA 3MD9A 4B8YA 1PQ4A 2PS0A 1H1LB 4WZAB 3AETA 2R7AA 5GGYA 2WI8A 4WESA 4MO9A 1N2CB 1KAEA 2M6LA 5KOJB 3ZTTA 5M2QA 1QGUA 3AEKA 4INOA 1G20B 2PS3A 3U7QA 1N2ZA 3TEFA 3AERA 2QI9F 3PDIB 2XV1A 3CX3A 3EIXA 1QH8A 3AEUB 3PSAA 4HMQA 2OSVA 2XH8A 4CL2A 4K3VA 2OV1A 1FP4A 5BVGA 4XPIB 3ZK9A 4LJSA 1M1NB 3NU1A 2ETVA 2AFHB 1KARA 2MINB 3MFQA 3K1AA 1M34A 2XDQB 4TKVB 4UTOA 5I4KA 4WNAB 4M7OA 2AFIB 1K7SN 4MLZA 4TKUA 4PAGA 5KOHB 5HX7A 2YNMD 5CR9A 2YNMC 4MDYA 4LS3A 4G07A 3AEKB 1N4AA 4FILA 1L5HB 4MX8A 2PHZA 3MINB 4ND8A 5AFSA 1G21A 2PS9A 1TOAA 5CX1A 5JPDA 5KHLB 1M1YB 1MIOA 3AESB 4H59A 4PM4A 3LI2A 1PSZA 1K2VN 2XY4A 4BBPA 5BVHA 5M34A
chains in the Genus database with same CATH superfamily
1US8B 2LTAA 3DT6A 1Q91A 1DOHA 5C81A 1XLUA 2ZP1A 3DFKA 4MS3B 2G6BA 2R6DA 4IIFA 3EVZA 4IIVA 4AKTA 3K6JA 4FYYA 1CDEA 1CR2A 1YGYA 4FT2A 4B82A 4JR0A 2W4MA 4BUJA 3ABZA 4J94A 3WAGA 1OMOA 3WLSA 1T2UA 3PI6A 4N5HX 2GWRA 1AN9A 4FNOA 3BBPA 3L7IA 4EGCB 2WD7A 2O59A 1EFVA 2VPPA 3KVOA 4OQPA 4R2IA 3IEUA 2PKXA 4H3KB 4UFOA 3FM9A 1I0LA 1E9RA 1YC5A 2VBIA 3DVQX 5CNMA 3U5ZB 3OZCA 3MMSA 5EQTA 3MXTA 1HGXA 2OVFA 3PEVA 3KR9A 2VH5R 2BMFA 1QZZA 1HZJA 4KE6A 1V9CA 4RKWA 4TV8A 4P0PB 3EQZA 1O94A 3FLMA 1NU8A 4ZVVA 4JI0B 3OECA 3V4FA 3HMKA 1ZMTA 3C4QA 4LPSA 1TUEA 5HVNA 4IDPA 3QVMA 1JMVA 2XTAA 4RVHA 3W6UA 2I22A 3PP8A 5DWVA 3ZZ1A 5L4LA 1ZRHA 1IPFA 2ZRBA 1TUBA 2ZI7A 3WL3A 1Z68A 3UJHA 4W5OA 3C48A 2Y0EA 1KI6A 1Z45A 2GO7A 3E5HA 4DIKA 2QVBA 3V7YA 2GZ2A 3O0DA 5L3QA 2V3CC 1V95A 5TLSA 2R8PA 4AW9A 1SKYB 3EFEA 1EWKA 1PT9A 2QTNA 1YR2A 3VZDA 2YOFA 5GIPE 1SUFA 1VLHA 1JAXA 2FSPA 2FRDC 3BMQA 3EFOA 3U7IA 1HFKA 3EPLA 1FCJA 1I3KA 1CUIA 3B5EA 3FHLA 4ZAVA 2GJ8A 1WF6A 1KJ8A 3JQ7B 4LOHA 5LOVF 4P93A 4O8ZA 2PEZA 4RMIA 4QRDA 3D31A 3NHKA 3ZCRA 1WCWA 3I2IA 2W2OA 2EC5A 4RY9A 3S2GA 3WXBA 2AK3A 1FLAA 4JOBA 2IYLD 2J3HA 4Q05A 2KPOA 5CTAA 1R2QA 3L7JA 3VJMA 1WZUA 3BWMA 1CUHA 1GTMA 3KZCA 4N76A 1RPTA 3FLBA 1IBSA 4BCCA 5JY1A 1CR4A 2GKSA 5AKGA 1QFJA 1SIWA 2HRZA 2WAXA 3CF6R 4P4LA 5EVJA 3VVLA 1IJKA 1ISSA 2HUPA 2XIJA 4YLEA 4KAXA 1Q15A 3DNPA 3K0FB 4FFBA 3NR2A 3VO9A 1Q74A 2YKGA 1V0JA 1W48A 2Y4NA 3QU4A 1BVHA 2HJ9A 2ESRA 1C1DA 4A36A 1OBHA 2UZ0A 1NLMA 1M34A 2A9VA 2YIDA 3FYUB 3P2EA 4EITA 3LBHA 1WDWB 1MENA 3ER8A 1L7RA 4RGBA 4QOSA 3NNDA 1KMIY 3H2SA 3JQGA 4DBVO 3Q7SA 2UYHA 2F7SA 1N5LA 2VRCD 2AEJA 1KQ3A 1XTIA 1QOQB 2FFHA 3AXTA 4IMJB 3DHVA 5JNLA 4KKVA 3RFXA 2R1ZA 1QO7A 3BHJA 3QE4A 5A4KA 1L7DA 1UP4A 2AOUB 2RK6A 2GRUA 2PKQO 4Z9BA 1JTVA 2WNHA 2ZM6B 1G8AA 1HEIA 6REQB 4CTMA 1BA2A 1M8GA 5L7YA 1DKPA 3BFVA 4E1AA 4PLVA 3PDHA 3FSGA 4QJIA 1GCIA 5B12A 1RYDA 1U9CA 1NSTA 3D6AA 1B7GO 1BS1A 3TSAA 3KQPA 2COKA 1SWWA 2Q1YA 1XA4A 4URVR 3D8TA 1PGQA 4DQDA 1DAIA 1C4WA 2PQ6A 1NKTA 4F92B 1XN1A 2E85A 2ZIFA 3KKKA 4WJKB 1NJ1A 1AH2A 1YV9A 2ZIUB 4QX6A 5FBRB 3TH5A 2AI2A 4DVJA 1MB9A 1P8JA 1T0JB 4HDNA 3T9CA 2GMWA 3MGKA 2BMJA 4BKOA 4GFDA 1U4OA 5FNVF 5JRZA 1QVRA 2AXPA 1TQHA 2I2DA 4IZOA 3UHAA 5EIFA 5LUAA 3CZQA 2W4IA 5ENZA 2VKQA 2GBPA 4WY8A 1JLLB 2QTVB 4DILA 1KKMA 1MA3A 2AEEA 4MV9A 3WYAA 4P3KA 2DUUA 3GNTA 2QU8A 4GR5A 2PR7A 1OXKB 1B8OA 4DIMA 1ZNWA 4LQCA 1AG9A 1HLDA 1Y8QA 1GPYA 4UATA 2GCIA 2XMDA 3O8DA 3QXXA 3OJLA 4CDNA 2QKYA 5SZKB 1D6SA 1T6NA 2AMFA 4R6WA 4IDHA 3PHHA 5FHRA 3HB4X 2IX9A 4EKIA 1AKNA 1OXBB 1ZKDA 2ZITA 4TWZA 1EG2A 1RCTE 3GWGA 3R3JA 2Q0HA 5ECGC 3SIPA 3TZEA 3TMYA 2MYPA 4J76A 1PLKA 1M0SA 4Y1RA 2MMCA 5B30A 3PC2A 4EKYA 4Q34A 5EYPA 3TL2A 4DM3A 2BW0A 3LHKA 3V4SA 4G0OA 4CN9A 4XYLA 4MAMA 4OU5A 1FA9A 1RRMA 4R1QA 3CX6A 2IY9A 5DTRA 3D2AA 3AF2A 3T3DA 4R9RA 1GKIA 3CLVA 4U1RA 4TLEA 1BFKA 1C2YA 4BMSA 3MCUA 4TS4A 4O2LA 1DEAA 2VXCA 3IAFA 1A2BA 5KKAA 2R7AA 1NMZA 3RVKA 1I7SB 2V7EA 4FZVA 5IBRA 4ZAWA 4C7JA 2O8EA 1Q1AA 2RH8A 3L01A 5LKRA 2PGNA 1MABA 1QGUA 4J3JA 3THYB 3UH1A 1TAUA 2O2EA 2ZRJA 3GN1A 1QCDA 5IDVA 1KJQA 1G59A 1OILA 4ETIA 1EB9A 4KYIB 4FLEA 2JIRA 2QRKA 1RFGE 2SCUB 2V7TA 4X6YA 4UTXA 1Z0UA 1U0EA 2IPOA 2RHJA 3A1DA 3JRNA 2C57A 2YS7A 2AL7A 3LX6A 4NQRA 4Q21A 3SN6A 1DKLA 2C5SA 1PL6A 4OLFA 2GN9A 3I5MA 4WZAE 2DSTA 1UMCB 1E6CA 2WG2A 4HDRA 1GR1A 5HX7A 1T8WA 4K9QA 3W4KA 1H6CA 4DT1B 1VC2A 2QTAA 2AN1A 4MR7A 2A5GA 2D54A 2OAGA 4MUNA 4ZAZA 2OYSA 1VKZA 3OIDA 4A2QA 2I8AA 1WF3A 3LV8A 1C81A 4JMLA 3PLRA 5EJIA 1AMOA 3C39A 1YU9A 2BFCB 1RLJA 3HB7A 3L7DA 2DCMA 4FONA 3AHGA 1NYRA 2QEQA 4DA7A 1WA5A 3SVZA 4IIDA 4CCAA 4RHEA 4KYTA 3DLTA 3FCXA 1CFJA 3FPFA 5C52B 3QFHA 2WWWA 3UMCA 5EHGA 3VPHA 2VDNB 1E94E 3ROZA 4B1FA 2VI5A 4LQDA 3L18A 3BRQA 2IBTA 3FVQA 4FEGA 4ND7A 4URFA 3HFSA 1RI2A 4Y2PA 3K20A 4LNAA 2QG4A 5AM5A 4RVUA 4HN4B 4JC8A 4ZVNA 1BDBA 1ZAKA 3CKKA 4Y6RA 3QOXA 4ARZB 5ALJA 3B13B 1VLLA 1M2JA 2GEJA 4AFNA 1TIBA 2BUAA 1PS8A 1WEKA 4ZVSA 3AERB 2UYYA 2O4UX 2B7BA 1OYOA 3RDPA 5KNDD 4PINA 1UPTA 4JOSA 1XX6A 2OV2A 5J4YA 4JJ7A 2HK6A 5F12A 1B8UA 1O6BA 3UB4A 1QZTA 1B16A 2YXEA 3Q2OA 3TD9A 1WZIA 1TGYA 1ZM3A 1B43A 4A6DA 4OIMA 4DG8A 4UHCA 5BUQA 4DR7B 1VG9B 3S3TA 3B6KA 3OFSA 3HEMA 4MDHA 4MS4A 3L0DA 3OFVA 2C98A 4QODA 4REQB 3SDZA 4LSGA 1ZD5A 3DHEA 2Q2NA 3G9UA 4JOQA 2IXTA 4WA7A 4HDMB 3ZZTA 5K51A 4CF4A 2O2YA 1KWGA 1DAPA 1N1EA 4FFRA 4A1FA 3WX0A 3NQ41 5JZ9A 1AKYA 3U5TA 5DM0A 2E9SA 2VJNA 5JFTA 5ILQA 3NCTA 5FBWB 4ZVOA 2BD0A 4D6YA 1I36A 1JYFA 3VHQA 3KT0A 1YOBA 1OJLA 4GNRA 1WPXA 2PMBA 3RRYA 3H05A 3TNYA 1E4YA 2PWZA 1QGZA 4TRRA 3TTVA 1FFSA 1WMSA 1RAHA 2WR8A 1F6BA 4O0LA 4NENA 4BECA 4Z4QA 1H69A 5K8VA 2CE7A 1KYXA 3GJXC 4JODA 3VH2A 3FNGA 4X7BA 1CQIB 5IC6A 3AEQA 4RK7A 5B36A 1BW9A 4FN5A 3ZWNA 3RK4A 2H00A 1S2DA 2Z95A 5K3FA 2QQEA 2H52A 3MAAC 3E8MA 4ZC8A 5T4FA 4M0EA 4J7CA 1E7QA 4LF5B 4V0NA 4CEIA 2R8BA 1N6NA 3FTDA 3P9CA 4RD2A 2XX3A 2YHIB 1Z0AA 2X9QA 3EIQA 5ALIA 4BKQA 3FOEC 1U4SA 4NQZA 2ZJ1A 1EWYA 4NECA 2PJRA 1DEXA 2EGUA 2KJQA 2CHGA 2XH8A 1JQLB 2W2NA 3GHHA 4G9BA 3L46A 2PUWA 5HIIA 1FRQA 4G4IA 4X00A 4KQHA 5AHXA 3W3AD 1MMFB 1J1IA 4A1OA 1DGQA 3RAJA 4FOLA 1XP8A 3VZQA 4PZAA 1TCUA 4IYJA 3N2GB 2ZUUA 3MCAA 3HCFA 1PEDA 1XE3A 2OK8A 1P2BA 2VQDA 3E84A 3G88A 3KWFA 1SUAA 3PR1A 4JSRA 4X7RA 3MB8A 1FP2A 2WKRA 4EX7A 4Z5XA 1SA0A 5LOVA 2A9QA 4XAQA 3Q4GA 1WY7A 3R4CA 2DBYA 2FKNA 4ZVLA 3TTSA 4MUFA 4UE3S 4S0XA 4CMIB 1PDVA 4MCHA 1TEXA 2NXCA 3UC9A 3NETA 1ZQ1A 3FWNA 3OPNA 4YRRA 3V42A 2PMKA 4RAQA 3C3JA 3K1ZA 3OFJA 4HLNA 3SHQA 3V1KA 1KY4A 1V39A 3DBHB 4UM9D 3L1VA 1F0YA 5E1OA 4DG5A 5AFSA 2CZGA 3MTIA 1DQZA 1JBKA 5D6NA 1BGWA 1T15A 3MBIA 2HO5A 2OPHA 2ZJ4A 2YWCA 1EQUA 1ETUA 1G8HA 1QYVA 2P5TB 1X7XA 1K9VF 3B82A 1EVZA 3ILVA 4K9OA 5F2KA 3OC6A 3KQYA 1I9CA 3N86A 3ZZNA 1S7GA 3LY5A 4F1JA 1U2PA 1OZAA 1D0VA 3EIEA 4RZIA 4BDSA 4MWSA 1NZFA 4JLWA 3FTEA 2B2CA 3U6KA 5AOVA 5FDFA 1YZYA 4LDQA 4PGFA 1G8KA 1OT3A 2JLVA 1TQ8A 2WF6A 1T8SA 3BK1A 2FEAA 4OX9B 1KEWA 3QM1A 5HQJA 3ZWOA 2DB3A 3ZOZA 1ZN7A 1TF7A 1VSQA 1XVUA 2GKOA 3O8OB 4JIMA 4L4XA 1GM5A 4D3DA 4DLBA 4QOEA 2FEOA 2XRMA 3Q41A 1GNSA 4Q02A 3WYDA 2WJAA 2DFDA 4HMOA 5AJYA 3HVRA 1I4WA 2GBIA 1XZIA 2WUVA 4KFUA 2OUKA 3FPLA 2PX3A 3H5TA 5GV8A 4ER6A 5AW2A 9ATCA 5DM4A 4CMAA 1A5AB 1CP3A 4BQOA 4ID9A 1JDNA 2FN8A 4PHGA 1KMCA 1ST2A 4J4HA 2AWOA 4H4DA 1DKMA 2RI1A 3ACCA 3QFCA 4NNOA 4PBTA 5B55A 1IOVA 1LX6A 1P31A 2ODWA 4WH0A 4J6EA 3VNQA 4BQQA 2WB4A 1WXHA 2CJWB 1CUYA 2Y1LA 1HDOA 1QR2A 3R6DA 3FPCA 2VWGA 4FLMA 4XX0B 1YJXA 5FNVA 2B1QA 1AKEA 3WB2A 5BT8A 4MPRA 5GZ3A 5CH5A 1X70A 3LT2A 3IELA 1J07A 3YASA 3GCXA 4XQ9A 1PYGA 5AUOB 1JPJA 2PS0A 2WMDA 1XF1A 3H9GA 4KWEA 5B4UA 4OB7A 1MPXA 1EXMA 1VSBA 1HNWB 1UK8A 4KRGA 1VJGA 4MKRA 1Q0HA 5ALHA 2I76A 3V4ZA 3WFZA 4JJGA 4OB8A 1WIWA 3E2PA 2ZULA 4KR3A 2QV0A 1GEEA 2P0YA 4OHXA 2G04A 3ND9A 3AJEA 1CUWA 4D56A 2TMYA 1SD1A 4RTLA 3OTOB 2C31A 3IAAA 5C46F 1Z17A 2O8BA 2J5QA 3HJRA 2IUSA 3D7RA 3T1QA 2LGJA 4BGDA 1LPOA 1U7TA 1V2GA 1QOZA 4MB6A 2Z4RA 3T15A 4Q9AA 1NJ6A 2KBEA 2L69A 2WTNA 2ZYTX 3FZYA 4JLPA 4NJEA 3A2NA 1DE0A 5CFLA 3BA1A 1ACMA 1BCRA 1MPTA 3ZWWA 2EATA 4UU1A 1RRFA 2LUOA 4XDGA 1ORIA 5FAXA 1G5FA 2BRUC 2NU7A 2VZLA 3AEZA 4JUIA 3TX2A 4B84A 1TU0A 4RCYA 5JJLA 3VPGA 3V1NA 1C80A 4DIBA 5I5EA 4J1TA 1E79D 5DHRA 1EH5A 4I9GA 5FNZA 4JXXA 3THRA 5FULA 2XGMA 1VIMA 5FFFA 4DNOA 3SWWA 1XDWA 1ZGBA 2FY8A 3QFRA 3ICOA 3L02A 3MIZA 5EMNA 1J1ZA 4IV5A 1BX3A 4JB0A 2CBGA 1D5CA 3FR7A 5SZJA 2GVZC 4P0QB 2PAFA 1PRYA 3ROPA 1K98A 4PXSA 5BNWA 1KR5A 4ZT5A 1USGA 1U9JA 3PRHA 4L75A 5CP8A 4BKPA 4D99A 4U9IS 3R6TA 2BWJA 1L5RA 1ZESA 3EZNA 3PD1A 3JAWB 4FIZA 3RRZA 2QJTA 2FQWA 3LZ6A 4ENSA 1WW2A 5LQNA 2W83A 1ZX1A 3TPCA 2WFMA 1V4BA 3LBIA 3I5YA 3PLAE 1E9AA 3I9KA 2CUKA 1E6WA 3IQHX 3UWOA 5C1PA 4UHJA 1ZR2A 4JUBA 4CIAA 3ANNA 3OZ7A 1H66A 1TXGA 2G3YA 2R84A 3G7NA 4HVAA 4LJAA 4MEBA 2FB9A 1G9TA 1IBRA 1TGVA 4XM1A 4W8HA 1GRNA 4ZA2A 2RKBA 1N36B 1A8QA 1IB6A 3CCFA 3CN9A 3J7TA 1VP3A 4F8JA 1FP4B 2I6UA 1H9CA 1MD9A 3EOZA 3PU6A 4R16A 2XDYA 4EHBA 1J2TA 5IAKA 1IOWA 3ZDDA 4DJEC 3BS4A 3TZ6A 3G2JA 4RZHA 3HY4A 2ZIAA 2RJ3A 4EY6A 2PT5A 4K6HA 3WMGA 4QPCA 4H08A 1NJFA 2NSHA 4H4CA 1EFDN 4PX5A 3OURA 1ODFA 4Q1BA 3RSQA 1ZR4A 1QK4A 3COZA 2K2WA 1B93A 2CNLA 2FLKA 1ADFA 5DYIA 3H86A 4XJVA 4WN9B 3K6SA 1FFEA 3CCCA 3SXJA 2P90A 1ZP6A 2H17A 1XLTA 2FP4A 3QTLA 2OT3B 2V9ZA 4ZXPA 4EG7A 1M33A 3M6IA 5HBRA 1Y7PA 4ODIA 1KYWA 1CJKC 4EBFA 4GX0A 4ZN6A 1U2DC 2C5LA 3OWOA 1DHTA 4BQSA 2HT1A 1Y6ZA 1UCFA 4P81A 3NFRA 4ML3A 3AVYA 1Z35A 3IQXA 1G20B 4ZO9A 3DPSA 3CWQA 4WINA 1MGOA 1D4OA 3EBPA 4DV4B 2DH6A 3CLTD 4MVJF 3F6SA 5A0FA 2C2GA 5AM3A 2G82A 2IYEA 4OLAA 2H6EA 4I5FA 2DGDA 1NGSA 1QHIA 2CL0X 3HADA 3NHAA 2IA5A 4JCCA 4JVMA 5F9MA 4M6WA 1JGTA 1BS9A 1ZJYA 2JFNA 5I4KA 1D2HA 2AYZA 5TR9A 4R9SA 2O2DA 2XYHA 1BTOA 2MSKA 1U8XX 5FQOA 3G1WA 4OXKA 2R8ZA 4HTFB 1UDBA 1E1KA 1ISMA 2J9GA 4UOQA 4EOGA 5E7QA 4F5EA 3Q3JB 4GC9A 1JFRA 5ITSA 3OM0A 3PXCX 4DUZB 1GZ3A 5I01A 1KRHA 2CNWA 3EN0A 3TZHA 5LXTB 1FYVA 1EJ6A 2XJ9A 3PB3A 4YC7A 4D6PA 2XDAA 5FUVA 5TVKA 5CBKA 5KYKA 2C0CA 1EI9A 1CRWG 3AG5A 4QVKA 2PYDA 4F2WA 5BWLA 1FFGA 5JH7A 1CR1A 1NURA 3THXB 1H9AA 3ESCA 5JE8A 5AI5A 4PBSA 3KTAB 5KSYA 4GS5A 4B48A 1W2GA 2QBYA 4U2KA 1WHSB 2AFHE 1T2EA 2GT1A 5AW0A 2H9YA 4OH1A 2ZW9A 3UJ3X 3EQ2A 1KFCB 4JP5A 4QHTA 2QMOA 3FUUA 4A6XA 1Q3TA 4DQLA 2A33A 2X4LA 3A06A 3ILYA 4D4HA 1KYYA 1SVMA 3EC2A 5A3VA 1SU6A 4JJ6A 1KSFX 4IFBA 5DM2A 5JNRA 1S9HA 1DP4A 1N2CE 2P3OA 2PH1A 4CJXA 4DANA 3RQSA 3IDZA 3P2IA 5D51S 5BV0A 3GVPA 3OIUA 5CM9C 1NJ8A 3GPDG 4LF4B 1ECCA 1P5RA 1TC2A 5CG1A 3P96A 5HUJA 3W05A 2JC3A 3GJ8A 3AR5A 2IYAA 3E23A 1H85A 3ROEA 5K0BA 2TYSB 3EWSA 2GZHA 4OMCA 5IC4A 2IEIA 3GRFA 2A88A 3C87A 4F96A 4ZGGA 3CXRA 1S2MA 3PX3A 1R0SA 2LXNA 2Q0SA 3L4JA 1URPA 2GD0A 1E5DA 2CFRA 3O95A 2FA9A 2YJ5A 4X24A 3RC2A 2MSEB 2XOEA 1E7WA 4EKDA 1FUIA 3A7DA 4ZPJA 2R6ZA 3P0HA 3UK1A 1WVGA 3K31A 3WYBA 5KEIA 3DB1A 1M2HA 1YS7A 1XL1A 2XVXA 4N5LA 2CJYA 4RY2A 1LEHA 3A25A 3A9UA 2V7BA 3D5QA 4TMFA 1KBQA 2P6RA 1MIHA 5LZ7A 1WB9A 2ZSBA 2ZYIA 1KMMA 2N9UA 5ALYA 2C5EA 4WDRA 1KH2A 4ALNA 3D1VA 2NACA 4OOEA 1G55A 2RH5A 4HH3C 2YW2A 3LUPA 4UUMA 5L95A 1N3BA 3BXEA 4QDXA 1BCSB 2SKDA 1CB0A 3DXXA 3CRRA 2JLYA 4OEHA 5K20A 4ZO4A 4MVWA 3H7AA 4RC9A 2B9EA 2QQ0A 4L85A 2WKQA 3K05A 5DTEA 1Y7LA 3S2FA 3NHYA 3C1UA 2OCAA 4I1YA 1EGHA 3R0QA 4I0WB 4BNNA 4QU9A 2J4CA 4RANA 4BFSA 4DWWA 4R1SA 2A9RA 2X76A 2ZS7A 3HVJA 5HF5A 3Q0EA 4QUJA 1RJ9B 1T43A 3CH6A 3H1EA 2VPXA 4BPRA 3UA4A 3L6UA 3KAQA 3RNLA 3EHDA 2WVHA 2FFAA 1TK9A 1HFWA 4RULA 3LYUA 1D04A 3MHPA 3RBZA 4EVSA 1VMKA 4QBHA 1SR8A 3D7MA 3DE2X 3OQPA 3Q8XB 4TX1A 3WIDA 3JALB 2RMKA 3DEHA 3NOOA 5IYZF 3U17A 2XCTB 4C89A 3WBKA 1ZCZA 5LZ4A 4KNYA 1GSIA 3LLCA 2ZIGA 2ZDHA 4ZEXA 1U65A 3UJNA 4LXYA 1ONPA 4FW9A 3DUFB 4LYAA 3SZRA 1QG2A 5HOQA 4GSLA 1Z6GA 3A11A 3ZV7A 2J6BA 4FBGA 1DZIA 1SVKA 5A1JA 4OHCA 2Q5HA 3HB5X 1ZJWA 1FY2A 2Q9CA 4LKOA 4RGQA 4RPGA 1PZNA 1E6UA 5I4BA 3E9EA 5EXDA 3AV0B 1SIOA 4AKIA 4MDYA 1XVIA 3MWKA 5U1PA 5EQJB 1E2PA 2QP9X 5DOVA 2C2OA 5BSTA 3Q8MA 4YCLA 3K5WA 1EP1B 4AMVA 2AZ4A 1U7XA 1P3JA 3R74A 1HYBA 1E63A 2MSCB 2HQSA 2ZPAA 1QYXA 1HDIA 1EAYA 3LUHA 3RVDA 5T57A 5CK4A 2X9LA 1V8BA 3IMFA 4IJKA 3REFA 4J90A 3MJDA 2ZWMA 3DCJA 4AO6A 3G13A 4EJ2A 3H2YA 3FNQA 1LRKA 4MW7A 3K09C 3KYDA 1AX9A 1G5PA 5JXHA 4ATNA 3EVCA 5J4KA 3VNVA 3UMJA 3LF2A 4AS2A 4MA0A 4PX3A 3JQ8B 3PPYA 1PT5A 2QGFA 3U49A 1CUCA 3TLJA 3RODA 5I7OA 4EPTA 1PW7A 3MZ0A 4M1QA 4PNPA 4F8EA 2QLTA 2RGCA 1BHSA 3ZXUB 2I6GA 4CUKA 3S8YA 4IPTA 5LYJB 1ZK4A 3MF4A 5D2CA 3FNFA 2PRSA 1R4NB 3EXEB 3EXG2 3V8VA 4ZKEA 1RLMA 2YCLA 4YP7A 1VPLA 2QVLA 2VG8A 4KNWA 1D2MA 3X0DA 3WWPA 3GLGB 1BVYF 4HN9A 4EHLA 3C2QA 5AVRA 2R5FA 2A5LA 1P9OA 4D92A 5AKZA 4L9WA 2J4FA 4NVRA 3RSGA 4PRZA 3L6DA 4TRNA 2IIVA 1XTTA 3C6BA 3SJCA 3P7MA 1UQTA 2R8EA 5JYDA 1IHPA 3R9KA 3ZWAA 1N1MA 2C2WA 2VQEB 2PTHA 4RENA 1E2QA 3BILA 4IX9A 3R7WA 3JRXA 1T5HX 3Q8LA 3VR6A 5BN5A 1V8OA 2ZQYA 1CSEE 2HRCA 4ALJA 4ZQFA 4PAWA 4FHZA 5EP4A 4BLOA 2DQYA 3BVPA 3QKRA 1W29A 4KXYA 5LB4A 2VXBA 1E3MA 3DTVD 2DVMA 2ZATA 4KN6A 4XIJA 4F04A 2Z1DA 5JECA 3PFNA 5B3JA 3C4VA 3OTQA 4HZGA 1X8KA 1ZBQA 2JFYA 1EXDA 4MB0A 2B6HA 4DAEA 2LD4A 4Q4AB 1MAHA 4YROA 4B85A 1RWKA 1ORHA 2ZTVA 3EOBI 3OQIB 1DJOA 4L27A 4RJLA 1JHYA 2ZRPA 5KOJB 3R9XB 1Y3BE 5L45A 1MNAA 3VC7A 2PWBA 2BE9A 3ICEA 1UJCA 2QTCA 1PUIA 2XKAA 1W5BA 3B1WA 4WVFA 2OHHA 4NFYA 1RHRA 1WXXA 2LKDA 2YMLA 3GPCA 5ILGA 1BN6A 3TM5A 1NZJA 3NHZA 3KU4A 2P2LA 4DNPA 1JHRA 5I7UA 2ZXUA 2A0YA 1XMSA 4FOPA 3KQHA 4CGZA 1VFPA 1AKRA 1H5NA 1N2IA 2KLBA 4U5QA 5F4BA 3V8NA 4F6RA 3WHIA 1CYDA 1SVIA 3PKIA 1DBWA 1Y42X 1Z7GA 3E82A 2I8CA 3AUTA 2PQ2A 2AFIB 1QPBA 1NOIA 3GLRA 5DU2A 5H16A 4B3FX 1N32B 2CC2A 2KWIA 1A7UA 2WA1A 4JWTA 3R6LA 2QX9A 3VTAA 3N0VA 1XMPA 2JKYA 4QDOA 4JA2A 5DXFA 3TGLA 1O94D 3FD8A 2ZLBA 3DFZA 1FDTA 3OCXA 1ARZA 1WX1A 2J9ZB 1Q6ZA 2XF2A 4JGBA 5ELLA 4G23A 4QREA 4LHEA 4JUFA 1U3FA 5F5XA 1KF0A 4OJMX 4LJ8A 1EKXA 4OJYA 1XBTA 3ZTWA 5MHTA 3ZGVA 3GN2A 3KVRA 5DSZA 2C7GA 4UHKA 3UPDA 1QQ6A 4JJAA 3W5AA 3QG5A 4Q4CA 4RAOA 4MWDA 3TRDA 2OORA 1LS6A 2RGWA 3ZNOA 1O9HA 3LD9A 3D8NA 4FNAA 4MVJA 4C4SA 5FEMA 1E6KA 3VVCA 3HCOA 1M7GA 2RJNA 3PDUA 1NG9A 3A6LA 3SSAA 4XKJA 1FRZA 4NE7A 4G9EA 4HG2A 5CGZA 1PEKE 1PD1A 4RACA 1SUSA 2OFWA 2B20A 3NG1A 3NTVA 3PUIA 4O4JF 4BVKA 2O8CA 4KVGA 1GNPA 2C9MA 4UM5A 2WIAA 1CZUA 1NVFA 1IRXA 1R9JA 2ZJ2A 3O8QA 2I66A 1PYDA 4GOND 3R7NA 4M38A 4TL9A 5JV5A 2XA9A 1ZJ4A 4FFDA 4KVAA 4ZWNA 3SF0A 3R3YA 4DMLA 5EKTA 5TGDA 2IYSA 4V3BA 5BW5A 3HDQA 1JEEA 5AW1A 3AR8A 3RHTA 1N3IA 1XZKA 1K6EA 4E22A 4H15A 5KYGA 3SZUA 2AJDA 4ZV4A 5ESXA 5C8XA 4WY5A 3DOUA 1P45A 4LXIA 4WI1A 4B6GA 3M7IA 2O19A 2ATCA 4L4YA 4YWHA 1U2GA 1U6JA 1NJGA 1NVWQ 1XRQA 3PXGA 4Z1OA 1I6MA 1U7HA 3JVUA 5F73A 2FSGA 5HRCA 3O03A 5L4NA 5KYXA 1CE8B 4I8IA 5AW5A 3RSSA 5EKDA 2VF7A 2HN9A 1K6JA 4NAHA 4AKSA 1CF9A 2QUBA 3P0FA 4TLBA 1PG5A 5C8VA 3VRHA 1KL7A 4WZBB 4CMKA 4W9MC 1EUYA 5EE3A 2BGGA 1LPSA 3OCUA 3HBMA 2P78A 2JI6A 5CIQA 2PGJA 5EXPA 1PBNA 1CK4A 2RI6A 1W46A 4Q66C 4LJ9A 1PZXA 2ZYSA 1H23A 3JWHA 3UJ9A 3ZV4A 4BN4A 2RGUA 5C5EA 5B58T 1EFRA 2BT4A 2OHVA 4BUCA 2BY4A 5K8CA 4OHWA 4I55F 4MVJI 4HOYA 4QRIA 4DMCA 3GQBB 2VH1A 4R51A 2O7RA 3LUAA 4JBIA 1SQGA 2A92A 2VYCA 5DISB 4A0FA 3C0KA 2K7FA 2UXCB 3FSGD 1XEWY 3VSAA 4QWMA 2HI0A 1PV4A 1MA0A 2J31A 4MGKR 2AVDA 3GEHA 5B3AA 3K9FC 1Z36A 2IU3A 3VFDA 1HMYA 2JGDA 2OECA 5CVEA 3DBLA 1UXHA 3DBRA 2AR7A 1O87A 1M2KA 1S1MA 3FOCA 3J81k 2OCPA 1K9SA 1JEJA 1PKXA 1MAWA 2VK8A 1HKHA 2BGJA 4OUDB 2BI4A 3I58A 3RC1A 3VJRA 3G5TA 4R6XA 4L5IA 2EBFX 4P2GA 2Z2ZA 2XQJA 1E96A 1E2HA 1JJVA 2D4HA 1E0JA 1HSOA 2JB9A 1JHVA 3KJZA 4QVIA 4KB5A 3B38A 5IEJA 5KJ1A 2BFPA 4OQNA 1M34E 3QKTA 2ORED 2OCBA 2ZRLA 4O6VA 1JR6A 2PD4A 3SKYA 2R0QC 3AZQA 5JC1A 5DHFA 4JYMA 3IEXA 2X2EA 3HP4A 3IURA 1T5LA 4EF4A 3DV2A 2V6JA 2JCYA 3V4PB 4QYIA 3CRZA 3PDWA 2GM5A 4LXTA 4N7MA 4E30A 2QXYA 4GXRA 1RRKA 4YMVA 2V6GA 2DFTA 1OX5A 2A1TR 4C0SA 2DPLA 4KJXA 4WOJA 2AUMA 2CGEA 5I4CA 2YMPA 4MARA 4R2XA 3JQRA 5GJBA 2OTCA 1ZOPA 3JU3A 4WN3A 3B1YA 4KBFA 3H11A 3OY7A 5EWLB 1IY0A 2JIBA 2QRNA 2YVKA 4W8GA 5IYZA 4MYCA 4EEKA 4G5FA 4Z7NB 3DL4A 1U0SY 2KYRA 5C5IA 4CV2A 2X0JA 5TT0A 2DTXA 5FTKA 1F8XA 1G2PA 3H6HA 1E9SA 2QW8A 3T3GA 4ZI3A 3EPJA 2W00A 1J1UA 3IUBA 8MHTA 3VPAA 4KPEC 3P20A 1Z9BA 2II6A 3TLGA 3WP1B 3IBSA 3BTVA 3EH2A 3KB6A 2X1VA 4NICA 5GZ1A 5K09A 2VYNA 1XPRA 1FLNA 1P2UA 2XYGA 3HJCA 3I9V1 4G5OA 3U7QB 3H8SA 1PIWA 4L3OA 2RG7A 4HDSA 4RY0A 2WFLB 2W6CX 3GVIA 1RS0A 1ISJA 3FDXA 1DFHA 5BV7A 3HBLA 1MFPA 2GAOA 4J0GA 1ISFA 4GLBA 1K7YA 1SZDA 1YULA 2JFPA 5K2MA 1WPRA 1EDZA 3HXMA 2E0IA 2C3YA 4XWKA 2HIMA 1IQPA 1M2OA 3PA8A 4PZDA 3T54A 5BUZA 3IEPA 3KWLA 5K9ZA 1XLTC 4B80A 4YK7A 4J1QA 3MQ2A 2ZYWX 1SCKA 3N2KA 2ORIA 5FPHA 4ARAA 1RM3A 1IAVA 1NW7A 3C1TA 3Q5GA 4JLNA 1QFMA 4D46A 5EWMA 2CXQA 3IODA 1QB8A 1V1MA 4AJ4A 5U4XA 4RD3A 3FVWA 2J0UA 4DLSA 2OLKA 3IUSA 2W2TA 3K8ZA 3L7OA 4YP5A 5JPIA 2ADFA 4BEJA 4D97A 2E4XA 3WL7A 2BJHA 1KO8A 1IZ8A 1TCAA 1Y1TA 4BNLA 2X9VA 5ED0A 5C34B 4ZI7B 3R5JA 3ZLJA 4G41A 1WUJS 4RIFA 5C4IA 1E4OA 5LJIA 2C82A 1ML3A 2XYVA 8LDHA 4NJOA 1PSWA 4IRXA 3BJEA 3PGLA 3QPVA 3IUYA 4M1YA 4W5WA 4NAUA 4B3JA 4V24A 4E7OA 1UINA 4FEYA 3E15A 3IVRA 5IT9A 1WW8A 3FYSA 4M9SA 2NVWA 3IDQA 3CVWA 3I4LA 1ESMA 4BFWA 3REGA 1C1XB 2BBSA 2NO9A 3DEKA 4Y2TA 2F43A 1XO1A 2FI1A 3EGIA 4K0RA 1DG1G 1N8SA 4HPJB 1EWRA 3RSCA 4WDQA 4KO4S 2XECA 2FE4A 1NUQA 2JAHA 3PYLA 4JKYA 1NY5A 4PC7A 5UKDA 1IY2A 1Z5UA 1V3TA 1FP7A 1S3FA 3BOSA 3JARB 4M9RA 4M22A 4QBKA 1O2DA 3DQPA 4BC1A 2MR6A 3AUFA 5I7EA 2HRBA 2NQTA 3KVNA 2P9CA 1E4VA 5BMVF 2HXGA 2WNSA 2YUIA 3LKDA 4CWAA 1EE9A 4U0JA 3NRJA 1YS6A 2IY7A 1ULZA 3OTGA 3ZXYA 3OQVA 1ZIPA 1CYEA 1D4AA 1UC5B 3CUUA 1T6XA 4UNIA 5GTDA 2H1OA 5KI6A 1UANA 4E5DA 2AC4A 4CLOA 2ABWA 3QWIA 4C4YA 2I67A 2HRDA 3K6RA 1XNJA 4PAGA 2VDWA 4AZ3B 3OZSA 1T3ZA 1X74A 1AVTA 3Q5EA 1U90A 3NUZA 4P4SB 3V1TC 2JIZA 5AVKA 4DW8A 5IUKC 5I8WA 1JEAA 4TS3A 1KY5A 1VZ3A 1L6RA 2QL7A 3LQQA 2YRFA 2PRJA 4QQKA 2I9KA 8AT1A 4LXQA 4KMMA 3O6VA 2P35A 3LQYA 1FE8A 4LNUB 4K7JA 2Y4OA 4X1IA 2AMJA 4BGUA 1WABA 3NM4A 3AW8A 4Q4HA 3OMWA 4W5HA 1G1AA 1BQEA 2GEUA 1RPJA 3G9QA 3N7AA 4OU4A 1JHPA 1EDEA 3M3HA 4LYFA 4Y2GA 5D8DA 3SX0A 1Y3HA 4YCNA 1A2OA 2XNJA 3RYIA 1IBLB 2PWPA 3KK0A 4LZPA 4ASUA 3LCUA 1HOTA 5CVVA 2DLCX 1D7AA 4BB6A 4G1EB 1D1SA 2XRFA 4DR1B 2X5XA 1ZGJA 1RXVA 3QVSA 2FFQA 3H1FA 4FMDF 3KP1A 4ZHQF 2VF2A 3SG0A 2CNKA 2REQB 3IQZA 4OK5A 3CINA 2ZTMA 1IQRA 3EASA 1YKGA 2HXYA 2I7VA 4FCVA 2F9FA 3EFBA 4R1NA 2BEKA 2BKXA 2GLUA 4L57A 3TOSA 2YWBA 2VCEA 4RM3A 1Z2EA 1FK8A 4EGFA 2GOYA 4W1PA 3GEGA 2I8LA 4NPCA 3WNZA 3SK0A 4B79A 3IKTA 4UDOA 1PV2A 3L1UA 5K6AC 3R3XA 5J2UF 1AHNA 4KR2A 4QLOA 2JAQA 3ETCA 5DW0A 4KRXA 2ZVJA 3VKGA 1JBEA 4QUAA 2NUTA 3UPTA 4UQOA 3VYSB 5KYVA 1VFNA 4AT1A 4WY2A 3RFCA 5D1HA 4F2PA 3SM3A 5K8UA 4RX1A 2IUUA 3FHTA 2V7VA 1EEHA 1JR4A 4O4JA 2WD7B 4C3OB 4S12A 3RHFA 3FJYA 4DR2B 1GUBA 1JE1A 4NZPA 1CUSA 4OBEA 1U0RA 1Y34E 1SBIA 1YCFA 2HSZA 3DR5A 4IGFA 4J8PA 5FOUA 2YN4A 4KGVA 3W9YA 1PR1A 1P7PA 4XYEA 1S3GA 1ZO8A 2QD5A 3LUJA 5B7NA 2YHBA 5T4HA 1ZM4A 3EUFA 1XZAA 4KNVA 1VBMA 2RB4A 2YV4A 3G8BA 5A3SA 1W85A 4CI0B 4RDXA 3ETEA 4UVEA 2D13A 4N4AA 4D9KA 1ZITA 4KBYA 5KVAA 2BFAA 4HB4A 1TM2A 2C2YA 4DADA 4GC5A 3I62A 2NOAA 3EOAI 4GVXA 3VZSA 2GPBA 1VHTA 2IQIA 3U1TA 3OLVA 2I1WA 3D1LA 1AQIA 2ZRCA 4ZMSA 4L2IA 4ZANA 3HKCA 2RJOA 1OZFA 1XGKA 1PUXA 1NVVQ 2J85A 4POAA 2CVHA 3DJYA 3DM9B 4KWHA 1Q92A 3TI9A 2H2HA 3DXFA 4HAUA 2C7OA 3BMQB 3E3NA 3TRIA 4BU0A 2VUHB 1KAQA 1L2TA 1GARA 4QT0A 4MH0R 5AJHA 2QVCA 4RD0A 1GKKA 1MOZA 2YFHA 3BGVA 1TO1E 2FW8A 3HVUA 4PHCA 4AP6A 1I80A 1PNOA 4JELA 4Y7CA 5HUQA 1G6KA 3WLFA 4C30A 1QH0A 3FVVA 3JVDA 5WRFA 4PYMA 3LDHA 4I55A 5JVDF 1P5JA 4MVCA 5LD2C 1QCYA 3NOVA 3BD9A 2Z5LA 2I3ZA 4UHDA 3OZFA 3SJAA 2PLRA 3IP1A 1JRLA 4QZVA 2Q5IA 3U4QB 1EVKA 1UQRA 3GDWA 2FG5A 5DMXA 1E60A 4D3FA 1TJ5A 4D98A 2SBTA 3EZ9A 1SUPA 4DMGA 1YKFA 4UCFA 3MT8A 2AHOA 3CUKA 3HDVA 3MFYA 5CDFA 4YT4A 2ZJ8A 1JT9A 4F38A 3WJAA 3D43A 1JP7A 1U99A 1KI3A 1LLUA 1S5PA 1VG8A 1O97C 1ENYA 3ANXA 1WB6A 2J7KA 5CFOA 3K7EA 4W1RA 3MJEA 4MLCA 3KB2A 3GGPA 4YA6A 4ANFA 1J39A 1MV5A 1SU7A 3BWXA 3LUFA 1SXQA 1ULUA 2WWGA 1NIJA 1XFAA 2HQRA 1R0CA 2HSEA 3D59A 3MCWA 4RE6A 4S1OA 5CIWA 3AHIA 2LNDA 1PTJA 4ZK2A 5K0TA 3COPA 4MCIA 4XZ3A 5FYQA 1UBTS 2PZFA 1IOZA 3PDJA 3PL5A 4Q00A 2A14A 4B4WA 1Y6JA 2Q8QA 4YGYA 4OQEA 2Z3ZA 3ZJTA 1M7HA 1NI4A 1ZJZA 2WE8A 4ZU6X 3WL5A 4B8ZA 3GEDA 4X7PA 2HOQA 3TQHA 4FJ2A 3HXTA 2EBUA 4OI0A 3NHBA 1SIBE 5EE5B 1SUEA 2ZVQX 3NKVA 4CLRA 4RPIA 1XMIA 4C7OB 3CPJB 3JVIA 4CMGA 3LYLA 5CLLA 4UPVA 2IPAB 4PIPA 5AKEA 1RYZA 2YMMA 4BJ5A 4WACA 1Z8HA 1E92A 1KK0A 1XD9A 4G3XA 3FMOB 5HE9A 4EL5A 4MUHA 5AM4A 3QGMA 3K16A 2ZKLA 3AFHA 4MQ4A 1CETA 3H1PA 4MRSA 1W47A 2WZBA 4HDNB 4E5YA 4EAQA 5B3JC 2IYQA 1FFXA 1KSJA 2QLMA 4JI6B 1JQEA 3FZNA 1ZGAA 4E2FA 4S1VA 3W8RA 5T8KC 2XQIA 2B4AA 2R6FA 4G1VA 4MQEB 4UNSA 4A8JA 3GJSA 4ENWA 1Z6TA 3AP1A 5JG7A 3EC7A 4PAOA 3CO0S 1JXOA 1L9KA 4KJZA 4M0LA 6YASA 2AZMA 3V46A 4C78A 2AEMA 4KODA 1Q0LA 3VPDA 4DUPA 3GBVA 3RREA 4G8DA 4Q1VA 4MW6A 2Q6LA 4TTJA 4XYGA 3UB2A 1DWPA 2ISSD 2WSYB 3FMVA 4Y9RA 1ZLYA 4PYQA 4IO0A 1RBYA 1UUFA 1YONA 2G63A 3ELBA 3RS8A 1GPMA 1T2CA 4YIHA 1SQFA 4MWCA 2H51A 4E5VA 2ROQA 3QIAA 4K26A 4MO9A 4WKBA 1VKOA 3AVPA 3F3KA 4XQGA 2QD4A 3HZRA 1QJ4A 3H0EA 4FQ7A 4NU5A 4PPNA 4ENRA 2A5JA 4L5AA 1ZCJA 4NCJA 4CL2A 3VKUA 2IY8A 4AIRA 5HKKA 3WIOA 3JAKA 2X86A 3O0TA 5ECWA 4ZYXA 3M5CA 3A3NA 3RIMA 3TW8B 4BO5A 4LSZA 2N0SA 3VBCA 5LBTA 5DNYB 2ID9A 2WJIA 2E6KA 3PE4A 3U1VA 1RIFA 1VE7A 4MRVA 3V8BA 3UCEA 4B44A 4B40A 8ATCA 4O2AB 1X2EA 3U4AA 3DEFA 2BZ1A 4BFYA 3N8GA 4J07A 3SZMA 4XVCA 4A15A 4JXZA 2Z1MA 2C03A 4MLZA 3UAGA 2OCDA 5BURA 3G1TA 4H1UA 1SBCA 2DQZA 2IZ7A 2ZUFA 2J41A 3HJAA 2OORC 3RC8A 2BFBB 1SC3A 1QIDA 1RWQA 2CNDA 2Y1CA 1HTBA 2O8EB 1MO2A 1UMDB 2C94A 2O07A 4IO1A 1I7QB 2V5UA 1Z7EA 1ZA2A 4IJVA 1S4QA 5ES4B 4P31A 1SN7A 2GPYA 1Y98A 3OEHA 4IVRA 4ZDKA 1EX9A 1VI5A 5CT9A 3FJOA 3EE6A 1KMQA 1DXQA 1B15A 4BLRA 1N5MA 3WLEA 2H9IA 3I39X 1MOSA 4X1KB 3KZMA 1P2FA 1NRIA 2YWFA 2FQXA 1FXSA 4J2OA 2CDCA 4XDHA 4Y6PA 2OXEA 4IEFB 2ZUDA 4B34A 2FG6C 4NATA 3QU2A 4ERXA 2X7HA 5BMVA 1YR9A 2CHUA 3FHJA 2FTKE 2PKQP 2WMOB 3QE9Y 2CYAA 4MVJP 4KQIA 4HDRB 3STWA 4C5CA 1I5OA 1U2GC 2EGHA 4ITUA 4R1TA 3X43A 3KLOA 2Q5QA 2ZSDA 2HA5A 1QF7A 2FEWB 4UEWA 3U37A 4D9JA 2BHNA 2Z9CA 1O0SA 1CPYA 1QIFA 4WLEA 3N05A 2YASA 3Q11A 1A95A 1G3UA 3QY0A 4U63A 2ID7A 4UXJA 2R8RA 2G28A 2Y0BA 3K5IA 5KX5F 1KDRA 3FDJA 5KVQA 5KTKA 1GU1A 2NO1A 1IJBA 4M1EA 8GPBA 2HTEA 1M1NA 5ITVA 1EDBA 2XUHA 3GEPA 5DHUA 4L5YA 1CUZA 5BVGB 1DV2A 2J3LA 3Q40A 4RK1A 1XA3A 1MAUA 2CXXA 1V6AA 1C2TA 2NSDA 3ED5A 3D2BA 2HY7A 1F8YA 4MUMA 4DB2A 1U11A 1PK8A 1E8DA 3TLBA 2OD9A 1B0ZA 2RHOA 2H31A 3PX2A 1YRHA 4ZIRA 4JZYA 4XEHA 5F9HA 3FPSA 1LI7A 2JNWA 1UPCA 5I7FA 3AL0C 3E7FA 1I94B 2NU8B 3T3MB 3SS9X 1PQYA 4JQOA 2AQKA 4OCZA 3ESBA 4ZVUA 1AKQA 1X7ZB 3F6EX 4EMTA 4DABA 1BXZA 3IMCA 5BQ5A 3IT1A 4NV3A 4RTKA 2ILTA 1ZIDA 5E6RB 4MDFA 2V0CA 1J7KA 1ORRA 5JYBA 2IIBA 1ZZGA 1XD2A 3K0CA 3NOXA 2CNWD 3ZHQA 4OM8A 3WO0A 1P29A 1HT2E 4PEVA 1ZCBA 3WB1A 1KEEA 1PS0A 4FCCA 4OHBA 3GR6A 4EY8A 1FRFS 4MR8A 1YAHA 5K3AA 2X8JA 2WJWA 4KLCA 4Q9KA 4YAOA 4YONB 1TYZA 5HZMA 5KIAA 1EXVA 4QAQA 4BP1A 3GD5A 5ELXA 2B4TO 3L92A 5J2UA 1DAGA 1E5TA 2CXSA 3CF4A 3ROQA 2EFDB 3ZHSA 4DBLC 5FBVB 4F3TA 4YJDA 1U7OA 4DXAA 3MTQA 4HB3A 4BY9E 2OKCA 4AJOA 3S29A 3OA2A 1N75A 1T2VA 2FN9A 2JZOA 3RNOA 3T4XA 4D8UA 3TD2A 1LRLA 2JJQA 4G24A 1PFQA 3NVAA 3JW8A 3WP0A 2QM7A 4UULA 5C3UA 2B94A 1NN1A 4Z4CA 4TOIA 1WULS 1X9HA 4UAUA 1JI3A 3R8XA 3FZQA 2MCFA 4ON9A 1J8MF 5HJEA 1AZSC 4UBNA 1ZNXA 5BOSB 2NAFA 2F8SA 5IC5A 1QAOA 2J6CA 2UVDA 3CWCA 2DCUA 3IX7A 4FWIB 4TLMB 5K3FB 2PFKA 4I5IA 3OOYA 1H4QA 2PZJA 1N5IA 3O82A 3NRBA 2GZ1A 4KAAA 1GV1A 2TMKA 2OXTA 4DPLA 4CEIB 1T0IA 3FKSA 3CUWA 1IWPB 2QPAA 5AXAA 4FILA 3SC2A 2G1KA 3TI7A 1GTJ1 1PSDA 1Y4SA 2G5TA 3WGJA 4IDEA 3FMIA 4TN5A 2VHJA 3UHJA 1M1YB 2NVBA 5KHLB 3LI2A 3A9CA 1HKUA 3B6IA 2R3SA 1H9BA 5C1IA 2BOVA 4F9GA 4GI5A 3SYNA 3GLVA 2IK8A 1SOVA 4MQ6A 1MFZA 4MQFA 2O8FA 1DUIA 2VF8A 3MBOA 4ZRDA 3ROFA 3WMRA 4CCYA 2PWYA 4G0YA 1FBNA 1SY7A 2ZSJA 4HNSA 2QAJA 4MIYA 4WSOA 3BBLA 3TCKA 3VSCA 2CVOA 4JN6B 1C0LA 3EQ9A 3NS7A 2B8TA 2QZZA 4NZOA 4PYRA 2ADMA 1OSNA 3KL4A 4Y1FA 2IYUA 1GPDG 4CKEA 2W4QA 3EEOA 2VVTA 2PX4A 5COBA 2PKEA 2ZUSA 1P2GA 1NX6A 3MWFA 5JVDA 5HDBB 1GAWA 5JS1A 1TNDA 2Q1UA 2XWJI 3D5TA 2FPMA 1JAIA 4G1BA 4MKFA 1I2DA 4PLHA 4KAFA 1UT5A 3RI3A 3TVTA 3UQZA 1OXVA 4EA6A 1YCHA 4AJHA 2MSDB 2PA3A 3HO8A 1P5ZB 3P0EA 5LDHA 4C0LA 3LOPA 1ZD9A 2Z43A 1SUBA 2R7MA 4YCDA 4EUNA 3D3EA 2PT9A 2ZJOA 3DLAA 2LZ0A 4PV7A 3B7GA 2PL1A 1SMKA 3S81A 1X7XB 1Z83A 3F78A 2IHBA 3LQ1A 2BHSA 2YZ7A 4AF6A 2QRQA 4XFDA 2GK7A 4MHOA 4KQ1A 1GVNB 3GPBA 4LC9A 2VHZA 3PSHA 3EG9B 1HDXA 1CQWA 2H4YA 4V0LA 3ZK8A 2WQZA 4FI3C 1BXRA 2ZIZA 5ALLA 2B82A 2E1PA 3U3KA 4MRMA 1GTZA 3W90A 4B6OA 2FUCA 1PJ2A 1MP0A 4C4OA 3Q7IA 4EYGA 2O1SA 4DCCA 2EFJA 2VRBA 1IHXA 3G9XA 3GZTB 4JLBA 4HVTA 2QM3A 3KXIA 2B2XA 3Q9LA 2GJKA 2YS6A 1C8KA 4S2UA 5KYYA 5BR8B 3FNEA 1EU1A 2FMHA 4YMWA 3HKEB 3DE7X 4NYMR 5AM1A 4ITVA 4JEHA 4FB5A 5KJFA 3UT5A 1DC5A 1U0OC 4JROA 3IBFA 4G85A 2NV6A 4JC0A 4HVCA 4HYQA 1QG4A 1V7ZA 2P2SA 2C3MA 3KYCB 3PC3A 4IGEA 3SHWA 4ZALA 1XTZA 1Z39A 2CMHA 3EVNA 5FPPA 5A04A 5TX7A 4YY3B 5KREA 1RABA 1JZSA 2Q2VA 3ZBQA 5ER6A 2H4XA 4JLUA 3ESAA 1KEVA 3LM8A 4IG9A 5AXBA 4IQ4A 5EPUA 4KK3A 2D7JA 1L7EA 4MR9A 5ALSA 2FWPA 4I4CA 4MQBA 4YLGA 3SBOA 3B6EA 1D0SA 2DUWA 3U0BA 4C05A 1X8XA 2GM4A 2JFWA 3GH3A 1U1IA 4HGPA 5KTPA 1NUPA 3E3OA 2C04A 1XU7A 4TLAA 5FNVB 3RKSA 4DIFA 2EP7A 2WP0A 3CURA 5C7IO 1HL3A 3THOA 3OP4A 4JP3A 5JHGB 2IELA 3OZXA 2RGGA 4RKEA 2JBAA 5B6IA 4WNAB 2D2XA 3HWSA 2XMGA 4LDNA 4Z86A 3CKMA 3E2IA 1FJXA 2CHQA 5C8DA 1QK5A 4KWCA 4JEMA 4W4TA 2VYFA 1J8DA 3MMZA 1JU4A 3UO8B 3CPEA 4BVJA 1VL1A 3T34A 4LCEA 3ZJ4A 1TAGA 2C1EA 4OLJA 2IHVA 1ZOSA 2Z8YA 2VNIA 3ZI4A 4FFSA 4DNXA 4Y2JA 1EK1A 1YH3A 4AKGA 3MQ4A 5CM2Z 4Z49A 1OPRA 4LJLA 1G21A 3FN4A 3MJSA 3QVGB 1COZA 1F2TB 2CLLB 4YPFA 4KQ2A 1PWHA 4PHHA 1I1OA 3CRW1 3MJVA 1VLVA 5L9AA 1AZWA 3SYMA 3HXOA 3D4BA 4DLAA 1RLTA 3L8GA 1TK2A 3E7WA 3VR6D 1XQ6A 1V16B 4B6PA 4DWJA 1N5RA 1RI3A 1XDUA 1BCRB 1G98A 2C0PA 1N2SA 1NAIA 2P3LA 2Y1DA 3LWZA 3T9FA 4H0NA 2JD2A 3GL9A 4U7FA 2L19A 1AUVA 2NU7B 5DHQA 4AJPA 3PICA 3ZDEA 1GR0A 4CKXA 2ZBRA 1I13A 2EZTA 2QIOA 4ND5A 4CHTA 3I83A 1B8PA 4UBKA 1M54A 2ZIEA 3U7RA 2GASA 2HBZA 2HZ7A 5T6BA 3VNAA 2JGIA 3EWAA 4RTOA 2VJQA 5D86A 2AXEA 4H4EA 1HUQA 4BXOB 3T7CA 2QUZA 1CEYA 1E1CA 4F71A 4TV9B 1Z22A 2YVUA 4HQOA 2QN6A 4I14A 3BD7A 2W0SA 1I7DA 1MVNA 1LNSA 5IK2D 3OIVA 2NO7A 4M36A 1QP8A 1GT6A 5IJ0B 1LSUA 5EQDA 1X8LA 4QM7A 1Q44A 5SY4A 2JW5A 3IVMA 4KVZA 4C7XA 1W34A 4KQFA 5HP4A 4RABA 5BUSA 3QKUA 4RBNA 5J1TB 5KOHA 3UXEA 4TSFA 5LDDC 1ORTA 4X45A 3EMBA 2AF3C 5BSRA 4BNIA 1HYEA 2EG5A 3H9BA 1EVQA 3NDRA 4JEIA 1Y4AE 3RG2A 5K01A 2CZCA 3RFFA 4AP9A 4QD3A 4US2R 1LDEA 1B6RA 3N8NA 1FW6A 5IDXA 4D2IA 1V1RA 4M8NE 4TZTA 4HZUB 5LCXA 5DZSA 1REQA 1MNQA 5CX4A 4L78A 1E3JA 1L4NA 1Y4UA 1J7JA 5BSMA 4KUEA 4G4JA 2OM6A 1VKHA 1SWVA 2ERYA 2P68A 5KZMB 1V25A 2Y76A 3V33A 3TS1A 2PCJA 3EYAA 1FPQA 4RV9A 5B1HA 4HVLA 1ZC4A 2DTEA 5A71A 5C8YF 5KX5A 4NBNA 4MW9A 2CZQA 3FBTA 4Q1AA 1OYVA 1V9LA 2YY5A 3F1LA 3OUZA 2RHTA 3KSRA 1R0WA 2DPHA 2Y0DA 2D1YA 3U80A 2AJLI 3KJEA 2F4NA 4P83A 5ALMA 5BN3B 3SXPA 1FU8A 4MVJD 3CSUA 4J16C 2Y6VA 1OFUX 1UKCA 1Z5GA 3MLBA 1RXYA 5M2QA 4Z4IA 2Z58A 5BWNA 4QEZA 1J8QA 1RYFA 5FI5A 1NQ5A 3H8VA 3OVMA 4J0HA 5IP5A 2H57A 4ZHQA 1YBFA 2Q4DA 3GP5A 3PPWA 1RXEA 4MUYA 1NASA 3F2IA 3WSVA 3MFQA 2VNSA 3QYFA 4IV0A 5JSHA 3FLEA 3LH5A 4M9CA 4UBOA 2N3ZA 1DS6A 4A5OA 4CL0A 2ZXEA 3QTBA 4F5WA 1HFJA 4KDFA 1DAMA 3DVAB 4TKUA 4DLLA 1MC5A 1F7UA 1WOMA 5F64A 5E0KB 4HUQA 4CNQA 3KE8A 5JBNA 1DC7A 3GP3A 2ALJA 4TM7A 2WE7A 2V8BA 3QXSA 2J5KA 2D06A 3MG9A 4GRDA 3RH0A 4WOPA 3LRPA 5FPTA 1QKKA 3F6RA 1QV7A 1VHWA 2HB6A 3VVBA 3FGNA 1PTJC 5ENDA 4IIGA 5J4HA 2W98A 1OVMA 4IUYA 1MH1A 3SC4A 1AHHA 1SELA 1J90A 2QTLA 4K88A 2VEOA 2QAGB 3EXIB 3LPAA 4MJ3A 5AUNB 1XC7A 1Z4MA 3VAYA 1ODTC 4O2BB 4C2UA 3B9PA 3B1KA 5AI4A 2BN4A 1HDYA 1MB2A 3HSKA 1IHUA 1DMRA 1COWD 3GYGA 5TQJA 3IJRA 1DCFA 4UNRA 4Y2UA 1E2FA 2VF5X 4WEQA 4Z3KA 3JVVA 1AC5A 1EFRD 4QXRA 3MPUA 3OD5A 3RVPA 1NLYA 4BFCA 4D9HA 2XXAB 3LSTA 3P9YA 4PZPA 3TIFA 4QNMA 3VAZA 1E77A 4RVGA 3ZXXA 4GDFA 1P7YA 3HYSA 1G41A 2ONYA 1ECGA 3TIGA 1BDHA 1TW3A 3GUHA 4OBXA 4XUDA 5F2NA 1PTKA 3B78A 2IP2A 2MR5A 2P4HX 3A26A 4RU1A 3OPMA 1WL8A 3KALA 4L1KA 2HZBA 4MA4A 3L8FA 3V9PA 4C4PA 2B1GA 3A4LA 3H9EO 3ONDA 4KPGA 3WWCA 5JH7B 4F5YA 5CXUA 3BX1A 4LQ4A 5FUQA 3U13A 2XNDA 2C9CA 5DNWA 3ZV6A 1G7TA 5ALPA 5KSOA 3LUDA 4UUBA 1MT0A 4A8JC 2LDBA 5JAIA 1B8NA 3DEAA 3WSTA 3BZWA 2Z2YA 1Q19A 4L50A 3TZBA 3P5BA 2HSWA 1T6ZA 3M5PA 2HNAA 1QV9A 4LQLA 2WC1A 2QN1A 3E6AA 3FI0A 4JYBA 4DDVA 4TSRA 2JD0A 3R3SA 1NQAO 1LGYA 3I73A 4G5RA 5HDQA 3SM9A 1L1QA 1KWKA 4IIEA 1TO6A 2GLTA 4CKYA 4DSUA 3DMDA 3D8HA 3TPFA 1QTIA 2ACWA 2OGSA 3NIBA 1BHQ1 4FFNA 2QTWB 5CU7A 4YECA 4BYMA 4CPDA 2C29D 4D0GA 1Q17A 3S1AB 1TTQB 1UBRS 2YWJA 2FRVA 3N59A 3EVAA 2HWXA 4GMHA 2BTEA 2ZSIA 2FDCA 1M8PA 1DOAA 3EQ7A 3L0CA 4WZAB 1JDBB 4XM0A 3CX7A 4J4BA 2ZI5A 4KSCA 1NT4A 1A1VA 4OP2A 1T4GA 3A6PC 1MQSA 2PXAA 2GPNA 2PS3A 4N49A 1IONA 1NR5A 2QOEA 5HF9A 3ROTA 4C0JA 4LYDA 3T5DA 1QZUA 3DKVA 3VDQA 3IQEA 2DULA 1NDQA 1OI2A 2GTHA 3GIWA 2ZYHA 3GT7A 1GSHA 4J0DA 4X20A 2XTZA 3ER6A 3E0XA 3S2ZA 5JD3A 1NLFA 3ESZA 4YJ2F 2WU0A 4V1CB 2CFCA 2VJOA 2VYND 2I4OA 3DOHA 4HAIA 4JBHA 4KUHA 4RESA 1IZ7A 4V38A 5FOSA 2JCVA 3DZKA 5ISMA 1Y4ZA 4C07A 1YJ5A 5F7ZA 1J00A 1QG0A 1AOXA 1E3TA 1OQAA 1B4DA 3FNHA 3TX6A 4PN7A 4Q0MA 1I0ZA 4JKOA 1QF6A 1GXSB 2HRRA 1QIJA 2P0AA 2W2LA 4HDQB 2PZLA 4GM0A 1HA3A 4FSDA 1F3LA 4HWKA 3AC0A 2HQ1A 5THXA 5CHYA 2B21A 4PRLA 4YPOA 4MEJA 2PXXA 2GVDC 2QX8A 2DBQA 2IXAA 3D8SA 1IK4A 3AU9A 2G1PA 1UT8A 3P5SA 1I6WA 3ADPA 4OREX 4A92A 1E5XA 1BQ4A 2P5SA 3G1UA 4TMKA 4C1BA 2NWQA 1KBOA 1P17A 3VZCA 2XE4A 4JJEA 1E2IA 3L0OA 2BEUA 2G36A 3P2JA 4C03A 4MJXA 5H0IA 3X1YA 4RKQA 2HT6A 2HDHA 3H2JA 1SRRA 1SJ9A 1UFQA 3OOEA 1HDCA 3K9GA 4XSHA 5JISA 1Y1PA 2DTDA 2RD2A 4GZLA 1TTHA 4OAOA 4U39A 2JJ2A 1GU0A 2P62A 1EYZA 2WJ3A 1ABEA 2X40A 3ZV3A 3WDMA 2XI4A 4JI7B 1I4OA 2H18A 3GFVA 2IYTA 3QVUA 4MLPA 3PI7A 3B5JA 2VUUA 2Y92A 2CLHB 4ZO7A 3FPAA 4DG9A 3E9YA 1NJSA 4R8SA 5AQ1A 2Y1OA 1W0KA 4KDCA 3GP8A 1KY3A 3OEWA 6LDHA 1GNTA 3IKJA 4NKRA 5DJ5A 2W6JA 3K15A 4I3FA 4W9NA 5LMNB 3THWA 3WWZA 3AB3A 2D2FA 3E9NA 2EW2A 2GN0A 5SYMA 4UPDA 3CH4B 1Q2UA 5AH0A 4JFAA 5C4GB 2QX4A 1VXOA 1RWNA 1LD3A 1RC0A 1P6UA 3C45A 3OCJA 4BMDA 1A4RA 5EGNA 3BMCA 4DYDA 2ZTHA 1NULA 2QMQA 4ITRC 5T67A 3FI9A 3X1JA 3EF1A 1WBJB 3K6KA 3K0CC 4X61A 3QOWA 5FWAA 3WDLA 4DAOA 4HGRA 5BMOA 3X44A 2HQBA 1AN0A 4E5SA 4YXWD 2C5BA 3ZVLA 2I9PA 5DM70 5AYVA 5H9VA 4LXXA 1LZLA 3VNRA 3JCZA 2XGOA 3GDHA 1JFVA 1HORA 4KRFA 1UP7A 3I5AA 3A1WA 3E22A 4HN2A 2Q45A 2ZSHA 1Q1ZA 3H4IA 3IIJA 1H2XA 1SXHA 1SCBA 4FEAA 4LWPA 2JIZD 4UW9A 5ESDA 5DI3A 4YBZA 4Y0NA 1T1IA 4EJFA 2OBMA 3K9QO 1SBZA 2O7SA 1QDEA 4MQUA 4OXIA 1H5QA 1IJFA 1I8TA 4FCTA 3PE3A 1KDOA 2CUZA 1E3IA 1U8TA 3AO0B 3IPAA 1VRWA 2DPYA 4OUKX 1G17A 4R2HA 2ODPA 4JENA 3KHUA 2CW5A 4R40A 5ITZB 1Z2PX 3R20A 3RRXA 2VWPA 3ENNA 4Z51A 5G0WA 1VPVA 3PG5A 1S3IA 2ANBA 1BN7A 2XD9A 4B4UA 4UVHA 3M3DA 1IJEA 1Z5NA 4A91A 4BHTA 5LP6B 4ASUD 4RWEA 4N48A 1TRHA 1G0OA 4RXUA 5BN5B 1NF3A 3MRTA 2YWRA 1QTRA 3QX8A 4QOIA 2F4VB 5AI6A 4QPDA 3GCGA 5KVSA 4OL0A 4FHCA 3TCXB 3FRIA 4PO8A 1KFKB 3UKOA 3QV2A 2PUAA 3QVKA 4HUTA 1H05A 1RZRA 4J0KA 3VTZA 2AG8A 2EARA 1ZWKA 2WAOA 3LUKA 5IAEA 5C8YA 3U0VA 3UOAB 1XRLA 3AJRA 2OGZA 3A9SA 2HCTA 2Q0XA 1SOMA 2H1RA 3CRNA 2J4DA 1PWXA 3GLTA 3KDAA 3MUNA 3OP1A 1DT3A 1ODIA 2JZCA 2WAYA 4MP6A 1T9GS 2PJUA 3NYRA 1NNSA 4Q16A 4B7ZA 4EPYA 1ZL2A 2PWAA 4FCWA 1ZDMA 2WSLA 4F97A 3IIIA 4IHAA 3WLOA 1X1DA 4CM3A 1B2RA 5E4FA 3ZVRA 3X1WA 2ET6A 4U7HA 2Q3HA 1PR3A 1L5GB 3VYWA 5D87A 3DV0B 4F6RB 3IJEB 3KTOA 2Y1GA 3G5AA 1NMEA 5FTJA 3U60B 4RMNA 2IXDA 5COQA 3TOXA 5LU8A 1JEYB 4P80A 4Z0TA 4YT2A 3L1HA 1BRMA 2LV8A 1SZJG 2P77A 1W2WB 2X22A 3WOHA 3QHPA 4YJGA 1QAMA 1EFLA 3N5KA 4INPA 4RV4A 2E5LB 2WK1A 1P1CA 4LF8B 3RYCA 2FHSA 3QITA 1OLSA 2DFVA 3NOQA 1UBLS 2ZDQA 3T5MA 3F5FA 4F3KA 1DJNA 2FW7A 3F90A 2QTRA 3HSYA 1LSSA 4D6XA 1IATA 1UBMS 2NZWA 4DZZA 4Y6LA 4LVCA 1P4RA 3JR7A 3OFNA 4P4TA 4ZCSA 2P2YA 1UJMA 3N2NA 4WCDA 5FO1A 5JSZB 1FSZA 1A4UA 3A0UA 2EQ5A 2PUCA 3WNVA 3EEFA 3V8EA 3DC7A 3KKNA 4ISCA 1EE2A 1E32A 3M8KA 4I5GA 4HY3A 1SB8A 2J3IA 4QT4A 2IW3A 2PZMA 3U3RA 1KKLA 2JAOA 3AYXB 3R6WA 2B5OA 2OGWA 1ID8A 4DQKA 2ORWA 1DDIA 3F97A 1IEXA 3EUAA 5ALRA 4K05A 4M0UA 3HL4A 1FNBA 3DNMA 3FA2A 5AWFC 3UJAA 4BFLA 3IUNA 5TXGA 4IAOA 2W6PA 4NNJA 3R41A 3TLMA 5F1KA 1CU1A 3JQPA 2RSLA 2NYRA 2G9VA 1VL0A 1Y9ZA 4X97A 1L5KA 4DLWA 5D3ZA 1PR5A 1ZXLA 2HMTA 2W43A 3UUGA 4MJLA 2D2EA 2Q46A 3GQVA 4FE3A 4V0OA 2ZRHA 4AN1A 4D8VA 5TVGA 1CLUA 5EG5A 3RU2A 2HMVA 3RVSA 3HNRA 1YBMA 2CL7X 3AHJA 3H9JA 1T6YA 1POWA 1P3DA 1R18A 1VHQA 2QT1A 2YXPX 5C80A 2HGSA 1WO8A 3ZTTA 4HQNA 1RBZA 3UG7A 3AUJB 1JKJB 1U7DA 1YI0A 2HMWA 2RGRA 1NMQA 2D8AA 2GHRA 4CV0A 4PLTA 1CY0A 1NATA 1WU7A 5DOZA 5HPYB 1BC5A 4AY6A 3G0HA 5HR5A 3K9BA 4FHEA 4HLUA 2G4VA 2G70A 3F9CA 1JDVA 3BB1A 4JI8B 1YS2X 4AZWA 2V6FA 2ODTX 4XPZA 4QARA 2X0FA 3B7WA 3VNBA 4C0HA 1CUVA 2WBLC 2XE8A 3M3PA 4XQEA 2H9AA 1PJRA 3BIFA 1ND6A 1SXPA 1R8QA 1RLUA 1DIHA 3C3DA 1YB4A 4L02A 1VRCA 4QYMA 5DLPA 1SXIA 5DBFA 1XAIA 1CIPA 4L16A 2JGDB 3M1AA 2R11A 5ALXA 2YJTD 1I3MA 4V2UA 3T0IA 4F4CA 1G7CA 1RDFA 2RHMA 4J4TA 1TU3A 3S8MA 1YVDA 3F5QA 2QRHA 3IT3A 2VFAA 3JYLA 3NBFA 4FUTA 7ABPA 4J75A 4K2AA 2D0PB 2EL7A 3NM6B 4R4JA 1OIVA 4UE2A 1EJ0A 3OE7A 4P84A 1MW8X 2C58A 4PPGA 3LFUA 1ESCA 1I6KA 1ZCAA 4HB0A 3B1FA 2PBZA 4YJ2A 16PKA 2ID8A 4OM7A 2G07A 1QRDA 3V4OA 1RQRA 5CIYA 4LE2A 3Q7RA 4FD3A 2PD6A 4YI3A 4RADA 3RIGA 2JHCA 4HT3B 3MS4A 4GX2A 3FH0A 4PXYA 4BP3A 4CMJA 3IEKA 1GKYA 4G5YA 4Q4LA 4Z6KA 1K3FA 1QGOA 1RHUA 2H2IA 1SB9A 1HE3A 3HWWA 4I46A 4LWOA 4YASA 1O5TA 4CQJA 3PCXA 1ZN2A 4NMLA 4YUXA 4XFKA 1N9ZA 4ZZ3A 1QH8B 5C18A 1KI2A 2O3UA 1W6UA 2OMKA 4GX1A 4UJ3A 3WIUA 4PNEA 2ZSAA 2C3UA 2GAIA 4RVFA 2EERA 3G2IA 3L8DA 4NCNA 4E12A 1N0IA 1KOLA 1GDHA 3TIXB 3Q3IA 4K86A 3NIFB 1QWSA 1L8AA 3CRMA 4N3NA 5ADWA 4NFSA 1OD6A 1QHNA 1G4AE 2LDXA 4FZ3A 3DMRA 2O14A 1TAHA 1HT3A 3EWNA 4BO9A 2OXCA 1BWRA 1O57A 3WIBA 1SQ5A 4JLDA 2AC7A 1K2WA 2QYSA 3GJ4A 3KSUA 4IDGA 4P34A 3ZDXB 4G0UA 4NHOA 2VYVA 4DC0A 3A6KA 3NEJA 3KKMA 4H7DA 1AQYA 1P4GA 2G4LA 2J3EA 2V65A 1W581 1US8A 2QP3A 2YW9A 1N8NA 1ZRMA 3LE8A 4LI0A 3LU1A 4NCKA 4ISBA 4NYJR 3OEHD 1C4OA 5AVJA 3QXGA 4BAZA 4S0ZA 2FF7A 1C7ZA 1XR3A 1Z15A 1JQKA 3NX4A 1OZHA 4XIGS 5JFGA 2WQ6A 2FOIA 3A4NA 1C3XA 3TSWA 2XB8A 2ZFUA 1K97A 3X3HA 2LE0A 4AYWA 3OBBA 5LVAA 3L8HA 3W34A 3QEMA 5B2EA 2O1WA 5CFQA 3FMFA 3P9SA 4DGQA 1DUVG 4CF3A 3LK6A 4OXNA 3JSXA 4FE4A 3TOZA 1JBQA 1FDUA 4MUXA 4Y2QA 4LFCB 4F72A 2R5NA 1KQNA 2WWIA 4CIVA 1NT2A 2DG2A 4RLFA 3NRCA 2P75A 1UJ4A 5G3YA 1E4EB 2IOFK 3DKKA 1RJWA 1QKIA 2C9YA 2IHUA 1GUFA 2AFHB 3MS2A 5T3YA 3CNQS 1BKSB 4RVNA 1U4NA 4CLDA 2IXGA 2Z5VA 4MW0A 4XGQA 4MTCA 4N1AA 2AF4C 2CJPA 2Q29A 1WCXA 3QJ5A 3DZHA 3SJBA 2BM8A 1NX9A 4H27A 4LBYA 3F0TA 3UGKA 3U4MA 5PNTA 3PQCA 3ZS8A 1JECA 1JWLA 2C20A 3C3EA 1O6ZA 4HLDA 4II2A 3TXAA 3WQHA 4BCDA 3L1JA 3IP5A 4GF5A 2DUJA 3K35A 2FMXA 3TE6A 5BWOA 2O2GA 2JJYA 2HJGA 4LPKA 2A7QA 3A6FA 4FMCB 5HFAA 4UNPA 5BYAA 3VDNB 1UM8A 3JASB 3RJMA 3GRCA 2A84A 1SUDA 1WV0A 2JFGA 4IDFA 1GTL1 1JXQA 2P40A 3IBGA 2IQ5A 4IUDS 4PQGA 5NULA 4YO7A 7YASA 1O0BA 3JQ7A 5FI3A 3G7UA 4YJHA 1R0XA 2JRLA 4O02B 4YRKA 1NV8A 2DLNA 3MBKA 4NYMQ 4ROSA 4EGJA 1ZGGA 4O5OA 4C4AA 4GDMA 1A71A 1CY2A 1W25A 1LVUA 5ALDA 3PEFA 2X23A 4DWOA 1XEWX 1QVZA 4UM7A 3UNXA 1WHTA 1F51E 1VJTA 2VDWB 2XTMA 2Y77A 3E3LA 4BBZA 4OHUA 3T7AA 4ILKA 3PPIA 1VIDA 4ZOBA 5LZ2A 3SXUB 2R5WA 1CUDA 1JB1A 1CRQA 1FS4A 1WG8A 2D1TA 3GJZA 1Z16A 1Y7TA 3RBAA 3K0FA 4BP9A 1KGSA 3FYCA 1P73A 1HYHA 4H7EA 3H42B 4C20A 5IJZA 3JQAB 1A72A 1EIZA 1A9RA 1EBBA 1OIWA 4EVIA 3DDWA 3BDIA 1UKYA 4DLKA 1OI7A 2C88A 2V7UA 1U3WA 3CW8X 3FYUA 5FLKA 1E98A 2P79A 3SYKA 3MHTA 3CHYA 2WUGA 4R5HA 4DEVA 4NG5A 3ETJA 1DT5A 1CRLA 2O0LA 4HZIA 4EW2A 3BCUA 5LQRA 3SC6A 3PVSA 3WYEA 5IUJC 1BAPA 1VG1A 2RH9B 4GP6A 3NUQA 1RC1A 1B0UA 2UUPA 3GK3A 4XIIA 3L8MA 1UXKA 3S7TA 4QM6A 1XEAA 3L07A 4AUMA 1FRNA 2HCBA 3SQWA 2H59A 4YRMA 2AOUA 3GY0A 2VNHA 2PVCA 1EVJA 1JG3A 2OP0A 5DASA 3MJFA 1V8PA 3H19A 3MVEA 2EJVA 2QYHA 3Q5DA 3VZPA 1T2DA 2HPZA 3LJKA 4ILEA 1ZUD1 3AU8A 4PANA 2IW1A 2YJ3A 3QUTA 4ZAXA 2OG2A 1FDVA 2Z8ZA 2PRYA 3FKSD 4GOMD 5CNKA 3TCNA 1EGAA 3I30X 3V80A 4BV3A 1Z82A 1WM1A 4N01A 1QO0A 3FG9A 3PRJA 4O4HF 2ZAYA 5BOVA 3BCSA 3CZ5A 3F1KA 5FBHA 1X0VA 4NBKA 2WKWA 3HU3A 1T0UA 5H4HA 3RJZA 1XTJA 2F1RA 2I6SA 4BO7A 5CB4B 3GRZA 5C7OO 5JZBA 1DQRA 2GM9A 3V48A 2FSFA 2HRQA 3Q6NA 4O8CA 5DB4A 1IFXA 2XGJA 1UR5A 3PYMA 1B74A 3VR5H 4ENQA 1UMKA 3NEYA 1Y1QA 3PPXA 2DYKA 4CV1A 5JARA 2VP0A 3V7WA 4BTVA 1QGYA 4CIXA 1VM6A 2ZXFA 3BAFA 3ETDA 4Q24A 4KR7A 3RPEA 4DCVA 4DCGA 2JL1A 1JLLA 2Z09A 3AKCA 3ZE2B 2Y1XA 3HCRA 4OJTA 1ZUIA 3L93A 4QATA 1FNMA 1EK2A 1B76A 5FUMA 1W0CA 4L08A 3C5VA 1XXHE 2GWHA 1OUMA 2RGAA 3FRHA 4WXYB 3G02A 1Q1EA 1WDLA 1SHZA 3KPJA 3TN7A 3FDFA 3OQNA 5JT1A 4Y98A 1FYDA 1NC1A 3ENZA 5FL7A 3V7FA 3R0JA 2ZZNA 4PX9A 1JXMA 1NBHA 1XQVA 4BX0A 2C77A 2ZZKA 4F45A 1C5KA 3RK0A 1H2ZA 2PPVA 1ZU4A 3HU5A 2YNMD 5KWEA 2Z08A 2RCNA 1Z4NA 2WAAA 5BSFA 2H5JA 4G65A 5TV2A 4Q15A 2CLSA 3RM3A 3UJBA 1SQ0A 1QP0A 3KUXA 4LDRA 3NBYC 4L2IB 3MINB 4NZZA 4MP8A 4V2IA 2ZI3A 5IAGA 2HPAA 3RRMA 2IH2A 3CUTA 2BLNA 5EVCA 1DLIA 4B6JA 3X1XA 1XMXA 1JT2A 1L7NA 4IVQA 3DVSX 1W59A 5KBYA 1J2RA 1Z28A 3QBTA 2RFLA 1LPNA 2CWWA 4P92A 2RE8A 1PI3A 1TM3E 3NNNA 4D9MA 1CJTC 4Q9NA 1G1MA 4W9NC 4LDZA 3D8UA 5E95A 1SVLA 3P4UA 2QF7A 2VPZA 2JGRA 2ZI4A 1TM1E 1Q7GA 2BR4A 2C2KA 3L6OO 2O0MA 4N5DA 2WSBA 3M4YA 5K99A 1BFUA 4MI9A 1ECFA 1VHJA 4O29A 3THYA 2V74B 3CEAA 3OOJA 1MG0A 1Z12A 1NW8A 3A10A 1ZRSA 3QNWA 3QBEA 2DR3A 2C4KA 3N0XA 3O1JC 4G81A 2SCUA 4YB8A 1U31A 1H2BA 4CM5A 4V1CA 1P0IA 1D4ZA 5LYYA 1BWPA 3T4PA 5JU6A 3RJ5A 1I7LA 1JQDA 2HIGA 2NG1A 2OMEA 2RH4A 5K5EA 1E0SA 1TM5E 1VLJA 3OEYA 1ZSVA 3MOSA 4L15A 1XTRA 1G3MA 1UKZA 1UMCA 1KTIA 5BQXA 2H1HA 4US0R 1PD0A 4AN0A 2XXJA 2QS9A 3RR2A 4GSYA 3HFGA 2JGAA 2NTEA 4G1UC 4PTZA 4DZRA 5CDYA 1USUA 1IMJA 1KPHA 1RD4A 3L40A 2D3WA 3M33A 4RDIA 3R23A 4TMVA 3DDSA 2YXBA 3TTUA 2Q5JA 4PBRA 2NQ8A 3F74A 4PZLA 1N8TA 1HV8A 3P0IA 3RT9A 3OESA 3RRBA 3ZE6A 2J33A 2DBZA 3FETA 1ZY2A 2BFCA 2Z4TA 1NRJB 1I01A 4YDHB 4WJLA 4QTYA 1ZINA 2IEBA 2QMYA 3AEYA 2QT0A 4MAAA 2UKDA 2E4VA 3H4VA 3A2MA 4EYKA 1MBZA 3PNPA 4B3IA 3EVTA 5IH7A 3DB2A 3NEAA 1S8AA 3ESXA 4DB4A 1NW6A 4OA5A 5HGXA 1JSZA 1XRPA 3CZAA 1SPBS 4NK5A 4L5CA 1NNI1 1YQGA 5K3BA 1EM8A 5C1OA 9MHTA 1ST3A 3CZMA 3VR0A 4CM6A 2JFBA 1RI4A 3I64A 1BXGB 2BH9A 1Y8RB 3B1JA 1SGWA 1AUXA 4KLAA 3U61B 1T10A 1FFXB 1BNCA 3AERA 3PWSA 2XNCA 3PXBA 3CVVA 2GZAA 3INYA 1NE7A 4LCJA 4O0MA 2QYTA 2JVJA 1QE3A 2VQ6A 5KTTA 4X92A 1DNPA 5JAQA 2W7TA 3TZLA 4MRPA 1H8HA 1N5DA 4V1CI 1VB5A 2EX0A 2QTZA 3HDJA 2BC9A 3ND5A 4D5EA 1PFKA 2ZYAA 4Y2XA 4P7GA 4REQA 5ERXA 5TRTA 1DRUA 5AR1A 3GLQA 4YFYA 1EE1A 4N9QA 4HDMA 2W42A 2OM2A 2XQFA 3RRFA 2IPXA 1EFPB 4QGHA 5G4KA 4PGGA 4JBNA 3ZU3A 4E6EA 5LC1A 4JLVA 4RTMA 1KI1A 5SYAA 5J4LA 5G40A 5DIFA 1KSGA 3ZY6A 2QRLA 4JU9A 4BO2A 3LCCA 4L5JA 4L3WA 1VOTA 3AT1A 4P8RA 1N4AA 2ASEA 1RQXA 4ZU1X 3WNQA 3QWHA 4LZNA 5C8ZA 2HEIA 3IVGA 2JFZA 1GO2A 1WLSA 4U0KA 5FHQA 5B1DA 4E7PA 3PQ2A 2YWEA 3VPFA 4E46A 1NVMB 2PY6A 1CQIA 5CA1B 3H7IA 4YDRA 2HADA 2QE7A 4BRWA 1R6TA 2ST1A 2ZSKA 3I09A 5EE9A 5BW4A 4H31A 2VPQA 5F33A 3VR3A 5LXTF 3R0XA 1Q5PA 1PWEA 3AHFA 1XDBA 3M9LA 3RYFA 3ZLUA 3JSAA 4BQIA 2NNLD 4B7AA 4YRJA 1EUQA 2OVBA 5HG0A 3UWDA 2YHIA 2JS7A 3PZRA 4UNNA 3I42A 2J5XA 2OE2A 3AKYA 3G3EA 4L9AA 5LQJA 3GDGA 1T1JA 1H1DA 4FKZA 4HDAA 1NC3A 4F21A 2YL2A 2FEXA 4DMMA 2Q6OA 3C1AA 4UKDA 1DO0A 1TEZA 1LU9A 3PWZA 1HE4A 4QJ4A 3U9LA 3OX3A 1YTLA 4Z9AA 1HE5A 2B4RO 4EG5A 2NZXA 4YRPA 1KEPA 2PMWB 3AVTA 4DUGA 1JALA 3C41J 4JJ8A 1I30A 3HCNA 2QSUA 3HHEA 4Y1GA 3PIRA 3SZLA 1J22A 1XWIA 2GKGA 1ICEA 2WWRA 4DSTA 2IXBA 3L7LA 1Z2CA 3PLNA 3HDTA 4US1R 3UJ6A 4CMIA 2VWQA 1YL5A 4HRAA 1R6UA 3ZWPA 1EBFA 1R8SA 4QYWA 4FPXA