5M3BA

Structure of cobinamide-bound btuf mutant w66l, the periplasmic vitamin b12 binding protein in e.coli
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
244
structure length
228
Chain Sequence
APRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTLQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Change of a Tryptophan Residue in BtuF Facilitates Binding and Transport of Cobinamide by the Vitamin B12 Transporter BtuCD-F.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Vitamin B12-binding protein
total genus 78
structure length 228
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5m3bA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5m3bA02
4FNAA 3AEKB 3ZK9A 3AEKA 3AEUB 4WN9A 3AERA 2YNMD 1QH8B 3MFQA 5M2QA 2XQVA 1FP4B 4MLZA 3MWFA 1H1LB 3PSHA 3MINA 5JPDA 4WNAB 1K0FA 4MO9A 5HX7A 1XVLA 4OXQA 5KOHA 1KARA 4IRMA 4OVKA 4ND8A 4FILA 3MD9A 4WESA 2AFHB 4UTOA 2AFHA 4TKUB 4HN9A 4MX8A 2RG7A 3LI2A 1N4DA 4DBLE 3ZKAA 1M34A 5KOHB 2ETVA 5B58T 3UJPA 5JOQA 3AESB 2OV1A 3R5TA 1M1NA 2WHYA 4XPIA 5AFSA 3MINB 1H1LA 3K1AA 1FP4A 2XDQB 2AFIA 2XDQA 4FKMA 4HMOA 1QGUA 4UTPA 3LHSA 4XPIB 2O1EA 5GGXA 5KHLB 1ESZA 3AETA 1EFDN 2WI8A 1MIOB 5M29A 1PQ4A 1K7SN 1N2CA 3HH8A 5BVGB 5BVHB 4H59A 4K3VA 3TEFA 3AEQA 1N4AA 3HJTA 1N2ZA 4WNAA 5JG7A 4B8YA 4UDNA 5HDQA 4WZAA 2OSVA 4FI3F 3TNYA 3GI1A 1M1YB 4MDYA 1G20A 4WZBB 2R7AA 1MIOA 2XH8A 4WN9B 5KOJA 4N01A 5M3BA 2XV1A 5KOJB 5GGYA 2R79A 4G09A 1M1YA 2OGWA 4WZBA 4G07A 3BE6A 2AFIB 1KAEA 5M34A 1QH1A 2X4LA 2XUZA 3K1AB 4BBPA 3NU1A 1KAHA 1M1NB 2PS9A 4TKVA 3AESA 2OV3A 3U7QA 4PM4A 5FLYA 2PS0A 2QI9F 3AEQB 1G21A 3CX3A 4M7OA 3PDIB 3ZK7A 4HMPA 3ZK8A 5BVHA 5BVGA 4GICA 4OXRA 4ND8B 3PDIA 3AETB 1G21B 1L5HB 2XY4A 2M6KA 4INOA 4CL2A 2Q8PA 1QGUB 3HXPA 4LJSA 1QH1B 5CR9A 4NNOA 3G9QA 1L5HA 1QH8A 1K75A 1PSZA 3AERB 3MWGA 3R5SA 3AEUA 3ZTTA 1M34B 4LS3A 4NNPA 4INPA 5I4KA 2PRSA 3PSAA 4HMQA 4TKUA 3EIWA 1G20B 4WESB 4H0FA 2MINA 5CX1B 2PS3A 4WZAB 3TLKA 3U7QB 2Q8QA 1TOAA 2PHZA 4PAGA 4TKVB 3EIXA 4UDOA 2YNMC 2MINB 5CX1A 1N2CB 2M6LA 3BE5A 5JJ5A 1K2VN
chains in the Genus database with same CATH superfamily
3IE0A 1L5YA 1WSDA 4REQB 4WKPA 2F43A 3QP9A 1II9A 3OH8A 2OBNA 3HLTA 3V8NA 4EYSA 1J20A 1Q6YA 3RFFA 4B6EA 1LSOA 2UYYA 4ZTUB 3HZOA 4N40A 2AC7A 1Y33E 2AV6A 3BXHA 1IN6A 1H1LB 1W1UA 1C4KA 1YOVA 4MZXA 2R7KA 4RPIA 2Q4TA 4LCBA 5KIAA 1UDWA 3EQZA 4XLTA 3EA0A 1VIYA 3PC4A 3DZFA 1NMQA 3UWOA 2E18A 2OSBA 3GBSA 3F8SA 3RNOA 5JRJA 2PUAA 3KT8A 3O8BA 1LVGA 3O9VA 2P30A 2H06A 4TKUB 3QUTA 3KQSA 4DEYA 4B6OA 2JB9A 5EHNA 3THYA 1NDHA 4IUCS 3W3AD 1U0BB 1WZCA 2FXVA 5TF4A 4DJEC 2PNFA 1E94E 3QWHA 4BU1A 1UOOA 2R7LA 3GFOA 1BE6A 1N5MA 3AHEA 3B9QA 4ZVKA 5HM8A 1U8FO 1ZNWA 1YJXA 3G3EA 3M5WA 3QENA 4NHOA 4YJ2B 2BELA 2P9CA 4D6XA 1Y6FA 3LYAA 2CCGA 2X4IA 3K16A 3NCHA 3PXUA 4PG6A 4REQA 2WI8A 4DR6B 1UBSB 2X86A 4UBLA 5DNYB 2A5DA 1A9TA 2YKGA 1BS1A 3TPZA 5AHKA 3I4FA 4QYTA 4RKWA 4KO8A 4RVGA 5BNTA 4DV7B 4CIAA 2AKEA 1T9BA 5H16A 5IBPA 1Q77A 1K6JA 1RYEA 3I23A 2GXUA 5REQA 3IDAA 3UGQA 5HQ3B 4YIHA 5BYAA 1WULS 2O8EB 3NEJA 5H7XA 3IOMA 4HH3C 4IFIA 1C9MA 3CGWA 3IIMA 1E6LA 4M89A 3GG2A 5DTJA 4AJIA 2DWUA 4G4SP 2BBTA 3FPBA 1XD2A 5AJZA 3C8DA 1GSOA 5FL3A 3P94A 4D56A 1QS0B 1Z7GA 2ODNA 2PE5A 2C3MA 1K5DA 2ORED 3DTNA 3VUFA 4Z9AA 3NMUF 5FTKA 2F1HA 2WHQA 4WOKA 4RD1A 1KL7A 2DG2A 1ZIYA 4MDHA 5LP6C 3T38A 1TGVA 5J40A 2OV3A 4BEVA 3WGVA 5JYCA 2CFIA 4Y9SA 2WM8A 4CM4B 3B13B 4LXXA 3GLGB 4Y0NA 2C1ZA 2IHZA 5KX5A 1MXFA 4WCFC 5F5LA 3LMKA 3R24A 2ZYAA 3ZEIA 1Z5ZA 3AFMA 1CDEA 4EPWA 1SPBS 2X0NA 4D3XA 1XA4A 4DSOA 4X54A 3INYA 5DJ5A 2VAPA 1P7VA 2WMOB 4R71A 1N7GA 1RI4A 2ZUBA 3NM6B 4AJ2A 2PL1A 1OLSA 5BW8A 1OQAA 1EP2B 3CZCA 1TCCA 3ME5A 4MV5A 4LJ6A 3LKVA 2CV1A 3TG2A 3QFSA 1XD9A 4M9SA 4I36A 3LPNA 5MDHA 3SKVA 5IKOA 4C4TA 1EWYA 1R5BA 1XAGA 2Q9BA 1VE5A 4X24A 4ZEWA 5BYBA 2GO7A 1NRJB 1W0JD 1TM1E 3IAM1 1JG7A 4K9NA 2JFPA 3RGGA 3UW3A 3F4KA 5KJ1A 1F7UA 4OB7A 1CZUA 4ABYA 4I4CA 4PY2A 2V7BA 3BCUA 2FP4B 2F59A 2V7XA 4E03A 5DF1A 3A0RB 3O8OB 4XTCS 3SJCA 2VNAA 3KJXA 3X1DA 2DU8A 1M7BA 3AB8A 3DBHA 4CFZA 1YB1A 1O6BA 1UPXA 1S7GA 4V24A 3JAKA 4TUYF 3N7AA 3PXAA 3PL1A 3E9RA 1FBNA 1VIVA 2PX3A 1GCAA 4KNYA 1E2PA 1KXJA 2FPSA 4QEZA 4Q1VA 3V4RA 5DSZA 1GQQA 4HUJA 1E4OA 3TOVA 3V9PA 4EG8A 4AAYA 2IS4A 4Q3KA 4KC0A 4XD2A 5L7WA 2QJTA 3ITNA 4C0AC 4ARCA 1G8JA 2F3UA 4DZZA 1TKRA 3BSWA 2FJUA 2P4UA 3H1EA 4WFIA 3TQSA 3W2FA 1QHSA 2VK8A 3RVNA 4LNUA 1TC1A 5A3SA 3BFVA 1PE0A 1AJEA 5DX8A 4ZVTA 1HNXB 3N53A 4O2AA 2G76A 4J4TA 1VPTA 1C4XA 2VK2A 1GNPA 1YXMA 1XDDA 2RC6A 2R1VB 1N6NA 2VK1A 3U1TA 4HNAB 4MVJG 4QKQA 1XZPA 2GM9A 2ENWA 4OUDA 4JI6B 3U9SA 3UV3A 5CDHA 4L75A 3AZQA 2D1QA 1YAHA 2V59A 4GVLA 4LRUA 1OSNA 421PA 1Y7HA 5BWLA 1P4JA 4Q0MA 3THXB 3FD8A 1AKVA 2R6FA 3AU9A 1ABEA 1EVKA 1Q5PA 3M89A 4RTJA 1VPWA 1L4GA 3F4BA 1E2EA 3T34A 3IR7A 1AKTA 4L2IB 4IF6A 1F2VA 3VV2A 1AXGA 4CMJA 2J1LA 1LCIA 4HSGA 5CBPA 5JQGA 3BE4A 2AZDA 2CVQA 5AVWA 5TJHA 1R0LA 1SOMA 3QLVA 3O2QB 4AIRA 4CLEA 4F4HA 1N8TA 4UVDA 1O94C 1R0BA 4ZIRA 4Q1AA 4GP6A 5M04A 3TKAA 1WCIB 5KZMB 4ITVA 5I7OA 3HI4A 3NBUA 3HU5A 5EZYB 3C3CA 5K45A 4DIDA 4I4TF 1GRNA 4UFNA 1P7CA 5ALHA 4GI1A 4MVJD 2JHAA 2A84A 4PGMA 4DMRA 1SQGA 1Q17A 3GX1A 3ZHYA 2JGDA 1THMA 3K1AB 3DF9A 4M0MA 2C4NA 2CJWB 2GN4A 2C7BA 1JMKC 1NX6A 1VL2A 3HO8A 1BA3A 2QI9F 1N2OA 1P44A 2O2GA 3R3HA 2NU7B 1KZ4A 2Q2NA 1JU9A 1YD7A 1Y5IA 3NHWA 1EUZA 5BOSA 3EK2A 1KI7A 3D5TA 5F2OA 2DQZA 4LISA 1L8OA 3LQYA 4ZQEA 3CZRA 2OQIA 3NEPX 2WU1A 1AMNA 2NTEA 4DA6A 3NFRA 3GD7A 2Q8PA 3GLHB 2X9NA 4J2TA 3QVGB 4TVOA 4F5YA 3FNHA 3KUDA 2BKXA 4JYPA 1YMQA 3R0ZA 3PCXA 2R25B 4M3NA 4PCLA 3CVWA 4DJTA 7MDHA 2J3DA 5K09A 3OWHA 1OT3A 1R5OA 1QO0A 2HNKA 3FPHA 4E5NA 2ZZNA 2EHJA 3SNKA 1AQIA 1I3MA 5HIKA 3BWYA 3PSAA 1TZKA 2GETA 3C4JA 1QIDA 1KGSA 3KL2A 4AI6A 3F0TA 4FZJA 1AV7A 2Q5HA 4MGHA 3D2LA 3I8XA 1TUBB 3GJ5A 4OGFA 1Q3HA 2B34A 2BM9A 1MZVA 1SJ9A 4I50B 2J32A 4Y2SA 2ZSDA 5H68A 5KVAA 3F46A 3VHXA 5JU6A 3BYZA 3MT9A 2HUNA 4IDHA 2WWIA 3PNSA 3DQQA 2ZRJA 1DV2A 4YAKA 4ZEVA 4RD2A 1QYCA 4CLRB 3LGSA 4N1AA 2VH2A 1JQJC 4KCGA 5AHOA 2CUNA 1ILWA 2AOUB 5EGSA 4H1WA 3RQIA 3T54A 3WJ1A 2F8SA 2JC3A 2H7YA 3G5UA 2E4UA 1XEXA 1KVQA 4YCCA 2QTAA 1IAQA 3KB2A 4X5OA 4I4TA 4PLWA 2QR2A 3DE2X 4FD3A 1U7DA 3TEMA 1YAJA 4BEWA 3RTBA 3B6JA 1RLIA 2QMQA 5EWMA 3TJMA 5F77A 4EPRA 4CUZA 5J4KA 4J91A 5E7MA 3ODGA 3W04A 4AU1A 1Z6YA 4IJQA 4JSRA 3F7MA 4B9EA 4BDSA 1TFUA 3ZJUA 3ZCTA 3M1YA 3KD2A 3EEIA 4D4MA 2Q3JA 3VR2D 2GJAA 3CZAA 5T4BA 2V9CA 4NU6A 4IO0A 5EHXA 4LK2A 2JI6A 2CHQA 3OY2A 1AM4D 2WFAA 3HCWA 3PPYA 2GZHA 4UM5A 4ARAA 1ZXXA 4R40A 4ZAYA 1UIMA 1F8YA 1GL6A 3ETDA 2VXOA 4RL4A 5JYEA 5JO9A 2XMPA 4RETA 1MFZA 4PCUA 1R27A 4JR2A 1KR5A 3KOWA 3MCAA 4PG7A 3VR6H 4ARZB 1LC3A 1P4GA 2A1TR 2AT1A 1IJBA 2SHKA 1F60A 4MUGA 5I45A 2FG7C 2W4IA 4KLCA 1LW6E 1PG0A 1H6DA 5A06A 1OLUA 4EY7A 3PQ5A 1QF6A 4UXHA 1N5LA 2XB9A 4MQBA 4XUDA 2DHQA 4KKXB 1LJ8A 4LDRA 3IIIA 1C0LA 1WZNA 1XZLA 4TMVA 4UU1A 3UT0A 2PUBA 1WOYA 4DNXA 4TVKA 1DMSA 3ZV7A 1FUIA 3S2ZA 2C9BA 2BEJA 4G5GA 2ECKA 3C5CA 3K4HA 3FB1A 4P53A 4F4FA 5JC8A 3BXEA 3F9IA 4BX9A 5JAIA 3E5NA 1SGWA 3QVLA 1L4BA 2JDID 4UUAA 2QG4A 1OLUB 1JHYA 3T3HA 5A9SB 3OZXA 4RULA 3GQBA 3OPQA 2WHXA 4TUYA 4KI0A 3RSHA 3PRJA 1O08A 4AMGA 2I8AA 3O6VA 2WYWA 2CW5A 1E6WA 4DSZA 5A5GA 2Y92A 3LGXA 1Z0DA 4OHXA 3AU8A 3IEVA 4OQ4A 3GV0A 3A9VA 5AESA 2VVTA 3DLBA 3OI7A 2DE0X 1G2QA 1E2MA 2OCXA 2ZSFA 4D8UA 2P9TA 3L9XA 5KVQA 3UA4A 4JJ8A 2FZLA 3K0CC 1I1HA 3AY0A 1ZK3A 4MVXA 2ID4A 1PFUA 3PQ8A 3WWYA 1DC4A 4ARIA 1BZYA 1FMTA 4WA7A 3DT9A 4XXHA 4JGGA 3LT2A 3PFHA 3UK7A 3TOCA 1YRBA 3HR8A 4BAGA 1OA0A 2YVAA 8ABPA 3TFOA 4PO1A 4MV7A 1SUAA 2REBA 4R84A 2INGX 2CZCA 4GBMA 5F12A 2DSNA 5DLQC 4I8XA 1F6WA 5DM70 2NYUA 1NU8A 2V6FA 1U3GA 4I1OA 1GTMA 2AFVA 2XPCA 1RWQA 4FGWA 2YNMA 2FI1A 2AG6A 3MLAA 3R3WA 3KQMA 4BGDA 1Y1QA 3OKPA 2YASA 5G3YA 2OORC 2R8XA 4HFNA 1GA6A 1K2VN 3OZUA 5AP9A 4UM7A 2VZLA 4DR7B 5DISB 3X1JA 5IHPA 4EJFA 1F0PA 2YNMD 2QROA 3ZHVA 4EUKA 1RU3A 3K8ZA 5K4AA 5AKXA 4DAEA 2CCKA 1OTHA 2AS0A 1N2IA 2IYRA 1JFRA 2JIOA 4PPGA 4YO7A 2O1WA 2XZDA 4M22A 5ALOA 3UK1A 4LBZA 1WP4A 1MX9A 3TQHA 3KQPA 4H0NA 1QWSA 4ESEA 4YRIA 4GKBA 1X1EA 2J6CA 3ENKA 1GGJA 1R0CA 3U4GA 2PZMA 3C0KA 1NN5A 1F3OA 1U0EA 4JZYA 1M2WA 1PHPA 4TX1A 4UDXX 4ZT4A 4EHDA 5J1TB 4D0RA 4D3YA 2ANCA 1K1EA 1KEWA 1P2BA 2GDJA 3RFXA 4RYLA 3FJOA 4M1WA 1RXUA 1CUAA 2C59A 4II3A 4JUIA 5AXBA 2J07A 4ZMSA 3AKZA 4XVUA 1W85B 5ER6A 1RRFA 2IWRA 3CIFA 3QEJA 1ZD1A 1O9GA 3HUDA 3SKXA 3NBZC 1RAAA 3C2QA 1E5LA 2IVZA 3UG7A 5AVZA 2P68A 1TAQA 1H6CA 1VL8A 1ORRA 3T5PA 1H23A 2D5CA 5BVGB 3KZMA 4Y7DA 2QRVB 4PEVA 2IUFA 3HNOA 4OHRA 1G9TA 1BE1A 4X1KB 2CYBA 2NZXA 1FRVA 3BD7A 4XLLA 3SN6A 3ZQ6A 4CMHA 1SC1A 2HQOA 1G8FA 1JW9B 1V9LA 2GZSA 2QENA 4P81A 2JFFA 1CG6A 3JZMA 4P4SA 5FULA 5AK3A 5HF6A 2R7AA 3PGJA 1OYYA 4YP7A 3V1LA 2EV9A 1U8ZA 4W1SA 1TM5E 3KXDA 3JPWA 1K8ZB 2G06A 2VIIA 3CRMA 1YACA 1S3FA 2BWJA 5LZ5A 3EAGA 3JZFA 3QIAA 5HK8A 4ZIRB 3EXHB 1S2LA 3A6ZA 4HDOB 1PFYA 2LD4A 1IDN1 1BD3A 1BQEA 1JR3A 3OO1A 3W6PA 1EE2A 3CW2A 4JJIA 4H7IA 2XMGA 3WRWA 1W7AA 1Y9AA 3EN0A 1WAMA 2VYCA 4BLRA 2XUAA 2XTJA 2PWAA 2YWGA 5IBRA 1I7DA 1E89A 1M6VA 3NHMA 3PD1A 1E9CA 4GBED 2HUPA 3SQMA 3G82C 4H6PA 1SVWA 3K72B 5A5FA 3AK4A 4A8TA 3WAKA 2F3QA 1RQ7A 3R2JA 4YRQA 1BE0A 2R8EA 2X1HA 3C3YA 4J2OA 1L1FA 3D6TB 3IO5A 3OP4A 2B98A 2MSKA 2VXYA 1I6WA 4GC9A 3WLEA 3I4CA 3Q88A 5JSUA 3UJNA 1FDSA 2P35A 3KKZA 4UJ3A 2F8LA 3JPYA 2H0RA 1N92A 3NETA 4TRJA 5B12A 1ZGHA 4CTKA 1Q0LA 4DBVO 2WILA 1JJ7A 4FCCA 1BRMA 2FZEA 2XUOA 4JCCA 4EUSA 4PRYA 4ZCPA 5LB2A 4QHTA 2VQDA 2B35A 1UBJS 5CW2A 3UKOA 2OGUA 5B1IA 2B8JA 1KKLA 3COWA 4J43A 3DE4X 5KU1A 4NV1A 1CVRA 1X1CA 1YS4A 2HDOA 2ISSD 1ZYUA 2R48A 3BXXA 3EWIA 3GJ0A 4ZCLA 4CZ2A 2YJGA 5KC9A 4HAVA 1Z8NA 3V32A 1F5NA 1X9HA 3M2TA 4RORA 1H2AS 2YHAA 1IULA 2FR0A 1SUBA 3GEEA 1LSJA 3PF9A 4KMOA 4Q21A 4BN5A 5JNLA 3ESAA 2D06A 3W1VA 3AERA 3ZDEA 3L4EA 4L85A 4N49A 4F1WA 3IP5A 1ETHA 3PP8A 3VOTA 2WJIA 1NUTA 4HRVA 1C50A 4H0CA 1SUPA 3BXFA 1Y82A 4MLZA 4Q1CA 4J4BA 2HF8A 1D8AA 2Y77A 1HSZA 1GCIA 3WY9A 1R16A 2J3EA 2FFQA 3GUHA 3W3AA 4FJ0A 3IAAA 1QZZA 4TKLA 2OUIA 3VC2A 2IGTA 4CLOB 1D0IA 4ZVRA 3RFUA 2J7KA 1USVA 3NT5A 5H02A 1NP6A 1KZ7B 1N3BA 1U8XX 4HQRA 3GT3A 2M1ZA 1VG8A 1T1EA 2F90A 1X1SA 1Q20A 4WNIA 3BFKA 2VHVA 3ZDFA 1I30A 4DE5A 1LX7A 3A9SA 4BPRA 1HL7A 1CSEE 1SVIA 2CMKA 4P2GA 4PTLA 4O8ZA 4ITRC 4OY3A 4Q1FA 3S27A 3EZ6A 3JSXA 3OM9A 4F3YA 2Q1SA 4ECEA 2Q07A 3KWLA 3ZDRA 4OI0A 4DSTA 1OAOA 1E3MA 3CH5A 4LZZA 1QH9A 3AF4A 3LKZA 2BFEB 1XQXA 1I33A 4V0LA 3D6FA 2FXIA 1X0VA 1HEYA 2FEKA 4DILA 1XEXB 3M9LA 4H60A 3WAGA 2RJNA 1LS1A 4IS3A 4OJYA 3CIOA 4U6QA 5IAEA 2IOFA 1Z6XA 3GDWA 2GD6A 3PNQA 3TVTA 1H2ZA 1OA1A 1NXOA 4BKUA 3ZHUA 4RA6B 3E1SA 3O7MA 4CE6A 4LRSB 4LJ7A 1QVRA 3ENQA 1XT6A 1WPXA 1VSUA 1Z16A 2JBHA 2Q6TA 4IGAA 5K3FB 3KALA 3QY0A 1SK9A 3ZGYA 1Z6QA 2XLCA 1BWRA 1KYYA 2WG2A 2IYSA 3DXXA 2IIPA 3H4IA 3LX8A 1NQOA 1E62A 1ZM7A 1A4RA 3ML1A 3VFDA 1EGAA 2P6PA 2ZIVB 4UBKA 2UYHA 3CNOA 3JYPA 1NQWA 1L6IA 1YC5A 3NV7A 4NBTA 2X0KA 4NULA 2IOQA 2VZEA 2I6GA 3QLEA 3MJCA 4JLUA 4Q4CA 2C4VA 2ZJBA 1LSUA 3IPYA 4I50A 4PCAA 1ZGCA 2A3RA 2QTVA 3SC2A 3V7FA 1T3HA 5A0VA 3VPXA 6NULA 2CLCX 2Y1GA 1AZTA 4N39A 5AI9A 3LU1A 2J4FA 4BFCA 1IE3A 2QRJA 4AZ3B 1UWLA 1E58A 1TT5B 4FINA 1MEOA 4GD3Q 3UC5A 4CCYB 4RJJA 4RFVA 3D64A 3ZVMA 1SB8A 1QH1B 2W43A 4DTIA 1HR0B 3EQ6A 3T9CA 3NP9A 5L4LA 4OBWA 1VHQA 3BTVA 1W46A 2Q9CA 3HK2A 9LDTA 1GG9A 1NW7A 3QPWA 2G88A 2E4ZA 4OI2A 4UMFA 3WYCA 2XB4A 4DCUA 3L7KA 1NBOA 3Q12A 1W2WB 2H5LA 4FYMA 4XX1A 5EQJB 3BFXA 3VTZA 4DMMA 4LNHA 1GPUA 4ZGGA 5DNAA 3ASYA 2LTAA 3HJRA 4FYKA 3EZLA 3K5PA 3ZLUA 3HY3A 1EFPB 3HXLA 4DRXB 5JFTA 5JZBA 1CW2B 5E7QA 4PYMA 5FPKA 5K5EA 1TEZA 3OIWA 3IP8A 5CB0A 3FPKA 3DHWC 3R3UA 3L6OO 4K6MA 5AHRA 4EI7A 1IXRC 3BJRA 2M6LA 1EUQA 4EFKA 3L01A 1ZZEA 3H1BA 1BJKA 4WN3A 4AXBA 2IYQA 1P1KA 4HQ6A 4MO2A 2VHYA 1OFIA 3TPCA 2EBUA 1S8AA 3CJRA 3QPVA 2QWXA 1G59A 4MB6A 3PQ6A 1XKLA 1UBTS 1E59A 1GCUA 3I3SR 4K0RA 5FOUA 5L3ZA 4AD8A 4D4HA 2BP7B 2P2CA 1EFKA 5KQGA 5IAKA 5FORA 2YW9A 1NBHA 1WXQA 3B52X 1IZ8A 3E9QA 1ORTA 3EUAA 3NGMA 4I7EA 2QQFA 1AZWA 1HQCA 3NM5A 2VSQA 2R751 2FW1A 1V11B 2TMGA 3PEWA 2F1IA 2JAQA 3D3KA 3RLFA 1FNMA 1PFQA 3T7AA 3DTTA 5JNTA 1VJ5A 3WA6A 5DM0A 1UK7A 1J56A 2EVWX 2V8OA 3W8RA 4D8TA 3HVKA 1NI3A 1UDRA 3AESB 1ATZA 4RQTA 1WKBA 2CHVA 4YJKA 3EOBI 4EJ6A 2ZIXA 5JQGF 1DIAA 2QUZA 5CG1A 3EVGA 2WF7A 4HNAA 4KSBA 1KY2A 1US8B 1HI9A 4BU0A 3EB9A 3KHSA 4OQPA 3BQ9A 1N7HA 1UFRA 5C52B 4PLHA 4S1TA 3LFUA 4R1OA 1RYHA 4GSYA 1H66A 4KVZA 4RQUA 3WDSA 3L92A 4D57A 5K8VA 1EFRA 1V4NA 4F46A 1NQUA 2P6UA 3IJ5A 1AU9A 1BS9A 1V5IA 2QTMA 4WXHA 2IYPA 3ZGVA 3KYIB 1OV4A 1ZD4A 2YFYA 1J23A 4FW8A 4JYMA 4URYR 3FPSA 4Q9LA 1RRPA 4X7PA 4YJHA 3OCZA 4XE5A 5EXSA 3SPXA 4RPKA 2IHUA 1E3LA 2IW3A 4P0PB 3SX2A 1N1GA 2H8GA 3ND9A 4FGUA 1GIAA 5K03A 2B6HA 1NXTA 1HE8B 4OV6B 1QK5A 1I2CA 3OLXA 2LBPA 4B2YA 4MJLA 5DNCA 4RIIA 5EXXA 3WIUA 2VUIB 2E7ZA 1HZZC 2H2AA 3CISA 4EYOA 4WOPA 2ECFA 2FPXA 4E7PA 4QJ3A 2XT9A 1I7QB 4J3JA 2QE7A 1QG6A 3G8YA 1D03A 2HWKA 4M98A 4R1SA 4XUCA 4CV3A 4FLMA 4HDMB 1SBCA 1HDIA 1Z13A 3RTAA 3H5VA 1ZN7A 3V4ZA 3JU3A 4X95A 1XF1A 3TKYA 3VAAA 4A8HA 1V8ZA 1DRUA 2VAXA 3DMTC 4AZ0B 2IJGX 4KACA 4I6JA 5EESA 4COOA 2FKAA 2VXBA 1NZDA 4TT8A 4EKIA 2Q5IA 3CNBA 3HJFA 4DCOA 3L43A 1OKKA 1XDWA 3FIUA 5EKSA 3BRWD 1JR4A 3L04A 2W6NA 1KWGA 5IJWA 2BD0A 5U4XA 3WKCA 1I5RA 1Z63A 1XMVA 4AZTA 1O6GA 2EX0A 3AEUA 3U7GA 1I4TD 3D2AA 4WTOA 1CE8A 4B6FA 3P2MA 4DLKA 4P93A 1ESEA 5D5PA 4C20A 5C9ZA 4X62B 1GAWA 5C1OA 2GAAA 4F12A 1CF4A 3W9BA 1YR1A 2RB4A 1P0FA 1YQDA 1WEKA 1Y42X 4I8DA 3UT6A 2DM6A 2PWYA 3OF3A 4JX8A 4NSNA 3IUJA 2DPMA 1NIPA 3QF4A 2QLTA 2QRQA 3G68A 3WYNA 2WPDD 3AOEC 4J76A 2Z9DA 1PFVA 1Q1QA 4K28A 3DYIA 3RS2A 3V97A 1SXIA 5AUPB 3DUFB 1XPJA 4HWOA 2QQ0A 3N2ZB 4K9LA 5TIIA 2H29A 3GXOA 4FCVA 4C9BA 3SFZA 4PF1A 4CF5A 1XGKA 5K99A 2JI8A 4M0KA 3SBOA 1EAYA 4F2PA 1GLVA 6Q21A 4MROA 1F6BA 2P77A 2O52A 4UEQA 2H65A 1W88A 3VZQA 4ALMA 4D44A 5BMOA 1NNEA 3OZDA 2HCBA 4HFRA 2VQEB 5DXAA 3B9PA 1Z2OX 3D4PA 3UMJA 1C7IA 4QVIA 1DV1A 1I01A 2CNWD 2XMCA 3DL2A 4N6NA 1CPYA 2HJWA 2W4QA 5HIMA 2N9UA 1SIWA 2YXBA 4KE6A 3NVKI 3FLBA 3ETCA 2FX2A 1U2DA 1KVRA 3NHSA 1I2MA 4JL8A 1DADA 1JJFA 3KJHA 4KXNA 4NDAA 1N4DA 4QASA 1H2BA 1S8OA 3AMVA 2ON6A 4RW0A 3AFOA 2GZ2A 2JGNA 4QREA 3LBIA 4YCMA 2CEAA 3QVSA 3ZCSA 4YJ2A 1ZXLA 3AF3A 4XQGA 5KQSA 1QONA 4G5SA 3VMFA 3I0ZA 2Q3DA 5H3CA 1UR5A 3QEKA 4KEAA 1WVMA 2WNSA 5L6LB 2OA0A 2PKCA 3IT3A 4O5AA 3LUHA 4JUBA 4AF6A 4BVLA 3C1AA 1RLMA 4B4WA 3CR8A 3GCDA 3UUFA 3CR3C 4R9NA 4RKFA 4O2AF 1OI4A 4EAAA 2JGKA 1NF9A 1COZA 2WAOA 2PJZA 2JAXA 2YVKA 3TMYA 5BN5A 3RJTA 1P7PA 4U1RA 1E3JA 3GARA 4A0RA 2JLQA 2NIPA 1GTJ1 3CRNA 5FPSA 4K46A 1C8LA 2W11A 4AMZA 2PA0A 4Y2RA 3K6SB 4GMKA 5C5CA 3DEKA 3FE2A 2A0KA 4HY3A 2D7DA 1JLSA 5ITZB 1DWOA 1DU4A 1JEDA 1LI5A 1RJFA 1SVMA 2QD3A 2X7JA 1CJUC 3CWCA 5JMPA 4Y9DA 3ST7A 3GDOA 1DWQA 4ML3A 4R4JA 2BI7A 1Z26A 3AR7A 4RL6A 1KAEA 2QYTA 3VR4A 3EISA 2O3UA 3M1IA 1U6IA 1U0FA 4N0DA 1PJRA 1VL0A 2QX8A 3WLSA 4A26A 4C3VA 3ANSA 2WWWA 1QRAA 4ZVLA 1FEZA 5G4KA 1NN1A 1YDFA 3WSWA 5FRDA 3LQKA 1QCYA 3V1TC 3W2IA 2ZYUX 3DTYA 4C87A 4MUMA 2P41A 4RD3A 4IV0A 2C5AA 4FZRA 1NUAA 2FPKA 3IAEA 4Y6RA 1PKEA 4FR0A 3ZY3A 4NNOA 4FGSA 2IXAA 3VNBA 2DPXA 2HM7A 1BJRE 3PUVA 4MYUA 2ZANA 5AM4A 3CEPB 2XKKA 4Y2JA 2HD4A 2DLDA 2CVFA 2QTCA 4K6KA 4V0RA 4YB8A 5ALGA 1OC4A 5F9MA 3TL2A 5J2TA 3VZDA 3DKPA 2ATCA 1BE8A 4QTTB 3VKVA 5A0TA 4K9RA 1VP9A 3DB2A 2PH1A 4V2UA 3OCUA 1RWNA 4G37A 4MYDA 4GP9A 2Z5FA 3O84A 1VCHA 4NJMB 4E94A 3E9EA 5MGBA 1O57A 1IB6A 1WUYA 1U5AA 4I1VA 3VAZA 4G5OA 2FR1A 4F8EA 5BWBA 5FFNA 3UENA 3H9QA 4A2WA 4XYEA 4BLUA 3H5TA 5IWAB 2VPXA 4TT3D 3TRIA 3ZCQA 3B1ZA 1Y1PA 3ZD6A 2PBLA 3CF4A 2Z1MA 4J75A 2HQBA 4JLWA 4CMKA 2CT8A 1FFYA 2ZJ1A 2RHOA 4FLFA 4XLZA 2R6GA 1NR5A 2IOFK 3A3NA 1E6KA 4A0SA 2V6GA 4ZKDA 4IZHA 2QRKA 4X61A 3DOOA 4XQ9A 4B2IA 1VRCA 3MM4A 1C80A 3KUUA 4J1TA 3BK2A 2R7NA 3ROZA 2NT4A 5FBKA 1JFSA 2N3ZA 2CZGA 4I1UA 1Z62A 2GDZA 1QVAA 2HMUA 2YWDA 4BVHA 1X7ZB 4FGLA 1Y4AE 2VYQA 2XT0A 3PF8A 2CJPA 3G0CA 2OV1A 3DLCA 3DBVO 4L0MA 5HILA 3I9JA 5IG2A 2ZTLA 4F38A 5KNCD 4KPYA 4LXYA 2HXYA 3U3OA 2IZOA 2CLHB 2N75A 1ZVJA 3B5IA 3K2BA 3QUAA 4GG1A 4DUGA 3U3JA 5C46F 4QX6A 2X9VA 1AZLA 4F2HA 4NS4A 1HYHA 3ZCXA 3ZN2A 1CZKA 2RGGA 2WE8A 4HKTA 2C92A 1H0HA 1WG8A 4NCKA 2EL7A 3UMMA 5EWLB 1Z22A 2NP7A 2BMWA 1EJ0A 1PFKA 4RDXA 1XCMA 4WADA 4FKBA 4KQWA 4ASUA 2C9DA 3BERA 3T3NA 2ZJZA 3CINA 4CG3A 3GRKA 3K1ZA 5AJVB 4RHEA 3G5LA 3L4BC 3Q6IA 2D0OB 3B9BA 5EPOA 1I5EA 2JHGA 1XXLA 4FFNA 3U7JA 5A6VA 1QP0A 3BILA 6YASA 3DMFA 1SZJG 1SRQA 4QFBA 5KDLA 2BUCA 3WA7A 1E3TA 4Y1RB 1FW8A 3GFFA 3C97A 4IDBA 4N8SA 5FIUA 4IZ6A 4R9RA 1I3NA 2JA1A 2BE9A 2HLDA 4V1CA 4UREA 4MQEA 3O8DA 3OUZA 4EW3A 1PGJA 2O4UX 4TLDA 4ZOCA 3VH4A 5CAEA 3RUHA 2GVZC 2H57A 1Y5MA 3ZVKA 1F0KA 3H9JA 1CY8A 2X3UA 1G8SA 5AMXA 4QGAA 3O4RA 1PTJC 1LB1B 4MGZR 5BVHA 4OQDA 1Q1EA 4TL9A 1JKMA 1GNVA 5JANA 1UXHA 1WU8A 1YU6A 2BKEA 1ZUIA 2NT3A 3VO8A 5DDIP 4NAVA 3V2IA 4C0LA 4YRKA 2LDBA 1M6NA 1DX6A 1QO0D 3CN9A 3WMWA 5B7GA 2YYYA 3D6NB 1DXQA 2QL5A 2XZLA 4YHHB 2A9JA 2CV0A 2IYZA 1MB3A 1JPVA 1TD9A 3QU2A 5J2UF 3EGVA 2PXXA 2QJRA 1WQ4A 2EKLA 1EP9A 2WD9A 2OZLB 4URFA 5DYIA 5FCDA 2OEPA 1RXWA 4W63A 1LDBA 3WHIA 3VOAA 4QUDA 4ZDWA 3U6KA 5ITVA 4L28A 4FWTA 2NSDA 5I5GA 4E1VA 1Z4KA 1NFQA 1YRHA 1IXYA 2YY6A 3IEUA 5D8DA 1XB2A 3T6KA 1BFUA 1H6BA 4DPMA 1AZSC 1Y0BA 3DLPX 3OJWA 5IBQA 2ZB2A 5DCUA 5E9WA 3TW6A 2UUCB 4KR6A 5AM0A 1D5CA 1WXWA 1G291 3AEZA 4NOLA 4Z3KA 3ZZTA 1M6YA 1USWA 1VB5A 2EFCB 4HDRA 5JSFA 1JLRA 3D6MA 2J3JA 3EVEA 1Z6TA 1KAQA 3PGLA 1Q0UA 5SICE 3GMSA 4DJJA 5BOVA 3LQQA 5ED0A 5FUXA 5A1JA 1RHUA 4RZ3A 1ND5A 2D1TA 1NDQA 4FYWA 4KO3S 1R0XA 2DQ4A 4EHIA 2WT8A 1C1DA 2NSLA 3L2OB 5FUMA 3BB3A 1MRZA 3ZE1B 2PVCA 2H1LA 2RK4A 2C98A 2NO0A 2OUKA 4LJKA 5EIBD 3AH8A 4MRVA 2GZ3A 1DBPA 2ZAIA 3KSZO 3LP6A 4QULA 3T7SA 4DY4A 4B09A 3ZBQA 4LBWA 3O8QA 5E9QA 1QYIA 1H8HA 1WOMA 3FWNA 1A72A 3OCYA 4MK4A 5FPQA 5IH3A 3T06B 1YHZA 2DHDA 4RA9B 3X1KA 3ZE6A 1I4DD 1M83A 4BV9A 3U0VA 2KB0A 4YQYA 2WAXA 4UU8A 3L8YA 3A2MA 1UMCA 5HTKA 5K0CA 2BGUA 1QGYA 1QQAA 1H8HD 3PLNA 1IXKA 1UMDB 3N2EA 3H4MA 4WINA 1SHTX 1M2FA 4XWOA 4HDRB 1H3EA 4OSOA 2R7MA 3AKDA 4URWR 1FJ2A 2HK8A 3IV9A 3UBMA 3T3OA 4WVLA 4ZRNA 4R98A 5B58C 1VZ2A 3TUJC 4QG7A 4E5MA 5CFZA 5JH7F 2B3TA 3GLIA 1P2TA 1X19A 1HEUA 3UCEA 2GTHA 4Y2PA 5AKHA 1EK1A 3I61A 2HO4A 4PN7A 2UVDA 2AOVA 4YUYA 3T94A 1W36B 4U2FA 2G70A 3RRMA 1L7MA 2ZJOA 4YRMA 2JVJA 5DGTA 4H31A 5NULA 4FCTA 1ZGAA 4DWOA 1XJWA 1VL1A 2JDIA 2GD2A 1DEHA 2YVLA 3UUGA 3AUFA 5ELXA 1QKJA 2ARKA 2EARA 1X39A 2XV1A 4CKBB 4DPLA 2PKEA 4LECA 4HI0E 3A9TA 4NBNA 3GLKA 2DFKB 1QM5A 3RWOA 3WG9A 1KO8A 2O8FA 2ACWA 3G0DA 3W0LB 4M1YA 4G5QA 4HAYA 2YZ7A 5KYGA 1QHGA 1VTKA 3AF5A 4BVJA 1M1NB 1JXOA 4GX0A 4DY6A 4C5CA 4EENA 1YJQA 3CVXA 1AQLA 4M8LA 3AEQB 2QM8A 2Q50A 4MGYR 5EINA 3VU9B 4LZAA 3ZU6A 3MUFA 3MWEB 3BMCB 1EUCB 5F1YA 2IY9A 1TPZA 3PQ4A 3V4FA 4IHAA 1YIOA 3NPAA 1M2OB 4X7MA 1YZUA 3B60A 2AJCA 2VT7A 1T34A 2PSFA 4GC5A 2N46A 2Q46A 2YOFA 5AI4A 3WFZA 4WOBA 2IPLA 2ZRQA 2G6TA 2P5YA 2ZYIA 4OFZA 4P3OA 1TADA 3C3JA 4LMAA 4N0MA 4Y6OA 4AJJA 3K05A 4HCJA 3HYSA 4TLLB 1ZH0A 2XXJA 1W88B 3F7TA 4P5PA 1JFFA 4DNOA 1AKUA 3AUAA 3HCBA 3R77A 4R2WA 2AWOA 4LS3A 3LNCA 2Q3BA 2O3QA 5TC4A 4A9AA 5LQCA 3G2KA 1SR8A 1W44A 5GM2A 4BQQA 4JI8B 2VTEA 3EUFA 5ALMA 2ZR8A 3IB6A 2P6RA 1U63A 4UW9A 2XA9A 1YCHA 1Z4IA 4MEAA 4JLOA 1W30A 3E7WA 4NCXA 4R83A 1MENA 2OE2A 4PXAA 3U7QB 5KTRA 1BJTA 4GT1A 1CJKC 3NS7A 4WFQA 4WCFB 2XOXA 4IDNA 1A9XB 1EXMA 1Z8FA 3L1IA 3MRSA 4ZTZB 5EIBC 1SXQA 3FG9A 3HN6A 4ZU6X 2YHIB 2FPIA 4EFMA 1XVTA 1Z18A 1C9DB 3SBEA 1Y8RB 3D6JA 1TVCA 1E2NA 4CHGA 4KHPB 3K9WA 1ADGA 4ES6A 3J7TA 4G65A 4X44A 3KKMA 3ZU4A 1R0YA 2JKVA 2PVSA 3DAPA 3IKJA 1BXGA 2GZRA 2N1MA 3OE1A 4JC4A 4ZHQA 5HUJA 2IZ0A 4CIVA 2VYFA 3IUSA 5FBHA 4ZI2A 5LMUB 1XNJA 2NXWA 4X3PA 3L0YA 4KQIA 3VXKA 5CA0F 2HJ9A 5ITSA 3P4UA 4GPD1 4QRIA 3EZGA 3IEXA 4R7GA 3MTIA 1HLFA 1HE2A 1QZXA 4YS6A 1ODSA 3LL4A 4C21A 2ZRHA 3NO4A 1GZVA 3FDXA 2QTLA 4FDTA 1YZFA 5EIFA 3QX3A 1U3FA 3R7LA 3HB4X 3QM1A 3ILHA 2QR3A 4BO8A 8AT1A 3GYGA 3AZPA 4HDCA 2EQBA 4HLUC 3QE0A 3PKZA 5E9AA 3N2GA 1TQ8A 4H4DA 5KKNB 3NW9A 4FMDF 4YR9A 4D02A 2K2WA 2CXNA 5DP1A 4LWOA 3V7YA 3AM1A 1AGXA 2PGOA 2NZ8A 3EGWA 5EHZA 5L3SB 3MMNA 1THGA 1KEEB 2GEJA 1BYIA 5CPFA 1TUEA 4II2A 3FVRA 2RB5A 4QDOA 3L7NA 3DBIA 3R6WA 5K6AA 2FHSA 4ZVVA 1JJBA 1RMTA 1CVIA 1PK8A 2FZ5A 1U90A 2P2GA 3HV0A 3FUCA 1TIKA 2CDBA 5E6SB 4BUZA 1AK1A 1UUFA 2AN1A 5J2TB 4UHHA 2EFDB 2SKCA 1CUUA 1V16B 1GXSB 3HYCA 2WT4A 2YRXA 1XRLA 3RDPA 1Y9EA 4LXTA 4RTOA 2F55A 3N6RA 3HL0A 1Z34A 4JB8A 2I3DA 3R5FA 4DCGA 2NUPB 1QH0A 4HLQB 4NYIR 4DLPA 1V39A 2AHOA 4QUIA 3SZ3A 3VX3A 5HKKD 2NZ2A 2KPOA 5FD8A 1S5PA 4KH1A 4PONA 5DPMA 2Y4OA 1XD8A 1G42A 2Z43A 3CNHA 3L6BA 4O4IF 3GGJA 2XNDD 1MC8A 4TZ6A 1O7JA 3UUWA 2ZRNA 2R85A 3DZCA 3BG5A 3OLZA 5EOVA 5TLSA 3MMSA 2IP4A 2WJHA 4B7ZA 3CE9A 4N5IX 2GX6A 2YRFA 1FDRA 1PR5A 3W8NA 4AZVA 2Q7OE 3IHLA 3V46A 4G8DA 1P74A 1QH8A 4DOMA 1GRRA 4IDFA 1EINA 2VWPA 4FBMA 3G0OA 1YRWA 3RKUA 4B3HA 1QK4A 4L8WB 2E89A 4KPGA 1HK7A 2J7PA 2LKCA 4L9RA 3GUZA 1PSDA 5DLEA 4CQNA 1Y8QB 3G49A 4RJTA 5AIBA 2B6NA 1XCPA 1CJBA 3O91A 3EYAA 4P34A 2PBRA 4NZ9A 4B3XA 3M83A 4JBLA 1KMHB 2V3WA 1XEWY 3AGQA 1XZGA 1NVDA 1UZMA 2P9YA 2VXCA 3LDFA 3PR3A 4H6XA 1ABFA 2OG2A 1N2BA 5FOXA 2XE7A 1QQTA 1X3LA 1FNBA 4UNQA 1IM5A 2VATA 2XXAB 4QARA 3CH6A 2A88A 4D9KA 5CW1A 2GCGA 1L5GB 3RS9A 1AHIA 1T1JA 5JNWA 2Z5VA 2PMBA 1F48A 1TMOA 2IPNA 2YV2A 1H65A 5I3CA 2TYSB 3ECCA 3FYUA 3NH6A 2BEWB 1BW9A 4KE8A 3IVGA 3MWFA 4R31A 3IP9A 3D1JA 3DBOB 4KRFA 1RQ2A 5L3VA 1G2IA 3ROEA 1MABA 1SBQA 1LKZA 1TT5A 1XAIA 2G09A 3NKFA 1XFAA 4V0ME 4CWAA 1SOAA 3MGKA 4IPTA 4D80A 4E51A 3KEQA 1RXEA 5HZKA 5JBNA 2PPVA 4X45A 4QATA 5EFOA 4RJ2A 2HT6A 4M76B 4L0QA 1L7AA 1WPQA 3G79A 4JYAB 2YINC 3ZU5A 1KS9A 3MWDB 3U7HB 3PCRB 3VUEA 2NU6B 2WWYA 4AQDA 3FROA 4DDUA 4CGZA 1JAIA 1XIVA 3HE3A 1I1QB 3TCXB 3IHWA 4PC1A 1DJMA 2KS6A 3FCCA 2V6MA 2B92A 4ME6A 4PFQA 1YU9A 2R3SA 5HJEA 3WNQA 1ESZA 1UQTA 3AETA 1Y34E 3ZXYA 3Q7QA 4M0DA 2LV8A 3DOCA 2IPXA 5DT2A 3F9RA 3BA6A 3QLUC 2Q28A 4UEJA 3C85A 1D3AA 5TQ0B 2X5OA 1JL3A 3DZ8A 5KAMA 2FW0A 3RUIA 5KBYA 3HRKA 1XWWA 3HB7A 4DHEA 4F1JA 4LDJA 1CFJA 1TC2A 2PX4A 5CLQA 1JSXA 5BN4A 4IJ5A 3K70D 4O4HA 1NVMB 3BTUA 1XDGA 3S81A 3LUJA 2O06A 2JLAA 2HADA 1DAIA 3CPEA 1Z9BA 3W34A 3VO2A 2VJYA 4Q18A 4E5DA 3C8MA 2AJBA 3X0DA 5KTKA 1U4OA 3ZCRA 2FMHA 4DDKA 5T5QA 4RD4A 3BIXA 2BH9A 3PXEA 4TXMA 3T7JA 2X0RA 4OTZA 3WL5A 3TTWA 2FLKA 3JQGB 3D02A 3D0QA 3DD1A 3TI9A 2J0EA 4R8KA 4JXXA 1V45E 2WHPB 1QE0A 4M37A 4BB9A 4X7BA 1DIHA 4C6HA 1GQFA 1RRKA 3PZBA 4CKCB 1T8YA 4LZOA 1VCIA 2VEDA 1SZCA 3HL4A 3ZX5A 1FXSA 3VC7A 4LOAA 1P4AA 2QVCA 5E6RA 4C7MA 3HKCB 3CUWA 5F1PA 1LA2A 2EP8A 3AHHA 4D4LA 3GGSA 1HO3A 1L5RA 1CNFA 2R6JA 2NZYA 3LP8A 5B55A 1AMUA 2BHNA 1OLXB 3ESRA 1MOPA 3JQRA 4OAPA 1Z0UA 3SXPA 2RIPA 1L8AA 5DI3B 4AKEA 4WECA 3A28A 3EDMA 3OIUA 3WGJA 4BQRA 3C7AA 3RYIA 3ND8A 5JCOC 2YWJA 1HDXA 1MO6A 3I01A 3OAAA 5JADA 4K9QA 1T8RA 2E4WA 2HMYB 2W6JD 1NC3A 5JNUA 1C3XA 2X1VA 1VRWA 3MTEA 4FBGA 4MUEA 4W5HA 3PNOA 2Q6OA 1NW8A 5ENVA 4YT8A 3K71B 1MZPA 1UKVY 1M6HA 4XX0A 1KIFA 3LC2O 2NP6A 3KQNA 4DMGA 2FSHA 1WVIA 1ZCJA 1SCDA 2JD2A 5JJBA 3B20A 4YJHB 1GG5A 2DH6A 4UC0A 2BSQA 4ZCMA 4JGBA 4O4LA 2PD3A 3H6KA 3WIEA 4UTNA 5JVDB 3QEMB 3TX2A 1SKMA 1K7EB 5AUNB 5C37A 2JJ2D 4G6ZA 3KDPA 3W6ZA 4V0KA 3I5AA 3A6PC 3BGDA 5PGMA 2ZI4A 1FPMA 1A27A 1UP7A 2LCIA 1VC2A 5AYVA 2RC5A 2WNIA 3ZE0B 3O94A 4AJEA 2D1SA 4G1UC 4TMKA 3KKEA 5TY0A 1SQSA 4KMMA 1EIZA 3DOIA 2O5RA 3AFIA 3TSOA 4OJMX 3STHA 1ZD3A 3V00A 1Z5GA 2YJ5A 5LYJA 4KI7A 2AE2A 4US1R 3A25A 2GESA 1XRSB 2ILTA 3AVPA 3IUMA 3OTIA 1PGQA 4URZR 2LWIA 5CYFA 5H5JA 3ZHSA 1NNLA 4FM9A 1NVKA 3HA2A 5C5EA 1E92A 3DAYA 3ZDDA 2W6IA 3BGOS 3IHTA 3RU7A 4XIGS 1ACMA 2I22A 4PYNA 1MG0A 2IA5A 1YQQA 3KBOA 3QIVA 1AUXA 2A67A 4Y1FA 1R50A 1CHNA 2GEVA 4IKEA 1GPWB 3SDZA 3P5BA 4R3NA 1XTJA 2BFBA 2J08A 4PBTA 5TGTA 3EEOA 2VTBB 2JZNA 3E3AA 4XCVA 1TK2A 3RLIA 4YYEA 3LAWA 2CF6A 2UDPA 4FMBB 4DQXA 3ONVA 2FWMX 1UP4A 3FAKA 2WVJA 2AN4A 3EBPA 1LXCA 4EKGA 3SVLA 3VC1A 1V1JA 4TV9B 3AXTA 4G8CA 2IU4A 3T7DA 3FGOA 2AW3A 2QSJA 4X1KA 1JYEA 1DC3A 3T5TA 1HQYE 2C9MA 2X0JA 3BHJA 1N3LA 3FFAA 3FTQA 3QU7A 4OAOA 4X8LA 4ZCSA 4ETIA 5F23A 3RTCA 4E5YA 1VKRA 2P0AA 3IQEA 3PUYA 1XKXA 1NXWA 1O96A 3IBSA 4H3VA 2H17A 2NO5A 4YRGA 5J4HA 3OT5A 4M0EA 4HEA1 4Q7LA 1UC9A 2VKQA 1QHHA 2BR3A 4FU0A 1VM6A 1CJCA 1W85A 2J09A 2VSFA 4N82A 5E6SA 4C4ZA 1X1TA 4QBKA 3AKCA 5CB4A 2BTOA 2X4LA 1K3TA 2QXTA 1FX0A 2Z4SA 2ZU0C 4TWJA 4YRJA 2ORIA 3DG9A 2DMRA 2XVMA 4IZOA 2GXSA 2XTZA 5GZ3A 1DJNA 1KEEA 1M67A 1Z15A 2G0AA 3BVPA 1LBQA 4XX0B 1VE6A 4RVDA 1J21A 3JQ9A 1LF5A 1OFTA 3NV9A 3EVBA 4E5PA 3R8FA 3HXMA 2G5PA 1FDVA 3PDWA 1Y6JA 1YI0A 3QKUA 1TFRA 3AR6A 4O4JF 4TRNA 4K1LA 1NZFA 4RV4A 3SIRA 3W90A 1WMSA 1GU1A 2FWJA 2O2IA 3SZUA 3WLHA 4DR1B 1JDJA 5CCDA 4OI4A 4B8ZA 4DV4B 4AMYA 3OA0A 1D9XA 2HIHA 3NORA 3PYXA 4OYLA 4B4UA 4GOJA 3W4IA 4ZYWA 4JQYA 5ELLA 1CBUA 4EYQA 3O74A 2PSHA 2VHTA 5LLDA 5C18A 2ODBA 3I8SA 4HYQA 2WKRA 1XSEA 4C7BA 2FSFA 4ZA2A 4H3SA 5F2EA 4RHTA 3WK7A 2ZLBA 1OKKD 5IYZF 3TFWA 1KORA 5KMGB 2XVYA 5I9TA 4D81A 3E9DA 5LB4A 3K94A 1YULA 4NCIA 2XOEA 3LVRE 4AS3A 2GKSA 2WJ6A 2WA1A 5HE8A 2AFRA 3IQDB 2MCFA 4D7AA 4Q93A 2EJWA 2BGLA 3AIIA 4M0LA 3ZWOA 4G1VA 1P73A 1Z45A 1H5UA 7AT1A 2G4LA 3LHFA 3VU0A 1FFWA 3NOXA 1RXSA 4QBTA 5EN4A 3RYFA 1LNZA 1OUMA 2XIQA 2ZSJA 3DVQX 5MN4A 3NTVA 1YKSA 5EHQA 1I14A 2QV0A 3UG6A 4BMOB 4WUVA 2OCYC 4LJLA 3WGGA 3U5TA 3DS8A 3H11A 4RY8A 4IIJF 3D0KA 4IV8A 3D59A 3DWFA 3WIDA 2EATA 3IUBA 5E4FA 3B3QA 1XTBA 2OZEA 4D3ZA 3HCOA 3JQFC 2G82A 3RYCA 3WAJA 4BNLA 2D59A 4Q7EA 1OGYA 1CV2A 2XNKA 3KYJB 4KQJA 4BIIA 4BHTA 4CLOA 1NATA 2Q45A 3A1NA 1PEKE 1OWNA 3H2BA 2CNWA 3O82A 1R9MA 2CFRA 5LZ4A 1VJ0A 4AY4A 1NW3A 1TQ2A 1WDMA 2XNCA 4PSDA 1DBQA 5JXIA 1VJGA 5HQJA 1NVXQ 1YDWA 4YDHB 1N8SA 1YVEI 1BS2A 3CHYA 1YVUA 4W5JA 3ZY2A 4QOJA 1JEYB 5BR8B 2PS1A 4NPHA 1H5QA 1B8UA 5FOVA 3N7TA 1JDBB 4RMIA 5CXXA 3FZYA 4I9NA 5A3VA 3O2JA 2GWRA 3TB4A 1JA9A 1WZIA 2BR5A 3CPJB 3TEFA 1TEXA 1X1RA 4RVOA 4X20A 3VPAA 1NULA 1K4YA 5JG7A 1HFKA 4WZ6A 1RTTA 5K8CA 2FF5A 1WBBA 1SZPA 3QG1A 4IIDA 3A36A 3L8GA 4G0NA 4I6EA 1SCUA 3EZ9A 3KE8A 3P9CA 3U39A 4URXR 1HGXA 3F3KA 3PHCA 4WN9B 3MUNA 4M1ZA 3F5QA 5BYKA 4D9NA 4ZJPA 2BCEA 4A3SA 2XXAA 4MRMB 4OMFG 4Z0HO 1QYXA 2I2AA 1DJOA 1TKBA 521PA 4NTZA 3TLAA 2WUVA 2WEKA 3TNLA 1WDLA 5HBRA 5TPWA 2ZYDA 4LNAA 4PYQA 3DMHA 2XI4A 3MC1A 1DOZA 5ESDA 3AKYA 4B3MB 4BAUA 1IVNA 3GNSA 5AT1A 9LDBA 2NGRA 2QM0A 2OHGA 2Y6VA 3G02A 5EZ5A 5FJIA 4E5VA 3HR4A 3B3JA 3LO5A 1CB7A 1EFUA 2ZIUB 3U13A 5CJ2A 3B12A 3HKBB 4FOPA 1IOVA 4YC7A 3SR4A 5LKRA 4F93B 3FNBA 2BHLA 2M6KA 2I1LA 3PUZA 2WMNB 1NRWA 1JVBA 2BM1A 3FDZB 2NO7A 3IKLA 3MSCA 2QUBA 3NC4A 2JFVA 2JJYA 3WZ2A 3ZIUA 4EI9A 5DU2A 3UANA 1K75A 3L6UA 2I9PA 4KB5A 1P80A 2JA2A 2Q5EA 1O03A 4OQLA 2ZE8A 2QN3A 3GCWA 1TPYA 1A9ZA 3KAKA 4H0FA 4RU1A 4BNZA 4G1CA 3ZJVA 1PWEA 2WU3A 2NZWA 4JA0A 4LAFA 1R8JA 2GKOA 4G0MA 5K8TA 4RK6A 3A4NA 4I46A 2NUPA 5KVSA 3DQZA 2WYVA 2ZBQA 3KVYA 5U1PA 1VDMA 4BGVA 1W4ZA 2G5GX 4J1SA 5SY6A 1Z0SA 1XRNA 3TLGB 4N7MA 3EIFA 2AQKA 1YZYA 4YK7A 3BHIA 1K6XA 2ODTX 4Z4QA 2K2QB 3N7UA 1FYXA 2ADFA 3WLMA 4RZQA 5GIOE 4KPFC 1RMQA 5JYDA 1R8SA 1QJ4A 3OOEA 2IIVA 3T0IA 3UMBA 2H9YA 4L9AA 3IUEA 4YMIA 1C8KA 3VPBA 4E2YA 1W48A 3QOYA 4NOMA 5FR1A 1E3EA 3ZE8A 1SEVA 2J45A 3G9UA 3PFKA 2YW2A 4U6SA 4K9OA 4R8MA 5L3SA 3MT7A 4RXUA 3RB8A 2UUOA 1MQ9A 2WTNA 1LQTA 1UH5A 1NHWA 3PVZA 4FE3A 4UEKA 3NCTA 2G67A 4YJDA 4ZRDA 3G2IA 3ZQ4A 5JCZA 3UJPA 4DLSA 2B0JA 2W6ZA 2QMOA 3L9WA 4I9FA 4MUFA 4X64B 3R0IA 3QJ5A 2JGDB 1IY1A 1YZLA 2GHQA 1GLNA 5KCZA 5FO0A 4KE9A 2NADA 3RC2A 1ENZA 3SQOA 1GRVA 3G2NA 4BNDB 1Q0TA 2WKQA 1ND6A 4OJNA 1PGPA 3S2IA 3VOBA 1FYDA 1GGFA 4M7WA 3MFYA 4Q1BA 5IWCA 2JLUA 1P3DA 1H22A 5KQRA 1ZEMA 2XRMA 2ZJ8A 4FNMA 2IXTA 2YFQA 3ETJA 3Q40A 4YMSA 2PL9A 4WX2B 2NUAB 3T7EA 2FFJA 3G2JA 4OU5A 4CIBA 1Z5UA 4DV6B 2HLDD 3RHTA 5CEJA 4P35A 1I1OA 1LWNA 4NMXB 4ANFA 3K0SA 4Z0TA 4GHWA 2QTBA 2I33A 3O4HA 4U7HA 4TTVA 5FTWA 1VSTA 1JR3D 1ZA1A 1I2BA 3LRPA 3S55A 4BLSA 3H7AA 4DNQA 4WKBA 3W3AH 2W2OA 1X7GA 4YAJA 3WLTA 1BEEA 4XVCA 4Y1RA 3IP6A 4M7PA 5GZ6A 1L4LA 3D8NA 3UM9A 4OATA 4Q6WA 1V1RA 4BX3A 2G36A 4WCFA 4JR1A 5IMBA 1VYHA 1SOUA 3U7QA 2GCNA 4TV8F 4UZSA 2JF0A 3PPWA 4H3KB 2JKZA 1JYFA 4G1BA 2JFBA 3RUCA 1GGHA 2IEZA 2YX1A 4V3BA 3QE2A 4JOCA 4WKNA 2LNDA 4YP9A 1M2VB 1YQXA 4ND8B 3TS1A 4D98A 3F96A 3WRVA 3ZJ4A 3W5DA 4AWAA 5KTSA 2DJIA 1TJPB 1ZMRA 4MSUA 1TX4B 1QHYA 2R6R1 4FX5A 4D2IA 1UKYA 1XMQB 1EIWA 5HKLA 1W75A 4UDYX 3IEIA 1DX4A 3I53A 3EGDB 4IUYA 1VLZA 3QVOA 4RS3A 3URMA 3W7BA 4WJKB 3ED1A 1PSZA 4RIGA 4XJSA 3UQYS 1L3IA 4P4UA 1MQAA 4KDCA 5CJPA 1JAHA 2XF8A 2BYTA 1G3IA 1P9NA 1RVV1 4QAQA 3OBIA 1Y7TA 4ZOAA 3SOZA 1OH7A 3O8OA 4INAA 4YP5A 2BGWA 2FP4A 1WL8A 5DM4A 3L5KA 3W4JA 4B7UA 4CG1A 3PXCX 1F8FA 5H1YA 2ZRLA 2GHIA 4V0MA 3DE1X 3UPDA 1UJ5A 1W0KD 1T3TA 2R00A 3EA4A 1XK7A 3FDJA 3Q72A 5AJUA 4BFYA 2BFMA 3A27A 1R6UA 2HPZA 3WB2A 5CDFA 4CF3A 1EVQA 1XNGA 1Z88A 4O08A 4RQAA 3K9FC 2C5FA 5L7YA 4N3AA 5K3AA 1XTVA 4RE6A 3K35A 2VH5R 1HNNA 4XSHA 4GLBA 5I7VA 3AUSA 1F1JA 1IZ7A 4F4IA 3G9XA 5FBQB 4M21A 3G2HA 3OG9A 1XK6A 3N0RA 3U17A 1OIWA 1KPIA 4HB3A 3U9LA 1OF1A 1SKQA 1CQJA 2FMIA 3B6ZA 4NJMA 1ISSA 1WUIS 2ZUVA 2X7XA 3CTMA 5K2MA 3UJ7A 4DM3A 5F2NA 1AB5A 121PA 1M2GA 4QYXA 1NLYA 1J9EA 1WWKA 2D2XA 2PYZA 4XWYA 4HX2A 4G5XA 3I5MA 4HN9A 4MV0A 1RCFA 1X6VA 1GNLA 2O6HA 1S7CA 1UJMA 3EMVA 3P1JA 1E8NA 2QHXA 5JS1A 2HA4A 1AT1A 4R2HA 1CHDA 4GM4A 5HG0A 1HT1E 4U7WA 3EF3A 3FNIA 4EGAA 1FU7A 1MNQA 3QE4A 4GKJB 4IH1A 3NTLA 2UVQA 3DPIA 2DUMA 1O94D 2R6HA 4DLBA 1M73E 4GKKB 3IKMB 1QCZA 3W5UA 3KXIA 4GKAA 3ZY6A 3K15A 4N0EA 2XDWA 3VSBA 4ESVA 5L40A 4BPBA 1QQ5A 5E1BA 3Q3CA 1A2BA 3G85A 3HP4A 4GOND 1U4NA 3BL5A 1TE2A 3Q3VA 4BQIA 4IRXA 2QQGA 1YKGA 3I9KA 4H16A 1GNQA 2HRDA 5A05A 4OQNA 4CM8B 2BGGA 3IOEA 1RXIA 4GE3A 2ECOA 1TTTA 1JPNA 2DLNA 4D0GA 2FW7A 3RUAA 1XMIA 4LJ4A 3THWB 2OLJA 1IZZA 1MAVA 5ITZA 2G63A 4GI7A 3OPMA 4NEGA 1E7YA 3BRSA 3I09A 4GWGA 5GINE 2AKAB 3HVUA 4EMBA 1QCDA 2FKNA 3OFJA 1TAGA 2Z3ZA 4Q02A 4UUBA 1OU4A 1UAAA 3BE6A 3GLUA 3QVGA 4WAUA 2JHCA 1KZGB 1ML3A 1G20E 2RARA 1H1DA 2O2YA 1DBVO 4D4KA 1R1DA 3NIWA 3OQOA 1IB0A 3MT0A 4C89A 2PX8A 1D4ZA 2ZRFA 4F9GA 3KSUA 5FI0B 4DC9A 4GZ3A 5J9FA 4MS1A 1FS6A 1JDNA 4B6PA 4Z0PA 2XNSA 4DSAA 1D4FA 4JHLA 4HRYA 2OZLA 1I3KA 3CVOA 4BRWA 4ZO4A 1UAGA 3QTTA 1DCFA 3VZSA 1RQGA 2I5PO 1B6GA 5DO9A 3ZDAA 4JLKA 4Q4HA 4EUNA 1MORA 4UHFA 2O5CA 1R6AA 1EX7A 1EBFA 3N1UA 2OZPA 4JYBA 3SZOA 4ER0A 1U7PA 4MV6A 1IWPB 4E30A 3I9NA 2FX3A 5E4JA 5LJIA 4NZZA 3T3DA 2IZ7A 5J47A 4LC0A 2PO5A 1O87A 1OE0A 5FYQA 4UTRA 4GNKA 3QKRB 3BRCA 4H18A 4P9NA 3TH5A 1R4AA 2GNPA 4B76A 5JMTA 1VSVA 2N42A 3FPEA 3WLRA 2EYQA 2QXUA 3GFTA 2FN3A 1E64A 2I7TA 4LSWA 1QQ6A 5E4TA 1OIVA 5C31A 5B7QA 3EPLA 4C2AA 3E18A 2ORWA 1H2HA 3OY7A 4FR2A 5C2JB 3HHPA 2W2LA 3AV0B 4EJMA 1A5ZA 4EABA 3EXEB 3RIGA 1VZ3A 2C95A 3IURA 4WBNF 3C6MA 4YCBA 2D74A 2ZWVA 3QYPA 1FFSA 3VSEA 2MSEB 3DO8A 1UPCA 4CQJA 3N5CA 1G1AA 1NHGA 3B3FA 4DG9A 5A3JA 1EDEA 4N4AA 3W3ZB 4DCMA 1WBJB 3F1LA 2FEAA 4OVKA 2FQQA 5DLPA 5DT9A 4WESA 1XEWX 4UTOA 3GOHA 4MCIA 5AIAA 5AOAA 3A0UA 1R88A 3TMAA 1WDWB 4Z6KA 1M34A 2ZKLA 3FNEA 4M7RA 2JS7A 2GLUA 3IAUA 3R5TA 3RM3A 3ESXA 2J67A 3OZRA 4B4KA 5DYGA 5LXTF 5KNBH 2ABWA 4C03A 1Z07A 3JQDA 1TXGA 2XD4A 1FDUA 2JGIA 4OB8A 4UUOA 4EMUA 5AW6A 1V9SA 4M9CA 4S04A 4M9UA 3I6YA 3M6VA 1AA9A 4KBFA 2ALJA 5IEJA 1IUPA 2HJVA 2CDCA 3JAWB 3RVOA 1OXBB 3L18A 4KXWA 3EXG2 3K1TA 4EP1A 4IKOA 3CRQA 1JKXA 2AI2A 1E8DA 1JDBC 1VGQA 4QXAA 5KTNA 3WC4A 1F4VA 2E48A 5JDCA 2Z6UA 3RPEA 4Y7CA 4AVYA 4HG2A 4YP6A 2OSVA 4MEBA 2PXCA 3OF5A 1OMOA 2I3AA 4G4GA 5AKEA 5SV2A 4JUFA 3WMGA 5KYUB 3HDQA 2X22A 5JJLA 1CYEA 1ZL2A 4P3KA 1GOTA 3GIDA 5FYDA 3VR1A 3MJDA 1E4EA 1QGOA 3P20A 4MUNA 4ZAFA 3SX0A 1NUSA 2G3YA 3U80A 1G4HA 3K7EA 2O8BA 4C4OA 3GR6A 2QLLA 3HSSA 3R7NA 3JTMA 2OXTA 3T52A 2ROQA 3TQQA 1EB8A 2DT5A 5DIZA 1TM7E 1TU3A 3GWGA 1SQ5A 3IOBA 4YAGA 2DQKA 4AJNA 5T3YA 2H2WA 3HPQA 2Z1NA 3JARB 5SY4A 4JP8A 4NBRA 5D2CA 1KMCA 3IAXA 5TX7A 4CKYA 1EVYA 1WS6A 2A9PA 2CBGA 3FTPA 1IFXA 3LFHA 1H3FA 3GP8A 1P2VA 2O4CA 5GONF 3SEFA 3FCUB 1FJGB 1WBDA 1M72A 3H1TA 4GXTA 2J33A 4U2EA 4PX9A 3CZ5A 4LHZA 1NF2A 3WYBA 3RT7A 5EIXA 2EZ8A 2YVUA 1NQXA 1WCWA 1PU2A 1LEHA 4ALKA 2X42A 4G25A 1D7AA 1JQAA 1YDMA 3RAJA 1JIKA 3SC3A 3QPDA 2CKMA 2NYRA 4YDSA 1NQTA 2G0NA 1ZSYA 3JYLA 3FZEA 1NASA 2H7XA 3KQLA 2JHPA 2UZ1A 2WSBA 4Q47A 5DBEX 4C4YA 5LMZA 3E48A 4IH9A 2AEEA 1VHJA 2P65A 4ZC8A 3HWRA 2D5LA 1EP1B 1RM4A 1ZGJA 4OSEA 2A9RA 4K6GA 2J7PD 2Y1DA 4DLUA 4C7OA 4EW6A 5TQ2B 4UFPA 2ZZKA 1I7PA 4FOLA 3FTCA 5M7EA 4B3TB 4U7PB 1FJHA 2F4VB 2IKSA 1JKJB 3DGFC 3ZI4A 3OIFA 3H86A 3KKOA 3LW7A 3ZXXA 3Q6MA 3S6JA 3M82A 3A1EA 1MHTA 1SXHA 3W6UA 1R0SA 1E77A 2W2XA 1UBLS 2FYTA 4QUJA 2JIPA 3WL8A 1Q57A 4HGQA 4HWRA 4MPDA 3ZLJA 3VKGA 3C6QA 4DRXA 3ZWQA 1O95C 1NMYA 2OB1A 4U2GA 5ALLA 1T8WA 1E2QA 5I9MA 2B4RO 1NKTA 2XXBA 3ENVA 3CRRA 4HDKA 3RC9A 1C9KA 5BQXA 4EDFA 1IVSA 1IN7A 2FSIA 3AYZB 2OPHA 1K68A 1RQNA 4YTEA 3H3FA 3UIEA 4LF8B 1YOVB 2IHVA 3KPVA 5THQA 3T3PB 5DHRA 2JFQA 2O5VA 4P38A 3IBYA 5IS2A 4Q4DA 2ZRDA 2ZUWA 1PT5A 3R5KA 1RTKA 4EF6A 3AP1A 2F43B 1I7LA 2H9IA 2D6FA 4I3FA 3KG2A 4NOJA 4MQLA 3NNNA 3FMGA 4AZ3A 2IF0A 2D1FA 4I5GA 4KBYA 1BWPA 4L5CA 3E9ZA 4YT5A 3CW8X 1K88A 5D86A 2UAGA 5TQ2A 2DR0A 3LY9A 2JGEA 4QA9A 4U9UA 3CVVA 3LX5A 1DT5A 2XZPA 1FQJA 3VDRA 1R4NA 5ARCA 1CK4A 1ZH8A 2IYNA 3Q15C 5TB5A 3ZGNA 4C0BA 5L4NA 1N7IA 2IT1A 3AL3A 3IP7A 3LPAA 2IYVA 1NDUA 4MJ3A 4OM8A 2YV4A 2ES4A 3E22A 4S24A 3F78A 2X4DA 3PXBA 2C7PA 1COWA 1W2GA 2BSXA 2J5XA 5JLJA 1Z08A 4ZWNA 5KOJB 1RQRA 1TL7C 3ICCA 1KYZA 3PJDA 4ZO7A 4EY8A 1FDOA 5K3FA 4JBYA 1MW8X 3LYLA 4C2BA 3GA0A 2ZAGA 2PKWA 3DTVB 3CWZA 4RZIA 3UJ3X 2PK3A 1S3IA 4H6WA 1W94A 5E8RA 3S2EA 3VZPA 3ZD8A 3JWPA 5GTDA 4MA5A 1IY0A 1MN6A 1NVEA 2WM9B 1HLPA 5FWYB 2HLPA 3KLBA 5I7AA 3SHVA 2ISQA 5KKCA 5AVJA 2WY2D 1J0CA 1YR3A 5TMPA 2ZSUA 3HJNA 3N0XA 4FPXA 3LWDA 4QJIA 2L18A 4JHXA 5CNJA 1DAKA 1E7RA 1GEGA 3UJ9A 2NVBA 4H77A 3OU2A 4QUAA 1GPYA 4JJEA 2O2XA 2CUZA 1F0NA 3D54D 5DH9A 2B82A 2V6IA 2Q4EA 3AG6A 4FHCA 5AW4A 4W5RA 4BAZA 2ID8A 1BXKA 4ZOQI 4C5AA 3HM9A 1G19A 1P61B 1RJWA 3GJYA 3MILA 4I2VA 5LYYA 3LX6A 3UYKA 1Q19A 1Q1BA 1EHYA 1PUXA 4LBVA 1X86B 2Q0XA 4AG3A 1OYWA 2DGDA 3IMGA 4YRFA 5D51S 2F48A 3FHLA 3QKSA 1DAHA 4OHPA 5D5HA 2BL4A 1RI1A 4L27A 4KXXA 1LW7A 3DWEX 5CCBA 5KSPA 1GUZA 1HKUA 1OJLA 3UJHA 4EBBA 3PQCA 4D8XA 5BSVA 1UK9A 1VPLA 1PEDA 3AO0B 1MO2A 2W6ID 4TWBA 1ZOPA 5LYJF 4BO3A 4EM6A 1K98A 2ZIWB 4WLEA 1NZJA 2OAP1 3JQ8B 4IRMA 4IZIA 1SMKA 2JKYA 4OHUA 4DMFA 2HSWA 1IAVA 1U5CA 1E6MA 2VF7A 2X8JA 1YFZA 1IZ9A 4OL0A 1DVRA 4H7JA 5LBUA 2CE7A 3KFVA 5JLAA 1ECFA 5F51A 4AY5A 1G3MA 1MEJA 1L4FA 4EA8A 3QNUA 4LHSA 5LR6A 3DV2A 3MRVA 1EM6A 1T4MA 2HHJA 3NOQA 5BPFA 2WA2A 1IBSA 2V9ZA 4EO9A 1TUIA 1ATIA 3UYLA 2ZBFA 3O3CA 2D5AA 2R6CA 1FNCA 1QU3A 1Y7IA 5BV1A 1KYTA 3F98A 3QI2A 1TYZA 4CV1A 4YRPA 3AHCA 3X2EA 1T1GA 2V1XA 5I3ZA 1UKZA 1ETUA 1BSVA 1I6KA 2YWRA 3MIZA 4GYWA 3PNVA 3SFTA 4XGQA 3DFZA 3PGKA 1IY2A 1DL5A 2JHFA 2O0KA 1BVRA 1WY7A 1Z0IA 2P67A 1RIIA 5FBZA 4ZC1A 1W5TA 1Z0FA 5DHPA 4A73A 2IYUA 2EZTA 3WRYC 2WABA 1VXRA 4CDNA 1Q3KA 3GEIA 1CP2A 4OI1A 1G2OA 3VNUA 3CCFA 3LHKA 3DZKA 2QQEA 3LS2A 3OIDA 3GFBA 2C1XA 3ZW9A 2SECE 2UYGA 3Q3EA 2WP8J 4RKRA 2C0CA 4YACA 5TMEA 1ZX1A 1J2EA 3UJ6A 3CV3A 3HDYA 4P4SB 3WLQA 4EHFA 4ICIA 3VU1A 4H35A 4FQ8A 4ETMA 4KMRA 4LYAA 1Z2PX 4Y1EA 2VZ8A 1DRVA 1FVFA 1Q6ZA 3O31A 3GC6A 4K9SA 4P0TA 1KEUA 2IPMA 4R9VA 1XELA 5SZIA 2I55A 3Q2OA 4ZAWA 4DT1B 1G21A 1TA9A 3PQ2A 4U7GA 1NPTO 4MV9A 5IARA 5AW8A 1OCEA 2IELA 3H0CA 2YJZA 2KSQA 3Q8XB 3X1ZA 5HHTA 1U3CA 3RJZA 3HQ4O 2V4MA 4NXMB 1D4OA 2XE4A 5F7ZA 2GARA 2OECA 4DVJA 2PGDA 4NBSA 2Y1KA 3VPDA 4MI6A 4YDQA 1ZVVA 2BZ0A 2X19A 3IXLA 4JU9A 4UEOA 1ZJYA 1MEEA 1GRQA 2AZ4A 2JFYA 2OHFA 2SCUB 3OMLA 3QVUA 1FSGA 1CDZA 4N5HX 2RGNA 3JQ7A 4UBIA 4UNIA 4ZQBA 5IEBA 3RFTA 5BSGA 4YRDA 1E60A 1HOXA 1RJ9A 4O4JA 2PV0A 4EDHA 3PT9A 2ZUSA 4ZVMA 4BV2A 5IF9A 2R66A 4C3UA 1U7WA 3NX4A 1ZM9A 1O5OA 2YDYA 4MR7A 1X9IA 3GLVA 1TRKA 2QE6A 3S1AA 2PSEA 2ZXFA 2IU3A 1KZ1A 4U0KA 1EWTA 2QV7A 5D87A 1AX9A 2EWWA 5I7EA 4L22A 3COVA 1DUSA 3PFIA 4I9HA 5DSTA 3RHFA 3HDTA 4ZU3A 4WCDA 3WGOA 2F7SA 1S6YA 4E33A 3GJSA 2BDEA 2G9VA 1QDEA 3OHPA 1YFKA 2DTXA 2PKXA 3L8MA 4I50F 1B1CA 5TMDA 5JAPA 2QSYA 4X6XA 1PR2A 4RGQA 4DQKA 1XAHA 2WP0A 5DWDA 1QG2A 1KP2A 2GVDC 4HEQA 2H9AA 2QTTA 3INRA 3O4FA 4OQYA 3STYA 4BYMA 4TYPA 1NTRA 4IXDA 5ENDA 2HW8A 4WBNA 1QIGA 2DQYA 4PG4A 3F49S 2HCTA 3C3WA 3JD1A 1FXUA 2XWBF 2NUBA 3HR7A 4JEIA 3FPLA 3TUIC 5AVTA 1RWBA 5J5AA 3AM4A 2UXDB 4QT4A 4XKJA 1T9GS 4P54A 4REOA 3M6IA 1GA1A 4LYDA 2IUEA 2HK9A 3KZOA 3A2LA 3Q8WA 1OX4A 2C77A 3A1SA 1CXZA 1NT4A 2F62A 3KSRA 3L0SA 5JUWA 5K8LA 2VBCA 2JFXA 3D0RA 4MW7A 4HUQA 5CGZA 5C8YB 1UZLA 5JOQA 3FPAA 1JFTA 1I32A 4QHSA 2ACKA 3KHKA 3ORYA 2R11A 4BGEA 4E2XA 3UBTA 5ALFA 2EIHA 1E9FA 1NI5A 1ONSA 2XVAA 4M1TA 4FT4A 2HHAA 2PT9A 1K63A 2GPBA 1YB6A 3LQFA 1ZBQA 2FN4A 3IESA 2IU0A 4WIAA 4W1QA 2JAPA 1YR8A 3MRXA 1IEQA 2RHMA 4UNSA 3QVXA 1K4MA 5K6RA 2XAUA 5IT5A 3PX3A 3TJZA 4PE5B 2O0MA 1QPGA 1BXZA 1X7XB 3A06A 3NRJA 2JIDA 3KR1A 4JBWA 3TNFA 5U9CA 1A7KA 1KNXA 3QOFA 3I58A 1ZHHA 5EWJA 4BJ3A 3TOXA 1C1YA 5DV9A 4JUAA 4ARBA 4Z7QB 4EB0A 2AEMA 3UMFA 2OO3A 2HA5A 3Q7RA 4EZIA 2Z30A 1GG8A 2WK1A 1FLVA 2G9ZA 4JP1A 4NCHA 5A03A 3BIWA 3PUJA 3RSQA 5DYYA 1LK5A 3LL7A 1N9ZA 5E9JA 1MDFA 4BNNA 4ER5A 5HJ5A 2FK7A 2FOLA 2XCLA 1PJQA 3CZQA 3JWJA 3H1PA 3UH1A 4B3SB 2B7BA 5FV7A 4NQZA 2R8YA 3F9CA 1OAKA 4DA8A 3T1VA 3T3IA 1UF9A 3TDNA 2FEMA 4Y2QA 1UCFA 2RGCA 4W9MC 3QV2A 5DRYA 3TLYA 4IKPA 2I1WA 4UAJA 1LLDA 1WV0A 2Y67A 5LBTA 4CG2A 3GGOA 4PPYA 3W79A 2FPRA 3CTPA 3S8MA 2LPMA 1JBEA 1FVHA 1ULSA 2CJFA 2FQXA 2EHDA 2W93A 2YJ4A 3L82B 1CRZA 1P39A 4ND3A 4CM5A 3O8NA 2JGJA 4BLOA 1X7WB 3F71A 2XW6A 1P2UA 1Q7GA 4OBXA 1FU8A 2IOYA 5IASA 2X8AA 3NKVA 3VHRA 3FOCA 4KYVA 2IF2A 2P6OA 3R6DA 3M6MD 3INGA 1E1KA 1QGZA 1R9NA 3DPUA 4PRKA 4Z9BA 2IWHA 1EGQA 4EW1A 3PQFA 3DJFA 4M1KA 4P8RA 3VZRA 2GFQA 4E21A 2C07A 5GOTA 1ZNYA 1E99A 3R7DA 5C5IA 7ABPA 3LY5A 1RWPA 4D6YA 5KQMA 1USGA 1ZM2A 5KNDH 5COAA 1NAHA 1OBFO 3LBAA 3PA8A 1P9OA 4BYGA 3VR4H 1AHPA 4CLRA 2RHJA 1QKIA 1LUAA 3KBBA 3BD9A 3A9CA 1JAXA 4LE0A 2Y99A 3DLIA 1DDIA 1DXYA 2MIIA 2O50A 3I04M 3R6TA 4K7JA 4L8FA 5FP0A 5TSDA 3ZXUB 4X85A 4MUHA 2COKA 1DIOB 3PWZA 3PFGA 4QICA 4QQFA 3TR0A 1ZNXA 4J7UA 3B51X 3LCRA 4TT3A 2Z2JA 4NBLA 3ETLA 2HU7A 3ED5A 1VYVA 1XNHA 3MJHA 3IQGX 3OCVA 2NNLD 1CUSA 3YASA 1P7YA 1KARA 3CXRA 4G84A 5ES3A 2H52A 1R5NA 2VK4A 1NNUA 2CHEA 2D2IA 1V6AA 4TMXA 4LF6B 1FFXB 1DG3A 3FPGA 4GOMD 4CW7A 1GQYA 2B8NA 3AR8A 2BIFA 1OBOA 4J6EA 2C3YA 2B94A 5E1OA 3RYTC 4EYKA 2ZB3A 2AFIA 4W5NA 1RJEA 4Z7OB 3EMKA 3HS3A 2GN8A 2QAGB 3MMXA 3P2JA 4DS3A 4HZUA 4RK4A 2OM2A 1E9EA 2R60A 1CERA 3ZH2A 1RC1A 4KHZA 3U9TA 4LW8A 1XZDA 4ZT3A 2JAUA 1M0SA 1B76A 1BGWA 3HCEA 1FFBA 2PXAA 3OKFA 2E82A 1E0SA 2VJBA 2PSJA 3B6KA 3ELWA 2D2FA 1DC7A 2I34A 1NUPA 4CF6A 2GUGA 1I13A 3IUYA 4G0VA 2RH8A 4UDNA 1T5HX 1GR0A 2P2ZA 3I92A 4TLCA 1MX5A 4MEJA 3JAMA 3TK1A 1TMGE 3O8RA 1CRWG 3CEHA 4BP3A 4OXNA 5MHTA 1VG9B 1Q0RA 3NASA 3NWEA 4JT4A 4UD2A 5ALWA 3AXSA 2I65A 2HHHB 1PFGA 1G5PA 1J8YF 3RT9A 1UWVA 2AXPA 4NU0A 3UV6A 1ODCA 3DNPA 1A7JA 3V1MA 4AF8A 3LYUA 3ND7A 4YHBA 3G2MA 1KY3A 2P3LA 2X1LA 1O77A 4FQ7A 2PLWA 2VDOB 4LV6A 5I4CA 5YASA 3C7TA 1FQKA 1PO7A 1T13A 3EFOB 4AF7A 2AWNA 5KYTA 4QGGA 5I7HA 3MG9A 3ACBA 4L2IA 1FDTA 2VRCA 4IIEA 4LJRA 4XQEA 3S3TA 1RMYA 1QGDA 5IC5A 3D8BA 1UFOA 1K0UA 1Q22A 4TPKA 3FSJX 4UZFA 4CKEA 3V42A 3RAEC 2E37A 3BWBA 3KAJA 1M0TA 4S12A 4UAVA 1NYRA 1RKXA 1P33A 3D5EA 3NXKA 4TTJA 2PWBA 1VCMA 5LU8A 1RRGA 1ZI6A 3AVWA 1OV6A 4ED9A 3PGVA 2OD2A 1ZCFA 2F67A 2P4QA 4H1VA 2K5UA 1RYFA 3E58A 1L7OA 4MKFA 3W9SA 4F4CA 1WZ2A 2BF4A 3HKEA 3IPXA 1W0KA 2GEFA 3B48A 4G9BA 4XWAA 5CYPA 1N2JA 2WLSA 2X8JB 4B8WA 2NG1A 3V8EA 5JWRA 2RKBA 1XRJA 2J87A 4NAUA 4N5NA 3H9GA 4HNHA 4DIOA 2Q5LA 5JAOA 2QRUA 1NW4A 4JP2A 3AX6A 4M8KA 5CD9A 4YA6A 3TD9A 1QNLA 4D0NA 1DO0A 2OOKA 2XJ4A 3OU6A 5LZ8A 2V6JA 3AEYA 3E2MA 4XPZA 5CTJA 1OHHA 3HBNA 3V5NA 4BBAA 1MBZA 5BUCA 1I51A 3SQWA 1M6WA 2GILA 1W19A 3IRVA 4IJMA 4UNRA 3ABZA 2B37A 2MMGA 4W9NC 2YXDA 4R6WA 4EW2A 2VL7A 1Q0ZA 2HXGA 2SBTA 3BBLA 3L1VA 4G3XA 1U3VA 4B40A 2G9UA 4GX1A 5KX5F 1KSGA 3U7IA 4CLXA 1OH6A 3VVCA 1ULZA 1KC1A 1ML4A 3FSRA 1MH1A 4FTWA 4K86A 1RCUA 3E0QA 3B36A 4DBLC 5T6BA 4QOHA 2AZMA 5DMXA 3OLQA 1TO1E 3ZKAA 5KB3A 1Z6GA 5A71A 2AYZA 3LDAA 5B58T 5IABA 4MB0A 4C0SA 1LTQA 1UBCA 4C7VA 1ZJ6A 1IN4A 1OLSB 2XUJA 4AW9A 2OCDA 2A4MA 1TZJA 2V7WA 3KK0A 2LZ0A 3NRBA 4G0QA 4G0PA 4GMGA 2CXPA 5JSYA 2EJTA 1ILEA 1FIUA 3GEGA 4ENWA 2IVFA 4HUQB 5C8YA 5LZ2A 2PZBA 1PVDA 1VA5A 2BUAA 2HRZA 3MLBA 4IIVA 1ZUD1 1VRVA 4A15A 2IQIA 1L9XA 1QUEA 3HH8A 5CLHA 1WKVA 2UYCA 2Y1WA 3VNRA 1VSQA 5IBCA 3O3OB 4G4JA 4UTVA 1XYVA 1BO6A 1E7QA 2ORYA 2VHXA 1R66A 3D7NA 2V97A 4MUAA 2JGLA 2R1UA 5HX7A 1E1LA 1R6DA 2IIQA 4RSRA 5JAHA 5GVSA 4LE2A 2FMFA 4OGWA 3HCDA 3LZ6A 1BX1A 5CFNA 4G9EA 4JI3B 1L9KA 2IL1A 2CBXA 5MN5A 1F0YA 2BLLA 4RABA 1TDJA 2QZPA 1ZW1A 1BHO1 2P9QA 4RM3A 4KQ6A 2QMYA 1GU7A 1UDAA 2O2JA 4F04A 4D0SA 2B21A 1CZHA 4IS2A 2HC9A 4ZARA 5JHGB 5JBQA 2O8EA 1I8TA 3R23A 4Y2HA 2JJ1A 1B6SA 1U1GA 4UCXA 3IOCA 1LLQA