4GOJA

The crystal structure of full length arl3gppnhp in complex with unc119a
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
175
structure length
175
Chain Sequence
LLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
publication title Structural basis for Arl3-specific release of myristoylated ciliary cargo from UNC119.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 59
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gojA00
4JLVA 4EPRA 2ANBA 5F9FA 3KQLA 1D5CA 1DELA 3BBPA 1JPJA 1ZIOA 4NYMR 2XZLA 1A82A 1GTVA 3SBDA 4D81A 3B1ZA 4R7ZA 3LLUA 2P6RA 2CLCX 2Y8EA 1G9XA 3KKNA 3CRQA 2GJ8A 5J40A 3QIAA 1C9KA 2NO6A 2XTMA 3U61B 4LHXA 4CEHA 1NJGA 2HXSA 4NYMQ 1G6HA 4KSBA 5H70A 4RCZA 2EFHB 3Q5EA 5EUMA 1CXZA 2CK3A 5JRJA 3DHWC 1ZD8A 2DWQA 3KFVA 4PZYA 5FBLB 3VNVA 4NHOA 4MGYR 4PSKA 2F7SA 1F60A 3K09C 1G64A 3RANA 3AV0B 5KSOA 2IEZA 1KO4A 1FUKA 2WJVA 3W34A 1KDRA 3NIBA 1QG4A 1OH5A 4DCSA 2R6AA 3AVPA 4S35A 4F4CA 3SFVA 3QI2A 3IUYA 3U6BA 1KO7A 1T4GA 2OG2A 3BIFA 2C78A 4V0LA 5AJYA 1JECA 1TF5A 3E2IA 3QXHA 4X8HA 1AZSC 3BFVA 3WHLA 2NO7A 3C41J 4E03A 4IDOA 4Z1MD 3OIVA 1SQ5A 3AEZA 2ZE5A 4MRSA 2ZXUA 3WY9A 2RGCA 3K0FA 1UKYA 1NY5A 4QRHA 2FE4A 4A15A 1GM5A 3OHMA 2V1UA 1TNDA 1KYIA 3DVLA 4LBWA 5JHGB 4QFMA 1PLLA 4IFBA 1J7KA 1LS1A 1L4UA 1SVIA 2IYZA 4L16A 3R9WA 4LBYA 1KKLA 1R4AA 4M9XA 4ZCLA 2KE5A 2YYZA 3AKCA 4Q4HA 4TYPA 2Z5FA 5J4VA 4W9MC 1E9DA 4X8LA 2OBNA 1BMFD 1DS6A 4HB4A 1KK0A 4I1VA 4WZ6A 4D0LB 1AKEA 4DLXA 2BEKA 1Z6GA 1OIXA 2EVWX 2HJVA 4XVQA 2FPKA 2HEIA 2FFHA 4JLNA 2O8FB 1U8ZA 1XMIA 1ZCBA 4LC0A 3V4RA 1AZTA 1XP8A 3FMIA 2P5SA 2DR3A 3GLFE 3U7EB 1Q20A 3K70B 1SHKA 4DC9A 2PLFA 3I1FA 4Z54A 2EFGA 1SVWA 1YZLA 2R8RA 1NBMA 4N0DA 3ND9A 1DAFA 1YZGA 3VMFA 4BZQA 4B75A 1JR3D 1TF2A 3ZIAD 1LNZA 4Q4LA 4WVFA 5SZHB 2BDTA 1CR0A 3N2IA 1D2EA 4KSCA 2WWHA 4TLCA 2A30A 4CF7A 3HU2A 2F6RA 1HQYE 4YMWA 5B2ZA 3UMSA 5JSZA 3KFXA 1ODFA 3CX8A 3GP8A 3H4MA 1SVSA 3KKPA 3FMFA 1P2UA 3FMPB 3N2EA 3UXMA 2UZ3A 1MRNA 4EJSC 4CZ2A 1X8LA 3B8HA 3OE7A 2I1VB 5DYIA 3SE0A 3ZD7A 1NI3A 1U81A 2GZHA 1H65A 2WJGA 1JJ7A 3SJBA 1J90A 2GK6A 4A6XA 1OXTA 1QVAA 2O0JA 4KFTA 4Q9HA 1FMJA 1R5NA 2W0SA 4TMWA 4AKIA 3HU3A 4M4SA 1ZM3A 5JJLA 1R6BX 2OUKA 1NN3A 3W8RA 3QXXA 2R65A 2J45A 1KZ7B 2WJHA 1FMLA 2B7CA 2LCFA 2ZSBA 3VU9B 1Q1QA 5FOUA 3Q85A 3B1XA 4NPHA 1MR3F 2NIPA 4AK9A 5AUQA 3AP2A 5BYJA 2X2EA 3DZ8A 3O8CA 1TL7C 3FMOB 4ZDWA 3NH9A 1RRPA 1N6PA 1EFTA 1Z6AA 3WYGA 1KI8A 2IYSA 3RABA 4POAA 4R71A 3K8YA 4DCUA 2OT3B 1TU3A 5CB8A 2JDIA 2VBCA 2ZTSA 2IHBA 3QBTA 4IDHA 4GBMA 2GXAA 4C2TA 2CNWA 3CPJB 3AUXA 1TQ2A 1P72A 3ZH9B 1S96A 3AF1A 3FOZA 1H8ED 1RJ9B 1ZYUA 3L82B 3QY0A 2QZ4A 3QXJA 4ZV4A 5AUOB 4Q7KA 1S0UA 3BAFA 3UG6A 1L8QA 1W0JD 5J5CA 3PENA 4BEBA 3VQTA 3LFUA 5E4FA 1E9FA 4DUGA 3T06B 2BHRA 4AKEA 1UAAA 4O25A 3WHKA 4XVUA 1D2MA 4B2PA 3SC3A 3THWB 1G8HA 3QG1A 1NKTA 3AP1A 1LFDB 3B78A 4A82A 1KI2A 4PAMA 1E2PA 1GNPA 3IQWA 3LW7A 2XEXA 4LHYA 4XD7D 1N2CE 4CVNA 5HZHA 3KQKA 2DFTA 3A4LA 4NCNA 4PC7A 4D6PA 4YXWD 1SULA 2EWWA 1CEEA 1E79D 3REGA 4GOXA 5FOSA 3K9HA 4PPGA 1RC8A 5FPTA 1WCV1 2ZETA 4PO8A 1ZM7A 5TV2A 2YWEA 5FPHA 5JWRA 3VR3A 1JAHA 1US8A 3K0SA 3HPQA 1MO6A 3LX5A 4YLGA 5C4GB 3QOFA 3L8ZA 4JLAA 5EE0A 2BKUA 4OQFA 2BKEA 2FU5C 1A2BA 1R0XA 2CL7X 2YOGA 2RB4A 5JECA 2KSQA 4B3XA 4HYYA 2BOVA 3IBYA 2QQEA 1D2NA 1S2MA 2ZS9A 5IDVA 3VR4A 1T0HB 4BE7B 2GNOA 1ZC3A 4YC7A 1SVKA 2AR7A 4M1OA 2QAGB 3U4QB 2DPXA 2QM7A 3EC2A 1P2VA 4NTZA 2OLKA 3TW4A 2ODNA 1JAIA 2W2XA 3ZQJA 2HLDD 2B8WA 1KO1A 2H18A 2ZRIA 4PC2A 4DLWA 5L3SA 3TVDA 1OH8A 4US1R 2J3EA 4HUTA 4DCTA 2ONKA 3PR1A 1W5TA 3LBNA 4BLPA 2ZUDA 1DAHA 4H1UA 4BECA 3THYB 4MKIA 1VG8A 4PZLA 4FD2A 5BN3A 4I1UA 5FPKA 1DE0A 1T8UA 3WYFA 2ZJZA 2P6NA 3PUZA 4Q48A 4TWZA 3GLIE 4IHQA 4HLCA 1E9BA 4UJ3A 1NIPA 1TX4B 4OK3A 3U3MA 3EXAA 4HLUA 2O5VA 1W49A 2YWFA 3IDQA 3TKLA 1H8HD 3ZS9A 4LV6A 2B8TA 1OH7A 1WP9A 4AYWA 4UJ5A 4C0SA 1AM4D 1KY3A 2BBSA 1O3YA 2RMKA 5FBVB 2RGXA 2PX0A 3WP0A 4HZIA 2E9SA 2ZJAA 4Q00A 1KI7A 2WMOB 3LXRA 4B6FA 5JLJA 3THOA 4OI2A 2DB3A 1ZINA 4C4PA 2G83A 1NG1A 2ZSAA 4QBIA 2FF7A 1YZKA 1XPOA 4TT3D 1OKKA 4C0KA 4KYIB 2NO0A 3PJRA 3GJ4A 5EZ6B 1GOTA 1IQPA 1PZNA 1G8FA 3RS2A 1NSTA 3SYLA 1SZPA 3WXMA 3ZYCA 5JCZA 1J8YF 1FNMA 1XEWX 3MFYA 4JS0A 1E2FA 2WMNB 1P2SA 2VPPA 4HLQB 1TU4A 4EPTA 1XCPA 4TMVA 1WDTA 5A5GA 3OFND 2JLSA 3SQXA 2D7DA 4OK5A 1U98A 1UDXA 3ZGXA 2GJ9A 2PL3A 2REOA 2QT1A 4LBVA 4BLOA 1G5RA 4BFVA 1VIYA 1CJUC 1NSFA 3BB1A 5KHOC 3ASZA 4IOLA 4Q66C 2ZS7A 4R2HA 3K0CC 4KO8A 4C0AC 2ZR9A 3AKYA 1E2HA 3LD9A 4HB0A 3W6NA 3ZS8A 1T5LA 4UNPA 3Q5DA 2IYQA 3HR7A 2WSSD 3CH4B 3EA0A 4FINA 5AJVB 3RRYA 5IT5A 4A0HA 4NKRA 3B2EA 2C96A 3AVTA 2ZJ2A 3KJEA 4ASUD 3U7HB 2REXB 4Q4AB 2BBOA 1FTSA 2MSEB 4Q4JB 3GEHA 1NL3A 4HSEA 2NZJA 2HCBA 2QTHA 4MKFA 2GEVA 2O8CA 4PPQA 4W5JA 3CRRA 2RH5A 4OHZA 3SN6A 2O8FA 4JVSB 4BGDA 2FNAA 4RFVA 2O0HA 4DLZA 3T12A 2W2TA 2GCOB 3IEUA 2E87A 1E0SA 1XNJA 3QSYA 3PFIA 1OXXK 2XB4A 2G1JA 4TTQA 2O52A 4CT5A 3BB4A 2FX3A 4WW0A 4LHVA 3RWMB 3D31A 1KDOA 3P4YA 3FHCB 4FMDB 5DI3B 4MYTA 1HE1C 3NHBA 3G82C 1HUQA 2QT0A 1EFUA 5EE1A 4OHYA 4HDCA 4PSAA 3U60B 3A6PC 1K8RA 1XMSA 2CXXA 1YKSA 4GNKA 1GFIA 1PUIA 3I72A 5DHFA 3AF3A 5EXTA 2IWRA 1KI6B 4G0NA 721PA 2QMEA 3FE2A 2D3WA 4YONB 5TXGA 2GXUA 1G8GA 4B33A 2GCNA 3P27A 4L9WA 3ZVLA 5DO9A 3PUWA 1XPRA 4JKIA 1T5IA 1ZAKA 4TTRA 3T5DA 2J7PD 4TLEA 2Z4RA 1ZIPA 3AF2A 4M9QA 3Q8XB 1VYVA 2OZEA 4F4JA 3RS4A 3ADBA 1ZNZA 1K5DA 4MYCA 4M1KA 5FOXA 1NMYA 1TQDA 1XJQA 1X86B 2G0NA 4A0FA 4A92A 1XPUA 3VU9A 2YZ2A 3ZIAA 2C2HA 5JRZA 1YVDA 1Q3HA 3RLFA 1XTSA 5KTYA 2WPDD 3SHWA 4Q1BA 2C5LA 1MABB 2R2AA 4B3FX 1K6MA 2C99A 1P9WA 4M22A 1E96A 4M1YA 1G3QA 3RS5A 5BWMA 2MMGA 2VLIA 3CNLA 2JLQA 2L0XA 2ERXA 4P32A 1IN6A 1E6CA 1SKQA 3V00A 4TZ6A 2PT7A 2IYLD 4JMPA 4M0LA 2IS1A 4ITRC 4L9SA 1W36C 4MA4A 2PCLA 4IVPA 3KJIA 4M1WA 1J2JA 2CCJA 3GFTA 3S1AB 3W3AA 4M9SA 2JASA 2JJ1A 3EARA 1RJ9A 3IHLA 3F0TA 2QUZA 1OFHA 4YQFA 1KSGA 2Q9BA 5FBQB 4PQYA 3W9YA 4O3MA 4RFSB 3VNUA 3EZFA 3U5ZB 4Q5IA 2XZPA 3THWA 3H86A 4LY6A 3TR5A 2GJKA 3BXZA 3GCGA 1Z0FA 2WIBA 3THXB 4URWR 1G17A 4BFWA 2ORVA 4AYXA 5FUWA 2DHRA 3E5HA 2ZSEA 1I2DA 4LV8B 1W36D 2WM9B 4I4LA 3W6PA 1AN0A 4KBGA 3T61A 2ZRJA 1OE0A 2JLVA 3JVUA 3QKRB 1GNRA 2D06A 3K9LA 3NXSA 4LYFA 3T1VA 2RGGA 3IILA 3T35A 2D2EA 3SR0A 2ZJ5A 1LF5A 2G9NA 2VP4A 3FWYA 4TMTA 2J0UB 3NVAA 4PAQA 1DAMA 4ON9A 3SNHA 5BW8A 4A8JB 4BEJA 2KJQA 3L0SA 3R8FA 3LW8A 1ETUA 3DOEA 1W0JA 1E0KA 2X19A 3NBFA 1KJZA 1JR6A 4PHHA 1P6XA 5JI2E 3TW8B 1MH1A 2NPIA 1U2RA 2ZU6A 4D4MA 4DHEA 3LLMA 4HUQB 4UNQA 4WAUA 1QVRA 3MJRA 2OCPA 3A4NA 4G5SA 2AWNA 4ZI2A 5KPJA 3FKSA 2RKOA 1ZM2A 4UNSA 3U4QA 2H16A 4JLMA 3D3QA 2GAAA 4CRWB 2H17A 4HB2A 5CITA 4DIDA 3CNNA 3AQ4A 3DMDA 1E79A 2QBYB 3LO5A 4WA7A 2XNSA 4GFDA 4OKSA 5KU1A 1TEVA 3WP1B 2ZI3A 4Z8XA 4KFUA 2J7KA 3A1WA 5CLQA 2VP5A 3OIYA 2YOHA 4OHVA 4C0BA 2RHDA 2FWRA 4FCVA 3THYA 4US2R 3H2YA 2ZRGA 1GKIA 2WIAA 1ZNYA 4TN1A 1E2JA 1UBCA 3A8TA 1KK3A 2OSBA 2VRWA 5EE5B 3HR8A 4BASA 4Q01A 3GJ3A 5AK0A 1NNEA 2FEMA 4A2QA 5CB6A 5FOWA 1Q1EA 521PA 2FZLA 3TRFA 4QGAA 3EAQA 1N25A 2BEJA 2HLDA 3PQCA 3MD0A 3LQRA 4I81A 2OFXA 4JT2A 1AA9A 1R0WA 2QSZA 2ZRKA 3RHFA 3UMFA 3C4JA 3GJ6A 4LI0A 4TMZA 2AK3A 2QEQA 1ESMA 2IT1A 3M1IA 1R7RA 4LWZA 4AKHA 4Z8YA 2PH1A 4UXIA 1A2KC 1E32A 4UXJA 4M1SA 2I1QA 3BFKA 2RHMA 2WICA 5A0FA 1E94E 6Q21A 1N5JA 4NE2A 5C18A 4Q03A 1HTWA 2ZRBA 2ECKA 1KZGB 2MSCB 1M1YE 1CTQA 4B44A 2IYRA 2RGNC 1T3SA 1T3LA 1ESNA 1ZNXA 2QRNA 3LA6A 1OFTA 2O8BA 3WNCA 3H84A 4HLUC 1U8AA 1A5TA 1VECA 3SDZA 4DCNA 1AGPA 2QPTA 4TT3A 1C4OA 4D4JA 2XTZA 5GJCA 2G3YA 3ND8A 4KV9A 1UADA 1Z0DA 4IJMA 1PVOA 3QPVA 4DLUA 4TSFD 2PZGA 3P32A 3CX6A 3DDCA 3GLGA 3L0IB 4YMTA 2OCAA 4KITB 2Z6VA 3GEEA 1XEFA 4KLZA 1N6NA 2GZDA 4OQNA 5DGXA 1DBSA 3TSWA 2F9MA 5D3QA 1EX7A 4NCKA 3MWYW 3GLHE 3I8SA 5DHAA 4JSYA 4Q4AA 4TZ0A 1VPLA 5EP2A 4Q4JA 3LX8A 4EIWA 1G3RA 4NCIA 4M1MA 2GILA 4GP6A 1GL6A 1R0YA 3MGCA 4WXPA 1HURA 1BYUA 5AR1A 1N5IA 2B92A 2R44A 3BE4A 1OT3A 1J99A 1G8YA 1XXHA 4MYUA 1HYQA 1W0KA 1AK2A 1D6JA 3DL0A 2QGNA 2ZREA 2RGDA 3KB1A 1Z2CA 1DADA 1XCMA 1SXJB 1P75A 2BMJA 3I73A 4JSTA 2ZE7A 4LX0A 4KXFB 1DTSA 2BM1A 4UXHA 1E1RA 2H92A 2DYKA 2QMHA 4O2RA 4PR0A 4NH0A 5DI3A 1RVDA 4AG6A 5DLQC 4KCGA 1RIFA 3X1ZA 4FWIB 5B64A 4DVGA 2ZIAA 3TVTA 4RD4A 2ONJA 2OFOA 4A2PA 4ASUA 5JEEA 1KNXA 3DM9B 1G4AE 1NBME 2ZI9A 1GRQA 2Q9CA 4PHFA 3FPAA 4L5BA 1KI6A 1NMZA 1Z29A 5KNBA 1PLJA 1X8KA 1E9RA 2JCSA 3QF4B 4QG7A 2V7QA 1G8PA 1VMAA 2PLRA 1W44A 3A1SA 4PANA 4CGZA 4KODA 1E0AA 1Z63A 4LPSA 4LJ5A 2PZEA 3GFPA 2XSZD 1N5LA 1E9AA 1UPTA 3FB4A 1RYHA 5BN4A 1W7AA 2CDNA 2JIZA 3BGWA 2IHYA 2O8EB 1IAQA 3G0HA 3VHLB 3VR1A 1EWRA 2QP9X 3BWDD 1IN4A 4IFEA 1HA3A 3EIQA 3MRSA 2A7QA 3U6KA 1P73A 1LF0A 2HT1A 1VIAA 4B3CA 4M8NE 3K0AB 5FTJA 3C16C 4R9UC 1GSIA 1AQYA 1MABA 1EK0A 1Q12A 1G3MA 4QXAA 2H5EA 1Z0IA 4LHZA 4Q9IA 2N1BA 4D80A 4PO1A 4TQ9A 2QY9A 1XTIA 4M9ZA 1Q3TA 1EFCA 5LBIA 1OXUA 4QGFA 2DFNA 1JJVA 3S1AA 4D4LA 1VKJA 4DLSA 4M53A 1NIJA 2J7PA 2EW1A 3TNFA 3CNOA 1S9HA 3QKUA 5HTKA 3PUVA 4RY2A 1R8QA 3IO5A 2LKCA 4OI1A 1N0WA 2YOFA 1Q1ZA 4DXAA 2B21A 4L8GA 2ZRNA 5BYKA 1UKZA 4F92B 3A4MA 4RFSA 3GFOA 2JJ2D 1GG2A 1ZUHA 1MKYA 1XD2A 2O8CB 4HI0E 3K9GA 2ORIA 2XNDA 3R20A 5JI3E 1GZSA 1W5SA 2Z0MA 4YMUA 3THXA 3EPJA 3AB3A 4CEJA 4EPYA 3WBKA 3OAAD 5E95A 1P5ZB 1GVNB 3NKVA 4DWJA 1II8B 1R2QA 2ZUCA 3RS3A 5K8UA 3AVYA 3PEWA 3PUXA 1RKBA 2VH5R 1UBGA 5CJPA 1LVGA 1Z08A 3QKRA 4TMKA 3SBEA 2RCNA 4OI4A 2QN6A 2AX4A 5KYKA 4DLRA 1BOFA 5IK2D 1BYIA 2J0UA 2NO9A 4A8JA 2QQ0A 3KJHA 4AY2A 4URXR 3I5XA 1GNQA 2IYTA 2OCYC 4FWTA 5UKDA 5EP3A 4A2WA 3EZ7A 3I32A 1TUIA 3BFXA 4LJ6A 1CR4A 2GWHA 2F43B 1KI1A 4V0OA 1COWD 3QE0A 1HH4A 1QHGA 2WJYA 1LS6A 1IXSB 5FFMA 2W2VA 3GQBA 1AS2A 1JBKA 3SJZA 4HUQA 2A5DA 3QPWA 2V9PA 4QL3A 5EP4A 2TMKA 4NZYA 2ZRCA 5KSPA 3AUYA 1XZPA 2OE2A 1M8PA 3DEFA 1UM8A 1N6IA 4AIIA 1M6NA 1G7TA 5KDDA 2H57A 4GL2A 3T5GA 3NEJA 1U0JA 2OXCA 2ZYVX 2G0TA 5JFGA 1OHHD 2BM0A 1BS1A 2HT6A 2WVJA 4IOKA 3EIEA 3X1YA 3Q7QA 4G1UC 1G3IA 2EYQA 1HV8A 2GBLA 2CE2X 4JLPA 4ZIRA 2WZQA 1FZQA 1VG9B 4I1SA 2OILA 3NTUA 4Q7LA 3TMKA 5CDFE 1WXQA 2AWOA 3SYKA 3AVOA 1KK2A 3E70C 4LOAA 2NPFA 4G5OA 3RAPR 4JBWA 3MWKA 2J87A 3LXXA 1JQJC 3X1DA 1NN0A 2GF9A 4EPWA 1NLZA 2EYUA 2YC4C 3LAWA 1SKYB 1ZUIA 4DEXA 5DISB 3AVWA 1N5KA 821PA 4G5RA 4PAOA 1OH6A 4KHZA 2QPOA 2W6ID 1G7CA 3BH6A 5G3ZA 3WMFA 4D26A 4II7A 4UNRA 5BN5A 5KUTA 3VR2A 1KO8A 1P61B 2QL6A 2VSXA 4FMCB 5HKKA 1CJKC 2QAGC 2REBA 1P3JA 1YHNA 1EGAA 1QHHB 1GITA 3OESA 2JGNA 3QKTA 1GIAA 1W2GA 1FNNA 5FPYA 4B43A 1N0UA 4BUJA 2CCGA 2V6JA 4JZKA 3UPUA 5FL7A 2JLUA 4OBEA 3KKQA 5CIWA 3TQFA 4MRVA 5AUPB 1B23P 1TADA 4BFZA 3KKMA 1R10A 3SHFA 5FR1A 2GJSA 3IPYA 4XWOA 3GPLA 3CRMA 5CK5A 2FDCA 2ZRMA 4V02A 3I4LA 1KGDA 5TDHA 4G01B 2WWXA 4DB2A 2V3CC 4B73A 3UATA 2Z43A 2ZANA 4DDUA 3SOPA 4QBFA 2J0SA 2VHQA 4EAQA 4AKGA 3LVQE 4XSGA 4QBGB 2CLSA 1J8MF 3HPRA 4MUBA 3B1YA 3QNUA 2P2LA 4RSGA 5JJKA 1E2NA 2WAXA 2AXPA 2IYWA 2BC9A 4QC2A 1XF9A 4LUCA 1B0UA 3TQCA 1T8TA 2OESA 3TSZA 5J4KA 2D7CA 3BERA 5BQ5A 3TAUA 5TB5A 4IEEA 5LB4A 5FUVA 3OIUA 4BRUA 4F93B 4RD1A 4B6EA 4S2EA 2CL0X 3NC0C 5G3YA 3ZQ6A 3FGNA 2VQSA 4G3XA 2FSHA 3VHXA 3W6OA 1C1YA 2C04A 5KNDA 1IONA 1QHIA 2W0MA 3F8TA 4ZKEA 3KXLA 4MH0R 1W2HA 1E2KA 1CR2A 1VG0B 4FCTA 5FUYA 1OF1A 2CHGA 5L3RA 3WRYC 5FR2A 3KJGA 3X1WA 4DDVA 4HAWA 2GJAA 3KDSE 3CKLA 3VX4A 1II9A 4TL6A 2FG5A 4K8OA 4DLTA 4D25A 2DWOA 4O2LA 4V0MA 1SXJA 1VCMA 4PX9A 3GJ8A 4NP6A 2ZU0C 2F55A 1I2MA 2X1VA 4FW9A 5DYGA 1TF7A 1DPFA 1VHLA 4ZCMA 4E09A 1XD8A 3WYAA 2CJWB 3NDBB 1CULC 1KI3A 2P67A 2FOLA 5GADl 3QVUA 3QKSB 3CW2A 4AI6A 2DFLA 1F6BA 1S3SA 2IK8A 2WBLC 2AXNA 4N1AA 4B35A 2AHOA 3CR8A 5EXPA 5LD2B 3VX3A 1AJEA 1XZQA 4D0GA 1HEIA 1FFHA 2IYXA 3QF4A 4C0QC 2OCBA 3U7FB 3B82A 1PJRA 1E1QD 1ZVQA 4XSHA 2SHKA 4JJZA 2ZQ5A 3PEYA 4GI7A 1U90A 3EPKA 1U9IA 5IRCD 121PA 3NBYC 4MQBA 3KQUA 2IA5A 3CUEF 4XH9B 1KK1A 1FQKA 2O8EA 1FUUA 1A4RA 3KQHA 2ANCA 2ZJ8A 3KUCA 2IBMA 421PA 5CIQA 1S9DA 1KMHB 4AYTA 1U94A 2RGBA 4PXAA 3K0AA 3K9NA 5JCPA 4B34A 3HDTA 3QF7A 2F1HA 4QHSA 2O8BB 3ZZUA 4ESVA 1Q21A 3CRW1 3CRVA 1E2MA 2A5FA 2MSDB 4ZO4A 1E2GA 1UBFA 4H9GA 4QNRA 4C0HA 5C4MA 1ZMXA 3T1OA 1GWNA 5B58C 3EZ2A 3LDAA 3D8BA 2JLRA 4XIGS 2Q3FA 2WKRA 3DKPA 2C03A 2EFEB 4LYHA 5EXSA 4XTCS 2QMOA 5DN6D 1JPNA 1Z2AA 2XSZA 3GLGB 3QUSA 1LY1A 4Q1EA 4BZPA 2ZI7A 4A36A 2JLYA 3SYNA 4RKFA 1K5GA 1U0LA 4QJ5A 1ZRHA 3ZJYA 4YDSA 2GEDA 4PPNA 3BJIC 2OM2A 3IIKA 1CRQA 3LBIA 3PEVA 3RRNA 3WNBA 4CEIB 1P9RA 3P20A 5CK4A 2XXAB 4JBYA 4Y0VA 2FSFA 4JKYA 1UFQA 4KJZA 5D3MB 1XXHB 2IL1A 1BH2A 3BH7A 2X77A 3MWJA 3LV8A 4XWKA 4TYNA 1CIPA 2HDNB 4EFMA 1II8A 5GVSA 1OB5A 1E98A 2C77A 2NGRA 4Z1MA 2C95A 2Q21A 1G19A 2EFDB 2KBFA 3SI7A 4DDWA 4HAXA 3DO6A 2BCJQ 4IOJA 1G7RA 2QG6A 4PC6A 4RD0A 1OIWA 3ZLJA 1LTQA 1M7GA 4ZDJA 3PVSA 3AM1A 1LV7A 1TUEA 5A4JA 3HWSA 1WF3A 3F3YA 5KSYA 1SHZA 1RE0A 4HDOB 1G4UR 1GL7A 3JVVA 3SZRA 2Q9AA 1CF4A 1E4VA 3G5UA 5DIFA 2CK3D 1NVUQ 3UWKA 3OEED 3QEJA 4JLOA 1IJEA 1JNYA 1UDWA 4TQAA 2IUUA 2F43A 4MUAA 1E2QA 1BMFA 2ZRFA 1JB1A 3EWSA 3O47A 2A9KA 2R6FA 4HDQB 4L15A 4FI3C 1DVRA 3L8YA 1G5PA 1EESA 4N0EA 4BPBA 1ZUNB 1VG1A 1YE8A 1F2TA 1JQLB 2GAOA 4RZUA 2FEOA 4LBZA 1JR3A 1I4DD 3AGQA 5IK2A 4OJKA 1D9XA 2GXSA 3N70A 3L2OB 4TL7A 1R5BA 3LY5A 3NHAA 3TJZA 3FHTA 1S1MA 2XOKD 5KPDA 2ORWA 3KUDA 1COWA 1P62B 1XTKA 2AFHE 1J70A 1SVOA 1EXMA 1O87A 1R8SA 4EFLA 4BFYA 4IXNA 2ZI5A 3V9PA 2ZR0A 4FXPA 4TQUS 1WB9A 5EJEA 3A1UA 1GL9B 2IYYA 2ZE8A 4OK6A 4GZLA 1OHHA 2VF8A 1N0VC 3DOFA 3ECCA 4Q7MB 1XU4A 3MMPA 4RZXA 3X2SA 1XD2B 3NC1C 4FMDF 3W90A 1QHHA 2VA8A 2VSOA 3BOSA 3CZQA 4GRAA 1XDBA 4X8OA 1NBMD 1W4BA 2W6JD 3D7MA 4YMSA 4W5HA 3TBKA 4F7WA 4CEJB 3R9XA 1YJ5A 2J0VA 2EWVA 1HY3A 1IXZA 4TLBA 4XJXA 4JIMA 4BLSA 3KKOA 5HZKA 2W58A 1PLKA 2PMKA 5SZIA 4BLTA 1EFHA 5TARA 4F38A 4RCYA 2ZS8A 5IHPA 4QOSA 4E07A 1IXRC 1H8EA 4LJ9A 3OE7D 1P7CA 3BORA 4PQRA 4P4SB 2W6IA 1XTQA 2P3SA 4C30A 2VP0A 2GESA 3EIHA 1NN5A 2CLDX 5CJ2A 4P31A 2FFQA 1Z6YA 4V0NA 5KDOA 2QPAA 1I4LD 4N3NA 1IY0A 1AGRA 4LJ8A 1GKUB 3KTAB 1T0JB 1TMKA 3MWLA 4MKHA 1FW6A 4FIDA 1KY2A 4QGGA 4B48A 3U3OA 4DT1A 5KNCA 3RRMA 1OFUX 2IF2A 3NWJA 1G5TA 2OFWA 4XD7A 2R6DA 3SU8A 1ZBDA 1W36B 4DSOA 4YXWA 3NBXX 4Z51A 1LB1B 5FTKA 1NG9A 4MDEA 2HV8A 4ZIRB 2GDJA 1Y3AA 4Y0AA 4DEYA 4A1FA 4BFTA 1JXOA 1UF9A 3KL4A 1T6NA 1CBUA 3KZ1E 2CNWD 3EG5A 4NYJR 1KSJA 1OW3B 2QROA 3P4XA 4OQLA 3O8BA 4ZI3A 4C2UA 1X6VA 2AN9A 2BV3A 1G20E 5DE3A 3AF4A 1ELOA 1XMJA 2ZI4A 5HCNA 4AD8A 5FTNA 2BVNA 3LH5A 4RD3A 4LJAA 4MRPA 4LYJA 3Q7PA 5AWFC 4DUGD 4NYJQ 2ZPTX 1F3OA 3BRWD 3T34A 1XXHE 5E3HA 4NBSA 2OEPA 2VF7A 1P2TA 4P33A 2CJWA 2GRJA 4HZUA 4P4UA 4HAZA 4JLDA 4CW7A 1S4QA 2HYDA 2WOOA 4ARZA 3QKSA 5L3QB 4JT4A 3H0KA 3JZMA 3QBVA 3VAAA 2W83A 4LJ7A 4KYUA 2V54A 3Q3JB 3HU1A 3IO3A 4FMBB 1Z22A 1R0ZA 2QM8A 1DG1G 3OEHD 1RZ3A 621PA 3EPLA 2NMVA 3B5JA 2VHUA 3ASYA 4AWXA 2WWGA 4MYHA 4BFUA 1ZNWA 1QDEA 2I4IA 2IC5A 1E4YA 3EZ6A 3ADKA 3KQNA 1NVWQ 1JXMA 1OYYA 4GSYA 2WJIA 3GLFB 1H8HA 5DNYB 5L8VA 1VCOA 1GUAA 1KMHA 4JL6A 2YV5A 2WWFA 1ZU4A 1TAGA 4DB4A 2ZAMA 1DAGA 3VR5A 2F3RA 1L7VC 2H7VA 2ZROA 3GMTA 4LC1A 3TH5A 3ZVMA 1S1CA 5P21A 5LDDC 4MGZR 2QORA 221PA 2N46A 2XGJA 2D74A 4KU4A 3P1JA 2ZR7A 3IIJA 1F2UB 4M21A 3AKDA 3TUZC 5HE9A 5F98A 4B71A 3AGPA 1Z07A 2FFAA 1ONBA 1P9NA 4KVGA 3TUJC 4WZAE 5JEDA 3L43A 4TTPA 4DBLC 5JS8A 1ZCAA 3EASA 1N6OA 2QAJA 1KDTA 3AH8A 2XITA 4CEIA 2XJ9A 2ZRPA 2GKSA 3OFNA 4LYAA 2XXAA 3W5IA 1G3UA 2XAUA 3VTKA 5D3MA 4W7SA 4KFRA 3RC8A 1ZD9A 3AVUA 2ZAOA 2ZVQX 3WNDA 3TLXA 4QNMA 3U7GA 3BS4A 3AVXA 2AD5A 2FGJA 1NP6A 1EG7A 3CPHA 3IEVA 2B6HA 4URYR 3C14C 1XFAA 2J59A 1CLUA 1S8FA 3CWZA 2ODWA 4M2LA 2WWYA 2WSSA 3B1WA 3HP1A 4ESHA 2I3BA 5HR5A 1OKKD 1SGWA 4QHTA 2PJZA 4D4KA 1FTNA 3PV0A 1N6LA 4NMMA 2H8KA 2CE7A 2PEYA 2QP3A 4IXMA 3CWQA 2PJRA 4RZ3A 3B6EA 4TLAA 2FSIA 1D8TA 3JZAA 4A4DA 5LPNA 4ABYA 1W4CA 4Q19A 1E0JA 2OV2A 1MO5A 3P26A 1RW4A 4IDQA 1E3MA 1GILA 1E99A 2IWHA 2PCJA 3I92A 4WZBE 4IVQA 2JAQA 3K0CA 5E7MA 4QBHA 2BJVA 4P3YA 3ICEA 1IBRA 1ZD1A 4YMVA 4QGHA 4ZDKA 1Z5ZA 1G1MA 2WWWA 1AQUA 3BD9A 3VFDA 2ZJYA 2OBMA 2VP9A 1WE2A 1P60A 2CVHA 3DMNA 2ZRLA 1NMXA 3ZZTA 4DSNA 3FHOA 3K70C 1QRAA 1UBEA 2IYUA 4BQSA 2D2FA 2Z4SA 3MUFA 1QHYA 3BK7A 4JYBA 4IDPA 4EFNA 3C5CA 3OEEA 1OYWA 4HAYA 2RGAA 1KNQA 1XJ0A 3T1TA 4HB3A 4QKQA 4F91B 3PXGA 3GJ0A 4ZPXA 4CT4B 1VHTA 3Q9LA 2W00A 4WOPA 3TSOA 1E9SA 1QHNA 1ZM9A 1W1WA 4A0RA 1ZM4A 3ADCA 3FYHA 4D0NA 3B60A 2VTKA 3ONWA 2QU8A 3M4YA 4GMDA 1EX6A 4EPXA 3J81k 1Q44A 2VHJA 3K70D 3RS0A 4JJKA 3QEOA 1G291 4H1VA 2Q3HA 5G40A 3GJXC 3GLHA 2HUPA 2WPDA 5AJXA 3FVQA 3MJHA 4PHGA 4U02A 1XTJA 2F1RA 4K81B 2CHVA 3FDIA 3RVBA 1G41A 1Z0AA 3V4FA 2FPLA 3R7WB 4ZCIA 3RSOA 2XOKA 1GAJA 1E9EA 2G6BA 1GRNA 1YRBA 2CBZA 2VHCA 3LNCA 4LDJA 3GLIB 4V0KA 2GZAA 4GMXA 1Z83A 2AKAB 2ODEA 1E69A 5GJWC 1U8YA 4OYHA 3L0PA 4P4SA 4BFSA 2XZOA 1A7JA 1BIFA 1FQJA 2JLXA 5L3VA 1TQ4A 3R9IA 3TGPA 2GTPA 1OIVA 2NO1A 4K46A 2EFCB 3PIRA 3GJ7A 2JEOA 4PO9A 3PUYA 4URVR 3AF0A 5G41A 1VCIA 3KTAA 4A0GA 4ILEA 1XX6A 1DEKA 3U3KA 2W6JA 4XWAA 4JVNA 4C7OB 2HXYA 3Q72A 2QENA 4OJQA 4LV5B 2JLWA 2FZ4A 4HAVA 5EP1A 2CEAA 1M7HA 2ASEA 1OSNA 4IOMA 2AD1A 2IXEA 3SJCA 2PZFA 1OB2A 2IW3A 2C8VA 2CCKA 3GEIA 1F2TB 1Q1BA 2YC2C 1S3GA 2RAPA 5H68A 2C98A 2XB2A 1VCNA 3B13B 3OF5A 2GETA 4CYMA 5EE9A 2BIFA 2C9CA 1Z6TA 1N6RA 4DLVA 3QPUA 3DKVA 1Q0UA 3HYTA 2X2FA 3IBGA 2R62A 3LQQA 4JBXA 2H1LA 3QJYA 4GOKA 2C9OA 2JJ1D 2ZRDA 1EFRD 4Q9LA 3CONA 1CR1A 2OO7A 2B7BA 3A1VA 3PG5A 4LZZA 1CS4C 2BJWA 2Z83A 5JWOA 1XEXB 5CYOA 3QG5A 1AIPA 5DI9A 2QNRA 2XX3A 4ACBA 1NVVR 5M04A 2HF9A 2G1KA 4RKEA 1KI4A 1RRGA 3RWOA 2NOAA 2IEYA 3WBJA 1IHUA 4EQ6B 5L3QA 1W48A 2QE7D 4V0ME 1SXJE 2EU8A 1T91A 4EKDA 2PMDA 1FPMA 3EW9A 1NVVQ 3NEYA 1GP2A 5FI0B 1NY6A 2A3RA 2QP4A 2F1IA 2D62A 1JEEA 1AS3A 2ZJOA 3REFA 4EJSB 5DH9A 5AJZA 3W5JA 3U44A 4GPTA 1A1VA 3WRXC 3BH0A 5FTLA 4HAUA 4NCHA 1Z8FA 2DY1A 4LGMA 3CF2A 2J41A 3GLFA 1N6KA 1Y63A 1W4RA 2WKQA 1Z06A 1MO4A 1YQTA 1FX0B 4XVRA 2V8OA 3K53A 3UWOA 4UKDA 2A78A 1WA5A 3FKSD 1IN5A 3T1QA 3SEAA 1KAGA 2J0QA 2J5XA 2FA9A 5TY0A 1XWIA 2IS2A 2WKPA 2YHSA 4NYIR 3OEHA 1F2UA 3SJAA 4L4UA 5K8LA 5HPYB 4DT1B 1M7BA 2HYIC 1Q22A 2FFBA 2V6IA 2VYFA 4LHWA 4Q1DA 2R9VA 1N3BA 2VEDA 5LD2C 2JJ8A 4MGIR 4OQXA 3CF0A 3RYTC 4NYIQ 2VP6A 2NQ2C 3DM5A 4PZZA 4BRWA 2OAP1 4OHWA 8OHMA 4DJTA 1Z0JA 2WWIA 2YVUA 4YDHB 5C46F 2IS6A 4GP7A 4KLNA 4KVAA 4JL5A 4CIDA 1XCGB 4US0R 5K8TA 1KSFX 3GD7A 4MDFA 3MLEA 1VDZA 3B7GA 4JLJA 5FOVA 2GVDC 4Q9JA 5CDFA 4NDZA 1KO5A 2AK2A 2AFIE 2GCPA 5IF9A 3T15A 1SVMA 3HYRA 1WQ1R 4FMCF 1W4AA 4F4IA 5JHHB 3AKEA 1DAIA 1NVXQ 2YWHA 1E2DA 3CX7A 4OL0A 2JLZA 2FH5B 2ZYTX 4TSFA 4D82A 4ZKDA 4U5XA 2FN4A 3TIFA 4HZUB 4R98A 3NH6A 1XEWY 1CJTC 3KXKA 4ARZB 2CVFA 1G21E 4TMXA 1DOAA 1OJLA 5FPSA 4OI0A 1IM2A 2RGNA 2VO1A 3ADDA 1RFLA 1P4SA 2ZRHA 1CKEA 2YINC 2BCGY 1MOZA 4BFXA 2CHQA 4G5QA 5SZKB 4DKXA 2ODBA 4A9AA 4JL8A 2IYVA 5EQTA 1VYUA 4B76A 4TYYA 2ZJBA 3DPUA 3MSXA 3UK6A 1Z3IX 2MMCA 1GRRA 1M74A 1E2IA 5K8IA 5E7JA 1ZU5A 3AVVA 3LVRE 2IF0A 2R6CA 4BLQA 4DDTA 1KJYA 1NLYA 4IW3B 5FBWB 2QTVB 3ZZ0A 4LJ4A 1QHXA 2ZRAA 3X1XA 3VKWA 4JYCA 3IKJA 1EWQA 3CLVA 4QM6A 3OZXA 1GKYA 1TTTA 4NU0A 1JR3E 5JWHA 2Q6TA 3RSLA 2BMFA 2FGKA 1YRAA 3EPHA 4PFSA 1TPZA 1IOZA 2ERYA 3GJ5A 5H8WA 5AUNB 3FFAA 4G5GA 2F9LA 3QENA 1VTKA 3ETLA 3UKDA 2VHTA 2FSGA 3PITA 3ZDQA 3AVQA 1F5NA 4I99A 2QTFA 5CM9C 1HE8B 1W0KD 2ZITA 1SKYE 3I5YA 5KO2A 2HJGA 2XJ4A 2F1JA 2FPMA 3CB4A 4BZXA 3QXSA 3QQ5A 5SZJA 1X1SA 5GJBA 4TYQA 1JI0A 4TLDA 2V1XA 4D2IA 2GXQA 2PX3A 1KJWA 2HF8A 3OIWA 5JZVA 3AP3A 5J4LA 4CDGA 5JBQA 1E1RD 3K0EA 2OLJA 2VSFA 3C5HA 1CU1A 1KOFA 3TUIC 2NG1A 1YZQA 4ZDIA 3R7WA 1YZTA 3QXCA 2O8DB 3W8NA 1CP2A 5DSZA 2ATVA 5B30A 1WRBA 1PV4A 3K1JA 4IEIA 1CJVC 3B9QA 3B1VA 4BWYA 3GLIA 1X1RA 2OAQ1 5FBRB 5FUXA 4C9BA 2UKDA 3FFBA 5E7IA 3K09A 2N42A 1FL9A 4GOJA 1XRJA 3BB3A 4MKGA 4PSVA 2V7QD 4B47A 2XTNA 2OXRA 1QG2A 4B74A 2V55B 4LK2A 3U3JA 3EC1A 2JJ2A 4B3BA 1CRPA 2BBTA 4EUNA 2JIZD 1UKVY 2KBEA 4QJ4A 4MRNA 5FOTA 4P0TA 3TE6A 4M1TA 3ICQB 3U2QA 1L2TA 1PUJA 2FMXA 3CR7A 1OXSC 4C7OA 3CM0A 3OAAA 4DIEA 3IQXA 3B9PA 4E5UA 5ELXA 1X8JA 4URZR 1ZP6A 2QRZA 1RRFA 3RC3A 3HJNA 1NN1A 2WJJA 1MV5A 3I8XA 1KKMA 4PC1A 4FN5A 1MO3A 2GHIA 2ZEJA 2ZVPX 2LKDA 5F9HA 5CM8B 2WV9A 4OQMA 4CEHB 5J47A 5FI1B 1JALA 3CIOA 1E2EA 1QZXA 3ZVNA 4AC9A 2JATA 3EX7C 5BXQC 1D9ZA 4DSTA 3CO5A 2A2ZA 1XEXA 4HLDA 4A8JC 2DWPA 1V5WA 1G16A 2UVQA 3CH5A 4Q1CA 2GVZC 1WMSA 2BMDA 2PT5A 2A5JA 1NLFA 3EA5A 1NF3A 3RDPA 1QBKC 1G18A 2G88A 4B3GA 3TAHA 2XNDD 1DARA 2G77B 2OBLA 2UZIR 4TL8A 3UIEA 4EQ6A 4PPFA 1ANKA 1XTRA 3F5FA 1E9CA 1WBBA 3SQWA 3R8CA 4KFSA 5KDLA 4RZ2A 4J0QA 5C2JB 3GLHB 1YU9A 3K0FB 3TK1A 3RS7A 1RRCA 5F3WB 4EJSA 4IDNA 1KMQA 2P0EA 2V4ZA 3IHWA 2YJTD 3M6AA 3NBZC 2ZI6A 3L0OA 2IXGA 4KI0A 1BO6A 1XD9A 2R6GA 4MITA 5FTMA 4GT1A 2GBLC 3EZ9A 4RD2A 1EFRA 3QVVA 2BBWA 3PEUA 1FP7A 5LB2A 4V03A 3N5CA 2YWGA 2ZSFA 1WBDA 1IY1A 2RGEA 5EUQB 4EPVA 2AL7A 2FJUA 4DRZA 3WMEA 2VP2A 3C7KA 2IX3A 4DLYA 4Q4HB 5EZ5A 1NRJB 4WIAA 5TMPA 5JS7A 3FKQA 3D6TB 1XMVA 4Q1FA 4IKEA 1DO2A 1FX0A 3I3SR 4GZMA 3A36A 3MAAC 2ZYWX 1OXVA 2LWIA 3CBQA 3CPEA 4Q9KA 4ERNA 2QE7A 5CLLA 2WSMA 3VKGA 5EE3A 3VKHA 5FL3A 3I62A 2QGZA 4X8MA 3U3RA 1T3HA 5AJWA 1VYTA 2BWJA 3VR6A 4HATA 1V43A 2FV8A 4PHTA 5HE8A 2WOJA 2A5YB 4LRWA 1E2LA 1FP6A 4E22A 2QA5A 1W47A 3UG7A 3MG9A 5JSZB 5JJIA 1TQ6A 1SVLA 4NONA 2E1RA 3LWNA 3PCRB 3IPXA 3UANA 1OFIA 5ANRB 1U99A 1LW7A 3B85A 3FTQA 2BMEA 2DCUA 1XJCA 1M2OB 4Q21A 4ACAA 5J4YA 2DBYA 3GLGE 2JDID 1R5OA 2VL7A 1KDPA 1QHSA 1KSHA 2DFKB 4C0JA 1ZW6A 4QM7A 3NDPA 2QAGA 4BLRA 1YR9A 1IJFA 4Q47A 4QJ3A 1QF9A 1HT2E 4XTRA 4KBFA 4LSGA 4B3DA 2YNMA 3MCAA 5FH9A 4PQFA 2QI9C 1Z6XA 2X8AA 5G53C 5HKKD 4IVRA 4IRUB 1Z47A 5H1YA 1RPZA 3WMGA 4B32A 3KXIA 1T9HA 3I61A 1I4TD 3CZPA 2WHXA 4JLBA 2QBYA 5FL7D 1N6HA 5TVKA 5KSZA 1L4YA 4JVLA 2O0KA 2ZSDA 1UEIA 1MRSA 4QHYA 1IN8A 1OLOA 3BC1A 4NL4H 3A58B 1NKSA 2P5TB 4R2IA 1OV4A 3M0EA 4JLKA 3E1SA 3IGFA 4W5WA 5F2EA 2ZUBA 3H1TA 4TL9A 3U44B 5CYPA 1XBTA 5GJVC 1BKDR 2K5UA 1ZC4A 1JEDA 1X3SA 3A37A 3RRZA 1IN7A 2KB0A 2QMUA 2A5GA 3RNLA 5HCIA 1DO0A 2NZ8A 4I1OA 2EQBA 1M34E 2J1LA 2P65A 2IXFA 1U0HC 4U00A 1KAOA 4WXRA 2GEUA 2YKGA 3SFZA 1SXJC 4PC3A 1G6OA 1YR8A 4URUR 2CMKA 2AKYA 2IUSA 4RVCA 4C3ZA 3DZDA 1DAKA 1NJFA 4C0LA 4WBSA 5GVRA 1Q57A 3UMRA 4MGKR 2ZYUX 1GDDA 1W46A 4Q02A 1IY2A 1RYFA 4LJYA 3LRPA 4AURA 1E1QA 1KHTA 4EDHA 4HEJA 5C1BA 3CF6R 3C15C 1DAEA 1YZUA 1FOEB 4DZZA 5KOYA 3SS8A 1OPXA 1KTVA 2ATXA 3W3ZB 1US8B 2IUTA 2HCJB 4Q18A 2NTYC 2GK7A 5JMTA 1AKYA 1YZNA 3NG1A 4KAXA 1HQCA 1AS0A 1UEJA 1CJMA 3C8UA 4O0MA 4GDFA 4OHXA 2IS4A 1XB2A 4XOIA 1ZJ6A 4B2LA 1Z0KA 2PEZA 4LCBA 1U9IC 4NCJA 4B2IA 4P4TA 5B57C 2KI5A 1SXJD 4JVMA 5J4HA 1HT1E 3KX2A 4RD6A 2Q3MA 1UKEA 1TEXA 3LBHA 4UNNA 4Q1AA 2CL6X 2D4HA 3O8RA 4LPKA 2PBRA 1II0A 3O8DA 2Q0HA 2C9YA 3EWAA 2VIIA 2O8DA 4A6PA 1KIMA 2J9RA 2J46A 3ZVRA 1DG3A 2JA1A 4Q7JB 1KI9A 5EXXA 4TYWA 4MRRA 5DN6A 2ZM5A 4DSUA 2WTUA 2QSYA 5L3SB 4FCWA 2ZE6A 3ZD6A 3TR0A 2WAYA 3IIMA 2KWIA 4PTLA 1MT0A 4U7DA 1F48A 2GF0A 2GA8A 4RJLA 1YR7A 1Z28A 3A1TA 4UQOA 2F3TA 1UJ2A 2P6UA 4DCVA 2GCOA 3KB2A 4AG5A 1YR6A 1G7SA 2OHFA
chains in the Genus database with same CATH superfamily
2BUCA 3PE6A 1VQ1A 4ZHQA 1GFSA 1SXIA 3Q7EA 2CVOA 2FMUA 3KQLA 2NP7A 2OV4A 3BBPA 4NYMR 1ZIOA 1C81A 2HLPA 2Q0QA 3PPWA 1GTVA 5U4QA 4N5MA 1AB6A 2OWEA 2JIRA 2XLBA 3EBLA 5F73A 4KYTA 4YN3A 3PLAE 1H1TA 1E1CB 4IWNA 3BWEA 2YWCA 1KR5A 3KKNA 4RIHA 3OPVA 2HZ7A 4TV9B 1JILA 2NZUG 3BGVA 1H4QA 1O57A 4I5EA 3QIAA 2NO6A 4WCFC 5ALOA 1MC4A 2ISSD 1NJGA 4NYMQ 2MSNA 1R8JA 2CLOB 4RAQA 5H70A 2IZ0A 1NJ8A 3X44A 2HA6A 1ZEMA 2EFHB 2X2PA 3ONFA 3Q5EA 4KDEA 4MWZA 2HTFA 4RCZA 3C3CA 4DKJA 1P4AA 4UASA 4LF6B 2F17A 3VNVA 3OVMA 4B80A 5HIMA 4D1YA 2PSEA 3QYFA 4PSKA 5FA8A 1GNTA 2F7SA 2ZZNA 3DOUA 1IH8A 3BICA 4MWEA 4BZZA 1G64A 3PDIB 5KSOA 2HIGA 3KT3A 1E5LA 4NY1A 5A3VA 2FW0A 3NIBA 5TF0A 1V3TA 3G5LA 1OH5A 5M7EA 2J67A 4UMFA 3QH4A 1ZRNA 5ALDA 2QQ5A 2OG2A 3D81A 4N12A 3BIFA 4E12A 1B2LA 2C78A 1IM5A 2HCRA 2PFGA 3NIDB 4V0LA 1TF5A 1VE9A 1JN0A 1P1RA 3E2IA 1WXWA 1V25A 5BOVA 3WHLA 2NO7A 4GX5A 4Y9UA 3RRJA 5H4GA 3EFOB 2M9MA 3MEQA 4GQAA 1H1LB 1QAQA 2H4ZA 5L4SA 2VQ6A 2ZE5A 4MRSA 3T9DA 3WY9A 4ZCRA 2WU4A 1LPNA 4HN2A 3L0DA 3A32A 3PKZA 3OUUA 4FGUA 4BO9A 1Y8ZA 1XZMA 1QE0A 4A15A 4U2EA 4LBWA 3VH1A 3P4UA 2GTHA 5JHGB 4GXNA 4YJFA 2A7XA 4FOTA 1PLLA 2P79A 2VSYA 3KQOA 4Z7JA 4IFBA 3TLAA 2GYUA 3NYWA 5B1IA 3PXEA 4LC9A 3RT1A 4NG4A 1J7KA 3R9WA 4L16A 5BO5A 1KKLA 1M5TA 3AKCA 4BMSA 2Z5FA 1TTPB 4GRDA 4WTOA 1DS6A 1FDRA 4DV3B 3FVVA 4D0LB 1JFFA 1U28A 2QUAA 3UMYA 1GHTA 4Z4IA 3BT7A 2GOYA 2I6FA 2ZOSA 2HEIA 1T1SA 3D8UA 3PUHA 4KI7A 1ZCBA 1AZTA 1XP8A 1O95A 2ID8A 1PFQA 4R40A 5AI8A 2XIJA 3ZV6A 4ZRDA 3U39A 4JUBA 4C76A 1CLEA 2E4UA 2AF4C 3WB9A 2PT9A 3G88A 1DAFA 1P4GA 3ND9A 4N0DA 5HQ3A 3ZZMA 1JR3D 4EY8A 4W5TA 3ODGA 2CUNA 1GD1O 2BI7A 1R6AA 1D2EA 1V7PC 1U2GC 1CZOA 2WWHA 4GBGA 2A30A 3B5EA 3IQFA 4KVZA 5LA6F 1WPRA 3L93A 2NQ8A 1DLIA 3KFXA 3BX1A 1UPCA 1XTVA 2XGSA 1ORRA 1GPYA 3L40A 3N7TA 1Y8CA 3B8HA 1E6WA 1X1TA 2H4FA 3H9GA 2Q5LA 1M2OA 3BMXA 3IVAA 3O3CA 1HDXA 4KSYA 5AKLA 1YNSA 2GZHA 3W1WA 3C3AA 1DJPA 3GB9A 1H65A 2WJGA 1JJ7A 1C5KA 1LRKA 1R8YA 3SJBA 1T8PA 2E89A 2GK6A 1PS9A 4Q6BA 3HWWA 2BGKA 4IINA 3F7NA 5DMXA 4Q9HA 4D41A 3ZW8A 4PIMA 5KTTA 3WJAA 1F5SA 2PRSA 1BC5A 4RXUA 1W8IA 3SIXA 1ZOLA 3F3MA 1LDYA 4WV3A 4Q3AA 1IVNA 1O03A 4AN4A 1SEVA 1XCBA 2B7CA 3OY7A 4ZT7A 5ILGA 2E4VA 2O54A 1U9ZA 2YIVX 3B1XA 4BYMA 1PJ3A 4P5EA 4AK9A 5JAIA 1KVTA 3AP2A 2FEKA 2CWDA 5BYJA 1RYDA 2Y1CA 3DMRA 3DZ8A 3O8CA 1C7QA 2J32A 4ZDWA 3K6KA 3NH9A 5BXYA 4NPAA 1N6PA 1E7MA 1Z6AA 3WYGA 1L5YA 1NUUA 3LFTA 1C0EA 3LPLA 5LBTA 4POAA 3RABA 3VZPA 2E4XA 2OQVA 1Q0LA 3H5IA 3MS2A 1TU3A 1Q3KA 3UJ3X 1Z34A 4JUIA 3HO8A 4RA6A 3OQHA 2VBCA 5E6SB 2P4UA 3QBTA 5CB8A 1Z6PA 2X22A 4GBMA 2CNWA 4S1NA 5F77A 1D1TA 2VATA 5A04A 4BNVA 4C7XA 3RAFC 1TQ2A 1P72A 1DQPA 1S96A 1H8ED 4FDMA 1Q15A 3F8WA 5LQMA 3H1BA 4NJMA 4OOEA 1S0UA 3W5UA 3JD0A 5FORA 4DS3A 1KAMA 1XKLA 4DV7B 4FYJA 3LFUA 5E4FA 1E9FA 3OZFA 5H16A 3ZNNA 2GM3A 3ONDA 1K89A 4DUGA 1UAAA 2O59A 3WHKA 1GGMA 2ZB3A 1SQGA 1L9XA 3Q2KA 2J30A 1PQ4A 1XZ8A 2R2GA 1T10A 1KYZA 1M67A 1U7DA 1RWXA 3CW9A 2O7QA 4W9NA 3EZGA 1LFDB 1DEXA 3LTEA 2YNMC 3B78A 3HNOA 4DBZA 3GELA 1ZS9A 3E4DA 3ORYA 1E2PA 3LW7A 1NUAA 2XEXA 2EFYA 1ODTC 4LOIA 1Y6QA 4OP2A 1TIPA 3F8SA 4F3KA 2VJDA 4ZU3A 4GBED 5LQJA 4YXWD 4PC7A 2EJUA 4OXQA 4D6PA 3L01A 3UO8B 1Y37A 1KFEB 1ZXLA 2COUA 4A26A 2ZRQA 4HDKA 4JI1B 1WCV1 3OOHA 3QE9Y 5K2OA 3V1TC 1LK0A 1FF9A 1ZM7A 4TMYA 2Q6LA 1YU6A 2QG4A 2YWEA 2GSDA 1F4VA 4F86A 5JWRA 4EUFA 2FPSA 2D0OB 3LX5A 2AV6A 4JBHA 4TKZA 5C4GB 3QOFA 1V3UA 2R3SA 4LJRA 4V0RA 2BKUA 1V16B 4OQFA 3ZDBA 2ISQA 3RROA 4Z4FA 2FU5C 3GA5A 3TRDA 2BHTA 1QLWA 3EBOA 4NFLA 2AMYA 1CF2O 1DG9A 4MWBA 2YOGA 3UHFA 2ZIZA 4HN4B 4B3XA 2VF2A 3OZEA 4BO1A 1J2YA 2ACVA 3DTTA 4CM6A 1IRXA 3AHGA 4F5DA 5IJZA 4MHOA 5DM60 4MUFA 5IDVA 4EVSA 5LN1A 5KQGA 3I04A 2GNOA 3GP3A 2H51A 3IEIA 3PNMA 3HVRA 4DR7B 2DPXA 4CXMA 1YF3A 1K6EA 3F1LA 3OT1B 2PQMA 3L1HA 1F8FA 3LX4A 2XE7A 5BR4A 1UDCA 4RU1A 4EABA 2W2XA 2GK4A 3JQ8B 3FGZA 4DLWA 4C3UA 2R7KA 4PC2A 1RSZA 4C4OA 1H6CA 3SR3A 4HV4A 5L3SA 1OH8A 1NF2A 4QRDA 1UFRA 1YB2A 1PQUA 5ERYA 3K3PA 4DCTA 2KLHA 5LFAA 2ONKA 2WF9A 5HMMA 4RHXA 4GKBA 3AYXB 1RS0A 3GUHA 3H11B 2FR0A 1W5TA 4K9KA 4H1UA 1JMYA 4L9RA 4BAGA 1DXYA 1L7RA 1XCLA 2BFEB 4FD2A 4I1UA 1TTHA 1DE0A 4PZLA 5C51B 1T8UA 4NQZA 1EUQA 2ZJZA 3OI7A 4Q48A 3TX2A 3SIPA 3GLIE 1RADA 4HLCA 1QU3A 1TI7A 3IR6A 3U3MA 1TX4B 3R5HA 4HLUA 3RTEA 1W49A 3TKLA 1T4CB 1H8HD 4YRGA 4EB3A 4IQ8A 1QM5A 4ZA2A 4UJ5A 1L4LA 3AR7A 3LKZA 3RBVA 4AYWA 5HM8A 3DDWA 1MQ9A 2HF7A 3EUWA 1O3YA 2YTZA 2W7TA 5DV9A 1QIJA 3LUPA 4YREA 5JNTA 3AL0C 1MHTA 2MINB 2NZXA 4ZJUA 4ZP1A 4HZIA 3FSGA 5CT9A 3RCBA 3DV0B 1K3TA 2ZJAA 1PS0A 1CUVA 2OCGA 3EIOA 4B6FA 1QPBA 2Z8ZA 4OI2A 2G83A 4B8YA 1GCIA 2ZSAA 4QBIA 4NOKA 1O5TA 5A6VA 3EAGA 1XPOA 3C7AA 1CE8A 3MCUA 5AKHA 1OKKA 4ME6A 3ZW9A 3GR6A 5HXAA 1HG0A 1Y1SA 5DX0A 4KZPA 1WBJB 3R0IA 4IL5A 2VJLA 1GOTA 1P5JA 1IQPA 1EDEA 1SUEA 1PZNA 1G8FA 3DYBA 3LA8A 3OZ7A 3RS2A 3R24A 4D5EA 1A50B 4XR9A 4CQLB 5CNKA 4M9CA 3IRVA 3VVCA 1E2FA 4G5XA 4IJ5A 4EB0A 4KAAA 1WHTB 1IDN1 2HWXA 2EL7A 2O0LA 5KTMA 4G97A 2EBUA 2HM7A 4EPTA 3B48A 5E9AA 1Z25A 2CLKB 3M9LA 4K9QA 3R2JA 4CLRB 1REQB 4HGQA 2HDHA 1P0PA 4Z49A 2YW9A 2EBWA 2HRQA 5G0TA 2D7DA 3OT4A 1UDXA 4DABA 1Y1RA 2QVZX 3NWOA 2QRHA 4RPIA 4JIGA 2PL3A 4YECA 2WFLA 3SQLA 3VDMA 1G5RA 4EA8A 2I8LA 3D3WB 1VIYA 1CJUC 4JXJA 2NXCA 3NWPA 1NVAA 5BNZA 4JDUA 1EG2A 4QD3A 2IH5A 2HK8A 5A02A 1JDUA 5E6RB 2KLBA 3HUDA 2GBPA 3PHCA 4PZPA 4MTCA 3ILSA 3NAMA 4L73A 3LD9A 3L7LA 3ZS8A 5CT8A 1H9BA 2BD0A 2R47A 2OZLA 4IGKA 3OZVA 1GY8A 3EA0A 7AT1A 4A0HA 2NV2B 5JCXA 1OILA 3B2EA 3NHZA 2C96A 3AVTA 2A9FA 4RNDB 2CD7A 4FT2A 3VNRA 4U2FA 4QGSA 2D0IA 4Q4JB 2ZLBA 4HSEA 4HX9A 4AF6A 4B3JA 4PINA 4JU9A 4PPQA 3RVNA 4ETNA 1EWYA 5T6MA 3KQPA 1C1DA 2CHFA 4PV7A 1K92A 2O8FA 2G7MC 1LI4A 2Y9MB 4ER5A 1SA0B 4J7XA 3F90A 1VI2A 3ZDCA 1RTKA 2O52A 4PIPA 4FSHA 3VI3B 4B3TB 2X42A 3KUKA 4WW0A 4M38A 1RP7A 3RWMB 3GCXA 1KDOA 1P0FA 4JV5B 3FHCB 4GEGA 4G8CA 4MYTA 2BISA 1SR8A 7MHTA 1DWOA 3UJCA 2UUCB 1XAJA 1THZA 2HJHA 1F0PA 4HDCA 4K6MA 4PYOA 3ET5A 4PSAA 2NU9B 3U60B 3R5JA 3A6PC 2P2ZA 2CW5A 1PVVA 4BKUA 3EHEA 2PZAA 1XMSA 1BXGA 1YKSA 4Y18A 3TNLA 1MCZA 5A9SA 2FQQA 2YJZA 2XB9A 2QMEA 4GKVA 1SQ0A 2RHHA 2X41A 1GO2A 2BHLA 4UVEA 4YONB 3WZ2A 2VDJA 4W1PA 3A0UA 1G8GA 1KAEA 5AW3A 4WBNB 1ZAKA 3D0RA 3F3KA 2C2XA 3DGFC 2Z4RA 4TTRA 2EX4A 5DEOA 5G4KA 5BSTA 5KB3A 1A97A 3OQMA 1MOSA 2M1XA 1PIWA 3KJQA 3I6YA 5BN4B 1Y82A 4DVJA 3I2KA 3ADBA 1ZNZA 1Z16A 1X9HA 2GRAA 4JWTA 4LJLA 5FOXA 1I3CA 1EEHA 1ULSA 2SKDA 4WOJA 1X86B 1N0HA 1GQOA 1KZYC 2V7XA 3OKFA 4AQYB 4HEA1 2YZMA 3OLVA 2K2WA 3FWNA 3HCFA 3O3OB 5KTYA 3PT9A 1TU0A 5H4HA 4YHHB 1K5HA 1X80A 3KEGA 3SHWA 3HY3A 4Q1BA 1J5PA 3IEKA 1Z2DA 2HLHA 1RWKA 1B8UA 5BWMA 1P9WA 3D7RA 4M1YA 4M22A 1G3QA 4YT5A 4YUVA 4U6QA 2MMGA 2VLIA 2NXWA 2JLQA 3F5SA 4P32A 5T4EA 5C1PA 5C80A 3URMA 3V00A 3X43A 4TZ6A 4Z53A 4JMPA 1E61A 1K08A 2F2TA 4XVCA 3V8QA 1RPNA 1CS0B 1W36C 4EDFA 3I2HA 1V41E 2DKOA 1J2JA 2CCJA 4M1WA 3ZE0B 2G9QA 3QVXA 4UDOA 3U4DA 3S1AB 2CF5A 5AICA 3ZD8A 4DE5A 2ZPAA 3FTEA 4KW7A 1G42A 2I54A 2C5HA 4W5RA 3IAAA 4QU8A 3ROGA 2PD6A 2ZULA 1GQYA 2IHUA 2C59A 5HILA 1T1RA 1HDEA 1FDVA 1RJFA 2B30A 3BK2A 3IBFA 1Z9BA 1JAXA 3T9FA 4C89A 4IQ4A 1J1UA 2RAVA 1P74A 2PSFA 1RP1A 4GDMA 4BMNA 3VNUA 2JGDB 4JQOA 1K0FA 2BLLA 4F5WA 3LUCA 2XZPA 1BKYA 1GPUA 2Q1UA 3KLMX 3A3PA 2H5JA 2XQFA 4HMPA 4O4LB 5DRTA 5G0WA 5IAOA 3GO4A 3TZLA 4HADA 3G0CA 3GCGA 4L5CA 4LECA 1Z0FA 5CGZA 3V55A 4LVNA 4EYGA 4URWR 1G17A 1QIKA 3DMPA 3LLSA 4AYXA 1ECLA 4WKOA 3QU7A 4GI1A 1BX3A 4OLFA 1I2DA 5IKPA 4HXGA 4UHJA 3W6PA 3N2YA 1I3NA 2JLVA 3T61A 2ZRJA 1OE0A 9MHTA 5L4LA 4RJIA 2IOFA 3COSA 1CUCA 1B2RA 1SVUA 2EHJA 4HTFB 2VAVA 3LZ6A 1GCUA 3IESA 2GA9A 3LUBA 4GRIA 3WAKA 2ZAGA 3ZHSA 2VP4A 3FWYA 4TMTA 5SYMA 4HWRA 5BW8A 4EGAA 1NJ2A 3L0SA 3LW8A 3R8FA 1RYEA 2X0KA 3IOBA 4I50B 3HDHA 3FUCA 3DT9A 1E0KA 1OGJA 1UK9A 3W2IA 1T8YA 2BELA 1KXZA 1P29A 2LD4A 3T0IA 3NBFA 2G17A 2YXLA 1A27A 2WVGA 1P6XA 3ONEA 3F2VA 1JR6A 5JI2E 3IIIA 3TW8B 1Y6ZA 1LBIA 1HDRA 4GXQA 4AY3A 4OIFA 4FDLA 5AVWA 1NXSA 1Z0SA 3A06A 3EA4A 2OCPA 3A4NA 2RGUA 2R8XA 4ZI2A 4IH1A 3EXG2 1FXUA 1MX9A 2ONCA 4ZQHA 4F9GA 3WIDA 4CL0A 2GAAA 3KV3O 3VPAA 4E2XA 1PCXA 4MCIA 3WZMA 4X7RA 2RGWA 3G2MA 3AQ4A 3KTFA 3OJCA 4XXHA 3ZGOA 3SMVA 3GGDA 1E79A 2DFVA 4FWBA 3EZNA 1VFPA 3ZCVA 1DC8A 4BQFA 1EZ4A 2DAPA 4J1NA 5L53A 3LYUA 3KOMA 3WRXA 3GRCA 2AFHA 2ZI3A 3QEBZ 2IH4A 1GZ7A 3MTEA 1U5BA 1JKMA 1NZFA 4ND1A 4D43A 4D4IA 4FNAA 3S2EA 5FX2A 2F90A 2ATEA 2LGJA 2VP5A 1PQYA 2O7NA 3AETB 3EGIA 4C0BA 5EJIA 5KNBH 4O2AF 2X8JA 2ZIWB 3AK4A 4B4DA 5JISA 3WMRA 1AF7A 4OAPA 3TOCA 2QUIA 4GPZA 2R7LA 3GP5A 3LOPA 2ZRGA 5KVVA 1TYCA 1GPMA 3T7DA 1H0KA 3DUWA 3VPXA 4X85A 1BXRB 1IZ0A 1PL0A 1UBCA 1YCGA 3A8TA 1L1QA 1JWAB 2FQXA 4TX1A 2VRWA 4XUDA 4FZ5A 5LJLA 2VWQA 5EERA 5LP1A 2NUBA 2IKSA 2IHVA 4Q01A 1P1KA 3GJ3A 3WWYA 3TW6A 2HRCA 3E3LA 5CB6A 2RK4A 5FOWA 4A1OA 2H2GA 1VI5A 3ANXA 4FUTA 1TA4A 4AUKA 4EUEA 2H7XA 1NQTA 3PC8C 3F67A 3RU2A 3LQRA 1O77A 1Q7EA 2OFXA 1AA9A 3IMEA 2ZRKA 3BIWA 3NB0A 3HFSA 1TM4E 2YS7A 3P9KA 3HJHA 3GJ6A 1U0EA 2BF7A 3JX9A 4TMZA 3IALA 2JBWA 5TRTA 4QPZA 1XZLA 2IT1A 1LTKA 3WLPA 1DJMA 1PBTA 1D7AA 3O4RA 4KIWA 1SCUB 4B0OA 1CRLA 1HDOA 3F71A 3KEQA 4G25A 4GAEA 1H22A 4PZEA 4RVGA 3BJZA 5FNVF 5HF8A 1CNFA 4XR4A 3U31A 1O9GA 2Y1XA 3BFKA 3PFGA 3GJTA 4P7FA 4MW1A 2OLEA 2QRLA 4UDXX 5A0FA 1N5JA 1TK9A 1E8DA 4KO4S 2FY8A 3FBWA 4HKTA 2ZRBA 3D6AA 1WW2A 3LL4A 1OROA 1BE0A 3NAGA 1L8LA 3PI6A 4FYKA 1M1YE 2AIRA 2WLSA 3DD1A 4B44A 3FW1A 2HFKA 2IYRA 2O2HA 3EDOA 1T3LA 1ESNA 3NBAA 4YAOA 3OUZA 2O8BA 5ALSA 3WNCA 3EG9B 4IUBS 1IK4A 2R1VA 6YASA 1XUOA 4AZ3B 2G4VA 4HX2A 2ZJ6A 1XLTC 3U1BA 4C0WA 4DM3A 5K6RA 3M6UA 4IAOA 5GJCA 5IX8A 5D6OA 3ND8A 2HH9A 1UADA 1Z0DA 2AOWA 2D54A 3LWBA 4BVAA 4BNFA 3QPVA 3WB0A 2V6FA 4DLUA 4ZEMA 4JGIA 3PE4A 3P32A 4M8LA 5LR6A 1V1RA 5HJ7A 3OCZA 2HXGA 3L0IB 4YMTA 1RVV1 2OCAA 5KU7A 1WPQA 5DGXA 1XEFA 3MN1A 5FQOA 3QK7A 3P96A 3U26A 2PGXA 1EX7A 1NI4B 4K9NA 1WCYA 4NCKA 4WJKB 1G20A 2IY7A 3FUWA 3GLHE 1EMDA 3NHJA 3IAFA 4MIKA 4XWTA 1TM5E 1VPLA 2B1RA 1DBVO 4WY2A 3VHXB 3PXDA 4M1MA 3UK0A 3AR9A 1R3DA 4GP6A 1GL6A 2PX2A 4P36A 1BYUA 4FZRA 5AR1A 4HQRA 1VBNA 3AMVA 2ICAA 1NPYA 4KPYA 2X0FA 3IBTA 4MYUA 4ZK6A 1KP3A 5LUAA 1AK2A 1OPRA 2IPOA 1O94A 3TZHA 4EO7A 4B84A 3K6SA 2X9NA 1SWWA 4R1TA 2J9ZB 1SXJB 4XX1A 3H19A 2J3HA 2BMJA 2ZIEA 3R40A 4KXFB 1W96A 4HAIA 1HYHA 4Y7DA 4BO2A 5DW3A 4PWZA 2H9YA 4UE3S 1Y0BA 5DI3A 3WWPA 1MBZA 3F1KA 3QPBA 1B6RA 4ZRMA 5T5QA 3X1ZA 3TQQA 2I7VA 4FWIB 3BFPA 2OXTA 4PYQA 5JQGB 1X1BA 2XTJA 4EGQA 2V8BA 3R76A 1F38A 2OFOA 3NANA 4QASA 3KBBA 1NBME 1OLSA 1GPNA 2Q9CA 3KQQA 4LDRA 4UW9A 4MB0A 4R1NA 3T7JA 5JNRA 1NMZA 1Z29A 3STUA 2ZTVA 1PLJA 1TCUA 1E9RA 4ZOAA 3ZWOA 5GIPE 2V7QA 4DCGA 3NT2A 2BYTA 2R7MA 2FPUA 1YDHA 4YP7A 1M3SA 1Z63A 2Q8NA 4LPSA 1YI8A 3E5MA 1I10A 2GEKA 2PZEA 3B89A 3GFPA 4LJ5A 4DXHA 5ABPA 1N5LA 1W9HA 4ZN6A 3LHKA 3P2KA 1W7AA 2CD9A 3AIMA 2B0CA 4ALNA 2O8EB 3UJPA 5ADHA 1EXDA 1I0IA 2HIHA 5AJHA 1GN8A 5TEWA 4BWFB 1EWTA 2XBMA 2G72A 4G4IA 4KPFC 3OHPA 3BWDD 3NYIA 2FPOA 5KWVA 3E22B 5C34B 2ZIFA 1Y8RA 3LT2A 4BE9A 1UR5A 1QOPB 4B3CA 3O5AA 5FTJA 4UQLA 1PNOA 3KCQA 3DT6A 2DERA 2QD3A 4PX5A 4YROA 3ZCTA 2XUZA 1N75A 3PJDA 1MB3A 1G3MA 4EI8A 4QUEA 4WJLA 4LHZA 3SZLA 4WNAA 4F6CA 5KVQA 4TQ9A 1FYXA 2XHEA 3BULA 5AM0A 4DIMA 3GPCA 4WL0A 1C9EA 3OCJA 5CVJA 2ADMA 2EEPA 2ZUVA 1EFCA 2XRFA 1GRVA 1MJFA 5LBIA 1HRDA 4QGFA 4D8WA 3C3WA 2H4HA 3Q40A 1IC6A 5I4BA 4DLSA 1NIJA 1RM0A 3HKEB 3PYMA 2BGNA 1R4MA 2XQGA 2CB0A 4NENA 4GWLA 1S9HA 4RY2A 2NP6A 1R8QA 3IO5A 3S8YA 2P9BA 3O4JA 2YOFA 4HQKA 3MINB 3EEIA 1O89A 1SCBA 2B21A 2ZRNA 4YWHA 5I48A 3RTCA 2CVQA 4RFSA 1BXZA 1UINA 2JJ2D 1V5FA 4M83A 4XEUA 3SSAA 1YQXA 2V5AA 3BWBA 2FN9A 4ZVNA 4HI0E 2XNDA 3R20A 2DH5A 1GYQA 4N0QA 4KAFA 4JQZA 5EESA 3M6LA 3GUVA 2QVYX 3LGXA 3OAAD 3OQNA 5TT1A 1QVVA 1W75A 3GCDA 1C0IA 5EJ6A 1I1QB 5GONA 2ZUCA 4KB5A 3DR5A 1EGHA 1X7ZA 1XZKA 4MWSA 1G6Q1 3RS3A 4EHDA 1C7FA 4UU7A 1RKBA 1UBGA 2O2XA 3EGDA 1M1NB 1S2IA 5CJPA 5B6IA 2YIJA 4MUNA 1HOTA 1DXQA 4TMKA 2FVYA 4CKEB 2OORC 1UMDA 2AOTB 4CLOB 2AX4A 1CP3A 5KYKA 4DV5B 5JAUA 2OHGA 4MIOA 4Z9AA 5EHGA 2JFGA 5K0BA 4A8JA 3ZV4A 2H0RA 1MEJA 3IEPA 4KXQA 2IYTA 4TM7A 1MF7A 2GM5A 3I5XA 3E9RA 3ZBPA 5ALKA 1H2HA 1TUIA 2H00A 4WZBA 5AIAA 3DT8A 4D8UA 2F43B 4V0OA 5D01A 2WJPA 5J3JA 3QE0A 3GEMA 1QHGA 2LUOA 1IOWA 1LS6A 2VYVA 3GQBA 1EK1A 1N1GA 3EXIB 4HUQA 3SJZA 4QL3A 2TMKA 2ZRCA 2VCYA 3DLCA 2AR0A 3DKRA 4NHEA 3DEFA 1C4WA 3NC4A 2Z3ZA 4HH4A 3AUFA 4CMEC 2VT2A 3A05A 1LK7A 3LBYA 2XBUA 4A0QA 2G0TA 1AMNA 3KHSA 2HT6A 1YBVA 1BS1A 4R6WA 3X1YA 1CG6A 4NNPA 2PO5A 4FPXA 1I1OA 2JI8A 1WV0A 3VZCA 3VO2A 4L6CA 1R16A 3DTVD 4WQMA 3MGKA 4Q7LA 5CDFE 3PPYA 1OWPA 2DUMA 2ZYIA 3DZIA 4EELA 1E6KA 1SOUA 1QRUA 3T3DA 3ZXYA 4LZLA 1RTTA 1JHXA 4IZ6A 1EZZA 1GRCA 4ID9A 4D3DA 5JDIA 4EITA 3ILXA 5IAAA 2G4CA 2J87A 5B6PA 3SLKA 2A0YA 3C5EA 3G5MA 3KHTA 2HA7A 3T7KA 1PR0A 4NR0A 4FW8A 4QUJA 3U16A 4LEIA 1L7DA 2EYUA 4B3IA 1ZUIA 3EXHC 5IF3A 1IHXA 4Y2TA 4H7PA 1U31A 4OIMA 5F4BA 5HF5A 4FYVA 1MG0A 5F64A 1M8KA 2OP0A 1T1IA 2A86A 4G5RA 2F48A 2LR0A 1LD3A 3KZOA 5HBRA 2H2HA 1OH6A 2DTDA 4ER0A 2X5OA 3CC8A 3MAGA 2OD2A 3ND5A 4KLCA 5FHRA 1ZH6A 1G7CA 4E13A 3BH6A 2H63A 4LRXA 4II7A 2RAUA 5BN5A 4MKRA 2QZ9A 3I0ZA 2C4MA 3VR2A 5K01A 4CG3A 2EDCA 3MYRA 1CJKC 1CHNA 3WLAA 2REBA 2QR2A 4CV3A 4QTZA 1QHHB 5EVCA 3NHSA 4QDZA 2VJOA 1W2GA 2IZ6A 2Z2ZA 1ODLA 4PYIA 3VR6D 1VPVA 3IYLW 4QQFA 1IWPB 4HH3C 4B43A 4NNJA 1GA1A 2AG0A 2QSUA 3G9QA 2V6JA 3QLEA 5BWBA 4OYLA 1MJHA 5IAKA 3A70A 3ZI4A 2Q3LA 3FKJA 1OYOA 4WPGA 5CIWA 2XGMA 1ZI9A 2P4HX 2ZXEA 1NW5A 3I9KA 3TQFA 1WUKS 2I6UA 4CIVA 5AUPB 4JITA 1YMVA 2ZCVA 3SHFA 3JQRA 1XELA 5FR1A 1JHYA 2JI7A 1OA1A 2R6R1 2V7BA 4AFNA 3HKDA 3PIIA 1C9DB 3COPA 1WLYA 3IPYA 4XWOA 2FDCA 2FQ1A 3I4LA 1KGDA 1TQHA 2PYIA 2KYRA 1ZJYA 2B61A 4DQLA 4TTSA 4LXGA 2NQTA 4G1FA 3VTAA 4OHBA 4DB2A 1RHMA 5GM2A 2RG1A 4RDCA 4P4GA 3OOEA 1UAYA 3RVRA 2Z43A 3GVXA 3SOPA 1NR5A 3KWFA 4QBFA 4RBNA 5EHQA 3VO9A 3WICA 4BMZA 1ILEA 4GPAA 2ZAIA 4QBGB 2CLSA 1DWPA 2Y1WA 2BKXA 3HPRA 3RU7A 2KPOA 2P2LA 4RSGA 3INYA 1GTJ1 4NOLA 3JYOA 3RRFA 1VSTA 3Q98A 1B0UA 2QQGA 3TQCA 3TSZA 2ACKA 4L50A 2D7CA 4DCOA 3OSUA 3TAUA 1N3YA 3M3PA 4IEEA 3RRBA 5A1TA 5JASA 4B81A 3KKZA 2F8TA 3ZE8A 3PNSA 2ODAA 5G3YA 5B1DA 3TDNA 1WDMA 3ZQ6A 2JHGA 2VQSA 4H3HB 3ZKAA 5KNDA 4NF2A 2W0MA 3F8TA 2VHZA 4H7KA 3NO4A 2AE1A 1K75A 2OV1A 1U2QA 3EN0A 4QG3A 1JEYA 1BKSB 1TMGE 3K0KA 3WGTA 3UQZA 1HTTA 4LJSA 1QS0A 4NBWA 4NECA 4QYWA 4TL6A 4GYKA 5DTEA 1W0CA 4URHA 4ZAYA 4DLTA 4ER6A 1T1EA 2QYSA 3HP4A 4O1MA 4P3KA 1VCMA 2FR8C 2IYFA 1LVUA 2QX8A 2GN8A 3EPRA 4IIJF 4MMZB 4KE9A 5EYPB 5ITVA 2X7JA 4ZMSA 3QSGA 1I2MA 3ESQA 4GECA 3UKJA 3C8DA 4DREA 5LNK6 4IIHA 1V4NA 4C20A 2EL9A 1E1LA 4AB1A 3NDBB 4PICA 5F2KA 3WLTA 1CULC 1WD5A 2P67A 1JDTA 1E4OA 2FOLA 4JCOA 1T15A 4AI6A 3L8CA 4EBFA 1F6BA 3TNYA 1S3SA 1F20A 2IK8A 2WBLC 2ZSJA 5KWIA 5C37A 3H5LA 4FDUA 3UTCA 4B35A 2G1UA 4Y2JA 3TSCA 1JX6A 1WNFA 2YBEA 3PA8A 1HEIA 2Q46A 4EZIA 1XAIA 3TOSA 2GNAA 3QKWA 3U7FB 3QVTA 2VXOA 1PJRA 1DHRA 1E1QD 1ZVQA 1O1YA 2C3UA 2PKQP 4IQ0A 4ENRA 2ZQ5A 4G23A 4GI7A 4GUAA 3FUXA 4LOHA 1H9CA 1HRKA 4HYQA 3KYCA 3DPSA 1K5PA 1A8HA 3DZBA 3W3AH 3AM4A 4C7KA 2HHCA 3AFOA 4P3XA 1SU4A 3O94A 5CCXA 2YRXA 4UMVA 421PA 3O75A 1JZTA 5CIQA 4P7JA 3NHKA 9LDBA 4KNYA 3MBIA 1DNPA 3NP9A 5AOBA 1U94A 3ULKA 2RGBA 4PXAA 2PGDA 3K0AA 1YB4A 2RCYA 1NVDA 3K9NA 3PHHA 4Y6OA 2QN1A 3QW2A 4B7UA 5JNLA 5EI5A 4E7PA 2HZBA 4ZO4A 2JFZA 4RK5A 4H9GA 3H5OA 4QNRA 4OHKA 3F5DA 4R81A 2C7GA 3OX4A 1RHUA 4R0VA 4ZFNA 5IJ0A 3U56A 2WKRA 3Q9SA 2EFEB 4LYHA 5BR7A 2KM1A 3QMPA 5DN6D 3IULA 3UJ6A 1PKEA 3W6UA 1TT5A 2XSZA 4H35A 4BAZA 1NULA 5AW9A 4A36A 4R1PA 3LHDA 4DQVA 5IBRA 3ZEIA 4K87A 4MW7A 3ZJYA 4YDSA 3I04M 1O96B 3QV1A 3LBIA 2XMDA 2I4LA 5JG7A 4CEIB 1JWLA 4AO8A 5A03A 3P20A 5BSKA 1QQTA 5JADA 3HJAA 1LBEA 2QRPA 4BNLA 3KPJA 1PT9A 5TEVA 4EW1A 1IWBB 2FSFA 3GGSA 3VOBA 1UFQA 1JHDA 1PFKA 1XXHB 3EMVA 3BH7A 4QYTA 3WHIA 2ADFA 3MWJA 3LV8A 2Z9CA 3O8QA 2HDNB 5SYNA 3L1UA 1TYAE 4HWPA 1LH0A 3O26A 3KQVA 4I55A 1XQ9A 4UC0A 5HDBB 1OB5A 2KBFA 4RTQA 1G21A 4DDWA 1IY9A 4HAXA 1E7WA 1TEHA 3DAYA 5EUCA 4AU1A 2QG6A 3Q2IA 4S12A 3ZLJA 4RF4A 1I51A 2ZIVB 1U1IA 3AR3A 3HJUA 1FP2A 3AM1A 4IIXA 3K72B 3VPFA 1M54A 3A31A 5A4JA 3UJBA 3F3YA 4WZZA 1SHZA 1FEZA 4HDOB 1G4UR 1GL7A 1YQDA 3JQ6A 3DZJA 3GEBA 1E4VA 1AKQA 4FFDA 1TOAA 3PQEA 2B8EA 4N6OA 5JDCA 4DXDA 1NVUQ 5IM4A 1U4OA 5K3FA 1P3DA 4GVPA 1UDWA 1WSAA 2IUUA 4GX0A 3V8MA 4MUAA 3GNQA 4IFTA 3IR7A 3ZE2B 5TNXA 4YPFA 4H4DA 1ATZA 1SQSA 2NZVG 1M34B 1FQWA 3O8OA 4Q82A 4DMHA 3G17A 1WEHA 3E18A 3C0KA 3NM4A 4FI3C 4NARA 4ND3A 4RLSA 3RREA 4IHKA 4JASB 1L7BA 1MIOA 2YXNA 3I2FA 1ZUNB 1U28C 1HE2A 4DLLA 1YE8A 1F2TA 1JF8A 5I9MA 2J9FA 4F8EA 2VDKB 5D7BA 2UYGA 1C9JA 2ZATA 2FEOA 3JD4A 4LMAA 4LOJA 1JR3A 4KK3A 4UCWA 3V8EA 4OU5A 1E9VA 1O95C 5IK2A 4WCDA 5JYCA 1KZ9A 1TYZA 1XTBA 2AX3A 1XQVA 3NVMB 2IXDA 4LMBA 3F2IA 1YWGO 4QPJC 2DPHA 1MG5A 1YTLA 3KZVA 3PD7A 4TUYA 2OBBA 3H1PA 1PJSA 1KARA 2FR1A 3R5XA 3FHTA 3R74A 3NTXA 2P69A 1G66A 1IATA 3KUDA 1ECGA 4UBJA 3G9XA 3WTCA 3EOBI 2H1HA 1SVOA 1NW9B 4KOAA 5ALMA 2BFMA 1XT6A 4KGXA 3MXTA 1R8SA 4RF3A 3R9KA 1OZFA 3EGXB 3OMLA 4EB8A 1ZY2A 1C2TA 5DXJA 2G82A 3OD1A 3ZJTA 3UV6A 3EH1A 1YVPA 3BD7A 2JARA 2P0YA 5THQA 4ZZ2A 1ZK2A 4S3MA 4QE3A 2E2WA 1LEHA 5FWDA 5CFOA 4ZCTA 5FBKA 3PLRA 1QHEA 4E5DA 3MMPA 2V3WA 3WYEA 4RZXA 4ZVMA 1N33B 1XD2B 3MCVA 3AWDA 3VR5H 2V98A 3W90A 1ZH8A 3BOSA 1RZRD 1XDBA 2BHNA 2Q5IA 4QBTA 1W4BA 4W82A 4YMSA 5DBGA 5D7NA 3QX3A 1P8JA 1RLOA 2J0VA 2EWVA 2ILVA 1T1GA 2YDYA 3TXYA 4TLBA 1T5TA 2WIFA 3VNAA 3VNQA 1Z17A 4UTNA 3BE6A 3KKOA 2OGUA 3PHLA 1B16A 4ZVUA 2XE8A 3AJEA 4DAEA 2XUPA 1JA0A 3JATB 4WACA 3D3EA 3PFFA 2PMKA 1PD1A 4FS8A 5HM6A 1MTZA 5SZIA 2WJ3A 3IEXA 4RK6A 3C5VA 1EFHA 4F38A 2HK6A 4RCYA 2A67A 4WBNF 1IBMB 1H8EA 2VC2B 4NE9A 4Q39A 1DC3A 3JZDA 3QIVA 3ZEAA 4YDQA 1IJKA 4U7TB 4N7MA 4B79A 2H06A 3HXMA 1WPGA 4Y7CA 5CNIA 2GESA 2CLDX 1X8XA 3MQ4A 3IB6A 1ZIDA 1Z6YA 2QPAA 2C3YA 4N3NA 1IY0A 1AGRA 1X7HA 3KE8A 4FIDA 1KY2A 1YT5A 3P0JA