4GOJA

The crystal structure of full length arl3gppnhp in complex with unc119a
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
175
structure length
175
Chain Sequence
LLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords ADP-ribosylation factor-like protein 3
publication title Structural basis for Arl3-specific release of myristoylated ciliary cargo from UNC119.
pubmed doi rcsb
source organism Mus musculus
total genus 59
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4gojA00
1DOAA 1ESNA 2DFNA 2VYFA 3I92A 4IEIA 3FB4A 1E4VA 1YKSA 2WPDD 3CZQA 4QKQA 4TT3A 3B85A 3LX5A 2DWPA 2AK3A 1P75A 4LV5B 2CLDX 5TY0A 2E87A 2VHUA 3BWDD 2D74A 2VRWA 2ZRAA 1SVMA 4IHQA 3PQCA 1S9HA 3CNLA 2QROA 5DI3B 2CL6X 2ORIA 4G5GA 4I99A 4QM6A 4YXWA 2ZJ8A 5L3QB 2VHJA 2XNDA 1KK2A 2XGJA 2ZEJA 1OB2A 4PSKA 3P26A 4TL6A 2GXQA 4G1UC 4JT2A 1G8YA 2QAJA 1ZM4A 2N1BA 3B1ZA 4C0QC 3C5HA 4AD8A 3R8FA 1FOEB 3LFUA 5LBIA 2W2TA 1UAAA 2VA8A 2PT7A 2ZUDA 2J3EA 3UMRA 2G1JA 3Q5DA 3THWA 1Q1QA 3L82B 4PPGA 3TKLA 4EUNA 3Q5EA 3J81k 5J4KA 1T3HA 3FMPB 3W6NA 5G53C 2QGZA 3MUFA 4DLSA 3LX8A 3MJRA 4EAQA 3DZDA 4PAMA 4GMDA 3NH6A 3RC3A 2ZU0C 2P65A 3N5CA 1RPZA 4MKHA 2A5JA 3LBNA 5JRJA 2OBNA 4OQXA 3U7FB 1N25A 3GJ8A 2ZUBA 4LI0A 3ZZ0A 1D2EA 2OM2A 5DH9A 1JQLB 3R9XA 1XEWX 4PQRA 4ILEA 2IT1A 2IXFA 1H8ED 1VDZA 4HLUA 5DSZA 4YQFA 3CF0A 4DSUA 1DEKA 1P2TA 2XTZA 2ZPTX 1MV5A 1DG3A 1E9DA 5TARA 3RS0A 3NHBA 2PL3A 3PEUA 4LCBA 3MWLA 3MLEA 4TLEA 3HYRA 1WMSA 1U8ZA 4GPTA 2HT1A 2C9YA 1IN4A 5SZJA 2OLJA 1RZ3A 1NRJB 2ZROA 3OHMA 3LXXA 2A5GA 5SZHB 1A1VA 1RYFA 1HE8B 1Q3TA 3KQHA 2WSSA 2BBTA 1OIXA 2RCNA 1P5ZB 2QAGB 3MMPA 4FMDB 4TN1A 5A4JA 2GA8A 3I5XA 1SULA 4PAOA 2IYVA 3GJXC 4M9QA 4Q4LA 3GMTA 4W9MC 3CX8A 3T1OA 3TMKA 3GLFE 1OYWA 1II0A 5GVSA 1IQPA 3ICQB 4RD2A 1RE0A 1GL7A 2ZAMA 2JIZA 1S4QA 1NJFA 1HQCA 2WICA 4IDHA 4PSVA 4EJSA 1A7JA 1G8FA 2WBLC 1P72A 1G7TA 2OAQ1 1KK3A 2UZ3A 3PIRA 5EXPA 2H57A 4CVNA 2BM0A 1RRFA 2J87A 2RAPA 2UKDA 2HF9A 4TMZA 2ZVPX 3I5YA 2IYWA 1JXOA 1IXSB 2AWNA 2WIBA 3B9QA 1XEWY 1AS3A 5JS8A 4QGAA 4Q00A 1OIWA 1GG2A 4HAVA 4RFSA 3WNDA 1KNXA 4XWKA 4Q5IA 3TSOA 3ZD6A 4Q4AA 1CEEA 4JMPA 4LBWA 5LPNA 3DOFA 1KK1A 4UJ3A 1M6NA 3CX6A 2VLIA 3RSLA 4OYHA 2DR3A 3GLHB 4LRWA 1Q3HA 3ZYCA 1KI6A 4V02A 3WNCA 3ETLA 3FMFA 3LBIA 3CWZA 1JPNA 3KX2A 5FBQB 1GM5A 3EPLA 2WWFA 5P21A 2D3WA 3TK1A 2GAAA 2FF7A 1G8HA 1DARA 3CPEA 4NYJQ 1PUIA 4AI6A 3N70A 2NTYC 2GJAA 3C15C 2B8WA 4QC2A 1DELA 4Q66C 2AKAB 1N6NA 5DI3A 2IHBA 1GIAA 4TYQA 2ZRCA 3T35A 4P31A 5L3QA 3NVAA 4AYTA 1GTVA 5CJPA 4XWOA 1KO8A 1CJTC 2WJVA 2YOFA 4PC7A 1E9BA 1G291 2BBOA 3QQ5A 4BFXA 3K1JA 5KDOA 2P5SA 2J0QA 3SYNA 4BFVA 2ECKA 3NBZC 2QGNA 4V0LA 2ZI4A 3U5ZB 1WDTA 3WRYC 1W46A 1Z5ZA 3F8TA 5EP2A 4BFTA 4QHYA 4BRWA 1ZMXA 1ZU4A 5FTJA 5FTNA 1OIVA 3BJIC 3WXMA 1GOTA 1AQUA 3O8CA 1YZQA 3DVLA 4F4IA 1FFHA 3L8ZA 4C0BA 4BZXA 1NSFA 4Q1AA 4D4KA 3IEVA 2F43B 4M9ZA 1XPOA 4WIAA 3AKYA 2O5VA 4JL6A 1PV4A 2W0SA 1KSFX 1Z63A 4DEXA 1E2DA 2F1HA 4WZAE 3TE6A 5JEEA 4U02A 3HPQA 4IVQA 1HH4A 3BE4A 2RGBA 3MSXA 3AEZA 5AUPB 5KSZA 2GETA 3NIBA 2C96A 1ZM3A 1EK0A 3C14C 1Z83A 3E2IA 4TLAA 2EFHB 3ZDQA 2P67A 5FOXA 1ZINA 1N5IA 4A36A 5JZVA 5IRCD 4LHVA 4JLJA 2QAGA 3PEVA 4US1R 3MD0A 4PZZA 4Q48A 1IY2A 4RCZA 3FE2A 3RS5A 5J4LA 5L3SB 4Q02A 5D3QA 1DAHA 2RH5A 2IYLD 2FPLA 1OLOA 1L4YA 3TLXA 1YQTA 1OJLA 2KJQA 5EE3A 4DC9A 4MYHA 4EFLA 2C77A 4V0MA 4DIDA 5CB8A 5JCZA 4KSCA 4CEJB 4X8LA 2JDID 1Z47A 3NXSA 3X1XA 2QP3A 2DWOA 3B6EA 2OG2A 3AB3A 4NL4H 4DLRA 1D8TA 4OHXA 4R71A 4ZI2A 1EGAA 4DT1A 1JQJC 1X8KA 4K46A 4KV9A 1G16A 4URXR 2JCSA 2V55B 4Q7JB 2VPPA 2ZJOA 1S0UA 4FI3C 3UKDA 3A1TA 1JEEA 1R5NA 4OI4A 5DHFA 3GFPA 1OFTA 2GK7A 2IXGA 2VSFA 2YYZA 1LFDB 1CF4A 4QNRA 1ZM2A 4OHWA 4ARZB 4PX9A 1NVVR 4QGFA 1SGWA 2KWIA 3BK7A 3TW4A 1DTSA 2WMNB 5B64A 3GLFB 5TV2A 1A5TA 1GNPA 2IL1A 5CLLA 3THOA 4LHXA 1MRNA 1E1RD 3JZMA 2OESA 4HEJA 4JVMA 5JLJA 3CO5A 2X77A 2WV9A 2IWHA 5EZ5A 5AK0A 1ZIOA 4MRRA 4LHYA 5AJWA 1EFCA 3AVQA 1TMKA 4Q47A 2OLKA 2QMEA 1Y3AA 3TUIC 5JMTA 4MYTA 5E4FA 5FPSA 4E5UA 2N42A 3I8XA 1KSGA 4HAXA 3DMDA 2IYQA 2BWJA 1SVLA 2OE2A 3WMGA 2R6DA 3QKSB 1TQ2A 4TMVA 3WYAA 3E1SA 1H8EA 3EZ2A 4PXAA 4HLQB 2VSXA 2CE7A 1MABB 4FIDA 4L4UA 4BGDA 4PC6A 3K0AA 4PPNA 5KSYA 1YR6A 4CEIB 1A2BA 3W3ZB 2R2AA 3B13B 4YMSA 5K8LA 5FPYA 4M1MA 3H1TA 1X1SA 3AP2A 3THXB 3KJIA 1PUJA 1S1CA 1OB5A 5DYGA 1TEXA 4QBFA 5F9FA 3G0HA 2FN4A 3Q85A 3K70D 2W2VA 3K70C 2KBEA 2QMUA 2QZ4A 4U5XA 4XH9B 1RC8A 3PJRA 2GBLC 2DFLA 3TH5A 4XOIA 3T06B 2KE5A 1OH8A 2OCPA 4I1OA 3PFIA 1G41A 3EPKA 1OXXK 1VYTA 4DSOA 1EWRA 4XTRA 3W6PA 1TF2A 1QVAA 4JVSB 4MRVA 3BIFA 2CLCX 3NC0C 3WP0A 2JJ1D 3FPAA 1AKEA 1VHTA 3CR7A 1ZUNB 4JIMA 2VP2A 3U3JA 3EPHA 4LYAA 4TL8A 1E98A 3O8BA 1FTNA 2OBMA 4HB0A 4B2LA 5KSPA 5JRZA 4G5OA 5FTMA 1G5PA 3WHLA 2CDNA 1OKKD 3VMFA 4ACAA 1XMJA 3TVTA 3KKOA 4DJTA 1W36C 1WE2A 2HF8A 2W58A 3KKPA 3EPJA 1RVDA 1XX6A 3Q3JB 3ADKA 1DG1G 4TLDA 4WBSA 4WA7A 1HE1C 2JLSA 3I32A 4KSBA 4B34A 4RKFA 3BRWD 2CHVA 3U7GA 3M6AA 2B6HA 1G7SA 1XCGB 3KJGA 1OT3A 5CYOA 3KFVA 5HE8A 1RFLA 3NHAA 1S3SA 2HCJB 5EE1A 1Z6AA 1Q1ZA 3CUEF 3E70C 4CEJA 4QGGA 3GQBA 1X1RA 3SJBA 1GWNA 1NVWQ 2DFTA 4HATA 1XD2A 3OIVA 4PO1A 1XXHE 1S8FA 2VP4A 1QHHB 5G41A 4URVR 4B71A 5GJBA 1KI3A 3GLGA 4KHZA 2ZVQX 4LPKA 5BN5A 1NN5A 4A0FA 5K8TA 3FOZA 1NMXA 3A1WA 4G5RA 4DXAA 5CK4A 3LNCA 3OAAD 4FW9A 5G3ZA 2BCJQ 4Q4HA 4Q7LA 5A0FA 1R2QA 4GSYA 5DN6A 5FOWA 3K8YA 3IPXA 4PZYA 1VCIA 3B1XA 4C0SA 1YZNA 2JLQA 4LBVA 2OXCA 3HDTA 3W5IA 2O8EB 4ZIRB 3U7HB 3RABA 2O8BB 3QIAA 4PO9A 4P4SA 1SKQA 2QTHA 3QKRB 1KAOA 5J4VA 3K70B 3SZRA 2KSQA 1ZAKA 2REOA 1CRPA 1W47A 2D62A 2OV2A 5FUXA 3OEEA 1X8LA 2F1IA 4JYCA 4FWIB 4BFUA 2RB4A 3KL4A 4JLDA 4WAUA 3D7MA 1SVKA 3P20A 3TRFA 2H5EA 3BBPA 4HAWA 2FG5A 4OK6A 1G6HA 2GF9A 2GZDA 4EFNA 3TQFA 3QKSA 2EFDB 5D3MA 5EXSA 1HT1E 1ZM9A 5AJZA 1MABA 4B48A 2P3SA 1E2LA 2R8RA 4JLMA 1G3UA 3OEHA 1G21E 3EA5A 4CEIA 3LWNA 2R65A 3ASZA 3B7GA 5FL7D 4WOPA 4CF7A 3EWSA 5AR1A 2YC2C 1CJUC 3NBFA 4F92B 1E2FA 1UEJA 1MT0A 1Q57A 4TL9A 2QI9C 5HTKA 1EWQA 2QPTA 2W6JA 2FFQA 4FMDF 3LVRE 4TTRA 1II9A 4MQBA 3N2EA 4B2IA 1GNRA 1JPJA 1KZ7B 4TMKA 1TU3A 1M8PA 1QG2A 3AQ4A 4XIGS 2FV8A 5FFMA 5EP1A 4L9SA 2B8TA 1QVRA 4HDOB 2ZR0A 4PPQA 4RSGA 1TNDA 2AD1A 1NG9A 2GDJA 4B3GA 4O0MA 5L3VA 4NCHA 3GJ6A 1XEXB 3QXCA 4Q1FA 3GEHA 4KFSA 1XP8A 3UG6A 4M1OA 4MH0R 1E2JA 2D06A 4AIIA 3F0TA 2ZR7A 1KGDA 1CKEA 4DBLC 1WRBA 4AY2A 1W0JD 4Q21A 2AN9A 3U61B 3WRXC 2YOGA 3QY0A 4CZ2A 2ODNA 4PHHA 3AKCA 3JVUA 4EQ6B 2GJSA 5FBRB 2ORVA 1IJEA 4NPHA 1JR6A 4MKIA 2I1QA 3VHLB 1XCPA 3REGA 5EZ6B 4G01B 4JT4A 1PJRA 1XPRA 4RD4A 3DOEA 2GAOA 4MGYR 1LS1A 3DL0A 4OQNA 4TQAA 2HV8A 3I72A 1E1RA 3QF4B 2JIZD 4EJSC 3SJAA 2BIFA 4JLAA 1N3BA 2BBSA 4OBEA 3LV8A 1W2HA 4Y0AA 4RJLA 2QSZA 3IHLA 4JBXA 2EU8A 5DI9A 5IK2A 4B74A 4DLYA 3FHTA 1GL9B 2R6CA 1QHHA 3BFVA 4TL7A 4IFEA 1X86B 2W2XA 3U7EB 5DNYB 4RD6A 3Q9LA 2GZHA 4MUBA 2AFIE 4PHTA 5C4GB 4IFBA 1YR9A 4GOXA 1XF9A 1UBGA 4PSAA 3PG5A 4QJ4A 3QBTA 2R9VA 4OHVA 2ZANA 2FX3A 5F98A 1J8MF 1F48A 5DISB 3ZQJA 2D4HA 2JLVA 2O8EA 3ZLJA 4KITB 1T6NA 4ZIRA 4HDQB 1E4YA 4ZPXA 4D2IA 2WWYA 2O8BA 2KB0A 2CBZA 3ZVLA 4NMMA 4RCYA 1XXHB 3K0FA 4A6XA 4BASA 1ZP6A 821PA 2IWRA 3K09A 4UJ5A 1SVOA 4Z1MA 4HUQB 2HDNB 1BKDR 4RZUA 3EXAA 4WZBE 5JS7A 1TQ4A 4P32A 1VIAA 3OIYA 3B1YA 4EKDA 1OH6A 2JJ1A 2Q3FA 2UZIR 1Q21A 1YJ5A 4M4SA 2H7VA 4IDOA 3VQTA 4AC9A 4BLRA 4GP6A 4D26A 4TLCA 4M1WA 2HYDA 3EWAA 2IYSA 1CR2A 1ZM7A 2WWIA 2J45A 1IN5A 1DS6A 1OKKA 2OUKA 4JKIA 2IYTA 2QPAA 1RJ9B 1XTSA 2R44A 2R6GA 3A37A 1XNJA 1KMHA 2L0XA 2VH5R 3EW9A 3L0IB 2GCOA 1G8GA 4LK2A 2IS6A 1W4CA 2JAQA 2PT5A 4GOJA 3T15A 1XCMA 2QY9A 5FOSA 4JJZA 4ZI3A 2A78A 2H1LA 1KKLA 2QUZA 1R5BA 3Q7QA 4GZLA 4FCTA 2V54A 3CR8A 4OHYA 4JYBA 1OH5A 1FMJA 3QPVA 2NMVA 1KSJA 1QHNA 4U00A 2G1KA 2QM7A 4ZCLA 1ZNXA 2C9CA 2DBYA 4Z54A 4NYJR 1XEXA 1YR7A 2DY1A 4HAZA 1XJQA 4WXRA 1ZC4A 4BZQA 2WJGA 4AYXA 1G18A 2QSYA 1W2GA 4QG7A 1ZNZA 3IGFA 4B6EA 1KZGB 3AM1A 1T3SA 4V0NA 5B57C 1NSTA 5JECA 3OAAA 2YHSA 4LYFA 4FD2A 4EQ6A 1F3OA 4P33A 1Z0FA 2QAGC 3IIMA 4O25A 1GKUB 3AF4A 1I4DD 3THYA 2YWEA 3WMEA 1ZIPA 4XWAA 1V43A 2C95A 1AQYA 3QF4A 1KI6B 1QZXA 4KCGA 5TXGA 4L9WA 2AL7A 1O3YA 1G17A 1AM4D 2C98A 3UWKA 3E5HA 2ERXA 3HU2A 3BD9A 2GILA 2BEJA 1RIFA 1W4BA 5EE9A 3PR1A 1RYHA 2ZE5A 3FVQA 2VEDA 2ANBA 3X1ZA 3ZZTA 4QHTA 4C0KA 4TTQA 1VCMA 3BB4A 2QA5A 5FOUA 1UF9A 1AGRA 2ZUCA 4FCWA 2IEYA 3X1DA 1L7VC 3QNUA 3PEYA 2AK2A 4M1TA 1G5TA 3G82C 4C9BA 2OFOA 2ZM5A 1KOFA 5FL7A 1L4UA 5EUMA 2DPXA 1E6CA 2YC4C 4P3YA 5HCNA 2PLRA 4MKGA 2PMKA 3TIFA 2V1UA 2IYYA 1TQ6A 2QMOA 4UNSA 3SS8A 3VTKA 1ZUHA 1QG4A 4NE2A 2P2LA 1XXHA 3RLFA 1KJWA 3VR4A 4C2UA 1JAIA 2F3RA 1GFIA 1A4RA 1ZCAA 3GP8A 3RAPR 2MMGA 1ZD8A 2AD5A 1GVNB 3GJ0A 3GFOA 5FH9A 4OI2A 3JZAA 1FP6A 2QPOA 4HUQA 1U0LA 2PEZA 3I4LA 1Q1BA 4Q01A 2CNWD 2ANCA 3IKJA 4HI0E 5JFGA 3CRVA 1HUQA 2CCGA 4YMTA 4QGHA 1G19A 2ATVA 2QORA 4TQ9A 4DSTA 4B44A 2HYIC 2ZU6A 4ZDWA 3O8DA 3GLGE 2FMXA 3GEIA 3REFA 5KOYA 3SDZA 1Z29A 1W0JA 5HKKA 3GCGA 1J70A 1RJ9A 1Z2CA 4I1VA 4OKSA 1FUUA 1PZNA 2F1RA 1W49A 2GJ9A 1XTJA 2QNRA 2C04A 3I8SA 1NIPA 2NO9A 2X8AA 5CIWA 4B3DA 2XZPA 2ZI9A 2ZREA 1Q22A 5BW8A 1R10A 2GEDA 2OHFA 1KDPA 5SZKB 3SBDA 3AP1A 1VHLA 2J7PD 5GJWC 1DADA 4OI1A 4DDTA 1JALA 4Q9KA 4GP7A 1ZBDA 2V9PA 4DT1B 4DB4A 2Q3HA 5JI3E 4BFYA 4L8GA 3CKLA 4Q03A 4W5JA 3TW8B 2BMDA 5C18A 4US2R 1Q1EA 1AA9A 5J47A 1E94E 2QU8A 2RGEA 2V7QA 4A92A 3FHOA 2XTMA 4B33A 2FEMA 3IO3A 3L43A 4IDQA 1P62B 2FH5B 2ZTSA 3OE7A 3KQNA 2VP6A 2ZSFA 2J0VA 2J0UA 3F5FA 1EG7A 5FBLB 3B82A 1D9XA 3CPJB 2PZFA 3ZH9B 2ZJ5A 2K5UA 3QSYA 2I1VB 2EWWA 2JLYA 4GBMA 3A4NA 3WMFA 5BYKA 2ZE8A 5TVKA 2WWHA 3A4LA 1BS1A 4BLTA 1KMQA 2QP9X 3LQQA 2WZQA 5DHAA 1AGPA 3LLMA 1CR0A 2WKRA 1O87A 5KDDA 4MA4A 3JVVA 3QXXA 3LVQE 5BXQC 2FJUA 4DZZA 1NN1A 3FTQA 1OXTA 1C4OA 1D2MA 3M0EA 2FSIA 4YDHB 1R0XA 1Z6TA 1RW4A 1VG8A 2Z83A 2FDCA 4JL8A 2C5LA 2ZI5A 1ZNYA 2WIAA 4NYMQ 2N46A 3K0AB 4JLVA 1NNEA 5DN6D 3PXGA 2JATA 4S35A 1N5JA 5CM8B 3OF5A 4ABYA 3TAUA 4FWTA 2IXEA 1J99A 1LTQA 2WJJA 4HAYA 2I4IA 4XSGA 1G7CA 1G9XA 2HUPA 3EZ6A 2EQBA 4JLPA 2PEYA 2QRZA 1OXVA 2ZRFA 3OEED 2JJ2A 3ND8A 5CB6A 3AF2A 4PTLA 1KJZA 4EPYA 5J4HA 2B92A 2EFGA 1L8QA 3AF0A 3V4FA 1QHGA 2ZRPA 1TUEA 2H8KA 5K8IA 1FX0A 3KQLA 3FKQA 2FE4A 1W4AA 3RRZA 4C0LA 1YU9A 5KSOA 2NOAA 3RS3A 1OFUX 4LJ5A 3VKHA 3OEHD 2J59A 4W7SA 4HB4A 3TAHA 3QXHA 3QVVA 4PC2A 3L8YA 1IM2A 1E0JA 4HZUB 2BDTA 5J4YA 3QG5A 4HDCA 1P2SA 5FI1B 5EP4A 3HJNA 4A2WA 1E0AA 3HR8A 5HE9A 1NMZA 2GZAA 3VX3A 2ERYA 4XVUA 1P6XA 1Q20A 2MSEB 2NG1A 2W6JD 4S2EA 4GOKA 3AVXA 3SQXA 4EPXA 5KPJA 2QT0A 4DCNA 1U2RA 1XTKA 3LW8A 3ECCA 4TZ6A 4JS0A 4XVRA 3T1VA 1E79D 4B3XA 4AG6A 2YV5A 3F3YA 5C2JB 1XRJA 3SJZA 1QF9A 5AUNB 2IF0A 4GT1A 2ZRGA 5LD2C 1E9SA 4DDUA 5F3WB 2O8CB 1I2MA 1TF5A 3LLUA 4M1KA 5IF9A 1XD2B 4ZO4A 4Q9JA 2QQ0A 1FL9A 2QG6A 1WCV1 2IHYA 2VIIA 3PUYA 4QJ5A 3GLGB 2BOVA 3PEWA 1GZSA 2LKCA 4B2PA 5FPTA 3ND9A 4JLBA 3S1AB 3TBKA 1G3QA 4Q1CA 1GL6A 1Z0KA 2EWVA 2V4ZA 1EFTA 2CXXA 2ODWA 4LBZA 1Z6GA 4Q4HB 2XZLA 5EUQB 3LO5A 3DMNA 4U7DA 1Z0IA 4MYCA 3D3QA 4A8JB 1VG0B 1KDRA 1J8YF 4GI7A 3PUXA 3B5JA 3SI7A 4FXPA 4UNNA 5KNDA 1KDOA 2DCUA 2TMKA 3U3MA 2X1VA 4HZIA 4DUGD 1E96A 5JSZB 4P4SB 4KLZA 2Z6VA 1FPMA 3QPUA 1Y63A 2D7CA 4BLOA 4B32A 1NL3A 1Z06A 2GTPA 4I1UA 5KNBA 1ZD1A 5IK2D 3NEYA 1DO2A 4AWXA 1QDEA 3SYLA 3CB4A 3EZ9A 3AVWA 3O47A 1C1YA 1WB9A 3DEFA 4TYWA 1S1MA 4KFUA 1YVDA 4DLWA 2VSOA 3KTAA 2B7CA 1NI3A 1ZVQA 2YJTD 5D3MB 3C7KA 4UXHA 2YKGA 1XZQA 2QP4A 2CNWA 4IDPA 4X8MA 2HJGA 2O0HA 4M1YA 1LF5A 3W6OA 3KFXA 1AK2A 1Q0UA 1WQ1R 2O8FA 4P4TA 3TUJC 2J1LA 5ANRB 3RWMB 1N2CE 1TPZA 3KQUA 2FNAA 1ANKA 2ZJZA 5H1YA 3IO5A 1CS4C 4B6FA 5AWFC 4LJ7A 4RZXA 4IOJA 2NQ2C 3PVSA 4R7ZA 5JCPA 1FZQA 1JB1A 4DCSA 2WAYA 3AVUA 1UM8A 1F2TA 4TYPA 1LS6A 3WYFA 2G77B 2I3BA 3K09C 4NCJA 4YMWA 4DCUA 4R2HA 1OFHA 2HLDD 1MO6A 4D82A 1F2UA 1XMSA 2Q21A 2Q3MA 4NCNA 3T5GA 4Z1MD 1T0JB 2CL7X 5LD2B 4IDNA 2P6RA 4K81B 4MDEA 1N6RA 4GMXA 2IS2A 2J7KA 3B9PA 3KUCA 2OCYC 2J7PA 5E95A 2IK8A 5LB4A 5UKDA 3LRPA 3T5DA 2NPFA 3SR0A 1JJ7A 2ZRDA 2OCAA 2X2FA 4LOAA 1II8A 1YR8A 1FMLA 4HZUA 4BQSA 2DWQA 3VR2A 4A0HA 1ONBA 2E1RA 3LH5A 4MITA 1TADA 1IY0A 4EPRA 4QXAA 1MR3F 5JWRA 5C1BA 3SEAA 5CIQA 3OIUA 1CJMA 2PX0A 4E07A 4RD1A 1TUIA 2CEAA 3DM9B 3LW7A 3OIWA 1U81A 3ZS9A 4DHEA 4A2QA 4M9XA 4BEJA 5FUVA 4M2LA 2RHDA 1E0KA 1GRNA 3RSOA 2O0JA 2QE7D 1IN7A 4RD3A 4GL2A 3TSZA 1NY5A 3CW2A 3BORA 4PR0A 2O8CA 4QFMA 2NZ8A 4NBSA 2VF8A 2XEXA 1MOZA 2JLXA 1N0UA 2CVFA 3ZIAD 1CULC 4ERNA 4QNMA 1NN3A 1KI7A 4LV8B 1ZUIA 1KO5A 4F4CA 2ZXUA 2WOJA 3RRYA 2C78A 1UBEA 3A1UA 3A6PC 3S1AA 1XFAA 2WTUA 1CP2A 4B76A 2PZEA 4CDGA 3DPUA 3ZVNA 2JLWA 2J41A 4KFTA 3QKTA 1SXJE 3R20A 4AKIA 4ZKDA 3B1WA 3QI2A 2CJWB 1XPUA 3SYKA 5KUTA 4R2IA 1MO4A 2IUTA 2FSFA 2YWFA 4PZLA 4A8JA 4TYNA 1T8TA 3MAAC 4IOMA 4AKEA 2CL0X 1WA5A 1G3RA 4TMTA 1UKZA 3C16C 2D2EA 1KO4A 1SVIA 2XJ4A 2ZJ2A 3QEJA 5JSZA 4CEHA 1CJVC 2FFAA 1DBSA 2PCLA 3BFKA 1S96A 1KIMA 1E32A 3EARA 3HR7A 3KZ1E 4YDSA 1D5CA 2C8VA 1JBKA 2EYQA 3CH4B 4YLGA 3P1JA 2H16A 2UVQA 3K0FB 3WBKA 4IRUB 2GNOA 4Q1EA 4TSFD 4Q9LA 3SHWA 2HT6A 3IEUA 2PLFA 3P32A 4IKEA 2G6BA 2IYXA 2ZRHA 3L0PA 3N2IA 5AUOB 2XB2A 2EFEB 2BBWA 2OFWA 3I1FA 2OEPA 1M2OB 3SJCA 1LNZA 2WWWA 1YZGA 2VF7A 2FSGA 3BH0A 3PUVA 5BQ5A 2ZI6A 5FUWA 1T8UA 4LC0A 1AZSC 2CLSA 1IONA 4NTZA 5IHPA 2J5XA 1EFRD 4LJ4A 3BB3A 3X2SA 3CWQA 2GJ8A 4HB3A 3K9NA 5FL3A 4KODA 2QM8A 4OJKA 3RRMA 4D4MA 3U3OA 4LZZA 4GZMA 3U3RA 1ZCBA 3GLIB 3CLVA 3ICEA 3U6KA 2QEQA 1ZC3A 3W8NA 1U90A 1KMHB 1Z07A 2QT1A 4CRWB 5BYJA 2GCOB 2ZJBA 4F91B 2Q9BA 4FMCB 5EJEA 4LJAA 3OFND 1FP7A 4KU4A 3R8CA 5KU1A 2ZS9A 3ZVMA 3RYTC 1E79A 5K8UA 4WVFA 2QTFA 1T3LA 4A15A 5CYPA 3AGQA 4AG5A 4LBYA 3VHXA 1XB2A 3X1YA 1PLJA 4DLUA 2IC5A 1SXJD 3PV0A 3B60A 1U94A 3D8BA 3UMSA 1I2DA 2PH1A 4LHWA 3EASA 4H1UA 2RHMA 5FOVA 2A9KA 4UKDA 1C9KA 4D0LB 1UJ2A 1H8HD 2BVNA 2OFXA 2RMKA 3H4MA 4PHGA 4HSEA 5HKKD 4E22A 5KTYA 3W9YA 1TF7A 3DM5A 4BE7B 5DLQC 3IBGA 3Q7PA 4KBGA 4ESHA 1KYIA 5B2ZA 4EPVA 2KBFA 4TQUS 1K8RA 3BERA 3DO6A 2C03A 4G5SA 1BO6A 4M0LA 3THYB 1HYQA 1JNYA 1YZTA 3W90A 3RS7A 4EFMA 4DUGA 2Z4SA 2BV3A 2DYKA 4M21A 2OCBA 3P4XA 1Z6YA 1S2MA 2V6JA 4RKEA 2X19A 2CMKA 8OHMA 3K0CA 3V00A 1P7CA 3VU9A 2ZETA 4BFSA 2XNSA 2V1XA 3FWYA 3SBEA 1E2MA 4B3CA 3GJ7A 5E7IA 2A7QA 4JLKA 4US0R 3G5UA 2V7QD 2HXYA 3A36A 4BPBA 1IHUA 2WMOB 1VYUA 1XBTA 2EFCB 1MRSA 2MSCB 4HUTA 1FQKA 5TMPA 3OE7D 1EXMA 4OK3A 1BH2A 4MRPA 1OHHA 2GF0A 3Q8XB 4UXJA 1KI2A 1CRQA 3HP1A 2CJWA 3CM0A 5FTKA 1UPTA 1XMIA 1T91A 2GXUA 2X2EA 5H68A 3SNHA 1W48A 4B43A 1R5OA 3AKEA 4MGKR 4OQMA 2VP9A 4KFRA 1M74A 1ZNWA 1OV4A 5FPKA 4M53A 3W8RA 4BECA 2P5TB 3T12A 1Z3IX 4L15A 2ZRBA 1NMYA 2WKQA 1NLZA 4X8OA 3V4RA 3VKWA 2QMHA 4GDFA 521PA 3LQRA 4ZDJA 2A30A 2ZQ5A 1ZU5A 1R8SA 4Z51A 2NGRA 2HLDA 4MKFA 5EP3A 3GFTA 4K8OA 4I4LA 3VX4A 3NTUA 1AS0A 2V3CC 4KO8A 4C7OA 1NKSA 1ZYUA 4URYR 4CT4B 3RS2A 2VO1A 4C0AC 1SXJB 2A2ZA 3GEEA 2VHQA 4DKXA 2IS1A 4URUR 1D9ZA 3AVPA 1E2PA 3GD7A 1E69A 2VQSA 4A0RA 4P0TA 4PFSA 4ASUD 4H9GA 2MMCA 3GLIA 1W44A 3KXLA 4C0JA 4LYJA 1ESMA 1VKJA 1S3GA 1N5KA 1HEIA 1NY6A 2FA9A 3AV0B 2XSZD 5F9HA 2ZJYA 2JJ2D 3ZQ6A 3CRQA 4MDFA 1QHYA 3K9HA 5JJLA 1K5GA 1YE8A 2IYRA 2O0KA 2JLRA 2XOKD 4O3MA 3AUYA 1WBDA 3TR0A 1U99A 2XX3A 3K0SA 2HJVA 2JGNA 2QE7A 4QBIA 1N0WA 1CIPA 4BLSA 1W5SA 1SKYE 2IW3A 3ADBA 2GWHA 3H0KA 2WJYA 2JLZA 4A6PA 2ODEA 5CM9C 3ZIAA 4DDVA 1Z0AA 3ZZUA 3U2QA 1GSIA 3BFXA 4YC7A 2Y8EA 1G8PA 4WW0A 3SU8A 5HZHA 2ZI3A 2IYZA 3PENA 3EIQA 2OSBA 1OF1A 1QHXA 4C4PA 2GCNA 1D6JA 1UDXA 2BKEA 3A4MA 2CHGA 1XMVA 3NBYC 2FU5C 3SHFA 5B58C 5GVRA 1XZPA 2AXNA 1CR4A 4IOLA 1FQJA 4NYMR 3TJZA 1R6BX 1HTWA 1U8YA 2J0UB 1FNNA 3QG1A 1AS2A 1E9FA 3HYTA 2BMFA 5H70A 1LV7A 5HCIA 3FMOB 2PJRA 4LV6A 5KYKA 2R6AA 2AX4A 3AVTA 3MWKA 1FW6A 4R9UC 2RGNA 3CRRA 3W5JA 2CCJA 3DZ8A 1F6BA 5E3HA 2ZYUX 1JECA 4KVAA 4GRAA 1KJYA 5C46F 1VG9B 2IYUA 1BMFD 1VCOA 1RRCA 3VNUA 3FFAA 4ZKEA 5FOTA 1W0KA 4TSFA 1J2JA 1P4SA 1QRAA 2JASA 1DO0A 4QM7A 1EESA 1T5LA 1DE0A 4B35A 3B1VA 5SZIA 1KI8A 2GKSA 1R0ZA 1G3MA 1KO7A 3MG9A 4KI0A 1KI4A 1KO1A 4QBGB 1KY3A 4LWZA 4JLOA 5FBWB 3T1QA 3A58B 3IHWA 3LD9A 4IXMA 4NZYA 3SOPA 5EQTA 1EFRA 3ZS8A 1XEFA 1JR3A 1W1WA 4Y0VA 5KPDA 3I62A 4LSGA 1DAKA 2REBA 2XXAB 2IEZA 4XSHA 1IY1A 3RVBA 1NLYA 5TDHA 2A5FA 4E09A 1DAEA 4W5WA 3PUWA 1AN0A 1KY2A 3W3AA 1CJKC 5E7JA 1ETUA 2Q9AA 5J40A 1IAQA 4ZDIA 1M7BA 3DDCA 4AKHA 3MGCA 4DEYA 3OFNA 4OK5A 1E2IA 2RKOA 4PQFA 3MFYA 2XB4A 2OXRA 4URZR 2HXSA 3ADCA 3IDQA 4WXPA 5GJCA 4ITRC 3TUZC 2QTVB 2Z0MA 3ZD7A 2ZRMA 5BN3A 1QHSA 1AZTA 1FX0B 4W5HA 4YMUA 5L3RA 3LBHA 4OQFA 3RWOA 2OO7A 1Q44A 1SXJA 3IILA 4MRSA 3CNNA 2DB3A 2CK3D 2F9LA 4M8NE 4IOKA 1Z28A 4YONB 3EIEA 1UDWA 1TTTA 4B73A 4MRNA 4D4LA 2WM9B 2BMEA 1KKMA 4DCVA 1H8HA 2ZITA 2GXAA 5JJKA 1VCNA 1CU1A 1T4GA 1NN0A 4PC1A 4D80A 1WF3A 1ELOA 2GVDC 5L8VA 1M7HA 2QBYB 1LVGA 1E0SA 4HAUA 2QL6A 1SZPA 4MGIR 4JBYA 1SVWA 3K9LA 4N1AA 1Z2AA 3CZPA 4BUJA 2ATXA 4V0OA 4RZ2A 1B0UA 2CCKA 4PC3A 3U44A 4HLCA 4OI0A 3FYHA 4J0QA 4QJ3A 4ZV4A 1U9IA 4DVGA 3BAFA 3QOFA 3HU1A 5CDFA 2IBMA 1TX4B 3OZXA 2RGXA 1ZJ6A 4PAQA 4RFVA 5EXXA 3EZFA 3MCAA 5FI0B 4RZ3A 2ZE6A 4C2TA 5G3YA 4WZ6A 1S9DA 4AK9A 4CW7A 3TGPA 3KDSE 1ODFA 2ZRIA 4F93B 1P9NA 2FPMA 3NEJA 1J7KA 4URWR 5IDVA 2FZLA 4HLDA 4Q9IA 1OPXA 4CT5A 1SKYB 1TU4A 1SQ5A 4UQOA 5HPYB 4D6PA 2XTNA 3KB2A 2A3RA 1N6HA 1KAGA 1YZKA 4IXNA 5JWHA 3RHFA 2CE2X 4DLXA 3VR1A 1NVXQ 2IS4A 2VTKA 2P0EA 1UKVY 221PA 4PQYA 1G5RA 2FSHA 2YOHA 4PO8A 4GNKA 3HWSA 3L0SA 1VPLA 2A5DA 3U6BA 3KTAB 1M34E 1VG1A 3B8HA 4Q4JA 2ASEA 2ZAOA 2AHOA 1FUKA 4XVQA 3BC1A 5AUQA 1SVSA 1F5NA 2QN6A 2W6IA 2O8FB 3P4YA 3PITA 4A8JC 3U4QB 4FCVA 4XD7D 3NG1A 2XXAA 3C8UA 3DHWC 3MRSA 2FGKA 3QKUA 4ASUA 1G20E 4M9SA 4FMCF 4X8HA 1NF3A 4NH0A 4JVLA 2O8DB 2XSZA 4XJXA 3SE0A 3CH5A 1XDBA 1F2TB 4KYUA 1QHIA 3R7WB 5IT5A 3KKNA 1OSNA 1E9CA 3AP3A 2YNMA 4ZCMA 2XOKA 1PLLA 4LJ8A 3AGPA 4ZCIA 1NP6A 3SFVA 3ZGXA 1F2UB 5FR2A 4D4JA 4ESVA 5LB2A 3IUYA 4B3BA 2F55A 1G6OA 1OW3B 4BLQA 2MSDB 621PA 4LJ9A 2BKUA 1IJFA 1YZUA 3QBVA 3H86A 4FN5A 1E2HA 2WSMA 2F3TA 3ADDA 2ZSEA 1R4AA 2H18A 3T34A 4DSNA 1II8B 1EFHA 4EDHA 1N5LA 4JJKA 3FHCB 1Q12A 1XTIA 2IA5A 4C0HA 3TQCA 1JAHA 3LDAA 4QHSA 4JBWA 1GRQA 3I73A 3UK6A 3AH8A 4B75A 4F38A 1XD9A 3EC1A 2ZYVX 4XTCS 1P9WA 2G0NA 2ZRLA 2ZI7A 3MWYW 1U98A 3VKGA 3QXJA 2QBYA 1R0YA 4Z8XA 1BOFA 1KNQA 1JXMA 1F60A 1N0VC 2F1JA 4TMXA 3KKQA 4HB2A 2OZEA 3M1IA 1NLFA 2ZIAA 4AYWA 1GP2A 2VL7A 3CRW1 5JBQA 3QE0A 4TZ0A 1BMFA 2BCGY 1E2EA 3DKVA 1XTRA 2ZJAA 3VNVA 4PPFA 5JEDA 4AKGA 1KSHA 4LUCA 3EZ7A 2YINC 2ORWA 1E3MA 4Q9HA 1M7GA 4A4DA 1W7AA 4LX0A 3NBXX 4Q1DA 4DLTA 2FPKA 2VHTA 4NCIA 3MWJA 1L2TA 1DAGA 2WPDA 2F9MA 3C4JA 4G0NA 2EW1A 3FKSD 1X6VA 3H2YA 2Q6TA 3K0EA 4IEEA 3T1TA 2BC9A 3CBQA 1VECA 4LYHA 1XJCA 4NDZA 3GLIE 4CEHB 1Z6XA 1KDTA 3B2EA 1ZW6A 3UG7A 2ONJA 3EX7C 1AKYA 3AF3A 1CXZA 3K0CC 3ONWA 3AKDA 4DWJA 1LW7A 1XWIA 1OFIA 5JHHB 3FGNA 1N6PA 2FGJA 1IN6A 2JA1A 3SQWA 1PLKA 1VTKA 4PANA 3ZJYA 1DAMA 3GLHA 1Z8FA 3IIKA 1JJVA 2GK6A 3L2OB 4R98A 1J90A 1NG1A 1OHHD 4QOSA 1KTVA 1M1YE 3UATA 2CK3A 2HCBA 3GJ5A 3CX7A 4KJZA 1N6OA 2GXSA 2IF2A 3WHKA 2WJIA 3U4QA 1IBRA 1VYVA 3I61A 1NVUQ 4L16A 2ZS7A 5AJVB 3LXRA 5KNCA 2XZOA 1PVOA 1X8JA 1KHTA 3WY9A 2O8DA 3PUZA 5KO2A 3SN6A 3RDPA 1E99A 4H1VA 4OL0A 1YRBA 1UBCA 4RVCA 3R7WA 3FFBA 1NBME 2FFBA 2RGCA 2XJ9A 3UXMA 4G5QA 3GPLA 4LY6A 2Z5FA 1R0WA 5CK5A 1IXZA 5DGXA 3EAQA 1YZLA 3A8TA 4BFWA 1W5TA 5JHGB 3EIHA 3FMIA 1COWD 2AR7A 4F7WA 4AURA 2G83A 2GVZC 1JEDA 1UFQA 2Z4RA 4TMWA 2JJ8A 3U60B 1E9EA 1G64A 4LJYA 3I3SR 2HEIA 2XAUA 2GRJA 3BB1A 2H17A 1KI1A 5DIFA 1NJGA 4B3FX 1IOZA 3TVDA 2ZSDA 2ZRKA 1P2VA 3NWJA 3NKVA 1RKBA 2J9RA 2F43A 3AF1A 6Q21A 1VMAA 2FOLA 4II7A 4LC1A 1A82A 4FMBB 5CLQA 3VFDA 2G9NA 4TYYA 2BHRA 2BJWA 3GJ4A 2ZRNA 3UMFA 3BH7A 1KI9A 3FDIA 1JR3E 4Q19A 2B21A 2A5YB 3UWOA 4KXFB 2GEVA 5KDLA 2P6UA 4CYMA 3BH6A 1GUAA 1YHNA 3NDPA 2RGAA 3D31A 4LHZA 4CGZA 1GRRA 5HR5A 4MUAA 4C3ZA 2Z43A 1US8B 3QJYA 1DVRA 4MGZR 2GCPA 5FBVB 3UPUA 5JWOA 4D81A 3NC1C 1W36D 2D2FA 3VU9B 1E1QD 3OESA 5DE3A 2DFKB 2XITA 4DB2A 1XTQA 4NONA 1MH1A 2Q0HA 3IBYA 4DCTA 4PHFA 5KHOC 2B7BA 1EX6A 4A0GA 3CF2A 3UIEA 5FTLA 2LCFA 1UEIA 3T61A 4G3XA 5L3SA 1U8AA 3PCRB 4A1FA 1NKTA 4ZDKA 1E9AA 1AIPA 3KXIA 4OHZA 3WNBA 2OILA 1NBMD 1ZRHA 2WKPA 5G40A 2LWIA 2JEOA 4NCKA 1E9RA 2QQEA 2W83A 4XD7A 1HY3A 3V9PA 2FEOA 4KBFA 2RGNC 2NO7A 2EVWX 3P27A 4IW3B 4LGMA 2V8OA 4EPTA 3RC8A 2VP0A 1BYIA 2ZS8A 3EG5A 1W0KD 1TL7C 1LY1A 1HV8A 2KI5A 3LY5A 3TR5A 1UKYA 2FFHA 3C5CA 3BGWA 1CR1A 2CVHA 3QPWA 4KLNA 1E2NA 4LPSA 5FR1A 4NYIR 4I81A 4ARZA 5B30A 4RY2A 1G7RA 1GKYA 5BN4A 3BXZA 4Q1BA 1W4RA 2BM1A 3QVUA 3GLFA 4C7OB 2ZYTX 1K6MA 2ZSBA 1P60A 1EFUA 4BZPA 4TT3D 4A82A 4OQLA 3VR6A 4BFZA 1JR3D 1CTQA 2R6FA 5EE5B 4BLPA 3CONA 1N6IA 3VAAA 1WXQA 5CDFE 2PJZA 4JSYA 2IUSA 1G4UR 4C30A 3D6TB 3RANA 1OE0A 5HZKA 4DLVA 4YXWD 2XNDD 1TAGA 1DAIA 2NO1A 1ZD9A 2WHXA 4TWZA 3A1SA 5LDDC 2J0SA 4M1SA 2AXPA 2OBLA 3GJ3A 2PX3A 2NO0A 1BIFA 1NVVQ 3U3KA 1Z0JA 1UBFA 1UADA 2OT3B 4Q7KA 3THXA 5AJXA 1SXJC 2AWOA 4Z8YA 3AVVA 2ONKA 3Q72A 5J5CA 1R8QA 2JLUA 1W36B 4FINA 4YMVA 1X3SA 721PA 4P4UA 1JI0A 3KB1A 2G0TA 2G3YA 2GESA 4A9AA 5JJIA 3KQKA 1GDDA 4D0NA 2BJVA 3NDBB 1TQDA 1E2KA 3H84A 3K53A 2NO6A 3TNFA 1DAFA 1G1MA 1XU4A 2R62A 1SHZA 3CIOA 3SC3A 2REXB 1WBBA 4D25A 4HLUC 4NKRA 2NIPA 4RD0A 3NH9A 3CNOA 1U0HC 2IX3A 2JDIA 2AKYA 4L5BA 4N0EA 4EPWA 5GJVC 3FKSA 1IN8A 4UNRA 1LB1B 1NIJA 2AFHE 2VP5A 1YRAA 2P6NA 3BOSA 4ACBA 1MO3A 1DPFA 1EX7A 4TLBA 4E03A 1UKEA 1IXRC 2H92A 2VBCA 3AVYA 3LA6A 1OYYA 1US8A 4DDWA 1TEVA 2QRNA 5DO9A 1OXUA 3L0OA 1U9IC 5BWMA 3QENA 1OH7A 1CBUA 2WSSD 2RGGA 2EYUA 2OAP1 1P3JA 2YWGA 121PA 4JZKA 2LKDA 4O2RA 3KJEA 2D7DA 2ZSAA 2PZGA 4M22A 5FPHA 4N0DA 1XJ0A 3QEOA 2GHIA 5H8WA 4Q18A 5EE0A 3CPHA 2ZRJA 1P9RA 3A1VA 1U0JA 421PA 5F2EA 2ZR9A 1GKIA 1E2QA 1BYUA 3MJHA 2PMDA 2WOOA 1RRGA 3KXKA 3O8RA 3VR3A 5FUYA 3IQXA 1P73A 1FNMA 1KK0A 2RGDA 1A2KC 3HPRA 3QXSA 4OJQA 2WVJA 4DIEA 4IVRA 3RNLA 4BWYA 5GADl 1CLUA 1Z22A 4NHOA 4DLZA 1E2GA 2J46A 4MYUA 2BMJA 3EA0A 4LDJA 4JSTA 4UNPA 3THWB 1G3IA 1Z0DA 1COWA 2IUUA 3DKPA 4QL3A 2Q9CA 2F6RA 4BRUA 3HU3A 1AJEA 2YVUA 3QKRA 1FTSA 2W6ID 1GILA 3EC2A 1HA3A 3M4YA 3R9IA 3QUSA 1SHKA 2GBLA 4GFDA 3K9GA 3QF7A 4IJMA 2NPIA 3WBJA 3AVOA 4CIDA 5AJYA 5C4MA 3R9WA 4V0KA 4B47A 2C2HA 4JLNA 1G4AE 2W0MA 2ZE7A 4JVNA 1MO5A 2GJKA 4V0ME 3W34A 4ON9A 1N6LA 4TTPA 4NYIQ 1I4TD 4KVGA 1R7RA 1V5WA 2O52A 3ASYA 4I1SA 5CJ2A 2ZYWX 2G88A 1LF0A 2DHRA 2CHQA 2E9SA 3IPYA 4POAA 3U44B 2YWHA 3WYGA 1OXSC 3LAWA 5E7MA 2WAXA 1HQYE 1E1QA 1P2UA 3KUDA 4UNQA 3RRNA 1H65A 1T5IA 4A2PA 3CF6R 1HT2E 4LJ6A 1K5DA 3ZVRA 3C41J 1GAJA 2WWGA 1MKYA 1QBKC 4QRHA 3B78A 4EIWA 5A5GA 4BEBA 3KJHA 4JKYA 4D0GA 2WWXA 2QENA 3GLHE 2PCJA 3X1WA 4NP6A 4EJSB 4KYIB 3WP1B 1Z08A 4DRZA 3IQWA 1NBMA 4JL5A 4HYYA 5DYIA 4O2LA 1T9HA 1WP9A 2WJHA 2VHCA 2FZ4A 1I4LD 4KAXA 1RRPA 2F7SA 2NZJA 2V6IA 5CITA 3CRMA 5M04A 3SFZA 1P61B 3TSWA 1GITA 2ODBA 5TB5A 2FWRA 3VR5A 1B23P 2W00A 4Q7MB 2BEKA 3BS4A 2YZ2A 1VIYA 1HURA 2GEUA 5EXTA 1GNQA 3RS4A 4F4JA 1T0HB 4RFSB 2C99A 3AUXA 3KKMA 4NU0A 1D2NA 4N3NA 4QBHA 1XD8A 4V03A 2PBRA 4Q4AB 3IIJA 5JI2E 4IVPA 5ELXA 3UANA 4Q4JB 2C9OA 4UXIA 2SHKA 1N6KA
chains in the Genus database with same CATH superfamily
5T5QA 3U39A 3LT5A 4DB4A 1PT5A 2XXBA 2OGUA 2Y4NA 3DP7A 2W6ZA 4ED9A 4EK9A 2JFUA 3E7FA 4QKQA 4RANA 1U1FA 2DWPA 2AK3A 2WTAA 3CEPB 4HEHA 3FPSA 3VUFA 2E87A 3CY6A 5KYNA 1OX6A 2AFHB 3UWPA 3KR0A 2MSLA 3ZHQA 1XNHA 1SVMA 1VL1A 1Y1TA 3C8HA 5T67A 3MOSA 1C3LA 1PKEA 2K6GA 5DI3B 5TT1A 3HKCA 1SUAA 1H6AA 4YXWA 4PYMA 5FPQA 2XNDA 2NT3A 1O8CA 5BR8B 4OBWA 1Y3DE 2XGJA 2ZEJA 5AW5A 1KY5A 2GXQA 2VQ3A 5K3EA 3EIWA 1T9KA 2ZB4A 5B4VA 5GMOA 3HTXA 4DS3A 2VA8A 2UUPA 2PT7A 2ZUDA 3DFMA 2G1JA 4G41A 2LD4A 4NX2A 4Q4CA 4I1PA 1C1XB 4XVCA 4GI2A 3HXQA 1EUYA 3DFZA 3TKLA 5ALFA 3J81k 2BM9A 3CUTA 5HJ5A 2Z6QA 1PNRA 3HCDA 1J8FA 3AZPA 3DXZA 3FSEA 3O1LA 1MDFA 2XTJA 3LX8A 3MJRA 3QU4A 4MVJE 1JAYA 4Y6OA 4EAQA 2ZU0C 2P65A 1UWLA 1XRNA 3N5CA 3ESBA 4AY5A 4D4GA 3H9JA 4MZXA 4N40A 2A4MA 3U1BA 3JQ9C 4LI0A 3ZZ0A 5HKLA 1D2EA 3A4VA 4Z4CA 2AE1A 2HX1A 3MTGA 1TTPB 3QUAA 4UM9D 3RBAA 1XEWX 4PQRA 1GA4A 1VMIA 3UWMA 2IT1A 2IXTA 1UZMA 2JL1A 4NBWA 5CURA 5ITZA 1H8ED 1VDZA 4HLUA 4BNNA 1OREA 3CF0A 1JHUA 2PZAA 1JJAA 1P2TA 2ZPTX 3HCPA 1MV5A 4IHJA 2X40A 3RS0A 1JEYB 4AY4A 4ZO6A 2PL3A 1SOVA 1FNSA 3MLEA 4P7BA 4FZ5A 1JMYA 2H8GA 4GKAA 2C7BA 4JP3A 1WMSA 4GPTA 1X15A 5SZJA 3E3MA 2PR2A 4YJ2B 3WRXA 3IUSA 4KIJA 1ZBQA 1A1VA 2E4XA 5SZHB 3PBKA 4FYKA 1F3LA 2Z8ZA 4ZAWA 2Q8QA 3ACDA 1UXIA 2BBTA 2C5EA 2RCNA 4DC1A 1OLSA 3EY4A 4FMDB 4D9NA 4F8JA 3I5XA 3V2UA 1J4AA 5BT8A 3WKBA 4UHDA 3QTLA 1Y9ZA 2PXHA 1IQPA 3IUMA 4YJDA 4JDUA 4P92A 3SG0A 4RD2A 1LDYA 5AHXA 3FW1A 1C2TA 1GL7A 2FPXA 4LQDA 1S4QA 4EW2A 4EJSA 4EYEA 3HXKA 1A7JA 2IU0A 3KO8A 1JILA 1G7TA 1EYZA 1CVRA 4L4RA 1FYEA 5KHAA 2UZ3A 4KXVA 4NULA 3FRJA 3NGMA 4UM5A 1QE0A 3LHSA 1C7RA 5ENZA 3MWEA 3T4PA 2BM0A 1RRFA 2ATCA 1R18A 4KQCA 1MUUA 4V0QA 3IKTA 3I5YA 2IYWA 1SPXA 1W581 3CH7A 2C83A 1DBWA 2HA3A 3B2QA 1XEWY 1C80A 1AS3A 2P62A 4OB6A 2D8AA 1U63A 1OIWA 4WL0A 4ZV9A 4KQMA 4RFSA 1B41A 1HFWA 3ANTA 5KHLB 2ZZMA 3HV0A 5ESDA 5FX2A 5J1SB 1RYEA 4H2DA 3KJXA 4KE6A 3ZK9A 4PNHA 1O4VA 3ZI0A 5FWDA 3C3WA 4QOFA 3WMXA 1J5EB 2O8VA 3QVWA 2D2IA 1BCSB 1M6NA 5T64A 4OYHA 4IX1A 1FSSA 1YKFA 2ZIEA 5EJ4A 1Q3HA 4IRMA 3GCZA 4V02A 3A0RB 3G02A 1U3FA 3KX2A 4L07A 4RHFA 1S3IA 4IJUA 2XEDA 2GAAA 2FF7A 3NUGA 1DARA 1H6CA 2HBYA 2SKCA 4NYJQ 4EY7A 2G7ZA 1C3XA 3C15C 3AFHA 4N18A 3VRHA 1UBTS 3JR7A 3H8WA 1VKNA 2AKAB 2ZUTA 1R0BA 2R751 2VUUA 1UXJA 1EM8A 2FQWA 1DWUA 4P31A 2DCMA 4A27A 5ESRA 1PFQA 2Y71A 5C34B 2F8LA 1KO8A 3CNEA 1CJTC 3GT4A 4PC7A 1DDIA 1FRFS 3SXUB 1D04A 4OXKA 1L5QA 1HDIA 1JXQA 4BFXA 1ECCA 2QDXA 2P5SA 5B1IA 3VZBA 3LYLA 4B40A 4N76A 2J0QA 3ZOZA 1Z8HA 4YV1A 1D2GA 1GQRA 4V0LA 3EXFB 3AWIA 4HBGA 4RFLA 4X24A 2A1UA 1KEUA 1JDSA 1FSFA 1Z5ZA 1P4JA 1NBIA 1S2IA 3KR2A 5AP9A 5EHIA 1Z45A 1B0ZA 2JCVA 3W1WA 4BRWA 4FYPA 1ES9A 1BOOA 1ZU4A 3EYAA 1XPJA 1Y4ZA 4IILA 5FTNA 1OIVA 3BJIC 3VR6D 3HB4X 3WMRA 1WDWB 1X2BA 2XLBA 4IWXA 4PEVA 1NJ1A 2QTMA 3O8CA 3J7AC 1RLUA 4F4IA 1NZFA 2OO5A 3L8ZA 3LK7A 4C0BA 2VT3A 5LLSA 4YJ3A 5KTTA 1RWXA 2D00A 1QK5A 4YJKA 2PQ0A 1DINA 1YTLA 5HILA 2F43B 1MW9X 1RAEA 1XL1A 3BWVA 5DRTA 2GYYA 5E0OA 4FLEA 4OD0A 5CXSA 3OOJA 4OVKA 1H85A 3JD0A 2XE6A 2W0SA 3GEBA 4MRAA 4C6TA 4CUZA 4DEXA 4WZAE 3UB3A 5F1YA 3TE6A 2B98A 2FWNA 3B1FA 5EC8A 2P9CA 3HPQA 3BE4A 4ZC8A 1F9AA 3MSXA 4L02A 4BQNA 1SCUA 5D3ZA 3AEZA 2H9IA 2PD4A 3BG5A 3JQBC 3JY6A 4FFWA 3HCEA 4NAVA 4OLHA 3RVRA 2B1IA 3ID6C 3ICWA 2C96A 4OHPA 2XECA 1EK0A 5E8RA 3SZLA 2ID7A 4PXSA 3DT6A 1LD3A 5DRYA 4FGSA 1NF8A 1PWYE 3ILHA 4KG7A 5AKYA 3GEMA 1N3IA 2YX1A 2X2OA 2PAAA 4YCAA 5IRCD 2VPIA 3CLUD 4LHVA 3THRA 4XYLA 1L4EA 3GF4A 4P38A 4US1R 1A4XA 3E9DA 3MFQA 4MXDA 4UPDA 3RADC 4RCZA 3FE2A 4MVJM 2YCLA 3IYLW 3N8KA 3NHUA 4R1NA 4Y6SA 1N5DA 1MVNA 2C0CA 1N0IA 2RH5A 2FPLA 3WLKX 2WIKA 3WLSA 3EQZA 3VU3A 4DNXA 2P6PA 1G2IA 1XZBA 1ADBA 4MYHA 4DC9A 2C77A 4DIDA 1YOBA 2HA5A 3PC3A 4O63O 4KSCA 3CIFA 4X8LA 1Z47A 3LFHA 3B6EA 2OC9A 4HNQA 4NZ9A 4B82A 3HHEA 2BH9A 3ETCA 4BGIA 5AIBA 4DT1A 1L5RA 4E2XA 1JQJC 2XUQA 3EFEA 1PFUA 2PRIA 3ESAA 1V95A 2KLHA 3MNFA 2JCSA 4KV9A 4URXR 4YY3B 2V55B 4Q7JB 5BV1A 4H7DA 1NULA 4P53A 1S0UA 1NJ5A 4FI3C 3TECE 2FW7A 3EGOA 4ARIA 4HTAA 4OI4A 1J33A 3AI1A 1JHPA 3GFPA 4FFVA 1OFTA 3OZAA 1JW9B 3AETB 5EL0A 1Z6QA 3GXBA 1CF4A 3BXOA 3ABIA 2JK1A 4Z2AA 4N3GA 1QCDA 2D1YA 3QLVC 3R77A 3EGXB 3ZXSA 2PUJA 1PFYA 1DTSA 2WMNB 5GP1A 1XCJA 3TW4A 1H4TA 3H2ZA 2PWZA 3OZFA 3BMQB 5CLLA 1VHJA 4XUDA 4PVCA 2KQUA 1MRNA 1RWMA 2QRMA 2NV0A 3R7DA 1F7UA 2N47A 2I99A 4O4LB 4EG1A 4HEJA 2PG3A 3GGOA 4UHFA 4I55B 1UBJS 5EZ5A 4ZTBA 4MRRA 1ISGA 1C9EA 1CDZA 1AK9A 1NFFA 1SJ9A 5BNFA 4BNFA 4O4JB 1J8VA 1H3EA 4JUFA 4BNZA 4X7RA 1TMKA 3O4JA 3D7NA 7AT1A 4CMEA 2X0NA 5A4IS 4POOA 2QMEA 1A98A 3GNQA 5JMTA 4MYTA 5E4FA 4E5UA 3TS1A 2E49A 1NQAO 3BMOB 2FN3A 2EAUA 2W2LA 2WVGA 1E7MA 1OTXA 3N05A 1FZTA 3WYAA 2R6DA 1D8AA 1TQ2A 4QYXA 2SICE 4TMVA 1ZOIA 3EZ2A 3QP9A 4HLQB 3FCOA 5L53A 2O23A 1TECE 5EGSA 5BWBA 4L4UA 4BGDA 2QLTA 3MTEA 3MQ2A 2RAUA 3G0CA 5E2IA 1JHOA 1QZUA 4YRZA 1OAOA 3J7TA 1L8OA 3KR9A 3W3ZB 5JY6A 4YVFA 1X19A 1ECBA 2WG0A 3DDWA 4KMRA 1WCYA 5HXAA 4AKTA 4DPKA 4Z1OA 1YR3A 1GNTA 4B6JA 1S1CA 2NXNA 4MPDA 2Q1YA 4X7BA 3UOGA 5EKXA 5EIFA 3RSQA 3IP1A 4EECA 5F9FA 1U3TA 1UCFA 4G09A 5HEKA 2VATA 4N7JA 5FBHA 2W2VA 3GBSA 2A58A 3UAXA 2QMUA 2P6MA 3UEOA 2Q9UA 4ZGGA 4OX9B 3RVMA 3HEMA 1P8AA 1RC8A 5BWNA 2H0QA 2YV3A 4RDHA 3OOEA 5JAPA 4WN3A 1YA6A 5F23A 4WASA 1VLLA 3KDAA 1FVHA 3ZDZB 3L8GA 2OCPA 1P80A 3PFIA 1Y80A 4F8YA 2FSUA 4HWTA 4KO2S 4C3UA 1QQ5A 2FN7A 4W7IA 4OJYA 3UAVA 4BVBA 1NX9A 1TF2A 1JZSA 1CY2A 3NALA 4TS1A 1E66A 1JBEA 4K8RB 4M38A 4MRVA 4IJKA 4XWGA 3WP0A 5JANA 3B2NA 1AKEA 3TPZA 5U4QA 1SY7A 4MV0A 3H9BA 1GU0A 5JRZA 3DBHB 5CU7A 1LQTA 1URPA 4G5OA 1G5PA 2J5QA 2JHGA 3HZRA 1NI5A 4I5FA 4U2EA 4KAFA 3KKOA 4DJTA 1WE2A 3GPBA 2IY9A 2R1TB 4N4AA 2RE8A 1ZISA 6AT1A 3AJAA 3VUEA 5A9TA 4K9SA 4TLDA 2PN1A 1M0WA 3I32A 2PRSA 5I5GA 1HLFA 4YRCA 4CKCB 4CR6A 1T1JA 3BSSA 4EUKA 5ERGB 3RSZA 5HX7A 2CHVA 4UUQA 2O07A 3OG9A 4JHXA 4PLYA 2C4MA 3GMIA 4H7JA 4GLBA 1J00A 3O31A 3E1KA 4FJ1A 2RHWA 3BIOA 1Z6AA 4N49A 3E70C 4RVGA 4PSCA 3M1AA 2CY0A 3P0FA 2H1IA 2WA1A 3D8HA 3LHDA 3GQBA 4HAOA 3AEUA 2Q3CA 3RJ9A 3RYHA 3GIWA 4R1UA 3SJBA 4HATA 4BE9A 1XXHE 2VK1A 3IP5A 2VP4A 1L5SA 3R5FA 2H52A 3DVSX 3GG9A 5GJBA 3OLZA 5K3FB 1AMOA 5DP1A 1OY1A 5GM2A 3U1VA 4PLZA 2IU4A 4LPKA 4CKEA 4YH1A 4A7PA 3CGGA 2FP4A 3FOZA 3A1WA 2BUAA 4G5RA 3W9BA 1UDAA 1BWPA 5C1OA 1DKMA 4C29A 3DDNA 2C5BA 3WS7A 1IXYA 2GPTA 1T2CA 3PLAE 3LOQA 3IPXA 1XZFA 2AJDA 3BWCA 4XJVA 4N54A 2RHHA 2OXCA 3W5IA 4ZIRB 3U7HB 3DB1A 1E89A 4PNPA 3QIAA 3ZHRA 4IQ8A 1SKQA 1K3FA 2PANA 3NNNA 2ASVA 3O83A 3D6VA 2IOQA 4KX5A 1ZGBA 5DTRA 5BV2P 5HF8A 2WLSA 1V7CA 1X8LA 2F1IA 4M0MA 2OGWA 2ORED 5LYJB 3GARA 3JV7A 3KL4A 4MS3B 4WAUA 2QM0A 3P2IA 4LXIA 5E6UA 4WCFB 4F97A 2Q4EA 3P20A 4OA8A 1MIHA 2JCBA 3FUUA 1Q17A 3BBPA 3GPCA 3T9FA 4L7QA 1XGKA 3INRA 4EFNA 2CB9A 5EXSA 4Q12A 4WEQA 4NOJA 2O4CA 1R4NA 1WUKS 1ZM9A 3OLXA 1CEQA 4GX0A 1JLLA 1MABA 5JSKA 3ZY5A 3S81A 2I55A 1G3UA 1MW8X 4FU0A 2FJPA 1DT5A 2B1QA 1CD5A 3FHJA 3F96A 2R65A 3LWNA 3B7GA 1YQGA 2QTTA 3KSRA 4RABA 4RSHA 4R8LA 1NW3A 2OHIA 1E5DA 1C7EA 1OASA 3VNQA 2GPBA 4M46A 5CP8A 3A4YA 4KE8A 5HTKA 4IIEA 4U9IS 5JUWA 2QPTA 3GFBA 1J56A 2IZZA 4GYKA 1ISJA 5BV0A 1EWQA 2D5CA 4RTNA 3M6WA 4LDNA 1II9A 4UE3S 3COPA 1O2DA 2I6FA 2PPLA 4MMYB 4B2IA 4P4GA 2JCXA 4N6NA 4NENB 3M89A 1QG2A 2BI7A 1PEDA 2HRCA 1TEZA 2CXQA 1L5HA 3V80A 4DUYB 4L9SA 5IT4A 1RC1A 3FPGA 1WOYA 1X94A 1Z37A 3PRKE 4BHTA 5I51A 3IEIA 4L4XA 3UBTA 3PQFA 1F12A 3PCTA 4LRQA 3TNDA 1DC8A 4D45A 4XLLA 2FXVA 2YBDA 2GDJA 3E9RA 3GOHA 5IFLA 4B3GA 3O73A 4NCHA 2VPYA 4NQRA 2YV4A 5L3VA 3T7EA 2GZ1A 1WB6A 2GGSA 3QXCA 5JBNA 3GEHA 4WT7A 3VJLA 2B35A 3JYOA 5JYDA 5KAMA 1XP8A 4NJOA 5GIPE 3ILYA 4HEA6 2QUKA 1ONNA 3EIXA 3MIIA 4J9VA 1RZVA 2O3JA 1CZUA 3TSYA 3SKVA 1FFAA 3U61B 1NYTA 3UHFA 2Q49A 2R66A 4LZWA 4ILKA 1ARZA 3RC9A 1BWSA 3CKKA 5A5DA 3O7WA 3DE2X 3QGMA 1ZN9A 2V7BA 3IAUA 1J06A 2GJSA 1EZ4A 4HXGA 3RWBA 3HA2A 5AVVA 3JD1A 1HL7A 2FR8C 1IZYA 5DWQA 1IJEA 4ND1A 4NPHA 1ICIA 1CNMA 1M2JA 5EJFA 4ZVRA 5FHQA 3RRFA 4JT4A 3CW9A 3NW9A 2GAOA 3DL0A 3LIIA 5LQRA 1QTQA 3T3GA 4M0EA 3FLAA 1T9GR 3I72A 1Z8DA 3QF4B 4OQNA 6LDHA 3G1TA 3MELA 2I4NA 3F5MA 1FYWA 5JFTA 2PE5A 1XTVA 4F45A 3VTAA 2Z4TA 4JBXA 3QW2A 1CQWA 1GL9B 2NV6A 3DHNA 1PR4A 2QN3A 2O59A 4K88A 3MA0A 2X7JA 2WT8A 2HCFA 3DE0X 2H1FA 1DB3A 5LIPA 5LA6B 3HKCB 1X86B 1PT6A 1YZ3A 2C94A 1GZHB 3ML1A 3DDHA 4FR0A 5ALZA 3TINA 4RD6A 2P41A 3A31A 3PHLA 5DBHX 1N5OX 2M6RA 3FYUA 2GZHA 4PHTA 3DS8A 1XF9A 1IBKB 1UBGA 3UT5A 3CINA 3KUKA 5GV8A 1AXRA 4E0BA 1BN7A 3SM3A 1W0CA 3QBTA 2EZ9A 1RPTA 3FWHA 5F98A 4MS4A 2ZPAA 4O5OA 3C3YA 1Y6QA 1FTYA 2VUTA 3KTFA 4YCJA 2D4HA 2JLVA 3I9V1 4C7BA 2DBVO 3PD0A 3P0HA 2ZUEA 1Q50A 4D2IA 4JOBA 2WFAA 2BZGA 3B9RA 3L4EA 3DAFA 4FB5A 1VXRA 1BE0A 4NMMA 3VR0A 3WL7A 1RZRA 3D8TA 4OAPA 4RCYA 2FKAA 3CLRC 2YL2A 1OCEA 4H3KB 3ZOKA 1CUIA 1YQ9A 4B9EA 5IKMA 2Z2XA 1JFVA 3KKEA 2WHPA 4Y98A 5BWCA 3K09A 4IQFA 5HQ3A 1SVOA 3L7CA 1QU2A 3KHSA 5DNCA 3WGNA 4NVRA 4OU5A 5ITZB 1W35A 4RMGA 1M2OA 4RZUA 4WZBE 3S7TA 4YHHB 4HGPA 2H4JA 3TRDA 1O95A 4X3PA 5JS7A 3KP1A 1VIAA 4P32A 5EMJA 4OLJA 1VLVA 1LI7A 4B81A 1U2GC 4EHNA 3VQTA 1F5SA 1DL5A 1DXQA 3A6GA 4FOTA 5MFPA 4TLCA 4JI6B 3OM9A 4D8YA 1NW6A 4LJRA 1I1QB 2HSZA 1BDMA 2WWIA 1IN5A 1BS2A 4IJWA 4MVJF 3N2GB 2ONCA 3A9UA 3O4RA 2QPAA 1RJ9B 5J47A 2BUBA 2ZKLA 5K9ZA 4PX2A 1KMHA 3RK1A 4GOLD 5HSGA 1AQNA 1LLDA 2WWRA 4LK2A 4IO1A 2IS6A 1P74A 1RI2A 2H6EA 2JAQA 2PT5A 4RGYA 4DW8A 4EI8A 1XCMA 1OLSB 3HCBA 2FI1A 4JJZA 3TL6A 4RGBA 3S68A 1R5BA 5DK6A 3BCHA 5CFOA 2LDBA 2VF4X 1K92A 3U4DA 2V54A 3GZNA 3CURA 5DGIA 1NVDA 2G09A 1DNPA 1T43A 1NRIA 4B0OA 1FMJA 1I7NA 4BUCA 1OBHA 3NONA 4FDTA 3GK3A 5C32A 4NV0A 2NMVA 5SV2A 3TNJA 5J2TA 4WK6A 1LWOA 4EG5A 1LPMA 4OGFA 5F2KA 4QNNA 3FWZA 4F6LA 4Z54A 1QGED 1G21B 4NYJR 2DY1A 3MWEB 4C3VA 4W5OA 4YNBA 4AKGA 1L4KA 1ZC4A 4BZQA 2R84A 1RMQA 3OA0A 1FDTA 3LOUA 1N2CA 1G8MA 4AYXA 3AL0C 4QA9A 3V7NA 2QSYA 4P82A 4R2MA 1SELA 4ZQEA 3KSDO 4UZEA 1PVVA 2QUJA 1XN4A 1ECGA 2FPGA 5BQOA 5REQA 1NSTA 2EHDA 4QU9A 3BVPA 3OAAA 2YHSA 2I54A 2RAFA 3NJRA 4JN6B 4QARA 3U26A 4EQ6A 4DCPA 4MVJP 2H07A 1CDOA 2I3DA 4WXYB 4O25A 1RPAA 2E55A 3LUBA 4YDQA 3FUWA 3PYLA 1OLUB 3AFOA 1RXCA 4XWAA 1V43A 3REOA 2F3PA 2GR9A 1EQ2A 3N7AA 1PG5A 5F35A 2ZYHA 2XBLA 4EZEA 3RUFA 2YJZA 1O3YA 4GM1A 3M3DA 4BBZA 1ZA1A 3UM9A 4R51A 3HU2A 1TMOA 1RQNA 1G5FA 1X2EA 5HRAA 3BD9A 1QP0A 5AW3A 2D0DA 2V0NA 4G24A 4I19A 1DTEA 2XYHA 1O6BA 1DG9A 1EM8B 1GZ3A 1SG9A 1QGAA 4ARAA 1X77A 4ND8B 4AXBA 3BE8A 2VJCA 4GYYA 1TIBA 4C0KA 1LPSA 3QLTA 1VCMA 3BB4A 4TTQA 4E5PA 5EIEA 1FE8A 5FOUA 5GOZA 5BV7A 3AM3A 2PUFA 2FHSA 1UF9A 4U6QA 4RTKA 2JHAA 3KWJA 1L7VC 3QNUA 1DV2A 4M1TA 3ANNA 1ORWA 2FB9A 4IIVA 4U9HS 1G5TA 3G82C 3ZWDA 2OFOA 5HS4A 2JGIA 1L4UA 5EUMA 2UYOA 1SXPA 4O0LA 3OT1A 1E6CA 3PF9A 4WLOA 5AOVA 4BOYA 3KC2A 1EDZA 2PLRA 2YHBA 4MKGA 5IXSA 4CKBA 2HA2A 3CLSD 1LDMA 4R2WA 4ZGWA 1TQ6A 5DEIA 1N77A 4KWHA 3ESDA 3VTKA 1ZUHA 4NE2A 4BLWA 1OR8A 3I30X 4K05A 3FR7A 4LMRA 4YJ3B 1X0XA 3RLFA 7GPBA 4CBVA 1QGDA 3EIOA 4AKSA 4EGJA 2F3RA 3NUZA 1ZCAA 3K16A 4GYWA 2XRZA 2WMYA 5ALXA 2MMGA 1ZD8A 1NV8A 1GVNB 3GJ0A 2OHVA 2J9GA 1I2BA 3PX3A 1FP6A 4C6TB 2JFNA 1U0LA 4HUQA 4P7FA 4QUKA 4NCBA 2YFQA 4EY8A 2PEZA 4UU0A 3VPBA 1E7RA 2ANCA 1JJBA 3IKJA 4WK0B 1HORA 5A2QA 2GBFA 3AHFA 3TTTA 3LDFA 4INOA 2WIFA 1AU9A 1SCUB 4FI3F 4JZYA 4CLOB 1TFUA 4DSTA 4B44A 3LCCA 3ER8A 3O8DA 9ABPA 3KYIB 5KOYA 2A59A 3HYCA 3SDZA 5IJXA 1J70A 1O03A 1B26A 5LZ2A 3EDRA 2NYRA 5K0GA 4TS9A 2F3QA 4L6CA 4DXDA 1ODTC 3KYDA 1FXWF 1GJRA 3MINA 3NYIA 2QNRA 5FJIA 4DCGA 3FTCA 3I8SA 3T41A 5LM3A 1SIUA 4B4VA 4KIFA 1LQUA 4P98A 3SSNA 2NT4A 2ZREA 4AULA 1Q22A 4RJTA 1R10A 3R5TA 4P08A 4U0KA 1XNGA 5DNUA 1KFJB 4DRXA 3G1UA 3GLTA 4R9SA 4RDCA 2EJBA 1JQAA 2J7PD 4OI1A 2I3GA 1P1CA 4HP8A 1ZBDA 4DT1B 3K9QO 2HY7A 3PPYA 3TX6A 3MUOA 1JHQA 4O4HF 4HPWA 4RPGA 3TFWA 3V2HA 3R7AA 5GZ1A 3T9AA 2BMDA 1RJWA 2AHRA 1GSHA 1AA9A 2Y68A 5DP2A 1E94E 1Q0RA 2H2AA 4MUKA 3RD5A 3IE0A 3FHOA 4OHOA 4B33A 4BE4A 2A94A 4KQWA 3L43A 5F78A 3ZUGA 1P62B 2HU7A 3J80A 5IC6A 4ISBA 3B52X 4IYRA 3N0RA 3KQNA 1BG6A 2VP6A 2ZSFA 2J0VA 1D9XA 1MJNA 4CIAA 3QSYA 3AERA 4E1AA 4PG4A 3OHSX 3A4NA 5DYYA 1GCAA 3WMFA 2IU6A 1P3DA 4HUJA 1JVNA 4C7VA 1UQTA 3A4LA 4NPCA 1VPDA 1KPIA 5C52B 4MIYA 1V7ZA 1FU4A 4FSDA 1HE5A 3DKRA 3EXG2 3HKBB 3PR3A 4H6XA 1XAGA 2FZKA 5KDDA 2I65A 3ORFA 2A88A 4CQLA 4DDMA 4HNUA 1B43A 2HRZA 1ZA2A 3KOMA 3QXXA 2GEBA 3TOXA 2FJUA 1NN1A 2X1LA 3FTQA 1ORHA 2R4TA 3M0EA 1TCCA 1TUBB 2FSIA 1Z6TA 5BO5A 4QGSA 4EQZA 3Q15C 3EZXA 4KOEC 4JL8A 3ZIUA 5A02A 1XN1A 5JRDS 2D3TA 2GPJA 4MHSA 1SU8A 2YBEA 4H3SA 4NYMQ 1NVFA 2WAOA 4F0JA 1HYEA 1OI7A 1N5JA 4FWTA 3OF5A 3TAUA 2IXEA 1LTQA 1CJSA 4YPVA 5EWJB 4KC0A 1VM6A 2PVSA 3SQLA 5AOAA 3EZ6A 3PNLA 3QA3E 1NT2A 1YK0A 4PYIA 1J7JA 1IWOA 2X9LA 5CB6A 2JJ2A 3ND8A 2N1MA 1KJZA 4WESA 1GLGA 3EGDA 2FZVA 2EFGA 1L8QA 2HLNA 4LQ4A 5AM3A 3JQFA 1QHGA 1EWVA 1NMEA 5B1EA 4Y3UA 2AZ4A 2DUUA 4KTTE 5J63A 4DR7B 1QE3A 2A67A 3EXHC 3KQLA 4NBKA 1YBMA 3RFCA 1S01A 1CHDA 1IHYA 3PICA 4YRLA 1ZD2P 5DGCA 4P80A 5KSOA 2VJNA 1OFUX 3ESXA 4LJ5A 3OEHD 4W7SA 3WADA 4HB4A 5LOVA 3VKHA 3L8YA 1IM2A 2A0WA 1E0JA 3CHYA 3K8ZA 4GOOD 2Q3DA 4P7GA 4DF3A 1AZLA 5LR6A 4QT0A 3QG5A 5FI1B 5HE9A 2JANA 2NU6B 5H5JA 4XAQA 2R87A 3EVAA 4CQMD 2A14A 2MSEB 5EKDA 4F1WA 2O54A 3D6MA 4BJ3A 1CV2A 3CLUC 3NFYA 5AVYA 2TS1A 3ECCA 4BMXA 4JS0A 2IBSA 1CJBA 4AG6A 4KXYA 3N0WA 1NNI1 4FT4A 5AUNB 2C5AA 5ALIA 2FX5A 3K72B 4L22A 5CDGA 1E9SA 4Y6RA 4DDUA 5F3WB 1P5JA 2GN6A 4ZICA 2WT9A 4NJMB 3GQBB 2FJ0A 1NUSA 1UJMA 3AEUB 3LLUA 3NDJA 4M1KA 3P0IA 4RORA 4UHKA 3RYHB 3PXEA 3DTNA 3GFRA 4QLOA 3WNZA 4MVXA 4C78A 4Q9JA 2QQ0A 2IHYA 2GKGA 4JP8A 2VUIB 1MJHA 2XCQA 4DLKA 3PEWA 1CF9A 5ITVA 4RVDA 1DKNA 2FP4B 2TMYA 4J0JA 2RARA 1GL6A 1MFPA 2XQJA 4C08A 3MT8A 2WUDA 2PZ8A 4Y1EA 1I4EB 3QOYA 3T8YA 1O0BA 4M55A 1RLIA 3DMNA 1BFKA 4P22A 4MYCA 5I01A 2H0RA 4DMMA 3RR2A 3A27A 3B3GA 2XUPA 1VG0B 4I46A 4LMAA 1FNDA 2G06A 3L7LA 4BWFB 2HTEA 3CLKA 3QFSA 4E70A 4EP1A 2NSJA 3V1MA 4MKRA 2CV0A 4TSKA 2W90A 3FZYA 2CLLB 5KNDA 1OI2A 3K31A 3KAKA 1E96A 4DCCA 1P2BA 4BNYA 3EXIB 5KCMA 2VOEA 1NWHA 4UEKA 3LC0A 4BLOA 4B32A 5KTNA 4LE1A 2WJWA 5KNBA 1E1NA 5IK2D 4NE7A 3DFFA 4AWXA 3SYLA 3MB5A 2I2XB 5E6UB 2C2ZA 5JNVA 3CQ9A 3DZJA 4ETMA 2J4FA 3O47A 5EESA 3KZNA 4JI3B 3BTOA 4HG2A 2HU5A 2XCSB 3DV9A 1Z68A 2VSOA 3IODA 3KPUA 2RGRA 2YJTD 4GXTA 4EFKA 1Q84A 4MJ3A 4RHXA 2Y0CA 1R4NB 1WHTA 1JLLB 1VJ5A 2Q5HA 4IDPA 2HJGA 4M1YA 3GUCA 2UZ0A 1UMBA 4O4IA 4ZQGA 3N6XA 3ZE7A 1ATZA 1WQ1R 2HZ7A 4P4TA 3D3EA 3ZZNA 1QIGA 3F3SA 1U8EA 4ZJPA 2TRSB 3L4SO 1TPZA 4HXEB 2FNAA 3TZKA 3PQ3A 3IO5A 2B99A 3R7SA 4IIDA 3LQKA 3QHAA 4IOJA 5KJCA 1NDHA 1O5IA 1JB1A 3PRYA 4L0QA 2EXXA 4DCSA 1N75A 3LPCA 3P5BA 1A88A 4IV8A 3IDSA 1F2TA 2OVBA 2VZ0A 1IB0A 3LUJA 3PEFA 5IJZA 3EFOA 5TIIA 1F17A 1NOIA 2XW6A 3N0XA 2E5WA 1WD7A 5AKZA 3AF6A 1L5HB 4P9NA 2PKRA 4R2HA 5L7YA 1OFHA 1MO6A 4J4BA 4QRIA 1XMSA 5GZ6A 2V58A 2YVQA 3T5GA 1T0JB 1OFVA 2I87A 2W2KB 4FFSA 3LT1A 1Q15A 3AJ8A 4K81B 2HD4A 4Q82A 1VBFA 2AG1A 3KUXA 1C0LA 3DPSA 3KUCA 3RVJA 3OF3A 5LB4A 1SUCA 3GDGA 2ZRDA 1PJSA 1CP3A 1JIQA 1NLUA 4KNVA 4OB8A 5BNTA 3CW8X 2DERA 2A9RA 4H0NA 3P2EA 1V11A 2PBZA 4R9VA 4BQSA 2DWQA 2V74B 1JQKA 2HI0A 2ZTVA 3LH5A 4MITA 5AOCA 5LKRA 5MN4A 4KPUA 4XB1A 4LNUA 4EPRA 2HGSA 1MR3F 5JWRA 4KNYA 3WKAA 1IDOA 3F9IA 2Q7OE 2O57A 4B83A 4DWOA 1QIEA 3OIUA 1VL8A 3V8MA 4RIIA 4I50A 1N1DA 2ZYSA 4J2TA 3PWKA 2XTAA 2CEAA 3DM9B 5TT0A 4H18A 3OIWA 4AF8A 5EJGA 4EI9A 4N39A 3AX6A 4BEJA 3KSZO 4M2LA 1ZMBA 5TMBA 3SCZA 5A5VA 3H75A 2ICAA 1SUFA 3RSOA 5GAJA 2BELA 5KC8A 2O3UA 4WFIA 1CUAA 2WUVA 2Q3JA 2QR2A 3KBBA 5IH7A 3DWGA 1QPZA 2YQ4A 2ZYDA 3R09A 4P3NA 5CDSA 1N0UA 1Y4AE 5LQUA 4IQ4A 1BN6A 3AIOA 3QY9A 1UWVA 3DW1X 3KE8A 3PX2A 4FSHA 1P2GA 4HWRA 4LV8B 1R4MB 4RS3A 2WLTA 4U7JA 5KJ1A 2GQ0A 2GO7A 1GUYA 3Q6NA 4QTYA 4C22A 5BSHA 5ADWA 1TQ8A 4ZRMA 2WOJA 4LOHA 4EF4A 5EIXA 4KPFC 2WG1A 5DHSA 2CLFB 3EBPA 5H3CA 1W76A 4Y7CA 3T5AA 4BQRA 1CP2A 1XZGA 2AC4A 2C3UA 4CDGA 4CV0A 3CCCA 3ZVNA 4XWWA 1RBQA 3QKTA 1SXJE 4AKIA 4NBNA 3B48A 4XI9A 4CF6A 3RH0A 3KV3O 3LWDA 2R6JA 3KCNA 4MS4B 4A8JA 1RBYA 3MAAC 3QHPA 2J67A 1RLMA 1RWWA 1ST3A 2X4GA 3OKFA 1WA5A 1PGPA 2C2BA 2XADA 2XIQA 3SIPA 4I5IA 3W7AA 4DWVA 4X62B 5FLXA 1SVIA 4YP9A 3DDUA 5CT6A 3UQZA 3BGIA 3BFKA 2IVFA 3CS3A 4PZEA 3WB2A 1D5CA 5JARA 2C8VA 2IPXA 4M8SA 1NAIA 2R8BA 5DXFA 3EEFA 5JAIA 2VJDA 3HB1A 3K4PA 4U2DA 5A4AA 3R8XA 1RWPA 4IDEA 4EHBA 4TSFD 5CFMA 1AKRA 2E21A 2HT6A 4PSDA 5FP0A 1KR5A 2PLFA 4IPTA 3HUDA 1QUEA 4J07A 4XX0A 4RTOA 2PSJA 3O8NA 4RTRA 2ZRHA 2P1RA 3ZE0B 2DWUA 2YN0A 2OEPA 1M2OB 1VJCA 4QPNA 4G8JA 5BQ5A 3BH0A 5FUWA 1JI3A 1ZJYA 4AZVA 2HA6A 4Q3BA 4AN4A 1Y4UA 1P5HA 2GUWA 4FVTA 1UK9A 4RJIA 3ZBUA 4JV5B 4JHLA 4HB3A 3RRMA 4GNRA 3U3OA 3HNOA 4GZMA 3G2OA 1U0OC 1X1QA 3CLVA 4ALJA 3U6KA 1EUCA 3C3DA 1ML3A 1KMHB 3EVDA 2NO4A 1E3IA 1N5MA 2CFTA 3GZJA 2BZSA 2CHEA 4M60A 5L3QA 4L8YA 1H0HA 2QW0X 2REQA 3KHUA 2ID8A 5SYMA 4X94A 2M6KA 1TA0A 5K8UA 4HPJB 1TLTA 2IELA 3GZNB 4Q37A 4A15A 2VC2B 1E61A 3L3BA 3G79A 2O3QA 3UY4A 1RKXA 5FCDA 3RJTA 1GZ6A 4N9WA 3VHXA 4KN6A 3F3MA 2C3PA 1XRRA 5J2TB 2IC5A 5FO1A 1JQEA 3B60A 1XQ6A 1V26A 2BFBB 5FI5A 1U0TA 2PH1A 4LHWA 2EGGA 1BXZA 2A57A 5FOVA 1N2CB 2CXNA 2DBQA 2PBFA 1G20A 1UJ2A 3U3XA 5B6PA 2P4EA 2Q1SA 2IUEA 3ZI7A 1JHRA 3H05A 1PZMA 2PRZA 5REQB 4B4OA 3ZCTA 1YNSA 4E22A 4HXFB 4FJ2A 1IJKA 3G0IA 2O8NA 1WDMA 1FW8A 2IVZA 2WYUA 3MHPA 4MW0A 1Z62A 4KBGA 5H9WA 4OGGA 3VNAA 4E4YA 5AK6A 1YJCA 3NHYA 3SQMA 1XYVA 1NF2A 2AOTA 2QRHA 4G5SA 3TBHA 5I3CA 4M0LA 1JNYA 3FNEA 3G5LA 3W8EA 1G8JA 3RS7A 5C7LO 1GCOA 3WR5A 3O5AA 2Z4SA 3RS8A 3DCIA 2OCBA 3T3IA 1W1IA 1S2MA 2E4ZA 5CNIA 2ZAYA 1GDHA 2PSHA 3PKJA 4UBLA 4K0KB 3NT4A 8OHMA 1RQLA 1P7CA 2W6PA 2ZJ6A 3EW7A 1EBUA 1MX5A 4KDFA 2D1QA 5KVQA 2RHCA 3OPQA 2WKWA 2DT8A 5E7IA 2A7QA 3MW8A 4F3RA 2HXYA 5KQRA 2EOAA 2WMOB 5AVWA 1H22A 4EVRA 4BMPB 3K5IA 1K89A 3CVJA 1YA4A 3KU4A 1XBTA 4EMTA 3D6FA 1DOHA 3OE7D 1ONSA 1BH2A 3MPUA 1OHHA 1SZCA 3HP1A 1CRQA 1HEYA 2CJWA 1T34A 3ASVA 1QJCA 1CUUA 3AFNA 3CM0A 1EXNA 3LIPA 3AK4A