3I34X

Proteinase k by lb nanotemplate method after high x-ray dose on id14-2 beamline at esrf
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proteinase K
publication title Radiation damage study of Proteinase K at ID14-2 beamline at ESRF
rcsb
total genus 99
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3i34X00
3DW1X 1S01A 1KDYA 2HD4A 5AMXA 3DDZX 1EA7A 3F49S 5JMOA 1V5IA 1ZVKA 3QTLA 4BWGA 4DWWA 3DW3X 5JXJA 1PEKE 2GKOA 2XTJA 4CFZA 2PWAA 3I37X 1S2NA 1JEAA 4CFYA 3WIUA 2PMWB 1YJAA 4LVOA 1S02A 3DVSX 3QMPA 1OYOA 1NDQA 1GNSA 1CSEE 5FBZA 3VTAA 2WUVA 1OYVA 3ZXYA 2W2NA 1WVMA 1T1EA 3A3PA 3PTLA 1R0RE 1BH6A 1ST2A 3AJ8A 1NDUA 3CNQS 1ZVJA 1TM3E 3LPCA 1WMDA 2IXTA 4K8RB 1OT5A 1TM1E 1AQNA 4CG0A 4ZOQI 5I9SA 2IY9A 3AFGA 1AF4A 4OMDA 1C3LA 5FAXA 3EDYA 3ZXXA 3DE7X 1ST3A 1VSBA 4AKTA 1P8JA 1SCBA 1Y3FE 3F7MA 3WIVA 2ID8A 3LXUX 3DYBA 1SIOA 1GTJ1 2PWBA 3I2YX 4ZARA 1GTL1 3GCXA 2PKCA 4HX2A 1SUDA 4KG7A 1P7VA 4DJ5X 1AU9A 4H6VA 1SIBE 2Z2YA 1PFGA 1SUCA 1T1IA 1BJRE 3WHIA 2SNIE 1THMA 4NMXB 1SCNE 2Z2XA 3EIFA 3VYVA 1DBIA 1SPBS 2PQ2A 1Y3BE 1TMGE 1SBCA 1SUBA 3DE4X 2WUWE 3Q40A 3TECE 2Z56A 3I34X 3H42B 4YN3A 3I30X 1GA4A 1Y3DE 4I0WB 2WV7A 1TO2E 1YU6A 3SICE 5ARBA 1GTG1 3VHQA 1SBNE 3LPAA 1TM7E 4NE9A 1T1GA 3T41A 1TK2A 3A3NA 3EE6A 4KB5A 3DE5X 1HT3A 1AH2A 3D9QX 1Q5PA 1SCDA 2Z30A 2SECE 2WWTA 3P5BA 2W2OA 4HVLA 1Y48E 2DP4E 4JP8A 1GCIA 3BX1A 1PTKA 4M1ZA 5B1DA 1IAVA 1DUIA 5AVJA 3A3OA 1WMFA 3VSBA 3SQOA 1PJ8A 4H6WA 1WSDA 5ARCA 1SELA 4LVNA 2G4VA 1SBIA 2ZWOA 3GT3A 1Y4DE 1NLUA 2W2MA 2TECE 2Z57A 1R6VA 3DVRX 3WQBA 1SVNA 1SIUA 5FFNA 2HPZA 1KE2A 3TI7A 4KPGA 1TECE 5CW1A 1Y33E 4J94A 1TM4E 2SICE 3BPSA 4GI3A 5ARDA 1V6CA 1C9NA 2B6NA 5JXGA 4AKSA 3DVQX 3F7OA 5SICE 1UBNA 1IC6A 1TM5E 1GA1A 2ST1A 1A2QA 4WOCA 1MEEA 1KDZA 5B1EA 5AVKA 3QFHA 2W2QA 3CO0S 1CNMA 2PRKA 1GA6A 2Z58A 4RYDA 2Z2ZA 1AK9A 1SBHA 3DWEX 3AJ9A 1LW6E 1WMEA 2PYZA 5K7SA 2QTWB 3LPDA 4C3UA 3PRKE 4FONA 2DUJA 1SCAA 3OSZA 4DZTA 1SCJA 1Y34E 2SBTA 1P7WA 1AVTA 4C3VA 4Z2AA 3DE0X 4WOBA 1SN7A 2P4EA 5JXHA 1EGQA 5JXIA 2ID4A 1SUAA 3Q5GA 1BE8A 1Y3CE 4NE7A 3DE2X 1YJCA 1GNVA 3DE1X 1KE1A 1MPTA 1AV7A 3GCWA 2XRMA 3BGOS 3D43A 4MZDA 1C9JA 1GT91 1XF1A 1SUPA 1KDVA 2X8JA 1BE6A 1R64A 2V8BA 3GT4A 1Y1KE 1Y4AE 3DE3X 2ZWPA 1BFUA 3UNXA 3DE6X 1BFKA 1Y9ZA 1SBTA 3TI9A 4OV6B 1TO1E 4B5LA 4H6XA 3VV2A 1YJBA 2X8JB 2E1PA 1SH7A 5AQEA 2DQKA 3L1KA 1SUEA 4OMCA 3VV3A 2ZRQA 2W2PA 1C9MA 3HJRA
chains in the Genus database with same CATH superfamily
4FR5A 2IHNA 3MOGA 5GTDA 3DUWA 1DBVO 2RBGA 1K8QA 2G9VA 4GICA 2WYHA 1ZJJA 3PQ6A 3O4RA 2WZCA 2WMOB 4QUAA 1W7AA 1XCMA 1AMUA 1Q74A 2FCAA 3FJ1A 4KHPB 2VUTA 3VZCA 4BYGA 1FSSA 2PS1A 1T2UA 4OU4A 3SEZA 3YASA 5JFOA 2QD5A 3Q6MA 3N2ZB 2Q3JA 4TROA 4HNGA 2I4LA 5GJBA 3HFJA 3CS3A 3TNLA 3AI3A 2QVZX 4E6PA 1M5RA 2ACKA 3H2KA 4UVGA 3RIMA 4MQ5A 1EKXA 3P9KA 1F5NA 1R4MB 1FXWF 4XD2A 3RIGA 1Z29A 3SYRA 3ZPXA 4CKWB 1WHSA 3U48A 1NBWB 1NHGA 4N6OA 3AUSA 2VPIA 1OVMA 3H5RA 4MRVA 5TIIA 1IL0A 4OJYA 1GUBA 4N0PA 2FPGB 3M33A 4YB8A 3LGXA 1DKMA 3BIFA 2H1FA 1QGUB 3JAKA 3L3BA 1JYEA 4ITVA 1Y1RA 1B76A 1CQPA 1Y6ZA 3P2MA 1JI3A 4J1NA 3U3DA 3QFSA 4DVGA 1YJAA 1OA1A 9MHTA 1Q20A 2QUBA 3O8NA 1BWPA 2FFAA 3COZA 1OYOA 5FTKA 2UYOA 3A1EA 1M5TA 4M2LA 3C5CA 3AVVA 4UHEA 2A92A 1AS3A 1FP2A 1RCTE 3BWEA 2QYTA 3CONA 1I4DD 1BHO1 1W4CA 2BJVA 2OSVA 3IMCA 1G5HA 3EOAI 4J16C 4PX2A 1R9JA 4PS1A 3AV0B 3O0DA 4UQPA 5EERA 2BTQA 1NN5A 3GQVA 3E5RA 3T3IA 3TX6A 4IHAA 4CJXA 2E48A 4BE7B 2V3WA 4CCYA 1KQFA 4AFNA 4BFZA 2A4MA 1YR6A 3DAGA 1HLFA 1O5IA 4YT5A 3W2HA 4C08A 5T4BA 4K5QA 3WSTA 2H7XA 3PE6A 4KGVA 5JFGA 2DHCA 4E5NA 4L8WB 1PRYA 2RGYA 2VTDA 4QPCA 5DM4A 2ZQZA 4HDMB 1Z8DA 3T9AA 1UC4B 3AY0A 2VBFA 3BG5A 4DR2B 1EXDA 4ZOQI 1J24A 3KQNA 3JYQA 1RMTA 2IJGX 4QO7A 3CZ9A 4F45A 1JBQA 2VBGA 4KLCA 4ENSA 1DQZA 3H75A 2I1QA 4O4IA 3ZXXA 3U19A 3MRVA 4WCFA 3WMRA 4MB0A 4HFMA 4JCCA 1T9BA 3CRQA 3FVRA 2L82A 1ST3A 4P0PB 3H83A 1DBRA 3QVKA 4YAEA 2ZZNA 4N7MA 1CP2A 4OP3A 4HDRB 3IL2A 2NUTA 4NVRA 1JIJA 1SUWA 3CW9A 3MSXA 2H0AA 3H11A 3ZHQA 1D6SA 2R62A 4Q1DA 2A5LA 3CH4B 1DC7A 1QIDA 2MSEB 2X2EA 1S5PA 1GZ4A 1FP4A 1B26A 4R9VA 4UMEA 3KAQA 2VF2A 1ZH4A 2NOAA 4INJA 1SO8A 4EW1A 2XMSA 2R6FA 2B2XA 4OUDA 1D04A 1NV9A 3ANMA 3RSOA 4Y2JA 3SZ3A 3RPEA 4J1TC 4JI7B 1DRKA 2VHCA 2HRBA 4Z9AA 2OUKA 1ZK1A 2X0EA 1K5PA 3E8XA 3HU1A 3QBEA 2BR5A 2X8WA 1E62A 2Q2OA 1DADA 3WGYA 1QC5A 1IY1A 1GTVA 2XQIA 4AIRA 2AVNA 4DTIA 1UQRA 2RKWA 1TJ5A 3BTOA 1KH2A 3HL4A 1KEKA 1EAYA 1IOVA 1UAYA 5TNXA 1UH5A 2XD4A 2O8CA 1MA0A 2B4RO 3MMZA 1JEYB 2XRFA 3SQWA 5TB5A 2Z1MA 4KAJA 3ILYA 2XUJA 2Z2YA 5IYZB 1O9HA 4BKOA 4PLVA 1RR6A 1ECPA 4FGKA 4TV8F 3HXKA 1E0JA 3QFCA 3C5HA 2I2WA 3G0BA 3PDCA 5E6RA 4I1SA 2CL0X 3JD4A 2FLVA 2G76A 1L5NA 1THMA 3BL5A 4JT9A 8ABPA 3GLHA 4MW6A 1DQNA 1VHTA 3HWSA 4ZQGA 3WGKA 4BGIA 1JT9A 5I7SA 1UBFA 5JCPA 1H85A 3N7AA 1A9PA 2W8BA 4BB6A 4WX2B 4GSLA 5A1JA 3DNMA 1QRSA 4O2LA 5LMZA 3E9RA 2D00A 5DMXA 4ESHA 2XYVA 4J0CA 1GILA 1A0OA 1ZH0A 2Q4BA 2XCQA 3EWAA 4CKXA 2AKEA 3HFRA 3ZOZA 3GPCA 4IIUA 3CO5A 1NBMD 3ENWA 3TBHA 5ALYA 4ZQIA 2X1LA 3C3BA 1XG5A 4NI5A 1CUDA 2JHCA 2VF8A 5B64A 1P2SA 5LYYA 2GILA 2NTJA 5DWDA 3EDCA 3FF4A 4AG6A 2HCRA 4BO4A 5CFNA 5KYXA 4R8SA 3WL4A 3NAQA 5IZCC 3W5BA 1IEQA 1NXWA 4EQ6A 4JS0A 1ZZGA 5AJUA 4ND4A 5F35A 3VNSA 3W9BA 1E60A 2EJUA 2QIOA 1ID1A 4LJ5A 3UK0A 1USIA 4P2BA 1T29A 1WDMA 4KQXA 3KB1A 3SI7A 4O4HF 2V55B 3IE2A 3VHQA 2OV3A 5BYAA 3GWZA 4NPHA 4J43A 3KT0A 3OKPA 1K6MA 1LVHA 4TLBA 3PNKA 4KWHA 4DMCA 5FX2A 5KU7A 3SDZA 1D2MA 1GXSA 1J56A 3EE6A 2MOKA 4IQFA 4MSUA 5ADUS 1KBOA 4E1AA 4JLJA 2WMYA 2YXPX 3HBJA 3O1LA 3SM9A 1TYZA 3A2MA 2ZRAA 4JLOA 2OYSA 1CEYA 1BX3A 3JQFA 5U4QA 2G5PA 2A9FA 2A1TS 3K1ZA 4Y2RA 4ZCRA 5A3RA 1WMBA 1KSFX 1RC0A 1SB9A 2XZPA 3BRSA 2H2DA 1UODA 2C04A 3PGVA 3TR5A 2RHLA 1WB6A 2OAQ1 4KXMA 2PU5A 2CFTA 3NQ41 2MCFA 3KUXA 1UEXC 2PS0A 5JNRA 1UJCA 3ACDA 4UHCA 3UC5A 4CMCA 2B35A 2PBRA 3JQ8B 1WCYA 4TKLA 2J08A 4JQSA 3MTBA 4KYVA 2BPOA 4EUKA 4EJMA 2UYGA 4A6DA 5IEJA 3GU3A 4AKHA 3DC7A 1UUFA 1KH1A 3EIHA 4LY0A 4U2GA 3NALA 1SUIA 1I7DA 4XWOA 3D6MA 1B7GO 3ZDRA 4DG5A 4C0BA 4X1KA 2YMQA 2ORED 2ICAA 3N39C 1ZNXA 1ND5A 4JODA 5DNCA 1W25A 1Z7YA 2WQ6A 3ABZA 4OQLA 2OB1A 1EVEA 4MV8A 2ZI4A 1C0PA 4WUVA 1IY0A 3OQMA 4C4TA 1NI4B 3SU8A 4CCAA 4I6GA 4R2JA 4RGQA 4KX5A 2NU8A 1OAOC 2CUKA 4FSHA 1XJ0A 4AZTA 1XVAA 3N28A 4EB3A 1EXNA 1LPOA 2G08A 4QXMA 3UICA 4JJFA 3VYWA 5REQB 4BVBA 2X3YA 4BO7A 2IOYA 3USCS 2GJKA 4AAYA 1LK0A 4FHZA 4GBMA 4WFKA 3HB4X 3FDJA 4K9KA 3NEYA 4UVIA 2JJMA 1AB5A 1LS6A 5IWCA 1AE1A 2Q2VA 1P4SA 3ENQA 1NBHA 2INGX 2XQFA 5EQJB 1F2DA 2HWXA 4I55B 2PGDA 2EYUA 4I8DA 4Y9UA 5SY4A 1YZVA 3GT3A 4DSAA 1LWNA 1QQ5A 3U0BA 1HA3A 1OE0A 4CMJA 2Y1OA 3BICA 4TKZA 2NVWA 1Z37A 2N9UA 1EZ1A 3HB1A 4Y9DA 2YC4C 5TT1A 1Y81A 1AHNA 1RLIA 2JATA 4MVJP 2XNHA 2ZR8A 1G5PA 4ND5A 5D5HA 1EK2A 4GXRA 1O6CA 1TEXA 2MR5A 4B8WA 3JQDA 4ZZ2A 1KAHA 2N46A 5IK2D 4S35A 1R6VA 3EGIA 4X8HA 3G2PA 3EXHC 2ZVPX 4ZC1A 2YIDA 3PUYA 4UJ3A 1CUWA 1TTPB 1DQYA 1FDVA 4L4ZA 2PN1A 4R9NA 5AI4A 2JA1A 1KOGA 4J6FA 2JLUA 4FB5A 4EJSB 2DCUA 1XIVA 3TLMA 1FC0A 3R3XA 1AQLA 2IW1A 3GNQA 1JS1X 1T5DX 3K1AB 4ZAZA 3A11A 2UVDA 1N0VC 3C3KA 1TECE 2H9YA 2QM8A 3BXPA 3ZLTA 1Y33E 4AUMA 1G64A 2QDXA 4G9GA 1LBIA 2DSNA 1GPAA 4MVJH 1MV8A 1YC2A 2A5GA 4KAAA 3IILA 4YYEA 4F4CA 4GE3A 2OGUA 4ZRMA 3B8HA 4N7RA 3NHYA 4D92A 2QD2A 4DM4A 5LPNA 2NU7A 4MJLA 2HF7A 4KQCA 4ZGGA 2K7ZA 1ZW1A 4W8GA 1GRCA 1UWLA 4EVSA 3C8ZA 3BXFA 3ROFA 2EC5A 5JNSA 1WB5A 2CXHA 3R0QA 3V55A 5ES4B 1PJ2A 2GWRA 1R6DA 1JSZA 3GPDG 4K8OA 1IH8A 3MTJA 4PQGA 3KQMA 3T1HB 3W7AA 1J8MF 1K6XA 3PQ2A 5DI3B 1LI4A 3QOXA 2NAFA 1JQDA 4C7MA 2DC1A 4RM2A 4C6RA 3SG0A 3DBHB 4M9CA 3I9JA 3X1YA 3VPXA 5JNWA 3PIRA 3SK0A 1S8OA 3ZHRA 1D2EA 2C3UA 2NUAA 3I0NA 3PD0A 3QTTA 1N9KA 4RZ2A 5FWYB 5DGTA 3B51X 1LH0A 1QJ4A 5H81A 2IS6A 2HA3A 5ITSA 1PT9A 3H2GA 3VQTA 1RJ9B 2AF3C 2NTVA 3KVOA 3SC4A 2D5LA 1SHJA 3QKWA 3PUKA 2XV1A 1T8TA 4TMXA 4U9UA 1S4QA 2SKCA 2BDTA 5DF1A 4W7SA 1NP6A 1UBJS 2XX3A 3BF7A 1FFSA 1XXHB 2YDYA 3KSBC 3SXUA 3I5XA 4L78A 1GNRA 4BASA 5L8VA 3U39A 5KVSA 1V5GA 3PQ8A 2I62A 2ANCA 2PL1A 5IHXA 3OCJA 1DG9A 2WM8A 3TUJC 1NUQA 4UZSA 2QHXA 2DRIA 2FZCA 3DR5A 1CZLA 4N9WA 2CD7A 4EW2A 1JKJA 3EAFA 1U0SY 3OZWA 3P52A 5KSPA 4B3BA 4KPYA 2Q2NA 4GQIA 3CB4A 3LT2A 4JITA 1YWGO 4UUNA 4Y8VA 3HCDA 1IQRA 1FYEA 3EQ2A 1UBEA 4QT0A 4QPZA 4RH3A 3UUFA 5ICGA 3PI7A 4X92A 4X7MA 3V8RA 4OLBA 1GL7A 3KKQA 3L84A 4X66B 4LYHA 3PEWA 5J3JA 2CW5A 4FBMA 2OCPA 4OSOA 2OYCA 1E20A 4RVDA 4CUZA 2K6GA 3IEXA 4J16A 1N5LA 1F7VA 4QYSA 1Z4LA 4WESA 3GUZA 4AW9A 3L8CA 3RRJA 1JV2B 1O97D 2B83A 1SKUA 2Y1DA 1BEEA 1TTQB 4JBWA 1T1RA 1T24A 3RKSA 3O7MA 1L7DA 1SHUX 1Y42X 4R1NA 5JXHA 2IPXA 3IT0A 4B3XA 3ZJUA 3BXZA 5LU8A 1L7BA 2D2IA 4MWOA 3W5HA 3BH7A 4BJHB 1BVHA 3HRIA 4XGNA 2OCXA 2O8BB 1GCUA 3E81A 3G0CA 1IAQA 4LY6A 4DFDA 4FOSA 1NI3A 5AJWA 1OSNA 3DQPA 4J29A 2C98A 4CT5A 2FQYA 2OT3B 2PG3A 3M3HA 4L5IA 4M1OA 3B3QA 5LQCA 3LCVB 4DR3B 2E7ZA 4JLVA 4LXHA 5ECYA 5K0SA 2CVHA 1L3CA 1P2TA 2I8CA 1EDZA 3WV4A 1YDWA 3RW9A 4EATA 2YJZA 1W0KA 1E8NA 1JJIA 2UVPB 3MJVA 3VBCA 1ZWKA 4M22A 5JYEA 4UAJA 2OSBA 3FYCA 3GJYA 3GO4A 4NU6A 4QDXA 1ZHOA 1EWKA 3VPDA 2XR1A 2IELA 4EGCB 1Y5IA 1IQ0A 3EUWA 2V7TA 3IEPA 4N7JA 4CZ2A 2I8LA 4DWJA 5AVQA 2AS0A 5UKDA 1RXEA 1UJ5A 1YRAA 2J5QA 1J8DA 4HXGA 4Q9HA 1G6KA 3P26A 1NVWQ 2RG7A 3CLHA 1IHUA 3H3XA 2VJCA 1H23A 4XGKA 1A04A 1D09A 2GYVA 5AVUA 4QYIB 1JIKA 5FFFA 2BKUA 5FP0A 3PWTA 1MMFB 2A0XA 4FGLA 4B1FA 2ZE8A 3PFGA 1CY4A 2D7CA 4C21A 2GARA 4PICA 1WSAA 4J1TA 1N77A 5EJFA 2GJSA 5P8WA 1HTTA 3M3DA 5FQNA 2QR5A 3H87A 2ZJ0A 3F5MA 3T5CA 2A5FA 2FKNA 1NSYA 2CXUA 2P0EA 3RUCA 4AJLA 4G2NA 1G1AA 1LC3A 4OKNA 2ATVA 5EZ6B 3TL6A 4D5GA 1ES9A 1EP9A 2B5OA 2BE7A 1C1XB 3ZQ4A 5CB4F 4UU7A 3DOUA 3GG9A 4KUEA 4ER0A 3U4IA 2W83A 4QQNA 1NX9A 4XLZA 3F3KA 1P7PA 3RD5A 1OTHA 4O63O 5AUNB 3BOSA 2JLZA 3LQYA 4EHFA 1FJXA 4LUCA 1YRLA 3N2GB 5LYJF 5FJIA 2X8LA 3HKCA 3E6AA 3DKPA 2C99A 1TO6A 2Q4RA 3K4QA 1XD9A 4YAIA 1N3IA 4W6ZA 5E9QA 5BSTA 1M72A 3C6XA 1MO2A 3RJMA 4NRDA 2BFMA 4ENPA 3ZJ4A 1BEUB 3BXOA 3PGJA 1WCWA 3C3CA 4IG9A 4QHYA 1TEVA 3QUAA 4CEHA 3C6YA 4C29A 3HCWA 4X1YA 5LZ7A 5ALXA 2C7QA 3U9SA 3AQ4A 2CWWA 3LNCA 1UBCA 4MMYB 1OX6A 2BUCA 4QOEA 3SPXA 4YDQA 4OL9A 3PJDA 1PX0A 1SIWA 4KQFA 1RWQA 3FM9A 5F2EA 13PKA 5AVVA 1HYEA 1RADA 3QE3A 2IEZA 3QPUA 2F00A 3IAEA 4EBBA 3BMXA 1TW3A 4MK4A 4Q4JA 2J85A 3OE4A 2O8EA 1LGYA 2XOKA 4KBYA 4P32A 2O7RA 3TTTA 2XKKA 4TZ0A 1XA3A 2QUHA 4AO7A 1G20B 5KTMA 1S2GA 5L3ZA 1CYEA 2Z1NA 2FETA 1N2BA 2EXXA 1QBGA 1UP6A 1EA7A 4M46A 4LN1A 1FMTA 2UAGA 3F49S 1E1MA 3P19A 3MFYA 3PYMA 3QVOA 1JQ3A 2PYIA 3L7OA 5AKIA 3EC2A 4YV7A 1O9BA 4IIFA 4XQEA 4G9BA 2HN9A 3U3ZA 1P0QA 3RODA 5CPFA 3V2UA 2GM4A 3JS5A 3MUEA 1X9IA 4PAQA 2ECQA 1LD3A 3O95A 1YFJA 3HB5X 1Q0HA 1I3LA 1DT3A 5AK5A 4EMBA 2DERA 2HDOA 4U00A 5JSZA 1OZ0A 4BN5A 2CVOA 4OM8A 3D0QA 2O5EA 3UCEA 4WXPA 4CFYA 5KPJA 3T6KA 4YJ3A 3OT4A 2ACWA 3N0VA 4CTMA 4YIKA 2QBYA 1LB1B 4LAFA 3HGTA 4MVJI 5HHTA 1QX3A 2MYPA 4HVLA 1M1YB 3NETA 1ECFA 1RHJA 4EY5A 3ZDXB 2Z0MA 4L95C 3DTVA 4W1RA 4AQDA 3RBVA 3CXRA 3RR2A 2YJNA 1K63A 3LKZA 3TKLA 1UJ4A 3IURA 3P0RA 2HLHA 5KINB 4N41A 1Z22A 1KI2A 3C8DA 3ZLJA 4G0WA 2ZSFA 4D8XA 3A26A 1NASA 4FYIA 3WGZA 3U5TA 4KVGA 5IG2A 1A9XB 2J9XB 2W2NA 4V39A 1WVMA 3T7TA 3UAYA 4DJFC 3PTLA 4TLCA 4ETNA 1I2CA 2FWBA 3FI0A 5H02A 5A03A 2AF4C 4FT2A 5AESA 5A5VA 5CG1A 3GEPA 2QYOA 3OZXA 4MEAA 3L1IA 1DU4A 5F76A 3G1WA 5JYBA 4FYKA 3U9TA 3F73A 1OAOA 2CYCA 3ZDDA 3DOJA 3U4CA 4AYXA 4I2NA 4B6QA 1YVRA 4BO1A 1M2GA 2IY9A 5JI3E 5ECWA 4OMDA 1C3LA 2H2HA 2IHZA 5J2TF 1X15A 2RHMA 5LZ8A 1UK7A 4CDMA 5JJ5A 3VAAA 3F98A 5K0NA 3DE7X 3GY0A 2ZITA 1GPWB 1JKMA 2VJMB 2QIPA 4WBNB 2CF6A 4Z1MD 3NIGB 3PC2A 1XQ6A 1Q1EA 3DEKA 4B6EA 3VC2A 1U7ZA 3F90A 1MG0A 4GX1A 2JAQA 4H4CA 4HX9A 3TSAA 3VI3B 9GPBA 3E1SA 1DC6A 5DSXA 2ID8A 2FV8A 3G0HA 2XA2A 3RJTA 2P1DA 5HE8A 4FWBA 3LX6A 3ESDA 4AP5A 1ZEJA 2DQYA 3HWX1 1PJQA 3MNFA 2D5AA 3VPFA 1MUUA 3LLMA 2IYQA 1QLHA 1VJGA 3BKWA 1Q1AA 5BYKA 2H08A 1OYWA 3NHAA 5KYTA 4CM7A 4HK4A 1KS9A 4I4TB 3CMCO 2PMEA 1DTWB 5JMTA 4OY3A 4AJ9A 4BRZA 1R6AA 1X7ZB 4R0NA 4CGZA 3U6KA 2Y05A 4L4UA 3A6HA 4RLQA 1OCEA 4JKOA 4JQYA 2XF2A 3BXGA 1COWD 1GPMA 3EXHA 3OIVA 3LKVA 3LUCA 3ORYA 1HRKA 3IEIA 4J0GA 1XC7A 4MLPA 1S9DA 4WW0A 2V7QA 3NGMA 1QLJA 4MRMA 5AVYA 3E9EA 2P9ZA 4IS2A 3RC8A 2REQB 4M8NE 1R16A 1BDJA 3BRWD 4H7EA 1FS5A 4BMCA 4RD6A 3F1LA 1H66A 1T1IA 3R4CA 1G8YA 2EDAA 5DX0A 3B2NA 3D0RA 1PVVA 4JFAA 2ZUBA 4K9RA 4F4JA 2J30A 5CGQB 3R8FA 3KCQA 5I4CA 5A7HA 4BJ1A 1VHJA 2AFVA 3S70A 4LNAA 5HRCA 3MOIA 3CWQA 4LFBB 2RAPA 3UYLA 4Q4CA 4ZVPA 3RSZA 1GU7A 4M76B 2VL7A 3CSSA 2CL5A 1U6JA 2DTXA 4I36A 1Y5NA 2I2FA 2PZLA 2WU1A 4YJHA 3EWNA 4QGFA 4ZI7A 2J3HA 1N5KA 5DI9A 1DP4A 2AKYA 4IDBA 3ZW8A 1HR0B 3ZYZA 4CEJB 4BIIA 3PE3A 1ZBDA 3T4PA 4YUAA 4ZO9A 1EFCA 2NX2A 1YB7A 1ZK4A 3TIFA 4D9IA 4RF4A 1UFKA 3BGWA 1XTPA 4NMMA 5DK6A 1I0ZA 5BV7A 5HKOA 4Y67A 1USGA 1Y1TA 3MPUA 4HEHA 3W8EA 1TIKA 4B33A 4N5LA 5KQPA 2F1IA 2BGJA 2AG5A 1BEZA 4YN3A 3FMOB 4WA8A 2V0CA 4M53A 3CKKA 2FEXA 2PKEA 3OE5A 1EE1A 1HWYA 1Y3DE 2UDPA 3G8BA 2HF2A 3PIIA 2C3OA 3QLUC 4XVRA 1N9GA 2Q6KA 4P3PA 2FFBA 2DY0A 5KNCH 1IUPA 2J0UA 4OI0A 1TF7A 3ETHA 1J22A 1L8XA 2FMFA 2IYEA 3O4GA 4J76A 3Q72A 1I94B 4LF6B 4MULA 1KAGA 1Y9DA 4UOQA 4C06A 5KNLA 4PIPA 3T41A 3WOHA 1MZPA 3SC2B 1ZR2A 1BROA 4G25A 1W94A 5GZ3A 2AKAB 5DYTA 5H9VA 2I91A 5GADl 1F06A 2CFOA 2O2YA 4U39A 2GBFA 1MLDA 1ZESA 5F5XA 4ZT7A 4BE4A 3KJXA 1QYIA 4IH4A 1AGPA 4PANA 2F8LA 4DGSA 1EP2B 1Y1QA 2D13A 1NNI1 3FHOA 4JGIA 3WP1B 2FH5B 4B74A 4N8SA 2SECE 4QREA 4J0EA 5FUQA 1AKMA 1WXQA 4UMVA 3BTSA 5EZYF 3LSYA 4R1PA 3FHLA 3DBRA 4PIMA 3RQSA 1E9RA 4UHHA 1FP6A 1W2HA 2FZKA 1C4XA 1L5RA 3EGDA 1E1QD 2ZVDA 3KD3A 2CZCA 3NTRA 5L3SA 2Z9CA 1IWPB 5H68A 2EX4A 4FUTA 4NBSA 1EA5A 4R9RA 1MXHA 4AMVA 1XAIA 4QUDA 2FFHA 1MBZA 1E3WB 2G1PA 4B3DA 4JB8A 2AZMA 5CCEA 2B0JA 1UFQA 2G9NA 2EZ9A 4M1ZA 3NC0C 3W4KA 1H2ZA 5IMSA 1ZOIA 4DILA 4E4TA 4P1ZA 1DFGA 3WZLA 2OK8A 2GLTA 1YOVB 4KQ9A 3IQDB 3TIXB 4E46A 1WMFA 4FYHA 2IF2A 1WVIA 1AKVA 3OTHA 1ZGBA 2PZAA 4D99A 4B35A 3IBFA 3EGEA 2SHKA 2WF7A 3LX8A 4XWGA 4FHGA 2JBWA 1XEWY 5HDQA 1CUUA 3TGLA 3OJOA 2XWBF 3JD3A 3LYHA 5TGDA 5CCBA 3T3OA 4DL9A 4RA9A 1GRQA 4PSUA 4OVKA 5ALPA 5ARCA 4Q02A 1SCKA 2VHYA 1M34B 3HB9A 4CEIA 4XX1A 2JC3A 3C4JA 5IULC 3D31A 1DBPA 1HORA 4IDEA 2FUCA 1NVEA 1NQ5A 4Z8XA 3WGHA 5A5FA 1G2QA 2GWHA 3A31A 1A76A 1MORA 3I42A 4OU5A 1CRZA 2BFFB 3KSZO 5TQ2A 2Q4DA 1U8ZA 2BJHA 2JJ1A 3GIWA 4EFDA 2F3TA 1P3Y1 1VZ2A 3KO8A 3MD9A 5CNKA 1VB3A 4U9IS 4HXEB 3WK4A 5BYBA 2HRDA 1CJKC 2QRUA 5CDUA 1QCZA 1ESZA 5AK6A 2Z57A 4FXOA 1Y9AA 2TS1A 3EIQA 3ZWQA 4DB2A 2W00A 4XCQA 1FFBA 2PA0A 1PL8A 2WIJA 4B3TB 3ZK9A 2AOUB 4LV5B 4A0GA 5C5DA 3N76A 5JWOA 2YV5A 2J0QA 4R8LA 1JZTA 5FL7A 5ALLA 1YSCA 5FFNA 3TTUA 1YR3A 3O1IC 4PG5A 5ESXA 5EZSA 1Z5UA 4COOA 1OA0A 1A82A 2R1ZA 3PGMA 5KQGA 1FLDA 2B36A 3G1UA 1P1RA 3V3TA 1JQ5A 5CD9A 5ALHA 3W6ZA 4HVCA 1NUUA 5FI1B 3R41A 2I80A 1XVIA 2GXUA 3MWDA 3ROXA 4RJLA 2QQ0A 1ZICA 4Q39A 1T36A 5LJIA 1ZHFA 2C5GA 1EAMA 2P4SA 4FFBA 1F6WA 1RIIA 4YEDA 4E7PA 4DSTA 3A1VA 3LLVA 3X1MA 1XHLA 4RENA 4BMXA 4MDEA 4OI2A 4JUBA 4LOLA 4URYR 1V1RA 1YB4A 4CIXA 3PJEA 2QQ5A 4EPXA 2F3RA 3AHHA 3SZMA 5KOHA 1T10A 4HTFA 3LQQA 2O0HA 3U7FB 4H1UA 2BFOA 2G70A 4RK4A 1ZGJA 4RLHA 4BQOA 3CVYA 4I5FA 2J9RA 2JH3A 2WEKA 3QK7A 4F2HA 1NW8A 2J4CA 2EP8A 2QQEA 1CY7A 4LOHA 1G21A 1U7WA 4CT0A 5C46F 3W1VA 5KNCD 1RQ7A 3BEDA 1H3EA 2V9CA 4O2AB 5BO5A 2CXRA 5CLFA 2HDNB 2PUTA 1HG0A 1CUIA 3MQFA 5ELLA 1ZG3A 4YXFA 2BZ1A 1W76A 3VUEA 1QVWA 2C94A 3BJRA 1W48A 1NBAA 5EFZA 3AU8A 2FW7A 1GZVA 2W48A 2E1RA 4AP9A 2AOVA 4UTRA 5DJ5A 5KYWA 1DKOA 3T5DA 2JAWA 2XRYA 1CNMA 2V59A 2VRCD 2PRKA 4UBIA 4DCSA 4WZAB 1WG8A 2X5NA 2OQRA 5F7OA 3DEYX 2HQ1A 4U2CA 3MN1A 5AM0A 1NKTA 1RP1A 2W2LD 2HA4A 7ADHA 2FQ1A 2GJ8A 2IIBA 3LC2O 2BR4A 3R7FA 1YJXA 4RULA 1ZN2A 4IRXA 5BR7A 4ANFA 1M74A 5K7SA 1V3VA 5CITA 3NATA 1UJMA 3ZWCA 4UPVA 3P97A 3HP4A 2OLJA 1RWNA 1TYEB 3D0KA 3EVNA 2DUJA 1TYAE 1S2LA 1G291 1OPRA 1QCYA 2H5EA 2JI4A 2ZFUA 3KXLA 1P4JA 5DGXA 3JU3A 5FNVA 2ZVJA 4FIZA 4D74A 4W5RA 1QP8A 1YULA 2LGJA 4RPKA 1F9AA 2HNKA 5I8WA 1JIQA 3UUEA 1R27A 1IIRA 2FTKE 4B17A 3LHFA 3Q7EA 4OMFG 4Q3NA 4EG3A 1C81A 3LA6A 3SZOA 2L2QA 5EOVA 5F2OA 4C4RA 2FPUA 2FMKA 2PUDA 1D6MA 5I48A 1U11A 4KVAA 3D8NA 2ZYSA 2WA2A 1NTRA 2X6RA 3DE0X 4WOJA 2OCAA 3OVMA 4H7IA 5F1YA 3N2KA 4YHHB 3VVLA 2GM9A 3ZHOA 3ECSA 5LLSA 3BK1A 2V6JA 3HKDB 3RREA 3QQ5A 2WE8A 2BM1A 1JILA 1DDGA 3C2QA 5JSKA 2OVBA 4WKOA 3RRMA 2HMTA 2ISQA 3PFFA 5J5CA 3ERCA 2ETXA 1KHHA 3G0OA 2I76A 4JJKA 2Q41A 4EJFA 3TL2A 1JVBA 1EP3B 2FHPA 3ORQA 4ZVRA 3U3RA 3U4QA 5HUHA 3IH5A 3LPLA 4D6YA 1BE8A 1NOIA 3DMGA 4DCNA 1GSIA 3OY2A 3DXYA 2XITA 5CNIA 3R3WA 4W5OA 2NNWB 3ROEA 3UG6A 1J6UA 1ZIPA 1ZW6A 3QWFA 5F23A 1CQJA 1YJCA 2ID9A 5HGXA 1U0HC 1NVUQ 5JANA 1WPGA 1PI3A 3WQQA 4HH0A 4C6TB 3QSYA 3KHUA 2I2CA 4LGCA 2QMYA 2TSYB 3QP9A 3MJEA 4EJSC 1WXXA 2QN2A 2ZJ4A 3O91A 1X7WA 3HMQA 1YGYA 4IFTA 1P73A 1QQTA 4NYMR 5KYYB 1IWBB 4NH0A 2FPIA 1AHHA 1O6BA 1JXAA 1V26A 3ZV6A 4DWVA 2F17A 3DYVA 4W82A 4C4ZA 2R6HA 4L4RA 4YMWA 4XRGA 3TSWA 5K6TA 4MDYA 3OQ1A 4PCLA 5F4BA 4F8JA 2JGIA 5IFLA 1MJGM 3JARB 1PGJA 4HY3A 3ZVLA 5JRDS 4R1TA 1QLWA 1SUPA 3S5UA 3W34A 1QU2A 1JJBA 1YA8A 1Z0FA 3A28A 3S4YA 3V4SA 5HVNA 2MSLA 1D2NA 3TOCA 3Q3IA 3SJCA 2QG4A 2AK3A 3D3WB 2BHSA 3WMXA 4E5UA 1L9KA 1AF7A 2XUDA 5GONA 3RYIB 4ER3A 1JECA 3I3SR 2TRSB 2Z6VA 3K16A 5KTNA 1SCUA 2Q99A 4TKMA 1GQ2A 4A0RA 4AI6A 4R1LA 1PNVA 4CM6A 1XFAA 3PUHA 4W7HA 4YONB 1ULHA 2CDRA 1K5GA 2BSAA 2WICA 2J67A 4AF8A 4JL5A 4IICA 2WFLB 3Q0IA 2X8JB 4KTVE 4DEVA 1UKCA 1HOTA 3KYDB 3ZHCA 3COPA 4NE2A 4TTJA 1FLAA 4PRLA 3VA7A 1UJNA 1W49A 2GVDC 2VQ3A 4PYLA 1QIHA 5KPDA 2CZQA 4E5KA 2QL7A 3QX9A 1XB2A 4K9LA 1T15A 1ZR4A 4YBRA 2PJDA 1NJ2A 2ZRQA 4YAGA 4BDTA 1Q0UA 1DO2A 3LFUA 3FCXA 5BOSB 2CY0A 1R4MA 3PFKA 3DW1X 3JWHA 2YW2A 4A8PA 1Q92A 4X5OA 5I7FA 5KS2A 4CKWA 2QUKA 2WWGA 2UXDB 3Q6IA 3R5TA 4BC0A 2C3YA 5KOJB 4MUJA 3FZEA 2OZVA 4TUYB 5K8TA 1QU3A 2GNOA 221PA 2AJ8A 2HHAA 3DDZX 1N2SA 2IP1A 2R85A 4JEUA 5EJ2A 1CZKA 2ZDHA 3VO2A 4F46A 4YMTA 4A6EA 3Q7SA 5HJ5A 2RC6A 3B48A 3F6YA 2PGAA 4X94A 5E0KB 1S3IA 1RYNA 1ZI6A 2HJGA 3QLUA 4ITRC 5EIAA 3INRA 2FSIA 3DAOA 1VMAA 3VZBA 1S3FA 4WDQA 3CZRA 3K73O 3TE7A 1FBTA 3OUUA 2F55A 1YZTA 3IUNA 3LUFA 2FPMA 3E3NA 3M6AA 3QOFA 1PFWA 2AXQA 3R40A 4RIGA 2FB9A 2D0IA 2HJ9A 2CCJA 3MCVA 1S2NA 2QSUA 3EIXA 3M1AA 3KQHA 4LI0A 3ZCSA 2XB2A 1KYTA 1WLYA 4JUFA 4CLRA 1RPZA 3W9YA 1LPSA 2YCLA 1HZJA 2JLQA 1E9BA 3DCJA 3M6IA 2YIVX 3RTBA 2D4AA 5CH3A 4EZIA 4B4VA 1JJ7A 5TEWA 5EJ7A 1TJNA 2COEA 1OKKD 4LX8A 1CJCA 2BGMA 4GKVA 2ZRKA 3A2KA 2PFSA 1HH4A 2H5IA 2PMKA 2V0NA 2FEWB 2X6TA 4HDMA 1ZWLA 3NJRA 3L0DA 4G4GA 3BMNB 3ONEA 1CSEE 2VZ0A 1JG6A 4JOCA 3G2OA 4D3XA 2P6RA 5LFAA 3D6TB 4TS9A 1QKIA 4JR2A 2VVTA 3DR3A 1TM2A 4AMZA 4HWPA 3TOXA 1H2XA 1PSDA 3PJGA 4MR7B 2R6DA 5KJEA 3WXMA 4HWTA 5BV2P 3QVWA 3A3PA 3WLKX 1I7SB 2X4IA 2C4MA 1UDXA 2HKIA 3C1UA 4Q48A 3WKCA 3AJAA 4BNXA 4B3RB 2XQKA 3IAUA 5B6IA 1EFAA 1IZ9A 3PC6A 3RRXA 4ALIA 2QQGA 1H0SA 1CBUA 4HB2A 3DAHA 4PFJA 3EDRA 3T12A 2AWOA 3KJZA 4REQB 4XX0B 4AU1A 1FUKA 3MRSA 4KXQA 4TYNA 2PH1A 3PQ5A 1NM5C 4QYMA 2IZ1A 2ADMA 3EHEA 3MTQA 1GPYA 1G5QA 1GFZA 2AK2A 2QDKA 3AF6A 4NNPA 1CCWA 1B0ZA 3M49A 4H0NA 3SQMA 2FZLA 3AH8A 1NBOA 2O6HA 4RVGA 1VSBA 2CFCA 3LCJA 2DVMA 3LZCA 4MUAA 4C2TA 1ZMXA 4IFBA 3T3HA 2AN1A 1Y82A 1ZNZA 2PUHA 3IUJA 3HR7A 1SG9A 1XBTA 4A2CA 1N4AA 3R3HA 3T0FA 3UWMA 3RAPR 3AR3A 4P7GA 3PE4A 3V4RA 4DDTA 2FPWA 1X1BA 2O2JA 3HEAA 1JEYA 2PJUA 2CMGA 3ETLA 2WOOA 1EFKA 4EPWA 2XXAA 5IBCA 1XMPA 5CB8A 4M1WA 2IW3A 1QIKA 1GTL1 5BNTA 4M1KA 1VGQA 4II2A 4PZZA 4UMDA 2Q3EA 4LF5B 1J5XA 3GP8A 3TVDA 1BKYA 1ZUHA 1A88A 4Q6BA 3FDZB 5G0SA 1THTA 4G5HA 4TMVA 2X8BA 4FQ8A 3UBMA 3ZV5A 2R66A 3KKNA 4JP2A 4RMGA 1AU9A 4QELA 3S1AB 2Z1DA 5ALQA 3LOUA 2GASA 4CKCB 1MC1A 2NZ2A 1LFAA 2PR7A 3MERA 3P9YA 4GPBA 2ZJ1A 5LJLA 4HAIA 1H22A 2RAVA 2MHCA 4LQLA 5I5GA 4J8PA 1V35A 2CJFA 3IUEA 3U13A 1S4MA 3LXRA 4BQSA 5M7EA 4OI4A 2B4QA 5JROA 2P67A 1PW5A 2ACEA 2ZYRA 3B7PA 3D3QA 4G01B 4WLEA 1LZKA 4JASB 4OHZA 3IO5A 3MWYW 5AW1A 1ZJWA 5A0VA 4AJKA 4LJRA 1MX9A 4NX2A 1UQTA 1V2GA 3C70A 1RIFA 3CLKA 3LK6A 2LBPA 3PICA 5IKXA 2XNKA 3SF0A 5BSWA 4WZ6A 1AQIA 3RIHA 3V2IA 1FIUA 4JBGA 4NBRA 2XA1A 2FDXA 1XPRA 3VR4D 1CZNA 3R0JA 4TMYA 1X77A 1WPXA 2WJ6A 3DPUA 4FW8A 2QR3A 4RVNA 3WMWA 4WY8A 1RJDA 4DQKA 1A5BB 3EC1A 4FLMA 3AXSA 2Z2XA 1J07A 1RHRA 2B82A 3ORSA 1PLLA 4GAEA 2ZDQA 3WDLA 3DKRA 1N7HA 2IHVA 2WJYA 3GBPA 1GNTA 4ZEOA 5HM6A 4S1OA 2PKQO 3CISA 3NHRA 1BAPA 1JKIA 2RGNC 3AK4A 4MEBA 3BJEA 3DE4X 4BOYA 5K4HA 2PLRA 1H8HA 1KZYC 2ISSD 2BEVA 3KE8A 3EA4A 4DR6B 1VP3A 2M1XA 3FSEA 3EVBA 2P4HX 3WWOA 4B32A 2QL9A 4NCAA 4FCWA 3ZWNA 4E5PA 3AT1A 3FF1A 3KWJA 1AN0A 2HT1A 5EXPA 3RU9A 4CXMA 2DPMA 2JHAA 3FFBA 3SC3A 4KGDA 3T3DA 2OFFA 5HYVA 3INTA 3OFSA 4JV5B 1CXZA 4DWOA 1VYHA 1Y4UA 2QRNA 5CD1A 3PLAE 1SKAA 1PS9A 3JQ8A 1YQGA 3W5JA 1MC4A 5IXJA 1A5ZA 3FETA 2Q3BA 4GLFA 1RWXA 1RT9A 3DE5X 2DT5A 1OJLA 3FW1A 1Z38A 3KJNA 1CDZA 4MI6A 1MU0A 3O73A 2YXEA 3IQGX 5K8IA 1Q5PA 3OF5A 2JDID 2ZM6B 1KDTA 4IWXA 1Z07A 4KEAA 2CYBA 3GXOA 1A9RA 1PR6A 4HDSA 4J90A 4CF6A 4CETA 5IKEA 2BYTA 3ZIDA 1AKNA 3CNLA 1I8TA 4AYWA 2CMHA 2YUTA 2AJCA 2I6TA 3VM6A 4QL3A 3MFQA 4QE3A 4BO5A 3LVBA 4RA6B 1N9ZA 1CP3A 4TRRA 3P4YA 5HUJA 5REQA 4C4SA 1JJVA 3OZCA 5A4MS 3EZ2A 2FPOA 2W6OA 4PLGA 3WJ1A 3WYEA 1WDKA 3PUWA 4MRPA 1MB9A 3W5AA 1SHKA 4GYJA 4B7XA 4L27A 4ARZB 1O89A 3S7TA 3HK2A 2O5CA 2C4TA 3D7LA 3QU5A 1FPQA 1TC2A 3IBTA 3O2QB 4MHOA 4OQDA 3K0KA 4F3TA 1VRWA 4XVUA 4I55A 4L07A 1DUIA 1F8YA 4PHTA 4ZAXA 3BE5A 1XZMA 3OZTA 4BN4A 1KYWA 3JWJA 4MQEA 2QP3A 1NY5A 3BULA 3DDCA 1ESEA 1WL8A 2N42A 2QUAA 4RLFA 5E2IA 4LX0A 4G5SA 1JT2A 5I3ZA 4DEYA 5IU6A 1PNRA 1UAAA 4HMQA 1TPZA 1F48A 2Y8EA 3NH9A 2ILTA 3KKOA 2FW8A 4IKOA 3NIWA 1NATA 1OFHA 1CY0A 3EFOB 4FUQA 1NG1A 4TN1A 1C3VA 5AVOA 1MFPA 3HO1A 1TZMA 1UL1X 2DHRA 4LRUA 4QVKA 1U8FO 3K9CA 4NDNE 3HCOA 1QDLB 1V11A 1BHSA 1VL5A 3HJBA 4AD8A 4EJSA 4ZMSA 2DFKB 4Q03A 1SOUA 3D6HA 4QGAA 5AM2A 2JCYA 2QA5A 1G5RA 2HU2A 4V24A 2X0NA 2R65A 4ZN6A 2I6GA 3MUNA 3FSGA 2AN9A 4IDFA 4ZQEA 2XSZD 5F2KA 4IIGA 1K2WA 3P0EA 3WIEA 3KDSE 1CY8A 4JR0A 2MU1A 1C8KA 4H7HA 4JLAA 1G7RA 1YQTA 5C3UA 4PLCA 5I5EA 1PP4A 1GL6A 3GN2A 3K9GA 1E1NA 5JH7B 2F6RA 1L6RA 1C3EA 2X9GA 1WA5A 4NOMA 1JFTA 1L4GA 2P0AA 1FNMA 2GBIA 1D1PA 1TVKB 5BMVB 1X80B 3GFVA 3NDRA 3UAZA 1WEKA 3MIIA 5DNDA 1ECLA 4GZ3A 2PSJA 3AINA 3CRW1 2Q7DA 3SYLA 1KGDA 3ZCXA 2Q3DA 2OY0A 3TI7A 5JC8A 1G18A 4URVR 5KREA 5CIQA 3IERA 3U1TA 3D6UA 2A0UA 1SVKA 4WWHA 5DI3A 1EQAA 2HEGA 4JY7A 2PT9A 3FUTA 4KPFC 3TLJA 4FFPA 1BMFD 1NMQA 1RYHA 2OBBA 3CXUA 2DAPA 3ELUA 4KHZA 3BPSA 4I50F 5ARDA 3DBHA 4EF4A 4PN7A 1Z4IA 4JC8A 3H1GA 2NG1A 3FDIA 2C54A 4QBTA 4QA9A 1BE0A 3EGWA 5JS2A 4F85A 4I8IA 2Q9CA 4KMOA 3T61A 4BNFA 2Y1GA 3OHSX 2EG9A 4OHPA 2AYYA 2G5TA 2I7TA 2DKNA 2ZRJA 4CM9A 5L3QB 2UXCB 1LC0A 2BELA 2RK3A 2VNHA 3GLFE 1RJ9A 4UEOA 2NQ8A 3KX2A 4LHSA 4RBNA 4JL6A 1O6GA 4DR7B 1NR5A 2XUFA 1IC6A 4C1NA 2GZMA 5LQDA 1B93A 3K9FC 2WPDD 1D1QA 2DPXA 1XXHA 3R6DA 1G5TA 1MO3A 1R0XA 4LWPA 2UYHA 1NF3A 1SBYA 1XVUA 4YWHA 1O58A 1Q2XA 2IF0A 4DSUA 1Z3IX 4EUHA 1GNLA 2G9ZA 1EPUA 3AY3A 3CHYA 1C7JA 2GZHA 4R01A 5EHXA 1DKNA 3TOSA 2E4AA 2A84A 4BFYA 4C9BA 2Y1FA 4PXAA 3GRYA 4W99A 2HLDA 2PGIA 3HA5A 3K0CC 5I7HA 4MVCA 1ZVMA 3P71T 1MB0A 1CE8A 1V4BA 2GFQA 4RTKA 1FVHA 4KR6A 3L8ZA 5SZKB 2P9TA 2A4KA 3LDFA 1P80A 2IWRA 1DZIA 3WR5A 1MR3F 3IKTA 2WWRA 4JKIA 1GA6A 1GUDA 3EFBA 4XUDA 3WWCA 4C0SA 3GDGA 1WPRA 5L3RA 3ETNA 4NMWA 3ZY4A 1Q1BA 3SIPA 3TKYA 3N3BC 1F17A 3KDAA 3HXMA 3ZDBA 3T1OA 2PX5A 2WSSA 3PQ4A 4MUYA 4KLZA 3LCMA 4TTTS 2QF7A 1EDEA 3D7NA 5E9JA 1G9XA 3ETCA 5FD8A 3VYTB 1YBMA 4G0XA 1OBOA 1UMDB 3MILA 4MKFA 3TB4A 4V2UA 2HWYA 2H1OA 1X0XA 2WPNA 3LCRA 3P8ZA 2HXGA 4EVRA 4WY2A 1N5OX 1W9MA 2CNBA 2JAXA 4DV3B 1M0SA 4UXIA 4A6PA 1T6BY 1ZD4A 4MQFB 2C96A 3NHMA 2GEDA 1DEXA 4B75A 4EZBA 1A77A 3IQFA 4OFZA 4F8EA 4FZ3A 5IAKA 5KWIA 4EM6A 4F2WA 3N70A 1WQ1R 4LHZA 3CBQA 1CETA 3E9QA 2BH2A 2JKYA 3OAAD 3VDMA 3BERA 4MAFA 1SVIA 4H6PA 3A70A 2XYQA 3SYKA 4PG6A 5G3YA 3OIDA 2C20A 3OEHD 2DR3A 4L4YA 3VNQA 2GAJA 4ZO7A 4O2BA 4BMZA 4X3PA 2Y0PA 3BZWA 2ZWVA 3PSAA 4EUEA 2FCRA 5AM1A 3T5TA 1L4YA 2WAXA 2XVYA 1NM5A 1U0EA 1T2FA 4UVEA 3A9SA 4C87A 1USVA 1AKRA 3J7TA 3FVVA 5EPOA 4WPGA 4D43A 1YVDA 3QJ5A 1EDOA 3OEED 4OXXA 2B92A 2O0JA 1HYHA 5EHZA 5CB0A 5C7YA 2YHBA 3PUIA 5IT4A 3DQZA 5EE3A 1KZHA 4AY3A 3CURA 5CFMA 4E21A 2V1XA 2POCA 4Z9XA 2JIBA 1UKBA 4FC6A 4OREX 4PC1A 3SCZA 5B3JC 1KSHA 1OLSB 2HB6A 4G5RA 4DDMA 4HDAA 3MZ0A 4WZAE 3F4KA 1MO5A 3QFTA 2EQAA 3SSNA 1YZUA 5ICFA 3I5AA 4K87A 3ICEA 1YKFA 4RZHA 3B1WA 3MQ4A 4ROSA 3N2GA 4YV1A 5IJ9B 4YJ2F 3KQOA 3AVYA 4BGDA 3FY4A 3LQKA 2DETA 3LW8A 3OQNA 7ABPA 2CCKA 3KE9A 4RCVA 2BMWA 4IZHA 4R5HA 2X86A 4M98A 4MUBA 3WGIA 4U6NA 1ZK3A 3A4LA 3AB3A 4RHYA 3V80A 2VPYA 4YP6A 2JF0A 4EJ0A 4YMHA 5ERYA 2YX1A 1L7MA 3GFTA 2FWJA 1L5GB 3TTVA 1WETA 4MW5A 3R3UA 1PJAA 3KAKA 1G5FA 1LRKA 1OFUA 1Q15A 1Y1KE 2WMDA 3VR3D 1Y4AE 2D74A 3BB1A 4PR3A 4ZJZA 4Q16A 3OUTA 1ZL0A 4JNKA 1YKSA 4TTQA 2QPAA 2FLKA 3DB1A 3AKEA 5FL3A 1HY3A 3BWYA 3WYCA 1NQOA 3HCCA 5K0FA 1QFJA 3DZ8A 1JH9A 2OXFA 1O97C 5F73A 1QYDA 1RXYA 5I4KA 3EGCA 2X1VA 5IM4F 1XLUA 3T9EA 1VBKA 4E0BA 1J06A 4Y3UA 3TRFA 1WABA 2IYOA 4EOGA 1KC3A 4ER5A 2F2TA 1CUZA 3W4JA 2R48A 2Y6VA 2DQKA 3FCCA 3E9MA 3BWCA 4YJFB 4ZGWA 3WGTA 4UMFA 4KR2A 3T7IA 3INGA 2VZ9A 1H2FA 3RC1A 1U80A 3FGOA 3TLBA 2GH1A 1LRLA 3FROA 4ED9A 4WKGA 1RRMA 2PX8A 3STWA 2RGNA 4IRMA 2Z5LA 4BFVA 4GEKA 4GC9A 3CR7A 2OV8A 3RGWS 2G1AA 2VJDA 5FLEX 1CIJA 4QBKA 4U7GA 4BX0A 5K8LA 1UM8A 3H19A 3UMJA 1YMVA 2EW2A 4MVJM 4M9SA 3DCNA 3LWNA 4WZBE 4XIYA 4UFNA 2QTHA 3AO0B 3OT1B 4RORA 2GKSA 2R3SA 4DWWA 4X8MA 1GQFA 1KDOA 2OHOA 3BH0A 3D2LA 3QPDA 4JI3B 3SJBA 3OPNA 5H4GA 1M1YA 4LE1A 5KNDA 2JH9A 3KTAB 4H1HA 4KXUA 3L6UA 4BTLA 3TZKA 3QEBZ 4KGZA 1BDHA 4KODA 1AUVA 2N3ZA 3ZD9A 5TXGA 4WN9B 3ZGXA 5IN4A 1RKVA 4V0ME 1ML4A 1WF3A 1MB4A 5J23A 3DG9A 1E2PA 1P45A 2IWHA 1F8UA 2BMAA 3P9SA 3RE1A 1GUZA 2W2KB 3UV3A 2W93A 3C7DB 3H5NA 1XOIA 2YJTD 3DZHA 4YUYA 2G7MC 4IUBS 4KCGA 5ALFA 3GGGA 3HI4A 3ISTA 4KP7A 4ENUA 1KC1A 1W35A 2BP7A 1K9VF 1UBLS 2HMUA 4J1QA 4LZJA 4DA0A 1KJ9A 1C30B 5HFAA 3LTEA 4ETIA 3C7TA 2XTMA 1U5AA 3BAFA 3M6FA 3N6XA 3BXHA 1XDSA 2OLEA 4E2XA 4IIDA 2XNSA 1W4BA 1LV8A 1ISJA 3T5GA 4BPBA 4L8GA 1XCPA 2P2DA 4TLAA 1FPMA 4F3KA 3FCOA 4AJNA 2Z4RA 5DFAA 3WJ2A 4FGWA 3N2NA 4PLZA 5EEGA 3ZK7A 4YAUA 5GV8A 1Q1NA 2PIDA 4CODB 4ENQA 5FDFA 1U9YA 3LD9A 3CSUA 1UEIA 3ILHA 1CIPA 3STUA 3UANA 3RHTA 5C8XA 7REQB 2C5FA 4C6SA 2BIFA 1Y9JA 2R7LA 1Z2EA 3CZMA 1LK5A 2Y2UA 1Z6GA 4NMLA 4FNOA 3SFVA 3STHA 2ZI9A 2TMKA 4G0OA 4S24A 3T3MB 4HAOA 4MKXA 1TM1E 1XQ1A 1Z36A 2ZSDA 1P7YA 2VDOB 1TZ2A 1GARA 2YIMA 4TS3A 4DLVA 3DFIA 3GRUA 3NANA 3WLHA 4CMEC 3ZWVA 4H3HB 4DIDA 1KFKB 4KX3A 4ZDJA 1NBMA 4ND3A 4KJZA 2VXYA 3IOMA 4QJBA 4QU9A 1T5BA 1DTWA 4XVQA 2XVXA 3KIPA 3P20A 4JC0A 3TLZA 5JRZA 1WZUA 3EMKA 3L0YA 5T41A 3DD1A 4PYKA 4TTPA 5B2EA 1W9HA 1N2JA 2ZR7A 4Y0AA 3FOEC 4D25A 3VSCA 3GJ0A 3KR9A 4JVSB 2KB0A 3UAWA 1T8RA 4WXRA 4EB6B 1VG8A 4KV9A 3WNDA 1DI0A 1QR6A 5C3MA 4I99A 4ZQCB 3U4DA 4JOSA 2Q6TA 4MIEA 3EJWA 2REQA 5FXMA 4LJSA 4R9SA 3M0EA 5A3JA 3BEOA 4F71A 1CW2B 5ANRB 3VTZA 1ZFNA 2F8MA 3HU2A 4H0FA 1ZGAA 4JBHA 4UDOA 1R1DA 4IMPA 1QB7A 5FWNA 1VGVA 1F1BA 3FKJA 1KPHA 3NONA 4OHRA 5BWMA 2JLAA 3C3MA 3R6LA 4IXMA 5IUKC 2YY7A 1WD5A 5G0WA 3ZX5A 3OX1A 4BX2A 2GTPA 1E32A 1ZRSA 5BNZA 3E18A 4HADA 1E2MA 2G9UA 2VDJA 2APJA 2O0KA 2WC1A 1BFDA 3AX6A 3M1IA 4O8ZA 5LB4A 3K2QA 4R2WA 2HMSA 3G2LA 3IDAA 3V4FA 1BYIA 2FLWA 1NQWA 4CEJA 5FPYA 2O57A 2A0WA 1NX6A 4KE8A 5K3EA 2BM8A 3ANSA 4IDQA 2QTBA 4H4DA 1E89A 4J2TA 1BCSB 4WI1A 2AT1A 5BQOA 2E3JA 5ULLA 4TL9A 2F48A 2QEQA 2ZS7A 5CT8A 2E85A 3RO7A 2QQFA 2NTEA 1C29B 3FCEA 2IHBA 2A5YB 3TM4A 3RG8A 1RABA 3VTKA 3TQHA 1FMFA 1X6VA 4M87A 1JVSA 2GVNA 3RC9A 2QE7D 1NVBA 2NWQA 3HACA 3G49A 3DOHA 2WQZA 2WIGA 3ZH2A 2YFHA 2GJ4A 3EVDA 4Z4QA 2J9FB 4BBZA 1GIAA 1F7UA 1SPBS 5KHAA 4BMDA 1IN6A 4ND6A 4QUJA 4MW4A 3CRMA 3O5AA 2O3TA 4FZRA 4WADA 5MF6A 4YRBA 5A62A 2QW1A 3BFXA 2TYSB 621PA 3ET5A 3D6JA 3R0XA 1JUDA 4YRJA 1J97A 3GRFA 1DAOA 1DTSA 1H8EA 1OI2A 4JC5A 1VKHA 4S2UA 3CF4A 2HU5A 4HEA1 2AEEA 1WXGA 1B2RA 3COSA 1O57A 1PDWA 1JWLA 2CGEA 1Y3HA 4BFSA 1ZA1A 2VTKA 1KKUA 2EJVA 1SXJB 3IHKA 2ZJBA 4RSMA 4I9UA 3K0CA 4KFSA 1Q0SA 3GNSA 2QRQA 1VJ5A 3SXJA 4C5CA 3ZVRA 3EEQA 3THRA 1JDZA 4YO8A 3EG5A 3LI2A 1T1GA 2VJBA 4JVLA 3STXA 5ICCA 1QX4A 1JR4A 1SZCA 1U1CA 4NCXA 3WNVA 1JB9A 2WJVA 2C83A 5IK2A 1KZ9A 1G6HA 3CEJA 3DZDA 5JQWA 1MXFA 5BV8A 3NH6A 5JD5A 3IEVA 2FW1A 4ROTA 4YC7A 5CBKA 3F78A 3D6VA 1IZ0A 1SCDA 1E3WA 2H59A 2JD1A 1GGMA 3NTOA 3OJ0A 4DADA 4MO2A 3TQRA 3BJIC 3UHFA 1TMOA 3RT1A 4BLQA 3HNPA 3DZIA 3JQ7A 1LLUA 1N6LA 4DGQA 2AMYA 1D4FA 3HDGA 4E32A 3ZE6A 4ZI2A 1E1CB 4CIDA 1BWSA 1DRJA 1OWPA 1RI5A 1T35A 2YWEA 4FMCF 5HA5A 4DNFA 4F1KA 5BW4A 3VC1A 3GLFA 2DJIA 2XIJA 4GZ5A 5F7JA 2P2LA 2QSJA 1IWOA 2IYPA 3SQLA 5JJKA 2AEMA 1XP5A 5KDDA 1G8GA 1HFJA 1Y8ZA 2UV8A 2UKDA 2EWVA 5JJLA 1YOBA 2FF5A 4QOSA 3ZJVA 2X2PA 5A0FA 4YRGA 2ZT5A 4Y6GB 4HL6A 2NT3A 4IH1A 2D0DA 3S2ZA 4F91B 4XB1A 4ZREA 4QTUB 1AXEA 3X1DA 1M34A 1SVSA 3M6WA 4RK0A 3EDMA 2YBEA 2JD2A 2YY5A 4GNKA 1NU6A 4RE5A 2EHDA 4DLUA 3O4HA 3ZBTA 2VJLA 3QBVA 4JP1A 4H7DA 4QBIA 3TQIA 2RJ3A 3VU1A 1U8CB 2VPZA 4BMSA 4BB9A 2VKTA 3GI1A 4EQZA 2PZJA 4CIBA 1LDNA 5BVGA 2BFFA 4G65A 2QSYA 1RPNA 2AJLI 1RWPA 2HJRA 3OKAA 4IX9A 4DCGA 1IY8A 2FP4B 1HE1C 2LRHA 2W5UA 3LFHA 4LXTA 4CG2A 1KO4A 4BZQA 3GGOA 4I3GA 1X13A 1DWQA 2ZPUA 1N1EA 4KYUA 2WTBA 4DA9A 1G8MA 1TLFA 4OQNA 1VIAA 1M5UA 1WSDA 3IAXA 4HKTA 1C1YA 4NOLA 5C0OE 3KJFA 3B1JA 3NDJA 1GKIA 3QW4B 3Q8WA 2D3TA 2YXBA 4L15A 1WMSA 4R05A 4ZC8A 1T2CA 3BIJA 3EWSA 4MVYA 3KUKA 4GX5A 2AOUA 3HBAA 4UUOA 2C4NA 1ZGHA 5B3JA 4YRSA 3WY9A 5AJYA 1C14A 2B30A 4ID3A 5IDQA 1JFVA 1A7JA 1V1MB 3A6KA 3HKEB 3T5MA 4DSNA 3KOWA 1GU1A 1OWNA 3L7CA 4J9VA 4OJTA 1WMAA 4AECA 2WM3A 5I9NA 4DV1B 1UPBA 1Q7CA 2Q5QA 3DNFA 4N1AA 4GBJA 2WT9A 4NS4A 2JGKA 5TLSA 4WA7A 1T9DA 4MVJG 4R3WA 4HNTA 3BRCA 2B9VA 2C78A 3D1VA 2FZ5A 3PEVA 4RM3A 5SY9A 4LZAA 2A78A 1K89A 1NXPA 2ATXA 1DAHA 3EMBA 3OZUA 2ZB3A 3I01M 4DBLC 3DLBA 2HPZA 3GZTB 4FFLA 2XUOA 1Z15A 5ALDA 5JAPA 1QTNA 4CL8A 5IBPA 4JSYA 1TKCA 2OWDA 4ZHQF 5CW1A 4ZJYA 5KC9A 2QTRA 1EFUA 4GWGA 1DB3A 3UV7A 3MS7A 2QTTA 1KK1A 1OVGA 2YWXA 4J2OA 1KMNA 2ZJ7A 3DO8A 4S1VA 3RFTA 2YHIB 4A2QA 1WWKA 2XJ9A 4AUNA 5K0JA 3I9MA 1GYPA 3UC9A 2R7MA 4OQMA 1HK7A 1E2UA 4QU5A 1W8DA 5KTRA 3EZ9A 3AVPA 4F4HA 2C58A 4X7PA 3Q3CA 4FSXA 5AHKA 4GP9A 5G2OA 3M4YA 4CFSA 2QGZA 1XJWA 1P3DA 4OBBA 4RK7A 5FA6A 2PX0A 1QH9A 1BH2A 3ELYA 2ZATA 1A50B 5D2CA 4LJ4A 1XMIA 4WZAA 2QN6A 3HZRA 4PZ9A 1XTJA 2CLFB 2XMZA 4DCJA 3RTEA 3JZIA 3A9CA 3GHHA 2YV4A 4UVHA 4BMYA 2Q5EA 4D82A 1LPBB 4NS1A 3B5IA 3IAS6 3SMQA 4P58A 1C1DA 2VRWA 1B0PA 1YHNA 3PPXA 5KSZA 1H2BA 1M73E 3HLYA 4WOCA 5JO9A 2WF9A 3BCUA 4ISBA 4O4LB 3VPAA 5C7LO 3RLFA 1THZA 5B58T 3KLMX 4QX6A 3OD5A 2C4HA 3F6SA 3BQNB 3LZ6A 2G0AA 4LA4A 2D1TA 1ULSA 1ZBQA 3ICOA 2M6KA 2R751 3ASVA 3DWEX 1YZGA 5B1HA 1SD2A 1U9IC 3WZMA 2CSUA 1MJHA 1H0KA 5AFSA 1RU3A 3FWHA 4LRTB 1EJ0A 3KJIA 1LW6E 2VT6A 4CR8A 2J5XA 2PJRA 2PO5A 5BUSA 2CNNA 2JEZA 4JJ7A 3EGXB 2CL6X 3HKDA 4D0NA 4TWRA 2ES4A 3HVUA 5BWBA 3KOXA 2AYXA 4K6CA 5EQTA 5JFTA 4CDGA 3KOYA 4BU1A 3PK0A 4WFJA 3M5CA 2J9ZB 3H1AA 5FPQA 3TPZA 3UJ6A 2P9BA 1XLWA 1EWQA 1AVTA 4MHSA 4KI0A 2IEYA 1XDBA 1MJFA 1VXOA 2JFYA 2OZLB 1K5DA 2O1SA 5FULA 9ABPA 1ICEA 4JJAA 4E11A 4P5DA 4PQRA 1EE9A 3PR1A 4E5DA 3TVYA 2Z08A 3GFBA 2WF5A 1S8FA 3V32A 3ZWPA 3GZNB 1PR5A 2RHWA 4MYUA 1PG5A 4C6TA 1F0NA 2Y67A 1SC4A 3A32A 2O7QA 2PNJA 4K46A 4CTOA 4ZK6A 3L7IA 4DLKA 1SQ0A 4RTPA 4JA0A 4KKXB 3OE1A 4YUZA 4L74A 1MHPA 1PKEA 4E3WA 4KXYA 2XNDA 4ZCMA 1XO1A 4FMDB 1ZOSA 5KYYA 2JRLA 2QPOA 1RJFA 3NTUA 1W5AA 4JKYA 4Q3OA 4UEJA 4OTZA 4CMEA 5JYCA 1NPYA 1T3HA 5TC4A 4Z4GA 4GLBA 1E1RD 2NXEA 1UT6A 2WI8A 3MCWA 2NXCA 4OQFA 2ZJAA 3DE2X 3F5DA 4PX9A 3L8DA 1EFPB 3JARA 4XJTA 1LQ2A 1ZS9A 1J00A 3HSSA 1LX7A 1XROA 5FUBA 5TY0A 4YACA 1P4HA 1X8XA 3DE1X 3SX4A 4BVEA 4CRWB 1UM9B 3Q8KA 3R74A 4LJ7A 3JZFA 3O31A 1TW2A 3T94A 2Q2QA 3RB8A 1KF0A 2IFTA 4IEFB 5AVRA 1NVXQ 4OK6A 1R4NA 4HSEA 2WSIA 3RYIA 1AKQA 1G9SA 4XVHA 2AR0A 2EGUA 1PEDA 5KZMB 3QEKA 1M8PA 1Y1LA 2WYOA 2JEYA 3I5UA 3OFVA 4RZSA 1LLFA 2JFOA 1QYVA 4HGPA 3UMVA 2QL6A 3KQSA 4O6VA 4G3XA 5CFOA 1PR9A 1L4LA 2D4HA 2X8JA 2G40A 3NHWA 3KYDA 1IXRC 1BX0A 2XVZA 3R5XA 4KE7A 4M0CA 1R64A 2ZI7A 1K8XB 3FMGA 4M0DA 5JQGF 1Z9BA 3GYGA 3HVIA 4FJ1A 2G80A 4JENA 4LZLA 4LNUB 1EI9A 2BVNA 5SYMA 3IP8A 2ZYWX 4A10A 4WXYB 1IULA 2XQGA 1XTIA 4R1SA 1RHUA 3IDQA 1VCOA 1L7NA 4P3XA 5H3CA 1M6YA 2XW6A 1B1CA 3IBGA 5BOSA 3DPSA 3QWAA 3G5MA 3LQ1A 3W5UA 1T1JA 3GRZA 3Q6NA 2VHEA 2W6CX 2FJ0A 1IE3A 1TA9A 2J87A 1PZXA 4TUYA 1USKA 1U0LA 2QXYA 4LXIA 3S3TA 1JFFB 1NMYA 2P40A 4WN3A 1Q19A 1YZQA 1P8AA 3QI2A 2I6XA 4YRZA 5CHYA 2DBZA 5DBGA 4JYBA 121PA 1RWMA 3FUXA 5I7OA 1SVMA 1QNLA 3C45A 2FN9A 2MR6A 4GW3A 4JGBA 4PGFA 5FWXA 1DKRA 1S01A 4J7UA 2F9FA 2HT6A 5AYVA 2C2ZA 1K7EB 3ZTWA 4D9NA 4Z1MA 5AMXA 2CV2A 2NTYC 4UTZA 3UCFA 4ZAVA 2CKDA 3GRKA 1T3ZA 4XA8A 4P92A 4F4UA 4TOIA 2V98A 1V3QE 1TU3A 3Q0EA 2WG1A 3ND9A 1HE4A 1E0AA 5IC4A 5T4EA 1E6LA 2VOJA 3OO1A 4B9EA 4JDUA 1IU9A 4FEEA 2R8XA 1GG2A 1FTYA 3GQBB 5J4LA 1E59A 4G8BA 4QSMA 4MMXB 2GHIA 4X3OA 5CYPA 5AXAA 1W93A 4RDXA 3ZKWA 1UMBB 5KSYA 2GF2A 5KTPA 2NZYA 5C52B 1DJQA 4DQ0A 3BMNA 4U0JA 4NU8X 4ZOCA 3FZQA 4ZYZA 1V7QA 3KQLA 2IODA 4EL0A 1Y5MA 4KQ2A 1VA5A 4KWTA 2H2GA 4K9SA 5H70A 1XKTA 3RYCB 4OQEA 2Q2WA 1YACA 1FTSA 1FYWA 4PZAA 4MS3A 1PTJC 5JZMA 3KJEA 4PPFA 3VKHA 3P9IA 2J33A 3NAGA 5K0TA 1XMQB 3RUPA 3HR4A 4IIJB 3U56A 1RWWA 3GCDA 1ABBA 3ECAA 2X19A 3DA8A 2GO1A 3F71A 4NNJA 4QJIA 3TEMA 4BBPA 1GSAA 4HUTA 4XX0A 3VU9B 1DC5A 1JDPA 1KMIY 4GMXA 1ODCA 4REQA 4AF6A 3SLKA 1GPNA 2FE4A 4MW2A 5THQA 3VHXB 3PFHA 2IYZA 3IXMA 3K5IA 1QFSA 1GGKA 1UBMS 2R1VB 4HN4B 4WLOA 4ZVNA 4QUBA 4PEVA 3GJRA 2WSLA 5KJFA 4UVDA 4ZGBA 3GDWA 4TPKA 3U2QA 1N8NA 3AHFA 1ST2A 4OYRA 3UHAA 2JG3A 1CUYA 1OXMA 1WXHA 4KACA 1HYQA 3ZU6A 4BGEA 1KI8A 4LYGA 2A9PA 4IIBA 4G8CA 5FBLB 2RG1A 1Z5GA 2GNPA 4AS2A 4D4HA 3PXGA 2XXBA 2OP0A 3E84A 5JIBA 4NY1A 3FN4A 4YLEA 3QITA 4LHEA 4BO6A 3B7WA 3IGFA 3SHTA 4KO3S 3TIVA 4KL8S 4DIEA 1WZEA 3I5YA 4KW7A 3BIWA 2V5AA 3C14C 4E14A 4M8IA 3WTBA 2CJXA 1KNXA 3K92A 3QELB 4QXPA 2GBCA 4DA6A 4PR0A 3UAVA 5CJPA 3FDZA 4F1JA 5JAQA 4C7JA 1LDEA 2FUEA 2C2BA 4DV0B 3GDHA 1FDUA 1TPYA 1DCKA 3WDMA 3WYNA 1ZINA 3S1AA 3UH1A 2AHRA 1P18A 1ZITA 3V8BA 3VDXA 4CKCA 5KTYA 4X41A 1G0NA 1UMCB 2QD4A 5FHQA 2RGAA 4JZYA 1VIDA 1P1FA 1RBYA 1AIPA 1HDEA 1W36D 2FXVA 2BGWA 3NRJA 3JWPA 3OM8A 2OC4A 1WCIB 2YWCA 4CU5A 1LX6A 3H6GA 3DWFA 3LT1A 3WIDA 3N74A 2JARA 2HDHA 2B61A 4AY5A 3U4HA 1D2GA 1OQAA 2QMZA 1DE0A 4N0DA 4XTCS 1DCTA 4RW0A 4BLTA 3W2TA 4AX8A 1QUEA 3PUXA 2NO5A 2NV6A 3M6XA 4PZLA 4QQRA 4HYYA 1D3AA 1H9CA 2B78A 2JIQA 2C42A 2VWGA 2AX4A 3D0OA 2BTOA 2YZ2A 1I3CA 2JL1A 3ODGA 4NOJA 3UMFA 4OATA 3L43A 3UUGA 1QR2A 4K6GA 1E1KA 4XOIA 1G16A 4ZVMA 4Y1EA 1K8ZB 3NP7A 4RHXA 3MC1A 2BI4A 3UGJA 2OCKA 3IR5A 1KY5A 4V0RA 1Q16A 4FLEA 3T34A 5CDYA 3BB4A 5AKGA 1OT3A 1ORVA 1EDBA 5K3AA 1R10A 1QF6A 3A58B 3DT9A 1GZ7A 1PDVA 3H7IA 4M7PA 2O6LA 4Y9RA 1TVCA 2HK7A 4DDUA 3EGVA 3T15A 1HF3A 4ZYUA 1JIIA 2IQIA 3EIFA 4X97A 1R5OA 1NW9B 4GUAA 2GN8A 2H17A 4C5AA 4OXYA 2PT5A 4BZXA 2EIXA 4Q5IA 4Q12A 2YWFA 4TMTA 3KFLA 4U9HS 3S2EA 1QMGA 1VLMA 1Y3BE 2G04A 2Q0SA 3RVRA 2OGZA 1H3NA 3ZWMA 5LA6A 5LR6A 1SQGA 1U8UA 4RHEA 4EA7A 4RIIA 5BV0A 2FSVC 4CBVA 2XQVA 2V9ZA 1UWKA 3PT9A 4UUPA 1HL7A 1GG9A 2AB0A 2LTAA 3PFIA 4G1VA 4RYLA 3V9AA 5FOXA 1PG2A 3OWXA 3B9PA 1YS2X 1PSZA 3GFQA 4B3HA 3AM3A 3M5PA 1K7XB 2WV7A 5F7XA 1GVNB 2QRZA 3CJRA 3L5KA 3KKPA 1DKQA 2C5LA 2DUNA 2W37A 4N49A 2ZU6A 4KMMA 3JASB 4WFQA 1QF9A 3E9CA 2X23A 4CCSA 3FPAA 5DIZA 4ZK2A 3LPAA 5JS7A 4PWYA 1KJYA 1QZZA 1RAIA 2FFQA 3KNZA 3RVMA 3RRFA 3QJYA 4P31A 4N03A 3CF0A 4ZEMA 4LV8B 1CUHA 1YRQA 2JI9A 3SF8B 2C1ZA 1IG3A 3K6SB 2C2KA 2ONYA 4FYPA 3RSQA 1NOJA 1U9IA 3DBVO 2PD4A 2X9QA 1P4GA 1X9GA 2CB0A 1WZIA 1Z4OA 3H5VA 2ZCVA 4I4LA 3MTAA 4G86A 4KQKA 2OZPA 4D9EA 4ZHSA 4ARZA 5I7EA 3FB1A 4I08A 1Y8CA 2XZLA 1TT5B 5BW6B 3UGTA 1ZRNA 3LS2A 1IB6A 3SLRA 3H1PA 1W19A 1EVQA 1W4AA 1P2BA 3KKLA 5ECDA 5ESDA 4EG1A 1MC5A 1V7ZA 2HMWA 1RWVA 2YWBA 4XDHA 1BX1A 4ZCIA 1OJ7A 5DXAA 4EEZA 5FPSA 2IEBA 4BFLA 3DWGA 3OJFA 1DTEA 1T9AA 4F2GA 1LFDB 1EM8B 4JP8A 1V3UA 3L9WA 2X3UA 2YFQA 1EJ6A 2IPLA 4RJTA 1EH5A 4L7QA 9ATCA 1N75A 4RIFA 2JW5A 4OK3A 2CDCA 1JSRA 3LAWA 4GUDA 1WXDA 5FI3A 1WQ4A 3D8TA 1KHTA 4Z3DA 3EFOA 5C34B 3T1QA 4DMHA 4CG1A 4EJ2A 2GZAA 1FNSA 3F7TA 1QK5A 3HI6A 3QYFA 4X62B 1CB7A 1ZGGA 5KVQA 1MX5A 3SDSA 2ZI5A 4WCVA 4ZEWA 2OXCA 1HMPA 2EG5A 4DABA 1TQHA 2J7PA 2UZ1A 5AVJA 4N47A 4NC9A 3CRRA 2FZ4A 3VSBA 3LQ2A 4MV6A 4GOKA 4EO7A 1T43A 3EG9B 4E2YA 4LFCB 2ONJA 2Y9MB 4MQLA 5AICA 1T9KA 3TWOA 2BFAA 3TPCA 3FWZA 3N86A 5LOVF 3WK9A 5JH7A 2FRDC 5AI0A 4QFDA 4F96A 3MBOA 1FP7A 4MNTA 3STYA 1X38A 3NYIA 4DA7A 3HXQA 2XBUA 1NQAO 4PFQA 1S7GA 1NI5A 1TVKA 1X80A 1AK1A 1P5ZB 2J3QA 4IV5A 2R7AA 5BMVA 4IKEA 4E15A 3D81A 1IQPA 5ED4A 4KKVA 5T57A 1NLUA 3F6BX 2DX7A 4JYMA 4FKBA 4RGYA 5DSZA 4DM3A 1ZSVA 3ADKA 1PX2A 2VQDA 3PPVA 2BFEB 2TMYA 2PD3A 4D1YA 1HURA 5IYZF 5AR1A 4EY6A 1O96B 4XFKA 1I1HA 3NI2A 4AY6A 4L51A 2HQSA 2IXGA 4OYYA 4KQMA 2ZS9A 3G89A 3TAUA 4NAHA 3KD2A 1G63A 3WQBA 3OF3A 2Q27A 3DDHA 1VSUA 1OFVA 4JL8A 1K7CA 3HB7A 1E5LA 1XRSB 2R4UA 2GQ0A 2JIPA 2GPNA 5L3QA 4NEHB 1KRWA 3I05A 2Q28A 2VHZA 4ZKEA 1KE2A 4K3UA 5HCIA 4KPGA 2F4VB 3FNHA 2HJWA 2HJHA 2LIVA 5CH8A 3DHEA 4EVIA 1NRWA 1RDFA 5CVVA 1L5ZA 2R60A 2ZROA 3ENZA 2G72A 4P7FA 1FRNA 3AL0C 2DOKA 1U2TA 3CT6A 1X1TA 5LZ2A 4DQDA 1VKRA 3HJFA 5A0TA 3IAM1 1KQNA 1F3LA 3KEMA 3KQVA 4BQNA 5AM3A 2GFIA 4R1OA 4P4SB 2B6NA 2WT4A 4Z99A 1XRLA 4WFIA 4Q00A 5K4GA 1VE5A 4LMAA 5LP6F 2NGRA 3ZUGA 1DAEA 4JROA 1Z5NA 2NZ8A 2E4UA 3UJPA 1P44A 4PZCA 5AWFC 3TZEA 3F7OA 1PV1A 1VJ1A 1QTIA 1X1EA 2AFIB 2YH2A 1G0OA 1MOPA 4C1BA 3QH4A 1E4VA 4NHOA 3BDIA 2HUPA 3TLKA 4UDYX 4YCLA 2B2CA 5TPWB 3EULA 5HKBA 1IOWA 1YQQA 4QOFA 2XKBA 3F74A 1TAQA 1HV8A 1FNCA 1NBEA 2WTMA 3AYZB 3E82A 1AKTA 3OMWA 1CR0A 1N8KA 4ZDKA 4E33A 1KFBB 5C9ZA 4TLDA 3FPCA 2G5GX 1JSXA 5ENVA 3L05A 4RH1A 3FOWA 4WASA 1Q2UA 3PZRA 3U3JA 4YYZA 3I32A 1SUSA 4LDRA 2GYYA 2H1VA 3QFHA 2Q7XA 1N0WA 1VPEA 1V6AA 1WEHA 2ZB4A 2R8YA 3KVYA 4I2VA 2GZ2A 1G3QA 4MP8A 4MQFA 4MW0A 2GHRA 2IZ5A 4EDFA 3WFIA 1EK6A 1JQBA 4Z4EA 1GZHB 4XFDA 3WNBA 1J5PA 3X43A 1OFIA 1EGHA 2R8RA 2P41A 3HS3A 1BC5A 3JYOA 3QF7A 3GT0A 1SXPA 2PGXA 3PQEA 1LQUA 2EOAA 1DJPA 3CVWA 4DM7A 3I6BA 2IHJA 3VR6H 1PTJA 1UBKS 2H92A 3PXUA 3ON5A 1WRBA 1SCAA 4FGSA 4QXRA 5JZBA 4FDLA 2Q8NA 4P0TA 3DTYA 2HFJA 4PHGA 1PFUA 4A03A 5GWXA 3NRCA 1H4TA 5BSMA 3E2MA 8ATCA 1K6JA 3A4TA 1N4DA 1VRVA 1ZMRA 2AR7A 1Y1SA 2IXAA 3AF2A 3DL2A 1Y5LA 4R8RA 5EWLA 3SSAA 3TB6A 3UJHA 4D9JA 2C0CA 4CI0B 2JVJA 3QPWA 5G40A 4IJWA 4MRSA 5BN1A 1UC8A 4W4TA 4WOBA 1C0EA 1DXHA 3NG1A 1A5TA 1MGPA 1XD2A 1M1XB 2RFLA 4X00A 4CDNA 4DLRA 2VHVA 3O74A 4IJ6A 1OLXB 1ADCA 2JHPA 4M99A 1CUXA 2PVCA 2XUPA 2GXAA 2B6HA 4MUIA 3VPHA 4D9FA 2C07A 5C8DA 2FG7C 3KDPA 3OIYA 3Q15C 3OWHA 3P2OA 3QXSA 4IHJB 5DMHA 2BOVA 4RD2A 2I3ZA 1OLSA 1SUAA 5I4BA 4QDOA 5AKHA 5CTAA 4UFPA 5BW5A 3CSDA 2JFZA 5C5IA 3RAGA 1ZOPA 4HRYA 3RUFA 3PKIA 4NFLA 3A37A 1DKLA 2IYVA 3BA6A 5IJ9A 5JNVA 3O8RA 1IBLB 3M8KA 2I9KA 4JVNA 2FUKA 1Q3KA 3E3MA 4P35A 4QHSA 4W8OA 4NE7A 1WLSA 4DC1A 3GDFA 3PPIA 1YTUA 3QLTA 3PU6A 4CM5A 1XL1A 4K28A 4XZ3A 4Y6QA 1TK9A 2J32A 2M98A 2OHIA 3C3JA 4A27A 3LECA 5CNJA 2ZJ3A 3ZZUA 4CCYB 2O59A 2DHQA 2B34A 4URWR 4E6EA 3MINB 1N6IA 1U6KA 4DJEC 1T1SA 3GBSA 1KIFA 2FN4A 4QNNA 1U7TA 3CVUA 1RYEA 5G3ZA 4X7BA 2ODBA 2ZUTA 2V65A 3EXEB 1GZ5A 2ZE5A 3G3EA 3HO6A 1K5HA 2OD7A 5EC8A 1JHRA 4GL4A 1WUTA 3EBPA 3ID6C 4Q3CA 3ZH9B 1R8YA 5A04A 3EXIA 5JVDA 2P65A 1FJ2A 4OP1A 1XVVA 2HK9A 1BE6A 2QU7A 3ZY3A 1KAOA 5E0OA 3RFCA 1QO9A 1WW2A 4MJ7A 4QDKA 4UPDA 1OKKA 4G24A 4X85A 4YJFA 3MW8A 3UA4A 4V03A 1JDJA 3DZKA 2OENG 3ASYA 1I4EB 4MR8B 3ZGNA 1YK1A 3K7EA 1ZDMA 5U1PA 1OBFO 5BSFA 2ZAIA 1Y9ZA 2ZUWA 4N5MA 5LB2A 1OFGA 3HDYA 1Z16A 3DBOB 2O7SA 1MOQA 2ZRMA 4H6XA 4OUDB 3VNVA 3SNHA 5TDHA 3VNRA 4XLTA 5KWSA 3KPUA 3KJHA 1M0EA 4TXHA 3KOZA 1AS2A 1KI7A 4GKAA 4UUBA 3AF3A 1QRTA 2DR0A 1WIWA 3L1KA 1EQ2A 4H1VA 4PLTA 5THKA 1XU4A 4B79A 1K6IA 1T5HX 1LLDA 2BI8A 1K98A 3KSMA 4EPTA 3SE0A 1DAFA 1UT8A 3AFHA 3EF0A 5CFLA 1RYYA 1LTKA 5AW2A 3KTAA 3ZU3A 2XI4A 2EQBA 2R2AA 1GAJA 1K86A 4NONA 4U63A 4WN9A 4Q7JB 3NR2A 2FSVA 1PNTA 2R8OA 2IEAA 2J46A 4IL5A 5C7OO 5DYWA 1B6TA 3S44A 4YCNA 4XWTA 2IV2X 1QBKC 1OH7A 4RV5A 4MI9A 4P7JA 3RUIA 2W2KA 4ZVSA 4LQCA 5KSWB 5F9MA 3SHFA 2Z5VA 4YQEA 4Y2QA 5KTOA 3W90A 1KJ8A 3LP5A 4MS4B 1JN0A 2W6QA 1H6CA 2NAPA 3W3AA 5AKEA 5DNVA 5JBNA 4BVHA 2OFWA 4H0CA 1FYDA 5FUMA 2XTJA 2WR8A 1C30A 4OGGA 4Z86A 4MKZA 3REGA 3ZU4A 1PEAA 1G38A 3IR6A 3VR2D 2XQJA 2WINI 1YT5A 1D4ZA 2OO7A 4NZPA 4OQZA 2ZIEA 2QENA 1ZQ1A 1GOTA 2J5BA 2VCEA 4QXQA 5HF8A 4KNVA 1KFEB 1HKUA 2P5YA 1JEAA 3WBKA 1EFHA 2QG6A 2GM5A 2VAPA 5JLAA 5KJ6A 1N6OA 2EKBA 3IVXA 3M83A 3DLIA