3I34X

Proteinase k by lb nanotemplate method after high x-ray dose on id14-2 beamline at esrf
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation damage study of Proteinase K at ID14-2 beamline at ESRF
rcsb
molecule tags Hydrolase
total genus 99
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3i34X00
2PWBA 5B1DA 2W2NA 2G4VA 3BPSA 5JXIA 4AKSA 4DWWA 1EA7A 3DW3X 4B5LA 4OMDA 2GKOA 3LPAA 1SBIA 3Q40A 1TECE 1SIBE 1TMGE 1WSDA 1AV7A 2ZWPA 1S2NA 1Y3CE 1VSBA 1YU6A 3TECE 2PRKA 1C9JA 2XTJA 2PWAA 3WIUA 1SCJA 2X8JB 1T1GA 3F49S 3AFGA 1UBNA 5AMXA 3DE2X 3QTLA 2Z58A 4NMXB 3BX1A 3DWEX 4ZARA 3HJRA 2Z57A 2ZRQA 4KPGA 4KB5A 2XRMA 3P5BA 1BFUA 3DYBA 2SECE 2ST1A 1Y3DE 2Z2ZA 1T1IA 3DE6X 3WHIA 2HPZA 4K8RB 4AKTA 2SICE 3TI9A 1AVTA 1IC6A 3DE7X 3I37X 3F7OA 1TO1E 3AJ8A 1AF4A 1PJ8A 1SN7A 3BGOS 1GTG1 3I34X 2ID8A 1TM5E 1ZVKA 3TI7A 1WMEA 1SCBA 1TM7E 1SVNA 5ARDA 3GT4A 3OSZA 4OV6B 2X8JA 1GTJ1 1GA4A 5K7SA 4LVNA 1C3LA 1DBIA 3LXUX 1BJRE 1WMDA 2PKCA 1TM3E 5CW1A 1GA6A 3VTAA 1BE6A 2W2MA 3QMPA 4DJ5X 1SBNE 5I9SA 4CFZA 1Y4AE 5JMOA 1GNSA 5B1EA 1ZVJA 4RYDA 5FBZA 1HT3A 2DUJA 5ARBA 5JXHA 1YJCA 4DZTA 1NDQA 3DVRX 1WVMA 1C9MA 3GT3A 1TO2E 1AQNA 2HD4A 2PMWB 1AU9A 1SUPA 1THMA 3UNXA 3CO0S 5AVKA 1NLUA 3GCXA 1S01A 3DE3X 1SIOA 2PYZA 3LPDA 1OYVA 4JP8A 4Z2AA 2TECE 3Q5GA 1PTKA 3DDZX 2B6NA 1SCNE 3WIVA 1TM1E 3AJ9A 1SH7A 1LW6E 1Y3FE 1PEKE 1JEAA 3SQOA 4ZOQI 5AVJA 1R64A 3QFHA 4H6XA 2Z56A 2WWTA 1P8JA 4MZDA 5JXJA 4M1ZA 2IXTA 1Y1KE 2Z2XA 1KE2A 1SUCA 1SUDA 2WUVA 4WOCA 1NDUA 1TM4E 1SIUA 4OMCA 1XF1A 2Z30A 2SBTA 1T1EA 3D9QX 4YN3A 1TK2A 4CFYA 1C9NA 1Y3BE 1WMFA 1ST2A 1GA1A 4FONA 3DVSX 4KG7A 1DUIA 3EIFA 1P7VA 1BH6A 3F7MA 2Z2YA 3VSBA 1YJBA 1IAVA 4HVLA 1SELA 4GI3A 1OYOA 5ARCA 1OT5A 3EDYA 3I2YX 5FAXA 3CNQS 5SICE 1CNMA 1BE8A 1SBHA 3VHQA 3VV3A 1P7WA 1GCIA 1KDYA 1MEEA 1GNVA 3PTLA 3DW1X 1AH2A 5FFNA 1R0RE 1ST3A 2P4EA 3EE6A 5JXGA 3DE0X 3DVQX 4BWGA 3A3OA 1R6VA 3A3NA 1Y4DE 1V6CA 2V8BA 3H42B 2QTWB 1SUEA 3I30X 1A2QA 3PRKE 2IY9A 3SICE 5AQEA 4CG0A 3GCWA 4NE7A 4WOBA 1BFKA 1SUAA 1AK9A 1SCAA 4J94A 1GTL1 4H6WA 1MPTA 4LVOA 2SNIE 1KDZA 4C3UA 1KE1A 3A3PA 1CSEE 1SUBA 1S02A 1Y34E 1YJAA 1KDVA 1Y9ZA 1Y48E 3VV2A 4H6VA 2W2PA 3L1KA 3DE1X 3DE4X 1GT91 1SPBS 4NE9A 2ID4A 1SBTA 3WQBA 1PFGA 2WUWE 2DP4E 2W2OA 2W2QA 2WV7A 3ZXYA 3D43A 2ZWOA 1SCDA 1V5IA 1Q5PA 3VYVA 1SBCA 4C3VA 3ZXXA 2PQ2A 2DQKA 3DE5X 4I0WB 1Y33E 1EGQA 4HX2A 2E1PA 3LPCA 3T41A
chains in the Genus database with same CATH superfamily
1T9ZA 4EF6A 2GRAA 1L5KA 3PVSA 4JLAA 2K4MA 4J1TC 4KBGA 2Z1DA 1J09A 1OTXA 1EWKA 1J2TA 1U8FO 2QGZA 4AVYA 2FWBA 4NU6A 5FLXA 3KWJA 5KMGA 1Z0FA 2ZUSA 1XDDA 3DV9A 4QYTA 1N2CB 2BZSA 1OB2A 3TN7A 1K68A 1RQNA 1WNFA 1U0NA 4IZ6A 1GTVA 1Q6YA 2CXXA 5DISB 4A8JA 5BV0A 1V9LA 3X0DA 1PL0A 4DDMA 2C9OA 1J2RA 4ALKA 1RLIA 3C3CA 4X71A 4NAUA 5BSKA 2IDZA 5GIOE 3WKCA 1D4AA 4U7JA 3QFSA 5L3SB 2ZBPA 1DKNA 3CLSD 2O8BA 1IE3A 3K8QA 3H4MA 4N8EA 2B3TA 3R2JA 5FQNA 1W1IA 3P45A 3TTVA 4OBEA 1GWNA 4XX0B 1C2TA 2NO7A 2QX7A 2H65A 4JI7B 4QLBA 1OZAA 1ZCJA 1GNRA 4IXWA 4KR6A 2OCGA 3JD0A 1B76A 2KS6A 3SE7A 1O96B 2COEA 3RU3A 3WHPA 2NPFA 2XMDA 1CJUC 2X2OA 3VR1A 3IKJA 3WIUA 4FB5A 1HC7A 5U4QA 4MDHA 1E2JA 4F86A 5JS8A 5IRCD 4GG1A 3K4QA 4Q12A 3NC4A 2IV3A 4JSRA 1X77A 4ZRNA 4F3KA 1KJIA 3OEED 3RSOA 4UZEA 2DLCX 4RCYA 1M2WA 1O08A 2P5TB 2HRQA 2JGIA 1CY6A 1F0PA 3WKDA 4E31A 2YBEA 1LX7A 2FOLA 5BN4B 1ANKA 2I71A 5IC5A 1BO6A 4Q02A 3MB8A 5TGDA 2CNDA 2DXIA 4MVJG 5C3UA 1LC0A 1R0KA 1U7XA 3DOUA 3RVDA 3UB2A 5GONB 4WK2B 2RGGA 1YGPA 2WF9A 1IBSA 1JG1A 2GZAA 1X94A 3LP6A 3MJTA 2I87A 3MWKA 4U7PB 5FBHA 1SXGA 4BIIA 4DCJA 1QGZA 3KT8A 3HCDA 5ALRA 4FD2A 4V0LA 2GJ9A 3PQCA 4MA0A 3ICOA 5KHAA 3ROZA 1GQRA 1D6JA 3QLTA 4G5OA 1ODFA 5CP8A 1WSWA 3O2JA 4EHAA 5CLFA 4LWQA 3F6PA 2RBGA 2YFQA 1NVGA 3N76A 5LQAA 2C94A 3PWTA 4BFVA 3CUEF 2IYRA 3I9NA 4PX3A 4DIBA 3ZHSA 1V4BA 4ND8B 3T9CA 3I3SR 4FCVA 1SG6A 2DFDA 1QK5A 3AIMA 2ST1A 5C53B 2JFGA 1ZK0A 5IVPA 2J0VA 3O7MA 4LYDA 5KYWB 1KKUA 4ITVA 2JHGA 3FKJA 1XXHB 1K8ZB 3BD7A 4HNAA 4DMCA 3QJYA 5KQSA 2BDTA 2PMFA 2GQ0A 1RQXA 4TMTA 3VR5A 3H0EA 1FEZA 4LRTB 1Z82A 2IU0A 2B61A 2ZRJA 4KYVA 2PD3A 4J6EA 2Q45A 4CIBA 2PLNA 1BJTA 1F9EA 2IZ6A 2TMYA 3KTFA 2GD6A 3LDUA 5TQ2A 2XT0A 4NEGA 1NMYA 5JO0A 3THYA 4O2AA 2IE0A 3L1HA 4HNSA 2Q1TA 3KQTA 3QBTA 1K6JA 3H8SA 3OQPA 4O3FA 1CYEA 1YKGA 3T95A 5KI6A 3VR3A 1ECBA 4PCAA 4AN1A 3HO6A 5J4KA 1R37A 1YS1X 1RJ9A 2I2BA 2J0UB 1MEJA 1HE2A 1N7JA 1MG5A 2JL1A 2P90A 1DKOA 2VTVA 2HX1A 3KPUA 5DE3A 2AKYA 4EG4A 3A9CA 1SZCA 1PGNA 1T0PA 2A9PA 3E82A 3GNTA 4JOCA 3EZ7A 3L8CA 3UT5B 4F6RA 3W5DA 2FI1A 1ZVKA 2FCRA 1YGYA 3PPWA 4OQPA 5AVXA 1T9AA 2G9RA 4D26A 4JX8A 3ZE0B 1VE9A 4JYBA 3D64A 2C5AA 4RE5A 1W0JA 2AEEA 2A33A 4UHDA 1IVSA 1V25A 3EGDB 2C2YA 5CCDA 1SK9A 4XGIA 3D3JA 3C85A 3I3OA 4BO3A 3Q6IA 4QU0A 3GPIA 1HYBA 2FZGA 4Q21A 1C1XB 3KCQA 5ES3A 4RIFA 3GR6A 5LMUB 3ZTTA 4Q19A 5FNZA 3TOCA 5I4CA 1DQRA 1WMSA 4BNGA 1C9YA 1M1ZA 2NVWA 3EN0A 3G17A 1A4XA 4JEHA 4C3OB 2BW0A 4ZI2A 1K0UA 5HMLA 4EFLA 1P2BA 2JC3A 2QBYB 2GEVA 1E1RD 5CEJA 1C8KA 3MXOA 4QAJA 4TS1A 3AP2A 2NAFA 3IA2A 4E4TA 1GZ6A 3LUPA 3WV5A 5C37A 1VL0A 1VOTA 3LF2A 4O8CA 2D1QA 2WHYA 1H5NA 2ISQA 4FHEA 3EW7A 3F98A 3X2EA 2EG5A 3JD2A 5FULA 1XR3A 3T7IA 4N6NA 1TQ6A 3V55A 3NDPA 3ZV4A 4YXWD 2QV7A 1XEWX 3RI3A 3KLNA 1SBNE 3ENZA 1L4FA 4F8YA 4BY9E 5DI3B 3G0BA 1HETA 2VDMB 1I3KA 5E4JA 3PEYA 2UYYA 1UDCA 2DLDA 3NBKA 3IMCA 4OO3A 4ZA2A 4XYLA 3B36A 3T7DA 5JECA 1CQPA 2P9FA 1ZVJA 4Y1RA 1ADBA 1RWVA 3IAHA 4LY9A 1PR0A 2FK8A 3MD9A 3EAGA 1NDQA 3ADPA 2ONYA 3ANMA 3OCVA 3EEIA 2WJ6A 2QN1A 4HH0A 4EB8A 1QH0A 2PLRA 2ZANA 3GT3A 3KDSE 4IZHA 4RKEA 4W8GA 2ZUFA 4JV5B 1XZKA 1X7YA 3FWPA 1VPLA 2Q3MA 3PX3A 4O2AF 4UD6A 4MV4A 4LMBA 3ZJ5A 4M0EA 1PLLA 1KZGB 1YBAA 2I8LA 3PDCA 3JR3A 5F35A 5DM2A 1S3GA 1OU0A 1SKBA 4GKAA 3E6AA 2QRNA 4RMGA 1P75A 1TNDA 4F45A 4F85A 3V33A 5TPWB 3Q3HA 1FNNA 2DM6A 4JU8A 3U7RA 4HZIA 2PVCA 4QM6A 3L8MA 3MG9A 721PA 2CLCX 4HDQB 3KVVA 4TMZA 4WT7A 2I7CA 2P5SA 3HWRA 5DHUA 1EVIA 3DTTA 3L18A 1H2FA 2FOXA 1XN1A 3DL2A 3NQ41 4FGZA 4MUKA 4D4LA 1IPEA 2VF4X 3GD7A 4UUOA 3B5EA 3MJSA 2CYBA 5DRYA 3GGOA 1NBWB 2PGNA 1XB2A 3RSHA 2FRDC 1SCNE 4CETA 2WRZA 5AW4A 2FJPA 1S7CA 4HDAA 4YFVA 3IO5A 1Z2NX 3ONFA 4AP6A 5IT0A 3X1XA 4AWXA 3M82A 2ICAA 2BC9A 3FLEA 4ZU6X 1FK8A 5A5VA 3UYLA 4OKSA 3UHOA 3TPCA 1TQDA 4RSMA 2Q8QA 1OE0A 3V7WA 3A05A 1R64A 2PJDA 1JG6A 3FM9A 2MJLA 3KBBA 4RD3A 3UUGA 4KE6A 4A8JC 2FNAA 1OJLA 4ZJYA 1KJNA 1IY0A 5FPKA 4WERA 5AI5A 2C2KA 2ZQYA 2QRGA 5U1PA 2YRFA 2HMTA 3H5RA 1XNGA 5KHOC 3TG2A 3VM6A 5HQ3A 1SKUA 2H9YA 3DBIA 3DMYA 3MM4A 3LQYA 4RENA 1YIAA 1SUCA 2RHTA 1T5IA 2QLLA 3EIUA 3AHGA 1VCOA 1J22A 4J7AA 1LPNA 1MVOA 2LE0A 4FZJA 4PPGA 1A50B 2ZWMA 4AT1A 3COJA 3CX6A 5LC1A 4MK4A 3T12A 3EQ6A 2DB3A 1KEWA 3R7WB 1I13A 2JS7A 3BE8A 3W34A 3I2KA 5IAGA 5CVCA 1NE2A 1TI7A 4HXGA 4FQ5A 4FS8A 3FPKA 5F5LA 4F9FA 1Y82A 1RRCA 1J6UA 1CY2A 2ZR0A 4HD8A 4ME6A 4EARA 2AC4A 3Q72A 3AIIA 1K7FB 3TRFA 4MR8A 2OORA 3RSLA 1GA1A 3ORQA 4RCZA 1LWNA 2F64A 2PS0A 2QUHA 2ATCA 1ITZA 2VJPA 2P9CA 3K9WA 3Q1KA 4BNZA 5K0TA 5LQJA 2LW7A 3NONA 3QPWA 1P4HA 1UADA 3RABA 1LGYA 1C30B 2QMHA 3G5UA 3MAAC 1Q7BA 1AO0A 1VP9A 3AKYA 5CVVA 3SDBA 4AYWA 4F6LA 1BHQ1 4WAUA 2D7DA 3VVBA 2BOVA 2PX3A 2E48A 1AK1A 1PBTA 2AGVA 2JHPA 2MMGA 2Y66A 3I04A 1PR2A 3FOAA 1EU1A 2JVIA 3IT2A 4W7IA 3RBAA 3U17A 4AG6A 4DCOA 1F17A 1X7ZB 1EPUA 3HR8A 5J4YA 4FDTA 1BD3A 4QNRA 3ITEA 1BOFA 3F71A 4YX9A 4QNNA 1B93A 1J2JA 1Z6PA 2TS1A 3SS9X 1YK1A 4FZ5A 1FJGB 4LOHA 3IPAA 2B2NA 3E7DA 5JZBA 3DCIA 4YMUA 4TS3A 2EYUA 3I64A 2Q41A 2OAP1 1W4CA 5SZKB 1IIBA 4PAOA 2OR3A 4AJJA 4ZPJA 3KXLA 1QYDA 2WBLC 4U9HS 1U3CA 1ODKA 3D7NA 3LUFA 5I9LA 3EZ9A 1VPVA 2QYHA 2P6OA 3FNRA 5DHSA 1PJAA 1W94A 1JU9A 2BI4A 1X1AA 3HB4X 2X0FA 2AG6A 4BE9A 1MVNA 5JCJD 3ICVA 2O2JA 2AZMA 3MINA 4IR7A 1U2ZA 2QIPA 1VI2A 2I1WA 3GJXC 4QQRA 4ZVKA 4N0MA 5AXBA 3T9FA 5F7OA 4PIVA 2Z2IA 1HOXA 4AW9A 3UGKA 1ZIXA 1EJ0A 3B6EA 1NF8A 3BKWA 1LVHA 1RWKA 2BIFA 1L4MA 1R6VA 4HF7A 4INJA 3BHNA 1ENYA 1YC2A 3OLCX 5A4KA 4IEFB 2ZRHA 3E5HA 4JQOA 2VRCD 9MHTA 4Y6OA 2JA2A 1I80A 2HJRA 3TF5A 2QYTA 4CR6A 1NA5A 1V2HE 3L7BA 4O4LA 2IYYA 1EFVA 4LOLA 1P3DA 3SEZA 1CQJA 4PGMA 3F47A 3WISA 4ZVLA 1CY7A 1T1JA 2D5LA 4Q5IA 1REQA 4HS9A 3FR8A 1WUKS 3W7AA 4IIJF 2MOKA 2O0MA 4RF3A 4U7TB 3COPA 1ZLXA 2ZCVA 1Q92A 1QB8A 3QVWA 1RWNA 1HGXA 3OHSX 3BS4A 2I8CA 1PT6A 3QYAA 4TLCA 3GLGB 1CULC 4EIWA 2CT8A 4H08A 4EQ6A 5LP1A 4Q9HA 4JDPA 1Z3CA 1M10A 3ZS8A 4F4DA 2I7DA 4BU0A 1PWHA 1MENA 4ZAXA 4XI9A 2N0SA 3TLZA 1V8BA 3MCZA 4JCOA 1L5HA 4CKCA 3SR3A 5C3MA 2J8ZA 3IPXA 1CJMA 3SG0A 4YROA 5DBGA 2PMEA 1ES9A 1NGSA 1SZPA 2Q07A 5LZ9A 2R7AA 3U4QB 3NTRA 3L8HA 3MAGA 3BTUA 2MSLA 3KXPA 1DZ3A 2V7EA 3K20A 1GM5A 3DCNA 5DI9A 5EG5A 1MPTA 1A7JA 2Z3WA 2NQ8A 5I7SA 1JDNA 2QN8A 3G8DA 1ZMTA 1U9IA 2W6OA 3CRNA 3G68A 3KTAB 1SNYA 4GKBA 4GPIB 4LVOA 4TKVB 5DNAA 1GCUA 5JVDA 5DSTA 4R2MA 2GTPA 4C3UA 3OOHA 3EG9B 2GRJA 1R4AA 3EVNA 4DFDA 4CTMA 4DMRA 3GZTB 3LDAA 4I9GA 3O9VA 1T25A 3U80A 1M6WA 3D8RA 3ZVRA 2BELA 2W58A 3VZPA 1XZLA 2ZW9A 1G8FA 3NWBA 2ZUDA 3II6X 3I0MA 3MB5A 3IR6A 3IL2A 3ZE1B 4CM9D 1U5AA 3ER8A 5IDYA 4GECA 1HO3A 1UBFA 5CX1A 1CY8A 3BVPA 3DFUA 4NZZA 1Z5WA 1C7ZA 5EWMA 1BU5A 5DM60 3K35A 1WM1A 5CBPB 2J85A 2RH8A 3DMRA 4BMCA 1TE2A 4TL6A 1RXYA 3ZBUA 4OP2A 5K4HA 1ESDA 4TTAA 2J30A 4DDTA 4JUIA 3OF5A 5JSHA 5JV5A 1ONPA 3GVPA 4JI1B 3AEZA 1RQPA 1CWUA 4MDEA 1D4ZA 1I2CA 2ID4A 1BMFD 3NDIA 2WD9A 3PFBA 1EAMA 5GJWC 3VU3A 2GA8A 4NV3A 4X61A 3HB1A 1U0RA 3HZZA 3VJKA 4K88A 1YCFA 5FPSA 1IFXA 1E1YA 4ILKA 4GMGA 3TL6A 3ELDA 3UMFA 1H8ED 3HCOA 1CB7A 3ZXYA 1PSWA 1Z26A 3R4VA 4HDKA 2ZREA 2AI3A 3KAKA 5CPBA 4TMWA 4YJ2B 1YR1A 4KJXA 2FSFA 5FT9A 4RHEA 3F5FA 2IEGA 5IAEA 1ZQ9A 4O4LF 1G60A 1ZUNB 3A1VA 1E2BA 1FBNA 4MKIA 1ZGHA 3CM0A 3GAFA 3IHLA 3D2BA 5E7IA 5JNUA 1FLNA 2R2AA 1SBCA 3M7IA 3B12A 4NJMA 4UNQA 1DGQA 1UZNA 3L9XA 2CZGA 4AC9A 4KYUA 2WOOA 4L6IA 2C7BA 5KINB 1ZEJA 3RFVA 1SJ9A 4EHLA 4Q93A 1CJVC 4AJIA 1TLFA 4PO3X 5E0OA 4MQEB 1AS3A 3BMOA 4QBKA 2FEMA 4LTNA 2W6JA 2ZJ5A 5IBQA 3MTAA 4FU0A 2IIBA 3JD4A 5IC4A 5IX8A 4R68A 3PG5A 1T5OA 3NOQA 4BVKA 2LKDA 3HMQA 4P5DA 4OMUA 1GPNA 5I9IA 2HZ7A 3R6DA 8AT1A 3ZX4A 4BC1A 1ZK4A 1GPMA 4JC8A 2CLLB 1UK8A 2C92A 3BA6A 2EP8A 2Q1SA 3QMMA 5TGTA 3GRKA 4ZYYA 1O0CA 2R6GA 5AVYA 3GRUA 3I32A 1SULA 4WVFA 4ND2A 9LDTA 2O5VA 2WHRA 2GJAA 1U02A 3HU5A 2VP6A 3I72A 2WHXA 2QTFA 5FOSA 4N3AA 3AR3A 3CTPA 3ELBA 4HQRA 4JI8B 3CLRD 3GVXA 1E1CB 1NZDA 2PA3A 3CUTA 4QM7A 3VPAA 2FLVA 1CE8A 4HB2A 3CY6A 3GROA 1V26A 2E6UX 2X2PA 1E94E 3TW4A 3RK1A 3TRHA 1QZZA 4O1IA 2JFVA 3LPAA 3P9YA 1IU9A 4GHWA 1GL6A 3RIXA 4I08A 3SC6A 3F78A 4ILEA 5CXUA 3JRXA 3F9IA 2OBXA 1W48A 4CQMB 5HIMA 1L9KA 1HG0A 2CL5A 2WJAA 1MABA 4FJ1A 1JH8A 4KSBA 2HCFA 2W4IA 4TSRA 1SK8A 4BUJA 3A4IA 1K88A 4PZZA 4M0UA 2Y4OA 1TMGE 2YL2A 4F1JA 1QHHB 4I8IA 4KR0A 3DDHA 1F60A 3QJGA 2OORC 2AV6A 3S2UA 4WASA 1WABA 1TA0A 2Q6OA 3EJWA 3ZV6A 4FMDF 4GLJA 1OIWA 1JHRA 3Q5DA 4U9UA 4B7CA 3IEMA 2ETVA 4JUCA 2H1OA 3WGHA 3GEPA 3ZWMA 3X44A 3KLPX 4LVUA 3B48A 4CTKA 3FPFA 4E5YA 4OX9B 3K4HA 4ZT4A 4MIOA 4BMNA 5E3HA 3JQAB 1K7YA 4CDRA 3RS0A 3L7OA 5TY0A 2CLOB 3SK0A 4BMSA 4BNKA 1Q22A 3PNLA 2AMJA 1Y4SA 3AU9A 3TLGB 1N5KA 3HLYA 2P40A 2ZS9A 5AMXA 5JJCA 2O8FA 1T2AA 3RPEA 4DBLE 5I9NA 2F3TA 4RANA 1K7EB 2UZIR 4YY3B 3D6TB 2X58A 1GZ7A 5KHLB 4NIMA 3HUEA 1U4NA 4CQLB 4G4JA 821PA 1M74A 4F3CA 2Y93A 2GDJA 1NXQA 2QE7A 1OXXK 3FJ1A 3OA2A 4MI6A 4W9NA 3RVKA 3LHKA 5C4GB 3EXIA 3OMXA 3WBFA 2J9GA 4X6XA 2X8WA 3B78A 3A14A 3IEKA 1Y6RA 1I6MA 1P5JA 3HKEA 1T35A 2KM1A 3UC9A 3HHEA 2QP3A 3NORA 1A9RA 1TYAE 4FKZA 1CUWA 3UZUA 2GEFA 4B85A 3VJRA 2XRMA 2DFNA 4KTVE 2OFXA 1HDEA 1NX9A 3AYZB 3H4TA 3GELA 2GBLC 4U02A 3G0GA 4Z3KA 2OB2A 2PL5A 4GQIA 5A04A 2JAQA 4GX2A 3OU6A 1JIVA 3NP7A 1G38A 1FRVA 2QS9A 2OA0A 3MUNA 3ETGA 1QUFA 3HBJA 4KXQA 1WSBA 1RJFA 1GU0A 2R11A 2I4LA 3ICQB 4XCQA 5FPTA 3JQQA 8ATCA 5LP6B 4MQLA 3HU3A 2PUJA 2Y2UA 3GMIA 3KD2A 4RABA 2BGWA 1TMKA 4KPUA 2O50A 1RYYA 1QFSA 1Z9BA 2XZDA 2XWQA 2BI7A 4K6OA 4QYXA 4LFCB 3K0CA 5LQUA 5DHRA 3L0PA 1YS4A 4IDHA 1E5QA 2CXTA 3N2NA 1J00A 2HPAA 1WJGA 3Q3EA 2P3OA 2FY8A 3D6JA 3HDQA 5IK2A 4AJPA 3JTMA 1E4OA 4DMKA 1N2OA 1ULSA 3F7OA 5B1HA 3FHTA 1JZSA 1N9ZA 4Q05A 3RLIA 4OXNA 3WWOA 4IG9A 1J23A 2L42A 4AZTA 1MUUA 3M8KA 3QXSA 4V03A 4V0MA 3UA3A 4I1RA 4EKIA 1H4QA 3WMRA 3E9EA 1E3SA 3B3JA 4GWGA 2JASA 4UUBA 1JHUA 5IYZA 2NU7A 3LAWA 4GOMD 4IUBS 4JBLA 4WH0A 5F3DA 4BPRA 3UPUA 1U8EA 1VQ1A 4DKXA 4J1QA 1JPJA 1M2OB 1AN0A 1Z22A 4XQEA 1GLNA 1GLGA 1GQQA 4J9VA 4O0MA 1RFLA 5ALTA 3INRA 3BEDA 3AKDA 1T9GS 5BYJA 1E9VA 3LUKA 2ERXA 5K3FA 3BGSA 4PICA 5KWJA 1IXSB 1U9IC 2VNJA 1GTJ1 1X14A 3BORA 4MKZA 3SKVA 3VKWA 2HU8A 1AZSC 2ISCA 2H5IA 3IUPA 2Q5IA 4R1TA 2YS6A 5GY7A 2QT0A 1V71A 2HT1A 1RM4A 2E4XA 2EP5A 3OJFA 1CJTC 4CG2A 2ORIA 2NX2A 3C6KA 1ZGAA 4ND3A 1IJFA 4G5YA 4NTZA 2FN7A 3D4NA 4ARBA 3GLIA 1VMKA 3NHSA 3RS8A 1GA6A 2LDXA 3FAKA 2WA2A 2XNHA 1BC5A 4DT1A 5THXA 3BXZA 4ENPA 5JXWA 2W2MA 3C3AA 4FX5A 4MQ5A 4TN1A 2BFCA 1VG9B 1IQ0A 3NMUF 5BMOA 2WJPA 1FSPA 3W2TA 1NE7A 2AYYA 2YC2C 4LNUB 5K0NA 1QAQA 4JP2A 1L8OA 2RHLA 4X3OA 1DTWB 3RDPA 3M4JA 5FO1A 3T9BA 2IS1A 3AH8A 2ZRNA 1KKLA 2OHXA 3A4VA 1L7QA 4TMFA 2J3JA 1M72A 3DM9B 2XOKD 2HRZA 1XCLA 2IS2A 1K5DA 4A36A 4IDNA 4BP9A 4BBJA 2PGLA 3QFCA 4Q01A 2NO0A 3ZK9A 1HDYA 3TCKA 5AM2A 1SC9A 4Y2HA 4WJZA 1A2OA 1PIWA 3LXXA 3WWZA 3WJAA 2FDXA 2BYTA 2JFQA 3K9CA 2OK7A 3QIVA 2OV3A 4HLUA 1DHRA 4CNQA 4C7XA 5B7NA 2D6FA 5IT9A 3KC2A 3BGDA 2H52A 2AFHA 5FPYA 4BKPA 2V65A 1GUZA 4EFNA 2IZ1A 2XWJI 1U94A 2HA5A 4IVRA 1UAAA 2CVQA 3R09A 4DN6A 4FS3A 1NLFA 3L4EA 2GTHA 1U9JA 2DKOA 3CUSA 3R40A 4TT3D 4WOKA 3VVMA 5LCXA 3ZWBA 3E9CA 3KFVA 2I67A 4CGZA 4X95A 5EPOA 1CETA 3NXSA 3DAFA 4DLWA 4FDUA 3CCCA 3DAHA 4R2XA 2HA2A 4LJLA 3D6FA 4M60A 1OYVA 2O0HA 5HYVA 3IBGA 1XEXA 3I4CA 2ZIGA 1JAIA 5IYZF 2QIOA 2H4HA 1ZCFA 1OPRA 2QTMA 1P5ZB 3TZHA 2EWWA 5HKAA 1ESZA 1D03A 1P0IA 1TVKB 3KWMA 2HR1A 4Y6RA 1Y89A 1KY5A 4XJSA 3S0JA 5LJLA 2F43A 3DULA 4GOKA 1I4DD 4PLYA 4XVRA 3CF2A 3FYDA 2A5DA 3IULA 4QODA 2OFOA 2YWBA 1NSFA 1BW9A 3UYKA 1X9HA 4PRLA 4DWJA 5EWLA 5KTYA 4FHDA 5FHQA 3IT0A 2WJ4A 1DXOA 1Y3FE 4DRYA 1RR6A 3AERA 2X1HA 2YWJA 2H57A 5KYYB 2HIAA 1VHWA 5DW0A 4ISBA 4HMQA 1X1SA 2PMDA 3SHQA 3Q15C 4HMOA 1P0PA 3QFHA 4NZYA 2D1RA 4OL9A 4R7ZA 3ZY2A 5JS2A 1RXWA 4OI1A 5DO9A 4LHSA 4WECA 1QIJA 2ANBA 3K5WA 4A8JB 4AJNA 1CFZA 3PSAA 2OC9A 4L3OA 4BGIA 4BLWA 1XAGA 2ZRDA 3AKCA 3NV7A 1B6TA 2IY8A 3W3ZB 3X1JA 5JT1A 3A6PC 3L77A 4DV6B 3FSGD 4MQFA 3U49A 3WP0A 1RAGA 2O8BB 3CNOA 2C0CA 1QBKC 1YTLA 3N0TA 5ADWA 2CLEB 4F3TA 2CV1A 1U3VA 4L8FA 1LVUA 4UNRA 1U0JA 2XUZA 3VTKA 2AEFA 2SBTA 3D9QX 2OV8A 1ACLA 4UUQA 4ZRMA 5IKPA 3JARB 1CIVA 3EPJA 3ZY5A 1PW7A 2PO5A 3NBAA 4JWKA 4Y2SA 1T4DA 1XZNA 2FW6A 5HMMA 1M76A 2NVUA 3EA5A 7MHTA 4HRYA 1THTA 2Q4BA 1U5BA 1S3FA 2IZ5A 1LXCA 4HNVA 3H2GA 4LDAA 4OHCA 3VR4D 1K8RA 4UEQA 1YDFA 2H2DA 3RAFC 4YUYA 1NUSA 5IDVA 2ONCA 3KSRA 5ELMA 2J08A 1DZIA 2HYIC 1BH6A 4BNUA 1D6MA 1KO4A 2Z2YA 4L2IA 1KARA 3K05A 2TYSB 2VH2A 4W9NC 5ICSA 5L95A 4W5QA 1PL6A 2PX4A 6REQA 2X0JA 3L1UA 2XNSA 5I9BA 3S1AB 4XVHA 1M6EX 4E2XA 5K45A 4LZWA 1SG0A 2VDVE 3TW8A 3VPGA 1SGWA 1F6DA 1YL5A 1L3IA 4A8PA 3ZXUB 4CPDA 3KSDO 2ZSUA 2BKUA 1LDYA 1XHFA 3PXAA 1LTKA 1A1VA 1K89A 3GBVA 2WJYA 2R6JA 4AN4A 4D9MA 1J8FA 5A62A 5J2TA 1I01A 3A9SA 4PQEA 4S1VA 3KU1A 3E1SA 2Y71A 1M34A 2R47A 2VJCA 1NQOA 2Q4EA 1G20E 4PXYA 3SZUA 3W3AD 5C81A 3B9BA 1IN1A 4JWTA 4WFKA 3MWDB 3GLHB 3LGSA 4D9NA 4BQSA 1Y7LA 1UFKA 4P92A 1MG0A 3HBMA 4J3NA 2H7CA 1U3GA 1QNFA 1W59A 2XUIA 4Q4DA 5G40A 1NYLA 2O7SA 5P8WA 2IP1A 3HY3A 3IHTA 5A0FA 2C4TA 1MA0A 1AKMA 4HNAB 4EG8A 1H1TA 1GZHB 2WZCA 3OFKA 3CB4A 3K70B 1B00A 2FPUA 2HM7A 3EC1A 1V8FA 1XMOB 1KP3A 3K0CC 4P7GA 3DV0A 4E2ZA 5LOVF 2HMUA 4DR6B 1GPWB 1LDMA 1QZXA 4UVDA 2QYSA 2V9ZA 4EL0A 5JSYA 1VG0B 1XTZA 4KXUA 5TQ2B 4GX0A 4KVFA 1WZUA 4IDFA 3WXMA 3FHOA 3OF3A 2PTHA 3BILA 3DFFA 5H4GA 2J3IA 2UKDA 4LY3A 4NESA 1NKTA 2G5TA 1RAFA 3AHFA 4K81B 4LEIA 5DRTA 3EVFA 4CLRB 2C5GA 3BQ9A 2ZSEA 3OJLA 2ZRLA 4MJXA 1GOTA 5HJ2A 5FJJA 2JLXA 2EX1A 2F00A 3DQPA 4UHJA 4LSMA 3RR2A 1ZITA 3I30X 4G1VA 2X40A 4EFKA 2PK3A 2ZPAA 4KN6A 4ZTZB 3TIVA 2H31A 5BR8B 1FFCA 1NPYA 2EJCA 3MUOA 2B78A 1H0KA 1VJTA 3JQBA 2CMFA 5IH3A 3PXUA 4F7WA 5COQA 1GQ2A 3UMBA 1MRNA 4G41A 2PS1A 4PBTA 3FR7A 1KC1A 1KI6B 1XQWA 4UFNA 2VNSA 5CTJA 4J7CA 2O2XA 1QF7A 3CLTC 3LUGA 1XMIA 2C8JA 4O4HA 3TMAA 3EK2A 3TOZA 4DSOA 3VVCA 3NI2A 3GBSA 1KA9H 3R4CA 4I4TB 1XG5A 5F1KA 3B51X 1RXVA 3D2CA 4RGVA 1E4EA 4ZDJA 1QDUA 3C3YA 1YHZA 1BCSB 2X5OA 3BIJA 1ECJA 2FFQA 1EP9A 1PJ2A 5F3RA 1KAEA 3UICA 1EFAA 2SNIE 2I4MA 3T9EA 4OYHA 4OHZA 3RAGA 3RSFA 5JI3E 1XQVA 2K7ZA 1R0ZA 5TC4A 3F3MA 1PYGA 2OSVA 2JGDB 3LKBA 5EPUA 4DIFA 2ZBDA 4ZYUA 4N7JA 3UW1A 3GP3A 1P73A 1UPBA 5G0SA 5AP9A 1X8XA 4YBRA 2QDKA 3HUDA 3UG6A 1IPHA 5J2TF 4N49A 1E3JA 1MH9A 1BXZA 1P6XA 3SHFA 3KCNA 5C9ZA 1YB2A 3HJCA 4J0KA 2GNAA 1G21B 1YAJA 3PRJA 4V2UA 2GWHA 3K8OE 1M75A 3H8JA 1G0NA 2XZPA 1YUBA 2JARA 3L7KA 4ZCMA 1C3VA 1WZNA 2G80A 2NOAA 2VWPA 4ZAFA 4KZPA 2B5WA 1DS6A 3GG2A 1UANA 1Z88A 2EFCB 3I09A 4GI2A 4QHTA 4XPZA 1DP4A 1QFXA 1QKJA 5K1ZA 2C61A 3HYSA 1RP1A 2PMKA 4C03A 3U7FB 2YHSA 3X43A 4HWPA 3OOWA 4ALMA 4DWOA 3AVXA 2AT1A 4HLUC 2MINB 2PXCA 3OU7A 3QKSA 3OWOA 2PL3A 1Z13A 3N2YA 3IP5A 3IE1A 3ZE8A 2PGJA 1A5ZA 2GKSA 4TVBA 4DMMA 4I55A 2IA5A 1ZX1A 1LLUA 3JAKB 4WV3A 2HGZA 2OV6A 2DJIA 1M2GA 2ZIXA 3IJRA 2GPJA 2JGLA 2JLUA 3A25A 4MV7A 4QUEA 3DBLA 3VDXA 2PV7A 3UN1A 5G3YA 5LQRA 2JFNA 4P0QB 1QPBA 2ZWOA 3D8BA 1VG1A 2AN3A 1HLPA 2RONA 1ZOIA 1DJOA 3A9WA 1DJQA 2H3EA 1BHO1 2VWGA 1J97A 4I1SA 4N18A 4UULA 3ZR4B 1XCMA 1E79D 3P2JA 4X9XA 4DPKA 3SS7X 2DPLA 1F2UB 2H29A 4ZI7A 5JQWA 1AKQA 1GITA 2KWIA 1GXSA 3P8ZA 4X1OA 4XQCA 1NATA 4JK3A 4NMMA 3K70C 4OJQA 3HZRA 3L82B 3N2GA 2P2ZA 4RNCA 1Z74A 2BFBB 2PXXA 4C4OA 1RKQA 3GN1A 5JO9A 4C3VA 1TFUA 3MPUA 1D04A 4C78A 5C1IA 1F14A 1GUDA 2VLBA 1IHYA 1QGOA 3F1KA 1MQ9A 2RJ3A 3HZOA 1FSZA 3E2IA 4D0SA 1IMJA 3MOGA 2CVOA 2QUZA 3B9QA 2GJKA 4LC1A 4TRNA 4I0WB 3ZW9A 2QQ5A 3UT0A 4JI0B 1PKEA 2Y99A 2YZNA 4JC0A 5KSOA 4BNMA 5C18A 1DTSA 2LV8A 4DLTA 5JOQA 4UPEA 2Z8XA 4FYJA 3KG2A 5TB5A 1UJCA 2Q4RA 2ZXFA 4CCSA 1L4EA 1SG9A 4QU9A 2G0TA 3CPHA 2BCJQ 2OCLA 4OQQA 3EEYA 2ZBFA 4IYRA 4RKWA 1YR6A 2DWQA 3CUVA 3O03A 3TDKA 5FPPA 4KQFA 1VA5A 4OQNA 4XB1A 3HBNA 2ODAA 1RXSA 4E3WA 3HFGA 1SXQA 2A57A 2ASVA 3VC1A 1Y3AA 1JWLA 3EHDA 1ZGCA 5LUAA 2ZE8A 2F62A 3VPSA 4TXLA 2OM2A 2D06A 3FI0A 4MTLA 4PYNA 2MSKA 4YCSA 3AHJA 3GLRA 1A27A 1QFYA 2HF8A 2PS3A 4PYQA 4TS4A 2VYVA 4DG8A 2V55B 1Z28A 1AURA 1XKXA 5HQ3B 1CQXA 3C98A 3NTUA 4P3XA 4HNGA 1JWBB 4KI0A 4IIJB 4G4SO 3RS2A 3A8TA 2UVPB 3GCZA 5K05A 5K4GA 2XUHA 5DYIA 3K09A 4HJRA 3OUZA 2Y3IA 1TECE 2Q3LA 4E21A 1QO7A 3AFNA 4QX6A 1O95D 4DY4A 4KUEA 3STYA 3A4LA 1MX1A 3N87A 1SIBE 3SZGA 4RK0A 4MUIA 4B09A 3B85A 3DZGA 2FFRA 2WWWA 4RKQA 1XJ5A 2ZDHA 1TTPB 1FSFA 4AK9A 3IILA 2EJUA 1AX9A 5FNVB 3W79A 1ZI8A 1D0VA 1FMCA 1RZVA 1VSBA 1NN1A 1Y1QA 1T3GA 4TXJA 3LTEA 5B57C 2HXGA 4EB0A 2XTJA 4UNSA 4I55F 2Y2VA 1OLUB 3DTVB 2OLJA 5T57A 2PCLA 2WT4A 1IUKA 3E61A 3PGVA 3ZHTA 1H5UA 1K97A 1VYUA 4NXNB 4O08A 5EXEA 3FFTA 3NHUA 2G9NA 3E7PA 5BWOA 4MW7A 3TGWA 2AQHA 1GCGA 3GJ8A 3WRXC 1WLYA 4XM0A 3OIGA 4Y2XA 2DBQA 1KY3A 3V8BA 4HDMB 4ZI7F 1LBEA 3BFJA 4KPEC 2C58A 3HJGA 1UEXC 1GPDG 3PLAE 3EGOA 2PAAA 1ABBA 3LV8A 1RABA 4LFBB 1G55A 1IRXA 1G5PA 1ZJJA 1FFEA 3T7JA 5HX7A 1NMQA 5EINA 4ZAZA 3FTEA 3IKTA 3E05A 5ESXA 4YRCA 1MO6A 1QOPB 4S3MA 5JBNA 3IEVA 3ILHA 1V3VA 3VAAA 1FDUA 5JRJA 4L72A 3OJCA 3JQFC 1OXMA 1R4ZA 4INOA 1ZOPA 3DAOA 4YQFA 1JLRA 2HAEA 1ILWA 2LZ0A 1CBUA 2P6NA 3M9WA 5LYYA 1IXRC 1VL2A 5CPFA 2XOXA 3A06A 4CT5A 2RH9B 3LWDA 4B3MB 5JAOA 4FDAA 2J32A 3G8AA 3S27A 1WOYA 3I6YA 3HA3A 5CNJA 3ZZTA 3WLEA 1ESCA 3LZ6A 4R2LA 2BGNA 1YZVA 1MQ8B 4GXRA 1E63A 5JATA 3MTDA 1SBYA 3P9CA 1RPJA 1FS6A 2ONKA 2REOA 3FFXA 5K99A 3GP8A 4XJTA 2XGGA 5HM6A 5M34A 2LWIA 1QR6A 2ZR9A 4GRAA 1NBIA 2ZJ0A 2HRDA 1CQJB 4RGYA 3INGA 1JEYA 3FZYA 4KXXA 3UT6A 3LFHA 4ZYTA 4NS4A 1H22A 3CONA 3ASZA 2AXPA 5K0FA 4YQEA 3S5JA 1GKLA 1JILA 2C88A 2M6SA 3I6MA 3JQBC 1X1CA 2Z2KA 1B42A 1PX0A 1E1MA 4HN9A 1A95A 2H59A 3DNFA 4GXTA 2C5FA 5JARA 4KR7A 2O48X 2FFHA 1RMQA 3BCHA 2CXPA 2ODEA 4JLMA 2YASA 4QOFA 4DNXA 2HO4A 2YJ3A 1U5CA 3MK31 5F2EA 1PJRA 1Z33A 1QYIA 4QTTB 1RW4A 2P8SA 1L5HB 4CKCB 5KU1A 1Z39A 3TI7A 2HFJA 3Q3VA 1EBBA 3OKCA 4OHFA 3K6SB 3EF1A 4GX1A 3HO8A 4J7UA 3R44A 1QH8B 4ZHQB 1YZTA 4E6PA 5B1SA 3IESA 4Q3DA 1X7GA 1YFZA 2FR8A 5F12A 3V6MA 3I04M 5I4KA 1KRXA 4JZYA 3ROQA 2GVNA 4MVJP 1YE3A 1YOVB 5FOVA 5JRZA 1R3DA 1Z4MA 2RHRA 4LVNA 1AA6A 1DBIA 2QPAA 5LZ2A 2JI8A 4H1TA 3MGAA 3AR9A 4IJMA 3SBXA 3K9QO 2QTLA 5E8JA 1QH1A 2PT5A 2Q4OA 2YVQA 3U81A 4B74A 4E09A 1L5GB 1B6RA 2PZBA 5SZJA 1YB7A 1A8PA 3W2GA 4C4AA 4WNCA 5EFOA 1MJNA 3QMPA 3BD8A 4HGYA 3EMKA 2M6KA 4V38A 4M0LA 3R9KA 2X1LA 1TZCA 1U2GA 4IEIA 1R15A 1P5HA 1VZ2A 3PE4A 1JN0A 2G1UA 3OZIA 3RQIA 4X60A 3NBUA 2X4DA 4OH7A 4F60A 1FDIA 2HJ9A 2FUEA 1DUVG 1Y4AE 1UOPA 2C1ZA 3MTGA 5B1EA 2BEVB 3AUJB 1CF4A 2HW8A 1WA5A 5EIBD 4BZXA 5AXDA 3MTBA 4D99A 2GF9A 4B80A 1NXVA 3DP9A 1V11B 4E08A 3GD5A 3MTQA 3QVGA 4GYJA 5K51A 3U09A 2Q49A 4L85A 3CRW1 3DNMA 2PZEA 4NBUA 3V3KA 4CCAA 4JQZA 3BWVA 1ZH2A 3PJGA 4B7UA 5CBKA 2QTZA 4HDKB 1RRFA 4IIUA 3RHSA 3Q2OA 4CKEB 5FADA 2JIZD 2ZB2A 4YUAA 4UTPA 3UK6A 1BEEA 4AX8A 1DBVO 2G70A 5FCDA 4BYGA 4H1WA 2OVBA 4WI1A 3AZPA 2RGDA 1VHTA 4MUAA 1YRHA 1BX3A 5GP1A 2G9VA 4XRGA 2XQIA 4LOKA 2C8VA 3P94A 2JAHA 1YRAA 3GCXA 4FINA 4NQZA 4QUDA 4ZQEA 1NV9A 2ZYAA 2IJGX 4LYYA 1NXWA 1IM2A 2ASEA 2DBYA 4WUTA 2GHRA 3G2QA 2PUBA 1CUDA 1SQFA 3KR9A 2WYWA 3S7ZA 4BGVA 5C5EA 1KAQA 1Q0RA 3FZEA 4FDLA 3ZV7A 2N9UA 4IHKA 1IL0A 1U2QA 1JDJA 4FZVA 1NFQA 3AQ4A 1VYVA 2J9FB 3COZA 1IRIA 1F06A 1VE5A 1E59A 3MSXA 4DADA 4W5NA 3DDZX 2IEAA 4AZ3B 1E5XA 1C0LA 1FNBA 2HQSA 2NSHA 2W8ZA 3HJAA 1AHPA 1RPZA 2G09A 3P4UA 1HA3A 1KI4A 1Z5PA 5AJZA 3WIVA 5DVZA 3WGTA 1ZD1A 1NU8A 5KYTA 4I1IA 2Q0XA 3BMCA 2BV3A 1Z68A 1QMPA 4PG5A 4X3CA 2H0QA 4LBYA 3ZY6A 1MZVA 1SHLA 2CFSA 2JRLA 3O9ZA 2Y1KA 3C3EA 2Y4NA 2WJGA 4FKBA 4J2OA 1M1YE 4N47A 1W85B 4TWZA 2R86A 1CUBA 2J9XB 5DBOA 1M8JA 1XZGA 2VDJA 4Z9FA 4KQCA 4MWBA 4YQZA 1PGOA 1E4VA 4A15A 4FXPA 5FBVB 4B0OA 4BQNA 2FVYA 3AUKA 3K09C 2V6JA 4C4RA 4C6RA 4DM3A 1N1MA 3A3YA 5EWJA 3HDTA 2Q7XA 2ZU0C 3HR7A 4BHTA 1E5DA 3MEQA 3GUVA 1MABB 1E8MA 1Q44A 3P0RA 5F33A 3F9RA 1J42A 2Z8YA 2UZ4A 4LZPA 1PRYA 4UPVA 3ND6A 1OX6A 4BLPA 2O9JA 2E3JA 3IHKA 4WN9A 4Z7JA 1FFGA 2F1HA 1J39A 1E99A 1F12A 1V9SA 3LE8A 3GJ5A 4LXQA 3UXYA 3W2FA 1YS6A 4G0VA 5F5NA 1TM4E 3W5IA 3VZSA 4EVSA 1M0TA 4NPAA 1I51A 1ZU5A 4V3CA 2X0KA 4KHZA 4YN3A 4ZT3A 4BVHA 2XCTB 1HLGA 4K86A 1P9OA 1WKBA 4Q1EA 1CB0A 2YYYA 5H8WA 1RE0A 4PSDA 2WF8A 2JJ2D 1T2DA 3GMDA 1U1IA 5F1OA 3TBHA 4C06A 4N7BA 5BWNA 5HA5A 4S1WA 3V5NA 1R50A 2BZ0A 4UVIA 2E21A 3ABZA 5A06A 1A4IA 2NTNA 2H3HA 1IOZA 3O0DA 1IN5A 1MC1A 4JFAA 3TJMA 3Q9LA 1F20A 5EHZA 4D97A 1T6XA 2Q21A 5JS6A 2G63A 2Q3HA 4DR7B 3AVWA 3AW9A 2YIMA 4D4IA 1PQYA 2F8TA 1UFOA 3OZBA 1Z7GA 1ISSA 1A7KA 2A0KA 4NR0A 5KYXB 2Q0QA 1X7DA 2EOAA 5FKJA 1P1KA 2P7HA 4R05A 1H4TA 2IPMA 2PBZA 5HM8A 3NTQA 5KOHA 1IWPB 4HH1A 2PWZA 1ADGA 3JQEA 4PZCA 2GK3A 3IEUA 4A0GA 4B2LA 4CMGA 4U6SA 4AJKA 3BH6A 5KWVA 3F6YA 2D4AA 3FCSB 4FHFA 4DQKA 4FXOA 5F77A 1JDZA 1L7EA 4I5DA 4DLKA 2X6QA 2HPVA 1VHLA 1A5SB 4PFSA 2WM9B 4WACA 3DWFA 5DHPA 3FNFA 3BK7A 4L4SA 4RPJA 4MUMA 3ST7A 4U1RA 2IZ0A 4BFWA 2QR3A 4OJTA 4HRXA 2WVHA 5FP0A 1RXEA 3I9KA 4M9RA 5BWCA 1XO1A 1AKEA 3BH7A 4EQZA 1QYXA 3CNEA 1EGHA 1KGDA 1LRLA 3NM6B 4WZBE 1LKZA 4F8EA 3RF6A 2ATIA 5CFZA 5CDGA 3BTVA 4PLCA 2I6GA 4ZEMA 1T9DA 5LBTA 4OSOA 3O4VA 3ZY4A 3TUZC 3KVYA 4H3SA 4HAUA 1C4WA 1DBQA 4HDNB 4PV7A 2O8CA 1SHKA 4JB3A 4P86A 3ZKWB 1MQSA 5MN4A 4H0CA 2HSDA 2ZZNA 1DX9A 4IRXA 1H4VB 4BYMA 4ENSA 1Y4DE 1B41A 3WK8A 5FR2A 3RFCA 1GGMA 1KMMA 2ZKIA 4YMIA 1BRMA 1D2HA 3RJ9A 1FE8A 1UBLS 1XRLA 4M7OA 3DZBA 2JGRA 1MB4A 1RQ7A 1W1WA 2ZQZA 3C3BA 2YVLA 2DPMA 5F78A 1HH4A 4JB8A 3O83A 4GLFA 4Z4QA 1K2WA 3VO1A 2XYRA 5EXXA 3CE6A 2G5CA 3TEJA 1IJKA 5SY9A 3WNZA 4RF2A 4JVLA 3FRJA 1G59A 1USWA 4ZDKA 2V0NA 1KH2A 2CLIB 3L79A 4L5CA 2FHSA 5ALQA 1NOKA 3BCRA 3NEYA 2V7XA 4UBLA 3R7FA 3TQCA 4C0LA 4A1FA 4V24A 1AUVA 3BMXA 5DP2A 2IY9A 2I33A 1OXKB 3NYWA 1EE1A 3OA0A 5CVTA 5IG2A 1QO0D 1OFUA 1WDMA 2DBRA 2WJ3A 3MLBA 4JVNA 4QUGA 4XUDA 1NNEA 3F74A 1CYDA 1WCV1 3D7KA 3VOSA 5FDFA 1A9SA 1ECPA 1JVBA 4LTDA 2FR8C 4MVJE 1OMOA 5DX8A 4CL8A 5AJVB 4EG1A 1W36B 4XYMA 2CYCA 4B17A 4WY5A 4QGHA 2WT9A 4NMLA 4XJVA 1MJHA 1SCUA 1PYDA 2NZVG 3SM9A 1U7PA 2IHZA 1E5VA 3BGVA 1WXGA 4M9ZA 5KSPA 5BW4A 5IH7A 1SCAA 2NIPA 2WMDA 2ZEJA 3M2TA 4NXMB 4RF4A 1SHZA 1V5WA 1TTHA 1WUIS 4H6WA 4KLNA 1XTRA 2OG1A 1K8YB 1GZDA 2RSLA 4QLAA 1XD9A 2IX3A 5FTJA 2Y8EA 4DJFC 5DSXA 1MDBA 1OKKD 3OFSA 2QD3A 1QLHA 3AIOA 3JQ8B 3JXEA 2XMCA 1R18A 4FE3A 3AZQA 1LRJA 4OYYA 2A92A 2QF7A 5LBIA 4DQVA 5AVUA 1TW3A 4AS3A 1NG9A 4EHHA 2GF2A 1OFTA 3JYPA 1WKVA 3NT5A 1U2GC 4H17A 1NBHA 4ZC8A 1X9GA 3CXRA 2FEPA 3D3KA 4KO8A 4PR0A 4JS0A 2MIIA 4IRMA 1WXHA 3EBLA 3MRSA 3SDSA 5LYJF 5MDHA 2I6QA 4G5QA 1RWMA 3S8YA 1KPIA 2H2GA 3NEJA 3R23A 1NMXA 1V8PA 1YACA 4RPLA 5MN6A 2AQIA 3CEHA 3GG9A 4PINA 2P77A 3ED5A 4UBJA 1KFKB 1SQ5A 4M0FA 2AXEA 1SPBS 1EFLA 2EQ5A 2G67A 3I2GA 4IKOA 3A1WA 3CO5A 5HW0A 4ANFA 2WUGA 3EGWA 4N76A 2JLYA 2QD4A 1YVPA 3C1UA 4BNDB 2CV0A 1X13A 2B8WA 4ARSA 4NH0A 1N5IA 2XGSA 3S1LA 4AG3A 4MQ6A 1Z0AA 4BASA 3ZDYB 2PIDA 2JZOA 3ETEA 3AEQB 4CCYB 4DEYA 2B21A 2XUQA 1GZSA 2GK7A 1SPXA 5CJ2A 2PZAA 2A5FA 5DTQA 3RG8A 3DG9A 1GRVA 1CS4C 5TS2A 5CLJA 3IEXA 1E9FA 2X77A 4ASUA 5KKCA 4M8SA 1KO8A 2I2WA 2AQ8A 4G84A 1YZKA 1KAGA 5EIFA 4C5BA 1XEXB 2RGYA 3VPHA 4OHWA 3RYHB 4EYOA 3CWQA 4MW9A 4PLFA 4RTPA 3G9UA 5ITSA 2A0XA 2A59A 2GAJA 2BBSA 4TROA 4Y2TA 3T4XA 1SA0B 2ZRAA 5IJ9B 2FLWA 3WGQA 3BWCA 3REQA 2F43B 3CVOA 4ESEA 1DIRA 1UZMA 1VL5A 2D0IA 2Z08A 5AK0A 1NQTA 3WRVA 3KJFA 1L1FA 2E0IA 2QG6A 3MVEA 2G4LA 1D6NA 1WULS 2IVZA 3OWXA 1DJLA 1TL7C 2ZJ8A 4CVNA 2XSZD 4EYKA 5LOVB 2X1MA 1P8AA 1QWOA 1CUGA 3LQFA 3D3WA 1KYXA 3GX1A 4IDDA 2CBXA 4YDHB 3C48A 4X7MA 1XZ8A 1V5GA 2R8RA 2NUTA 1JKMA 3CX3A 3CFYA 2K87A 4L07A 4A5SA 2WB4A 2QGFA 4S1TA 3U7JA 3O1HB 1XXHE 1IAQA 3SYMA 1NDHA 1ZD9A 4V02A 3M0EA 1V37A 4AUMA 4P4SA 2IIQA 4BBZA 1EA7A 5T4BA 1SOWA 3HWSA 1OJ7A 4QJ3A 1G66A 2PYDA 4I3HA 1DAIA 3CQ9A 4INZA 3TL2A 3HLKA 3BMNA 1YE8A 3FLAA 4X1YA 3WLMA 1NRXA 1OGIA 4QFCA 4XPIA 4PQGA 1MFPA 5F7XA 1C1DB 1F6BA 1K8QA 2NZJA 4ZQBA 3ZIDA 2IYUA 4DREA 1JQJC 1SVIA 3CF6R 3OIFA 1E20A 5BQOA 3TRIA 1WCXA 3PIRA 4O4JA 3G2JA 1BWPA 3IA7A 3QFTA 4IQ8A 3SQLA 5A7FA 4F2WA 2VA8A 4NBRA 4MVJD 5BO5A 1RQRA 3OTIA 1VJ5A 1W96A 1MPXA 4MYTA 5DWDA 1J21A 4GEGA 5JSFA 4MITA 1U5BB 521PA 1Y3CE 3KQKA 3TTTA 4PF1A 1XPUA 1HSOA 3W1VA 4PO1A 2XPCA 1W5SA 2XCQA 2FQQA 4W4TA 5IABA 5DYNA 3NBFA 3PR2B 3P9QA 5EMJA 4ZICA 5KUTA 1J1UA 3TXYA 2FKNA 1G8YA 3CNHA 3IQFA 3BWMA 4KXWA 1BXRA 5HSGA 4L2IB 1U3WA 4EJSB 2Z4TA 1HDZA 4IHAA 3BC1A 4FFVA 1Z6YA 3GAAA 1UBNA 2HF7A 3JWPA 3I39X 3RC1A 3WGNA 4WLUA 3OZDA 5C5IA 4JJGA 2HSZA 2ORYA 3KKNA 2EDAA 3RARA 3NO4A 3T5TA 1ZHFA 4LJRA 3HKDA 1XCBA 3K0KA 3P71T 2BEUA 2C9CA 3FCAA 3RD5A 2DUNA 2XZTA 1FP4A 3PNKA 4KUGA 4RSRA 4LZNA 4Z0PA 4C89A 3UMMA 1ZK1A 4RS4A 2IUEA 3HM2A 4TGLA 2EQAA 2P4SA 3OOEA 4HFRA 1TU4A 3A11A 1ZOOA 2BFPA 3LXRA 4EMBA 5I9TA 5HF6A 2B7LA 5JD3A 4Y6QA 1U63A 4C43A 5TEVA 3IIMA 4PSAA 1NVEA 3HHPA 4B3HA 1ZA1A 1A72A 1XFDA 2AZ4A 2OEPA 3FTFA 5EZYA 1UMDA 2PX0A 5JJLA 3DYBA 1IHDA 4TV8A 1MAWA 1O97D 5HQTA 3ZEAA 5KNCH 1DAHA 1JDBC 1XC7A 4CLOA 3U0BA 4R8MA 2HBZA 5AVTA 4YEDA 4GPAA 5LDDC 4JSTA 4MCJA 2A67A 2IYAA 1PNTA 1YS9A 1NPDA 3TD2A 4RH3A 4P38A 3WOHA 3PDIB 1XMJA 3O3NB 2Z09A 4Y18A 1G3RA 1OH7A 1XD2A 3MMSA 1TMYA 4QOJA 3KZCA 2OCDA 5TF0A 3SQMA 2AJBA 4M8NE 1RAAA 2CXSA 3K2EA 3QK7A 1MAAA 3AEUB 4W9RA 3R9WA 1HUQA 2IZOA 2OWDA 3C7AA 4Q4AA 1TVCA 2WSSD 3GY0A 3MS4A 3NRBA 1N4DA 3WVNA 3FNQA 4Q3EA 3EOZA 5IJWA 5B4UA 3U44B 4N03A 1USGA 1OAAA 3GHHA 3HFJA 2C54A 3RYIB 3I37X 3LO8A 1UMBA 4YMHA 1KI1A 3N59A 1RBQA 2XRZA 1PDWA 4A2QA 3WGVA 3G8YA 5FWYB 3KYJB 4NF2A 2DULA 2PSDA 1Q7RA 2ZUWA 5EIXA 1ZISA 4REQA 1TCUA 4OFWA 2FWNA 2XNDA 1C3JA 3E3AA 4LJ5A 1OA1A 2VRBA 5BN3A 1TYZA 2QRPA 4O4IF 4O4JF 3EFOA 1DO8A 5CNKA 3DFIA 3QWFA 5DW3A 1HSZA 2DFLA 1XP5A 2EZUA 3K0BA 3OIYA 2F2TA 2NUPA 4LDJA 4AS1A 2CK3A 2OBYA 2XE6A 3I8SA 1RU3A 3R75A 4DRXA 3RJ5A 1KBZA 4LJ6A 3UAYA 3WAGA 3Q7SA 3ZHOA 4FEEA 1S4MA 1JA0A 3HXQA 3FBWA 1JNXX 2DR0A 2WPDA 3PI6A 1DNPA 1MV8A 2L19A 2OC4A 2ZAMA 3QIAA 2QZSA 3P9ZA 1N2HA 3EXG2 2YWRA 4MSUA 4AZ0B 2X8JA 3T5PA 1PHPA 1YXMA 2WOJA 2VS1A 1YQGA 1U6JA 3A1EA 3HKBA 2AFIB 1KMHB 3MTIA 5BMVF 5B2FA 3CMCO 1Z0JA 2ODQA 3TAHA 2V7QA 2ZUVA 1PK8A 3DZFA 1P77A 3OE7D 3RFXA 4IUDS 3U9LA 1NVKA 4JKIA 2HV9A 3KHUA 3G49A 1TK9A 2YBDA 1EVYA 3VBCA 2YC4C 3FXAA 4QXRA 3S6JA 3C7CB 5M7EA 3JD3A 3DEZA 3QPBA 4XOIA 3ZC3A 1SKQA 1RTKA 3KO8A 3HPRA 5JE8A 2ZUTA 1E4YA 3TQFA 1F8XA 2JGKA 2A8YA 1LX6A 2VJKA 3AUXA 3ROKA 3WIDA 1FX0B 2Z6UA 3NJRA 3GNQA 4Z1OA 3DGEC 4A8TA 2B7CA 4M89A 2JLQA 2I7VA 4IDGA 4BO9A 1W46A 1I3NA 1Z7EA 3NBQA 4B4KA 4D1YA 4FFBA 4RADA 3CN9A 2GZDA 2Z8ZA 3KKEA 3R0VA 4L3VA 3RSSA 2FXVA 4TV8F 4L5YA 1P44A 1UBGA 4ZV9A 3ZI4A 4ARCA 3QKSB 4FK8A 3LT1A 3ZWWA 1T9HA 3GPDG 3KOMA 2D3TA 1XTBA 2K7FA 1E9EA 4M38A 4K6FA 1PUIA 4N3NA 1DTEA 1G19A 1KDTA 1QFZA 4KLAA 5JRDS 4KIWA 2ZIXB 5LUBA 3Q3GE 2Q4DA 4LDPA 2Q2OA 4ROSA 4RHYA 4HS4A 2AW3A 4G01B 3ILSA 1GAJA 3TR0A 1NVAA 4S04A 4QJIA 3P9SA 5K6RA 4QT4A 2VTEA 1Z63A 1EDZA 4JD5A 5KS2A 4JP5A 1TO2E 4UHFA 4E12A 2F3UA 2IF0A 1CRQA 2Q0SA 1DCFA 4QUHA 4L8GA 5HDBB 4F72A 1SUPA 1N6KA 2N3ZA 3N8NA 1UM9A 4UBOA 3PHIA 4Q1FA 1BKSB 3LWZA 3M6VA 5AHOA 2ECPA 3G13A 5JBIA 3AXSA 4ARVA 3UH1A 2OO3A 2OV1A 2D59A 1NJ2A 3H1BA 5AKLA 3T7RA 4PG8A 3N0RA 1Y7PA 4LF6B 1WF3A 2XQKA 1FYVA 2QROA 4EI8A 3HDHA 5E4FA 3UUEA 4D56A 2E89A 3HDGA 3KJGA 5C1DA 4MB6A 3FVWA 3ZU2A 3GH3A 1RKVA 1KQOA 1JDTA 4RNDB 4F4UA 5DGIA 4HEJA 5JYBA 1JHPA 4HNTA 4HUQA 5C8VA 3JWJA 1W8IA 2BEJA 2BBOA 1P60A 4PFKA 1DADA 1P7ZA 4ZAGA 3EDOA 4D44A 3HJTA 4BLUA 2YQ5A 3AILA 2ZE5A 5JH7A 5AXAA 4EL5A 2G77B 2QSYA 4KEAA 3S2SA 4ECAA 3NR2A 4LF4B 1TM1E 5TMDA 1DKPA 5E0KB 2BFOA 5KC9A 3GUCA 1N5DA 1Z4IA 1YQQA 4LYAA 4ZALA 1EZ4A 3W04A 1PVOA 5HE9A 1TJ5A 4ER3A 3PQFA 2O3TA 2H0AA 1Q84A 1XT6A 1A8QA 3OE4A 5FWNA 1YI8A 2NSDA 2D1SA 1YBHA 2W42A 1K27A 3WGZA 1EFKA 2NADA 4N3CA 3TMYA 3VR6D 2HMVA 4JY7A 4BUZA 4MP6A 4JLNA 1ZYUA 1PFQA 4PG4A 4XASA 3H2IA 3VOAA 4ALLA 1JEQA 3KE8A 3QFRA 4YHHB 5JXJA 3AJRA 5HILA 2XNKA 1E6UA 2I22A 3FPJA 2D5AA 4QGFA 2B94A 4KR2A 1UKVY 3HXLA 3OZWA 2JANA 1FZQA 3KLOA 3EA4A 1TT5A 5PGMA 2A9KA 2G08A 3OE1A 4XARA 1YZGA 1AN9A 3OCYA 5EHGA 2X14A 3ZCXA 3UENA 4ECEA 3LD9A 3KKMA 2D2XA 3D1LA 1JNYA 3ICCA 4HAXA 3NG1A 4NZMA 1KL7A 2R6DA 3GXOA 5DK4A 3W6PA 2Y0BA 5DH9A 1KHTA 1Y1TA 2Q9UA 4PRZA 1U7DA 4FONA 1WHTB 2QB5A 3DVSX 2AH5A 3PP8A 3MJDA 5HJ7A 4AROA 4DNPA 2HJHA 2Z95A 3NAQA 4PZ0A 3IUQA 4FR5A 4C7BA 3ZKAA 2YUIA 1QB7A 4UXHA 3G1WA 1XZHA 1DEXA 1E3WB 4DL9A 3GJTA 3DLPX 1VBFA 5AVRA 4BJ5A 3Q8MA 1IEXA 1YONA 5D87A 3NWJA 2RI0A 4KITB 1U9ZA 1IAVA 4HVLA 3ZHRA 3W8FA 4PC7A 4YLYA 1N77A 1OYOA 3ZXIA 2VTKA 5CFPA 2VA9A 2FPSA 3MMNA 1XMSA 3HSYA 4HK4A 4O2LA 1G5HA 5TV2A 1JP7A 5BN5A 1BH2A 2H4YA 3JALA 2M9MA 1I6WA 3G5TA 4YCNA 1AGPA 1E6CA 2DR2A 2G6TA 3TXXA 4GPD1 4F4FA 2IX9A 3GJRA 3WHLA 1Q14A 1UWLA 3LA8A 4CT4B 1WE2A 2J46A 2CYAA 4KQGA 2YJ5A 3BF7A 3KUUA 1HK7A 1H6BA 2XXJA 2CXQA 2HYDA 3QYFA 1MOSA 4K9SA 5ES4B 3V8QA 5KDDA 4GBED 1L5ZA 4KXNA 5JH7F 3WAKA 1DKRA 1P72A 1PJTA 2W71A 1V4VA 3IOMA 3ESDA 2IUTA 1B0AA 2C59A 5F9HA 1QCCA 2ZI4A 3A6ZA 3LXMA 1C4XA 2P62A 3DVLA 1R88A 3DVQX 5EJFA 4DUGD 3QMVA 4H0NA 4IQGA 3KQQA 1DC3A 1PS8A 3LU1A 3W5VA 4B75A 3GLVA 1UBHS 4XWWA 3ABOB 1NQXA 2A9QA 2ROQA 4FNAA 1ACJA 2O0JA 3AL0C 1V6CA 4TLMB 2PZLA 5K09A 4II3A 1GNPA 3JR7A 2YFHA 3BL6A 5COAA 4LGYA 3G2HA 4R83A 4AQ7A 3IUNA 5AI4A 1KFJB 3UPDA 1OWNA 4C6SA 1M7GA 3H42B 1ZPDA 4DY6A 5JNTA 1AIPA 3BFVA 1SUEA 2J67A 4EVRA 4JUFA 3SHVA 4MKGA 1A2BA 1EZZA 1Z2PX 2ZLBA 1TZMA 4AU1A 3N07A 1TUBA 1LZKA 1X42A 4IP0A 2HCTA 4AS2A 4CGYA 3KQLA 2OQ2A 1RM5A 2FSSA 1RWBA 2K2WA 3QU7A 2FZ5A 3OM9A 3IBFA 1EG7A 2ZJOA 3BA1A 1M67A 4OI4A 3L6DA 3C97A 1OXTA 2Q1YA 2A58A 3G9ZA 1QG2A 1KK0A 3GUZA 3BJEA 1LFAA 5KVQA 4KNVA 1C9DB 1X86B 5L3QB 2AIRA 2DWCA 3SIXA 4DM7A 2W6NA 4Q7EA 1ZGJA 4INAA 3LT4A 4YUXA 2Z83A 4ZZ3A 1Z6GA 2X8BA 3PL5A 1RIIA 1UT6A 3LCMA 2WFMA 2PUCA 1VKRA 4BLOA 4AF8A 1P81A 4MYRA 1S4QA 1Z7WA 3RBXA 1XTSA 1RKXA 3R3WA 3EEOA 3H2SA 5CU7A 4WLNA 3ZGNA 2HQRA 4HLCA 1TJYA 2WIAA 4FLFA 1E5LA 1KTIA 1S0UA 4ZHSA 2DUWA 1QX3A 1W4ZA 3T1YB 1APBA 5HFJA 4MLDA 3W5SA 3ADCA 1NONA 4DDKA 2NU6B 1L4BA 2ZI5A 3FPEA 4E5SA 2PE5A 1Y34E 3HBFA 1G4AE 1WW3A 3NPAA 2PQ6A 4TL8A 4ZOEA 2DWPA 6YASA 5HGXA 1MJGM 3SN6A 4O5OA 5SYMA 1WPGA 5C80A 5L3VA 2LXNA 4P4GA 3TFQA 3SYKA 1MNAA 2LNDA 2OXFA 1TD9A 4BB9A 1O5OA 3B5JA 4C3ZA 3N5KA 4UCFA 1E6EA 1CDOA 2IH2A 5CDFE 1Z06A 4R1MA 5ILOA 4EW2A 5B53A 4YONB 3L6RA 4WD3A 1C7IA 1E64A 4Q03A 2GJ8A 2A86A 4TMVA 1BHSA 2LR0A 1B8NA 4Q4HB 3TNFA 1S8NA 2HF9A 2JGNA 2OAGA 4QBFA 3SYRA 1M66A 1P5FA 2WSYB 3TCXB 1KWGA 2V4UA 4LTMA 2SKCA 4M21A 1NFFA 1UXJA 1YJXA 3RS5A 4OOEA 1EUQA 1H2HA 1A5TA 1US8A 4DJTA 2O8NA 3GJZA 1M1UA 4RD2A 2YMMA 3QWHA 3C3DA 1JHOA 1EFDN 2G9QA 3PNQA 5AJUA 1XI2A 1H2XA 3UWSA 4U9IS 2W8BB 3A10A 1KGSA 3L6OO 5JZMA 2XW6A 5KX5A 3K1ZA 1FRZA 4MHTA 3GDHA 4GRIA 3T3OA 3ZOZA 2QENA 1XVUA 5ELLA 1LJ8A 3KUCA 1OREA 4MROA 1OLOA 1NX6A 2CDRA 4CMIA 2YJZA 3HB7A 2XYGA 5JWOA 1AMUA 3DBOB 3KPVA 3KV1A 5KB3A 1TC2A 5GZ3A 3DE5X 1Y33E 3HWWA 1Q74A 1Q7TA 2E6KA 1YIOA 2YNMA 1CY0A 4M7PA 4RXTA 5DGCA 4AL4A 4CV0A 4V0QA 2F1KA 2I6TA 3TMKA 3L41A 4B34A 4DBLC 1YA6A 3BJRA 4II7A 1H6AA 4GF5A 5EEHA 1QG0A 3D8SA 2O4UX 2PXHA 3ZWQA 1CDEA 2QN6A 1V6SA 2HA3A 2Y1FA 1I94B 2PLWA 2UXDB 4L51A 5AKGA 5DBEX 5I51A 1JFFA 2BFMA 4LV6A 3G23A 1W88A 1G16A 4WNYA 1W34A 1GRRA 2QMZA 3U13A 3BPSA 4WE3A 3OIVA 3QF4B 5JXIA 1M8FA 4P53A 2C99A 1OGYA 2FPWA 3F4BA 3JWHA 4CM6A 3C5WP 2WVJA 1X7WA 2XRYA 4B5LA 1KFEB 4S1NA 2RCNA 1EBUA 4ND1A 1V47A 1LPAB 3PQ3A 4QYWA 4B3XA 5DGDA 4Q7KA 5KOYA 1GO2A 1JYSA 1QS0B 1XQXA 2Z5VA 1VYHA 2IYLD 8ADHA 4E5UA 1BXGB 2N1MA 4PYRA 1U28A 4UZSA 3ZLTA 4A6XA 3X2FA 5AD1A 2G07A 3LSYA 2WHQA 5D6NA 1UXGA 3TLJA 5L7YA 4TTVA 2FN8A 3JRWA 3OTGA 2QNRA 4JN6B 4BO4A 1WPQA 2G36A 2IEYA 5J59A 3S2IA 3HJNA 2Z6QA 4PNEA 2QK4A 1LQUA 2F3QA 2VQSA 3H9JA 1K7XB 2VUUA 5EE3A 1B2LA 2RHJA 3EAQA 4LHYA 4YT5A 2HA4A 2CFTA 2ZT5A 2JH9A 2W6ID 2D4HA 4I1YA 1T6ZA 3ZZ1A 3FNGA 5HKKD 3WZMA 1ECCA 1SCJA 1Y6ZA 4Q9NA 1OU4A 2YZGA 1T1GA 2H5JA 4V0RA 2R4TA 1BKDR 2GYVA 3RVMA 2AUNA 4UZFA 3WC4A 2EHDA 2CHEA 4RZQA 2W43A 1J07A 5EKUA 3DM5A 3QUBA 1N1DA 4FEAA 3L93A 2RGAA 3A58B 1UF9A 1UJBA 4KW7A 4ER6A 2Q4TA 4E2FA 5HKOA 4FE4A 1M0SA 4L78A 1S2MA 3TR6A 1ONOA 1OQAA 4A0HA 5B3AA 5KSWB 2ZG6A 3WIEA 3LBIA 2EGGA 3SM3A 2C00A 1M8KA 3GOQA 5KNDD 4U7DA 1WZCA 1SHTX 2DKFA 3B20A 2PRJA 5KX5F 2WK1A 4D6PA 2XA1A 3DLIA 2HXYA 1QC5A 3TZKA 4JUAA 3TZ6A 3AL2A 3O4HA 4EKDA 1Z37A 5FH9A 3G9TA 5LYJB 1JJ7A 2ZBUA 1SXIA 2ZSDA 1Q50A 3P26A 4S12A 3SJBA 4FR2A 4W63A 1NOIA 4EGCB 5T7BA 3MJRA 4N3GA 1NI4B 1PQUA 2AVNA 4CMBA 1RXCA 4CDNA 4B33A 2EATA 4WESA 5SY4A 5FPHA 4LOIA 2X76A 3V48A 1KVRA 3VAYA 4EI9A 1JDBB 3UAZA 1YHNA 2WKRA 3QU9A 4S2EA 2Z6AA 2OK8A 2O8CB 3FMFA 1H3EA 3EMBA 1U0BB 2HI0A 4CM3A 3U1BA 1ENZA 1J25A 5ESRA 4DJEC 1Z4JA 4WK4B 3FYTA 1ICEA 4H77A 1OFVA 3SJAA 4FB4A 2Q5CA 1C7EA 3PR3A 4W99A 2WTEA 2VJBA 2GCNA 2SICE 2ATVA 4FWIB 3TI9A 4AKTA 4PN3A 3OIDA 4Z4IA 1HOTA 4FI3F 1QVZA 2JIDA 2WNIA 3SLRA 1FDSA 1IC6A 2JBAA 3ASVA 4Q4CA 4MUHA 1SXJE 5JJIA 1HYQA 1FQOA 2VFAA 5B1IA 2JFPA 4KGVA 3V1UA 4GKJB 2Q0HA 2FPIA 3A4TA 5AI9A 2FEKA 4ZOCA 1I7NA 3DDCA 3WFZA 4B3IA 1Z34A 1ZD2P 5KWSA 3SYTA 4RPHA 1JIJA 4D9GA 2J09A 3AJ8A 1G8MA 1RIFA 2BGUA 2DWOA 4UEWA 1W93A 4EH1A 2WG1A 4ETMA 1TIBA 3CF4A 4QASA 1DPGA 4RTMA 4B3TB 1V48A 2W6CX 2RJOA 3MCAA 4N4AA 2JCXA 2D00A 2VSQA 3M6WA 2CDNA 3ZCVA 4QNMA 1AS2A 1I4EB 4JA0A 3I34X 1MB9A 2QW1A 3FNHA 3EWIA 2ID8A 1JMKC 2OZKA 2ZJ7A 3H1FA 4LHVA 4MI3A 1BA3A 3ABIA 5DN9A 2CL6X 1ZM4A 2FWMX 2RK6A 3NB0A 1SCBA 1EE9A 3I9V1 3RYTC 1H0SA 1T8SA 4KJZA 2EIHA 3WWYA 5ILGA 5BQFA 4I50A 1FNMA 3DS8A 3FF4A 5KKAA 1KQGA 4HUTA 3A0UA 3VI3B 2E18A 3AF4A 4YDSA 5HZKA 2QW8A 1CUSA 3TIXB 2G28A 5TS3A 5F2OA 1DEKA 5I45A 2ET6A 2WYOA 4FN5A 3RUFA 3B3FA 4CM1A 2XMBA 3LXUX 2IHJA 2FCAA 4OG2A 4F11A 1AY0A 1X1QA 2XCRB 2W2LA 2D1TA 1V7ZA 3LP8A 1ONBA 3THOA 5JY1A 1N3YA 4KU4A 2RG7A 3CGWA 3DEYX 2PPVA 1UOOA 3PYXA 5DASA 5L7TA 4FYWA 2PL1A 2ZM5A 1M2JA 3L8YA 1X3LA 2G7ZA 1UJMA 3KZOA 2R1TA 1RXUA 4BN0A 3RRMA 2FQWA 1P80A 3ZUGA 4JASB 1C0KA 4DW8A 2PWYA 3VKFA 3RKUA 3OETA 1I33A 1RSZA 5AK4A 5EKXA 3A70A 2FFAA 4TWIA 1T4CB 1GNSA 3DNPA 4G1MB 4F0JA 4HP8A 1UOEA 1GGFA 3OT5A 3OO1A 1YL6A 4QUJA 2B2CA 2HEIA 4RCVA 5D86A 1BS9A 1HT3A 2YXBA 1XP8A 3SVZA 3VHLB 1RXIA 2WHEA 5M04A 1VJGA 3HC7A 1Z75A 2QTVB 3WQRA 5DMHA 4DRZA 3ES9A 3QE2A 4Q4LA 3T5BA 4TMXA 3P27A 3VRHA 3WAJA 1W4BA 3Q2KA 3ER6A 1Y1SA 4QUIA 5EJ2A 1KP9A 3FJYA 1G7RA 4J0GA 5H3CA 2PT9A 4YAIA 4ABTA 1ZRNA 4MYHA 4WXHA 3Q6NA 4MV3A 5FUWA 4LXXA 2BUCA 9GPBA 2XGJA 4LRXA 4NCXA 5HBGA 2LP4Y 2X9LA 5ESDA 3E3OA 1GG8A 3C4JA 1E9BA 1E62A 4RL4A 3MGCA 1LSJA 3DBRA 5TEWA 5KPDA 4B3RB 2PN1A 3EUAA 3LK7A 2J5BA 1PL7A 4AO8A 4EJ6A 4YJHA 3DJFA 3LZCA 5CLQA 4YI3A 4A7PA 1G63A 1JT9A 4QDXA 4HZUB 2GWRA 4QT0A 1R3UA 3SJCA 2YNMC 3GFTA 4Z8YA 4UAJA 4ESHA 3QA3E 4U00A 3W5UA 2C4UA 4UC0A 1DWUA 3ID6C 2OY0A 4I4IA 2QORA 2VJMA 3UUWA 2IEBA 4CIAA 4WXPA 3RWBA 2W93A 3KJEA 1WUHS 3D3WB 1BQ4A 4G25A 4I50F 2Y67A 4QEDA 4WNAB 1CIPA 1YS2X 4L6AA 1GSIA 1XALA 2XHZA 3D5QA 1OLXB 3KEMA 3OZ7A 4ODIA 2W6PA 1U3DA 1Y5RA 2PVSA 1LW6E 1K7CA 1KJWA 1JJBA 2IPLA 3JRNA 1QGUA 3TLAA 3PFFA 3ZWPA 4CHGA 3AVUA 1TC1A 3HYRA 3MLEA 4FI3C 5DHAA 1TRHA 2G5PA 2FGKA 1SXJD 2N46A 4GMXA 3VO9A 4G5RA 3VH1A 1BVUA 4F9GA 1NOJA 2GEUA 3ANYB 1ZEMA 3IVMA 3R0QA 3V3TA 1PU2A 2V3WA 2R66A 4UNIA 3UOWA 4C76A 2H4ZA 2PGDA 3I12A 3O3MB 3HYTA 4XPIB 1Z6QA 2WWTA 3FSEA 3PX2A 1U28C 4JOBA 5CA0B 3S5UA 1M6NA 3GQBB 1BGWA 1Z8HA 2VUHB 5F21A 4F2GA 3VR0A 4O4IB 2CFRA 5BURA 1MHTA 3TZQA 4IJWA 2AI2A 3BSSA 3EOAI 3GPCA 4ED9A 3BB1A 3IJEB 4LY6A 3A04A 2BTOA 1IJEA 1Z8FA 3I6BA 3ZGOA 2PX8A 3CEJA 5AFSA 4WPGA 5HF8A 2DBZA 4U2GA 1XF1A 5SYNA 4D0RA 4DJDC 1Y98A 5DEOA 2FW1A 1XU4A 1F8FA 2PBFA 2NPOA 2XUDA 4OXIA 4EZIA 4WINA 4DILA 2QZ9A 3O3CA 1EM8A 5G4KA 1R2QA 3PC7A 3HCBA 1ST2A 5EZ5A 3SXUB 4EVQA 3HRHA 4D3YA 2J6IA 1T0IA 2C3YA 3ESXA 4AY4A 4BGEA 3IVCA 1PSZA 2WPNA 4HAZA 4ZO6A 3AYXB 5IAOA 3Q8LA 4YRFA 1DC5A 1YQXA 4XWOA 1PJCA 3F7MA 4GW3A 4IHQA 1ZNWA 4EHFA 1IBMB 3WGIA 1XYVA 1Z47A 2HDHA 2WYVA 4P4UA 4RLHA 5DKFA 1QRTA 4HL6A 5DT9A 5TPZD 4G1BA 3U3MA 4UM7A 2FMTA 1J1IA 1HQKA 3IQHX 1IULA 3TLYA 4BNXA 3VZCA 1E5TA 4G9GA 2ORVA 2VTBB 3OFJA 4C5CA 1KH1A 2HGSA 5REQB 1VL6A 3F8SA 3EDYA 4RLSA 3R24A 4MGEA 1GYQA 2ZUBA 3OT1B 5E7QA 4Q3LA 2JLSA 4CTJA 2AR9A 2BGTA 3SEQA 5IDXA 1UMDB 1YF3A 3ZW8A 4JDUA 4TV8B 3R3XA 4R4JA 3O4JA 3E1KA 1ZM3A 4M1SA 3GT0A 4RA6A 3VSAA 2NP7A 2A7QA 3C3PA 5AW3A 4OD0A 4FOLA 4CKZA 4KO1S 5JCOA 3UJDA 4KL8S 5AOAA 4DNQA 1ZXBA 1JR4A 4J2HA 4UM9B 2WU8A 2VQ3A 5HTKA 4U7HA 2P4HX 3RRYA 2PU5A 3CF0A 3SIRA 5JPDA 3DZDA 4L4XA 1I4LD 5KNBD 4FJ2A 1NVUQ 3CZ9A 4IDPA 2NUAB 2VSNA 3PKJA 1L5OA 1J33A 4GR4A 4FYVA 4NOLA 2C7RA 3AM4A 3CKLA 3Q8WA 4EAQA 4UE2A 2JGMA 3B1YA 1D09A 1EUDB 4BN5A 4MDFA 1GPUA 4R2KA 4PR3A 4AMUA 1U4OA 5KCZA 1E7WA 3CZ4A 5DGXA 2XXAA 1MC4A 3OVMA 2QTWB 4CIVA 1FJHA 5TVKA 1BFDA 4B35A 5CVEA 2ZSJA 4LSGA 4TLAA 2IXBA 5A7GA 4YRSA 4IJ5A 4UOZA 4EPYA 4YMLA 1I7LA 2XDYA 2XE4A 4MS1A 3PRKE 4QTUB 3PWZA 4BTLA 4DRXB 1QKKA 3AY0A 2UUOA 2M32A 3NFRA 1NLMA 3DYIA 3L1IA 4UEKA 1X1TA 1WDLA 4JJKA 4R9RA 5D7NA 4BLVA 2ZFUA 4G65A 1ILEA 3PF9A 3UIEA 2Z5LA 1UPUA 4BAZA 3L0DA 4IM7A 4LJYA 4MWCA 4EUNA 1Q1NA 1O57A 1ZAYA 2XOEA 1ETHA 3JVEA 3NUQA 1YQ9A 1PZFA 3ED1A 3HKBB 4D79A 5BWMA 3K31A 5JS1A 3BM5A 3BCUA 1NMEA 3K32A 2Q9BA 3WK6A 5AUNB 1ONSA 5CXSA 2WZBA 2FQXA 2OE2A 3D0OA 1N5OX 1GUYA 4EBFA 3DO6A 2Y1DA 2V7VA 4GOND 1VPDA 3KXDA 5K4AA 5C8ZA 2P2LA 5J43A 4U6NA 3OY7A 1P3Y1 3WDSA 3LBYA 5AKIA 3NHPA 4J9UE 1SC1A 4BIMA 3U40A 5HKKA 4GWLA 4DLBA 1SBQA 2KPOA 2VP9A 3SX4A 1Q0UA 2DE0X 2QLBA 1WV0A 2C2ZA 2X7JA 2VPIA 2R751 1EFRD 3JATA 3FYUB 5ALNA 4DQLA 1RHJA 1ZAKA 3PNVA 3NXKA 1YBFA 4RMIA 4A10A 5GTDA 3HVRA 3SYNA 5HP4A 2AG0A 1H8HA 1BN7A 1PZXA 3C6MA 4AMBA 1PV1A 1CZOA 3JQ9A 2NO5A 3QY0A 4AJLA 1HDIA 5JYEA 1E98A 1KYTA 1Z56C 3VA7A 4RTNA 1X19A 5CK5A 2J33A 3MQFA 5T6MA 3KETA 2EBWA 3MN1A 1MF7A 3C3KA 1PDVA 1T6YA 1Y5NA 4CKWA 3GPBA 1U8XX 3KYDA 3LQ1A 4G5FA 4NE9A 4FGUA 1E61A 1WD5A 4ZQCB 1Q19A 2YIDA 4UTRA 2EEPA 1CV2A 1M1YA 1FFWA 5BR7A 3OCXA 1F2VA 1J2YA 4GFDA 4I4NA 3ZQ6A 2DP4E 4TVKA 4LGMA 3STTA 4CL2A 1MP0A 2RDMA 2VCEA 1YH3A 3K8YA 1YO6A 2BM1A 3HTXA 1N78A 3GFBA 2HRCA 2KX7A 1CR6A 3PR1A 4Z4FA 1AQLA 4MAMA 4ZU3A 1WPXA 1SCDA 4BJ3A 2MMCA 3THRA 1NW4A 2QT1A 2ZYRA 5J1SB 3MUFA 1FCJA 5TMEA 3PXGA 2I80A 4Z3DA 3PC8A 4BWVA 1MO3A 5HNKA 4IBOA 1V39A 2EXXA 2OGZA 4PRYA 4EX7A 4J0HA 4XSGA 3U1TA 5JANA 4K6CA 1GADO 1KMCA 2A9RA 1G9TA 5CVJA 2IYNA 3AKZA 3GUUA 3IFSA 5KJFA 4F1KA 2OLKA 2YV1A 3FGPA 4UE3S 1CQIA 2NN3C 2FUCA 3EUWA 4PX2A 1WB4A 2OGUA 3DXXA 4A8HA 4L4RA 1IATA 4YCJA 1W35A 2Y6UA 3VU9B 3GB9A 1JSCA 3UFXA