3I34X

Proteinase k by lb nanotemplate method after high x-ray dose on id14-2 beamline at esrf
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation damage study of Proteinase K at ID14-2 beamline at ESRF
rcsb
molecule tags Hydrolase
total genus 99
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3i34X00
4KG7A 3WIVA 1YU6A 1SN7A 4NE9A 2WUVA 2X8JB 2Z57A 4HVLA 3EE6A 3OSZA 4ZOQI 1SCBA 4NE7A 1LW6E 3VTAA 1YJAA 3H42B 3AJ8A 1GA1A 1C3LA 5SICE 3BGOS 1ZVJA 1TM5E 1Y3DE 4RYDA 3F49S 5K7SA 3UNXA 1WMFA 3PTLA 3PRKE 1TM7E 5AMXA 1R6VA 5ARBA 1NDUA 3GCWA 1C9NA 4OMCA 2X8JA 3GCXA 5AVKA 3I37X 1T1EA 4H6WA 3SQOA 1SBNE 3DDZX 3DE4X 3LPDA 3WIUA 2Z2YA 2SICE 1SBIA 3Q40A 1SCAA 1SUBA 1AU9A 1ST3A 1GTL1 1Y3CE 1SUAA 1SH7A 2ZRQA 5B1DA 3F7OA 1SPBS 1SELA 3Q5GA 3VV2A 5FFNA 4AKTA 1CNMA 1NDQA 3P5BA 5JXGA 1SUDA 1Y34E 2W2NA 1MEEA 3DE2X 1AQNA 4BWGA 1AH2A 1V5IA 1KDYA 1C9MA 1BH6A 3CNQS 4OMDA 3DVQX 2ST1A 1AV7A 2ZWPA 3A3NA 3QFHA 3I2YX 1SBCA 1BFKA 2WWTA 2HD4A 1GTG1 1Y4DE 5JXIA 5CW1A 1DUIA 1TO2E 3VHQA 4H6XA 2XRMA 1TM3E 1BJRE 3EIFA 1SCDA 1P8JA 1Y1KE 1TK2A 1GT91 2G4VA 3CO0S 2GKOA 5B1EA 1GA4A 4M1ZA 3DE7X 1KDZA 3DE6X 3ZXXA 3LPAA 4FONA 3WHIA 1IAVA 3DW1X 4CFYA 2E1PA 1AK9A 1SVNA 3BX1A 4CG0A 1WMEA 1CSEE 1SIUA 1Y33E 1YJCA 3HJRA 4LVNA 2P4EA 3TI9A 1TECE 2V8BA 1GNSA 5FBZA 1BFUA 4YN3A 1NLUA 1SUCA 3DVSX 5I9SA 3TECE 5AQEA 1DBIA 1R64A 1SCNE 4Z2AA 2PWBA 3LXUX 3A3PA 2PYZA 4J94A 1TMGE 1PFGA 1KE1A 2DQKA 1OT5A 1JEAA 3VV3A 1PEKE 1KE2A 2W2QA 1P7VA 2TECE 5JXHA 2ZWOA 3DYBA 3TI7A 4JP8A 1S2NA 3AJ9A 5FAXA 2ID8A 4B5LA 4KPGA 2XTJA 1SIOA 3DWEX 1OYOA 4WOCA 4DJ5X 1KDVA 5ARCA 1Y48E 1XF1A 3D9QX 1IC6A 3DE3X 1GCIA 3A3OA 4K8RB 4NMXB 3VSBA 4MZDA 2B6NA 2Z30A 3BPSA 4OV6B 3L1KA 1Y3BE 1AF4A 1BE6A 3DE0X 3D43A 1WMDA 2Z2XA 3VYVA 2HPZA 2WV7A 1S02A 1SBTA 3DVRX 4LVOA 2Z2ZA 2ID4A 3F7MA 1Y9ZA 4CFZA 1BE8A 1Y4AE 1PJ8A 2DUJA 1V6CA 3GT4A 5AVJA 1WVMA 4DZTA 1EGQA 5JMOA 3DE1X 2SNIE 1SCJA 3LPCA 1A2QA 3QTLA 2W2MA 2W2OA 1EA7A 3DE5X 2SECE 3AFGA 1ST2A 1WSDA 2QTWB 1SBHA 2WUWE 1GNVA 1VSBA 1PTKA 1T1IA 4GI3A 3WQBA 1S01A 4AKSA 2PQ2A 1HT3A 4C3UA 1AVTA 4ZARA 1SUEA 3DW3X 1T1GA 1TM1E 3T41A 1ZVKA 1OYVA 2SBTA 1P7WA 2PKCA 1MPTA 4WOBA 1YJBA 1R0RE 1SIBE 3EDYA 4DWWA 3I30X 5JXJA 1SUPA 1UBNA 1TO1E 4C3VA 3SICE 2PMWB 4H6VA 2DP4E 1Q5PA 1C9JA 3ZXYA 5ARDA 1GTJ1 3QMPA 3I34X 2PRKA 1TM4E 1THMA 2PWAA 1GA6A 2Z58A 4KB5A 1Y3FE 2Z56A 2IY9A 4I0WB 3GT3A 4HX2A 2W2PA 2IXTA
chains in the Genus database with same CATH superfamily
2UKDA 2YXPX 5G02A 5GVRA 4KZKA 5A06A 3PRHA 4G0UA 4DA8A 2Q2VA 2RARA 4JEMA 4NE9A 4NULA 5CLGA 2Z57A 2IF0A 3PQ2A 4XWKA 2VBCA 1E4YA 2UZAA 3RCBA 4WD3A 1HE3A 1YRYE 3HCOA 4IIEA 4NZMA 2PZJA 3KWMA 1NU8A 3SPXA 3G59A 3OG9A 3BF7A 1VSTA 3DQPA 1KEPA 2GCPA 1ZZEA 3BSYA 3D7NA 3RSOA 5FWYA 1IZ0A 3IUBA 3NYQA 2AN1A 1I2MA 3GJ7A 1JILA 3FYUC 3AJ8A 4HWKA 3NONA 4L73A 3W04A 3PUKA 3IIIA 4HUQA 3MTAA 4XJSA 4PHGA 3JPYA 3G5MA 5FUXA 4F2HA 1RQNA 1VJCA 4XVQA 1GT6A 4M98A 1HG0A 2FW9A 1XZJA 3GLGA 4Y1GA 8AT1A 5IEJA 1SHTX 3K9CA 2QG9A 4FNAA 4IKPA 3WV5A 2YX1A 3V1LA 3VAZA 1T2UA 3DZIA 5DTJA 2CK3D 2HJWA 4ARBA 1UFQA 4LIPD 4MUAA 2ILVA 2NLOA 3L7IA 2NU8A 4B3TB 5F23A 2FEKA 1QOQB 4OOFA 3A6ZA 3SX2A 3WIEA 2CDAA 1LRKA 3U17A 6CHYA 2YOGA 1GCUA 1RM4A 1N2SA 1TTQB 1P2UA 4MS3B 1BXGA 4GI7A 1QX4A 4G97A 2B30A 1RLOA 1QK3A 4DCPA 1LFDB 2ZQZA 4WERA 3DR5A 1X9HA 3PUXA 3R9WA 3W1VA 1XKQA 3TL6A 4BE9A 4KR3A 3H4MA 2ZXFA 4KYUA 1YJ5A 2B4YA 4B82A 2IV7A 2ODNA 4O4HA 4RGBA 5CFMA 1T34A 2CXPA 2Z98A 3K35A 1YI0A 3RHZA 4BEBA 4IOMA 3KEMA 2GJKA 5ECDA 1E61A 2C3OA 2KS6A 3COPA 4LXXA 1BHQ1 1C1XA 2CZGA 3AP3A 3DDZX 4Y30A 3EQ9A 4CF3A 3HY6A 4OMUA 4DRZA 3LWZA 1G59A 1I4DD 3LQQA 1U0SY 2QM7A 3ESRA 2O2XA 1GEGA 4UTVA 1JZQA 3FE2A 4ND8B 3O93A 1WZ2A 3A06A 2BCJQ 5BR8B 1BX1A 3CZAA 1D3AA 3DSRA 1O5OA 4QJ5A 3MWGA 3P96A 1USKA 2Y9MB 2V7BA 1D4AA 1W1IA 4G37A 3S6JA 2Z4SA 3IPAA 5HK8A 3QVMA 5EP4A 3DO5A 6AT1A 3D5TA 2JLVA 2H0QA 3DXXA 4LV6A 4AUEA 3IHTA 4EKGA 1YACA 4O4LA 2IFTA 4P58A 1UODA 1P60A 5B2ZA 1N78A 3VNVA 1WMAA 2WUDA 1IVYA 2FPIB 4YJ3B 4PLCA 2Q50A 5CURA 4AG3A 4OQFA 5HZKA 2JH8A 3TMYA 3PGLA 3MXTA 3DHNA 2XD4A 3CX7A 1KDPA 5DASA 4GNRA 4KGDA 1W0KD 2P68A 3L7DA 1ZX1A 5BQXA 2PZMA 3ZJUA 4KRXA 4G09A 3CUUA 4RPLA 2V6GA 1DWOA 5J2UF 4DCSA 1OROA 3GLHB 1Q3KA 3R5TA 2ZK7A 1O77A 3L8YA 3BK7A 4KQ1A 5C5CA 1RZRD 1FBTA 2XV1A 2H7VA 3GX1A 3NHLA 1IZZA 1U7DA 2YVAA 1G8PA 3E48A 3HP1A 3MNFA 1L4MA 1Y42X 3HJUA 4I2NA 4B8YA 1RPTA 3ZJTA 2X58A 1F9EA 5EJGA 4N8DA 3TJRA 1GPUA 2OZLA 3DE2X 3OQIA 3LVRE 4ZK6A 1AG9A 3KSAC 1N3BA 2HXSA 4LF4B 1N2CB 4AZ0B 3L7BA 3E2MA 4LJ8A 1XE3A 3RIGA 2C5GA 5EIBC 5F5XA 2B8TA 1U2SA 5F9FA 3S1AB 2O8BB 2PN1A 5E6UA 5EFOA 1MF7A 4IAOA 1CJBA 4GBMA 4MRPA 2V0CA 3DVQX 1O1YA 4RH0A 1Z82A 4L78A 1UDCA 2GBLA 5L4SA 4X92A 2E82A 3EXHC 4YGYA 5JY6A 1FTNA 3PQ6A 4ZAZA 4FDLA 5JQGB 1T9HA 3MVEA 3NM4A 1ABEA 2M9MA 3L0YA 4J2HA 4OJYA 3HCPA 1EAMA 1SA0A 1T2AA 4UBOA 2ZKLA 4WZBA 1N7HA 1DAMA 4ZU6X 5FF9A 5JSFA 1WBDA 4C3ZA 5BWNA 4LTMA 4R05A 4XWGA 2V4ZA 2FPKA 2YV5A 3FCSB 3X2EA 4W5OA 4G1BA 1FXSA 1L7XA 1UDWA 1BD4A 3NOXA 3FX2A 3O8NA 1AN0A 4WVLA 1DKNA 3QX7A 2IPXA 4PYRA 5HYVA 5I9BA 4XFJA 1Q57A 3U4IA 2NOAA 3FPCA 4JUBA 1NL3A 1TJNA 1UC9A 1COZA 1KK1A 1XKXA 2EFHB 2NTVA 3Q87B 1Z3IX 4FGSA 4P3YA 4DEYA 2B82A 3LC7O 4TWAA 1KQ3A 4DVJA 5FLXA 3LRTA 2FF5A 5HF9A 1V7CA 3K2QA 1SVWA 4EFDA 5I7WA 5LU9A 3S1LA 5FPTA 4C2BA 5BNIA 1MKYA 1PQUA 1RJEA 3PWTA 1I0IA 5K0SA 2GTHA 2LUOA 1GFIA 1IG3A 2VUHB 4Q4JB 2EWMA 3VOTA 3SSOA 2H6EA 1TFRA 2PMKA 2C7QA 1KDZA 4WK6A 3JQAD 3DZ8A 4NBKA 2V7VA 3D6TB 3WHPA 2JIOA 3SX0A 2IU0A 3MINB 4EGSA 3VZPA 2C03A 4IWYA 1EBUA 3ZWWA 3KSZO 3TN7A 4DG9A 5DWQA 1IHOA 2E1PA 3VJRA 1YU9A 4S0XA 3EY4A 2V96A 3G2KA 1ZJ5A 1ICIA 2LR0A 3E9MA 2JJ2D 3ZDZB 5FOQA 5T3UA 2FW7A 5I51A 2AH5A 3D2CA 1WNTA 4TXHA 1NJSA 1Q16A 2VJMB 1NW8A 2CW5A 3LTEA 4WIAA 4IDPA 4WQMA 4JBGA 3MUNA 4ZO7A 5K3AA 2PXCA 5EP3A 4KDRA 3MRSA 2XYGA 1FFGA 3H2YA 4TMFA 5BSWA 1A4IA 3TI9A 5EJ9A 1IHUA 2NTEA 1HEUA 4EJSB 1VI2A 3V48A 2OMEA 1WMBA 4M22A 4Q4AA 1M8PA 2ZZNA 7MHTA 2IY8A 1YFJA 4F85A 3T7RA 4LOAA 1G0OA 1W4CA 2WWXA 3I9JA 3U61B 1N6OA 1A5ZA 4R9VA 3T94A 3X1WA 1XWWA 1TU3A 4IUBS 5CT6A 2V6MA 1UBUS 4PNHA 4GYJA 5AQEA 4F5WA 4HXGA 2COKA 3TEMA 1RWVA 3H9EO 4M1YA 4AN0A 3ZD9A 4MGEA 1J99A 3RW9A 4WXMA 1QM5A 4JMLA 3T3PB 2BDTA 4LJ6A 3QM1A 1AUXA 3G5AA 1UDXA 1L5YA 1YR8A 1NXXA 1SXGA 2HJGA 3AI7A 5ADUS 3CZ5A 1LZKA 3K1TA 3O8QB 4Q3EA 4TUYB 4IF4A 5E4FA 3IP9A 2JGMA 5KNCH 3NBFA 1WD7A 3A9VA 3QELB 3AHHA 3E61A 1P0IA 5FBQB 3D2BA 3KWFA 1JHMA 1I2CA 3FJOA 3M6UA 2W2QA 4F04A 3ZHXA 4FHEA 4DMRA 5JXHA 3R6WA 2Q3LA 4WRRA 2D7CA 2XRFA 1RRKA 4RF2A 3SQNA 2FE1A 3PV0A 3TTYA 1L9KA 3T5TA 2YC2C 2I29A 4NH0A 2JEYA 3FOCA 2O5CA 1E9BA 2I6UA 2H4XA 3CRVA 4KTTE 5GONF 4WCFB 2R9VA 1RI4A 1QYWA 2IZ6A 3A8TA 5CDSA 1RTKA 3Q2OA 1GL7A 1NBMA 2E4WA 2HBQA 2HSJA 4P4NA 4WFIA 5ALEA 4L15A 5DYNA 3VBCA 4DUGD 3JQAB 2X3UA 4ALMA 4MUXA 4BNIA 3RUEA 4I3FA 3PQ5A 1U1FA 5FA6A 2IZ0A 3OQBA 4C03A 3JWHA 2O7NA 1NHGA 1Z8NA 1G5HA 4PHTA 2IIPA 2R6ZA 4P2BA 1IY1A 5HVNA 2GO7A 1P18A 3TQQA 4HNVA 3NOOA 4GOJA 1SIOA 3IJRA 2WDPA 3BWEA 2VCHA 3ZGXA 4M54A 3COVA 3QVJA 4J0IA 3O8CA 3OM9A 4DYHA 1QG6A 4W99A 5FLEX 5CBPA 1KDVA 3TZKA 2H3HA 1A77A 1QCCA 3A31A 3G2QA 3KEGA 2XQGA 1JVNA 1RBZA 1XZFA 1YDEA 2YVUA 3D9QX 3I04M 3OUTA 1DQSA 4G9EA 1HL3A 1GCIA 1OIXA 2C88A 4QXMA 4KO3S 1PU2A 2F6RA 4KE6A 1W1WA 5F2NA 5KX5F 1WAMA 4DMUB 2QVBA 4MPRA 4QUKA 3QI7A 3W7BA 1YIAA 3T7CA 4QEZA 5ALIA 2RHJA 3V7YA 3G0BA 4GMHA 2JJMA 3FTPA 4LDZA 3V4RA 4OHMA 1NW3A 3TSAA 1L7AA 1PCXA 1M72A 4OLHA 4O5OA 2OK7A 1V71A 5JQWA 1MB4A 2O7QA 2YICA 4ALIA 4TVOA 4BZQA 3R0QA 2BM1A 1JJBA 1R4ZA 1JDBC 4WTOA 1U9IA 2X5NA 4KN8A 4E1BA 3K6SB 3EPLA 3GD7A 3HBFA 3LYAA 5C3MA 2V4MA 1F1BA 1H8HA 2P2LA 1RWBA 2IUEA 1U1IA 1UBMS 1ONPA 3IPYA 1TX4B 5JSKA 4ADSG 2PL9A 1NQUA 4G36A 1ZMTA 4CZ2A 3BE5A 4L2IB 3VNBA 3WGLA 3HACA 2C3YA 3ZVRA 4FFDA 4BVEA 3LNCA 1KEZA 5CFLA 4BO1A 2EARA 5HXAA 5L3QB 3GCGA 3LQFA 1EHCA 2DUJA 2EGHA 2ZYVX 3H87A 1WDMA 1KC3A 3NI2A 4KXUA 4BN0A 1LLDA 4C6HA 4K1LA 4BO7A 1SKYE 5H3LA 2GBIA 5EQDA 4G5YA 1SB9A 3RUHA 1E64A 4DZZA 4PAGA 3KC2A 4WN3A 2QRKA 2CSXA 3KTAB 2QS9A 4O63O 2OHHA 1I10A 2OKGA 1ZFNA 2ZYRA 3PX2A 5KYNA 4KREA 4OQXA 1AA6A 4DHWA 1GAQA 3HV2A 1TI7A 1UPUA 3GF4A 3CIOA 1MJNA 3R3UA 2AN5A 3DBHA 4KKXB 4L75A 4M9SA 2GEBA 2RONA 4NQZA 5T8KC 4TV9B 1CZUA 5C8YB 3STTA 5CNMA 1JB1A 1U8AA 4GR9A 4OKSA 2NYAA 4NJEA 1XJ5A 4BDTA 4B17A 2FXIA 3OZSA 5KJ6A 2ZVDA 2FB9A 4I4CA 3AHCA 3LK7A 1F5SA 3PI7A 4ESOA 1RJFA 4C4PA 1UJ5A 4RKQA 5DGHA 3GUHA 3BILA 4ZEVA 2X7XA 4CG1A 2AZXA 4MIEA 2IPLA 2J59A 3CX8A 4LDPA 4NFSA 1ESDA 3SYRA 2WOJA 1R6AA 1WF6A 2OO5A 1EFHA 1C9YA 3AFGA 3KO8A 3AVOA 3QLTA 4RC9A 4ESVA 1ST2A 5DTEA 1W85B 4FIDA 4YO8A 5KTKA 2FDRA 3MJCA 1E2IA 4UBNA 2ZTVA 5SYMA 1T8UA 2QVZX 5JDCC 2JASA 3ADKA 2GJ9A 3GEDA 1ODIA 4NV1A 1S3FA 3AYXB 1EZ4A 2HRBA 3EC1A 2RGCA 4RQAA 1FP4B 1K6IA 1V37A 2FAXA 4U4AA 4YAGA 3LZCA 4C2UA 2L82A 3HJNA 4GZ3A 3UMFA 3MG9A 2GF2A 2ZYDA 3DW3X 421PA 1O0CA 1H2XA 3MM4A 4QFCA 1JDNA 1XTRA 3LY9A 2JAPA 3SG0A 3LCCA 4FZVA 1BYUA 3BB4A 3MIIA 4KGXA 4F45A 1A5SB 5BO5A 3EUEA 2DWOA 2IZOA 4Q34A 2ERCA 3KLMX 2WFZA 1VPVA 1MCZA 1ZI6A 2HA6A 1XQYA 3PC3A 1AO0A 1N5KA 2P3OA 1H5NA 3BEDA 3IP5A 3WK7A 4HDRA 3ZU5A 2PNFA 3EAFA 2OYSA 5L3ZA 4AF6A 1GQFA 1U3FA 2ENUA 4RE5A 2XVMA 4JLMA 3AERA 5ALDA 3GD5A 4KR0A 3ZWYA 1ZIXA 1LLQA 3V4OA 3Q8MA 4ZRMA 4H16A 1VXOA 3BC1A 3REFA 2UYHA 4PFSA 1E63A 3V4LA 3WO1A 1G6OA 4KQHA 1FFHA 1UADA 3MJ4A 1CS0B 4LXQA 4KV9A 3BMXA 1K5GA 4O0LA 4O4IF 4BAUA 4TT3A 1MTZA 4XLZA 4ZYYA 2EFEB 1APBA 2PMWB 1POXA 5HMLA 3IV9A 3IJ5A 1QF9A 3AGQA 3ZXYA 3FLBA 4IIJB 3HLKA 3NBYC 4MP8A 5JARA 4K1XA 3M4YA 1PS0A 2HLDD 1F4VA 4IV0A 4CM1A 2OZPA 3JQEA 4F8EA 2NUAA 3FLAA 3IT1A 3JSAA 3KUUA 5K8TA 5BYAA 2H00A 3OECA 4GRAA 4IOJA 1XB2A 1V7PC 1ZP6A 1CUCA 1BKYA 4KCGA 5TEVA 4EITA 2FH5B 5ICCA 2DTEA 3EZ7A 1VKOA 2A6PA 2YZ2A 3H8JA 2XZDA 3ORYA 4NAHA 4KAJA 1B0ZA 3I5XA 2IEGA 2A9JA 5HZMA 4ZOAA 3UXMA 1R16A 4AYTA 2WWYA 2YBEA 4FYPA 2GA9A 4H0NA 1N5OX 3RVPA 1MBZA 2YYSA 3E4CA 3LUFA 3UICA 1C3OA 1U28A 4EI2A 1RAGA 1FRVA 3LP8A 6NULA 1GKUB 3WIVA 1JHDA 1TU0A 4G0YA 3ZCXA 1NV9A 1D9ZA 4V1CI 3ZNNA 2PBLA 2VPQA 2WUVA 2B83A 2WJIA 3FI0A 3GJ4A 2ZS8A 3PQ8A 2OUIA 4Y7DA 4E2YA 3KKOA 4UUMA 3GZJA 3CLUD 4I1SA 3R3VA 2ZJ6A 3ILXA 1LW6E 3SZGA 3ZWVA 4EP1A 2C31A 2OOKA 4E4RA 4NICA 1YL7A 5HCNA 5C5IA 4FQ7A 4M9ZA 3QXJA 4M9QA 1XVAA 5EZ5A 3W5IA 3DZHA 1V16A 4DY6A 4P86A 1MIOB 1ZK0A 3LXRA 4MRRA 5FUWA 1UMBA 1T13A 3C5EA 3HA5A 3OI7A 1COWD 4GPBA 5DN9A 5EKXA 1ZAYA 1PQ4A 4JHXA 4XCQA 1RXSA 1VSQA 2GFHA 2YC4C 3BQNB 2WJZB 2AEFA 3OESA 2AZMA 3T9DA 3ZUGA 3EXG2 4HB2A 2IP2A 1EX6A 4XFKA 4JN6B 1Z15A 4P08A 4PLPA 4QIHA 5DHAA 1OLXB 4YCDA 2EGGA 3WSVA 5JIBA 3HYRA 2PAFA 4LC1A 1DL5A 4LE0A 5LP6F 4Z6KA 3THWA 3JATA 1UEJA 2B94A 3ESXA 4YNBA 4ETIA 4WGFA 2UVPB 1NVBA 3P9YA 1UPFA 1DG1G 3HZHA 3O9MA 4JLVA 4QUHA 5SY6A 4L1KA 4ZD6A 4I19A 2WQZA 1NVFA 2YXDA 1QUFA 2YL2A 4RIIA 5CIWA 1DBRA 5GADl 2C29D 3IMCA 3QFSA 4WXYB 3UAGA 4D9EA 5EJ8A 2I4RA 2OLEA 2QVCA 4DNFA 1LUAA 4XQGA 4DJAA 3GJRA 3RADC 3KVNA 3AIIA 2LXNA 3NETA 1W46A 3HKBB 4JVMA 1MP0A 3RYCA 5FTLA 5KWEA 1G4HA 2BRUA 3NWPA 3V1YA 1G3QA 3GCXA 3RTEA 4ZQIA 4RPHA 3ZVNA 5BVHA 3K92A 4OYHA 4WOPA 3G8YA 3GG2A 5FHQA 3KOMA 4AJNA 1KTVA 4CM6A 2DM6A 2P2YA 2Q62A 2OCKA 3GYBA 1GLNA 3R77A 4RSRA 5GIOE 3PKIA 3W7AA 5G1PA 4Z9XA 4CKBB 4PN7A 1CQWA 3I5YA 1Z88A 3O1LA 5IF3A 4ZOLB 4LJ9A 2VUIB 2IS1A 2FFQA 4WLVA 3OQOA 5H1YA 3EOAI 2SICE 1C7RA 1JZTA 2HIAA 2G7ZA 1G21E 2R8ZA 3BZBA 1UBEA 3NJ8A 3I0MA 4U8GA 3ITEA 5EE0A 1Y3HA 2D2IA 2QU7A 3AG6A 3BGDA 4Y1FA 3U4HA 3UWDA 3VR6A 2V6BA 3IXMA 1PVVA 3B53X 4LDAA 3KCQA 5IBCA 1XDWA 4DV4B 1E77A 3QKIA 4QSHA 5LLTA 1OA0A 4PYLA 3SLKA 1Z0UA 2BMFA 4FFBB 4N0DA 3OZAA 3QFTA 5K8VA 1DEAA 4B48A 3IDSA 2P91A 2Z83A 4ZVTA 4ZEOA 1E5LA 5EZYF 2QTZA 3ZG6A 4DNQA 1Q7EA 1DLIA 3C5WP 3N0VA 5FNVA 1SBQA 5JADA 2ZI6A 2H2DA 1AUOA 1BE0A 1RMTA 5DYYA 4J49A 3WWEA 3DEYX 3TMAA 4BKQA 3VV2A 1AIPA 2XCRB 4E1VA 2DPXA 1X38A 2Q3EA 4DLSA 4KPYA 1VP3A 4P81A 1WB5A 1V8DA 4YEDA 2YQZA 3CHYA 1XU4A 2Y3IA 1WDLA 3HNOA 4LMAA 4WESB 1C29B 3VU0A 5I9LA 1ILEA 5CRIA 2MU1A 3IAXA 4RF5A 3ZWCA 3I04A 4UREA 4DMKA 1MEEA 3QNUA 1NKVA 4RA6A 1B3RA 2CWWA 4Z7JA 5I7OA 1Z37A 2IDKA 5IXJA 1RS0A 3TIFA 4B4VA 1IK6A 2NNLD 5BN1A 2LGJA 1ZZGA 1XK7A 3FVTA 3LX8A 4ZEWA 4MEAA 3M83A 3DEFA 2A7XA 2ZOSA 2VK2A 3FGNA 3SMQA 5IJZA 4MEBA 4O1MA 1G8MA 1C7IA 4B09A 5AVZA 2J67A 3ZD8A 4CTNA 2WT4A 1K9VF 1DHTA 1P91A 2HI0A 3Q41A 1BFKA 3OQJA 3PRYA 4PG6A 3OM0A 1IATA 2O50A 2ZWIA 3KLPX 3MPUA 3PUYA 4TYYA 4C06A 1CERA 2EJWA 3TTXA 4BWFB 1H23A 4RK7A 2E87A 5DTRA 3T4PA 3D2AA 2DWCA 1CK4A 2I3AA 2PAAA 1A2KC 4M0LA 5FL7D 3VHQA 3WL3A 3TZEA 2WF6A 4C04A 2QT0A 2QJTA 2QY6A 4DGSA 4E30A 3M34A 3BXOA 3EWNA 2ODEA 2DHQA 4BB0A 1S4QA 2WZCA 2ZT6A 4JGIA 1G8HA 4K40A 5J2UB 4JLKA 4MQ6A 2R5WA 3FWHA 2WPDD 1OAKA 4P7BA 4KK4A 4XB2A 1X7ZB 4QM7A 1SKYB 5CA1A 4BUCA 2C42A 2ZIWB 5KTYA 3KCNA 1Y37A 2QWXA 4RU1A 1ZR4A 1MORA 1R4NA 3LT4A 4LZNA 1F8YA 1IZ9A 2WA1A 1CDZA 3DXYA 3QP9A 5EJMA 3ZE8A 4NH4A 4OQMA 4QL3A 1TAGA 1OWMA 3DLBA 4C6SA 2HRZA 2DT8A 2X19A 2SCUA 3N2GB 4N9WA 2HBYA 3HNPA 1S96A 3O38A 3LM8A 3JR7A 4UMEA 3IO3A 4TMWA 4DR3B 2FW0A 4KMSA 1I6MA 3H6HA 3AI3A 4KFSA 4NG4A 4CTJA 5HSGA 2QMYA 1KO1A 2W2LD 2AOTB 4EYGA 2O19A 1ZUIA 1WB6A 4EUKA 1MB0A 1PNRA 2GPAA 1CQXA 1NVTA 2OECA 1QO7A 2RIRA 5EWLA 3ZHUA 4HN2A 2OWDA 1PK8A 4X1OA 1BMFD 2JVIA 5K3OA 1JI0A 4NNOA 2ECFA 3DNFA 4WZ6A 2QLNA 5DOZA 5CB6A 3VO8A 2F62A 2G63A 3QXCA 4YPVA 1XJQA 3ASUA 4NK5A 3AR8A 3SS8A 1Q1EA 1Z0JA 1YJCA 4DC9A 1UPAA 3QEBZ 1KNXA 1KI8A 4TZ0A 1MH1A 3OPYA 4LVNA 3FCAA 3HJHA 4R81A 2XUGA 4RH1A 2BTOA 2OKCA 5EXSA 2YMLA 4FGZA 2H29A 2CUTA 1DGQA 3HVJA 1O8CA 2BUCA 2MIIA 3ASYA 4ZCQA 1D9XA 4EMBA 5AVXA 1U6JA 3JQ8A 5A1TA 4DLWA 2ZR0A 4RMIA 1HQYE 3BWYA 3GQBA 1SUCA 3LFTA 4LBVA 1YCDA 5DCWA 2ZCUA 1LY1A 4JJ6A 5EIAA 2D6FA 3PF9A 4PZ0A 1YCHA 1GOTA 4HAXA 1CUJA 2YZMA 5ALQA 1TYZA 1JA0A 2GT1A 1L4YA 1Q84A 3GBSA 1U4NA 3K0BA 3RIEA 3WAKA 4AL4A 1RWWA 2A1TR 4JLBA 3S2ZA 4QTUB 1CUEA 5LZ7A 3V2UA 4YXWD 3NG1A 3INNA 3D1JA 1RU3A 1TIKA 2YIDA 3G17A 3D59A 6REQA 4TTSA 1FDVA 3MGAA 1PZMA 3IVRA 3QW4B 3OIWA 2ZSHA 4MV3A 3ROFA 4BJ6A 1TT7A 4H7JA 5LSAA 1QGZA 4F5DA 1JEYA 3PFIA 1ESZA 4HCJA 1JDJA 1G3MA 1G66A 2ZUSA 1UZAA 1I4EB 3FNBA 3JQ9C 2PHZA 1Q1AA 4ZQEA 2YFYA 4C2TA 3BIWA 3QI2A 4OQLA 4J3NA 1XRPA 3G85A 1ULUA 3AJDA 5M3BA 1QGAA 1DAIA 2QE6A 1CUYA 3PVCA 1D07A 5I7RA 4RHEA 3W2TA 2JAWA 3LA6A 2FW6A 3KEQA 5KKNB 2EG5A 1X1DA 4KE8A 4KU4A 1UOPA 4LRUA 4J0EA 3HCCA 4ZV9A 3GJ0A 3N39C 1Q83A 2RHTA 3TTSA 1KVUA 2OGTA 3LTNC 3CH5A 3GLIA 4BLTA 4P31A 2PNJA 2OQRA 2OXRA 3FVVA 1OY1A 2JD2A 2ZTLA 3CF4A 3RR2A 2FZVA 1BU5A 1V7QA 3JVVA 4BMCA 1Y7HA 1RDFA 3FN4A 2AJCA 2Y0DA 4BFLA 1JPVA 1IAQA 2PPVA 2GFQA 4IL5A 4JUAA 1NJGA 4KQWA 1ZM7A 2VP2A 4QUEA 2QZJA 2YRWA 4GW3A 4LCJA 3UKOA 1SC9A 1UOOA 2RMKA 2WWHA 3OQHA 5FO0A 3PQCA 5GJVC 5KDOA 1J1UA 3COSA 1ZGBA 1V3QE 2GCEA 4TS4A 4P7FA 4DR7B 4DJ5X 3KV1A 5CDUA 1QVVA 1GUFA 5FHRA 4BGUA 3ER6A 4FINA 4ALNA 4WZZA 3B2EA 3LC1O 2V7XA 1Y48E 4RH3A 4ESHA 4GC5A 2GK6A 2DFVA 3A3OA 4NMXB 4YRMA 4YV1A 3O2QB 3Q1LA 4YYEA 1E2LA 2PS3A 3ZVLA 2G40A 4BP9A 2PKQP 2ATEA 4OD0A 2IHBA 1DO8A 1IPEA 1D8TA 1E79A 3PNYA 4QPNA 5I7AA 1X1QA 4CLHA 1A69A 1F2TB 3GJ8A 4KYTA 5JYEA 4HQLA 4A16A 1X7YB 2VDKB 4PZCA 1ODTC 3N05A 3QPCA 2X5XA 5ALZA 4YCLA 1CE8B 1FYVA 1E2HA 4MWBA 1HF3A 1SXPA 3RG2A 1T6ZA 3VJKA 5AM1A 4F8JA 2CVFA 4AJIA 5AUPB 3P0HA 3KLOA 4F4FA 4HFMA 3PPIA 1SZCA 3R4CA 9GPBA 5D8DA 2VA8A 3RSCA 4MZXA 5GONB 1P3DA 1S02A 1PZEA 4BLUA 5ICGA 4RS3A 2ZYWX 4Y6RA 2AWNA 4YMSA 5JNUA 4HYYA 4W7HA 2BE9A 3AETB 3CLKA 2PX5A 2JW5A 3MEQA 4UHJA 1BFDA 2OTCA 3AOEA 4L3WA 4B84A 4YUZA 3SKYA 2QXUA 4KQXA 1DINA 1M1YA 4PINA 5AVQA 5LWQA 3FCCA 1Y89A 2AJDA 3KXPA 4NSNA 3W5JA 4DPLA 1TB4A 1BE8A 4P5DA 5CFRA 5IN5A 4IQ4A 2NWQA 2QROA 3G0OA 3V80A 2YCBA 4BLVA 4IJWA 4EW2A 1N25A 1YUNA 5AVJA 4IRXA 3V1NA 4BFTA 1T5DX 2ZRDA 2OV1A 3WK8A 1RLIA 1J9EA 1QDUA 5EUBA 2D5CA 3ZXIA 1IDN1 1M0EA 5KX5B 1ND6A 4I5DA 3TGLA 4KRYA 1G1MA 4WUVA 3LCJA 3NTVA 3OQ6A 1T3GA 3ZDFA 3BFJA 4X54A 3U6KA 1FNBA 1QGUA 1XZHA 2C57A 2RI0A 2ZYHA 1ZXBA 3IE1A 1XP5A 5BV0A 5AI0A 1T35A 3AX6A 5KKCA 3EWIA 3DO8A 4UJ5A 3UFXB 3GRYA 5K3CA 5CVTA 3PTZA 3B1WA 1Q0QA 4WY8A 1WCIB 3AINA 2ECQA 3PXGA 4E5DA 2WTBA 4EB8A 1EPUA 2ZPUA 4IV5A 4OA8A 3O92A 4BNZA 1DV1A 1U99A 4OFWA 2W6ZA 4TTJA 3Q6MA 1S8OA 1QTQA 3D6FA 3N8NA 1EP9A 2AVNA 5FO1A 3UFBA 1V47A 3RHSA 4MW5A 1H1LA 1GZVA 2BEUA 1G21B 4H77A 4K26A 4RGQA 4L4XA 1QVAA 5HKBA 1UK7A 1VRVA 3KFVA 1IU9A 4N6OA 4XUCA 3W2FA 1Q3HA 2HTFA 1URPA 3CG4A 3JWJA 1LI7A 1PWYE 2RH4A 4GI3A 5JSZB 3L7JA 4LMRA 3R7SA 4CLOB 5JAOA 2QP3A 4NCXA 5BR1A 3QXXA 3KZOA 3IVAA 5JCPA 4LC0A 2I3BA 1BSVA 1SKQA 5FOWA 5FOVA 3KT8A 5G0TA 2XE8A 5JD4A 2K7FA 1G55A 3TG2A 4Q00A 1L4GA 1S1MA 1J39A 1JLMA 3GLQA 2C0QA 2BEVA 4INZA 4HJRA 4POAA 4QOGA 2VHTA 1VIYA 3TRDA 4EI9A 2JLWA 1RQ2A 3WADA 3LDGA 4H60A 5A62A 4NK4A 1BW9A 1KDTA 2VHEA 1Q6YA 3FHJA 3GA0A 5HS6A 2WLTA 3ETLA 2BUAA 1PHPA 4QYWA 2V7QA 1TEZA 2IUTA 5A71A 2ESRA 2V6JA 3TFOA 4EFMA 2GNAA 3NWBA 3EBOA 4J4BA 1W2GA 2ZCJA 3T1YB 1E3TA 3EDYA 2ET6A 1KP3A 1Y8QA 4BKUA 2ODWA 4IJQA 4C87A 2GKGA 5KVQA 1Q0UA 5BYBA 1PKXA 4HNHA 1GUDA 2H1VA 3QE3A 5HQ3A 1LPAB 3RS2A 4D46A 3R40A 1BVYF 3CNEA 4C3VA 2Y99A 3QU9A 3I4LA 4DEXA 1VXRA 2XCLA 3BKXA 5TRTA 3WJ2A 1I3KA 4OXNA 4YCAA 4K6GA 2ZTSA 1CV2A 1E3LA 5E4YA 5J40A 4BGVA 1I5RA 4LSMA 1Z07A 1QDLB 4D42A 1Q2XA 4BP8A 4DABA 5CD9A 4M0CA 2OBYA 2I7TA 3DTYA 5ARDA 2GZ2A 1XD9A 2X42A 2X86A 3PIDA 1SR8A 3PXCX 5K8IA 3EYAA 4ZJPA 5LD2B 1CYDA 2GN0A 2CEAA 4QU8A 5F3RA 4ER0A 4GYKA 2AHRA 3W6ZA 2FUEA 3IPRA 4JB8A 3WGTA 1VCHA 4DLLA 3TDKA 2MR5A 3AY3A 1AQIA 4FFNA 1MNAA 2Q5FA 2FRVA 1Y7TA 2I76A 1VE3A 2ZR9A 4U3JA 4YDRA 3CSSA 3ICWA 4E5KA 4BDSA 4NF2A 1VE6A 2P62A 2XQKA 3AR5A 1DTWB 5KYKA 3NPAA 3IQGX 4E21A 3H65A 1EVJA 2HMTA 3ZWBA 2FMXA 2WU8A 4F5EA 4YCCA 3FMVA 1C0EA 1E60A 2W2PA 4HRXA 3L7LA 4V39A 1TF5A 3ICPA 4S24A 3RWBA 2UYOA 3HI4A 1BHJA 2C77A 5F1OA 4HAYA 3K0FA 4L5IA 4RTPA 3D7LA 3UCFA 4TXLA 2WAAA 5C2JB 3LD9A 5EA2A 2CXUA 5AVVA 3F6PA 2UXCB 4PW0A 3TZLA 1P1RA 5BVGA 1C4OA 2J9FA 4UPVA 4DCTA 4URWR 2WMNB 1I94B 4ZOQI 1UIMA 1RRGA 4ND1A 3WGQA 1CR1A 5FWXA 4O4IB 1P4JA 4PZAA 1KY2A 3N0XA 3DBLA 3LGXA 4HWOA 4NS4A 1MJGA 3FZQA 2RGRA 5IDVA 1BKSB 3EDCA 3I09A 1RQGA 4KACA 4PLTA 2NU7B 4UAVA 4ZT2A 3V8EA 3F8WA 1FDRA 4XPIB 4EGFA 2YCLA 5HUHA 1YR9A 1H2YA 2FWMX 1MJHA 3ZCPA 5AM5A 3KZCA 1VQ1A 3ZY2A 3A4IA 5ITZB 2QF7A 3B89A 4GWGA 1ZJ6A 1FBNA 2HPAA 3I2IA 1U5BB 2KLBA 5E0KB 3UNXA 3USCS 2E85A 1BRMA 1UBFA 3OKAA 3WE7A 1FLVA 2XDQB 2D5LA 3L07A 5EHQA 1NQAO 1FK8A 2OE2A 1UXGA 1PV1A 4Y2YA 1M67A 2WWVD 3UC5A 3RAEC 1HMPA 1PFQA 1E98A 1X42A 4UPDA 4BQFA 3PQ4A 3BRQA 1YGYA 4OUDB 3ZDCA 5B7GA 2PZFA 3P7MA 4PAMA 4FFMA 1PJTA 4FT2A 5ED4A 5I3ZA 1OR8A 1Z6XA 3BEOA 1J0EA 5F7XA 2VDRB 4W8GA 2GEKA 1N2JA 4LDRA 3WICA 4J91A 4L5YA 1A5BB 2O2JA 2JVJA 1WPGA 3OM8A 4HEHA 2CF6A 4I9HA 4IDEA 3ZE1B 4UM7A 1Z35A 4IIGA 3UUFA 1LWOA 1P0FA 3BD6A 1ZICA 4XGRA 3QEJA 3AEKB 4OHCA 3TVDA 2XZPA 3SQOA 3IBTA 1IEVA 1AQJA 1ACMA 2YJZA 3OE5A 4PONA 3V4VB 4JK3A 1D4ZA 3W9BA 3MLAA 3QKRB 4O2BA 4GSKA 3S28A 1P0PA 3C4QA 4JGGA 3TRHA 4MUKA 3EMBA 3VKUA 4B2PA 1M9NA 2WT8A 3B2NA 4NNJA 5H16A 4B3JA 3FWKA 2RGDA 1I0LA 1ZLYA 3BD9A 4YJ2F 5B64A 5EJEA 4D4KA 5DN6D 3CA8A 4WN9B 3PLRA 4Z3DA 1Q17A 3RANA 5C46F 1NXTA 1ZESA 3OCVA 4OSEA 9LDBA 2PL1A 3ROEA 2ZJBA 4QRDA 3P4XA 1M1UA 1ZPDA 3E9EA 1U6IA 2ZU0C 3PGKA 4YAJA 5BW6B 3VR5H 4X94A 2I2BA 1CEYA 4WK0B 3Q98A 1C1DA 1P0QA 4MKGA 3UTCA 5ABPA 4MQBA 1WZEA 1X14A 3L6UA 1PFKA 1YR1A 2Q0SA 3JZIA 4ID9A 2VYVD 2QZ9A 3W05A 4G24A 1JR3D 4B1FA 2NZJA 1U9CA 2YWBA 5KDDA 3QIVA 2FFBA 1CY0A 4C89A 2I1VB 1DVRA 5B1DA 1N2ZA 2WJHA 1U5AA 1IG0A 3G88A 4PRKA 4ANFA 5JAHA 2AN3A 2C7VA 4Q9IA 4MWGA 1TPZA 3NDBB 3GFRA 2A0WA 3KQOA 2RAUA 1Z0ZA 3EXHA 3O8OB 3QGMA 4FGJA 2FOLA 3Q5GA 1DDOA 1FRNA 1RKBA 1N6PA 4DSNA 1O97D 4JQOA 1YE5A 1CNMA 3U7IA 5BQPA 1W7AA 1SZPA 1T9CA 2NUBA 4FYYA 2Q3FA 1ECPA 4FSHA 4GC9A 4JIGA 3P5BA 4J0QA 1OX6A 2FV8A 2JFPA 2VK1A 1HOTA 4MJLA 1EFPA 5GGYA 5F1PA 3TW0A 4A92A 1GQ2A 5IU6A 3U9TA 2HJRA 1PT6A 2JI7A 4KL8S 5F2EA 1A71A 1IXSB 5AVOA 2IRWA 4I99A 1SVLA 1XTPA 3R8FA 3K31A 4GYYA 2Y05A 2ZYTX 5DTIA 3D6NB 3IUEA 1A8IA 4GXNA 2YYYA 5EHGA 3BHIA 4NENA 3OUUA 1KI6B 4MMYB 5L7TA 3UA3A 3QENA 4HX9A 3WL7A 5IHPA 2VHWA 5LA6F 2NUTA 1P39A 3A6KA 2NPOA 4P53A 4EPXA 2W6JD 3DUFA 1F38A 3K0AB 4B76A 5IBQA 3FCEA 1X39A 3PEUA 1Y9AA 1GJRA 4Z4QA 4L22A 2O14A 3I2HA 5TXGA 1MAWA 2HSZA 3JQ7B 1E5XA 3U3DA 1Y8ZA 5C32A 2IYYA 3T0IA 4CR8A 5KPDA 2HRCA 1PIWA 5EZYB 5H4HA 3PEYA 3K0HA 2PRYA 1F1JA 2O1EA 1RNLA 2PX0A 4P84A 4QJ4A 1C14A 5C1PA 5CW1A 2Z2IA 5MGBA 2FJ0A 3ONVA 1YJXA 1KERA 3OO1A 5DMHA 3C39A 5FUYA 1DC7A 1C81A 1RVDA 1EG7A 2PVPA 2YMPA 3C2QA 4BKOA 1YNSA 5I4BA 5KYXA 3BMNB 3K4PA 4IXDA 4BMZA 1QCDA 3AF0A 4LE2A 5G1OA 3ML1A 4X20A 1T9BA 4PIPA 4PX2A 4TXMA 4X3OA 3UMYA 2NP7A 1N8KA 3AHJA 2ZJFA 4BFWA 2DHDA 4LJKA 3I5AA 1Z13A 4GLBA 3KLNA 2QJWA 2C9OA 4X64B 1OPXA 2BGIA 3AEUB 2F8SA 3O47A 3DOHA 2IYVA 2OSVA 3ND6A 2ZAYA 3A6LA 3B3GA 3ISJA 4W5WA 3D31A 1T2NA 3ZWMA 1UOEA 3G2HA 4AUNA 2HLPA 4BFYA 4F1WA 4DF3A 1XD8A 1UF9A 4N54A 5B1IA 4BFCA 3GFSA 4BS9A 2DUWA 1KYYA 4K9OA 3U3ZA 1NOJA 4OGLA 1O94C 2BI4A 1YR6A 4YDHB 2EFGA 1XHEA 1KEVA 2NVOA 3JQGA 3OZ7A 1DC8A 2BGLA 1Y81A 3KSBC 2GA8A 1JU4A 4LRXA 1Q6ZA 2ZE5A 1DO2A 2PGLA 1WF3A 2XZLA 1E9EA 1S8NA 4J8PA 1H3NA 3UHJA 2C94A 3PCTA 1EGMB 2QM0A 3BMCB 4RVCA 5HFJA 4R0MA 4MHOA 2XBMA 3EISA 4DLBA 5JYCA 1ULBA 3KBBA 1GLVA 3O5AA 2CV1A 1FXWA 3NIBA 1V3VA 1SVNA 1WZCA 3KUKA 4KTVE 2VH5R 1O0SA 4MVJD 4MUBA 5KQRA 1ONNA 3Q3JB 1TJ3A 1E3WA 2CLSA 5DGIA 3HJRA 2QT1A 3P1JA 1DKLA 2YOHA 1ZM3A 4OBEA 1O58A 3G2OA 2K6GA 1XEFA 2P4EA 2E1RA 1NBAA 4X61A 2UYCA 3U56A 1N7GA 3MB5A 5IJAA 3SEZA 5CM8B 1WZUA 4CGZA 2G0TA 4OXKA 1DTEA 1F4LA 3P2EA 5L45A 4CEJB 1JU9A 3K8YA 1U7HA 2QNRA 3SEQA 1WUYA 1U1GA 1Z7EA 5DSZA 8GPBA 2BTQB 1FTYA 1FYWA 2QAGC 3DZCA 4B5KA 4OX9B 4KVGA 3ER9A 5EPUA 1W87A 1C3VA 2Z43A 1O6CA 3BJIC 4D0SA 4YMLA 3WIDA 2ZJ0A 2NTJA 2ZJZA 2V5UA 3GGOA 2C7GA 3QVGA 3F73A 4Z2AA 1IY8A 3BA6A 3RPEA 1FVOA 3WB1A 4PG8A 5CH8A 1CIJA 1OVGA 2BW0A 2DQ4A 1YQUA 2X1HA 3WGMA 2PZGA 1KE1A 5C1OA 1XRNA 2WW8A 2DBRA 3FI9A 5GZ6A 4EF6A 3KRTA 1VBNA 2DFTA 2NADA 2JGDB 4K9KA 3UCEA 3VU9A 5KQMA 1BHSA 3RYFB 5U4QA 2QL9A 3A9TA 5AQ1A 4CV3A 5DE3A 5KWVA 1IJKA 2CKDA 3OPMA 4UM9D 3I5MA 3WYEA 2OQIA 2P9BA 2H48A 5IC4A 3TI7A 2O1SA 1ZUD1 3IP7A 1QIEA 3X43A 1ZGHA 2YINC 4JYBA 1MOZA 1RXVA 5CA0A 4BBAA 5EKUA 2YASA 3WK4A 2XJ9A 2BPOA 2JJ1D 4N82A 4MK4A 5ED0A 1JU3A 2JZOA 1FVHA 3E8SA 5K3FB 4UUAA 3N2LA 3RAGA 5K45A 1Z18A 4OMFG 1DXOA 1GTVA 1P81A 1T8WA 3JAWB 5AW0A 3AKDA 1QQAA 3VOBA 3G6KA 3FHCB 3CR3C 5FI0B 2G28A 1RKQA 1V0JA 3QH4A 3B1XA 4J76A 1Z5PA 1XCOA 3A05A 3DWEX 3E82A 1T29A 3CNBA 4HYTA 3BDAA 3WNZA 4DYDA 3NYWA 4DJJA 3J7TA 3ZZUA 4DDUA 1U3TA 1RJWA 4KDFA 4N3AA 4WOCA 4X93A 5BQ3A 4DB2A 2AEEA 1WHSB 1JPUA 4X5OA 4ZIRA 4JZYA 4JXZA 1PT9A 2FP4A 4GRIA 4TLDA 4E31A 1K97A 3N2KA 4C3OB 4BU0A 1XELA 3L4JA 1CUUA 4IF6A 4S05A 5JNVA 4G23A 4IZIA 5F9MA 2RGXA 4OXQA 2NXWA 4QXPA 5B58T 4BV8A 2FFJA 2IXAA 2E5LB 1ZCFA 1M10A 3C45A 1NY6A 4U7FA 3RU7A 1E9CA 3K2BA 1KI7A 4IEFB 4OL0A 4RK5A 5BV2P 3ABRB 1QONA 4HC4A 4OFBA 1VL0A 4IDHA 3LYLA 4ZFNA 3Q7IA 2DERA 5CTAA 4FCCA 1P8AA 4S35A 3MILA 3BSSA 4LECA 2L19A 4H7KA 2ZJAA 5T8KA 3TFQA 5KSWB 1CDDA 2WAXA 5HJ7A 1HV8A 2PUAA 5J4YA 1VCMA 3LHIA 2AT1A 4CKCB 2ZSJA 1Z25A 4TSFD 4QOSA 3S3TA 5T4BA 3X1XA 3MGCA 3L0BA 4TX1A 1P1CA 3I9OA 1OYYA 4HGOA 1IEXA 4QASA 4JOBA 4R2IA 3ZCTA 1SUSA 3T7AA 2D0IA 5JH7F 5LJLA 2DCMA 4OX9Y 3DV9A 2ID4A 4Q3DA 5E4TA 1JEDA 2YN4A 4JIMA 4EYSA 2X2PA 1Q7GA 4NYMQ 4OIFA 4UBKA 4ZT6A 3VC3A 3WB9A 2H65A 4YFYA 3IUMA 2VP4A 4HOYA 4RD4A 1PUIA 3TTTA 4JI2B 3K70C 1TC1A 4Q1BA 3LHDA 5JDCA 3GO4A 2I2WA 2WG2A 1WUHS 2Y6UA 4HDMB 2QG4A 1VGRA 4MWDA 3LFHA 4AJ2A 4HQNA 2NYRA 3CKYA 3T12A 3RUFA 2Q4BA 1IB6A 1UBJS 1UJ6A 5FOXA 3WBJA 1N2EA 5EZQA 1ISPA 1TJPB 1SKBA 2P0EA 2DKNA 5JWOA 4LEIA 3L5OA 5HZGA 2ZJ8A 4QYIB 3BIXA 4HNUA 2JFNA 5KOHB 3MLBA 1MRZA 3B6EA 3OP1A 4DDTA 5IC5A 4IQ0A 4LJ4A 5AVTA 4QFMA 3QUSA 3KHUA 1ZK3A 4WEOA 2ZVQX 4A8PA 3OFKA 1N2IA 5EIEA 1N5JA 4Q1DA 2CLOB 1OFUX 2OGUA 3ZQKA 3IOCA 4D9JA 1ZS9A 4IQGA 1SHJA 5DIFA 5A9TA 4BMSA 1NXOA 4M9RA 3GLSA 1YVUA 5BPFA 1PNQA 3E22A 1XMPA 2AI3A 1UBTS 5HS4A 1LBHA 5IG2A 4LJ5A 2HBRA 4M1OA 4DLTA 1V4VA 1B74A 3NWJA 3G13A 3T5PA 3DZJA 3WMWA 3EBPA 4NDNE 4BAZA 2QRQA 3DMHA 3K1AA 2Q2QA 4BRWA 1S01A 4KQ6A 2E18A 2PD6A 4LA4A 4C20A 2X5KO 4X90A 4Y0NA 4GPAA 3TIXB 5CR9A 4MI9A 3GUVA 5JJBA 2O2HA 5FUMA 4FEGA 3TSWA 2Q0QA 1RD4A 5C8DA 2YRXA 2BWJA 3C87A 4HH1A 5H5JA 3NHZA 1RHRA 3IDFA 4XTCS 4BRZA 1TQ2A 4JYMA 1SD1A 3CRMA 4H31A 1XVVA 3K05A 1TCCA 3A37A 1MPTA 3O9VA 4J07A 4ND6A 4WOBA 5FEMA 4QXQA 3U7EB 4COKA 4B4WA 5LN1A 3MJFA 1X1SA 3HKDA 2JBAA 5K3DA 4O6VA 3RUIA 4X84A 3S70A 4D9HA 3AM1A 4UOQA 4FFVA 4NBUA 4DCJA 1R6XA 1DARA 3FJYA 1NMYA 1UWCA 2IU3A 4G67A 4JJAA 3EUAA 1LRLA 3KZVA 1UBNA 5EGNA 3EN0A 4MSUA 4YPOA 1FP6A 1S2DA 1X9GA 2PFKA 2VF7A 4WZAA 1QHGA 3BMQB 3ZGOA 3VA7A 1N3LA 4OHUA 3CONA 4GOKA 5FA8A 1Z3CA 1I8TA 1ZA1A 2PZEA 1VM6A 2VPZA 3EUFA 3LDAA 3HVHA 1NP6A 1MT0A 1YR3A 2CDBA 3EXFB 3N7TA 4Y2JA 3BFXA 1Z7WA 5DLDA 5K0JA 4X6UA 4CN8A 4M46A 4QOJA 4HDAA 4KPUA 3S7TA 1V43A 3NHKA 3I34X 5KYWA 3GIWA 3GP5A 4D02A 4ARIA 2CHGA 3WYAA 3TFWA 4ZHQB 4D45A 4MGHA 2A59A 2CXOA 2CBZA 2W37A 3K1YA 2EGUA 3H7IA 3IBYA 1SMKA 1MAUA 4M86A 3V8VA 2ZPAA 3AWIA 2PSHA 1O2DA 2IHVA 3I2KA 4LRSB 5EKSA 1O4VA 5AW5A 4DPMA 4ARSA 4J0GA 2FZCA 2ATVA 2Q4OA 3JQDA 1XUOA 2PUFA 2R8EA 2PM8A 3EFOB 521PA 2ECOA 1U0EA 3ZZMA 1R5OA 3JASA 2UZ1B 4FB5A 3Q0TA 1RLJA 4PO1A 1TQ6A 4RPJA 2WTXA 3HWSA 3IDQA 3SQDA 3WFZA 2DWUA 3AKZA 3W2IA 2VUSA 1PP4A 3IEIA 2GM3A 3RJ5A 1NQTA 1ZM4A 2FG6C 3FCYA 4HPJB 3UJPA 3ACDA 2NSLA 3IEXA 5EEHA 1DOAA 1D6NA 2C7PA 4I4IA 1I4TD 3MWFA 1R9JA 2HY7A 2ZEJA 3B1YA 3IXLA 2FPPB 4HO1X 4DLNA 3F6YA 1ZOOA 3EFHA 2ES4A 2R7AA 4B2IA 2QD4A 1UT8A 5LDHA 3AUKA 5LXTA 3RE1A 3GDOA 3N0TA 4ABTA 2V8OA 1VCNA 4M7OA 2A67A 4P4SA 4ZPJA 2GCOA 5CNIA 1OU0A 1T9ZA 1QP0A 3AB7A 2PLRA 4LMPA 5DHQA 3DFIA 3OLCX 2TMDA 3G8DA 1Z4IA 2MDTA 2I9KA 3EGDB 3BQMB 3H42B 2FUNB 2QTNA 10MHA 1KBZA 3MWDA 1BGWA 1OFHA 4V0NA 1EGHA 3MS2A 3PI6A 3GLRA 2XZTA 1R27A 1TM5E 2KE5A 3KB1A 3L7OA 2AOXA 2UUPA 1P74A 2DQYA 4TYWA 2C97A 2O8DB 1UBCA 3PJGA 3E0XA 3PQDA 5IN4A 5LQUA 3N2ZB 2P6PA 3QITA 1GQQA 1TKRA 1QAQA 1W2HA 1WOMA 2YY5A 3DL7A 3ZWAA 4V38A 3ZE9A 2ISSD 3I32A 1TLFA 3IB3A 4EQZA 3VAYA 1EDBA 2H4WA 3O1IC 3THOA 1E1QD 1E4OA 4HDNA 1EK6A 2FOIA 4C21A 1UOQA 4ZDJA 4MV5A 4QBKA 3VM6A 2FUG1 4R5MA 3CKMA 1RCFA 3UW1A 3SJZA 4PN3A 2CHEA 2EFYA 4GLOA 3AC0A 3L6RA 4NMWA 2GETA 4PGAA 1ESMA 1WHTA 2QTVA 3OZWA 3WBFA 4AY4A 3MMSA 2GBPA 4AX4A 5F2KA 2GCGA 4TLCA 2P6OA 4QTYA 3UM9A 3L4EA 4W5NA 2YJ4A 1E1RD 3TPFA 1NN5A 1I7NA 1CFJA 3F90A 1ECLA 2IDZA 3B1FA 1AUQA 1YIDA 7GPBA 4GR4A 4POOA 3JYNA 1QC5B 1NVVQ 2YQ4A 5F33A 1JH9A 3WV4A 2BCGY 4LPSA 4TRRA 1WABA 4GQBA 4YQFA 1LPOA 3E3MA 2IXFA 4B4DA 4WNAB 1E1LA 3SDBA 3OCYA 3OURA 5GV8A 4PAQA 3V42A 2NTNA 4JSRA 3IDAA 2H4YA 1NI4A 3HXOA 3LQYA 1V9LA 1PGOA 3F5SA 3FDJA 3FOBA 3PHHA 4CMIA 2QNIA 3MT0A 1FNCA 5AT1A 4I1UA 1KTIA 3H2KA 1FU7A 2QRPA 4J0FA 5IVHA 4TTIA 3NHPA 1GGEA 4YMWA 5IM5A 3R7AA 1SKAA 4KXFB 1JJVA 1PJSA 3RBZA 3TOZA 3VC7A 2DPGA 5LVAA 1K9SA 3FYSA 3SIRA 3V6MA 5HHTA 3VO1A 4IVRA 1OGJA 3AH8A 3HHEA 5EKTA 1GDHA 3C70A 1FSFA 1Z2OX 2P6UA 5C1IA 1UAYA 2Q1YA 3LI2A 3OTQA 2WP8J 1I9CA 3S2GA 4CLRB 3FPFA 1DIOB 2GX6A 1UXKA 3W3AA 2QORA 5EQTA 4A0HA 3IX7A 4R8LA 1V9SA 5JRJA 3V33A 2FA9A 3BYZA 4LQ4A 2R2GA 4YREA 1D2NA 3U3KA 4BNDA 4GR5A 1MX3A 1NC3A 2ZJ7A 3FDZA 4LJYA 4XA8A 1WB4A 1QE5A 4ZK2A 4HAZA 3DWFA 2AOVA 3DPSA 4O8ZA 4TYQA 2Z8ZA 3OJ0A 1IE3A 4WKPA 2UUAB 2EJVA 2F48A 4W5HA 3CBQA 4YMHA 1NPYA 1CQIA 1J4AA 1PX2A 2I2XB 3BXHA 1WV0A 4WNIA 4PAOA 4MB0A 3RVLA 2QE7A 5HIKA 1EQAA 4DKXA 2ZJ1A 4EI7A 1UXJA 5DHFA 4DIUA 1JAZA 3P9ZA 1R0SA 1CJTC 1DP4A 4YJ2B 3SJ7A 3TZQA 3OWOA 1MD9A 3WY9A 5TF0A 1N33B 4KN9S 3LT0A 4CM4A 1W5TA 1ZK2A 1FS4A 1AH2A 1V5IA 1TUBA 3BK1A 3NANA 4YV2A 3L6OO 3D8HA 4E22A 3BM5A 4CEIB 2NZ2A 2WF7A 3C4JA 3ROGA 4K0KB 1XFAA 3LCMA 1A96A 1UC8A 3MB8A 3R6LA 4UXHA 1AV7A 2A7QA 4XVRA 3RUDA 4PICA 2P75A 2WM8A 1C1YA 3WKCA 4BFUA 4EG8A 1BA2A 1TAUA 2BFEB 2QHXA 3IAM6 1JHRA 1T4CA 4FLMA 1TMYA 1ZJZA 4MIKA 5D1NA 1Q95A 3G49A 2NGRA 1GGVA 2IP1A 2YHUA 1U94A 1WU7A 1FLDA 1T5OA 3G2LA 2VRCA 4EPWA 1WUTA 3FH0A 3LLSA 3MUFA 3QOWA 4B2YA 4G5XA 2BHRA 3C16C 4ML3A 1KFJB 1RKVA 1U4OA 4MHTA 1EWQA 3MJTA 3B20A 3QKTA 3IBFA 1CP3A 1PT7A 4YJGB 1IBSA 4PPGA 2NSYA 4MICA 2CC2A 2B5OA 4GI1A 4LKRA 2AMJA 4UMFA 3ZCUA 1DIRA 1YC2A 2FWAA 1NQVA 3CNHA 5FPSA 3GJ5A 3HABA 3W0LB 1KWGA 1VL1A 1HE4A 2PSJA 2O0KA 2WE7A 1SVUA 1NOIA 1EGAA 2I22A 2KLHA 3AM3A 3P9KA 3EDRA 4FZ5A 4GG1A 3ZE6A 2QGNA 1Z5UA 3CXUA 2HF9A 4N6NA 1U0NA 4R6WA 3JARB 3H5WA 3RJTA 1XLTC 1TKCA 4NP6A 4QNMA 2JFXA 1INLA 3OQNA 2F3RA 5BWCA 5LA6B 1E2GA 1I13A 1P9RA 3UY4A 3ADDA 4FI3F 1D5WA 2IIBA 1KXJA 1F3OA 2BGRA 2CVPA 1USIA 4LUCA 1DRJA 4RFSA 1VL6A 2YFHA 4P33A 4UE6A 5EHNA 5L7YA 2QXYA 2JFFA 3V9AA 3PWZA 4OH7A 2H06A 4Q24A 3ITDA 4BE7B 2H2WA 4DA0A 2EX4A 4HY3A 1JFRA 5KREA 3QBTA 5K0BA 3L7CA 4FYMA 4W9RA 3R8XA 3GMSA 4MQFA 4DS3A 5DCUA 4JI3B 1C3JA 3MFQA 3Q0EA 4BTEA 3JQ9A 1TQDA 3CLTD 3C6QA 2ZWAA 1CXZA 1CQJB 1H1TA 4CTMA 1V7ZA 2B5VA 4QQ8A 4CIAA 1MABA 9ABPA 1O08A 3OLVA 4BNHA 1U0BB 1QRUA 2O4CA 4PZEA 3L18A 3HV0A 3VTFA 5IULC 3Q6IA 4E46A 5SV2A 2Z9BA 3WTCA 3D0RA 4KPEC 1OWPA 2D1RA 1JE1A 1SWVA 3BWVA 4RWEA 2FSPA 5BOSB 1KEEB 4JJZA 4K2AA 4NEGA 1XK6A 2DHCA 5JC8A 1B76A 3TQOA 4CI0B 3I64A 5M7EA 2ZRPA 3MYRA 5GIPE 1U80A 4RTRA 1P2VA 1ZINA 4R7GA 1WKVA 1FYXA 4ER6A 5HJ2A 2IH2A 4MWCA 2MSLA 2HW8A 1UJ4A 4G8BA 4UHDA 2XUZA 4RQBA 3R9XB 2NN3C 1BMQA 1D6MA 5FOSA 3VPFA 1N4DA 2WILA 2R1TA 1SCNE 2GXUA 1JKXA 3TE7A 3BJEA 1X3SA 5JD3A 1EIWA 4A15A 1AV6A 1XWIA 2VAVA 1N2OA 4UW9A 3CWCA 4RQUA 2OHFA 1Y1PA 3EWAA 4L4SA 4HMOA 1G7CA 2QLMA 3QOFA 4WCDA 3JCZA 3ZXSA 4YC7A 1PR3A 2QRVB 4L8GA 4CDGA 3GU3A 5BN4B 4RV5A 2ZUBA 3M6XA 3CZ9A 3O21A 4XB6B 1OT5A 1KI2A 4KH1A 4JROA 4EY7A 2X4LA 4IDFA 2X4DA 4IWXA 1PEKE 2WLSA 4MRSA 2EEPA 1JMKC 2FN4A 1VIVA 2JATA 3C3KA 2X5JO 4NESA 1JQEA 4JWTA 2ZWOA 4ZT7A 3RARA 1ECJA 2EZ8A 2BI8A 1IJBA 1MVLA 2ZP1A 1CUAA 3C98A 3K9GA 3UJNA 1N8NA 1SOWA 3DLIA 4S3MA 1UWKA 3JYLA 4AO7A 2W70A 4IINA 3ZWKA 4LJRA 1W76A 3DVAB 2ZWMA 3RFXA 2VYQA 4KPGA 3HBLA 3R09A 1QZXA 2ACKA 3MW8A 4V0OA 3R7LA 4EB6A 4AN1A 3F47A 1QGED 4PO8A 2N0SA 2VUUA 1PBNA 5ALUA 1H8ED 4Q3NA 1K7CA 3SYKA 1E7YA 2EP5A 3KUXA 1SU4A 3DV0A 1FP2A 5LB2A 2H4ZA 4F3YA 3FWPA 3JR3A 5DK4A 1FF9A 1U0GA 4S0ZA 2V7UA 3EOBI 4QU5A 4QXAA 3KALA 3P5SA 2QBYA 3M8KA 1RYEA 1XF1A 2CNDA 3GLGE 4TVKA 5JY1A 1BQ3A 4M37A 1FMTA 2ZI5A 2XSZA 4TVBA 1Y8RB 2OG1A 2B6NA 4Y2QA 3WRYC 1X6VA 5JSUA 1H9AA 2HNBA 3M6AA 4JZKA 5JVDA 2F17A 1ADGA 4B3XA 4OM8A 3TKLA 1U90A 1C9DB 1OREA 3R75A 3IVGA 2HWXA 1JE0A 1XMSA 2WG1A 4FCWA 4LBWA 4M3NA 5KVCA 2RB5A 5I9NA 3OZFA 3RF7A 1BE6A 2NZXA 1KYWA 2X9GA 4BB6A 3CCFA 2W00A 1EUQA 2RGNC 4KW7A 2CNOA 1ZC4A 2OXTA 5LCXA 1BC5A 1VGQA 2J1LA 4HXEB 4H4EA 2FG5A 2VHUA 4WKNA 2QX9A 3DMPA 1T5BA 4GO1A 2RKWA 5ITVA 3O4GA 2JAXA 3P0IA 3TZBA 1IFXA 2YV1A 4NDAA 2V5AA 2WQ7A 1EQUA 1WNFA 1LKZA 4X3PA 2H2GA 2X0IA 4KDEA 5EE9A 1DRUA 3K0CA 1FFXB 2Q6TA 3ONWA 4KIFA 4L9SA 4CM5A 1YTUA 3WQQA 4F60A 1L1QA 4HEJA 2D7JA 3PNQA 4UEWA 3UUWA 4X3CA 2VC2B 1OFUA 1VC2A 3PNOA 3FIJA 4KI0A 1NQOA 3BXZA 1FOEB 3EVFA 3FCXA 2A78A 1M5RA 3CGGA 1W4AA 1XDZA 5JECA 3S81A 1U0OC 1TJYA 1WR8A 1JEEA 1SUIA 1MC1A 3D5EA 4CRWB 4V24A 2WWGA 3RVQA 1T91A 4HRAA 4RJ2A 3H75A 1CQZA 4IO1A 1L4BA 2PS0A 1QMPA 3W5CA 4PNEA 2WVGA 5K6AC 1YK1A 2PZAA 4LXYA 1W8DA 3SGLA 3O90A 4PC3A 5TJ9A 3C97A 3M6FA 2A57A 2H4JA 3EZ2A 4P92A 4Y0VA 1FX0B 2FK8A 1EFLA 1P4AA 3BXGA 1JSXA 3FTDA 2AZTA 2GPNA 2UZIR 4ZAGA 4WCFC 3KXDA 2JEZA 4O2AA 2WJ3A 4AF7A 2RI1A 2W6OA 4OCZA 4RPGA 1H5QA 4GI5A 1ISRA 3QSYA 1HDGO 2VPTA 1O96B 4JT2A 3L05A 3T15A 2CVZA 3WFJA 2AD5A 2D5IA 4OFXA 3W8NA 1RCTE 6GPBA 1S4MA 1NDHA 3FF1A 2D00A 3NKFA 2HJVA 3GNSA 4S04A 3KFLA 2NAPA 4PYMA 1H0KA 5DNAA 3IL2A 3B6MA 1J8MF 2CT8A 3PGA1 4B8WA 4ER3A 3DD5A 1JQKA 1SULA 1VSBA 2PR7A 1XG5A 5CPBA 5JH7B 2M6LA 2RG7A 5CXXA 4Z7NB 5E1MA 5JYBA 4FQ8A 4GP7A 5MHTA 2UZ4A 4Y2VA 3ZY6A 1KEUA 1Z4QA 4R6XA 4MI3A 5CFOA 5F7OA 4LYHA 4QE3A 5AW2A 1L4KA 3AF3A 2GARA 1XZLA 1PGNA 1HLGA 5EWJA 3PFBA 4RUKA 4XEHA 4D8TA 2REOA 2I99A 1PTJC 2DJ5A 3D6UA 2BISA 1DXQA 3P20A 4U0KA 1JRLA 2B2XA 2RHBA 4ARZB 1A72A 4QUAA 3RTAA 3C5HA 3IAS6 1JLLB 5FD8A 2QP4A 2C2XA 5C5DA 4FS3A 3UJ3X 1EI9A 1V48A 3VYWA 2XCUA 3CPSA 4OQNA 4UNNA 4B4KA 5FB3A 1XCLA 2IYNA 2OCYC 1P9NA 1UBKS 2EZ9A 1KMQA 2RGYA 2QP9X 4I9NA 5B3KA 1FB5A 1L4EA 1ZW1A 2HDNB 2VWGA 3QEOA 4AJKA 2GBGA 3AVVA 3R76A 1AS3A 3ZJ5A 3I30X 4LZZA 3FHOA 4QUDA 4UOZA 1RYYA 3GZNA 2CB0A 3G9QA 3JZDA 4GPTA 5FQOA 5T4FA 3AEQA 4V0ME 4BJ1A 2XCTB 4J1NA 3KB6A 1T4MA 4I1RA 1YHZA 1X1RA 3H2SA 3IQZA 4B33A 3OAAA 2XD9A 1W73A 2P5UA 4B3DA 1XMVA 3RVKA 1NKTA 1Z2EA 2WKWA 3B52X 3FGOA 3IOYA 4IEIA 4LVCA 5F78A 3WNVA 3QVVA 3I6MA 5IJ9A 4KQCA 5H82A 1USVA 2WM2A 3CBGA 5I7SA 2J3IA 4TV8F 1Y1TA 1IVNA 2AFIE 2BMVA 2FMFA 3BDIA 3UK0A 4ZZ1A 2Q2OA 5EMKA 3UK2A 2PX8A 4K9SA 3I73A 1O6BA 2I3DA 1NF8A 3P0RA 4OEHA 5DBEX 2V7TA 1HTWA 2C0CA 2YHIB 4RXTA 4AZWA 1WY7A 2K2QB 3SC2B 1Z8HA 4RTSA 2C4MA 1MOSA 2XOXA 2V98A 4NBNA 4IHQA 4NONA 2PWAA 5EHIA 2J08A 2BEKA 1ZCBA 4QVKA 1E7WA 4GHWA 4NOJA 5ALRA 4EHJA 1XTJA 1IUPA 2V3VA 4R1LA 1D1SA 3CV3A 1C80A 3CW8X 5DWVA 3VHLB 5AXBA 4CDMA 4NYMR 3WL5A 5K3EA 3CWQA 3IULA 1WG8A 4JLSA 4LBYA 3ENQA 5DB4A 2CXRA 4J7UA 2GHIA 3HZZA 4EM6A 1WXQA 4MR8B 3WWDA 5L9AA 2DEUA 4F84A 3RVOA 1WBJB 2AUNA 2MWMA 1I01A 2C4KA 2IIQA 3D81A 3IP8A 2GSWA 4B35A 2FSVC 3X1JA 2OVFA 4WT7A 4F6RA 1K6MA 1L3IA 2FX3A 4IDCA 1FDTA 3EG9B 5F77A 1WVIA 2LWIA 4DIFA 3IBGA 2QR2A 4YJHA 3EE6A 4S1PA 4CMKA 1E5DA 3P0EA 3K0KA 2AHOA 3N87A 2AQ8A 2QUKA 3K8ZA 5G0SA 1KFEB 2FEPA 3JD4A 1YJAA 3NFRA 2VJKA 4WX2B 2HSWA 3AR9A 3OZEA 4GMKA 4Y9SA 2V7PA 5E8RA 5TGTA 3R7WB 3T4EA 2XUHA 1W93A 2CY0A 3VR2A 4F86A 2D54A 4ZMRA 2WD7B 3TS1A 5K7SA 3GZ4A 3U7QB 1W30A 2G25A 2WWFA 2IITA 4H59A 5FUQA 4RZIA 1AXGA 4GZ6A 3FPJA 1KZGB 1KQPA 5DNVA 4RTLA 1AXEA 1CETA 1X92A 1FC0A 1ISGA 1F51E 1XD2B 2I1LA 1XU9A 2JIZD 3B6IA 3K32A 4DCUA 2PGIA 4LZPA 4A8JB 3HE3A 1VKJA 3WLTA 1H4QA 2EFDB 2I4LA 1KOJA 2W2TA 3CYFA 4OHZA 1KVQA 4B31A 3E9NA 3TL3A 1WX1A 2JKZA 5F12A 3GCWA 1QBKC 3EF1A 3WYDA 2BLNA 2QJOA 4X8HA 4D92A 1GZDA 2QL5A 1GKIA 1NYQA 2PGOA 1XTZA 2Y1GA 4GQIA 4ZI3A 4Q1CA 1VPLA 5IDWA 2DJIA 1NFRA 1RYFA 3IJEB 3D1LA 3E1SA 3IB6A 4J6FA 5CJ2A 3KR2A 3RH0A 3T3NA 1ONBA 2AOUB 3H2HA 1T6BY 1U7OA 3ZW8A 1JAIA 2VHJA 3VU3A 2JGFA 3NT5A 3CJTA 2A1UA 5EJ6A 4D3XA 4RABA 3RS3A 3TB6A 3OEYA 2R6FA 1H6BA 3F8TA 1Z68A 5H83A 2M1XA 2NQ2C 4N9QA 4XPZA 4EMUA 2KPOA 1QDEA 3QK7A 2ZUTA 5IVIA 721PA 1M74A 1CZLA 5HILA 2G67A 3C5CA 4BFXA 1QHHB 4KXYA 4PIMA 1OOEA 4YASA 5DK6A 3RRXA 3PGMA 4FILA 5E6RA 3ZJYA 1C5KA 3MUOA 4MVWA 2ZSKA 3RSQA 4HJXA 4ZCRA 4GX1A 1CUWA 4Q1AA 3TLGA 4RIEA 3PGJA 2Q2WA 3JPWA 1B4DA 3BH6A 2R85A 5D7NA 1TCVA 1PWXA 3R0JA 4RO0A 1LSUA 3L4SO 4DM3A 3C8UA 4PANA 1QQ6A 4YDSA 5K0ZA 2BP7B 1UXHA 3U13A 3WLOA 2GTPA 1GWNA 3FFXA 5A4MS 1W9HA 2OESA 3ZD6A 1UKVY 5DYIA 3NWOA 2IKSA 4EJ2A 4ZAWA 2GMWA 1N36B 3VHRA 4GX5A 2BJWA 4IYJA 4J0CA 5FWYB 1ZXLA 1Z12A 4KQFA 5F73A 4TWIA 5JE8A 3C3XA 1IOLA 4E2ZA 1ARZA 4PGFA 3ZVMA 5CNKA 1GPNA 1WVGA 2MT9A 1EBBA 2BFCB 3K9QO 2GEFA 4G0NA 2H1CA 2WICA 4PM4A 4HWPA 3X1DA 5I9IA 3ESBA 4ZGWA 3G1UA 3KELA 3DLAA 3LSYA 4LVUA 4PNPA 4J1TA 4TKUB 1DAHA 1Y34E 3GGGA 4XASA 1X15A 1SOUA 3AILA 5IM4F 2O0LA 2XNDD 4YR9A 4S1NA 2XXAB 1MO6A 4UNSA 4C9BA 5IYZF 4UDYX 2ZIAA 5L95A 3RAJA 1DHRA 2CYAA 4FHGA 1CJSA 4X95A 5KOYA 2CFIA 3CTMA 3O0DA 4M83A 4Q4HA 4RWZA 2NU9A 3JS5A 5TT0A 3DTVD 3WGGA 4CQMD 2PS1A 1TIPA 2H8GA 5AIBA 1GYQA 2B2NA 1QCYA 1V25A 3OQVA 1D7AA 4B4UA 5HNKA 1KDYA 4F91B 1ZSNA 2LRHA 3WYCA 3Q85A 4M55A 3SFTA 2Y0CA 3KSUA 3L92A 1SCQA 1DIBA 4RTOA 4LYJA 2B37A 4E2FA 3T54A 1J8FA 4IZOA 1VMDA 1AQ6A 1J49A 3LUJA 3I4FA 3QFHA 1O94A 2FMIA 3RTBA 2IQ5A 1BZYA 1PUXA 1SVKA 3GJ3A 2EBFX 3SY8A 1BDMA 5CW2A 2IHUA 2G6BA 4M1WA 4REOA 1RW4A 5KNBD 3WLLA 5TSDA 2Q49A 3PDJA 2CLIB 2IWRA 3OIFA 4MDYA 1DUIA 4LGVA 2HK7A 2VDWB 4H6XA 5LC1A 1RBQA 2IEAA 4PZLA 3LUCA 4RAOA 3ZTTA 4PRLA 3MGGA 5A2QA 4EUNA 1Y1RA 3R3SA 3VPGA 3EX7C 5B2FA 4HXYA 1V1RB 1KOLA 1YQWA 1IDOA 1EFVA 4PSKA 4BQIA 2BKUA 3KQTA 3O3MB 2JZNA 2A0KA 2OV6A 4CF5A 5JEEA 4OA5A 4N12A 1ISMA 2I1QA 3OX3A 1T6YA 4YMVA 3AHEA 4JGBA 4MS4A 2RGAA 5AKIA 3WR5A 2REQB 4Z51A 5GVSA 3TG8A 1YKFA 4CF4A 3CLUC 4DDVA 1NVVR 1TK9A 4DSZA 4ENSA 4N0MA 4BZWA 1L5QA 4D3DA 2E6KA 2QAGA 2ZI9A 3DKPA 3GFTA 2CGEA 2VH1A 1WXWA 3QE0A 4J75A 1ONSA 4CUZA 4ZYXA 1J2TA 2Y27A 4RELA 3GELA 3G9XA 3A4VA 4ZGBA 1AUPA 1X8LA 2XWSA 4RDIA 1CUSA 1RWOA 2QX4A 3I39X 1IM8A 3ZIAD 2VDMB 1FE8A 2CXNA 3EHDA 4I50A 2EDCA 2HU8A 1YZKA 3T3EA 1DNPA 3TD9A 2C5EA 2B1QA 3P9PA 4DMLA 3DTVB 2C54A 1CNFA 1NJ8A 2EZ4A 2P0AA 3MMZA 2Y66A 4GD3Q 4NMLA 4XR9A 5EKDA 5LBUA 1Q20A 3PFNA 1NI3A 2FR0A 2QRNA 5BRNA 4IPTA 1JG7A 1TECE 4KN5A 5B4VA 1MN6A 1QXSA 4Z2YA 1H6DA 1STOA 1UPTA 4MGZR 4M2LA 1YBAA 5BW8A 4CEHA 4ITVA 2GF9A 2RFLA 3AI1A 3LXMA 4YAOA 2XB8A 3WVNA 2EX0A 1IWBB 3GFGA 5AJWA 1R9NA 3UOWA 5KYTA 5IW8A 4OQYA 1YS2X 1SVSA 2ZSBA 2G1JA 3GV0A 1R88A 1LQUA 2G36A 1U0HC 3STYA 2AE1A 1C2TA 1QS0B 5EMMA 3VI4B 3ZN2A 2BGWA 2YW2A 1KJ8A 1PF7E 4CM8A 2VK4A 3A26A 3ZKWB 1RTTA 2PWPA 4GP6A 4HAVA 1TTPB 1EEXB 4UAGA 4XJXA 2WIGA 4G5RA 1RKUA 1EX1A 1YR2A 4V0KA 3KT6A 1ZLXA 2RHWA 3C6YA 4FXPA 3WWOA 3O26A 1XC7A 4G0PA 4MI6A 1LJLA 3FZGA 1T3LA 5DSXA 3DYIA 3IXQA 5TPZD 1EK1A 1RYDA 2XTMA 2HU2A 3BWXA 3RRNA 4D0GA 8ATCA 3NNDA 1P1KA 1FQKA 2PYZA 2X5OA 4DWJA 1C30B 4U0JA 3ND7A 4Q1FA 1GSAA 2GB4A 4RK0A 4RZXA 3QPAA 2ARKA 3F1LA 4RVSA 3ZHRA 4CL8A 2F8MA 2JFYA 1QG0A 3WNDA 2ZIFA 2AC4A 1IHXA 1VLQA 4M87A 2ORWA 2XGJA 1SAYA 4RXMA 1WEHA 3AHDA 4EPYA 5JUWA 2QD2A 2DUNA 1G19A 2AFIB 2M2IA 3FW1A 3H83A 3MXOA 4PGHA 4XYEA 4DPKA 1EWVA 2D4AA 3V4ZA 4U7DA 1L4NA 3TPZA 4DG5A 3ETHA 2ZJ2A 3OEHA 4MUFA 4LSGA 4Q3AA 1WWKA 3VQTA 4HQFA 1H6CA 1TYBE 4NL4H 1E5VA 3IUPA 1UL1X 2VZ8A 1H66A 3QWAA 1OYOA 4A4DA 1AE1A 4OHRA 4ZI7A 4NECA 4Q15A 1ZRSA 4ZA2A 5LQAA 1CRWG 4P5PA 1JFSA 1AQYA 1QP4A 3ZWNA 5JS1A 4WPGA 1KJJA 2CHFA 4NJOA 2ZUWA 1KFCB 1EE9A 4G41A 5DYTA 1JZSA 2BGUA 3FKJA 2TMYA 4WLOA 3FAKA 5DI3A 2ODAA 1EXWA 1T26A 1BHO1 1DKUA 4BKRA 4QHYA 2JI8A 1KGSA 3F3MA 3CVXA 3EF3A 3EWSA 3R0VA 4RKWA 1MA3A 1MRNA 1A27A 1K6JA 1RJ9B 1GYPA 1YIOA 2FX5A 2Z30A 3IELA 3U40A 2Q9AA 4BMOB 4EKIA 3E15A 1YBVA 5HGJA 2QM3A 5ALNA 4CUJA 4IDBA 4W6QA 4B80A 4HUTA 1N3IA 4B81A 3BF8A 2YJGA 3HI6A 3QZUA 1RQ7A 3ZDDA 4UM5A 3B60A 5CPFA 5ELLA 3UAXA 4G5QA 3CVUA 1VA5A 3FBTA 1GGMA 3GT7A 4OPMA 5LB4A 1U31A 4KZPA 3EXEA 4A0GA 4ENRA 4L07A 1YZTA 4U63A 4YRAA 3AP1A 3C43A 3B7WA 4WFKA 3A4MA 1C1HA 3PSHA 1JHPA 4B7XA 3VYVA 4E33A 4BQEA 4CYMA 1IXYA 1PVOA 3H1FA 3GPBA 1G17A 3S8YA 1HX7A 2C8VA 3R9KA 3ZTWA 4F21A 1AHPA 4C7OB 3I52A 4I5FA 4JI5B 1G20E 4UTXA 3T06B 2FFAA 2WU0A 1L4LA 2AZDA 4HI0E 1A4UA 5KYUA 1E9FA 1E3IA 1FUEA 1U9JA 3FSGD 3HGQA 4ZVOA 3T5DA 5L8VA 5L7WA 1I2AA 4LV8B 2NO6A 5A7FA 2JFOA 4QO7A 2D1FA 3EASA 2VBIA 2UUBB 1UKBA 1VRWA 4HGQA 4MX8A 3RS0A 5JISA 4CMEC 1H2RS 5D6OA 1HDZA 5CEEA 4FFLA 3PGXA 1SO8A 4LFAB 2C1EA 3UOGA 3C48A 1BWSA 1GN9A 4P54A 3SJBA 4YP6A 2O57A 2W90A 1N1DA 3AL2A 4LQLA 4M8IA 4RGVA 4JT4A 4FBLA 4AY2A 3LZ6A 4EEZA 2FWPA 4JB3A 1OW3B 2WF5A 1GR0A 2QLLA 4ITRC 5THKA 1Z36A 2FSIA 4EZBA 4X7RA 1Q7TA 4GEGA 4UQLA 1AZWA 3FBGA 3GNTA 2JH3A 3A1UA 4QYMA 5IZCC 2BR4A 1W47A 5PNTA 4HT3B 5JFGA 4XVHA 3DAYA 4EYEA 2WSSD 4LY6A 4MYHA 1PW7A 3T9FA 5TPWA 3TTWA 4A03A 2FRXA 4OHVA 4AVYA 5A6SA 2DHRA 2PE5A 1V6AA 4X8LA 821PA 2PX6A 1Q0LA 3E05A 1ACJA 2P9FA 1KQGA 4LXIA 3DE5X 4C4ZA 4B3MB 3JSXA 1G9SA 3R24A 3LA8A 2QVLA 4YB8A 3ORQA 4FOPA 3KXIA 3RHTA 4DQ0A 2HREA 3ZZ1A 3PXUA 3N2EA 2H1RA 1A4RA 2WUWE 5CBPB 3LPNA 2AXEA 4R98A 3LY5A 4DMCA 2FGKA 2H5EA 5E3JA 4KWCA 3PPXA 4TT8A 1O9HA 4LF8B 1X7XA 4Q21A 2HRRA 3JVIA 2QZSA 3V8PA 1E2DA 3HU3A 4DR2B 3TMKA 5BW4A 4BNJA 4HD8A 3JZAA 2KB0A 3T99A 3I01M 4D9FA 4A7PA 4CTOA 2AK2A 1ZHFA 1DKQA 2XYRA 4ESEA 3OSUA 1WUJS 1EXNA 2VJYA 4MV9A 5D5QA 3SYLA 3RS9A 4GGOA 2C5HA 3MTGA 4LF6B 1YCGA 1Z0SA 2HMAA 3NEPX 2FUKA 1Z7GA 1WZNA 3UMMA 1VYVA 4P36A 3MQ4A 2CCKA 5E6SB 3QE4A 2C4WA 4KSYA 4O2LA 2ZULA 2PRZA 2YZKA 4NOLA 4YCJA 3UEOA 3W77A 1U7WA 1II8A 4U2FA 3GA7A 4FD2A 1GAXA 4B3RB 1Q15A 1ZO8A 2OBBA 4JL5A 4B32A 2ZIXB 1OASA 5JCZA 1ISHA 4JT9A 4Q7LA 3E9ZA 3E58A 5EJ5A 5HTKA 3A28A 4K3VA 4HDKA 1QHXA 2HKIA 3IMKA 4P3PA 4F3RA 1Q0PA 3NRCA 2IWHA 5E2BA 1ICEA 2PH3A 3VR6H 2CXTA 1U2QA 3ORSA 4YJFB 2VN8A 4JB0A 2DP4E 3URMA 4DCGA 2E4VA 3HR8A 3TINA 1SZDA 3JWEA 3ZZ0A 3HVIA 3QEAZ 4LHEA 4DRYA 1EXVA 2B2CA 1SQFA 4BATA 1UMDA 3PFGA 1AZTA 4AYWA 1GG5A 2A1IA 1IJFA 3E03A 4IDDA 1TM4E 4ND4A 3ZDQA 1BOOA 1MXHA 2G09A 1HFWA 2ZSFA 1T0HB 3AZQA 3PD0A 1JQ5A 4JVNA 3EDOA 3DDNA 5CMLA 3NXKA 4DQKA 3TOSA 5DW0A 3RYTC 4AJ4A 3HB5X 2O2ZA 1D7OA 2VHZA 3KPVA 2C5AA 4MPDA 4WECA 3ETJA 3KT3A 3T3DA 3AUFA 4LISA 4DUPA 5AHXA 2AXPA 1HDXA 1XPUA 1FYFA 3TW8B 2GS9A 3N6RA 2I67A 4HX2A 3NVKI 1PN3A 3I9V1 3F9CA 3EGOA 1EUDA 2XPCA 2WYIA 3EXIB 2C07A 2DE0X 4I81A 3K1JA 3ROPA 5CTJA 4XQ9A 4ZVKA 3FOWA 3RC2A 1W36D 3LBHA 2R79A 4KG7A 4ED9A 2NU6A 4XRGA 3O8RA 2W6IA 1LLFA 2FJUA 2EX1A 2ERXA