3I34X

Proteinase k by lb nanotemplate method after high x-ray dose on id14-2 beamline at esrf
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Radiation damage study of Proteinase K at ID14-2 beamline at ESRF
rcsb
molecule tags Hydrolase
total genus 99
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3i34X00
4KPGA 1KE2A 2WWTA 3PRKE 3DE6X 4DWWA 3TI9A 1SBNE 1OYOA 1Y1KE 3EDYA 1Q5PA 1WSDA 1T1EA 1SIBE 3WQBA 4ZOQI 1CSEE 2PKCA 1Y34E 3H42B 3DE2X 3CNQS 2WUVA 3F7MA 1IAVA 1AQNA 1Y3FE 2Z57A 1AF4A 4WOBA 4JP8A 1OT5A 4NMXB 2X8JA 2WUWE 3F49S 1TECE 5ARDA 3VYVA 3HJRA 5FBZA 2Z30A 1Y33E 1SUCA 2B6NA 1GTL1 3DDZX 1PTKA 1HT3A 3PTLA 3LPAA 1Y3DE 1CNMA 5B1DA 3Q5GA 5SICE 1S01A 1UBNA 4CG0A 1WMFA 5ARCA 1Y9ZA 3A3PA 2SBTA 3ZXXA 2W2MA 5I9SA 1AK9A 3DE5X 3GCWA 1Y4DE 5B1EA 4MZDA 3AFGA 1SPBS 4H6VA 3CO0S 4YN3A 1YJBA 1GA6A 1TK2A 3VSBA 1YU6A 2W2NA 4J94A 1NDUA 1PEKE 3D9QX 1Y4AE 3VHQA 1AU9A 4AKTA 1JEAA 1TM3E 1S2NA 2Z2XA 1SBHA 4GI3A 2Z2YA 1SBCA 2ZRQA 1EGQA 2PWBA 3QMPA 3GT3A 2Z58A 4WOCA 4CFZA 2Z56A 2Z2ZA 1GCIA 1LW6E 1DUIA 3DWEX 1MEEA 3DE0X 5JXHA 1SELA 3D43A 1GTG1 3F7OA 5CW1A 1BE8A 4Z2AA 1S02A 3I37X 3I34X 3WIVA 1TM4E 3QTLA 4C3UA 1BFKA 3EIFA 2TECE 2W2QA 3DVRX 4I0WB 1SUAA 4FONA 1SUDA 1P7VA 3GT4A 2IXTA 4B5LA 1SCAA 1TM5E 5JXGA 3DYBA 1SN7A 4OV6B 2IY9A 3I2YX 1SCDA 1Y48E 1SUBA 4OMDA 1TM1E 1C9JA 1KDZA 2XTJA 2X8JB 5FAXA 1KDYA 3P5BA 1V5IA 5JXJA 1Y3BE 1GNVA 1BJRE 2PQ2A 4HVLA 2ZWOA 2PMWB 5AVJA 1R6VA 1T1IA 1IC6A 1WVMA 1GTJ1 1C9MA 1P7WA 1SUPA 1SUEA 1R0RE 4NE9A 2GKOA 1NLUA 3Q40A 3TI7A 1SBIA 2SICE 3DW3X 3BPSA 2V8BA 2HD4A 1P8JA 3TECE 1PFGA 2WV7A 3GCXA 4NE7A 2XRMA 5JXIA 3SICE 1TM7E 3BX1A 3DVSX 2DQKA 5ARBA 4CFYA 2HPZA 1EA7A 1C9NA 1VSBA 2G4VA 1XF1A 1SH7A 1AH2A 4DZTA 2QTWB 2DP4E 3L1KA 4KB5A 3VV3A 1GA4A 1ST3A 1C3LA 1ST2A 3EE6A 1THMA 1ZVJA 2W2PA 3DE7X 2DUJA 1A2QA 3WHIA 4K8RB 5JMOA 2P4EA 1SIUA 4H6WA 3A3NA 1T1GA 1OYVA 5AVKA 2PRKA 2ZWPA 4LVOA 3AJ8A 4RYDA 1ZVKA 4DJ5X 1PJ8A 1SCBA 2SNIE 4C3VA 3DW1X 2PYZA 1GT91 3LXUX 1NDQA 1GA1A 3DVQX 3I30X 3VV2A 1AVTA 1BFUA 1BE6A 3AJ9A 1SVNA 1YJCA 1R64A 4LVNA 2ID8A 2ST1A 1GNSA 1TMGE 3LPDA 3A3OA 4OMCA 3WIUA 3DE1X 1V6CA 1SIOA 1SBTA 3VTAA 1TO1E 1TO2E 3DE3X 2ID4A 4BWGA 1AV7A 3UNXA 1SCNE 1BH6A 2PWAA 4H6XA 2E1PA 3DE4X 4ZARA 1SCJA 1MPTA 1KDVA 1KE1A 5K7SA 4AKSA 3T41A 1WMDA 3OSZA 1DBIA 3BGOS 2W2OA 2SECE 3SQOA 5AQEA 1YJAA 4HX2A 1Y3CE 3LPCA 1WMEA 3ZXYA 3QFHA 4KG7A 4M1ZA 5FFNA 5AMXA
chains in the Genus database with same CATH superfamily
1ZOPA 2CHFA 1JUDA 3EGIA 4DSUA 1N2GA 1GU0A 3JX9A 4QJBA 1S2LA 3BDIA 2R25B 2EX0A 1A7UA 1EFVB 2QD1A 3GJ8A 1A9ZA 2JEZA 1TL7C 3PT5A 1P1HA 3CM0A 3F9RA 3L7OA 5SYMA 4EK9A 2HNAA 1X7XA 3PFCA 2NZWA 3EHDA 4MWGA 5K8TA 1WD5A 2AN1A 3IQZA 3VSEA 4ZGWA 1KPGA 3GJ6A 5J2TB 2P9FA 4QSHA 3HA2A 1CR2A 1N6IA 1MC5A 2OCKA 2ZKIA 5EE1A 1RIFA 4OJYA 2CDCA 3G5MA 5AK6A 2W11A 3LCMA 1W2WB 5C1BA 1ZUWA 3FDZA 1XKTA 1Z5PA 3H5VA 2AEJA 2CXUA 2O7NA 3K4QA 3EGDB 4G86A 5KNDH 2QVYX 2VWHA 4QTUB 1P4RA 4PLHA 4F92B 4BQSA 5DGDA 3SSMA 1CS0B 4OJKA 3HVKA 3I6BA 3II6X 1PV2A 5CJJA 1KOJA 1ORIA 1CUCA 5C80A 4LZOA 5LXTB 3O95A 1YIOA 3CIOA 1I3OA 5D3MB 3CNQS 3I6QA 3QTTA 5EQTA 4I4TA 5G0TA 4BX0A 5F7OA 2AG1A 4U00A 5EPUA 2ZSDA 1IAVA 3JAMA 2L17A 1QLWA 5CT8A 1F0KA 2QP9X 1FYFA 2I7XA 2XX3A 4C9BA 3F3SA 1JDJA 3LX4A 1GAQA 1N1MA 4QUHA 5COAA 4IDAA 4JI3B 4RVSA 5TPWB 3LCJA 4B2LA 5FTMA 4YAIA 2NN3C 1FS6A 1MRZA 3N2KB 4JP8A 5EJ6A 3FTNA 2ZB7A 2B34A 3SYRA 2X8JA 2QV7A 3ZU4A 4E46A 2IL1A 1FYDA 1GNLA 2VO1A 4IVQA 3CVUA 4M9ZA 1JI0A 1I4LD 3BXEA 4INZA 5FFFA 3CT6A 3WMXA 4BBZA 1X9HA 3U4QB 4KPUB 5ARDA 3VVCA 4A36A 3W6ZA 4AECA 1V3QE 1QFYA 2V45A 1Y33E 2XVAA 5CX1B 3EF3A 3EGVA 3U7RA 4IJWA 2Q3DA 3WK4A 1V4NA 1JZSA 3MILA 3C6QA 3A7DA 3H2SA 4C0HA 2H7VA 3QELA 1UBSB 1YRLA 3OLXA 4HWPA 4UARA 1QIDA 3AIKA 4RVGA 2A92A 3UAZA 4DQUA 3RC7A 3LPAA 4YI5A 3PQ2A 1T8RA 5CLFA 1B26A 1P5FA 1RC0A 1T5LA 3DGFC 1B0UA 5HIJA 3T54A 3TJMA 4FZVA 1N6RA 1KPIA 1UC9A 1E3WB 1RQPA 4MV5A 2QL9A 4ZT6A 5HGXA 3M6WA 2Y6VA 3AVYA 1J00A 1GYRA 2H92A 3NBZC 1G17A 1EUDA 2N75A 3IBTA 3UJCA 9ABPA 3HWSA 3KEMA 2FX2A 1MTZA 2VDWB 4HPXB 4JDUA 4JBXA 4I8IA 4KH0A 5DLQC 3X1ZA 3ZXXA 2ZU6A 3V2HA 4Z7NB 3DP9A 3WLNA 5TLSA 1HH4A 4GP7A 4FFWA 2IY7A 2RH9B 3LLVA 2ODBA 4G25A 4KN6A 1JSXA 1V5FA 1WNTA 1VHLA 2IODA 5CVEA 4BGIA 3M5PA 1E6LA 3PBKA 1PWEA 4RC9A 4ZXFA 4XQCA 4ZAGA 3SX2A 1ONNA 2ODTX 3IJPA 4F3TA 3OQPA 3V7YA 1I3NA 1P8AA 2J6BA 2JH3A 2OO5C 4UNSA 4EZIA 2OLJA 3KETA 1SOVA 4ND6A 5IUKC 4ZZ3A 1HDEA 3HYTA 2VT6A 4UAJA 4DJJA 2ONKA 5IVIA 3K2QA 2XLBA 4PX2A 5PNTA 1OBCA 4U7HA 1XKLA 5A4IS 4DV4B 2ZR0A 3B5IA 1W5BA 4Y0AA 1QKJA 2HLNA 1P39A 1XYYA 4DAOA 2PSHA 2V6FA 3UB3A 3HVRA 1BKDR 1Y4AE 1ZJZA 2DFLA 1CY0A 3INYA 4P4UA 3ZV7A 1AU9A 2CLKB 4QPNA 3ZHCA 1YDFA 5EZSA 4JIGA 3TAUA 3RYHB 3RTEA 1VZ2A 3EPKA 3RAJA 3I0NA 3IP7A 4JHXA 2UYQA 1GIAA 1KJZA 3KXPA 4LOAA 4BHTA 1ID1A 1XN4A 2VP5A 5KJEA 1GZ6A 1K98A 1U1DA 3ZVRA 1ISHA 4EATA 3VO1A 6GPBA 5MN6A 2PRZA 4HDAA 4H1HA 4AJ1A 4CI9A 2H48A 4WFQA 2PZBA 3RFCA 3CLUD 4BJ6A 4DMHA 5DTQA 3SYNA 2ZTMA 3LA8A 3N2LA 1NONA 4UHCA 3R7BA 3FZNA 3GJQA 1W2HA 3QJGA 4MTCA 4X41A 3ZV5A 3B5JA 2J9FB 4CM6A 4CKYA 5J4YA 3LT2A 3GT3A 3QKTA 2HNBA 5HF9A 4QBTA 3TNJA 3LXRA 3K09A 1F2VA 1JU4A 2GZRA 3H6GA 4HXEB 4AM8A 4OF4A 5J4LA 4R69A 4CFZA 3IGFA 4L75A 4NU5A 4BNKA 4EY3A 4EUHA 2Y0CA 3HUFA 1LKZA 3QBTA 5TXGA 1I2AA 5K03A 3ZIAD 2GKSA 3S7ZA 5DNYB 4G24A 3JS5A 2QAGB 3HDJA 3EUFA 2JD1A 3TLCA 1ZZGA 3OZEA 2R8PA 5JS2A 3VZCA 1GAXA 2EJBA 3CNHA 1Y5RA 3H5IA 3T9FA 4TZ0A 4C08A 2BE7A 2XQVA 1YMQA 1JHMA 3C5CA 4LHXA 3MTDA 3U7QB 3NGLA 2J3EA 1W19A 2GZHA 3GK3A 4K81B 1KORA 2VDVE 2NUAB 4R2JA 5SY4A 3T9EA 3URKA 3CVVA 5EJ2A 3I39X 1M0WA 1XD2B 3I72A 4ME6A 4YJHA 4HWRA 3B38A 3S2UA 5L3ZA 2ZU0C 4MR7A 3RS0A 1J39A 2HUNA 3GAMA 4TV9A 4D9FA 1FUIA 1P7VA 4G0MA 2E82A 3LNCA 3T0FA 1I2CA 1JLMA 1R0CA 2GK6A 4FFNA 3UB2A 3QFSA 2YVQA 1HYHA 4KBFA 3H5NA 3C3MA 3CZRA 4QE3A 4HRYA 3O3MB 1EVZA 3OZFA 4DM7A 4EYGA 3ZIDA 4E2YA 2ODPA 3AI1A 3HFJA 3I1JA 4I1SA 4F8YA 1G8PA 2JFZA 2O8FA 4ZO4A 4KNWA 2HPVA 2TMDA 4HGOA 2OOKA 4UEOA 2XMDA 3GG2A 4WA7A 3BTSA 5GY7A 3W34A 1PL0A 1PZHA 3CZ9A 5EXSA 4IXNA 1S2IA 4E5VA 2UDPA 5LQUA 2VAPA 5DIFA 5GV7A 2C82A 1NG9A 1YRHA 2TSYB 4RESA 4JBHA 1M8GA 1OBHA 4JI5B 4EVIA 1KDYA 4C0BA 3K6KA 1Y4SA 3D54D 4FYIA 1FY2A 1NATA 1ZD1A 1AZWA 2EXXA 4WKPA 3L6BA 1B8OA 1EKXA 2D0OB 2NO6A 3F9CA 3OZSA 4G1CA 4LSGA 1UXIA 4FMCB 4BE9A 4I8DA 1O4VA 3P2YA 3QJYA 1NI4B 2QYHA 2O2HA 2YZ2A 4DOMA 2PAFA 1G60A 2GNOA 2IYSA 1WZUA 2NIPA 3SBXA 1L5WA 2HIHA 4WE3A 4ZGGA 4PTYA 1NDHA 3BE4A 3GFRA 1KC3A 4PHFA 4TLCA 1K6EA 2PZEA 1KIAA 1I8TA 5IG2A 2ZT8A 2UYHA 1D04A 2QJTA 1O77A 3KKNA 3WGHA 4OY3A 2CUNA 2X7HA 3HGMA 4HB3A 2RIPA 4D43A 1GTJ1 3JWHA 3WGJA 3RVKA 4DYDA 2J0QA 3HCDA 4C7MA 1XVLA 4PPYA 3C3BA 4YPVA 1NLUA 2FOXA 4HP8A 4F6CA 2GHIA 4W5JA 2Y4OA 3Q10A 4GT1A 1P75A 1SBIA 1T9ZA 2FZWA 2MR5A 4LYHA 4MOWA 3TQOA 1LVUA 4D4GA 4FFSA 3GHYA 4P4TA 4OD0A 2RHLA 1AQ6A 4MQ6A 5E38A 2QENA 4UTRA 5AUPB 4PZUA 3PGKA 1DMSA 4MK4A 3SGLA 4MS3A 2R8OA 5EIWA 5C8VA 2WIBA 3EXAA 4P38A 2GZ2A 1IUNA 2ZGVA 1PL8A 1J4AA 4MO2A 1H1TA 1XKQA 1X1EA 1YL5A 3ZWXA 3NBXX 1WU8A 3KQYA 4X1KA 3GCXA 3FPSA 4GHWA 4NKRA 3P9SA 4J7AA 2INGX 3AY7A 3MEQA 3C1AA 4LGYA 5JXIA 4XFKA 1H0KA 4ZQHA 1EP3B 2PX6A 2XRYA 2PZJA 1NQVA 1O54A 1JWAB 4BMOB 1P2SA 4UAGA 4FBMA 4G4GA 2PMKA 2PFGA 1XRPA 3CZQA 4EL0A 2DMRA 3ACBA 3FR8A 3S99A 3VMMA 1XA4A 3F97A 1I51A 3B89A 3HFRA 1M8KA 1E79A 4N18A 4R9VA 5KSZA 4XUCA 1C9YA 1TZCA 1W0JA 2O2XA 4K0KB 3VUEA 3IKLA 2EIHA 3PHJA 2AOTB 5A5GA 2CD7A 3DF9A 4YUZA 2GD0A 3S2SA 3W9SA 3O9MA 4R8LA 1ZH2A 3PLNA 5BY2A 2NM0A 3SVLA 4BQOA 1E9SA 4V2UA 2AH5A 4KACA 4TKMA 3Q8WA 3MHTA 2UZ0A 3ZDXB 1E2PA 1N0HA 1L5FA 1EB8A 3FH0A 3L1KA 4NENA 4CKWA 1I0ZA 3NOOA 2XODA 2B4YA 2H1LA 1E18A 4R8SA 1PV1A 4I5GA 5ILOA 3BH6A 2F8MA 3AEQA 1M0SA 1QX3A 1ZGJA 2H6EA 3LKDA 3N8NA 3NRBA 3P0IA 3PD0A 4M1MA 1BTOA 3GP3A 3RVRA 1DIHA 2WSYB 2Q62A 3UGJA 1JVSA 1L4MA 3GIDA 1YTUA 1M0TA 1IUKA 1SB8A 1EFRA 2BFMA 4ZTBA 3RWMB 2HU8A 4QOEA 2VRCD 2XA2A 1OX4A 3LQ2A 2GCEA 3NHJA 3DV9A 4B1FA 3RVLA 1YRAA 1CETA 3VR1A 4Q1EA 3C74A 5C8YB 1Z5NA 4A16A 2FN3A 1RADA 3MS2A 4C06A 5KJ1A 4W5QA 4ZMBA 2UU9B 1MXFA 3AVPA 2D2EA 4XEUA 1T4BA 3WKDA 4JYZA 3RAFC 1T1GA 1T3GA 2DWCA 2X4GA 1X77A 3TQIA 5KWVA 2ORED 1E0JA 3KD2A 5C32A 1RQXA 4LE2A 3N0TA 2IW1A 3U3DA 1ML4A 3Q7EA 3AF0A 3H86A 4D8XA 1RCTE 2ZSBA 4KR9A 4YMVA 3UMYA 2GFHA 5HJ7A 4YRLA 1DIBA 1WHTA 2Q6IA 3OY7A 4CMKA 1NBIA 1N25A 4PAWA 4R41A 2F43B 4YGXB 5IJAA 1B8UA 2JCXA 2ZWAA 4NV1A 5J58A 1QQ7A 1XWFA 3GRZA 5JY1A 4E7OA 3MUEA 2R1VA 3GGOA 1BGVA 3K9QO 3GBPA 1VJDA 3HCWA 2VF7A 4MWOA 4NCAA 1NBWB 1N5RA 3C7AA 1F17A 4B80A 3E2PA 4YJ3A 5KNBD 4ADSG 1GQRA 4I4TF 4L22A 2F67A 2XY4A 4R05A 4PZCA 1N5DA 1YOBA 2PKYX 3L84A 2JPDA 1X1SA 2Y05A 3G88A 3PE4A 1Q3TA 1YBFA 1EK5A 1DC3A 2OCLA 4IF6A 1UXKA 4KQ1A 3OJEA 2CW5A 5PGMA 1AA6A 1KYVA 2M1ZA 4LRSB 2RD2A 5CJ2A 1GGMA 2DPGA 3B7GA 1U6KA 3ROQA 3R0IA 4JKYA 1A8QA 1OFUX 4WZ6A 2HXYA 1Z08A 2F3UA 1OQAA 4W63A 3NVAA 1F8YA 2VHZA 4K40A 3V4SA 1RBZA 3W2EA 2ZBUA 1CJTC 2P6PA 4NYIR 1JFRA 4FX2A 4DC1A 3HB4X 1WHSB 3D8RA 5T3YA 3EJWA 5CH8A 3W6OA 1G1MA 4EFDA 5LQJA 4F7WA 4L9SA 4ZDIA 3G68A 1SXQA 3T1NA 1ZO8A 2QTTA 3L1VA 1V5WA 1S96A 1WP4A 1VIAA 2WMYA 3EIUA 3FVWA 3L41A 3O3OB 1TO2E 4HYTA 5CT5A 4IZIA 5DHQA 4DEYA 3NM6B 2J0UA 3QRWA 1C81A 2Q5IA 5LMZA 1HYEA 3G9UA 2G8NA 2QDKA 3EEBA 2H0RA 1ISSA 3THWB 1JFFB 4HH4A 2RHMA 2RI1A 4IRMA 4IOLA 1L6RA 3CG0A 3VBEA 3JQ7A 3CS3A 4DLAA 4ZCMA 1ODIA 3RVPA 3NORA 4TQ9A 1LRLA 1BMDA 3ILVA 2CFIA 2I7DA 3M5WA 1WV1A 1R9NA 2G82A 3PD7A 4TMZA 4ER5A 1HFEL 1NNI1 2ZVDA 1H23A 1OFGA 1VGQA 5E6UB 2VJNA 3C7DB 4KJZA 1WABA 5FOSA 2AW3A 2AI3A 1V7PC 1PNOA 3LKBA 3OEHA 4Q4AB 4RS3A 3IDSA 3RBAA 5I7VA 2GJ8A 4KFCA 2YJZA 3K1AB 1U9IA 4EYOA 1PQ4A 1TMKA 5CEEA 2AZDA 1KU6A 5AW2A 1C3OB 1WS6A 2P2ZA 1DBIA 3E61A 2PGNA 2W2XA 2IQIA 2YZ7A 1EX7A 1EFTA 1I80A 1TZBA 1RE1A 2PGDA 2WSMA 4OFWA 5JSKA 4ETIA 2DRIA 1NUHA 2OV4A 3SQOA 2RCYA 2ZTLA 5L95A 2RH5A 2ZJZA 3PC7A 2AI2A 2NZ8A 5A0TA 4QGBA 2G5CA 3QJ5A 4NG5A 2OP0A 1G5QA 1JDVA 3OIVA 1ZPDA 4WW0A 4Y7DA 1P2BA 3WJ2A 4BC0A 2E48A 3GZTB 5JJ5A 4Y9SA 3DQQA 3UA3A 4YFYA 3AETA 4X44A 3U40A 1EX1A 1WKVA 2PRJA 2GM5A 3T4XA 4BLVA 4JEUA 5AI5A 1JG2A 2JHCA 3VU3A 1Y42X 3CQ9A 4LMPA 2CLOB 4P3YA 5K2MA 1XVUA 1C7QA 4QEKA 3SNKA 1V9LA 4YUAA 3G17A 4DAEA 4E6PA 3KJNA 3LOPA 1AHIA 4BC1A 2Z5VA 2G9ZA 4LF9B 2NXCA 4LXIA 1MPXA 2AUMA 2PFSA 3F71A 1F14A 3UUGA 2QF7A 3AVOA 3Q41A 1IU9A 3GARA 4BOYA 1VL8A 1BEZA 2A86A 5IH7A 1SXJB 4J0GA 4FGJA 5I7OA 2G09A 1UXJA 2GM3A 4I9NA 5KTRA 3ZNPA 4BZPA 2WFAA 1RQ2A 2PS3A 4P3XA 2VAVA 4US0R 2MCFA 2MYNA 4IIBA 2QIPA 4Z7JA 3GLHB 3ZZ0A 5LQDA 3RAEC 3ZKWB 3SIRA 1H65A 4LV6A 3OEEA 4YRZA 4Q24A 3D7SA 3KSDO 5LDHA 4S04A 4JI2B 1B00A 1C4KA 3C43A 3MJEA 4L73A 4N4AA 3W5IA 4RHUA 4PHTA 1QSGA 2NU6B 1D2EA 4XDZA 1Q91A 2Y4NA 1P0CA 3O26A 1GRQA 3IDZA 4PLCA 3DAOA 3N74A 5I9MA 5LP6C 4ZEMA 4RY2A 3ZD8A 4G1FA 2FDCA 4CQLB 2GVZC 4BO0A 1E2FA 4KYTA 3I9OA 4ZOLF 4WRRA 2Q8PA 2VRNA 3SQWA 2YV4A 5IYZF 1KFBB 4B2YA 3H5LA 4DCOA 1JQEA 3L4KA 5LZ4A 1XB2A 2M32A 3AHFA 4GOND 2GAIA 2WA1A 1HE1C 3ADDA 1JEQA 2MYPA 4TV9F 3ZW8A 3PLAE 2W71A 3D7LA 2C7VA 3D5QA 2QVXX 5I7FA 1TCAA 1K7SN 2A67A 2H1CA 5KAPA 3NEAA 1ZQ9A 3UENA 1FRQA 1YL7A 1Q1EA 3FROA 4N0EA 3UYKA 4BL5A 3L1HA 1YV9A 3RIEA 1XQYA 4S12A 1F3OA 2VUUA 4URFA 4LYAA 4UW9A 3FCOA 4G85A 1O95A 3Q3JB 3RROA 3P9YA 4FB4A 2V0GA 2WU4A 4PYLA 1LVGA 1RDFA 3P2JA 1V7CA 4LYJA 3PFGA 2V6IA 1DWPA 4QVIA 5TIIA 4CTKA 2QTHA 1B2RA 4YO8A 4M7PA 5EMMA 2CB9A 1BCSA 1U02A 3HJGA 3KRTA 3U3XA 4RXMA 1KP9A 3TLYA 4IUBS 4NS4A 1GYPA 1EHIA 3JWGA 5D3QA 3T52A 1CNMA 2CCJA 3A7EA 4DSAA 5BW4A 3C24A 4JFRA 1PUJA 1BXRA 3A4LA 4LJAA 4CU2A 2NT3A 1BH2A 4NXNB 1J8YF 4MLZA 1OY1A 2WWGA 2Y1KA 3FI0A 4R9RA 4GU5A 3AF5A 1BO6A 2A3RA 2BZGA 2L2QA 3A25A 3HKDB 3LOUA 3OTWA 2XGOA 4MJ3A 3HO6A 4HB2A 2OPHA 2JG3A 5ARCA 1IHDA 5D5QA 1O2DA 2W6IA 1NQXA 1L9KA 3JWPA 3ZQ6A 3S2YA 5IAAA 1RI3A 5FA6A 3I05A 4JL5A 2JGRA 2O0MA 3O0TA 4J0DA 1EBFA 4FDVA 4L78A 1ZICA 3H4TA 3N2GB 2B5OA 2AOUB 2X0RA 1OV4A 3GY0A 5F5LA 4CIYA 4MAAA 4M0FA 4N0QA 4PZEA 1HZZC 3SF8A 1WCV1 4OH1A 2G83A 1JG6A 3NLLA 5FYDA 1N8SA 2DKNA 4ND5A 2PBRA 1OMOA 5E4FA 5FTWA 3EVEA 3NOQA 2AOVA 1I6LA 3OBIA 4GFDA 4RJKA 5FUBA 5JS7A 2ODQA 2WJVA 3QFFA 3QNUA 4FKZA 4JKIA 3VSBA 5IPFA 4O4HB 3DEKA 3UAXA 4WACA 1NQWA 4Z99A 1EP2B 4RV4A 5ELMA 3U44B 3JATB 1CZUA 2WFLB 4ND7A 4EA7A 1KOFA 4I55B 2ZJ1A 3Q12A 4KXNA 1KDOA 3WGNA 3QVGA 2XQGA 3K20A 3KHTA 2EERA 1OXKB 3A1EA 1E3JA 1MOQA 3D9QX 3JQDA 1W581 3WOVA 1IBSA 1U0FA 3R76A 5EJ7A 1O96B 1CZHA 1E5QA 1NRJB 1H2ZA 4XX0A 1XAJA 1PS8A 4WSOA 4ZYYA 3M4JA 1NZJA 2FMXA 2BL4A 4PLZA 5KNDA 3GEPA 1RIIA 4L9AA 2C2XA 3DL4A 2I3GA 2JF0A 1OU4A 4BWFB 2YV1A 1PJCA 4RTPA 2NXJA 4LYFA 4JBNA 1LK0A 3C3YA 3ZV4A 3M49A 2HU7A 5CBPA 1OX5A 3QBJA 2FSGA 4R1NA 3HVIA 5JZSA 2WZBA 5TT0A 4DPMA 3U60B 1CVLA 2RI6A 3R5SA 2NTNA 4YPOA 3HGTA 2ZBEA 2A2ZA 3HCEA 3DDWA 2R47A 3V55A 5JADA 3DTVA 4X95A 1VYHA 1KYXA 3DT6A 1V1MB 4FMDF 4OATA 2CXQA 4QASA 5BSEA 1D7OA 3L6CA 3T5BA 1ZMTA 4WDRA 4BKPA 5FTNA 1SQ0A 4YMLA 4HAVA 5I7HA 4BRSA 4RMJA 1MXHA 3A4VA 2GN2A 3NHPA 3VR5H 2IE0A 3E15A 2VPXA 4YMSA 5C5EA 5IEBA 1EQAA 2PAAA 1MEEA 2V7VA 3DL0A 3QE4A 4RQTA 5B3JC 2LCQA 1J8FA 3B9PA 2WYUA 4H4EA 3BSFA 3OQ6A 5JXHA 5CLJA 5I4IA 1XZMA 1ETHA 3HM2A 4MNTA 1R8SA 1XMOB 2XA1A 3AR4A 4X8HA 3SQMA 2RHWA 5A3QA 2DERA 3K0CC 1KK1A 3ID6C 3R3XA 3EZ2A 4AO7A 4OGLA 3H84A 4TSFA 1H1LB 1Q1ZA 3TO5A 4YX9A 4YV1A 1W85A 1KEEA 5E6SA 4F2HA 2X2OA 3UVEA 2IBSA 3VTKA 4DCSA 2P41A 4OYRA 4TWRA 1U80A 2X3FA 4IJQA 3I0MA 2UZ4A 3P0HA 5JSZA 3V8PA 4TYNA 2ECPA 3GUYA 4X8OA 4TTQA 4YP6A 3E1KA 2H4YA 4PSVA 1G3UA 3GT4A 2XB4A 4DCPA 4WN9B 2DUUA 1OW3B 2BM8A 3OF2A 1RLUA 1GZ5A 1EUCB 1KY5A 1GXSB 1ZINA 2WJHA 4S0XA 4U2DA 5DHRA 5K6AA 3A9UA 3R7WB 2FPMA 1PW7A 3L7YA 4XEHA 2YW2A 1TI7A 3WYDA 4E07A 1FP6A 4O2BA 2ZYGA 5BW6B 1LH0A 4CEHB 4EYQA 4F4UA 1ENYA 1D2CA 3KQMA 2DFNA 1YVRA 2OQRA 2Q5LA 4AMVA 3HA7A 1FTSA 4R8KA 3C5WP 5AHRA 1AQUA 1U1EA 2HA4A 1N6LA 2WTXA 4ALMA 5L4LA 2XBMA 3M1AA 3RSLA 1XL0A 3NHYA 4QQKA 4DJTA 3MWFA 3R7FA 3BE6A 3SYMA 3TNYA 2GUWA 1U81A 1WD7A 3D3WB 4NTZA 2X5OA 4O3FA 3P7MA 3N6RA 4PPFA 4DC9A 3GMSA 4NEHB 3OOYA 4DA4A 3BREA 1VLZA 2C2BA 5FF9A 2PJRA 2JD0A 1SU6A 1OROA 4XX1A 2ZWOA 2EFDB 4IHJB 2VA8A 1YO6A 5CVUA 1EESA 2Y0EA 4BMYA 3WGKA 4V0OA 3LQKA 2BMVA 4OGGA 1YBAA 1ODJA 2WHRA 4QBIA 1FZTA 4Q3DA 4YDHB 3WFJA 2YCLA 5IBPA 4UUMA 1ZISA 2B1RA 3CC8A 3ECCA 5FTJA 1SUPA 1OIVA 3CO5A 4A0RA 3MJSA 2E4YA 3ZJYA 5HM8A 3PDCA 3QF4A 5FFMA 4TL6A 1IHXA 1UXGA 2ZSUA 4HQLA 1U5BB 2BGKA 1E94E 1GL3A 2YIMA 2A6PA 4CCYA 5AKJA 3CLKA 2SICE 4RY0A 3CZ4A 2O1XA 1QFXA 4OREX 3KZMA 5IC6A 4XAQA 4RJ2A 2HK9A 5EJ4A 2QN1A 3IURA 1PWXA 5TJHA 3G6KA 3PRYA 4CCWA 4EQZA 2FFAA 3ROZA 4RZSA 1TZ2A 1QYCA 4NIMA 1OKKA 3KL4A 3BA1A 4IIXA 3GR6A 1HMPA 2J5KA 3L1IA 2Q2WA 1VJRA 4WXMA 1SKYB 4MQ5A 2PO7A 2B2XA 3JZMA 4IDHA 4UATA 5IDVA 3X3HA 1QIKA 1T2NA 2PSDA 1AO0A 3NTVA 3PSHA 2YIJA 1FPQA 3E5RA 2J9YB 4QXAA 3EOBI 4WY5A 5A05A 4B3IA 4X94A 2CZQA 3RV3A 5MHTA 4Z4EA 2CY0A 3D3QA 2G1JA 3AGPA 3NYIA 3QBEA 1C7ZA 4JJKA 4ZT2A 1WOMA 4DIEA 3BZBA 2QUAA 3SKVA 1QPZA 4BMSA 2ZQZA 1RKQA 4MUJA 1JA9A 1HDZA 1SU4A 4BDTA 5A4FS 1E9DA 2XKBA 1AKTA 1MZVA 2D1SA 2JLSA 4CNBA 1LLQA 1OXMA 4D4KA 3LVRE 4OI0A 2CJWB 1TUEA 2W2VA 3AO0B 3QUAA 1HLFA 4BMXA 1KO7A 4K9PA 1HSZA 3FTQA 3REQA 3NM4A 3HR4A 4NFYA 5F2NA 4Q9IA 4MS4B 2F7SA 5I9IA 4JLPA 1U6IA 9ATCA 2CWDA 3KLNA 4F85A 3D3NA 1LPSA 3HVJA 1UM8A 3M0EA 4R4JA 3D5TA 3SU8A 1DQNA 4UU0A 5EERA 3TKAA 1RABA 3KR9A 3CNLA 1H0SA 2NVBA 3L02A 3AVVA 1Q0UA 3R9KA 2BFBA 1ORVA 2W2PA 4GR5A 4WNAA 3C8ZA 3KUUA 1AUQA 3PK0A 4J7XA 1JT9A 2DHCA 2JEYA 4L74A 4UVHA 1PR1A 3B6ZA 3NHWA 4F06A 2ZCUA 1UBEA 2AJTA 5K0SA 3ELUA 2Z43A 4XPZA 2I22A 4RU1A 2C9MA 3V6MA 1WQ1R 2EYUA 2GJ9A 3KSMA 2OUKA 3AM5A 3L8CA 1I0LA 1WKCA 1G9TA 1N8TA 3OLYA 4FWIB 4GP6A 3VC3A 1W73A 3V00A 2OBXA 4ZPXA 2D0IA 4LF4B 3DPIA 3H5WA 5E1MA 3RFTA 1QRTA 4HO1X 3GD5A 1JDUA 5KJ6A 1XLVA 3KQKA 1ZI8A 1GFZA 3KZXA 3T34A 3WLKX 3AP1A 4OI4A 3T7IA 4LVOA 2IWRA 4C6TB 1H9AA 1HE2A 1T3HA 1TAGA 3Q0IA 3WLSA 3EW7A 1A4RA 3HMQA 2C5BA 5IWCA 2CVZA 1DBWA 2R8YA 2VSQA 4LDPA 3U7JA 3O8RA 1YS2X 3AKEA 5TGZA 5DK4A 3ESQA 4CIWA 2XTZA 5FV7A 3KTFA 3RTCA 3FG9A 1W36D 2PEZA 4FYYA 2QTCA 4WUVA 2HJGA 5AVQA 2E18A 1R6BX 1HO3A 1WB9A 4YV2A 1U0NA 1ZLYA 1ZD5A 1GT91 1I0IA 1EHYA 2XYGA 4RD0A 5M5BA 4ECEA 4NH0A 1XOIA 2QBYB 3GT0A 1KHHA 1YZGA 1ZN7A 2Q1SA 2ZRDA 3WDLA 5GJVC 3WQSB 1SXGA 1JKMA 2VXBA 2O3JA 2CF5A 4MVWA 2C7GA 4IUCS 5JD5A 4EUFA 4RGBA 3U0BA 3ROMA 3AEUA 3O1IC 4A03A 5CVCA 3DLCA 3GLSA 3AGQA 1H3NA 3RODA 5KYTA 3K8OE 1SOUA 2IEYA 3NIGB 1G38A 5MDHA 1R64A 3AR3A 4UTXA 3IMEA 4LVUA 4RTKA 4FD3A 2BUBA 4PPQA 3BERA 4BTLA 4GE0A 4MICA 1XRRA 1O6GA 3TSOA 5DM60 1FPMA 3BFJA 2Z6UA 2PZKA 1TMGE 2C54A 2D1QA 4HQKA 4NJMB 1MMFB 2ZUDA 1HX7A 2CXRA 3A3OA 2WK1A 1ZVMA 2ONYA 4FOSA 4Z8YA 3ZLUA 5GVSA 3O8OB 3PXXA 3UUEA 1H9CA 3C3WA 3CR8A 4MRMB 2DHDA 1XLTC 2C4TA 4Q4JB 1XCMA 3VTZA 4YCSA 5KVAA 1ENZA 3PX2A 2FE1A 4EY8A 4XB2A 2HSJA 4WECA 4A82A 3KOMA 3AEZA 1CT9A 3F46A 2F62A 1PG5A 3A1NA 4UVIA 3V2IA 1L4BA 5B58C 5LKRA 4LXHA 2O8EA 2ID4A 2DLCX 5BPHA 4K9DA 3W4IA 3ILYA 2O2SA 3ANMA 1G3RA 1JLLA 3HRKA 4B3GA 3MS7A 5JSYA 4CMBA 3FPEA 2GXUA 5AESA 5T8KA 3DOIA 3D6AA 4MUNA 1CEXA 1Z9BA 1BE0A 1Z18A 2NUPA 2CFCA 2JHAA 1TJPB 3TJZA 1AXEA 2JAPA 4ZARA 5FA5A 3THXA 4JYAB 1ZOIA 3HJFA 2WQ6A 3FM9A 4WERA 1G7RA 3GZJA 4FGWA 6REQA 4RJJA 3A4TA 3NTUA 4N5IX 1G4HA 2PKQO 1XT6A 1YVEI 1XU9A 2E1RA 4M1OA 3HB9A 4RADA 4AKSA 2QN2A 1JPUA 2ZQ5A 2I1QA 3QI2A 1E1CA 2O4UX 5EJFA 1E63A 4ZCQA 3LECA 4D2IA 5CFPA 4EP1A 2K4MA 1O1YA 1SQFA 3BS4A 3O8QB 5JQGB 3S8EA 4EENA 4AQYB 2A1TS 2GHQA 2WP8J 4RXUA 2F64A 1H94A 3E9DA 2I2FA 3KQSA 1TVEA 3TPFA 1Y7IA 1FXUA 3WLTA 1KZHA 3UXMA 4UTZA 4E32A 4PAOA 3T5DA 1OOEA 2UUPA 4Y6QA 1NRXA 4HEQA 4C5CA 3HCCA 1FLNA 3AG5A 3HP1A 3FMGA 3LDAA 2JGEA 3CRQA 1YZQA 3SM3A 1JFVA 5ALEA 3H87A 4GWGA 3ER8A 1KDRA 3VR2A 4EB6A 3DEIA 3HLKA 4ZCIA 3E9RA 1SCUB 4AF7A 4B31A 1B76A 1C7IA 4W5WA 2QVZX 3FB4A 5L3QB 5EMLA 4B46A 4KXWA 5HA5A 4YPFA 1JU3A 2XZDA 3RHFA 1TLLA 2V7PA 3RC8A 1BMTA 4WKBA 5K3BA 5HYVA 3L82B 4QGFA 5B30A 2ZUBA 4AJ4A 4RDIA 2ZANA 3CEHA 3HH8A 4K3VA 4C01A 3EHEA 4ZDKA 5I48A 1WXWA 2VJKA 2ZAIA 3HCOA 1L5SA 4L8WB 4Q18A 3LUKA 4DLWA 3RSHA 1RM5A 4UCXA 1RW4A 1PFYA 1DJLA 1JIUA 2WJ6A 1CB7A 2D74A 3KV1A 3VDMA 4EIWA 5JISA 1ESDA 1DDGA 1QPGA 4ZAXA 1PYGA 2FUG6 2HXSA 3IAS1 3DLTA 1RP7A 3JWEA 2GZDA 4PSAA 3DZGA 5FUQA 3BGIA 1Y6FA 4FTWA 1UCFA 4PFKA 5SZKB 2QEQA 3OTOB 2XGMA 4G8BA 2DJ5A 4RGVA 5ELXA 2JIOA 1CULC 5BMVA 3BGVA 4DNPA 2AE1A 2ZSHA 3QYFA 3LWBA 2BZSA 5JZ9A 4D8UA 4R3WA 3WL4A 5I4CA 3PHHA 1LGYA 1QLHA 3GELA 1P4SA 4L7VA 4RELA 1T6YA 4H7EA 3RASA 3QP9A 3D2BA 2G6TA 1LTQA 1UIRA 4XVHA 2BAGA 3AUKA 1CFJA 4COOA 3KKKA 4XI9A 2QMQA 4Z9XA 1S89A 5KOHB 5LJIA 3T5AA 2QLFA 1CUAA 1OAOA 2M6RA 1WR8A 4A6XA 1J0DA 4BPRA 4ENQA 1AMUA 1QIEA 2QN9A 1T0JB 5L8VA 4PGHA 1F2TB 1T3SA 5TQ2A 3GEGA 1EDOA 3IA2A 4TUYB 1OXUA 5KYYB 2NU9A 3OQOA 2DPYA 2HWYA 2J0EA 4QDZA 1AKYA 1VJCA 3CUYA 5BN5B 5TQ0A 1W88A 1BOOA 5D5HA 3CUVA 3VVMA 1E3SA 2ACKA 3C3AA 4REMA 3F49S 1A4UA 3HZHA 4Y67A 4GMXA 4L50A 4KQEA 5EE0A 1GVHA 1ZIYA 1T1SA 2GZSA 3M6IA 5IAJA 2CLSA 2MU1A 4I81A 3KJGA 2ORWA 4MS1B 5AHKA 3R3JA 1W8IA 3P8ZA 5IJ0B 1KWKA 1U63A 3OF3A 4O29A 3DHWC 1X7GA 1T2EA 4LC9A 4D8WA 2ANBA 5LPNA 3KK0A 2X13A 1TD9A 2R00A 3RTAA 4NEGA 4BATA 1JXQA 1QZ3A 2YWFA 1NVAA 1IDN1 3SJZA 3B1ZA 2EFJA 3GOQA 2PUVA 3VKUA 2XH8A 2GD2A 3KXKA 3VZBA 4Z0HO 5LZ7A 2XT9A 1PSDA 1K88A 1W0JD 4OYYA 3W1EA 5AI6A 4OLAA 1L6IA 1SQSA 1UBNA 2HV9A 3RH0A 2C1EA 1FJHA 4G1BA 3QF7A 3RTDA 3BCSA 1BOFA 1U6JA 1J09A 1I13A 2HRBA 1KMCA 3OKPA 3UIEA 1RAFA 4N8DA 4EHHA 3A3PA 1QVRA 5A9TA 4AMZA 2EHDA 2JB9A 3AY0A 1XCLA 5L7WA 4QARA 2WYIA 3KKOA 3DTTA 3RK0A 2KX7A 1OWPA 2OFOA 4HSEA 2BKEA 4E08A 5A3SA 1CJCA 1K75A 1WB5A 4B32A 2XMZA 3KU1A 4YS6A 3OLWA 5B1EA 1Y81A 3FTDA 1JFTA 1OGJA 1P81A 3CRVA 4NMMA 1U4NA 4QM6A 4TSKA 1N2ZA 3BRQA 1MO2A 1SVIA 3HYCA 3L0IB 2ZATA 4E4RA 3WQQA 3TYXA 3EVAA 3FYHA 1NX6A 1EFRD 1PJSA 3L0BA 4IWNA 3N87A 4OHMA 1DJQA 4BP3A 2MR6A 5GIOE 3GBSA 3IBFA 4NCHA 1HY3A 2OVBA 1YC2A 4URWR 3LP6A 2IYPA 5DOZA 4Q19A 3RIYA 3PE6A 1N9KA 5P8WA 2ZAMA 1ZGBA 3OUUA 4B45A 1HOTA 4EF5A 4UXIA 2NU7B 5JROA 2C84A 3W7BA 4LSWA 1J06A 3V34A 2HK7A 3BK7A 4UMEA 4PSKA 1WL8A 3EDOA 4FFBA 4L95C 3VHQA 3VR6A 2IS4A 3WTCA 3TWOA 2NVUB 1IEVA 5CB6A 1AKWA 1TJYA 4J7UA 1VIMA 3SZMA 1MJ5A 2Z4SA 3MG9A 2Q50A 3VOTA 1KK0A 4J0HA 2P8SA 2M6LA 2O3QA 3T1QA 1NRIA 4N03A 4C1BA 3SXJA 1C41A 1J25A 1P2DA 3TGPA 2O7RA 4MYTA 2OGZA 3HKEA 4Y2PA 3GRPA 4XDHA 4UOEA 1KEUA 1A04A 3PGLA 2QPTA 3O03A 1Z82A 4BE7B 3AR8A 4LISA 1UFVA 2WHPB 3STHA 1M2VB 2B0JA 1FTWA 1XTBA 3NDPA 4ZCLA 3QMPA 3WBFA 5J59A 5CXXA 4BUCA 4IDCA 2XAAA 5CT4A 1U28A 1WXHA 2EKBA 2IXEA 1IONA 1L7RA 4OHBA 2W6PA 3H1FA 3TSWA 4EEZA 1KAMA 1DUIA 2CL5A 3LH5A 4P2GA 1ABFA 2GEJA 1I9CA 3BWEA 3DFIA 1R10A 3H2HA 4Q05A 2V6BA 2H5LA 1B6SA 3RS5A 3WGYA 3V8MA 1D6NA 1COWA 2GHTA 2FF5A 4H7JA 3ZY5A 5ALJA 1RM3A 2RB4A 3SNHA 3BB1A 3ADOA 4JY7A 4F9TA 1T9HA 3I34X 3ACDA 1J5EB 2R48A 4I19A 3PNVA 2PZAA 3PUVA 5KTNA 1D0SA 3BWCA 1BW9B 2QG6A 5CVJA 4BECA 1BFKA 1KO5A 2EF0A 3I6MA 4AS1A 5JRDS 4O4JB 5HVNA 1YB5A 1LZKA 2EGGA 2WIAA 3A4MA 2RGBA 4Q39A 4PIVA 4F4FA 1TF5A 2BGRA 1EGHA 3P4UA 4FONA 1DAFA 1M10A 2QB5A 3DM9B 5TF0A 2IYQA 2GAFA 1UWKA 3RD5A 4PAGA 2LKDA 3E1SA 2HQRA 4MR9B 3QVSA 4ZODA 2QVCA 2A5YB 2LP4Y 3G1TA 4GICA 4Y0NA 4YRCA 1IK6A 4DLRA 1B0PA 3CKLA 3KALA 3LG2A 2OWDA 4Q6BA 3UWDA 1F7VA 5BVHA 4J90A 3FYUA 1SCDA 1TE2A 3FXAA 3T9DA 3CLRC 1FBNA 4BZXA 2JEOA 1O5TA 1A9YA 3T5GA 1DRVA 1UL1X 4MVJG 1M1YA 1HEIA 3DEFA 3ENZA 1M1YE 1QUFA 2RARA 7REQB 4HMQA 5KQLA 1RLIA 1AV6A 4RFVA 3ISJA 3F4LA 1E6EA 2VKQA 2R2GA 4GEGA 1XEXB 3T7TA 1QV9A 4L8GA 4LHEA 4WBSA 4QT4A 2VDNB 3C8MA 1UT8A 1Z0JA 3VAAA 3O8CA 3R5FA 4TKUA 3OEHD 1DAHA 2ZXUA 3L8MA 4ITVA 2QX4A 4K88A 5KSPA 1SEPA 2ZJ2A 3KVRA 4PIPA 3K9LA 1O94C 3SVZA 3DWFA 2IF0A 3A1WA 5TS3A 2WNHA 3PR2B 3R5HA 4O2AA 4JVOA 4NOMA 5FUMA 2RAFA 3DBVO 4URXR 1V2GA 4WIAA 1EQUA 3TOZA 1TTQB 1Q7BA 2GS9A 4RA6B 4XSGA 1FYWA 1HNNA 4FGZA 1N7GA 3OTIA 3PEVA 3JYPA 1C9MA 1TKRA 2QD3A 2QLTA 5B7QA 3EVBA 5JYCA 5H02A 3FOZA 1IXYA 4HLCA 1E20A 4HN2A 1JQBA 4L8VA 5LYJB 1CF2O 1GLNA 4R1OA 4MEJA 1U4SA 3EBPA 1US8B 3LY7A 4QXPA 2B8TA 4U9IS 1TF2A 3TI7A 3Q7QA 2XMGA 3ETHA 3IT0A 1PRYA 4RIEA 4Q9JA 2HADA 5FQNA 4RJLA 2HQOA 1IMOA 4IKEA 3NR2A 5EZYB 1K63A 5JDIC 1C14A 3H75A 4EL5A 4PQGA 1NR5A 2NQ2C 3W7AA 1GAWA 521PA 3NNNA 3VR5A 3QX7A 2F9FA 2HH9A 4OGWA 5DHPA 4AG3A 2R7NA 4LC0A 4OQQA 1Y5MA 2F9LA 3ZHRA 1UR5A 3HY4A 1NUUA 1E5DA 3LYAA 2C4VA 2QM7A 2ZRNA 1VB5A 2J4FA 1QR6A 1TM7E 4B48A 3DVSX 3ZDQA 3ETLA 2X0EA 2BBWA 3MINA 1XG5A 4I3FA 1WBJB 4Q1DA 1MABB 3DKRA 5B7PA 4RFLA 4LHYA 4CFYA 1W9HA 2BEWA 3C16C 3JVIA 4MA4A 4UHEA 5MFZA 1EWQA 5KKAA 2BFDB 3PXBA 1BRMA 1RBMA 3WHPA 4OLBA 3QE0A 2OHFA 3OEED 3WXMA 2CXNA 1OWNA 3USES 1YR6A 1WDMA 3PIIA 1XU4A 1VI2A 1VFPA 2WIJA 1DI0A 1SH7A 1FSFA 1QQTA 2QR2A 2X41A 2SHKA 1MLDA 4YB8A 1UXHA 3VPCA 5GJCA 2ASVA 3WV4A 1U2SA 3BTVA 5CEJA 4Y30A 2P69A 3DT9A 3D4NA 1BWSA 2C42A 3C3XA 4DA6A 4YP1A 2C83A 1O4WA 1XQ9A 1NQTA 2D2IA 3B51X 3COVA 3N8KA 3SZGA 4QBFA 4DLYA 1POWA 5BN4A 3CKMA 1IXKA 1NBAA 4RVDA 3WLAA 4E5NA 1TCVA 3RRXA 4G0WA 2BKLA 1ULSA 2R6HA 2XWQA 2JASA 3QPDA 4H31A 5LUBA 4EZEA 4Z53A 4D0SA 2XJ9A 4ON9A 1YS4A 3PYLA 4BLPA 3KU4A 1G3QA 1RU3A 1Z45A 2ALJA 3EZFA 1CZLA 4P7FA 5DTEA 3V8RA 2V6JA 3NWOA 4QWMA 4B82A 2G9RA 1L5YA 3DHYA 4KXUA 1O95D 3DPUA 3H6KA 4AG6A 3I2JA 4XOIA 4BB9A 1NVEA 2FCAA 1S3IA 2I2XB 1E1DA 4E94A 4GBED 1NWHA 1PR9A 5JMOA 3ESYA 5ED4A 2IGTA 2Y66A 4QTXA 4BX2A 1SXJC 5EUBA 3R3VA 3UCFA 1C80A 2ZJ7A 3B8HA 4GI1A 2DBZA 1CS0A 1RS0A 1IQPA 1E3QA 2E55A 2XMPA 3O5AA 2DLNA 3R0QA 2IDZA 4HK4A 5JNUA 5LXTA 2V65A 5D3MA 1QP7A 1NJGA 3NV9A 4C4SA 1ISFA 1R0WA 1ZKDA 2VA9A 2PVPA 1XWIA 3A31A 3DLAA 4QDKA 3DLPX 4O4LB 3A9TA 3EDQA 5F78A 4EJ6A 4DJ5X 5BMVF 1VYVA 1ZONA 1JEDA 1DS6A 1FK8A 2EEPA 2OKGA 3HDTA 1OGYA 2NV0A 4C4AA 3W4JA 3HNRA 1EFDN 2FW1A 5EGSA 2QD5A 3T4EA 5B6PA 3GXBA 4IIJB 2R62A 5TPWA 1J90A 1OLXB 3ENNA 3MLEA 2M9MA 3W7VA 4BTEA 4C3VA 3N2KA 3N58A 3VA7A 2O2CA 3CEPB 1S8OA 3F78A 4IMRA 2GFQA 3G7SA 4PYQA 2UUAB 1Z15A 2EIXA 3G49A 4HUJA 3HFSA 3BWDD 3DVQX 2WTMA 4OK6A 5EHXA 3U4QA 4O2LA 3SIWA 2ZIEA 4KPUA 2CVQA 4KX5A 4DWOA 1JA0A 1XDDA 4CF3A 2DLDA 3AJ9A 3FNRA 4YJKA 4UHHA 5EJIA 5HTKA 3ZLBA 5HUHA 3SSAA 1FYEA 1G5TA 1NV9A 2O7VA 2HWXA 5CAEB 2IK8A 4POAA 2MIIA 2WM9B 1RAHA 3FJOA 3WIDA 4I2NA 1JF8A 4L0QA 4ACBA 3BFXA 1XXHB 2XE6A 4OHXA 5B1SA 5MN5A 4LBZA 2C4KA 2P9TA 1UQRA 2OCYC 2ECOA 1CR0A 3BBPA 3DYIA 2H9IA 4GPIB 3CVJA 4EB3A 2Q6TA 1XLTA 2C77A 1KJYA 1OGIA 1D2NA 5KNDD 1SXIA 4TTJA 1GD1O 2PUJA 3W5HA 3L0SA 3V33A 2Z09A 3V8QA 4MKZA 3TRJA 2C07A 4UJ5A 5JARA 1JG7A 1RTKA 4EF6A 4WLUA 4MGIR 2HY7A 3UV6A 5BSVA 4LF8B 4BJHB 3PWTA 3U6BA 4N3AA 3KQUA 3ZDDA 2WUGA 4Q7MB 3TX2A 1TCUA 2H07A 3E9QA 3SY8A 1ATIA 2OWEA 1K97A 3K9BA 3B1YA 2VH2A 4EITA 5K0BA 3CLVA 3ESXA 4ZC8A 1AV7A 2D1YA 3VFDA 5KSYA 5SZIA 2Z95A 1RWXA 4KOEC 4KQHA 2AKAB 3RS2A 2CMDA 2FSPA 4H1TA 4MJXA 2IKQA 3ZBUA 2XBLA 2Q2QA 1RRVA 421PA 4QGSA 4GSYA 2XCIA 4GX0A 1E3TA 4UNPA 2BMAA 4HBZA 1W44A 2YVKA 2CUKA 4PX5A 4P3KA 3MZ0A 2XR1A 2PANA 3EMKA 4G01B 2G25A 2ZOSA 4I3GA 1VHJA 2MSWA 2OAGA 3AP2A 1PUIA 4BGVA 2O1EA 4WZAB 3P45A 4WTOA 4TRJA 1RJWA 5FWXB 3QTBA 4HAUA 3VI4B 5LD2C 4P9NA 1Y7PA 2IP2A 3A1VA 1W5AA 4FQ7A 1ZI9A 5KDDA 3RYHA 3D2CA 4TSFD 4MWEA 1RYYA 4DIMA 1Z6XA 4GL4A 1XRLA 2RH8A 2C99A 2FQYA 3F4BA 1APBA 4KR6A 2R9VA 1J6UA 2GNAA 3EEYA 3MRSA 5BUSA 2D7DA 2FPWA 4TV8A 3EB9A 1QK5A 2Q4BA 4U7GA 1NUQA 4UUBA 5DW0A 1ISJA 2JGAA 3EUEA 4BMVA 1REQB 1XRJA 1SVOA 4I6JA 4LJLA 2AXNA 4Y7CA 5L3VA 1B1AA 1Y1SA 3DMNA 3G85A 2FZCA 4ISBA 1Z6GA 5TPZD 1UANA 3QKRB 4HQ0A 5DSTA 1Y3CE 3C39A 1E1LA 1I4DD 2J9FA 5E4TA 3KSAC 4PNHA 1WXDA 4CEIB 2DKOA 3LSYA 1FFYA 3O84A 3B1FA 4QYWA 1VHQA 1NKTA 3GGSA 3VVLA 1YA8A 2J3JA 2CNKA 1S1CA 3PDJA 3VNSA 3W2HA 4ZCRA 5HRAA 1S2DA 5FBHA 1CJBA 2ZM6B 2D0DA 2REOA 4IS2A 4BLUA 3R9WA 4YCLA 2QAGA 3GNTA 1KEZA 3DZCA 3FF4A 1P74A 3EVTA 5DSXA 2GBLC 3CEJA 4ZAZA 2J7KA 4MB2A 4AN1A 2EJTA 3BVPA 1NJFA 5BSMA 2BM9A 3C8UA 2NTVA 1UDWA 2VCEA 4MROA 4B3TB 3LIIA 3LFUA 4JI4B 2Z5FA 1Z56C 2OA0A 2HF2A 1QKIA 2J5XA 1I4WA 2VHQA 2P4UA 3LM8A 4PM4A 5DM0A 1H2FA 3OP1A 4QU8A 1IM2A 2NUAA 4FFRA 4RPHA 4O3MA 1D1SA 3HCPA 4WZZA 1JR2A 4M4SA 3K30A 4WXYB 2R0QC 2HA2A 4NDAA 5JH7B 3TFOA 3MSXA 2KJQA 3CRNA 3DA8A 5HZKA 1NVMB 1R0KA 3I01A 4KWIA 4ZOQI 1TPYA 3W0LB 3DE2X 3R3YA 3IKMB 2GTPA 1R8XA 4L76A 2Q6LA 5IX8A 2LIVA 1ONPA 5LU8A 4H16A 2FSIA 3BDAA 1QANA 1ADBA 1ZD2P 4JZKA 1KC1A 2PG3A 3S81A 3WYNA 1VPDA 2XITA 3L8GA 1B4DA 3A2LA 1PLKA 1VLLA 3M6VA 1UKBA 2QM3A 2Z57A 4KUEA 4B76A 4B2PA 3AHGA 5T7BA 4IO1A 2IA5A 5IT0A 2XHEA 1TZJA 4ZCSA 5IJ9A 5L51A 1QIFA 4MW9A 1PZXA 2DQ4A 3K0EA 3Q3EA 2CC2A 1VI5A 3LNTA 2XZOA 4AXXA 4F3CA 4OHVA 2F59A 3ZDRA 3CW9A 1TJ3A 4KWHA 4BFXA 2FZGA 3W2IA 2WWFA 4CZ2A 1OKKD 4DV2B 2MSKA 1GUAA 2QQEA 2GB4A 1WUYA 1GYQA 2GPYA 3EA0A 3JALA 4M76B 3DTNA 5DBEX 2CMFA 4RFSA 4J16C 2YWGA 1XZGA 3VYVA 5LQCA 2HK6A 4TLBA 2R7AA 4X00A 5D2CA 4XZ3A 1GTRA 1NI4A 2RBKA 3FKQA 3CIFA 3AL3A 4X65B 3DDZX 2G0AA 4Q9NA 4FEAA 3U3OA 5JECA 1A88A 1JWBB 1MT0A 1KAEA 3HN2A 1Y8CA 3VX3A 1KI1A 2IYVA 2IV7A 4A2PA 4CNQA 4I9HA 3NPMA 2ONCA 1U0RA 3HI4A 4BKQA 1UM9B 2OPBA 3C6YA 5AK3A 3E03A 1AZSC 2M2IA 5AICA 3VZRA 2SBTA 2X5NA 1QJ4A 3EFEA 2PZGA 1MGPA 4O2AF 5T4BA 4A15A 2GLUA 2QUJA 4KMRA 5I9SA 4DIUA 1LC0A 3FFAA 3A9VA 3KPUA 4K9OA 3JQGB 4TGLA 1NX9A 1YD7A 4O4IB 4PZDA 2FP4B 2IX3A 4MI3A 1VSTA 2OHXA 1JAXA 4OHCA 3P0EA 3PFKA 3NYQA 3VC2A 1JH8A 2BSXA 4RD3A 4FZ5A 1X9IA 4H6VA 1G0NA 1XALA 2OCDA 2QN3A 4UVGA 2YN4A 4ALNA 1HTBA 1VBMA 3NIDB 1KJIA 1H66A 2UV8A 3U17A 4AKEA 1JE0A 1EDBA 1JIKA 1TQ4A 2B92A 1Y80A 1VE1A 2QUHA 1ES9A 2UVQA 1Z4OA 1PAUA 3G6WA 3PUXA 4MYUA 4PNPA 1YFKA 3RFFA 4D4MA 1T15A 1YI1A 2FEMA 5KOYA 4YAUA 3DZJA 1RI2A 3B1JA 3LYLA 4DHEA 4JC4A 3ZWMA 5LMUB 3EWIA 1F7UA 5AM4A 1U8FO 5FA8A 3RS8A 4N7MA 4ZIRB 3I6IA 1JT2A 3B2NA 3GIWA 3MPUA 2PUGA 3CCFA 4FM9A 4YMUA 5HZMA 3QLTA 2GYVA 2AOTA 4G8CA 3AMVA 4K2AA 4X63A 4IICA 3ZHXA 2R8XA 4LV5B 5G4KB 1HNXB 1G18A 1ENOA 1HE4A 1Z36A 3ER6A 4KV7A 1EMDA 2YHBA 3RNOA 5JD3A 1MC4A 4EGAA 3EW9A 1H93A 1WPRA 1T4CA 4JLWA 2HSEA 4LTNA 4DTCA 4D97A 4NCIA 2YYZA 4MA0A 4CJXA 1N34B 4NBWA 3Q98A 2B3DA 3DXFA 1IRXA 5B3AA 3USCS 5E8JA 2OCIA 5C7YA 1TYEB 1P1BA 1PF7E 2YWDA 3S3TA 3TEFA 2POCA 1GKUB 4C4TA 3U61B 1M5UA 3P32A 2Z3ZA 2IUEA 5JJCA 3DR3A 5FBLB 3OJ0A 2MINB 3K9WA 1X1BA 3JQBA 1FDTA 1R4NB 3ZHTA 3TZQA 2YN0A 3HLYA 2Z56A 3GNLA 1D1TA 2QRKA 3ABIA 3O8BA 2NO0A 1ORHA 1FLDA 2GPTA 3A26A 4IHAA 3HJHA 2FPIB 3GUUA 1JHRA 2C5SA 3TRFA 3A1SA 4ALJA 3FNEA 1ZRSA 1YCHA 2RGEA 3OIFA 5C8YA 3R8CA 3D43A 1GV0A 2ZSIA 5A3JA 3R6WA 1JMYA 1BS9A 5I7EA 1BE8A 3DFFA 4JVMA 3IYLW 3WRYA 1SVWA 4OXYA 4YGYA 4QYTA 4YRFA 5F33A 2WAXA 2ZJ3A 5CH5A 5F5XA 2NQTA 4KAFA 4OSEA 4GXQA 2FEWB 2VYVA 2P35A 4X61A 3T95A 1OF1A 3LC7O 1KO4A 1HR0B 3IRUA 4KSCA 5IM4A 2H2FA 1ZM7A 3A10A 4I9FA 3CJTA 4RTRA 2J30A 4KH1A 3GJXC 5B58T 2G1UA 4D9GA 1SUAA 3OPYB 2F43A 1P4HA 1QF7A 1RXVA 1J1ZA 1YCGA 1SUDA 1G5PA 2XI4A 1LJUA 2DZDA 4IRUB 4RM3A 5ESDA 4M0UA 4UQPA 3MQ4A 4A7PA 3JCZA 4S05A 2P75A 5TV2A 4OCZA 3AVTA 3TZ6A 2UUCB 1TYCA 2IY9A 3WADA 1E7MA 4YT5A 2GEUA 2VOJA 3DZKA 4DILA 4B6OA 2O8CA 5K9ZA 4HG2A 2F4VB 4GO1A 3UKOA 3GQBB 2A33A 4TQGA 4TM8A 3BOSA 5E1BA 3QVXA 2BSAA 4NJEB 1MA3A 3F8TA 3UH0A 3QVOA 1RFGE 2JGNA 2XKJE 4K6KA 3OVMA 1T0IA 4HLQB 3FETA 3I9V6 4EJSA 2WVHA 1O94A 1I32A 3ET4A 4FD2A 1J2YA 2VJCA 3PC3A 1K3UB 4DXAA 5KTMA 1OH6A 2VXCA 1XZ8A 3RG2A 4DQ0A 1NU8A 5DZSA 2D3WA 3TBHA 4C4RA 4WEQA 5A5VA 6CHYA 1CIJA 1TGYA 5TS2A 4BFCA 1SVUA 4KQ6A 3R3SA 2WF7A 1R66A 3RYCB 1WHSA 4WJLA 3H65A 4RKQA 3IEKA 3HVUA 3HKCB 1MCZA 5LOVB 1M2FA 5A2QA 4CE6A 4NZOA 3EN0A 1IC6A 1SHZA 2DE0X 5LFAA 5B2FA 5SYAA 3BXGA 2H1OA 1SC4A 1ADJA 1JIJA 5C31A 4LJYA 3RU3A 1YSCA 1KZGB 1R0RE 3DXZA 3OIWA 4I4NA 2WJJA 1UIMA 4WQMA 4ONEA 4ML3A 4QFBA 3VR2D 4C4XA 1N32B 4ND8B 1PX0A 2O3SA 2GDZA 3KWFA 2Z8YM 5KNCH 3WNQA 1J20A 5DI3B 2Q29A 1N2XA 3UMSA 4ZKDA 3PA8A 1JL3A 2SCUB 2A35A 4HRVA 4OOEA 1JFFA 5H4GA 1FTQA 2D4AA 2DC1A 2ZE6A 2Y1FA 4UUAA 4BLRA 4EFKA 5AVXA 4GOMD 4MQEB 3TFQA 4AZSA 4K05A 4RWEA 4UUPA 5A6SB 2I6TA 4BGDA 1QP4A 1ESNA 2PUFA 1T8SA 4MW0A 3S5JA 2VK4A 4DM4A 3SHVA 1E59A 4A0FA 1KZ6A 1VPLA 4JS0A 1CLUA 2C1ZA 1VMAA 1XZFA 2PLWA 3A2MA 1UFOA 3Q8XB 4IKPA 4Q4AA 4RBNA 4A8JB 3MRXA 1OREA 1Z2OX 3KIPA 1UP7A 2PH3A 3K1AA 1K5GA 2Y93A 2FWJA 1T9GR 1YHZA 3U7EB 5JJIA 4O63O 4HGNA 2ZB2A 3HYSA 2QLNA 2XZLA 1C3OA 1SKAA 5JZOA 2AF3C 3KBOA 4QRDA 4LOLA 3KVYA 2PVSA 1WMBA 5KX5B 1U2DA 1DEOA 2CV0A 3TXAA 1C9NA 4ROSA 1Y6JA 1VSBA 5FQOA 1J2UA 2YDYA 1WZ2A 1J7JA 2AK2A 1FMLA 4C22A 1ND6A 4UBKA 1BQEA 1FFAA 3IKTA 3H0EA 1N1EA 4MPTA 1AH2A 2VHXA 4OK3A 4R5MA 5AXAA 3ZWPA 1XELA 3P9CA 1TCCA 3OO1A 3FYTA 3VH4A 3IBCA 2OO7A 4GSLA 4U2FA 2I7TA 4CM8B 8AT1A 2GARA 2ZIWB 3FFBA 2QRLA 2O8DB 4HDMA 3HK2A 2VHWA 4TV8F 4ZZ2A 4E5KA 5KVCA 3DBHA 4ZU3A 1SQGA 2Z8YA 3UAOA 1QAMA 1Z34A 2QDXA 3WICA 3IOCA 2J41A 2FPGA 4X8LA 4OHUA 3U56A 1OE0A 2COUA 4Q9LA 1E4VA 2W98A 3I6ZA 3ICCA 1EDDA 4IM7A 1V9SA 4QGGA 3PPVA 4UQOA 3ZWYA 5BWLA 2PKXA 2WABA 3A36A 1M2JA 1D09A 3DE7X 3RC1A 1H1DA 4MVJP 4FDUA 4MP8A 3TDNA 2IOYA 4QOFA 3PDWA 4H18A 3PB3A 3TPZA 3R3HA 2P4SA 4D96A 1MJGM 1SXJE 2DUWA 3MT9A 4AX4A 3AR5A 1EINA 5GOTA 3BL5A 3DXXA 1JEYB 2PXXA 2R97A 4G26A 5I51A 1XXLA 3GLHA 5HFAA 5IH3A 4HN9A 3ZKWA 3FUVA 3GLHE 5H80A 5EYPB 4E21A 4QULA 2I87A 1A95A 4JEIA 4MLCA 4S24A 3AHEA 2GPWA 3S5UA 2TYSB 4LA4A 5CW2A 2B82A 2NU6A 4E4YA 3D3KA 4DCTA 1YUMA 1VGRA 1X42A 3PA6A 4ES6A 4G6ZA 1LPMA 3FW1A 1P6QA 4YP7A 4D44A 1H0HA 1U2RA 3LRPA 3KYCA 5JPCA 1ZVKA 4CQLA 5FPQA 5CCBA 4MI1A 1QR2A 2V4MA 3FMPB 3QG5A 1Y3IA 4GI2A 4PG7A 5LA6F 3ZDCA 1SCBA 2GMWA 2OCAA 2SNIE 4C0LA 3GHHA 4YUVA 4UXJA 2DFPA 4IMIB 3ZYZA 3DMGA 2XRZA 4WNCA 4MA5A 2HEGA 2OVFA 5K5EA 1RWBA 1W29A 2H0AA 1KGDA 2BZ0A 2LGJA 1CUFA 3V97A 1E96A 5IFLA 3GRCA 1BHO1 2E5WA 1HDYA 3D4OA 3ELDA 3P5SA 1UOQA 2J7PA 2ZE7A 5LB4A 1O97C 1MDFA 2ZI7A 2OXEA 1DDIA 4LAFA 2DR2A 1G21A 1WETA 1W75A 1G21E 3WMGA 5HQ3B 3LF1A 4M7OA 5JATA 4IINA 2O0KA 3SOPA 1GU7A 4BO9A 4DABA 5AHWA 4QL3A 3UJ9A 3JYNA 1KAQA 3INGA 5I3ZA 1UBRS 4PYIA 2XYPA 2JJ2A 1TU3A 3P97A 4LZZA 5KYXB 1AURA 2Y0PA 3BL6A 5BR7A 5DNUA 3KJXA 2ID8A 4NZMA 4QOIA 3PC4A 3QXXA 4L1KA 3L01A 1HDRA 3QIAA 3MCTA 3KLBA 1RMQA 4P36A 1M9NA 4FMCF 1NI3A 4DZRA 4WVLA 5A1TA 2VSOA 2RKBA 3ICEA 4KO3S 4YRDA 3HKDA 4ZEOA 2EL9A 1F20A 5DGHA 3V8VA 1DE0A 1XD8A 5GAJA 1N9ZA 1TIPA 1V6CA 1Z0IA 4GI7A 2OD9A 4TYPA 3AHDA 3OMLA 3OT4A 2ZYUX 2GO1A 1GPWB 2JCVA 3B7PA 1D9XA 3IMKA 2PIAA 3PI7A 4Q0MA 1TO1E 3QEOA 4OI2A 2JD2A 4JGIA 1JGTA 2JGIA 3DL2A 4YCDA 1BQ4A 3R9XB 1W5SA 1JQDA 2EW2A 2JATA 3N0XA 4YC7A 3T1HB 1QF9A 4Z4IA 2OYSA 2BF7A 3RRNA 1S9DA 1PEYA 3KG2A 2V9ZA 2E1PA 2HRZA 4RTOA 1UOPA 1XMQB 3PNSA 3H11B 4M46A 4Q34A 1SCJA 1T1JA 1IQUA 4QD3A 1Z6ZA 3JATA 1MFZA 1XP5A 4JENA 1G5FA 1GCUA 4OLJA 2FUKA 1ZLXA 2IHJA 4I55A 4CIVA 4DKXA 1EHCA 4KAAA 2RK3A 4W1RA 3OZXA 4CMHA 2I91A 3DGEC 1UUFA 4WJKB 1MNQA 3KKLA 3NEPX 1GU1A 4BO1A 3ZUGA 1GSHA 1O96A 2EEZA 1BKYA 2PX5A 4PR3A 3T41A 1L7EA 4NF2A 4JVNA 3W5DA 2IELA 3OQIB 4V0QA 4HRXA 2HR1A 3KHKA 4HGRA 5KI6A 1ZXBA 3WLLA 3PQDA 3NHSA 4CL0A 1ZCFA 2AMYA 1E7WA 1LNZA 1Z4PX 2H5IA 3H2GA 2K7FA 4NK4A 3UV3A 1ISMA 3R7LA 3ZY4A 3W5BA 4QSMA 2HM7A 2VJYA 2ET6A 4X1YB 1XTPA 3BWYA 3W6UA 4YRSA 5LJLA 5CU7A 3QNMA 2J07A 1M2WA 3Q2IA 1SC9A 1U3CA 4N8SA 1UPCA 5AQEA 3DLBA 2Q7OE 3HRIA 5CX4A 5LMCA 2BOVA 1ICEA 4ALKA 4YR9A 1IOLA 1MRSA 1XVIA 2J6HA 4F97A 3TIXB 1L7NA 4HDKB 4PSDA 1JYEA 2C29D 5HKBA 4K6FA 1L8XA 2O2JA 4PCVA 2XDYA 3PEEA 5FFNA 5AJXA 1I14A 1GPH1 2KQUA 2ZBDA 1ZA2A 1NVKA 1CDDA 2E21A 4YEDA 3WNCA 2V7BA 2BISA 4B6SA 2DHQA 2AZ4A 3AW8A 1K6XA 3PRKE 3GFBA 4ZVUA 2PKQP 2OHVA 3G2KA 3ZNNA 4FOLA 4L9WA 4MKGA 3A2KA 2G08A 4II2A 2QV0A 4GUDA 4F3YA 4A0SA 1CXZA 5DYWA 3JASA 1JIVA 5G02A 1H1LA 4WT7A 5K3DA 4N82A 5F1OA 5KNLA 3IEPA 2R6JA 1TTPB 2HFKA 4IXMA 4OHWA 5EL0A 5FV4A 2PU7A 2DPMA 2WVAA 2BCJQ 2I4LA 4H4DA 2Y71A 4EHLA 3CCBA 4RKWA 4DQLA 1F38A 1YDMA 1SQ6A 2FEPA 4FMBB 3L1UA 4F8EA 5A2GA 3H42B 2QX9A 5K3CA 1LSOA 4EI2A 3SBDA 4N12A 1EFPA 3AESB 3DUWA 3ELYA 3F8SA 4DARA 1EUCA 1AGPA 1ZRNA 1GXSA 1RHKA 3DBIA 1RT9A 1TXGA 3T12A 1G19A 4PBRA 3G2MA 3ZHZA 4XFDA 3BKXA 1KO8A 1FBTA 1PR0A 3F8WA 3IUNA 3AJDA 2D6FA 5FXMA 4CDGA 5HE9A 4ENRA 2P6NA 1BS1A 1USWA 3RSSA 1UKCA 5EIFA 2O2EA 5E9WA 3C4JA 2EKPA 1XQ1A 1DEXA 2JAWA 2J6IA 2UYCA 3Q6MA 5ULLA 4J16A 4NMXB 4RAOA 1EM8A 1YTLA 4IX1A 4YP0A 3VR5D 4CLDA 4MCIA 3GGJA 4AJEA 2PMBA 4EGSA 4EPVA 3D3WA 4YAGA 1GADO 3O94A 2HIAA 2ZG6A 3LL7A 4G89A 4JBLA 4RGYA 5CLIA 2Q3JA 4O5OA 3U1BA 1JWLA 3RF6A 3BT7A 1C8VB 4TWZA 1INLA 1E4OA 4RSMA 1LPPA 3OJWA 4HCJA 4IHJA 4HXFB 4U7TB 2YRXA 5L6MB 3KYDA 3V7FA 4U6SA 2J5BA 2VNHA 1O9GA 2Q27A 3NH9A 3EVNA 1JEJA 1GRRA 1XMPA 3BXOA 5B1DA 5DGCA 1Q2XA 1G4UR 2OSVA 4ZVMA 3IXQA 4CM7A 3BGWA 3TMKA 2GCOB 1EBBA 4Q82A 2GZAA 2HAEA 2YOGA 4PGGA 4RIFA 2QX7A 4KYUA 1K3FA 1U5BA 2B30A 2H51A 4IJUA 4LY3A 3ITDA 4RHFA 3AQIA 1P5ZB 4ZQFA 3AR9A 1TA0A 3W9BA 4X45A 1CIPA 4MPDA 1N2CB 2JI9A 1HTTA 1LLDA 4XVRA 5HKOA 2IYAA 3AM3A 5B5SA 1JSLA 4G23A 4KV9A 3FSEA 3PUIA 4RDHA 2WEKA 2YNMC 5B6IA 4FHEA 3V4VB 1KI6B 3CISA 2J6CA 1D6MA 3UJ6A 5K8JB 4K1LA 1OUMA 3B82A 3HFGA 1HL3A 3L8ZA 3WIEA 4X92A 4LHVA 4NEQA 3KPVA 4JWKA 2EQ5A 1CBUA 1N2JA 5DASA 3WDSA 4J0JA 5AVZA 3VNAA 4DSTA 1G16A 3T06B 2XYVA 4ZK2A 5A4KA 5JEEA 2CB0A 5IVDA 4DV0B 4GQAA 2OV8A 1KP2A 3CNNA 2VAXA 3EC2A 2PJZA 1UFKA 2C5LA 3MWDB 4DA0A 2FWAA 3S7TA 5LNK6 3AR7A 4KU4A 2G36A 1GFWA 1CLEA 5LB2A 3TQFA 4GC9A 2JI8A 4FR2A 1VYUA 2B78A 1ODFA 5LR6A 3PNYA 4Y1RB 4CG2A 3JTEA 2CJWA 4O1HA 4OMFG 3ZDAA 1AQJA 4IDOA 4RKYA 1DZ3A 2AG8A 1IHOA 4TS4A 1EDEA 4MS4A 2EWWA 1NW7A 3NNSA 2EKQA 2F8TA 4GZ5A 3TIFA 3EXG1 4N3GA 1FEZA 1TC2A 4B17A 5D3ZA 2X0KA 3NJRA 1E1NA 2CMGA 1IZZA 3QK7A 2I54A 2O2ZA 3DD5A 2IT1A 4HMOA 2L19A 2GXQA 5ER9A 2C4NA 3EG9B 1ZNZA 3A27A 4GSKA 2ZUCA 1R74A 2FYTA 2GYYA 2IXDA 2WUFA 2W90A 3E18A 4LEIA 2X0JA 2VK2A 2ZITA 3K8YA 1AE1A 2LW7A 4PC1A 5A7GA 3ZZNA 3U4MA 1LSSA 3BMNB 1J22A 2PA0A 3MOGA 4DLUA 4CLOB 1U8AA 1K08A 4GZ3A 2X5JO 1CJSA 3QXJA 4FDLA 4DNXA 1GSAA 3OWXA 4L02A 1ITZA 1MHPA 1NHGA 3F7OA 1HYGA 3MRTA 5CW1A 5H7XA 5CG2A 1N36B 4OK5A 2XQKA 5BSGA 4ZTUB 4J1TA 1MW8X 2H7XA 4LNUB 4A73A 2ZYSA 4R7ZA 8ABPA 1PJLA 3EEFA 4M0LA 1IZ7A 2YJ5A 1QFSA 5I9LA 1PD0A 2EYQA 4XVUA 4QEZA 4C6TA 2Z5LA 3AKDA 2IRWA 2IYYA 2HMTA 1XMXA 3A9SA 3LRXA 1N4DA 3PT9A 3DVRX 3UAVA 1L8AA 1NPYA 1I24A 4FHFA 4JWTA 4TKLA 4DMRA 3EBOA 3I28A 4ZI7A 3CH5A 4YROA 3WKCA 1YI8A 1E61A 3E2IA 2G07A 4XD7A 3KZKA 1LD3A 1H22A 1DMRA 4WZBA 1VLMA 4ZVQA 2IH5A 2R87A 4WZBE 4H1WA 5JPIA 3ZVLA 4HJRA 3LA6A 3ZK9A 2IDMA 4KQ9A 1LBSA 1OZAA 2C7OA 1E3EA 1HDIA 3UXYA 1YQDA 2B37A 3TM4A 3VDQA 4A2QA 1LV7A 2XUQA 3OE7D 5FDFA 2QBYA 4OMDA 1OLUB 4OQMA 4J7CA 5AW9A 1GLGA 3LP5A 1UBGA 1VHDA 2H7CA 4A0QA 1XHEA 4U1RA 4JLVA 3KPWA 4DNFA 3BXZA 3NANA 4F8JA 1RXSA 1IQRA 4D6XA 1ZEMA 2PL5A 2VF5X 2FMHA 2QSJA 1FMCA 2VL7A 4JEHA 2CVOA 4R51A 4MR8A 3B7WA 3GJTA 3V5NA 1GCOA 5B4TA 1Y3BE 2X9QA 2JLAA 4DYVA 5B12A 2BTQA 5IXJA 3S27A 2ONZA 1CF9A 4AY3A 4QBHA 2BTOA 3D02A 1RPTA 3OHSX 2C3YA 2X1LA 3LHKA 4ANFA 4BV2A 4NJMA 3ESBA 5DJ5A 4BV9A 1DTWB 4WBXC 3TKYA 1L4KA 2WPDA 3O8OA 4FPXA 3ADPA 3N75A 2GESA 1JAYA 3PYXA 4HYYA 4K5QA 4NBLA 2MDTA 3R41A 3RSQA 4BE4A 3LX8A 3TVDA 1GPLA 4BX9A 4ZI3A 1GDTA 3KHSA 1JQJC 1XRMA 3JZFA 2F90A 4FUTA 2XT6A 5A06A 5JJLA 1ELOA 2HMYB 1R6UA 4MAMA 1FE8A 1FLAA 3BZUA 3C41J 2XUZA 3E23A 4WNIA 3T38A 3PJGA 4EW3A 4YRAA 1W6RA 5L40A 1QIIA 2WTNA 5ALKA 1XR3A 4IWYA 4OQYA 3DAHA 1W34A 1M73E 1OA0A 4AMYA 3I32A 4GAEA 3ASUA 1M3SA 1VMDA 1QORA 3FDJA 4E0BA 2L69A 1QTIA 4F9EA 2ZVJA 2EJCA 3C1OA 3MUOA 2R4QA 1NTRA 1AF7A 4GZ6A 1YQGA 1SU8A 3A6KA 3DDHA 4RQAA 3M6FA 4FU0A 3HXLA 4RQBA 3K3PA 4P98A 2NO1A 2B1GA 1RWWA 2J85A 5ISMA 1M6VB 1G59A 2RGRA 3ZBQA 3FLEA 1EXWA 5I8PA 4E5DA 2P0EA 2AEMA 2WNIA 3O8QA 3SS8A 2ZVPX 1QG4A 3KPJA 3PQ8A 3HXQA 1NC3A 1U0OC 9MHTA 1ZBQA 4MJ7A 4I55F 1ZHHA 3X1MA 1FXWA 1ILEA 3GDFA 3I3OA 1KVSA 4I6GA 5C4MA 1PS9A 5JAIA 2FMTA 2D1RA 2ZYDA 4IH9A 4RD1A 3QMMA 4PO8A 5E0OA 5HF5A 3OOJA 4XQEA 5IABA 4FHCA 1WUIS 2WJPA 4GECA 3HO8A 4N0DA 4QQ8A 2R5WA 1DX4A 2CFTA 2J09A 4HQ6A 4OBEA 5EMJA 1KL7A 2DP4E 2QE7D 2WV9A 1BX0A 3SAJA 4MCHA 5L3QA 2P65A 2AD5A 3L8DA 3FCXA 3QENA 5DBHX 4NU8X 3VO9A 4C3ZA 4LJRA 4PC3A 1EXDA 3IE0A 1TLTA 2Z5GA 3ZY3A 5JS1A 1J0EA 3MTJA 3R5KA 3WGZA 1GJRA 3IDFA 3WJ1A 1XEWX 2XVXA 5J63A 3R6GA 5KQPA 1EX9A 4Z1OA 1JMVA 2C8KA 2CKDA 3EE6A 1ZGCA 3W5VA 3OHPA 3ANXA 2EOAA 3W78A 1UK8A 2JIMA 4I1YA 4OTZA 3ZH2A 3WWEA 3PTAA 1USKA 2Q2NA 4HNAB 4W1QA 1TO6A 4DY6A 1CJVC 2IYUA 3E3LA 3D0OA 2FPRA 4D9KA 4NCKA 2W2KA 3OD1A 1HNZB 3QLUA 1OB5A 1P5JA 5CR9A 4BZWA 1Y3AA 2I2WA 5SY6A 3GLKA 2H2GA 3I62A 1OXVA 3WZ2A 2ZYRA 1A5AB 2G28A 5EHIA 3HEMA 5IUJC 2YN2A 1E6MA 2PQ0A 1R4ZA 2BMFA 2B4TO 1VKOA 5EWLB 5IC5A 4MW1A 1GRNA 1U0GA 1T0UA 3CUSA 3GPBA 4LZLA 5E4JA 4TMFA 2B8JA 4M1SA 2VP2A 3WHLA 2CFOA 4F3RA 4HNQA 2E5LB 1QU3A 1Y8QB 3TTUA 1LPOA 1P7YA 1YASA 4Q9AA 2JAXA 5GOZA 4RVNA 1D0VA 1Z0AA 2ZROA 2P9GA 1EFLA 4JNCA 4URUR 1CY1A 3MB5A 5I7SA 3B9RA 1P72A 1P6UA 4UVDA 2F3RA 3MXOA 4MW5A 1YR9A 3TRKA 4CHGA 2PUCA 4IVRA 3GLFA 1J97A 2JGDB 4NATA 4MQLA 1YQWA 1CY2A 4LWQA 3T7RA 5KNCA 3B52X 4J4TA 1R4MB 3KWJA 1BNCA 1FFXA 2GILA 4QXQA 4HS4A 5DYGA 3DUFA 4BVEA 1SIWA 4B3XA 3W5SA 1KGSA 4N40A 5BN5A 5HCIA 5KYUA 2GM4A 4RV5A 1X7YB 1NDQA 3MWJA 3VDXA 1U3DA 1Y7TA 5AKGA 4DBLE 3QGMA 1EQ2A 4UZFA 2HA0A 2LDXA 2Y8EA 3UOAB 2R44A 4JP5A 4K9SA 3N28A 2XB6A 1IHPA 1SVNA 4LZNA 4FI3C 4IQ4A 2F9MA 5IJ0A 3QOXA 1C0LA 3BL8A 1TMOA 4HAOA 1E2HA 3TIGA 1IG0A 4X6XA 1D2RA 3W8NA 4B33A 2XB2A 1DV2A 2WTAA 2ZS7A 3BILA 1XN1A 4UMDA 1G1AA 2BPOA 2W6MA 4BV3A 1LLUA 4A8PA 1PR2A 3WI7A 1USGA 3FFTA 2VDOB 2HYIC 3V8EA 4IIDA 3A1DA 5AVUA 1CHDA 2A5LA 2WJ4A 2XMBA 4REOA 5IHPA 2FA9A 2R7MA 1KH3A 1VPWA 3IV7A 4FGSA 3IUEA 3T5CA 5CM2Z 1X15A 1GNQA 3PEWA 2DOKA 1L8LA 2NSJA 2BGJA 1UAYA 5CLGA 4RJTA 3COSA 1DIAA 4ZAFA 2BE9A 5HCNA 2C0QA 1PKXA 2W6CX 4KN5A 3WGIA 3EPLA 3C8HA 4KNYA 1O8CA 4Y2VA 1AQLA 2BP7A 2GBPA 4ZVSA 5CURA 2JGFA 2KS6A 4N1AA 4OAOA 5I8ZA 1A97A 3JZAA 1MEOA 2GF0A 3IEUA 3KM0A 1Z7EA 2IYNA 2D2XA 2W6QA 3QU9A 1CDOA 2IUYA 1TRKA 5FOXA 1PBNA 4BEWA 4RF2A 3ZCRA 2PX0A 3FDXA 3RK1A 3QU5A 2YJGA 4RMHA 4XM1A 3KR2A 4YWJA 3BTUA 2MT9A 3T9BA 1FNSA 3RUDA 3KV3O 2IXFA 3M3PA 1P17A 4DUZB 2W00A 3GC6A 3GF4A 3E9MA 4JYPA 3V7NA 4AP6A 4J6FA 3OJFA 2N46A 5HMMA 4NYJQ 4DR3B 4JASB 4PQFA 1YDWA 1YB1A 5E3HA 1QCDA 4EZBA 5A6VA 4EKNB 4OI1A 5FEUA 2H4ZA 4FLMA 3GUHA 1RRKA 5JVDB 4DL9A 1DO8A 4A0GA 5GZ1A 1R3DA 4XIYA 5E0KB 5EMKA 2NVUA 4ZHQF 5BQ3A 5I9TA 2PQMA 2O8BA 1PT7A 4KREA 2FG5A 1NXQA 1DC4A 1ZH6A 2C31A 4IIEA 3RVNA 2VJPA 3QHPA 4EAAA 3O92A 3MCZA 3EIHA 1E9FA 5CB4F 1MX5A 5JCZA 3L6OO 1AKVA 2R2AA 3KYBA 1G8FA 1NVWQ 1MD9A 2WM8A 3H3FA 3NASA 4GBJA 1U7WA 3TEJA 1KR5A 2ODWA 2ZIXB 5JW6A 1Q7CA 3RJ5A 2JFBA 4D9BA 2OB1A 4MV9A 4UUQA 4YI3A 3O3NB 2VH5R 5DTJA 4YMIA 1BSVA 1L4EA 3KQTA 1QIHA 3D2LA 2I78A 4PYOA 3LQQA 3I8SA 5JCXA 1QH1B 1VJGA 2C5GA 5K0GA 2A84A 2D5LA 3G59A 2J3HA 3SPXA 1T9BA 3QNWA 4CEJB 4IR7A 5ALGA 2C2WA 4NFSA 3URMA 4O59O 4OAQA 4XGIA 1USVA 3DE6X 2FRDC 2BFFB 1D8TA 4DNQA 2OKCA 3P71T 3BJEA 3AEKB 5L3RA 4MV3A 4N6OA 2N42A 3EQ8A 1RD4A 3I1FA 2PHZA