4RTLA

Complex of escherichia coli dna adenine methyltransferase (dam) with sinefungin and with dna containing distal pap regulon sequence
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
269
structure length
254
Chain Sequence
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSANSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVRRSIRKKVDELLALYKPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA adenine methylase
publication title Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
pubmed doi rcsb
source organism Escherichia coli
total genus 74
structure length 254
sequence length 269
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2014-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4rtlA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4rtlA01
5DXAA 3KKZA 5DX1A 2ZLBA 3VC2A 2ZWAA 1IM8A 1NE2A 4WVLA 3MERA 2BR5A 3PFGA 3SSNA 5LQRA 5DSTA 2YXLA 4GF5A 3UJCA 4AZWA 5D1HA 2OY0A 3BGDA 4PNEA 1RI4A 5BW5A 3SSMA 5DX8A 4OQDA 4QVGA 3C6KA 4M38A 4RVFA 3CGGA 1UFKA 4ER6A 1WZNA 5ERGB 1SG9A 3G5LA 3CJTA 2BH2A 4OBXA 2PY6A 1JSZA 3DUWA 1VP9A 3KQMA 5K0JA 2VDUE 1NBHA 3C0KA 2IBSA 3TLJA 3ERCA 1SQGA 3QOXA 2WA2A 1Q0TA 2N47A 3EVFA 1DCTA 3TMAA 3P9IA 4PINA 3EVCA 4X63A 4Y2HA 2AOUA 3P9KA 5EEGA 3UA4A 3ELUA 1YFLA 4RTSA 3DMHA 4AZVA 4P7JA 2PXAA 1NW3A 5GM1A 1XVAA 3PX3A 2UYHA 2IH4A 4BP1A 2IGTA 4CXMA 3FRIA 1O54A 2AOXA 2GLUA 3CCFA 3HVJA 4QPPA 3GRYA 5E1MA 3KR2A 3VC1A 2G8NA 3M4XA 2F8LA 3MB5A 5CVJA 3ID6C 3UJDA 2AN3A 3LSTA 2CKDA 4M36A 3Q87B 3EVDA 4P7GA 1R8XA 2AS0A 5CVDA 5EMLA 3Q7EA 3P97A 5K0EA 5LQKA 5HZMA 4HH4A 4RYLA 1G55A 3PVCA 3OCJA 4QTTB 5LQNA 4RTOA 1R8YA 4MTLA 2DPMA 4YUXA 4GOLD 4QVKA 2PGXA 5EHGA 1NV9A 3KPUA 5K0NA 4HTFB 5FWDA 3CBGA 3DULA 4HRAA 4KW7A 4PWYA 5E1DA 4HGYA 2IDKA 2HV9A 3O31A 1I4WA 3KR9A 3SXJA 2NXNA 2OBFA 4PIPA 1JG2A 1NW5A 1L3BA 3FTFA 2ZZNA 3LKZA 1BKYA 3PS9A 2HMYB 1KPIA 2Y1XA 2YX1A 4C04A 2ONYA 2P41A 3CC8A 2HTEA 3ELDA 5DM2A 2BR3A 3EVAA 5HIMA 1Y8CA 4OQEA 4DA4A 3LCCA 2O07A 4FT2A 3GDHA 4YMGA 5T67A 3BWBA 4GEKA 2P1DA 2P3QA 3THRA 3TQSA 4RTPA 10MHA 2OXTA 2AOUB 4DZRA 2B25A 3BUSA 1VIDA 3BWMA 3FRHA 5FTWA 3UFBA 3UWPA 1VLMA 2OZVA 3HCDA 4BY9E 4RTMA 4HC4A 1KXZA 1KIAA 4GQBA 4E2ZA 3E7PA 3P2IA 4YV1A 3K0BA 3RODA 5FA5A 3T7SA 3MTIA 2PX8A 1B42A 1YZHA 1RJFA 2P8JA 1BC5A 4PYOA 3AXTA 3FTDA 4PYNA 2IP2A 1G8AA 3D2LA 5EMJA 3FYDA 4DM3A 3QV2A 5CVUA 2CMHA 1FBNA 2ZSUA 3KQTA 3GRRA 2I7CA 2PT9A 3FPJA 4OA8A 4O29A 2AOTA 5DSXA 2ZIEA 2FHPA 4K6MA 1SKMA 3NDIA 2VDWA 3P9NA 4C4AA 2PXXA 3G89A 4LG1A 3GGDA 3SVZA 2NP6A 2JG3A 2ZIGA 5E8RA 5EPEA 4XUDA 3R9XB 2JH9A 4BLVA 5MHTA 2CMGA 3LDUA 4LWPA 3AJDA 4GUAA 4E32A 4ER7A 3B3JA 4RVGA 3GCZA 3HCEA 3PLAE 2UYOA 1P39A 5DRYA 1L1EA 3GO4A 2PJDA 4MHTA 4X60A 1N2XA 3B5IA 4R8SA 3HM2A 4PCLA 1O9GA 3LECA 4RTRA 3RW9A 3EMDA 4YV2A 3EEOA 2ZVJA 1P1BA 5HOQA 4FSDA 4GC9A 1JR4A 3HCBA 1RI2A 3P9CA 1D2CA 5EOVA 4E30A 3GWZA 1EIZA 2AN4A 2PX4A 2NP7A 5EIFA 2VP3A 2PKWA 9MHTA 1ZGJA 3HEMA 3MCTA 3UZUA 5KS2A 2YVLA 3GJYA 5LQAA 3UJAA 3SX0A 3LDFA 4NECA 1QAMA 4RTQA 2UZ4A 3EVZA 2NXJA 1KPGA 2FPOA 1F38A 2I6GA 3GIWA 3MHTA 3NWBA 2XBMA 3KQSA 1INLA 3BXOA 1ORHA 1NV8A 3G5TA 3JWGA 4YUVA 4OX9Y 2ADMA 3A26A 3F4KA 2EX4A 3S68A 2GH1A 2LD4A 3IYLW 5FQOA 3KR0A 3R6TA 3UJ6A 2YXDA 2OB2A 1WXWA 2DULA 1N7JA 5E2BA 3TKYA 2C7QA 1X1BA 1YF3A 1YUBA 3ORHA 4QDJA 3EVEA 3HNRA 4Y30A 3TM4A 5K09A 3NTVA 2AOTB 5DLYA 4RTJA 5FQNA 4GOND 4KDRA 3FUXA 4X61A 3ME5A 2ZWVA 5CVEA 3PTAA 1T43A 2BZGA 1ZKDA 4GC5A 4F86A 2P7HA 3V8VA 4ZTBA 3R24A 3HVHA 5K0LA 3M6VA 3BZBA 7MHTA 4YV0A 3CVOA 5JUWA 5F2NA 5K03A 1YZ3A 3P8ZA 4KWCA 3ER8A 3HTXA 4HG2A 2XYQA 3DLCA 4EMSA 3A7DA 3CKKA 4E33A 3KPVA 4C03A 2K4MA 3FPHA 3OZRA 1FP1D 3ANXA 2B3TA 3GNLA 3C3PA 1KYWA 5DWQA 2E5WA 1WY7A 2Z6AA 2YTZA 3BWYA 3TFWA 3PX2A 1JG3A 2ONZA 4G56A 1PRYA 1NW6A 2FK8A 4DF3A 3I9FA 2GA9A 3OZTA 5K01A 2PWYA 4CKEA 3EEYA 4EKIA 5E9WA 2PX5A 3BGIA 3VYWA 1R74A 2WA1A 1VQ1A 3A25A 4P7FA 2GAFA 2OKCA 2XYVA 5B1SA 1RJEA 3JWIA 4RX1A 2H1RA 3HP7A 4BLUA 3T7TA 4KDCA 4C08A 4OA5A 5DM4A 1KYZA 3FZGA 4RWZA 2O05A 4E2YA 3AXSA 2ZW9A 2ORED 4X41A 3KHKA 4BP3A 4XUCA 1RI5A 2PBFA 1X1AA 5DTQA 2VS1A 2B9EA 3MQ2A 1VBFA 5E2AA 4MWZA 4H0NA 1AQIA 3CJQA 1HMYA 3KQOA 2G71A 2ERCA 4RTLA 2G72A 3G7UA 3KPWA 2ZCJA 3DH0A 3EGIA 2YQZA 3JWJA 5EG5A 3SMQA 5D1NA 2IH2A 3OE4A 4C05A 1X19A 4RTKA 1XDSA 3TR6A 4AZTA 4YMHA 1G6Q1 1XXLA 3TOSA 4YUYA 3HA7A 3DXZA 4JXJA 5ICFA 5KQSA 5K0CA 3AY0A 5DPMA 5F2KA 1WS6A 4FZVA 2Z6QA 3O4FA 4QQNA 5LQJA 2CL5A 3DLIA 5E9QA 5G02A 5EKXA 2NXCA 4CKBA 1NT2A 2BM8A 1P91A 1XDUA 5K05A 4PGHA 4E2WA 5GIOE 3P2KA 2P3LA 1H1DA 3DXYA 3PT9A 4RSRA 2NYUA 5T64A 3SGLA 4CWAA 5HIKA 2ZZMA 8MHTA 2JH8A 1RI1A 2AZTA 2AR0A 3IHTA 5ICCA 1G38A 4KIFA 4CTJA 1Q0SA 1JG1A 1QZZA 2JHPA 2QRVA 2C7RA 4EK9A 1JQEA 3ELYA 1P1CA 1R6AA 3REOA 3OZSA 4YUWA 3KU1A 3E23A 1YFJA 2FCAA 5F2OA 1DL5A 4A6EA 4E70A 2GS9A 4R8RA 5EMMA 5E8JA 3EPPA 4E31A 3L8DA 2WK1A 5IKMA 2G1PA 1EAMA 1QYRA 4HSGA 4OBWA 1SUSA 2IPXA 4M37A 2ZBQA 2ZTHA 3OPNA 3IEIA 3PB3A 3DOUA 1FP2A 2PSSA 4L7VA 4V0RA 4IV0A 2ZBRA 2PWPA 4KRGA 1PJZA 4PYMA 4KVZA 1KR5A 3BKWA 3LBYA 3TM5A 5DTRA 2ZBPA 1FPQA 5DTMA 1OR8A 5C0OE 1DUSA 2C7OA 1JTEA 2Q41A 4XUEA 3UJ7A 3HCFA 4MIKA 3BKXA 5LQCA 2NXEA 2C7PA 2EJTA 2FYTA 5KQRA 5GOZA 4EQZA 3C3YA 5K0FA 3T7RA 3FTEA 3UJ9A 4EVIA 1G8SA 1XCJA 2H00A 1XJ5A 3HA5A 5H02A 1QANA 5HFJA 1TPYA 1HNNA 2PXCA 2I9KA 3OU2A 3OE5A 4AUKA 3FUTA 3PFHA 4PYLA 4DKJA 3LCVB 4PGGA 3QOWA 5EHIA 2OYRA 4PYJA 2I62A 3OFJA 1NW7A 3DTNA 4PYKA 3DXXA 2AN5A 1SUIA 5EMKA 5JR3A 2ZFUA 2XVMA 4PYQA 3JWHA 4V0QA 2EFJA 1ZQ9A 5HIJA 5T6BA 2QY6A 2AVNA 4PIMA 3FTCA 2QRVB 4U7TB 4U7PB 3U81A 5CCXA 3C6MA 3O7WA 2BR4A 3E8SA 1R00A 4LWOA 5FWAA 2ZIFA 4QDKA 2O57A 5HEKA 4C07A 1UIRA 1WXXA 4RV9A 3LX6A 5EKUA 1ZG3A 2QM3A 3K6RA 3LL7A 1IY9A 3NJRA 3KQQA 4M7RA 1JQDA 2YUIA 5GWXA 3M6XA 4KIGA 1UWVA 2EJUA 2G70A 3MAGA 5EGSA 1L3IA 3TPZA 5DRTA 3H2BA 1KPHA 5CIYA 4DCGA 2AOWA 1I1NA 2JHAA 3E05A 3HVIA 5IH3A 3KQVA 1AQJA 3LKDA 1F3LA 2IBTA 3KQPA 1Z3CA 2P35A 5E1BA 4CKCA 3GU3A 5P8WA 3KR1A 4IKPA 5LR6A 5DX0A 4R6XA 5K8VA 4C06A 5EIWA 2FK7A 3X0DA 3M6WA 3A27A 3EGEA 4FGZA 3FPFA 4ER0A 2Z6UA 2QYOA 4YUZA 3MGGA 3OFKA 5LSAA 1WG8A 3RIEA 5M5BA 3ELWA 5K0BA 3UJ8A 3LDGA 1AV6A 3EGVA 4LECA 4FT4A 1D2HA 3VSEA 1JSXA 5ICGA 5HIIA 5C9ZA 2VZ9A 1VPTA 3UJBA 1SQFA 2AVDA 1JG4A 4DMGA 1VE3A 3HVKA 2QE6A 3FUWA 3LHDA 5ICEA 3A7EA 1EG2A 1TW2A 3M33A 1JTFA 3HCCA 1RJGA 3NVMB 1KHHA 1ZHFA 3DR5A 3WSTA 3M70A 1X1CA 2HWKA 2IIPA 5U4XA 1AF7A 1FJXA 5FHQA 5K0GA 3THSA 5FCDA 4ER3A 1M0EA 2JHCA 4ISCA 5KVAA 5KYGA 1EJ0A 5EZSA 5E9JA 3NMUF 1EJ6A 1L9KA 1I9GA 1R18A 4RTNA 3G8BA 5EZQA 2PVCA 3I58A 2V74B 3R3HA 4B17A 5GIPE 2GB4A 2PV0A 1RJDA 1EQAA 4HTFA 5GP1A 4GOOD 3AWIA 1D2GA 3M6UA 2O06A 2XVAA 1JQ3A 3EMBA 3EVGA 4ATNA 2P40A 2P3OA 3B89A 5CM2Z 1KP9A 3G8AA 5C1IA 3MCZA 5GM2A 1M6EX 3OU7A 2IH5A 5GINE 3B7PA 1QAQA 3P71T 4MQ4A 3SSOA 2R6ZA 1MHTA 3FUVA 4A6DA 1XCLA 4XCXA 3FPGA 1BOOA 4EKGA 5CD1A 4ER5A 4FSXA 3DMGA 4FP9A 3IV6A 4PONA 4F85A 1NW8A 4QTUB 5CCBA 2HR1A 3HA3A 1IXKA 2FRXA 2XYRA 3R0QA 3GRVA 3TRKA 2PLWA 2ESRA 2AOVA 4X1OA 3GRUA 5DM0A 5FADA 1V39A 1RI3A 3I5UA 2YR0A 3EVBA 1X1DA 5FUBA 1VP3A 3NVKI 2O0LA 4FR0A 4P7KA 1XTPA 3BWCA 3I64A 3NDJA 3A4TA 1M6YA 5DXJA 1VL5A 2R3SA 3KQWA 4P58A 3TKAA 2VDVE 3OU6A 4POOA 2CWWA 5HILA 3UBTA 2V7EA 5BXYA 2P7IA 3UA3A 1ORIA 1G60A 1MJFA 1NBIA 2OPBA 5FHRA 5E1OA 3KQYA 2IFTA 3NW9A 4IWNA 2KW5A 2OO3A 2UYQA 2ZULA 1QAOA 3LBFA 2H11A 3BT7A 3BGVA 4E2XA 4CTKA 5DM1A 3FYCA 3GRZA 3P2EA 4AZSA 5CVVA 3LGAA 5EEHA 1N7IA 3LPMA 4FS8A 5DT2A 4RVHA 5EQJB 3GXOA 2UYCA 1XDZA 4GOMD 4HGZA 2GPYA 3MTEA 4RVDA 5EC8A 3G88A 2BM9A 5FA8A 2PT6A 3G2MA 5EVJA 4AX8A 1SVUA 1ZGAA 2YXEA 2NNWB 2HNKA 3HCAA 3V97A 4QQKA 4PYIA 3DP7A 4DCMA 3B3GA 3LCUA 2B78A 2B2CA 2Y1WA 3I53A 3T0IA 3ER9A 2EG5A 2ZZKA 3B3FA 2PX2A 5FULA 5BP7A 5LQUA 4PCAA 4Z2YA 3G2OA 3SM3A 4F84A 2OB1A 4QPNA 4GBED 2A14A 3DMFA 4R6WA 4DQ0A 3FPEA 5CUQA 5BW4A 1O9HA 1YB2A 4BLWA 3FUUA 4UOEA 2JJQA 3G2PA 1U2ZA 4WXHA 1NKVA 4IV8A 4R05A 3NWEA 3KPJA 1TW3A 3G2QA 2IDJA 3SR4A 1L3CA 3CJRA 3KPYA 1BHJA
chains in the Genus database with same CATH superfamily
1EFKA 1U3CA 1WMEA 1FB5A 2J6CA 3T4PA 3DMPA 4OOFA 5K0FA 3CXUA 5ED0A 1N77A 5KTRA 5F23A 1F8UA 1J39A 1AKUA 3BGDA 3HVRA 5EHQA 1W88A 1II8A 4PVCA 2PD3A 1BWQA 3VO2A 1SG9A 1X7XB 1PN3A 2WC1A 4HNHA 4IIJA 5ADUS 4OHZA 1EUZA 1JT9A 4U4AA 2FSIA 2H2IA 5SY6A 1NMXA 4ARCA 1A7KA 1SULA 2WINI 5FLKA 1OKKA 2MSLA 2P6PA 3BAZA 5CLGA 5F12A 1FDRA 3B2NA 4X63A 2H2GA 2BFDB 2QU7A 4YV7A 5LNK1 3ADBA 4II3A 3QKUA 2X5JO 4LOKA 4REQB 2B7BA 2WFAA 3MRSA 2PHZA 4K9KA 3W5JA 1Y4SA 2PXAA 2R6HA 3FDZB 1M6WA 1J8YF 2C78A 3PG5A 1V41E 4W5JA 2FEMA 1E0SA 5IHPA 1H6DA 3J7AC 1VM6A 3VHXB 1W96A 1J0EA 1HQKA 2PX0A 2VAXA 2O2SA 2VJMB 1WSDA 3PWKA 4QM7A 1SCKA 3ZOZA 8GPBA 2VPQA 1L8AA 3LSTA 5CH3A 5JECA 4NU0A 1XZHA 4ZU3A 2HEGA 3AHEA 4RQAA 2EV9A 5EMLA 5CVDA 4AJLA 3KLPX 2VYND 3PYMA 5A5GA 4IGKA 4BLRA 4V38A 4W63A 5EXXA 3RLFA 4OHCA 4GSKA 3LHKA 1SKBA 4C30A 4J0EA 1S2LA 1T2AA 1FFSA 2FWPA 2IXDA 4F21A 1W4RA 4X91A 4F6RA 2R8YA 1SU7A 2B20A 4NIMA 2EZ8A 4RCZA 5CTAA 2ZB3A 3MXTA 3ITDA 4CTOA 2PUCA 3DQZA 1V25A 5IMSA 4UXHA 2IHTA 3FLMA 4KQ6A 3ZU2A 4I9HA 1I1HA 4M8SA 5AICA 1P7ZA 5AOAA 1GPJA 2JVIA 4EY7A 4MYCA 2P41A 4JNCA 4NICA 3QNWA 4FW9A 4TMVA 5FFMA 4Q3EA 1AH2A 3K5PA 5FBRB 2E4AA 1K9VF 1TKCA 1WUIS 3AM4A 4OPMA 1EFAA 1HPLA 2N75A 4FKMA 4FT2A 2HRZA 2E4VA 1PV1A 3LMKA 1XT6A 3GL9A 4EGQA 1CRWG 4K9SA 1T1GA 4RTPA 2H2AA 2D1QA 1S2GA 4US0R 4E14A 5I45A 2NTJA 2VSFA 4MB6A 4DDHA 1W1IA 2JA1A 4GZLA 4TS4A 4ZOBA 2YJGA 4BY9E 1JDBC 4U3JA 1HV8A 2A9JA 1PO7A 2VEDA 5J4VA 3CH4B 3KXDA 4OV6B 5HXAA 3MIIA 2QM7A 3K0BA 1F6WA 2OVBA 4OSEA 1TUIA 3TW6A 5IX8A 5JXGA 4OXKA 5LXTB 3KUKA 1G8AA 3DTVA 2QPTA 3KAJA 2XOEA 2PT9A 3VR4A 1L5OA 1R66A 4LZOA 4I0WB 4PN3A 3HXPA 3A6LA 4IZHA 3ZWXA 4BWVA 3NDIA 1G19A 2A1UB 3AIOA 1J07A 5DYYA 2Q1SA 2H17A 3AZOA 3E2MA 4DVGA 1VOTA 5IKPA 2OR3A 5ENZA 1DFHA 1YQQA 4YCCA 3DV9A 3H75A 3QYFA 3B1ZA 1AUVA 4GUAA 4NOLA 4OEHA 4DUGD 3BMQB 1EHYA 1ZM2A 3NONA 4JELA 3WL5A 2AYYA 4G4SO 1Z39A 2CVOA 3GO4A 2CXRA 4JL5A 4L28A 4QUKA 4X60A 1M1NA 5ELLA 1OXBB 2QN1A 3P1JA 1NBEA 4QJIA 2B0JA 3UC5A 3V8EA 3H8SA 2FKNA 4AJ1A 4RTRA 1W19A 2YRFA 1KI3A 1P1BA 1MIOA 2ZREA 4MV4A 1IM2A 1G8MA 1W0JD 4CQLB 1CJSA 1RI2A 1D2CA 4OHRA 2QRQA 2PUWA 1Y7LA 3DTTA 2I4LA 5AVWA 1GCIA 5EIFA 5LFAA 3OHMA 1S7GA 1UBSB 1L5VA 3GB9A 4HWRA 3ZD9A 4S1WA 1QR2A 1T8YA 1WP4A 1YVRA 4OXYA 5LQAA 1RQNA 3L07A 4KN5A 2D5CA 3BBLA 4WBNF 3R2JA 4WXYB 1Z5OA 2QL6A 4HFNA 3PGVA 4MV1A 4NEQA 2SNIE 2BN4A 3ZIUA 1HL3A 1PEDA 2AXNA 6Q21A 1I3KA 3Q3HA 1KC3A 4L7QA 3G3EA 5G0VA 3QY9A 4FMBB 1NC3A 3F4KA 4D41A 1JLLB 1TX4B 2GPNA 3I2KA 4IMIB 2H4ZA 2IK8A 3ZHCA 4EUSA 2QA5A 5LJLA 1NXWA 1UMCB 2XKKA 1PR6A 2P9EA 2G25A 1WPGA 2IYNA 3ORHA 2V9PA 3HNRA 4QDJA 5LZ7A 4D6XA 3NTVA 2AOTB 2V65A 5HGXA 5K6AC 3RVOA 3ME5A 5HTOA 1D7OA 2OBXA 1T43A 2PA3A 4F86A 3CZ9A 2RSLA 2MMCA 2O4UX 4FYYA 4XB2A 1IZ9A 3V8VA 1OMOA 1KI4A 4KIJA 4IUBS 4BBJA 2MYNA 2ZRKA 2ZE5A 3VPXA 4OF4A 2BFAA 3MYYA 5MFPA 2XYQA 4UBKA 3THWA 1X1QA 4HDKA 1A7AA 1S3GA 1XZQA 2GZDA 2VPIA 3DMTC 2GWHA 2FEPA 4EYGA 1Y9ZA 2DUUA 1XQYA 1YIAA 5TY0A 1DT3A 1EUCA 3U0BA 3VAYA 1DAOA 1SR8A 4J2OA 5LP6B 4IDPA 3W2HA 1TAHA 3IXMA 2B2XA 4CQMB 4B83A 1PR1A 5BSKA 3OSZA 4I1YA 5JJKA 1TVCA 4WHMA 4UEJA 4Y1FA 1R74A 2MSDB 4CFSA 3A25A 3JV7A 2QN7A 3DXFA 2UUBB 3L8YA 2WG2A 2QJWA 1HE2A 1UQRA 2PLFA 2XHZA 4WNAA 5I01A 1VCHA 2GAIA 4JIMA 1D4ZA 1KYVA 5REQB 2DTDA 4WTOA 4V0NA 4N9WA 3ETLA 4KLNA 4BV8A 1QHFA 5IXJA 1RQRA 1SC9A 1U0OC 2ZRNA 1SQ5A 2NVWA 1B8OA 2IZ7A 2P8SA 1P5HA 2ZW9A 3ECSA 4G3XA 5EIBD 4P5PA 3VHRA 1RI5A 5C37A 2HU5A 3FVTA 4OD0A 4GXRA 2GESA 5TS2A 1P2FA 2QVZX 3KYCB 3C6BA 3OUTA 1Q83A 4H0NA 3IMEA 4CT0A 2O2ZA 4B2YA 1BROA 5I48A 1DO0A 1HDXA 2JJ2A 2ARKA 1JS1X 2FWIA 4UJ5A 5EG5A 1ZVVA 1XHFA 3MLBA 3BTVA 3OE4A 1XZKA 2F1JA 3IEVA 1U81A 2FR1A 2PZEA 2G5GX 3AERA 2Z9BA 5KBYA 4BZPA 5F2KA 4MV5A 4X65B 1CUIA 2CL7X 1YB4A 4K03A 5CGZA 3ZNPA 4RZIA 1JECA 1BCSA 3D4PA 1QFYA 2CDNA 2ECQA 1ADCA 3JQ6A 2IEIA 4C0SA 4QT4A 2V4MA 1X2EA 1APBA 1JYEA 2HU7A 4XYGA 3SGLA 1U3GA 3AEZA 4M60A 1WF6A 5JPIA 2J48A 1W4AA 2O3TA 5IJ9A 2GYUA 3A1UA 3H8JA 3TN7A 3OIYA 4KIFA 4MWEA 2RHHA 3H2ZA 3AVOA 4RKRA 1P3Y1 3GGPA 5F5XA 1CZOA 1ZJYA 1EFCA 3O8DA 3WBBA 2COKA 4BC1A 5KOHB 4XLTA 5L51A 3CNBA 3NXSA 2IPOA 5TF0A 1RU3A 4E70A 1U11A 2O8BA 2HIGA 3MZ0A 5ABPA 1NNSA 3CZAA 4B3BA 2PGLA 1PVVA 1U7TA 3GRCA 2OV4A 2ZDHA 5EE5B 2H3HA 2SKEA 4C0KA 2IU3A 4FC6A 3VGPA 2HH9A 1PW5A 1PKXA 2AQIA 3ITKA 4JUFA 4TMKA 4UUMA 4WKGA 2OQVA 2PSSA 4ALKA 4C2AA 3ONEA 2CXTA 1K7EB 2CHGA 1PJZA 2ZBRA 3FPKA 3R23A 5EWMA 5BURA 2DHCA 4O2BB 5F77A 2QW0X 4K05A 3OT1B 3W8DA 1WMAA 1Z82A 2A58A 4QX6A 5FLXA 3QEOA 1XWWA 2O8CB 4P82A 3WGTA 4KE7A 2VHZA 4DV2B 3N74A 2ZR9A 5KQRA 4JNKA 1Y34E 1A8QA 1B6SA 2ZE6A 3EIXA 1YT5A 3IA7A 1G16A 3K30A 4HP8A 4WDRA 3B2QA 5L7YA 1POWA 2VYFA 5IDQA 1N5DA 1QANA 4M6WA 3W2EA 1Y3FE 2DBYA 4YCAA 2DKOA 4C7VA 5ALYA 4AQYB 2OP0A 4LJRA 3OU2A 1GG9A 1P1JA 2IV2X 1P4SA 1ZH6A 1T3GA 4P08A 1Y6FA 2EYQA 2I33A 5J3JA 2Q3FA 1ORWA 1SNYA 1G8JA 4NATA 1U2RA 4PAOA 4EQ6B 5JSZA 4G5YA 3ONVA 3N8DA 4YJFA 1G20B 1UKEA 1XCOA 2WZQA 3P5SA 2VVTA 4U7TB 4ZMBA 4ND1A 2HWXA 1B4DA 4JOBA 1K66A 1EFDN 1UPXA 2YQ4A 2C42A 4P3OA 1NN1A 3V9PA 4IVPA 1UIRA 2WMYA 1WXXA 3GMSA 1ZD1A 4RV9A 3B78A 1CE8B 4E03A 3KVRA 2ZCUA 3U3XA 4CMEC 1QZXA 2WP8J 4FCCA 5EGSA 1SM4A 2FPIA 2AOWA 1QG2A 1RMQA 2IEYA 4FHDA 4Q4AA 3T1NA 3QHQA 4NH4A 3DQPA 3MCAA 4Z8YA 4QJ4A 4A6XA 4JS0A 2ECPA 5LOVA 4Y7DA 4CM9A 4IR7A 5G0UA 4FFPA 2C83A 4NYJR 1DDIA 4D4HA 4ZN6A 4AMGA 3FOFC 2XUGA 4K8RB 1GUDA 4GXQA 1QRRA 2E5FA 2P90A 4MEJA 2UZ3A 3B60A 1EB8A 2X3UA 3PHBE 5JW6A 1AQNA 1GYPA 1Y8QA 4G6ZA 4N6NA 2J7PD 4ZVTA 1VCIA 2G04A 4UMEA 1P6UA 1RJWA 3S0JA 5A3QA 3L6EA 3C43A 3Q40A 3VSEA 1M75A 3AHHA 1RM0A 2VZ9A 4B2LA 2O1SA 1OGIA 4P80A 4W6ZA 5LQDA 1ZJ4A 2H4XA 3ZVMA 1M33A 2BY4A 3IAUA 1BEUB 3MCVA 1ZC4A 4EJ0A 3GI1A 3UM9A 1E0KA 1RVV1 4D8TA 2O3RA 4PZ0A 1Y8RA 4AM8A 2J4CA 4U6SA 2J5KA 3F3SA 1TVKA 2VUSA 1N5IA 2YYSA 4WBXC 1I5EA 4V3BA 4ZDJA 1GPNA 5DMHA 3M4JA 4A9AA 1KHHA 1P5ZB 4D45A 3LUJA 3JCZA 3OUZA 4DIFA 2R84A 4WESB 1DBWA 3AY7A 4OH7A 3PIDA 3WYFA 1HRDA 3C87A 4G0WA 1VG8A 4MMXB 1EFVB 1FDTA 1M6HA 2I66A 3UMFA 4EO4A 4YJDA 3VMMA 1W5SA 3CM0A 4W5TA 1D2AA 3CXRA 4RPGA 4RZUA 2JK1A 1ZD9A 4B3HA 4B17A 2V74B 1AXEA 3DFIA 4D82A 5CFPA 3PJRA 1HG0A 1CWUA 1TQ8A 3CB4A 2CEAA 2WZDA 1QC5B 2W7TA 1O97D 1T6NA 5KQGA 3KSUA 2REXB 3KKNA 3RFTA 4B43A 3CMMA 4URVR 1JQ3A 1ZH2A 4JP1A 1ZHOA 2P40A 1TPZA 2JFWA 2PVPA 4P0TA 4D9EA 5C1IA 1R7RA 3H42B 4MARA 1PLLA 1T2CA 1C8VB 1SELA 5IDVA 1XMQB 4J90A 1FLDA 4BFUA 2IOFK 2V6MA 5DTEA 1GUAA 4JWKA 4CR7A 3H9GA 5JJBA 4CMBA 4C2UA 3AEUB 3IVRA 1IN8A 2PU5A 4N0QA 1GZ7A 1UM9A 1EZ4A 5F64A 5IAGA 3SR0A 2Q9UA 4Z49A 1E18A 4RELA 4D3XA 3OLCX 1ACMA 1BJRE 4XTRA 1ETUA 1GPLA 4FILA 3OTOB 2HR1A 1E3JA 3L8ZA 1S0UA 2LWIA 2ZITA 4YMSA 5JVDF 1ECJA 1HF3A 1LD3A 1C7QA 1LQTA 2WVJA 3GGJA 2IEZA 3SQOA 5FADA 3I5UA 3D64A 4ZCSA 3S1LA 2O5EA 3MJRA 1O2DA 2ZJ8A 4FOSA 3TRJA 2HSWA 2ZB4A 4WJLA 1B76A 4OHWA 5G41A 1IM5A 1XTPA 1Y1PA 3AG6A 1OLXA 4BNUA 4V1CA 4PTYA 3A4TA 3BL8A 4LCJA 5G3ZA 3QVTA 2VDQB 2PUFA 3UAZA 2P9GA 3L01A 1HM5A 4E4RA 2D5LA 4UMDA 4AMBA 3DSRA 4NYMQ 1FMFA 4EH1A 3EZGA 2HRQA 4MP3A 5JY1A 3BRSA 2H57A 2BZSA 2Q3MA 3MNFA 4OHOA 2VXBA 2OO3A 3DFKA 3R5HA 2QVXX 1QP7A 2I6FA 2OUIA 3ZCTA 1IEXA 3ORQA 4TUYF 2YNMA 4JD5A 4JUAA 3LHSA 4DSNA 2BKUA 1PWXA 2HA4A 4U02A 3A4MA 3G9TA 3JTMA 4ZPXA 4HQKA 2BD0A 3GXOA 4Z0TA 4D9KA 1B14A 4ENTA 3GUHA 4DJJA 3ZHXA 2FDCA 1G8FA 4D26A 2WICA 2Z8YA 5KWSA 1PVDA 3OH8A 3FX2A 4FYIA 2E18A 3GFQA 4WZZA 1Q0UA 1OI7A 4EHFA 4QASA 5B3JA 3BK1A 5DN6A 1VKNA 3T0IA 4IHQA 2ZZKA 5JAQA 3ZWBA 3TLKA 3ZWOA 4TQAA 1KAMA 3HUUA 5JXJA 2MHCA 3IULA 4MYUA 4GLBA 4AMVA 2CZGA 3VI3B 5IM4A 4CIXA 3UGKA 5KC8A 1AE1A 2R7AA 3GLFB 3JQAB 3ZZNA 3H9UA 3HK2A 1DQSA 3O75A 721PA 2A35A 4BQEA 4XARA 3RABA 3KPJA 3A6GA 4MVJG 1Y8ZA 3PHGA 2H2DA 1B6GA 1T24A 3S3TA 4RSHA 4K2AA 4WVLA 1W9MA 2X42A 1N1GA 4FGWA 2BR5A 4X1YB 3V1YA 1XOIA 3MTAA 1KJZA 1UKBA 1RI4A 4HO1X 1GTRA 4MWBA 4DG8A 3C6KA 3FVVA 4L4SA 3AFNA 4E13A 4OB6A 1M83A 1WZNA 3CBQA 1VPWA 1SUEA 1QCZA 4IIHA 1I32A 4IDAA 4MP6A 1A9ZA 3BS4A 3UFXA 3FG9A 5LYJF 3ERCA 2DHRA 3H6KA 3IAS1 3QOXA 4WCFB 1YE5A 3IESA 3EVFA 1LY1A 1O7JA 3RVDA 4I8IA 1RZUA 1HRKA 1NXVA 1SD5A 2DQ4A 1K4YA 4K6OA 1Z0ZA 4WK4B 5GM1A 5T3UA 2PFKA 3RYIA 1ULAA 3SYRA 5E7IA 3SLGA 5KOJA 1OGYA 3FF4A 3HVJA 2XGGA 2WU4A 1Z6QA 2NSJA 3LC7O 1Y3BE 4JT4A 2A5JA 3CR8A 1HE5A 2K5UA 1TCBA 4EITA 3ASUA 3O26A 4F3CA 4IDFA 4RZXA 5ISMA 1PGQA 1N0UA 2WJ6A 1SZDA 2P4HX 2ATEA 1B7GO 1MZVA 2R65A 1KXJA 1VYTA 2EL7A 5D6NA 5FF9A 4G25A 1R0YA 1N32B 1OASA 4G0UA 2FG5A 2ZB7A 5ALSA 1J24A 5IN5A 5F9FA 5EHGA 5FAKA 4OOEA 1M8FA 3M1YA 2O23A 3B12A 2IDKA 3EF1A 4KGXA 2NXNA 2JGEA 3DHNA 2X0DA 3UHAA 1NW5A 4S12A 2Z9DA 3H6GA 2K87A 3PF8A 5K8UA 4EY8A 2ZQZA 4DR6B 3Q8XB 4C04A 4TXNA 4XA8A 2WJPA 3CC8A 3RANA 2HQSA 3DDOA 4Q4JB 3TK1A 4FKBA 2WWYA 2BR3A 3W3AD 2EKLA 3MYRA 4KNYA 3LDAA 1HETA 4R68A 2NYAA 1YR2A 1XNHA 1O03A 3RROA 1MOZA 2ZRFA 4ZT4A 4M0LA 1CIJA 3DCNA 1XXHB 2PDAA 5AVUA 3B3QA 4UNRA 1IVYA 3B1WA 4B4WA 4QGFA 3X1KA 1AQYA 4C87A 1P0IA 2DLNA 3LLMA 3H86A 3R7LA 1CV2A 2KB0A 2Q5CA 2YASA 3MT8A 3CG4A 4I4LA 1G21B 2V7QD 2P6UA 3FSEA 3OP4A 5AK4A 1T1SA 1ORVA 3VNVA 2AI3A 3M4ZA 4MCAA 4OMUA 4U5XA 3UCFA 4IZ6A 3UAOA 4F71A 1KI2A 3DGFC 4YJGB 4DMFA 1XTSA 3D31A 3EZXA 4EPWA 3IIKA 4PYNA 1NMZA 4LF7B 1JSRA 2R5WA 1L4GA 5C1DA 1E6WA 3F6RA 4QYSA 1F4PA 1AOXA 4LDQA 1FZTA 3OAAA 4HADA 1RWNA 5IZCC 4U7JA 3BH0A 5F7OA 3QFSA 4H7FA 3FPBA 4HNGA 3MINB 4I5GA 1R50A 4FONA 5LL6P 2CFOA 3R9XB 3Q7PA 1SURA 5JSUA 4HDMA 3AR8A 3I2JA 1PK9A 3FOAA 1JA1A 3QSYA 4L5JA 4HQFA 4C4SA 4MHTA 4A23A 1K8ZB 2NZ8A 3VMFA 2CNNA 2COUA 4U7DA 3RVPA 3RW9A 3EEOA 5CVTA 1AXGA 4DSUA 2EDCA 2I80A 4I4NA 4EKDA 4EKYA 1UJBA 3OA2A 1OUMA 3LIPA 1N5MA 4O4IB 3P7MA 4W7HA 2NP7A 4HFRA 3U31A 1SCBA 4BVBA 1MKYA 5JISA 3WWPA 5TLSA 5CB4B 1R4NA 1OPRA 1LDEA 5E3IA 5I5EA 1LS1A 2BFEB 2PLRA 4MUNA 1S2DA 5CP8A 2PD6A 1W5TA 4J91A 4NECA 2WQZA 1P2BA 2ZTVA 3KOOA 4RJKA 5GVRA 2BF4A 2X0KA 4YAJA 4J03A 4WW0A 1RHJA 2ZE8A 3QVXA 3R0IA 4LJSA 2WD9A 1M1XB 2HLDA 4MB0A 3T9DA 1Z07A 1JXMA 3DOJA 4DLBA 1LK0A 4B4UA 4KLRA 5BO5A 5H4GA 3KYDB 3ZW9A 3RVMA 1T0IA 3L0SA 2GEDA 4QO8A 3L1HA 3ROPA 5E2BA 1N7JA 5K3FB 4EGJA 1U3TA 1I2CA 1PYDA 3DAOA 2JLWA 3LRTA 1V8DA 2NX2A 5AM4A 4GWGA 1QU3A 2EW8A 1BGVA 3K1ZA 2O6HA 3WMRA 1KI1A 1YZNA 1SU6A 1EX7A 1L4YA 3ZWCA 4BB6A 4JI1B 2XUPA 5K0LA 4QXAA 4DGSA 1DRUA 2PYIA 5F1YA 3I5AA 1GZSA 2ZRIA 2ZSJA 3TLEA 3ZGXA 5HUHA 4Q4HB 4MR7B 5CA1F 1KK1A 4FGLA 5FTNA 5J2UB 2VWHA 5KVVA 2VT7A 1F2TA 1KMNA 2VA9A 1A9TA 3ASYA 4JJIA 2PMFA 3AIKA 3AQIA 2CMDA 1JDZA 5AUQA 5BNWA 5IEJA 3BERA 3TFWA 1XQ9A 1TQHA 4XQEA 5FPQA 1AN9A 1XD2B 2VHUA 5CLHA 1GTSA 5HM8A 5AJXA 2Y27A 4B31A 1C7JA 1NYQA 3PDCA 1P4AA 3OVMA 4DR2B 5CD9A 3WK4A 3OOEA 3UMJA 1N9ZA 5KX5F 1GNSA 3JQQA 3SIWA 5AJVB 3FTQA 5TGDA 5JHHB 2XNKA 1XFDA 4PFKA 5C4MA 1MO2A 2YJNA 5ALMA 4L3VA 3ND9A 1CLEA 3HB0A 4KNVA 3KXLA 1DCMA 1WQ3A 3N5KA 1S5PA 4FGKA 4NOJA 4OSOA 3SS9X 5FJJA 3NHAA 2VNAA 1DWQA 1B43A 4L6IA 3H2IA 4MRSA 4XUCA 4W9MC 2GNAA 1Y1RA 2OHVA 3MILA 4HQLA 2PRYA 1F51E 4DR7B 1AKNA 1XEWX 1ZMOA 2H9IA 3LBAA 5D6OA 2OXCA 5DLPA 1FSSA 2ZCJA 1CY8A 4B6RA 1J2EA 1JKXA 2XMZA 3KXKA 1QOPB 1M73E 2O1EA 3C15C 4UM9D 1TIKA 1FFXB 2Q3HA 4EATA 3RK1A 1JBKA 3JR7A 3RT1A 2GDJA 1B1CA 1QYXA 4KKXB 2FN4A 4MQ5A 2JFVA 4GBJA 3BRWA 1V43A 4XFDA 5D84A 3DBIA 2PUJA 2VJOA 3DE1X 3IFSA 4QQNA 4BDTA 3DTVD 3ZV7A 1V16A 3ZBTA 5EKXA 2HT1A 2F2TA 3GN1A 1XDUA 1TMYA 2QB5A 2MYTA 4GW3A 4D4JA 1FX0A 3NGLA 5CBKA 2C2KA 2Q7XA 4Y1RB 4CWAA 3DLHA 2I0FA 2FXVA 3HWRA 3QBDA 4HAZA 4M3NA 4DA6A 1W2WB 4DCPA 4GO1A 5IC4A 3N3BC 4I5IA 3VPCA 4CEIB 1A5BB 2HHHB 1F12A 1CRZA 2JHPA 3LVFO 1QG4A 1VRVA 3OPYI 4UMFA 1USVA 4MROA 5EZYB 3RWBA 3RSSA 3C45A 3R6DA 4YPVA 2RGEA 1OXKB 2AMYA 2QTHA 4CLXA 4AJ4A 1XV5A 6GPBA 4P3NA 1LBIA 1RQPA 3Q3IA 3TW0A 5IWAB 2GS9A 4MLZA 4YQZA 2P2SA 2BFNA 3ITEA 1K08A 4UM5A 3I61A 1DSSG 5JATA 1NAIA 1ABEA 2J4FA 4H16A 1GV1A 3L43A 4M37A 4IIXA 3M3HA 4ZOLA 2AXQA 3TJZA 1NWHA 3ODPA 4V0RA 4EYOA 4D98A 2GX6A 5L53A 2GOYA 2H1HA 1U02A 4FMCF 1XO1A 2Z8YM 2FN9A 4B45A 1R37A 2PMCA 3I04M 1QIIA 2PZMA 4MIKA 4D0RA 5LQCA 2WFZA 1Q14A 4E5KA 4IMJB 4MWCA 5ITWA 3LT0A 1JGTA 1WBDA 3HABA 4I1RA 4QRIA 1N8NA 3BILA 4WLNA 1QVZA 2ZSDA 3KHSA 4CCYB 1VHLA 2Z57A 3WYBA 3DHYA 4ZPJA 5A6SA 2QSJA 1FDOA 2DBRA 3C3BA 2C9DA 1KK0A 4LDJA 1K63A 3K6SB 3TEJA 2BI8A 1RQLA 4NF2A 4ETWA 3DE2X 4DMHA 1M2WA 2Q8PA 1QO9A 2OQIA 4UXIA 4XQ9A 3DW3X 4EX7A 3EIHA 1ZQ9A 1JN0A 3S2SA 5HIJA 1A95A 4R69A 2Z8ZA 4DBVO 3PJFA 1XJ0A 1U5BA 3UH0A 1PIWA 4JYAB 1RKVA 3Q5DA 4GRIA 1EJ2A 4XLLA 1NP3A 1RIFA 4WY2A 3H13A 3R3SA 3U3ZA 3HKEA 4RLHA 4F5WA 2HWYA 3PITA 3K6RA 4TYQA 2WU8A 3MTQA 3R1IA 1Z08A 5DIFA 4BUCA 4K1XA 1FOEB 1XP5A 4LCBA 4I81A 2ZS8A 4QT0A 2UVPA 4X24A 3OZEA 4QXRA 3E05A 1M2FA 2BGUA 3CURA 2B61A 4HS9A 4W5WA 1CD5A 1K5HA 1JZSA 2ZYVX 3F9RA 3NR2A 5JCJA 3RC2A 3URMA 3ZY5A 2JZNA 1J09A 1D2MA 3R8XA 4IKPA 2G09A 2ZS7A 3O7MA 2GA8A 4MR8B 4C06A 3FH0A 1MA3A 1WZUA 3OF2A 4FGZA 4KQJA 4Q7MB 2EWMA 2YY5A 3VTAA 3G2HA 1OV4A 3OSUA 4CG2A 4M7PA 3ZLVA 4UHBA 4LECA 4FUTA 5CXSA 5JADA 2O7RA 9LDBA 3VKHA 5C9ZA 1VPTA 3F6CA 3LGSA 5A9SB 3HRHA 3M0EA 4RQUA 5JXIA 4B74A 4M49A 3N2GB 4AMZA 1YH3A 4Q3AA 1Z0IA 3PC2A 3QPBA 4DM7A 1EG2A 2R1TA 4HYQA 5E6RB 4H7JA 5BSWA 1QCYA 4J1TA 1OLSB 4RK5A 2GZ2A 5FOSA 3CYFA 1CRLA 1GUYA 3WQHA 4AG3A 1U31A 4MPRA 1X70A 4NZYA 1KTVA 1J5XA 1U2GA 3IHKA 1MGOA 3N7UA 4IHJF 4F56A 2VNKA 4HLNA 3RTCA 3WYCA 2QN6A 1FRZA 1U9IC 3QUTA 2MR5A 4HQ0A 4P1ZA 3STTA 2FZEA 4F5YA 5H3CA 3P96A 1NVVQ 2JRCA 1RAHA 4V2IA 5BUQA 3D4LA 4G67A 4XPZA 1G66A 2PKYX 3AY6A 1NQXA 3PQCA 1DQRA 1C41A 4ML3A 3W5SA 4GOOD 1OBVA 3PQ8A 2FMIA 1Q0QA 2R5FA 3TCXB 2QL9A 1KO8A 1C2YA 4LKOA 4LC0A 4XFKA 4BO3A 1SUWA 1FYWA 4MRAA 4FD2A 4WK6A 2Z30A 3JR3A 4BFZA 4U2FA 3TBFA 3F2IA 3OU7A 4IX9A 3RASA 1QAQA 1YJQA 3CV3A 3PKJA 4AD8A 5HRAA 1MB9A 4F2WA 4QBGB 4ROTA 4U9UA 1US8A 5K3AA 2MOKA 4PX2A 2C2WA 1YR7A 4KBYA 2IYEA 3DKKA 1CDEA 1XNGA 2W0MA 3F8TA 3I05A 3QWAA 4GNKA 4HEQA 4MXDA 5HCUA 1NW8A 1SHZA 4K0KB 3C7DB 4XR4A 4IIFA 2ZATA 3P94A 1IEWA 3DBVO 3BSWA 3JZIA 4M8LA 3D3QA 4ONEA 4P6VF 1U65A 3OJWA 3CE6A 4WOJA 5SZHB 4F3RA 1E9SA 4BN4A 4D3ZA 1GCUA 3VDRA 3W5CA 3OIVA 2NO5A 5CPFA 4X6XA 3WIBA 4RD4A 4DSTA 1X94A 2FSHA 3LQFA 3WK7A 3K1YA 4FMDB 4WKNA 1H94A 1NBMA 3OQ1A 3FOEC 2AA3A 2A0FA 2HSGA 3ZBPA 3QX7A 4ZO8A 4J7AA 5CURA 4C5CA 2XD4A 3B13B 4ARVA 4L9WA 2YXNA 3JAWA 1FXWF 3EY4A 2GUWA 1ETHA 1L7AA 3B7WA 2DFVA 3TDNA 5KUTA 2P7IA 4TMWA 1UT6A 2FX2A 1A8PA 3BE4A 2W42A 3LW7A 3IDSA 2IFTA 4IWNA 3TO5A 4IVNA 2JS7A 4KP7A 3FZNA 2D7JA 2UZ1B 3BT7A 5KPDA 4TVSA 3GEEA 2JJ8A 4TV9B 2C1ZA 1W52X 1PL8A 2HHLA 3JXEA 4R9NA 2BE7A 4MUAA 4FS8A 1ZBDA 2CXXA 2W2KA 1G9SA 1U7ZA 1E9RA 2D8AA 4C0AC 1M2GA 3QTTA 4HNVA 1ZBQA 1IY2A 3O82A 5EC8A 4FGUA 1SVUA 4IILA 2AFHA 4ARSA 2PWBA 3IUYA 3JD0A 5B5SA 1XCGB 1G2OA 1X9HA 2FMHA 1REQB 2HU8A 1FF9A 4ZRNA 2YV5A 4OI0A 1I14A 4H7DA 4G36A 4M1YA 4R3NA 2X1MA 4Z2YA 1HNWB 5ITZA 4F84A 1UH5A 4QG7A 1JV2B 1L6IA 1TK2A 1G3IA 2BFBB 5LD2C 3H0CA 4PQEA 1M8JA 1KO4A 2IA5A 1O9HA 2XE8A 1KS2A 4OGGA 3UW1A 5I7HA 2BFMA 4BJ3A 4CL8A 3VU8A 4K5QA 3RUCA 4TYYA 1C1DA 4HEJA 4N5DA 1BH6A 3RAPR 5B7NA 2R25B 4LY6A 3VR2A 1L3CA 5A5FA 2HGSA 1QR6A 3I4FA 1EFPB 3HKCA 3QTBA 1UWLA 3KKZA 3GMIA 3VSCA 3VKGA 4NNPA 2P9TA 3CW2A 4G63A 5DBIA 2OG2A 3ZU6A 1C30A 2QRLA 3V42A 4AZWA 2ATCA 4RCVA 1H3EA 5BW5A 3LF2A 1E3DA 1LNQA 3AL2A 3R5FA 4RVFA 3IOCA 1NAHA 1YDGA 3A06A 4MA0A 4OUKX 1KZ9A 2HWUA 2Q4BA 1TYAE 3DZCA 1E2UA 3GNTA 3KQMA 2F1OA 1FNNA 2X5KO 4G8BA 5K0JA 2KLHA 3G23A 2NAFA 2C2YA 2YHSA 4ZVPA 4TL8A 2HSEA 5DNUA 1SK8A 1U4NA 4Y2HA 3GLSA 2MSNA 1O95A 4AJOA 4HXYA 1BXRB 3FXAA 3U2QA 5DGIA 3ZU4A 4EABA 1PFYA 2FLKA 4AZVA 4JB3A 2WJ3A 3DAFA 2IGTA 1Y8AA 5FNVB 1N2CA 4Z5XA 2RGRA 3PJDA 1LX6A 3GRYA 4PHGA 2D3TA 5E1MA 2N42A 4TTPA 2O3UA 3TSOA 3BJMA 2F8LA 4X85A 1BE8A 2QMZA 4TWAA 5ER9A 4JFRA 6LDHA 1ULBA 1I6LA 5F7XA 3VR6D 4PSVA 4DWOA 2ZROA 3CRVA 3NHLA 3QBTA 4M36A 3CUWA 4MUJA 1P33A 4Y9RA 5JNUA 1B2RA 3G0HA 1WSBA 3H0KA 3R6LA 2EBFX 3GCDA 2CMKA 3Q41A 1G55A 3U7JA 3HY3A 1J0CA 3OCJA 1UMDB 1OBOA 1Q3HA 2G76A 3K70B 4PO8A 3CISA 4GOLD 3F6BX 4P4UA 1FJHA 3NCHA 4Q39A 4NZPA 2ASVA 2IDZA 2V45A 5DTJA 5F76A 2B4TO 3TIXB 3V2IA 3VFDA 1J2RA 1NUAA 1C0EA 3NDPA 3S2EA 3SXJA 5EIXA 4WKBA 5H8WA 2OBFA 5EQTA 4ZJPA 2MSWA 3LCMA 5BQFA 2ZYUX 5LC1A 2VSQA 2Y1XA 1W88B 1II8B 4QARA 3WGVA 4QAQA 2WDZA 3E22A 3F3MA 2XLBA 4HPXB 3L8FA 4HQRA 1AZSC 4IIJB 4KQ2A 3MJCA 4DLLA 1KMQA 3VJRA 4PLVA 3G9XA 5ALTA 2ABWA 3G6KA 3II6X 4E51A 1B8VA 1F0NA 2PBLA 2DY1A 2JFHA 4DZRA 1U8XX 1YQEA 1Z7GA 4HAVA 4A2WA 1VLMA 4E1BA 2X14A 4LHWA 3NS7A 4WFKA 2CC2A 1UP7A 5EXEA 2XAUA 5F3DA 5BW8A 2P5YA 1CUSA 4TWZA 1YMQA 1EINA 1L5MA 4DL9A 4HDOB 1C3LA 4LZZA 3OOJA 2BLLA 2BGNA 2JEYA 1ZVKA 1PLKA 4RY2A 1UQTA 5DLQC 4KQEA 5IFLA 2ZGVA 2CMHA 2FWJA 3RV3A 2I7CA 1EA7A 3I6BA 1SVWA 2KPOA 5DASA 5LU9A 3V7UA 3U1VA 3IPYA 2I7TA 2RHGB 5A5VA 3D4IA 3ZE9A 4QYMA 4F6RB 2AUMA 1AG9A 2JG3A 2NP6A 3JQ7A 4XUDA 4N9QA 1A2OA 3FWNA 3LI2A 3K1JA 4LSZA 3LDUA 3RG2A 4ER7A 2LE0A 1G42A 4WLEA 2VUUA 4LRXA 4DM4A 2RI1A 4E6EA 4N3BA 3I01A 3D4BA 2MYUA 3IERA 4HS4A 1OAAA 2AX4A 4UPDA 3E1GA 2QL7A 3O4VA 1Y98A 4URUR 4FFLA 3AI1A 2HBZA 4NP6A 1MAVA 4PCVA 5CLFA 4XASA 5HOQA 2PQ2A 4FSDA 1MAUA 2W2PA 2HDWA 1JR4A 2M1XA 2NAPA 2GUGA 3TZKA 4A0QA 2JAXA 3NEJA 3RE1A 1E9FA 2YZNA 2VP3A 3N8HA 3A2MA 4R3WA 3GOHA 3U4AA 4HX2A 1TE2A 1H0KA 1W4BA 2JLUA 2C8KA 4QICA 1UOOA 3WY9A 4C22A 2VDPB 3IE0A 3ZCQA 4HDAA 2XKBA 3Q7IA 3RRNA 4PSAA 2HA7A 5K5EA 4IIDA 1QAMA 4GBMA 4CG1A 4U3JB 1TI7A 3W1WA 4BJ6A 2OXIA 1Q7EA 2W6JA 2I6GA 4CIYA 3MHTA 1FS5A 2VLIA 3IP3A 4CPDA 2FE4A 3TI7A 2QTRA 3G5TA 3ZZMA 1GL9B 3LLCA 3NORA 4MK4A 1KF0A 2QJTA 1PR9A 1NG1A 4GX1A 5K3OA 3DTVB 2YXDA 3MCUA 1WXWA 3LLUA 1CK4A 1ZU4A 2JD1A 4H1HA 3SBOA 4FNOA 3MJHA 1P0CA 3GIDA 4WBNA 1EGVB 4JT2A 2DPYA 4I3HA 2AHOA 2GCEA 4D92A 3W2GA 2F9FA 4GC5A 4ND4A 1WRBA 3A6DA 1ISHA 4LZWA 5ALDA 4F7WA 4YIHA 4JLOA 3N2ZB 3ZI4A 5C1PA 2JFPA 3OLXA 3ZDZB 4WZAA 3BZBA 4WXRA 1NR7A 3EOAI 5AVSA 3CVOA 5CLQA 4A10A 4DLTA 4HX5A 1TLLA 2GAAA 3PQDA 4D4GA 5L7WA 1YQTA 3R3YA 4EI9A 1M1NB 4NCHA 5ALGA 3D3NA 3JQGA 5CW2A 1HFEL 3VQTA 2NV2B 1NI3A 1ZESA 4XRGA 1MIOB 4G0NA 4Y2SA 3VBCA 2FX5A 3GFPA 2YJ5A 1XF1A 4XD7A 1X7WA 1Z2PX 1JNYA 3LQ4A 1CY1A 4O4HF 1D0IA 4JR2A 3JAKA 2X1VA 5E4TA 1IULA 5FJIA 3A3YA 4CHTA 1B0ZA 5C7IO 2PX5A 4IDOA 2PUDA 2HW8A 1JKIA 2DBVO 4YMVA 4RX1A 4H0CA 1EI9A 2B2NA 4K2HA 2FWNA 1KKUA 3TRFA 4BLUA 3NKLA 5DM4A 4NBTA 1Y5MA 4NS4A 3AXSA 4PAGA 2ACWA 2HMWA 3KNZA 1BJTA 4HGNA 1P74A 4JZKA 1SU4A 2GK7A 3KVYA 1FDIA 3PNYA 3G49A 4K6KA 2EL9A 3R4VA 4W7IA 5E2AA 4BB0A 2Q4OA 4ZTZB 3IEXA 1JPVA 2JKVA 5C7LO 3ZD7A 3KPWA 5B7PA 3PPYA 1PFQA 4CLRA 1U2QA 4HCJA 1S4QA 1NY6A 2YCBA 4HNQA 1X39A 3I73A 1VJ0A 2XUOA 3AWDA 5LBUA 3C3EA 2WWIA 5IKEA 3WWEA 3LSYA 1T36A 3UWDA 4NNOA 4RVNA 5IJ0A 4L3OA 4HDKB 1N6IA 4HDNA 4KYTA 3THWB 4J16C 2KJQA 5KI6A 3VU9A 1NP7A 4TRNA 2IVZA 4TKUA 1BO6A 3CF2A 2AKAB 3VKVA 3LOPA 1VG9B 2ZZMA 1EUCB 4L9SA 1ADJA 3T8YA 2VUHB 4JI4B 1YOBA 2AZTA 1Y1TA 1RHUA 3FBGA 3K2BA 4L5IA 1QIHA 5GGXA 5ICCA 5JAIA 3VJLA 1QU2A 3C24A 2B4RO 3MPOA 4EK9A 2NN3C 2W37A 2Q6VA 1JQEA 2FP3A 1J5EB 5H81A 1R6AA 2V97A 3KU1A 3N5CA 1U8EA 4AXXA 4AJ9A 1NJ8A 3GRKA 1PD0A 4WNAB 2ENWA 4M9UA 3O0DA 1DO8A 1T6ZA 4ZAVA 4LTMA 1D1QA 2A4KA 3F78A 1QYRA 2GAJA 3AR9A 4P7BA 3JU3A 4MKXA 5JCPA 2YMPA 2UZAA 1XJWA 3KKOA 1W76A 3PNMA 4GH5A 3G0DA 4KRGA 3GUUA 1KR5A 1XAHA 1PL6A 3HBJA 2K7ZA 2CB9A 4HDQB 3H1FA 1HNZB 4MPTA 4UBJA 5DNWA 3PXDA 2Q41A 4B75A 3QJGA 4FCTA 2ZYGA 5FUQA 5CA0F 1QIJA 1RCTE 2ZJAA 3WFIA 1NKTA 3ZHYA 1TYCA 3ZY3A 1QF7A 5ARBA 2C4VA 2V7XA 1H2ZA 3FTEA 2ZBEA 2IYOA 3AERB 1KI8A 4UHEA 1P9RA 2BMFA 1T4DA 5BSUA 1AT1A 4TLCA 4KQMA 1SHTX 4U7FA 5DEOA 4F1JA 4PVDA 5KSZA 1BCSB 1SKAA 2PYZA 2VTKA 3G7NA 4GI1A 5CB6A 5JYCA 2R97A 1R64A 3QOWA 3S8MA 4CQJA 4HUJA 3NYWA 4QFMA 1TTTA 5EE3A 4G23A 4BQPA 5GGYA 2D5AA 2IY7A 1U6JA 2JDID 3K6JA 2FN3A 3LF1A 5IJ9B 1C1XA 4G07A 3JYHA 4QGGA 2WB2A 1MLDA 5HOEA 1PEYA 4X97A 2DQZA 2FY8A 4BZZA 5AUOB 4EI8A 5AW4A 2XRFA 3C6MA 2PZBA 2IV7A 1UC8A 2WBLC 2PQ6A 1SY7A 3OFND 1HORA 4I50F 1PWYE 4UTXA 5H16A 2O57A 3L1KA 4HRYA 1JJBA 1E1RD 2O8BB 1YHYA 4UQPA 2ZJ0A 2YN0A 3GUYA 3VNBA 1K97A 3L46A 5ADHA 3D1LA 1RXYA 3TECE 4DQXA 1PT9A 3PNBA 5A7HA 2W6ID 2R00C 2SKCA 2FB9A 3QPDA 3HVIA 2FX3A 2OQ2A 2RGUA 4RL6A 4D81A 5I7EA 1P72A 1MRNA 3V1UA 2P35A 4Y2GA 3OJCA 3A1FA 5CXXA 5FUVA 3ICQB 5EWMB 1SVSA 4IGAA 1OLUA 5CPBA 5LR6A 1CP2A 3D54D 1UT8A 2QYOA 3G85A 3IB3A 4P83A 1JXAA 3PR3A 1JH9A 1CRPA 5DSZA 1N4AA 1AV6A 4UZEA 3VR5D 3BL6A 1WDLA 1I3NA 5DLEA 1FYXA 2WIBA 3AO0B 3K2IA 1O94C 3NNNA 4INOA 2XMCA 4M6WB 2FR8C 1ISFA 2EXXA 2JK0A 3FSGA 3JQ9C 3MRXA 1DAMA 2E7ZA 1RWQA 3AR6A 1F8FA 4IINA 3OQIA 2WM8A 1JG4A 3QBEA 5ITSA 5ADVA 3LJKA 1L5ZA 1VL2A 4RE6A 1KMHA 4GP6A 3KE8A 2IYUA 4I1VA 4OB7A 1LBSA 3ZWYA 5JBNA 3HJAA 4R9UC 4CUJA 5JSZB 3PDWA 1TYDE 1X86B 3HCCA 4J7XA 1NSYA 4YJFB 3DDNA 2IIPA 1Y42X 2CLIB 5DIZA 2NACA 1CULC 3OETA 5KTYA 2JIZA 5LDGA 3E9QA 1PT5A 3ZV5A 5C8YF 2JHCA 4ISCA 5EZSA 1U8YA 3BRWD 4PX3A 2XBLA 3DE5X 3RVLA 4BFSA 5DXFA 1YA8A 4PTZA 4D5GA 1SBNE 4RNCA 3C4QA 1F0YA 1ML3A 2BAGA 4HLUC 4F91B 1C1YA 5EVCA 3E70C 3HJCA 1ES9A 2PVCA 3G5MA 3H2SA 5GZ6A 2NTVA 5DGXA 2PV0A 1GNLA 4NU5A 2VJDA 4UE2A 1DELA 1JHUA 4RWEA 1SFRA 2FPIB 3B6MA 2E87A 3KFLA 2WTNA 4ZHSA 2QD2A 4Q4AB 3VO9A 3LAWA 1J2JA 4NV3A 3EVGA 1SUPA 4ZRDA 3NHKA 5LOVB 3B89A 1VFNA 5FRDA 2C7VA 2GGSA 3UNXA 2OCGA 1AGXA 3M5CA 1ZA2A 2C2MA 3IEUA 3DM9B 4KQIA 4EJMA 4C1BA 1RKBA 1ZN9A 3S27A 1S8AA 3FUVA 1N8SA 4Q21A 5CYGA 3IQXA 1XCLA 1JW9B 2ZIXA 3N2LA 1GCAA 4C5BA 1Y8QB 5KYVA 2HDHA 4GOKA 2I4IA 4U63A 2CN1A 1KL7A 2VNSA 1Q11A 2VT6A 4OGKA 1UFVA 2FRXA 5J2TF 4CLHA 4CN9A 3GYGA 3QW2A 5EFZA 5GMOA 4TYPA 1BH2A 3H5AA 4X1OA 3U40A 4B4VA 3DA8A 1SUBA 5AK3A 4OJKA 4XVUA 3EVBA 2GF0A 2ASEA 4ZVKA 4Q3KA 5BYBA 1Y8RB 3CO0S 1RZRA 5I3CA 1M2NA 2CK3A 3GARA 1TVKB 3FNGA 3OTWA 4NWIA 1U2EA 2P4EA 3HBAA 4DLRA 5ALPA 2OFWA 4TVKA 4D96A 1LXCA 1J1IA 2V1XA 2Y2UA 9ATCA 1O8BA 3MMSA 4JC8A 1C9DB 4YXWA 4XOIA 5TMPA 1H9AA 1SXJD 2A8YA 5HILA 4EECA 3UBTA 4Q9HA 1TEXA 2DH6A 3I01M 1SZCA 4DCVA 4KE9A 3CCBA 4QKQA 5BXQC 3GUCA 5JVDA 1WL8A 1GSOA 5SY9A 2O5CA 3RRMA 1FUKA 1U7XA 2HV8A 2IHBA 2NZVG 4B0OA 3RHSA 5B1YA 1QAOA 2EU8A 2BBSA 3F6SA 3SEQA 3WKAA 1W34A 4ENVA 1DKRA 1GN8A 1LZLA 2R1VA 3EXFA 3ZIDA 4L50A 5BWBA 2XVYA 4NBVA 4DEYA 1G5QA 2K2WA 4P84A 3R75A 1NMEA 3EWSA 2G1JA 1MD9A 2N46A 3SSAA 2QD3A 3G2MA 5EVJA 1Z5NA 3W7AA 3HCRA 4YAUA 2XEDA 3EW7A 3KYIB 1Z8HA 2NNWB 3W3AH 4YCSA 4COKA 1U9YA 3A10A 1JJFA 3EA0A 3UJHA 3KDPA 1TNDA 1D07A 5FL7A 2P9QA 121PA 4TUYA 4X71A 1UM9B 5TC4A 5FOXA 4AYTA 2IS6A 4BMYA 3AMVA 5KYKA 4L3WA 4PCAA 1F0KA 3GFTA 4RABA 4QC2A 4KQ9A 3SC6A 2I65A 2BFCA 2MIIA 5ELMA 3VX3A 3MJTA 3O93A 5KVQA 4B4DA 1NASA 2ST1A 1ECGA 3R3JA 3KCQA 4FU0A 3U3KA 4QLBA 2YMQA 1XCPA 1V3VA 3N8NA 1V45E 4KO8A 3U39A 3BULA 2QTMA 1D4OA 3EISA 3FROA 3O0TA 3QOYA 1MHPA 4PSDA 1A2QA 2V59A 1L4EA 1N2HA 2QXUA 4AUEA 1LTQA 2HHJA 4I55F 1OLXB 2EBWA 3G1WA 4V1CB 4HAIA 2DR0A 4TTQA 1NE2A 2VT3A 4ND7A 2Q9AA 3SSNA 4WZBE 3ZCUA 1FS4A 2C07A 3AGQA 5FR1A 2DSTA 5K8LA 2R79A 1KZHA 3FCEA 1ML4A 4IUYA 3G2JA 5KSPA 1OZ0A 2REOA 5ERGB 1HA3A 3GFSA 3SI7A 2BH2A 2NWQA 2ZRGA 4OBXA 2FQWA 3CEMA 4GE0A 1QGZA 3L05A 3RS9A 1HDCA 2IUFA 1C0IA 2VDUE 2QJOA 5ALVA 3DAHA 1GQQA 4QGHA 1JZTA 3TLCA 3M6FA 5CFRA 5MFZA 1ZNWA 2WIDA 2IPNA 1CVLA 3DG9A 3BD9A 2J9GA 1C8LA 3NT5A 4RH1A 4WFQA 1CUFA 5B7GA 2PMKA 1Q1QA 1GQSA 5IPFA 2DBZA 3WX0A 5B2FA 2CW5A 4ERXA 3M1IA 4YDRA 4RVUA 4LNAA 4DCJA 3DFUA 1YR3A 1E7RA 5LYJA 4B71A 1J33A 5LMCA 1T5IA 1PDVA 2WU1A 2XVZA 3A2LA 3PJEA 1BYIA 1F7UA 3VRHA 2VF5X 2O1XA 5IBPA 2DJIA 1L5RA 1G1MA 1U3DA 2JD2A 2R8EA 4O5AA 1XEXA 3BC1A 3UWKA 4EHNA 4EJ6A 4JCCA 4RIEA 2FTKE 2IHKA 5IC6A 3IL2A 2JFYA 1J42A 1MDBA 1R9GA 1QHGA 2L42A 2ZYAA 3P52A 5CGQB 2PGXA 3DWFA 3ZIAA 5B12A 3C74A 8LDHA 5JJ5A 4B6PA 4J76A 1NJ1A 1WU7A 4FB5A 2YJTD 2HF2A 4IJVA 4N03A 4PO1A 3EDYA 2JGIA 1P60A 4PWYA 2FFQA 1VE5A 4PX5A 1Y4UA 1I4WA 5E1DA 4GZ5A 5DZSA 4AY5A 1GL6A 3W05A 2EBUA 3DFZA 3NO4A 2BFFA 2JD0A 2FE1A 3L84A 5AO9A 3T7AA 4JU9A 1JXQA 3PS9A 4I36A 4FHCA 2R8PA 4P34A 1JIJA 3S1SA 13PKA 1JQAA 3HKDA 4JCOA 4L07A 2OAEA 4XJSA 4HWKA 3S70A 2X0RA 3EZ2A 3IP1A 5HIMA 1ZGZA 1W4ZA 3UMVA 2HDOA 1T8PA 4G4SP 3GDHA 1Z4LA 4RQBA 1FSZA 4KQWA 3UFXB 4G5QA 1HI9A 2GR9A 1GPMA 2HJWA 3QXJA 4ZI7F 4W6QA 1T0BA 3SYNA 1BRTA 4M0EA 1NVXQ 1RLUA 4LOJA 4BFWA 4DRZA 2J5BA 3Q9SA 1WXHA 3S99A 1U94A 1RXEA 1Y4ZA 5JZ9A 1FLAA 3RYIB 2Q3LA 3OZGA 4GQBA 5HF5A 4TZ0A 4XSVA 2Z58A 3H1PA 5KOJB 4Q82A 7GPBA 4QZVA 3ZWDA 1TB4A 3FCYA 1YZHA 1I2DA 4IF6A 1M34E 3AUUA 3S7ZA 3UXEA 2JW5A 1PTKA 3K32A 4H6XA 2IP2A 3WLNA 2V3CC 3ZVRA 5HZGA 5LBTA 1P7VA 3JQFC 2B83A 3QELA 2A2ZA 2Z5GA 3K0CC 1X87A 3NC1C 5DSXA 2FHPA 2WSLA 1HLPA 1USGA 1YBFA 2NU9A 4DG9A 5A5DA 4PC2A 4MOWA 3M9WA 4XE5A 3ZHTA 1V9LA 1RZVA 1Q1ZA 4YRLA 4FEEA 2JFFA 2OV8A 4WT7A 3AJDA 1BFKA 1E0DA 2YV3A 4BMOB 3EDOA 4E32A 5I9NA 1XRSB 4DRXA 3T5AA 3IUEA 3FTNA 3CUTA 1MV5A 2O2JA 4L6AA 4UHJA 4CT4B 1VPEA 3LUAA 1N2XA 4RDXA 3QI2A 3RKSA 4JJFA 4YS6A 2BVNA 3E0QA 3Q7RA 2GFIA 4EKEA 3A58B 3LT2A 2ZAYA 4ZXFA 2ZT6A 3ICVA 4MW5A 3KQHA 4DGQA 3AF6A 1D4FA 3ABRB 5C8DA 4AO6A 4JZYA 3CRMA 2JBHA 4GEGA 1OH8A 1GPBA 2H2WA 5HDQA 4I2NA 1SBHA 1BHO1 2RMKA 1BDBA 2WZBA 1FDVA 1ZGJA 3KJGA 3SYLA 3A36A 3ILHA 3EXG1 5I9TA 3VR4H 3TLYA 1YVPA 1WSWA 2BTOA 1ZUWA 4G9BA 1XMSA 4WV3A 3RS5A 4D8WA 3ZHRA 2UZ4A 3EVZA 3NOQA 3DZHA 3C7KA 3O47A 3RFCA 1I7LA 3MJFA 5D3QA 5C8XA 1EH5A 5KWVA 2XBMA 1ZYUA 4QGBA 1ORHA 2KBEA 4JLPA 2P78A 4TTRA 1GSHA 3DEAA 3NXKA 1I36A 3FLEA 1WXEA 1XPOA 1MMFB 3DL2A 3SJUA 2C9YA 1WR8A 2DULA 3O8OA 4URHA 4CN8A 1O95D 1FNMA 3P0HA 4LNUA 3TRDA 4M1MA 5A4JA 2IHUA 4RV5A 2OGTA 1RQ2A 3TI9A 3FUXA 3JY6A 4Z9BA 1ZA1A 5E9AA 1ZRMA 1CYDA 1TYZA 3FCOA 4Q7JB 4ACBA 3TGLA 1ZKDA 1CDOA 1RLIA 1KEZA 5FO0A 3WA7A 2G9VA 4UU0A 3S8YA 3I83A 1V37A 1PG0A 3AV3A 1K7XB 3LBHA 4BVEA 3JQBC 4JK3A 4YH1A 1IU9A 4HDMB 1EWRA 1J7KA 1DT5A 2Y76A 3H0EA 5JUWA 2YFHA 5LKAA 1XHEA 3U62A 4Q7QA 1AA9A 4YBRA 2VO1A 3CKKA 2K4MA 4QFBA 3IT2A 4I1SA 1CVRA 3SIPA 1E2LA 3B6EA 1KBZA 2DECA 3OESA 3WIOA 3U3JA 4C0QC 4BO4A 4G5FA 5J4LA 3IAHA 1Q0HA 2ODAA 1NDQA 2Q2WA 2QN9A 3AJ9A 3HWWA 3LUHA 4X62B 1G3UA 2X5XA 4GT1A 4RPIA 4M99A 3K7EA 5AI5A 4ENSA 1CSEE 4EKIA 1C7RA 3K9QO 2AJTA 3H97A 1R4NB 3N05A 2ZG6A 3OJOA 4YRJA 3U4MA 4OMFG 3B2EA 3SC4A 5JBIA 4DARA 2WWWA 2OQRA 3BZUA 2PZGA 3CGWA 1H22A 2ZSIA 5CA1A 3O74A 1OZGA 1V2GA 2B0CA 4AU1A 3F1LA 1QVVA 1KNQA 2FF5A 3FZGA 4HLQB 4EG0A 5LDDC 4A5OA 2WJ4A 1BQ3A 4C4ZA 1QMPA 2Y0DA 4YPFA 4PGFA 4X41A 2VP4A 3D43A 5AT1A 4HH0A 1G7SA 1KRWA 4KFSA 2FMUA 5CJ2A 2HFKA 3ESAA 3O4HA 3PTLA 2VTDA 3DDHA 4HRVA 1WQ4A 3TIIA 3UH1A 1FJ2A 5KX5A 3B6JA 1HDRA 3M5WA 2L0XA 2JZCA 4KDEA 1J21A 1JIXA 3PHLA 1ZCBA 4M0PA 2YQZA 2L2QA 1LDMA 4D9NA 4G84A 5LCXA 1X19A 1XDSA 4ZGGA 2MINA 2G7ZA 2XCIA 4DIEA 3TOSA 1M1YE 1A72A 1Z38A 1KNXA 5IZCA 1J90A 1IOZA 3QVLA 4MVXA 3I6IA 1VHJA 1NXSA 2L17A 2VAWA 3OZUA 4KUHA 1NQUA 3L7DA 3HJGA 5M7EA 2VKQA 5G1NA 4JB0A 1RTKA 1P91A 5B1IA 3I5XA 1F2TB 1ZM4A 3INRA 2ANBA 3OO1A 4RSRA 2VAPA 5TVGA 3TSWA 1O89A 1HURA 4B46A 1YRYE 4D9JA 2ZU6A 3PLNA 3WNCA 3AVWA 4WX2B 2WYHA 3TBKA 2IYYA 1CJUC 3F6YA 3MWLA 4X1KA 2Q5QA 3C3WA 4HWTA 4PXSA 4FM9A 2CUKA 1SIWA 4BLPA 2OXRA 4J1NA 4UOZA 5KTTA 3VSBA 4X66B 5FUWA 3ZXUB 1X13A 3H2GA 1FQOA 2VBIA 2VPPA 2XLCA 2XIJA 1Y80A 1C8BA 3F7MA 4GPIB 2FCAA 1L7MA 1YE8A 2YJ3A 3C3KA 4DPLA 2CZQA 2OC4A 1U98A 4QGAA 4BGEA 2NPIA 4D9HA 2ZDGA 2CJPA 4KAAA 1TU0A 2PBZA 4N8DA 5DO9A 1COWA 1EAMA 1J8VA 2J07A 4GX2A 4MW0A 4LFCB 2GD2A 4ASUA 4WUTA 2VBCA 4G4IA 1IWOA 1JEYA 2PSDA 3QG5A 4L7VA 4IV0A 5KSOA 1QPBA 3OICA 1DDOA 1K3FA 1Z5WA 5CT4A 2NTNA 1E2DA 2ZBPA 2PKQO 4NC9A 1IJEA 4OM8A 3HPQA 4UFOA 2H07A 3OIFA 4YJKA 8OHMA 4QVIA 2V6IA 2CSXA 3QFTA 3OTHA 4IG4A 3AV0B 3LO8A 2VEOA 4S04A 1HDOA 1JU4A 4B3JA 5FPPA 1DUIA 1PZXA 1YCDA 3C16C 3FHOA 4KYUA 1N5RA 4R0NA 4EA7A 3EJWA 1O6BA 1G4AE 4OTZA 1XL0A 5C7YA 3QSGA 2PXCA 3GVIA 3PQFA 5AHKA 4P5EA 1G1AA 3FUTA 4RK7A 4V03A 1V16B 4WNCA 1LDGA 4M1QA 4MGEA 4A0GA 4OLHA 1L7DA 1RBQA 1UZNA 1FX0B 2EFEB 3NBZC 2O0MA 5DISB 1PWZA 2L18A 4R2XA 4X45A 2ZJ2A 3QVVA 2GXQA 5BSTA 3SMVA 1UBEA 1A76A 1HO3A 2C1XA 2GASA 4LCEA 3W6UA 2JLSA 3DMDA 3ZGNA 2CHUA 3EHEA 3A6EA 3SEZA 2ZSAA 3BWVA 4OY3A 3PPXA 2ZIFA 2QZJA 3BMCA 5TQ0A 1PNVA 1EHIA 5C53B 3PNOA 5CXQA 5A2GA 1LVHA 2X7JA 3PI6A 2P68A 4L6CA 5CH5A 3H65A 2QM3A 2ONKA 4JYPA 4QTXA 3SD7A 1L4LA 2OCPA 3HDHA 2YY7A 2ZPAA 4G5OA 3LA8A 4UCXA 2G70A 4H9GA 2PE5A 4X44A 1RXWA 3VPAA 1KPHA 1MN6A 2UV8A 2GPWA 4LI3X 4R2KA 2Z2IA 2QP4A 4AP6A 1GG8A 4Z1OA 5EWLA 4EW2A 3PNVA 2CLEB 1U7PA 3KQVA 4P36A 4ZOLB 5ALUA 4GVPA 2FW9A 5J4KA 2IBTA 5EKTA 3L8HA 1L5GB 1YDEA 3W9UA 1RE0A 4KMOA 3PWZA 4D9GA 4QO7A 5C46F 2FK7A 2NUAA 3GH1A 5I9SA 3OWHA 1DE0A 4M46A 1T6BY 3K71B 1HDIA 1KS9A 1L7OA 2GFHA 3D7NA 3UJ8A 2E55A 1DC8A 3IR7A 3WG9A 4RDIA 3MT9A 5AHXA 2C96A 2FRVA 3O9MA 4B84A 3TSZA 1AMUA 4ARIA 4PQGA 3EFEA 1CR6A 3BHIA 5A6SB 3K8OE 2W6CX 3PRJA 3UJBA 4OK6A 4XW2A 4FTWA 4YRDA 2F3PA 4HYEA 4QL3A 3RUAA 4XM2A 3WMXA 3PL5A 3MSCA 2BCGY 4L5AA 3WLRA 2DB3A 2AT1A 3NPAA 5DHRA 2ZIAA 2IJGX 1A82A 2CLKB 2QW1A 3EGDA 3H19A 3VTFA 3BIJA 1QO7A 1KRHA 5JASA 4JJ8A 3U7EB 5EIOA 4US2R 1N25A 5BSVA 1AF7A 2NTYC 3QNUA 3W34A 3THSA 4ER3A 1U5BB 2ODNA 5SYNA 3AYXB 1TM7E 1IHPA 1UP6A 3R09A 4G1UC 1EJ6A 2J5XA 2V0NA 4G0ZA 3HKEB 2FPRA 1N3YA 3VSAA 1IFXA 2YFKA 3GEIA 4DMRA 3PUWA 1Z9BA 1CUAA 3R3HA 3L7AA 1KKMA 3KT0A 3OLWA 4GX5A 2PJRA 1A0OA 3COYA 5AIBA 2QTLA 1O5IA 3WJ2A 2UVPB 1CQXA 2WM9B 4ZTUB 3JWEA 1SPXA 2BEVA 1U0FA 2QQ0A 1KFCB 3DE7X 2WAYA 4IHJA 4YP6A 1SXJE 1TMKA 2QJRA 2X9GA 3Q5GA 5JDCC 2PMEA 2V6GA 3IDQA 3L77A 1K92A 1ZLXA 2YINC 4KLCA 3RRFA 4BAUA 4DKXA 4F11A 4D9BA 4KR6A 2OAQ1 3AJRA 3OPVA 4B7ZA 3P0FA 1UXJA 1QB8A 4FHZA 1BOOA 2C5SA 3NBMA 4N1AA 1IBMB 2C57A 3DL7A 3K73O 3L9XA 1ICIA 1NOIA 4EFKA 1NQWA 1P2DA 2QL5A 5PNTA 1B15A 1KEEA 1IZYA 2G5CA 2OHFA 2WTEA 3DVLA 3CH7A 5TT1A 3T7KA 2AC4A 1AZLA 1MJGA 3WGKA 3H3FA 1JKFA 1JDPA 1JIUA 1Z56C 1TGYA 2R1TB 2YC4C 5A7GA 4CJXA 4EVSA 5COQA 3VR6H 1AV7A 2X13A 3ETEA 4YY3B 4BRWA 1DAHA 1L4NA 2WSSA 4D5EA 3TTVA 2IYVA 4N7MA 1WZEA 1MPXA 1JHDA 2I78A 4PC3A 4REMA 2NMVA 2RONA 1TJPB 1TU3A 4L75A 1SHKA 1KEWA 2EP7A 3HJBA 4V0LA 1CF9A 1OT3A 1OY1A 1PSDA 2PGAA 3IO3A 3PA6A 4V0ME 2DM6A 4RD1A 4I9FA 4DLPA 1FXWA 1LB1B 2EF0A 1E4VA 2J33A 1T25A 1E62A 2H7YA 1N9GA 3KJIA 3M2TA 4G0YA 5ANRB 2RI6A 3E7FA 4ILEA 5AUPB 4PM4A 3CVVA 1O97C 3O8NA 1S8NA 3KLBA 4IIYA 4TT8A 1EWQA 2JI7A 1ID1A 3E3LA 2VDOB 2IE8A 3AVXA 4GMXA 1N8KA 2XUHA 2XOKA 1US8B 3B51X 5EP4A 1UXIA 3K2EA 3F6EX 3KOWA 1K6XA 1T8UA 3B20A 3EC2A 3T35A 2J45A 3NQ41 3P0JA 2PUVA 3PUYA 4EGAA 1GR1A 2TMDA 3FAZA 3A1SA 3NHJA 3PNQA 3UPTA 3Q2KA 3PHCA 2YY6A 3N76A 3QLUC 4DR1B 2DUWA 2OL4A 1QPZA 3MD9A 1KETA 2EATA 2BIFA 1MB3A 3HXLA 3G2PA 4PW0A 2LXNA 1ZK1A 3ULKA 4MVWA 1NKVA 1IUKA 4PPNA 4XWTA 4S3MA 3SX2A 2PXHA 4XCVA 4ZT2A 1FP4A 3FYUA 3GT7A 5DGDA 1ZGCA 3JAWB 4CM3A 3QU7A 3MTDA 3VC2A 4BO2A 3C8UA 5IYZF 5EN4A 3OQJA 3KKEA 3W5AA 1DEXA 5IF3A 1ZD2P 2JGFA 3RAFC 3BD7A 3FSGD 2IOHA 5JI2E 2AG5A 4PWZA 3BDVA 3K9FC 3I32A 1ISPA 3KETA 1FLVA 1NG9A 1JSZA 1Z8DA 1DKOA 3F90A 4PFSA 1M2KA 5EWJA 2IBSA 3VH4A 1JHAA 1YZQA 2VF2A 1U9IA 1V3TA 2W2KB 2CBXA 4YP9A 2YS6A 1N2SA 1SIBE 2AOUA 3P9KA 3WO0A 4AJHA 4E46A 3QW4B 4LDNA 4OHPA 2C9OA 4NBNA 1QLWA 2HJ9A 3E9EA 1OAOC 4GYWA 3DTYA 4XWGA 3EIEA 2FRDC 3OJFA 2AFHB 2DHEA 2I3ZA 4Q05A 3B8HA 5LWHA 4L72A 4PG8A 5ELXA 1B93A 1EDDA 1IB6A 2WJAA 1A4IA 2X1LA 3PFCA 4HL6A 1XEAA 1QWSA 2FW7A 2JFBA 4Z4QA 3EEBA 1ZISA 5GONF 1G7TA 4QQFA 4MQFA 5IAAA 5HYVA 1QK5A 4BNXA 2F67A 1C3OA 3L18A 4QJBA 5ITZB 1YHZA 2WSYB 3ZCRA 3OQNA 5FFFA 1C0LA 1QKIA 1N2ZA 1NUQA 1V7QA 1XMVA 2PMDA 2ZB2A 1SVOA 4D0LB 3F74A 3X1MA 3DB1A 4EW1A 3L4JA 1LSJA 1C1DB 4EMBA 4Q18A 5KC9A 2GZAA 3BIFA 3KZXA 4L76A 4TT3D 1RVDA 2WM2A 3ZY4A 3F67A 1EGHA 2AF4C 1R4AA 1X0VA 2D2EA 2NO4A 2RARA 2WVHA 3HKCB 4FS3A 4YRPA 1OYOA 4CMCA 3O3MB 1I3MA 1JPNA 1LV7A 4BMSA 3SJZA 4DIBA 1C30B 5C5DA 1LWOA 3FKQA 2HK9A 3BRQA 3IVGA 2PH7A 2XYGA 2VPYA 4JASB 3I30X 2VJLA 4UE3S 3FAKA 3L4BC 1H8ED 3C70A 2FUG6 1L5HA 1PJQA 1YGPA 4PS1A 2RHMA 3GJQA 4XIYA 5LB4A 4JI5B 2WYVA 1FVHA 1GPWB 4P0PB 2J7KA 2XQIA 4MWDA 2O20A 2H1CA 2P1DA 1N6HA 5FO1A 1QGUA 3MF4A 5K3SA 3C7CB 2O2CA 1TC1A 4XSGA 1GRCA 5HJ7A 3AHGA 4FYVA 2BTQA 4C7MA 1Q50A 5HKBA 1EHCA 3F49S 4C0XA 1N6PA 3SQWA 3O1JC 3HB5X 4GPAA 5EJ4A 3QH4A 3TIVA 3E0XA 2JLVA 3IURA 2VUIB 2VUTA 4M8KA 1N2CB 4NE7A 3HZZA 3UV6A 2ZWMA 3EAGA 2FSSA 4Y7CA 3ZYCA 5MN4A 4UM7A 3I5MA 4RMIA 5CT8A 1YNSA 4DM3A 1II9A 3OZFA 4Z86A 2QLTA 4P4TA 1WKCA 1D5WA 2ZSUA 5F4BA 1SN7A 4YQEA 3E35A 3VOAA 4ZGWA 1Z22A 4K6MA 4NFLA 1PR3A 2A9VA 2AJLI 3I0NA 4IICA 5EJ7A 3AEKA 5LM3A 2NZWA 1JVNA 2XUFA 3SR3A 3UB3A 1E2HA 3NALA 2HFJA 3SVZA 4YDQA 2ZIGA 4JLVA 1NVKA 3K1TA 4UXJA 5DCLA 3C3DA 3MJVA 4DEXA 3DYBA 4LVNA 5J5AA 2BPOA 2CMGA 3N3AC 4ZQGA 4CM4A 5IUJC 1E58A 3NIWA 3E7XA 3ROFA 1R2QA 3CZRA 4RVGA 4D6PA 2UYOA 5K7SA 1JHPA 3KKPA 5ESWA 1H4TA 1AHIA 5TS3A 5ALJA 1N78A 3K1AA 4Q3CA 5A3RA 5AESA 2P79A 1NQTA 3E22B 4WEOA 3WMWA 1COZA 4OK5A 5J4YA 1ZR4A 2ZVJA 3ZDEA 3KX2A 2C3MA 2C8JA 4A7PA 1SVIA 1KU6A 3HPRA 3I3SR 1JMYA 4J2TA 1AA6A 3NHZA 3THXA 4KGDA 2H4JA 3I76A 3RCBA 1F5NA 4EMTA 2XGJA 1YS7A 2A1TS 2WM3A 1TZMA 3GJYA 4ZQHA 3IXLA 1GL7A 3HO6A 4MS3A 3KJHA 4KR3A 1J8DA 1R0XA 4JBXA 1P5RA 4UOEA 4O6VA 2ZSHA 2AR9A 2P2CA 4FD3A 4PNPA 4BNHA 3BFKA 3HE3A 2GRAA 2YOGA 3GGCA 4ESHA 4WECA 3EPHA 3WB1A 4CV2A 1INLA 2C3OA 2G1AA 3LYAA 1G6KA 3A26A 3PUHA 4JMLA 4MA4A 2WF8A 2LD4A 3IYLW 4Y6QA 5H7XA 1SVNA 4K87A 2VJPA 2W2LA 4HF7A 5SYAA 1V8PA 4MAMA 1X1BA 1W47A 5K09A 1ZK2A 2P1RA 4IM7A