4JASB

Structural basis of a rationally rewired protein-protein interface (hk853mutant a268v, a271g, t275m, v294t and d297e and rr468mutant v13p, l14i, i17m and n21v)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
121
structure length
120
Chain Sequence
SKKVLLVDDSAPIRKMVSFVLKKEGYEVIEAENGQIALEKLSEFTPDLIVLIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/signaling protein
molecule keywords Histidine kinase
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
total genus 39
structure length 120
sequence length 121
ec nomenclature
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jasB00
4CBVA 1EWVA 4MQEA 4RV5A 2PL9A 2BGGA 4WXEA 3T95A 1KRWA 4RXUA 2I6FA 4EVSA 1Z18A 4N0PA 3LUAA 4N03A 3GBVA 3QLUC 1CEYA 4KMRA 4MR7A 4TLLB 4RZSA 3RQIA 5JNTA 2JVKA 2H0AA 3LKBA 5JNWA 5KQGA 2JBAA 1A0OA 3KSMA 2NT4A 4KRFA 3QEMB 1RZRA 3TB6A 3FGZA 4KV7A 2QVCA 2NZVG 4YGXB 4Z4CA 1U2QA 4MS3A 4NICA 2PE5A 2M1ZA 1DC8A 1C4WA 3EGCA 4YWHA 3DGEC 4DQDA 1CYEA 3LUJA 1B00A 3HV2A 4WWHA 7ABPA 3CKMA 3OM1A 1D4ZA 3CNBA 4QPJC 1QQAA 4JASB 3HM9A 3E3MA 4G97A 1JL3A 1JHZA 2QR3A 3N0RA 3C3WA 4LRQA 1ZH2A 2PMCA 1T34A 3OO1A 2FMKA 1XHFA 1NXVA 1ZH4A 2FN8A 4XARA 1F51E 4JB2A 3S99A 1Z13A 3KTOA 4ETMA 2O20A 4OLAA 4OG2A 2TMYA 2NUBA 4XXHA 3W9SA 4MR8A 4RKRA 4GPAA 1A04A 2A9PA 4IGAA 3RVNA 4ETIA 4EUKA 1DCFA 1TVMA 1VLZA 2JVJA 2E4WA 4ZMSA 2FTKE 1QQBA 3G1WA 2GI4A 3GRCA 2E4UA 3JVDA 2R25B 1TJYA 4WT7A 4MS4A 2FQXA 2MSWA 2HQRA 3FMVA 5IEBA 4W5RA 4IRXA 1JFSA 1YK0A 3LUDA 4YS6A 4F06A 4S05A 3KKEA 3B2NA 3LKVA 5TPWA 2FW0A 4F8JA 2YHAA 1QO0D 1E6LA 1RNLA 4W5OA 2A9OA 3LUGA 2GX6A 9ABPA 3RVMA 5IUJC 1E2BA 4QYWA 4MYRA 1JDPA 1M5TA 4KQCA 1P8AA 4PEVA 1Z16A 4OBBA 2AYZA 5HKOA 1JWLA 1DBPA 4D6XA 4OTZA 5CNKA 3QX8A 3HO1A 1SXHA 3KS9A 4Z4IA 5TQ2A 1DBQA 3CG4A 5B3JC 4MLCA 1EAYA 5BQ3A 1LK0A 2FVYA 1M2FA 1KGSA 3JTEA 3KG2A 3KYJB 5FBHA 4JOQA 1MB3A 4DADA 1NXTA 3EULA 4LE2A 3ILHA 5IUNC 4MLDA 1BAPA 2FN9A 4MS4B 1PNRA 1K68A 1SRRA 2FKAA 3OLYA 2R4QA 2FEKA 1VRVA 5TPZD 3HSYA 1QKKA 4Q6WA 3H5WA 3RH0A 1LBIA 5TPWB 2GWRA 4IMJB 4L4UA 1QPZA 4G0OA 3A10A 1NY5A 2L17A 2LIVA 3MM4A 3QLVC 4MRMA 1U04A 1DJMA 1E6KA 3QEKA 4H3HB 4RDCA 3SY8A 2ZWMA 5EWLA 3Q7TA 3HS3A 3LUHA 3HUUA 2A9RA 2QW1A 3H5LA 5TQ2B 4KPYA 2ZAYA 3RVLA 2GBPA 4XFKA 1PNTA 3N75A 2JRLA 2F8SA 2XDYA 4N0QA 4QYMA 4KZKA 2VUIB 4Z4EA 4RK6A 1L5ZA 5TQJA 1JX6A 4RS3A 2E4VA 1LJUA 4G0XA 4MS1B 6CHYA 1D2AA 1AB5A 3C97A 3OQNA 3VNAA 1GLGA 2FMIA 1BVHA 6ABPA 3I42A 1YS7A 4Z99A 1KRXA 1BDJA 1EWKA 1NXWA 3JY6A 2V0NA 4ZPJA 3OMWA 2CWDA 4O1HA 3SAJA 1ZITA 4EYGA 1RZRD 2OENG 3LUKA 5TQ0A 2HJ9A 1Z25A 1GCGA 1OXKB 2L19A 1DBWA 3QK7A 1JBEA 1ZVVA 5T3YA 3CFYA 1IIBA 3G85A 1EWTA 5EWJA 3TX6A 2PKXA 1M2EA 3MMNA 3OQMA 3H6GA 3DZDA 3M9WA 3BILA 1EHCA 1NTRA 3IPAA 4KK3A 2P9HA 4MAAA 3FFXA 3ROFA 5EWLB 5FWXB 5T7BA 3L6UA 2JB9A 3HJFA 4Z4HA 4YLEA 1GUDA 3SQNA 1EFAA 4RXTA 3UK0A 2PL1A 3DLBA 2OQRA 5C5EA 2RJNA 3JPWA 1D1PA 4JA2A 4RK5A 1CHNA 5EWMA 1C0EA 3CRNA 3LUCA 2HPHA 1ABEA 3LOPA 4O1IA 1QMPA 1A2OA 4GNRA 4MQFB 2JK1A 1F4VA 4LZLA 1USIA 2CHFA 4W5TA 4OATA 2FQWA 1RXEA 1RPJA 1ZESA 2FEWB 3F6PA 4MQEB 5ED4A 5KC8A 2IOYA 3O2QB 3IP7A 1LBHA 2CHEA 2QSJA 4G86A 4PZ0A 4YRZA 3H5TA 5EWJB 1J56A 4EGSA 4XLTA 2GKGA 3SNKA 4N41A 2IYNA 4MR7B 5KQPA 4G0PA 5CNJA 2JBAB 4YCSA 2WJWA 3N53A 5JNVA 4G0YA 1Z17A 1ZHHA 4FE4A 3DGFC 3CG0A 4XAQA 2ID9A 1OXBB 4RK0A 2FSPA 1W25A 5B3JA 3O74A 2MYNA 2WMYA 3C6QA 4W5QA 3O1IC 4MS3B 5JNRA 1Y1LA 3EJWA 2B1JA 4MGEA 5EWMB 4TN5A 5TE9A 5BRJA 1TMYA 4TLMB 3ROTA 5IC5A 3OLWA 1P6QA 5IX8A 2L18A 1JFVA 1QP4A 4N47A 1NXPA 3KYIB 2E4XA 3KLNA 5JNSA 3GBPA 4WUTA 2HQOA 4RK4A 1JDNA 4Q7EA 4OLBA 1L5YA 1DCKA 1P2FA 5JS2A 2JVIA 3DLHA 2MSLA 2VUHB 3C3MA 3GWGA 5DGCA 2RDMA 3SG0A 3E61A 4UHKA 5KWSA 3N0XA 4QICA 3QLVA 4MR8B 3BBLA 2PAFA 1YS6A 3D02A 2LPMA 3DBIA 2WJAA 3QELA 5GQSA 3CZCA 3H5VA 3Q15C 3NHZA 3HXMA 2F8TA 3I5AA 4YO7A 4M88A 4YV7A 5BRAA 4KK4A 2MYPA 5CNMA 5GOTA 2QZJA 2MYUA 3R0JA 4JAVC 3IP6A 4FB4A 2M98A 4TMYA 3LTEA 3HDGA 5KI6A 1Z15A 5HSGA 5ABPA 4PYRA 1FFSA 3CTPA 3MQ4A 4LX8A 1SD5A 3CZ5A 3H1GA 2WY2D 4EY3A 4YR7A 3EAFA 1TM2A 5IULC 1D5WA 2E4YA 4RXMA 2R47A 2IPLA 3HDVA 5FWYA 3Q9SA 3T6KA 3KHTA 2PUEA 1JYEA 5DTEA 1NXSA 2PJUA 4L85A 3EQZA 1FFGA 4MR9A 3CLKA 3NBMA 3TMYA 4RY0A 3N0WA 2QV0A 3MIZA 4Z4FA 3QLUA 3NNSA 2QU7A 2HQBA 2IKSA 4HYEA 3RVRA 4RK7A 3H75A 1DP4A 1U0SY 3MA0A 2H3HA 5FBKA 3CS3A 3O1HB 4P1ZA 4EYKA 1ISSA 4PICA 3O21A 2FEPA 4KQ9A 1APBA 4KVFA 1U8TA 4WZZA 4MPTA 2WB4A 2X7XA 4P98A 4ETNA 3M6MD 1D1QA 1VKRA 3QEMA 4LDAA 4KFCA 3RVQA 3ILYA 1S8NA 4MRMB 1QP7A 3C3KA 3MF4A 2PUGA 3HZHA 3OO0A 3H5IA 3UUGA 1P6UA 3RVSA 1DG9A 1DC7A 4KNYA 2MYTA 1ABFA 4ML3A 5CHYA 3F6CA 4NCBA 3K9CA 3CHYA 2RGYA 4H60A 3F73A 1DRKA 1JFTA 4NQRA 1USGA 3GV0A 2HSGA 2JCGA 3RVJA 3URMA 4ZJPA 3OLXA 4PE5B 5JNUA 4N76A 4W5NA 2PLNA 5PNTA 1JH9A 2CD7A 3T8YA 1BDHA 1H9CA 4Y9TA 1ZY2A 2Q5CA 3BREA 5HQJA 1YMVA 1YTUA 4Z0NA 4D74A 3FFTA 2N9UA 1WETA 4HNSA 4O5AA 3JVIA 2B4AA 5IBQA 2PUDA 5TQ0B 2FMHA 1GUBA 3LMKA 4G0QA 3VNBA 1ZGZA 1GCAA 1PUXA 2A9QA 8ABPA 3I09A 1DZ3A 3IPCA 4Z9BA 5E3JA 3QLTA 2WWVD 2PUAA 1YK1A 1URPA 3EDCA 5DKFA 3N6VA 4RY9A 4Z4GA 3A0RB 1UDRA 3O2SB 1DCMA 2IPNA 4ZMRA 1VPWA 1TLFA 3RVPA 3FDFA 3EODA 1E6MA 1DRJA 1ZDMA 2IDMA 3BRQA 3JS5A 3P9YA 4IF4A 4DN6A 2VK2A 4NCAA 1QNLA 3H1EA 4ZYLA 1KMIY 1ISRA 1RXIA 3L49A 2LP4Y 1M5UA 4B09A 1PHRA 2QXYA 1MIHA 5D2CA 1MB0A 3HCWA 2WRZA 3GT7A 3I45A 2IPMA 1XWWA 3LUFA 4EYOA 3OQOA 3TO5A 1YIOA 2NZUG 3IP9A 1Z2EA 1NXOA 2IPAB 4EVQA 2AYXA 2ID7A 1LJLA 1YMUA 4RKQA 4LE0A 4RSMA 5KQLA 4FE7A 3IDOA 3NHMA 1I3CA 3A3KA 5HM6A 5DCLA 2PUCA 4NV3A 3HUTA 2W42A 3FFWA 1Z12A 1YVUA 2J48A 3KCNA 2NT3A 3OM0A 3O2JA 3RVOA 1ZAYA 1FSPA 3MYYA 3HEBA 3H1FA 3Q41A 4F3TA 5DLEA 4WXMA 1JYFA 5CNIA 3N8IA 4D6YA 1AB6A 3A0UA 2RJOA 3EQ2A 2KYRA 2FMFA 2MSKA 4XASA 3SM9A 3M9XA 1JF8A 1Z26A 3O1JC 5KQMA 3KLOA 3CU5A 3HK2A 1QP0A 3OLZA 1K66A 4Z9AA 2E4ZA 3H6HA 5IEJA 1ZGGA 2QVGA 1QO0A 2FLWA 4LE1A 1BA2A 1R8JA 1HEYA 4E7PA 3RVKA 4MS1A 4S04A 5JS1A 2FLKA 1ZN2A 1SXIA 1W9HA 2YHBA 4RWEA 4KREA 3Q7RA 4IMIB 4G0ZA 4JP1A 3QX9A 1BDIA 4RK1A 5KC9A 2PUBA 3T38A 4HNQA 4UHJA 3K4HA 3QELB 3JPYA 3KJXA 1PEAA 1PEYA 3LFTA 1JLKA 4HNRA 1MVOA 4LDZA 3H5OA 5C5CA 1Z2DA 1SXGA 1XHEA 3OLVA 3NNNA 1FFWA 1FQWA 1U2PA 4H3KB 2LUOA 3UKJA 1NATA 1NXXA 4YP9A 2PUFA 1MAVA 4G0MA 4RU1A 5FWXA 4F11A 5TPZA 2FQYA 4Q6BA 2LBPA 3IP5A 5F64A 5IUKC 3GYBA 4EYQA 4IILA 3O75A 4EVRA 4F12A 3OMXA 2L2QA 1USKA 2FXIA 3D8UA 5FWYB 4RY8A 3Q7SA 3BRSA 5I4CA 2VYCA 4MR9B 4MQFA 5BR1A 3TD9A 2R48A 2P4UA 4E7OA 3HVRA 3F7NA 3GL9A 3NNDA 3GA5A 4JB0A 2DRIA
chains in the Genus database with same CATH superfamily
4FKMA 1Y8ZA 2VXBA 1C7FA 3PFGA 1F6DA 3BGVA 1PD1A 4PG7A 3X1YA 1FNNA 1MJFA 1O95D 4FGUA 1P3JA 1KIAA 2V9ZA 3CQ9A 4Z3OA 1WLSA 5J5AA 1E9EA 1KIFA 3FHTA 2W70A 4ZZIA 1C7JA 3GH3A 1P80A 2AGVA 2JGJA 5H59A 3WWPA 3IMGA 4LHEA 2EFEB 3I9KA 1WEHA 1Q1AA 4HDKA 2NPOA 3LKBA 4B4WA 2HHLA 3TG8A 1N5MA 2UUOA 2X13A 4CM7A 1UADA 3V1NA 2YZGA 1QG0A 1Z0UA 5H3HA 4Z4CA 3UTCA 4CCWA 2QT0A 1V6CA 4MARA 5KNDA 2GD1O 1KOFA 1NDQA 3PQ8A 2ACKA 4A2CA 2PE5A 2Z3VA 5F1YA 1C4WA 1NVVR 4M3NA 3DGEC 5JSKA 1CX9B 3OZCA 1CTQA 1NFRA 1TI7A 2WIFA 3QYJA 1B00A 4MWDA 3K1JA 4JIGA 2BFDA 4PQRA 4ZFNA 1P7ZA 3AY7A 2BHSA 1R0YA 1IL0A 1R9GA 5INTA 3UMMA 4MWGA 5BYKA 4F8EA 3EGWA 3KD2A 2C31A 4KN5A 2C7PA 4G97A 2NO1A 4XRGA 4H59A 5AHKA 5KJFA 1EWRA 1TLTA 1UT8A 2AG1A 1CSEE 3AERA 3F98A 3N70A 2V6IA 1N7GA 3OO1A 1VBKA 2OCLA 3T0IA 4Y2VA 2ZUFA 3A70A 3M4NA 4FT4A 4ZN6A 1W85B 2PM8A 1U98A 3A8TA 3P20A 4HX2A 4O2LA 1ZVQA 1ZI9A 4KU4A 5HFJA 3FCUB 5F2OA 3B52X 1IBCA 2ZI5A 1WMFA 3DNFA 4MV0A 1W5AA 4S3MA 5C8YB 4A16A 3K05A 3NLLA 1ACLA 2WNIA 3TOSA 5AVUA 2ZRKA 1MC5A 1OUMA 3D3NA 3QU9A 4CM3A 3JQQA 3ZJ5A 2B4TO 1L4HA 4RHTA 5FLKA 4EKYA 2CFSA 4IXTA 2HSEA 2H18A 5JSQA 2ZSEA 3IEIA 4D3YA 3KZOA 3WGTA 3WLSA 5DM1A 4MUYA 4MJXA 1CS0A 1IUPA 4TV8F 5TMPA 2ZRNA 1PJBA 4GOKA 4OQPA 3HKCA 4ARIA 1P4GA 4FFMA 4GX2A 2O0JA 4WNAA 4BKMA 3FOBA 1VLQA 721PA 4TRRA 5HF6A 2XCTB 3B6KA 3I9OA 5JHHB 1BG6A 1M5TA 4OSOA 1RLIA 1VECA 4X1YB 1C4KA 3D8TA 3SJAA 4HZUA 1GTJ1 4AY6A 1WB9A 5JZBA 3RQSA 4EENA 4DOMA 4LNUA 3BYZA 2X3YA 4YO8A 5EEGA 3MOGA 1N2ZA 2J3IA 3CO0S 4JCOA 3GU3A 1F2TA 2BEWA 3IE2A 3RUDA 5BSRA 1Q0UA 1V11B 4HFRA 1ENYA 1P7WA 2FDXA 2Y0DA 3GVIA 1Y80A 5EXSA 1M34A 3IIEA 4L76A 5CLIA 1XQXA 4ZOEA 5KQSA 1VKJA 4NVRA 1UUFA 3Q7QA 5A9TA 4IG9A 2QZ4A 2AG5A 4OQEA 1AGNA 1SCJA 2IXEA 1KDZA 2I5PO 5KPJA 2PKWA 1UBJS 2IYQA 4HXFB 3DVAA 4I4LA 2M1XA 4E3WA 1I4LD 1RXSA 1FP6A 4FYWA 3RH0A 3K6SB 2X5NA 5F5LA 1JKFA 1R3DA 4WTOA 3GW8A 1M54A 1W0KA 3LNTA 1T3GA 2IIVA 4JT8A 1QVZA 1RZ3A 4CMEC 1L7DA 1NVVQ 1T5BA 3ET5A 2CLKB 5M29A 3S8YA 2GZ3A 1R4AA 4CQJA 1JLRA 3QEKA 1ODJA 4A8JA 5H70A 3MSCA 1H85A 2I54A 4HBZA 1DBVO 2YOGA 2TMKA 3Q7TA 4D82A 4M7PA 2BZ1A 3LUHA 4DQUA 4H15A 5F76A 3JARA 2ODBA 2W2KA 1FP4A 5LD2C 1I4EB 3ZGZA 1D4AA 4PNZA 3ZYZA 5TC4A 2NTVA 3K2IA 4CMJA 1UFVA 5JATA 1ONOA 5HFNA 1THMA 821PA 3QKRA 2ZJOA 4MS1B 3RYIB 6CHYA 4Q4LA 2EZ8A 4HRXA 4X00A 2PZKA 3TLAA 5C2JB 1FIUA 1GLGA 4I9GA 3ZJUA 1NVWQ 2GH1A 2Q2NA 1TF7A 4FN5A 2ZP1A 1G1MA 2JLBA 2Y77A 1SB8A 4IHJF 2ZSKA 3ROGA 4ZMBA 2V5UA 1FJHA 3BWMA 2WHYA 4GQAA 4D9NA 1DJOA 1GG2A 3OCVA 1RAHA 2ZRLA 2HGZA 2HHJA 5FOSA 4YAKA 1AV7A 4P8RA 5JECA 5D6OA 4GWLA 3S1AA 4E09A 1G5TA 1S3IA 3QNMA 3BZUA 5AM0A 5DNUA 4FZ3A 4DCUA 2ONZA 3T7KA 1MFPA 2AW3A 2C4TA 5KU1A 1TM3E 4KK3A 4N3BA 5FYQA 5KTPA 3THXB 3L6UA 2KE5A 3H17A 2Q9AA 1Z4PX 1QIEA 3EEIA 4YLEA 4Z4HA 4MDHA 2ZYDA 3THYB 3ZE0B 2PWPA 3P9IA 3RJZA 3IR5A 3UXHA 1BD4A 1DRVA 2DFLA 2JHGA 4DR3B 1QS0B 5BUQA 3DKIA 4MEJA 1GL7A 2A0UA 1R0KA 2PWAA 3N86A 3PK0A 4JJ8A 4B8ZA 2PR2A 1E4VA 2Q9BA 1PZNA 3SSAA 1IC6A 4X3PA 1P7CA 3LUCA 1TQ2A 3OEEA 4JVNA 1O3YA 2IYRA 1WO8A 4FWBA 2BMFA 2OHHA 1X42A 3KT6A 1D0IA 3K1TA 2W8ZA 3JATA 1PTKA 3K6JA 2YCLA 4DDHA 3THRA 3UB4A 1NVTA 4FD2A 1PDVA 2FEWB 2HUNA 1E1RD 3BTUA 4FW8A 2P41A 6AT1A 5ED4A 3J81A 2IOYA 3WLFA 3K2BA 4NMHA 1T8SA 4WESB 2ILTA 1M74A 2P3OA 3N5KA 3DEHA 1IY0A 1CHDA 2XKBA 1ZX1A 4MAMA 1SA0B 1TUBA 1YRWA 5F2KA 1P45A 3HR4A 3INNA 3KKOA 3AOEA 4XLTA 2O1XA 1PJAA 4FCVA 1O5OA 4TQGA 3TQCA 4PSCA 2NN3C 2XJ4A 3B9PA 2OMKA 3HBJA 4FW9A 4BNLA 2CLMB 1IATA 3K35A 2PEYA 3L8DA 4PC7A 5HF9A 5DYYA 3T7SA 4URFA 1RU3A 4DWJA 4XAQA 1CLEA 5HVNA 3GJ0A 3JYHA 1UBFA 4AJLA 4D2IA 2OGSA 4MS3B 4JC5A 1XPJA 1NJGA 3IA7A 3EVTA 4OI1A 3T3MB 3N8GA 1Q12A 4NDAA 4ZEXA 1NF9A 2COEA 2V7QD 3JYLA 1GUFA 2C3OA 2P9GA 2OSBA 4LYAA 4JQSA 1Z4IA 4TMFA 2DY1A 5ICCA 1FNDA 1ZZEA 1N6PA 2FE1A 1A77A 4TV8B 4B3RB 2W93A 4ARBA 1PG5A 1KC1A 2K2QB 3DDHA 3M3PA 3QYPA 3VR6H 2ASEA 4OQNA 4RESA 4S1WA 4BHTA 3MWYW 2EWVA 4RK4A 4TYNA 4OJQA 2VKQA 3ENKA 2FUCA 2WZBA 2HBQA 2NNLD 2H85A 4L5CA 3A4LA 3CRVA 4M9CA 2VUHB 4A82A 3A1UA 3LLCA 4KRGA 4J49A 2RE8A 3QU2A 3FNEA 1GD1O 3BGOS 2X8AA 2YVKA 3HN7A 4Y2SA 1AMOA 2W6JA 1WKVA 5E6RB 3U44B 3L9XA 1HT1E 1WZNA 3MT7A 4FDLA 1ZJYA 4M1QA 1TK3A 1JKMA 1YR8A 2X6TA 1EK0A 3NC1C 3UB3A 2BN4A 4MICA 4PZCA 5BRAA 1S2IA 2CHQA 2ON6A 4HO1X 2Y67A 5A4AA 4CEJB 5KHOC 5ALFA 4IIEA 1RJWA 4X6UA 4H1VA 3AKDA 4F3NA 1ZK0A 1ZNQO 3WGOA 1JLMA 2ZSFA 3UC9A 1N57A 3IIJA 5A71A 4RPLA 3FYHA 4D0LB 1L1EA 1Z15A 4IWXA 3PNMA 4YT5A 5H80A 4K88A 5HSGA 4GBJA 3PQ4A 4DJ5X 3CZ5A 4ND8B 4CETA 5BY2A 4YAOA 3RRNA 3FAKA 3JAWA 4C3OB 2E37A 3EGIA 2ESRA 4A8TA 2AXQA 3DMGA 1LTKA 1UJNA 3EFHA 4L85A 3NEAA 3ZWPA 2LKCA 4IW3B 4DJEC 4H1WA 2ZSHA 1NBHA 1BS1A 4W4TA 1MAAA 3LQ2A 3KCQA 1E0JA 1RZVA 2ZIEA 5ENZA 3DE5X 6REQA 4K9QA 4FHDA 4XIGS 5KOHA 1FQKA 1QFYA 1TADA 1H2YA 1EDOA 2XUAA 2WPDD 5C7IO 3UN1A 4POOA 4GS5A 4HN2A 2HDHA 2O7NA 4JNCA 1SG6A 1SOVA 4GMFA 4YA6A 2Z3WA 4IS3A 4CCAA 4M9RA 1ISPA 1NW8A 1OIWA 1KPIA 2HLDA 3JCZA 4ZVQA 5KKAA 2F8LA 2N1MA 4GUDA 1O57A 1YZUA 4W7HA 4IHJB 2GEVA 5J47A 1XZAA 3M6MD 1CS4C 1AT1A 1NU8A 2JKZA 2WM9B 3L5KA 1I6LA 3O73A 3EQ8A 3P71T 4S1TA 1NVAA 3TLZA 2GUGA 3ILSA 3L8YA 3L8FA 3KSZO 1QP7A 1DXHA 4YMVA 4O2AA 4KSBA 1R74A 3N2KA 2R1TA 3QU5A 4MW2A 1TNDA 4PHHA 1J0EA 1DC7A 2GDJA 3LX6A 3EH1A 4RX1A 2QZPA 1G8FA 2C5SA 3K73O 3OPVA 4QO8A 1T9HA 1QKIA 4EG5A 5C1OA 2V65A 3QI7A 3STTA 1KVTA 2CLFB 4LOLA 4NQRA 4KTTE 4B6PA 4JBWA 1TO2E 1KERA 3M4XA 5F52A 2P9JA 4EA6A 1B41A 2NU9A 2PA3A 3CNQS 2YTZA 4JR1A 4NQZA 2RAVA 5JBQA 4Z0NA 1G291 4ZAWA 4E22A 4JZYA 1ECCA 1GYQA 5ALQA 3TECE 3DPSA 1ZN9A 1F4LA 4CG1A 3M8KA 1H4TA 1X86B 4TRJA 1MAHA 1OZGA 2GVNA 2IPXA 2WP0A 3CC8A 3EHEA 3ORFA 4P4UA 3CH6A 1P5HA 4O3MA 2QGZA 3JASB 4TKUA 4AY5A 1GCAA 4YJ2B 1DZ3A 2Q6KA 1CJVC 1JG6A 1Q15A 2XOEA 1V8FA 1AIPA 3CX3A 3ETHA 1KBZA 4KXWA 1UIMA 4EAAA 1H05A 3KOXA 2LIPA 3CLRD 3F74A 1DAFA 2G63A 3KYCB 4HFMA 2O1SA 1ECPA 1ZRNA 2MSDB 3LVFO 2ZXFA 1ZOLA 3PIRA 2IEZA 3THSA 3X1ZA 4L0MA 1UJCA 3ZCXA 3TQOA 3HDTA 4AECA 1CR0A 1H2EA 4AJ9A 3I32A 4YV1A 2J85A 4JI6B 1IBMB 3V80A 4WKBA 4Z9FA 1MIHA 3V7NA 5LQKA 1R9MA 4FQ8A 2ZIVB 1FF9A 2WRZA 5DNCA 2XZPA 1P7PA 1YI0A 2HSWA 5H1YA 1WSBA 1V9SA 2VG8A 3NP7A 2J07A 2ZYHA 3IV7A 3T5BA 4GKKB 2XNSA 4ND2A 3SPXA 5TMBA 3B78A 1F12A 1PSDA 2Q07A 3R3ZA 4G4IA 4F92B 3IP9A 1OKKA 1PJSA 4YNBA 3U4QA 4I3GA 1DC4A 1ZCBA 5DRYA 5A9SB 4D81A 4HQOA 4B47A 4LE0A 3EXFB 3UCFA 4CT5A 4MVJP 2D5LA 4IR7A 1IY1A 1USVA 1DPFA 1OAOA 2IZOA 4LJ7A 1OBOA 2XKAA 1ADBA 1PTJC 3RVOA 3CB4A 3BXXA 4F2WA 1GGJA 4M6WA 4QUJA 1Q7TA 5DE3A 2LV8A 4TYQA 4PYQA 3SJ7A 2XRZA 2I2AA 1X1SA 3FNRA 2Z0MA 1W2HA 2OO5C 3B48A 1YULA 4D92A 3ULKA 1Y48E 1Z8HA 4KUGA 3UT6A 3ZGNA 3IURA 2M6KA 4F72A 3FPHA 4RFVA 4ZEMA 1SN7A 3GZNA 4QASA 2PGAA 1XTIA 1YCGA 5DF1A 2ZIAA 3PT9A 1L4EA 3HK2A 1PIWA 4MTCA 4DNFA 5DV9A 1F7UA 3UTDA 4JI8B 4Y2RA 3OPYA 3VR6A 2VA8A 5K0SA 1QO0A 3LO8A 1QH1A 3I6YA 5G2OA 4ESEA 2JHPA 1XZFA 1XL0A 4X6XA 4DTCA 4JQCA 2HMAA 2HJRA 4WBXC 5K6RA 4EK9A 1CIJA 2J41A 2A5LA 2GPBA 2FETA 3U49A 5K20A 1RXWA 4JP1A 3M4JA 1TUGA 1Z5GA 4FHCA 4CQLB 3UBMA 4JI0B 1DC3A 4GPEA 4MGKR 4UREA 1QK4A 3SOPA 1NOKA 1CPYA 2CNNA 2YIDA 3I30X 2RHCA 4I1SA 4S0XA 2FN4A 2F3SA 4DWOA 4ER0A 1VL8A 4MV4A 1SJ9A 1XHEA 2RIPA 2VBGA 3ZBPA 2FFHA 1V37A 3MTJA 1XEFA 1N2IA 4IF6A 2JDID 3NDIA 3QQPA 1KJ8A 1RXCA 4UOQA 2A58A 2QDXA 4WBNF 1GZSA 2PUFA 3FJOA 1MAVA 4G0MA 4LKOA 5C4GB 4EUHA 1TYZA 1PZHA 2EJWA 3HPQA 3EVAA 4IJWA 4Q6BA 3F6EX 4Y6RA 5B5SA 1KEKA 1FYFA 4JB3A 8OHMA 2V3VA 2ISQA 4QOSA 4HNHA 4EVIA 2O7RA 4IILA 4XOUA 1SHTX 2P7HA 3RC1A 3LPCA 3OMXA 2PT6A 5DM0A 4ZCQA 1EDBA 3FA2A 5CURA 5FWYB 3UYLA 2P67A 4BLUA 3DS8A 5G02A 1IE3A 4Q1EA 4Y1FA 3Q7SA 3BRSA 4U7JA 4YBRA 2JLSA 1ULTA 1LJ8A 1N5IA 3DMDA 3OQPA 4J4BA 4EHAA 1Q7RA 3B1WA 2PX8A 3MUOA 4MQFA 4F4HA 4MYHA 4ZI3A 3UCEA 3QVGB 1IBKB 2B7LA 3D4LA 1US8B 2DPYA 3F3MA 3HDJA 4FYJA 4PTLA 2GXUA 4QJ4A 1UFKA 4TX1A 1QHXA 2HHAA 3T0FA 5B12A 3GEGA 5ISMA 1ZAKA 2J59A 2WAMA 4GPBA 2JH9A 4O0MA 1S02A 4DIKA 1M1NB 4PIVA 2FF5A 3UWPA 2CE2X 2JS7A 2VI5A 1VKHA 4GVPA 1IAVA 1AZTA 1JHVA 3AEUB 1BQ4A 4ZRDA 4XB6B 5TMDA 2YASA 4MVJF 2A7XA 3RQIA 4YRKA 3KSMA 2IVZA 3W9UA 5I9IA 5A4KA 4B32A 1J20A 1KJJA 2JW5A 3RC9A 3D5EA 1V8PA 4LRSB 3FY4A 5IJ9A 2AB0A 5FP0A 1XTUA 1Y9JA 1SQ5A 2HCJB 1IJEA 1AXEA 4Q19A 3RB8A 3P9RA 1IPEA 1MTZA 2YZ2A 3HV2A 2C9MA 1QF6A 1S0UA 1D4ZA 3VO1A 4QPJC 3KETA 3TDMA 1U9IC 4Q48A 9LDBA 3HB5X 2B69A 4JUCA 3ZE2B 4JV5B 2QR3A 3ABIA 4L73A 5FBQB 1L5WA 1XTSA 1OYWA 4EKGA 4CI9A 1VDZA 4ICIA 4YLYA 5T57A 3G0GA 5CJ2A 1JAYA 3FKQA 3P2KA 3X1JA 1XHFA 5JJ5A 4MKHA 3GNQA 2WIDA 3QBJA 4F4CA 5GINE 2O8FB 4OLAA 1J23A 4KQHA 4L27A 3VZBA 3WMXA 2AUTA 1NJ1A 2JLCA 2EFHB 2DPHA 3FVTA 3IMCA 3PXXA 4QBKA 2XTMA 5JXWA 3BN3A 1A04A 3OTGA 1AA6A 5KYNA 1U7DA 4HUJA 2NU8B 4YGXB 4Y2JA 3KYDA 4F4IA 1VQ1A 3KOMA 2GPSA 4J7CA 1KHTA 3TZ6A 3AETB 2UAGA 3RUIA 3SEFA 2FPIA 2Q7DA 2FQXA 2OWDA 3L1JA 4J7UA 2DPXA 1M34E 3T94A 3TZHA 1YK0A 1TM4E 2CDBA 1CBUA 2DPLA 3OWHA 1VG1A 5KOJA 4LOKA 2W8BB 4S05A 2VK1A 3FDZA 1GNRA 1T6XA 3MILA 1JQKA 4WFKA 4EPWA 2BT4A 2X58A 3QF4A 2AD5A 4NYMR 4TVOA 1UC5B 2WD9A 2YHAA 4E08A 1RQXA 3K0AB 1RJEA 3SR0A 1GVNB 3UAWA 5AJHA 5K3CA 1KSFX 5K3BA 4NENB 4UQPA 1SQSA 1M8JA 4C4PA 4M1KA 4PCLA 1AK2A 4H6VA 1TW3A 3ZIDA 1QORA 5HX7A 2Q1UA 3WLKX 1TU3A 4NWIA 4Z4IA 1OYVA 1SQ0A 2QUHA 3P5BA 1JH8A 1ECGA 4LRTB 4MUAA 4XM2A 4BWYA 2YWJA 3FPFA 3VHRA 3D3EA 3FWZA 1QOZA 3HCAA 4LJ6A 4EUSA 5BQ3A 1L5OA 4JP2A 4TUYF 2NP6A 1V16B 3ZU2A 5U9CA 3TEJA 3AG6A 1E60A 4PYJA 3FWHA 3M6UA 1ULHA 4NZPA 2VAMA 3VZPA 1V6SA 1TQHA 4G1UC 1BAPA 2FN9A 4MS4B 1PNRA 3K20A 3FDXA 5GM1A 4RQBA 4K8OA 2ZBDA 1R4MB 1UJBA 1YQWA 3KZCA 3N6XA 1P29A 3BCHA 2QIOA 4Y98A 4IMJB 3WK9A 3C5HA 5IAOA 2CF6A 1AKQA 1GFSA 2L17A 2OKCA 4GW3A 3WNVA 2HEIA 1ECFA 1L7RA 1E5VA 1SR8A 1TJ3A 3MM4A 4RJKA 1YZGA 1I6MA 2ASVA 3ASZA 4IFEA 1K0UA 1E6KA 3OJOA 1OAOC 1AGXA 1W2WB 2EW2A 3FCCA 1MC4A 4J3JA 3LZCA 3SY8A 2F9MA 2W2LA 3HS3A 3B6MA 4V24A 2BJHA 4WBNB 1GRRA 2GPYA 2MSCB 3HUUA 5HRUA 3CRZA 4B80A 2QRZA 1J8QA 5K8UA 1N25A 2ZUDA 3RREA 2GZDA 5HNKA 5IT9A 4MZDA 2PK3A 3B89A 3E9NA 4IEEA 3FM9A 4BFVA 1FLVA 2UYCA 2PGDA 4P3XA 1CZOA 5J5VA 3NTRA 2BFOA 3S8MA 4BYMA 4HVLA 2ZWOA 2XXBA 3CLSD 5HZHA 5JMOA 1RI4A 1KP2A 2JNWA 1WF6A 1P2SA 1EQAA 5KTRA 3N2LA 2XGGA 1FW6A 4A0QA 3EQ9A 1OFGA 1TYBE 2FWRA 3MK31 4RD0A 3HCDA 4QRHA 4A15A 1LPOA 2XCUA 2CWDA 4BCBA 4EYGA 3KDSE 4C0XA 4E30A 2AC7A 2I9PA 2L19A 4IEIA 1QF7A 1A1VA 4N6OA 1WDTA 4LQDA 1ZVVA 4RY2A 4E6PA 5EWJA 3HRIA 2BMJA 3KQOA 3TX6A 1QC5B 1Z8DA 4DDKA 4YWJA 1KGDA 4XUGB 1MD9A 2P9HA 3DEKA 2V7GA 4JYMA 4F21A 5AM5A 3DL2A 3JWHA 2DXIA 4ALJA 4NYMQ 4QU8A 2QLNA 4K9NA 4KQWA 3VPHA 2EDAA 3PKIA 2D1YA 3GRVA 4EF5A 3WFZA 1RM3A 1SWVA 1RVV1 4BE4A 4XFJA 4AZ3B 4RK5A 3JQ9A 3QIAA 4L8GA 1C0EA 1WSAA 2Z5FA 3LDUA 4JSTA 1R50A 5K0ZA 5JYCA 2VBIA 3NHFA 1QYIA 3WTBA 1D4FA 3ZU3A 1IBLB 3A06A 3RYFB 3HFJA 1T9BA 4C3VA 2PFKA 3U16A 4M22A 2BDUA 4CQMA 4D9MA 2VF2A 2CHGA 2ZUBA 4OSEA 5SY9A 3FOAA 1TTPB 5D1HA 3X0DA 1JR4A 1NZJA 4AJ4A 5BQFA 1J1IA 4EY8A 3IP7A 1LBHA 1W5TA 2O2SA 5KYXB 3ECSA 2MSNA 4A7PA 4DM3A 3UATA 1ESEA 4K03A 4IIJF 4EPRA 1M7HA 4IH4A 3VR4H 3RYCA 5IN4A 3JWIA 3UAXA 2NUTB 2WJWA 2CDAA 4PONA 4ZAVA 4A0HA 1F8YA 4ZHQF 4IDNA 4DWWA 4NYIR 3OEWA 1BW9B 3O4FA 4FOPA 4IS2A 3O1IC 4M0UA 5HYVA 4EW6A 1XUOA 4QQRA 4LHSA 3RF6A 1Y1LA 4CL3A 3K30A 3OJCA 1H6CA 5FFFA 4EB0A 2JLVA 5KSYA 1E4EB 5JO0A 2CV2A 1F7VA 2NNWB 1N1MA 3IKVA 4N47A 1QQTA 4X3OA 5KNCH 3ZDRA 4JC4A 2V03A 3KLMX 1GNLA 1QH9A 3GP8A 3BICA 1B4DA 3BL6A 1GKLA 1BCSA 1W4RA 3ETNA 3GNSA 2NG1A 1HDYA 1CEXA 1UL1X 2Z9DA 3L6EA 3PHBE 1T8UA 4QREA 3I23A 3K4PA 4D8TA 1U3WA 2WR8A 3EBLA 3SG0A 3TXAA 3U80A 2WF8A 3ZCQA 1OZFA 4DIEA 1K97A 3QLVA 5B2ZA 3QNUA 1QTRA 2UV8A 3BBLA 3WHKA 3EXG1 4KACA 1NSFA 4K0RA 2LPMA 1YRYE 4DR4B 4GUAA 4LNHA 3GGPA 2PL5A 1IM8A 2G1AA 2IS2A 3CE6A 5DASA 4NFSA 4TUYB 3HXMA 3D2LA 5KWJA 2QYOA 3NHKA 2VHXA 3U3JA 5M34A 2IOFA 1NL3A 1GT91 3Q9NA 3TTXA 4C30A 4DRXB 1E4OA 4U8GA 3GMTA 2ZIGA 1EK6A 1JVBA 1JAXA 3CN9A 1C0PA 5FNVF 2H51A 1ODKA 5KI6A 5JD5A 3QBEA 5J2UA 4IH1A 3L04A 1CRQA 2Z1DA 1G8GA 1PFVA 1I8TA 1LQ2A 2AD1A 4Q9IA 4D41A 2I4NA 4UNIA 4LF4B 3LQQA 4GSYA 1KSHA 2VPQA 3AUYA 3AVTA 5FULA 1E3SA 1X1CA 3EY9A 2PZFA 1YE8A 1T0PA 1R64A 2TMGA 3LLMA 1QYRA 4X1OA 5KYWB 2P79A 1X8XA 1VHLA 2ZVDA 3NATA 4HTAA 1HRKA 3TMYA 3R5KA 2OHXA 1G41A 1LVHA 1GPH1 3KSRA 4MROA 4ARUA 1VJ0A 4PX9A 4HP8A 5BSEA 1NMZA 4YP5A 4BLOA 5CDGA 1LPNA 1Y8AA 3GFOA 4MCJA 1C1DB 4HMOA 1KWGA 2F00A 4RK7A 2X0JA 3O1LA 5E4FA 2A3NA 1KNQA 2ZUWA 4J6FA 1HOTA 3K2QA 3VSEA 1OLOA 5CB0A 1O0BA 5FBKA 4MRAA 5FTNA 3PNPA 1K8XB 3IP1A 1P5FA 5IK2A 3RIMA 2GD0A 2KLHA 3WQHA 5BSMA 1Y7IA 1Z4KA 4EW3A 1Z5UA 4YAGA 1A7JA 1Z75A 2HF9A 4YRPA 3W1WA 4L0CA 4NZOA 4UZSA 3VH1A 3GRUA 1GQFA 3MGBA 1E7SA 4NYIQ 3UW1A 2OK7A 2Q99A 2C0QA 2I6SA 4K87A 2BBWA 2J6BA 1AA9A 3MXTA 2PH1A 3OHPA 2PZAA 4PIMA 1T5SA 3IAFA 4C4YA 1LPSA 3LRTA 3VGJA 1EG2A 1UM8A 3HP1A 5FTMA 1V7ZA 4C4RA 5BVGA 4MYUA 2ZUEA 3ICQB 3LT1A 2XRFA 3KZNA 3BMQB 4EI9A 1XTBA 5FV4A 4X95A 1S1MA 1W8DA 1OC2A 4M89A 1RMTA 1FDTA 3L5OA 4LVOA 1JHAA 4OXQA 5EFZA 3RVJA 2HSGA 4WPGA 1GNQA 1HQYE 3DPIA 2MHCA 4Y30A 3OTIA 2PLNA 1TQDA 5DHAA 4UPDA 1BCRB 3TKLA 3W78A 1BDHA 3BC1A 4YMUA 1B26A 2JFUA 3QXGA 2CBGA 5EHIA 4ME6A 5B30A 4RIHA 5E38A 1UEJA 5CH5A 2ATVA 2M6RA 1UXHA 4LISA 1ZCZA 3RTBA 4H7FA 4O5AA 2BMWA 3P9QA 2G09A 2GF0A 4Y6PA 2YFQA 3CLTD 2GHRA 1KS9A 3R4CA 3RV4A 2VYFA 2PHZA 3GLKA 3NC0C 1GUBA 3Q3IA 1GL3A 3T1VA 1IDN1 2ECPA 4H9GA 3BFVA 1RTKA 4JCCA 4QDJA 2ZAIA 2NQ8A 3SD7A 4AIIA 2NYUA 5ITWA 1SO8A 4F85A 3TFOA 4XSGA 2QLBA 5ALDA 4NBLA 5DP1A 4F1KA 1IQUA 1FDRA 2BFAA 1O95A 1W48A 3NYRA 1SUSA 1BWQA 3AYZB 2AZTA 1ZNYA 3C4QA 2HUPA 1GA1A 1VKNA 3A0RB 3D8HA 4IIJB 5C3UA 2IPNA 3B1ZA 4CJXA 4ENWA 3C7DB 2ECFA 2OCBA 4MWTA 1ZXBA 3MBKA 1E9RA 2R6DA 4KLRA 2BFFB 2DFVA 1VBNA 3BRQA 2FXVA 3ZC3A 1CLUA 2A86A 2GK4A 2H2AA 2X8JB 1MAUA 1SU6A 3OFVA 4IJKA 2I62A 3V3TA 4DBLC 3D7LA 1MO4A 3T1NA 3SXUA 2X5JO 2JFOA 3OA0A 3CPJB 1TVEA 3QENA 3G17A 2WKRA 2OBYA 2VJLA 3HCWA 2R65A 1UK6A 1XLVA 5HWSA 3U7FB 2HK7A 1R8QA 1BROA 2E89A 4JJ7A 6YASA 1CJUC 1B15A 3IHWA 4H3VA 4LRXA 1Z6AA 3HZOA 4OGKA 5EJEA 4ZCSA 1TJ5A 3N8DA 2P6PA 1PVVA 4MJ7A 5AJXA 2IUSA 4V0NA 4XDYA 4BCDA 1U31A 4Q5IA 4YRJA 4B0PA 3P96A 3O4GA 1SZPA 1G2QA 2C7QA 2NTEA 3A7DA 5I3ZA 3QPVA 1OLUA 2AQHA 3VX4A 1GPDG 4F0JA 5KQLA 3JQ7A 1L1FA 1USWA 2XDWA 3ZTWA 2AN4A 9GPBA 3K6RA 3UFXB 3N87A 4C0KA 2FPXA 1BHJA 2GN6A 1YB5A 2DQKA 2JD1A 3ZHRA 1N8SA 5ALLA 5TGZA 1IULA 1IZ0A 2HNBA 4Q39A 4AZWA 3EZNA 3TOCA 3H1FA 4F3CA 5GVSA 2WWXA 3UMRA 4KG7A 5AYVA 2JLZA 2ZREA 2DERA 5I7EA 1HZZC 2PLRA 1J39A 4IOMA 2OLEA 1ZSYA 4V0MA 4E5KA 4B3IA 3SM9A 2HPVA 4DLLA 4EG8A 1NF3A 2GRJA 2I87A 4R7TA 4J7XA 1B3RA 2ZE5A 3EJ6A 1JE0A 4XPIB 5E8JA 4BGVA 1K88A 4WAUA 3CY6A 4EHJA 1KDYA 2W83A 3CE9A 4C05A 4KWIA 2O2IA 3O4RA 4LE1A 1AKYA 1RM5A 3EXG2 1JQAA 4EB6B 3M5DA 4XX0B 3EZ7A 1UBOS 1IHUA 4JU8A 5DGTA 1SVKA 4JJ4A 4BV9A 2VNJA 2PSSA 2G0NA 1M8KA 2P68A 4ZTUB 4EYEA 2O7QA 1FS5A 3PD1A 4RK1A 4TPKA 3RUHA 2FUNB 4ZQGA 4LRYA 1ZEMA 1MHTA 3LCJA 4RHYA 3P9PA 1YFLA 4EFLA 4LDZA 1UBNA 3GMIA 3EZLA 4HN9A 2HWYA 3MG9A 4WERA 2ZRDA 3H11B 4URWR 1A4IA 1KR5A 1DMSA 3OX2A 3KYCA 4XDGA 3WL4A 2DUMA 4ERNA 5HZMA 1JZQA 1SVNA 2DAPA 3EVCA 4YHBA 1N9GB 3ZD8A 5EG5A 1WB4A 2CLOB 2E4AA 3VO9A 5C8DA 3LCVB 1PLJA 4GQIA 1Y3FE 3CH7A 3H7AA 4U7GA 5HBGA 4DQLA 3GUZA 1SVSA 3TLYA 1BU8A 2FQYA 3TW0A 4UPEA 1N6OA 4PRKA 4JLVA 2IHZA 1IFXA 4BLPA 4KAAA 4CMHA 4ZC1A 1GKIA 1XOIA 1H6BA 2L2QA 4WI1A 4MW9A 1I6WA 1QZXA 2HN9A 2QQGA 1KYIA 4L3VA 4X60A 4CFYA 3DWGA 4ZQBA 2UZ4A 4TS4A 1IEQA 3Q3EA 2FRDA 2TSYB 1LKZA 1PYDA 3G88A 3WKBA 1D2EA 3KJEA 2R62A 5KQRA 3OX1A 5HKLA 3TD9A 4DIFA 2WE8A 4E70A 1E92A 4PNEA 5A62A 2A0YA 5AW0A 4RD6A 1Y63A 2JGNA 2WG0A 1XJWA 3TIGA 4F5EA 3TLGB 1IRIA 4RV5A 3H9JA 3U9SA 4Q7LA 1KETA 3AVWA 5JIBA 1EB9A 1ZJ6A 4RUKA 1DQNA 3IOYA 2XMQA 2P1RA 5DXAA 1ELOA 4NV1A 4BRUA 1NVEA 5KTMA 1VJTA 2ZWPA 4YY3B 4AZTA 4F6RB 4Q15A 4E21A 4AUMA 1CR6A 4AO6A 4DC9A 2OEPA 3TJZA 5IF3A 1F1BA 1FX0A 1OMOA 2DFTA 4IX1A 5TSDA 3CUKA 5H68A 2XWPA 1RP1A 5HGXA 4Q4AA 4WKOA 3IILA 3OY2A 1A5BB 4HCJA 2BR3A 1T2VA 2VCYA 4KH0A 5H9VA 2FZKA 3IGFA 3HKBB 1RXVA 3LUJA 3CX6A 1JWAB 2XBLA 1FNMA 2Z08A 3HB7A 4C5BA 5K5EA 1Q6YA 3VC7A 1MHPA 2JIDA 2I8CA 2YICA 4S0ZA 4FMPA 4K86A 4DMRA 2ZBGA 5FTJA 3VR5D 1N2BA 3LZDA 4D3XA 4RTRA 3HCBA 3OEHD 3T52A 2P7IA 3LT4A 5KYUA 3C14C 2PBLA 4HDOB 1DV1A 4I5GA 3S2IA 5JZVA 4YIKA 4I8XA 2XKJE 3QU7A 1SZCA 3FOEC 5KOIA 1AQLA 3L0OA 4V03A 1E1RA 3WK8A 2JVJA 3FD8A 5IKEA 3P97A 4ALKA 4ZV7A 4HQFA 4MINA 3CIOA 1WCIB 1G16A 4EO7A 1UDXA 5J3JA 1B93A 2UZ0A 2HQRA 1R15A 2QF7A 3BVPA 3CZ4A 3DP7A 3L8EA 1EFKA 4FCTA 4KC0A 1SIBE 3N8KA 1R6UA 4FXPA 3DTVB 3LE8A 4TXMA 5EYPA 2GSWA 4NXNB 3ZZ1A 2J4DA 1JBQA 4EOGA 1THTA 4W9NA 3A3YA 2W7TA 4F46A 1V71A 3FW1A 4QT4A 3D3JA 3FPKA 5CRIA 4JI7B 4P82A 4JEMA 1LBTA 4BX3A 4DCJA 2HSJA 2VLBA 3LTNC 1KK0A 1NLFA 2GLXA 2ETVA 3L1HA 4KQCA 2FPPA 1QUEA 1FNSA 2YFKA 3LK6A 4KO8A 2PKCA 2V7QA 1K7CA 1SXHA 4ZYYA 1SKYB 2IJGX 2WFZA 4HNUA 3LPAA 4BE9A 4NDZA 2C9BA 1PJ4A 1TTQB 3PC7A 4M1MA 1WF3A 4KQIA 4UDOA 3VDNB 3GLGB 4ZEOA 2YNMD 2M6SA 3KJZA 1A82A 2RHDA 1AUXA 5HA5A 1NXQA 4LGVA 9LDTA 4JOQA 1BXRA 3IAM6 3O5AA 4BDTA 3FSGD 1NVDA 4W82A 3HLTA 4HJXA 3UJ6A 3R4VA 2WYIA 3W2HA 2P9ZA 3I9NA 3K9HA 2MMGA 3RSFA 4D26A 4ND1A 5EVJA 1IZ8A 1SBNE 1TO6A 2XNCA 3JQ8A 3ACBA 4GR4A 1SFRA 2HT6A 4WEQA 5E4YA 2REQA 1A1SA 4E94A 1A96A 3E8MA 1A7AA 1BH2A 2R8XA 2I34A 1W6UA 3FTNA 4AYWA 1UC8A 5LU8A 4C5AA 1DJMA 2J3HA 1QR2A 3ZHOA 2G5PA 2YHIB 3UFBA 3AF4A 3ETDA 3RLIA 5K6AA 2DQYA 4EFDA 5KAPA 4E13A 3VXKA 3C2QA 1TYEB 4P54A 4ZYWA 3T61A 1KFEB 4N5IX 2F6RA 3DCNA 3P9SA 3N75A 3ZOKA 2R8EA 1EK1A 1XQ6A 4X84A 2VUIB 4Z4EA 1RPTA 1RBYA 1E3WA 5LLSA 3S4YA 4QTXA 5HCIA 2VHVA 1N78A 3MTAA 1CQJA 3GEBA 1FLAA 2E18A 3GJXC 1LDNA 4Z99A 1P2BA 5ALIA 4MI1A 2PX4A 2H1FA 4Y2PA 5KREA 1RWMA 2DYKA 1HYQA 2CLDX 2O0KA 4NI5A 4YUVA 3VYVA 5DBFA 4FINA 1P4HA 4D9FA 3G2IA 5D84A 2VRBA 4KKXB 2EL7A 3G2OA 1KAHA 4S2EA 4IXMA 4L08A 3ZY2A 4YV2A 3K96A 4KLAA 1JBEA 1ZM7A 3D43A 2JATA 1P62B 3HBFA 1I13A 1JDBC 1P1CA 1ZEJA 4B9EA 2WPDA 1M8GA 3M9WA 2P35A 4WW0A 521PA 1LPBB 3PGMA 4BTLA 2VRCD 3ROFA 1ZUIA 5FWXB 5FX2A 3AILA 1QQBA 3GFVA 4AS1A 2NSJA 5CLHA 1WDWB 2QN9A 5C52B 3SF8A 2QROA 4YYEA 2ZT5A 3NWBA 4FFRA 1LD3A 1XTRA 3Q9UA 4XB1A 1XDWA 2OLJA 2AQKA 4PXYA 1PGPA 5CCBA 4WCDA 4MRRA 2FZGA 2NXEA 4FB5A 1TECE 1ABEA 5I51A 2CMFA 1GJRA 3A1EA 2EWWA 3W3AD 4EFKA 1CY8A 4N4AA 4E4TA 1G98A 1O9BA 2IGTA 4PAMA 3W4KA 3LWZA 3QWHA 1RIIA 1ZRHA 3BFKA 2W71A 1NULA 5KC8A 1AH2A 4BNDB 3DT9A 1W4CA 3FJ1A 4B3XA 3Q8MA 2X9VA 3FH0A 2C5EA 2G4CA 5F3WB 1L7QA 4PZ0A 2OM6A 4EGSA 3HKDB 1ORDA 2Z30A 1JIXA 4C7OA 3VVLA 2BW0A 2Y2VA 2IE8A 2QJWA 3PJRA 4R1QA 1KZ7B 1RYBA 3G8DA 4RDIA 1HYHA 1MC8A 1KH2A 1NRXA 4XWWA 4FC6A 4YCSA 3AVVA 1H1LB 1RABA 4PFKA 1VJDA 3ZHBA 3ACDA 4FYKA 2ACWA 3UMVA 3WK4A 1G3UA 2CHVA 1PR6A 1UBMS 2AFHA 3DGFC 4K28A 5FBLB 1U6KA 5LXTA 5KSWB 3EEOA 2J0QA 3HJTA 1EA7A 1L7EA 1MJGA 1TJ4A 2PT5A 4R1PA 1X7ZB 3R7DA 4R71A 5BRJA 4OHKA 2VZ8A 4GVXA 4YRNA 5DCUA 4MNTA 1MOQA 3ROTA 2XYPA 3VPAA 2L18A 4Z49A 1VDMA 3C7AA 4OREX 3EH2A 2Q8PA 4TWAA 1LK5A 3EDOA 4L5YA 1VHJA 1G8PA 2V6MA 3ROXA 1NQAO 5A5EA 4OFWA 2ZPTX 1FTYA 1RYMA 4YCCA 1V1JA 4EPXA 1KIMA 4DXAA 1OX5A 4C20A 1VPTA 3GYGA 4B2YA 1IU9A 2RDMA 2F9LA 3HN6A 1G18A 1QGED 4M0MA 4PQGA 2JEYA 4Y7DA 5B1SA 3WLNA 2FF7A 1N7HA 4ROSA 4J0FA 1DWQA 1GRVA 2FI1A 1ZN8A 2HA5A 4H08A 3H9UA 2G70A 4FDUA 2WJAA 3ZQ6A 4B79A 1LPAB 2DG2A 4GOMD 3ANYB 4QUEA 3REQB 3QXHA 4Y1EA 1WPQA 3I5AA 1FXUA 3HCCA 2VXYA 3R09A 4D42A 3DONA 1GZ5A 2YXNA 4WJLA 2O57A 4FFVA 1RCUA 4QUGA 5LU9A 2BYTA 3WK7A 2VXOA 1JNXX 2M98A 3D4OA 4MCAA 4RAQA 3C5CA 4BY9E 2XWBF 1XA3A 3I8OA 4ZI7F 1XGKA 1JB9A 4B71A 1UMCA 2WY2D 3FPGA 3AXTA 4E15A 1XD8A 1KAMA 2E4YA 3TZCA 2IPLA 4GGPA 3W8RA 4E12A 2Y1WA 1AJEA 1X7YA 2LW7A 2XUIA 4OHXA 5LZ5A 3T7AA 5ILOA 3EDYA 4WKNA 3X1WA 2QOEA 2HWXA 3GUVA 1WNFA 4DCNA 5C4MA 3R23A 1CNMA 4W9NC 3B1JA 1M2NA 2YN2A 3NNSA 4DKXA 3FUVA 3V00A 2VNIA 3OLQA 4DR6B 2EYUA 2V6GA 1XROA 3AF1A 1OV4A 3QUQA 2A1UB 3RFCA 1IN4A 5YASA 5JJIA 3IELA 1PJTA 2F8TA 2COKA 4P1ZA 3B9RA 2PMBA 3GT0A 5AW6A 1U8AA 1S3SA 1DAHA 1I1OA 1DRUA 3A9WA 1RAAA 3IP3A 5FBRB 3CF4G 1QGUA 1NNSA 4BIIA 4BP1A 1TCBA 2V59A 1J9ZA 4IDBA 2HA0A 2HRZA 2CGEA 1T29A 1VB3A 5HDBB 5HCUA 3TL6A 3VYUB 1OFHA 4FZ5A 3ZDFA 1EM8B 2X5OA 4K6CA 3MF4A 3IR6A 5J5CA 3C8HA 2R96A 1RWKA 2ZAGA 2GPAA 3O91A 3OECA 3W1VA 2JDIA 1XDDA 1XZEA 3HNRA 1LVUA 1LTQA 1KMMA 2ZYAA 1BDMA 4HRYA 3KQUA 1LZKA 2J6CA 1E8MA 1YB4A 4YJKA 4NBSA 4PE5B 1XNRB 1JIQA 2X19A 1QK5A 1WAMA 3VZDA 3ABSB 3RAEC 4E5MA 2QTZA 1E7MA 1FUYB 1I1HA 3D2CA 1M2JA 2PU5A 4Q66C 2YRXA 4CLHA 3TYXA 3P0EA 4EHFA 1T3HA 2ZGVA 2DKNA 5AWFC 5IC6A 3UV3A 3JVIA 1JQEA 3TN7A 5AD1A 2H29A 1T1EA 2PFGA 3ICOA 5E9QA 3E81A 3OICA 5AJWA 1JHUA 3ENNA 2VH1A 4A5OA 4RENA 4BXOA 1QV6A 1T1RA 1YK1A 2JA1A 1U2DC 1QONA 3OA2A 3QKTA 3LF2A 3VSDA 3HLYA 3MYRA 2RK6A 4CMKA 4EGCB 3I62A 3EG9A 3FMOB 1DV2A 1C30A 1EX9A 1P77A 3GLHA 4R7ZA 2R4TA 4EJSC 2IDKA 5IJ0A 2R85A 4YCBA 4DC1A 1V5GA 1OTHA 3SQDA 4YASA 4TWIA 3SJBA 1ZDMA 3P9YA 1BKYA 3ESDA 4BVEA 2JIMA 2II6A 2FKNA 3DE4X 1W76A 4ZYLA 1ISRA 1LNQA 1P0CA 4RVNA 4U2EA 2I33A 2BM8A 1CUDA 1PP4A 3GPBA 1KH3A 4HTFB 4M0CA 4KLNA 4JEHA 4WDQA 5ELMA 3A6DA 5TGTA 1AQJA 4V0ME 2P3SA 4EYOA 1YR3A 2OECA 3F7OA 4PLCA 1QWSA 5DN6D 5C5IA 4HR7A 4LIPD 2C4NA 3AB3A 5TRTA 3CZPA 1N0UA 2R8BA 1A5TA 2VIIA 3VUEA 1HFWA 2GM4A 2QX8A 3QMPA 1MLDA 3BFXA 2VP9A 4WZAA 4CDNA 2EL9A 1YJ8A 4YRQA 3LXXA 5ALZA 3U9LA 2H5EA 3Q88A 1RXUA 2R5NA 2V96A 3EFBA 4JSRA 4UM9D 2IEDA 3W5HA 5A4MS 1TZMA 4MYTA 4DA0A 1XYGA 1DIGA 3QE0A 5KHLB 1JB1A 2WWIA 3W6NA 1OLSA 1GRCA 4HUQB 1ADJA 1V5EA 2BFCB 2G7ZA 2JBWA 5DB4A 5DLEA 5CNIA 3RBAA 4MVJG 1S7GA 1KY5A 2PD4A 3IV6A 4KFSA 4ID3A 5CXSA 1JA9A 1D2MA 1T3ZA 2FFJA 4D7AA 1Q74A 3WSVA 1XCBA 3HL0A 3HBLA 1RDFA 2NWQA 1B6RA 2XUQA 3RBVA 5KQMA 2D1TA 2V1UA 2QG6A 4R8KA 1Q0QA 2WDPA 2ZDQA 2XKKA 5C8XA 1QP0A 1MJNA 1SEVA 4ZI7B 3IR7A 2HPAA 2BMAA 4Q3EA 4E2WA 4ISBA 1N3BA 4TRMA 5JAUA 3NS7A 3OPMA 4Q3DA 3PNOA 5FIUA 1NFQA 3CLRC 4U9IS 2YQ4A 1CT9A 5AK5A 3ZJTA 4II3A 2GCOB 1YWGO 4KB5A 4RWEA 3IE0A 2H1SA 1PCXA 4ZVKA 3E70C 5D3MB 3WQRA 3WNBA 1J8FA 4IVQA 3UJDA 5KYVA 2BR4A 7GPBA 4KE6A 2SCUA 4HDRA 4EA8A 2QN1A 5J4LA 1OAKA 2JCXA 4J6EA 1RHJA 4HNRA 1MVOA 1PV2A 2B30A 4R1TA 3NJRA 3TI7A 3ZQ4A 1PFKA 4N7MA 1GN8A 2ZANA 1AM4D 5BSGA 1Q50A 4AZ0B 3PKZA 3VBEA 5LFAA 1A8PA 2DOKA 4ZVTA 1BN7A 4TKVB 2V6BA 4DGSA 3A4VA 5HZKA 4K9LA 2NSHA 3UGTA 3DHYA 3JALB 3PDIA 1U8ZA 2HDNB 2KBEA 3ZCTA 5GTDA 4BBZA 2RJ3A 4GOND 4M1ZA 2YYYA 4JI5B 1TKCA 1I2DA 2GPWA 1YR9A 1K2WA 4HH1A 4IMPA 4C9BA 1A4UA 3S27A 2ZAMA 4ZOBA 1EGMB 2EP8A 1F6WA 4UFNA 4JJFA 4CG3A 5ITZA 1L4NA 1GPJA 3LXMA 4PZDA 2Q5EA 3AHIA 3HY3A 4H6XA 1FXWA 1T24A 2ABWA 3QFFA 4UE6A 1KSGA 5CT5A 4KV9A 3J81k 2H07A 2VKTA 1LQUA 1G5IA 2R48A 4JK3A 4PTZA 2JC3A 1OBCA 3NHUA 3UV6A 1WU7A 1QIJA 3VNRA 1HDXA 2DSNA 2Q4OA 3N0WA 3AL2A 1MG0A 1PJ2A 4QYSA 2P2SA 3WMEA 2ZKIA 2IELA 4Y6LA 3Q11A 3GJ3A 3ZJVA 4AO7A 4PZZA 2AOTB 5B6IA 1P2DA 1RYFA 4JJEA 3T12A 5JI2E 5BR8B 2ORED 2CMKA 1JILA 3CONA 1BJTA 3W2TA 1ONNA 1XAJA 1ZWKA 2PBFA 2OORC 5IXJA 2ZJ8A 3CVUA 1Z06A 2YUIA 3ZWDA 5JNWA 3ETGA 5C8YA 1X1AA 3ROKA 4YT8A 2DHRA 3PFHA 1DKNA 4QYIB 2VT7A 1PI3A 2ZSBA 5FI5A 3M83A 1R27A 3QEMB 5J23A 4BVGA 4N5HX 2XZDA 4HJRA 3BMCB 3NC4A 3D4NA 4DMKA 4ZYZA 4GGOA 1NR1A 2V4UA 1JFTA 1U6IA 3EGCA 1GQRA 1YIAA 4UM8B 3IT1A 5JXJA 1RJGA 4C29A 3EAGA 3WQQA 4H7PA 4GNKA 1NE7A 2VP2A 2O2XA 2ZAOA 2V3WA 2XT6A 1A8HA 1KYTA 2B36A 2FZCA 3K09A 3PQEA 4NXMB 1E9DA 1P33A 4MPDA 4ZJUA 2YH2A 5CG2A 5IMSA 3H18A 3C1OA 4GU5A 3NG1A 3RU9A 4JASB 1VSUA 3PTZA 5CTJA 4Z5XA 5LQDA 3LQKA 1JL3A 2C98A 1ZJ5A 3NAZA 4ZCPA 4GLFA 3VSBA 2VDLB 2XE8A 4XQGA 4O8CA 3WO1A 1XZCA 1X19A 1ZOPA 2C00A 2PX3A 3AY3A 3OCYA 2IIPA 3L93A 2P65A 5AM4A 1ZGHA 3DB1A 3E8XA 3GGOA 4XXHA 3WQBA 4J07A 2QLFA 1E1QD 1N6NA 2VXCA 3M2PA 3C1UA 2O2DA 3RT9A 4YPVA 2Y1LA 3MSXA 1I4OA 4P84A 4CMAA 5CLJA 3CEMA 3FUCA 4V0SA 2H11A 3LQYA 1Q3TA 5BNZA 4G01B 1KZ4A 1TC2A 1SY7A 2B82A 2FPMA 1JEEA 2HU8A 5CB6A 2A67A 2EJTA 4BP3A 1JW9B 1L5SA 5KO2A 1M1XB 3SC6A 1AKMA 1ND6A 1SCUA 1CD5A 3DCYA 4YS6A 3TXYA 4WSOA 3WSWA 4MKZA 4YUZA 1NASA 3GUCA 1B6TA 2G88A 1L2TA 4DMGA 5P21A 2HGSA 4Z6KA 5FADA 4YX9A 1T1SA 1RFGE 1QRUA 1GQSA 3L2OB 4EQ6B 4P5DA 5F1PA 4MB6A 1TM1E 2ONJA 1GKUB 1XTKA 4EMUA 2OAP1 2Q5JA 1ZHOA 4CR7A 3LUBA 5CDFE 2G08A 3KO8A 4DLYA 1YBHA 5LKRA 1JHRA 2H4YA 5JR3A 1L4GA 1PT9A 4G09A 1T8TA 2Q5LA 3EOZA 4X94A 2FVYA 2ZYVX 5DYNA 4ZT7A 4I1YA 3KG2A 3A58B 4CWAA 1QQ7A 3ILHA 4LE2A 3R7AA 4I1PA 1HXHA 3K0FA 1O54A 2PZEA 2XF2A 4QNNA 1QH0A 1SRRA 1JECA 4PHFA 4Y0AA 2D5IA 3TBFA 1Y1PA 4G85A 3HCNA 4K9DA 1KJWA 4K8RB 3SP1A 4YAJA 3T1YB 4D3SA 5I8PA 3SKYA 4ZOAA 2FEOA 1CIVA 1R37A 3HA5A 1YCHA 1PZGA 2BZ0A 4H1UA 3C1TA 4HWKA 1V2HE 2YV5A 4D57A 1T9KA 2QN3A 4IM7A 1X9HA 1K08A 5JYBA 3PUVA 1WDLA 2DBQA 2OHIA 3BHIA 3JAKB 1DKQA 1DAKA 4R98A 1JEYB 4I8DA 1M2VA 3AJ9A 4Y2HA 1WTAA 1GILA 2GTHA 3AF0A 3ZQJA 3ZHSA 1JXAA 2GBPA 4YRAA 5KX5F 3CWQA 1FRVA 1ULUA 2ZG6A 4NE2A 2X5XA 4MW7A 1WDMA 5KDOA 2IY9A 1YF3A 1L5ZA 2VNKA 2XJ9A 4MVJH 2I1LA 2WKPA 1JRLA 3R5JA 4RE5A 1M66A 2ZIZA 3TSWA 4YXWD 3RM3A 1CY1A 3NV7A 3ORQA 1BDJA 4Q05A 2QL6A 1PL6A 2PPVA 5A7HA 3SAJA 1N6HA 3UNXA 4W5WA 4AN0A 4R9NA 1GCGA 4B4VA 4E46A 4EG1A 1U0LA 5EUCA 1UT5A 1KY2A 4NK5A 3LKDA 3F2VA 3IMFA 4P9NA 2XADA 2PG3A 4IUCS 4YP1A 1R7RA 1YIDA 1KZ1A 1SA0A 1T4MA 2AFIA 3M1YA 3PDHA 4XPZA 1YR2A 3OAAD 3CW8X 3ND7A 4YDSA 3WYNA 1WXDA 1MEOA 2XUGA 3E9QA 1DEOA 5EWLB 4M87A 1TUEA 3D6HA 4KMSA 1X2BA 2YXEA 3ZWXA 2ODNA 3KAKA 2XCRB 1PT6A 2FPOA 2P40A 3TINA 4GT1A 2KS6A 2QJRA 4U2FA 4E2ZA 3L0PA 2DH5A 1J33A 2ZATA 2GJKA 1HL3A 3T7TA 3QU4A 5I7HA 2G9VA 2JK0A 3Q6NA 3AV0B 4WV3A 4JVMA 4QDKA 3MS4A 1BXKA 1E1CB 1D1PA 4KJXA 3U48A 2BLLA 2R8PA 5I01A 3EXHB 3GLUA 4R9VA 3H8WA 2YWBA 2ERXA 2XRMA 2AFHE 3ETEA 2GYUA 2PD6A 3F3KA 5CW1A 4Q4JB 3TTVA 5CXUA 4QM7A 3QOFA 4RGBA 3R8FA 2QLMA 4BQPA 4B44A 1E9CA 4IQ4A 2CHFA 4JOSA 1NJFA 1W6RA 4GFDA 2IWRA 1ZZGA 2QAGB 1JXQA 2D2VA 1DELA 1TO1E 4QTZA 4F6LA 2F67A 2YBEA 4PLFA 4Q3KA 1XDZA 3A28A 2XR1A 1F0PA 1Q21A 5ILGA 3GG2A 5JMTA 3HM2A 1P9LA 4N1AA 4UVHA 3LS2A 4B7UA 3MD9A 3IQWA 4BO6A 5BNWA 1W29A 5J2TB 1TAGA 2YJGA 1M7BA 1AQYA 1RW4A 4ENPA 2BTOA 1L4BA 3A1DA 2AOWA 2GKSA 1E6UA 2CXTA 2WWRA 2YFYA 2TS1A 2PSEA 1GA4A 4K46A 4G0YA 4QPDA 5BUZA 3U44A 1LI5A 4XR4A 3CG0A 1XJ5A 2ZUTA 1O4VA 2A0KA 2MYNA 3C6QA 3CNHA 4DR5B 1GDTA 2F1HA 621PA 4CEJA 3GOQA 4HXEB 3DL0A 4UBKA 1KYWA 2B1JA 3TMKA 4TN5A 1TMYA 4HGZA 2MDTA 2A0XA 3OIDA 2CK3D 3EY4A 3BEDA 1U0FA 1ZM3A 4WX2B 5EQTA 4ZICA 4OHOA 3G02A 5BMVF 2JHAA 3H84A 1JE1A 3WHLA 1Z6PA 4FEYA 5K99A 4MPJA 4NTZA 1W94A 3GX1A 4OLBA 2H0QA 2O3RA 1L5YA 2J45A 4L4ZA 2JVIA 2NZ2A 3GT4A 3VU3A 1BGXT 2QZ9A 5DGCA 3PDJA 2BP7B 4JI4B 4RGVA 1LDYA 1X92A 2BL4A 2H7YA 4I4NA 4M8IA 4LF9B 3OZSA 3IIMA 4DY6A 3W3ZB 1VGVA 3QV2A 2PAFA 5I9NA 3DBIA 4BKRA 3N7TA 3BULA 4JFAA 4DV7B 2RAPA 3C3PA 3PQDA 3NB0A 3UPDA 2Q6LA 3MGCA 2OP0A 1VI6A 1EK5A 3FMPB 4A6PA 4ZC8A 4BMYA 1NVGA 5I6DA 5A0FA 5CNMA 2VH2A 2POCA 5KNBD 2Q1TA 1FX1A 1RCFA 3VZSA 4EGQA 3R0JA 4K0KB 4FB4A 1NUPA 4TMYA 4FOOA 2H5JA 4B4UA 2XMRA 3DC7A 1T5OA 1THGA 1USUA 2Y1EA 3H0CA 2PSJA 3PQ7A 5LOVF 4D25A 2GVZC 3SWWA 2JGMA 2ENWA 2I2WA 2G5GX 4CW7A 3L7NA 4KWTA 2O7SA 4ZO9A 3PS9A 3ILVA 3ZU5A 3JSAA 3ONVA 4NCNA 1MAWA 4Q1BA 4UBOA 5DTEA 2IBTA 2FN3A 1BC5A 2JGFA 4DSNA 4Q16A 3GRKA 2BE9A 4GYJA 1NYLA 5F2NA 1W5EA 1Q7BA 4EMBA 4PZPA 4IDOA 5JS7A 3MFYA 5G1PA 1NVUQ 2VCEA 2WPNA 5KX5B 3Q8LA 1YZKA 5H83A 3H0EA 2B0CA 3C6YA 5J1TB 3CURA 4Q24A 3C3BA 1VG8A 3QITA 5J58A 4X8HA 1UJ2A 3IBTA 3FTPA 1AXRA 1E1KA 1QCDA 2OKGA 4PAGA 4IEFB 1HYGA 2B8JA 3WB9A 3F4BA 1ICIA 1CUJA 5CIQA 2PJDA 5L9AA 5JRJA 3OESA 4KVFA 1ML4A 5BNIA 3IB6A 3L0BA 3KUCA 3ND5A 4LYGA 3FNIA 2AJCA 1H2XA 2BGKA 4LF6B 4GKVA 4RPCA 3F7MA 1WP9A 1L8XA 4LJYA 3ILYA 1Z62A 2A9JA 1S8NA 4YPOA 1Z47A 4Q7KA 5FOTA 2JKVA 1TU4A 3CLVA 1WVMA 3W5BA 3OO0A 4MW4A 1ESCA 3D3WB 3DXXA 1MH1A 3ND6A 4ZQHA 3U4GA 1R4ZA 1TCUA 1CZUA 1ID1A 1Y82A 2HXSA 2IYZA 2M2IA 3CJRA 2PX0A 3KWFA 3ONEA 1H0KA 3AFMA 2BDEA 2SNIE 4PVCA 4QUAA 3TCXB 2EHJA 3M2TA 4TZKA 1MABB 3VAAA 1PWZA 1RYZA 3GLHE 2BTQA 1E2FA 5JNUA 1LA2A 3PQ6A 4UUOA 2F3RA 3VMFA 4E32A 2DKOA 3AVOA 3L6DA 1OH5A 3PZBA 1M1YE 1A98A 3BREA 1N3IA 5AW9A 3SVTA 2BSAA 5BV1A 1QU3A 4BNNA 5IF9A 1ESZA 3COZA 5G53C 2B98A 2VVTA 3ZBQA 5FPKA 5A3VA 4RLFA 4TLCA 2PV0A 4UUQA 2XTNA 1R0SA 2FMHA 4WXPA 1L5HA 4QRDA 5EKSA 5FPSA 1ZW6A 3GLIB 1ZC3A 3H3XA 2FSVA 2R00A 3VO2A 1T3SA 2YMQA 2Y1CA 1ODFA 3IPCA 4Z9BA 5AXAA 5A1TA 2VDRB 1EI9A 4F04A 1Y9DA 2E55A 2ZJ5A 4RY9A 1LDMA 2PCJA 2D5CA 1TIKA 4MI3A 4RQAA 1CUYA 2CL5A 2DSTA 1VPWA 4JBHA 2XMBA 2AVDA 3PX3A 4QQKA 2ZJFA 4WZAE 2I6QA 1U0BB 3EODA 3WHPA 4IJ6A 4FTWA 1NMYA 2WU3A 2DJIA 3DMFA 3NAQA 5B58T 4H2DA 1BH6A 3SFTA 1D6SA 5B37A 2UVDA 1PHRA 2QUAA 2X1HA 3IS3A 4LYEA 3SYMA 3V2HA 2HYIC 1X0XA 4QYXA 1P9NA 4HFNA 3GT7A 2XDQB 1T2NA 4UXJA 4FFSA 2CJFA 1MXHA 5BMVB 3JQRA 3TO5A 3IVGA 5I7WA 3VU8A 3V4FA 5KWEA 4Y9DA 1LBEA 1H5NA 2RCNA 3F47A 4RGQA 1Z2EA 3OE5A 4KRYA 4Y6GB 5JDCA 4RTQA 3W9BA 3TLJA 3VR5A 1JQJC 3INGA 4RKQA 1VMAA 3OEHA 5K1ZA 3WIBA 3TOVA 2QUZA 5CCDA 3AKZA 2BJWA 2XTJA 4CQLA 2I3AA 3PNBA 1O9HA 1NPYA 1YR1A 2N46A 2NT3A 3D6JA 2WUFA 3IDQA 1V8OA 4LF5B 4XEHA 4ZZ2A 3ZZUA 3HYNA 4O0LA 1KYVA 3C98A 4JX8A 4CCYB 3G1UA 1UK8A 1H22A 2J5BA 2PX2A 4A10A 1YC5A 3DL7A 3OZFA 5CIWA 1Z0JA 1UDAA 4XASA 2QTFA 1FU7A 1UODA 2NP7A 2HKIA 2NXCA 1TOAA 2JH3A 3FUUA 3KZ1E 4RELA 3BMNA 1DUIA 3TOZA 3GFQA 4D4HA 2ZRHA 5LOVB 2DUUA 1KHHA 2X9GA 4WIAA 3G0IA 3R1IA 4M86A 4F5DA 1YOVA 3ROEA 2WLTA 5L3SB 3GEPA 3FLBA 1P0PA 5JASA 3UGJA 5HK9A 1ZJWA 2VJYA 4QBFA 2DHQA 3WP0A 3AK4A 1VYVA 4C1BA 3VDQA 1UEIA 2XDAA 4UMFA 1HZJA 5CGZA 4BLRA 4BNVA 1U99A 3HUDA 1E8NA 1O6BA 2OFWA 3PQ3A 1BEEA 1F1JA 1OYOA 3OJLA 4HNQA 3OZBA 3JPYA 1T43A 1V5IA 1UWVA 2YNMA 5TMEA 1I3NA 5BN3B 3UT0A 1L4LA 1XDBA 2JI7A 5EE0A 1M1NA 3OLVA 5JD4A 4YUYA 4BPBA 2WHPB 3FSGA 1NWCA 4UHEA 1HE1C 2WTEA 4I1UA 4OGFA 3ZWYA 4GPTA 4IXWA 4L02A 4F9FA 3AEUA 2DH6A 4B1FA 3THWB 1ZUD1 1OFUA 2QZSA 2NXNA 4GC9A 4A36A 1LV7A 1TPZA 1MT0A 2RC5A 3LDGA 2FDCA 5K3FA 5DNVA 1UMDB 1PVDA 4MDYA 4OIMA 4ZWNA 1FQJA 4MEAA 4EL5A 2HMSA 3OVMA 3RSHA 2I4TA 2NUAA 1F8XA 4UNPA 4PN3A 1ZA1A 2IY7A 2J31A 5C7OO 2ZS7A 4I55F 1XJQA 2I7TA 3KQPA 5KU7A 1XEXB 3VVCA 2XZLA 1IMJA 1B8NA 2CNOA 2HF7A 2ZBRA 4AY3A 1ZJZA 5JFGA 2XB4A 3VYTB 1GRNA 1SCBA 4D8XA 4FYIA 3HVRA 5JG7A 1UZUA 4Z9XA 4KQXA 1Z8FA 3REGA 1OI2A 1KVQA 4CBVA 3HU2A 4FDTA 5BN5A 3VA7A 3U7QB 1V1RB 2VPTA 2LE0A 3A2LA 3O94A 3WJAA 3BB4A 2OCXA 3HO6A 3PTAA 3BXZA 4G5XA 2WJ6A 1GZ4A 1HTBA 1N36B 2IWHA 3UHPA 3VU9B 1F2UB 3RGGA 4BO2A 3FRIA 1G5HA 1ZM4A 1M73E 3B8HA 1KAQA 5BXQC 3RBZA 2GPJA 1N1DA 4BB0A 2Z98A 1Z4QA 2NZYA 1KMHB 3O8QA 1YGPA 5AICA 2RC6A 3EGXB 3HFGA 4UHFA 1PNVA 4O4HA 3V8MA 3ZKWA 1M5RA 2OT3B 1EP3B 4I0WB 3CF4A 2Y0BA 3AETA 4NJEB 4X6LA 2JIPA 1R5NA 1CK4A 1O94D 4IJUA 1L5QA 1SVMA 1H23A 3FZEA 5ELXA 2ZB4A 4PBRA 1Y1SA 4UUAA 2W8BA 2IHJA 1ZVJA 4QPZA 2VRCA 2XNKA 1KDVA 1XN1A 1F0KA 4H18A 2MCFA 4BTEA 4K3UA 2IYOA 3ZZTA 2HMTA 1WTCA 2D0PB 2ZW9A 3QX7A 2HU5A 2ZULA 5A3QA 2XHEA 4DT1A 3KEMA 2Q9UA 2ZJ7A 4QO7A 1ZJ4A 4U3JB 5HMLA 1KZYC 4AG3A 4B3BA 5HKBA 2UZIR 5F21A 1IXKA 4NENA 5HUQA 2Z04A 2FMXA 4LY6A 2JKYA 2EP7A 1T34A 1N2HA 4AK9A 3OF5A 3DH0A 5LP6F 4ETMA 3MHTA 3WNZA 3D6NB 3RTAA 4EPYA 5JD6A 5EPEA 4DDMA 3W3AA 5L7WA 2TMYA 4HAYA 3Q2OA 4OI2A 4MIOA 4BMSA 4HWTA 1DG1G 1BYIA 2OQ2A 4OQDA 4E11A 4ZMSA 3EXEA 1YZQA 3F78A 3KXDA 3PRHA 3CV3A 4U4AA 3VZCA 4C7BA 1ES9A 3MB5A 1NN0A 3G6KA 4AYXA 4M76B 2W4QA 4MS4A 3DR3A 5GPBA 4UNSA 5LMUB 2R79A 2P2CA 1R4MA 13PKA 2XVMA 2FSVC 4X44A 5LQNA 3HV0A 3HYLA 5J59A 5K8LA 2PL3A 1DIOB 2C9YA 2HA6A 2QSZA 1WB6A 3E3OA 3HE3A 4W5OA 1EP1B 1KTVA 3T9EA 2UYYA 3GJRA 1Z9BA 1PQUA 1HL7A 4UTXA 3L7IA 3PUZA 3NRJA 5EZ5A 5ITSA 4PEVA 8GPBA 1HDCA 3QX8A 2ORVA 2V8OA 2O2HA 1ZQ1A 4CIDA 3ANSA 4NE9A 3RCBA 1Y1KE 2AR9A 1GGMA 1MPTA 2F1JA 3KVRA 5COAA 4ZAFA 3LA6A 1F2DA 4GXTA 2C4WA 4LY0A 3CGWA 4P3OA 4IFIA 4MUEA 3DBHB 4ODIA 4FOSA 4RJIA 2CEAA 3EULA 4JWKA 4K40A 1K7SN 5BSVA 1JSRA 1Y7PA 5AI0A 3HC7A 5K0JA 2C4VA 2YR0A 3DE3X 3QUBA 4MVJI 3LBHA 5HQTA 1DAMA 2G5TA 1H69A 2FGKA 4AS3A 1OH8A 5TPZD 2FEKA 3JQBA 2JGKA 3RFFA 2BH9A 1KMNA 3PLAE 2CVPA 5L40A 2XMSA 3DEAA 4RDHA 1GAJA 3N59A 3A10A 1Z0FA 3MJRA 1YCFA 2LIVA 4I66A 3O0DA 4JBGA 1J8DA 4XVQA 5DTQA 3LHSA 4E1BA 5EJAA 1GY8A 3I2FA 2JGDB 1FP1D 2PZMA 1C9YA 4KPGA 3QJGA 2WABA 3UGQA 3ENVA 4H3HB 1OA0A 4NAVA 3PR2B 5HTKA 2B2CA 3W8FA 1U1CA 5H82A 3E4CA 2QW1A 4ND4A 2AFIE 1NMXA 3E9MA 2UVPB 2GETA 2QNBA 1SXJD 3R5FA 4FLMA 4QECA 4UEQA 3VISA 3WVNA 4E51A 3LDAA 2RKOA 5ALVA 2QP9X 5DM2A 5CCEA 1CC1S 2V7EA 3UJHA 4AZ3A 4HLUC 3W5SA 2PSFA 3UHOA 2E4VA 1ZG3A 1BX1A 4N5LA 2I4IA 4R41A 5P8WA 4HVCA 1D2AA 1QHNA 2R7NA 4R0NA 4I55B 3U9TA 2QTVB 3WB2A 5H0IA 3ZCVA 1WCXA 3ZZNA 2FJ0A 2W6CX 3RYFA 3U7IA 3ZDAA 4E5NA 4FGLA 3FOFC 1KVRA 3AU8A 1JJFA 1OAAA 3ZGOA 1ZITA 1WXGA 3FE2A 1DQYA 2ZR0A 3R76A 3ZY4A 5B4UA 5EMNA 2YZMA 4AL4A 3ECAA 1CDOA 1QIHA 3H5NA 5HW0A 4DIDA 1ZMTA 3RIYA 2GM3A 3EE6A 1EWTA 5KYXA 1B43A 2Z09A 4NFLA 1ISJA 1P8JA 4HAZA 4KXFB 3O0TA 3VC2A 3ZV7A 2JB9A 4RTSA 2HAEA 1X2EA 1GV1A 1YGYA 2VFAA 3W1EA 3SM3A 4MO2A 3MT9A 4RXTA 3IT2A 2ILVA 1D04A 3BWDD 3G49A 1C8BA 3GCXA 3GPIA 5IBCA 5HR5A 1U7WA 4AKSA 2MINB 5ECDA 5FO1A 5BWBA 2N75A 4IL5A 3PYMA 1CHNA 4LY9A 3CVYA 3F5FA 1IN5A 1PRYA 3WK5A 4FZRA 1E4EA 2OBBA 3G2NA 5AFSA 4L8FA 5DHPA 3TCKA 2B83A 4LTDA 2QRVA 2FQWA 3M82A 4V02A 4MSUA 5HJ5A 1ZESA 1RPJA 1L6IA 1U0EA 5AVSA 5IC4A 1QRSA 1SQGA 2HMWA 4QWMA 4IIVA 3W79A 1ZGBA 1KKMA 4UUPA 2EGGA 3PV0A 2OGZA 1ZD9A 3G8CA 1XLTC 3GAAA 4P92A 1BMFD 4EHNA 2QV7A 3AZPA 1WKCA 1CZNA 1DEAA 1IBRA 1UBHS 4IKOA 1F4PA 4RETA 1T1GA 3CVOA 1WV0A 4YCJA 1C9KA 1T4CA 2FUG1 2MT9A 4QFCA 5IM4F 4CKZA 2O8DB 3M5CA 4Q4HB 1C4XA 2H8KA 3TGWA 3WGLA 4ZKDA 4JGBA 3DAOA 2IE0A 1W25A 5K3EA 3IQEA 4KAXA 4GLOA 4A6DA 5A4JA 1BRTA 1Q92A 1NQTA 4O4IA 3EJWA 3ZV4A 4GOLD 3ZS9A 4EO9A 2GXSA 3B5EA 4IOLA 4DRXA 4N8DA 5DSXA 3OLWA 4U0KA 4KI7A 4KNWA 3SIRA 1SZJG 3T15A 5JNSA 4QJ5A 3IJPA 4O4JA 4QNRA 3LGSA 2EFJA 3WQSB 2I03A 4ZTZB 2OVBA 3DYVA 1RAFA 4OYRA 4YJGB 2ST1A 3FWYA 1A4XA 5JS2A 2EBHX 3A1WA 5ICFA 3FB1A 2AN1A 4HZIA 4LYYA 3TEMA 3GWGA 3ZXSA 3T7JA 3ND8A 2DECA 1VP3A 2WILA 2Q0HA 1UC9A 3VYRB 5EMMA 4MR8B 1ZD1A 4AZVA 1XZJA 2NZJA 3LYHA 4JLDA 2FWJA 2Q0QA 1Z4MA 2VPPA 2CWWA 2VTVA 1PJZA 2GO1A 4Z2AA 3K15A 4G1VA 2Q49A 5DN6A 2AJ8A 2BI8A 1EK2A 1K6EA 3KHUA 4YO7A 1G6HA 1UT6A 1XCJA 5AJVB 5F4ZA 4U2KA 1T0HB 4F3RA 4PF1A 3JQEA 3PL5A 4IRMA 4DZTA 2ZKLA 3NPMA 1KQPA 1YBFA 3AUKA 3RVDA 1C7RA 3KKZA 3LK7A 4WLVA 2ZWIA 4CM4B 3AEKA 5CXQA 3H99A 4DJJA 5B6JA 2PPLA 1G5FA 4MVYA 2QT1A 5I47A 1J7KA 3K1ZA 4RA9B 1W0CA 2JI6A 3FWPA 4EEXA 5JAOA 4KUHA 1GXSA 4I3FA 1ZN7A 3TM5A 3WZ2A 1HH4A 3L06A 1CUXA 5B4VA 1UPFA 2IEIA 4TVSA 2PKRA 4KTVE 3S2EA 3QVOA 3CCBA 3E1SA 1UP6A 1ZONA 4HMPA 1A9OA 5EIHA 3GCDA 1UCFA 3DCIA 3H97A 4HNAB 4XWTA