4JASB

Structural basis of a rationally rewired protein-protein interface (hk853mutant a268v, a271g, t275m, v294t and d297e and rr468mutant v13p, l14i, i17m and n21v)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
121
structure length
120
Chain Sequence
SKKVLLVDDSAPIRKMVSFVLKKEGYEVIEAENGQIALEKLSEFTPDLIVLIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine kinase
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/signaling protein
total genus 39
structure length 120
sequence length 121
ec nomenclature
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jasB00
1PNTA 2MYPA 1ZHHA 3EDCA 3LUJA 3LUCA 1PNRA 5DCLA 4MS4A 1D1PA 4PE5B 4H60A 4RWEA 5IUKC 4YRZA 3DLHA 5KQPA 1ZN2A 2X7XA 3I42A 4G86A 1MIHA 4QPJC 4RXUA 1E6MA 4Z4FA 1JX6A 3CZ5A 5KQGA 5EWLB 3RVSA 3CKMA 1A0OA 4KPYA 4YLEA 4Z4CA 4TN5A 3HEBA 5IULC 5KC8A 4GPAA 3OLWA 2PAFA 4H3HB 4LZLA 1Y1LA 2IPLA 1YIOA 1GCGA 4XFKA 1ZGZA 4WXEA 5TPZD 2CHFA 3RQIA 1DJMA 4RK4A 4ETIA 4EY3A 4QYWA 4ZMSA 4HNRA 3C97A 3CS3A 3L6UA 1A04A 2QU7A 3QEKA 4JB0A 4RXTA 1QO0A 4RDCA 5CHYA 4N76A 4Y9TA 5TQ2B 1Z26A 4DN6A 2PUCA 1QQBA 3M9WA 4JB2A 2PUFA 4MLCA 2MYTA 4RK5A 2J48A 3H5LA 4ZPJA 4IILA 1XHEA 3F6CA 1Z25A 1YMUA 1EWKA 1GUDA 4KZKA 4N47A 3F73A 2IPMA 2QZJA 3EAFA 2PUDA 2QV0A 1FFSA 1ZGGA 2YHBA 4D6YA 5BRAA 3A0RB 3RVKA 2AYXA 1YK0A 3I45A 1M5UA 3A3KA 2JCGA 3HM9A 1BA2A 4XAQA 4MYRA 2WY2D 3H75A 1BAPA 3EQ2A 3F7NA 2FMKA 5JS2A 7ABPA 3SNKA 2O20A 1TVMA 4HNSA 1QQAA 2TMYA 3KLNA 4YGXB 5IEJA 1JLKA 3NNDA 2PUGA 2GX6A 2BGGA 4W5NA 3FFTA 3QLUC 1IIBA 2L2QA 3N53A 4MR8A 4Q6WA 3KCNA 1JL3A 2E4WA 4WWHA 4RKQA 4F06A 4ZMRA 4S05A 3OQOA 3CG0A 4N03A 5GQSA 3RVPA 2ZAYA 4RZSA 3UK0A 1L5YA 3S99A 1YMVA 3L49A 5TQ0A 1JF8A 1QP7A 1KRWA 4YR7A 4RKRA 3QEMA 1NXSA 1JFSA 2P9HA 4XLTA 4XASA 5CNMA 1GUBA 5PNTA 4NICA 3Q15C 3MM4A 4HYEA 2FKAA 2MSWA 1JYEA 3SQNA 4N41A 2RDMA 3I09A 4ETNA 1ABFA 1ISRA 2A9RA 4LE2A 4DADA 2PE5A 1ISSA 4YO7A 4WUTA 1QMPA 3BRQA 4D74A 3NBMA 1U2PA 3KS9A 1EWVA 1ZDMA 3LOPA 2JVIA 3FMVA 9ABPA 3O2JA 2E4XA 2PMCA 3QX8A 5C5EA 4W5RA 1NXXA 2JB9A 1M5TA 4QICA 1QPZA 3LUDA 3OLYA 2HQRA 3FFWA 5HKOA 3GT7A 4EYKA 5HSGA 4CBVA 2QXYA 3DLBA 3N8IA 1MAVA 2RGYA 3LUGA 1TLFA 2JK1A 2MYNA 1PUXA 3F6PA 3I5AA 4MRMB 4MQEA 2PUEA 3RH0A 3LTEA 5TQ2A 2A9OA 5EWJA 1RPJA 5E3JA 3DBIA 1I3CA 2GI4A 2QVGA 2PJUA 1GLGA 3MA0A 3K9CA 4KV7A 3G85A 5FWXA 4KREA 4LE0A 4YS6A 3HV2A 1C0EA 5D2CA 1AB6A 1K66A 1YK1A 4N0PA 3MQ4A 1RZRD 2FQXA 1ABEA 1E6KA 3OO0A 3OLVA 4JP1A 5T7BA 2NT3A 2GBPA 4JA2A 5IUJC 3JY6A 4G0QA 2QVCA 4S04A 3N0XA 4Z9BA 4QYMA 3Q7TA 2VUIB 5FBKA 3C3KA 4PEVA 4MGEA 3ROFA 4YV7A 2L17A 2XDYA 3BRSA 2IOYA 1P6QA 4XARA 2IYNA 3M9XA 3HDGA 3RVMA 4IRXA 1D2AA 2FMFA 1RXEA 4G0MA 4KQ9A 2PUBA 3HJFA 2VK2A 4MPTA 1BDJA 4Z0NA 4WZZA 4H3KB 2GKGA 3RVQA 1DRJA 2FEKA 1MB0A 2PLNA 2JBAB 3CHYA 4HNQA 1DC8A 5EWMB 5IC5A 2B4AA 2E4YA 5JNWA 3P9YA 2WWVD 1C4WA 4OTZA 4MS3B 1USKA 3FGZA 2R25B 1UDRA 2FQYA 3CU5A 4WT7A 3KYJB 3JVIA 6ABPA 5C5CA 5DTEA 3JPYA 4WXMA 1VLZA 4KMRA 1APBA 4PICA 1Z13A 2V0NA 2JVJA 1Z17A 3HS3A 3Q7RA 1RNLA 3KG2A 3RVLA 1U0SY 4E7OA 1NY5A 5TE9A 1LBHA 2L19A 4MR9B 5TPZA 1T34A 3G1WA 3HXMA 1M2FA 3EGCA 1SXGA 3CG4A 4LRQA 3GBVA 1F51E 1S8NA 3T8YA 1DP4A 2MYUA 2M98A 1YS6A 3D8UA 3O1HB 3QLUA 4JASB 2L18A 3SAJA 4F12A 1Z15A 2E4UA 4KK3A 3LMKA 2CHEA 5IX8A 1XHFA 2LIVA 3LKVA 4KK4A 3UUGA 1LJLA 2A9QA 1Z18A 3NHMA 4IGAA 1YTUA 3LKBA 3Q9SA 2A9PA 1W9HA 1ZH4A 4MQFB 2AYZA 3N0WA 3HUTA 1DCFA 1JFVA 4LDZA 5IUNC 1E2BA 2PKXA 3LUFA 3KTOA 1CHNA 3IP6A 2ID9A 3O74A 4Q6BA 2PUAA 4FE7A 5JNSA 4L4UA 3JS5A 2WRZA 2R4QA 1B00A 4N0QA 4TLLB 4IMJB 3IP7A 3IDOA 4RK7A 2HQBA 3O1IC 2I6FA 3GWGA 2CD7A 3UKJA 4B09A 3RVNA 4YWHA 4ETMA 2NZUG 3NNNA 4Z9AA 2WJAA 2FN8A 3OLXA 3BILA 3MIZA 5TQJA 3C3WA 2R47A 3SM9A 5EWLA 1LJUA 5HQJA 1DBWA 3ILHA 4P98A 3H5TA 1E6LA 3LUAA 1P6UA 2NUBA 5GOTA 1Z12A 3DGFC 3N6VA 4W5TA 2PL1A 1WETA 1SD5A 2FXIA 5CNIA 2JBAA 1DC7A 5EWMA 4PYRA 3N0RA 4NCAA 2HSGA 5TPWB 3TO5A 4W5OA 3O2QB 3OMXA 4GNRA 4MS3A 4RSMA 1EWTA 2HQOA 8ABPA 1KMIY 1ZESA 1ZAYA 3SY8A 1ZITA 2LBPA 3B2NA 5B3JC 3T38A 3TMYA 1JWLA 3A0UA 4P1ZA 3IPAA 2FVYA 4EVRA 3LUKA 1ZVVA 2H3HA 2JVKA 2VUHB 1QNLA 3GBPA 4G0PA 3OM1A 5BRJA 5JS1A 4G0XA 3KSMA 3KLOA 3LUHA 4FB4A 4L85A 3H1FA 1NATA 2IPNA 4UHKA 3H5WA 4EUKA 4RK6A 1OXKB 3VNAA 3OQMA 3H1GA 3IPCA 2LP4Y 4W5QA 1L5ZA 1W25A 4OLBA 3H6HA 1HEYA 1FFWA 2JRLA 4LX8A 1CEYA 3URMA 3H5VA 1MB3A 1EFAA 3HSYA 5FBHA 3RVOA 3OM0A 4UHJA 1SXIA 2RJOA 2LPMA 2H0AA 5DKFA 5FWYB 2M1ZA 2PL9A 1VPWA 1FQWA 5CNJA 4JAVC 1USIA 3OLZA 1ZH2A 1CYEA 3TX6A 2OQRA 5BQ3A 2MSLA 4PZ0A 2FLWA 4M88A 5JNRA 1OXBB 3QELB 4MQFA 1LBIA 3D02A 4MR8B 2IPAB 4EYGA 4G97A 2MSKA 3VNBA 4JOQA 4Z4HA 3ROTA 2FLKA 3HCWA 3K4HA 6CHYA 2WB4A 3GL9A 4OLAA 1F4VA 1GCAA 1NXTA 3MMNA 5TQ0B 1AB5A 3H1EA 1NXOA 4OATA 5KWSA 2HJ9A 1TJYA 3CRNA 3QEMB 4KQCA 4KNYA 4Z4EA 3NNSA 3OO1A 3W9SA 2FEPA 1EAYA 1DBPA 1BDHA 1QP0A 1Z16A 2F8SA 2WJWA 1D1QA 1PEAA 3IP5A 3SG0A 4XXHA 3QX9A 1M2EA 1URPA 4FE4A 4MR7B 1VRVA 5ABPA 1KGSA 1KRXA 3EODA 2LUOA 2P4UA 4NV3A 2FMIA 3HVRA 3T6KA 3HK2A 1QO0D 5IBQA 4TLMB 5HM6A 2FMHA 4O1HA 4RU1A 4E7PA 1FFGA 2QR3A 4F8JA 4Z4GA 1PHRA 3GYBA 3EQZA 3HUUA 3OMWA 5I4CA 3CNBA 5TPWA 3LFTA 2FN9A 1R8JA 5JNUA 5CNKA 3O21A 1D5WA 1VKRA 1Z2DA 3NHZA 4ZYLA 3H5OA 4Z4IA 4OBBA 2E4ZA 1JH9A 4IF4A 4MRMA 2E4VA 1TMYA 4O1IA 1J56A 1NXVA 3O2SB 4MQEB 1P2FA 1BDIA 2NT4A 1DZ3A 2HPHA 3FFXA 5DGCA 5EWJB 1U8TA 5F64A 4MS1B 2FQWA 3RVJA 3E3MA 1DBQA 3O75A 5FWXB 4RXMA 1XWWA 1DCMA 3CZCA 1JDNA 4MLDA 5KQMA 5FWYA 1JDPA 4RY0A 3N75A 1SRRA 4ML3A 3BBLA 4Z99A 1JHZA 3R0JA 3TD9A 1QKKA 4MS4B 3GV0A 3HDVA 3Q41A 5ED4A 3C3MA 1A2OA 4NQRA 4TMYA 2Q5CA 3QELA 2FW0A 3RVRA 3KJXA 5KI6A 1SXHA 2ID7A 3CFYA 3Q7SA 4YP9A 2W42A 1FSPA 3KKEA 4MAAA 4G0YA 3CLKA 3A10A 5B3JA 4D6XA 3OQNA 2B1JA 2CWDA 4RK0A 1JFTA 1ZY2A 4RK1A 3DGEC 1LK0A 2QW1A 2ZWMA 4IMIB 1D4ZA 1U04A 1Z2EA 4RY9A 1DCKA 2IDMA 4RV5A 3QLTA 5IEBA 1TM2A 2KYRA 3T95A 4KFCA 3M6MD 4MR7A 1P8AA 2FSPA 4O5AA 4EVQA 2YHAA 3MYYA 2N9UA 2NZVG 3CTPA 1JYFA 3H6GA 1H9CA 2RJNA 4OG2A 1PEYA 2OENG 4F11A 1K68A 3JTEA 4LDAA 3TB6A 4G0ZA 1DG9A 2IKSA 4KRFA 5KQLA 4LE1A 1JBEA 1QP4A 3HO1A 3QLVA 5JNVA 3EJWA 3IP9A 3HZHA 4MR9A 4Q7EA 1YS7A 5DLEA 3C6QA 3QK7A 1NXWA 3GRCA 4YCSA 1U2QA 2DRIA 1USGA 3BREA 4DQDA 3ILYA 2FTKE 3KHTA 4NCBA 3E61A 3QLVC 2F8TA 2FEWB 1BVHA 2WMYA 4KVFA 5T3YA 3FDFA 3H5IA 3O1JC 3MF4A 4EYQA 4EVSA 3KYIB 2R48A 4EYOA 4EGSA 1NTRA 4MS1A 4F3TA 5KC9A 5JNTA 2QSJA 1YVUA 1MVOA 1NXPA 3JPWA 3JVDA 4G0OA 2GWRA 1DRKA 1RZRA 4RY8A 2VYCA 3EULA 4RS3A 1RXIA 3GA5A 1EHCA 4ZJPA 5BR1A 3DZDA
chains in the Genus database with same CATH superfamily
1R0CA 2N1BA 1Y6ZA 4YYZA 4JLNA 1PNRA 1RLOA 4Y7DA 4F9GA 1VMIA 2IS6A 2P90A 2ZIXB 1QK4A 1Y1SA 5DX1A 1W4BA 5G53C 3ACBA 3ZZ0A 1WW2A 2QRVB 4TKZA 5AVOA 3W9UA 4MRRA 2PZBA 2V3CC 4GKKB 1ZXBA 3FETA 3HB1A 1QXSA 1ZWKA 1XZMA 3LXUX 3GD7A 3VYTB 2BMJA 2EKBA 1KOLA 4KPEC 1E1QA 2AC2A 4O59O 2ACWA 2IDZA 3H9QA 1Y8ZA 3CT6A 4KR3A 2QMZA 3Q7EA 4ZARA 5FBZA 3SHVA 5U4XA 3T5DA 1U2TA 3G68A 3FFAA 1ZH0A 5JJCA 1JJBA 4JD5A 2W11A 4DAOA 3MRTA 5AI8A 1BQ4A 1CSEE 3DHEA 4XVQA 5HGJA 5JIBA 1BHJA 1QYRA 3VDRA 4K9SA 3DT6A 3MXOA 2AXEA 2H11A 3AWDA 3C4JA 1M2OA 1G21B 4MGKR 1K9VF 3ZGYA 4NR0A 3WLLA 4PCAA 3AVXA 2PUCA 1H2AS 2ZYTX 3FTNA 4KQXA 3A4YA 1BQ3A 3K9FC 3CH4B 1XQWA 5H1YA 3G7UA 1C3XA 4I14A 2R8BA 1Q1EA 2ZRPA 3H5LA 1FYFA 4F56A 1HL3A 4L2IA 3F5MA 1A9QA 4GG1A 4F8YA 1WW3A 3AF5A 3QWHA 1VLJA 4QXRA 1EMDA 3RVKA 4QLAA 2ZJ5A 3D4NA 3OWHA 4IG9A 1KO1A 3BDVA 4DAEA 3EXHA 2JCGA 3D3JA 2MR6A 1JHQA 1RQXA 4RE6A 5D84A 5FJJA 4BL5A 1EFPA 3K09C 5GGXA 3S2EA 4ZRNA 4B7CA 1BWRA 1E7MA 4FFMA 4Z7OB 2ZT6A 5CB4A 4PG7A 1NVWQ 3V2HA 4A16A 5ARBA 3V8NA 2TMGA 4YGXB 4JI5B 5IVDA 4EHLA 3O91A 5IAJA 4MV0A 4IDBA 3WWDA 5J43A 2ZK7A 1AZSC 3UH1A 2TS1A 3NC1C 2PGOA 3OTGA 3QLUC 1QHGA 3MFYA 3ZYCA 1G8PA 3TZ6A 4US0R 3CG0A 5CJJA 1QV7A 5H82A 1XB2A 1L5YA 3V7WA 5J4KA 1XTJA 5JDCA 2W70A 4ND5A 1DIGA 2YASA 3R5TA 3BA6A 1GDHA 1M2NA 1T1JA 3FLMA 3LX5A 5H7XA 2IHVA 5BVHA 3FXAA 4B44A 3K8YA 3LO5A 2V6GA 1MEEA 3CN9A 4PQYA 3ZXIA 5BQFA 1M74A 1D1SA 2R62A 4HJRA 2INGX 4R6WA 1IN5A 2XMRA 4V24A 3U4AA 1HLDA 4E07A 4BP9A 2QTHA 2XRFA 4AUMA 2ERYA 1J5XA 3UZUA 4F0JA 4F5ZA 2IU6A 2A5GA 3NGLA 1LX7A 1VLMA 2CNOA 2HHAA 2OY0A 2VHEA 4PRZA 3H13A 4UNNA 5A3VA 4TQUS 3SSNA 4JI8B 4YJGA 1K7FB 2B4KA 3HL4A 3KTAB 4GU5A 4IXMA 4BVBA 2OZLA 3C8MA 5NULA 5IH7A 1IHOA 5HM8A 4IIXA 4UVIA 1YNOA 1L5VA 4UBIA 2O8CB 1G18A 3E5NA 3GX1A 4C4RA 3AM1A 1JHDA 1HH4A 1MP0A 1T0IA 3ZWVA 5IWCA 5DCYA 5KS2A 4IVRA 5H3LA 4EYKA 3ZGNA 3BERA 2VHJA 5A5VA 1OBHA 1YASA 2FEMA 1XN4A 2JGIA 3BWMA 4MYCA 1Q84A 1O97D 3C48A 2RHGB 1D2GA 4F4UA 5L40A 5KX5F 3P9SA 2XAAA 3NTQA 1IQPA 4R6XA 4AJKA 1YCHA 2BFEB 4YGYA 3GLIB 3FDIA 2YDYA 1J42A 1NVTA 2PJUA 3BRCA 1D6MA 3PGA1 4FCWA 1OHHA 1JLMA 2OLJA 4DWVA 2DF8A 3OJFA 3QBJA 1LCIA 1YQWA 4QTYA 1GT91 2ZE8A 4HGOA 1EVYA 3AJ9A 5GMOA 4Y6RA 1UBUS 5I7EA 5L7YA 5AMXA 1S3GA 2AFVA 4GR5A 2NSJA 5IJZA 4BEJA 3I5YA 1N5LA 4ZQHA 4L4SA 4BQNA 3QVGA 1LX6A 2OV1A 4JA2A 1B23P 2GESA 3BXXA 3PXBA 2XRZA 4QYMA 1F2VA 3NHFA 3Q7TA 2P67A 7AT1A 4OGGA 1RAEA 2J5KA 2QOEA 2O1WA 2P3LA 2NXNA 2WPDD 3AB3A 4PYLA 3OF5A 3C3YA 4XARA 5JS7A 2H8KA 5K01A 5BR7A 1TM4E 1CULC 1GA1A 1ZXLA 2B5WA 1ZMTA 2XEXA 3EDMA 4OQEA 3D3NA 3NDRA 5DM1A 5EAIA 2W2LA 3KR2A 3BC1A 2QPOA 3ZX4A 2DU8A 4WZBE 3PF8A 2CHGA 1J9GA 5HE9A 2CXTA 2QIOA 1ODSA 4ZCQA 1KVTA 5L9AA 4MX8A 2BFCA 3OJCA 5I4BA 4AUNA 5JNWA 5ALGA 1DMSA 4IY1A 2XHZA 2I6QA 4EELA 4OK3A 5B3AA 2R8RA 3RS8A 2X2PA 4RJIA 4P3XA 5KCMA 2DHRA 3S5JA 1EA7A 2ZJFA 3WLNA 2OFFA 2FQYA 3F2IA 3W2GA 1DX4A 1P81A 2OHHA 3FPGA 4DJTA 4C7XA 1Y8RB 4GKAA 3OQHA 3C6ZA 3VJRA 4GMKA 1SUEA 2QN9A 4Z6KA 5AW6A 1TT7A 2ATXA 3FMPB 5CB8A 4YEDA 4O2LA 3UMYA 5J23A 1E66A 1HE5A 3LBIA 3COSA 5JMPA 1MO3A 1SO8A 1EZ4A 2I2BA 3TQFA 4G37A 5EUMA 3WYNA 2XTMA 4MXDA 1MEOA 2MYUA 1RMQA 3D31A 3EOZA 4OL9A 3LG2A 4QU9A 4KYIB 4X44A 2Y1KA 5I9IA 2J8ZA 3LQ1A 2LIVA 5IK2A 3B13B 4PPFA 1S02A 3PNPA 2ZSJA 4HTFA 4IZOA 4R01A 1H2RS 1W46A 1X1DA 2ZIVB 3Q9UA 3NHMA 5IMSA 4F8EA 3RC8A 1XXHE 1CIJA 1B76A 2Z4RA 3F3KA 3Q11A 1PK7A 3A2NA 3D5TA 3HUTA 3WL6A 2PD4A 2G1PA 2C5FA 3FCAA 4IEIA 6AT1A 3KTOA 3VU8A 1Z5ZA 3D3EA 3FTCA 1YZKA 2CZQA 3NORA 2PTHA 1YJQA 3OY7A 4MP3A 1Z9BA 4QFMA 3ZH2A 1DFHA 2C2YA 1SQ0A 4EUEA 2IP2A 3M83A 2RCYA 4TMWA 2ADFA 2POQX 4Q48A 3WJ2A 2R8ZA 3LHIA 3R3UA 2C59A 2K4MA 2F00A 4PINA 1T8WA 2I6FA 4WOKA 3TTSA 2NLOA 4ZVOA 4TMTA 4EMSA 4LQ4A 1V6CA 2GZ3A 4J91A 1PV4A 2G70A 4QDTA 4MW1A 4OP1A 1VKOA 2Z98A 3SYRA 5JHHB 4D97A 4RIEA 4UVGA 4Q9NA 1MJFA 4XUGB 1XPRA 2D7DA 1XIVA 4CKXA 4O2BF 4PLZA 3FHJA 3T7SA 3GLFB 4MP8A 1PLJA 4JYMA 4Q0MA 1Q7GA 3DR3A 1LFDB 3GA7A 2XT0A 4RPHA 3JQBA 3THRA 2IYAA 4CJXA 4ZI7B 3G88A 4MV3A 1X7HA 1F6WA 1HBJA 4GNRA 1WQ4A 4KGVA 3DOHA 1FLAA 2RMKA 1LBQA 3G7SA 2QG9A 3A2LA 1ZJ5A 1EUCA 2C5BA 3D7NA 5AVWA 3WK7A 1NWHA 3ZZTA 1ISHA 3DHYA 1V4BA 1U0EA 4XI9A 3SKVA 3U6BA 3U9SA 3IVAA 1LBSA 1OA1A 5TEVA 1Z07A 4R16A 5AOBA 2O2IA 1RHMA 2GEVA 3IQXA 3OQ6A 1AQNA 3IB6A 1F14A 2MCFA 5CYFA 1CVRA 1TZ2A 1VHDA 4B2LA 1B41A 4W1RA 5CBPA 3B9QA 4ZWNA 1JDUA 1QG6A 5A6VA 4X85A 2C2OA 1HNNA 1X1QA 4KN5A 3OIGA 1CQIA 5JBQA 1YR6A 3N2YA 1BN6A 1WSWA 4J2OA 5FBHA 2AMVA 1JDTA 3U81A 2RJOA 3W8FA 5EMMA 3J81k 1UCFA 2BUAA 3URKA 1ZN7A 1J90A 3KEFA 4XEUA 3QE3A 3WC4A 5DYTA 4G65A 1JJAA 2BC9A 4MJLA 1FVOA 4MA5A 1ZIYA 2LVBA 2QRKA 3PUIA 2ZRFA 1ULTA 1MC1A 3MCAA 1EH5A 4FYHA 1L9XA 5LYJA 4E3WA 5JNRA 1IQ0A 1X1BA 4B6OA 3H11A 1CDZA 2WHXA 1XN1A 1KYVA 1Q0HA 4ZO7A 5T8KC 3WIOA 3IBYA 3ESYA 1MFZA 4BE4A 2GLXA 3I9JA 3JYOA 4URXR 3MGAA 4UHCA 3P2EA 3TTVA 1HYBA 2J4FA 3GN2A 1FS4A 3MN1A 4Z4HA 4AJ1A 2DT5A 3AHJA 3A3YA 1QPBA 2C00A 3UWSA 3X1DA 3EWNA 4Q15A 2BBTA 1K5PA 4MO9A 1NXOA 4R2MA 3TZKA 2X0NA 1SBTA 4KQCA 4LOLA 5F9FA 1B3BA 2QZPA 5AW1A 1XEXB 3THOA 3MS4A 4QTZA 1QP0A 1FX0B 2G9RA 1AY0A 1TJ5A 4YFVA 3DQQA 1Q91A 3VU1A 1ZI6A 4FE4A 1URPA 4KO8A 1P2DA 4MPPA 1KGSA 1E9BA 2ZTVA 4JLUA 1TIKA 1XDBA 4N12A 1N92A 4KGXA 3QA9A 4I6GA 2Q8PA 1US8A 2HIHA 2YJ5A 3L93A 4ZC1A 4GW3A 4WESA 1U6IA 2FRXA 4AXXA 1ECJA 4DJFC 4ZAXA 4N40A 4N0EA 1W85A 1PDWA 2OGWA 4WKOA 4Y30A 5BORA 3GJZA 3HCOA 4LSMA 5BSUA 3CNBA 3E9RA 3H9GA 4US2R 3NWBA 2WHYA 3OCWA 5E1MA 1NUPA 1P7PA 2XXAA 2O2GA 1MEJA 3HA5A 4RFLA 4OSEA 5ALYA 3RRYA 4EHHA 3H42B 5JVDF 1G5QA 2CE7A 3A26A 4UOQA 3LLSA 4NJEA 2AF3C 1A50B 1NVUQ 3AT1A 3BK7A 2VQSA 1VPLA 4ER0A 4HMOA 4EHFA 3Q3CA 3PG5A 4O1IA 2W2VA 3WLFA 3MHTA 4GXQA 4EUFA 3HRKA 2UZ1A 2HPHA 5DGCA 1VKNA 2QXTA 3VTZA 4C4XA 4YUZA 5CEFA 5C8VA 3NJ8A 5JZ9A 5IXYA 4TLAA 3UANA 4F84A 4OHZA 3KT8A 4PXSA 1E77A 4FD2A 5JALA 3IEUA 1SUBA 1M2HA 1P77A 4KITB 1A4XA 3CUEF 3BE8A 4XW2A 1CY2A 4REQB 4ZAGA 2EW8A 1XTBA 3Q3VA 3PDHA 2EBFX 2P9YA 1Z8NA 4JLMA 4D0LB 5H9WA 5KWEA 5JYEA 3MLBA 1E79A 2Q1SA 1U0RA 3B1ZA 1N0HA 4HNVA 4AJJA 1R74A 2GPYA 3AY7A 1R0WA 4PFSA 1MF7A 1OYYA 1VL8A 2CNDA 1POWA 3BAFA 3CRQA 2FHSA 3ED1A 3NIGB 3NRJA 3OZDA 3AP1A 4N3BA 4HNUA 1QB8A 2CF6A 3CUKA 4XQ9A 4JJ8A 2O3SA 4KL8S 3TSAA 1P62B 2G4VA 3S1AB 4BJ3A 4TQAA 1U3GA 4YJ3A 1G59A 3KLMX 1PAUA 1T2VA 5UKDA 3VDQA 4DFDA 5HQTA 3NBQA 2IQIA 1DINA 4X94A 4BGUA 3LPMA 1XT6A 1VKJA 3TIVA 1YCDA 4BKUA 1U2DA 2OP0A 1XTKA 1DV2A 1P75A 1WKCA 3C4VA 2WFAA 4RFSA 3TLZA 4CTOA 1GL6A 1IN1A 2HV8A 3IOCA 5BV0A 1FW6A 1ZN9A 3B70A 3T1YB 1TM2A 4G56A 3EJ6A 4UZSA 1B3RA 3ZKWB 5LMZA 3UJHA 1JHRA 4G84A 2FZLA 2BGLA 3UY4A 1WBDA 2IXDA 4DV5B 2BPOA 5I7RA 4P3PA 3KPVA 5KYKA 3J81A 3LTNC 3T7TA 4MVJG 1O6ZA 1K6JA 4OY3A 4ZVUA 1TJ3A 1KL7A 1TD9A 3A9WA 2AEFA 3EPRA 3HEAA 3JZDA 3O03A 2GARA 2HBRA 4PFKA 5D3KA 5EKSA 2JAWA 4LBWA 4LOKA 4MCJA 4REMA 3TRHA 3VZQA 4W9NC 3FPBA 2ROQA 2VP9A 4JQOA 1XBTA 4XLLA 4URVR 4LTMA 1A8UA 3B1KA 4M9ZA 4EGJA 1TK2A 1WWKA 4GEGA 1FJXA 1N7IA 1T9BA 2YYZA 3GRCA 2JLCA 5DWDA 4D4MA 2BDTA 4CTKA 2EERA 1TZKA 1KR5A 3BQMB 4D4LA 4ZK2A 2JLVA 1VHJA 2R68A 1PWYE 3ZWYA 1BVYF 1A9SA 2OP1A 3E9CA 1HY3A 1GVHA 1NOJA 3EPPA 3H7IA 1LPPA 3HFSA 2H65A 1CUYA 2R48A 2IE0A 1ST2A 3SZOA 3WWOA 3OFKA 2HT6A 4U7GA 1C7QA 1LY1A 1GL7A 4RZ3A 3DF7A 3U4CA 1M1NA 4U7JA 1U28C 1PFWA 1NRXA 2XYRA 4RUKA 3M6FA 3UEOA 2CL7X 2FMTA 4YV0A 4QYIA 3PE3A 4XUDA 2IUUA 3ONVA 4AIRA 4EMBA 1HDXA 3AI1A 2XGJA 3GROA 4CKEA 1T4BA 4OQQA 3E3NA 3DFKA 5EEHA 2HA6A 2VQ3A 2ZS8A 1EGAA 3AU8A 2AN1A 3B3AA 2NTJA 4QO7A 5DMHA 3REQA 3UIEA 4DVGA 2ZRLA 3EEQA 4D46A 1NVDA 2H06A 4UTVA 1C30B 5JXHA 3IIMA 5F1OA 5FBVB 1AKEA 3NH6A 4QPZA 4MS4A 5IUKC 2G40A 2XMQA 4P53A 4YRZA 1T9GS 3D2LA 1QH8A 4MMXB 1ZN2A 4MQMA 1W1IA 2DR3A 1O4VA 2JA2A 3V1YA 1NHGA 4H2DA 4R1OA 4RXUA 4BMSA 2GCIA 4LYFA 5IVIA 3UJ7A 1IEWA 1DNPA 1I0ZA 4YXFA 5KYWA 4WOBA 1HE8B 1LQ2A 2GZAA 3BK1A 2H1CA 1C8LA 2ZBEA 2WG0A 5D3ZA 5JSUA 3W2HA 1T1EA 3TOSA 2IVZA 3HEBA 3HLTA 4RESA 2ECPA 4X8OA 3VU9B 4CT5A 4DQXA 5J2TB 2R7LA 4PAWA 4QM6A 1OAOC 4MQLA 2VIIA 3H16A 3O7WA 5CVVA 2ZYWX 5AVYA 5EIWA 1P0PA 4L7QA 5DASA 3UFBA 2GUWA 3R8XA 2V5AA 4II3A 4CM4A 4S12A 4IUCS 3OPQA 4X5OA 4ZMSA 4D4IA 1LSJA 1AHNA 4ZVKA 2GFIA 1L7MA 3D8NA 3NVDA 3FF1A 4I9FA 4HY3A 4ZGWA 3OEEA 4CQNA 5TQ2B 2I4TA 1QQBA 4MLCA 1TW2A 5D87A 3JQPA 3DEIA 4KTTE 4R8VA 4BWGA 5I3ZA 2O7SA 5T4EA 1GUDA 1PUJA 1T3ZA 3LL4A 1W7AA 2R85A 4WV3A 5DGIA 1JR3E 3PEVA 1G8FA 1S1MA 5BRAA 2RKBA 3IYLW 4DMUB 1V71A 3FDZB 1TUGA 5EQTA 5I9LA 2HREA 1PO7A 3GUVA 4KX3A 3KOXA 1M0TA 1M2KA 1TCAA 2XNCA 1UKZA 3A70A 4UXIA 1XCJA 4E1BA 3JAKA 2O20A 5K6TA 3U2QA 5K20A 1RXYA 2ZKLA 3KLNA 5BV1A 4MVJA 1O6CA 1XZIA 1ESCA 2P8JA 3VO1A 1NM5A 3F78A 1Y5MA 4L0MA 1RWBA 2CD9A 2XD4A 3C3XA 2J7PD 3PHCA 4MR8A 3WTBA 4BLSA 4J1TA 5K3FA 4GKBA 4WZ6A 2VNJA 1YI0A 2WV7A 2CZGA 2DECA 4X64B 2NO1A 2QYOA 3ZXXA 2ZAYA 4MPDA 4MP6A 3GLTA 1KSGA 3JQ9A 4IJUA 4EF5A 4ARIA 3K9HA 3N3BC 1X7YA 3DVQX 3EW9A 4JL6A 1Q50A 1Y1QA 4Q34A 4ROTA 2YC4C 1E2EA 1G2PA 2PQ0A 2WT4A 5DBGA 3RUAA 4EEKA 4YAUA 1YI8A 1S1CA 3OZUA 3PQFA 4YTEA 3V8QA 4EABA 1RPZA 2HIGA 1OBCA 1JFSA 1CR6A 4XASA 5C51B 3DMYA 3ZXUB 3BGIA 4CEHA 4A82A 4P5PA 3L6CA 4D25A 1PBTA 3B8HA 2A84A 2ZYAA 4P58A 4Y9DA 4UTRA 1KFKB 3IQFA 5FA6A 1NF9A 3LUBA 1KHHA 3EPKA 4HLNA 4MLPA 1PCXA 5B6IA 3T0GA 4FWTA 3HFJA 1R27A 1Q11A 5EVCA 2ARKA 1GRCA 4D74A 4LI3X 2VTBB 1HDYA 3ZDEA 5MF6A 2AOWA 5KUTA 2C96A 4DM4A 1PYGA 1TKCA 4RPLA 4JOCA 2ZDGA 3DZHA 3T7EA 3EYWA 1NFQA 2EYQA 1XTQA 1LQUA 2HQRA 5B57C 1C8VB 1KYQA 1NI5A 5K3EA 3NMUF 1PZHA 3UGKA 3SOPA 4L8FA 1U3UA 1VHWA 1U7WA 2D4HA 1DGQA 1UBNA 2NN3C 3WXBA 4BMCA 1XTTA 2O1SA 2K5UA 5BOVA 5TLSA 3ILVA 4NZZA 1GTJ1 2BFMA 4MEBA 1SA0B 3FYCA 4AKSA 1AA9A 4HQRA 3TQTA 3DH0A 5B1IA 2A57A 3E5HA 3IVMA 3T7AA 1PL8A 5CFQA 4RLFA 2PANA 4WECA 2XLCA 1KY2A 1P72A 5D2CA 5BSKA 4KU4A 4NYJQ 2VZLA 3OTWA 1L2TA 1V39A 3GLHB 4UNRA 4RF4A 1L5MA 2GCEA 1M2GA 3B6IA 3TLEA 2EFHB 2HWYA 4G07A 3A9VA 4X45A 3RCBA 2REXB 3WO0A 3ZBPA 3TLMA 5IT5A 1WZ2A 1Q44A 4QBFA 5F5LA 1Z0SA 1MZVA 2FJ0A 2BBWA 1RBYA 1VGQA 2CE2X 4QXMA 4KFTA 2TECE 4DA6A 1PK9A 2AOUA 2EYUA 2VDJA 1C4KA 5I5GA 4LGCA 1M3SA 3OHSX 4C7OB 2JFXA 2FGJA 4I66A 5E2IA 3RVMA 3SC6A 4GHWA 3VRHA 3TE7A 2A88A 4A4DA 2EWMA 3CSDA 3B6KA 4JU8A 1NU6A 3EEIA 3IQHX 3KEMA 4LXUA 1XELA 4XYLA 2VQEB 2A9KA 2GKGA 4EI2A 3IVRA 2WOOA 5JQGB 4AO7A 5C18A 2CVHA 2PLNA 3KE9A 2VATA 3PK0A 1GA4A 2FB9A 2UXCB 1PDVA 3I4CA 3AF6A 5HR5A 4CTJA 2D7JA 4PG4A 2V4ZA 4GYWA 2JAUA 3EB9A 3NHBA 3NYIA 4BX8A 3FGZA 2LXNA 2VCHA 4X8HA 3IAXA 1BU8A 1CUJA 1Y1RA 2JL1A 3LD9A 3SN6A 3NOVA 3SYTA 1IBKB 3KYJB 3AHCA 5C31A 3GGCA 3LW8A 5G3YA 3R6LA 1ZLYA 1YULA 2V7WA 3GGGA 1E8DA 2M32A 4E21A 1N2GA 1G64A 4PLYA 3KZOA 4ZEWA 3VFDA 4CNQA 1IMJA 3K9BA 3OCCA 2CUNA 1G16A 1B0AA 3A6DA 4IG4A 1JQJC 1RWVA 4IJKA 2BHNA 4L4ZA 3P9NA 1UDCA 4V2IA 2C3OA 2D2VA 4YP0A 2P91A 2FW1A 4I2NA 3EVBA 3WLRA 1E63A 3FPJA 2B4TO 1FFDA 3NBUA 2BP7A 3P5SA 1F51E 1S8NA 2VPIA 4PBSA 5I7OA 1SC6A 4D43A 5HS4A 4OYLA 1PN3A 4BX3A 3GUCA 5LU8A 3UMMA 3COJA 4O2RA 5TX7A 2I3AA 3JD1A 4KOEC 2QN2A 4BUCA 1NUSA 2YBDA 2O2HA 2IBTA 3JQ8B 4NIMA 5CG1A 2Y76A 2BKLA 4NF2A 3VISA 3BOSA 3FUCA 2FPGA 3HSKA 4PGHA 4GZ5A 3V9PA 4YRBA 4N3GA 1FRZA 3LKBA 3Q0TA 3ELYA 2XZOA 3QVTA 4GGOA 1TX4B 3I6MA 3JQEA 3CLUD 4IZ6A 3JQRA 1A8PA 2Y71A 4XX0B 3W8NA 4G24A 4JUFA 2XUGA 4BAZA 4RF2A 1TZJA 1CF9A 1P4GA 3W5DA 1QK5A 4D0SA 5ECYA 2EP8A 4HUTA 1UEJA 1OYOA 2P8SA 3V48A 3BB3A 4JEUA 4DPKA 5EXTA 3RWMB 3HXMA 1RQ7A 2F2TA 3R0XA 1T9DA 3HB7A 2PX3A 3C5VA 3PFCA 1FE8A 2VP2A 2KBFA 3AU9A 4YWHA 3ZD8A 3WK5A 2NZUG 2R2GA 5LQCA 3TEMA 3ZHYA 1Y7TA 3EHDA 5EP1A 1NC3A 1LH0A 1EEHA 2AT1A 2NQ2C 2NUAA 5EY5B 3GZ4A 4NJMA 1VLVA 1N6OA 1QIDA 1RT9A 1T26A 2J4DA 2JH3A 3EDRA 3JZFA 2QUJA 3QXSA 4CLEA 4KR6A 3DL0A 3LUAA 1XPUA 4WLVA 1GNQA 1ECBA 2OZVA 1L8AA 4LJRA 1M6VB 1VFNA 5E8JA 1SIBE 3WKCA 3N0RA 1OD6A 3PQ8A 3UH0A 4AMGA 2NZ2A 1FYXA 4DC9A 2NPIA 3IO5A 1JZSA 1NN3A 3FMFA 3L8ZA 1OXSC 1J2RA 1D6JA 2X0IA 4C3ZA 4KR7A 4RQUA 1ZGCA 2QM0A 3R4CA 4HXGA 5L53A 3T9DA 4EEXA 1BKYA 4JJZA 4OIMA 4EHJA 4ALMA 1KSFX 3K20A 3GUZA 3KJNA 3MGCA 1FCJA 2Y6UA 3F7MA 3A3NA 1QNLA 3BD8A 2IV7A 2HI0A 4HVCA 1SXPA 3C3JA 3K1YA 4QARA 4H7JA 4RELA 1E4EB 2OMEA 1N33B 1XJWA 3UMRA 2CVOA 5B1YA 1ZOSA 1A9RA 4RK6A 1X9HA 1KMQA 1BD4A 2YJZA 5DP2A 4D3FA 2AUMA 2F9MA 1OGJA 1QANA 2QRGA 3I6QA 1J2UA 4XTCS 4DEYA 1QV6A 2JRLA 2D2FA 3AF1A 4ZQIA 5AIBA 5K4GA 3GCWA 2P9FA 4HZUA 5GAJA 2A92A 3VI4B 3WRXC 1SXIA 1VE6A 1X3LA 4TXNA 3IDZA 3EGXB 2CEAA 2P1RA 2YH2A 3KAQA 4M1OA 3RHSA 3TQCA 2M1ZA 3RTAA 1L4LA 1XMVA 4RDIA 1UT8A 3GDGA 4BO9A 4QPPA 3KSAC 3ZVNA 1QRUA 5DM4A 3SJZA 3MWEB 1OSNA 1UF9A 2WD8A 2ZULA 3WKAA 3INRA 4WK0B 4EFLA 4WFIA 4M88A 3DS8A 4XE5A 5FO0A 1YJCA 3IBSA 3T0FA 3R44A 4ZAYA 2XDAA 3HYTA 2FAXA 2HL6A 2X23A 2ZR8A 4G97A 3VX4A 1U8YA 4I9UA 1PE0A 2C4NA 4NAVA 1EJ2A 1Y6RA 1FYVA 3H87A 4FR0A 4YQYA 5EJ2A 5AW5A 4BNZA 3CVUA 4RJTA 3D0QA 1F4VA 4ENPA 1JG6A 1EUQA 1P7YA 2QE6A 2WIKA 3DP9A 1E62A 1P91A 4JROA 3ABRB 3T3NA 3ABZA 1PQ4A 2HRDA 2FFQA 1R7RA 3SZRA 4MGZR 4PNPA 4IDDA 1PEAA 2Z2ZA 1KIFA 2A2ZA 4IXTA 3R7SA 1BEUB 5K8CA 3N7AA 1CU1A 1PD0A 2VQFB 5DO9A 3TSWA 2MMGA 1MH1A 1EK1A 2ERXA 2FXVA 1X39A 2AKAB 2GRJA 4MUFA 3UJBA 2I1WA 2V6FA 3I2GA 4B3MB 4F2GA 4GR9A 4A1OA 2ZANA 1DI0A 2HMAA 3K4PA 1M2JA 3LPDA 4FT2A 1Q0SA 4Z0PA 1GVNB 4GOJA 4GM0A 1N6LA 2FW6A 3WLAA 4F2WA 5TPWA 3O8CA 4XUEA 5BN1A 3MTBA 1KJIA 3BAZA 3DDCA 4H1VA 1IWBB 5KU1A 2AFIE 4R1NA 3ICPA 4IXDA 2HDHA 3R77A 3I30X 3LA8A 2E4ZA 4DCOA 2WU4A 3KELA 3V1LA 1N34B 3D64A 5M04A 1D03A 4I55B 4OHWA 3F2VA 3T1HB 2A0YA 2OHXA 3FMOB 4NENB 4P35A 5D86A 2HSZA 1E2PA 1W88A 4M36A 5JO0A 1V26A 3R1IA 1HETA 4DUGD 5KTTA 1U8TA 2JFNA 3PCXA 1L6IA 3KZCA 3PIRA 4QBIA 3CT4A 1DWUA 4DSTA 5I7WA 4URWR 2HZ7A 4LJLA 4NZ9A 4R84A 1XWWA 1YRWA 2BMAA 2EJCA 2ILTA 4IGKA 4J2HA 4N3NA 3SXUB 3VOAA 4ZI2A 1RPNA 4RDXA 5IYZB 1W76A 1ZOOA 1GA6A 4H6WA 1WMBA 1RTKA 2VK4A 3L9XA 5DP1A 1S2LA 3RHZA 2ZUCA 5D6OA 3AVWA 1Z7GA 1GGHA 3O6VA 4I8IA 4KE9A 4BUJA 4K6FA 3L1KA 5K3AA 2UUAB 1E1CA 3IUNA 3OQ1A 1KO5A 3EARA 2Q29A 5JZBA 4GXTA 3GV0A 3SBDA 3L7YA 4U6SA 1C1DB 3ELDA 3HG7A 2C7PA 1TYCA 2VPTA 3HUDA 4MUXA 2PRIA 2P6OA 3LDHA 3PC6A 4EK9A 1N2CE 4QAJA 3KKEA 1KORA 4MYTA 5LP6A 3W5SA 2YJ3A 4RS4A 4DY6A 5IPFA 3CLKA 3KOMA 3PQ6A 4AWBA 3SVLA 4NCNA 2VJPA 1HOXA 1Y0BA 2N42A 2VBGA 3DZGA 2GCNA 3PDCA 4P2BA 1QF6A 1QIKA 3GJRA 5I8PA 1F0KA 1CLEA 4KKVA 4CKWB 1MRSA 2PBZA 4KIUA 5AQ1A 5EJ6A 3G9QA 4MR7A 1XTRA 3HP4A 3SEFA 4EVQA 2IUSA 3UTDA 2CLCX 3H1AA 1Y8RA 3HDJA 2Q0HA 4ZKDA 3H6GA 3I6IA 1DO8A 1U4NA 3C7DB 4RPCA 2R66A 4W1SA 1D07A 2CDNA 5FQNA 3ROQA 7MDHA 9ATCA 2IKSA 2IU3A 2JBWA 2DHDA 4Q1FA 1IBCA 4ZVSA 1XEAA 5TS3A 1BWQA 1JXMA 2ZI7A 4PSUA 4QBHA 2OA0A 3TLJA 3W6OA 3ZHZA 3IP9A 4RC9A 2G88A 3HZHA 4D9FA 1EVIA 1PT9A 2R7KA 4YBZA 3DVLA 3N74A 4AXBA 3TG8A 2I7VA 3V5NA 2F1RA 4N9WA 1AS2A 1Z4KA 4CF6A 5LUBA 3RWBA 4GXRA 4OO3A 2X8BA 3W1VA 1YQGA 2QRPA 3VC7A 1JXOA 4F93B 1ENPA 1U0OC 1AV7A 2DX7A 1K98A 2IQ5A 3ITEA 3U3MA 1RMTA 3EY4A 3SMVA 4BBZA 4FFBB 3VO8A 4QUGA 5BNIA 2WAYA 2P9CA 4NCXA 3TOXA 1Z2NX 1ZD4A 2Q4BA 2Q5FA 3WK6A 5BUZA 1M73E 4EFNA 3OAAD 4GYJA 3EASA 1N2ZA 2MSCB 4IHJB 5E9AA 2ZUEA 1CEEA 2EJWA 4OQFA 4D4HA 5GVSA 1WXDA 5L3QA 3C6XA 2A0XA 3JVUA 3X1KA 4TXLA 4J0IA 2SICE 5LB2A 5JANA 3VVLA 1XZCA 3RBVA 2Z8XA 3DG9A 3JW8A 2G17A 4M89A 2O8VA 2YCBA 2ZEJA 4CKZA 4P7GA 1YNSA 3SIXA 1IBRA 4YONB 4M9RA 5EINA 2RHOA 4YRPA 5FX2A 3LUCA 1SU6A 3BJEA 1BS1A 3D4BA 1OIVA 1X9GA 1CJKC 1IAVA 4J03A 2QYSA 3EC2A 3WGVA 2CLIB 4KWEA 4QVGA 4LJKA 3F6BX 4YMWA 4UBJA 3CX4A 3I9FA 4P54A 1KP9A 1X86B 1MDBA 4RPKA 1XD9A 1HDRA 3B7GA 3TLGB 4EUSA 1JWBB 1OI2A 4KGDA 4CCSA 4G2TA 3GLFA 3Q8KA 1IY1A 3QTBA 4F5EA 3THYB 1K63A 1NQUA 3PX2A 2CSXA 2Q4TA 3PGXA 3ORFA 4I5EA 4NZNA 1KQNA 1CJBA 1DOHA 5KC8A 4ZI7A 5AKXA 1U9JA 2J32A 4P31A 1AKWA 2Q5IA 5DBIA 1TTPB 2ODBA 2YC2C 1RI2A 2QD1A 4C6RA 3U3RA 3VPXA 2FZKA 2YFQA 3WHIA 3TZQA 3IMFA 1FTYA 221PA 2VA9A 1SVMA 4K81B 2JFOA 5GV7A 2QN7A 4CTMA 1ZPDA 3T1VA 4ATNA 1QO0A 4F71A 2HH9A 3D81A 3OX1A 1R6DA 4EG3A 4J0QA 4HQLA 1PS0A 3ICOA 1LD3A 5GZ6A 3RLFA 4CMEC 2EX0A 4OVKA 3ZW7A 3ES9A 3TR0A 4GMFA 5FAXA 5KVCA 1YF3A 3EMBA 3K1ZA 1EFUA 3ABIA 3HC7A 4BPRA 1IQRA 4YDRA 3A9UA 1U9ZA 3GJ5A 3QBDA 4QRDA 4OK6A 4K9KA 1D0SA 4TTJA 3SKXA 4TSRA 4YJ2F 4BN0A 1LZLA 1ZM3A 3IHWA 1PL7A 1NMXA 1YK0A 2QNIA 1V37A 3S2FA 3KKNA 2RBEA 1F4LA 4HPJB 1CDEA 3DCYA 4M99A 2BISA 1K97A 4BIMA 1NVVQ 1RWOA 1UEXC 1RYMA 2QQEA 3GA0A 4ZVNA 3OZTA 5HIAA 2CV1A 1QNFA 1ISMA 3PWSA 1XMOB 3PTLA 4Y2JA 1KK3A 1YZLA 5LC1A 2PUGA 2DFPA 2GX6A 2YMLA 3FFTA 5CLIA 1N9GB 1TYBE 3DFFA 5B53A 5JPIA 1DRVA 4OJNA 1YT5A 3OQOA 3NP9A 1C3EA 1SUIA 3D6AA 2R7MA 3T4EA 5JAUA 3LBAA 5IAOA 3GZTB 2F1KA 2QE7A 1SURA 2R6GA 1EWYA 2BGKA 4ITUA 2D2EA 5JTTA 5IKEA 4YT4A 3QWFA 3PFHA 3PE6A 2DY0A 4MW0A 5EUCA 2A59A 1WXXA 4ZOBA 4FFWA 2BFDB 3TF5A 3HYNA 5D7NA 1H2XA 2DPLA 4IIVA 3UKDA 3RV3A 2AH5A 3AIIA 5HIKA 5KNDH 1PX0A 2K2WA 4CQMB 2IVFA 4IGIA 2AZDA 3MJFA 3EGVA 4HWOA 4MPJA 1J20A 4DADA 3RFUA 2OORA 4EHIA 2DPYA 3AV0B 4E12A 5A3QA 3U7EB 1PSZA 1V1JA 1CQJB 2EKPA 1ZDMA 2WVHA 2C9ZA 2Z3ZA 3LOPA 3LZCA 4MV7A 1K08A 2C5HA 2TYSB 5MHTA 3U4QB 3W3AA 4DZRA 1V2GA 3ECCA 4YCCA 1YRAA 2FUNB 4WUVA 1C3VA 5JTUA 2FP4B 6ADHA 4I1IA 1UIRA 5CTJA 4NOMA 2Q6VA 2ZJ7A 1JKMA 3LHKA 5AK6A 4PCUA 1Z6AA 5H0IA 3RRMA 4AUEA 2YN4A 3S2YA 2J0SA 3MWJA 3AIKA 5SZKB 3PHLA 3QY0A 2ECKA 4ZN6A 1XV5A 1N5JA 2BKEA 4K2HA 2O54A 3WNZA 2VHVA 2E82A 3WG9A 3BDIA 2OCKA 4DSNA 1FTNA 5ANRB 2NIPA 3D4LA 1MB4A 2GVDC 4GLBA 4TT8A 5JWRA 2O2CA 2WYUA 4LXTA 4PHFA 3FR8A 2ZYRA 1PF7E 4HD8A 3EFOB 5JISA 5EIFA 4BMNA 3ETJA 3G0OA 4RYDA 4K26A 1DQSA 2Z1NA 2PZMA 2JLAA 1ISFA 1IBMB 3BZWA 4AJEA 2AUNA 1ZJWA 3HL0A 3ZHCA 1EBBA 2PQMA 1FDTA 1QVVA 3HR8A 4TWRA 5IUJC 3JY6A 4X6XA 1YB1A 3LFHA 4MMZB 3ND6A 3SVTA 2EW2A 4NTZA 3DWEX 3WQSB 4MLZA 4YRJA 4HDQB 2RAVA 1IJFA 1UC8A 1X74A 1Y9EA 4XIIA 5JEDA 3K35A 3E5MA 2P35A 1LSUA 3V97A 3HA2A 3UGJA 3BMQA 1WZIA 3PJGA 5T4HA 4WZZA 3DLTA 1U9YA 3BTVA 3GNLA 4Q4AA 3QFFA 3TRDA 1RJGA 1VMKA 1MB0A 1SBNE 2AVDA 1QTIA 3N1UA 4RL4A 1NY6A 5KQSA 1Z22A 3C87A 4IIDA 1FU4A 1XRPA 4IFTA 2A33A 4MOWA 4XWYA 2ZIWB 5HRAA 3RAEC 3TZCA 3CU5A 2WR8A 4ER7A 1G6KA 1W8DA 4NU5A 4GP7A 3E8SA 2VZ8A 2I3BA 2NADA 4B40A 4DJ5X 2PZJA 5DHQA 5B36A 2W4MA 2GBLC 4NG5A 3LPCA 4KMRA 1OWPA 1PEDA 1MJGA 4QYSA 5LR6A 1OT3A 2FSIA 1RHUA 2WMNB 4RTPA 2WU1A 3Q8XB 3CZAA 1Q21A 3DHVA 4HDKB 2P9QA 3STHA 1CFJA 2Q5JA 4B31A 3K09A 2WTMA 1OROA 1V2HE 3G2JA 1ZM2A 3PD0A 2G1JA 4DR7B 4OFWA 2BGIA 3HLKA 4MR9B 4HZIA 1HKUA 3WX0A 1UADA 5DN6A 1CE8B 2ORWA 1SXGA 4FZ3A 5AKKA 3EVNA 3VHLB 4KRYA 3T8YA 1X19A 1W47A 3LIPA 5J40A 3QLUA 5F5NA 1Z0UA 3NAZA 2L18A 3QQPA 1QU3A 1DC4A 3D1VA 5BN5B 3FB4A 2XNKA 3OX3A 1VG0B 3D2CA 1I80A 3P9KA 5B7NA 1FZTA 4GL4A 3KQPA 1O89A 1UPTA 2CK3A 2R8YA 4B45A 4CLXA 3AJEA 3WZLA 2W6NA 1LU9A 2HADA 3KFLA 3WOHA 3OCZA 4P81A 4BFVA 1HI9A 1ZC3A 1GAEO 3FNEA 2O5RA 4P2GA 2B0CA 5MN4A 1O87A 3B60A 2J3KA 2KLHA 2QVLA 3LC2O 4U7TB 3UK6A 4YYEA 2GPTA 1BFDA 3I9V6 3UCEA 3UAZA 2XRYA 1E2BA 4ZVRA 1E4VA 2F9LA 1NI3A 2WVAA 3QUTA 4FE7A 5JNSA 3EOBI 4JI2B 1UKEA 4R8LA 4IZIA 2VYVD 3B85A 5F5XA 3MQFA 1C30A 1NW9B 4M0UA 5E8RA 1FSSA 3PPXA 5ALNA 1R0RE 1ZRSA 4JJIA 3VR4H 2PL3A 1GHTA 1GAXA 3R3SA 4EB6A 1T36A 2J67A 1VBFA 4FEAA 4W8GA 5DTMA 2W4QA 4ZHQB 5KHOC 1RR6A 2WJAA 5EQFA 3PVZA 5L3ZA 2GM4A 4J4HA 1XX6A 4BRWA 3IRUA 2O48X 1EXWA 2PH5A 4UTXA 3D5QA 4Z4FA 3RYIA 3T5MA 4YDSA 2EIHA 2HKIA 1EVLA 1FMTA 4F6RA 4Z7NB 5A4MS 3HVKA 4OQXA 1GKKA 3AR7A 3MBOA 3MUNA 1M2VB 1HPLA 2PL1A 1KOFA 4HDCA 4TSKA 2VDQB 3HWRA 5D85A 1A3CA 3VU9A 5CNIA 1WNFA 4D4JA 5I5EA 4LF7B 1DKRA 3VYRB 1GPWB 3CC8A 3OIDA 4YQEA 5J5AA 1WZCA 2PO7A 4DA0A 5DTJA 4H7FA 3ADPA 1XO1A 3NCHA 1PYOA 4UBKA 1J22A 3KQOA 2WWRA 1PHPA 1XTSA 2FFAA 4XOUA 4LZZA 4RFVA 3DTTA 2M9MA 3L7LA 1OFUA 5DIFA 3T38A 3N7TA 3UPUA 1B6GA 1XLTC 4DR2B 1H2WA 2FZ4A 1ZVJA 2VRBA 2UUBB 1GR0A 3GEMA 4IRUB 5JH7F 4G0PA 1MC4A 1N0IA 2L0XA 3OM1A 1XZJA 3AVQA 3C7TA 4DNXA 1EPUA 1SQSA 3ZE0B 1ZM9A 1XAGA 4QQRA 1O8BA 4B6EA 4CR7A 1QRRA 3DAFA 3OQMA 1OXVA 5AESA 2ZBFA 1RP1A 2IYEA 4I6JA 1DUVG 2WJ6A 3X43A 5JSFA 3DBRB 2PEYA 3H17A 1RWXA 3TMAA 2Y6VA 5FEUA 2QHXA 3H5VA 4B76A 1VJ1A 3FDZA 2FQQA 3MJRA 5JS8A 4J07A 2JF0A 2OXFA 1DRUA 1QO9A 2OR3A 3SFVA 3TNDA 2LPMA 2FY8A 2COKA 1Z29A 4RGYA 3WBKA 4BFYA 3GLGB 2A0WA 1AZTA 1VKZA 1RC8A 1GKIA 2XD9A 2QDXA 3ZDRA 2PL9A 1CK4A 1RJFA 4FEEA 5AXBA 2AX4A 4E09A 5JMWA 1P39A 2O0JA 2RKOA 2LIPA 1IM8A 2C03A 2HXYA 2PX0A 4K9NA 2WVJA 3R0VA 1E20A 4E2ZA 5G0SA 2ZS9A 3LU1A 3JQ7B 4P0QB 3TIFA 3OZWA 2FLKA 4E5YA 4UCFA 4FCVA 4IQ4A 1GCAA 1Z6QA 1PJRA 1Z4LA 5JPDA 4RZUA 1WLSA 2HJ9A 4ZU1X 1V8DA 3WNQA 4A6DA 3ZGOA 4GPBA 2EZUA 1NN5A 3KL4A 1OLSB 3LHFA 3W9SA 3K70D 5JAQA 2H4HA 3PDWA 4CRWB 1ATIA 2WYVA 3CNLA 2QAJA 1Z4QA 1CUAA 1N7JA 4KDRA 3HCCA 1YJ5A 2C7GA 2A0KA 4ZXPA 3F74A 2OXIA 2HDOA 4JVNA 5CDSA 4PYIA 4J76A 2GCGA 1DAHA 1HG1A 2G08A 3ZZNA 4C4TA 4OXYA 4FIZA 5ELMA 4TLMB 3RREA 1VSBA 2JGDB 4KVZA 4RADA 5LP1A 1NXQA 2H2AA 1D6SA 3K05A 1ULZA 3OI7A 3W6NA 2JLWA 4IJQA 3L0ZA 3HJCA 521PA 1STOA 4N7BA 1J1UA 1C41A 3HVUA 5CNKA 3A6HA 1SFRA 5F7ZA 1EM8B 2CLOB 2RGGA 3AI3A 3MWDB 2DWPA 1JTEA 2OG2A 1AF4A 3IEKA 3Q3IA 3SJBA 2E4VA 2JATA 3WA7A 5IT0A 5C52B 4PN3A 1G7CA 2PR7A 1WP9A 3P32A 5JRDS 2BDUA 3FFXA 3QIAA 4WCFC 3ID6C 2CNBA 2Z8YA 4XX1A 1G41A 3UV7A 3FWPA 4GBED 1L4EA 3FLAA 4V0OA 2Y1EA 3RVJA 1UBLS 1WUYA 2BUBA 5BT9A 2VOJA 3F3MA 1O0CA 4Q1EA 3ZDCA 1EBUA 2GF2A 5ALXA 4ZCRA 3GP5A 4QGHA 2OILA 3R7LA 2A8YA 4MQ4A 3JQGB 3ZK8A 1UC4B 1E8MA 3JQAB 1O8CA 3ZE2B 4EJSA 1RU3A 4OXQA 1KJQA 2WWTA 2FE4A 1DE0A 2NZXA 3BBLA 4FINA 3DV2A 3IP1A 4MUNA 3ZIUA 2CHQA 4UUPA 5CLHA 3E7WA 3ML1A 3ICWA 2SCUB 3Q41A 1CB7A 4WBNB 3DXYA 3PPIA 4DIFA 3T5AA 2XZDA 4PZLA 4PBTA 4OI1A 3T7JA 4J6EA 4X97A 1OPRA 3WQBA 1L1QA 4DRXB 1DPFA 3WLEA 3PZRA 2ID7A 4GSLA 1N9ZA 5HUJA 1T4MA 2P9EA 4FZJA 1BE8A 4ZEVA 4FQ5A 5KSZA 4RVSA 2W90A 4DCVA 2Q4DA 3P4YA 3W5AA 3AUYA 2OQ2A 1H2EA 2EHJA 2PZAA 4G8CA 4GC9A 3T34A 2W4IA 3KP1A 3T9AA 4E2FA 4W1QA 1ZNQO 5ISMA 5SYNA 4RD4A 3L7MA 4CF5A 3FE2A 1TCUA 3JWJA 1E4OA 4UVHA 4CFSA 4EHBA 3NRBA 3RC2A 2JIZA 1PJTA 2WWXA 1Z4IA 4AF6A 1PEYA 1K7YA 2MJLA 1E92A 4HEJA 5TR9A 4JHLA 3TB6A 2JJ8A 3IAHA 1R9MA 3H0CA 3R3VA 3UAOA 1E32A 2K6GA 2WP8J 4WSOA 4M7RA 3SC2B 3KXPA 3F1LA 2JI7A 1VJTA 2YVKA 1YS7A 1BXGA 3BGWA 4HDNA 4U0JA 5KNLA 4XSHA 1E1NA 3ZLJA 1KYWA 3WYBA 4CODB 3ZVRA 4U2EA 2V55B 3ONWA 5LM3A 1CFZA 2Q5LA 1Y42X 4RVFA 5BSVA 2D2IA 3NEJA 1QTQA 5T8KA 1MOPA 1OLXB 2Q3EA 4PC7A 3K9NA 2AE1A 1PR1A 2HM7A 1Z68A 3JQ8A 4B6SA 5GZ3A 1BGVA 1Y1KE 3T61A 1OIXA 3KM0A 3O4JA 1YUMA 3AUKA 4UM8B 4BNHA 2CV0A 1PQWA 2CHVA 4KNVA 3EXG2 2AZMA 4TYMA 3E1KA 4ZCTA 2QSJA 1O97C 1IVNA 2V59A 4HWPA 5DNWA 4C2TA 2CNWA 4FS8A 1JQLB 4A1FA 2E4AA 4XX0A 3I37X 3L7BA 4UFOA 1Y5IA 1JLHA 3LYUA 2WY2D 4FM9A 1CEQA 1RC1A 3E2MA 4CVNA 2J9GA 3MWYW 4HLUC 5JQGF 3KETA 1A9PA 3EDCA 2GEDA 2UVQA 4L8LA 3MB5A 3P9CA 4I1YA 2ZM6B 1ZMXA 2ATCA 2BUCA 2BKAA 2RGNC 2XA2A 2EW1A 3QSGA 4YT2A 2RB4A 1DXYA 4Q9HA 2KJQA 4J90A 2GJ8A 4D0NA 2ZRDA 1GR1A 5JXIA 4N8DA 1NVKA 4NBWA 4OOEA 4R0VA 1J1IA 2VF5X 3SSMA 3T4UA 5JAPA 1N8SA 1A0OA 2BGTA 3NB0A 4EKNB 1MNQA 5JSHA 5A62A 4OH1A 4C4ZA 1TU4A 2QTNA 4E6EA 1M6VA 1SBQA 1I30A 2PSFA 3DV9A 4B9EA 3FZNA 4I8DA 2J5RA 3EZ6A 3NOXA 1AHPA 4O25A 2LD4A 2JIMA 4MI1A 4WFQA 3UWPA 3WV5A 1LV8A 2R9VA 2QLNA 4JYPA 4WXEA 3TR5A 4F45A 4AMVA 5HA5A 1PFUA 2XCQA 3DDNA 4DMCA 2WJJA 2ZS7A 4RLHA 3LDUA 3RJ5A 1OREA 1T2CA 1GRNA 1S7GA 3KLBA 4WNCA 2CNKA 1FUEA 3NASA 3PLRA 4JIGA 1VA4A 3B6EA 3VAAA 4V39A 4F96A 4OFXA 2FSFA 1E4EA 3IVCA 3HTXA 3MCWA 2Q3CA 1MB9A 4IFBA 1HNXB 2C1EA 5DYGA 2C9YA 2IEZA 3JALB 2XWSA 3MJEA 1EYZA 2PEZA 2X8JB 5F2NA 1A9XA 3D8BA 5AKYA 3EUEA 2JW5A 3E15A 1XDZA 4FS3A 1CVIA 4BNMA 1Z5WA 2ZROA 3OT4A 4IP0A 4KFRA 5ESWA 3EXG1 2J3QA 3P26A 1QS0B 4HRXA 1AIPA 2WG1A 4PR0A 5F78A 3HM9A 3OZVA 1TRHA 1N75A 4JFAA 5B3LA 3QWBA 5SZIA 1U63A 1T8PA 2JFYA 3A3OA 4UAUA 2CLLB 2CUTA 4ZVVA 4DLVA 5K0NA 2CJPA 3GH3A 2GEUA 3TCXB 3NHPA 4LHWA 1QHEA 4Q4LA 4RD3A 4B4OA 1YZFA 4HOYA 3RK1A 2YW9A 3GLSA 5JS6A 2PX8A 3A4VA 3WFZA 2R6HA 2BKUA 2I34A 3DXXA 1P4AA 3HRIA 2ZYSA 2ZAIA 3GFTA 4CMHA 4XH9B 1XJQA 2AOTA 4HB4A 4O4IB 1BRTA 3UJPA 4OA5A 1XKLA 5JNLA 1TM1E 1VB5A 3NV9A 1JF8A 4NYMQ 1K86A 1FDRA 1KDRA 2CXNA 3NPAA 1H0KA 1LTHR 2B3TA 4CGZA 2QRMA 3AY3A 5F4BA 5AI0A 5DI3B 5LXTB 1K9SA 1H22A 1X13A 3HU1A 4NICA 3WB2A 2PO5A 3FF4A 2A30A 4LYHA 3ESXA 3IOMA 1ZK2A 1UC9A 2VWHA 2WFLB 5J59A 4RIFA 4W9NA 2QUZA 4YMLA 2P4QA 3ZGLA 2IH2A 2GBIA 1GPJA 2WAMA 4ALIA 4ENQA 5HF5A 2Q2VA 4MEJA 1MX1A 1EDZA 3CGWA 3OFVA 2W6JD 4CL0A 4H1WA 5HKAA 1QCDA 2SKEA 2HBZA 2YY6A 2OVFA 3CH5A 3L7KA 2FWNA 4H6PA 3PLNA 3TD6A 3FMVA 4G1UC 4WZAE 3BL8A 4UPDA 2XA1A 4C6TB 1I94B 1V9LA 3WNVA 2I54A 4I3FA 1U7DA 2YZ7A 2J1LA 3AKCA 3W77A 2O07A 2J0QA 2B34A 3A4MA 3FVRA 3EPJA 2CGEA 2GLTA 1PR2A 1T8SA 4DMRA 5HSGA 4GQAA 3GY0A 3PYMA 4HBZA 2ZQYA 3TZHA 1P2VA 1MAVA 2Q6OA 3PHIA 5KNBA 1R6VA 4Z0HO 2YDXA 3BWXA 3AKYA 1CJCA 1FK8A 1QAQA 2ORVA 2QRNA 4LWQA 4NESA 4Z9FA 2GPJA 4Y9UA 3ZU6A 5A2QA 3SLRA 3U80A 2HFJA 5HBGA 4JSRA 4BMOB 2VDVE 4BATA 4CL3A 3E9QA 3G85A 4A0QA 4V0NA 1RIFA 3U7IA 1TO1E 3V1MA 4AO6A 4V0MA 1YR9A 1L5NA 3QU4A 4Z1MD 5IYZA 2VAPA 4XDZA 2QP4A 2NU6B 5AR1A 4L5IA 3IAFA 5AW7A 2O6LA 5AJZA 4DLKA 2QRZA 4A8TA 2Q1YA 5AUOB 4N54A 1AKMA 3IDFA 3PXCX 1E6KA 2CSUA 2VH5R 4JP1A 1ZL2A 4UXJA 4W4TA 1Y6QA 2JIBA 3EUWA 3RJZA 1B74A 3VGPA 1KERA 2QVCA 3UVEA 1MJ5A 4Z9BA 4BZPA 4ZT2A 3WYDA 3BH6A 1K4YA 3WLQA 4L6CA 4E5MA 1IRIA 5AVZA 3ROFA 2PX4A 1C1DA 4Y2RA 5ITWA 2HNAA 3O8DA 4NNJA 4BO6A 4DV0B 3LKZA 2P3SA 1BXRB 1G6OA 3FGPA 4BHTA 1PSWA 3SS9X 1W9MA 3NETA 5TDHA 3SEAA 4ASUD 5K0ZA 4RULA 3L7OA 5E2BA 2VDUE 4YRGA 5KWJA 4JH0A 2GPNA 5BN3B 1N6HA 5JHGB 3KQSA 2JBAB 1PYDA 1QDLB 5KSWB 4HG2A 3JVEA 4TLCA 3CCCA 1OMOA 1W49A 4FNAA 1EGQA 1EINA 1CDDA 4NCJA 2Q3LA 2GD0A 4ZOLB 1CIPA 3ZLUA 1YWGO 5AW8A 3JVIA 2VTDA 3A6GA 5FV4A 2W58A 1NHWA 2Q4EA 2FPIA 2OO5C 4QAQA 6LDHA 3LK6A 2V6MA 1RWMA 1T2NA 5GIPE 3S40A 2IDKA 2ZAGA 1RM3A 5C32A 1Z17A 3OOHA 3KQTA 4PC6A 2PNJA 4OAPA 3AFMA 1QZUA 2I33A 5CMLA 2OM2A 4IIJB 5LYYA 5LYJF 2JLQA 2WG2A 3O3MB 1BKSB 2C5GA 4IKPA 3ASZA 7MHTA 1RDFA 2PKQP 3FYHA 3NATA 1T5BA 2VSNA 3HKCA 4DIDA 4AZWA 1MPTA 1SG6A 4LRQA 4PWZA 4IXWA 1Z3IX 5J3JA 3TLXA 3T7KA 1AQLA 2ZBRA 2ZVQX 1TVKB 4FFBA 1PWHA 4LZWA 3ACDA 4KK3A 5CXSA 2ZSEA 5KYXB 3W06A 3A6JA 3L7JA 3RT1A 4B48A 1P1JA 4PC3A 3K0BA 2XXJA 2UUCB 4ARCA 4TXMA 1A1VA 3FBWA 3OLQA 2IP4A 2WP0A 4OQZA 2QU8A 4MRVA 1JR3D 3QXHA 4PU0A 1FTSA 2C7VA 2VT2A 3VC2A 4GI2A 1ZINA 3SQWA 1FMCA 3MSCA 1GN9A 2O19A 2ZBVA 3A28A 4CKCB 2DR0A 2ZBPA 4RLQA 3LECA 2XE6A 1VJRA 1TVCA 5DHUA 4XVRA 1YSCA 3ZTTA 2G82A 1P45A 5JD6A 3SJAA 4V0QA 1SR8A 3DTYA 3F6YA 4LC1A 2XB9A 1M7GA 3IQIX 3B3QA 3S8MA 3ZI7A 4QHTA 3I32A 3RIHA 4HFJA 2WTUA 3ZWKA 1DTWB 1UPUA 3PKIA 1BKDR 3E70C 4FU0A 4OP3A 5J58A 2DTDA 2J7PA 1ZQ1A 1VL0A 1ACMA 3T06B 4IIHA 3ZHVA 2HMSA 1F9EA 2QLFA 4G1VA 1RI3A 4TSFD 1HYGA 3G6WA 3P1JA 1JVSA 2CVPA 3FTQA 2OUKA 3TLGA 1RLMA 4FN4A 3REGA 3WGIA 1WTAA 4HQOA 3RS0A 2YICA 1TEZA 3MTGA 3HBNA 2EQ5A 1EUZA 3ONEA 3UFXB 2H1OA 1G21E 1SQ5A 1ZXXA 4BWYA 3VBCA 4B5LA 4Q21A 3AEQB 5DISB 5CU7A 2NYUA 1LW7A 3KR1A 3ZBUA 5E4TA 4WCFB 4OGFA 2X22A 1M8JA 3KJHA 3BIJA 2OL4A 1AK2A 1K8ZB 3QQ5A 4JT9A 5DULA 1X1SA 1GU1A 1KZ1A 1RACA 1RD4A 2ZQ5A 2H3HA 3EF3A 5EN4A 3O8QB 2FSHA 4J49A 5K5EA 3KSMA 2W2QA 3ZHQA 3V8VA 2UYOA 4BN5A 3WL8A 3U7QB 5BXQC 1YKGA 3O9ZA 3TPZA 1R8QA 4IHJF 4DWWA 2AJTA 1Q0TA 5JJBA 3QE2A 2PT5A 1XTUA 3DTVD 3L0IB 4MWSA 3A14A 5J2UF 2YYYA 2XWQA 1I32A 3TUIC 3RLIA 1DJLA 4K03A 2C4KA 3C5EA 1Q1AA 3OM0A 4YJHB 5DKFA 1BN7A 3QBTA 1FY2A 3WO1A 4MVJM 4BS9A 4CM8B 1RBQA 1HNWB 1MG0A 3T7IA 4C30A 2IX3A 5CLFA 8MHTA 3RRXA 2JJ2D 4LRUA 1E2GA 4CU2A 1XNJA 5LQMA 3A9SA 1YA4A 1ZEJA 2V65A 1V11B 3AXSA 4KTVE 5G0UA 3GQBB 4EITA 4YMTA 1YVDA 2Q6LA 5LDHA 1LBIA 2GZ1A 3DCIA 4IO1A 3PVSA 4UM9B 2WW8A 3NJRA 3GEBA 2BTEA 5IKOA 3FRIA 1N2SA 2QW0X 3QKSB 5TIIA 3K4HA 4BN4A 4PG5A 1KK2A 3DFUA 1TFUA 3IB3A 3RGWS 1PJ3A 1NIJA 2QD2A 1S96A 5JROA 4IGFA 3OURA 1TUBB 1EK2A 5AW9A 5EOVA 3KZXA 2H17A 5A5GA 2Q8NA 2WD7B 5ICFA 3TGPA 3B6ZA 3VA7A 4MWOA 1U65A 2BFDA 4KH1A 3V4SA 1F8UA 1Q7RA 4R1UA 2I65A 3AQIA 5EMHA 3IP5A 4Q4HA 5AOCA 2PGXA 3GP3A 4XXHA 2AZTA 5JPCA 4OV6B 1OFHA 2ZYHA 4URFA 4ER5A 2QUAA 2JFPA 1CR2A 3G2IA 1DJOA 1MGOA 4KFSA 2FPOA 4UUOA 3F0TA 4WXPA 5AXCA 5K2OA 3EQ7A 3P9PA 3QFHA 3HVRA 1N5OX 3AZPA 4RU1A 4UNPA 1D09A 1XC7A 1MFPA 1R4MA 2YN0A 1JQDA 3C8ZA 1B6SA 1CZRA 3H05A 3TGWA 1UBJS 1Z08A 1LLQA 1WCXA 2PUWA 3NHWA 4UTNA 2F3QA 3LFTA 3QG5A 2N75A 5TMPA 3E9NA 5IDWA 3GLIE 2FP4A 4UZFA 5IM5A 4ZIRA 1PTJC 3PJRA 3RVBA 1OYWA 2XB4A 1CR1A 2ZDHA 3S2GA 1D9XA 4R7TA 4RV4A 5H3CA 2BTQA 2NSYA 1MT0A 1H3NA 2IEGA 4DR6B 2WTEA 3NHKA 1R5JA 1Y1TA 5CVTA 1VFPA 4MQ6A 3FDJA 3CGGA 3HRHA 1SVWA 4WCDA 4PIPA 3MAGA 4FMCB 4UCQA 3UT0A 3EFOA 6PFKA 1RIIA 4JI7B 3OZCA 2RG7A 3O75A 1KDYA 1KR2A 1ZD9A 4LBVA 5KAMA 3RSZA 4YUYA 3CW8X 2WZBA 4CV2A 2H48A 4YP7A 4BKQA 2D06A 3FLBA 1Z2PX 3E05A 3RBXA 4KJZA 5IH3A 3TQRA 3I6YA 3GGJA 1GZUA 2H1RA 1HWYA 4OQNA 1Z82A 3FWYA 1DBIA 1VJ5A 3TDMA 2XRMA 2QTWB 3GJSA 3HMQA 4GXNA 4BFUA 4CUZA 2M6KA 3UHPA 1NRJB 2EGGA 2IHBA 3SGLA 2O0HA 2YKGA 3GF4A 1MXFA 2HGSA 2I4MA 4M4SA 1ZW1A 3C6BA 1IVYA 2JCSA 5IFKA 1HYHA 1J2JA 3L6RA 5CVDA 2NSHA 3CVXA 4F5DA 1B8NA 5C53B 4RTOA 2GO7A 4INPA 1N2XA 2QTBA 3DDHA 3Q7SA 4YP9A 4RGVA 3F9RA 3EXFA 4A23A 5JXWA 3KZNA 4MB6A 4LISA 4XJVA 3JX9A 2I1VB 2CWDA 2QTRA 1E1DA 3IESA 4YWJA 3SDBA 5J1SB 3ZGZA 1HQDA 2OSBA 2NVUA 2ZWMA 2YHIB 2VHYA 1ADFA 1IHXA 1PW5A 3OE4A 4L50A 4RD1A 4RY9A 4WERA 5K4AA 3M4JA 1B42A 4N8EA 4PHHA 2PGJA 1YB5A 1SOMA 2CJXA 3BEDA 3F7TA 5TS2A 3T95A 4KQHA 5FLEX 4AYTA 4AJNA 2EFEB 5A7HA 2CF5A 3VKUA 4FW8A 1UBTS 1V16A 4LKOA 2HA4A 1XOIA 2RJNA 2IZ0A 3AVYA 4TVOA 4Z7JA 4FFRA 1QFSA 3CONA 3OU2A 3P9ZA 3WRXA 1BMQA 1Y9AA 2P4EA 4M0EA 5HK8A 5IU6A 1TJPB 4IX9A 4C87A 1O6FA 1M66A 2YXDA 4GAEA 4QYXA 1Z6GA 2H1HA 1L7DA 4JKOA 4TKMA 1NBEA 3D54D 3RF7A 2O3QA 4QREA 2IEDA 4V0KA 4LHSA 1ES9A 4MR9A 4RHXA 1U5AA 4YREA 3R6DA 4COOA 5KKAA 3I4FA 2GN2A 2XY4A 4LJYA 4FR5A 1FFXB 2JD1A 1P5ZB 3N5KA 1UAYA 2VJMB 4U7WA 5AOVA 1LPNA 5BN5A 3L1VA 1BJTA 5CD1A 4N6OA 1R5NA 2NPFA 4M8SA 3GVPA 4QQ8A 3VHXA 1P8JA 4JLOA 4P4GA 3AYZB 4C4PA 1BZYA 3WKEA 3CRW1 2OK8A 1X80B 4B4VA 1FP7A 3TRKA 1A77A 1QIMA 3I8SA 3RVDA 3SHFA 4C7VA 4DCMA 4UDOA 1NTRA 1JI3A 1WIWA 4MS1A 1J49A 2SKCA 1HE1C 3DV0B 4KYUA 4TMKA 1IZ7A 3ELWA 4NC9A 5EGNA 5CP8A 4I1SA 1KK0A 3G49A 4B6JA 1C2YA 1ZLXA 4LC0A 4JUAA 1UP6A 1Z5UA 3DXZA 1WSBA 2UU9B 1SQGA 4MKIA 3HWSA 3VOTA 5IVPA 4TN1A 3RFTA 5FA5A 1EHCA 4U8HA 2HA2A 5AM2A 1VL1A 5JFOA 2G67A 1C9JA 1S3FA 1I2DA 4BFWA 2KW5A 4HCJA 1TYAE 4HDMB 4OHKA 1TQ4A 2EKDA 4CM6A 1I2ZA 2Z2KA 3B5IA 5EJIA 2H52A 4WCVA 4X7BA 3AF3A 5KCZA 1SULA 2IL1A 1DAEA 1DEOA 1F60A 1QFMA 4RD0A 3TS1A 5M2QA 4O2AA 4HB3A 3UWDA 2OHGA 3O4IA 3LCJA 4DR4B 5ICMA 1IHUA 1JHVA 4Z3DA 2JRCA 2Q07A 1KAHA 2EJBA 2O4UX 5FR2A 4BX0A 4N7JA 3ISTA 1MW8X 1Z45A 3LA6A 3LYAA 1P9WA 3EZ2A 1U02A 5F4ZA 1L4YA 4LZLA 2WKRA 4DHWA 1QOPB 3F8SA 1IY9A 1WRBA 4MH0R 2V98A 3JD0A 1DJMA 4TOIA 4Q00A 1NLYA 1PVOA 5K9ZA 2BMDA 4Q4JB 1XAIA 2X3UA 4N76A 2C0CA 1QJCA 4JBHA 4M60A 1N77A 2EP5A 4XWAA 4AKEA 1U4OA 3DC7A 4ROSA 5EL0A 5GGYA 3TZEA 3IOYA 4J9VA 2CYCA 2H51A 1R9JA 2PKQO 2QL5A 4B3SB 3UXEA 4RK5A 1OLUA 4KWHA 4PYQA 1W36D 3O4RA 3W8DA 1WL8A 5J47A 3FRJA 4YCMA 4UBLA 3ISJA 1ND6A 4FIDA 3OQVA 4QUBA 2HLNA 3A1TA 4R8MA 4U9IS 4Q24A 1IN8A 1FFSA 3A1FA 4FSHA 5GJCA 5IDXA 4YRRA 1FXWA 1KBQA 1LRJA 1VJCA 2VJAA 3A06A 3H18A 3DP7A 4G8DA 5FNZA 1PS9A 5FR1A 3IAAA 2IEBA 4HAZA 2Y3IA 4XAQA 4E2XA 4CEJB 2HN9A 1N8NA 4NZPA 1W0KD 4QWMA 5JZMA 4I4CA 3ZD7A 2C1XA 4DUGA 3OU7A 3GDFA 1BFUA 1TO2E 4X62B 2QTLA 2VRWA 5G02A 3ZWWA 2VTVA 4Y98A 3CW2A 4GUAA 1G1MA 4CWAA 3TPCA 3FVWA 4H16A 1RYHA 3JQ7A 3Q0IA 1U0GA 3DUFB 4PRYA 3WYEA 4GOXA 1JPVA 1D04A 1K6IA 1E7SA 2WBLC 2FQ1A 3BSWA 2O1XA 4RZSA 5D5PA 4F2HA 3RNOA 5EJ7A 2LW7A 5M3BA 2B4QA 1AN0A 2JFWA 3LT0A 4RQAA 2Z58A 5A9SB 4K88A 2FPUA 1AO3A 4G0WA 2CN1A 4D3SA 5DK6A 5G4LA 5CFMA 3JAMA 3FG9A 3WYFA 4HXYA 4Y18A 4YMSA 1M2WA 4L8VA 3E5RA 1Z7EA 1AGXA 4G9EA 5DWQA 4FGZA 3CZQA 2G04A 3HB9A 3P0JA 5AVRA 1ILWA 4GI3A 2RDMA 1X8XA 1UWCA 1YDMA 4N7RA 5EYPA 4N41A 3HCNA 4B4WA 3WWZA 4EO4A 2XBLA 5HP4A 1X7DA 3Q9LA 1JECA 2O3UA 2WZCA 1T13A 4M7OA 5D1NA 2GTPA 2IHNA 3PBKA 3AMVA 4S1NA 1OXUA 1Z3CA 2LDBA 3KKPA 3U4HA 5IJ9B 2B36A 2R6JA 2OV6A 1QYCA 2JVIA 3N2GA 3NUZA 4KQ2A 4B0OA 3NIWA 1MW9X 2Y1DA 4K9RA 4XIGS 4Z9YA 2FRVA 3UMCA 2A86A 4FLEA 1R16A 4G6ZA 3AETB 1TF5A 2AN4A 3PC3A 5HKOA 5HRCA 2X0RA 1NYRA 4LNUB 1YQ9A 3TLCA 4C4YA 4CG3A 1AQ6A 2O06A 2R1ZA 1Z5PA 4MRMB 5A4JA 2HHLA 4PO3X 2PR2A 4HDRA 4E5SA 2Z4TA 4D4KA 2JAQA 2FN3A 4TS3A 2A9OA 5DNVA 1PFGA 4GOOD 4U3JA 1HO3A 4CLRB 3TL6A 5J4LA 2PFSA 4DVJA 1EAMA 3WGMA 1PL0A 5C1BA 1F48A 4LXXA 3DT9A 3T5BA 5ADUS 1UL1X 2A5LA 2Y0EA 3QX7A 3JQGA 3INGA 4FMDF 4CEJA 3I72A 4M55A 3MT7A 5AYVA 2VZEA 2F1HA 1DL5A 2A4KA 1PT5A 4TVBA 1PT8A 4GVPA 5T7BA 2E6UX 2FEXA 3NUGA 4JI0B 3N0XA 3D6NB 3W9BA 4X54A 2PQ2A 1H66A 1GG2A 3OAAA 3KLPX 5A0FA 3SOZA 3G9UA 3EXEB 3GAZA 3LBNA 4BWVA 5JCJD 5LOVB 1Y48E 3CJQA 3AESA 3O4GA 4FOSA 4WJZA 1D2AA 4JC5A 3ER6A 2NU8B 4NZYA 1NQWA 1KJJA 3T12A 1F0PA 1HFEL 4Z0NA 1VGRA 2FWPA 5FKJA 1J8QA 3TIIA 5M7EA 2ZLBA 1AKUA 2X6TA 5LQNA 4Y2PA 2PGDA 3MRVA 4NL4H 4XPIA 3K8QA 3UG7A 1XRMA 1OIWA 1FFCA 4BP3A 3OC0A 4B1FA 2FMXA 3C7KA 3KUUA 1C2TA 3UHAA 1P2TA 1GUFA 2EATA 1AVTA 4ZV9A 4K6MA 3USZA 5HQ3A 4Y6PA 3HXKA 3GH1A 5E7QA 4C05A 5IARA 3KOZA 1HDOA 1Z2OX 3NTOA 1ZVVA 4BZXA 1BYIA 4EPTA 1K89A 4NFHA 5H3HA 3AUXA 1GL3A 1XROA 1YS9A 3KSDO 5U4QA 1FSFA 2XTZA 3FYSA 3EVFA 2E49A 2G6TA 2WT9A 4PQRA 1J23A 3NBAA 3V1TC 3VNUA 5LUAA 13PKA 3HCEA 2DFNA 2DETA 1MOQA 1I2BA 1G5RA 1CUGA 2RAUA 2PUHA 2QGFA 3NFRA 1XA0A 3P97A 4BE9A 1FXSA 1PJCA 2NG1A 2R8PA 5CT9A 2FZVA 2BEUA 4WW0A 1K8QA 1ESMA 3BHNA 3CEHA 2JFBA 2I67A 5IX8A 1JPUA 3K5PA 1WO8A 2KI5A 2P9BA 4KAAA 3EA0A 3KKKA 3M82A 4CMJA 3UUGA 5GV8A 3PEYA 4QUEA 2XIQA 4OD0A 2VNAA 3EVTA 3IE2A 4GVLA 4YP1A 2GYYA 3THXB 1GYQA 2G06A 1RLJA 2B30A 5H02A 2BCJQ 2WJVA 2FZEA 4OMDA 1T3LA 3ROKA 4HO1X 1TLLA 1MO5A 3BYZA 3LUFA 3TVDA 2V0GA 1CHNA 2AE2A 3O74A 5ULLA 1U0HC 3K0SA 4UD6A 3IAM6 3DL2A 3KKMA 2OAGA 3HI4A 3HPQA 3TLBA 1NKTA 4FFSA 3UAYA 1VYTA 4RSHA 4V0LA 2VUTA 3MMSA 4GH5A 2R8EA 4O4JB 2PRYA 3PQEA 4MJ7A 4B7UA 4JBGA 1CG6A 2FR8A 1XKXA 2IXEA 3FAZA 3MK31 5EGSA 5TQJA 3C3WA 3NAMA 4ZZ0A 3TEFA 4OAOA 3A05A 4RA6A 3D59A 5HQJA 4ABYA 3G0GA 2DULA 4D6PA 5BV8A 2AFHE 1YQTA 3DL4A 3L8DA 1SUCA 4BBJA 3BF7A 4ZYTA 3DGFC 1NBHA 2LRHA 1O5OA 2GKSA 2Z8ZA 1T29A 3ET4A 1SKQA 2X7JA 4C0HA 4CIBA 3JU3A 3ZU2A 4CF4A 4A8JC 4B83A 4J3NA 5KU7A 1RQNA 5FIUA 4A10A 1JJ7A 1KVQA 4IVNA 1GTG1 1ULAA 2A5JA 1OOEA 3FCYA 4RLSA 1B8OA 4LMPA 1H2HA 1I8TA 2DZDA 3B3JA 3RIEA 1ZESA 4BLTA 5L95A 5KOYA 1MAWA 1E6EA 2CZCA 1NV9A 1Z36A 2FOXA 2W83A 3B2NA 1WV1A 2TMDA 2Y92A 3CB4A 3MG9A 1ODLA 3TXXA 3SWWA 1Q0QA 4ZEOA 1I7NA 1U98A 3L8YA 3C3DA 3JXEA 2B4YA 5LDDC 5JS1A 1XWIA 2DXIA