4JASB

Structural basis of a rationally rewired protein-protein interface (hk853mutant a268v, a271g, t275m, v294t and d297e and rr468mutant v13p, l14i, i17m and n21v)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
121
structure length
120
Chain Sequence
b'SKKVLLVDDSAPIRKMVSFVLKKEGYEVIEAENGQIALEKLSEFTPDLIVLIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine kinase
molecule tags Transferase/signaling protein
source organism Thermotoga maritima
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
total genus 39
structure length 120
sequence length 121
ec nomenclature
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jasB00
3TX6A 4M88A 4Z99A 2A9RA 4MQFA 2FN8A 3CHYA 3KS9A 4IF4A 1BDHA 1H9CA 1QP4A 4G0YA 4KQCA 4MQEA 1USIA 1D1QA 3IP9A 5EWLA 2LBPA 2NUBA 1M5UA 4G86A 4D74A 1SXIA 1JDNA 4FE4A 1BVHA 1XHEA 3B2NA 5GOTA 1LJLA 3IDOA 5CNJA 2PUCA 4F8JA 1PNRA 4JP1A 2NZVG 2QZJA 1QPZA 3OQMA 1Z17A 3DGFC 5EWJB 3URMA 4ZMSA 1PUXA 2MYUA 3Q9SA 2F8SA 1P6QA 4KK4A 1YK0A 3ILYA 2H3HA 3JS5A 4HNSA 5TQJA 1FFWA 1JLKA 3TD9A 3OLXA 4WXMA 1ZAYA 3LUAA 1EWTA 1KRWA 3LKBA 3CZCA 1Z18A 3HXMA 2PKXA 1DP4A 3I42A 4Z4GA 4EYGA 4WT7A 2GX6A 1Z16A 4NV3A 1F51E 1QMPA 3CRNA 3SAJA 4WUTA 1CEYA 3JY6A 2QU7A 2GBPA 2JBAB 5EWLB 1ZITA 3LFTA 4HNRA 4G0MA 1DRKA 3JPYA 1W9HA 1D2AA 3O2JA 1Z12A 3SNKA 1TLFA 1D5WA 2F8TA 1U2PA 3FDFA 1NXOA 3CS3A 4LDAA 1URPA 4HYEA 1GUBA 3K4HA 4MS1B 5TQ2B 4RDCA 2HQOA 2P4UA 3H1GA 3CLKA 3SG0A 3A10A 3RQIA 4NCAA 3RVJA 3IP6A 5DLEA 5KWSA 1NXXA 5T3YA 3C3MA 1RZRA 3QLTA 3QLUA 2FVYA 3T8YA 4RXUA 1UDRA 2W42A 3CU5A 1MIHA 1ZH2A 2I6FA 4MRMA 4EY3A 3H1FA 3QELA 3H6GA 2E4XA 3JVIA 3O21A 5FWYA 4OLBA 2QSJA 1F4VA 2M98A 4O5AA 2R25B 4JOQA 3F73A 4MQEB 2NT4A 4XFKA 1YMVA 4FE7A 1JX6A 1QP7A 3IPAA 5JS2A 1JFVA 1YIOA 1BDJA 4EYOA 4IMJB 3O2SB 3Q7TA 4NCBA 2X7XA 1YK1A 3O1HB 3H5WA 4QICA 3RH0A 2VUIB 2JVJA 3A0RB 4EGSA 5KQPA 8ABPA 3FFWA 3EQ2A 1QO0D 3IP7A 6CHYA 2LUOA 3BRSA 5FBKA 3OM0A 4OLAA 1D4ZA 2PE5A 2BGGA 2JK1A 1I3CA 2RJOA 1CYEA 4D6YA 4LE0A 3CZ5A 4XASA 4Z9BA 4KREA 2IOYA 3Q7SA 4G0ZA 3LUCA 2GKGA 3HM9A 3IP5A 2FQWA 4JASB 1IIBA 5JNVA 4MR8A 2CD7A 2LP4Y 2Q5CA 1VRVA 2MYTA 4O1HA 4YP9A 3RVQA 1QO0A 1TMYA 3G85A 1NXWA 5IUKC 1DZ3A 1WETA 4LDZA 4MR8B 1U04A 1Z15A 4RV5A 5CNKA 4F11A 5JNWA 3MQ4A 4DN6A 1NXVA 5HKOA 3DLHA 2FEPA 3KYIB 1A04A 1Z2EA 2J48A 3OMXA 2CWDA 1DG9A 4MR9B 2PMCA 3RVRA 5BRAA 2GWRA 4S04A 2PUGA 1Y1LA 2IKSA 3C97A 5CNIA 2IYNA 3FFTA 2ID7A 1EHCA 1U0SY 3H1EA 4Y9TA 3EGCA 3EAFA 4MS4A 1YMUA 3H5LA 1YTUA 5F64A 5IEBA 1JFTA 4YV7A 4Q6WA 4N47A 3HDGA 1GCGA 3T95A 5DCLA 5BRJA 3OM1A 1FSPA 1GCAA 1QKKA 2FSPA 4Q7EA 4RKRA 4RK7A 1FFSA 5KI6A 1ZH4A 4RU1A 4W5TA 3DGEC 1LBIA 4IMIB 3M9WA 4LE1A 3N0XA 3SQNA 1XWWA 2HPHA 1ZN2A 1JHZA 2PUAA 9ABPA 3N8IA 1APBA 4GPAA 4ZJPA 4QYMA 5B3JC 1DC7A 4YCSA 4XXHA 3FGZA 4MR9A 3NHZA 3KKEA 3D02A 1ISSA 4YWHA 4YRZA 3KJXA 2VK2A 3NBMA 4HNQA 4N0PA 4PICA 1TVMA 4B09A 2FKAA 4KZKA 3L6UA 1E6MA 5KQMA 2FN9A 5HSGA 3MYYA 3K9CA 4KK3A 4WXEA 3KTOA 3S99A 4W5RA 3GA5A 2CHEA 5FWXA 2ID9A 3H5VA 3HCWA 3I45A 3OLZA 2JBAA 4RK0A 5DKFA 1YS6A 1VKRA 2FW0A 4D6XA 3SY8A 3KLNA 3Q7RA 4JB2A 4MGEA 4KNYA 2AYXA 2IDMA 1DBPA 3GL9A 3Q15C 3DLBA 1NXPA 5GQSA 5CNMA 4E7OA 4L4UA 1R8JA 3HSYA 4RK6A 1MB3A 4TMYA 5TQ0B 4RXTA 3DBIA 4WWHA 3HO1A 3MF4A 2QVCA 2L18A 4G0QA 3EJWA 5HQJA 3KLOA 1RNLA 3HV2A 3H6HA 1KRXA 3N75A 4TLMB 3F6PA 3TO5A 1CHNA 2JVIA 3GT7A 3TB6A 1QP0A 4MS3B 2V0NA 4YS6A 2WRZA 4ETNA 4MR7A 1W25A 4Z0NA 3C6QA 4YO7A 3R0JA 2A9QA 1U8TA 1C0EA 4Z9AA 1JYEA 3QELB 5TPZA 5TPWB 4ZYLA 4E7PA 4H3KB 1B00A 3N53A 4MYRA 4MRMB 4MR7B 4H60A 5KC8A 1NXTA 1ISRA 1USKA 2E4WA 1K68A 1SRRA 3LKVA 3LMKA 3O1IC 4MS4B 5IC5A 1VLZA 4EVQA 2PLNA 1KMIY 3BRQA 1M2FA 3N6VA 2B1JA 3EULA 3LUHA 4KFCA 4G0XA 4XAQA 3M9XA 4IGAA 1Z13A 1A0OA 1NTRA 3NNDA 4EYQA 1M2EA 2R47A 4LRQA 3GBPA 5TE9A 1JH9A 3KSMA 3VNAA 1E6LA 1JBEA 2P9HA 2QVGA 3GYBA 3ROTA 3FFXA 3TMYA 2ZWMA 3CNBA 3LTEA 3N0RA 2WJAA 3OLYA 2JCGA 1ABFA 2QV0A 4NQRA 2AYZA 5HM6A 5KQLA 2OQRA 5B3JA 3JVDA 1ZVVA 5DGCA 4Z4CA 1DCMA 1XHFA 3O1JC 3LOPA 2MYNA 2VYCA 1YS7A 3RVMA 1U2QA 3NNSA 3ROFA 1USGA 2L2QA 2WWVD 1ZGGA 3QX8A 4EVRA 3HDVA 4PE5B 2FLWA 1QQAA 3RVLA 1M5TA 1PEYA 1Z26A 2MYPA 1QQBA 4NICA 3EDCA 1NXSA 3QEMA 3VNBA 2FQYA 1RPJA 3OO1A 3I5AA 3RVKA 2WMYA 3EODA 1EWKA 2JRLA 3EQZA 3RVPA 5TPZD 3UUGA 2B4AA 1P8AA 3LUFA 4KMRA 5IUNC 1JF8A 5BR1A 5JNSA 3OQOA 2FMFA 4ZMRA 2FLKA 2KYRA 1FFGA 1T34A 2LPMA 5I4CA 5TPWA 2A9PA 3M6MD 3C3WA 4G97A 5ABPA 4KV7A 3CFYA 1MVOA 3MIZA 3GRCA 3GV0A 4KVFA 2YHAA 4QYWA 3GWGA 4MAAA 3UK0A 4ETMA 3NHMA 3E3MA 3H5IA 2IPAB 2JB9A 3FMVA 4G0PA 3QEKA 2L17A 2HQRA 4TLLB 7ABPA 5TQ2A 2N9UA 2VUHB 4RY9A 4N0QA 4LZLA 4YLEA 1DJMA 2E4YA 3CG0A 3LUJA 1ZY2A 4Z4FA 2GI4A 3RVOA 2PUBA 1P2FA 3F6CA 2FXIA 1RXEA 4L85A 1JWLA 4Z4IA 2DRIA 2E4ZA 5PNTA 1MAVA 2M1ZA 1JL3A 3H75A 4F06A 1DCFA 1AB6A 2FMIA 1AB5A 5IUJC 3OO0A 2WB4A 4S05A 4N03A 3JPWA 3A3KA 4EVSA 1MB0A 1E6KA 2HJ9A 5IX8A 3RVNA 2RJNA 1RZRD 2PL1A 2QR3A 3H5TA 1PEAA 1YVUA 3CKMA 2PJUA 4Q6BA 3IPCA 2FTKE 4MLCA 4P98A 3CTPA 4OG2A 1BA2A 5JNRA 4MS3A 1ZDMA 4LE2A 5KQGA 2NZUG 4RS3A 2R48A 1GLGA 1LJUA 4JB0A 3UKJA 3HZHA 2ZAYA 1ZGZA 4Z4HA 1JYFA 3RVSA 1KGSA 4EYKA 3KCNA 5CHYA 3P9YA 3W9SA 2MSWA 3QEMB 4OATA 3GBVA 4OTZA 1EWVA 4P1ZA 2IPNA 4PYRA 5JNTA 5KC9A 5ED4A 1PNTA 5TQ0A 1P6UA 4GNRA 3DZDA 4OBBA 1JFSA 4IILA 4KQ9A 5FWYB 4MLDA 2FEKA 3OLVA 1SXGA 1FQWA 2QW1A 1OXBB 1DBQA 1LK0A 3QLVA 3N0WA 4EUKA 1BDIA 4F3TA 4RY8A 5JNUA 4UHKA 2XDYA 4YR7A 1BAPA 4MQFB 5JS1A 2IPLA 4IRXA 2PAFA 1DBWA 3MMNA 5EWMB 2QXYA 1NATA 4O1IA 3E61A 3OLWA 3BBLA 1VPWA 5IULC 3T6KA 4G0OA 1K66A 2TMYA 1DC8A 4RK5A 1EAYA 4PEVA 4MS1A 4Z4EA 1JDPA 2NT3A 2A9OA 4W5QA 4CBVA 1SXHA 4UHJA 2O20A 2RGYA 3F7NA 5D2CA 5EWMA 1TM2A 2L19A 3H5OA 4PZ0A 4QPJC 3C3KA 5C5CA 3HJFA 1L5ZA 2E4VA 3KG2A 3G1WA 2RDMA 1DRJA 4ETIA 4H3HB 2E4UA 2FQXA 2FMHA 3I09A 3QX9A 4YGXB 2PUEA 2HSGA 3T38A 1QNLA 3Q41A 2LIVA 1D1PA 3NNNA 4JA2A 1NY5A 3L49A 3JTEA 5E3JA 1J56A 5IBQA 2PL9A 3HEBA 6ABPA 3OMWA 3MA0A 4XLTA 3HK2A 4KPYA 4W5NA 1GUDA 2H0AA 4RWEA 1A2OA 1HEYA 4RK4A 2FMKA 4DQDA 3BILA 4RK1A 3HUTA 3QK7A 5DTEA 3O74A 3KYJB 4RXMA 3LUDA 1RXIA 3ILHA 3KHTA 4TN5A 2MSKA 2PUDA 4FB4A 1SD5A 2WJWA 5EWJA 1EFAA 3CG4A 4MPTA 1OXKB 1ZESA 3LUGA 4JAVC 3A0UA 4WZZA 5BQ3A 2CHFA 1ZHHA 2FEWB 2R4QA 5FBHA 3HVRA 2PUFA 4RY0A 3O2QB 3OQNA 5C5EA 4XARA 3LUKA 4DADA 2WY2D 4W5OA 3MM4A 3HUUA 2JVKA 2YHBA 2HQBA 1TJYA 3O75A 1DCKA 3SM9A 5FWXB 1PHRA 1Z2DA 4N41A 4LX8A 4RSMA 1S8NA 3HS3A 1ABEA 5T7BA 5IEJA 4ZPJA 3QLUC 4RKQA 1C4WA 1LBHA 3D8UA 4KRFA 2OENG 4F12A 2MSLA 3QLVC 4RZSA 2IPMA 4ML3A 1E2BA 3BREA 1L5YA 1Z25A 4N76A
chains in the Genus database with same CATH superfamily
2PMDA 3AXSA 3CPEA 5FI5A 4C0XA 5MN4A 4CLRA 1E4YA 3Q6MA 2GZRA 3ZH2A 3T94A 3O8LA 1RCTE 1JMKC 1N2OA 4RM2A 1ZW6A 2LBPA 1BYUA 1UPAA 3R0ZA 5FTMA 3BRWA 3RNOA 4AWBA 1L1EA 1XHEA 1SHLA 2V58A 4YWJA 1DBIA 2N1MA 4LJYA 1I7SB 5CW2A 3TPCA 2O8NA 1XZEA 2PT5A 2NAPA 4TWZA 4F9FA 4XIIA 3X1KA 4PYJA 2W8BA 2RB5A 2VJNA 1KYQA 3FTDA 4RL6A 5EJGA 3NKVA 3EA0A 2FE4A 4G5XA 3ZBUA 1NBEA 1UM9B 2DE0X 2IDJA 4MUKA 5AOVA 4B87A 4TSRA 3V80A 1UT6A 1CQWA 1WMAA 3R6LA 2OV4A 4EENA 1PVDA 1ZYUA 4E5UA 1MQ9A 4IYRA 5HIAA 5IF3A 1N9GA 1QK4A 2C82A 2EFCB 2XV1A 5KHLB 1MOSA 2FP4B 1Y37A 4HEA6 2QVLA 4G6ZA 4K3UA 2CZCA 3TR5A 5IU6A 2PT7A 2VRBA 1NVFA 2Q3FA 4ZYZA 1LFAA 2G9ZA 2PKXA 3INYA 1I0ZA 4X5OA 1GPJA 1DUVG 1YFZA 2BM8A 1A8QA 2D1YA 3Q6IA 1LTQA 3O4HA 4M98A 4Q4JB 4YRJA 3WY9A 3ZX5A 4PN7A 3RBXA 2XQIA 3RHSA 1ZEJA 1YU6A 4XDHA 3V34A 2GXQA 2JBAB 4HEA1 4RESA 4CMJA 2HNKA 3M81A 1YZNA 1MU0A 1HXHA 1NDUA 4YMVA 3JQAA 2QPLA 4P4LA 3AJ9A 2I1LA 3IT1A 3DJFA 2I2FA 3OJWA 3MTJA 4UEKA 1BWSA 2ODNA 5AI0A 4AJOA 1OXMA 2OO7A 3U4QB 1A72A 1C4KA 1QM5A 1SUWA 3D5TA 3NM4A 2WMNB 1GZ4A 3ENWA 5JSKA 1NE7A 2X7HA 4JS0A 3TLAA 4HQKA 1JTVA 4FIZA 2NQ2C 2O50A 1NG1A 5A4IS 3FDIA 4BLQA 5ALKA 3L7CA 4XB2A 3HCFA 5ILGA 3N6XA 2LDXA 4M87A 3NDRA 4R8MA 1N7HA 3GPLA 4CCYA 4K1LA 3T8YA 4F6LA 2WUWE 3E3AA 3MWYW 1PSDA 5SYAA 2Q3HA 4XGRA 3BVPA 4EX7A 1YS2X 2PLFA 2QMEA 4ZCSA 3QELA 1LZKA 1QKJA 2E4XA 3R7LA 2ZJ7A 3JAMA 5FHRA 4OLBA 4P34A 2XCIA 4XPIB 1QP8A 2M98A 3PXAA 2WD7B 1HE4A 3EMDA 3VNQA 4PTZA 2PLRA 3GEMA 5F12A 5A5GA 3ESRA 3O94A 3ZW9A 1U2SA 4RVCA 4X97A 3RF6A 3WRWA 4X66B 2F1RA 4R0VA 4LI0A 2HTFA 5IC6A 1V41E 2WFLA 3H5WA 3KOUA 3UGJA 4M1WA 2JIBA 3A0RB 5KQPA 1MGOA 3OM8A 1RLIA 3CUUA 1VTKA 5KMGB 4NY1A 3FFWA 3JARA 2HYIC 1NVWQ 4DJTA 1I4WA 2X13A 2BJVA 2RARA 2YN4A 2GT1A 3GLRA 4U7PB 1E6EA 1R4AA 3I9V1 1FU8A 4CKWA 2C20A 2CYAA 4FWTA 9MHTA 1YIDA 2QLBA 4XASA 4D5GA 5ITWA 1JHXA 4C4XA 3BQMB 3ETCA 3DYVA 1L4FA 4AECA 4I55B 2PSHA 3RYFA 2CD7A 2SICE 3CZPA 2GF9A 1RXYA 2Q5CA 3DHYA 4CZ2A 1WDWB 4KKXB 2CL6X 2UZ3A 3ZV3A 4V0QA 1WETA 3UV6A 2PZLA 3BB4A 4J2OA 2UZ4A 1M2GA 2ZI5A 2EP7A 1P7PA 1CVIA 3C85A 3GA0A 4IDCA 5DHTA 3ZE2B 2ASVA 4KR7A 1L5WA 2GHIA 4BLTA 3ABRB 4CT5A 1GNRA 1JIIA 4DLPA 4BQQA 2QJWA 3FUXA 2J48A 5KUTA 1G6KA 2OHHA 1HTTA 4QARA 3CW2A 3ZZUA 5LL6P 5EG5A 1JI3A 3E35A 2JIZA 3ORQA 4FMCF 3VPCA 4WTOA 3RC7A 2O5CA 4GI5A 2EZ8A 1JU3A 2ID7A 2P35A 3EUEA 3GH1A 2VEOA 3DR3A 3QG1A 4P4SA 3RRBA 3TOCA 4WJKB 1BE6A 1K2WA 3BBPA 2XDWA 3PPWA 4L75A 4NL4H 1J9EA 5AJTA 3AFHA 2VHXA 3WO0A 4CFZA 4CQJA 3QFHA 5JMOA 2WZBA 2WHPB 5JXGA 2WDZA 4R71A 2P9TA 2H51A 3GFBA 4PYNA 4MGHA 1EFVA 1O87A 2ZBUA 3PFFA 3RYHA 1D0SA 2YXPX 3BGOS 3FOCA 3FLBA 4TRMA 3AG6A 1WCXA 2QENA 3MUNA 2VK4A 5LQJA 1XDUA 2EKZA 3OUUA 3G5TA 3K92A 2Q4TA 1E4VA 1Y9ZA 4LOIA 4C78A 1R3UA 4W5TA 3CLSD 2H18A 2WIDA 2RHWA 3T15A 4CMCA 1YE5A 3G0DA 4KIUA 1J25A 4L5AA 2QQFA 4KR0A 5H16A 3K9QO 4UZFA 3SX0A 2OBMA 4AP9A 2Z1DA 4E32A 2PWPA 1KI4A 3Q1KA 1P3DA 4J03A 4RSRA 1M5RA 2C7OA 3DOUA 2A0UA 2V74B 3PRHA 3RFFA 2GYUA 1KBOA 2OY0A 3FIUA 1MRSA 4LY0A 3L93A 2MSNA 4WCFA 3LP8A 1N6OA 5J4HA 4YWHA 3SC6A 5LQMA 1DC5A 4F2PA 1PGPA 2EATA 4HNQA 2FK7A 2F59A 2FK8A 3TNYA 2D7CA 3W2HA 2QI9C 4EK9A 5KBYA 1BROA 3ZD7A 1P9NA 2EDCA 1C3XA 2QRGA 3K70D 1TMGE 3UAWA 3HCWA 1C9YA 4I1SA 3FPKA 1WD7A 4EM6A 2NZWA 3SM3A 3PEVA 1JT9A 1ZI9A 1NNSA 1FRFS 1TZKA 1PYGA 1D4AA 1UK8A 2JGLA 3T41A 3WKEA 1EXNA 3WISA 3DLBA 1E79D 1VG1A 1PNVA 4L4UA 4IINA 5E4TA 3V4PB 1UMCA 1CRQA 1A4IA 4BVGA 3L7BA 5AXDA 4B9AA 1M7BA 3Q9UA 4YCBA 3W4KA 4HDRA 4NXMB 2IZ5A 4HV4A 3MTBA 1JQKA 2ZOSA 1YZ3A 4BATA 3DLAA 3MNFA 4D1YA 1JEEA 4JVOA 5IASA 1RNLA 2ZWOA 3FYSA 3H6HA 4ZOEA 1LLDA 2G1AA 3EXG2 5D6NA 1GUZA 1QVZA 2W4IA 2ZUEA 2PMWB 3C3DA 5FA5A 3EHEA 4V0KA 1NLYA 3VTFA 3MT9A 1MNQA 2V0NA 2ZXFA 3F3YA 4RA9B 1U9ZA 3S8EA 1XRSB 5LSAA 1P4JA 3M6AA 3PXCX 2G7MC 2YXDA 2WIBA 2ZR0A 4J4BA 1RAHA 5CFRA 5IT9A 1H1DA 3QELB 5AW7A 4I50A 4LF5B 5P21A 2IYTA 4H3KB 1G5FA 2HJRA 4OYYA 4TV9A 2X0DA 3ZK8A 5KQRA 3WAJA 5BT9A 1EX7A 1ST2A 4CLOB 1XTTA 3FCAA 2ZIWB 3KSAC 1J09A 1KY2A 1H6BA 2FWAA 3LKVA 4GH5A 1Q7RA 3KR9A 4EVQA 1Q2XA 2KWIA 4OMUA 5EVJA 4P5PA 2H1CA 3AI3A 4BNVA 1BS9A 1FDWA 5EJ8A 3M9XA 1J7KA 1X3SA 4IX9A 5FDFA 1NTRA 2E1RA 4GMFA 1E7QA 4UMFA 3WL6A 2C57A 1ZGCA 4NBRA 1O94A 3HYLA 2YNMA 2X0RA 1I4LD 3FWNA 5JSYA 5BQ5A 3EMVA 3GPBA 1E6LA 4L8VA 4P3YA 5KX5B 4YQYA 1M67A 2D5LA 3BHMA 5A9SA 3LTEA 3D8HA 4JGIA 1PG0A 1WCIA 2CSXA 1T2VA 5MGBA 2D0PB 3VJMA 2OBYA 2V4ZA 1ZO8A 4Y6GB 3ZLTA 5J4LA 5ARDA 1J0CA 2DVMA 1XHLA 2P1DA 3INRA 4YHBA 4K8OA 4CKBA 4INAA 5M7EA 1BE0A 3THRA 4UUOA 1HG1A 1GQQA 4E2ZA 3PFBA 4INOA 3RVMA 4Q7MB 3ZHOA 3QVTA 1TQ2A 3ZHXA 1NQAO 1GRQA 1U81A 1NVXQ 2FVXA 1R8SA 5I3ZA 5ITSA 2J32A 3ESAA 1GGVA 2QG4A 2P7IA 4I19A 4QL3A 1PEYA 2RHGB 1NBAA 2A3RA 1AKRA 1U3DA 4HDCA 3VSEA 5LQNA 4PHTA 3FYHA 1VI2A 2CVFA 2VLBA 4KJZA 1UJNA 2B20A 2GXAA 5C18A 2BC9A 3I5AA 4UE3S 1IN7A 1K9VF 1NVGA 3KCQA 2VHJA 2RBGA 2B21A 3GNQA 3OZSA 2OD9A 3KL4A 4FILA 1JKXA 4L0CA 1S2GA 1O89A 4AMUA 1CB0A 2J3JA 2D4AA 3H2GA 1E3TA 1XTIA 2I2WA 3OQHA 4XX0A 2A1IA 5COQA 5CX1B 1WZCA 5EGSA 4ZZ2A 1JU9A 3C7TA 4S3MA 3AF2A 4H4DA 5L3VA 2O8VA 2RHOA 2I29A 5EYPA 5ALIA 1GNVA 2MSCB 1PX2A 2ZBPA 1EVYA 4HQFA 1NNI1 4KXUA 1ENZA 4KV7A 2D2FA 1N6LA 5JD5A 2PFKA 2ZJ2A 1GZDA 2NZYA 4KN8A 6NULA 4O2AB 1Y82A 5H83A 3SIPA 3OD1A 3V9AA 2W2PA 1YDGA 4J75A 2G67A 4ZVKA 1TQ4A 4Z53A 1Z6QA 3WK8A 2HX1A 1TM7E 1LPAB 4TMXA 1PL8A 2CDBA 2GA8A 3SHOA 2GKSA 3HDYA 1Z0JA 2M6KA 1XJ0A 4FX2A 3COYA 3S70A 1XROA 4JEMA 1DC4A 1B6TA 1V7CA 3O9VA 3R3HA 4MQBA 2J3KA 1TTPB 4PSDA 3ZD9A 1KZ6A 1E7MA 3OPNA 4Q9IA 4OHFA 5DLYA 3SSAA 4DA9A 3GLGE 3DHNA 2NUPB 3OFKA 4GPZA 5CIQA 5B1DA 1OB2A 3AU9A 1NNEA 5F23A 1RYFA 3EXIA 1JL3A 2VF8A 3GJZA 3JD2A 4NQZA 4NBLA 2G6TA 4GKJB 1VIDA 3KJFA 3HY3A 4AG6A 3ANSA 1CIVA 4Q47A 1PYDA 1SKQA 1DAHA 2G08A 4N03A 4RFSB 1N6NA 2VHCA 4G2NA 4U4AA 3SNHA 4JBGA 4B6PA 3SBOA 3T7AA 4GBJA 3ZIAD 5L4LA 2F8MA 4QTYA 4EGJA 1KC1A 2CVPA 3HN6A 4UBKA 5BSUA 4W8GA 1S2DA 5DBHX 1IBSA 4Y0AA 2R48A 1SXJE 3AFNA 4AKSA 3K9BA 4R9NA 1K5PA 4KWTA 3LPDA 1DEKA 2FH5B 3VDXA 3AUJB 1LRJA 5AK5A 4BLPA 1UXIA 5FADA 4C4OA 4UDYX 5I7AA 1GIAA 3K73O 3IRVA 1EWVA 1X0VA 2DC1A 2FI1A 1JAIA 3ESBA 1TYZA 3DZDA 4QQFA 4JL5A 2QDXA 4BO0A 4OQXA 4A5SA 5I6DA 1JXMA 1VHDA 3EQ7A 5AOAA 4H7HA 1H5NA 5D3MB 1SXGA 3JQPA 5BN4B 1FX1A 3B1XA 3IBTA 4Q12A 3SDBA 3NOQA 4MUIA 4ZHQA 1WXXA 4ZCTA 1LNQA 1S2IA 4LN1A 4I50F 3GROA 4LYEA 2V5VA 4P3OA 1FSSA 4EF6A 5L6LB 3CKKA 3G9UA 2ZJ0A 3NJ4A 1GU0A 4QBIA 3TW0A 5AVYA 4CI9A 2PX5A 4CQNA 5LYJF 1EGQA 2JAQA 2BGIA 1D7OA 1QG4A 1I2DA 1ZM7A 2DBZA 2ONZA 2YWFA 3ELBA 1G7RA 2WWGA 3HCNA 3K8QA 3O73A 4IOKA 2PIAA 3LI2A 1HRDA 4GGPA 3SQMA 2IYOA 3Q0EA 1RKVA 4R1SA 3NP7A 3KTAA 3PWSA 1ZMBA 1P2UA 3GVXA 3L41A 4NJMB 1STOA 1NFFA 3QQPA 4C07A 3VGJA 3PKJA 1GGKA 4HSEA 1NMQA 1UBNA 2P5SA 3BUSA 2IOQA 3FAZA 2VWPA 4K86A 1KR5A 2WLTA 4QPJC 5L7YA 2BBSA 3G7UA 3GT3A 3RGWS 2I7XA 4TYWA 1QE0A 4FBGA 2PX4A 3I9KA 5B58T 3WL4A 1FMCA 1SXJC 3AHIA 3CM0A 5FV4A 1ZCJA 1LX6A 4U7HA 3TJRA 3TE7A 5K0ZA 1T2FA 1LVUA 3N74A 3T38A 4S2UA 2EZ4A 1QNLA 2PLWA 4XOIA 4FW9A 5IHXA 1UMBB 1SM4A 3TEJA 3GGOA 5KKCA 4YCCA 4A6PA 1I13A 1SWVA 4X60A 1XZKA 3PYLA 5FLKA 5BMVA 3SYNA 3VR3D 1WEHA 2H4JA 3W2TA 2WJZB 4WKOA 1OI7A 3IEPA 4E09A 3BXXA 3RAPR 4MDFA 3UNXA 2P9CA 1QPBA 2H92A 2JJ1D 2RG7A 3ZIAA 3HQ4O 1KTIA 2W6PA 1H4VB 4CIBA 1EFAA 3QUQA 4OAPA 4RZHA 4EEKA 4RY2A 2BFDB 2RB4A 1PJ3A 4GQIA 2RONA 3NBKA 2ZRGA 5SYNA 4X3PA 1QYRA 5C3UA 3WJ7A 4P6VF 3T5TA 4B2IA 4IZOA 3DAOA 5DBEX 3B78A 4W1RA 1U9YA 4XARA 3V32A 4BL5A 2DKOA 3EUFA 1YB5A 3WLKX 1EVJA 3JAKA 2AS0A 4EIWA 2BGKA 3NBQA 3IALA 3CWCA 2WP8J 4U8GA 1I80A 2HQBA 1OV6A 2YHBA 4R2IA 4BLOA 4D0NA 5C46F 1C81A 5B6IA 5JU6A 4ZREA 1YNSA 2A7XA 2NSDA 1FTWA 3A9TA 3HS3A 3E9RA 3SYLA 2GHQA 1TCVA 1Z4NA 1G2PA 4OF4A 3OJOA 5B55A 3NQ41 3G79A 3MWDA 3L0DA 2ILTA 3D7SA 5LQAA 1IL0A 4WNAA 2DT5A 3UMCA 1ZUWA 3TQOA 4IZIA 5L95A 4EQ6A 2DFLA 1VLJA 1O9HA 5J2TA 2C0CA 1JV2B 3MWGA 2GCEA 3P9XA 3HEMA 3D4LA 3H8SA 1E9AA 2OQ2A 5FL7D 3EJ6A 5CVDA 4GG1A 5H70A 3IP9A 1NLZA 2P68A 4P0TA 4RGQA 4KL8S 2AG8A 1GA4A 2JW5A 1NBWB 2K7ZA 4U9IS 4EG7A 3ZI7A 5JV5A 2FG5A 4FD2A 2ORVA 4CG3A 2GPTA 1XMPA 3LXRA 4M36A 3KFXA 1IY0A 2AR7A 2PZBA 1NMEA 3U09A 4F4CA 1Y1RA 3ECSA 4C0JA 4W5HA 1TLTA 1IOWA 2CNNA 1ZHFA 4EI8A 4FVTA 2O8CB 3B8EA 2V6JA 2P79A 3AERA 3MILA 1EFUA 3DL4A 4HNGA 3ORHA 1DE0A 4QVKA 1GZSA 5DNUA 4CMIA 1VE7A 3WLAA 4V1CB 2DHRA 3W5IA 1ZAYA 3AHEA 2FUKA 4TWBA 1R27A 1KO4A 3H9JA 4OYLA 5AM5A 4WZBA 5K2OA 4HRVA 3C3AA 4DA6A 1MRZA 5K3BA 3B3GA 1H2RS 2F00A 2JJ1A 1RZUA 3BMOB 1CEEA 1P81A 3G9QA 3CZRA 3KJGA 5FA8A 5HVNA 2QX4A 1DB3A 1LI5A 3TOZA 2V8OA 1ZSVA 5JXJA 3J81k 3PFCA 1F1BA 4FYVA 3N3AC 3QVGA 4PYMA 2XOKA 2P9ZA 4G0MA 1MMFB 2L42A 2Q8NA 1Q14A 1WAMA 1C1XA 3TRDA 1FNMA 4HQRA 1G19A 4JIMA 1FLAA 4MQ6A 2Q4DA 3TKLA 3VC3A 4I4TB 2GCIA 1EQ2A 1T1IA 3TINA 3PNYA 3HRHA 3PHIA 2WF5A 3FYUB 4XJTA 5CLFA 5K8JB 2G7ZA 1UBMS 4J6FA 2CFRA 2LV8A 2YMQA 4RDCA 4LFBB 1VKNA 2H2DA 3E2MA 4X1IA 3T0FA 2CLSA 3BGDA 4FJ2A 1U7DA 1DEAA 1L5HB 2ZJYA 2OK7A 4HBZA 4JLAA 3UMBA 5BSFA 1O7JA 3IP6A 1QPGA 3P9QA 2QN2A 5FPPA 3W6UA 2FSHA 3AKDA 3NHLA 4MCIA 1N5DA 4GOJA 1B8PA 1DT3A 4AP6A 3HYSA 1KDPA 2XCRB 2BHLA 4MDHA 1OKKA 4Z49A 1YHYA 1Y48E 4FZJA 4D02A 2PIDA 2FDCA 1IXSB 1SH7A 2O8BA 1X6VA 4TKMA 1C3LA 5DJ5A 2AZTA 3NUGA 2VDVE 1GN8A 3L04A 4OOEA 5G0UA 1NI5A 5B12A 5K8UA 1IY8A 1AA9A 3L7DA 3ONFA 4X54A 4AP5A 3TW8B 1EK5A 3HB4X 4DCOA 4GRDA 4BNIA 2W2LD 3ESXA 4C2TA 4NCBA 1ODLA 2X7XA 4NVRA 4C4AA 2XE7A 3RH0A 4NNPA 4Q01A 2QRMA 4Y2QA 5FPQA 2FPIA 2XVAA 1E7SA 2A4MA 1ZD4A 4IDEA 3HMQA 4D9FA 3V7FA 2Z2XA 3IMGA 521PA 3HU1A 3D59A 3LZCA 2UZIR 3ZWDA 3QSGA 4MUJA 3AF5A 3AH8A 1BX3A 3FPSA 3PNLA 3WGYA 1AUPA 4FYHA 2FHSA 4O08A 3TQCA 1UJ5A 3JZAA 1QO0A 5IUKC 4C3ZA 5ALVA 3DBHA 3M4JA 2EJCA 1UPTA 4GLOA 3TLGB 1D04A 4N54A 1W6UA 5JD4A 3EXEA 3UUWA 5CB4F 1FMLA 1NA5A 2H63A 2VDKB 2O7RA 1G98A 5JYCA 1XTUA 1M1XB 3KYIB 3W3AH 5JJKA 4AKHA 4C0WA 4TVSA 2R1UA 5IJWA 2GRUA 4AMGA 1Q7EA 1FE8A 4MV7A 1H4TA 1A9SA 2R8BA 3Q6NA 3G2IA 4CMIB 4V1CA 2WAAA 1NIPA 3AEKB 3ND5A 2QRVA 3OPYI 2IKSA 3G9TA 3LY5A 1MIOB 1FTGA 2Y92A 1SCKA 1KL7A 1VLLA 3HL4A 4LOKA 2XE4A 1EFPA 4FFLA 1T8PA 3TNDA 1E32A 1X42A 2PQ0A 3LSYA 1VBKA 4F9GA 1SIOA 2O3SA 2AXEA 4U6NA 3VYVA 1H5UA 3WRVA 4YV7A 5I3CA 4GOXA 5D7NA 3VYUB 5IHPA 3RIHA 2PT9A 3QIVA 1Y8AA 3DDCA 4BVAA 5JQGA 3VOTA 1KXJA 2WQ7A 3NGMA 1JQBA 3BIJA 2NIPA 4HZUB 3EDYA 4WERA 1HMYA 1QKKA 2C4NA 1ZSNA 2HMTA 2ZYIA 4E22A 4H6PA 3ZKWB 2XX3A 2ZKIA 4FCWA 4M37A 1ZH4A 2YFHA 1YHZA 3PDHA 5LP6F 4KRGA 4G4GA 3RSFA 1C80A 3C3PA 4UNIA 2BV3A 4CLEA 3E9EA 2FZWA 3W5BA 1LSSA 3EPHA 3V1LA 5E6SB 1ZN2A 2Q3CA 2OGWA 2QL6A 3GLSA 4OGLA 3JQBC 2QRVB 1FLDA 1YR9A 5BOSB 2RCNA 1DADA 4CM4A 3A4YA 4Q9LA 1N5MA 1AKVA 2D62A 3E58A 3VPSA 4BNYA 1E62A 5KNBA 3N8HA 3UKJA 1GPUA 3O91A 1V4NA 2AUTA 4ADSG 1SWWA 2WUDA 3KKEA 1ISSA 4GFDA 3FYUA 3M1LA 4HDKA 2PY6A 2XXBA 2VK2A 1YZKA 3GU3A 4BFWA 4A2WA 4B85A 2Q0XA 2W2LA 1JDUA 3NATA 2V9PA 1DKRA 5IKEA 5K5EA 4IOMA 4TROA 1NI4A 3ZXSA 4BU0A 3VR5H 5BSHA 7GPBA 3H7AA 1X7ZB 2FZ5A 2XCOA 3WIUA 1AGYA 4C4YA 1EVEA 1GGHA 1LVHA 4HGQA 2H08A 1X8XA 1WW8A 2G25A 3W0LB 1VKRA 1RJ9A 4WXHA 1XU7A 4YCJA 2RBEA 1Z8FA 2Z5LA 2FYTA 3EEBA 1Y7TA 3IQEA 2XBLA 5FO0A 4ERNA 4J16C 3RODA 3VVCA 3UUEA 1RLTA 2OGZA 2AR0A 1EU1A 2R6HA 2UZAA 4UJ5A 4ZT4A 2R6GA 4EW3A 3EARA 3DBIA 4ZDKA 1N3YA 3V1NA 2WFZA 5JPCA 2QORA 4RSGA 5TXGA 221PA 4IG4A 5EHIA 3NBYC 2B8EA 2YN2A 1ORIA 2BI8A 4JKIA 1PZGA 1G16A 1T4DA 4JJGA 3FHOA 3KDPA 4NBSA 2DFDA 1AN0A 4YAEA 3TB6A 3WAGA 1T5BA 2GPWA 3S2ZA 1PJAA 4JI8B 3ETNA 2GN1A 2VP3A 5HOQA 4BYMA 4NK4A 1G4AE 1KZ1A 3HZOA 3IOCA 1WMBA 2GUWA 3PP8A 3L9WA 1EWYA 4M0UA 3GMIA 3DWEX 1Q1QA 4TVKA 4B4OA 5KC8A 3P0HA 1NQXA 4NE2A 2E4WA 2I3GA 4PONA 2ZCVA 3SVZA 3RUAA 4D9JA 4URVR 3FMOB 5DISB 5F7OA 3BWVA 3UGQA 4E51A 1SHUX 1XDBA 3OIVA 4NYMR 2B1IA 1NQ5A 2GVZC 4GBED 1QUEA 3Q7QA 1UXHA 4K81B 3K6JA 4Y2SA 2Y6UA 1NOKA 3IPYA 3KP1A 4WKNA 3KE9A 2Y2UA 2HXSA 4XI9A 2I67A 4DCGA 1EUDA 1WVIA 2ON6A 4OAQA 4O4IB 1NV8A 4BC0A 3N76A 3V48A 1PFVA 1XQXA 5CYOA 4D92A 4YDQA 3DEJA 3L1VA 4MHOA 4PX3A 3W5UA 1U1FA 5C53B 1N8TA 3U7QA 3DMFA 3WB2A 5ICEA 4PR0A 3ZXXA 3U7GA 2JGJA 2RKWA 1ZD9A 2ZCUA 3AYZB 4EFKA 3CE6A 4R68A 1WDMA 4JB8A 4OKSA 5TGZA 5BSGA 3ULKA 5EJ9A 1QIMA 2BBTA 2VT6A 4KOAA 4BBAA 3PC8A 3QYAA 1HSZA 5IKPA 4A8JA 4YQFA 1YRYE 5IM4F 1GKYA 1FBNA 2Y1EA 3HUDA 4QGHA 4UHCA 4KLNA 4PRZA 1D1TA 1ADGA 5DGHA 2HWWA 3TLKA 3TZKA 4YY3B 4IEFB 3HM2A 1L4MA 3PXEA 5DT2A 2W93A 1EUDB 1GOTA 4NOKA 4O4IA 3WLHA 5C8DA 3ZCRA 1TVCA 4ZVQA 3ROEA 4IGFA 3PT5A 2R7KA 4GF5A 4ZVVA 2GZ2A 2BMAA 2VA9A 1O0SA 4BGVA 2MMCA 1EWKA 1Z47A 4LHZA 3FUTA 1CUHA 1N2IA 3I64A 1RACA 2REQA 4MIOA 3V8NA 5K0SA 3TD2A 3D5QA 4JBIA 4YEDA 1XPRA 1LDYA 4EJSC 4P3PA 4ZFNA 3K09A 1LK7A 4FHEA 3QA9A 4KV9A 4RC9A 4ENPA 3IOYA 4YP7A 1TUGA 5EJ2A 1V96A 2IT1A 2DU8A 1BRTA 3LBNA 4XGKA 5G53C 1G4UR 2EFGA 2G9VA 1FP2A 2WF7A 1QGUB 1YVDA 3LO8A 1H2WA 4JQZA 4M6WA 4BCBA 2O54A 4RVUA 3GV0A 4XRGA 4YJ2B 1TJ5A 2ZSUA 4WASA 2YL2A 3NHMA 5GADl 2HSEA 1DAOA 1S8OA 3DXXA 3OCZA 5FPSA 2G9RA 1ZUD1 4M7OA 2B9VA 3QU9A 1T1EA 2GH1A 1LX7A 2I80A 3F47A 4RPGA 3LLCA 3MWDB 1KEKA 1R15A 3CC8A 1HL7A 1KJZA 4N0QA 2C4WA 3DF7A 4ND7A 2D2IA 4BWGA 4XE5A 3UWOA 1KYYA 1S3FA 1AKUA 5KNBH 3RVOA 4DMRA 3F6CA 2JATA 4C7OA 2XBUA 3N7TA 1E2EA 1X7GA 1E2JA 3G89A 4QQNA 5IK2A 3E3NA 2N75A 5EFZA 3SZUA 5JNLA 1THGA 1VIMA 1YQQA 3NEYA 3B1KA 1EDBA 3C5EA 2BBOA 2P6NA 4DIUA 3JPWA 4CG2A 1SUPA 1PKEA 1F2VA 1JJ7A 2KW5A 3E4CA 3VV2A 3DULA 1J07A 2HMVA 2VN8A 1BGVA 1HRKA 3RVNA 4KAAA 3ZK7A 2DWQA 4BNKA 5KDOA 5C4GB 1KSGA 5AK4A 3IKMB 3SIRA 2FTKE 4REOA 4ZOAA 3JWHA 3HVIA 3OP4A 2ISQA 3W5AA 2UKDA 5FTLA 4ZKDA 1FUKA 1E1LA 3MD0A 1MJNA 1QB7A 2C5SA 4GD3Q 4RLSA 4UDOA 1YAHA 2PEZA 4KXXA 1KGSA 2I2BA 3P19A 3TGWA 3KT8A 4K6GA 3SIXA 4POAA 1P2DA 4G3XA 4YAJA 1QHYA 3U7IA 1AMNA 3WBFA 3CLUC 4LRTB 4H27A 2PMKA 2WG1A 1CD5A 1JH8A 4MI6A 5AH0A 3RS5A 3EG5A 3PUIA 4KIJA 4DLZA 5JEEA 2JLXA 2CSUA 2I3ZA 2LE0A 5G3ZA 5LXTB 1I01A 4KQ9A 1RRPA 3NANA 1X8LA 3R3UA 2F3PA 3DEKA 1FXUA 3I2HA 1XZFA 5EXTA 2GFIA 2QW1A 2TS1A 5CLLA 1VL0A 2P4HX 4ENQA 1L8OA 2F1HA 4KYUA 4FZ5A 2RGAA 4A1FA 4C0LA 4FHCA 4V1CI 1T4BA 4F3TA 3B52X 1LZLA 4LHVA 2ZSIA 1C3EA 4NR0A 1TEZA 2JH8A 3W7BA 2ZB8A 2FCRA 4MQFB 1U80A 1UWVA 2VPTA 5EESA 2XMGA 2QS9A 3ILSA 4NENB 5JDIA 4R7GA 2I55A 4IXDA 3TLMA 4PEVA 4ESVA 2AKEA 1GAWA 1TB4A 3TD6A 5JAPA 3CH7A 1KPGA 3ELUA 3CH4B 3H7IA 3KKOA 3WDMA 3R0VA 2GOYA 2OO5A 1JXAA 2L19A 3DMHA 4PZ0A 4WX2B 3EBOA 4F11A 4L4ZA 4BP9A 3G1WA 1K4MA 3G82C 3G0BA 4G1EB 1DRJA 2AVDA 3NASA 4H3SA 3DFMA 1OJLA 4Q9DA 5FBVB 5CDHA 2HSGA 3G7SA 4IV5A 1PKXA 4KAXA 2I2AA 4QO8A 4YRFA 3AI1A 2AXQA 5TS2A 5JTTA 3LQ2A 5JLJA 3OCVA 3A4VA 4PNZA 2FE1A 3HMKA 4HB3A 1ZBDA 1QJCA 4KYVA 2Q9AA 3PDUA 3SBEA 3UTDA 3HJAA 4MB6A 3QV1A 3S8MA 5C1DA 2X5NA 5EIOA 3B2EA 4EG1A 3T3GA 2E5FA 1L0BA 2GWHA 2WZQA 3Q3CA 4M2LA 3ADBA 1I3LA 4BNWA 4TXLA 4Z7JA 3BHNA 1DX4A 4B6SA 1QFJA 3LK7A 4PSKA 3DVAA 5DTEA 1SG9A 2ZAIA 3SXPA 1AS2A 3LDFA 2PKWA 2QE6A 1M2NA 1ISGA 1LQ2A 2CHVA 2X0KA 2AMVA 3RLFA 3WNZA 3ZQ4A 3ESQA 3IR5A 4HXFB 3OCWA 4QAQA 4EW2A 4JOBA 2ZIEA 4L73A 3W1WA 3LLMA 2PZAA 3AGPA 1RRFA 3Q9NA 1PSZA 2VS1A 4HEQA 4BVLA 3IQGX 4DIMA 1IHXA 4CKXA 3ZGOA 4ZKEA 2VNKA 2OXEA 3O75A 2OHFA 3T3PB 3BJMA 2VH5R 3PJEA 4OQ4A 3RHTA 1PHRA 3PK0A 4H7KA 5HPYB 1JILA 4FOLA 1Y3CE 2BM1A 4FOPA 3EG9B 4XOUA 4AUEA 2Z1NA 4X1IB 3GGJA 3ZYCA 5BR8B 1WY7A 4AD8A 4DIKA 3HRIA 2IGBA 4WKCA 2BEUB 5A05A 2O7SA 4C2UA 4ZV9A 3N2NA 2Z04A 5DOVA 1M75A 2DWUA 4YMHA 2PZ8A 1JTEA 2A9RA 2QT1A 3BCSA 2FN8A 3MWEB 4QSHA 3P9IA 5C5IA 1Z35A 3AZOA 4E03A 5DTMA 4Q4HA 4EW1A 1H69A 4IGKA 4R83A 3OEWA 4CRWB 1HG0A 1RQ7A 4XSHA 4E31A 4DLNA 4QNRA 4YREA 1HEUA 2OHIA 1XFDA 1RQRA 3BIOA 4U8HA 1JQEA 1NRWA 4BJ3A 3OP1A 4IQGA 3CSDA 1M2OA 3AVPA 5EP3A 3SKYA 4B5LA 1AQIA 1Q2UA 3AOGA 4JP1A 3PSHA 2F1IA 4CU2A 1K1EA 2PMFA 2Q5OA 2X8BA 4D9HA 4F2WA 4G0UA 3LX4A 1PUXA 1PF7E 3A9VA 5EMJA 1PW7A 4V2UA 1XQ6A 2VT7A 1JG1A 1K0FA 2ZWPA 3H1BA 1AHHA 2XQJA 3MUFA 3QXHA 4YGYA 4A8PA 4L50A 3FWZA 3T7EA 2WT4A 1YGPA 3RSSA 5HGJA 4XVQA 4DMFA 3V8PA 3P0EA 2A9KA 2IY8A 3WGUA 2XGGA 3T61A 2JLBA 1DELA 1JWBB 1Z18A 2RI0A 4Y98A 3CEMA 4N9QA 1GL7A 1P0IA 2GS9A 4XUEA 2YV4A 2CMDA 3UO8B 2GX6A 1G7CA 1IUNA 1C9EA 1J0DA 4ND2A 1RPZA 4TWIA 4JJ6A 4ZXFA 2OG1A 2FPWA 3JYOA 4FFPA 4IF6A 3EPJA 3ELYA 2PU7A 1BU5A 4PZEA 2CVHA 2QU7A 1H6CA 1NVBA 1OV4A 2CCGA 2Q3DA 1BEEA 2B37A 3STXA 1T3LA 5JZVA 2P27A 4C7VA 4CJXA 3RG8A 3VJLA 4ZQBA 1W5TA 3E2PA 1QQ5A 1E89A 1UBUS 2WM9B 4YJ3F 2WYHA 4BE4A 3WGGA 4TTAA 4HYEA 3FRJA 1B8UA 1P9WA 4PO3X 5HIKA 1GUBA 1MP0A 3K4HA 2MMGA 3NS7A 3WLQA 1CW2B 3V5NA 2IS1A 1NMYA 2Q5EA 2AEMA 3M5PA 2VI5A 4DWJA 4XQCA 1OAAA 3ABZA 1QTRA 3OFNA 2VATA 3KNZA 5B7GA 1MUUA 1X9IA 4KOEC 3E8SA 2GCOA 4HNTA 4ABYA 4MDEA 3E4DA 3D7MA 1TQ8A 1Z28A 3PRJA 3R75A 2H1IA 1QGUA 4OK5A 2W42A 5HQ3A 1G59A 2TMKA 3PIDA 1MCZA 1ENPA 4G56A 5EHQA 1WHSA 3V55A 3LLUA 3CB2A 4HH1A 2VF5X 1RHKA 3ZZ0A 1ZXLA 5FWYA 5JATA 5HRUA 1PX0A 4LHWA 3PNMA 4R9UC 2CBXA 2MU1A 2OORC 2VIIA 4JYZA 1U3VA 3F73A 2HCBA 4YFYA 4DJEC 4BKPA 1W88B 1TGVA 3N28A 5F33A 1HT2E 1IEQA 2R8PA 5BQXA 2QLJA 4WZBE 3KPWA 1YF3A 3GFSA 4WADA 1YI8A 5LLSA 3VDMA 4E6PA 3LS2A 2F17A 1UXOA 3FNEA 5B6JA 3IAAA 2LUOA 3V6LA 4XYEA 2C00A 3FZNA 5TEVA 3U49A 2FN4A 2G1UA 2JK1A 2RJOA 5B2EA 3ZWNA 4JJAA 3ADOA 3CVXA 2C4TA 2PRIA 2QXTA 2QN9A 5FJJA 5TT1A 1HA3A 1HE5A 1RQLA 2IOYA 1QYCA 3LUCA 3MMZA 3EXEB 4YK7A 4AUMA 1SULA 3PNVA 4EA7A 1QWSA 4R8VA 2QTAA 5A4DA 5ALMA 2RGRA 2IX9A 2Y1LA 1DZ3A 3PHBE 3ISJA 4WJZA 3RJZA 5EEHA 3VHRA 4FFNA 3D2LA 4RV5A 3GLFB 2JGMA 4LRSB 3I1FA 3ONEA 2PUWA 2PGDA 1HGXA 3EBLA 5KAPA 1G3UA 4IJ5A 1QF7A 3GRUA 1JFFA 1OY1A 1V9CA 3HLTA 1SBYA 1V9SA 3SJAA 4E21A 3E1GA 4WFKA 4TTPA 4KUHA 1C0KA 4N0DA 3PHCA 4URZR 3ANNA 1T5SA 3GHHA 3EGWA 3BULA 2A3NA 3DM9B 3BDIA 2QUIA 2E2WA 3RPEA 1I3MA 1HDIA 3SHVA 3GDHA 5E95A 3R77A 1JR3D 3CGGA 3ILVA 4LOJA 5JAUA 1VB3A 1KTVA 1RYNA 1OXXK 2FZKA 2QRHA 3KK0A 3NKFA 1CQPA 5B1SA 4BV3A 1V16B 1KORA 4QNNA 4R2KA 3EEIA 5TEWA 4PV7A 4P92A 3AVOA 4CIYA 5JC1A 4IIFA 5HKBA 2ODQA 4HJRA 4O2BA 3RK4A 1NR7A 5GGXA 4EG3A 1L2TA 5D01A 1PWHA 5E6RA 4CV1A 1VJCA 5KWVA 4GI1A 5DF1A 1SUSA 3FXAA 4C88A 4BV2A 2PUAA 2XE8A 3LHDA 3ZY5A 1HYHA 1L5HA 4RS4A 2AWOA 4R41A 3W3AD 2XGMA 1KEEB 4V39A 1UFRA 1T9CA 3KAQA 3TZCA 4AUNA 4EHHA 5C1BA 3IUBA 2YQ4A 1KI9A 3LGXA 5EJ6A 2BAGA 1GU7A 2IDKA 3KJXA 3R0QA 3UJ9A 1KAQA 3WI7A 3KKMA 4ZYTA 2B7LA 3UB4A 4PPFA 4DOMA 2XT9A 1L4YA 2ZI3A 2JJYA 4OHOA 4DDVA 4LC0A 4BMSA 4DJJA 3FHTA 5K0BA 4PNHA 4CDRA 2PX6A 2J5QA 3AF0A 3JWIA 5ALXA 3VKFA 4JYBA 1YS6A 2YYZA 5AKXA 5EPUA 4GC5A 1OGIA 3PSAA 1IB6A 3GN2A 2PKQP 5AUQA 4A2QA 4AWXA 3GIDA 4CDMA 4YDRA 4QYTA 4E5SA 5L3SA 1ISIA 4ALJA 3ET5A 1XNJA 4BB5A 3SF8A 1X1TA 4HDKB 4UM8B 4AFNA 3U3ZA 1T3SA 1WXFA 4OY3A 3KQLA 3O2NA 1R6XA 2PGNA 4UXIA 2QVCA 2NOAA 1XD2B 4IQ4A 5LWQA 4H1UA 3WWZA 4GPBA 4LJRA 1SKMA 5CTAA 2HO4A 3ON5A 3TO5A 2A4KA 3VUFA 2VBCA 3RLIA 1KI7A 3GT7A 3IIMA 3ZY3A 1GFIA 1HDXA 4W63A 1CV2A 2WM2A 2WRZA 1RKQA 3UW3A 1W25A 3T7JA 4JJFA 2NACA 3W2IA 5CD1A 4PBSA 4YO7A 2GXUA 2A9QA 2BM0A 1XZJA 1ZQ9A 3CH6A 4NYJQ 3DE0X 4WQMA 3JYNA 2WA1A 3IUJA 4TLDA 2D74A 4E7PA 3DDOA 3FCCA 4CR8A 1V1MB 2JJ2A 3D54D 4GYYA 2V6BA 3BGIA 1F3OA 1GN9A 1NT2A 1AD2A 1FFHA 1FS6A 1USKA 3G9ZA 3JQGB 4EPYA 1JS1X 3ZCVA 1AK9A 4BLSA 4ENRA 4JVLA 1E3EA 1NUPA 2GSDA 3D6FA 4GQAA 4Q1DA 4CM6A 5H1YA 1ECGA 3JVUA 4QQKA 2VHQA 1C1YA 3T4EA 5KTRA 5A0VA 2J3MA 3WLOA 4II3A 1FCJA 2XJ4A 3AHJA 3AUYA 4XDGA 4RD0A 3V1TC 4F56A 3P71T 5KOHA 1M8KA 2QZSA 1HDRA 1IAQA 5A7HA 5LZ8A 3U9SA 4UFNA 1FDRA 4KWEA 3PLNA 5KQLA 1EUQA 1KFKB 4EPTA 5LMUB 3IBFA 1UXKA 2QHXA 3B1WA 3GC6A 5AVWA 3N8NA 2H8GA 3PUWA 3WQBA 2V6IA 1RI4A 3ROFA 1BC5A 3CV3A 1IB0A 3PGLA 1J20A 1U3CA 5DU2A 5A9SB 2RHTA 4EVRA 4NFHA 3UVEA 5ECDA 4TV8A 4DZZA 4ZCRA 2AI1A 4Z9XA 4HDOB 1MPTA 1NW3A 1MR3F 3ITKA 5AW4A 5LFAA 1SCUB 4MARA 4OGWA 1GTJ1 3LM8A 2EG5A 1NXSA 2NSYA 2JJ2D 1I36A 2HWUA 1MOPA 3A1TA 3E9ZA 3QEMA 2B82A 4MMZB 4L51A 5ES3A 3RVPA 4U7TB 3AB7A 3DAPA 3FMIA 3KTFA 2O8CA 4B82A 1RC0A 2P5YA 4PFQA 3TX2A 1IXYA 3OQOA 4DCJA 5A5EA 2B34A 2FLKA 2JL1A 2YZMA 1M2OB 2SCUB 3KE8A 4GM1A 3K1AA 4N0EA 3GBSA 3T7RA 2Q6VA 3SVLA 1AS3A 1ETUA 1EJ0A 3M6MD 5DOZA 4F21A 4HNAB 3P9SA 4LY6A 2FOXA 4XQ9A 2GN8A 4Q7KA 1H4QA 1RHMA 3IBSA 3LPCA 1KJJA 1MVOA 1RXCA 1Y1QA 4KVFA 4UUQA 5AKIA 1N1DA 2J59A 2VP9A 1UZNA 4YMTA 1P1RA 3GAZA 5A71A 3LW7A 4ZK6A 3OZAA 1ZD1A 1R5OA 4ZRMA 2YIVX 3EZ9A 4KBFA 4MYDA 2YR0A 3Q7IA 4JJEA 2PCLA 4A10A 2KBEA 4ARVA 2ORWA 5KOYA 2NV2B 5A4MS 5JMTA 1L5SA 1P2GA 2EYQA 1ZMTA 2QP4A 4XSGA 4REQB 5DEIA 5F76A 2AUNA 4KQ6A 2O4CA 4O33A 2I0FA 2FW9A 1EJBA 3I92A 1GZUA 2E7ZA 2GI4A 1ORVA 3L8CA 4OHPA 4R2XA 1O97C 4Z0TA 3RREA 1ZJZA 4UTOA 5B1IA 1YL7A 4IIJB 4ZI5A 1RR6A 5FA6A 1NBHA 1MB9A 1Z68A 1MAVA 4R1QA 1E96A 2PZKA 5PNTA 4EFMA 2B8JA 2GAFA 1AB6A 5AD1A 5D85A 2LTAA 2AIRA 2MSEB 5JADA 1MXFA 1PZXA 3HKBA 1GKLA 4ZU1X 3U7HB 1X1CA 1FJXA 4EVSA 1Z37A 1OLXB 5BQOA 2W48A 3RI3A 6AT1A 2PL1A 4FMDF 4RPIA 5JCPA 4N3NA 4IHAA 4ZQGA 4EJ6A 1FTQA 3TRKA 1II8A 1DQPA 2IW3A 3I53A 4TLEA 1DG1G 3SEAA 4ZEMA 4RKFA 1S2OA 2ZR7A 1ONBA 4ZTUB 1L7RA 2HMWA 3O5AA 4BO8A 4S0XA 1JQAA 1OFVA 1TUBB 5AKYA 4OATA 4BX2A 4OB8A 3A2MA 2ZQZA 1ZVMA 1KVSA 1QC5B 2P2CA 2PD4A 2ZREA 4LJ9A 3P9ZA 3QY9A 1QTQA 1OTHA 1T0UA 4X41A 2BW0A 1P6UA 4GNRA 4KAJA 2XB4A 3NC4A 4CQMD 1GU1A 4QXOA 5FWYB 2OKGA 2VJCA 1JIKA 2ZBFA 3M89A 4RQTA 1W94A 3GCWA 2K87A 5SZKB 1TK9A 4O3FA 1KHHA 2P1RA 3JQ8A 1WMSA 4U2EA 3C16C 4HT3B 4GI7A 5H02A 3AVYA 5K09A 4DDTA 2VYVD 1BXZA 4JLKA 3SFTA 2LZ0A 3WGQA 2JLVA 1NQOA 1DBWA 2PAFA 3MMNA 5EJAA 5REQB 1L1QA 1UEIA 4M55A 2HLDD 4O63O 3V1MA 4JLWA 5ALLA 2C5FA 1EAYA 1T8UA 2BTQA 4GOLD 2A9JA 4L78A 4WFQA 5AJHA 5C8ZA 2A9OA 1GKUB 3GGDA 4TZKA 1J2UA 1VSVA 2HSZA 2W6JA 3GJXC 3MJ4A 1IN6A 4M1SA 4OLJA 5C5CA 3D8TA 1G55A 3B5EA 1AO3A 4NV1A 1QHSA 4WD3A 2RGCA 2ODWA 4JVMA 1YZLA 2C9ZA 2QKYA 3FGNA 4S0ZA 4ZCQA 5K0LA 3I09A 3QX9A 4YGXB 4MHTA 1MC5A 1NNUA 2VQ3A 5G0TA 3L8EA 4WZAE 5DX0A 4ZI7B 3SVTA 1TTQB 3CVWA 1C30B 2XIJA 3AKYA 3R3WA 5L7WA 5U9CA 2NTEA 1A9YA 4MW1A 3NNNA 3DV2A 3PPVA 3WLJA 1MX5A 2NVUA 3JTEA 3VX3A 3EWSA 3CYFA 2H1LA 1DFGA 3LXMA 1DXOA 1L3IA 4KE8A 1L3CA 1XYVA 2H3EA 3BXGA 2WWRA 3OEHA 4JLJA 1XTSA 2WHPA 5ANRB 5FEUA 1XK7A 1Z74A 2HU2A 1E6CA 3B36A 1XNGA 3BXPA 1NUQA 2GF2A 4N3GA 4YHHB 5FNZA 3IR6A 2IXEA 2R00C 3HCCA 3TR0A 4BNJA 1HT1E 2WNHA 1CVLA 2GILA 4HX5A 1DX6A 3CX7A 3E22B 3O74A 4PVDA 4RXMA 3C5VA 4EBBA 1F8GA 2H16A 2ZKLA 1WB5A 3O4RA 5G4KA 2AH5A 3LUGA 4JAVC 4UAVA 2C7GA 4DE5A 3KD2A 4JC4A 5C2JB 3UT6A 1I0IA 4JL6A 3RTGA 4RZ3A 4E4YA 2PV7A 2Y4NA 3HDHA 4WK6A 4IIYA 5J43A 2ZJ6A 3K9NA 3OOEA 2O3TA 3E82A 3IE0A 3LF1A 4B3DA 3F6RA 5CDSA 1JB9A 1ODIA 4OQMA 2PNJA 9LDTA 3FPBA 1IM5A 1DTSA 1N2EA 1T3HA 3HUUA 3OICA 4LZZA 3TSWA 4D56A 2DUNA 1GGEA 2CW5A 3HDTA 1NMSA 3P4UA 3O8QB 4MW7A 2C9MA 3QYFA 1IMJA 2C4HA 5ICGA 5CGQB 3LX8A 3F5MA 1T5DX 1WZEA 1POXA 3C43A 3DBLA 2X2EA 4FPXA 5CFLA 3L0BA 3EVNA 1TVEA 1Y89A 1X80A 3M34A 3PG5A 2OHGA 4HWGA 4JOSA 4RZSA 5GM2A 1IHYA 1FUUA 4MHSA 3VR2D 3BGWA 1L5YA 4JY7A 4OREX 3GVIA 4HMOA 3DFIA 4YFVA 2A9FA 1CEQA 4GPD1 4Z99A 3VKWA 1BDHA 3TW8A 3PPXA 4G9EA 4PLWA 4D9EA 1UC9A 1T9GS 4ONEA 5E1DA 3OJFA 4LMPA 5KCMA 4A92A 1KJYA 1BFKA 1ISMA 3OZBA 1JDZA 1J1UA 1FYDA 2BF4A 4G86A 2CLMB 4C0BA 1LJ8A 1T8WA 1IWPB 2WC1A 4EEZA 1NONA 1EHIA 3NVDA 4IKPA 4JYPA 3I01M 2BZ1A 2DG2A 4Q4LA 4X45A 4XJVA 1CUAA 2C2GA 5CX1A 3FVTA 3JRXA 1EK1A 4ACAA 2NPOA 3UCEA 3LVRE 2XF2A 3OJEA 4RZUA 3TZQA 4HN4B 5LBIA 2QQGA 3PGMA 4XR4A 5AK3A 3STWA 3T1YB 1EFPB 4OO3A 2HQ1A 4WOCA 4F60A 1A8PA 3TW6A 3QKRA 3ZE7A 2EJUA 1CZUA 3NHJA 5JCXA 2OAQ1 5D84A 3A4NA 1XELA 2Q0HA 1JAXA 4M1TA 1UAGA 4KITB 4D9KA 2O06A 1ZVJA 4I2NA 2WUFA 3OG9A 3QU7A 2VYFA 3CZCA 5BR7A 4XCVA 1JLRA 2HF8A 4RGBA 3NVKI 3O4JA 4JKOA 2JNWA 1JZSA 1NKTA 1JW9B 1QMPA 4JLSA 4M21A 3RTCA 1P5JA 4HXGA 1SELA 3OKAA 3JY6A 4GSLA 4K7JA 3EVCA 4NYJR 4MB2A 1XDDA 2GXSA 3U26A 4LPSA 2JD2A 4CQLB 1BKYA 2PRYA 1W9HA 2B4RO 1D2AA 5JD3A 1DJOA 1WCIB 2GBCA 4X64B 1ZIOA 4B44A 1D5WA 2F8TA 2YICA 1NXOA 4FKZA 5MDHA 3IOEA 1YQUA 2OCIA 1QQ6A 3D3QA 3GLHA 5AM3A 5KQMA 2I2DA 4QPPA 3IJRA 3K0BA 2B1QA 2VQFB 4MW4A 4II7A 4RKWA 4YR9A 1TAQA 2Z9CA 3TRHA 2CJWA 2OCLA 1VP3A 4J7XA 4MW2A 3L0ZA 1IG3A 5DWQA 3TW4A 4LRUA 2JCVA 4ZGWA 6Q21A 3M6XA 4HDNB 2P9GA 3IH5A 4RVSA 4XXHA 3WIBA 1NOJA 1G2OA 4DB2A 3OZVA 5E9WA 2HTEA 4US1R 5DI3A 4EKEA 5FLYA 621PA 2H57A 5FPKA 1I7PA 2FZCA 5CP8A 1R0SA 1SOVA 2QYSA 3JQBA 3L0YA 5DK6A 1KQNA 1HOXA 1ZJJA 5BNFA 4ASUA 2GZ3A 4NNOA 3AR4A 1JLLB 4UCWA 3I37X 3FOAA 1JECA 1PD1A 3RUCA 1UFVA 3T1VA 5IDYA 4YP6A 3VUEA 3A1VA 3KXIA 4EATA 4INZA 3KKZA 3BICA 1E0DA 4GX1A 4B34A 2EFEB 4JOQA 1J2EA 4TTIA 3BB3A 2ZYGA 3SFVA 3GUYA 3WJ2A 3U6KA 1DO8A 3LWBA 1Q0ZA 2Q5QA 4FJ1A 3F5SA 2PBFA 4RO0A 4IMJB 4YJHB 4JITA 2IYQA 1UJ2A 2B3DA 3I6ZA 1YK1A 3O2SB 3NI2A 4NZZA 3U3JA 4KIWA 4DHWA 5KYNA 1VSUA 5FNVA 5F51A 3UMVA 4J9UE 4JSTA 3MJDA 4BUJA 3DBLB 3I2IA 4HQOA 4AQ7A 2DFKB 4JIGA 4OLAA 1H1TA 5IW8A 5DSTA 3KQOA 1L4LA 4D26A 4D8UA 4MWEA 1BE8A 2X8WA 4MQMA 2Q8PA 4Z9BA 5I9MA 2QAGB 1CHDA 2Z4TA 1T13A 2GZHA 3VH4A 2FX2A 5JNVA 3ZJYA 4B4DA 1XJQA 2CJXA 1PO7A 4YCNA 2C42A 4O1HA 1O96A 3RVQA 1WX1A 3KT3A 3V4LA 1AV6A 4CE6A 4LJSA 4JSYA 2CL5A 3QWAA 1BWRA 2YXLA 2HRZA 3DBVO 4G5GA 4OCZA 5JC8A 2OGTA 3CLHA 3MQ4A 4ISBA 4LXXA 2A84A 1C7IA 4DN6A 5HKOA 5AVJA 4PLFA 4C7OB 1FF9A 4UMEA 3KQPA 1CNEA 2XCQA 2AB0A 1T6BY 3V3KA 4ND8A 1M3SA 1ZN8A 4Q9NA 5HS4A 1MPXA 2VZ8A 4YV1A 2GWRA 4S04A 3RYIA 2H4WA 1IYZA 1TU3A 2QUJA 2HHAA 2YFYA 1TO6A 4MKRA 2EFJA 2CBGA 4CTMA 3A6GA 3H1EA 2BYTA 2IYFA 2IXAA 4XEHA 1T36B 1I9CA 5IVDA 2GPNA 2DLCX 1COWD 1T6ZA 1RWMA 1IXRC 3DMRA 5F64A 2WQ6A 3FFBA 2ZWVA 2QRQA 4XQEA 1XF1A 1SKBA 2PUHA 3FB1A 4GUAA 2W43A 2AXPA 4FW8A 3D6VA 4NBVA 3VBCA 2CXRA 3UJNA 1KKLA 1SUCA 2VJDA 4M38A 1C30A 4HY3A 5FWAA 2C31A 1TZMA 1KQGA 3O8RA 1LSUA 1TF7A 1PR0A 3OZEA 5AOBA 2HRBA 5CM9C 1ONOA 4C21A 4XB1A 1NZFA 1QC5A 3V1UA 2IEZA 3IVCA 3VQTA 1SY7A 3MCAA 1UQTA 1APBA 2ZIGA 3IAM1 4NJOA 4ZN6A 3W9UA 4UM9B 1MDBA 2AL7A 4YMUA 2DHEA 3OE4A 2J9ZB 1GQFA 2W6ID 1OAOA 3DTVA 5FUVA 3VZBA 5KNCH 3DXYA 1I5OA 4A03A 4J3FA 4B73A 3DHWC 3RFVA 4RLHA 3DMNA 1QDLB 3NWOA 3GLFA 1KHTA 1VL6A 3QOFA 1RAIA 2XVZA 5CPFA 3BTSA 3ABQB 2FEAA 1XFAA 3R5JA 4NAUA 4TUYA 2GARA 2UYCA 3L8YA 3OTGA 4DRYA 2Q2QA 2I6XA 4PNEA 2BSQA 2UXCB 2CV0A 4I55A 2FW0A 2IUSA 2PS0A 4I1RA 2ECQA 4YUXA 2ZRMA 4EG8A 2ECKA 1EXWA 1K3FA 2OKCA 3L6OO 5KYKA 3SGLA 1E0KA 1T4CB 1VJTA 1NXPA 1A2QA 2NSJA 3LQFA 1IOLA 2QRNA 2ZBRA 3NTOA 4R7ZA 4RNCA 1NTOA 1YJBA 4UU8A 4ZVOA 3VTAA 1R8JA 1A9XB 3AEQB 2VXBA 5JISA 5LUAA 4RZQA 1KSFX 1CFJA 2UXDB 3PHJA 4OXKA 4RXTA 2D7JA 3K09C 1JEQB 2FUEA 2P7HA 1J2TA 4C4RA 3ZDAA 2GAAA 3EH2A 3CKYA 3N5CA 3MMXA 1WQ3A 1PQUA 4KX3A 4NH4A 5ULLA 1A8HA 3VI3B 1JHVA 1SPXA 5KZMB 4HZIA 2LCIA 1J5PA 4ZP1A 3QG5A 5EXXA 3STTA 4TYNA 2R44A 4AZ0B 5B7NA 1I1QB 1FNBA 4IUYA 4H6XA 1F20A 3FMFA 3UICA 1E2QA 1P44A 4I8IA 3LYAA 1CRWG 2ZATA 4FGJA 4HNAA 4V3CA 1ODTC 5I45A 1QBKC 3BGSA 2BJHA 1U94A 3BSFA 1GPKA 5TPZA 4LBWA 5LBTA 5TPWB 3RRZA 3CLRD 4FT2A 2W4MA 1Q92A 4R51A 3KWMA 4YRCA 1TD1A 1PW5A 5SZIA 1E1QD 2GCOB 1TM4E 2YWGA 1Z0FA 3OH8A 4UBLA 5EZYB 5A0TA 3ORFA 3BDVA 2C07A 2NUPA 1LC0A 3NBUA 4I66A 4QASA 2WIFA 4ZJZA 5ED0A 3W5HA 1M2FA 5IABA 2B1JA 1R4ZA 1FP1D 1SKAA 2LIPA 1T9HA 3LUHA 3N2GA 4JLMA 4RPLA 5BUCA 3MHPA 4H77A 4HK4A 1DIBA 1MQ8B 2AK2A 2CL0X 1DWOA 2WUVA 3Q88A 4YMGA 1NWHA 1RVV1 2XQGA 1NW7A 3DD1A 4M8IA 4M7PA 4U5XA 3E7DA 2NVBA 1P1JA 4LXTA 4YC7A 1JBEA 1TT5B 2DFPA 3UAXA 2A8YA 3GOHA 2JGFA 2ZWMA 4BVHA 2BMJA 2C97A 3OLYA 1VYVA 2F1JA 4BLVA 2VYNA 2D8MA 1U3WA 2DQKA 3D2BA 3DA8A 3AW8A 5CDTA 1T43A 4ZAYA 3HWWA 1AXEA 2NYRA 5DGCA 1YI0A 5BORA 4EY7A 1Y5RA 3AEYA 3ESYA 2MYNA 3F5QA 3WS7A 3ZU5A 2WAXA 2XHZA 2CNWA 3A1FA 2FFRA 2M2IA 2XTAA 5ALSA 2WTXA 4RTMA 3KWLA 2VAMA 3P2MA 1NJ8A 2RK6A 4M9QA 5AI9A 4DPLA 2WNSA 5LXTA 4JBHA 3U3KA 1CR0A 1F4LA 1ZGGA 2IBTA 2PL3A 4DT1B 4AY6A 5HWSA 5KNDD 3RVLA 4ER0A 1JUDA 3PCRB 3PC2A 4KE9A 3G2QA 4R9SA 3DFKA 5EE9A 3QKRB 1N33B 1A97A 2HRQA 2VWGA 3VNBA 1MA3A 3KDSE 4Y1FA 2EVWX 2G88A 3EODA 3GEGA 3UUGA 2HEGA 2IZ7A 3F8SA 3E0XA 2H00A 3EVFA 3KUUA 1SXPA 3QVSA 1EGVB 2EX1A 2FKNA 1H2XA 2HD4A 1SCJA 3A37A 3GRKA 3NIGB 4AJ4A 1JHYA 4ZMRA 3PFHA 5BV8A 2Y71A 2A9PA 3QPWA 4PZLA 4C9BA 4F45A 2ACVA 1NIJA 1R9NA 3GLQA 1B1CA 1E9CA 1DKPA 1QE3A 3BORA 1PL6A 1QOQB 3U1TA 3C3WA 5KTPA 5A62A 3GLFE 1KYWA 2BGTA 3AUUA 1XA0A 3LT0A 3MIZA 3TTUA 3WBKA 4ZI7F 3NTXA 3VSDA 4BNFA 3A2KA 3OHPA 3HBAA 4XPZA 4IRMA 5FRDA 2OO5C 1DOZA 2JB9A 2IS2A 3FMVA 2F43B 4BNGA 3ICPA 3P2YA 2ZUCA 5KOHB 2CJWB 1BZYA 3GELA 5G41A 3FUWA 3CVUA 4G4SO 4R6WA 3GMTA 2POQX 2JHPA 3CNHA 5LDHA 1SU6A 2X5OA 3DDWA 3MCZA 4WUVA 5CLIA 1SIBE 3TKAA 3WRYC 3WLFA 3CG0A 5ENVA 3NOXA 1ZY2A 2G07A 1SUDA 3UXHA 5FIUA 5H81A 1C3VA 5I4BA 1J0BA 2FXIA 3DOIA 1V9LA 1YXMA 2ZTHA 3CH5A 4N01A 3RIXA 3U9TA 3AP2A 4TQAA 2W2OA 3OKFA 4CV0A 4NFSA 2IVFA 5HF8A 3U4HA 3N2IA 5LLDA 1EXMA 1UQUA 5EYPB 3GQBA 2W2QA 3PA8A 3EIUA 2XOEA 1M72A 3AJDA 3AHHA 3H5TA 3RDPA 4HWTA 3H42B 3WK4A 3PF9A 4ENVA 3SLKA 2QBYA 1NV9A 2NZUG 4HLQB 4ICIA 4QOSA 3RTEA 1K8YB 5GGYA 4PXSA 1C1DA 1D6JA 4E1AA 5AUNB 2I78A 4BFXA 2P65A 2QLMA 3KCNA 5D1NA 1Q95A 3B1JA 3M0EA 1RHQA 5I9TA 5IH3A 4ZQHA 5K3SA 4ARBA 2XR1A 5F1OA 1XLTA 1QHNA 4OIFA 1N1GA 1LRLA 4EY5A 1VJ1A 1XMJA 2WMDA 2ZRPA 3S1SA 3A9CA 4C43A 2XD4A 3FPHA 3VPAA 1UMCB 4PHFA 1OZAA 1ZRHA 2HCTA 2CLCX 4Y1RB 4JZKA 1XUOA 4CTJA 2QQ5A 1I0LA 1R5BA 3AZPA 3QF4B 3ZHZA 1RQNA 1ZGBA 4WLVA 3MGAA 3T5BA 4D0LB 1XZDA 2RGUA 3SXJA 3T5AA 1P61B 3HE3A 2WAMA 5BPHA 4UHKA 4W7SA 5IZCA 2H7YA 3UYKA 1IVNA 1B8NA 3IT3A 1KY3A 3AVQA 1O8CA 4X8HA 5F2EA 3THSA 4F4JA 5A3RA 4NXNB 1RS0A 3LDUA 1R0YA 4X61A 4FYPA 2QLLA 2VSXA 3OLWA 1YRQA 1RLOA 2DKNA 3E5NA 1DIOB 3KO8A 4MVJD 2TMYA 2Q28A 2QRPA 2PH7A 3E7PA 5J5VA 1AKTA 3ENNA 3X2EA 3R9XB 4DBLE 4QM6A 5BSTA 2H2AA 4UHJA 4WNIA 2O20A 2G82A 3U9LA 2RGYA 3K70B 2V6GA 3KQVA 2Q6OA 1A82A 2QNBA 2FGKA 3F90A 5EWMA 3T9BA 1BHJA 4PSAA 3WYCA 3DFZA 1MN6A 4ME6A 4XJXA 5REQA 2GQ0A 3DHEA 4GX5A 4XWOA 5C4MA 1ZM3A 2P67A 1OBFO 2RDMA 5CVJA 1XAIA 4MMYB 5IAAA 1AJEA 5IN5A 4A0GA 2E4UA 1PG2A 1YSCA 1SG0A 2X5JO 3CR3C 4YV2A 1CJCA 1V25A 2H2FA 1LPMA 3QBVA 4GIBA 4QRIA 1ORRA 5AVKA 2EERA 4UAGA 4ZHQB 2XVMA 1UFQA 2AF3C 1E1RA 2LIVA 3NTLA 4GUDA 4WLOA 3L49A 1Z6XA 2UZ1A 3GPDG 4X1KB 4X93A 4C7KA 3NR2A 4MGZR 2HK7A 6ABPA 1TPZA 2OTCA 4XLTA 3OIGA 3TPFA 4RJKA 5JWOA 1XA3A 1R12A 5GV8A 5HJ7A 2R5NA 1SK8A 2H5EA 3V4SA 3DEFA 4KRYA 4DZTA 4CUKA 4RK1A 3RUDA 5KWEA 3H5RA 4FHZA 4PLVA 2PJDA 1X1DA 4KMSA 4JQSA 4TM7A 5AWFC 4J7UA 2WJWA 1ORDA 3AOEA 4GVPA 1E9BA 1KY4A 2BCEA 5LNK1 4HZGA 3LDGA 4EW6A 4N8EA 2BTEA 1W87A 3L82B 1F4PA 5EE1A 4LHSA 4IDGA 1BKSB 2SKCA 2XRFA 1CF9A 3L7KA 5JJCA 3TOVA 1Q7CA 3IHWA 1MV5A 3O2QB 2UUPA 4RIHA 3LBYA 1DBSA 2DPLA 1LS6A 5GMOA 3RS2A 1WQ1R 4FI3C 4L8LA 3UV7A 5AVOA 4G36A 4R2WA 4E5DA 4W5OA 3BFXA 1WBDA 2I6QA 2V0GA 3P2KA 1D2CA 4G4SP 2OCAA 3LUBA 2I8AA 4JL8A 1TJYA 4J0DA 1BJRE 1RWWA 1CSEE 4ID3A 1RHJA 3T3NA 1Z2DA 3ET4A 3P9NA 5E2AA 3TM4A 4C89A 1VFPA 2SKDA 4Q9AA 3TGPA 4S1TA 4JUIA 1C4WA 2E82A 2V5UA 4W7HA 3WOHA 4KRFA 4RPJA 1VPDA 3AUKA 5MGNA 2GM3A 1G63A 1IMOA 2ZI9A 4LCJA 1S8FA 2ZRBA 1U1EA 1H05A 2QDKA 2ISSD 1FTYA 3NTVA 2GNAA 3ZHQA 4M88A 1D6SA 5A4KA 1WJGA 2FJ0A 4BZZA 5L45A 2OORA 3MMPA 3FSGA 2X7JA 1HT0A 3QPVA 1SB8A 3PXDA 5A03A 3HI4A 1KOGA 4ZC1A 1CJKC 4P3NA 3UFBA 3GD5A 1P0QA 3R6DA 3RFUA 1CJTC 2JHGA 2QVXX 3EWAA 5ELLA 4LYFA 1D07A 3FPAA 4XW2A 1TADA 2GNPA 4GOKA 4MDYA 5FI1B 4RL4A 3KYBA 1VHWA 5CIYA 2BFPA 2AXNA 4YV0A 1HYQA 2WD8A 1QV9A 1CETA 1MTOA 2F4NA 4TVOA 5AJYA 4LEIA 2PXCA 1MRNA 1P39A 5EMMA 2J0SA 3JAWB 4UBNA 5JBIA 2Q62A 4MW9A 5KYWA 4WY5A 5ADUS 2I9KA 2G40A 1R9GA 1E1YA 1EVIA 1JPNA 1Y7PA 2J67A 2O23A 4JC8A 3QVWA 4KQ1A 1V26A 3FWHA 1KRWA 4V38A 2XOKD 3HC7A 2H54A 4KLCA 4ABTA 4LF8B 3UANA 1NPYA 4K9SA 4NU5A 1FS5A 3TK1A 1VRWA 4F6CA 3OT1B 5AICA 4DSTA 1KK3A 1F51E 1QLJA 3EXHC 4EECA 6ADHA 5CH5A 3SSOA 2CBZA 5ILQA 4B83A 4KB5A 3GRRA 5JCOC 5A2GA 3C3XA 2HU8A 2JLYA 3LFTA 1GRRA 1QH8A 2P2ZA 3A27A 2G28A 2JZNA 2XMDA 2VF4X 3NB0A 5TB5A 2Z4RA 5CDFE 1E18A 3HU5A 2HMUA 2FJUA 2H11A 2JBWA 2ZZKA 3AP1A 3IVRA 3QXJA 4MVJI 4EY6A 5EOVA 3VHQA 5HKLA 1JBKA 1DUSA 1JJFA 1YUNA 4MP6A 4NMHA 2R8OA 1VHTA 4RCZA 2JIMA 3EFBA 3IJEB 4D98A 3I32A 3LQQA 1PT7A 1D2NA 1J99A 3A10A 4JR1A 4EF4A 3O84A 3F3MA 3UJ6A 1H2FA 1QIHA 4X6UA 4HWRA 1V3VA 3U62A 1CDZA 5SY6A 1FXSA 4RMGA 3E8MA 5AM0A 3U3XA 4DLSA 1QNFA 3AUSA 5B3KA 3S68A 1JZTA 1G8AA 1TC2A 1WNTA 2I03A 1N2HA 1FXWA 1W1UA 3FPFA 3IP1A 4R2HA 5LN1A 1MT3A 5CPBA 5I7WA 4J1SA 4JU8A 1ACJA 2LDBA 3UKDA 2H7XA 2ZULA 1JLLA 3DZ8A 4GC9A 1V5FA 2I71A 4GNKA 2IS6A 1UKZA 1ZD2P 1VRCA 3CIFA 3WWEA 4CTOA 4YRIA 3GA7A 1J4AA 4LV8B 1TGYA 4I5FA 4YPFA 4XFKA 1LWOA 3I6YA 3HYNA 3SP1A 3V97A 4EPRA 4WBNB 4ZIRB 4EMBA 3PXXA 1XVAA 1CX9B 3DS8A 4BGEA 4UNNA 4HF7A 4LSWA 1T5TA 2O3RA 4PG7A 2O8FB 2FDRA 1P74A 2YZGA 3M33A 1JALA 4BRUA 1TEVA 5KOIA 1YJAA 4EGSA 5LQKA 1T2EA 4LK3A 4Y2PA 5AVQA 1SOWA 4DFDA 3FVWA 1YRBA 2JARA 2QN8A 4KQMA 3BXHA 2CXTA 2DQ4A 4E4RA 2ERXA 3DV0B 5D5PA 3DWIA 2VXYA 3TUIC 1I3CA 1P5ZB 2FSVA 5LJLA 2CV1A 2PQ2A 4ND4A 4D9NA 2UYOA 1T4MA 5AOCA 4K28A 2FQWA 4OM7A 4UPDA 4MR8A 2CLOB 2NXNA 3E9MA 1Z6GA 2OZVA 2MYTA 3CPJB 3MN1A 2WTAA 4GHWA 2V03A 4PGFA 3DZHA 4PPGA 4MKIA 3OA2A 2YQZA 3T9FA 4MR8B 5BYAA 3B7WA 3EXIB 1Z4JA 3BK7A 1QCYA 3IIJA 2J6CA 2VK8A 4PYLA 5DASA 4Q7QA 2FEPA 1HLGA 1DTEA 1HY3A 3P26A 4Q1AA 1NURA 1KJQA 4L6IA 5KYTA 2NLOA 5EERA 1CJMA 2XUDA 1BQEA 3QMWA 4MR9B 3PR1A 2C58A 1G20E 3H3JA 3R5FA 4BS9A 4CF4A 4WACA 5CNIA 1LPSA 3PDJA 4OMCA 1U0SY 1O5OA 2M6RA 3KVNA 5G4LA 2JA2A 4ES6A 1USWA 5D7BA 4MV1A 5TQVA 2O7QA 1BX1A 3UWPA 4MIYA 2FSUA 4HSGA 4YJ3A 3LBFA 3MWKA 3UHPA 5DCLA 4WOKA 4E5VA 4EYEA 1KS2A 4MQLA 2KJQA 4MWGA 3UPDA 1SBHA 3IR7A 5A3QA 1JQJC 3ANMA 1FFSA 1OE0A 3FWKA 3GP5A 5K8VA 1W4CA 3VSAA 2XMZA 4B0PA 4N7BA 5F7JA 3TZEA 2BFCB 3F9IA 1KZYC 3LV8A 5K3FA 1Z5WA 2GAJA 1I1OA 2AN3A 4ECEA 2R4UA 3DCIA 1WS6A 3PI6A 4QPCA 1DV2A 1VE3A 5EP4A 4UQLA 5LJIA 2F1OA 4ER3A 3OETA 3DV9A 2P5TB 4OJNA 2IHNA 1KETA 2WIAA 3I4FA 1QAOA 3DKVA 1YBFA 3IDZA 2B69A 1PDOA 5INTA 4DUPA 4WV3A 1ONSA 3WWDA 3A1UA 4G1UC 3R76A 2QTNA 2XSZA 3GA5A 5MN5A 2VNJA 2VNIA 1XRRA 1Y5NA 2E49A 3KXKA 1TAGA 4K2HA 5DN6A 1JTFA 4EP1A 4RK0A 3L4KA 3LCJA 2QZ9A 5JSHA 3MCVA 3ZGXA 2I22A 3VZRA 2I87A 2FR8A 5HP4A 2ZIZA 1WXEA 3EGDA 3BDAA 1EVLA 3U0BA 2Q1UA 3COVA 3ZCPA 2OFOA 4GI3A 3IB6A 1XF9A 4FXPA 2D1FA 3G5LA 1TMKA 1Q1GA 2HFJA 3KV3O 4RK6A 3ZR4B 5F21A 1S02A 1SBNE 3SZOA 3NCHA 4U2FA 5K8IA 3GLTA 3IQFA 3UN1A 3ZE6A 4GT1A 4M83A 5KINB 1W5AA 1PZFA 5LD2C 3N87A 4M0EA 3P2EA 4WNCA 4MWSA 3KWFA 4TLMB 4R6XA 2R5WA 4HGNA 2XUAA 5TMBA 3DD5A 2ECFA 2JVIA 3KFVA 3PTZA 1QP0A 3D9QX 1AC5A 4LI3X 3HPQA 3H2ZA 1YA4A 4B8YA 3UGTA 3CNLA 5TF4A 1GQSA 1UC8A 2HYDA 2JJQA 4C3VA 1TYAE 4K0RA 4KO4S 4JI6B 4LVNA 1S89A 4RD2A 1OLSA 3RVBA 4EF5A 1VA4A 5K4AA 4W9MC 1JNXX 4X65B 1JEYA 4BQFA 1B00A 1U7OA 3N53A 3VR2A 1QGOA 5A6SB 4LXGA 3U2QA 2H9AA 2ATXA 5EKUA 3CN9A 1JSCA