4JASB

Structural basis of a rationally rewired protein-protein interface (hk853mutant a268v, a271g, t275m, v294t and d297e and rr468mutant v13p, l14i, i17m and n21v)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
121
structure length
120
Chain Sequence
SKKVLLVDDSAPIRKMVSFVLKKEGYEVIEAENGQIALEKLSEFTPDLIVLIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/signaling protein
molecule keywords Histidine kinase
total genus 39
structure length 120
sequence length 121
ec nomenclature
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4jasB00
2CWDA 2MYPA 1NTRA 3B2NA 5IX8A 4PZ0A 1PNRA 2RJNA 3ILYA 4QYWA 2HQBA 3Q7SA 5JS2A 4MS1B 4NCAA 1BA2A 2HQOA 1K66A 3UK0A 2NZUG 4MPTA 4Z9AA 4RK4A 2QZJA 3EGCA 5I4CA 1OXBB 4Z4FA 3A0UA 3HJFA 1LJUA 3TMYA 4N47A 3SNKA 5FWXA 3OLVA 4YLEA 2JCGA 2A9OA 3EQ2A 2LPMA 2IPAB 3CRNA 3N8IA 1K68A 4ZMRA 5DTEA 3L49A 3LUFA 4EY3A 2FMIA 2WY2D 3N75A 1NXWA 4G97A 3IP6A 5EWLB 2ID9A 3H5WA 4ZPJA 4EGSA 1DBQA 4Z9BA 2MSWA 3KCNA 1M5UA 5JNUA 1D4ZA 1ZH2A 4MLDA 1JLKA 3KJXA 2GI4A 1DP4A 4MQFA 1ZY2A 4RDCA 3O1HB 4EYKA 1JHZA 2HQRA 1C0EA 1VLZA 5FWXB 4QICA 5B3JC 1Z25A 1Z15A 1DCKA 2F8TA 2FVYA 2L18A 5DGCA 1KGSA 1CYEA 4KQCA 2PUAA 1U0SY 1Z2DA 2IOYA 3KYIB 1ZVVA 2RGYA 3JPYA 2IKSA 2QVCA 3MA0A 3EDCA 3TO5A 1RXIA 4LDZA 1DG9A 4YGXB 1LK0A 1USGA 2HSGA 2QV0A 4LZLA 4MS3B 1S8NA 2QSJA 4ETNA 1SXGA 3EULA 3QX9A 1ZDMA 3UUGA 3LUKA 8ABPA 3I5AA 4O1HA 4ETMA 1RPJA 3FFXA 3CS3A 3EAFA 3RVPA 4CBVA 1RXEA 2E4XA 4GPAA 4L85A 4MYRA 4WUTA 2FXIA 3T95A 4Q7EA 2LP4Y 2JVIA 2E4VA 3NBMA 3GBVA 1QP4A 1YTUA 3D8UA 3E61A 5KQGA 2QR3A 5KQLA 4OLBA 3I45A 3R0JA 1DRKA 3HXMA 4TLLB 5D2CA 3OMWA 2E4WA 3ROTA 3T8YA 2MSKA 2NUBA 4RXUA 4KK4A 1GUDA 3C3MA 4YCSA 2B1JA 2PLNA 3MQ4A 1USKA 4FE4A 4EVSA 5TQJA 1NXTA 3H5TA 2JVKA 5FBHA 1P8AA 1Z12A 1LJLA 4MQEA 7ABPA 2NT4A 2H0AA 4RY8A 2CHFA 2E4ZA 3RVSA 4MR7B 1NXOA 1QO0A 1M5TA 4DADA 1JFTA 4KRFA 3OQMA 3O2SB 1YMVA 4JB0A 2P9HA 4UHJA 2GBPA 5E3JA 3QELA 1QQAA 1NXVA 3HSYA 4RXTA 1GCGA 3MF4A 4F8JA 4Z4GA 4XARA 3KYJB 3MIZA 4Z4HA 5HQJA 4GNRA 3QK7A 1JF8A 1TLFA 3HK2A 1SXHA 3QLUC 3ROFA 2M98A 3A0RB 5HM6A 2FSPA 3M9WA 1YS7A 1LBHA 3Q7TA 2RJOA 3LKBA 1MVOA 1DBPA 3T6KA 2FMFA 2VUHB 4D74A 4MR7A 2VYCA 3HS3A 4YWHA 3EODA 4O1IA 4JP1A 5C5CA 4OATA 3N0WA 4HNQA 1BDJA 4G0ZA 1DCMA 3O1JC 5B3JA 1NXSA 9ABPA 1AB5A 3DGFC 3QELB 1NY5A 1VPWA 1U2QA 1QNLA 5DKFA 1Z17A 1KRWA 4KZKA 3NNDA 1F51E 3G1WA 5KI6A 3Q9SA 1EWVA 3F73A 2E4UA 5T3YA 3KHTA 1RNLA 2WB4A 4XAQA 4HNRA 1APBA 1LBIA 2YHAA 3H5LA 3HUTA 4G86A 3CG0A 3KTOA 5TPWB 4LDAA 5CNMA 2FQXA 2Q5CA 4W5QA 4PICA 5CNIA 2JBAB 2FEKA 2IYNA 4UHKA 3H5IA 3RVKA 2LUOA 2FMHA 4Y9TA 1ZITA 1HEYA 3N6VA 3OLYA 3QLVC 1YK0A 4G0OA 3DLHA 1YK1A 3TD9A 5HSGA 5KQPA 1P6QA 1PUXA 1ZHHA 2FN8A 2V0NA 4MS1A 1ABEA 1KMIY 3BRQA 3C97A 3O75A 2PJUA 3O2JA 4NV3A 5T7BA 3T38A 3QLVA 4RKQA 1Z16A 1JX6A 1RZRA 3E3MA 2JK1A 4IMIB 3DLBA 2AYXA 2F8SA 2LIVA 4YV7A 1E6MA 3L6UA 3QEKA 3F7NA 4LX8A 3HVRA 1DZ3A 1CEYA 1JYFA 4NCBA 1W25A 3GRCA 1PHRA 4RY0A 2A9RA 1TJYA 3HV2A 4Z4IA 4O5AA 2L19A 1FQWA 3QLTA 4IGAA 1EAYA 2L17A 5TQ0B 4WWHA 4KREA 4DQDA 3CNBA 4M88A 5GOTA 3IPAA 3KLOA 2PL9A 3H5VA 4XLTA 1EFAA 3OLXA 1DRJA 1NATA 4RK6A 3NHZA 3EJWA 4N0PA 2FW0A 1TM2A 2AYZA 4ETIA 3GBPA 2JVJA 2CHEA 3O1IC 2GKGA 3FFTA 1QKKA 5TPZD 1ZGZA 2CD7A 3NNSA 3OLWA 3TB6A 1I3CA 1T34A 3QX8A 2GWRA 3HDGA 1U04A 4PE5B 3CKMA 5PNTA 4G0YA 4E7OA 3HDVA 4D6XA 5JNTA 1EHCA 3LKVA 1GUBA 3QLUA 4WXMA 3SY8A 1GCAA 1GLGA 2OENG 5DLEA 4ZMSA 4IRXA 2MSLA 4MS4B 3LUGA 3CHYA 1VRVA 2N9UA 2PMCA 3IP5A 4WT7A 5EWLA 3LUJA 1YS6A 4N76A 1P2FA 2PKXA 3HZHA 4KVFA 4MR8A 4MS4A 5JS1A 3K9CA 3CZ5A 2A9PA 3H75A 4YS6A 4YO7A 3JY6A 5F64A 3C3WA 2I6FA 2M1ZA 3KLNA 3OM0A 5KQMA 3VNAA 3JTEA 4KMRA 1FFWA 3A3KA 2QXYA 4H3KB 4N03A 2IPLA 3LUHA 4Q6BA 1ISRA 4RS3A 3RVJA 3O2QB 4TMYA 4MR9B 4FB4A 2B4AA 5JNWA 5CNJA 4EUKA 4W5RA 1URPA 3HM9A 2QU7A 4H3HB 3Q15C 5IUKC 2PE5A 1A0OA 4XFKA 1BVHA 2WJAA 3G85A 2PUFA 1U2PA 1TMYA 1CHNA 4N0QA 4HYEA 4FE7A 4MQFB 4PEVA 5IBQA 3OQOA 1OXKB 2MYTA 1JFSA 1BDHA 3CTPA 4D6YA 3C3KA 1MB0A 4RKRA 4ZJPA 3LUDA 4Z0NA 1JH9A 3LUAA 1J56A 4IMJB 1W9HA 4MQEB 4Z4CA 1Y1LA 3LUCA 1Z2EA 5TQ2B 5JNRA 5JNVA 4JOQA 2IPMA 1FFGA 4G0PA 1A2OA 4RV5A 1JWLA 2R4QA 1L5YA 2A9QA 3H5OA 2FKAA 2QW1A 2TMYA 4RK5A 5KWSA 4P1ZA 1NXXA 3LFTA 4RK7A 3HO1A 5KC8A 1JDNA 2P4UA 1MB3A 4RWEA 4F11A 4NICA 2WMYA 5BRJA 3MYYA 3GT7A 3P9YA 2E4YA 1YIOA 4OTZA 4YP9A 2PUBA 3CG4A 2BGGA 5TPZA 2ID7A 3H1EA 4WZZA 5EWMA 4TLMB 3LTEA 1QP7A 1R8JA 5IULC 1PEYA 3BRSA 1YMUA 1EWKA 3N53A 4JAVC 1WETA 5EWJA 1XWWA 4IILA 3DBIA 3RVRA 3RVMA 1ABFA 2PAFA 4LE1A 2FLWA 2OQRA 4LRQA 1DCFA 2R47A 3SM9A 2PL1A 3F6PA 1A04A 1NXPA 4MR9A 1ZGGA 4DN6A 1KRXA 4S04A 2HPHA 3SQNA 3KS9A 4MGEA 3W9SA 5C5EA 4YRZA 1E2BA 3GWGA 3RVLA 1SRRA 3ILHA 2H3HA 3IPCA 4MAAA 1C4WA 4KK3A 4YR7A 3KKEA 1ISSA 5TPWA 1JDPA 4B09A 1DJMA 4KPYA 1BAPA 2FEWB 2PUCA 4IF4A 3HEBA 5JNSA 3FMVA 1USIA 1U8TA 1MIHA 3H6HA 3EQZA 3JS5A 4KV7A 5FWYA 4EYGA 4PYRA 1Z26A 4KNYA 3M9XA 4JA2A 2ZAYA 1DC7A 4G0QA 4Z99A 3TX6A 5IUJC 4EVRA 4OLAA 2DRIA 2IPNA 2JB9A 5IEJA 3NHMA 1BDIA 4NQRA 2YHBA 3GA5A 4W5NA 1QPZA 1DBWA 1UDRA 3OO1A 1B00A 2MYNA 3BBLA 3VNBA 4E7PA 4MRMB 1VKRA 1SD5A 4H60A 4F3TA 1MAVA 3IP7A 2J48A 3FFWA 3M6MD 5ED4A 3H1FA 3BILA 4RZSA 1YVUA 2GX6A 3HCWA 1JYEA 1ZH4A 2FEPA 1ZESA 2FQYA 2FN9A 1JBEA 4RY9A 4Z4EA 3HUUA 3IP9A 3IDOA 1PNTA 2VK2A 2VUIB 3MMNA 3OM1A 6ABPA 1RZRD 4RXMA 1SXIA 3CZCA 3MM4A 4ML3A 1D1PA 3Q41A 1E6LA 1E6KA 4W5OA 5BQ3A 4N41A 1FSPA 1XHFA 3CU5A 3H1GA 4XXHA 1ZAYA 4XASA 5CHYA 4EYOA 5BR1A 4MR8B 2R25B 4G0XA 5FBKA 2JBAA 3C6QA 3Q7RA 5EWJB 3RVNA 4EYQA 1QO0D 4QPJC 3I09A 4W5TA 1L5ZA 4Q6WA 3DZDA 3N0RA 1D2AA 3GV0A 4ZYLA 2PUGA 3I42A 5ABPA 4EVQA 3O21A 2WRZA 5DCLA 4S05A 2L2QA 3D02A 3OLZA 1QQBA 1Z18A 4RSMA 5TQ0A 3URMA 5KC9A 1XHEA 2MYUA 2ZWMA 1D5WA 3FGZA 5FWYB 5GQSA 3UKJA 4TN5A 1ZN2A 3CFYA 2WWVD 3OO0A 2FLKA 5BRAA 2RDMA 5IC5A 1D1QA 3FDFA 3LOPA 4OBBA 3KG2A 1JL3A 2PUEA 2FTKE 3S99A 2FQWA 3JPWA 3CLKA 4P98A 4KFCA 4LE2A 2O20A 3A10A 1AB6A 3F6CA 4QYMA 1JFVA 3JVDA 3BREA 4MRMA 2FMKA 3KSMA 2WJWA 1H9CA 1M2FA 1QMPA 3N0XA 4KQ9A 6CHYA 1Z13A 3OMXA 3OQNA 3RVOA 4OG2A 1IIBA 2HJ9A 2JRLA 4RK1A 4G0MA 4WXEA 3SAJA 1TVMA 4F12A 1M2EA 3QEMB 2NZVG 2QVGA 3NNNA 3DGEC 3O74A 2KYRA 3GYBA 2LBPA 4LE0A 5HKOA 1DC8A 4MLCA 5TE9A 2XDYA 3QEMA 4RK0A 1F4VA 5IEBA 3SG0A 4F06A 2R48A 3JVIA 4HNSA 1FFSA 2PUDA 5IUNC 4JASB 1P6UA 4MS3A 5CNKA 3RH0A 4L4UA 5EWMB 3RQIA 3RVQA 3GL9A 1PEAA 3H6GA 4RU1A 1QP0A 4JB2A 5TQ2A 1EWTA 2IDMA 2X7XA 3K4HA 2W42A 2NT3A 3LMKA
chains in the Genus database with same CATH superfamily
5LXTA 4CQLA 4U2KA 5I7UA 3RHSA 3QWAA 3EIOA 4J16A 3ZZUA 1DAGA 1NTRA 4LVNA 1PNRA 3IA2A 3HMQA 1RI3A 3LX4A 1EA5A 4US0R 3STWA 1QWSA 2SECE 2HQOA 1WXWA 4CCSA 3QOFA 2HF2A 4O8CA 3HGTA 3A3NA 4RK4A 4F4CA 3V7FA 2RHJA 3EDQA 5E7QA 5MF6A 1D7OA 1OE0A 3WFIA 1G55A 3ZVRA 5D3MB 2Y1GA 2Z95A 1KY3A 4LPSA 4B45A 2O19A 4X61A 1DPFA 4Y6PA 3F9CA 1FMJA 4E08A 2HNBA 5J4LA 2QM0A 2Z2XA 3LXUX 2P0EA 1VKOA 4YLEA 1S4QA 1PJCA 2O0JA 2GKOA 3M6VA 3MTEA 3KWMA 3AL0C 5AVYA 4KQEA 4X64B 4K8RB 3T35A 1A9XB 1JHMA 1S2MA 4MO9A 5LSAA 3P9KA 4FMPA 2IITA 2QJTA 1MC4A 1FFEA 1JNYA 3QA3E 2YS7A 5JNLA 4C22A 4JVOA 3IKTA 1J2YA 2VP4A 3NZEA 3Q6MA 2NZ8A 4Y2GA 3ZBUA 1DBQA 5BN3B 4X93A 3N39C 1FLAA 1G8GA 3IV7A 3KCNA 3RWOA 1AKQA 3CB2A 1D4ZA 1OBFO 2B8NA 4G84A 3ZHSA 4D26A 1ECJA 3SCZA 1DP4A 3BIJA 1LNZA 1O6FA 2Q6TA 4PV7A 3WLLA 5HOEA 1J8VA 2QVYX 3I2KA 1E69A 2C3PA 5LR6A 1NQ5A 4BZPA 1P3JA 4GL2A 1FMTA 4D3FA 1G5QA 1XEXB 4XW2A 4YHHB 1IVNA 1Y4ZA 4KQCA 3VDMA 5E95A 2Q7XA 1VA4A 2W6QA 1YIAA 4OYYA 4DYHA 3FOEC 5FB3A 1KC1A 3OJOA 2RJ3A 3CH5A 2I2FA 4ZOLF 3K0AA 3WLFA 4L0QA 1QIGA 4YMIA 3ZY2A 2CBXA 1R0ZA 2GF0A 4BNUA 1ANKA 3PDJA 1YDHA 4M37A 3WKAA 2BHLA 1A96A 3UZUA 3GT3A 2QT0A 3D6NB 4HMQA 2GR9A 3L8FA 3ANLA 4O08A 4P80A 4UM5A 4R71A 3BERA 3NJRA 3GRZA 3F46A 4D0RA 2C3YA 2G5CA 3BXFA 4Q21A 1DQNA 3L9WA 4LGVA 4EB6B 4BZXA 5LQSA 3PB3A 4O4LB 5DP2A 3ZTYA 5BV7A 5C4MA 1Q2XA 2VPZA 3U9SA 1ORHA 3TINA 1G8YA 4WLEA 1KEEA 1X8LA 4JEHA 2XB4A 2X86A 1BVYF 4AI6A 5JISA 1AE1A 3HGQA 4FFWA 4HS4A 3DHYA 1R2QA 1Q7TA 5C7YA 1ZMBA 4AC9A 5EJEA 3DMTC 3O26A 2O14A 4LOJA 5EEHA 2ZM6B 4PO1A 1ZEJA 3ZLUA 2WJ3A 1GPYA 2QRHA 2Y1LA 3R7LA 2VT6A 1MPTA 5CH5A 1J1IA 4YV2A 3H05A 2E18A 2FSVC 2WFZA 2ZKLA 4LYGA 4MJXA 4DNFA 1TQHA 2P2LA 5P8WA 1SNYA 1H05A 2OM6A 1YR7A 1YHYA 4Z7QB 2Y2UA 1P8AA 1TUBB 9GPBA 2Q8QA 2CEKA 3GFGA 3PNVA 1P1JA 1GYRA 2FR8C 3CW9A 3EOAI 2H0AA 2VDQB 4KAFA 3W3ZB 4KBGA 1YNOA 4UZEA 2OZVA 4HQRA 3WRYA 4CT5A 3K6SB 1QCDA 3L07A 3OZRA 4MR7B 2D62A 3A31A 4FMCB 1QO0A 1YASA 1M5TA 3C6KA 3HB1A 4R1PA 3K0FB 3KZ1E 1DMSA 2Z1NA 3OQMA 3JATB 3ROMA 1Z2OX 3R6LA 3W78A 2WTXA 1Z22A 5EUMA 4DKXA 4JEIA 1JS1X 1KO4A 3QNUA 3V7UA 5GTDA 4W99A 4RXTA 1I7NA 1QGUB 1E60A 3HH8A 3KYJB 1W88A 3P20A 3IBGA 2ZSDA 1LQ2A 4WX2B 4XARA 4ZREA 4BP1A 1OH6A 3F7TA 4D46A 5B57C 1ZBQA 4E5UA 3CRZA 1ADFA 1NSTA 1Q14A 1HRDA 2O2IA 2P91A 2YWHA 4G6ZA 1FJHA 4NDZA 5LBTA 3RFXA 3UJ3X 5J2UF 5IAJA 1VJCA 4YDSA 3Q7IA 4ZT4A 5AVSA 2GUGA 4D8XA 5J4HA 3OCZA 1RFLA 2XT0A 3W4IA 2XGJA 2EBUA 2VUHB 1JU9A 1IWPB 2BEJA 2ZRFA 3GCDA 3T9FA 1NU6A 1UPUA 1G2PA 2ZTVA 4L4RA 5EHXA 3H5AA 1I7PA 5AIBA 3RRZA 2QGNA 3ZXXA 1QORA 1R4MA 2H4FA 2FN7A 2GCEA 2QMQA 3HYLA 2QE6A 4W5JA 2HGSA 3QELB 4YQZA 3ON5A 3RSLA 1OX5A 1KVQA 3IJRA 5AUQA 1LDBA 2P7HA 3LBAA 1T3SA 4CKZA 721PA 4GPBA 4BV9A 1AV6A 3N2YA 5ALSA 3LRXA 2ZTSA 1S6YA 3CF0A 4HNRA 1RXSA 4K5QA 4CR6A 2HJGA 3VH3A 4Z1MD 4MW6A 5A3QA 1RXWA 2Q5CA 2X5OA 5FL7A 3W5HA 1H2RS 4IHJB 5D01A 1LPPA 3FJ1A 4N9QA 1RJ9A 2H7VA 2RG1A 1ZD3A 3SSOA 4UEWA 4OJTA 4NKRA 3BB1A 3M89A 3D9QX 1XDWA 3H65A 1YWGO 1V5GA 1JTEA 2VF8A 4RCVA 3KJFA 4H9GA 3BXGA 2FW6A 3NRCA 3PPWA 3RC2A 2VA8A 3BMOA 5KKCA 2NNWB 3SXPA 3FNBA 4BCBA 4F84A 1B8PA 4YLGA 4RY2A 5TLSA 2H65A 3AJDA 5T4BA 2IHNA 2RGRA 4RV4A 4FWBA 1QFSA 2OFFA 1E3SA 1EX6A 2OO5A 3SXJA 3HUEA 4G37A 4WE3A 3ZDAA 5JJLA 1U1CA 1CUEA 3W6OA 1ZK2A 4I4TF 1W25A 3FYUA 4KN8A 4ZKEA 2AT1A 2R4UA 3OT1B 1YRYE 1PGJA 3SDSA 3VR5H 5AYVA 4FW9A 4ANFA 5EJ4A 4OHYA 5GJWC 2I3GA 2PGJA 3RT9A 1JIJA 5JWOA 4IGAA 1FQWA 2J0UA 3ECCA 3Q0TA 4RPLA 5H83A 2REQA 1V6SA 3UH1A 4YMUA 4I4IA 2VHVA 3HP4A 1X14A 1B26A 1K08A 3UG6A 2ZTLA 4U02A 5KNBD 5KU7A 1NLYA 3A7DA 5K9ZA 1R50A 5B3LA 1JPJA 3PGVA 3TMKA 5JCOC 1W85B 1ITZA 3O84A 3K09C 2XA1A 1RR6A 4N65A 1E1RD 4M1EA 1M1YE 3FFTA 3ZX5A 3CLUD 1E3JA 3JARA 1QKKA 3K4QA 1O94D 2JJ2D 2A1UA 4A1OA 5BR4A 1SKQA 3HDGA 3PXBA 4M2LA 2YFQA 2A3NA 2X1VA 3KXDA 2CLSA 1KVRA 1CFJA 1QIDA 4EO7A 1G60A 2WSYB 1QVVA 5HJ5A 2P27A 3LI2A 1EX9A 4URFA 2Y0DA 5EIBD 2GZAA 3MMSA 1CT9A 2F1IA 3LUGA 3CHYA 2N9UA 2HBYA 3I0ZA 5IC4A 1G8FA 3JR7A 3O82A 4PAMA 4RHEA 3WHIA 1PSWA 2JLWA 5AI0A 1EK5A 3K30A 5IK2D 3RRFA 2BW0A 3WMWA 3ZJTA 4RQBA 5JS1A 3MWEA 4MI6A 5IABA 2B5VA 4GDMA 3WRXA 1J2TA 5DASA 1K8RA 4P86A 3T3GA 1H2XA 4BNTA 1KS9A 4LJ7A 1SRQA 4GMHA 4L76A 1NMYA 3PDIA 4RVHA 3AINA 4F4JA 1E9BA 3OM0A 3DOIA 2H5LA 1FFWA 3D3EA 1AS2A 2X8LA 3LUHA 2IS6A 5JS7A 1KEWA 2VEDA 4OQ4A 4I9GA 4RD4A 4WKOA 3DG9A 5JNWA 4EHJA 3L6OO 4YNBA 3RSZA 3MWLA 2VXOA 5KDOA 4Z3KA 3ORHA 5DNUA 4CEJA 2ZSAA 3KT8A 4DKJA 3RSHA 1XLUA 4Z7OB 3EVZA 1JJVA 2XWBF 1G6OA 2C58A 3DOJA 3M9LA 3A70A 2IYOA 5F7JA 5L40A 4Y18A 1QF6A 3R5TA 1JU4A 4GSLA 1Q0UA 4U2DA 3LUAA 4NL4H 1J56A 4NDNE 2IC5A 4QXAA 1VI6A 2FJPA 4MQEB 1NW6A 3BCSA 4ZZ0A 1XNRB 2NYAA 3HO8A 3GRYA 5DM1A 2UZ0A 3G2JA 3NHWA 4PFQA 2ZDHA 4Y6RA 3EXG1 3IV9A 3ZWDA 2HJVA 4ABYA 2E49A 3CGWA 1NBOA 4KX3A 1GFSA 4DLRA 4UATA 1UDCA 1RI2A 3H04A 3GDGA 3B7GA 3KL4A 4TM8A 1Q22A 2G4LA 5E9AA 5FWDA 4EG6A 3LTNC 1SFRA 3L4KA 1Z36A 2G83A 1Z06A 2YYYA 4HAIA 1DDOA 3OD5A 4ZQGA 1SBNE 5SY6A 1I30A 3T3PB 4DV5B 1Z0JA 4S0XA 1JDNA 1RBYA 5U4QA 4C7BA 2Q2QA 4AO8A 3SEQA 1F8FA 2BFPA 1XXHE 1PFKA 2AMFA 1MW9X 1Q92A 2NIPA 3DUFB 3GH3A 1OUMA 1I80A 3TW8A 3VJMA 4E51A 4GXQA 3SHTA 4RTOA 3U49A 1E6WA 2CLKB 2IU6A 2IYWA 1S0UA 3C7KA 3V7WA 4LJYA 2E1PA 3U2QA 4LRUA 1OA0A 4BMPB 1HGXA 3ZE2B 3FCUB 4TS3A 1L4GA 2OGSA 2XVZA 2ZB7A 1J0DA 2QLTA 3D0KA 2G36A 5FFFA 1N2EA 4MJ3A 1QZUA 2FLWA 3DE5X 4QPDA 3OX3A 2C42A 3BGIA 5DF1A 2ZETA 2CCKA 3A7EA 4AD8A 5IDQA 1A8IA 5L3VA 2Q8NA 1OLXA 2PS0A 4F86A 2VJBA 3IR7A 1ULZA 2C57A 2EJBA 4L4YA 1I4EB 2JAQA 4MGEA 3W9SA 3TTVA 1N34B 3WZ2A 2DFTA 1U3WA 1UZMA 3G6WA 2MWMA 4UEOA 4HPWA 3CRRA 5AM0A 2Z3ZA 1ODCA 1YZQA 2DHRA 2ZWOA 2I76A 1RJWA 2HEGA 1G3UA 3OSUA 3VDNB 3UW3A 2FOIA 4Y2HA 3DT6A 1DJMA 1DQRA 4KPYA 2YY7A 2Z8YM 1WMAA 3B1KA 1ULSA 2R00C 4DB2A 5K3FA 1ETHA 1WXXA 2AFIE 3DYVA 2ALJA 2DG2A 4GUAA 2IYSA 4KFTA 3WL7A 1D4OA 2QP9X 1X0XA 1X39A 2G70A 4FS3A 4R7GA 5BPHA 5JDIC 2UUCB 5F98A 2H4YA 1WL8A 3KUCA 3VC3A 1KJJA 2EW1A 3AILA 3MCUA 4J8PA 1DC7A 4F7DA 2Q6LA 4FS8A 2NP7A 4MB6A 2HC9A 3VO1A 4EVRA 1GQQA 1NJSA 3KB2A 4DIDA 4TRRA 4Z7NB 5A04A 3OM8A 3I2HA 1DAIA 2JLVA 1OFUX 1R6VA 4PLTA 3GA5A 4MIOA 3DJFA 4RF5A 5DOZA 3R5FA 1UBMS 2HLDA 3URKA 2X2PA 4HTFA 3KPYA 1PR2A 5IKXA 2W8ZA 2VYND 3QBTA 2Q4BA 2D5CA 1ECCA 1F2TB 2D8AA 3KEQA 3L1HA 4I1IA 4FKBA 3FOWA 4LJKA 4F4IA 3ZQUA 1O87A 2ZYVX 5JO0A 4RZSA 3Q88A 1P7VA 1SQGA 2DFPA 3TUZC 3N8HA 1XDSA 4GKBA 3UAOA 3E9CA 4M8LA 4EJ6A 3TJRA 4TXHA 5ER9A 1VMIA 3A6ZA 3VZQA 1B0PA 2BEWB 3QW4B 2VHWA 1E18A 1CG6A 2PRSA 3AVQA 3D4IA 3TR6A 6ABPA 1YFJA 2RHWA 1SXIA 4O02B 1UEJA 2VJAA 2OV4A 3Q41A 3JQDA 1E6KA 1XGKA 3A9SA 2JKYA 1KMNA 4OHZA 1I33A 1QCCA 3W6ZA 1V26A 3EWAA 2OM2A 4MP3A 3LQQA 2X13A 2BWJA 3C6QA 3E0XA 3FXAA 2FZVA 3MFYA 2DXIA 1DTSA 4B3MB 1BD4A 1RPAA 5HE9A 5IDVA 3RSCA 4BWVA 1N6RA 3GGGA 4JLWA 3UWMA 3ELDA 3FPAA 2F8MA 3KFLA 1P5ZB 2H1IA 3DVQX 1Z0ZA 3B36A 3PNKA 3FMFA 1WBJB 3G2HA 1CEQA 3VX3A 3T5CA 4PPNA 2ZPAA 1RW4A 5JZBA 5ALDA 4L6CA 5I7WA 1W5TA 2HRQA 5ALKA 3ZXYA 1ZD9A 1SKBA 2BFFB 3EIQA 1BHSA 4ZCQA 1QGAA 5ERXA 4TMWA 3DJYA 3IAS1 4CKBA 3KFXA 2WAOA 5JU6A 1SC3A 1S1MA 2GYUA 1GN8A 2PMKA 1M10A 2EU8A 4R05A 5EZ6B 5INTA 1U8CB 1TYBE 4PQEA 2VNJA 4Z86A 4ENSA 2H1HA 4D9JA 3B8EA 3CE6A 2IE8A 1WV1A 1RWPA 1T8SA 2GHQA 3OWHA 1CS4C 2O3QA 2R8PA 4HQOA 3HR4A 5F4ZA 3ZI4A 1XNQB 2A0XA 3QVXA 4QFDA 3AT1A 3IIIA 1Y6FA 1IIBA 2JRLA 1PL6A 4YMTA 3BKWA 5LQRA 1PJQA 4P53A 2C0CA 1K97A 4Q3KA 4F12A 1N25A 2PZEA 3CW2A 4OSEA 3MJEA 4LXXA 4ZT3A 2DT5A 4CMHA 4PRYA 4DCMA 4YRMA 3C16C 2LBPA 5DISB 3NTQA 3LX8A 4BNZA 1EWRA 2BISA 3GCWA 4DT1A 1EUCA 2XDYA 2YUTA 2FPIB 1KZHA 2WWTA 4BMXA 2C5EA 2BBWA 3F1KA 4MS3A 4XI9A 1UKEA 1L7PA 3HABA 3RQSA 2WQ6A 3C7TA 4I81A 2PS3A 1MZPA 2Y1KA 1OBCA 2WIJA 3RAGA 1N2CE 1WVMA 2EDAA 4NY1A 4MQLA 2IDMA 2IUSA 5BMOA 1NFFA 5F33A 4Z7JA 2WFLB 3N58A 4AYTA 3K4HA 2ZJ8A 1NOKA 4LC9A 3U3ZA 3VR0A 3VNSA 4KR7A 2EJWA 2HWWA 4XLLA 1U0BB 3B52X 1XZHA 4NSNA 3BD9A 3O8CA 4E2YA 1GOTA 3DOHA 3F3KA 2VDKB 5LB2A 4S1TA 5TVKA 3V8MA 3SZLA 3VU3A 4ER5A 2V5VA 1LXCA 3FTNA 4BWFB 1BA2A 2D5BA 4WNYA 3L6EA 1VL2A 4JJ8A 3SMQA 3RGWS 4KIJA 3BS4A 4F2DA 4CQNA 5FOXA 3FLEA 1GZUA 1DVRA 2XRMA 3WQSB 3WLTA 1XPOA 3IKLA 5F2KA 2RHMA 5BOSB 1HWYA 1LJUA 2D2XA 4XJVA 5B12A 1ZRHA 5DTMA 2RAFA 2AD5A 5E6RA 2LTAA 3IPRA 1FW8A 1W8DA 2I1QA 1WB4A 4HADA 1V8DA 5T67A 4DUGD 2OBYA 1XVIA 3OU2A 1N7JA 1K8ZB 3KCQA 1ZSVA 1FTSA 3GLQA 3MXTA 2GBLA 3ADKA 3OTQA 5EE1A 2ADMA 1V3TA 3A2MA 3G5MA 3AHJA 4BP9A 4JBWA 1O6CA 3FHLA 1UM8A 3W2HA 4KGXA 1OFVA 4L51A 3IVMA 3RG2A 1L5HB 3NW9A 3LIIA 4XM1A 3V2GA 4CLRB 4NOKA 2HO4A 4PC6A 5C5IA 2GLUA 2W6PA 4GZMA 3VPHA 3F2IA 5EUQB 4XD7D 1GZHB 2XUQA 3MRTA 1X38A 4J2TA 1HLDA 4NYIQ 1ATIA 3E5HA 4JBXA 2W70A 3W77A 4MQFA 1RWKA 1CR4A 2IZ7A 2OP1A 4IUCS 3DT9A 4HYQA 3SS7X 1U1IA 3ZBQA 1VLZA 3ZVKA 3D6HA 1JKJA 3P0HA 1E4YA 5GGYA 4EHFA 2JH3A 2CW5A 5CVJA 3IS3A 4GZLA 4D4IA 5I5EA 5IT9A 1W34A 4P3YA 3R44A 4V0KA 1ADGA 4CW7A 1Z28A 2R65A 4PO9A 3ZV5A 5TMDA 3GLFA 1DO2A 4E70A 1X7HA 4W8OA 2JCXA 4GZ6A 1RWOA 3Q12A 2A1TR 4MPDA 2AR9A 2X8JB 1E62A 2HMYB 4AX8A 5JMWA 4P54A 2GETA 3PWSA 1U3FA 4MS3B 3T4UA 4K2AA 2GJKA 3L0BA 3SMVA 1Q0LA 3WL3A 2IU3A 3Q1LA 3UUGA 4DBZA 5E0KB 1RHMA 2VWQA 5EC8A 4O1HA 3DL2A 4A10A 5A6SB 2PZGA 2WQ7A 4D56A 1XQ1A 1TZBA 5DRYA 5FJIA 1QONA 4XGNA 1ZBDA 3FWNA 2H0RA 1KZGB 2JHFA 4II3A 4UXHA 3WOHA 3CJTA 1RM5A 1K7CA 5DHRA 1G41A 3DV0B 3STUA 5CEEA 3O8BA 1GCIA 1FUYB 4UFPA 1ZCZA 4I1VA 5FI5A 4AT1A 4DNXA 4PHHA 3KP1A 3IT2A 4YCCA 3QHAA 3VU1A 3OMWA 3R2JA 1XD2A 3AHHA 2H2GA 4HBZA 1QUEA 3ESYA 4DZTA 4OMFG 5B2FA 5K20A 5AKKA 1NBMA 3M5WA 2DEUA 3DZBA 4HQKA 1NP3A 2DAPA 2OBLA 2XWQA 3EGXB 2H2DA 3R75A 1KPGA 1Y9DA 4N39A 1J99A 1DKUA 4L57A 4HX9A 1GGMA 4F97A 4TSKA 3KSUA 3N5KA 4Q7LA 3KVRA 2V7QA 4B2YA 3IUQA 3CZ4A 4MUKA 2YZMA 5HKKA 2Y0EA 3IEKA 4X20A 1FTYA 1ZGAA 3S3TA 1RXVA 5FBLB 3N28A 2LDBA 1PDOA 4KYIB 4MWOA 5KO2A 2R6CA 3OAAA 1S2OA 5FLYA 3T9EA 1GQ2A 5L3ZA 2PD6A 3DVAA 1PR4A 1A7KA 2H54A 1IEXA 3T41A 4JXKA 5KHLB 1P44A 4MV9A 4NCJA 4P32A 3R7WB 1BE0A 2YNMD 1R7RA 4UUQA 1X7DA 1TKAA 2J30A 2FF7A 3FDJA 3D5TA 3I0NA 1KDVA 3TLYA 3VYUB 3MGCA 4B31A 3VVBA 3ZBTA 3Q7TA 3CUYA 4B7UA 2R96A 3N2NA 1T5LA 2W11A 2CXQA 1ESCA 3VSEA 4DIOA 2DUJA 3ISVA 4KXFB 2W7TA 1XVUA 5KX5A 4RQUA 1ISFA 3MJDA 2QTAA 1EVJA 3SLRA 4D3ZA 3OPYA 4PTYA 2I0FA 2HCFA 4EHNA 1GP2A 2WKRA 1N5MA 4YAUA 1MENA 4MHTA 2ZCUA 2C0PA 3DE3X 3KSDO 2WR8A 3QYAA 5T41A 2CLMB 2Z9BA 2CFTA 3UOWA 3QV2A 3S68A 3AI7A 3FN4A 3GVXA 4MYDA 4WINA 2E37A 2QVXX 1H22A 5AK4A 2JD0A 2CBGA 3FFBA 1PQYA 2QTHA 3K0HA 4URWR 4WLNA 1ZOPA 3FM9A 1M8GA 2O1WA 2X9GA 3ZD7A 1SUSA 5M04A 3LXMA 3KPUA 1E7RA 4DR6B 3L3BA 3ABZA 2PVSA 2LNDA 5T64A 1N6KA 2B9EA 1FZTA 2D59A 4JLAA 1BKYA 1Q11A 1DC4A 1RXYA 1NIPA 2LE0A 2VTVA 3QVKA 4BXOB 2Z83A 2IYNA 4IEEA 3WBFA 2QRVB 3SEZA 4D79A 3I5XA 3WGZA 4Y2XA 2E21A 2O2HA 1SWVA 3TPFA 1KI8A 1R6AA 1QE0A 3KYDB 3P0EA 2VDWB 3ZHXA 1AK2A 4S3MA 4JXJA 3ZU6A 4RCZA 3TAHA 1CY0A 5HJ7A 4M9QA 5C8DA 4LCJA 4QG7A 3QI2A 1SD2A 3E3MA 1PLLA 1ZICA 2SCUB 3ABQB 5EVJA 4ESHA 3M2PA 3UMGA 2LIVA 1WPGA 2G6BA 1P60A 4I2NA 4WKBA 3KZCA 4L5IA 1V16A 1YHZA 2OOSA 2OUKA 4RETA 5CT4A 3THWA 4LZWA 3FPLA 4K9NA 1FA9A 1AMNA 4EKGA 1H3EA 2X5NA 3LX6A 2ZSUA 4WWHA 2C9MA 2YDXA 2YC2C 1VJRA 1NYRA 2QRGA 1X8KA 1VQ1A 3KD3A 1OYVA 1TU0A 5TJHA 2XR1A 1O77A 3ZWVA 1RQLA 3L8YA 2NVWA 1TNDA 4CM4A 4CMJA 1IK4A 2Q9BA 4ARZB 1WAMA 2Y05A 3MWEB 1V8OA 3KQWA 3FLAA 3ORYA 2QJFA 4DIUA 3PQ3A 3ZZ1A 2NP6A 1E0KA 3V4VB 3KT6A 2GK7A 4LJSA 2V6BA 3QSYA 2Z43A 2KWIA 4IMPA 4X7RA 5A4MS 2WWWA 2O7SA 4GXRA 4PVCA 4KN9S 3FH0A 3QFFA 4G0YA 4FOOA 2XE7A 1N5LA 3MIIA 2DU8A 3B82A 5ECDA 4XB6B 2JKZA 2P5SA 4UZFA 3WLIA 1ZK0A 4BRWA 1E2JA 5KOHA 1WDKA 4KLCA 4YDRA 2EX0A 1GL7A 2BONA 1GPH1 4OQPA 5D86A 1ZMRA 1KU0A 1CK4A 3AH8A 1V37A 4J3JA 1GY8A 1FRFS 4UDYX 1GILA 2GBCA 3RTEA 3AVYA 4ARUA 1ZNYA 2Y92A 2HT1A 1ZM9A 4BYMA 4I36A 5T4EA 4L2IA 4DV2B 2UXDB 1IB0A 3HZHA 2WKWA 3OZFA 3GVIA 5JJCA 2GN1A 4J7CA 1VE5A 1QQ5A 1UF9A 1AKVA 1SPBS 3DO6A 1SBCA 3L77A 4DMUB 4ZOQI 5TB5A 2QD4A 2DFLA 1JAZA 1WR8A 2JK0A 4L72A 5HUJA 5C18A 4KX5A 5C3UA 4XA8A 3LUBA 3BJRA 2JCBA 5BNWA 1UKVY 3LHKA 3VNAA 3B60A 4TKVB 4KMRA 5AJXA 4KPEC 4CQJA 1R9JA 2GTPA 2Z2JA 4P9NA 3Q85A 3QOWA 4O2AF 3L7AA 3TOVA 5B3KA 4C6TA 2QYHA 3PNPA 4O4HB 3DLTA 3Q15C 4OM7A 4XFKA 3T3IA 1E5LA 5F5LA 2P6RA 3OBBA 4HB4A 4BFLA 4E5VA 1GDDA 3J81A 5BYKA 2JZNA 3JQ9A 3OIVA 4XTRA 4JFRA 3ABIA 3B70A 3D8SA 3IVCA 3NAQA 4QT0A 4DHEA 4D6YA 4HEQA 4KE6A 5KYGA 1Y6QA 1LDMA 2GXUA 4R2IA 2VJPA 5HRAA 5DI9A 4Z0NA 4F92B 2OY0A 3JZFA 3NBZC 4TTJA 3Q8KA 4DUPA 5LXTB 2ZRGA 1C1DA 2I55A 3GLGE 5KVVA 1P3DA 4UZSA 2GZDA 4ZALA 5JNRA 1F4PA 1G2QA 3L0YA 5BN5A 1O9HA 4B32A 3EG9B 2BTQA 2H08A 1JZTA 2KE5A 3BMNA 3O0DA 4P6VF 2J41A 4ND6A 3AG5A 4EPVA 2C7PA 2BJVA 1LSSA 2PSFA 1PS9A 2IHZA 2C4KA 3LFTA 3W5AA 1FNSA 2Y3IA 3TBKA 5BRJA 5AFSA 4BNMA 2NSDA 2ZIEA 2VJKA 3EF1A 3ULKA 5A6SA 1R37A 2IYFA 1JLRA 3ZVMA 1SCIA 2LV8A 3HCFA 2PKEA 3EA0A 4MDYA 4AN0A 3WXMA 4PIVA 1PZGA 1LBQA 1N57A 2P67A 4K26A 1AH2A 2W8BA 1ZXBA 4IDNA 3EF3A 2NACA 5FNVA 1JHPA 1Y5RA 2IZ5A 4JAVC 1LZKA 1X6VA 3LD9A 2R751 4LEIA 1QYCA 3EQ6A 4ES6A 2BGWA 2GFQA 4RPIA 3ANTA 3KPVA 3IAEA 3R74A 2GFHA 2F90A 4RIFA 4IIYA 5JD3A 4JNKA 1FLNA 4EA7A 2G7MC 4H7PA 3UEOA 4KG7A 4L75A 3KS9A 4YO8A 2XV1A 4JLPA 2ZRNA 4JIGA 3NDRA 4WCDA 4PLYA 4QPCA 2E85A 2EZ4A 2GMWA 2IGTA 2WF5A 1KK3A 2AN5A 3BDIA 3ILHA 3NB0A 4JVLA 4M0EA 4W1PA 4NONA 1LX7A 4MAAA 2Q46A 3DMPA 4V03A 2ACWA 3B78A 2EP5A 4DR2B 3P45A 3CPJB 1NKVA 1SZPA 8AT1A 4RTRA 1IM8A 1M1ZA 3IBCA 5GM1A 4ZHSA 1NQAO 4KXXA 1FX1A 1VGVA 2Q3EA 1DKLA 4MHOA 1A8SA 1DXOA 3JS5A 2YRXA 4I19A 4R2HA 5J4VA 3W5VA 1II8B 4ZIRB 4IIGA 3MW8A 1NRIA 4RO0A 1RJDA 4OHVA 4UTVA 4YUYA 4BY9E 1YE3A 3D64A 3F5FA 1JKFA 1JSRA 2LRHA 1GRCA 4X90A 1AIPA 2CZQA 2ZITA 4IP0A 3N76A 2C96A 1LI7A 1UOQA 3O4RA 2GVZC 1H85A 3MSXA 3QFRA 2GZRA 3QH4A 2FPOA 5HMLA 2MYNA 2PS9A 3LAWA 2HU5A 2O48X 5D5HA 3L92A 2HI0A 4UM8B 3IDQA 4B3IA 4GF5A 2IUUA 4YEDA 4YCAA 4BKMA 2IXEA 1P7WA 1CVLA 2IHVA 4WLOA 3WYCA 5B55A 2ZATA 1G1MA 5LOVA 2GX6A 1XQXA 2E89A 3KXLA 2BZGA 3HYCA 3O91A 1MEOA 3HXPA 2O8FA 3RJ9A 5EXEA 4AZ3B 2WTBA 1JBEA 4Q3NA 1X8JA 3T34A 1BDBA 2YMMA 3U4CA 5I3ZA 1JI0A 5L3SB 3MM4A 3TQSA 4Y1RA 2LR0A 3PQDA 1OREA 4MKXA 4LF5B 3ML1A 2WDZA 1ISPA 1RCFA 3MVEA 1HL3A 1P0PA 1P72A 4JEUA 2I3DA 1TGVA 5BR1A 1P7PA 2I4TA 2IW3A 4Y0NA 1IXSB 3QG5A 1MQSA 3FUCA 1XV5A 1CS0A 1YTLA 3HCPA 2V4UA 3HKDB 3PC2A 5BSEA 2Y4NA 3NTLA 4NS1A 4FT4A 2OBFA 3DL7A 3PNYA 1C7RA 5CTAA 4TWBA 2HIHA 2YHIB 1XQ9A 3U1TA 2DWQA 2VHUA 1MIOA 3RO7A 4HFRA 3P0IA 4DSUA 1U02A 3IOMA 3H4MA 1HOTA 4OQQA 3G5UA 1DS6A 4YECA 5F9HA 3WMXA 1CRLA 1V4VA 4JYBA 4GG1A 1PZFA 1WMSA 3VVLA 1HE1C 2O6HA 3AFHA 3KALA 4N5LA 1PIWA 4B7AA 3CW8X 4A16A 2AKEA 1FU8A 4LRWA 1GU1A 2M9MA 4P98A 2X4LA 3SEAA 3ZD8A 1VECA 4I50F 1CETA 4BVLA 1R15A 5IKOA 5I9BA 4C1NA 3K35A 1T3TA 2NV6A 3ED1A 3JVDA 3C8MA 5KJEA 3H3JA 4EJSC 5HXAA 4X92A 1T9CA 1FXSA 2HT6A 2V1UA 1U8EA 2ZFUA 3L46A 1Z13A 4L8VA 4Q3AA 4FOLA 2A7QA 1ZSNA 2WBLC 2Y1OA 4KDRA 2ORVA 2OWEA 3B53X 1AGNA 3BXEA 3ZK9A 2J6BA 4BN0A 4ARZA 3A6EA 4K8OA 4AX4A 4GX1A 1WJGA 4UAGA 4PN7A 5C32A 4F85A 2YWGA 3ECSA 4LE0A 2E6UX 2PKRA 3HWX1 3CZAA 4KSBA 2ZIUB 3ZHTA 4TMZA 2CJPA 3IP3A 1ONNA 3FR7A 4HNSA 4UE3S 3V4FA 4UMDA 4O4JA 2O6LA 4F2HA 4OF4A 1Y37A 3AETA 5TR9A 3FBWA 4DMGA 1GQOA 2VPTA 1QHFA 3E9YA 4JQYA 1UBFA 4B73A 4AJPA 2XMQA 1QTIA 2DQKA 3HVIA 4A0SA 1XZDA 2WHPB 3PPYA 4MUAA 2Z6VA 4MI1A 2C59A 1Q21A 2BMVA 1RLIA 1SUAA 3R5XA 4OUDA 4HDNB 1ZVQA 1W4BA 2XLBA 2ZUBA 4HGQA 2BOVA 2YHIA 4FJ2A 5FBWB 2QJWA 4ZD6A 4M9CA 4DMKA 4ZHQA 5KQRA 4PFKA 2KB0A 3MUOA 4KIUA 4NG5A 3L18A 4L7QA 4P83A 3ZIAD 1BWPA 3Q7SA 3NOXA 4YI3A 2IZOA 3SYNA 1DEHA 4DCTA 3SHWA 2X9QA 4B71A 4BQFA 3OU6A 1WDLA 3OZCA 4Z4FA 2QUKA 1U28A 2ODPA 4P84A 2RAUA 1TGYA 2AEFA 1DXHA 5GY7A 4R3UC 1DEAA 1PFUA 3EBLA 3HLKA 3PUVA 4Y2UA 2W6ZA 3HP1A 1PTJC 3OFJA 5GV7A 3K1YA 4W9RA 4WBSA 3ZYCA 3UJ9A 1K3FA 3OLVA 2BEVA 2HY7A 1CD5A 3GHHA 4MWGA 3L6BA 2YVLA 5ERGB 1I51A 3QPAA 2EGUA 5DXFA 4JC8A 1EZZA 2V7VA 1JQEA 3RFTA 4B17A 2WV9A 3WRYC 1KR5A 1KO1A 1QK3A 2DY1A 1PD1A 4X3OA 3FY4A 4IJ5A 1B42A 4K87A 4PG6A 3HCCA 2HCRA 3A1EA 2WU0A 5HILA 1G5FA 4C08A 3HJAA 3PJRA 1J5PA 2HTEA 3LX5A 2HCTA 2Z5FA 4PXAA 1IN1A 1G8HA 3EEYA 2G9NA 2CL6X 2Q4OA 1MOZA 2JGIA 3M1LA 5LMUB 4WACA 1XTSA 3VZDA 2WLTA 3E7WA 4JELA 3RGGA 1A9SA 1HT1E 3PFFA 2H52A 2EKBA 3E9NA 4WXPA 1KERA 2DWUA 2VC2B 1MCZA 5FWXB 5LQMA 1W96A 4KQ6A 1P0MA 3WP0A 4O29A 2W22A 3JD0A 1U3TA 2WSBA 4NMWA 1A76A 2W83A 5E6SA 1EWYA 3L1VA 4A6EA 3ANYB 3GFRA 4BFWA 4ZVRA 2JBWA 5HDQA 5A4IS 1MO3A 1UBJS 2IKSA 4D4JA 1HSOA 4WDRA 4RHYA 3A4LA 3WA7A 4IVNA 1WBDA 2I7VA 3NDBB 1G64A 4HX2A 4MV0A 3QE0A 3QBJA 4EP1A 4Z54A 2OHIA 1W36B 3ZQJA 1USGA 4IDCA 3AL3A 1O5OA 1Q19A 1VHTA 1EWQA 1G66A 3HFSA 2AG5A 3V8EA 4ETMA 1SG9A 3FFXA 3H42B 2WLSA 3GCXA 3SFZA 1RXEA 2H9YA 3DUFA 1R64A 2ZIGA 2PO5A 4UEJA 2A0YA 4XX0B 3RS2A 1U8XX 2NXEA 3GPIA 1XF1A 2QPTA 5GGXA 1LS1A 2X5JO 1QDEA 3NBMA 4R2JA 5A7HA 4C3ZA 1E9EA 1ZXLA 2YJ5A 2C07A 3OIWA 1AS0A 5H4GA 2FUNB 4G5FA 4YJ2B 3PT5A 1KXZA 1Z0DA 4FVTA 2DBQA 4D8YA 4A4DA 3WL4A 3ZS8A 3FTQA 1XMPA 1VLQA 2P2DA 4MEJA 2ZE8A 1S89A 3NHRA 1P2DA 1TZMA 4MMYB 5CUQA 3ROTA 5IVPA 1E5XA 1W5FA 4TXMA 3IJ5A 1HDIA 2OVFA 3O8DA 4DQXA 2Q3HA 3EPPA 3WGVA 2AHRA 2WSMA 2ZJ6A 4YCSA 3K0BA 2D6FA 4DA9A 2VDNB 3WWOA 1Z45A 1GGNA 2PQ0A 2CDCA 3NBYC 2FP3A 2I80A 1CUAA 1WU7A 2WWIA 2ZPTX 1LV8A 3ASYA 2QRUA 4LSMA 5HE8A 4BFTA 5JUWA 1J33A 3RFCA 4PFSA 3V1UA 3ELUA 4NOLA 1XL1A 1HLGA 2ZB3A 5TARA 2QOEA 2XCTB 3C2QA 3TSAA 3E1KA 1J8QA 1IVYA 3KKLA 5NLLA 1IULA 1IWOA 1NLMA 3U26A 1ELOA 3WR5A 4DADA 2B35A 1WU8A 3D43A 5A0VA 4IG9A 3I34X 1ZIXA 2ZAMA 3I8XA 4WKCA 2MOKA 4XGQA 3TI9A 3QELA 4IZ6A 5JJ5A 4C89A 2VPYA 5COAA 1ISHA 1FDSA 1ZISA 2IQIA 2W98A 2YMLA 3KU1A 5AKXA 5EE3A 1TAQA 1PYGA 4JUAA 2P0YA 5C46F 2VSNA 3P9CA 5HQJA 2ZVJA 4UHHA 2DHCA 4RZQA 1NLUA 1WDTA 4H1VA 2Y2VA 2ZJYA 4C0BA 4ASUA 2R00A 5B1EA 2DTEA 1I24A 2FR0A 3RU7A 3R0VA 1MVOA 4C0JA 5I45A 3T6KA 4IY1A 4BMNA 3OIGA 3L7OA 2BEKA 4RLQA 4ZOAA 2CNWD 5T57A 1TCAA 3CX4A 2FUG6 3QU2A 4G0ZA 3GIDA 3ZW7A 4AY5A 2PX4A 1YL5A 4I55B 3WK7A 4QT4A 1OV4A 3UENA 4CKWA 1Y4UA 3M34A 1ZC4A 3WVNA 4D96A 2FUG1 2B99A 4UCWA 1RAEA 5KI6A 4D8VA 4ENPA 1US8A 2QP4A 1NC1A 4EJ2A 3N2ZB 1M8PA 5T3YA 3H7AA 1S3SA 2PU7A 4N6OA 3EXIB 4QTUB 4CKWB 1TEVA 4ZK6A 3RYFB 1JIQA 2J9ZB 3KTOA 2OLJA 4PVDA 2DPMA 4OKIA 3BL8A 1TUBA 2AS0A 4DZZA 3D3WB 1KZ4A 3EBOA 5DEOA 4GKJB 3SX4A 1D0VA 5HM8A 1AV7A 1RKUA 2REQB 4DBLC 5K01A 3DC2A 1QSGA 2XJ4A 3Q1KA 3MMXA 3RS3A 5G02A 1VI2A 4F3NA 3MTDA 1VTKA 4Y9RA 3H3FA 4RA9A 4E6EA 4CF7A 5JAZA 2VXCA 5LXTF 2NUPA 4TS1A 3SKYA 1C8KA 4DIKA 5K6AC 3VH1A 4YCNA 3L0DA 4JI8B 4BUCA 4C9BA 2DY0A 2X5XA 2FN4A 3FROA 3G2KA 3PVSA 1E1MA 3QFTA 3RUCA 5T7BA 4IDEA 1LRKA 1O95A 5BNIA 1T8WA 3EVNA 3WLOA 1IRIA 4OU5A 1SKMA 4GSKA 4PSCA 1RRKA 3F96A 1TU4A 4NFHA 4CIXA 2ES4A 4ZK2A 1JYFA 2HK7A 3IAAA 3GRCA 5HFJA 3H7IA 5DM2A 4QL3A 3H0EA 4DMLA 4O4HF 1DU4A 2Q49A 2BE7A 4GX0A 4UCQA 5DXJA 1UBHS 3DE0X 4EIWA 2I8LA 3PQFA 1XAIA 2NQ2C 1XEWX 1D2CA 3CNBA 3K6RA 3W2GA 4CCYA 4YX9A 1D2HA 2PL9A 3PC4A 4UU8A 3VPGA 2I6XA 1TB4A 4L07A 1ZEMA 2PXAA 4HDKA 1ZZEA 4BRUA 4G2TA 4EI9A 4NULA 2QKYA 4IDDA 4NZOA 2HIAA 3GBPA 4BC1A 3RVDA 3JQEA 4RGVA 1P2TA 5K0FA 1KFJB 3GJYA 1NC3A 3NLLA 2PA0A 4KUGA 1OTYA 1CQIA 2P8SA 3OJFA 3RFVA 3KOUA 1SKYB 3DZHA 2P4EA 2EC5A 1WUTA 3OE4A 4GAEA 5AP9A 4OFZA 3TB6A 4PE5B 4LOAA 1QPBA 5K05A 4ZYVA 5I3CA 2N46A 3EEIA 5CB8A 3LHDA 4FONA 2O2CA 3NM6B 2DPYA 4J75A 3IMFA 3AVOA 3NIFB 4FQ5A 4RZXA 4GKKB 1E9VA 1QG0A 4HG2A 3SQOA 4XVHA 4BV3A 1N78A 1OIWA 3Q5GA 4LVCA 4KO8A 4HH0A 1K6XA 2G1KA 2ONCA 2QTCA 2ZDQA 3D4NA 4G65A 4PZEA 2QTLA 1LBEA 1NVAA 3QQ5A 3ST7A 5U4XA 4KQWA 3MNFA 3I5UA 4S35A 2J4CA 3C4QA 3PYLA 5CM9C 3IIKA 5B1SA 2VPXA 3HFJA 1MU0A 2ZBRA 4HB0A 3P2JA 3TLCA 5LMZA 1E3DA 4EHLA 3TNFA 3UXMA 5AUPB 4KLAA 2PD4A 4PZ9A 3T5PA 2AFRA 3ONEA 3C3DA 3V9PA 2GCPA 4QU8A 4QSHA 1V48A 4EY7A 3NIBA 3T7DA 1VIVA 3GLKA 1G17A 3N6RA 3FCYA 3GZTB 1G8PA 2PQ2A 3TSWA 3TUIC 2XA2A 1TRHA 2WSSA 2MMGA 3WP1B 3NR2A 3QX7A 4RJLA 4F5YA 1LH0A 1VXRA 4KJZA 4PEVA 1GV0A 1Z4MA 1VPVA 2WG1A 3T9CA 5IJ9A 2A57A 5JANA 1UXGA 4QGBA 2O54A 2MYTA 1XRLA 1YC2A 1KJ9A 4ITRC 4ZQBA 1MPXA 3PGLA 4NEHB 3HXKA 2IGBA 2EZTA 2PRZA 2QX4A 4D1YA 2JJMA 2H8KA 4YAOA 3HXQA 1R4NB 4Q7MB 3CA8A 3F6YA 1V2HE 1MGPA 1UPCA 4PZYA 3L8EA 4OYHA 4B9EA 9LDBA 3E6AA 3PKIA 1IG0A 3UXYA 2H92A 3U3RA 2IPMA 4OB6A 4KAAA 3ZGYA 3FLBA 1A2OA 3P26A 4NU5A 2GAAA 4B6OA 3HI6A 1XRQA 1EP1B 1Y3AA 3CLSC 5EJ5A 5KWSA 5MN5A 2WE8A 1VHQA 1PJAA 2SKEA 1RRGA 3CJQA 1OAKA 4FYYA 3VR1A 5LKAA 1U5CA 1Q74A 4ILEA 1CWUA 2ZOSA 3PNMA 3RROA 3FGOA 4GRAA 4PO3X 4AZ3A 1NR7A 4OTZA 2O05A 4WGFA 2OC9A 5BV2P 3TYXA 1WSAA 4XDYA 4MV1A 1MTZA 3T54A 3VPSA 5BQPA 4NPCA 2E48A 1X9IA 3L8CA 4B4OA 1OV6A 4JHLA 3A9CA 2OXRA 4QHTA 1N36B 5AW0A 4BNHA 1FUIA 4V0ME 4ZI2A 3SWWA 4HHEA 4L8YA 1BG6A 2C4WA 1XWWA 3EK2A 1QK5A 2IV3A 3FZQA 3DBIA 3ZWOA 1YBAA 1GN9A 1T0PA 4IXWA 5HF6A 1A04A 4PGGA 3UWDA 1Z62A 1ZGGA 1FFBA 1GGJA 4KXNA 4DABA 2XW6A 3RBVA 3FWYA 3P9SA 4PRKA 1BHJA 1C3JA 3GMIA 4MPPA 1JDVA 4QDXA 1YDMA 2HWUA 2PPVA 4IS3A 3RVLA 3UFXA 1GNSA 3WOVA 2N1BA 3J81k 3DE7X 2HDWA 4WCFC 3ZCRA 3GNTA 5ETJA 4DR5B 1VC2A 3IMCA 2Y8EA 2DETA 4QUBA 3KELA 4J1QA 2X3FA 1I6MA 4KK3A 3ORQA 2GWHA 2WIAA 3HUDA 3I9V1 4NMLA 2BFCA 3D1VA 3D3NA 1TXGA 3DWFA 4QDKA 4YJGB 2CMDA 4CFSA 3SQDA 3R5HA 3OQVA 2R6AA 4KJXA 1OKKD 3TKAA 3VQTA 3NCTA 4MMXB 3PTAA 5A4DA 2OORC 1VYHA 1XTBA 5IDYA 2BMEA 3RSGA 1AZWA 4XIFA 4PYJA 3SU8A 3DMHA 1O94C 4FZRA 2YL2A 4HWGA 3JQFA 2JI7A 3MINA 4NP6A 1W52X 4D4HA 3OIYA 4KWEA 2J3KA 1P19A 3PNOA 5DOVA 4DLKA 5DPMA 2C9BA 1O4VA 4EITA 3PXXA 2EF0A 1J5EB 2WU4A 3SJAA 3DQZA 3BE8A 4FZVA 1YJQA 2I6SA 3UOAB 1WG8A 4LI3X 5BN4A 4UMEA 2FPIA 1P9LA 1VSVA 2YV3A 4JBNA 2B92A 3CX7A 2ZWAA 4F3TA 1V35A 3GMSA 3JARB 4FN4A 4OXYA 2HJSA 3EMKA 1FYFA 1QH9A 3H1FA 1U7HA 3SXUB 1XQVA 1YVUA 2C84A 2JCVA 3HI4A 3AW9A 4TV8B 4QM7A 4B0PA 1J2UA 1ZMXA 4ZVQA 1VG8A 2GUWA 2YHSA 3TXAA 4QGFA 3MAGA 5DNWA 1MMFB 1LRLA 1SKAA 4U4AA 1KJYA 5TEWA 2DX7A 2ZIXA 2QR2A 2UYGA 3EOZA 4LXHA 4IDOA 1VIAA 2I7XA 1GPNA 3OUZA 1D4FA 1E1KA 2Q5OA 2GBGA 4G81A 3UGKA 5H59A 1FP4B 1L7XA 5A71A 2GLTA 3U7QB 1J25A 4HQ0A 1SJ9A 3PNSA 4PPGA 1X42A 2WV7A 4QPJC 1L5ZA 2GS9A 3DZDA 3AGPA 2MCFA 1H6DA 2J32A 2YQZA 4R6XA 1I5EA 3D02A 4YRGA 4RSMA 4CV3A 1SUPA 1XHEA 2D2EA 3HDHA 3COSA 2HSEA 4X44A 2FPGA 3W7VA 4P3NA 2OZPA 1PNVA 2P78A 4HAOA 1NYTA 3NPAA 4K03A 4Q9KA 3LT5A 4DMMA 1KYXA 1UFVA 1CDZA 1M1YA 5BP7A 5K09A 1X0VA 2I2WA 5F35A 4B6SA 5I7SA 2IX9A 2AD1A 4A03A 4DPKA 2VP5A 5IAOA 2UZAA 2AC4A 4NPHA 1I5OA 1N6HA 2HXGA 1EM8B 1YZFA 1MG5A 2UVQA 5AKYA 1F5SA 3FR8A 4NABA 1MGOA 2XMCA 1QXSA 1W581 3CKYA 4LDRA 3KSMA 1G6HA 1H9CA 1M2FA 3GLIA 1BRMA 2F3TA 1KO8A 2NZ2A 2JBHA 2HB6A 3DBRA 2HJ9A 4YJ3A 5DCYA 1MJGM 1CV2A 1GPKA 2PLWA 1S2GA 1M2EA 2JFBA 1PFWA 3K9BA 1UEXC 1YZNA 3ERCA 4PXYA 1R4MB 4J1NA 4TVOA 2ZGVA 3DOEA 3DVLA 3GGSA 3H2KA 4K86A 1AKRA 4L3OA 4YRCA 3WHLA 2AN3A 3H6KA 1G5PA 5IKPA 1EGHA 3H8WA 1WKCA 2C5SA 5AW6A 2PUDA 3PUYA 1P6UA 3A9TA 5CNKA 1AVTA 1UR5A 1PEAA 3A8TA 4RU1A 2CDNA 1J49A 1LW6E 2X0IA 2UV8A 1EWTA 3QZUA 4GP9A 4KPUB 3R76A 1B8UA 1GZ3A 2JAOA 3IOCA 3WMFA 4DDVA 1Z08A 2O5RA 5HS4A 3D0OA 1PJ3A 1T8UA 3GDFA 3EA4A 4OX9Y 5ECGC 1XPJA 4L5YA 1NUPA 3R3VA 3KAQA 2IXDA 2P2ZA 3KQUA 3PUHA 2EYQA 3U16A 4WVFA 2QLJA 3ILYA 4F4HA 3EZGA 1FFYA 1L5FA 1KWKA 3A1TA 2B9VA 3RRYA 2H2AA 1W8IA 2VYVA 4DJ5X 3DEHA 3PICA 2QZJA 4YH1A 3MJVA 1VMEA 3MFQA 1TE2A 2D2VA 2P68A 5AQ1A 4Y9SA 1A7UA 3A0UA 4H17A 2IELA 4DDTA 2GBIA 8ATCA 3UY4A 2B34A 5FWXA 5A2GA 3RU3A 2Q9CA 3ER6A 4J16C 3SC2B 2AOTB 5H9VA 1KZ9A 3T7JA 3GVPA 4KN5A 2FW8A 3UG7A 1J1UA 1K6IA 1ZSYA 2P5YA 2QAJA 2FK7A 2QL7A 3BMNB 3HYTA 2A4KA 3RD5A 3SLGA 4CKCA 5CLJA 3R0XA 4M49A 4DDHA 1K68A 2J9FB 3QA9A 3MWJA 1KYQA 4TT3D 4CN8A 1B0AA 2IUTA 2YXNA 4II2A 4CKBB 5JSFA 5K0GA 2CV1A 2GEBA 2XDQA 1Z38A 2MMCA 3IP6A 4GXNA 4L3VA 5L7YA 2ID9A 4UBLA 3W90A 3ZCTA 2GEJA 1QYXA 3U4QA 4Z9BA 1KAMA 2JFWA 3O5AA 4FMCF 5IVDA 4U6SA 4FD3A 1Y9AA 4A27A 1UMKA 3AJAA 3HN2A 4IIVA 7REQB 1SBZA 2VDRB 4KXMA 2BDTA 3LFHA 4I5FA 4MW9A 4QGAA 2EDCA 5FFMA 5K45A 2PJRA 2OO7A 4MPRA 3EWNA 1UPFA 1IY8A 3GEGA 4MOWA 3WLHA 2OB2A 3FNIA 1Z15A 1JEQA 1T2NA 1NGSA 2N3ZA 4EQ6B 4ZCRA 2ASVA 1MOSA 4DL9A 1HPLA 5JYEA 5GJCA 3WKCA 1NVWQ 2WMNB 3G0DA 3KYIB 3PI7A 4R0VA 3MA0A 5MN4A 3IEVA 1LDYA 1S96A 3F4BA 2WZCA 3P94A 4XR4A 5K3SA 4D5GA 3DEIA 3I64A 2P9JA 4UJ5A 4CLEA 2XYRA 3SYKA 5AW3A 5K8LA 1IDOA 3FLMA 4LZLA 2AN9A 3L40A 3TSZA 4K6FA 1G3RA 1EMDA 4UULA 4MLZA 1H3NA 2FGJA 2PT7A 3G9XA 5F1PA 4E1BA 1YI8A 3CZ9A 4BJ5A 3DLBA 1QE3A 4XIYA 1CEYA 2FXIA 3FPKA 4GMKA 4E88A 4UVHA 1VMDA 3U4GA 1OFIA 1HG0A 2GN2A 3PQ8A 1I2DA 4HVLA 1P91A 2W6NA 4XIIA 3DCNA 4MVJP 2FW9A 1BGWA 1FLVA 3E3OA 4DA0A 1XXHB 1M34B 3GLHB 3Q3GE 4YWJA 1UMCA 4I1PA 1XTZA 3ZY5A 2FSGA 1L7MA 1IB6A 1N6IA 1XAGA 1LLCA 1PJBA 2B7BA 2G8LA 4IIXA 1Q0ZA 2BFDB 4KK4A 4V02A 3WAKA 1HH4A 1QB8A 1CUXA 1VKHA 3E2IA 5LU8A 1QHGA 2CWWA 2R1UA 2XVMA 4X62B 1O3YA 2B4QA 5BQXA 1ZJZA 2ZE6A 1CZHA 3AR6A 1JLSA 1UXOA 3KB1A 4EYSA 1R4NA 2WVHA 4QTXA 3C1TA 3CF4G 1G20A 1P33A 5GIOE 3FOFC 4WK2B 4QU5A 4HSEA 1XTUA 3W5DA 3GHYA 3FRHA 4ZV4A 5FX2A 2WYIA 3EQ9A 1WEHA 5IG2A 1HEUA 3FKSA 5IHXA 3IR6A 4ZZ3A 4I50A 2HAEA 3LCCA 2EL7A 4RIGA 1JFTA 1YKGA 2YIVX 3Q10A 4QOSA 2PUHA 4DREA 2WP8J 3WMRA 4B0OA 4ZDKA 2QAGC 1DT3A 1XCLA 5J2UA 1YBVA 3JAKB 5CK4A 4PCVA 5AT1A 1Q7EA 4B44A 1G42A 4FBLA 4EUFA 3IX7A 1IAQA 3LECA 4R83A 2PMDA 4GNRA 4PQRA 4YUXA 5KWEA 1C7EA 4Y7CA 3AEQA 3BN3A 5DBEX 5FOTA 1S9HA 4ZJUA 5DDIP 3FAKA 3RYCA 1JEOA 3WGTA 2FSPA 3Q6NA 2OXCA 3I30X 3HKDA 2VJOA 3OZEA 2VKQA 2VH5R 3TEMA 4X6YA 4KI0A 4PLFA 4KE8A 1T43A 4DM7A 5CLFA 1QG2A 2J5RA 4IDGA 1UC9A 5DTIA 1XAHA 2NM0A 2R11A 4JVSB 2C7VA 4MVXA 3N0WA 1MBZA 1NKSA 4HAYA 3U4DA 1ZK1A 4OJYA 3U81A 3D8TA 5JEDA 4UQLA 2C4MA 3UPUA 4LN1A 4B7XA 3OJLA 4G1FA 4JJAA 1RLJA 3I23A 5K99A 3KYBA 5GMOA 2NGRA 3AUJB 2NV2B 2YIJA 4YP1A 4EG3A 2HHLA 3PD1A 4K6KA 4U7PB 5GONA 5KTOA 1LBIA 2PGOA 3AKYA 4ZHQF 4AG6A 1P2VA 4LDAA 4NC9A 2WNIA 1HLPA 1NMXA 2OYSA 1AF7A 3EQ8A 3AMVA 5DW0A 2O4CA 3DR3A 3GAFA 1NPTO 2G9UA 1V7PC 3CN7A 2RGAA 4DRZA 2FMHA 4ZVUA 1DARA 1VSUA 2CXSA 2HV8A 1PWEA 3AKCA 5IBPA 1XPRA 1LBSA 1BJRE 5LJLA 1TT7A 1L1RA 3L41A 5T6BA 1O6GA 2GZ1A 2G28A 3ETHA 2XNDA 3MJ4A 3Q2OA 2NOAA 1O94A 4J3FA 4XQ0A 4NV3A 1FFAA 2XE8A 3RC8A 2V0CA 1IUPA 1V11A 4FFLA 4R6WA 3F0TA 3SE0A 5D1NA 2V7XA 1T6ZA 3F7NA 4FFOA 4LJ9A 4DR1B 3EEFA 4QXRA 3CYFA 4MUJA 3KNZA 3K6KA 2J33A 3RUAA 5JD4A 4RMIA 5TQVA 1FP7A 5H82A 3TLXA 3PUIA 1LB1B 4BMDA 3TNJA 2ZG6A 5GOTA 1ORRA 5LMNB 2WP0A 5C1OA 1QP8A 4EL0A 3OLXA 4AMUA 4HPJB 3VR2A 2PKWA 2W6JD 1NDQA 2QB5A 3CX6A 1BJKA 1T5OA 2HA0A 5BSTA 1MOPA 1DB3A 3FUXA 3K0KA 4V2IA 2REXB 2A86A 1BE8A 1E1QD 4FE3A 1L5SA 1JR4A 2CHEA 4HDAA 4IOMA 4N4AA 3DZ8A 3JQ8B 5AJYA 5T8KA 4PHFA 1C4KA 3BC1A 2VK1A 2WUVA 4CLOA 5FTNA 1XQWA 2OHFA 3K5WA 5CLHA 2PBRA 4YQYA 5D3QA 3U3MA 1G20E 3KV1A 3CEHA 3WZMA 1EHCA 1UM9B 4LGMA 3LKVA 5EIWA 3ZHVA 1HQCA 4WXMA 1JPUA 4X3PA 2Q5QA 4IUYA 3FJYA 4ZMSA 1SCQA 5GZ1A 2D3TA 2ZQYA 3KSRA 2ORIA 1BCSB 1N8KA 1DBRA 3K1TA 4S1VA 3W4JA 3TG8A 5F5NA 1GZ4A 4JI6B 3U37A 4N76A 1YR9A 4MWCA 2J4FA 1FSFA 1NR5A 4CR7A 5JEEA 4PYOA 3H4IA 1AU9A 1T2CA 3IEPA 3MSCA 4Z2AA 4ZCTA 4HI0E 1F2VA 1A8HA 1W1UA 3H75A 4IKOA 4TVBA 1RMQA 1NQXA 4DJJA 1NW3A 1T0BA 4C6RA 2JEOA 2VZLA 2YZ2A 3D5EA 3S1AA 3LT4A 1CY6A 3DEJA 1WZCA 1XJCA 3DTTA 5F73A 1WKVA 2ACEA 4Q6BA 4EVIA 2IPLA 2WYOA 2IOFA 2QSUA 2ORED 4DWJA 4F45A 1OWPA 1ZR2A 1QYIA 4MVJE 3DVSX 4BASA 3IR5A 1XU7A 4PSKA 4K9KA 5HGJA 3IE1A 3KHKA 2JAUA 2Q4DA 3A6GA 3GNSA 3PGJA 4XVUA 3HSSA 2IBTA 1AOXA 3FVRA 3H16A 3MRXA 2IXFA 5AKIA 4DXHA 4MQFB 4JS0A 3E4CA 4OJKA 2C9DA 2V7WA 2ZRAA 3SJCA 5JALA 3R0QA 1TYZA 4DM4A 1M3SA 2VWPA 4CMIA 1UWLA 4AY4A 2ROQA 4GI5A 1OH5A 4Y6OA 4A82A 1L3IA 4UTPA 4W8HA 4ZJPA 4ND5A 4Q1DA 4FNGA 4DR7B 2IVZA 4ZTUB 1XC7A 3H9GA 4J3NA 2XZDA 5AVJA 3BHMA 1FFGA 3P5SA 3HA7A 4E3ZA 2VNAA 4KSCA 2DZDA 2NO4A 2D06A 2WHPA 3AB3A 2WNSA 2A9QA 1XIVA 3P4UA 3QPUA 1GQYA 1JT9A 4QGHA 2YXLA 3QVSA 1G2OA 2WUFA 2YUIA 1ZGBA 4OPMA 4TV8A 1KI7A 4LOKA 3WGJA 1P2BA 4RK7A 1GDHA 4F2GA 1WWKA 4HL6A 1RBQA 3ILXA 4IS2A 4NCXA 4BUJA 4DCNA 5B6IA 5F7XA 5A0TA 4YP9A 2E4AA 1T1JA 3KTAB 5KCZA 2QAIA 4HR7A 3ZI7A 2BL4A 5TPZA 4ZCMA 5FDFA 1JALA 5SZHB 5IJXA 2B94A 1G9XA 2BF7A 2DWPA 2KS6A 3HZRA 1E2FA 3MRVA 3TECE 1R8JA 3OE5A 3ECAA 3EC2A 4UUOA 2YXEA 1I2CA 3W5UA 3SIRA 2C1EA 4MQ6A 1F2TA 3ADPA 4A0RA 5KOHB 1U4OA 4FNAA 4PLWA 3PYMA 5KYYB 4HZIA 1WXHA 2WM9B 4N7JA 1GAQA 4OY3A 1D5CA 7YASA 3NWBA 1KFEB 4Y2YA 4RTSA 1ODSA 3B3GA 3BFPA 5D87A 3AVPA 1OTXA 2C99A 3PFCA 5CITA 1EFRA 3C48A 5FO0A 1IOWA 1Q2UA 4DUZB 3UYKA 1BH6A 2IYTA 2IX3A 4TL7A 1TC1A 5BXYA 2HPHA 4S04A 5CDSA 1N33B 5HTOA 3HVJA 1IHUA 4UTRA 3L7BA 1BXRB 3EXEA 1K0UA 1IHPA 3X1MA 3CO5A 3I72A 1CZOA 1XRNA 3C3JA 5K3FB 3VTZA 4FGUA 4M99A 4PR3A 1C0PA 3L1KA 1SWWA 3E03A 1W75A 4BQPA 5CFZA 4XTCS 2CN1A 3C3CA 3EGDA 3RBAA 5LQKA 2PEYA 1J0EA 3VI3B 3V8NA 2J1LA 2HZBA 2RGUA 4AK9A 1AUVA 1GEEA 1U2GC 2VHJA 1OZFA 1ODIA 2ZBUA 5DX8A 3U39A 3ZKWB 4EK9A 4RKYA 4EYGA 1RYZA 1MJ5A 3WIVA 4PG8A 3THYB 2QRNA 1EK2A 1G8KA 2DRIA 3NTVA 4YVFA 2A1TS 2XI4A 1ESZA 2XEDA 3C5WP 4NQRA 4EW1A 3ZCSA 3Q3JB 4EF4A 3OO1A 2O3JA 1DOHA 1C50A 3BJIC 3B5IA 2XNJA 3DXZA 1T8YA 4I3GA 3SC4A 2HDOA 1YU6A 5CVEA 3BIOA 4E7PA 4NEQA 3W2TA 3CGGA 1Y6RA 2VAWA 1MAVA 2WTEA 4D81A 1CULC 1GPBA 5TS2A 2ZZKA 5JQGF 2AHOA 1AO0A 4OREX 4RJKA 5H3CA 3GVHA 1ILEA 2EGGA 1JYEA 3F3SA 4D57A 4ZAGA 3ANMA 3LQ2A 5IJ0B 2R0QC 2KBEA 3W5SA 3ROPA 1LQTA 4FX2A 5FV4A 3NGXA 2VK2A 4O4LF 4EL5A 2QBYB 4IH4A 1M2VA 4O4IF 1NJFA 3IGFA 4DG5A 3THYA 4OQLA 3L6CA 3IUSA 3KFVA 1U1GA 1BX3A 1NUTA 3PWTA 1H2ZA 5CB0A 3MQ2A 4PIPA 1T4MA 4I1SA 4QOFA 3WJ1A 4RF4A 5DP1A 5DYTA 2NO6A 2BGLA 2VBIA 1HKHA 4G0XA 4YA6A 3SFVA 1SC4A 2CCJA 3LP6A 5C0OE 5T6MA 2HA7A 1ZRNA 2PUGA 3UWSA 4UJ3A 4BU0A 1IQPA 2CK3D 1T35A 1B8VA 2Q5JA 4L4ZA 5K0BA 4JI4B 1RZ3A 2WUEA 3BMXA 4DDKA 1Y48E 5KC9A 3NHKA 4TN1A 2PKQO 3B13B 2ZROA 1Z7BA 1Z75A 1Z68A 1KDTA 1MRZA 3MTJA 1Z82A 4G4SP 1GGVA 4DV6B 3EXFB 1UJCA 2YZGA 3HB4X 4C29A 3SQWA 1VG0B 3GDOA 1RHRA 3BA6A 2BYTA 2HPZA 1OBOA 4ERXA 5JFTA 2DMRA 1U9ZA 3ZXSA 4RIIA 2QVBA 3U62A 4Z8XA 1I9CA 1WE2A 4PPFA 1D9XA 1OGYA 2VNHA 4H59A 1TJ4A 3O8QB 1BIFA 1SBHA 2BVNA 3V8QA 3FZEA 4R7ZA 4JLJA 2WJWA 2ZM5A 1NOIA 5FFNA 3RUFA 1EK0A 2HBZA 2VDLB 2O2DA 2BLNA 4RVSA 3TKYA 1Y3CE 1QHIA 1ZUIA 4AG3A 4G8BA 2O2SA 4C04A 1M73E 3H97A 2GHRA 3OPXA 5G41A 3RS4A 3TL2A 4D0NA 2BJHA 5AHRA 2YMQA 3I9LA 3HWSA 4FINA 1H4TA 4ZI7F 5C37A 3OA0A 1SOWA 3QFCA 4JLOA 4A15A 2B3TA 2PG3A 2PXCA 3RIHA 1FW6A 2QSZA 1DJNA 3QUQA 4TS4A 5CH3A 4U7JA 1B16A 3I92A 3EE6A 1US8B 1GJRA 4ID9A 1IN4A 5FV7A 5BURA 3B7PA 4QU9A 2OBBA 3H6GA 5IYZF 1E98A 1IMJA 4OFWA 1CVRA 3GFOA 3TR5A 5AW7A 3VC7A 2LKDA 3C24A 1R9NA 4OU4A 2YJZA 1B0UA 3BL5A 5F76A 1M72A 3KVYA 2E82A 3AHCA 3EFOA 1NPYA 5M29A 3GJTA 3NC1C 5TMBA 3S2ZA 5F52A 2BFWA 3QVJA 1NYLA 2VATA 3SJ7A 2OBNA 2HBRA 3NQ41 5J23A 2HWKA 5LZ7A 4CV2A 2AEMA 3GLGA 2D8MA 2G5PA 1E9SA 1R0KA 3CT4A 4Q9AA 3H1TA 4Z6KA 4WFKA 3AFOA 1RPZA 5J40A 4N18A 1CY1A 1F6WA 3AR9A 3CLSD 3IA7A 2RGEA 4TZTA 4RF2A 2M6LA 4C0WA 1G6KA 3BRWA 3ZCPA 3KWLA 3HU5A 3SNKA 1JKJB 2FJ0A 4AMGA 5FH9A 1EFHA 1NVMB 4IICA 1KZYC 4YRDA 4E13A 2DBZA 4CGZA 3OZXA 4C0AC 2H9IA 1ZH6A 2O7VA 5F2EA 1C5KA 1EFDN 3B3FA 2XXJA 5ARBA 3O4VA 4TKVA 3NWEA 1N7HA 3BCHA 3LGAA 4XDHA 3B6JA 4P93A 3NASA 5FAXA 1OW3B 4G97A 2H1CA 1U7XA 3HNRA 2YX1A 1X94A 1R5JA 2PWBA 3NOQA 3UO8B 3TAXA 5HPYB 4AS2A 4LSZA 3AUKA 1E59A 2RCNA 5E4JA 2QLLA 4DG8A 1H2WA 1MAHA 5ISMA 3F2VA 5C8YA 1GPDG 3C3XA 4M0MA 3FRIA 1ZW1A 5TGTA 5AM3A 3JQ9C 1E1YA 1KNXA 3T5DA 3UVEA 3VR4H 2R3SA 3IC5A 4KRXA 2AOXA 4V38A 4UTXA 2XBUA 3ZK7A 1GZVA 1DCKA 3H2YA 3TE6A 3F5DA 4ZQIA 3EDOA 3NUQA 4G85A 3BEDA 3SI7A 1U0SY 1A82A 1CDOA 1VP9A 1B6TA 2WOJA 2ID8A 4U3JA 2O1XA 2IXAA 1OU0A 2WAYA 3CT6A 3TO5A 4Y2QA 3ZHRA 1HTTA 3C6MA 3EEBA 4R3NA 3TRJA 1PJZA 1QZ3A 2ZB8A 1SCUA 3Q0EA 4ND4A 1ZRSA 1P5HA 2FRDC 2QSJA 3R9KA 2XVXA 1K8QA 1OY1A 1TQ8A 1WMBA 3A6LA 2P1ZA 4ZT6A 3W2EA 3GLGB 1N75A 4K9PA 5J2TA 3ZGZA 2N47A 2ZBVA 3O0TA 4GPAA 4TV9A 2WFLA 4EG8A 2WM2A 1AKTA 1ZNZA 1EIZA 4L22A 3GJ4A 5D7NA 1SGWA 3HJRA 4TTIA 4IHJA 2PYIA 1AKYA 1CQJB 4RGQA 2NXWA 3T9DA 4UOEA 1DRKA 1Z56C 4V0NA 1VMAA 2ZIXB 3HP7A 4HY3A 4G4JA 3GJQA 2JIQA 1AUPA 2FETA 3FMPB 3HRIA 2AV6A 2HU7A 4PWYA 1RYHA 2C54A 2C8VA 1UKAA 4R5HA 1XCMA 3D0RA 1GTG1 1PDWA 4GP7A 5IMSA 3MQ4A 1V1RB 3AQIA 3FCAA 3WWYA 2PA3A 3ZWQA 4CKYA 1Q1AA 1HKUA 2XVYA 5TQJA 2JVKA 1JKXA 1PR5A 2DLDA 3HDTA 8MHTA 5EJ7A 4NAHA 4FILA 3RT7A 3T4PA 3V1NA 4F04A 3OX4A 4WECA 5D7BA 3ZE0B 2YJ6A 4KP7A 2QRVA 3KSZO 1BWRA 3QY9A 4MP8A 4Y6GB 1GA6A 1Z0SA 3PFBA 4K9OA 3FDIA 5CCXA 4E5SA 1V8ZA 1ZD5A 2BRUA 1JE1A 2H4JA 3RIEA 1N9ZA 1Z6TA 4RJ2A 5EMKA 3CVOA 3I5MA 4LS3A 3HZOA 3FIUA 4WZAB 5MGBA 1O0SA 2BZ1A 2GK4A 4XDZA 2IFTA 4YJ3F 3I62A 1XTKA 4MYCA 3T0GA 2GNAA 3KO8A 4EM6A 3L43A 1DIRA 3BE4A 3PHBE 2YTZA 1B93A 4RSRA 4KXVA 2AK2A 3K2QA 1PVVA 4UM9B 2JGNA 2QY9A 3ACBA 1SC6A 2XF8A 4Q9LA 3UK1A 2OAQ1 1CRWG 2ZIAA 3AEQB 3EMDA 1JXAA 4OIFA 4YWHA 3VAAA 4ZEXA 2VQFB 3SIWA 1E3MA 1R0SA 3LSTA 1M0TA 2FWIA 1Q7BA 1U9YA 1DCMA 3O1JC 1AF4A 5CX4A 1IK6A 3PYXA 4IXNA 3C6YA 3PDHA 3FTFA 2PRJA 4N0EA 4EY6A 3P2EA 4OQYA 3IELA 2XUHA 4ZOCA 4AS3A 1RWNA 1PGQA 3X1DA 3UPDA 2D1QA 4JJKA 1PR3A 1PT7A 3GEMA 4KVZA 3BE6A 5ADHA 1FY2A 2YQ4A 1V6AA 2XTZA 3L7DA 2WU3A 1U2DA 5DM70 2HD4A 4JN6B 4B6QA 2X3UA 5IXYA 2AUTA 1ECGA 4Q9DA 1S2DA 2A5YB 3DC7A 3OWXA 1EGVB 4KVGA 3D4BA 4CV1A 4IRUB 3PC6A 3DSRA 1KYZA 1ORVA 4XUGB 1TF7A 5DT2A 3ZJ5A 3LA8A 3S8YA 1XK6A 4UVEA 4Q3EA 1OQAA 3I9OA 4C14A 1M6EX 4W82A 4LY0A 4JZYA 2WAMA 1WPQA 4KAXA 4LDQA 3S2YA 3FAZA 3KOMA 1IXRC 4RTNA 4PQYA 1DEXA 1XVVA 4DG9A 3TEJA 4QDJA 4J0KA 2R7LA 4FK8A 2ZYGA 3O2JA 5DFAA 1LNQA 2X77A 2P6PA 2VSOA 2PH3A 4A8JC 4ER7A 4WBNB 3PI6A 4E6PA 3GH1A 3V32A 3NBKA 2CMGA 4BE9A 4YRNA 5ICCA 5JRJA 3GJ8A 4RFSA 3QP9A 2Z6UA 1DG1G 1PNQA 4ZYZA 1MJGA 1TC2A 3PUJA 4BJ6A 4J1SA 4LMBA 1Y8ZA 1Z2AA 3LQKA 5JMPA 2PT5A 1O89A 5EAIA 4HUQA 3T3OA 5JC1A 2XSZD 1YVDA 5ICGA 3BQNB 1GG2A 1BJTA 4C7OB 1KXJA 2OD9A 1U2RA 5CDFA 3LV8A 2RI1A 1XMVA 4TT8A 4AAYA 4JJ4A 2GM5A 4WCFB 2UU9B 5EKXA 1N0WA 2AYZA 2C2OA 2YZNA 4EHKA 1A2BA 1WCWA 3Q8LA 4NHOA 1X7ZA 1SIOA 4IR7A 1RYEA 4RELA 2CD7A 1DLIA 4WADA 1IN7A 2PO7A 1ND5A 1QPGA 1YACA 2JAXA 1QIHA 2BFNA 5PNTA 4EUHA 1QQ7A 1YT5A 4X00A 2GPAA 3GJZA 4M1YA 2BELA 2P2SA 1D2NA 4TV9B 4E7OA 2H1SA 2ERXA 3JALA 3OMLA 4WEQA 4MUNA 3HCOA 4DNOA 4JBLA 2O3TA 4QM6A 1ML4A 2TS1A 3BTVA 4JT9A 4YY3B 4H0CA 2Z1DA 4P2GA 3OT4A 1MFPA 1OASA 2ODQA 3W3AH 1CTQA 2AWOA 2XDQB 4HCJA 4OJMX 2ZEJA 2ZUWA 3NANA 5DJ5A 1MH1A 2RHBA 4LY6A 5K7SA 2I8CA 4ENUA 4RUKA 2C78A 6LDHA 3W5BA 4RADA 3K53A 3NYQA 3MGGA 3FCSB 2RMKA 3GLFE 5EZQA 1XTTA 1G4AE 5EZYF 1GRRA 1YR1A 4LHZA 3H9EO 3L7YA 5TSDA 5ENVA 5FORA 2AIRA 2C1XA 1UBSB 3A1WA 3ZI0A 2DUUA 1TK2A 1REQA 1LEHA 3FBTA 4E94A 1V25A 4FSXA 2GT1A 5EJ6A 4K6CA 2J0EA 4B6PA 4GIBA 3L0CA