2Z9BA

The crystal structure of azor (azoreductase) from escherichia coli: reduced azor in tetragonal crystals
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
200
structure length
193
Chain Sequence
SKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FMN-dependent NADH-azoreductase
publication title Expansion of Substrate Specificity and Catalytic Mechanism of Azoreductase by X-ray Crystallography and Site-directed Mutagenesis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 76
structure length 193
sequence length 200
ec nomenclature ec 1.7.1.6: Azobenzene reductase.
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2z9bA00
1KBOA 1WSWA 1XT6A 1KBQA 3HR4A 5FX2A 3HLYA 3B6IA 3JSXA 4QOJA 4YALA 5LJIA 3RPEA 3GFQA 2M6RA 2OHHA 2M6SA 2QX6A 2ARKA 4HS4A 1QRDA 2FDXA 3L9WA 2GSWA 3NLLA 4DIKA 4J8PA 2MTBA 3OWHA 3U7IA 3L9XA 1ZX1A 5LLDA 2ZKIA 2V9CA 1FLAA 2QMYA 4Y9UA 4CETA 4R81A 1CZHA 5LVAA 2OHJA 3K1YA 3NHSA 4HEQA 1AHNA 2HPVA 3S2YA 1J8QA 1FLDA 3NHLA 2F1OA 1QBGA 1YCGA 1CZLA 1T0IA 4NLLA 4LTNA 4YAOA 2FCRA 2BZSA 3EDOA 2MOKA 3K20A 3R6WA 1B1CA 2AMJA 1AKRA 1C7EA 4Y7CA 2Z9DA 4YAUA 4FX2A 4FGKA 1FX1A 2Q9UA 4DY4A 2MWMA 1RTTA 4FGLA 4GI5A 5TGZA 5F51A 4FGJA 4ZVKA 1ZWLA 1H69A 1JA0A 2BMVA 1D03A 1CZRA 5EAIA 1DXOA 3GFSA 3ZHOA 3ESZA 4H2DA 5A4KA 3NHPA 3NHJA 2OYSA 1YCHA 2XOEA 4PTYA 3NHFA 5EMNA 2FX2A 5EA2A 1J9GA 2KLBA 1FTGA 1C7FA 4U7FA 1FLVA 1AZLA 1CZUA 5F4BA 1TIKA 1RLJA 3QFCA 3U7RA 5B3LA 1AKUA 3B6JA 2QX9A 1GG5A 2FZVA 4ZVNA 5LBUA 2V5VA 2Z98A 3N3AC 4QOHA 4U7GA 2WC1A 2BN4A 3P0RA 3GFRA 3O2NA 1CZNA 4PU0A 3SVLA 2B3DA 4QODA 1YCFA 1YKGA 3FVWA 5JROA 3QE2A 3OX1A 1AKWA 4XDHA 2N1MA 4C76A 1OFVA 2FAXA 2V5UA 2OHIA 1E5DA 1BVYF 1AMOA 4YAWA 3NHYA 3NHKA 3OJXA 1NNI1 1FUEA 4GQIA 3HA2A 3UXEA 3GAMA 4C14A 1TLLA 4ZVMA 3FW1A 2W5UA 3OX3A 3N3BC 1RCFA 2QX4A 2QWXA 3QFRA 3D7NA 5B3KA 4LTMA 4PTZA 3F90A 4C0WA 2QMZA 5FA6A 5LJLA 5BUCA 3TE7A 3OWXA 2HNAA 4ZVLA 4S24A 4YQEA 2XODA 4Y9RA 3TEMA 3W78A 3B6KA 3O73A 2X2PA 1AKTA 1FVXA 4LAFA 5ULLA 4GR9A 4BMOB 3KLBA 1XYYA 1SG0A 5FUQA 1VMEA 1RLIA 3NHUA 3KEGA 1CZKA 3KAQA 2HNBA 4QOIA 2FVXA 2D5IA 2Q62A 2QX8A 3LT5A 1F4PA 3NFRA 4QOGA 4QOFA 5LBTA 3W7AA 2R96A 5NULA 4F8YA 1FLNA 3ES9A 2KQUA 3FNIA 3NHWA 1DX9A 3FX2A 3F6SA 2RG1A 4H6PA 4CF6A 2X2OA 2FZ5A 1T5BA 3ESXA 1X77A 5F12A 1H66A 2MT9A 3NHRA 4BMPB 1JA1A 1QR2A 3F6RA 3UXHA 3FJOA 2BPOA 4QOEA 3LCMA 4M0CA 3B6MA 4YAFA 3W79A 1J9ZA 1AKVA 2FOXA 1OBVA 4U7HA 1BU5A 1YDGA 3F2VA 4OXXA 1D4AA 1ZWKA 5NLLA 1OBOA 1YOBA 1AKQA 3TZBA 3G5MA 1XYVA 4ICIA 4N65A 1CZOA 2BF4A 1XI2A 1SQSA 3OVMA 4XDGA 5LMCA 1AG9A 2Z9CA 4LA4A 4NULA 2A5LA 3N39C 3ESYA 6NULA 4ESEA 4DILA 1J9EA 4LTDA 2R97A 2QR2A 1I1OA 2FLVA 3OJWA 4N82A 4C0XA 3OX2A 4D02A 3EYWA 1DXQA 1D04A 2Z9BA 1YRHA 4N9QA 3W77A 1QHEA 3KAPA 1V4BA 1WSBA
chains in the Genus database with same CATH superfamily
1KY3A 4J6FA 2FMIA 4KCGA 2EIXA 2VUHB 3KTAB 4XGNA 3WRVA 5DM70 1WSWA 2WJHA 4RTNA 4QUKA 1Y6GA 4LHYA 2B1GA 1J09A 3KUCA 4Y2VA 5MDHA 4D6YA 2VTEA 2ES4A 2FPWA 5JDCA 1A8SA 4OHPA 2B5OA 2RDMA 4M2LA 2AR9A 4JEIA 3DEYX 3EBOA 2XQIA 4F9GA 4ZEOA 3CLUC 3D31A 1NQOA 1YVRA 2P40A 5E9WA 4YRSA 3EFOB 3GFQA 3IDSA 5LQUA 4DAEA 2J3QA 2NYAA 4PZ9A 4UAVA 3FGPA 3SJAA 3WB0A 1FP4A 7ABPA 2ZBPA 3OZCA 4CIVA 1GNRA 1YAJA 3DMTA 4UEWA 4RM2A 3NP7A 3VTKA 4KMSA 2M1ZA 5JFTA 2YWBA 1H2YA 1GSAA 3Q85A 1OXVA 3HXLA 4UQLA 1IHYA 1I94B 1T5IA 1D7AA 4G01B 4R9SA 2B5VA 2QY9A 2IOYA 3MINB 1MXFA 1IN4A 4G1EB 2CW5A 2Q4OA 2ZTHA 1C9DB 4OXNA 4CMEC 2DLDA 1N6HA 4Y0NA 1EQAA 3MK31 4XJTA 2QB5A 1PR5A 3AB3A 2XSZD 3IEXA 2HHCA 2EL9A 4L1KA 5FUMA 4H1WA 4CHGA 4H7JA 4LVUA 4R83A 3FMIA 4JHXA 4WNAB 2X7XA 4JMLA 5KNDH 5JYEA 4CXMA 4V0LA 5KJFA 4FE7A 2FJUA 4WNIA 4KWEA 1D2HA 1DRVA 2YW9A 3AIMA 4REMA 4EGCB 4ETMA 4WY5A 2CL0X 4Y9UA 1HOXA 2V8BA 5LSAA 2VJLA 4UMVA 2PZLA 2ZOSA 1KS9A 3HN6A 4P3NA 3WLRA 1ULAA 3IE2A 3HVUA 3N9IA 3UXMA 5BP7A 5HKBA 5JO0A 1G7CA 3HBMA 4HP8A 3AJ8A 3S7TA 1IWPB 3IHLA 2I9KA 3B3GA 4G23A 1G9XA 5JBQA 4XVUA 2B34A 3P2IA 1MRNA 1CY7A 3FYCA 3I2KA 4EQZA 1NFQA 2QUAA 3IT1A 3QJGA 4W5OA 2WM9B 3LUGA 3V97A 3L0CA 1X3SA 1AHNA 1W5AA 3W0LB 1TVKB 2ALJA 1NI4B 3CUYA 3L41A 4R16A 3TN7A 4E32A 4AW9A 3TIXB 4ZMRA 1N34B 3L46A 1K88A 3IVXA 3GLUA 1J8QA 5A5GA 4IVRA 1OILA 4GO1A 1JDUA 4P0QB 3L8GA 2G0TA 3BEDA 3I58A 1P8AA 5F2KA 1YONA 4QVIA 4LYDA 4ARSA 2AZXA 2ETXA 4QZVA 1Z0JA 4EY5A 2HWUA 1DQYA 1M2WA 2IU0A 1ZQ9A 2QR5A 2I1WA 3TYXA 4EHHA 4E3ZA 1OI2A 5UKDA 4UATA 1B1CA 4G89A 2UKDA 3GCDA 3W5AA 3DYBA 4FJ0A 4DIBA 4L5CA 2YV4A 4EO7A 3R41A 4ZTBA 4EYQA 5IU6A 5DNYB 5I4IA 2YVKA 4ARZB 4MWSA 1FFEA 4KOEC 2AZ4A 3TIFA 3MYRA 1J23A 1Z25A 1YHNA 2A0YA 2RGEA 2F9MA 2NOAA 1J6UA 2UZIR 2E6UX 5AXDA 2CDCA 4BB0A 1XZEA 3F97A 3H5IA 1PQYA 1H42A 4UDOA 3RABA 4KGZA 1KTIA 2HI0A 3NCTA 2A88A 1YJXA 4O1MA 3R5JA 4R0VA 1APBA 3F49S 3QE9Y 2BMWA 2H17A 2OZEA 3U0BA 4CWAA 1DC3A 1L1FA 3VTAA 1XCMA 1P60A 2J30A 2EFYA 3B89A 4YXWA 4L0DA 3ED1A 2C2XA 2HSDA 2OD9A 4WEOA 5FPKA 5HRUA 3P27A 2O5RA 2P6MA 3TVTA 4FQ8A 3TQSA 4G0PA 5HUQA 2BOVA 1R0RE 1CE8B 2X6RA 4PZLA 5JCJD 3LMKA 3OLZA 1YRYE 1A82A 2FSPA 1R6XA 2HDWA 2I1LA 4Q37A 3MMZA 3MT8A 1I33A 2IY7A 2ZWMA 5AP9A 1Q1NA 4ZJPA 4Q1CA 2CMHA 2VEDA 3VAZA 1K8RA 3ZV5A 1G21E 2IZ1A 4LJYA 3TXYA 4JI2B 1XNRB 1HDXA 1PN3A 1FRZA 1YIAA 3EDMA 5G4LA 4A16A 4ZVOA 3GP3A 3KLMX 1QLWA 2Z83A 3G5UA 1PR6A 3NHPA 1G3MA 2ZJ5A 4L02A 4QDXA 3S2ZA 4JAVC 4BLWA 3HPRA 3FBWA 2Q9CA 1FXWA 4IF4A 4L8YA 4WZBA 4E15A 5KPJA 3EZ2A 3WV5A 3R7WA 2JEZA 2QZJA 3NB0A 4OQXA 2RHOA 2V45A 1E4YA 2WV9A 1JLMA 2D2EA 4I4NA 4NJMB 1UAYA 1QCCA 1J9GA 2G5TA 2H29A 3W7VA 5DSZA 4A6DA 4YMUA 3WLKX 2V7UA 1VIAA 1J8YF 2VDVE 4O4HA 2GBLA 1Y7IA 2YJNA 2YW2A 3PKJA 2VTBB 1KXJA 4G25A 4UM5A 2GMWA 4RSMA 1Q7EA 1G8HA 2ZI5A 2XUAA 3QXGA 4PNPA 1QYVA 5FNVB 1XTZA 1C7FA 3PPVA 2ZS7A 3DCJA 1I5RA 3UWMA 1DBWA 2PFGA 3PD0A 3QBJA 3UV3A 1AZLA 2HHJA 2IYSA 3KSUA 2IYPA 5GONA 5T6MA 3CFYA 1FX0B 3LBIA 3PDIB 1Z2NX 3WWPA 2WE8A 4KPYA 4ZU1X 3ZBPA 5KREA 2WK1A 2RBEA 3BB1A 3HUEA 2QN1A 3L0ZA 1TM3E 2XBLA 1X0VA 5KUTA 4XX0A 1Z0ZA 1M7BA 3WGJA 4QFMA 1L7BA 4FFVA 5BUSA 4E2WA 3MAGA 3WGTA 2V5VA 1BDJA 1E94E 3OCJA 4LSGA 4HR7A 1L1RA 3LVFO 4WLVA 4GKKB 4Q4DA 1RZ3A 1ZJWA 4FR2A 4LHXA 1JEJA 2ZTMA 4CDGA 4B2IA 3L1VA 3AQ4A 4L2IB 1CUFA 3GW8A 1ZY2A 2D8AA 1Y8AA 4Y2RA 2OLKA 3BZWA 4L5BA 1PJ4A 3RLIA 3BJEA 4XRRA 4CMJA 4RKFA 4W82A 4WSOA 1GPYA 4RPLA 1LC3A 1AO0A 4LJLA 1S8OA 4JEUA 2D74A 1NVKA 5TMEA 4JLAA 2QGZA 2PGDA 5C1OA 3GJ0A 5ITZB 1AQLA 2E4VA 1S4MA 3GVCA 3NC0C 5THKA 1N0WA 5FULA 1SELA 3IOMA 5GQSA 3S55A 1U7XA 3FCYA 3HP4A 1L3IA 4KXUA 3LT2A 5C8ZA 5JCZA 3RBXA 4RTLA 2PQMA 1IATA 1GPJA 3A1UA 3JQRA 1ISGA 1X0XA 1C3EA 2CZCA 4WEQA 2XCOA 5DTJA 4JZKA 1UXOA 2ZJBA 4J0DA 3LPCA 3NBYC 3NHZA 4IHJA 4LHZA 3O1JC 2ZJFA 3ESDA 2OE2A 3FZNA 3IXMA 3P97A 1R8YA 4YCSA 3T9CA 1UR5A 4Q7JB 5EIHA 1KTVA 3ZW9A 2WJJA 1FFGA 2PVCA 4EW1A 5HNKA 3QU9A 4FYWA 1PQWA 1YL6A 2OL4A 3BXEA 2GZ3A 3A7DA 3I09A 3OAAD 4LSWA 2B30A 3VNRA 1K3TA 4DB2A 4KU4A 3T5GA 2LDXA 3JPWA 1KZYC 1XEXA 4G4SO 2DB3A 5D2CA 4PFQA 1DLIA 4BKMA 4F5WA 1JAYA 3L4EA 1FUEA 3VDMA 4DNQA 4EMSA 1P4GA 4D92A 1WMSA 2J5RA 2QL7A 4NTZA 3W8DA 2VP2A 4CTOA 4TWBA 4MRNA 4JXXA 2JD2A 3GDGA 3UYKA 3MB5A 5DO9A 4DLZA 2Q4TA 5HWSA 1NF9A 2Q3LA 4AQ7A 4WCDA 5JJ5A 4MQEB 3CY6A 2FFBA 3WQQA 1B41A 2CV2A 2EJUA 2I2CA 1UFQA 1VKZA 3KSDO 2ZRFA 3N7UA 3WQSB 2XDWA 1KVQA 4MKXA 1DRUA 2QUIA 4R1LA 1JEOA 3BB3A 4FDVA 1XBTA 1ZGCA 3KJXA 1KRHA 4M55A 5D7BA 3U44A 2GJAA 2R65A 3U4AA 5DTRA 5BOSB 5EYPB 3DHWC 2I3BA 3U40A 3HN2A 3DYIA 2XOXA 4YAIA 1MO4A 3IP1A 4UBOA 3BULA 2GM4A 1JSRA 2ZJZA 1JJAA 1SCNE 1V43A 4BRUA 2CC2A 1GLNA 1XHFA 1PJQA 3C3XA 4M9UA 4Z99A 1IOLA 3ZHSA 2ZBQA 4NOLA 4OGWA 1FDWA 2DQKA 3NC1C 1LZLA 4G26A 2OZLB 5EKSA 3BSWA 4D1YA 4DQKA 4B80A 2ZWVA 3RVSA 2XGOA 1Y0BA 2PFKA 1B42A 3E53A 3TLAA 1MHPA 3H65A 3MW8A 2FN4A 4DYDA 4EEKA 3SC2B 1PWZA 1PUIA 3HB1A 5IABA 2Q4EA 3B1WA 1BX0A 1JHPA 4XW2A 4EW2A 4U39A 3ILYA 3QFFA 3DYVA 1MIOA 3RRJA 6PFKA 4KFTA 3TR6A 2W2XA 4YUYA 1TQ8A 3ENWA 3KQOA 3B6KA 1FU4A 2AQIA 2OM6A 1MX9A 2IVFA 2ZSIA 3O73A 4FINA 3L07A 1TM2A 4MWTA 4NZZA 3UJ3X 4NYJR 3M7IA 3BIFA 3IEIA 1JP7A 5ALTA 2CWWA 1Y63A 4EECA 2SCUA 2IUTA 2ZB4A 4PVCA 3EQ2A 2C84A 3QQPA 1DQSA 5GOTA 4I99A 1HL3A 4RK1A 4DA7A 1P7CA 5L4NA 2F3QA 4NI5A 3U3OA 1DJMA 4YPOA 1PKXA 1NNSA 3A37A 3GFVA 1ISJA 1M7HA 2CXTA 3GPBA 2ORVA 4A6PA 2IYAA 1KP3A 5HOEA 3PPIA 5CYOA 1FFXB 2G9NA 4P4LA 3RSFA 3I2IA 4DVJA 4AZWA 2HB6A 3FDIA 3T1OA 3NAGA 4OREX 2PAAA 5JR3A 3Q87B 3AK4A 4B4KA 1ZSVA 2WU4A 4B0OA 3I61A 3VVLA 2O7QA 3N8NA 4IEIA 3K71B 3OPXA 1XZQA 4K6FA 4KXFB 5CX1B 5C7YA 1GNQA 5JC1A 1HURA 2JCVA 1CULC 1SHKA 4FEAA 4KDEA 5HFJA 1QCYA 2BUCA 4QGGA 4GVLA 3ZBQA 3D3QA 4RA9B 4KTVE 4UUMA 3R5TA 5DYNA 3R7SA 3FMVA 8LDHA 3TSWA 1FRVA 5C51B 3UAGA 2DC1A 2YH2A 4HG2A 3W7AA 5CB4A 1UBTS 1O4VA 4G1MB 1DIRA 1VECA 4J1TC 1XWWA 1IM2A 4XA8A 3GLHE 2ZIXA 4AUMA 1OUMA 2BR5A 3KPUA 4LYYA 1R3DA 2ZSHA 1H6AA 1POXA 2KQUA 2GO7A 2YWRA 3DZCA 2B3TA 3HRKA 3IODA 1ULZA 3ETLA 3FUTA 2Y68A 3DMFA 4WH0A 3F6SA 1ORWA 3GIDA 1YC2A 3SLGA 4UNSA 3ZE0B 1V5EA 2XKKA 3DM9B 2F4VB 1UQTA 4EA8A 1LDMA 5LQRA 2H5LA 1YD7A 1JR3A 3VR3A 2ZG6A 2FMHA 3QG1A 4FLMA 1SBYA 4Q7KA 3R3JA 2J3JA 1TIBA 2ZUSA 2UVPB 4FFRA 4I1IA 2A0UA 4UJ5A 4K9PA 4RHEA 4XJSA 1K6IA 4MYCA 3UWPA 3GUUA 4GM4A 1SVSA 3CRQA 1DTWA 4QTYA 5CJ2A 3GT3A 2JFUA 1JEDA 1YL5A 4CMIA 4ZI7A 3HXTA 3QZUA 2R48A 1XVLA 1KMHA 1D6MA 1DIHA 3RTGA 4D5EA 4W1PA 1IM5A 5JSFA 3DKVA 1Z5UA 4LSMA 2IE8A 1ACLA 4PG4A 4RLQA 3UJPA 3VTFA 4MCAA 3X2SA 3B6MA 3DDWA 1MBZA 3OZXA 4H4DA 1E32A 2QZ9A 2VPTA 2YDXA 3A25A 5JSYA 1M34E 2AL7A 1PK9A 2C94A 1JVSA 3I9V6 1AKVA 1ZK2A 1OBVA 1PWHA 3DWIA 3CJQA 1PSWA 4KMMA 4AIRA 4KZKA 2NXEA 1D1QA 3KWJA 3UFXB 5HQTA 4ZT2A 2K4MA 3DWGA 4QEKA 1PRYA 5KSZA 3G23A 4Q16A 3GQBB 1I6MA 2IK8A 3AF0A 3OTGA 4JBGA 1O8BA 4PRLA 3RSSA 1U0EA 2WMOB 4CNQA 2ZVDA 3SYKA 2XKJE 3QE3A 4TWAA 3RAJA 3I9NA 2D5BA 2FKNA 4FW8A 1QIFA 2O2JA 4LJ9A 1OLXB 4FFLA 4F3NA 3AG5A 4R1SA 3U1BA 3KTAA 3RYFB 1XWFA 1WKCA 1XQ1A 2WTEA 3C3JA 3LOPA 2HMAA 4TMTA 1JSCA 1URPA 2GKSA 3I76A 2YHUA 5HS6A 2P68A 4KR6A 1HO3A 3FMOB 2DUUA 2ANCA 5AW2A 4OH1A 1NUUA 2Z8YM 1ST3A 1EX1A 3K5PA 4KJZA 1CS0B 2A2ZA 1E1YA 2YV3A 3EFOA 1XNGA 3IR7A 4FYPA 2C3YA 1Z83A 1OH7A 4HFJA 2A5LA 4EZIA 3N39C 3PQ4A 6NULA 3TXXA 3RRZA 1WUYA 4IICA 4LC1A 1KIAA 2HCFA 2R97A 1DAMA 1I6WA 1TUBA 5JSKA 5FOUA 4Q1EA 2FCAA 3FRIA 1VJCA 4B74A 5AKZA 1CS4C 3OJWA 4ZO9A 2HJGA 3N0TA 2I4MA 2O3JA 2IIBA 4HTFA 1PIWA 4ZOLB 3HZRA 3A6EA 3EYWA 4B5KA 3UMFA 4D0NA 3EQ7A 4ZOBA 5L3QA 1RLUA 3LKZA 3PCXA 2B78A 4QNMA 4INOA 3INYA 1C50A 3R5HA 2W48A 2RGGA 3EZNA 4I50B 3EDYA 4QUIA 1JJVA 4WWHA 2CXUA 2R4QA 3QYAA 3BL6A 4HN2A 1FTQA 4GI7A 1KO1A 2HLDD 4XIIA 3SK0A 3WYBA 3LW7A 4JUDX 4CEHA 3G2QA 1Z73A 1Y1RA 2UYQA 3BK2A 5IEJA 4ALKA 1XZNA 4ZC8A 1T4DA 2B98A 2PKRA 2YZNA 3V4SA 5AM2A 2FQWA 3MA0A 4OIMA 5CLHA 4M54A 1QYRA 1VE5A 1U1FA 1PJ8A 3QXCA 1PU2A 1Q7RA 5B7PA 4Z4EA 1IWBB 1GRQA 2O0HA 3SVZA 4CL8A 8OHMA 1TM5E 1Y7HA 4YIHA 3WKCA 1PCXA 5JZBA 1MV8A 1NVUQ 2IYEA 2Q2VA 1JFTA 5KCMA 2P9BA 5TQVA 4F6RA 2G1KA 1DAIA 2QVCA 2W6QA 1U5CA 2RH4A 1TVKA 3NIFB 1NI4A 4EG6A 3OPYB 4P98A 2MSLA 4Q9JA 3DWFA 3EAGA 4H0NA 1L7QA 3AR2A 3O4HA 3U81A 1QAOA 3LX4A 3NYRA 3HP7A 1XVVA 4JENA 5KQPA 1QZXA 3PP8A 5BW4A 1Q15A 2Q6LA 4LYAA 1NP6A 4J2OA 1LBIA 4KIUA 4E22A 3T1QA 1FIUA 4R2JA 4ECAA 3BMQB 1LD3A 3FVRA 4BLQA 2HHHB 4QU9A 3JQBC 3TRIA 4RVNA 1HM5A 2WZBA 4QYTA 1CXZA 1G6HA 1ZA2A 2GM3A 1P1HA 3UJNA 3T5PA 3U7IA 1BE0A 2YMPA 3CTMA 3E9EA 1IONA 3ZQ6A 4PZZA 1PGJA 3H1PA 3HB9A 3PXUA 4PYRA 1U9YA 3U3ZA 3B2NA 4I4TB 3FYHA 3THSA 1EFPB 4LZAA 4CETA 3E5HA 2X5KO 3EARA 4GNKA 5EIBC 3RNLA 2RGXA 2P5YA 3KB2A 3VNVA 5HF6A 4UMDA 3WGVA 1XTRA 2G5GX 3SR0A 3LQRA 4NV1A 4YS6A 4C05A 2P9TA 4MVJH 5AVXA 4MUKA 1J0XO 2NO6A 1CE8A 3SQMA 1PEYA 3EVEA 3RFUA 3A6PC 1VRWA 1HYGA 1NT2A 2Y0BA 2I55A 3HEAA 5ANRB 1V2GA 2VHJA 3ZI7A 3H19A 4N49A 3RJTA 2AFIB 1JLLB 1G2PA 1ZESA 4U9HS 2AX4A 2VWHA 3AR7A 3FR7A 5EJFA 3BXHA 2UV8A 4M8NE 1MZPA 4N4AA 5HMLA 3HA5A 5DNDA 1DQNA 5TQ0B 4RM3A 1T5HX 2ZXFA 2ADFA 4NOMA 4LDRA 5E2BA 1YI8A 3CN9A 3SIWA 4A36A 4DABA 5AUNB 3VISA 4BOYA 2DSNA 1T4BA 1GRVA 5ITVA 1JKMA 2GJKA 1NNUA 1NKTA 1SVUA 1NVTA 2OBLA 2QR3A 1SD2A 4LKRA 2VQDA 2PMEA 4ZEVA 3L8HA 2P8SA 4KFCA 5KZMB 1OHHA 3EVTA 3HA7A 1PQPA 1U90A 4YAUA 4NJMA 1XNHA 1P73A 2B99A 4FGKA 4ID3A 4IS2A 4Z2YA 2Z8YA 5C53B 4K86A 5KINB 1ICIA 2ZRDA 3L04A 4QVKA 1SO8A 2I76A 3HV0A 2VTBA 3DCNA 1V4VA 5REQB 1S8NA 3CF0A 4Z49A 3O8OB 2WV7A 4RMGA 1UZMA 5FNVA 3H7IA 3ADCA 1V47A 4NEGA 4TL8A 4TMFA 6REQB 1GZVA 2EF0A 3KM0A 1YR8A 3A1VA 5ECGC 4TTPA 4YK7A 5GJVC 4CI9A 1X80B 1ZUIA 4I5EA 2X3FA 3S27A 1KQGA 3HB4X 4S04A 1Q19A 1WVIA 5A9TA 1FX0A 2WICA 3PDIA 4JH0A 1DDIA 3VZDA 1BWSA 3WQHA 1Y33E 2EX1A 2PWBA 2P9EA 4ND4A 3ONFA 2QYSA 5BPHA 2C3UA 4B4UA 3EOZA 3SIPA 2WAOA 3A26A 3GJ8A 2PUCA 2FR1A 2QF7A 1I4TD 3BE6A 4MOWA 4V24A 4XLLA 3RD5A 4G36A 3HY6A 1DC8A 1Y4AE 1ZVKA 3AHGA 1Q74A 1SB9A 4UEOA 3D6TB 4I0WB 1BEEA 2FP3A 2Y1OA 4QG3A 1CR0A 2MSNA 2OORA 3C6BA 3C6XA 5ITSA 2PNJA 3CPSA 3ZHOA 4OB8A 1Y1TA 1J00A 2JFPA 5GJWC 5AKJA 4QHTA 4L28A 4F2GA 5JXIA 1A2QA 1XNJA 2FQXA 2PTHA 1R37A 1VIMA 5TGTA 2G25A 4CM8B 1Z4KA 3ELBA 2C1EA 3IUPA 2Z58A 1FMTA 3JASB 3JYPA 3KKMA 1YACA 4M1WA 2PM8A 1E58A 3LP5A 1TEHA 4NE2A 5GZ3A 3PC8A 2H2DA 2YBDA 4QTUB 1I9CA 1G8MA 3OT5A 2J32A 1WP4A 4LDAA 3RVBA 3F67A 5DXJA 2XYHA 1U7WA 1VM6A 4OMFG 3TPZA 3M1AA 2QYTA 1FLVA 2WPNA 3ANLA 4N5DA 4PZ0A 3NNDA 4KDRA 4ZQIA 3ZTYA 3CX7A 2WIFA 3Q12A 4CV3A 4RK5A 1NVVR 4Q1AA 3U62A 1M73E 2VKQA 3T34A 1NVXQ 3B6JA 4YUXA 2QX9A 5LXTB 3PNLA 4CZ2A 1W19A 5AOVA 3HJUA 3BWYA 2ISSD 2BFMA 5LBUA 1Q3HA 5KIAA 1RRVA 1ZN7A 2PH3A 3AFNA 3EGOA 5J59A 4D96A 5ICSA 1Z6TA 5BT9A 4C43A 5IHPA 4F4JA 5AMXA 4X95A 3VHLB 4QUGA 4AC9A 4X44A 2B6HA 1IXKA 2X4IA 4HADA 1AQUA 2TMYA 1ODIA 1WD5A 2LGJA 1F8GA 3BMNB 1TUIA 4MQ4A 1WY7A 3DAOA 4XWYA 5CAEB 5K8IA 1UBMS 1ZM4A 5CFNA 2NXWA 1FFAA 3CB4A 5KNCH 5KQGA 2G17A 3VPGA 3TQQA 3FR8A 1F48A 4PU0A 3I2YX 4X20B 4ABTA 3L7JA 3AR5A 5BOSA 4IF6A 3KJQA 2WIAA 1ZNZA 2D7DA 1KO8A 2X23A 3C5HA 5EYPA 4HWOA 1NHWA 2V6JA 1NTOA 1QLHA 4EAAA 1ZMOA 3ZTWA 1T4CB 3K0BA 5CM2Z 4ARVA 5KSWB 1H94A 4Q48A 1B23P 1SULA 3MUNA 5JROA 1YS7A 1Y37A 1LFDB 1LPBB 1SUFA 3VC2A 2BGRA 2JJYA 2XJ4A 2O5CA 4B75A 3EPRA 3O38A 1W5TA 2C2KA 3SXUA 4TYPA 3HWSA 3QUSA 1WZNA 3KQMA 3ENKA 4YI5A 1BS1A 1EWKA 1JHOA 3QK7A 4Q02A 2Z4RA 1NP7A 2H07A 5CGQB 1GGFA 3WIBA 3T5BA 3KQUA 1FRFS 3K2QA 2ZRGA 1D0SA 2L19A 3B8EA 3S4YA 3SC2A 2I6UA 5DP1A 4URFA 5AK3A 2D7CA 3ELDA 1BDBA 3RYIA 2DH6A 2ZUDA 2E9SA 4DA4A 4DMUB 3K09A 1WD7A 1MJGM 1XEAA 2VJAA 1SCDA 1ONOA 3EH1A 4XI9A 3HA2A 1NM5C 5T67A 4RSGA 1VI6A 1ZN2A 4ESOA 1F06A 2VSFA 3ZOZA 2CXHA 1ZUD1 2AFRA 3EZFA 3R6TA 1QH0A 3K2IA 2PXXA 1PFQA 4GWLA 5EZQA 3W4JA 1F0YA 1FRNA 2C3OA 3C3EA 1TC1A 4HDSB 4HWSA 1CQJA 1NYQA 3GLVA 1E9DA 4OHYA 3JZMA 1CX9B 3IAM1 3G1WA 5FI0B 2L69A 4QDTA 1B4DA 3E5RA 3NOXA 3C85A 1SAYA 3N86A 1ZC3A 5I9SA 1ZMBA 1FEZA 4MA4A 2C4MA 3WV4A 2WWFA 4IPTA 3VNAA 3R2JA 4DMRA 3RVNA 5JWOA 1L4UA 4JL5A 3ZS8A 1A97A 1RQNA 1YZQA 3IAFA 3KDSE 3UJ9A 4BYMA 4EWLA 2LXNA 2GUGA 5AI5A 1E66A 4H4CA 5C9ZA 4YECA 1FFXA 3W90A 4R71A 4FCVA 4ERXA 4XVQA 3KJFA 1LPNA 1T1RA 3ABSB 4GG1A 3O8CA 4QHYA 5FJJA 2UXCB 3C8ZA 2WPDA 1H0HA 2XUJA 2VEOA 3QEOA 3ASZA 3FNHA 2VAPA 2G76A 5CX1A 3CHYA 3CEHA 4Z6KA 5T4EA 2I2DA 2RIRA 2ZB7A 5T8KA 4P5EA 3AFGA 3FWZA 4LJ4A 4S24A 4W1SA 1LX7A 5EI5A 4YQEA 4F21A 1IULA 1M74A 1Z0AA 3QUCA 1UT8A 2HNKA 4Y6SA 1SVLA 1FJHA 3K16A 3V32A 1A1VA 1U9CA 2PRJA 3NJ8A 2H57A 4P36A 1U2DA 3D4OA 3WL8A 1PLLA 2NIPA 1JHZA 1VYUA 4K2HA 4BAGA 4P22A 1Q17A 4BY9E 2IUUA 1HXHA 1KVUA 1NYLA 2B6NA 3HDGA 2X0IA 5EESA 3E9RA 4OL9A 4IGIA 4L4RA 3DF9A 1Y4DE 5KU1A 4TX1A 2QJRA 1U6JA 4RH1A 1KYYA 3CKYA 1HETA 2AN3A 4MROA 4N3AA 3U7QB 2YWXA 5C18A 1EVQA 1SY7A 1K6JA 3W6OA 3H1EA 4AMYA 1FPMA 1WLSA 3E8XA 3FB4A 2WU8A 4E51A 2XTJA 1RW4A 1QOZA 3H5OA 3OURA 3UGTA 1L4FA 3AUFA 1T43A 4G0OA 4WQMA 3V1MA 2B94A 1ORDA 3B6EA 3AUJB 4CKXA 2XBUA 2HBRA 4HQNA 2M9MA 4GQAA 3QEJA 3CVWA 2C2ZA 4GPAA 4D4KA 5EHZA 2C2WA 2QVGA 1ID8A 2HF9A 5GJBA 2QP3A 1EFCA 1Q95A 3QVJA 4MGEA 4I19A 1GTJ1 1YDFA 1ZSYA 3AR4A 4RKQA 1AN0A 3ZU3A 1R0SA 3M70A 4IIYA 1A95A 4MYUA 4OA5A 1IL0A 2HA6A 2KWIA 5IW8A 1MB4A 2PHZA 5LQAA 2QTBA 2ONCA 3ZXSA 4NBTA 2VR1A 4QSMA 3GP8A 2BFOA 5LIRA 5TRTA 2F59A 2JL1A 1PR0A 2AH5A 2WHPB 2ZRQA 2P90A 1S3FA 4INJA 4MO2A 3RUHA 3EIWA 5THQA 3ZD6A 3H75A 2GH1A 1OASA 4UHBA 5LLTA 5AHKA 1JX6A 1UODA 1Z16A 3KIPA 4G56A 2VDMB 2PT9A 3DO5A 3FKJA 5SV2A 2GYYA 5DMXA 4K9MA 1HV8A 1II9A 1R0XA 1DBIA 1YOVB 3H2BA 4NWIA 1NW4A 4ZT7A 3W3AH 1ZI8A 3GQBA 2C8VA 3FNIA 1J0AA 4AX8A 1Y9AA 4B2PA 1DCTA 2GPYA 3FX2A 1ISMA 3F8TA 5B36A 4GZ5A 1N8KA 1OZHA 3EODA 1NRXA 4FT4A 4DJJA 1DMRA 1OLXA 1PQ4A 1E96A 1ULHA 1RM0A 4IOKA 1T3GA 1M72A 1T5BA 4LZNA 4RKEA 3C8DA 3E1KA 3RYFA 4C3OB 3UH1A 4DG9A 4YCCA 5KBYA 5EIXA 1FDRA 5AKKA 1T9GR 1H66A 1P1IA 4NK5A 5G1PA 5P8WA 2GTPA 2WQ6A 4QYSA 4CYMA 5C1PA 4M1TA 2IEGA 1WXQA 5F5NA 4BATA 3GNQA 3AVTA 4L6CA 4LWOA 1MJGA 4WY2A 1CS0A 1E1QA 2PR2A 1C1YA 2YIJA 2DQ4A 3H2GA 1P9NA 1UUFA 3KCNA 2BI7A 1K2VN 1SQ5A 2MINB 3GA0A 4ZGWA 2O2XA 5E7IA 3U4HA 2N3ZA 4RPJA 2VAVA 2EQBA 3GEIA 5TXGA 4M76B 4CMEA 4Q19A 4JUIA 2GBFA 3EGEA 1KJ8A 3BYZA 1BN6A 2Z5LA 4S0XA 5IJXA 3ZXYA 4YAGA 2PUWA 1KO4A 2SICE 2H0RA 1X8JA 4ZXFA 3VHRA 1NV9A 4BQIA 1CP3A 1RHKA 3IIMA 4M0CA 3V6MA 4E14A 2WJGA 1T6BY 1C8LA 1P7WA 4ZOLA 4O5OA 3UMRA 4Z5XA 4ZAXA 1UMBA 1I5EA 4OKIA 2D3WA 3BGWA 3DP9A 3V46A 3H5LA 5LQCA 5EJGA 4S12A 3THWB 1A8QA 3H8JA 3ZZMA 1ML3A 2WR8A 2ZAYA 3GNTA 3O4IA 2B7LA 4I50A 4N12A 3ZEAA 4KAFA 4AF7A 5E8JA 5AVSA 4Z9BA 5FI5A 1MDBA 1TM1E 4O2AB 3RAGA 5CM9C 1CVIA 1Q7GA 2C92A 3CNNA 3L1JA 1CY0A 1WUKS 3V8PA 4DQDA 4F04A 4PE5B 5NLLA 4PR3A 4BC1A 4LHWA 1T10A 4PSCA 4PBRA 5A5EA 1LPPA 3G88A 3VC7A 1PV2A 4P4TA 1KQNA 2OYRA 4Y6GB 1AKQA 1PJSA 1T6ZA 3HCRA 1XYVA 1MH9A 4S05A 1S89A 4P3XA 1TQ2A 1MW8X 5SZHB 2GNPA 1ZRMA 3A6DA 4HRYA 3MBOA 4R84A 2COKA 1ZOLA 2H1FA 2XIJA 1AG9A 3D1JA 4KIGA 1P0IA 5I7OA 5CIYA 2OLEA 3ND7A 4NULA 4W7HA 2LDBA 2PU5A 3D64A 1D1PA 3CO5A 2XXJA 2DLNA 1MB0A 2AJCA 1W5EA 3OPYA 1AGPA 1ZI6A 4TKVB 5E9QA 5I48A 2A35A 2HRQA 3R20A 3F2IA 4CJXA 5HOQA 1OYVA 2VCHA 3IOYA 2JIOA 2GEKA 2F8TA 4QIHA 2FLVA 3IV6A 4XVHA 1PZXA 3BE8A 1C9JA 1D0VA 1O9GA 1ULSA 2FSVC 3TTTA 4LMRA 2X3YA 5TVKA 3A6LA 3IQHX 2PSSA 4D02A 4YT2A 3S8YA 4OGLA 3C3DA 3PL1A 3HCCA 1J33A 2NT4A 4JVNA 4OHUA 4I55F 3PENA 3PC3A 3VU9B 1N6RA 3G2MA 4HXFB 4EVRA 4G0UA 2AR7A 4ZHSA 1IEXA 2HZ7A 3E5MA 2CSXA 5E2IA 1LVHA 3MQFA 4B6GA 2VH5R 4BAUA 1XPJA 4PEVA 2PUGA 4HWGA 3IPAA 3PQ5A 1KO7A 1SRQA 3IUEA 4NRDA 5FHRA 4ZFNA 3KQPA 1N5MA 2FWRA 4UARA 2ESRA 4A0GA 5L7TA 5A2GA 1EX7A 1OI3A 1ECGA 1XZIA 2QN6A 3DR5A 3FAKA 5CFPA 4I4TA 1FTWA 3A2LA 1SRRA 3PGMA 3DLBA 3F6BX 5F77A 1NJFA 1AM4D 2CXXA 2X8JB 2BEKA 4K0KB 5DMHA 4O4HF 4HAUA 2VWPA 1V7ZA 1XTIA 1ZIOA 1II8B 2BISA 3QTTA 4XWOA 2PQ2A 4MQ6A 4KUGA 4TZ0A 2POCA 1YMVA 3OFSA 3EVCA 1NN3A 2RFLA 4MW6A 4RENA 1TPZA 2PT7A 1R5NA 3X3HA 1NMSA 4MRSA 4M53A 3PQ2A 2P3OA 3HYCA 3I2FA 4RIHA 2AFIA 4D8WA 5GONF 1JLLA 2G63A 3HYRA 1Q7TA 3TSCA 3ZH9B 4URVR 4EITA 1N33B 5K8LA 1RWXA 2HJSA 3OQIB 4M0LA 5BWBA 2ARKA 2JHGA 4HS4A 1XR3A 4ARBA 5TQ0A 4Z3KA 3PE4A 3AY3A 1JZQA 1SIWA 1WLYA 3AILA 5KWEA 2VYVD 3EH2A 2R00C 1IXYA 5KVSA 3K15A 2BYTA 1WF6A 2GBPA 4AVYA 4PYKA 4BQSA 2BKEA 2C2GA 1M75A 4B85A 4UZEA 1G1MA 3G89A 3ZCPA 4X3CA 5EWMB 4DR7B 3TMYA 4DB4A 4LFAB 2GEUA 3OJLA 2G82A 2P1DA 1PVOA 4TLDA 2XYGA 1WDKA 3NUQA 3ZY3A 1GZ3A 1ND5A 4Q9AA 3NANA 2P9ZA 4C30A 1U8XX 1Z17A 1HE3A 4GPD1 4KN9S 4ZAFA 5DBIA 2V9CA 2FPIA 4O0LA 5CDFA 1C7QA 1BNCA 1P62B 4IO1A 1VP3A 4L4YA 1TZCA 2BR4A 4NARA 4Q7LA 1VYTA 4YEDA 1XAHA 4X1IB 5REQA 3O8OA 4P9NA 3PDJA 1UT6A 3BE4A 2L18A 3U5TA 3OA0A 4FN5A 3PA6A 1KP9A 5FTLA 2ONJA 1MQ9A 1X1BA 3KFLA 1QYCA 1X80A 2H18A 1ULBA 4GI2A 5L3ZA 1KI2A 4OQYA 2Y71A 4Q05A 2YFQA 3ZWBA 3D5TA 4CQLA 4DDUA 1KRWA 5GY7A 4DBLE 1Z35A 1U0NA 2C4KA 2I4NA 1HE8B 3I9LA 3R3YA 3K70D 3Q40A 1E2MA 2QIPA 1DJOA 2C0PA 2Z3WA 3BBLA 2JK1A 1RS0A 2FX5A 3OOWA 3N58A 2HPZA 2V3VA 5EHGA 4Y98A 2Q8PA 5I9TA 4UC0A 3IUYA 4BFVA 4N5IX 3FJ1A 3FNEA 4R1PA 1E4OA 5FBWB 5L40A 1KOGA 3T0FA 1V39A 3IQIX 2DYKA 3H2ZA 3RO7A 8ABPA 3T4EA 1XA0A 4JT4A 2PO7A 4U2DA 3RHSA 1T9CA 1L3CA 1L6RA 1F51E 4ZO6A 4BJ5A 2HU7A 2PD3A 4EG8A 5CVCA 4EHBA 4PLVA 1C7EA 5LYJB 3JASA 1NDHA 4AMUA 4BFXA 3WLEA 3E70C 5TPWA 5HR5A 3EG5A 4S1NA 2R66A 2Q9UA 3SU8A 1J1IA 4MIEA 2EGUA 3L43A 2P6PA 2C7VA 1W88B 1U3VA 3N07A 3O03A 5FPSA 2XJ9A 5KAMA 2CV1A 1VLQA 3HACA 1QZUA 1VI2A 3TQCA 3F73A 1FSPA 1WQ3A 3QA9A 3A14A 3FNFA 3DR3A 4K6GA 3TL3A 1QVRA 4EP1A 4BEJA 4YCMA 2BMEA 2WAAA 3MCAA 4W8OA 4XPIA 3TLBA 1YGPA 3M5DA 1E18A 1Z8DA 2KMLA 3JRNA 4E09A 1D0IA 4DR4B 1U9ZA 4URHA 2WTAA 3VSAA 3M5WA 1SIUA 5COQA 5EWJB 2XUDA 5DNUA 1KYVA 1LNSA 1QFJA 5B3JA 3HKDA 5LXTA 2AD5A 2BMVA 2XE8A 1EFUA 3QUAA 2VPQA 5KQSA 5TNXA 3X44A 3KETA 1QB7A 2IODA 1OW3B 1W8DA 4WD3A 4TTQA 1PG0A 2G04A 5DISB 1KZ4A 1RU3A 4AU1A 4IGEA 4MB2A 1G5IA 3P5BA 1CJTC 1F8UA 3O0TA 5GM1A 1ZK0A 3HYNA 4FLEA 2PT6A 4JEHA 1EZ1A 3TLJA 3CZMA 3PQ7A 4OXRA 2V3WA 2R7LA 1T91A 3O8RA 2QQ5A 2CFSA 4C4ZA 1RJGA 4ZEMA 3EIXA 3ZE9A 2ZT6A 4C2BA 4AK9A 1GVNB 5JBNA 2JGEA 3F8WA 5FO1A 4PNEA 3TG8A 4X20A 1OI7A 2OY0A 2OXEA 3BERA 3AF2A 1I3NA 4AG6A 1MXHA 2QGFA 5BOVA 4YO7A 2ATXA 3PEVA 1LPOA 4U5QA 1T4CA 4R8RA 3G2KA 4YXFA 4BXOA 3G9QA 1PR3A 2D4AA 3KZMA 3OIDA 1E69A 2VBCA 3B5EA 3A9UA 1CUVA 1SFRA 4YVFA 4G41A 5EWLB 3ZIDA 5HZHA 2LZ0A 2ZCJA 1O5OA 2J0VA 2JAHA 3WDSA 4Z54A 2V8OA 4JI7B 5C35A 2AK3A 1SCUB 1ZEMA 1SU7A 4B73A 1GO2A 1OXTA 1ZXLA 2BKUA 1GTSA 5JJKA 4F7DA 3HUTA 3F3MA 4ESVA 3HUDA 2I78A 2XMBA 4OPMA 2H3HA 5FTWA 3K0AB 3LGAA 3QY9A 1TADA 2FQ1A 3CRMA 1RAIA 1TKCA 1IB0A 1YB2A 3ISTA 4KPFC 1TM7E 2BFAA 4YT4A 4HLNA 5H3HA 4YFYA 3VNBA 5CRIA 1DZIA 5INTA 4JV5B 4XFKA 4HTAA 3F9IA 1MT3A 2HSEA 2FSGA 4RTOA 4H0FA 2CNLA 1G5PA 1C9MA 3IPLA 5KOJA 5FR2A 2P2ZA 2RG7A 2ZJ0A 2A9QA 4M1KA 4TT8A 4C4AA 1CRZA 1WMDA 1QP0A 2WYHA 1T2NA 5CW1A 5JJLA 1GU0A 4AO6A 4AY3A 3VKGA 3M4NA 4M0UA 1FW6A 1F12A 5DASA 1RJWA 2R8ZA 2P9CA 3O9ZA 5CB4F 4WKOA 1P77A 1A71A 4HSGA 5E6RB 1WSAA 3T5AA 4O8ZA 5H82A 5KS2A 4EBBA 1AB6A 3TDMA 3ROFA 3VGPA 5E7JA 5IARA 3WLMA 2BWJA 1U04A 5CFRA 1C8VB 2OMKA 3F3SA 5HYVA 5K0TA 3QTLA 1HZZC 3X1DA 3DT8A 2O8CB 3ER6A 3LLUA 5JZOA 1XPOA 1FYWA 5BWMA 1RQRA 3UN1A 5DOZA 3CW8X 4YP0A 2Q2QA 3A31A 1UADA 4XDHA 4ISBA 5CH3A 4BVJA 4B3SB 2JFNA 1BA2A 2FUEA 3R9WA 1MEJA 1D1TA 5TF4A 4DR5B 5DLDA 2R6AA 2ATVA 1RXIA 1PNRA 3IV9A 621PA 4Y6OA 3UMCA 1RAEA 4ZV7A 4ARCA 3R3WA 4FCCA 4BGUA 1XAGA 4UUOA 4W5TA 4YY3B 4ZGBA 1KO5A 1EUZA 1VHQA 2ERCA 4KR9A 3RAFC 4WLNA 1L4KA 2AV6A 4RU1A 1GYPA 1RBZA 2WHRA 5KSOA 1C0EA 2D0PB 1B3RA 1QMPA 3EBPA 3LQ4A 1EXDA 2DPGA 4TTSA 2ZSAA 1UBKS 4FYXA 2XEXA 3ROPA 3I01A 4B7XA 4J16C 3VYTB 1RLTA 1YRQA 2DBZA 3SF8B 4HZIA 3B38A 4EHAA 5G0VA 1XP8A 4YCNA 1IJKA 4DIEA 4GZLA 3MWGA 3NORA 1ISPA 4JKOA 2WVAA 4HDAA 4YRRA 3L0YA 3OKPA 4EB3A 1T5LA 5IANA 3RF7A 4EB8A 3P0IA 4IIJB 1PTJC 3B9PA 1V16B 1VSVA 3D8UA 4XJXA 3W1WA 1HTTA 3UBTA 1TD9A 3P2KA 3LECA 3JD2A 4X8HA 1EK5A 4JNKA 3K0KA 4CVNA 4YMLA 2RCNA 4LTMA 1YS6A 1OJ7A 1XCOA 3CR8A 4RVFA 4HQKA 1XDZA 1JHMA 2PMWB 1LBEA 4XM0A 4Y18A 4N7MA 3LYHA 4J91A 1DCMA 5IFKA 3QY0A 1PK7A 3PHGA 4B6EA 1YASA 1G21B 4M7OA 4CQMB 1M0WA 3L6OO 4IY1A 4OAPA 4PZDA 3QJYA 5EUQB 4E7OA 5JQGB 3G9XA 3TUZC 2BELA 5CCXA 4W5HA 4BL5A 1MGPA 3L5OA 3X1XA 2Z95A 3GVHA 2JF0A 3NH6A 3WWCA 8AT1A 2I2AA 1JBEA 4JBXA 2F1RA 5H9WA 2DM6A 2WTNA 1XRPA 2IS6A 2WHPA 5JYBA 3HCNA 3AZPA 4WBNB 4Q0MA 5BN1A 3DAGA 4GXNA 3EDRA 4DA9A 3B60A 5IVDA 1CDDA 2HCRA 5E6UA 3K0HA 1HTWA 1B6SA 4DEYA 3Q8MA 4XYGA 1XUOA 2OQRA 3E2MA 2DQZA 4GMGA 3ZU4A 2OT3B 1OH8A 1ESZA 4UNRA 2X2PA 3ERCA 1UXJA 1YOVA 1AKTA 3ZHXA 5CH8A 3QEAZ 3K2EA 2JGJA 1F5SA 2PMKA 1RTKA 5T4HA 2GEVA 2PG3A 2FPRA 1EBBA 4RULA 4Z7NB 3W2TA 2VUSA 1O89A 4UHDA 5ILOA 1W87A 2OPHA 2D2IA 1MAVA 3FHLA 2ZJ3A 1TCCA 2EP7A 2IPLA 1ESDA 1W34A 3M49A 4Y2HA 1EB8A 3ETJA 3THXB 4CL0A 3GWZA 1OFIA 2EKQA 2J4CA 1GQ2A 2H8GA 4HC4A 4A0FA 5C1BA 5EE5B 9ATCA 4AAYA 3NONA 4MV1A 4A6EA 3BZUA 1QFXA 1SIOA 1UDWA 2I6TA 4X5OA 1RRMA 4UOZA 2BBSA 2CYBA 5LMZA 3MM4A 4ZYTA 1NJSA 1Y1KE 3I9JA 3ZGYA 1QFZA 5KTYA 3UG7A 4B09A 1ZH0A 2XR1A 2GHIA 5IBQA 1QYDA 5HZGA 2NU7B 4BNHA 4E33A 1M33A 4UUQA 1RHQA 5M04A 3OHPA 4MQFB 5B30A 2WG0A 4WIAA 4EJ0A 3RS7A 4CDMA 3P32A 4RCZA 5BNZA 1F4PA 4OUDB 2G1PA 2CNOA 2DUWA 2FE1A 3I9KA 2Q1WA 1HDRA 1PV1A 3PDWA 3FAZA 5P21A 5DM2A 5DFAA 2GPAA 2ZI4A 3KV1A 2XUKA 2Q4DA 3DKPA 4EPXA 5GGXA 2V7PA 4M22A 1KQOA 1GG2A 2O1SA 1HEIA 2GETA 3G7SA 1UMDA 3NTLA 4LWQA 3KKOA 4OHBA 4UBIA 4CMHA 4FE3A 1PJ3A 4BJ3A 2IU3A 5IJ9A 3Q8LA 1UBEA 1ECLA 2IPAB 4CMAA 3DG9A 1R4NB 1YBVA 2BRUA 3G68A 3IUSA 3KG2A 3PHJA 3I28A 4BZPA 1D3AA 3R9KA 3MHPA 4H6PA 7MHTA 4D99A 3SLKA 2VC2B 4RS4A 4WLOA 1UMCA 3GP5A 1AF4A 2OUIA 4JUBA 3TX6A 5I5GA 4CODB 3IQEA 3REGA 3VPFA 2VPPA 3GD7A 5IUJC 2GTIA 4D7AA 3BHIA 2VKTA 4FFBB 4EKDA 4YCJA 4YMVA 2OAQ1 5CFOA 2FX3A 3QTBA 3T0GA 1BVHA 3CZ5A 4HB3A 4RY2A 4ZV9A 3NALA 2GJ9A 5G4KA 4JYAB 5L6MB 1RJDA 3HQ4O 1JHUA 2F3UA 4EF6A 2C5SA 3MGBA 4ZJZA 4YQFA 1O96B 5CA1B 4W5RA 2DR2A 1PNTA 4LECA 3Q5DA 1E1LA 2B37A 3ITNA 3RVRA 1UCFA 1T2EA 1ITZA 1WX1A 3UXHA 4TKVA 3K72B 3I8SA 1KEZA 5EXEA 5JO9A 3ROQA 3UAXA 3QUBA 2OCYC 2XCTB 1G20E 1E77A 1Z4PX 4MCHA 4J0KA 4AJJA 5KVCA 5LZ2A 3U7HB 2IYUA 1E3EA 3EZGA 1U1DA 4GQBA 1EA7A 2FUNB 4RVHA 3B48A 4L22A 3SHWA 3E23A 3NGXA 1U0HC 3A4YA 3GN2A 3S2GA 1V5FA 4K9LA 2O06A 3ORRA 4B48A 1VXOA 2CXPA 2DMRA 2AA3A 2DQYA 3CV3A 4PSDA 4Q24A 5AWFC 3VU9A 3WB1A 3WIVA 1K68A 3SDBA 1U0BB 3WQBA 4KNYA 1FVHA 3U39A 4U7HA 5JJCA 1GCIA 5CVDA 4JQOA 1YDGA 1MMFB 4PQGA 3GEGA 3IR6A 4QAJA 2IYFA 1X7XA 2ZBFA 3L6CA 1RVDA 2QTZA 3WBKA 1TZBA 4DKXA 1GG8A 5ED0A 1FMJA 5TEVA 3EPHA 2WHYA 4PXSA 2IP2A 1E2GA 3FWPA 4DVGA 2R1TB 4QO7A 4ZU6X 3Q5GA 4IV0A 3D02A 2X8JA 1U0LA 4K81B 5IVPA 3A9RA 1F0PA 1WF3A 3NETA 2QT1A 3ZHCA 1QNFA 3L49A 3RQIA 4AY4A 2HJWA 2XT0A 4DIUA 4K88A 1II8A 1S3SA 4LXHA 4XQEA 2I6FA 3FLBA 1EE2A 1OHHD 2FR8C 4LA4A 1TIPA 2ZRNA 3CZQA 1P3Y1 2XZTA 3K4QA 2OFFA 3IBSA 3A0UA 3P2JA 1F0NA 4BQNA 2IXFA 2ORYA 4WADA 5HRCA 3VKWA 4P7GA 5DSXA 3BA1A 4C1NA 2XITA 5J2TF 4F2DA 3H05A 3OQIA 4OM8A 1E79A 3CR3C 2P7IA 4FGUA 5ARBA 4QJ5A 3Q8KA 1GM5A 2VYFA 3O82A 3PGA1 1RBQA 3EC1A 4GPTA 4OXYA 3ZJYA 5AVUA 3CS3A 2WAMA 3OX2A 5A4DA 2G8LA 2Y67A 2EJTA 3BPSA 2AS0A 3VPAA 1FDTA 1LPSA 3DVLA 4MI9A 1KH1A 4B3IA 3U6BA 4UE2A 1S1MA 2MIIA 4JB0A 4D74A 1XF1A 3NEPX 2J08A 2HA7A 3DH0A 3GBVA 3G2JA 1UZUA 2Z4TA 5EWMA 4CPDA 5KTPA 1MC5A 4XLTA 2ZUVA 3P1JA 2M32A 4LDNA 5CR9A 1OFUX 3A9SA 4XGKA 3ZE8A 4BNUA 1GTG1 1KSHA 2RJNA 3QHPA 3LVRE 1WHTB 5CK5A 5AKEA 3U7FB 4MVWA 3QXSA 1JQKA 4PM4A 4QASA 4HWRA 2Z5VA 4IUBS 2IXEA 2J0EA 3MCWA 4CKYA 4ZJUA 4C0SA 4TSFA 1HPLA 4X1IA 5J4KA 5CT8A 2FRXA 3KHTA 1DEXA 4EO9A 1OV6A 1IVYA 3T7IA 3V8RA 2QE6A 2QUJA 4YROA 2EEZA 4DV5B 2PRKA 1N2BA 1J97A 2PPVA 2XMGA 2RHDA 2YUTA 4IYJA 3FPGA 3JSXA 1B0UA 2YYSA 4HLUC 4ZV4A 2RGRA 3MWFA 2XVYA 3CKLA 4LSZA 5AHRA 2OV8A 2VLBA 2VJCA 4MUJA 4I9NA 4O4LB 2IT1A 3G5TA 1C2TA 3AUXA 3GLHB 3ZWXA 6ADHA 3GLFA 4EB6B 1SPBS 3NRJA 4R9NA 2R7AA 3KR0A 4U2BA 3FCCA 1IXSB 2C0CA 3KL4A 3GMTA 3JZFA 4DCVA 2XYPA 2VAWA 3RLFA 1FTNA 5KKCA 2ZRIA 2I3DA 3HCWA 4JA0A 1YR2A 2JEYA 3RUFA 2H08A 1EP1B 3G2PA 2XNDA 3JQAB 4FDTA 1RM5A 4J1SA 3RU9A 2R8OA 3PD7A 5H68A 3IO3A 3RIEA 2RI0A 3BD6A 3UWOA 3PEUA 1ES9A 3I2GA 4FWBA 5LYJA 2Z6AA 4RTJA 1LNQA 3CEMA 3ZQKA 1BOFA 1YQQA 5EKTA 4WRRA 2JLVA 2ONYA 1R0BA 3BRQA 2YHBA 3KEQA 4BTVA 5AJYA 2IZ0A 2AE2A 4N8SA 4MVJE 1EXWA 2PGIA 3AW9A 4G5YA 4CTNA 4G8CA 1EE1A 2A67A 3HVRA 3I9V1 4FHGA 4GOLD 2IKQA 3CPJB 4TV9B 1Y82A 2YYAA 4AKSA 3T7KA 2F3TA 2I22A 5HBRA 2QN9A 3GN1A 5CURA 1E8NA 4Q3DA 5ALPA 1KEKA 1CDZA 1LB1B 2MCFA 3QSYA 5KC8A 4KYTA 5K03A 3QYJA 1KDTA 3PNKA 4HO1X 2CJPA 5EWJA 2HCBA 3CH4B 4IXMA 5JIBA 1FFDA 2LKDA 4Q9LA 3GFOA 4PC6A 4GL2A 1FLDA 2Z08A 3MT0A 2FZ4A 2FOLA 3KPYA 3LCUA 5IC5A 1RC8A 2HT1A 3RVQA 2P91A 3RRYA 1XN4A 1CUAA 3TL2A 1CG6A 1IAVA 1LDEA 3LHFA 2VK1A 3KJHA 2ZROA 3E27A 4HNGA 3CUSA 4NIMA 3RVJA 1AKEA 2GAIA 4ZI5A 2FDCA 2XXBA 1RQ2A 2A4MA 2QL6A 3ZV6A 1OXMA 3EVAA 2XUQA 2CXSA 3LK6A 4GIBA 4IH4A 4RXTA 4BE9A 5B7QA 3W5DA 1X9HA 2CVOA 3ZDFA 5KNBD 3ZCTA 1TPYA 2NV2B 1D4ZA 1RWPA 2BE7A 4H9GA 5ITWA 3VJKA 3PX2A 3C7TA 3ZZTA 4ZRMA 5MN6A 1QRUA 3JALB 2Z57A 4AMBA 7MDHA 2PXAA 1RIFA 2NVBA 1QGED 1X19A 1Z8NA 4KG7A 4XZ3A 3D7RA 1UWLA 3PQCA 3BD8A 5AVZA 1P9WA 1XEFA 2HMVA 1EWRA 3K2BA 4D98A 5AYVA 4DG5A 1AUQA 4WOKA 2EZTA 3TRFA 1TEXA 5J4YA 3OEWA 5GPBA 4BFWA 2XNSA 1E0AA 2OMEA 1NV8A 3IBTA 3OZGA 2VOJA 2XTZA 3DHNA 4NG4A 5F51A 4AROA 4BB9A 1SCUA 1SXHA 2I7XA 4KIFA 3BGDA 3TZ6A 1N0IA 3LV8A 5LMUB 1K98A 1H8ED 1PD0A 4CLOB 2IX3A 3R7AA 1DQZA 2BSAA 3K0AA 4QYIB 5EKDA 3U26A 5DOVA 1EUQA 3A06A 4MW4A 1QRRA 1KRXA 4IOMA 4PINA 3Q0EA 1Y98A 1TEZA 3WL7A 4CGYA 2ODPA 3COYA 4IXTA 5GADl 3JQ6A 2B8TA 3VR4A 3C2QA 2HAEA 4UPVA 4XASA 2IHTA 2J4FA 1GTMA 1T13A 1ZITA 3GEBA 2BDEA 4H2DA 2PX0A 1QSGA 1DOHA 3E3AA 3ESAA 4NABA 4O4IB 5IAAA 4GMHA 1VA4A 3L7BA 4B9EA 3O2QB 4E08A 2GAAA 1OT5A 4J1QA 5A3SA 4DZTA 2OBYA 2R84A 3KQSA 2K87A 1XZ8A 1M2VB 3KJNA 4I5DA 1CY1A 2JLBA 1I01A 2FX2A 5EMNA 5JG7A 5C37A 3S99A 3MTBA 5IT0A 4UU7A 3I4FA 4N48A 1F3OA 2XUPA 3FZYA 5DN6A 4DPMA 2KBFA 1OSNA 3HG7A 4H3VA 3HBLA 3ZWQA 4BFZA 4C4RA 2VHEA 4N3BA 4DA8A 3G85A 2C5AA 2YVAA 5EQTA 3LLVA 1P61B 2BE9A 3NCHA 3DBOB 5E3HA 2QM8A 4U7FA 1QAQA 4DMMA 1GARA 1YA8A 2NUAB 5A9SB 1GTL1 3LD9A 1RKXA 4GDFA 1G6OA 1OV4A 3HZZA 4V0ME 3RE1A 5I8PA 5IYZB 2NT3A 4DMHA 2OLJA 3VBEA 2X6QA 3D0RA 3WGYA 3IUBA 4ZHQF 1RC0A 3TB6A 4N3GA 5B3LA 4Q03A 1QIHA 5JMPA 3AVUA 1FE8A 5CDSA 2E4AA 1TEVA 1GG5A 3UGQA 5BR7A 4XDZA 1JFRA 3LQFA 4P7BA 2OQ2A 4R8LA 3QPUA 1SZJG 4YLEA 3QH4A 1GZSA 5JW6A 1E1RD 4PF1A 4DLXA 1AS2A 5B58C 1YQTA 3WA7A 2WNHA 1NLUA 2LCQA 2J85A 1BA3A 5CFMA 1QZTA 2B83A 4FZJA 2FRDC 1FSSA 3UA3A 2Z2ZA 2GD2A 4AJ9A 2JKZA 2P5SA 2QRJA 3ILSA 4R2WA 4PIPA 5ICFA 3TLXA 4EYSA 5GIOE 4GP6A 2HSGA 1X92A 2C7RA 3K1TA 4ADSG 4C89A 1SK8A 3MLBA 3CIOA 3D6UA 4WFIA 1EGMB 3VR6A 5CLFA 2YVUA 1ZZGA 4JELA 3GNLA 3ND5A 4BX9A 4EG0A 3V4OA 3G6KA 1RPJA 2VPXA 4P34A 5ALOA 3RC2A 3PZBA 4XYLA 1IXZA 5HRAA 4TTRA 5TSDA 2ENWA 2ZIZA 3FBGA 3GT7A 5JD4A 2CMFA 4B3TB 4FPXA 3GB9A 1THZA 1YXMA 2J31A 1U0JA 1Z0DA 4NYIQ 1O8CA 4K26A 3HJTA 5TJHA 2D1SA 1JT2A 3L4BC 3U3RA 4BKRA 2DWOA 5DHQA 2EWWA 1U8UA 2A0WA 3D7LA 3WWZA 1K7SN 3WMGA 5JQGA 3MBIA 3FVTA 2OESA 4ED9A 4H1HA 1TVEA 3MTDA 2UU9B 3LY7A 1AMOA 1ORIA 3I5UA 4TTVA 3NHKA 3AERA 3OJXA 4KQKA 3ICCA 3SJUA 4OVKA 1MO3A 1B8VA 3VR5D 3SI7A 4WBNA 1OFUA 1YJQA 5EZYF 2P7HA 1NN1A 4L8FA 2JAUA 3TSYA 2ZXUA 4IDFA 3GAZA 1RKVA 3IA7A 1VBNA 3UXEA 1JR2A 1ADCA 2GCIA 3GAMA 1E1QD 4TL6A 1UP6A 3IVGA 3PITA 1BGVA 3RG2A 1W94A 3MCUA 3AESB 1TLLA 2DOKA 4L27A 4ZVMA 4CNBA 3V8QA 3GUVA 1THMA 1OX5A 2ECKA 1RRKA 2HK7A 3A05A 4E1AA 3UF0A 3VUEA 4C3VA 2IDZA 4QAQA 3ICQB 2B9VA 3BWBA 5TE9A 2E5FA 3G8CA 1IQ0A 1HUQA 2OC4A 2UYCA 2HPAA 3N1UA 4JBHA 4OCZA 3DV0B 5KDLA 4DLRA 1XJCA 4BKQA 4DSUA 1F20A 5DCYA 3THXA 3A3PA 2ZBDA 3SYRA 4JC4A 1OC4A 2C95A 1E5LA 3ZDZB 1Z6AA 4R69A 5CVVA 1JQJC 3T1VA 4DF3A 1BU8A 4YV2A 4V1CA 2QUHA 1ZISA 3PYLA 2QK4A 3UJDA 4C0WA 1NE2A 1BHO1 2AG6A 4KSBA 3VTZA 3E0XA 1IPEA 1TYCA 4DADA 4MTCA 2EFEB 2WDZA 4GZ6A 2E2WA 4DBLC 1WY5A 2A3NA 5C8XA 3SE7A 4MVJG 1KI9A 2FGKA 3F6CA 4ODIA 2NU7A 3DWEX 3Q72A 4ZVLA 5DI3B 2PMDA 3ON5A 4MQFA 1YK0A 2H59A 3CVOA 4XJVA 1R9GA 2C88A 1ZRHA 5ALHA 4F12A 4OUDA 4C21A 3EPLA 3NXKA 4DJ5X 1XYGA 2PV7A 3PJGA 5KYWB 3HNPA 4U3JB 1KMIY 1S9DA 4RJJA 2A5JA 3AVQA 3KZKA 1CIVA 2PS9A 2WHEA 1NVAA 4YGXB 2PJRA 2VDWA 5A62A 4A0SA 5ABPA 1YI0A 4GEKA 3UWSA 2XDQB 4KAJA 2EX0A 5KMGB 3QPDA 3HUUA 2OAGA 4ND1A 4UDNA 2BJVA 2MDTA 1DP4A 1BYIA 4TLEA 4R54A 4BGVA 2KS6A 4M99A 1R4NA 1NQTA 2PUFA 3K4HA 3G9ZA 3R40A 2AMYA 1E7WA 2WSYB 3ZHBA 2TMGA 4EX7A 2GZ1A 3G0DA 1RJ9B 1J0EA 1U2SA 3DPIA 4GX2A 3RBVA 3UPTA 2YXLA 1AXGA 1JU9A 1WW2A 2RGBA 3QXXA 1N75A 1RYNA 1EHCA 1SG0A 4JLBA 1F1JA 2PBFA 4P4UA 3GG2A 2O3SA 4RPKA 3MFYA 3KEOA 4HH1A 3PTAA 3KAJA 3PFWO 3VX3A 4MINA 2QA5A 1VMEA 2IH5A 3CZ9A 4FMDF 5BQ5A 4DUPA 5EHXA 2Q4BA 3E6AA 3P5SA 3QQ5A 2ZLBA 2A30A 2PH1A 3VHXB 5MFPA 3OE4A 2FWAA 3DDUA 3ORYA 4KJXA 1Z6GA 1A27A 1KGDA 3VU0A 2HYIC 1W75A 5CA1A 4BB5A 3AUAA 4F93B 1WMEA 2I4TA 3SHOA 3LTNC 2YASA 2YZMA 2BEVB 2FSUA 2VYNA 2WP8J 4MHSA 5I4KA 5I7VA 1YTUA 3DV9A 4JWKA 1V9LA 2RC5A 1NRWA 1DTEA 4QDOA 3Q7IA 1QFSA 3PQFA 4DEVA 4NU8X 1SKUA 5DF1A 4C5BA 2JGNA 3E22B 2GWHA 3ZWDA 5KYTA 3L7YA 2ZM6B 1JF8A 3BWXA 2GILA 4DBVO 3VX4A 1N2EA 1YKFA 4CU5A 4F8YA 1EIZA 4ETWA 4IG4A 5J47A 3TGLA 3W9BA 5DW3A 1A77A 2NMVA 1DV1A 4HDNB 3EZYA 4BUZA 4QXPA 4IFBA 1U5AA 2Q45A 3CVJA 1YDMA 3C4QA 5HBGA 1K7CA 2FPMA 3CLVA 4OBEA 5CNJA 1T36A 2JFOA 4MWGA 1WTCA 2RI6A 4WCFC 3TR0A 4CI0B 2R1TA 4BGIA 4GD3Q 5DXFA 3THYB 3O4GA 4KGVA 5JBIA 1KJZA 2BKVA 2WYVA 3J80A 4L57A 3I5YA 1JR4A 3U4MA 4MWOA 1JVNA 1GPWB 2PGAA 2O50A 1VKJA 2EKPA 1YBMA 4OL0A 1JJIA 5EPUA 4QU0A 5IC4A 5TEWA 3KD2A 2QNBA 2Z04A 4H59A 3RBZA 5BW5A 2VIIA 2ZYAA 4AS1A 1AQ6A 1ENZA 2JCSA 1Q0PA 4F6LA 2CUKA 5TIIA 2HADA 4MRMB 2R00A 1Z2CA 3WOHA 3OZAA 1GYQA 4FZ3A 2EKBA 3CUVA 4BQQA 4DMGA 4GUAA 3GZNB 3I37X 3LJKA 2HDNB 2PRZA 4MUYA 1EU1A 1P0CA 3K9NA 1KY2A 3LF2A 4QPCA 3WNDA 1U7OA 5KYUB 2GK4A 4F3KA 3LAWA 5EVCA 4B71A 1ZBDA 3I23A 1E7MA 1B26A 1V45E 2FJPA 1SKMA 3R0JA 4K87A 2HHAA 4WNYA 2EW8A 2PKQP 2X9LA 3EIQA 4I14A 3TQIA 2H8KA 5C5CA 3ZS9A 3ULKA 4HVCA 2ODTX 1JN0A 1HF3A 1WHTA 1ZWKA 1PWYE 2XYQA 3LPAA 4PAWA 3ANXA 4OAOA 2NZJA 3LP8A 3ZY6A 1O2DA 2F2TA 2XQKA 1CHDA 2NO7A 3DUFB 4KXXA 3H11B 1JFVA 1SN7A 4GAEA 4HT3B 4EKYA 5M34A 2B4TO 2HU2A 4AZ3B 1R1DA 4C0KA 4WTOA 2HA2A 2FW8A 2CJWB 3WY9A 5DX1A 2OHXA 5AK5A 3RU7A 4OGFA 5COAA 2CJFA 5A1TA 3QOYA 5CYPA 4EGFA 1VHDA 2VF4X 4IIUA 1QXSA 1X15A 2WILA 4NMMA 2R6JA 1JHRA 4KO2S 4O4LA 5AK4A 4U6QA 5CFLA 4RKWA 1R0WA 7GPBA 4ONEA 4I5FA 1U0SY 1MENA 2ZYHA 4EB6A 2GVZC 7AT1A 2YX1A 4ENWA 3RKSA 3ICPA 2VT2A 3KOZA 1TAQA 3GMDA 4OJKA 4UREA 5E1DA 1SJ9A 2E4XA 4ZCQA 5LB2A 2X22A 2GJ4A 2ZI3A 5DTMA 3ROTA 1WCV1 1JWLA 4JQCA 1QGOA 1CQPA 1ZGHA 2B21A 4RGBA 2YJ4A 2DJIA 2PRSA 1YC5A 2W4IA 3I1YA 1W49A 5B4VA 3ZDCA 4FK8A 1VE6A 4YRQA 2X7JA 1BX1A 4HGNA 3TSZA 4UFOA 3W77A 5A5VA 4HNTA 1RI5A 1TF2A 4YLYA 4P2BA 1GUBA 5I8ZA 3WG9A 4DM7A 3VVMA 3EJ6A 3JWIA 5AI9A 1COZA 2X7HA 4J0HA 5FOVA 4ZVTA 4RTPA 1CSEE 1Q3TA 2N42A 5DRTA 2H31A 1U2EA 3LUJA 4U6SA 5DXAA 4B8YA 2FW0A 3VKHA 1K89A 1SCAA 3I5XA 4BTEA 3V9PA 1P1CA 4BO4A 1MU0A 3WL4A 2GA8A 1HDIA 3ICEA 1Q11A 5FX2A 4BNZA 2YJ6A 2G1UA 4TV9A 4X1KB 2RB4A 4ZAZA 4Z1MD 1I9GA 4OXIA 2PDAA 4RF5A 4YALA 4BQEA 1DBRA 2AG8A 1MAUA 2IS2A 3DTVD 2N47A 1DI0A 1SM4A 1XNQB 3S1SA 2CL5A 4JOSA 1N1EA 1M34A 1X7GA 3OZEA 5CHEA 5BNIA 2O05A 4JI1B 2UZ4A 2A57A 3N05A 1GZ6A 2PGJA 4F4HA 2W6JA 2A1IA 1VL5A 4ZCSA 4CEJB 2QTVB 1U7UA 4KE8A 3AO0B 2NG1A 1XDSA 1VPLA 2M6SA 2ZSFA 2EP5A 3E1SA 1E62A 4HNSA 4OBWA 3RWBA 2AUTA 1F9AA 2XDAA 1RQLA 5JANA 3BTOA 1M0TA 1A5AB 1L2TA 2GN9A 1VQ1A 4MQUA 2HLPA 1EK0A 3FNQA 2Q0QA 5HK9A 1ATZA 3TG2A 2V55B 3LBNA 1PJAA 1SOAA 1XQWA 1LCIA 1WZUA 3GFFA 2XD4A 3KSRA 1AQYA 5IAGA 2CHUA 4CCAA 3JALA 4E5UA 4HAVA 4KO3S 4X7PA 3IOBA 2C9CA 2QMQA 4NC9A 2VSYA 3NFYA 5AHWA 3C6MA 3N2GA 4EJ6A 1NVMB 2PWAA 2Z2XA 4N76A 2JNWA 2H7CA 1QVVA 2XA2A 1SKBA 2QMYA 3GK3A 3ROGA 2OENG 4G0MA 3TOZA 2NZUG 4D9GA 3T3MB 3WL3A 3FPEA 1XVIA 4Q3CA 1EVKA 3LC0A 5EKXA 3X1WA 2YV1A 4EGJA 2ONZA 3B7GA 1RC1A 1X7DA 4Y1RA 1YGYA 1RPTA 4MW5A 1O9HA 1OPXA 2J9YB 4CLOA 1JS1X 1WL8A 2D1QA 4I1OA 1QTRA 3DAPA 4QYIA 4ZDKA 5JISA 1ACJA 3KYBA 1ABFA 1RMTA 1VJ5A 1CERA 2FA9A 4L4ZA 1QP4A 1XTKA 5K8CA 5BORA 1DWUA 5EXSA 2I54A 2I3AA 4G63A 4K05A 4R8MA 4OUKX 5C8YA 5AI6A 1IBSA 1AC5A 4L0CA 3KWFA 3UY4A 3FKSA 1W93A 4DWVA 4F9EA 4P32A 2NSLA 4O4IA 2AOXA 3KFXA 4KX5A 1N4AA 2MOKA 1Q7CA 2YXPX 1LLCA 4FVTA 3SC4A 2Q5QA 3KOWA 1NN5A 3QIAA 4PY2A 1O9BA 1HZZA 3BRCA 4E94A 4B3MB 2GM5A 4OJNA 1AKRA 1XTSA 4K9KA 1KFKB 3IGFA 3FPBA 1HI9A 5C7IO 1GNLA 2V6IA 1GPAA 2NXNA 4I9GA 4IL5A 2QS9A 1FSFA 1RHMA 4UMEA 4GRAA 1X2EA 2I2XB 4MV9A 1OU4A 3EMDA 3H3JA 1SKYE 4PC2A 2X5JO 3AZOA 1PHRA 2WWXA 3LWDA 4BWGA 2RAUA 2IW1A 4JLWA 5JAIA 5EJ4A 4MDEA 7REQB 2BZGA 4EHNA 3L93A 5A9SA 4XTCS 1LV8A 1J5EB 3WWEA 1MHTA 1ZGJA 5JI2E 3B3AA 4MMYB 4N5HX 4JDPA 1IDN1 4LVOA 4M0FA 1I2AA 1JSLA 4AXBA 4NECA 1VPTA 2FWJA 3QITA 4M1QA 3ETGA 5ALLA 5FLYA 5MGNA 2HR1A 2H11A 1J20A 2XGMA 1RFGE 1RVV1 2C99A 4N7BA 3PZRA 5FT9A 3N0WA 3OLXA 2DXIA 5G41A 2QP9X 3MILA 3ELUA 1HT1E 3DC2A 3DLTA 4EA6A 5JSZB 1QAMA 2A8YA 2OQIA 4IO0A 3H6GA 1IJEA 3D4BA 3E58A 2J33A 3H87A 3GLSA 5LDDC 1RYDA 2IPXA 2AVDA 1OY1A 2OZVA 4JROA 1DKMA 4DT1A 2UXDB 2C9MA 4UVHA 3NM5A 5LUBA 1IYZA 4FONA 1FP6A 3IDAA 1X1RA 3PFKA 4X24A 4ZGGA 4YJDA 1QOQB 4MZDA 4MIKA 2X9NA 3PFFA 2JJ1D 1NPYA 3V80A 3CGGA 3WSWA 3QLUA 5EMJA 1PSZA 5LZ5A 3QPCA 2AIRA 4BWVA 4TVSA 4X64B 2C7GA 3ROKA 3Q3CA 4KO8A 1PNOA 5AD1A 1NG1A 1Z75A 2J9GA 3RSCA 2EC5A 1XV5A 2ZBGA 1YV9A 4F3TA 3IERA 2I2BA 1ZH2A 3NATA 4IWXA 4B79A 4BUJA 3LRTA 3L79A 5HKOA 2CLOB 1P2TA 5ARDA 3FYUA 1PZFA 1JXOA 4C3UA 1LWNA 2B35A 2GPTA 2J59A 1Y8QB 2FNAA 2WKPA 3C48A 1Y34E 2PCLA 3T9BA 1T2CA 1ADJA 2UUPA 3HJCA 2XQJA 3WFJA 4RABA 1AA6A 4MQ5A 4D9BA 1Q6ZA 2F43B 5K09A 1O97C 2DEUA 4I6GA 4ZP1A 1WE2A 3CG4A 1E3TA 3S8EA 1UOOA 1Z5WA 3WC4A 1J49A 4AY5A 1G64A 1XMPA 1EA5A 1K8ZB 2B69A 2ODWA 1IUPA 3RT7A 1MVOA 3C6ZA 3DNFA 1PWEA 4PLCA 1KMCA 4I81A 1UKYA 2NXCA 4KHZA 3AU8A 3IALA 1IK6A 2O3UA 1QK3A 1B0PA 1L8OA 3P0RA 1AD2A 1JI3A 3AVWA 1ISIA 3M8KA 3BL5A 4ALIA 1YZGA 3A1WA 5AJWA 1SXJE 3PBKA 2JIZA 4CF3A 1LH0A 1TF5A 3C8UA 3QMPA 1G7SA 5EL0A 4KBYA 5LIPA 5TT1A 1DAFA 5H02A 3EXEA 2HL6A 3DV0A 2BP7B 1GVHA 3FVWA 3MJHA 5K3EA 3GXBA 5KX5F 2G4LA 1FZQA 3FNRA 1ZJ6A 3D8RA 3M6AA 1NMEA 4XQGA 1XALA 3NTRA 2RGYA 5AK6A 1V8FA 3T99A 2P1RA 3A1NA 3ZYCA 1MOZA 5DV9A 1OX4B 4I1VA 1EFHA 1O6BA 1JIKA 1UBFA 4CF7A 2N1MA 1VLJA 3TAXA 2C77A 2QLTA 3KSBC 1XMVA 4IFTA 3RIMA 2AXNA 2OSVA 2R11A 1DEOA 3BWMA 2V59A 4WJZA 4JP8A 3A8TA 1OXUA 2G70A 5DYGA 2IIPA 2H1OA 4LZLA 4Y2XA 4TMXA 4NYJQ 4NICA 2PLRA 2ZRAA 1JLSA 4B0PA 2IYQA 1NUQA 5AVYA 3ZLBA 4O02B 3KPWA 1NXSA 4OI1A 4U3JA 3IQFA 1JKIA 5DCWA 1G5HA 1JRLA 1Q44A 1QGYA 2ZI9A 1NXWA 3H2SA 4BCDA 5CTAA 1PLJA 2FHSA 2ZIWB 4Y30A 2A59A 3NBAA 4WK6A 1U0RA 5KMGA 2XDQA 2GLTA 4H1TA 4ZDWA 4XVCA 1DKLA 5TC4A 3VC1A 5IWCA 1SG9A 2F00A 2NX2A 2P35A 2PKYX 3EASA 1RCFA 4ND3A 2VRWA 4GFDA 4PHTA 2PKXA 5FQNA 5L9AA 2BHLA 3ECSA 1NR7A 5BRJA 4ETIA 1OWLA 4CLRB 4LVCA 3S7ZA 1GDTA 3G17A 3E9NA 2A1UB 1N2JA 3KQQA 4G1BA 3T06B 3LK7A 4ZODA 5F76A 1K9SA 2JRCA 5F2EA 3CEAA 3OIYA 5LKRA 4MW9A 1C4OA 3AYXB 1VFPA 4L6AA 1JDTA 3PI6A 3PRHA 4MLDA 2VHTA 4F4FA 5JE8A 5IMSA 2ORED 3BF7A 3LNTA 4O0MA 3VHXA 2RJ3A 4KV9A 1P5JA 3D8TA 5GIPE 1PS8A 2EP8A 1M0SA 1L5NA 2ZRPA 1CFJA 2XKAA 2IYZA 4DJTA 4EFDA 2QLFA 5EJ5A 3CLSC 5CVUA 3O93A 3LM8A 5HG0A 2AR0A 2LVBA 5KJEA 3T35A 1OXXK 1GUFA 3IQDB 3PDUA 3QP9A 2BEVA 4H3KB 3KBBA 3HU3A 2P2CA 4D8UA 1AHPA 1O5IA 3AJRA 2OVBA 4HNVA 3GGOA 2WWIA 3L0BA 5B12A 1DGQA 4OSOA 1ULUA 3KZ1E 5BQFA 3M3PA 4ZYYA 3QELA 3DVAB 4QHSA 3C4JA 3D0QA 3TNJA 4BN0A 1O58A 1VBMA 4HGOA 4TT3A 4H7FA 3K9WA 2FLWA 3AJDA 3KU1A 3MJCA 2Z6QA 2IHUA 1G55A 1YK1A 4HDNA 4HLCA 4RIGA 4Y2YA 4Q3AA 5D1NA 1G8JA 1YSCA 5H3LA 5KPDA 4YPFA 1DIBA 4KO4S 2PL1A 3NOQA 1N2OA 3GT0A 5TX7A 2QAIA 3HR7A 1NASA 1U1EA 1JE0A 1KK1A 4HUTA 1T5TA 2WWHA 5JXJA 3PIRA 4KBGA 2GHTA 2NQ8A 2XF8A 2ZE8A 3BHMA 3K0SA 1GFIA 2IYTA 4Z4FA 4ZT3A 3AIKA 4OBXA 1A3CA 2EJVA 2O0KA 2Q46A 1GPLA 3AHFA 3MIZA 4QT4A 5CFZA 2CBXA 2HDOA 2ZZNA 4CM3A 1RLIA 3KE8A 4BQOA 2GLXA 3LBHA 3KEGA 1TFUA 3P2MA 5HXAA 3AFMA 3KAQA 4LW8A 3CT4A 4YUAA 4H6XA 1XXHB 4P0TA 1NSYA 1P1FA 2ZIEA 1BQ4A 2ACKA 1H3EA 1T3HA 2IA5A 2X5OA 4MRMA 5HA5A 2QTAA 3CU5A 3GCWA 3ZI4A 1FVFA 3HHPA 1N2ZA 1W4BA 3I9OA 1SQ6A 4KQFA 5H1YA 4IKOA 5WRFA 5KWJA 3V8MA 3BX1A 1WU8A 1XZPA 4EPVA 1QS0B 2VPIA 3OC6A 3WNVA 1SB8A 3M0EA 5ALWA 3QU4A 3GZ4A 3I53A 2QRLA 2XYRA 1IU9A 5KYUA 2GAJA 1U4OA 5JPIA 2HF2A 3G9TA 3TZCA 3FB1A 4ZDJA 1Z2AA 4RE5A 2GEFA 5NULA 4AUKA 2IUSA 3T1TA 4QE3A 4NVRA 3MWDB 1B6RA 1ISFA 1MFZA 2OK8A 1SZCA 1JGTA 4NE9A 2P30A 3TJMA 1EVJA 1K66A 4AN0A 1I80A 4BO2A 2CBGA 2J6BA 4J76A 4YRBA 3B1VA 1EE9A 3FTQA 3T3IA 1X77A 3OFNA 2OCIA 3H11A 4HLUA 4LWPA 3WIDA 3QW2A 2C03A 1TUEA 2BZ1A 3HDVA 3S5UA 1NBIA 1U6KA 1XZGA 1M5RA 2AN4A 1NBHA 4MAFA 1KU6A 2YVQA 2YYYA 2CJWA 1Z47A 5HGJA 3ZIAA 5F9MA 3SIRA 1XZDA 2EG5A 4CUZA 4NBVA 2NVOA 4OHMA 4HV4A 1SVNA 3P9YA 4RK4A 2B25A 3C3KA 1FA9A 1T1SA 3Q1LA 5FWAA 2BSXA 1RXVA 4Z0NA 4D3XA 5C3UA 3ZV4A 1I13A 1QR2A 1U8TA 1HFEL 1WMAA 4GXTA 4CUJA 3T5CA 4BNMA 3K94A 5FWXB 2XV1A 2BGJA 3A9CA 3ZVRA 1UJCA 2G71A 5G2OA 4DYHA 1QUFA 1ZM3A 2QV0A 5DZSA 1J1UA 3N8DA 4QOEA 3V3KA 4CIAA 1J2UA 2H65A 3U1VA 3NDBB 1GQFA 1DG9A 2QPAA 3BH0A 3N8KA 2DFKB 3WI7A 3AEYA 3KKLA 1SU8A 5DGHA 4RKYA 2WG2A 4FYIA 1X39A 2Y27A 2YYZA 4JLUA 5TGDA 3SQLA 5TJ9A 1Z26A 4BZXA 5L3SB 1K5GA 2MYPA 1GG9A 2C29D 1QFMA 3KZCA 3R5FA 1ZOSA 4NCJA 1EI9A 4IAOA 4U8GA 2J9RA 2GD0A 2PT5A 3UOWA 1IQPA 3UHPA 5ES3A 3WWYA 1KI3A 5GV8A 1GPMA 3DLPX 1QRTA 4ZAGA 1AO3A 3HL0A 4TRRA 4BCBA 2XE7A 1E2UA 4FC7A 4AS3A 4DSAA 4DOMA 3PS9A 1K9VF 3GJTA 3QBDA 4FI3F 4KRXA 4X1KA 2KBEA 3KUKA 4OYRA 4CKWA 5FWNA 3TZLA 5LN1A 2ZSKA 4OQLA 4YDRA 2J0QA 4W8HA 4F45A 2CNDA 1WV1A 3S6JA 4DR2B 3L0SA 2HPHA 2W2TA 5BW6B 3W2GA 1PT6A 1K5DA 3FZGA 1Y7TA 4G4GA 2ZSBA 2JJ2D 3GA7A 3GYBA 4QTZA 1K8YB 2QTVA 4CEJA 4C06A 3AJEA 2I6QA 5E1MA 3PPWA 1RQGA 4ZMSA 5A9RA 3TTWA 1U9IC 5JVDB 1WTAA 1AGXA 2FYTA 2ID8A 3PFNA 1U3UA 4OLAA 2X9QA 2JGDB 1Z74A 1LBHA 4XLZA 2OWDA 4MPDA 4LQ4A 4DNPA 3EB9A 5JFOA 3D6JA 1E5QA 1FFBA 2C4WA 2P9HA 3I12A 1D04A 1S2LA 1PFVA 5JALA 3QWIA 4LYHA 1DEKA 1E4EB 2NVUB 1FBTA 4BVKA 5DNEA 3WRYA 3TBKA 1A9TA 1ZA1A 3I42A 3ZGVA 1W52X 4JQSA 3TK1A 2ZRLA 1B8OA 2LP4Y 1EHYA 1H2RS