2Z9BA

The crystal structure of azor (azoreductase) from escherichia coli: reduced azor in tetragonal crystals
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
200
structure length
193
Chain Sequence
SKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FMN-dependent NADH-azoreductase
publication title Expansion of Substrate Specificity and Catalytic Mechanism of Azoreductase by X-ray Crystallography and Site-directed Mutagenesis
pubmed doi rcsb
source organism Escherichia coli
total genus 76
structure length 193
sequence length 200
ec nomenclature ec 1.7.1.6: Azobenzene reductase.
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2z9bA00
1XT6A 3OX2A 2FCRA 2X2PA 1CZNA 3KEGA 4FGLA 2BN4A 4PU0A 4LAFA 1FUEA 1AKVA 2QMZA 3B6KA 5JROA 4ICIA 5A4KA 1ZWLA 5NLLA 2MTBA 5BUCA 1SG0A 3NHSA 2HNAA 6NULA 3NHYA 4U7GA 1WSWA 5EMNA 2ARKA 3UXHA 5LMCA 2WC1A 4LA4A 1YKGA 3GAMA 4F8YA 3W78A 1JA0A 3G5MA 3KAQA 1CZHA 3NHRA 1E5DA 1AKTA 1BVYF 2R97A 4Y9RA 1YOBA 1AZLA 3F6RA 4ZVKA 1J9EA 1ZX1A 4YAFA 1BU5A 1XI2A 2MT9A 2FZVA 1FLNA 3F2VA 4ZVNA 3HR4A 4CETA 1CZLA 3LCMA 4PTZA 5NULA 3FVWA 4QOJA 4D02A 2Q62A 4GI5A 3OJWA 4YAOA 4N9QA 2OHIA 2RG1A 1FLVA 3TZBA 2BPOA 2MOKA 3K20A 3QFRA 4HS4A 4QOFA 4R81A 3KAPA 4DILA 2XODA 5EA2A 3OVMA 2F1OA 3HA2A 5FUQA 3QE2A 1J9GA 1H66A 3B6IA 2BF4A 4S24A 3UXEA 3W79A 4C14A 1YCHA 3K1YA 1AKUA 3NHJA 1KBQA 2OYSA 2B3DA 3EYWA 2QX9A 4ESEA 3OJXA 5F4BA 3W77A 1C7EA 4XDHA 5F51A 4OXXA 3FX2A 2Z98A 1AG9A 1CZRA 3U7IA 3LT5A 4LTDA 1VMEA 4PTYA 5LJLA 4QOGA 4DY4A 3FNIA 4Y7CA 5F12A 3ZHOA 3TEMA 1CZOA 1FTGA 2V9CA 1V4BA 2QMYA 3FW1A 1D04A 3NLLA 3S2YA 4N82A 3GFRA 1DXOA 1B1CA 4LTMA 4DIKA 3OX1A 3N3BC 3ESZA 4C76A 5LJIA 3NHKA 2QX6A 2V5VA 5LLDA 4XDGA 2HPVA 5LBTA 1AKWA 4YAWA 2BZSA 3SVLA 5ULLA 3F6SA 3U7RA 1D03A 4N65A 1QBGA 4YAUA 2FVXA 2W5UA 3NHWA 1OFVA 1CZUA 2QX4A 3KLBA 4QODA 2Z9DA 2Z9BA 3NHFA 1T0IA 2QR2A 3R6WA 4HEQA 1QRDA 2QWXA 4BMPB 2BMVA 4M0CA 4H2DA 1AKQA 3B6JA 3O73A 3OX3A 5B3KA 4LTNA 2V5UA 4Y9UA 4FX2A 1YRHA 1D4AA 3F90A 1XYVA 3HLYA 3RPEA 2FZ5A 1RLJA 3W7AA 1DXQA 1FLDA 2OHHA 1FX1A 3N39C 1T5BA 4U7FA 4YQEA 3OWHA 4FGJA 3P0RA 2FX2A 1TLLA 1JA1A 1RTTA 4H6PA 1YCFA 4QOHA 1RCFA 3OWXA 1DX9A 1ZWKA 2D5IA 2FLVA 1KBOA 1WSBA 1TIKA 3NFRA 4U7HA 1AKRA 3N3AC 1C7FA 3D7NA 3L9WA 2XOEA 3NHPA 4CF6A 5TGZA 1CZKA 2Z9CA 4FGKA 2KLBA 1RLIA 1SQSA 3L9XA 1H69A 2AMJA 3ES9A 1X77A 4GR9A 2M6SA 3NHUA 3ESYA 2N1MA 5EAIA 2M6RA 2ZKIA 1OBOA 5FA6A 1NNI1 3ESXA 2MWMA 2KQUA 3TE7A 3B6MA 3EDOA 4QOIA 3GFQA 2OHJA 2HNBA 2FDXA 1I1OA 5FX2A 2R96A 3GFSA 4NULA 4QOEA 1AHNA 1OBVA 3FJOA 2QX8A 4C0WA 5B3LA 2X2OA 1AMOA 4YALA 3QFCA 2A5LA 1QR2A 4C0XA 2Q9UA 1FVXA 1J9ZA 5LVAA 4J8PA 1FLAA 3NHLA 2FOXA 3O2NA 4ZVLA 4NLLA 1F4PA 1QHEA 2FAXA 1GG5A 4ZVMA 4BMOB 1XYYA 5LBUA 4GQIA 1J8QA 3JSXA 2GSWA 1YDGA 1YCGA
chains in the Genus database with same CATH superfamily
2B36A 1PG5A 1QDEA 3NIFB 4NXMB 4Q6WA 4L0CA 4ITRC 2QLFA 4M22A 1GZVA 1WLYA 2A0KA 5LQJA 1M8FA 2W4QA 4DBLE 2JRCA 5KYYA 4KJXA 4CCWA 1DRUA 2F43A 1F7VA 2CNDA 5FULA 1L7RA 2W6MA 4JLVA 1IY1A 4Q48A 4D0NA 4WKNA 3DPSA 1I2AA 2JZCA 1QQ7A 2V0NA 3AJRA 5IU6A 2EJUA 1KYVA 5ITWA 1VHDA 1J5PA 1UOQA 3B8HA 3JYLA 2PUEA 2PQ2A 4MQ4A 4C0QC 2Q3LA 5BPHA 5ITZA 1D0SA 4J1TA 4QXOA 3DC2A 5EUMA 3EA4A 1GKIA 1PWXA 3CKKA 3L77A 3UMJA 4LGYA 5T64A 3B2NA 4MVXA 4M55A 4UNPA 1WVGA 4TLCA 4Y2TA 1WPGA 1KP2A 4OATA 1R6DA 2VPYA 1P2UA 4C89A 4ECEA 4EG3A 5EQFA 4Q34A 1TYDE 3ZX5A 4DA9A 4BZPA 3R7DA 2UUPA 4YRKA 3VR6A 1I24A 5D6OA 4NBSA 3U7GA 1N4DA 3FUTA 3FZGA 3FZEA 1TMYA 3NHSA 4IX9A 4PWZA 3W3AH 1OX5A 2GNOA 3V7YA 5JCJD 2YY5A 3QF7A 3LWZA 5JAMA 1U3TA 2XYGA 4OY3A 3THXB 4PYJA 3NHYA 5KPDA 4O0LA 5ESXA 3DZJA 3B89A 3I6IA 3M6MD 1FNMA 3PE3A 4Q7KA 2E4ZA 5DBEX 3C3KA 2NZUG 4L50A 2AHRA 2ZE5A 3TTWA 4Z9BA 1M73E 4B81A 2O6HA 1SKMA 2OG2A 3OQPA 5F2KA 1N8TA 5K2MA 2WC1A 4I1VA 4I6EA 4ZMRA 2EJVA 1Q74A 1VLVA 3D5TA 1NUHA 3LA8A 4CFSA 4LUCA 4LVOA 3NJ4A 4YUXA 5JJIA 1UBEA 1GRQA 4FP9A 1Q7GA 2V7UA 3ZV3A 4CKCB 1XQ6A 1M7HA 1S6YA 1MJ5A 1OILA 1Z15A 2Y67A 3FDJA 3HN6A 5BV1A 1ENPA 3HCWA 3QOFA 4BFZA 1P39A 2Q4OA 5CVTA 1GPUA 3BOSA 3NVMB 4BLSA 4BQOA 3P5BA 4CMIB 2P9FA 4G1VA 1P5ZB 2AV6A 4ZV7A 3J81k 5EHZA 1FU4A 4WZBB 3AHCA 2FW6A 1UKVY 2D3TA 3GY0A 5HDQA 2EJTA 2FSVC 1HGXA 2QD4A 3EXAA 1IJKA 1H2ZA 4XQCA 3UNXA 2PXCA 1JILA 5LIRA 1U3FA 3TTSA 1KVSA 1E2JA 1YFZA 1AN0A 4CMEC 1W96A 2WSBA 4JLPA 1I4DD 2VQSA 1KMMA 2XXJA 4B7ZA 1V9CA 2NTEA 3CNOA 1RACA 2EZ4A 1LLQA 3H7IA 2WV9A 3BSYA 4YWHA 3T3NA 5EZ5A 4DLAA 1S9DA 1GCGA 2NIPA 4MWGA 5ED0A 3PHCA 5FJJA 1U0LA 4DLWA 4YP5A 2J1LA 1ULUA 3LQ4A 1QVVA 2JHCA 1PNQA 4GSYA 4JCOA 4L0DA 2CMDA 5JW6A 1M54A 2ZG6A 2WMOB 4LYHA 5TMPA 2XOKA 4W99A 3O92A 4MIYA 4JQSA 3ZVLA 4C2UA 2J7PD 1VFPA 4GRIA 3HWX1 2DCUA 3VZCA 3N76A 3G23A 5HM8A 1VZ3A 5M5BA 4EF5A 4XD2A 2MINA 3R3UA 3W3AD 1UBLS 1RPAA 3SKVA 3SWWA 3JYHA 1XEFA 4MUNA 2CLFB 4GZLA 3GOQA 1J99A 3MCWA 2RGAA 3JQGA 3EEOA 2ATEA 2HIHA 1HNZB 1T24A 5THQA 4AG3A 4D02A 1JR6A 4ZT3A 2BFBB 5HKOA 4GI5A 1SN7A 3OFSA 3CNLA 4KWIA 5C2JB 3KT6A 1YFJA 1YS9A 3KVNA 2JS7A 2MSNA 2D0DA 2FMKA 4ZI5A 1RVV1 3MUFA 1Z18A 4PLCA 3ZPXA 4LXYA 1F2VA 2VWQA 1ZFNA 2GAAA 2OV3A 2RG1A 1N6RA 1UZLA 2JJ1A 4U2DA 4R2LA 1YQEA 5JNUA 2D5LA 4JXZA 3NCTA 3IUNA 3JAWB 4F9TA 3GZNB 3NNNA 4BQRA 2QVCA 1QGDA 1TW3A 2CGEA 3GELA 3KOMA 5CMLA 2YWEA 4E5KA 2F59A 2VHVA 2XCTB 3CR8A 3GG9A 2QM3A 3KUXA 5A9SB 1TVMA 1N1EA 3BX1A 4S1VA 3HA2A 2PUJA 2FP3A 1J00A 1XXHA 3PVZA 1F7UA 3N5CA 2PL5A 1W6UA 2G83A 3B6EA 4BATA 1U9YA 1H66A 4BVJA 3ENVA 2IGTA 3OFVA 4TWZA 3DNFA 4UE3S 1GZ5A 1QHXA 2R00A 3Q3EA 4QYIB 4HAOA 4B87A 1GTSA 1SUIA 2OSBA 3K72B 2BTQA 1D6JA 3AKDA 1R6AA 1TA4A 4HWOA 1KZ6A 4HEA1 4ALIA 4YRJA 3ELUA 3EVFA 4S35A 4J3JA 3CLRD 4WESA 4ZV4A 4C78A 1BJTA 1XZJA 4HBGA 4TKZA 2R1VA 1NV8A 3TLJA 2QKYA 2YX1A 1R15A 3NH9A 2OBNA 1ZLXA 1O95C 1CD5A 3HSKA 3TF5A 1JB1A 3UQZA 2W93A 4MEBA 4KQKA 5GV8A 1ZSVA 3TNFA 1VI5A 3UUFA 2C7RA 3OQIB 4Q9AA 4YV7A 4D9KA 4C3VA 5EP1A 4FEYA 4KC0A 1WXQA 4TMFA 1C7EA 1UZUA 3KPYA 4LNHA 5ILGA 1BRTA 2E7ZA 2UVDA 2ZQZA 1N0HA 4FI3F 4K86A 1KY4A 3P5SA 4LKOA 4CN9A 1B8PA 2ZB4A 4FHEA 3H42B 2PYIA 5K6TA 3R5JA 4N6NA 2RJNA 1N5RA 3ZK7A 1NA5A 3I2GA 4E6PA 2OGUA 1G21E 3L6DA 4H1UA 1KMQA 3B53X 2WHYA 3L0OA 5IAGA 4REQB 4WVFA 1W46A 2FKAA 1PZMA 4QOGA 1VJ1A 3UMFA 1BDBA 3B38A 3P0JA 1ZVMA 2O8CB 2RI1A 3BJIC 4KBFA 1Z62A 2LW7A 4OB8A 4R5MA 4JEIA 2YWBA 4ZCMA 1MV8A 3L46A 5D2CA 3V4FA 2NQTA 1WL8A 4I9GA 2FW7A 4WECA 4KOEC 2J3KA 5HJ7A 3NNSA 3BH0A 1TD9A 1REQA 2WHQA 3AERA 3GQVA 3F5MA 1KFCB 2OY0A 2AC7A 3AEXA 3SDSA 3SSOA 4BNYA 5CFZA 2AYZA 1H3NA 4YMIA 3UJ6A 2W2TA 4ND8B 4CGZA 1Y4SA 1U7TA 2DP4E 3I4LA 3JW8A 3JWHA 4OYRA 1QIEA 2H1SA 2GCOB 3KQWA 4FHFA 5ALOA 3QTLA 5EMMA 2BMJA 1I3LA 1UBUS 2FZWA 2OOSA 3S28A 1KQGA 4O1HA 4RGQA 2BTEA 4KXLA 4A15A 1WSDA 1UXKA 2IPMA 1AKEA 2GS9A 4E0BA 1KSHA 3AG6A 3P9PA 4F4UA 3HVHA 5T8KC 3STWA 2WD7A 2O2ZA 5AVSA 1MO4A 2HSGA 4B3HA 4H27A 4U7DA 2SKEA 4AYXA 3L8ZA 3NEYA 4P3PA 2DLDA 3MTBA 5DI9A 4ZYLA 4U1RA 2FN8A 2VWGA 2FGJA 2XUDA 4ZD6A 5ARDA 4G8CA 1Z2PX 1B7GO 3P2MA 3Q0IA 1KFEB 4MUFA 1ZUIA 1H2XA 2GD2A 2Y92A 3F5SA 4OHFA 1ONOA 1T8PA 5JSHA 3DKIA 4Q05A 3ZVRA 5FBVB 2ZSEA 3P2YA 1EZ4A 1T0JB 1CY0A 5DM0A 4NV3A 4L9SA 4RGBA 3V3TA 3I73A 3W5UA 5ALTA 3EISA 2IXGA 4MW6A 3MQFA 4GNRA 4YCNA 4RPJA 2BHTA 2VI5A 1CWUA 2FH5B 2XT0A 3HVJA 3DOEA 3SIWA 3ND6A 2XSZA 3MBOA 3M81A 5ADHA 5JH7A 1X7HA 2OFPA 4IJMA 4YO8A 4CEJA 3LCRA 1E1YA 3KIPA 3NHWA 1R6BX 2JNWA 1GDDA 2H06A 3T3HA 4GX5A 4ZCRA 3NM4A 2GXQA 5LQUA 3KALA 3ZY5A 4ODIA 2OUKA 3PEEA 3PNOA 4O2BF 5EZYB 1MDBA 2Q29A 3BK7A 1JDTA 2Z9BA 5TPWA 3NHFA 4BMNA 2GKSA 4P22A 1U4OA 1IVNA 2HXYA 2AF3C 2MMGA 2JBHA 3AJDA 4DGSA 4ZIRB 5IUJC 2OCLA 2X23A 3ADOA 4ES6A 5J4YA 2V6IA 4QFCA 3DL0A 5DYNA 2AI2A 3K5WA 1K9VF 1SVLA 2D2VA 2HN9A 2C5FA 3U48A 4H2DA 5FBKA 3AZQA 3OX3A 2R1TA 4F86A 3DLHA 4NKRA 1VHQA 2EFHB 3DDNA 3LU1A 3NBKA 4GXNA 3SP1A 4EHBA 2A78A 5B3KA 5IWAB 1Y6FA 1BOOA 2C2XA 1ZCAA 3BMNA 3EULA 5EP4A 1XZKA 4OYYA 5BVGA 1BW9B 2J4FA 4Y2UA 3AYXB 4R71A 3I9OA 3KT8A 2J6IA 3CKYA 2O50A 1Q16A 1LNSA 4XLLA 5B3JC 1D4AA 2JHFA 3D59A 4OB7A 3WIOA 1GLGA 3CR3C 4KYIB 3OG9A 4WLVA 1D1PA 1N1GA 2JFXA 3ANLA 4R1PA 3PV0A 4UCWA 3IHWA 4X6XA 5EHIA 2J6HA 3PXCX 3B12A 1N0IA 1SBZA 2ZZKA 3IBYA 3KTAB 5K6AA 2VHWA 5C35A 5IG2A 4CKBA 3UMCA 3FOEC 2NVOA 2OK8A 4M7WA 5BW8A 1CF4A 1NMQA 1V0JA 1ZGGA 3UAVA 4A8JA 4K2AA 4ZQFA 4DCOA 1AGNA 4DOMA 2E89A 4YBRA 2I6TA 2G9QA 4M7RA 4YMWA 3WOHA 2Y1GA 3Q7TA 2FFBA 4OHWA 3WMXA 4M2LA 1ZJ4A 5K8UA 3H65A 4TLBA 2BKUA 3FYTA 1F8YA 1T8UA 1QP7A 4DSZA 1G41A 4ZAXA 1TZJA 3Q0TA 3ETDA 5HIMA 5A3RA 5AHRA 2BFNA 1JLLA 1L7EA 1WY5A 3PHBE 4AS2A 1JIXA 3FNEA 5FT9A 3TWOA 1RWMA 3P4XA 2GF9A 4QICA 1WHTA 1WMDA 1U1EA 2YZ2A 1VI2A 2NYVA 5IYZB 2ZRCA 1RR6A 1SUEA 1ZMXA 1PHRA 2CLLB 5HILA 2QSZA 1DKOA 3DE1X 4GI1A 1JJIA 3MOIA 5AM4A 1SXJE 3V97A 5C5DA 2JJMA 8OHMA 3W2TA 3BRWA 3C8HA 2HWKA 1JT2A 2AW5A 2MSCB 2VAMA 3AHDA 3VKUA 5IF3A 3NFRA 1WQ3A 2J3EA 4B9AA 1N2OA 1ZAKA 2FEAA 2P9JA 5AKEA 3LQ1A 4EQ6A 1MKYA 1R8SA 3EZFA 4WY8A 1HK7A 4OVKA 3T6KA 5DWVA 2WT9A 4ADSG 4BLUA 1AZWA 1HQCA 1M9NA 4Z0HO 4ABTA 3O1HB 2ONZA 3V8QA 1GU7A 2P3QA 1R37A 2AFIB 1PWHA 3JD3A 3QBVA 3KP1A 4YRSA 3OPYB 5SZHB 4WZAE 3LRTA 3NYRA 4CM9A 1M8GA 2BHRA 2OLJA 3B3FA 1EFLA 4MTCA 4J4TA 5JSYA 3ER8A 2WJWA 3I6QA 4H3KB 2XR1A 4B35A 4DIMA 3R9XB 3BJMA 1ESMA 2VQ6A 3CN7A 5LU8A 2XMBA 3FLMA 4J2HA 4RPCA 4WJKB 3BWBA 3BRWD 3AH8A 1BU8A 1UM8A 5IT0A 2PZMA 1M6WA 1FMFA 3BH6A 2AMJA 1NJGA 2FR8A 1CB0A 3WAGA 1JAYA 4XGNA 1WS6A 4AZ3A 3OZTA 4BRWA 5JQGF 4LJSA 3IX7A 4NAVA 1KO4A 2JGNA 1E9RA 2QXYA 4GM4A 4YASA 1PAUA 3GLKA 4FOSA 4C7XA 3TQCA 3NS7A 1XMPA 3R5SA 1X94A 2H2WA 2GYVA 1HURA 4V02A 4CM3A 3CVXA 1RZRD 4W5NA 2ZT5A 3EXIB 1Z0AA 2D13A 3IUPA 2ID9A 1GGMA 2GLUA 3DB2A 3M8KA 2A2ZA 2PQMA 3TZQA 1CNFA 1OIWA 4RD2A 1SO8A 2JIOA 2DB3A 1NYLA 2B1RA 1WU7A 3PFHA 4MCJA 4UULA 4BFTA 2NXWA 3IBGA 3COJA 1LCIA 2CLCX 2VP0A 3PJGA 4RD6A 3AJ9A 4K6CA 1RFGE 2C3YA 1VPLA 4J9UE 1S3GA 2I29A 3FSGD 5AOBA 3NONA 3GFQA 4XM0A 3SZGA 1ECFA 3KU4A 3N2GA 4HNGA 2IWRA 3OEEA 2QZZA 4AP6A 1IXKA 2Y66A 1RPNA 5E4YA 5CXUA 2B8NA 3PDWA 1O8BA 4WEOA 4B8WA 1AHNA 1VG0B 4CGYA 3ANMA 3BGVA 1T6BY 4R68A 4YDSA 2PLAA 3BHNA 3WLPA 4A27A 2QX8A 2IW1A 3BM5A 4E46A 4F21A 1H94A 4H59A 5MDHA 1O7JA 5E3HA 2CJPA 3M6VA 4LCJA 3NT2A 2A0YA 5ICFA 2BHLA 3VU0A 1M2GA 4E5MA 5KYYB 5GJVC 4OBBA 2CEKA 4OA8A 3AGPA 3MB8A 4IFTA 2PKRA 3M49A 1E98A 1AF4A 2F17A 3JY6A 4IZ6A 4P58A 1YS4A 2VNIA 4FKBA 3IMCA 2OV1A 4MQBA 2GFHA 1XEWY 3L07A 4B4OA 2TSYB 2H0RA 2TYSB 5CLLA 3S5JA 3NWBA 2EGGA 2RD2A 1AA6A 5M7EA 1LFAA 3K1AA 3SQWA 1NBWB 3IQHX 5I9SA 1M2NA 3MAAC 5TMDA 3UJ7A 1ORTA 2CDRA 1N8SA 3IHKA 4LW8A 1IONA 2D62A 4Y98A 4TT3A 4UZEA 3BAFA 1T9HA 4QGBA 3K73O 2QL7A 2FPMA 1I51A 4NH0A 5CNJA 4ED9A 1D07A 2CHGA 3VHLB 5FTKA 2AG0A 3ZV5A 4GNKA 3ZWYA 2ZATA 1GG5A 3E2IA 4EMUA 1O6BA 5JWHA 2K7ZA 3AUXA 4XE5A 5IBQA 4ZYVA 1JFLA 3DTVD 1XYYA 3KV3O 2XT6A 3W9UA 3OP4A 1I2CA 2GYWA 1CR4A 3LYLA 4ZYWA 5KQRA 1TF2A 3K96A 3WQBA 1NBME 2OAGA 3LCUA 4IIXA 2HDHA 4CF5A 1F38A 2GTPA 4I9HA 2D59A 4LFAB 3IOEA 1E58A 1W2GA 2ZVQX 5FB3A 1AXEA 1KQFA 1YMVA 2PX0A 4F2GA 4UAUA 5DGTA 4HO1X 2JFWA 3OLYA 4OH7A 1TIPA 2B5OA 3SEZA 4JYAB 1C7IA 1J1ZA 1FRFS 1GGEA 2DWQA 2FCAA 1HQDA 3GRYA 3GX1A 3NALA 3SBDA 5BUQA 4TN1A 3AF3A 3B60A 3GYBA 3EARA 4JKYA 3EIOA 3R9IA 1QGZA 1T5DX 2FWJA 2H29A 4KZKA 2FW8A 4POAA 2OXRA 4KV9A 4B6FA 3G9QA 3NXKA 4FW8A 1M5RA 3OM1A 4Y0VA 1YAJA 3CA8A 1DIBA 1EVQA 4AXXA 4EL0A 2B34A 1HPLA 2E85A 3W1VA 3IEVA 3CW9A 3MRXA 1N2XA 2WUGA 3MIIA 4I9NA 4M8IA 3PQ2A 3GPBA 3Q11A 5AM1A 1SB9A 2M1XA 1M66A 1PX2A 5GZ6A 2V58A 1E64A 1MTOA 4LDZA 4PC6A 5F5LA 1Q0RA 3RGWS 4F8JA 2GBLA 2CZQA 1UWCA 5DLDA 5KWEA 2BFDB 2XMSA 4X65B 1J2RA 4XQ0A 1K5GA 4B3GA 2BFMA 5ESDA 4UXHA 2CXUA 1FYVA 4IM7A 4QUGA 4U2GA 3QUCA 1WHSA 4TXJA 4WACA 1G8JA 2JVIA 5HCUA 1IRXA 3AV0B 3QKWA 4FKZA 4U0JA 4NMHA 5H83A 4N54A 4DTCA 4X8LA 1UOPA 4LXXA 3OZUA 1ODCA 2MINB 4AW9A 2YDYA 4R9RA 1K66A 2P9HA 1Z29A 2P2CA 1NZJA 3RB8A 4UOZA 1EK5A 3PLAE 3H4MA 1PR6A 2FZ4A 3A27A 1GAJA 1MEOA 5J4HA 3FDZA 4PAOA 4QJ5A 1TYZA 4K6MA 1W8DA 4UNNA 1YBFA 3KUUA 3L0PA 3VI4B 1AS0A 2O0MA 3QFHA 4JUAA 3LC2O 1MC8A 5CIQA 1NWHA 1V96A 1YOBA 3KV1A 5BW5A 1DC8A 2CVPA 2LKCA 1XNRB 4BIIA 5A0FA 1KH1A 4E22A 4CMBA 1EXVA 1CUFA 2VT6A 4LZOA 4F2HA 4D6PA 1WMSA 1N34B 3CO5A 1KTVA 3H0KA 1T36B 3RADC 3PNSA 4DMFA 4LDQA 4RFVA 4BE7B 2ZJAA 2GARA 4F06A 1MAHA 4CMAA 2IYAA 3U0VA 4TN5A 3PUKA 3G2QA 2XKJE 3H9EO 4MVJG 4OP1A 4B34A 5E7IA 1CEYA 2WVHA 4WLUA 2Y0PA 1XI2A 1MP0A 2P6PA 1E3IA 4UDOA 1H05A 2HYDA 2UV8A 2O4UX 1PYOA 2WF9A 2WK1A 3JD1A 1X15A 1S7CA 4G0OA 4Y6QA 4EEXA 3RI3A 1B0AA 1C7JA 1IZZA 4IUCS 1VGVA 4O2AA 4B6EA 3ICEA 3MOSA 1KJNA 2JI4A 2E18A 3HPQA 4ZJUA 1TQDA 2WIGA 3DCJA 4B3DA 2IHYA 3QI7A 2QT9A 2R1VB 3UT5A 4ZJZA 1GAQA 1I3KA 4NBVA 1YJ8A 1N2CE 2O1XA 3UUWA 3R3YA 2I8LA 1V48A 2YV3A 1DVRA 3ESQA 4F1KA 4DUYB 1XN1A 2WNSA 1XZDA 4PRKA 2DR0A 3LT1A 2W8ZA 2MMCA 5NULA 3WGTA 4C3OB 1QYWA 3DZ8A 2WDPA 5JFTA 4OLFA 4NU0A 2D0OB 3E2MA 3IGFA 1N5MA 5TQ2B 4B3SB 1N6OA 1DOHA 1L1QA 1YJCA 2RCNA 2GHQA 4BE9A 3BF7A 3P2EA 4HH1A 1UQRA 4D0LB 3ZTWA 1A9TA 3VSCA 4LSGA 2BEKA 4RPIA 1JI3A 5ALEA 4GL2A 2WYWA 4BJ6A 4AQ7A 4CLEA 4HFMA 3TZBA 1Z82A 4I08A 2GESA 1VLHA 1QKJA 3PQCA 4PYQA 2ERXA 4H0NA 4DR2B 1I3OA 2VNHA 4UATA 1ULAA 5FLEX 1Q7RA 2NN3C 3C0KA 4I4IA 1UJBA 3OVMA 4N39A 3U26A 5JALA 2QE7A 1ZO8A 2XVZA 2NTVA 3AY3A 2J41A 2QJOA 3DD5A 5CPBA 4FSDA 4BLWA 5I4CA 3I2KA 2NADA 4MH0R 4MRNA 2C4HA 4PZYA 3GGCA 3V33A 3CNQS 1G6HA 1G5HA 3QXJA 3CG0A 2OBLA 1T13A 1LI5A 2FQYA 3JQ6A 2DSTA 4TLEA 2IZ7A 4DDUA 1Q3KA 3AERB 2EFEB 3QPBA 5B6PA 1HFWA 2ZB8A 2NSHA 2VZ9A 4GBMA 3CU5A 8GPBA 4D99A 2JI9A 4MWTA 1PQYA 2ODPA 4ALKA 4CTOA 4Z4EA 1MV5A 3UHJA 2V1XA 3ZV4A 5BY2A 3ILYA 3LDHA 3W5VA 3IP7A 2I4RA 3D31A 1A1SA 1ADJA 1J24A 2FFRA 2J3QA 2M6KA 2GAJA 3RUCA 5HYVA 1CE8A 4DJEC 1IQRA 2C3PA 1CETA 4TLMB 3AI2A 4FINA 5JRZA 4O33A 2HUNA 1P1FA 2ONYA 1LVHA 3NB0A 2DBRA 1M2EA 2EF0A 5FBZA 3DAYA 3L0BA 4R51A 1PO7A 5KWIA 4IHJA 2ZE8A 3QMMA 1CJSA 2GASA 1P91A 1VL2A 3O7MA 5I9NA 2QI9C 1L0BA 3NPAA 4QU5A 3C3CA 3WYGA 2VDKB 1NLFA 2OYRA 4HXGA 4YJ3F 3F1LA 1OA1A 4HC4A 4KK3A 2ZJ6A 5H3LA 2ZJBA 1WPRA 4Q9NA 3ZYZA 5CA0A 3NAMA 3FCXA 1WUIS 4PF1A 4HQKA 4S2EA 1JAXA 3GJTA 5AJUA 1Q57A 5K3DA 2O2SA 1NVKA 3LT5A 2VH5R 4OLJA 1V8PA 3C8MA 3ZVNA 2Q4BA 1X7ZA 3H04A 1ILEA 3SZMA 1CC1S 3A1WA 3LL4A 2EWWA 4NJOA 4A6XA 2IUSA 3IVAA 1RQNA 3WGJA 4AM8A 4WCFA 3AWDA 3IE0A 2W90A 1EGQA 5EJ2A 2D74A 3TEMA 3VBEA 5JS7A 5JH7B 2R4UA 3UJBA 5KHOC 4DB4A 1MC5A 3J7AC 2YVLA 1OIVA 1U7PA 2E37A 5B7NA 4RMGA 1S01A 2X1HA 5KKNB 1MQ9A 3JPWA 4DLNA 4EH1A 4MP6A 4XIFA 3KQKA 1B4DA 3CUKA 1BWQA 4M9SA 5ALVA 2YW2A 1ZIPA 1KY3A 2X1MA 4JH0A 1DKLA 5TPWB 3VPCA 2HWYA 3U1VA 2GZ3A 3G3EA 3IUJA 4YR7A 1SQ6A 4J9VA 4JT8A 3IIIA 4DEXA 4XR9A 2Z2KA 2P69A 4DV4B 3KOZA 1VCOA 3CNBA 2G9ZA 4Q4AA 4KQ2A 5MN6A 2VJMB 3T7SA 3SR4A 1FFYA 4D6XA 4C5AA 2PVSA 1EP1B 2APJA 4FZ3A 1XGKA 4MVWA 5JXIA 5K3BA 4DGQA 1VHTA 3MC1A 2QRNA 1B41A 2RH8A 4FFLA 3ZWCA 2FR1A 4BNMA 3OZWA 3BMNB 1IN5A 1CUEA 4RLHA 5C34B 3ZZNA 4ZO7A 5BVGB 1K98A 1E7MA 3B3JA 4CT4B 1I0LA 3H5TA 1K0FA 2VP2A 3VNSA 3P20A 1BH6A 1MDFA 2C8JA 4WZBE 3LQQA 3KRTA 4YONB 4WNAA 1FFWA 1GUFA 1VG9B 3A9UA 3EIQA 4F5YA 4RMNA 5D84A 3PENA 4X63A 3TPFA 2NZ8A 3QYFA 4KAJA 1TEHA 3PI7A 2VDPB 1KP3A 5K0NA 4F3RA 1YULA 3QMVA 3CQ9A 5GJCA 3S29A 3SF8B 1ABFA 4KI7A 1TL7C 3I30X 3GL9A 3BD7A 4A8JB 3M34A 4IEIA 1KKLA 4DC0A 2AOTB 3LGXA 1IEXA 4FKMA 3ZJYA 4ARZA 3IP1A 2VTBA 1CNEA 1WOYA 4BWYA 4L5IA 4LYGA 4E2WA 4S1OA 1CF9A 2FXVA 1IK6A 4LWOA 5AJTA 3I53A 3DF7A 4QUAA 1TF7A 1ZJ6A 4X1IA 2XUHA 1SCAA 2G6BA 3AFHA 2I8CA 1QO0A 3E1KA 4OGLA 4LOAA 3MB5A 4AO6A 4HCJA 4XJTA 3HO8A 3ODGA 4O4IB 4YAKA 3ZNPA 4I19A 3UBMA 2NXEA 2OKGA 5TMEA 4PQRA 3V55A 2VJAA 3VNAA 2JGLA 2XCUA 3N6XA 3GUHA 3T1YB 4LRYA 4D92A 4J6EA 2G63A 3C8UA 2Q46A 2H5LA 2WUDA 3IQWA 3RFTA 3DFFA 2FN3A 3WYDA 5CB4A 4J0JA 4EL5A 1E0KA 1G19A 1SCDA 3WIVA 1V3QE 4X0EA 7MDHA 2Y1KA 2VFAA 3ZGOA 1NIPA 2RHRA 5E2IA 2WJ3A 1IZ8A 2R7KA 1FNNA 2DUJA 4Y9UA 1T8RA 3N8NA 1FDWA 4J16A 3ZXIA 5CBPA 1T2EA 5FEUA 3CUWA 3BA6A 1DO2A 1BXKA 4YJGA 4J3NA 1VE6A 2FVYA 4N6GA 4TS1A 1DEXA 5D7BA 2RHLA 3CH4B 2AZ4A 4JOQA 5CXXA 3VR2A 3E9NA 3G2HA 1ISFA 2R4QA 3GRKA 2O2IA 3I3OA 4NESA 1Y1SA 1GFIA 3HMQA 4NZPA 4AJIA 3KSAC 4FONA 3K70C 3RJTA 4BGVA 4LC9A 1FPMA 2QD2A 4YK7A 3OTHA 2VA9A 3WYFA 3G6WA 1OI2A 3RG2A 4YMVA 1WDKA 1D6NA 1XQ1A 3K9WA 1LC0A 2ZE6A 3WDLA 4AZ3B 2GWHA 2XF2A 2J3JA 4G89A 4NY1A 3ZWMA 1FP7A 3KELA 1EFPA 4BWGA 3ZIUA 3CZRA 5TC4A 3B13B 1YZGA 3GRAA 5BORA 4AS1A 4UHCA 2XBLA 4Q21A 1RHQA 1SOVA 3VR2D 2QN2A 1R5OA 3D3WA 2ZU0C 4WXMA 1ZDMA 3QEKA 4KVZA 1G42A 4UVGA 2JVJA 4BMSA 2VEDA 3OAAA 4TYPA 3ZHTA 3TQRA 4OIMA 2G77B 1AQYA 2OMKA 4N40A 3SS8A 1P6UA 3X43A 3INYA 4FGUA 3QWFA 4DNOA 2BR3A 3N2GB 5CT6A 4MP3A 1ZUNB 2F8LA 3H16A 1MB9A 3WISA 2W2XA 2YWFA 2LZ0A 3BB3A 1YHYA 4K7JA 5SZJA 2EG5A 3X1ZA 1SU8A 3MWDB 3WFJA 2X4DA 3D8HA 4MW2A 2YV4A 2GXSA 2XOEA 3T15A 3W2HA 2O0JA 1A77A 4PANA 4M1SA 2CJFA 1JQBA 2I4OA 2FUG6 3O7WA 3OAAD 1CZKA 2Q1SA 2PKQO 4NECA 3TMYA 3V7NA 2J09A 3DEIA 2NO0A 3Q15C 5J9FA 4LHEA 1PGJA 4LYAA 1KK1A 2VBGA 4RKFA 2HXGA 1P8JA 3KLOA 4FQ7A 2VQFB 1EIWA 4EJSA 3W2EA 4AYWA 3BIJA 1DTSA 3KKKA 3A4IA 2PH5A 4IFIA 4G9GA 4XWOA 3HVIA 13PKA 2L19A 2PWPA 5A6SB 1NYTA 3U7QB 1LSUA 1ZUD1 3E7FA 2GHIA 1QHHB 2J5BA 2HRZA 3H9CA 2VH1A 3QVJA 2VXCA 2BGLA 2J3HA 2YFHA 3ADPA 1X0XA 4X00A 2W2OA 4XYBA 3T3DA 2YBDA 4DRYA 4DDHA 3LLSA 2PX8A 2EJWA 2IYFA 3FIUA 1U2EA 4JLKA 1YS7A 2V7BA 1GQSA 3ZU2A 5JVDB 2PJZA 2QUKA 3QYPA 2OBBA 1HFJA 1IHPA 5EIBC 3QM1A 3B51X 3BRCA 5FYQA 3G2LA 5HMMA 5L3QA 2FDXA 3HN7A 4GWGA 4JYBA 4JYPA 1JW9B 2DETA 2J9XB 3ITEA 4GPEA 1GYRA 4MB2A 5D8DA 4RVNA 1C4XA 2ST1A 2SKDA 3NUZA 3QVLA 1WW3A 2CDBA 2PZJA 2XRFA 1QGUB 4MIOA 3AOEC 2D6FA 1C0IA 1QFSA 4ZAFA 4BAUA 3X2FA 1P60A 1SCQA 4PBSA 1P2VA 3RYFB 1JIUA 5TB5A 4F8EA 4OXIA 3BFXA 2GVNA 1B0UA 3TL2A 2BKLA 3BIWA 4WADA 3TQTA 3PFKA 1V6CA 3A6GA 3FKSD 4P80A 4Z9XA 4X62B 4ZTZB 2JEZA 1W5EA 3D8SA 4MI1A 3RJMA 1XNJA 3LW8A 4OUKX 3WDKA 2EF1A 2HF7A 4BO3A 4C1BA 3D5EA 4H7KA 3LQYA 5HX7A 1V26A 2GM5A 3UJ8A 4AX4A 1YVPA 2C0QA 3S2IA 2VHJA 2DFDA 2DZDA 3MJDA 4QDXA 5E4JA 2NV0A 4FS8A 3CURA 3DW3X 3BTSA 4ZVLA 3WYBA 2X0NA 3LM8A 4EFMA 2YVKA 3I1YA 2VJYA 4OHRA 2IITA 1AE1A 2ZSDA 3JQ9C 4MUMA 4CV1A 1PZFA 2RGNC 4ANFA 2C8VA 2TMDA 4NFLA 5DU2A 3VI3B 3OLXA 4QDUA 1IRIA 2VSYA 5SYNA 2VYCA 2QW1A 1RBYA 2X6TA 4UCFA 3KXIA 1YQQA 3UF0A 3V42A 4C88A 1BWSA 1GNSA 1HY3A 4XWYA 1W88B 4H7EA 1XJ0A 1WHSB 5M2QA 1U3UA 3G82C 2NO5A 4L76A 5P8WA 2I9PA 2FRVA 2PMEA 1WPQA 3WS7A 4MS1A 1FXWF 3NORA 5TQJA 1XVVA 3GVPA 3OEHA 3R3ZA 4WXRA 3U37A 4Z4FA 2GBCA 4TUYF 2HAEA 3OX2A 4P36A 5LU9A 2RK3A 4X64B 3CPJB 3L43A 4W5HA 2YH2A 1IOWA 3LHFA 4UMFA 4D9GA 3NASA 2LDXA 2VATA 4XGIA 1KOFA 1AF7A 4UC0A 3PF8A 3UHAA 3WKAA 4BRUA 1NRJB 1AX9A 4PYIA 4QM6A 2QROA 3DTTA 1GZ7A 3ZU4A 4QQKA 1IWPB 4BVKA 4E32A 2G72A 1DKQA 5FFFA 4DANA 1UAAA 4KVAA 2WUVA 2HIGA 1WBBA 1C29B 1YIDA 1I7PA 2H6EA 4UPDA 1WXEA 3WHIA 3P4UA 3F7MA 2P79A 4MKFA 3O82A 4GBED 3UZUA 3VPFA 3NDBB 1NVGA 2J07A 2DSNA 2VEOA 3BXHA 4DNXA 1ODSA 4E03A 4H35A 2BFAA 2P67A 3V34A 4PYOA 1BXRB 1P1RA 1YI1A 2HM7A 4TKMA 4X41A 2PY6A 1FQOA 4XX0B 1UDXA 1A71A 4CIAA 3RT1A 5JSKA 5LDGA 4HPJB 4EGSA 1HOXA 2P4HX 1MVLA 2YCLA 3OFNA 3PSAA 3U80A 3QFSA 1Q22A 1LBEA 4QTZA 4WNYA 2F7SA 1W59A 3A3KA 3IPRA 4KK4A 1OPRA 2PRIA 2BHSA 3ZWQA 5CVEA 5EIXA 2ZPTX 2WHXA 4HGYA 2IIQA 4O2AB 3G8BA 3VJRA 4FFOA 4HLQB 3VPBA 2I7TA 3A4NA 1VPTA 4OMCA 1TQHA 1WX1A 2IU4A 2W8BA 3UT5B 2HJRA 2VZ0A 3VH3A 3W6OA 1H0KA 3C6BA 5DT2A 5FOSA 2P0EA 1JG2A 1I1QB 1XTVA 1C5KA 2OWDA 4BFXA 1KS2A 1II8A 3UOGA 2AFIE 2XNJA 1XEXB 3Q88A 1B43A 3AHFA 3OFND 5JS6A 1NI4B 3BQ9A 1TMGE 4Y6GB 1EVEA 1YJAA 2IOYA 3U9TA 4I2VA 3CZPA 3KB6A 2AR7A 2DKFA 3O26A 1QJ4A 1IUKA 1C9EA 1YNOA 2C2YA 4YACA 1NRXA 2QTTA 3ZY6A 4IWYA 4YCAA 2WLTA 4IV8A 1BJRE 4M1QA 2GD1O 3WBJA 2PHZA 2Y1LA 3ZI7A 4HNRA 3IILA 4U3JA 3PKIA 4BLQA 4DB2A 1II9A 2PSFA 3C1AA 5FIUA 3A05A 3HEAA 1R9JA 2WVGA 4G5RA 2EIXA 4QBHA 3VPHA 2JIRA 2QPLA 4AROA 1W29A 3B6ZA 2G80A 3HCCA 3C24A 4LJYA 5LYJF 5JYEA 4AMYA 4BQPA 3UT0A 1CVLA 2O0HA 1GL6A 3PTAA 3CIFA 3QUAA 4HSEA 3FSEA 1P18A 3L1HA 2AXPA 3OWOA 3F6YA 3KLNA 4Q93A 1YL5A 1L6RA 3JATB 4WVLA 1SB8A 3T5BA 2VJNA 1DBQA 2HA3A 2MT9A 4ZEVA 5EMHA 3SLKA 2AOWA 1PHPA 2IUFA 3IOMA 1WXXA 3AEUB 2A9OA 5DDIP 4E70A 2YUTA 3X1JA 5FQNA 4YRQA 1YKFA 3AKYA 3W04A 1PZEA 2RH5A 1QG6A 2GUWA 3N59A 4Z0NA 3WWDA 1YZUA 5K3SA 3DMTA 4YJDA 1ZY2A 1YJQA 3I23A 3JRNA 1L7AA 2JFBA 3U4CA 3ABSB 5BW6B 2B20A 1S7GA 4ENQA 4MK4A 3LTEA 3OPVA 3AIOA 2IV7A 4BNDA 3VDXA 4M1KA 2DT5A 2CHFA 2HRQA 3EGEA 4G4SP 2H1HA 4GS5A 1CY2A 5L4LA 1G5IA 1Y1RA 3LNCA 3VVCA 1DJMA 5TPZA 4KN9S 4TTVA 4BS9A 4KDEA 4YJ2B 2MYTA 2CEAA 3ZHCA 4C6TB 2O1SA 2PG3A 4N9QA 3QSYA 2X2EA 3Q2KA 2OHIA 3T95A 5CA0B 1CJMA 3C3BA 4P5PA 5AJVB 3V4PB 1O2DA 1CBUA 1Y0BA 4LF5B 2V4MA 3O9MA 5F1KA 5GY7A 5CCBA 4X3PA 1OZAA 3RAGA 3SBEA 3F71A 2OR3A 3TUZC 1M0EA 1P74A 1X7ZB 2YXEA 4KMOA 2G17A 4FHCA 4WERA 3RKRA 1VG8A 3W90A 1CY4A 3F3YA 3JTEA 2A1TR 3DDSA 4MX8A 2E1PA 2PKCA 2SECE 2IE8A 3WO0A 2LP4Y 5G1PA 2ZCJA 3NR2A 1OOEA 3B6IA 3KHSA 2OECA 3HGQA 3FLBA 4NF2A 4RVFA 5D86A 1NVBA 2QD1A 3MTGA 3QIVA 1W5AA 3FPFA 5HE9A 3VC2A 3R9KA 4YNBA 3CLSD 3ZXSA 1ORDA 4NU6A 2HV8A 5CIYA 1XCJA 4EZEA 2A1TS 5G3YA 3V8RA 3DAHA 3O1JC 3QPUA 3UAYA 3MTAA 4JU9A 2OYSA 3O8BA 1VKHA 2YQ5A 1NFFA 1ZN7A 5LWQA 4ESEA 5JAOA 1D6SA 1I4EB 4H6VA 1O6CA 3PS9A 3IUBA 3NGLA 4L0MA 3Q7EA 3TTYA 4BRZA 4GYKA 1GCIA 3SI7A 3P9KA 4N5LA 2I22A 5JAPA 3NEPX 4OA5A 3CV3A 1LS1A 1SCUA 5T41A 2ECPA 3MIZA 3IBFA 1DAFA 3DLTA 4I99A 1ISSA 5SY4A 4P7JA 3ZY3A 3G68A 5G53C 1SELA 2NX2A 2D2EA 2GHRA 3BE8A 1L4HA 1XMQB 5LJLA 3TX2A 2VL7A 4CMCA 4JZYA 4W9NA 4BLRA 4FUTA 4ZC8A 5I9BA 2EQBA 3BTUA 2OCXA 4FMDB 1X7DA 1FY2A 1NOJA 2I2BA 2IDZA 1MPTA 3P0EA 4H1WA 4PCLA 1E0JA 2CLEB 3ELDA 3LOPA 1BJKA 2P4EA 1V4BA 4FILA 3U4DA 2ONCA 3NKLA 4Z4GA 3QLVA 1H1DA 1KI6A 1LDGA 1SHJA 3ZN2A 4CEIB 1CUBA 3I8XA 1GNQA 3E15A 1H8EA 2P6OA 4IQ8A 4RZ3A 1AOXA 4DRXA 2OTCA 2VDUE 2ZRGA 4FEEA 2X0EA 2YJ5A 3I6MA 4LBVA 4EO4A 5IVPA 1F2TB 2PRSA 4F91B 1TRKA 1IZ9A 1NM5C 2QLMA 2ZIAA 1J0BA 4WY5A 4E2XA 1G7CA 3OO1A 4AYTA 2PUAA 4GKJB 1FRNA 2O2GA 2PUHA 5T4FA 1SCJA 2AMLA 2Y0BA 3DMFA 5LJIA 4QVGA 2NYUA 3ELBA 4O6VA 4DL9A 2R6DA 2QNIA 1Y34E 5DYYA 4BNXA 5KINB 3NUQA 4JR1A 4PZZA 2OCYC 5JBQA 3QW4B 3KR9A 4KXVA 2DPXA 5IDYA 2D1YA 2VG8A 2X8JB 1XQWA 2OK7A 2XITA 3QVWA 4TTRA 1L5GB 5CBPB 4AIIA 2B30A 2MSLA 4IDFA 4L8WB 3RSGA 3TZ6A 4D0GA 3TG2A 1JQDA 1LPSA 3HDTA 1QRRA 2HQ1A 4JLOA 3MJEA 2ZLBA 3A0UA 1EWTA 1YGYA 3JARA 4QPNA 5DYIA 4AMZA 1P4AA 2Q8PA 1Z36A 4RHEA 2ZXEA 5K05A 1KRWA 3EJ6A 2H63A 2C5EA 3WJAA 2E4UA 3LYUA 3OCWA 1BXZA 2G08A 3FHCB 4C2AA 2EFJA 1X1SA 3EZ6A 5JHHB 4S3MA 3OY2A 3D4IA 3E48A 1BKDR 1B00A 3QY0A 1P19A 1Z08A 1ZS9A 1VJCA 3ZU3A 4HEJA 2H1VA 1XMIA 5AR1A 4HH4A 3K70B 1MUUA 1L1EA 1EFPB 3VHXA 2ZEJA 4DN6A 3DMHA 1P0MA 1GT91 1YFKA 3KCNA 1HNXB 3HYNA 5CDGA 1T1JA 2HJ9A 3QUQA 1SCBA 4PSKA 2PEZA 1Y9EA 3HZOA 3E7PA 4C6RA 1YVDA 2PFGA 3DDUA 3S2UA 4UUOA 4DNQA 1OH5A 3TLMA 4QVKA 4CCYB 1G3UA 3WGIA 4O2BA 1YTUA 2AOXA 2YMMA 4OI1A 2H8GA 3MXTA 4IYRA 1RKVA 1SBIA 2M1ZA 1XZHA 3IP9A 3F3KA 3FWPA 1F8UA 1W8IA 2BD0A 4R7TA 3KEFA 4JLUA 4QTUB 3RVJA 1PFGA 2X9NA 2CBGA 1COZA 1M5TA 2C2OA 3T9BA 4N0QA 4R5HA 4E3WA 3Q8XB 5KQGA 2F6RA 4PS0A 3CHYA 1T5IA 4TTTS 1A4XA 3MT9A 1KVQA 3SSAA 5GAJA 3R7AA 3QMWA 1Y6JA 3LC0A 2J31A 3P0FA 5IM5A 1UBOS 4R84A 4NX2A 3HG7A 4H16A 1X1BA 2PJRA 1FLDA 4S0ZA 4U4AA 1BX1A 1EX6A 1BHJA 1Y8AA 3VZQA 1P0CA 1M0SA 1NGSA 4RK6A 3KVVA 2L69A 2W9XA 1WUJS 3DPIA 3PA6A 1KYZA 4GL4A 4HRYA 4WBNA 1T2DA 3UW3A 4DDWA 4REMA 2CZGA 4L2IB 5AT1A 2WWWA 5FOXA 1OH7A 2IYEA 2YFKA 3FNHA 3P32A 4RSRA 3E9RA 3CISA 1OTYA 4W82A 1BIFA 4CW7A 1E5XA 4DDTA 4L5AA 4R1UA 3OM9A 1RAAA 4ZDWA 4MUGA 1NW6A 2HUPA 2GN9A 1Y37A 5ALDA 1U2SA 3MEQA 3I5UA 1AXGA 2Y99A 3I8SA 4RQBA 4TWAA 4WZZA 5LA6F 4HZUB 5LCXA 5CB0A 5H59A 2X9LA 4LI0A 2HEIA 4HWRA 5EWJA 4K5QA 3UG7A 5KVCA 2JFUA 4PNHA 1RCFA 3TDKA 3I42A 3KXKA 1O54A 3MSCA 3KJIA 4CV2A 5FI0B 4EWLA 2O4CA 4LDRA 3T9CA 1PD0A 1YU6A 4I50B 3IT0A 3TDMA 4RYLA 1XB2A 1U6IA 2GCGA 2WFZA 4FFWA 3BVPA 1T9BA 4FSHA 5C4GB 3WHPA 4W8GA 1RC8A 1WUYA 1XHLA 2F1IA 2M6LA 1UDAA 2EOAA 5DW3A 4MUXA 3PDHA 4Y2QA 3WLJA 1UEIA 2H0QA 4A0RA 3NU1A 2ZAGA 2ZCVA 5EZSA 2BISA 3ZUPA 4RK7A 5CGQB 5ILOA 2XNKA 2OGSA 1P7WA 4M9XA 3K2IA 3A4TA 2ZWVA 4B33A 4HVLA 4FGSA 3DBRA 3IHTA 3W9YA 1D1TA 1RLUA 1E18A 1KQ3A 5JNTA 4CQNA 2IYWA 3RSSA 4O59O 4D9BA 3ITNA 4MV9A 3RBXA 5IHPA 2A1UB 3V9PA 1GUBA 1S5PA 3CIOA 1JHZA 3IH5A 5BN1A 3PUVA 3P7MA 4Q4CA 1KZ1A 2DFNA 2I55A 4BRSA 1COWA 1PF7E 4I81A 1HMPA 2NXNA 4PIPA 1P7VA 5B1SA 5IXJA 1VSBA 1F1BA 4IZOA 5K1ZA 1KI4A 4PPGA 4R83A 4AJ2A 3GUZA 4F4JA 1C4KA 3C6ZA 4KWHA 4N03A 4X97A 3P9IA 4TZ6A 2ZETA 1E3SA 2HMWA 3G2PA 1NW4A 2HTEA 3DE0X 3JVDA 1P1BA 2W4MA 1K0UA 4JMPA 4KQMA 1KF0A 3ZIAA 4CM6A 1VM6A 3U4MA 1G4HA 1VXOA 1DRWA 4MJ3A 5JQGA 1DBSA 1U28A 1Q7TA 2XNCA 3FFTA 5HEKA 3DONA 4E5YA 5HUJA 1X80B 4P5EA 2D1QA 4EO7A 1Y9JA 2DHEA 4K05A 2JB9A 2DY0A 1DBRA 2XWQA 1MO6A 1XZBA 1JIJA 1RXEA 3GEBA 3PIRA 1ODLA 2PR2A 3AHEA 3D6TB 4CE6A 4EY7A 2I6XA 1KRHA 2VJDA 2ZAIA 1D0IA 3AT1A 2AFHA 4HYEA 5CPFA 4JIMA 2D1SA 3PXDA 4ZVVA 2PN1A 4E5DA 1E7RA 2NO9A 4LNAA 1V3TA 4UM5A 2MYUA 4UEJA 4X9XA 2CV0A 1L7BA 3UT6A 5GVSA 3CLRC 3IDZA 1ZOLA 5U4XA 4BNZA 2HK7A 1ATZA 1CQWA 1LBTA 3NC4A 4ETNA 1P7CA 2ZTSA 1MRNA 4JIGA 2YRFA 5KNBH 1GA4A 1ZVJA 3C7TA 4PLGA 3TPCA 3AR5A 4CLRA 1YV9A 2ZJ1A 2BEVB 4LHZA 1EA7A 3GK3A 4LBZA 3HP7A 4IOJA 4MS4B 5AKYA 4KGDA 2UZ4A 3FYCA 2OZVA 1M7BA 3MMNA 4RCYA 2DTEA 3RWOA 4Q4HA 2CYCA 2PAFA 3HYCA 3IAEA 2JH3A 1FLAA 3Q8WA 5DP2A 5EJIA 1M10A 4A8PA 1L7OA 3EDCA 3NIGB 1FFAA 3QKIA 5JTUA 1QS0B 4TS4A 3W9SA 2VCEA 4WA7A 2VWHA 4XUCA 3TLEA 1CRPA 2H2FA 2IEZA 3AEYA 3PX3A 5EKXA 3H11A 2WM2A 4I5FA 5K0GA 4MR8A 1OHHA 3WRWA 5IBCA 2P5UA 3O2SB 3H1EA 5E7MA 5E6SA 1C8LA 3Q5DA 3LXUX 5B6IA 2DUMA 1MX1A 4N3NA 4DJDC 2O7VA 3AVQA 5FPTA 2XZLA 3DNPA 5ICGA 4PGGA 3EWIA 2JLAA 3DWGA 3ZGZA 2EARA 4B2IA 4LJ9A 4JI2B 1Z2CA 2NZ2A 3IXLA 4R7GA 4BQQA 1XT6A 3D2LA 2F1KA 3AB8A 3D4NA 3OJEA 2BYTA 3B1KA 5KCMA 4IHAA 1L5NA 2W6IA 5TJHA 4B84A 1TTTA 3G7NA 3EJWA 3SJCA 4FR0A 5JYCA 1NT4A 4W9MC 1JIIA 2Y0EA 4J0CA 4PICA 1GNTA 5DH9A 1MG0A 1S2OA 1Z88A 3O1IC 4NOMA 1JYFA 1W5FA 1OMOA 1YR8A 1FX0A 1U5BA 1NR1A 2C96A 2OBMA 3ZZ1A 5A1TA 1KEEA 1Z0FA 4AG5A 3AG5A 2VZLA 2Y0DA 1CHDA 3DHEA 3HR7A 4QAJA 3GT7A 1HRKA 1QZXA 4RJTA 5FHQA 3ICQB 4M0UA 1PKEA 4L51A 4MRRA 4OMDA 2H57A 1BHO1 2AB0A 1E6KA 4MQ6A 3TZKA 5KU1A 1FPQA 4S1NA 3WQQA 1NN5A 3X2SA 4YRDA 2J0EA 5KNBD 4BNIA 3FKQA 3UPTA 3VU3A 2W6ID 3MN1A 4RAQA 1ZL0A 2Z4RA 3ESRA 4MKRA 1B2RA 4K6GA 2DOKA 3IIKA 4OSPA 1V4VA 4XPIB 1BQ4A 1IHOA 2AG5A 2JL1A 1P80A 2HEGA 2E55A 3KTFA 1SGWA 3UJAA 1R5JA 2AWNA 3CBQA 4M53A 1KDRA 3L1VA 4GRDA 1JHMA 3EVCA 1A76A 3D6FA 4HJRA 2XGOA 3BIOA 1P4SA 1WSWA 2WA1A 2JBWA 1C3JA 1SC1A 2ARKA 2I3GA 3ZJ5A 5K3OA 2H54A 2PCJA 4QXQA 2AEEA 4CF7A 3W3ZB 2VP4A 5AVVA 1GQFA 1WUKS 3GGJA 4ZVTA 1LSSA 1UJCA 2ENWA 3BZWA 1YAHA 3CZCA 3KB1A 4HDQB 4WJLA 5B58C 4BNDB 5THXA 3PDIA 4LN1A 1K92A 2GKGA 3ABQB 2WU4A 1PL7A 1K2VN 2XB4A 3PUIA 1I5OA 3Q2IA 5IXYA 5F21A 2UAGA 4NNPA 1E6EA 4ZQHA 4XWAA 5TVGA 4AS3A 2OMEA 2R97A 5ALPA 1OI4A 1TMKA 1CUSA 1VKRA 5AJYA 5AUQA 4JBIA 3VC7A 4GWLA 5ALYA 5A4FS 2Z4SA 4OLBA 3AKCA 1X13A 3C7CB 5JMTA 3BKWA 3SEAA 1E4EB 1J4AA 2BGTA 1SWVA 3SNHA 3WQHA 5CCDA 1L3CA 3GMSA 4MI6A 3AUYA 1LPOA 2ZYAA 2BP7A 1T4CB 5BWMA 3ZWBA 3DVLA 3GRZA 1RPTA 1UK8A 1DWUA 1Z26A 1RNLA 3H5LA 4V0LA 5CFPA 3A2KA 3UAOA 1L4EA 4PHHA 1NMZA 2KB0A 5CITA 2VT2A 2WSYB 2QVLA 5I7AA 2ZT8A 3TTTA 3EEYA 4WEQA 4CMJA 5KYUB 5FHRA 2ZKLA 3H9GA 3OZIA 2XB6A 4KFRA 4PWYA 1WABA 3RAEC 2A35A 4JOSA 5AW4A 2QN6A 1XCPA 1RWNA 2WJVA 2NT4A 4FYVA 5ELLA 2RBGA 3HR4A 1W30A 4BFWA 1QFYA 1JV2B 1KARA 5BSFA 1JT9A 5EIOA 1MIOB 3A9TA 3N8KA 4CM4A 4A36A 1Y3CE 5J2TF 1NN3A 1SD5A 4QOJA 1IXZA 1H5UA 1HKUA 2VLIA 4X8MA 3R0QA 1KZ7B 5HK8A 1MVNA 3HVRA 2Q5CA 2W6CX 3MS2A 3O21A 1G7TA 2DPMA 4JJ7A 2V5AA 1Y5RA 4ALNA 2AOUA 2YN2A 3RV3A 4B8YA 4MDFA 3G0HA 2DBQA 1RFLA 2ZBQA 3GC6A 5J23A 2QQEA 4MV5A 1N7HA 2CYAA 1N3YA 1SCUB 2Q99A 2X5XA 3DF9A 5IUKC 3VUEA 2QRUA 3EEFA 3IEPA 1J6UA 1XU4A 4W8HA 4ZOAA 5I8PA 3IT2A 3K9LA 5IC6A 1Q1BA 3FMPB 5IH7A 2V3CC 2XQVA 4N12A 1LI4A 2P8SA 1T29A 4BKMA 2P3SA 4PN7A 4MV7A 1PCXA 4OU4A 1W1UA 3RJ5A 3W2FA 4ERXA 1E6WA 2UUCB 2W0SA 1IHXA 1T9KA 3BN3A 2XQJA 1KR2A 1SBTA 4UKDA 4WAUA 4BNUA 1JGTA 1N6PA 1SVKA 2QUHA 3MAJA 3TSOA 4C1NA 4QXRA 1AIPA 2C97A 3WHLA 4IIEA 4PS1A 4AUKA 5T7BA 1N0UA 1Q20A 3UBTA 4DRXB 4J1NA 2BDTA 5DIZA 1G3MA 3MGKA 2KYRA 2VBFA 3D3QA 2IYQA 2UU9B 4AKHA 1G5TA 1RQ7A 1CJTC 2CL5A 2D2IA 1G63A 2IHUA 2QIOA 3A4YA 3QWAA 2I03A 3UCEA 4C14A 1EM6A 4CG2A 1GZHB 1XF9A 1XTSA 1NJSA 3HKBA 4N0PA 3UMVA 2QMUA 1C9DB 1U2DC 2XT9A 3NHJA 3UWDA 3BE5A 3ROMA 1A9YA 2FG7C 3HNPA 1N9ZA 2LIPA 2HHAA 1ESCA 5C7LO 1LB1B 1M2WA 5DTQA 2WTEA 1UFKA 3AF4A 1ICIA 3I5AA 4L75A 2G1AA 4U02A 3C48A 3G79A 3AUJB 4EW1A 3WA7A 3K7EA 4B6QA 1DOAA 4OOFA 1DT5A 1NZFA 4XW2A 1IMOA 5IEBA 3L0IB 1KZYC 2GKOA 3OC0A 3N0RA 1ZK0A 3WMWA 4XB1A 2QD3A 3BJRA 4Y0AA 4AZ0A 4BKQA 2P27A 3ZWWA 3BWMA 5A4MS 1CSEE 4MVJE 1UXGA 4RENA 1JTEA 4FB5A 1DAOA 3CGWA 4AWBA 2P4QA 5AIAA 1UC4B 1GAEO 1RYDA 2EP8A 1FRQA 4LTDA 4Q0MA 3FAKA 1RXWA 5HXAA 3GFVA 1ST2A 2YICA 4YJ3A 3QBDA 4FHZA 4YT5A 4D8WA 4BX2A 3FETA 4IJUA 1Z39A 4E4RA 2MJLA 4PHTA 2CXPA 5CX1A 3D54D 5I01A 1G17A 2BL4A 4YREA 1L4KA 4BTEA 2IS6A 4FWBA 4K26A 4GXQA 1IXRC 2ZRFA 3DEYX 2VRBA 3PKJA 1CUCA 2WHEA 4PZUA 1RLMA 2V6JA 1JH8A 5L4NA 3FPAA 5LN1A 1ZOIA 2BFOA 1NW8A 2Q4DA 4LWPA 5JAZA 1CQJB 3NOXA 4ZKEA 4D97A 2J0QA 5DLEA 2QG6A 3O8LA 4H7HA 5F2OA 4RK5A 4TMXA 3IVRA 3PNKA 2AF4C 5FF9A 4LJ4A 3L4JA 4YYEA 3SZRA 5U1PA 3HY3A 2PZBA 1G2PA 3AR2A 2YMPA 2AR9A 1U8XX 5A3JA 1WKBA 4PO1A 1TM1E 3ZE0B 5LP6F 4RF4A 5AKLA 4ZICA 1R8JA 1EFUA 4TXLA 2XE8A 2XVMA 1H6BA 2FFJA 1T2NA 3OO0A 1K8RA 4KNWA 1RTKA 5D3ZA 1WTAA 3VR3A 2Y05A 3QVVA 3NC0C 3HP4A 2Z30A 1HETA 2YNMD 2ZOSA 1L7NA 3G7UA 5JDCC 1AGPA 4P7KA 1DAIA 3RD5A 4EY4A 5A7HA 3UB4A 3V48A 3ODPA 3QE4A 4Z51A 4JUIA 2B35A 4JKOA 4MS3B 5AO9A 3A3YA 1U0RA 2A9QA 2H92A 5KWSA 1I0ZA 4K6HA 1SEVA 4W9RA 4RDXA 3DR3A 1Q15A 2O8FA 2RE8A 3B9RA 4ZPXA 4GU5A 1T3ZA 4LY3A 3IJRA 4JJFA 3PUYA 2BH9A 3P9CA 4JBNA 1SXHA 4WBNB 2PO7A 5DV9A 4ZCIA 3VR3D 4BWVA 4B79A 1L5SA 1T8YA 3B85A 1QBGA 2CHVA 2P77A 1NNLA 2FFAA 3SY8A 1G5RA 1MTZA 3MWEA 3FGNA 1YB6A 2OCPA 3I2IA 2OZLB 3MS7A 3RSHA 1X38A 4CM5A 1U1IA 3WHKA 4EG8A 1QRTA 2C00A 2GK7A 4UDNA 3UIEA 3JQ7B 4LHYA 3OQ6A 1OFIA 1DTWB 1DZ3A 1TLTA 3JASB 3PUWA 4U6SA 1X39A 5TEWA 1R4AA 3RJZA 4CG3A 5B1HA 3WQRA 5GONF 4BMPB 2JLZA 1AHHA 1PEAA 1PJCA 1RZVA 5AW8A 4RXUA 1GGKA 3LUFA 3WB1A 3WWPA 4J49A 2G9VA 3I05A 4CKEB 1H0HA 1T2VA 1Y89A 2V5UA 3P52A 3A1DA 3PGKA 2XMDA 3BHJA 1E9CA 3E5MA 1UC5B 3I9JA 4HRAA 4TVKA 5IVDA 4B6PA 3MF4A 5T6MA 1QO7A 1M2OA 1N2BA 2XUKA 3GFTA 3OH8A 1JH9A 1J1UA 2EYQA 3K94A 4X92A 3UWPA 4BFVA 1DQZA 1LTHR 2DULA 3ELYA 3MJHA 4CLOA 2QMHA 2AN9A 2HC9A 3M4ZA 4RKQA 1F20A 4CIBA 3OSZA 3HCOA 5CT8A 5FRDA 5LR6A 4BKUA 1AA9A 3A1NA 3TSCA 1MABA 1T6NA 3IOBA 4O2LA 1I7LA 4XRGA 4MLCA 2A9JA 2OO3A 5AW9A 1ESNA 1T5BA 3E1GA 3T9EA 3K31A 3JXEA 4B45A 1X92A 4DMRA 3AB3A 1D2GA 1VKJA 4YQEA 3VR5H 2GBLC 2E1RA 3T9FA 2R6R1 4C03A 1W44A 4P92A 4YP6A 3AL3A 2WWXA 121PA 1Q1AA 1N2SA 1ZSNA 2A94A 2QDKA 1DWOA 3IT1A 4K9NA 5K3CA 3WLQA 2ORYA 4F5EA 5DFAA 1DU4A 4KG7A 1JKMA 4I6GA 4UQPA 2C4NA 2VHUA 3UO8B 1A5BB 3ROFA 2CDNA 1JPJA 4M7PA 3TB6A 4MUYA 4ETMA 2XXBA 4DMLA 2JIPA 3B48A 4II3A 1HNWB 1V47A 1VA5A 3BICA 3O4IA 3TRFA 5FYDA 4D42A 5F64A 1MFZA 5HS4A 4OLAA 4PZCA 3HHEA 1CQZA 1LWOA 1Q92A 4U7JA 1P2SA 3OA2A 1HT3A 1SAYA 2E5FA 3G8YA 3RSLA 3AUUA 3N75A 4Y30A 1PUIA 1XOIA 3LQ2A 2FMIA 2AFHB 5E2BA 4EKIA 5LQRA 4AMGA 1W5SA 1GSAA 5LYYA 2EX1A 5EFOA 2QYHA 3V1UA 3ZCSA 4ZGBA 1C7FA 4RLQA 3EC1A 4DM3A 2GM4A 2MYPA 2P7IA 2PZLA 4LXUA 4B3RB 3K8QA 1BA3A 5I8ZA 3AX6A 5C80A 2NOAA 1W5TA 5FL7A 3RHSA 5HIIA 3L82B 3ZXYA 1CUHA 5CFOA 3P96A 1TA0A 2J3LA 1PT9A 2VO1A 4FTWA 5DTMA 5P21A 3MTQA 4YPVA 3UMBA 4F4CA 3OE7A 3OTGA 4MYHA 3QV1A 3T34A 3FVTA 3OKPA 1E1RA 4W4TA 3WKDA 2HU2A 4J7UA 4CG0A 4A8HA 2R6FA 3GGOA 3VPSA 1X77A 5TGTA 5T6BA 1Z5ZA 3ESYA 4RH0A 3W8FA 4AB1A 1U2GA 2ACWA 1FDVA 1U0EA 4P32A 2O59A 2NU6B 1R9NA 3H1PA 4KE6A 4YJFA 1LPMA 1AH2A 1E79A 1IJBA 2NW6A 2ZRHA 3BORA 5IDVA 3RLIA 4Q5IA 5FL7D 4ER7A 3O4RA 5M3BA 3DO6A 3PNVA 1A4UA 4UVIA 3VR5D 1I3MA 1KKUA 2W2LD 4MKGA 4X20A 1NVTA 5CFNA 1UXHA 3OE7D 1X8LA 4FFRA 4KSCA 3PCXA 1T0BA 2YMQA 4DYHA 3K92A 3COSA 2J3MA 3CUVA 3OLQA 1JPVA 5C5CA 1BYUA 1XCBA 2XWSA 1JKFA 1H23A 3AHHA 3OSUA 4LQDA 3H5RA 1U1DA 3CRNA 3VDMA 2IX9A 1Y33E 1FDOA 1GT6A 1II0A 1N9KA 1XA0A 2Q0XA 3A3OA 1MA3A 3HRHA 4I0WB 3UMSA 1XSEA 1CR2A 3RVLA 6REQB 3FSRA 3RLFA 3FJOA 2WWFA 1X7WA 2VDQB 3C41J 4BO5A 1U0JA 5B3LA 2X2OA 2VPZA 3P0IA 4QPZA 5C7OO 4U2EA 4MCHA 1V37A 4NQRA 3E5RA 4CM8A 4JA2A 3FWZA 2Y6VA 4AD8A 4DADA 3FPSA 4WT7A 2V0GA 1JECA 2A5GA 4ZAWA 1JFRA 4LBYA 5G1NA 1KSJA 2Y4NA 4GMDA 1TX4B 4EHDA 5EPOA 1U5BB 1W4CA 1AMUA 5A7FA 2CDCA 4E3ZA 3PNQA 3E23A 5TT1A 5E6UA 1PNRA 4B7XA 1PDWA 1XXLA 4DMCA 3QKTA 2ZVPX 4UEQA 2QTHA 1KQOA 2KBFA 1B16A 4DXHA 5M29A 1JPUA 1QVAA 3HBJA 1DQNA 4N01A 4RVGA 4JJAA 3QENA 3VZDA 1KEUA 3MOGA 5FBLB 9LDTA 1MA0A 4QREA 5ADVA 3TG8A 4UBLA 4QU9A 3JVVA 2J33A 3II6X 3PFGA 4GOND 4IGKA 2CBZA 2GZHA 2E0IA 4PONA 1AQJA 2D1RA 5AHOA 5JNLA 1PNOA 1R0ZA 1WZEA 2GEJA 3WL3A 5HRAA 3G1UA 4RPHA 2KS6A 3NAZA 1ZA2A 1XDBA 3AINA 3GJRA 3OD1A 4KN8A 5M34A 4C0JA 1P2GA 3Q3VA 2ZYVX 4AFNA 4RA6B 3B3QA 1L7XA 3IYLW 1OFHA 2GBFA 3IPXA 1SUFA 2CZCA 4GHWA 1Y5NA 2ZWAA 2BJVA 2GCNA 3ZLTA 1C0KA 4MWBA 5KBYA 3WNCA 3NHAA 1YCGA 6ADHA 2XNHA 4FD3A 2LWIA 4AK9A 4TKVA 2IXBA 2R6JA 2Q1TA 3DYIA 4JUBA 4Q1VA 4RH1A 4TMYA 1UDRA 3RTBA 3UWSA 1E60A 3HB0A 2IWHA 3NBXX 5GQSA 1WIWA 3PDIB 1X9HA 4FZVA 4JDPA 1TM7E 4XCQA 1FXWA 2H5JA 4KN5A 1BCSA 1JLHA 2HIMA 1MOQA 1GZUA 3DMGA 4Q1DA 4TUYA 4WK2B 5GGYA 3QFTA 3EDRA 6GPBA 4M49A 4C0HA 3IP6A 3K32A 3TRJA 4XQ9A 1ETUA 5EEHA 2R5NA 2OM6A 2OVFA 2WWHA 5IWCA 2NM0A 3WL4A 4EB6A 4CTKA 2WOOA 1TQ6A 1WUHS 3DDZX 3SICE 3HY4A 1NTOA 1Q11A 4LQLA 4UD6A 4WZ6A 1UKEA 3WWOA 1SG9A 1ADBA 1PZXA 2F3RA 3F9CA 3GEIA 3LOQA 4KWEA 4NH4A 1T43A 3UFBA 4CXMA 1RAGA 1AKYA 3BFPA 1HE8B 1FC0A 2WFLA 1BDJA 2X19A 1RYZA 1IUNA 4MW0A 1RIIA 5NLLA 3QG5A 2AX3A 2HSZA 3U1BA 3I34X 3O8OA 2E48A 2VUSA 3H6HA 2HQOA 3ANNA 3PPIA 1E0AA 3ASUA 2ZJ5A 3QE0A 1RLOA 1AURA 4KTTE 2IEAA 4DKXA 2P2YA 3NWOA 3Q8KA 2WU1A 3TO5A 4HVTA 2HSDA 3CNNA 3I04A 1XMOB 4KFCA 1W2HA 4R0MA 3D8TA 4ER3A 2O3UA 4U2KA 3UXHA 3IT3A 3NYQA 1WXIA 3AEQA 4JT2A 1Y3FE 1Z5NA 5JJCA 1KNQA 2NTYC 4CM4B 2MU1A 1SZJG 3FVVA 2X40A 1RQPA 5MF6A 1POWA 3MS4A 1S1CA 3VU8A 2PMKA 2B9EA 3B8EA 2CLOB 1WDLA 1B3BA 5T4EA 3V8MA 3ZEIA 2AOUB 2WMNB 2FOLA 3TCKA 3EW9A 1IYZA 3Q40A 4IEEA 3ENQA 3CX8A 4XVQA 1CNMA 2RKBA 3DLCA 2PANA 3ISJA 3ITDA 3L4BC 3RNOA 4CMKA 3L7NA 4F3NA 4TWBA 1YC2A 4K0KB 1NVVQ 1OZ0A 1GTVA 2FRDA 3STXA 2IQIA 3PQ7A 4UHHA 1KO7A 5IAJA 1EG2A 2X9VA 5BR8B 2C9MA 1YONA 1E0DA 1NVVR 3UPDA 4H0FA 2RHGB 3PC3A 2J0VA 4LBWA 2RSLA 2WJHA 3UY4A 1B6SA 1ZP6A 5ARBA 2QZSA 1H2HA 4WW0A 3NDJA 2Q3DA 1YNSA 4DCSA 4EVQA 3LUCA 2Q1WA 2HHLA 3E35A 1J39A 1WEKA 3CBGA 5T4BA 4I5IA 4QHSA 1GWNA 3RGGA 3ZD7A 5LYJA 5BYAA 4YXFA 3W4KA 2NQ8A 2YWJA 3SM3A 1A8SA 4BYMA 5JNSA 1SU4A 3AVOA 3E5NA 4JXXA 4ACBA 3WXBA 3COPA 1B15A 3H1AA 3B1VA 1M34A 1FF9A 3KE8A 1B6GA 4HQRA 4CLXA 5B2FA 2IZ5A 1GFWA 2EHDA 2EKPA 3LUKA 2EQ5A 2Q9CA 4BEBA 4L8FA 5DN6A 1ZGZA 1JHAA 1NT2A 2I34A 5BYJA 3HFGA 5CBKA 4NK5A 4QG3A 1GGJA 3OTQA 4KACA 2B8EA 3K6SA 4L4RA 1WMEA 3R1IA 4HV4A 2HK6A 1K8YB 3ZLBA 2O57A 2AUNA 5KYKA 4OKIA 1SIBE 1XRSB 3RS0A 2HADA 2H4WA 1FNCA 3BC1A 4PC2A 1E1QA 4MA4A 4R81A 4R1NA 3RVQA 2J9YB 2D5AA 1CHNA 4GPAA 1E1LA 4PSVA 4YJ3B 1ISPA 2E6KA 3DFUA 3FPGA 1QBKC 3R7FA 5DN6D 1CX9B 4JB3A 4DNPA 3BZBA 4BKRA 5LKAA 5JJKA 3VVBA 5HF9A 5TS2A 3D2BA 3QE2A 5ALJA 1YS6A 2R1ZA 3ENNA 1J9GA 3CVOA 5AUPB 1IFXA 2DHQA 4JAVC 4UBJA 1V7QA 1XU9A 3ZV6A 3RVMA 4YIKA 3SBOA 1E9AA 2H00A 3BJEA 1GU1A 1NUSA 2PTGA 3CZ9A 4IZHA 4W5QA 3ZG6A 4D9MA 2ZREA 2X8LA 1X7XB 1KK2A 3QWIA 5DASA 3RAJA 4EIWA 2ZJOA 1KYXA 1UZNA 1C4OA 2Q6IA 5DJ5A 4G0XA 4F2DA 3D81A 1M8PA 2JPDA 3CPSA 1YB5A 1GNLA 2Y93A 2PD3A 1QZUA 5EZYF 1IQ0A 3OPNA 3C1OA 1KBQA 3AP1A 5ALGA 2BFWA 1INLA 5BPFA 1L8XA 1HZZA 1VJDA 1ZESA 1FP4B 4TTQA 5CLIA 5EIFA 4D44A 5CVJA 1UWVA 3EXHA 4V0SA 3R7WA 5BV0A 3H9UA 1QFMA 4NEGA 1PIWA 3WGMA 4I1PA 1RMTA 3U4QB 3LBIA 4IIBA 3LD9A 3KQSA 5BUSA 4P33A 2Y27A 2GOYA 2XDQA 2YWDA 3RC9A 1TKBA 1LFDB 1YQUA 3C8ZA 4QBIA 4Z0TA 1A4IA 3C5CA 3LHDA 4C4YA 5F9HA 2Y1XA 2X22A 3KJQA 1YJXA 3R75A 1MGPA 4XM1A 2JJQA 2NPIA 5KJEA 4GBJA 3RHFA 1LI7A 4PTYA 3ZIAD 1F51E 1ZA1A 3RIHA 3QX3A 5G4LA 3I2FA 4IW3B 2GXUA 3A4MA 1VJ0A 4KXFB 3K15A 3DTVB 3LKZA 3RUHA 3LY7A 3TQOA 1TW2A 5HFJA 3B3AA 2OHGA 1N2IA 3EQ9A 4FMPA 3GLGA 1FFDA 1UBKS 2KJQA 4KXQA 4B2LA 3SQOA 3MWEB 3QELA 4MULA 3R8XA 1BDMA 3J81A 4PPQA 2HT1A 1YVEI 2GPAA 3FYUA 4UEKA 2JGFA 1KSFX 1O6ZA 1U2RA 4AL4A 4M9CA 5YASA 4ML3A 1HT1E 3B1FA 3TE6A 3JYPA 2G76A 1PJAA 3FAZA 1V1JA 1KFKB 5AM5A 3TW8A 3ECCA 1FQWA 2FNAA 5AKZA 4DSNA 5BYKA 4DV7B 2PXAA 1KAHA 4V0MA 3SK0A 1BXGA 2KHZA 4L07A 1XE3A 1GA6A 4EHJA 3QUSA 4E4TA 3VO2A 4NMMA 1DDOA 2GJSA 2MIIA 2R8XA 4HB0A 2FSGA 4HMQA 2ZROA 1S96A 1Q1EA 1PRYA 5IYZF 2HCBA 1P2BA 2G07A 4AC9A 3LKBA 2GFIA 5KCZA 2HHJA 1TADA 2ZW9A 3HBFA 1B76A 2R751 2AHOA 3MWYW 1VJRA 1VL1A 4DLZA 2N46A 2CFTA 2IYLD 5CT4A 4CLOB 1JFSA 1VB3A 5K20A 3YASA 1CUWA 3REQB 1T8TA 2WU8A 1G3RA 1YCDA 3DOJA 3I39X 2XEDA 4RIHA 2GWRA 1Z33A 3ELWA 1JSZA 5FTMA 4FDTA 3EWSA 1K7EB 4UBMA 3RFCA 3RAPR 3ZKWA 5KQPA 1RMYA 2C2BA 1NPDA 2R7AA 5HIJA 4A5OA 4YAUA 4HFRA 1GA1A 2R9VA 1U3DA 2IUTA 4YX9A 2XTZA 1CTQA 2AR0A 1RWQA 1ZBDA 4AN4A 4JI4B 1OFVA 2I2WA 2JLBA 1I3NA 2Q41A 1VL5A 4WY2A 4B76A 1IG3A 1AY0A 2RHMA 2Z9DA 3H2JA 1NXSA 5DLPA 4NBKA 5ECGC 4MVJP 3ZWOA 1Z8HA 4BJHB 2F3TA 3T7EA 1P3Y1 2OGTA 3JWGA 4FIZA 3FM9A 1KJ8A 3L02A 2VAPA 2PZGA 1ZRNA 4MR9A 2VHCA 2BWJA 3GBSA 3VJKA 1JXOA 2QDXA 4GP6A 3E3OA 4A0GA 2UVQA 3H5OA 5KNCH 1YK1A 2ZTHA 4ND1A 1BX3A 2J6CA 1FTYA 2RGCA 3A6JA 3C8DA 4QRDA 5ELXA 3THRA 1NDUA 3UXYA 5JCOA 4C3ZA 4MB0A 1OB5A 3D0RA 2WJGA 1YUBA 1M6YA 3RQSA 3I1JA 2ZB3A 2HKIA 2ZUFA 3VC1A 4LTNA 1XKQA 2RHDA 3I9FA 4DKJA 2F9FA 1HH4A 2QLTA 1V7CA 3H2ZA 3JQFC 4QUDA 4G8JA 3EK2A 1Z5VA 4GM1A 1LQTA 4HJXA 4FX2A 3TBFA 7REQB 1W6RA 5GINE 5KX5B 5HP4A 4WV3A 2C5LA 4NU5A 4ZREA 3E0XA 1XYVA 3ZIDA 4E30A 1RLJA 3DE5X 3EVGA 2HU8A 3G8DA 1A8UA 4G85A 3T61A 3VR4A 3DZHA 1FX1A 3NNDA 2XA1A 2WSIA 4QRHA 2I54A 1RJEA 3N39C 1AMNA 5CG2A 3OHPA 4RJLA 4EPYA 4C7OA 5KNDH 2R5FA 5DLQC 2M32A 4M9UA 1QCYA 4D0RA 1A7AA 1FVOA 3A1UA 2BFEB 2Y4OA 4FN4A 3EDYA 2CCKA 3A36A 4HDOB 3HJBA 1ES9A 2BJHA 2GCEA 2PH1A 3AFNA 2VAXA 1LH0A 1YR6A 3AESB 3LZCA 3OUUA 2QY6A 4H18A 5AKJA 3HCFA 1V71A 4LPKA 4EMSA 1IB6A 3G13A 3K3PA 3M33A 4LY6A 5FUMA 4RQUA 4PSCA 5DIFA 2HF2A 4DIDA 1O0CA 1QH1B 2FGKA 3K30A 4WBXC 4F2PA 2B1QA 1GEEA 4Y2JA 1NY6A 2H9YA 3U39A 5DBFA 5HQ3A 4IJ5A 2HYIC 5IASA 2G71A 3RASA 5FXMA 4X20B 5DK4A 4CF6A 2D4HA 5KS2A 1E5TA 3W5SA 3IXQA 1Q1QA 4FBMA 1KFBB 1L5VA 1NXTA 2HB6A 1RM5A 5LA6A 4XSGA 4ZCSA 2NSLA 1E8DA 2Q50A 2YJZA 2QM7A 5J43A 5I51A 5C52B 1ZQ9A 3A2LA 3ZEAA 2ZWPA 2Y1EA 1G4UR 4KDFA 2HMAA 1DLIA 4GAEA 5KNCD 4KZPA 1Z35A 3GU3A 4O63O 4WKBA 5JDIC 1HWYA 1OCEA 2FWPA 3OCUA 3D0OA 4CM8B 2V6BA 1FSZA 4CM7A 4ZI3A 4Y2GA 3C45A 2G7ZA 4N5HX 1QCCA 1SXQA 2YWHA 4IS3A 1YA8A 3IAHA 2Z9CA 3U7JA 3K71B 4Z7OB 2R86A 1NX6A 5CYFA 2KLBA 1RLIA 5C7IO 5IW8A 4WNCA 5JISA 2V65A 3GA5A 3HC7A 4RA9B 5DHRA 4XVHA 1US8B 1WJGA 2G9RA 1Y9AA 1ZN9A 2XAUA 2ZDQA 4PYKA 4YQYA 4ZOEA 5E6UB 1GTJ1 1ZK4A 3FNFA 3SJUA 3THWA 1GL9B 5LNK6 3VZRA 1KI1A 3HBNA 1R9GA 2B78A 1DL5A 1WAMA 3QLJA 1PQPA 5DGHA 4DRZA 1QYIA 1U98A 1F8XA 3HADA 3RC3A 1A9XA 2P7HA 4KLNA 1ZNXA 3T7CA 5KYWA 1IE3A 1NNI1 2GBPA 1PT8A 1RP7A 2R65A 1XWWA 3S5UA 3SE7A 2R8OA 4AJKA 2KQUA 2A59A 2DJIA 5DRYA 3TE7A 3FPEA 3ZHVA 5I9LA 1EEHA 1Q0HA 4TT8A 4U2CA 2RAVA 3G2OA 3DMTC 3R3SA 1HE3A 2AC2A 1H2EA 1XRRA 1ZL2A 3DAOA 5KKAA 5I45A 8LDHA 2H4ZA 1HUQA 5DNYB 3JZDA 3PQFA 3TEJA 1NV9A 2IYUA 5EUCA 3ZOZA 1F2UA 2ZVDA 7GPBA 1G21A 1VZ2A 4KQHA 2E5LB 4G2NA 1QAQA 4UQLA 4X94A 2WHPB 5LIPA 2E3JA 2NUTA 3WLRA 2BBOA 2O2EA 1DKNA 1IN4A 4S0XA 3JQDA 4WTOA 4RUKA 2RARA 3HTXA 1N32B 4EUSA 2PH3A 3ZV7A 4F56A 2QQ5A 4FJ2A 1NULA 3H97A 1F1JA 3CLSC 3T4EA 4C29A 3H5NA 4DEYA 4B71A 4F4FA 3RUAA 1GUYA 1EWRA 2NSYA 1NU6A 1KI9A 2AN4A 2GPYA 3ETEA 5CH8A 5K51A 5K45A 1HXHA 3OQVA 4E08A 3AVTA 1PWEA 1PL6A 1ZJ5A 4H4EA 3WRXC 2A3NA 1L7PA 5C1PA 1A7KA 2IPNA 1W4BA 3BXZA 3N53A 1A2QA 4GKBA 3IV9A 4KXNA 2W6JD 3FYSA 3TS1A 1TJ3A 3L7YA 4EB6B 4FC6A 5SYMA 2EL7A 4ECAA 3B82A 3QVSA 1W49A 2R6CA 2D0IA 2PV7A 3KJEA 2RFLA 3CH5A 4J8PA 4KO1S 3TR0A 1TTHA 3GXBA 4YLEA 1EI9A 2JK1A 3TQIA 5KJFA 1WZIA 2GN2A 2HF8A 4B40A 5ADUS 3NHLA 5EP2A 3OQJA 4B5KA 1GKLA 1GRNA 3W5BA 5DGIA 3TLKA 4KO8A 2FOXA 1JU9A 4B75A 1Z5WA 1RRKA 2DWOA 3EPLA 3FHOA 3K0EA 4DMHA 1R6XA 3O8OB 2Q9BA 4ARSA 2RB4A 1WY7A 4CEHA 2BFCA 4ACAA 1RYYA 4JHLA 5BXQC 4BMOB 3KHUA 3SIRA 3KSDO 4FGZA 4BP1A 4QHTA 1QYRA 4UHEA 5FPKA 5A06A 1VP9A 3CVWA 1LBSA 4OBWA 3V4SA 1VCMA 3QOYA 2ZRNA 4M36A 2P78A 3WZ2A 1ZUHA 2BMWA 2VP3A 5AI5A 3E3AA 5A5GA 3MGGA 1Y8QB 1WLSA 1DRJA 3KT3A 1KMHB 1C9MA 1W4LA 2RKOA 4MB6A 3AEQB 1T3TA 1OU0A 1KYIA 4GR4A 1FEZA 1F6WA 1WOMA 1VI6A 2ATVA 3A9VA 5ALLA 3H83A 4B3IA 2NV2B 3PEWA 4NZ9A 2H17A 5BN4A 4DCJA 4X1KA 4GT1A 4W63A 1C9KA 4F3KA 3OE1A 4ZCTA 3D7LA 3PXUA 3PNBA 1XZGA 1L4LA 4HAUA 1HV8A 4P4NA 2BN4A 4XYGA 2SKCA 2V7XA 3OPXA 1QX4A 2ZBUA 3FPCA 3ER9A 4TTPA 3CINA 3O3MB 4RADA 1UMBA 3HJGA 3WRYC 4ER6A 4S1WA 5H80A 2OILA 3H2YA 3P4YA 3TNYA 4EHFA