2Z9BA

The crystal structure of azor (azoreductase) from escherichia coli: reduced azor in tetragonal crystals
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
200
structure length
193
Chain Sequence
SKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expansion of Substrate Specificity and Catalytic Mechanism of Azoreductase by X-ray Crystallography and Site-directed Mutagenesis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords FMN-dependent NADH-azoreductase
total genus 76
structure length 193
sequence length 200
ec nomenclature ec 1.7.1.6: Azobenzene reductase.
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2z9bA00
3NHUA 3F6SA 4ZVLA 4C0XA 4H2DA 4C76A 4YQEA 1C7EA 4YALA 2QR2A 5ULLA 1FTGA 1NNI1 2FAXA 5TGZA 2XOEA 2BZSA 3NHSA 3NHRA 4YAFA 3S2YA 3SVLA 3ESXA 1CZOA 1YCHA 4N82A 4M0CA 1RLIA 1VMEA 3KAPA 4HS4A 3OJXA 3O2NA 3OJWA 5LLDA 3B6JA 4LA4A 3KAQA 2A5LA 3LCMA 4NULA 3FW1A 1OFVA 3TEMA 4DILA 3TE7A 4HEQA 2QX8A 1AG9A 4DIKA 3D7NA 2MT9A 3OVMA 4GQIA 3ESZA 5LBUA 2OHJA 2QX9A 3W79A 3NHFA 1F4PA 4FGLA 1AKRA 1D03A 1SG0A 3OWXA 1QRDA 3R6WA 4QODA 5EMNA 4ZVNA 3F6RA 1FLDA 1ZX1A 2QWXA 4U7FA 3OWHA 1XYVA 2Z9CA 1CZKA 4CETA 5FUQA 1AZLA 1XT6A 1AKTA 2BF4A 3B6MA 1FX1A 4Y9UA 1J8QA 4YAWA 1FLNA 3NFRA 1T5BA 3K1YA 3RPEA 4GR9A 2V5UA 4Y7CA 2OHIA 4PTYA 1J9EA 1KBOA 3W78A 2FOXA 2BN4A 4NLLA 1OBOA 2M6SA 2BPOA 2Q9UA 1WSWA 3FNIA 1V4BA 2D5IA 3FJOA 4LAFA 1BVYF 2X2PA 4QOFA 5F4BA 2RG1A 3UXHA 4YAUA 2QMYA 4Y9RA 1J9GA 4ZVKA 1H69A 3N3BC 1D4AA 4ESEA 3QFRA 5EAIA 4BMPB 1YCFA 1CZUA 2FZVA 5NULA 4PU0A 1YRHA 3OX3A 4S24A 1YCGA 3N3AC 5F12A 4XDGA 1OBVA 2FLVA 2FVXA 1QHEA 4U7HA 3F2VA 1YOBA 2FX2A 2MWMA 4F8YA 1E5DA 2QX6A 1X77A 3LT5A 2V5VA 1AKQA 4GI5A 4N9QA 4QOJA 3ZHOA 2BMVA 5LBTA 5NLLA 1CZNA 3JSXA 2Z9BA 3NHPA 5FA6A 2MOKA 2OYSA 2WC1A 4C14A 1J9ZA 1QBGA 3GFQA 4N65A 4R81A 3GFSA 1RLJA 2XODA 1RCFA 2F1OA 3ESYA 1XYYA 2W5UA 3L9XA 1WSBA 4LTMA 3W77A 3W7AA 1FVXA 3KEGA 2QX4A 2Z9DA 3K20A 1TLLA 1AKUA 4ZVMA 1DXOA 4LTDA 1C7FA 1CZLA 2M6RA 1XI2A 1B1CA 3NHLA 3OX1A 4XDHA 4YAOA 5LVAA 4QOIA 1AMOA 3B6IA 2HNAA 4QOHA 1ZWLA 5B3LA 2R96A 1I1OA 2FDXA 5LJLA 1YDGA 3L9WA 2B3DA 1QR2A 3O73A 1GG5A 3UXEA 2FCRA 3NHYA 3QE2A 1AHNA 3EDOA 6NULA 1FLAA 1JA0A 5LMCA 2N1MA 5LJIA 2QMZA 1AKWA 1D04A 3EYWA 1JA1A 2MTBA 4FX2A 1RTTA 3NHJA 3TZBA 4BMOB 2Z98A 3U7IA 4CF6A 3GFRA 3OX2A 2GSWA 1AKVA 2OHHA 4QOEA 5BUCA 5FX2A 1TIKA 4H6PA 4U7GA 5B3KA 3P0RA 1DXQA 1FLVA 3ES9A 2X2OA 3G5MA 3GAMA 2HNBA 3QFCA 3KLBA 4FGJA 2R97A 3NHKA 5EA2A 5A4KA 2HPVA 2ARKA 1FUEA 3HLYA 4PTZA 3NLLA 1T0IA 2FZ5A 3FVWA 4QOGA 3HA2A 1CZHA 2ZKIA 4OXXA 1DX9A 1KBQA 5F51A 4C0WA 4D02A 1YKGA 2V9CA 5JROA 3FX2A 1H66A 3HR4A 4J8PA 4DY4A 3N39C 2KQUA 2AMJA 3U7RA 1ZWKA 3F90A 3B6KA 4FGKA 2KLBA 1CZRA 2Q62A 1BU5A 4ICIA 1SQSA 4LTNA 3NHWA
chains in the Genus database with same CATH superfamily
5TJ9A 2B36A 1FVHA 1HLGA 5CT8A 4LI0A 3HJCA 4AY5A 2UVDA 4BX0A 4AUKA 1VBMA 5ADHA 1TQ8A 1EWTA 1E2HA 4DCOA 4NEHB 3FJ1A 1EWQA 1CB0A 1JX6A 5JIBA 2YHUA 3R3UA 3WKDA 4B4KA 1J33A 1SBIA 4WY8A 4RD6A 1FVOA 4D3YA 1CUIA 2DH5A 4PN7A 5CA1A 2D2EA 4MKXA 3NWOA 4RTLA 3IBCA 2WKPA 3RG2A 2WIKA 4JKOA 1Z4MA 4QFBA 3LMKA 4GX0A 5JNWA 1LPAB 1KHTA 3AM5A 1XEWY 4G36A 4JODA 3OURA 4NV3A 4RGQA 5KWSA 2M1ZA 5C52B 1EU1A 4DGSA 3HYCA 4CKWB 3Q8XB 4MHOA 3EVBA 4H7HA 2AN5A 4MYCA 4Q5IA 5CVTA 4NTZA 4UBIA 1UOOA 2PMBA 3CLHA 4H1UA 4KBGA 4BVHA 1V39A 5JCPA 2HDWA 4PBTA 5GM2A 4GR5A 4PXSA 3H5OA 5BP7A 3SOZA 2D5LA 3ZOKA 1X9GA 2FSVA 4HGNA 4UZFA 1YF3A 3QMVA 4G81A 1OXUA 5JCOA 3VPHA 1T4CA 4OMDA 4JJ6A 2DETA 3GGSA 2NV2B 2QAJA 5DK6A 4PLTA 4EKGA 4PPNA 4KOAA 5JDIC 2WB2A 1TKBA 2A14A 2P2CA 2QZJA 3E35A 1WL8A 4ZVKA 3HJHA 1RQ7A 4JK3A 2UUAB 9ATCA 1RQNA 4P1ZA 1MV5A 1BQ4A 1L9XA 1T9CA 2A9VA 4DLRA 3BDVA 2HK8A 4DCJA 2ZBFA 1E58A 2GGSA 3HDYA 3PFHA 3OM0A 5EYPB 2QX7A 2XMBA 2QXYA 2O8DB 4R5HA 3RLFA 13PKA 3DD5A 3DE3X 3W5IA 2AR9A 2I65A 5LP6B 2YZNA 4JT4A 4B2PA 1XRJA 3R77A 1W4LA 5BVGB 1U0NA 1DUSA 3IKVA 2G9RA 2Q3HA 1AT1A 1QH1A 3LUHA 4M0EA 4CVNA 1OJ7A 1V8OA 2ZR0A 2HT1A 2XE6A 3D3JA 3TMYA 4TRRA 3R3VA 4R2HA 2QJFA 4BV9A 2L2QA 5A3QA 4H7FA 2OAEA 2CVPA 5JQGA 5C7YA 3GLTA 3QSGA 5JCJA 1R88A 2R96A 1LJUA 2OD2A 4WVLA 4YXFA 5HUQA 5DTMA 2NP7A 4ZO9A 3U17A 5DV9A 3WP0A 2Y4OA 4MUGA 3H99A 5LJIA 5MFZA 3ZY5A 5DXFA 5FBRB 1TTTA 4PYMA 4Z51A 3REGA 1H2FA 4DA6A 3B53X 3C3DA 3P9XA 3KG2A 2N42A 5EZ5A 4B6RA 5EJ5A 1Y5NA 4X3OA 4XYGA 2NIPA 3SHVA 4E5MA 4EHJA 3KJXA 1GFZA 2HQRA 2CFIA 3OJEA 2OV3A 4E7PA 4K6KA 2R5FA 4W1SA 4J6EA 1IC6A 2Z2XA 3MCUA 5DNDA 1QVZA 2Z09A 3QHQA 4OQEA 3PNVA 2ZRPA 5JS1A 1USGA 2BZ0A 2JLUA 5HCUA 2XGJA 1W2WB 2HCBA 2GBFA 1XQ1A 4EMBA 4NXMB 3DO8A 1FA9A 2I4IA 3I09A 2ZUFA 4M0MA 4O2AA 1IG3A 2ECKA 2JAXA 3GFPA 3K1TA 4O3FA 2B0JA 2EX0A 5M5BA 1P3Y1 1YWGO 1BU5A 1SB8A 3DEKA 2V3WA 4MWZA 1Z38A 4B3SB 1YJBA 3AVXA 5LXTF 3DDHA 2Q1YA 4PY2A 4WOKA 1JEJA 5BQPA 1A8PA 1KH1A 1M3SA 2AKAB 2P11A 2VF7A 1V2HE 1PR6A 2WAMA 1FBTA 3MGAA 4H7KA 4NCNA 4TYMA 1B93A 2CXXA 2VEOA 3IXQA 4WJZA 3RYFA 4LJ8A 3BC1A 1ODLA 1XVTA 2IP2A 2AUMA 1ZICA 3N53A 1P73A 2HA2A 3HUTA 4KQ6A 4V24A 4LA4A 3EFBA 4LY9A 4TKZA 3CLUD 3LUCA 1L7VC 1JFTA 2V7QA 4MINA 3UKOA 3UFBA 2A7QA 5JASA 3ER9A 4GZLA 2HDOA 4I4TA 3QZUA 3MNFA 1SBZA 1YHNA 1XDBA 2C5LA 2GK3A 4G26A 4UVEA 4D3DA 3VR5H 3GH1A 4YJGB 3WRVA 1C7QA 1C7ZA 1VHQA 2MJLA 4D5GA 3FFWA 1C80A 4Q4AB 3T5AA 3KETA 4Z4CA 2KI5A 3RWMB 2RH4A 3GJ0A 3TVTA 1XWWA 4JYBA 4MW2A 5DEOA 1AHPA 3DAHA 1BWRA 1E9AA 1LBTA 1SBYA 3LRTA 4IX9A 3U3KA 1XP5A 2OGUA 4CPDA 1C3EA 3L6DA 3W78A 1ODSA 2O48X 3NBZC 4R7TA 3UW1A 4EUKA 4CM4B 2ZYWX 2OO5C 1U1DA 3WJAA 4I50B 2Y9PB 3IXLA 1HLPA 1O77A 3M4YA 1UOQA 3DCJA 2J0SA 3ER6A 4O4IB 4XUCA 5KTTA 1NZFA 1FP1D 1T8WA 3CNEA 4OKSA 2VLBA 5HZHA 2V98A 3I2FA 5LYYA 1X0XA 3NUZA 4FUTA 1L6RA 3LX8A 3PDUA 3LUAA 2WHQA 3W05A 1UBOS 5AUOB 1CPYA 1N92A 1J20A 1VOTA 3DZCA 1RVV1 4RIGA 4N6NA 4H77A 4YWHA 2RGWA 1W88B 1G66A 2ZJFA 3LNCA 3V4OA 1EESA 4N65A 1QG0A 1JXMA 3IQGX 2Y71A 3COJA 1R6VA 2EBFX 3LUJA 3BSYA 3TB4A 1PT6A 3W1EA 1GU0A 1OVGA 3A7DA 1A2OA 4LOIA 2H31A 3QWAA 1OAOC 3K4QA 4WZAA 2ODTX 3FCSB 1MX1A 3AUJB 3FWHA 3O5AA 5E0OA 3T7TA 1VJTA 3IOBA 1RM5A 1JDNA 3MBOA 1JBKA 4QO7A 4O25A 4AMUA 2VNKA 3LFTA 3T0IA 2WWXA 3T3EA 4D82A 3CCBA 4O29A 3NBFA 2SECE 3HA7A 2GKSA 1FDOA 3Q3VA 2G4CA 1D04A 4XX0B 2HC9A 2B5OA 2DT8A 3E2IA 3PWKA 1P2BA 3VGPA 1SAYA 2V6GA 3PFGA 1IOZA 4KI7A 4B33A 3BGIA 4OXRA 5ECYA 2PEZA 4JOCA 1KMQA 4HDSB 4X6YA 4IH1A 4B9AA 2BI7A 3RYCB 5D5PA 1HE1C 3MWLA 3MWJA 2VJNA 4BZWA 3AOEC 4LF4B 1A9XA 2Q4EA 2FJUA 1QYRA 3WKBA 1QC5B 4DIFA 1NVTA 2OBFA 1HSZA 2VTVA 3QKUA 3R7LA 1I32A 1JZQA 5A9SB 4E08A 1M33A 1MXHA 2Z8YA 1VSTA 1Y48E 2X3FA 4KKVA 4C7OB 2NM0A 4OAPA 5ELXA 4AX8A 1QUEA 1RWOA 3HYNA 2PH1A 2WHPA 1K3TA 1V5FA 4PS0A 4RVDA 4BFTA 5IJ0B 4C0SA 2ZPTX 2J87A 3ID6C 3EODA 1GZDA 1FSPA 2R8OA 2XADA 5JBQA 5C8YF 3D6HA 2DMRA 3BE4A 4LMAA 4LWOA 2WABA 5E8JA 4GZ3A 1PD1A 3RT1A 5IT4A 1GNTA 1V7ZA 3NI2A 2Y76A 2I4MA 2YL2A 4KDCA 1SVNA 5IBRA 3O2NA 5C8XA 2X9LA 5HBGA 2IS1A 4X6LA 3FGPA 3NP7A 2WR8A 3UGKA 1QK3A 3E8SA 1D7OA 1KQOA 2CCKA 3IPRA 1HUQA 4JI1B 5K8IA 1E7SA 3ET4A 3DF7A 3ZKWA 4D9MA 2XCSB 1N25A 3EFHA 3PDCA 3WTCA 4YP9A 4BO1A 1S5PA 1P4JA 1GITA 2FGJA 2PRJA 2RKBA 2GAFA 1H65A 3PQ8A 4G4IA 4PG5A 4ZGGA 5HM6A 4MYRA 1C5KA 3I6ZA 5LPNA 2VH1A 2XI4A 3B1VA 1SXJE 3FCAA 1IWOA 4LMBA 4ECAA 1S1CA 3AVVA 2PGXA 1QIGA 1RHRA 3MS2A 2GN4A 4Q48A 4RL4A 4V39A 1H5QA 1UAYA 1A69A 1JU3A 1Z6XA 4QJIA 2J3DA 1AQ6A 3COWA 4CF7A 1QHIA 3FB1A 2AXEA 4PTYA 2GXUA 3USCS 4AYWA 4MHTA 1DPFA 1A50B 4MR7B 2K4MA 3SNHA 1JPNA 3IPCA 3EIWA 1ZCZA 1DUIA 4WASA 4UUPA 2QU8A 2VS1A 3TOVA 3EC2A 3VNBA 4YLEA 1L7MA 3V2UA 1SO8A 2FZEA 4YGYA 1A2KC 2UXDB 2WVJA 3GLFA 2VRCD 5JQGF 3MIZA 5JPIA 1MC5A 3E1GA 3RS2A 3KUDA 1EIWA 4XXHA 2FWIA 3NEJA 4GGMX 3GP8A 3DV2A 5CNKA 2HRRA 3L7MA 2ZUEA 3LIPA 5BRNA 3OIWA 1C7RA 1JDVA 3W8EA 4YLGA 2B61A 1S2NA 4B7CA 1W4BA 2YVKA 4LJRA 1LFDB 1GGKA 1V1RB 4GHWA 1X92A 4IIVA 2HK6A 4KQCA 2L17A 2EDCA 2JHGA 1HURA 4CHTA 5B30A 3RV3A 4W5HA 1PAUA 3NO4A 4UEWA 4YMSA 3VVCA 1NUAA 2RGCA 4O1IA 4J75A 2IHTA 1KGDA 1BKYA 4Q7KA 3G2LA 3GLHE 3PD7A 1Q3KA 1WMAA 3WO1A 4LQ4A 1GL9B 5IPFA 2AZMA 3S1LA 1ZJWA 2OTCA 3ZE2B 6NULA 3OY7A 2I2XB 1ESMA 4RVOA 2XWJI 1I4WA 4P3OA 4KPUB 4RD3A 3FPKA 4JMLA 3UGTA 3DB1A 4G4SP 1R15A 1ST3A 5LP6C 1FSSA 5TEWA 1I7LA 4D44A 3C3KA 5BSUA 2EEPA 2H4ZA 1PJBA 4G0XA 1C4XA 1H1DA 2BEVB 3GX1A 4IOJA 1L5VA 3S8YA 1TJNA 2ZS8A 1VL8A 3MD9A 3RM3A 5I5EA 3H9CA 3OZSA 3FBTA 2OOKA 4KN6A 4UQPA 3VOSA 1HR0B 3RLIA 5ERXA 3E61A 4GOOD 2NU8A 3ITEA 4F85A 1KDPA 3H5LA 2IELA 1II9A 3B85A 3IT0A 4EFNA 4XVCA 4P81A 2PUDA 1NW7A 3QG5A 1WOYA 3VH4A 2ZE6A 2B3TA 5IRCD 3QVJA 3K4HA 3S6JA 2XUKA 3IOEA 4WLEA 3BXOA 4E2XA 4HYEA 3E15A 1VMAA 4G8DA 1U7ZA 4UBOA 3PQ5A 4F1JA 4MQBA 2IU4A 1Z16A 2J3MA 1TAUA 1EDEA 1RBZA 4V0OA 4YVFA 1H3FA 3PHLA 3V8QA 5KU7A 5KBYA 1X74A 3PA8A 4NBSA 4M1MA 3M70A 2QNBA 2QV7A 2QD1A 2JH8A 3EXFB 1TJ4A 4PRZA 4PXYA 2GN8A 5JWHA 1FDIA 3WR5A 1VIMA 3GRFA 4BUCA 1QQ6A 1NUPA 3IQWA 4IJQA 4DMMA 4F56A 1VL6A 5C8YB 3LQ4A 4S04A 1HRKA 2GEDA 3AF0A 2I1QA 1Y4AE 3D7NA 1KNXA 1N77A 3UHJA 3M34A 1DG3A 1EUZA 3G2OA 3ZCUA 1PNRA 4RZHA 5M29A 1NYRA 4BNDA 1KSFX 4TWAA 1A04A 2EZ9A 4AECA 3L06A 3T38A 3LQFA 4YO7A 3KK0A 3KP1A 2EU8A 1F12A 5EY5B 4OHRA 3WLHA 4DIDA 5BSGA 4U6SA 2ZYVX 2VDWA 3HUFA 2J32A 1HEUA 4M54A 1UPTA 4ZCLA 3DXYA 4Y98A 1HRDA 3JD1A 1JAHA 1ZUWA 3H65A 3S1AA 3KZNA 3GUUA 3HO6A 3QQ5A 2D5IA 1UANA 4I1IA 1PNOA 4UHFA 2VHUA 1M1YA 1B7GO 1G5IA 4OBWA 2HEIA 4FSXA 3W9YA 4ESHA 1JHUA 4EUHA 4RTQA 4QT4A 1SIUA 4ZGWA 1JMYA 1E9EA 4EGJA 1UPUA 3ZVKA 5CAEA 5ED4A 4O1HA 4BAGA 4WMLA 2Z4TA 2AX4A 3ZDDA 2JLBA 1FTSA 1G55A 2FW7A 3P0IA 4C5CA 5KTOA 3LW8A 3PUIA 2BKAA 3CNLA 2RK3A 1QDEA 3HY6A 3N0XA 3O8QA 1XZAA 2H0RA 3BQ9A 4LSMA 4JLOA 2Z56A 3JZMA 3CYFA 3JPYA 1Z7GA 4LDJA 4MV6A 3MRXA 2DT5A 3UJAA 1L5FA 1EXNA 4MRMB 3X1ZA 3Q0IA 4BEWA 1SU6A 4A2QA 5FYQA 5JY6A 3QUAA 1F4VA 1LBHA 1RKUA 2HF7A 4ONEA 2FP4A 5JVDF 3GFTA 1JSZA 2AFHB 2MSDB 3N2KA 3S2SA 5K7SA 2FQXA 5BO5A 3WBFA 4BE4A 3CMMA 1R3DA 2VF2A 1E5TA 1C9EA 1LSJA 1XTTA 4WLNA 5DW0A 4ZAWA 1UDBA 3L6OO 2CNDA 1PFQA 2F59A 2NSHA 3OEYA 4Q4HA 5LFAA 3EC1A 1YZGA 2IK8A 1G0NA 3AJEA 1U8XX 1UZNA 1MGPA 4HAZA 1CUXA 4PAQA 3U0VA 1LLFA 3C6XA 4O4JF 4ZV7A 4V1CB 4JX9A 4RPKA 1U0TA 4IHAA 2C92A 2QTZA 3HA5A 4RIFA 5E6RB 4ZGBA 5FAKA 1VKZA 4Y6LA 3GRAA 3RRBA 3CU5A 4ZMSA 3RUFA 3VX4A 4C0AC 1TPZA 4QTYA 1NI3A 1UQTA 3LZDA 3U13A 4DWJA 1LF5A 3FVWA 2Q5CA 1N1MA 1R6UA 5IKEA 1JQDA 2PH7A 1W0JA 3F46A 1JZSA 3ZWOA 5I4BA 5F2EA 4ZCIA 1N0WA 1NOIA 3KWMA 1QVAA 3NRBA 4I19A 5COBA 1GG2A 4I50A 4Q34A 2VWHA 5E2IA 2WFLA 1S8OA 1S96A 4IMIB 1SEPA 2J0UB 4N12A 4TLDA 3WMXA 2O8VA 4V02A 4AQDA 2PMCA 4HPJB 4L75A 4ZDWA 1DBSA 1MX3A 4PRLA 2GHRA 1RTKA 1TLFA 2GUWA 3RG8A 3G6WA 4B2YA 5ANRB 4MPDA 3ABSB 3L5OA 5DSXA 1EDDA 1RHQA 3QXJA 1U5AA 4EDFA 4F21A 1DARA 4YLYA 1GPDG 3VYWA 2ZI6A 5AI5A 5EVJA 1XROA 1TI7A 2UZ3A 2ANBA 1GLGA 2QM0A 4M0KA 1JJAA 4BRZA 5EJ8A 1NBEA 5J1TB 3M6MD 2QRVA 4BBAA 2Q49A 3ADKA 5FPKA 3V00A 3HCEA 4MLPA 2R6CA 3VDNB 1I01A 3FETA 1GQYA 2I66A 2J6CA 4CLRB 1JNYA 1T2FA 2RG7A 3RRNA 4M87A 4OBBA 4ZI3A 2NTJA 1I51A 2VDQB 4B7UA 3DPIA 1W44A 4P5DA 3EGXB 1M6HA 4IHKA 3WAGA 5JZBA 3W7BA 4AN0A 2PYIA 3MILA 4N18A 1WIWA 4Q9LA 4HSGA 1EFLA 4Y9UA 4CDRA 1OH5A 4ZEMA 3IB3A 4EEZA 2W22A 3DOIA 3RSGA 4NP6A 1E2NA 2KYRA 2O1XA 4L8LA 4LC0A 4ROTA 1C9YA 3DBRB 1MA0A 2AKEA 4EHHA 4AU1A 1I2AA 1SM4A 4G84A 3KSDO 5HIKA 2XIJA 4OHKA 1RI1A 5E1BA 3DVSX 1CV2A 3CBGA 3DBLB 2BH9A 1OFUA 1U98A 4Q1VA 4D97A 3BIXA 4RJIA 1QX3A 3U1VA 1ZK0A 2CYCA 2J85A 3K9LA 1H1LB 1HZZC 4KGZA 3UB3A 4AKSA 3IPYA 1U11A 1CR6A 5TQ0A 3S2EA 4ZOLA 3RK4A 1VECA 1VIYA 3UOWA 4DEXA 2TRSB 3GFQA 3C3PA 3PTAA 5IX8A 2ZSJA 3P2JA 1ADFA 2RHDA 3B48A 6YASA 3VRHA 4N5DA 3Q8MA 4L72A 3CKLA 3UM9A 3CSUA 4LE0A 5CBKA 4LHYA 4TM7A 4X20A 2XKAA 1K4MA 5ALSA 5AM1A 3RHFA 4BRSA 4MQEB 4E12A 4JI7B 4XWAA 2HNAA 1S3GA 1WZ2A 2WMOB 4CV1A 5A6SA 1PFVA 4ALMA 5AW4A 2HOQA 1U0OC 2VPPA 4YJFB 5G0WA 2AN9A 1U6JA 2JLRA 3NAGA 5C0OE 5LZ8A 5KU1A 2GN2A 3ZE7A 2FR0A 1II8A 2GN1A 3UJ3X 5EFZA 1EMDA 1ENZA 2OZKA 2QE7D 3RVSA 2GAJA 2OCBA 3GA0A 4I3GA 2V7BA 5K5EA 4QSMA 5JMPA 1Y7PA 4KWTA 1FK8A 2Z0MA 5J5VA 2ZIAA 1F6DA 3MLEA 1VE5A 4JL5A 2C2MA 1N2HA 4BLPA 4NU6A 3ZZTA 2CLMB 4MV0A 3A25A 2EGUA 3AB3A 1K98A 3QVOA 4WNAA 5BXYA 4UUAA 2BGUA 1G3RA 2QRMA 3QBVA 2GUGA 1ETUA 4TLCA 3ZHUA 2QTCA 2JGAA 3H8WA 1SVIA 6CHYA 1U65A 1ZN7A 4J8PA 2WNHA 2FEKA 1XRNA 4Q4CA 1N7IA 1W88A 4U1RA 2YRWA 3KVNA 1EJ6A 4BMZA 3PHGA 4BVEA 1M2EA 4CGYA 2QPLA 5IAAA 2CJWB 4I7EA 3B38A 2FLKA 2F62A 5KOYA 3ESBA 2NG1A 3TKYA 2IDKA 4ZEOA 4U3JB 4LXXA 1QRRA 2ZTHA 4UCFA 4AG3A 2VTDA 3FE2A 2EFGA 3CA8A 3A6LA 1ZCAA 4YASA 2BMFA 2FK7A 2YWCA 2WM3A 4HDKA 2R5NA 3NPMA 1CY8A 4RPLA 4W8HA 2OLJA 2AXNA 1Z5NA 3JRWA 2A8YA 3MXOA 1X42A 4HUJA 1I36A 3QPDA 2GKOA 3GQVA 4YGXB 3VH3A 5JS8A 1ISIA 2ADFA 3MRVA 2PJUA 3F9RA 3VR5A 2JEOA 3I83A 3E5HA 1T2EA 2ATCA 1MV8A 3NM6B 3WSVA 4AULA 3PNKA 4IIHA 2VWGA 3AG5A 3NNSA 4EPXA 5CW2A 3EF1A 5KTNA 5HTOA 2FG6C 4RQUA 4IO0A 2RHWA 4QECA 4D80A 3AF2A 3BB3A 2QWXA 4AKIA 1XD9A 4GMXA 1KK3A 4OGWA 2FUG1 1ZD3A 2A0WA 1XTBA 3L7JA 3ZQJA 2P77A 4O59O 3I6QA 1CY0A 2HK9A 2ZYRA 2B8EA 2WYIA 3KOZA 3O8QB 4M0LA 3IGFA 4W5TA 1NL3A 1GVNB 1PL0A 2FOXA 3EA4A 3RUDA 1Y4UA 1BROA 3G23A 4EA8A 3NT4A 2BPOA 3BXXA 2EX1A 3DGEC 1GUYA 4RQBA 4U7PB 3R6GA 2UYCA 3R9WA 4MGZR 1FYXA 4FC6A 1EX1A 5A9TA 4TV9F 4HY3A 1IN5A 3ED1A 4EUNA 2M1XA 2VUUA 1RW4A 2AI3A 3VAAA 1Z0AA 5FBHA 5BT9A 1XZFA 2HHJA 2ZWVA 2K6GA 4HQNA 4LNHA 4RVSA 4D8XA 5BWOA 1VYUA 1ECBA 5BVHB 2QLLA 4RFVA 3V1LA 4JMPA 3OEWA 2BUAA 3PGJA 4ZANA 5FUBA 4ZJYA 4UNSA 2A3NA 2JASA 4WUTA 3NRJA 1TE2A 3ZBUA 1FNBA 1XU7A 2WTNA 4UAUA 4IDOA 3L9XA 4DMRA 2A5FA 4Y9TA 1OH7A 1LRJA 1OQAA 4UXIA 1UJ6A 2Z9DA 2Z1NA 3PEFA 3S8MA 4DUYB 1H4QA 1C4OA 3B5EA 1SHUX 1DCMA 4BQQA 1S4QA 4CLEA 4EB0A 4WK6A 2QBYA 4ZAGA 2GVDC 1D5WA 3GLGA 1E3TA 3WQHA 4LRQA 1P5ZB 4BATA 4F3KA 1HDIA 2NZ8A 3HYLA 3QTTA 3G0BA 3VR6A 1G38A 4MW0A 1RQ2A 3UMCA 4XR9A 3THYA 1VLLA 2HU5A 3BIOA 4IYRA 4BBJA 1CDOA 3RJZA 4E94A 3D4NA 1C1HA 2GJ4A 5IM5A 1N8KA 1O5OA 2GI4A 3TKLA 1DG1G 1V5WA 1W19A 3NR2A 4Z1MA 3URMA 1CQJB 4S3MA 1A72A 3I9LA 3ZXYA 2QN1A 4E5NA 2HSDA 4JR1A 4U5QA 4IVPA 4IDPA 1H22A 3ASYA 3ENVA 3D6FA 3H97A 4LKOA 1K2VN 4YIKA 1M10A 4CN8A 2BFAA 4AXXA 3FSEA 4B9EA 5JWRA 2BTQB 4Z9BA 5AVJA 5CA0B 4BMSA 2J5RA 3FVRA 5I3CA 1RYMA 2WJHA 2PMDA 2DJIA 2D4HA 3FCYA 4BCDA 4KE6A 1V71A 2YN0A 1EBFA 1N2IA 3MTQA 3VYTB 4C1BA 5ITZA 3U09A 1PE0A 3VKHA 3LC7O 4H4DA 3L1JA 1WUTA 3T7DA 3IEKA 2WUWE 3D8RA 1K0UA 1R5BA 3DL4A 4JLKA 5D86A 2IU3A 4UJ3A 3R7AA 2H2IA 1E9RA 1AD2A 1SC3A 2R6FA 4WD3A 5U4QA 5I48A 1DGQA 3R5XA 4FP9A 4HH3C 2CXRA 3B1JA 3CW8X 1AJEA 3PT5A 2C8JA 3QU4A 1CUZA 4DLUA 1JAZA 4H31A 3DQQA 3DT8A 3K6SB 1N1GA 1SIBE 5CG1A 3ROEA 1R0LA 2PS0A 2XYQA 1G21A 4OJKA 2Q3DA 1XCJA 4DHWA 5A4DA 3QU9A 4WOPA 4HWRA 2BCJQ 3JASB 1W6UA 1U3TA 3ICVA 4MI9A 3GWGA 4TOIA 4D4GA 3CB2A 2ZUTA 5AVYA 4MB6A 2DLDA 3UC5A 1CJCA 1YCDA 4HTFA 1I94B 1BHJA 1T3TA 3MTGA 1FQWA 3QKTA 4RHUA 3U1TA 4UNRA 4Y7CA 4RKWA 1NJ5A 3QHAA 3CRNA 2DUJA 1GFSA 1I6MA 1PKEA 1U94A 4FUQA 4JLDA 5IAGA 2B83A 1R6AA 3G2IA 4QYIA 4ZQBA 1GPAA 1KEEB 1NMXA 1VGQA 4GOXA 4IFBA 1E66A 3TDNA 4LSGA 4PEVA 3AH8A 5T4BA 1IN7A 1FYFA 1KEUA 3E05A 4KUHA 2P3QA 3CX7A 4S24A 3NC1C 2HO5A 4L8VA 1C3OA 2ZCJA 4F4CA 4Q7LA 1NWHA 4BTLA 1MOZA 1IVSA 3M6WA 3OT4A 3P0FA 4ITVA 3AKZA 4JL6A 4MOWA 4NBUA 4ECEA 1ZSVA 1ZUHA 2XSZD 3G9TA 1RM0A 4RA6B 1ECCA 1YRYE 2QGZA 1UBKS 4F2DA 4FM9A 2D2XA 1XZBA 2ZYHA 2Z83A 3D6UA 1EQUA 3LO5A 1ZOOA 2Y27A 1H0KA 2IGTA 2X7JA 4P93A 4EVQA 5G1OA 4B7AA 4D9GA 2IYVA 3CLTD 3F0TA 4ZMRA 4CCSA 2CUTA 1LPMA 3E9NA 4K7JA 4KFTA 4MR9B 4YRTA 4CUJA 4DSAA 2WPDD 3ZOZA 5TQ0B 4GI3A 1G20E 4MAFA 2VRWA 1LDEA 4FEEA 1YUMA 2RGNC 4IJ6A 2R8EA 4B3FX 3KWFA 4FINA 2I9PA 4F4FA 5LMUB 2X5XA 2XDYA 4JI5B 1OXMA 2G70A 4ZI7F 2CBXA 2DFLA 2O2HA 1CIJA 2FPPA 3AU8A 3I0MA 4FLFA 3TQHA 1G5QA 3R8XA 2ZR8A 2IH2A 5BNIA 3V46A 2J3QA 1U3VA 5LNK6 2GAIA 4KQGA 1OIVA 2XBMA 4P58A 4XB6B 5G40A 3R4CA 3RUCA 3EW7A 1MG5A 3KFXA 2FSUA 2C07A 3Q3GE 5F33A 2LTAA 2AX3A 1EFKA 2BGLA 4FD3A 1JWBB 2NT3A 4O08A 3URKA 4AF6A 1PD0A 1NQOA 2Q6TA 3DCYA 3FAKA 3BFKA 4OHCA 4YACA 5EKSA 5BYKA 5J4YA 2DWUA 2R8RA 3FMFA 2O3TA 2A9QA 4ZOAA 3UAVA 1WBJB 4BAUA 5FWYA 5B7GA 1DRJA 1IFXA 3L46A 3RIHA 1LLCA 1PUXA 2FUG6 2WWRA 1E1QA 1GEEA 4DLZA 3BH0A 2A5JA 3EHDA 3CEJA 4AJ2A 1Z4NA 3OQBA 3WHKA 2J08A 5A05A 4PFQA 4GMHA 5J58A 2ZRIA 3BTVA 2BW0A 1S4MA 3B52X 4FPXA 3QGMA 4CF3A 3PDWA 3OKAA 1R6BX 1XZKA 3O38A 5F1OA 1A9RA 3HPRA 2EG5A 3LCMA 3C70A 3NOOA 3F7TA 1XGKA 4UMEA 2WU3A 1EK1A 3OQIB 1UZAA 3ZR4B 1ISSA 1V3TA 2PV0A 1IBKB 2AG0A 2IPNA 3IKJA 4DG9A 1AQYA 3GMTA 4ZYYA 5CH5A 1KORA 5CDTA 3HJGA 3F6EX 1JIVA 3QENA 2HGSA 2Y0BA 4FKBA 4PGMA 1T6BY 1ZR2A 2ZT7A 1G6KA 3NMUF 4TZ6A 4NECA 3BZBA 4FZ5A 2CNLA 2WWGA 4YECA 3VZBA 1YBAA 2ZTUA 2RGDA 2GEKA 2LNDA 4TT8A 1P81A 1NSFA 4JGBA 4JGIA 1WSWA 1V9LA 1CS4C 3NCTA 3FPFA 4B31A 3WGMA 2CJPA 2HUPA 2E18A 1WCIB 3EZLA 3H6KA 4HRAA 5AJHA 1ZD8A 3A6KA 1JBEA 1XU9A 1Y1TA 3AI7A 3T3IA 4BVAA 5J63A 1SGWA 3NKVA 3EXG1 4RLFA 2E6KA 1N9GA 1B8PA 5JZSA 1LTQA 4CR7A 1JQKA 5KC9A 4EDHA 1E5DA 4DTCA 2W6ID 3IALA 1RM3A 5K3FB 4UATA 4IV8A 3R7WB 4BHTA 3HU2A 3HV0A 4CMKA 3AHEA 3OCZA 4LVOA 5H82A 4TSFD 1X80A 3OCYA 4RYLA 1SRRA 3TIFA 4C4PA 3WNQA 4CZ2A 2QVZX 3C8MA 3GFSA 2J4DA 3OG9A 2YXNA 1Q1ZA 2JBWA 1Z5WA 3ZY3A 4B3IA 5KCMA 4AY3A 5HR5A 4DLWA 2FR1A 1GGJA 3B70A 4FNMA 1QLWA 5EJ4A 5A4FS 1D6JA 4KX5A 1XZ8A 1H5UA 2IJGX 4HEA6 4H4EA 4LCEA 1JFFB 4MVJG 4C7MA 4YP6A 5EUQB 3WE7A 1DHTA 2JBAA 5EZYB 4O3MA 3UG6A 1CFJA 4X85A 4YR9A 2BSXA 1G17A 4HK4A 1J25A 4RY0A 4TWZA 1OLSA 3ABIA 1SOUA 3BUSA 3MUFA 4Q1AA 1NI4B 2IGBA 4X24A 3T7RA 1UK7A 2A0KA 2FW0A 3CVUA 3C39A 5E7IA 1PLJA 3HFGA 5KS2A 3VAZA 2I6GA 2RGXA 1NKSA 1P62B 2MSNA 3WK5A 4B3CA 2Q4DA 1ESDA 2BMJA 3D59A 3FMVA 5FX2A 5DM70 1SXQA 2IYZA 1RMTA 5BYBA 1P7CA 3SKVA 4GLLA 3ZHQA 4BJHB 1A8IA 3KQWA 3JYOA 1F6BA 1UP4A 3CH4B 2QLFA 4LN1A 1KC1A 4GNKA 3AIOA 2WYUA 1L8QA 1YZQA 1L5OA 1H66A 2C1ZA 2IYXA 2O50A 4HB4A 4IOKA 2OT3B 3A6ZA 3TRJA 1WNFA 1Y3BE 2JHFA 4MV7A 1T1GA 3OU7A 4KPEC 2ZT5A 1YZYA 4E13A 4W9NC 4PTLA 4Z86A 1UBCA 3P45A 4D81A 5HRUA 5KINB 4JI2B 4YTEA 2PHZA 4AF7A 1YDEA 2B8WA 2E48A 3OWOA 4RCZA 4CEIA 1E6KA 2CB0A 2B98A 2VDLB 3DT9A 1PCXA 4JLMA 4JLNA 2ZBPA 3LOQA 2TMGA 2ZB4A 1H8EA 2M98A 3EGXA 1RLOA 3M5DA 4RS4A 4EMSA 2D54A 4YJFA 1HDXA 3CUTA 2WQZA 3LSYA 3PRHA 4WZ6A 4F6CA 4ANFA 1SU8A 1ZH4A 4LJSA 1OFVA 4L08A 4R8VA 4N3BA 2C94A 5FBLB 3T9DA 1NGSA 4R2XA 5D1NA 2REBA 4DPMA 4OXNA 5BW5A 2TMYA 2W2QA 4M8SA 2P9EA 3KVOA 3CEMA 4POOA 4UQLA 4MTCA 1QPGA 3AYXB 4CGZA 4FQ8A 1CJKC 3WMGA 2PSSA 1QIFA 1V37A 3Q11A 4OGKA 1XYVA 4F91B 4K81B 2PJDA 3RTGA 1J2RA 1GAWA 2VG8A 1T9HA 3M81A 5ER6A 4FIZA 1I7PA 1K86A 2G67A 1AN0A 4OI1A 4DHEA 1ZONA 3C3WA 4YDSA 1IHUA 4BLWA 1IXRC 3JAKB 4MS3A 2EKQA 5FOUA 1DKPA 1XV5A 2FPPB 1SKUA 5AI0A 1XZEA 4M22A 5L6LB 5KOJA 3EH2A 3KPJA 1TECE 4X8HA 1S8AA 3I34X 3BJMA 1IPEA 1CD5A 3V1NA 3IP3A 3IKLA 5AKJA 1TC2A 5IDYA 3UVEA 1P8AA 4LHEA 4E15A 1G5RA 1K08A 3BULA 3IOYA 1GADO 3L79A 2BR5A 2J9RA 4YRSA 2RGRA 2OB2A 1GO2A 5EPOA 2CLKB 2MWMA 2WJGA 3TRHA 1ZC3A 2YVUA 1Q19A 1T24A 2Z95A 3VNAA 2BZ1A 1SKAA 3C24A 3L6CA 1TZCA 1BCRA 3QVTA 3B1FA 4G3XA 1O96A 2NAFA 3OLVA 2QQGA 3AR7A 4A6DA 1A2BA 1G4UR 3EUAA 1XMJA 3JQ9A 2DFNA 2JFBA 3FWPA 3MB8A 3OJOA 1PR2A 5ICSA 4F4DA 3A3YA 4M6WB 1A4UA 5BQFA 1C3OB 1LV7A 4WNAB 3VNRA 5FJJA 2AYXA 1NVVR 1FJGB 2IHZA 1Q0SA 5KJEA 1HZZA 1YDGA 1U2PA 2JLYA 4XQ0A 4GYJA 3SC3A 1V0JA 2R6AA 4B6JA 4LY3A 3FPHA 1KO5A 4P4GA 3NUQA 4LJ5A 4FX2A 4LXYA 4MA5A 4OA5A 3AHGA 4IVRA 1Y98A 3M6FA 1G3UA 4I6EA 5BSMA 4IJWA 3A9UA 2I7CA 1PGQA 3C2QA 1IY9A 1NVFA 3DP9A 3IMKA 1JPVA 4YCLA 2PL3A 3LECA 1DTWA 2TMDA 4FYPA 5GQSA 1UXGA 4F06A 5HCNA 3BIJA 1B1AA 4U63A 5DASA 1G5FA 2ARKA 1R8XA 3K72B 3CKMA 3SX2A 4KO2S 3WLOA 3ZZUA 4OAOA 2H1LA 2WTXA 4IDEA 3TSCA 4C0BA 3EVAA 3IS3A 2QPOA 2IQ5A 3FIUA 4CTOA 5KJCA 2A4MA 1P9WA 2LXNA 3K6SA 3DFIA 3CONA 2LW7A 5CFOA 1FBNA 4TKMA 1DIHA 1EM8B 5L6MB 4Y67A 3CH5A 5SZIA 1POXA 1X7YB 4WLUA 2ENWA 3JZDA 4XGRA 3X2SA 4DF3A 2XB6A 5EIBC 1JWAB 4IILA 4ENQA 3DEZA 4YAFA 3VYSB 4EIWA 1XELA 1BXZA 1X6VA 1GZ3A 2D7CA 1NMEA 1EFVB 3KLMX 2FN9A 3UAGA 4AY2A 4XPZA 2QSUA 1W29A 1ELOA 2Y8EA 1BXRB 1L8OA 2GPYA 4HX9A 3RHSA 4C6HA 4M7OA 4I9GA 4OU5A 3QLUC 3D1JA 4PX2A 1EBBA 4MRMA 1O9BA 5GADl 4XOIA 3QVVA 2B1QA 3ESZA 2R8ZA 2E82A 4IZIA 2J48A 1F4PA 4JP2A 1E3WB 1RLUA 4ZVRA 5EMNA 1THMA 4D6XA 1RBMA 2VK8A 2C4HA 2X19A 3GT4A 2VHVA 4L1KA 4RZIA 4TWIA 5AJXA 5ADWA 3K9FC 2CXSA 2WE8A 4B80A 2GNPA 2VF5X 3ZLUA 5AK4A 4FOSA 2IIBA 4XVQA 1R7RA 1VCOA 2NUAA 2H18A 3P5SA 1E0JA 5ALMA 1OIWA 4UNPA 3V6MA 4RU1A 1T0BA 3I45A 1ULSA 1H8ED 5FQNA 4CCYB 4BV2A 1K7SN 3KJIA 2XBUA 3SXJA 4QE3A 5F98A 3JATB 1H2AS 3UMJA 3OQ6A 4ZYXA 1BE8A 1E3WA 1YVUA 1J21A 4W1RA 4IMPA 3AGQA 2YBEA 1Q1BA 3VPGA 5F12A 2BDUA 3IV9A 4LDPA 4ESOA 1YACA 2WAXA 2D0DA 3TRDA 2C8LA 4W9MC 3R2JA 1QCCA 1GLVA 3WS7A 4N9QA 2HJGA 1NI5A 2RCNA 4BX9A 3L84A 1RPAA 2BBTA 4Z7JA 1N6NA 4EPWA 1TU4A 2I22A 4OFWA 3ORSA 4DA8A 3NHPA 3F8TA 1P5FA 2ZS9A 4F5DA 4U2DA 4A0SA 1GG9A 2CNWD 4M0DA 4AQ7A 4ZREA 1M8KA 1RLJA 5JI3E 2GN9A 4LJYA 1M8PA 2PRZA 1GP2A 3EA0A 5DNCA 1QK5A 2Q7XA 2ZIZA 3G49A 4MIYA 3G59A 1DKRA 2QQEA 4C3ZA 1F2UA 1YS1X 3OIDA 4MV4A 3BG5A 5CGZA 3ZLBA 2PSHA 4R2WA 1TX4B 2AEFA 3FWZA 1Z5PA 2Q8PA 3SIWA 1DRUA 3Q5GA 3HYRA 1E6EA 5H3CA 4DDWA 3G9XA 2NO4A 3T0FA 2BE9A 1UZLA 5JAOA 3QPVA 4LEIA 1OU0A 3B2NA 4BDTA 1K7EB 5CB4B 4RM2A 1MBZA 1GR1A 4IIFA 3ROXA 2XTAA 4GMKA 3VHRA 4QUJA 2ZQ5A 2PUEA 1HDRA 2IHUA 1XALA 2XTJA 3I39X 3ESRA 3OZGA 1W6RA 5EWLA 5EHZA 2C9OA 5JUWA 1GL7A 2AB0A 1I9GA 2MDTA 2XJ4A 2Z5LA 2ZRFA 3A04A 3JVUA 3PX3A 1ORDA 1E9BA 1ZGAA 5BSFA 1JHRA 2GHQA 5I3ZA 2YWEA 3C15C 5G0VA 1P39A 2Z4SA 2O57A 3KKEA 1FY2A 3OP1A 3T9BA 3IH5A 3OZAA 2G9ZA 4QICA 5K2OA 1XNQB 3AR9A 4DQLA 1ODJA 3HGQA 4MYTA 3VOTA 5B37A 1G3IA 1U9IC 3WLMA 1SY7A 4IBOA 6PFKA 5E9QA 2DCUA 4E21A 3S70A 2GFQA 2XKJE 5T67A 3PVSA 1E1DA 3HCWA 3UG7A 1UJMA 3PIRA 3WZLA 2Y1KA 2C9ZA 1YDHA 2Q4TA 4PW0A 1Y0BA 3I3OA 2W2VA 3KWLA 2ORWA 4WCFC 3Q8WA 2AG1A 1GUFA 2EARA 3CC8A 2E9SA 3E8XA 4TL6A 3JVDA 3H1PA 1OXBB 2R6JA 3I2YX 3Q8LA 1YA8A 3RYIB 2WMNB 1K3UB 1OI2A 1RXYA 3GLHB 4M9XA 2W48A 5DLEA 3ZKAA 1M8JA 4E14A 4EKEA 1CRQA 4BWVA 4RACA 1G8JA 1JAIA 3CNQS 1ECJA 4GWKA 1IJEA 2PYZA 4YAGA 4NENA 5BV1A 1IYZA 4MAAA 4E6EA 2D1RA 4F84A 1F8YA 5IYZA 4WBNF 2FR8C 5DB4A 1CUSA 2GJAA 3V2IA 2P9JA 1KETA 1AV6A 1RRVA 4FU0A 4AKEA 5CFQA 2JFQA 2R0QC 3U80A 1UH5A 1SUAA 3AF5A 4YEDA 5ITSA 4KN8A 4A3SA 5BQ5A 3NTXA 2F17A 3MJVA 5BSVA 3WL5A 1S3SA 1DEOA 2QGNA 2VJMA 3TR5A 4HAVA 2CHEA 3N0WA 1GVHA 3IKMB 4ZALA 1BS9A 1RXSA 2J3HA 1R4NA 3L6BA 4CL3A 2VDRB 1RXWA 1GRCA 1R10A 4R9SA 4L6AA 4O0LA 5LD2B 3SU8A 4J9VA 4RDCA 3TVDA 2DE0X 1I2CA 1TQDA 4D6PA 1FFDA 4JX8A 3MC1A 4NJEA 2I7DA 4IV0A 5KVVA 2QT0A 3BMNB 3K8ZA 2IHNA 2YIMA 3EWSA 3MTEA 4XA8A 2IY8A 4C06A 5KWIA 4R9UC 2WU8A 1KDTA 3ZX5A 4RF5A 1X77A 1E6CA 2CE2X 1ZS9A 3GJSA 4TMFA 5AI8A 4AP9A 2JAOA 3I9MA 4RW0A 5CB8A 5FEUA 1A1VA 1S8FA 3I2JA 5T6BA 2PVPA 3OIYA 2YS6A 3V48A 4KOEC 2CMGA 5FRDA 3H2BA 5P8WA 2EYUA 5JAPA 4DV2B 5KNDD 1QHHA 4Q15A 1SXJA 5TGDA 2VBIA 4YP7A 4DLPA 1G2PA 1S2DA 4G23A 1UKEA 2VCHA 4V0MA 2YN2A 3LX5A 1X7XB 3NH9A 4QDTA 4G1EB 3R8FA 1AK9A 3ILHA 5FB3A 3WKEA 4BJ5A 1HOTA 4WBNA 4CEJA 4YDHB 3W3AD 4NWIA 3U3JA 4F8EA 2G80A 2ZE7A 3Q41A 3G17A 4NPHA 2R62A 2VQFB 2AOUA 3T3PB 2O8DA 1Z2DA 1UXIA 1AF4A 3Q7SA 1N5OX 1CNEA 2D1TA 2G40A 2JGFA 1N6PA 3OOYA 2ETXA 1WY5A 2X14A 3PCXA 4L5BA 4O2BF 5G3YA 3V8PA 2ZSAA 4BFVA 5JT1A 4JLVA 5CX1A 3T41A 3GLQA 3SDZA 3C5HA 3HCFA 4C01A 1DEHA 2YNMA 2LCQA 2YKGA 4AWAA 1QIEA 1NBWB 1UM9B 4AYXA 3WBKA 1JQAA 1RYYA 1U04A 5ES4B 4EBBA 5IN4A 4WBXC 5HW0A 3R5KA 4MR9A 4JUBA 1MEOA 2ZXEA 2CL5A 1DBIA 1J70A 4R8KA 2C78A 1RKBA 5B55A 3HHEA 2W6CX 2AK2A 4K8OA 3U5TA 4Q1EA 3QFSA 4UDNA 4TQ9A 5AK6A 3JAMA 2HIMA 2VYVD 4MIOA 2G3YA 3TX2A 4UM9B 3N0RA 1A96A 3L05A 2Q3JA 3IUSA 1TM4E 4OHXA 5KX5A 4P92A 3QI7A 5T41A 4IVNA 5L4LA 3B6KA 3JY6A 4EFDA 2Q62A 2WYWA 2X15A 4KO1S 4KCGA 4WADA 1KSGA 4EVRA 3JAWB 1KIMA 1QZZA 1V2GA 3QY9A 5AK5A 3GVPA 4DOMA 2OHXA 1I1NA 3F6SA 3O8NA 4OP2A 3QNWA 4TVBA 4PG6A 2IZ7A 2AC7A 3U3RA 1RWQA 2IZ0A 3TN7A 3SY8A 4B71A 1PWYE 1Y4DE 1EK0A 3RU3A 4JELA 3BFVA 4ZRMA 1E8MA 1XSEA 2PJRA 3ROFA 2E5WA 4IGKA 2E4YA 1X1CA 2OZLA 2BJHA 4P53A 4D41A 2VYVA 1BW9A 1V95A 3AV3A 4BVLA 4PZDA 4LF5B 1HFWA 2A9KA 2J0UA 3IP5A 1KYWA 5BR8B 3DD1A 4MUNA 2HLDA 4W4TA 3JYLA 5IJ9B 2AIRA 2QYSA 1W87A 4KQ1A 4WKCA 4EG1A 4DV4B 4JNKA 2PIAA 5TY0A 3E53A 1ACJA 2IIVA 4L2IB 1P9LA 3UT5B 1VYHA 5BURA 5JCXA 2JGKA 4R1TA 2Z9CA 3S0JA 4LBYA 1KZYC 1JAXA 1AKTA 1NULA 1OU4A 3JQRA 3IIEA 3LY5A 3PI6A 1T4DA 1XZIA 1OE0A 1ZUNB 2P6UA 3B82A 3NETA 1IATA 2OQVA 4CF5A 2FCAA 3H6HA 3U4MA 4RHCA 2H2HA 3N5CA 2RHRA 3ZTWA 1UM9A 1ZY2A 2IXFA 3GUHA 3L1VA 4CM3A 4DQDA 2R7LA 1WW8A 1MUUA 2QI9F 4UFNA 1A27A 3FMOB 4JI6B 3TLYA 3Q15C 1YQGA 3A58B 3PIDA 2OMKA 3DA8A 4X66B 5A4IS 4N1AA 3JCZA 2Z1MA 1WE2A 3L5KA 3TK1A 3TQTA 1QV9A 1VE6A 3F2VA 2PXHA 1NXTA 4HN9A 3E7PA 3Q6NA 1QLJA 1VGRA 1ZHOA 2YVAA 1P75A 3EE6A 4I14A 1XJ5A 3WLNA 1HDZA 1JF8A 2JEYA 3FUCA 4W5JA 4F5ZA 4Z4QA 2P4UA 4IQ8A 3A2LA 3TCXB 2F7SA 3DVRX 1Y8QA 3NEAA 4URHA 4R2JA 3JATA 1FMFA 4HNRA 4E33A 1IK6A 3RGWS 1FNNA 2O5CA 3AKDA 2R47A 5LVAA 3DOCA 2AOTA 2OAGA 4Y6OA 1VLHA 3PQ3A 4PGHA 2XT0A 5DE3A 1SK9A 1O9GA 2QN3A 3G0GA 2OBMA 3S68A 1J8FA 1IEQA 4KH1A 2ZS7A 4FI3C 5CXXA 2GPBA 1F8UA 1UMCA 1SA0B 1Z0FA 2QRPA 4X54A 4R8LA 2A2ZA 2IH4A 2OCIA 1NUHA 2HMAA 4YMLA 3WMRA 4JHXA 1QE0A 5JAUA 4OLBA 4N01A 4F9TA 3GELA 3KOMA 4L27A 3KKPA 4CL2A 3H6GA 1PGPA 4CEIB 1TIKA 1TM5E 3K7EA 1DXQA 3R20A 4OYHA 2FPKA 2ZIFA 2IOYA 4MO2A 2G17A 5ECGC 3C5EA 4FGWA 2BWJA 2OD9A 4QEDA 4UCWA 4YREA 2GMWA 4CMEC 5B4TA 2IBTA 4TXHA 1BDBA 1W96A 1MVNA 3DEIA 3O8CA 3L4BC 4QHTA 5LM3A 3QP9A 4URYR 3HH8A 3CISA 4P2GA 2VQ6A 3WLIA 2PT5A 4CKCA 4HLUC 3W3AH 2Z8XA 3AFGA 3PHHA 4E09A 1YQUA 2JKVA 5HIJA 4QPJC 5SZHB 2H08A 3BSFA 4F45A 5E4JA 4CXMA 4UHEA 4DQKA 4PZEA 1OB5A 4H2DA 3QVWA 4YQEA 4ARZB 2AN4A 4OXYA 5B7PA 3DO6A 4UVGA 1JKJB 2YV3A 2BGRA 4KW7A 3J81A 2Q1XA 5FUYA 4AWBA 1J8DA 4FHGA 3AUUA 5AQEA 1WR8A 3GGCA 3GJXC 1P2DA 1DWUA 1DUVG 3HDQA 4QPZA 4ZCSA 4M46A 3UO8B 4BLSA 1I4LD 4CODB 5HHTA 1ICEA 2H07A 1UK8A 4MWOA 1CUHA 4YRFA 4YUZA 3E5RA 4OJNA 4FFNA 2DBYA 2Z30A 2OHOA 4N4AA 3T9FA 3A4VA 2DPYA 3GCGA 4GC5A 1F38A 4BFSA 5LQNA 2CDRA 1JVBA 4JQYA 2ATVA 5HKKD 1F60A 2QTVB 3GRZA 3DZKA 5ILGA 4A82A 1PJSA 3WICA 4I2VA 4HNAB 1AC5A 4DANA 2W7TA 1QPBA 2J07A 1YZTA 3FKJA 4JR0A 4KFRA 3T1TA 5I9BA 3TW8B 3ZXUB 3BERA 5TRTA 1ZO8A 1U8TA 2KW5A 2ONZA 1XPJA 5J2UB 1X9IA 5G0UA 1T29A 1QIJA 1TM1E 2CSUA 5BWNA 5JD5A 5I8WA 2K7ZA 3CBQA 3LXRA 4IM7A 4BBPA 1JZTA 2YY6A 3FJOA 3PNBA 3O9MA 4FXOA 2CV1A 1DTEA 1R50A 2EW1A 4M1KA 4KQWA 4TV8F 2PRIA 1CDEA 2RHHA 4KZPA 3W6UA 1PK9A 5I5GA 2H54A 4NCIA 4HEJA 2RCYA 4KQMA 2AYZA 4S05A 4TRNA 4HJRA 3RJMA 3WISA 4PVDA 5FTMA 4Y0AA 3A2NA 3F1LA 3SC4A 4YX9A 2NO1A 4UARA 1KYVA 1PJ3A 4DC1A 2FRDC 4YN3A 4BB9A 3O84A 5C34B 4DARA 5HPYB 2FSFA 5F7JA 4JS0A 3FNGA 3KCQA 1JLRA 1ZVMA 2H9AA 1MPXA 2CD7A 4U0KA 4RK1A 5JZMA 2ZU6A 3LK6A 1OROA 1SVLA 4O8ZA 1QYDA 1VKJA 4BMDA 3K20A 4M2LA 2AJDA 2HZ7A 3HRIA 4MI3A 5AJYA 1QF9A 4G24A 4RLHA 3SSAA 2HB6A 3V32A 1Y8ZA 3DV0A 3ZNOA 4M53A 3L8YA 2IYUA 3OLXA 4R71A 2Z04A 1DJQA 3PQ2A 5DNWA 3EZ9A 3E18A 1JXQA 3COZA 1GXSA 4EA6A 2Q5FA 2VPWA 3FRHA 1U2RA 4US0R 3GIDA 1KDZA 2QVBA 2IPAB 2VUSA 3F5SA 1TUGA 4BMOB 4MPRA 1BSVA 3R9XB 2NT4A 1QQ5A 2GSWA 4J90A 3NYWA 2GJ8A 4YJHA 1RFLA 3EEIA 4MQEA 5KAPA 3BB1A 5DNUA 1L4EA 1V41E 4URUR 2PMFA 5CLLA 1DX4A 1L1RA 5M3BA 1XHEA 4UTZA 4J0FA 4MVJI 4YY3B 4Y2YA 2GF0A 5IJZA 4CG2A 4RZUA 4PQEA 4TUYA 4X1OA 5FDFA 5ALNA 2GK4A 4N39A 4B75A 3F7NA 2JLVA 2FMTA 3FNRA 1K8YB 4N54A 4C08A 1THTA 3QE4A 4AO6A 3C5VA 1FDUA 1HWYA 3PPVA 4M38A 1RD4A 2IIPA 3C7AA 5JH7A 2AXQA 4A27A 2NN3C 4AW9A 1V3UA 4CIVA 3MHTA 2DXIA 1JHZA 1N6HA 2R7MA 4RTNA 4YMTA 3DCNA 3LPAA 5IJWA 3JQCA 4OK6A 2EJCA 3CVJA 4G5GA 4AIIA 4AY6A 2XVAA 5HFJA 2OAQ1 2ZYTX 3K8OE 4IOMA 4L8GA 2XQFA 4QGGA 2GEFA 1ZNZA 5DBOA 4IIJF 2WILA 5E8RA 4AJLA 4W5QA 1CW2B 5E95A 3PSHA 1IQ0A 1GTJ1 2QUHA 4MUYA 4ITRC 3S5UA 2ZJ2A 2W58A 4MAMA 1T4CB 4L50A 3AM4A 1QYWA 3F1KA 1QANA 2J33A 2Z1DA 3ANLA 5HFAA 2JIBA 3N7UA 1JFLA 2DUNA 2EJWA 2P8SA 4B48A 1GA6A 1O87A 2CL6X 1DC3A 3A1DA 1A9XB 3IVCA 4UMDA 3GRRA 3WY9A 4EENA 1GZ5A 2HSZA 1MAAA 4WIAA 2DF8A 2X5KO 4PR3A 6REQB 2F1KA 1ISHA 1SUCA 4N5IX 2WEKA 3IQHX 3JD3A 2FQYA 3MOIA 3OC6A 3PHIA 4QAJA 5HJ2A 4C78A 3MD0A 3WOHA 3UOAB 1M0EA 1HT0A 3UMRA 4N0DA 2BTEA 1CQWA 2NZJA 3DFZA 3NBXX 1L5HB 2XNCA 4F2HA 1VHJA 3IDAA 3LG2A 1LUAA 4IUBS 2PX3A 1NVWQ 2FN4A 3UJPA 5I9LA 3R7DA 1R8JA 1U3DA 2JIMA 2FDRA 1VG8A 1BWSA 2H7XA 4FMBB 3B2QA 4E4TA 4EHDA 2ZI5A 2QG4A 4FN4A 4MKHA 1V5IA 4QXAA 4A6PA 1CYDA 1P9RA 2QTLA 2WIBA 3LP5A 3Q7QA 1IXSB 3GJZA 4GLJA 4HDMB 1OASA 4ZVPA 2GDZA 2R2GA 4HCJA 4ENTA 4RVNA 1LW7A 2CJFA 3A1WA 3N8IA 3C1OA 2ZU0C 4B3HA 2YYZA 4BO8A 5HKAA 4EPRA 3L1UA 3W5UA 1CF2O 221PA 4OATA 1N0UA 1BS1A 2C2ZA 4CLOB 3GVHA 5THQA 4P98A 2XQIA 2IWRA 2XY4A 3BXZA 5CEEA 1ITZA 1UWCA 3RVLA 2H57A 4WEQA 5HK8A 1G8KA 2H63A 2JIPA 3PNLA 1JJBA 4C6SA 1K89A 3IJPA 3T5TA 3CGWA 2F9FA 3V1TC 3TH5A 4CQMD 1REQA 2G9QA 4MVJE 3F78A 1THGA 4HB0A 1JA1A 3RSLA 2XZLA 3W8RA 3OJCA 5JXWA 1KMMA 3RKUA 2VF8A 3ZCSA 2X4IA 2QW0X 3FNEA 3PIIA 4JQSA 2X0RA 4O2BA 4RH1A 5KOJB 1RKVA 3PNQA 4EVIA 1IG0A 1IOVA 2EDAA 2XQKA 3K16A 3U7EB 1PV1A 4A8HA 1BHQ1 4B5LA 4KPYA 4UXHA 1PWZA 3TW8A 4AZ3B 2P9TA 3GLFB 1JJVA 2H29A 2QTFA 1TJPB 3VR2A 3A3PA 4QNRA 3RT9A 2VHYA 3ETJA 1PDOA 3SBDA 3U4HA 3MOSA 3KJNA 4NG5A 4BPBA 3FRJA 3FYDA 3COVA 3KQNA 3KVYA 4YBRA 3S28A 1UJ5A 2HU8A 1JILA 3B7PA 3G5UA 4C2BA 4DPLA 3UGQA 5G1NA 1O94C 1U2QA 1Z3CA 2C4WA 1ZN9A 2CVHA 5BSKA 5E3HA 1ZXXA 3D3WB 4F5WA 3CS3A 2B4KA 4Q9NA 3RRYA 3NTRA 2WYHA 3N76A 3DAFA 3UANA 4AZVA 5B6PA 4N0EA 5CHYA 5AESA 3L77A 5CLQA 4CCWA 4Q4DA 1O95C 1W2GA 2F4NA 1MN6A 1T6XA 2D1QA 2C3PA 2O0JA 1OWOA 1TFRA 2H4WA 3KEMA 3NDIA 1C7JA 1SVSA 2G1UA 3D5EA 1QO0D 4OO3A 2J4FA 2ZYDA 4Y30A 3ADDA 4ZODA 3KT3A 2JCBA 3QVLA 3UMSA 3VNQA 4KMRA 3LD9A 4LF9B 3GZJA 3JQFA 4C9BA 5BW4A 1Z0KA 4JLSA 3EGDA 2FEPA 5HJEA 4ATNA 1P4RA 4V38A 4LC1A 4RJ2A 4IAOA 2GCOB 4H0NA 3K6KA 3WXBA 3TXXA 2EGGA 3AIKA 1YDFA 5KCZA 4DMCA 1TEHA 1Z6QA 1QGUB 2LCFA 2PJZA 2I80A 1WZCA 1X15A 1GRRA 2XMSA 1KI7A 1YB7A 5HNKA 2EWVA 2X6RA 3LPDA 3LYHA 4I9NA 2TECE 1LB1B 5ECWA 5EIOA 3VH2A 4DY6A 1I7DA 3PX7A 1JEOA 3QOFA 4LS3A 1E5LA 3NVMB 1NE7A 3QH4A 4X7RA 2G7MC 4S0ZA 1X7ZB 4FYWA 1J9GA 1U2TA 3ZJVA 3DZHA 2F1JA 4P33A 2OL4A 1PQYA 2ZVDA 5DYGA 4O8CA 4NKRA 3TPZA 2IBMA 4BO0A 1YTUA 3N58A 3K5PA 3F9IA 4JITA 5GOZA 1RPJA 4HJXA 1FP2A 1PJ4A 1NP7A 2JBAB 1NKTA 3H4VA 1NQXA 1CBUA 2PQMA 4B3GA 4TSFA 2H6EA 3L0PA 2YOGA 4LRTB 4DTIA 2WWWA 2EX4A 3CKYA 1AGRA 2D6FA 4ZOLF 3C98A 4RDXA 2NVBA 2XF2A 4NARA 1FDRA 2YNMD 4CHGA 3HY3A 4EAQA 2V7EA 2B37A 2VK4A 3E7XA 5EIBD 4GRIA 4HDCA 1IY8A 4DLTA 4ENUA 5CBPB 1I4EB 4M89A 4M8IA 4AI6A 4NOKA 4ADSG 1SOMA 4MKGA 3UF0A 4EHFA 5HK9A 1JQBA 1ULAA 2UYGA 2WLTA 4KQ9A 4PCUA 4EG4A 4XB2A 1XXHB 3RUAA 1LI7A 3W9SA 2PBRA 1KO8A 2ZJBA 1WVIA 1A0OA 3L9WA 2C9CA 4HATA 4NHOA 5AM2A 1V9CA 2UUOA 2HTFA 4CLXA 1NXVA 1H3NA 3IUBA 4EEXA 3DHWC 3WL6A 3HXKA 4D9HA 2NW6A 1HQYE 4MVWA 4QBIA 4CG0A 4X0EA 1LD3A 1B74A 3I6YA 3SS8A 4XPIA 3STTA 6ABPA 1JXAA 3G5MA 4RK6A 4BDSA 3IUEA 4GIBA 4YQZA 1WCWA 3T1QA 1JI0A 4MPPA 3ZV6A 4CV2A 1DO2A 2YZKA 3SYTA 4K28A 4XB1A 2FPGA 2D0PB 2R6HA 2EXXA 1KJ8A 4G89A 3ZHVA 4Q4HB 2OC9A 4IHJB 4ID9A 5JDCC 5T4FA 3ILYA 2PZKA 4BGUA 1AY0A 2A9PA 3IILA 3S1SA 2AMJA 4FHCA 3OETA 2HXYA 2F1HA 3LC1O 3OHMA 4D6YA 3RVNA 3ICEA 3FFTA 3HE3A 4RPIA 1TKAA 2VRCA 2ZB8A 4DIOA 3R41A 3RV4A 1MDBA 2XIQA 4KDFA 4URFA 4P22A 4C0XA 1XTRA 5A02A 1SUEA 4JUIA 1Z15A 4QJBA 1CRZA 1N3YA 1TAGA 3B7GA 3AP2A 3SSOA 1MJFA 1FFBA 2OBLA 1N2CA 3E1KA 5CXSA 3DE7X 3QXXA 3AEQA 5JALA 3IR6A 1CZOA 3KPYA 3H5RA 2E21A 2ZE8A 1RU3A 3EDCA 2F8MA 1US8A 2UYYA 1H4SA 1SPBS 3OE7D 5BUQA 1W76A 2PKQO 1K6JA 2QL5A 2WM8A 1HDCA 2K87A 1ULTA 3AERB 3K0EA 2EFDB 1E2DA 1CIVA 1HQCA 2QNRA 2QX8A 2W8BA 2WV9A 3D8NA 1IMOA 1SCAA 3OVMA 4MO9A 1GCGA 4NU5A 5CDUA 3THWB 3RS8A 3O4FA 3O92A 3RRXA 3WIDA 5HDBB 3QSYA 1ZINA 1ENOA 3FYSA 5DTQA 2CK3A 3VM6A 5JAMA 4QDKA 1PRYA 1XCPA 1GL3A 3X2EA 1AGYA 1ZL0A 3H7IA 4WDRA 1ID1A 2AUTA 1WUKS 2ETVA 2GFHA 4AZ0B 1X86B 2QY9A 3QXCA 4CV0A 1J9EA 5H8WA 4Z4IA 1EX7A 3KKMA 1P1FA 1O03A 3AQIA 3FG9A 2C2BA 4KXYA 3O91A 4XI9A 4EFLA 2CHQA 1KI2A 3COSA 5CUQA 1JU4A 5TT0A 2Q3LA 2SKDA 1NE2A 3ND9A 3ON5A 3OJFA 3JD2A 1YI0A 2I29A 4FOOA 2FVYA 2ZOSA 4REOA 1AH2A 2HCTA 1BOFA 2HREA 1W36B 1N6KA 1SELA 1QTQA 3QTBA 3FR7A 1UWVA 3INGA 4CM8A 2MYNA 4V03A 1N2EA 3DKPA 1N9KA 1AKQA 2VT6A 1Q0PA 1FMLA 2MINB 4NFLA 4RKFA 5LR6A 1VJCA 2WSSD 1W85A 1F06A 1J9ZA 3DUFA 4XVHA 5B7QA 5EESA 5CVJA 3OY2A 1AB6A 3DP7A 3FFAA 4J76A 1UBRS 1WZNA 3P9SA 5FD8A 2PUGA 4GOND 1U0RA 5ALOA 1T0UA 1Q77A 1RQGA 1XZJA 5J2UF 2VSOA 2XXJA 4GWGA 2YIDA 3J80A 1VIVA 1DBRA 2ACVA 2Q3EA 5CPBA 5J4HA 2W2MA 4DCVA 2CNOA 3IP6A 5G1PA 1J39A 4WKGA 4MRNA 5F7ZA 4D8TA 4P3NA 4TSRA 1FEZA 3CEHA 1O94A 5AI6A 1J8YF 3I1FA 3I6MA 1AKMA 3MSXA 4MYSA 4ZZ2A 4D8VA 4NCAA 1WOMA 3PE6A 3PT9A 3E9DA 3KTFA 4PNHA 3RVOA 1NXQA 1TM3E 3JQ7B 5JSZB 1DBQA 3ZHCA 3A4MA 2HYIC 2WW8A 4DV5B 2HJSA 3BA6A 4V0LA 5LWQA 2HIHA 2OHGA 4JYCA 5GIOE 4UAJA 4O63O 5DU2A 5P21A 1XEXA 3H42B 4HTFB 2YYAA 1N5RA 5AH0A 4GF5A 2P6PA 3KXIA 3VKGA 2JRLA 3TAHA 4KRFA 1KBQA 2EKDA 3FKQA 1X1RA 2ENUA 4B17A 5F1PA 5J2TA 4CMCA 1KPHA 3BMOB 3WFIA 2O2JA 1CRLA 2YFKA 3WK7A 4JP8A 1J09A 4YXWD 4OUDB 4M36A 1USVA 3PITA 3RS9A 4BLOA 2IBSA 2A9FA 2XYVA 1JHYA 4GSYA 1P7PA 1DAGA 3A14A 4MUBA 3KT6A 4BUZA 3ZHTA 4J91A 3E5NA 3OKPA 3PYXA 1QWOA 1B0PA 1FTYA 2WJIA 3E3OA 1TJ5A 5IKPA 4OMCA 3HB0A 1FP4A 4KFSA 3EPPA 5HDQA 4P3KA 1C9NA 3BXHA 4I8IA 1OKKA 1E6MA 2FMFA 3QVGB 4XWWA 3RAGA 3MS7A 3JQQA 1R8SA 1V1MB 4Q7JB 4CQNA 1EB9A 1NW6A 1KJIA 3QNUA 4KNYA 1T3SA 1ZGZA 4JOQA 3QIVA 3GPCA 2QTHA 1I3NA 1U3GA 2R44A 2A84A 1I24A 2FW8A 2OHJA 3A1VA 1PFGA 4RCYA 4NIMA 1XHFA 1OYWA 1U0GA 2E85A 2G7ZA 3W6OA 4EAAA 2PX8A 1NA5A 2BF7A 2Z6VA 4U6NA 4BMYA 1TIBA 4ILEA 1ORHA 1XNGA 4BWFB 4KR2A 1FFGA 3BGVA 2QZPA 2HWKA 3P2MA 2RK6A 5CVCA 3WWOA 1DQPA 3Q0TA 2SCUB 3FTCA 4M1OA 3VV3A 2CY0A 2D8MA 4DABA 1HX7A 4HG2A 1NHGA 1E2MA 2H00A 2Q4OA 1MAUA 2R6GA 4XIYA 4UU1A 5KKCA 3L1HA 2CWDA 5F4BA 1MEEA 1OWMA 2OMEA 2X23A 2QS9A 4HRYA 1Q17A 3MW8A 4G5OA 1OAAA 5E0KB 3U6KA 1RJEA 2NWQA 3U4QA 3PJFA 1C0LA 1MO3A 3OX3A 2P90A 3FPBA 2FLVA 4RHYA 2Y2UA 3T3DA 2D74A 3SFTA 5FPQA 1NV9A 2H92A 1N5JA 5AW9A 2FZKA 1SD5A 3PHCA 4MCAA 3WGTA 5DKFA 3SP1A 4O4IF 3R5FA 1ND6A 4XM1A 5A3JA 5CG2A 3H1TA 1EQ2A 4FE4A 1X94A 4MP3A 1E60A 2MHCA 3IXMA 1SUFA 4NABA 1NRIA 4PHGA 1YVPA 3D54D 2Y2VA 3KYCA 3Q2IA 2P1RA 2BH2A 1EPUA 3JQ7A 1Z4IA 4OEHA 4UEOA 4WK0B 1V8DA 5D3MA 4Z8YA 3V4VB 3WV5A 1K7CA 1A97A 4IDFA 3L1KA 3CZRA 1E3DA 3GW8A 3GLIB 1TAQA 1LA2A 4LJLA 4GZ6A 3VO8A 4HAIA 1M75A 2WF9A 5HG0A 3GCWA 5AHRA 2GPJA 1UPCA 3NT5A 2HWXA 4TUYB 1FXWA 2PZGA 4BZQA 2NZXA 4ER7A 3CPEA 1IHYA 3C14C 4JXKA 2XA2A 1RYZA 2FMXA 4K6MA 2DFDA 5JI2E 1JDSA 2EKPA 3F6BX 3JQ8B 4CLRA 4ASUA 3GLGE 4EYOA 3CLRC 3U26A 1UBUS 1ZOLA 5I7RA 1OB2A 2CLFB 4NE9A 1MENA 1GNQA 2FEWB 2HMWA 2GR9A 5FTJA 3BMNA 4ZQIA 5CT9A 3VZSA 1TT5A 2JCGA 3VJMA 3DDOA 2R11A 3R75A 1VSQA 1F1BA 4TV8B 3G0DA 3GEMA 2OCLA 3WGIA 4BU0A 2GBIA 2EYQA 4FS8A 4ZOLB 2NU9A 4Q24A 3ZV7A 2XYPA 4P7BA 2POCA 3L8GA 3E7DA 1PW7A 2QIPA 3QLUA 4HDAA 5HIMA 3LTNC 3TLEA 4MQ4A 5JSHA 3I61A 4PZAA 4R98A 3L18A 1PU2A 4YNBA 4OKIA 2HJRA 3K8QA 4DL9A 10MHA 1JB1A 3NHWA 3ZCTA 4YMHA 4UBNA 3T3OA 3NHUA 3EGDB 2QVYX 5HILA 3WJ1A 4PLYA 2PXAA 4JR2A 5ALQA 2B25A 1MW8X 2R8YA 1Y9JA 4RNCA 3UHFA 1IZ0A 1XTQA 2GEJA 5SYMA 4GVPA 3R3XA 3NORA 4CI9A 2R86A 5L4NA 1UAAA 1NQ5A 2XUJA 1GTRA 1F0PA 2G1JA 1H0RA 3N87A 4TS1A 3TINA 4D4JA 5KPDA 1WEHA 5KNCH 1T6YA 2Y4NA 1YFJA 3IODA 4QQKA 3M49A 1ZD2P 1LPOA 3I8SA 2C82A 2QU7A 3NAMA 4QA9A 4Q1CA 5EXSA 4LF8B 1WAMA 5G4KA 5H80A 4N7RA 3FI9A 3KKNA 5HOQA 3D8TA 2Q8QA 3AEKA 3SSNA 3BMCA 2LVBA 4WZAE 4LY6A 5DHSA 2ZXFA 4U2EA 1UXKA 1G5HA 1J4AA 3OQVA 3INNA 1E94E 4Z3KA 3F4LA 5EIXA 1XKTA 5B2EA 4UTNA 3LBYA 1T36A 2R87A 1NQAO 2Z5VA 3BMQA 3MWEB 4QYWA 2BFOA 3B1KA 4N48A 4WN3A 4ZQCB 3ZCRA 1AK2A 1G64A 5F3DA 4HWGA 4C0HA 2O07A 2O6LA 3C3AA 1YCFA 1YJQA 3M3HA 2BGIA 4J4HA 5DYNA 4O6VA 3KT0A 2AFIB 4DT1A 2SNIE 2BSQA 2OM2A 5E6SA 3SX4A 4R01A 2FX2A 1OREA 1M8FA 2XDAA 1AK1A 2MMCA 2O2SA 3BXEA 3TS1A 4JI3B 2FE4A 2WAOA 2O3QA 3T15A 3OCVA 5FTLA 4TL7A 1T4MA 3SZ3A 2WC1A 4XH9B 1L9KA 2I54A 5K01A 3PNMA 2QYHA 3I5MA 3MHPA 3LUGA 4YP1A 1PUJA 2CXTA 3PFWO 1JFSA 2FY8A 1GUBA 1NUQA 5FORA 1CZLA 5BQ3A 2ZUUA 3C7KA 1JYFA 2W70A 1VXOA 5I01A 2OLEA 1QS0A 5DGDA 4C04A 3ISVA 4WI1A 3TLAA 3P5BA 2XEXA 1YT5A 1XQWA 4Z9FA 1B43A 3NBUA 5D7NA 2RH9B 4M76B 4O2RA 3VBCA 3RDPA 1PJTA 4J1TA 4PWZA 2ZULA 3AP3A 4C6TA 4ZV4A 2JCVA 4Z53A 3EH1A 3K1AB 1NN1A 2CMKA 4TTPA 1P2TA 2C54A 2MTBA 2PS9A 5TEVA 2F43B 3B1ZA 5JEEA 1IZ8A 1TTPB 3CEAA 3EWIA 1QGZA 2GHIA 3I64A 1JQEA 3NOVA 4DIEA 3EPJA 1XEAA 3C41J 5JH7B 2WG2A 1AKVA 4IOLA 4NF2A 1DEKA 2PWBA 3RYHB 3SVZA 5M04A 1EUYA 1Y37A 2E49A 2XGOA 3GL9A 4I2NA 4C5AA 4E22A 3IQDB 4Z9AA 1WMBA 4NRDA 2X7HA 4GBGA 3GJQA 3IAEA 2ZTSA 4IQ0A 2KE5A 1WKBA 4KEAA 2VYNA 4X6UA 4GWLA 3WYAA 1W5AA 3G13A 4YV1A 1GLNA 1IPHA 1ODTC 4PG7A 4A6XA 2Y66A 2ZJ5A 3PP8A 4Q3AA 3TD6A 5KHAA 1SB9A 1SA0A 3OQHA 5L3VA 4YR7A 2HSEA 3G8DA 2FPSA 3KEOA 4GKBA 3UCXA 5IABA 3SBEA 2QUJA 3L7NA 2QY6A 4EHIA 3RANA 5LQJA 1E2LA 3B60A 4QYSA 3KSAC 2BHLA 5K6RA 4PS1A 2AJBA 1B16A 1TK3A 3LZ6A 1B6GA 4UC0A 4COKA 1NRXA 4B4OA 1JR6A 1U2DC 2HU7A 2QUZA 3DFKA 3TTUA 4CIDA 1ZISA 1LK0A 3DDSA 4KWIA 1E77A 3EIHA 3MTJA 3NHSA 3QJYA 3T1OA 3ND5A 2BIFA 3UJCA 4HNUA 3VTZA 4Q3BA 3DEYX 1GUAA 4Q4JA 4GPAA 1LJ8A 1GDDA 3DOJA 3TTXA 4BVGA 4QX6A 3R3JA 1QGED 2WU1A 4N9WA 1I4DD 3BSWA 3TUZC 1VM6A 1PZGA 1Y42X 1Z0JA 3DDWA 3F47A 5CB4F 2A4KA 1UMDB 4Y18A 3QIAA 1H2RS 3MMSA 2A5GA 1P2SA 5KNCD 2ASVA 2NLOA 1QGDA 2JGLA 1IL0A 3BWBA 5JFGA 3FF1A 2A30A 2XCIA 4ND8B 1FVFA 5EUBA 4NMHA 1J06A 3TR0A 2DTEA 2C3UA 4AO7A 1L5QA 5FPHA 2BFDB 3PJRA 3FSGA 2YS7A 3P97A 3V8MA 4ED9A 4FMCF 4TWBA 5D84A 2PMEA 4C4AA 2C5SA 4F7WA 3B9BA 1MABA 1XOIA 3T4UA 4EO9A 3THWA 2OECA 2HA6A 2B6HA 1DADA 5E9JA 1QP8A 1FP6A 1OFTA 4DDMA 1JMVA 3AZPA 2NTYC 2XUIA 5C5EA 2PL5A 3HRKA 4B7ZA 3GRPA 1VQ1A 1MT0A 1XUOA 3JQBA 3I9NA 1BQEA 1V35A 2SCUA 3FKSA 3FF4A 2AFHA 4UMFA 2QX6A 3VJKA 3WGZA 1A82A 1EFPB 3ANNA 3IEXA 1UFKA 3KIPA 3CZ9A 2HK7A 1E98A 1SD1A 4NOLA 3R4VA 1KEEA 3N6XA 1J22A 2IQIA 5A0TA 4HQFA 3D0QA 4ZI5A 1DWOA 4B79A 3TNJA 1HH4A 3EA5A 2Z2IA 4LOHA 2Q07A 1VBFA 1I3OA 3PGVA 1JQ5A 2BHRA 4GLFA 4OI2A 3KCNA 7REQB 4UFOA 3M5WA 5A5GA 4GZMA 1XO1A 4DC9A 1MC8A 3MJCA 1U3UA 4G0YA 4G8BA 3Q7IA 4BNFA 3ET5A 3I6IA 1QR2A 3EG5A 1GG5A 1KFKB 1DKLA 1R0XA 3CLVA 4RK7A 3NDBB 1VA4A 2H7VA 4E1BA 4HZUA 2BEUB 3S2ZA 1Z0SA 3D8UA 2HSWA 4WH0A 1USUA 3U0BA 3ZYZA 1N75A 4BE7B 1FXWF 4KXLA 5BUCA 4LXIA 1NFFA 1JR4A 3N0VA 2AMVA 4EJMA 1HE3A 2C4TA 2FSSA 1E6LA 5CLFA 2JHAA 3DTVD 4ZVVA 1QVWA 4LZAA 2YRXA 3D9QX 4Y1FA 3IBTA 3QVMA 2VDWB 1T0IA 2DH6A 2DM6A 4DNOA 1S7GA 5AIAA 4S2UA 1JJIA 4ZQHA 3AZQA 1M0WA 1DWPA 3CX3A 1CE8A 4W1QA 1GAXA 1WXHA 3SYKA 1T1IA 5EHNA 16PKA 4IY1A 4NONA 1RACA 5KNBH 5L3SA 3EMKA 1XCBA 4K9QA 1ENPA 3I9V6 5CH8A 2PFKA 2NYVA 3SYLA 1M83A 2GVZC 4ZEVA 3CR8A 5BMOA 4UDXX 1USKA 4D2IA 3X43A 1NBIA 1X8XA 2ZR7A 2JJ8A 5JY1A 2WTUA 2G6BA 2FAXA 1TT5B 4G97A 1YIOA 1E1YA 2QENA 5HGXA 5K0SA 3QFFA 2QVGA 4HWTA 2BKEA 2ILTA 4P4UA 3IVAA 4PINA 5DRTA 1KMNA 4GECA 2V45A 4OHMA 3JWGA 3GLIE 3PXAA 3BFXA 5E1DA 1P33A 4NCBA 5JSQA 3KZCA 2NMVA 3D5QA 1PWXA 2HM7A 4MWEA 5FWYB 1LZKA 1EBUA 3QITA 3STHA 4FR0A 2V9ZA 2I9KA 3D7KA 3SG0A 4OVKA 4DW8A 2AJLI 1PHRA 2QN2A 4B6SA 5EJMA 2BL4A 4NJEB 3TCKA 4K3VA 4QUAA 3UJDA 2JJ1A 1JMKC 4QKQA 1KRXA 2WUEA 5IANA 1FTQA 4QYTA 3ZVRA 3TSZA 4BLUA 1KC3A 3GF4A 3SQOA 4YCJA 3WNZA 5KTMA 3LQQA 3UA4A 3ZHRA 1YZFA 2BBSA 3SJBA 4IGEA 1X9HA 3AR5A 4J2OA 4PYRA 2OHIA 2AG5A 2QRGA 4RO0A 3T12A 2F43A 3SM3A 3I3SR 2QP3A 4NLLA 1BMFD 2LCIA 2VP6A 4A36A 1P19A 1N8NA 3ZJTA 2P5UA 1NBHA 3RHZA 3DOOA 3TPFA 3HS3A 3HUEA 1EP1B 1G9TA 1JSXA 3GD5A 4YAUA 3CGGA 3GOQA 4GDFA 2CV2A 5ELMA 3INRA 3FHJA 1FTWA 1IVNA 1R0ZA 2B1IA 2IKSA 4IIJB 4X3PA 7YASA 4DDHA 4DSUA 5AKLA 2C83A 2I6UA 3OA0A 2Y77A 1F4LA 1Z22A 1WDKA 5CEJA 3K15A 4DJTA 1RMQA 2ISSD 3I23A 4DJDC 4ENPA 2WJZB 1BWPA 3OFJA 4RHXA 5FOTA 3VISA 1MJNA 1NRJB 3AL3A 3F5QA 3GT0A 4I4NA 1PP4A 4DXHA 2FSGA 2W2KA 3ODPA 2GZ1A 4YCMA 1L4FA 2ATIA 3RF6A 4C4TA 4O4IA 4XWGA 5AVXA 2JI9A 4LXGA 1DKOA 721PA 1T3GA 2LIPA 1TEZA 3RYCA 3LLMA 1KAQA 1JSLA 1T5HX 1UJCA 1XCOA 4M0PA 5DTIA 1D8TA 1YSCA 3RSZA 3SBOA 4DT1B 5E2AA 2N0SA 2GCEA 2GWHA 3K2QA 4HVAA 3W2EA 5ILOA 4BWGA 3BDAA 5JCOC 2OR3A 5HKOA 4P5PA 1I0LA 3VTKA 2X58A 2V6FA 2QLNA 4FZJA 5FPYA 5JDIA 1KRWA 4NU0A 1G18A 4DZRA 4TVSA 3TQCA 1Y9AA 3U9TA 1NQTA 3CRRA 2PU5A 1VPEA 1R6TA 4JOBA 1SH7A 2QM8A 3FYUC 3ACBA 4DAEA 2I6FA 2GK6A 3KV3O 4RZQA 1B42A 2FEMA 2HL6A 3CVWA 4OQPA 1T5TA 3KXDA 4L07A 1ZEJA 2BMDA 2H17A 4QBHA 4WLVA 3QYFA 4BNVA 4RJTA 3SIRA 3P2EA 1T3LA 4M21A 4MEBA 3DO5A 3WADA 3ZGZA 4KQIA 3LM8A 2XMZA 4KE7A 4BP9A 2I4NA 4UBLA 2Q6LA 1CKEA 1M6WA 4FMPA 2XLCA 3MLAA 3ZEAA 3LQ2A 1UC9A 1RWMA 2XA9A 4W82A 5KVQA 2X8LA 1HQKA 2YUTA 5FKJA 3DLCA 1FXSA 1JQLB 4KAFA 3ENNA 4AMBA 5M34A 1WD7A 1VB3A 1G8AA 2RGAA 3N2IA 4IGIA 4IIJA 4Q39A 4Y8VA 5IXYA 5LP6F 3TZLA 2PGDA 3WDKA 2KS6A 3HRHA 1GPLA 3MWKA 4GM0A 4JV5B 5KNBA 2J9FB 4YFYA 3TOZA 4UULA 3GYGA 1B23P 3DLBA 1J49A 1TCCA 3P71T 3N2KB 2G25A 2IX9A 5CDFA 1CQPA 2V74B 4Q02A 4QULA 4KP7A 1PI3A 4LYGA 4AICA 5I7EA 5KOHA 3TRFA 1K88A 1IY0A 4DB2A 1LTHR 1NJ8A 2HLDD 4Q37A 3ZU4A 2FMIA