2Z9BA

The crystal structure of azor (azoreductase) from escherichia coli: reduced azor in tetragonal crystals
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
200
structure length
193
Chain Sequence
SKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expansion of Substrate Specificity and Catalytic Mechanism of Azoreductase by X-ray Crystallography and Site-directed Mutagenesis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords FMN-dependent NADH-azoreductase
total genus 76
structure length 193
sequence length 200
ec nomenclature ec 1.7.1.6: Azobenzene reductase.
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2z9bA00
4LAFA 4FGKA 2Z9DA 1NNI1 4GR9A 2HPVA 3L9WA 4FGJA 5LJIA 5NULA 1XI2A 1SG0A 4F8YA 3NHRA 1OBVA 5B3LA 4C14A 3GFRA 2AMJA 2QX6A 1KBQA 2OHIA 1I1OA 4ZVKA 3GFSA 5LBTA 2GSWA 3RPEA 3W7AA 2FVXA 3HLYA 6NULA 3EYWA 4DIKA 3B6KA 4FX2A 1OFVA 3NHYA 3GAMA 4Y9RA 2WC1A 3F6RA 5LLDA 4DY4A 1RTTA 1TLLA 3OWHA 5FUQA 3UXHA 4U7GA 2KLBA 2V5UA 5JROA 3UXEA 3N3AC 4U7HA 3B6MA 1XYVA 4BMPB 3KAQA 2OYSA 5B3KA 3NHFA 1H69A 2V5VA 3KAPA 5A4KA 1AMOA 2XOEA 1XYYA 4FGLA 1D03A 4QOGA 4H6PA 1BVYF 1CZNA 3SVLA 3GFQA 1FLNA 4CETA 4QOFA 3QFCA 2Q62A 1YRHA 2FLVA 1CZRA 4C0XA 1QHEA 1RLJA 1XT6A 2BMVA 1J9GA 2X2PA 4ZVLA 3TE7A 1FLDA 1H66A 1AKTA 3K1YA 2MOKA 3O2NA 4YQEA 2Z98A 2R97A 2BZSA 2FOXA 1C7FA 4DILA 2RG1A 2FAXA 1YCHA 1CZUA 4ZVMA 1T0IA 4CF6A 1AG9A 2QMYA 3JSXA 1YDGA 1YKGA 1JA0A 2ARKA 3TZBA 5F12A 1YOBA 5BUCA 3FW1A 3G5MA 3OX3A 3QFRA 5EA2A 1AKVA 4YAUA 5LJLA 2D5IA 4PTZA 4YAFA 1TIKA 1YCGA 4QOEA 3W77A 3W79A 3NHUA 4M0CA 4H2DA 4Y9UA 4ICIA 3NHSA 3OJWA 1AHNA 1CZHA 2F1OA 2FZ5A 4GQIA 2QMZA 5LBUA 4LTMA 2OHJA 3FVWA 4N82A 1J9EA 2N1MA 1ZWKA 3ES9A 1ZWLA 2M6RA 3N39C 1DXQA 2QR2A 3K20A 1RCFA 3NHWA 4NLLA 4GI5A 5FA6A 3OX2A 4D02A 4N65A 1BU5A 4R81A 3NHKA 4XDGA 2BPOA 2OHHA 2Q9UA 1C7EA 2Z9BA 1RLIA 2FDXA 2M6SA 2Z9CA 3D7NA 4LA4A 1KBOA 2BF4A 1WSBA 2W5UA 1WSWA 3LT5A 1FLAA 3QE2A 3S2YA 2HNBA 5F51A 3TEMA 3R6WA 4ZVNA 4LTNA 2B3DA 1QRDA 1JA1A 1YCFA 2QX4A 4QOJA 4ESEA 1FTGA 4YAOA 3HA2A 1OBOA 1D04A 2R96A 4S24A 4XDHA 1FLVA 3U7RA 1CZLA 3FJOA 4QOHA 3LCMA 2XODA 1X77A 1FVXA 2X2OA 4YALA 1ZX1A 2MTBA 4LTDA 2V9CA 5LVAA 2QWXA 3OWXA 1VMEA 3L9XA 4QOIA 4YAWA 2KQUA 4Y7CA 3EDOA 4HS4A 4OXXA 2QX9A 1CZOA 3ZHOA 1AKQA 1AKUA 1J8QA 1DXOA 5FX2A 1V4BA 1AKRA 3ESXA 3NHJA 3HR4A 4J8PA 5EMNA 3F6SA 2ZKIA 4C76A 1F4PA 3KEGA 3W78A 5TGZA 4NULA 5LMCA 4PU0A 1AKWA 1QR2A 3FNIA 4C0WA 3NHLA 2HNAA 2FCRA 3FX2A 1FUEA 3N3BC 3O73A 3OJXA 1B1CA 1D4AA 3ESZA 5EAIA 2FX2A 1E5DA 4N9QA 1CZKA 1FX1A 1QBGA 4PTYA 2A5LA 3B6JA 2BN4A 3NFRA 5NLLA 4BMOB 3NHPA 1AZLA 2FZVA 3F90A 3ESYA 2MT9A 4HEQA 1SQSA 1DX9A 2MWMA 3F2VA 4QODA 3B6IA 3OVMA 3OX1A 1J9ZA 1T5BA 3P0RA 4U7FA 5ULLA 5F4BA 1GG5A 2QX8A 3KLBA 3NLLA 3U7IA
chains in the Genus database with same CATH superfamily
3ZY4A 2FUG1 2PKWA 4OHYA 3H9QA 3TXAA 4CG1A 1B6TA 1EHIA 1HF3A 2BI8A 4YX9A 4QPPA 3A25A 4PSAA 3RRFA 2PUFA 1NWCA 3ZTTA 3ZN2A 5BOVA 1YKSA 4AJ4A 2CXPA 3ZGYA 2CNNA 4E07A 3KXKA 5JUWA 1VL5A 1ZI6A 2HSZA 3NKLA 3VZPA 3B9RA 1GZUA 4ZCPA 3VKWA 1KNXA 3K0FB 4A6DA 5AVWA 3U40A 3W3AH 5HQTA 2DQKA 2CJPA 1TZCA 2CB9A 5F52A 2GAAA 2WP8J 3OQIA 1YQ9A 2YWHA 3ZHVA 4ZQFA 1FSSA 1QB8A 4BEBA 2MINA 1SXJC 4UXJA 4XLTA 4KIJA 3IELA 4Q9DA 3DEZA 2QD1A 3TIIA 5AOAA 1PR6A 4I5FA 5I9TA 4OAPA 2IHZA 1CZRA 2Q3BA 3P2MA 3B7WA 1U0NA 2AFVA 1GQYA 2VPYA 2XVAA 4C1BA 1YVEI 4EKEA 1JKJA 3EMVA 4DV3B 1L4NA 4P93A 2IYWA 4MV7A 1JXAA 1HE2A 2CWWA 2NU7A 2P11A 1K5HA 1Q74A 1RFLA 3A4YA 3SLRA 1JPVA 3E3OA 3EUWA 3NQ41 1BFKA 4DIDA 4HN9A 3TKAA 1E2GA 3VJMA 5BMOA 2VNHA 1J8DA 4ZT4A 3QRWA 4BNZA 2XGJA 3FHOA 3KX2A 4U3JB 4J4TA 4RV5A 4WK0B 3BCUA 4FFBA 5HKLA 4MQFB 1GZ4A 4IQGA 3QKRA 2LCFA 2WTAA 5ALKA 1CZHA 5EKXA 5HGXA 3K2EA 4LMRA 4HNHA 1RZRD 1BIFA 3INYA 4N82A 1GUYA 1Z0FA 3RFCA 2EX0A 1D6JA 2O0JA 2WAXA 4L4SA 1O97C 2YWJA 4YVFA 2QY9A 4WZBE 1A97A 3DWFA 4ZAWA 1AA6A 4GPEA 3TFQA 1C3VA 1WA5A 1Z34A 2ZSHA 1JQJC 2DPLA 4G56A 4I4TB 3DL4A 5AVKA 3N70A 3Q41A 5T67A 3RWMB 2E21A 3FTDA 1H3FA 1YZFA 3R5SA 1L6RA 1XWFA 2QS9A 4HDSB 2YQ4A 4IKEA 4O6VA 4YECA 3SXUB 2C4UA 1XNJA 4C4TA 4JLKA 3MS7A 1GGFA 4MAAA 2NOAA 3GJ0A 5D3MB 1BC5A 1JZSA 4FDAA 3ME5A 4R8KA 2MSNA 5G02A 2FQ1A 2I3ZA 4D82A 4DANA 2ZRCA 5IZCA 2PX8A 3CZCA 2QM0A 3VSDA 2AOXA 1VKNA 2OXRA 2WKQA 1DRWA 3EPPA 2IY9A 3PDIA 1CJKC 4U39A 5EPOA 3S1LA 3C1OA 4CWAA 1B0UA 3T41A 2ZJ2A 2E82A 2H8KA 1OFIA 3RRYA 1U1CA 2B4TO 3MCTA 1YAHA 1DKOA 1LK5A 3KEGA 3DZIA 2C5HA 2DLNA 3OD5A 4E46A 4WNYA 5BSEA 5JHHB 1MX5A 5JS7A 3JYHA 1L5ZA 4J0GA 4M87A 1L5YA 3P52A 3UMFA 4D41A 1EA7A 3KQPA 4PTYA 4DIMA 1HZZC 3WHKA 4DNPA 1OI7A 4M0PA 3V1NA 4JBYA 1P80A 3PX7A 4V2IA 4FSXA 1Z16A 3ESRA 4JR0A 3UYKA 3KKNA 2VYFA 3ZKAA 4E7PA 1NR7A 3M70A 2I3DA 3P0RA 4QL3A 1ODFA 1GG5A 1GR1A 2REQA 3EDYA 1BWPA 1XTRA 4CL3A 2D0DA 3NASA 4BNTA 2A9QA 4CQMD 5K03A 1RPTA 2P2CA 1E9DA 1TUGA 3U37A 4QASA 1SXHA 2KSQA 3MJTA 1NR5A 2ZYWX 3W8RA 2C0PA 1FNCA 4N7RA 3WLHA 2G77B 2YN4A 5E9JA 2B1IA 4YS6A 1VFNA 1X1SA 3QNMA 4C89A 4HGQA 3Q8LA 1LBIA 2VHQA 5BNTA 3K05A 4M7WA 3DE6X 1KO1A 1JEQA 1DWOA 3FZYA 4LOAA 1ULBA 1IWOA 3F7TA 3M1YA 3WHPA 5IBCA 1MXFA 4KO3S 5JI3E 3BULA 3DC7A 4XPIA 3GRAA 1AMOA 3ETGA 4PNHA 4JIGA 2HWXA 2WIBA 4Q7LA 4KNVA 2HCBA 2Q5LA 4AJIA 1G8KA 1CX9B 2FSIA 2I3BA 3SHWA 4C3UA 5K0BA 1XRMA 2AJCA 2JGAA 2VDJA 2ZDGA 4FFNA 2V58A 5E0OA 3WIOA 4EFNA 2DF8A 2PGDA 2H4JA 5EHZA 1ESMA 1CS4C 3RVNA 1Z0DA 1K98A 4W6ZA 4HLDA 5A06A 5LQUA 1XDSA 3H4IA 5CFNA 2QX7A 3KHTA 3NAZA 4XQGA 3R0QA 5ALOA 3IJ5A 3VR4D 4LC1A 5K4HA 4DDMA 1MC4A 4EH1A 1U3CA 3OIVA 1NN0A 1H3NA 4CCAA 4UTVA 1VP9A 1JLSA 4PZPA 3GZJA 1NNSA 2WNIA 4JUBA 3EDRA 5EJ9A 3BA6A 4F8EA 1L5WA 4RV4A 5JTUA 1EUCB 2O1EA 4FQ5A 1GRNA 2EYQA 3WGZA 4C7XA 1VIMA 4U8HA 4UPEA 1HE1C 3OEED 3I53A 5IMBA 2VF8A 2XAAA 4FD2A 4MKZA 3MAJA 1TLTA 2O5RA 3D0QA 3H3XA 1NVDA 4CRWB 4Z7OB 4FFWA 4K03A 1JZTA 4RDHA 2CXSA 5BNFA 4GX2A 3H2ZA 1Y8ZA 3KNZA 2KPOA 5DGCA 2XLCA 2XSZD 3IQIX 4F96A 5DYYA 2SHKA 1FRQA 5IS2A 1RWMA 3UMYA 3O26A 16PKA 3N2GA 4ZYLA 3LX8A 2O14A 4JUCA 3HBMA 4HLUC 4Q18A 3L6UA 4DMCA 3IVGA 3VQTA 1TAUA 3COVA 3AU8A 4CG2A 1H0SA 1DBSA 3WOHA 4B46A 3HVHA 1X7GA 1MN6A 2C3OA 1ZZGA 3D6JA 1QH8A 1CQIA 3EA5A 5KYYA 1HG1A 1EG7A 2E7ZA 2F3RA 4X7BA 1V1MB 2C03A 1EFVA 3VISA 3ZX4A 1UXJA 1T0HB 1N32B 3CCFA 4OJNA 4H3VA 1IZZA 2NUPB 1JKXA 4M1EA 4ROTA 4A36A 3T4PA 5K0TA 4KE7A 1IXSB 3GZTB 2YZMA 5K6TA 3T0IA 2ZU0C 2FW9A 4DCCA 4PFSA 4F5WA 5HRUA 1E63A 3QVVA 1LCIA 3JRWA 3LT2A 5EMKA 2ZBRA 2CNLA 1S3FA 2A9FA 3A31A 4BLQA 1R64A 2Z8ZA 1F60A 3VVLA 4C0HA 2GETA 4ZEXA 2ZYSA 5BYBA 1F6BA 4TS9A 1QO7A 1QG0A 1DIGA 4EDFA 2E1PA 5CB4A 2PUJA 4OGWA 4XB6B 4LOKA 4DCUA 1W36C 5EI5A 1T0UA 4LC0A 3OQOA 3CNNA 3UGTA 2JL1A 2I78A 2QR5A 3FPHA 3OIUA 5DEIA 2HTEA 1LVGA 2IYYA 3IPXA 3A1WA 4JVMA 5HE8A 3O92A 3I4LA 4N8DA 1DWQA 1TZJA 4XOIA 2GM9A 4JYZA 4DN6A 2YUIA 5E2AA 3K73O 5DK4A 5B2FA 3PJDA 1GM5A 1UMDA 5EE9A 4UUOA 2IXFA 3QYFA 4PTLA 3SM3A 4F93B 2CFOA 4IGEA 4Z7QB 1G7RA 2BMDA 2YVLA 3HKCB 3RUHA 2ZYDA 3JQPA 4Q48A 2WW8A 1Q1QA 1HLGA 5AH0A 3EZ9A 4P7GA 3K94A 1JH9A 4UU1A 1PJRA 4CF5A 3JTMA 2VUHB 3Q87B 3QFCA 1N8KA 3R0JA 1HQKA 4F4CA 2R5NA 5L3ZA 1ZVJA 2QY6A 2IYRA 1I4TD 1MOSA 1RHRA 1MJFA 1D4FA 1XVIA 2V6FA 3MTGA 1X19A 2XMBA 1UQUA 1Y63A 3W8DA 1NR1A 1T1EA 1SOUA 4NU8X 4S1OA 3MMPA 3G8DA 2VG8A 3HSYA 5FFMA 1ADBA 4WLOA 1ND6A 5GZ3A 3NZEA 2WWRA 4BVLA 5KEIA 3O03A 2CMHA 5KZMB 1NY6A 1Q57A 3K4QA 3HPQA 2WUWE 4M0CA 2FMUA 3ZZUA 5K8JB 5BSMA 2J5BA 2ZYRA 4F2GA 4R41A 2BTOA 3ANTA 1YHYA 1SRRA 5FEMA 1J9EA 1CR4A 3BZWA 1CFJA 5EESA 3JYPA 4JOQA 4N54A 5CJPA 5ILGA 3P2KA 4ZO8A 3USCS 1G64A 2QR2A 4CCYA 1P29A 1JLRA 4R01A 2CVOA 5HS4A 5BQOA 1N77A 5IZ4A 3N74A 4R81A 3DKIA 1J5XA 3EEBA 1I4OA 2O7NA 4TV8F 1I7QB 4FCWA 3TLMA 3BN3A 4MI9A 2ZRLA 1RJDA 2I29A 1IHXA 5L6LB 4MCHA 2BZGA 4OHFA 3T6KA 3CTMA 1FW8A 2LBPA 1UDRA 2GXAA 2VXOA 2IYVA 5AJUA 1HL7A 4EYOA 2PL1A 2ZJAA 3ESCA 1E7YA 3HN2A 2C4KA 3ECCA 2BEVA 3IIIA 5EHIA 2XNDD 2DWPA 3FUWA 3G02A 4O2BF 3LFUA 1SUBA 2B94A 3PE6A 1JSZA 3W9YA 5C2JB 1Y34E 3L02A 5CCBA 1AQIA 2DULA 4DM7A 3GEPA 5E4YA 4RACA 4B74A 2GLUA 2NUPA 4HYTA 4KKVA 5IYZB 3P2YA 3NHBA 4JSTA 2QKYA 2P3SA 5IJZA 1DBVO 4U7WA 1Y7TA 1SPXA 2Z5VA 2WHXA 2YWBA 3TI9A 3B1XA 4DIUA 5JAOA 4RTLA 2XNHA 3JVUA 4AF8A 4HDCA 2YJ3A 4UJ3A 2O7SA 1A95A 3COJA 1RJEA 4CGZA 3PGA1 4QECA 1Y4DE 2Q3LA 3GJ6A 1ZMOA 2VAWA 5CW1A 2VBIA 1DELA 2UUOA 1JDNA 3O2JA 1NMSA 3HCFA 4MA0A 4HNTA 1RWXA 4E5MA 3WYAA 3LUBA 1JWBB 2ZRDA 1VIAA 2JKVA 4E33A 2JLUA 1S96A 2ZR7A 4NCXA 3D6AA 1WD5A 3AY3A 4GP6A 2AX3A 1HOTA 4NCIA 2XITA 2IX9A 5FOXA 4FGKA 1UDBA 2DTXA 2W71A 4I5GA 1IN5A 2CL5A 1BA2A 1O97D 1Y89A 3OETA 1QQAA 3CWCA 3EDQA 3WV5A 4K6KA 2GXQA 3DHNA 4WNAB 4UKDA 3RIXA 1GTG1 3A4VA 5HF6A 2FVXA 2RAUA 1L7OA 3ACDA 3MT0A 3FPBA 5FA8A 1RKXA 2Y0PA 5EHXA 3WLQA 1UOEA 1CJMA 2A86A 3KR0A 1OTYA 4WKCA 1E7RA 3B85A 3LP6A 4Z8XA 4BEJA 5HVNA 3MCUA 1GYQA 1Z5WA 1SBCA 2WIGA 4P4GA 3REQB 4B33A 5EIHA 5I9SA 2W37A 3EFBA 3S1AB 1QTQA 4TMVA 3ROXA 2D4HA 1N2GA 4HDKB 1EFKA 3ZXIA 1HDEA 1PZNA 2FSHA 4UOQA 3DWIA 5GV7A 2JCGA 3WKAA 4J0QA 3NXKA 5IAKA 5BORA 1YVPA 2B7LA 5G1PA 1U1IA 1UBUS 3PFHA 4RETA 5IX8A 2A0WA 2AQIA 4FBMA 4B82A 4Z4IA 3ZHYA 4B75A 4FMCB 1R5BA 3PC8C 2UVPB 3S4YA 3T0FA 4CG3A 1LX7A 4E5YA 2PUWA 1JSLA 1A88A 2WU0A 4LI3X 2QEQA 3HP4A 3EDCA 3ANYB 4L9AA 4E4YA 5TMPA 1B23P 1DU4A 5BUCA 2OZLB 1U5AA 3LKBA 4FUQA 4LX8A 2VATA 3KOUA 4RSHA 1V2HE 2YWDA 2ZE5A 1ZGBA 1TQ6A 1TA0A 5A6VA 1U2SA 2R1TB 1FX0A 4YJGA 1PJ3A 1RLMA 5JNWA 4XAQA 5LOVA 3E81A 3FWYA 3THWA 2KI5A 3KG2A 4BXOB 1JDJA 1Q1ZA 3N2EA 3H5VA 4G0PA 4JJ6A 2VWPA 4IHJF 4WHMA 2YOHA 5T3YA 2NUAA 2H59A 1TDJA 2BHSA 3NPMA 4JBWA 3WNVA 1YR9A 1KDVA 2E6KA 1XEWX 2DWOA 4X71A 5JQWA 1GGNA 4DUYB 4LXYA 1F8XA 1VG8A 4IVPA 4MMXB 3Q6IA 3QMVA 4C0QC 4GLJA 3K0SA 4WLNA 4PWYA 2H2IA 1FDRA 4IIHA 1CZLA 1PD1A 1G0NA 1P4GA 3E05A 1ZAKA 1JMYA 2OR3A 4WN3A 5G0TA 1BE1A 1G291 3PGXA 2IF2A 1WDWB 5DRYA 2I4RA 2QT9A 4IDPA 4YPVA 1I4LD 2OORA 3K1AB 2WABA 3ZY2A 1UKVY 1BYUA 3P9QA 2N47A 5KSWB 1SKBA 1QR6A 1WXXA 5J4YA 4K9OA 2XPCA 3OUZA 1C0KA 2FWPA 3R0ZA 1FUYB 4FD3A 5E2IA 5E6SB 3NGMA 4C43A 2CKDA 1B14A 2FPRA 2OBXA 3CLVA 2ZUDA 3TPZA 1HYQA 1Q6ZA 2WIDA 1DAOA 4ZK2A 3L6CA 3G5TA 4G1BA 4N9QA 3L4BA 4YV0A 1FTQA 1FCJA 5BPHA 2LV8A 3TUZC 4HUQB 4OQXA 3ZW8A 1C9MA 3A4MA 3PPYA 5ITWA 3NFYA 2QJRA 8ATCA 3L46A 5FIUA 3SP1A 2HIGA 4NCNA 1QFSA 2RKBA 3ZE6A 2BELA 3T15A 3WLJA 2JH3A 3WK9A 4E0BA 4KUHA 4X90A 3U7JA 2OLKA 4TS4A 5JWRA 3GJTA 2OMEA 5LKRA 1A04A 4QU9A 3WADA 1EBFA 2ZI7A 3OP4A 3VGJA 1SG0A 2V7WA 3LE8A 3R3VA 4F8JA 1F7VA 5B3LA 1SHUX 4OQZA 4TYMA 4U8GA 2XNKA 2B0CA 1ZI9A 1X7XA 1X1RA 3I34X 4ZP1A 5TDHA 3WGMA 5AHRA 4WLEA 2H1HA 821PA 3DM9B 1D6SA 5CH3A 1OFVA 1IVYA 3BXPA 4G97A 1E2BA 2WYWA 3TD9A 1F3OA 4F72A 2P6UA 1N2EA 5LZ7A 2J4CA 3FUVA 3PL1A 4U7GA 2R1VA 1EFUA 4QO8A 2J9ZB 4LFBB 1AM4D 1M2OB 2NSHA 3GHYA 2DFKB 3VVCA 4NMLA 3ANMA 3NYQA 3A7DA 3OY2A 3EFOB 3T3IA 2Y68A 3OQJA 3OOJA 4NE9A 3LA8A 2JCVA 3TSZA 3O9VA 4CQJA 2BFEA 3N7TA 3UUWA 1BVYF 4WZBB 3CSSA 2MSEB 3T34A 1T5LA 2ENUA 4WEOA 1CQZA 1NPYA 2CBXA 2IW1A 4BU0A 4ZICA 1QXSA 4G37A 3PFCA 3QOWA 1A7UA 4MPJA 3ZG6A 3ZH9B 3DHYA 3NHMA 2CGEA 4BAZA 2QIOA 4LBYA 4I99A 3FTEA 4ND3A 4B0PA 4FZ3A 4IKOA 3S2SA 4I1UA 1NRWA 5F12A 2H65A 2H2AA 3KTAB 2B20A 3UOWA 4RWEA 2EP8A 1EGHA 1KVUA 2R44A 1A71A 1A9TA 1O58A 3TKYA 3CRNA 3DOOA 3ZDEA 1DC3A 4BNVA 5IXJA 1J0AA 2ORWA 4JYAB 2VXCA 4N12A 3AG5A 1Q84A 2ODEA 4WY2A 1CR1A 4BVEA 1U0LA 2ZAYA 3RVRA 4K9QA 1T3HA 1W93A 1MO3A 2P62A 3ORSA 5PGMA 3RG2A 5LB4A 3IL2A 3L1UA 1FUIA 1I3MA 2I9PA 2IZOA 2VA8A 1IE3A 2ZRMA 4PAWA 5H83A 5I4BA 5I7WA 3ONDA 1D3AA 4FYMA 1SOVA 2VDLB 4JI3B 1KDOA 3HDHA 4RY0A 1DMSA 2WSBA 5AM0A 1GR0A 2GM3A 3VVBA 1R4NA 4MPRA 2CCJA 1JVSA 4EHJA 3B9BA 2FETA 5KWSA 2J1LA 4R6WA 3SXUA 3N8NA 5G3ZA 3R6LA 3P9RA 2BGTA 3AR7A 4BBAA 4LGYA 1FTGA 1NBHA 1YE8A 1NN1A 1UIRA 2OCAA 2WSYB 1Z45A 3HU1A 2YC4C 3UV3A 4C2TA 3UWPA 4NL4H 1EX6A 2R9VA 1JBEA 3WLNA 3P20A 3ZS8A 2MTBA 2W2KB 4ERNA 2R7NA 2V9CA 3HBLA 4G81A 5AVTA 2P1DA 4F0JA 1CIJA 3MUNA 3KZ1E 2B7CA 2I6QA 4HBZA 1RXVA 2CXUA 4CKWB 4NFSA 4TTIA 4GKKB 4GPTA 1JJAA 4AW9A 1YHZA 4GOXA 4BL5A 2H4HA 3RRXA 2I7DA 4RK6A 1F4PA 1JIKA 1UKYA 1V41E 3DV0A 1WABA 1Z33A 4BLRA 2WKSA 5CITA 1UJCA 1OA1A 3GA5A 3ZS9A 3MD0A 5JADA 1G60A 3R20A 4HQFA 4Y2RA 2OK7A 1YL6A 3QKIA 2YIDA 3O1IC 1I9CA 5FUBA 3T5MA 1DPFA 5IAAA 3E22B 2PS9A 3DBHA 1CYDA 5HF5A 4MVJM 3FH0A 2Q41A 4HL6A 2GO1A 3VNRA 1BDJA 1CC1S 2JFFA 1NMQA 3ELDA 2B4KA 4ZQGA 5JT1A 1OH7A 1O95C 2B25A 1RWOA 2AZ4A 4AY2A 2FFQA 4YWHA 3UJNA 1I3LA 2FUNB 4G8BA 3LHKA 4Q9AA 4RVNA 2DR0A 1FVHA 3N8DA 3OEHD 3TQCA 1N5LA 2Q1XA 2FMXA 3H1FA 4OGLA 2RKOA 4M8NE 6ADHA 5T57A 1W5EA 1COWD 2PKQO 3OKCA 2GHTA 3PDCA 5CM9C 4YT4A 2QPOA 4WNCA 3AF4A 2GXSA 3EF3A 3MTQA 5CDFA 4AXBA 5C1BA 3NDPA 5T7BA 5EVJA 3LUJA 1DO0A 3GEDA 4YJ2A 1NQWA 4FYYA 4JLUA 3WFIA 4EJSB 3E3NA 4WJLA 3CW2A 2KBFA 2BMEA 5EIOA 2W6CX 2IWHA 5B1EA 5GOTA 2PL3A 2ZTLA 4TMXA 1G3MA 3RUAA 4RPIA 3KKZA 4G8DA 3S0JA 2DUMA 3LWDA 4UM8B 4R16A 4AURA 4FYKA 4LF4B 1YI8A 3H18A 3QOXA 1YR1A 4GKAA 4X1KB 4Z2AA 3NYWA 1ZL0A 3WY9A 3QXSA 4L50A 1C9KA 1Y6GA 1VJRA 2D2FA 1TVCA 1D1SA 3FCAA 1KYYA 2GNPA 3GDOA 4B0OA 1XTUA 5JAMA 2BISA 3RQIA 3LUCA 2FPPB 2WUDA 3IKLA 4YMWA 2FQWA 1O2DA 2EBFX 2J59A 3I58A 5FOTA 4E5NA 2GF9A 3QLUA 3OKAA 4Z4QA 1AQLA 3HB9A 2IP4A 4AZWA 1ZC4A 4EKIA 3IT3A 4TYQA 1ONOA 5BQ5A 4WK2B 4UBIA 4DR1B 1XF9A 1Q91A 3P26A 4TKUB 4K1XA 2IWRA 2H18A 1SUFA 5JAPA 1VMIA 5I9IA 10MHA 3ANXA 3G9UA 4JA0A 1UKEA 3DB1A 3PYMA 1T8WA 2BGNA 4IJMA 4LE2A 2HU8A 2ZW9A 3VPCA 2QGFA 4CI0B 4AB1A 1S4MA 3G0BA 1P45A 2Q7XA 3GWZA 3W6PA 2EZ4A 4M9UA 1KJYA 2Q99A 4Y6RA 2O7QA 1MH9A 1B8UA 3GGJA 4KN8A 1N2OA 1KHTA 2YHIA 5EOVA 1FU4A 2IA5A 1K86A 1Q17A 2ECOA 1FXWA 4LTNA 1G8AA 1NW8A 1E5XA 1LJLA 1P2DA 2PUTA 3TCXB 4D4GA 4AY6A 1ZIOA 2Z5FA 3RYIA 3K0CA 3HG7A 5LDDC 3T1TA 3CV3A 3BWEA 3ECAA 1TJNA 5F7XA 4CIBA 2IPAB 3HV2A 2NXEA 1SHKA 3H8WA 3PB3A 3FPCA 5J40A 1KI1A 4H08A 1B6GA 2ZQ5A 4UAGA 1E8DA 3LHSA 3USZA 4HCJA 4HXEB 3ML1A 1DJNA 1NJ5A 2IU3A 4KH1A 1EM8B 4RAQA 2J6HA 1NI4A 2BR4A 4LRUA 5TLSA 4CT0A 3WGOA 3F6YA 3M81A 2Z8YM 2CJXA 3STHA 3GP8A 4TSKA 1Q3KA 2I76A 2P6MA 4DG8A 1ZRHA 4Y98A 1P44A 4OJYA 5AW6A 2DWUA 1MAAA 3MYYA 4PXAA 3EQ2A 3LDFA 2F6RA 2O2DA 4HR7A 3U4AA 5KSPA 5CHYA 2IJGX 4ZPXA 1NVVQ 5CA0F 2XYRA 1TOAA 4XGQA 4QXOA 3N05A 2P90A 3F2VA 3R8FA 4TTTS 3OVMA 3L8ZA 2GASA 1ULZA 1HO3A 1YH3A 3JQ8A 4CE6A 4H7IA 3L6DA 2EJVA 4JBHA 1UH5A 2AMFA 4FGJA 1SEVA 3UGKA 1U7HA 3K5PA 3LU1A 4W5WA 5FHRA 2NPOA 1D1QA 1U2TA 2ZUCA 3BERA 2VC2B 1YDMA 2G5CA 2NYRA 2X0KA 3EEFA 3Q2KA 4INAA 3T9DA 2WB4A 4Y9RA 5LYJB 2C97A 3C3CA 2FDCA 2JGDA 3UJHA 4CJXA 1H9CA 1O6ZA 1THMA 5IJAA 4QXRA 5CA1A 4BATA 5TGTA 4ZCQA 3D43A 2H1VA 2Q9CA 5LA6B 3H6HA 1KJ8A 4V1CB 4GE3A 1MC5A 3LO8A 2OB1A 3DL2A 1EGAA 5A02A 3LP5A 1VL6A 4JLSA 3RHZA 4QOFA 1JKIA 1TO2E 3OQBA 1BEZA 1DDGA 3Q11A 2PKXA 1W35A 4IM7A 4CN9A 1THGA 2J41A 2VH2A 3LQFA 5CB6A 3PENA 3DZJA 1ISJA 1EYZA 1R6UA 1XZGA 3DAYA 1I5OA 3U3DA 1XE3A 5AW1A 3RAEC 3H6KA 1KTIA 1JIJA 3Q72A 4ZVMA 1RXCA 2YMPA 4FINA 1QVAA 5AOVA 4HWKA 1XVTA 1YDGA 3TX6A 2WDPA 1K4YA 3TZBA 5B4VA 3B8EA 3M9WA 5JVDA 1HM5A 2EFDB 3A06A 1WIWA 4K1LA 1IXKA 5JD5A 5LQDA 1RPZA 3BXHA 4O1HA 3D8RA 1ZUWA 2BLNA 4OB7A 4NAHA 4N01A 4C78A 2PLAA 3TFWA 3VTKA 2AUNA 5ALHA 2MMGA 2CFCA 5ECWA 1HUQA 1DKQA 3KOOA 5E4JA 4ZYTA 4EHIA 2K4MA 4GT1A 1JHZA 4FWBA 5ETJA 5B4UA 3QFSA 1AV7A 5EG5A 4OBXA 4G65A 2DEUA 2GYYA 1RS0A 4YLGA 4XX1A 2GGSA 1RZ3A 3FSGD 2FDXA 3EY4A 1YGYA 4HB4A 4UHDA 4ZAFA 2A9PA 1ZL2A 2ZIFA 3HZRA 2J9GA 3TLCA 5EZYF 4CL8A 4E32A 5K3EA 1E7SA 1ZZEA 4DRXB 2YJZA 5CXUA 3KXIA 3IV9A 5KREA 2FPUA 1M5RA 3MJDA 1U2EA 5BSTA 2W2OA 2ZYVX 3K9FC 2DHCA 1MOQA 1YV9A 3CEHA 1QE0A 3DVRX 4U4AA 4GP9A 1F0KA 2QVCA 3PTLA 5AJZA 3WL4A 1QE5A 3O3OB 1RJ9B 1WB6A 2R8BA 2F3UA 1F6WA 2C59A 4KODA 4EJSA 4D0RA 4YQFA 2IYUA 3HWWA 1RI2A 4O4LB 4RTOA 4W5JA 3WSWA 2JGFA 5I7VA 1ZSNA 3EDOA 4H9GA 3I5YA 4P0PB 1IY9A 1GDDA 1Q83A 1X0VA 3C8DA 4K05A 2PLWA 3MGAA 4KR6A 2JK0A 3HFSA 5G0SA 4D8TA 3QX8A 1MB2A 1L4GA 3I76A 4N6GA 3KB2A 2VEDA 3ADOA 4GUAA 3TXXA 9GPBA 1N0WA 3TIXB 1L4MA 2B4AA 3U3JA 2ZWIA 1NOJA 5EEGA 4B6GA 5IT9A 2E3JA 3KYIB 1I24A 2J6CA 6LDHA 3F8TA 4HVTA 2FPPA 3ZVMA 1V5EA 2Y1LA 3DR5A 3RIYA 4QNRA 1P7ZA 1T4BA 2ZS8A 3JQFC 4DV7B 1Y9AA 1EWTA 3QTTA 4W9NA 5WRFA 4B4VA 3UWOA 4F4UA 5LIRA 1JDBC 1D2CA 3PG5A 1MGOA 1P1CA 3E7PA 2Z2IA 3BXGA 5ALPA 3VNBA 5I5GA 1L5OA 1R9NA 5BURA 1YBMA 2B37A 1D0SA 1REQB 3P9IA 4GLBA 4INJA 1L1FA 4CM4B 4XWKA 5DNUA 1TYDE 3NHRA 2GT1A 1WD7A 5CXXA 4JBGA 3WNCA 1OC2A 4KFRA 2OHIA 1HLDA 3W7AA 1OAAA 1H2XA 2C07A 2CL7X 2W83A 4BNNA 3IB3A 1OLUB 4B34A 3M8KA 2EGHA 2OTCA 3RK4A 4ENQA 2I3GA 3WV4A 3E9DA 3T61A 1ENPA 5BUQA 3ZWXA 1PTKA 4QFDA 2O4UX 1HDYA 4JT2A 1EVZA 1XZMA 1PZFA 2B8NA 2BFAA 2V5VA 3JZMA 4Q01A 4RX1A 4WCFA 3SIPA 2EZ8A 4DUPA 5JNTA 4QARA 4ZKEA 2CXQA 2PBFA 4DDWA 1CZNA 4FC7A 4K81B 4MUGA 4O25A 5EMMA 4EEZA 3DKVA 1DRKA 2GCIA 1W0JD 1SB8A 1ZCBA 4O4IA 3NBZC 2P67A 2ZSIA 3HO1A 4HGPA 4X3PA 3O31A 3NBQA 2D7CA 4LRSB 3FZNA 4LVNA 4AP6A 2P3OA 5K8TA 3VA7A 1MABA 5CMLA 5KVCA 3KYJB 4P0TA 3EVNA 4RJKA 2CZCA 4IWYA 3QYJA 3O84A 4IRXA 1YOBA 4XCXA 3REGA 1QRRA 3WDLA 2BFBA 3CEAA 4M0MA 4MV3A 4AQDA 1KY4A 3FKSD 1PV4A 1L1QA 1Y3AA 4X6XA 3TL6A 4NFYA 4KPFC 1J0CA 4XVUA 1C4OA 1KY5A 2PDAA 2H0AA 3DWEX 4GGPA 2X19A 1U80A 5J2UB 4PYJA 5EKSA 3UV6A 4JKIA 1KHHA 3I8XA 1NBMA 4Z0TA 2C2ZA 5E9AA 3UQYS 1DGQA 1O0BA 1LC0A 1DQYA 2BMJA 3B1YA 2D6FA 4Y0AA 2XJ4A 1XYGA 2Z9BA 5L7YA 2GD0A 3T1HB 3ZGNA 2WI8A 2E49A 3KZNA 4UBMA 4X1IA 2UV8A 3LF2A 3A0UA 2ZUTA 3G0HA 4L6IA 4PWZA 4OV6B 4KGXA 2NT4A 3VPXA 3I01M 3VR1A 3I9V6 4AIIA 4HSGA 2R4QA 1HTTA 2YWCA 4WUVA 4EBFA 1K5PA 2JI8A 3EH1A 3IEPA 2JGNA 3VU9B 1M74A 3X3HA 4D5EA 5L95A 4P5DA 1KEWA 4FYIA 3QG5A 4LJ5A 4PYIA 4P7JA 5EHGA 1L7AA 4C0JA 3OZSA 1QX3A 2PH3A 3P71T 3TPFA 5BVGB 5KUTA 2IXBA 4FWTA 3BAFA 4MMYB 3UAVA 4L4YA 3FKQA 4ZDKA 3GROA 3PNVA 4Y2QA 1GLNA 1MIOA 3G5UA 2XQGA 1KJQA 3DDZX 2VZEA 1Z7YA 2EP5A 3V80A 4GW3A 3KB6A 1QPZA 2EEZA 1L5MA 3STVA 4BO4A 3WK6A 4P53A 2F62A 3MPOA 4M0EA 4CFZA 3SJBA 3EJ6A 1YK0A 1ENYA 4JS0A 3LMKA 1E9VA 4PINA 2Z4RA 4EQ6A 1V16B 5AI5A 1VE3A 1ICIA 4OSEA 3RS2A 3U3XA 2XMSA 3GMDA 4PAMA 3DV2A 4JMLA 1MJGM 4G41A 2GHQA 2YVKA 2ZSUA 1OX4A 3V2IA 3NTRA 3ZCRA 4UCFA 3AUUA 4TTPA 4AYWA 4EI9A 3P4UA 4X7PA 2PU5A 3NONA 1DEXA 4WVFA 4CDRA 3WQRA 1E0AA 4KW7A 1VFPA 5CIYA 1LFDB 2QAIA 1WXQA 3GDGA 3J80A 2H16A 3ICQB 2HADA 3FDFA 4TLCA 3GRUA 3UWMA 4KXFB 4I55B 3PA8A 5FPPA 2YR0A 3U1VA 3IA2A 1AX9A 3GHHA 1GGHA 2B1RA 2ORIA 3BJIC 4RLHA 2C2OA 1FMCA 1RTKA 1EVQA 3HKDA 4CM9A 5KOHA 1GPYA 1SXJE 4F3TA 1OV4A 3FNQA 4I9NA 1WZCA 4K88A 2QRKA 3SDZA 5EXTA 1GNTA 2IZ0A 2X22A 3WLOA 4BWYA 3KFLA 2BKAA 4MVJH 4ZYWA 3NBFA 5DMHA 4EG4A 1UKCA 2DXIA 3NGLA 4CF4A 1ZK3A 1V8DA 1CWUA 3OU6A 3IHTA 4QXQA 1YKFA 4K5QA 3K4HA 5CTJA 1M2FA 4DSOA 1U6IA 4DQKA 3OY7A 4NJEB 3DAGA 3JALB 4KQCA 3UT6A 2J0VA 4QSMA 3IUPA 3WK4A 4KXLA 4QDXA 1UOPA 4MO9A 3JVEA 1W2GA 2Q21A 3DO8A 4TPKA 3QG1A 4K6HA 3TNLA 1QP7A 4V03A 3DLHA 3QUSA 3AXSA 4OYHA 5KOHB 3W9BA 4ZKDA 3LHIA 5GV8A 1U8AA 1V43A 1JDVA 3LWZA 4FVTA 4AN1A 5ITSA 2D00A 1NKTA 2R5FA 1TK2A 2C2MA 2V7BA 3BD8A 4GMDA 3V7FA 2Q7DA 3ZKWA 4C0BA 4ARAA 1R0WA 5DBHX 3NHUA 3PR2B 5EXEA 5FD8A 3RHTA 3RWBA 5JNRA 1MA0A 4NESA 2FZ5A 5B7QA 1KJWA 4MWOA 3KCQA 2EJUA 1QQBA 4R9UC 3ZU2A 1OROA 2ZR8A 4F9EA 3E3MA 1KA9H 3Q3VA 2XUZA 3AF1A 1L5GB 4ER6A 2QTNA 4XJXA 2VZ9A 1NP6A 3AFGA 5FYDA 1GU0A 2UVPA 4K8RB 4R3WA 1W59A 4IICA 4DNOA 3G1UA 3OAAD 3R4CA 1LLFA 4MB0A 5THKA 5KNCA 2W5UA 2X5XA 3R3JA 4UHFA 3EQ8A 3KPUA 4NK5A 2PVPA 1E5TA 2G5GX 2N42A 3MWLA 4IKPA 4PBTA 1NV8A 3HABA 5T5QA 3DLTA 4AMBA 3AJ9A 5JSZB 3ROKA 2VQDA 2HJ9A 3C7TA 1BTOA 5EPEA 4N41A 3D1VA 3MCZA 3A1VA 4NEGA 4L7VA 1L5QA 2NQTA 2W90A 1CUSA 3OZ7A 2PLFA 3VXKA 4U6SA 4B3JA 3SZOA 1Q7BA 4CODB 2HNKA 2RGWA 2LXNA 2VJKA 5LVAA 3CPJB 1J7JA 1I2ZA 2QTCA 2E0IA 4FFOA 5JSKA 4EGJA 1JFVA 3AR4A 1BSVA 2R47A 2VVTA 4BO9A 1J0DA 1DAEA 1YO6A 1WKVA 1YZQA 3OF2A 3UWDA 3U09A 3G79A 2ZRPA 2OXCA 2ZRGA 3W78A 4PSUA 5IJWA 4ZCIA 3J81A 4XRRA 3AUYA 1NZJA 1WTCA 2C8JA 5E9QA 4BZWA 2ZVDA 2XXAB 2B3TA 5DN6A 2OAQ1 4QAJA 5IAGA 3OD1A 4CMJA 2ZCJA 1ZR4A 3A4IA 1Z7WA 1U0EA 1ESEA 3WSTA 3VDQA 3WDMA 3LYUA 5NLLA 3IQXA 3ZOZA 1LFAA 1ATZA 3NPAA 4UEWA 2RI0A 1LRJA 1Z5NA 1FFGA 5K3AA 3DKRA 4AJLA 4WI1A 3HRIA 5BN5A 3RM3A 1YE3A 2PSSA 2X0NA 3C7DB 3Q9UA 3WL8A 4TXLA 2W2PA 1T43A 1U9IA 2R6ZA 4DYDA 1EHYA 2OMKA 1OA0A 1XI2A 3EC1A 3GEGA 5K3OA 5C51B 2XBMA 1G3IA 1WBDA 2BJVA 4KJZA 4QHTA 5ELLA 1G2IA 3LCCA 3LZCA 1RRPA 1TJ5A 2W6ZA 5HE9A 3NO4A 4JNCA 3STYA 4KZPA 3KSAC 5J2TF 1P0MA 2YFKA 3OEYA 4BVBA 4PR3A 2C57A 3N3AC 4XRGA 2BUCA 4EHKA 1K08A 3GJSA 4S2UA 3ZGXA 3T4EA 1GRVA 1M1UA 3R1IA 2QD2A 1U3UA 1U8ZA 3UJCA 3ZQ4A 3ZWYA 1BJKA 3KBBA 1C7QA 4CLDA 4EB8A 5J2UF 2XZLA 4IUCS 1EM6A 2AOTB 1JAXA 5G1OA 2OBYA 1G9TA 4OCZA 1ND5A 4RPKA 1KE2A 2G9ZA 5KNCH 2B92A 3ROFA 3KR1A 1K92A 4L5IA 3C5WP 1W19A 2WIKA 5HUQA 2BKXA 4O0MA 1HZJA 4UM9D 4E30A 4CXMA 4YCBA 3QIAA 4PQRA 5SZHB 2ID4A 4Y67A 2BZSA 1NBEA 5E95A 4LHEA 2FAXA 4C3ZA 4BNIA 1ZBDA 5EIFA 1S2IA 3MMXA 1FYXA 1VA5A 1WNFA 1GAJA 1T4GA 5F78A 3RKUA 1PT6A 3AH8A 4H7EA 1P2UA 5DFAA 4JLOA 5EUCA 2OP0A 3Q4GA 2V6JA 5DI3A 3U4CA 2V1XA 2PJZA 2PUGA 5BOSA 1PGOA 1NBWB 1XAGA 4RFVA 2YFYA 5LKAA 5AKXA 4WDQA 3ZZMA 4FSDA 1ZWLA 1JAZA 2LIPA 2NNWB 4IDFA 5F1OA 3EGDB 3ROTA 1ZJ6A 3FFBA 4D02A 3KM0A 4Q1BA 3G9ZA 4TL9A 1IN7A 3IYLW 4V24A 1QDEA 4BMXA 2Q9UA 4Z5XA 1NJ1A 2A5DA 2IYOA 2H1OA 3UGQA 4R2XA 3KELA 1MGPA 3HCCA 1NVFA 2EU8A 3MSXA 5ER9A 5B1IA 3AFIA 4PV7A 5FWAA 1SHLA 2IUSA 2PSEA 3RT9A 1ZBQA 4AJ1A 7AT1A 3UMGA 4X3OA 5EGNA 1O6BA 2DPXA 3I2KA 2V97A 4PLPA 2W70A 1FSGA 4OBBA 2AKAB 2QL9A 4BYMA 4IF6A 4DC0A 4BNXA 3LC2O 2YIMA 2PG3A 4CFSA 4GEGA 2F17A 1HXHA 1BJRE 1ONSA 1R6VA 3AI2A 3GMIA 3HFJA 3ID6C 2YV2A 4MPDA 5EXXA 1ZVQA 1KZ6A 2BCGY 5E1DA 3QKWA 3SMQA 1WUKS 3BBLA 3B8HA 3S3TA 1I1HA 5J58A 4IO0A 1OC4A 3O2SB 2C3MA 4GVLA 4UQPA 1VYUA 2XQJA 2FP4B 4HTFB 1E94E 3NHJA 1QKIA 4GXRA 4QVIA 2WA1A 4Z4GA 2FRDC 2Q6VA 2V96A 1N92A 4DCMA 3ZU4A 3E8MA 3RC7A 1VHWA 2RGUA 2A7XA 1QGDA 1N78A 1DSSG 1SC1A 3UT0A 1U2GA 2FGKA 2Q29A 5IVPA 1AUXA 4FR5A 3SLGA 3EGXB 1QAMA 3HU2A 5G4KB 4RK4A 1L3BA 3GYGA 4UCQA 3L2OB 4Q19A 4QOSA 4C7JA 1Z2NX 3E23A 3I6ZA 5FUWA 1RXSA 1NE2A 3EK2A 3JD2A 1XCLA 1EK1A 2XQKA 3TLKA 2WAOA 3HCEA 5HOEA 1WZ2A 2CLHB 1EI9A 1G5QA 3FNGA 3GC6A 1K3FA 3C5HA 4HAWA 4MDHA 4OQYA 3ELWA 1PLLA 4JCOA 4QUAA 1NUQA 2C4MA 4YQYA 3K35A 3VHXA 4ZMRA 4ARSA 4LZPA 3N5CA 3QLUC 5DTJA 3SDBA 2QYTA 2WWYA 3LQ2A 3A2MA 5C81A 4CCSA 3IOMA 1EA5A 4J0FA 5EXDA 3W2HA 2IH2A 5CM2Z 4TT3D 1Q0SA 5FHQA 3U4DA 2JA1A 4NCAA 3AYZB 2H4WA 3QEOA 4MW4A 3L84A 4FHCA 1N6PA 1UF9A 3T54A 4EJ2A 5CBPB 3DEFA 2XAUA 1C1HA 3QELB 3RYHB 3OQNA 1M54A 1NG9A 4C0LA 2G70A 2UZ0A 7ADHA 2EFHB 1H69A 1JJIA 3CT6A 3FSGA 2X76A 3H9CA 3WWZA 4D0SA 1OILA 1V45E 1E6WA 1RHUA 4PC7A 2RGRA 4Y2GA 5K20A 3Q5GA 5T3UA 5AO9A 1ULTA 2B4RO 2R2GA 1L5NA 5CG2A 1IY2A 1SOAA 3KJQA 1JGTA 2X4LA 3EF0A 4KUEA 4NENB 4OYYA 3ND8A 1LSSA 4JLPA 1D2EA 2C31A 1CP3A 3P2JA 5IEBA 4PHHA 5B6PA 6YASA 2FKNA 2FQYA 3AUAA 4J49A 1NLFA 2ZWPA 3R7NA 2GESA 2G8NA 4FFPA 4XJSA 5E38A 4LZOA 1I14A 4EKYA 1KSJA 1D2NA 4ACBA 4XGRA 4EMBA 3T12A 3GUUA 2WE8A 3NC1C 4PLWA 4E1BA 4EOGA 5C5EA 2WMDA 3OICA 4J1TC 1B4DA 1BEEA 5LL6P 1N6IA 1QUFA 3CVYA 4ZYYA 2O8CA 3B5IA 3DFMA 4HEA1 2NO4A 3KK0A 4UQLA 3ZDBA 3SBDA 3L7BA 1OU4A 2ID7A 3EYAA 3OT1A 5I4CA 1XMQB 2BDTA 3PX3A 4KQ9A 3DYBA 2BFCB 4RTPA 4G0UA 2LR0A 4YRZA 3OE5A 4LPKA 4BB0A 3K30A 1XXLA 1GO2A 4RF3A 3ABRB 3U44B 4LKOA 2M1XA 4COOA 1H1LA 4K8OA 2CYCA 5IH3A 1P1HA 3OIWA 3ZR4B 4KE8A 4H77A 1OWNA 1SKQA 3D3QA 3AB7A 3F71A 1CERA 2K87A 3W6UA 4F6RA 1YZ3A 1R6BX 4GLLA 3WJ7A 3AP2A 1RJ9A 2WU1A 3MWEA 4YP0A 1MBZA 1EXWA 1Z35A 2G07A 2QD3A 1VPDA 2G5TA 2FWIA 3ELYA 1JF8A 3R9WA 1C3OB 1E79D 2YRFA 2WSSD 2QZPA 1DIBA 3HUEA 1B2RA 2RGBA 4K46A 1RI4A 4MRMB 3WGKA 3WWCA 1SWVA 4LJLA 1RAEA 3ZHSA 1ISFA 4FYVA 1F9EA 2QSYA 3ETNA 1H4QA 3CH4B 3F6SA 2AEFA 3I2YX 3W5UA 1SG9A 1Y81A 2OFFA 4JN6B 5KNDH 4CT5A 4EUEA 3TLJA 3FDXA 5UKDA 2JCXA 3FAZA 2DJ5A 1KOLA 5FUMA 1QGUA 5GOZA 1JSCA 1E7MA 2BHLA 4LY9A 1H1DA 3DJFA 3UN1A 4XB2A 3WE7A 1X9IA 4I7EA 1GKYA 1YRBA 1V2GA 3UKJA 2IF0A 5HP4A 4M9QA 2B1QA 2RHGB 4I1RA 3D9QX 2P5YA 3HC7A 1IHOA 1G8SA 3DF9A 3RUEA 1PO7A 2AN4A 4C05A 1NGSA 1SK8A 2DBQA 1EDDA 2RDMA 3L0OA 4KG7A 5EJ5A 5EINA 3NV9A 1Z13A 1ZUD1 3SZ3A 3ETCA 3IBTA 3OLXA 3V42A 4Z9AA 2R66A 1C2YA 1RVV1 1XU4A 2NQ8A 2ZBUA 2BI7A 3F98A 3BEDA 3AZQA 5F1PA 3VU9A 1T9AA 4D4HA 1U0OC 2FSPA 3MTIA 1NF3A 4KK3A 4MEJA 1TT7A 2NU8A 2HI0A 5EIWA 3SF8B 1V47A 2PIAA 3PUVA 1XV5A 1R37A 4G2NA 3QBEA 4BMPB 1ZXLA 2J5RA 1JNYA 1BWSA 3IKTA 1HLPA 2EAUA 3GLGE 1OI3A 3GVCA 5K6AA 1XMOB 1K3UB 2QTHA 1S02A 6REQB 1N8SA 3GFVA 2C1EA 1L8XA 3G8YA 3BQNB 1NDQA 1RYEA 4R2JA 1FDIA 4KSBA 2B36A 3GUHA 5J1TB 2N46A 4FZJA 4ZODA 5CLJA 4JT4A 3M6WA 3CNLA 2IP2A 2WIAA 4FLEA 3KWMA 2VS1A 3TD6A 4O4HF 3L7YA 5D2CA 5F73A 4BNMA 2NGRA 1UINA 4EJ6A 1P1KA 3C97A 1QGOA 1QMGA 2UVDA 3L4KA 1AG9A 1MX9A 1R0XA 2EG5A 2J7PA 2A58A 2X6TA 3PK0A 4YRJA 1GWNA 3VUEA 3F3KA 1K6IA 3O8NA 3I4CA 2CNWD 4DBLE 2ASVA 3C45A 4A0QA 1VLLA 5GTDA 3CURA 1PD0A 4AO6A 2AC7A 1MG0A 4LGMA 3L3BA 3M9XA 5SZIA 3CRMA 3BRCA 4J3FA 4JOBA 4X1YB 2WD7B 1FOEB 2XUIA 1U0HC 4PLVA 4ZVQA 2HX1A 1UPBA 4BAUA 3INGA 1GDTA 5JRDS 1BKDR 2V7VA 5BR8B 5EZ6B 4IDDA 2GSDA 4ALNA 1FDTA 2Y1KA 1YL7A 3LQQA 2OHHA 1F48A 4D6YA 3T7AA 2CUKA 2QORA 2XZPA 3HWRA 2AG8A 4AROA 3IMFA 1E2DA 1X7ZA 2IU0A 2C8KA 2J7KA 5DSTA 1G20A 3NI2A 2JVKA 2VUSA 1BFUA 1V37A 4M1YA 1BD4A 4BLTA 4WERA 1VI5A 4IILA 2MINB 4F38A 3DEAA 2B8TA 4K86A 4RJJA 2GJ9A 2VUTA 4B6RA 1SIBE 2EERA 2FF5A 5DT2A 3WZMA 1GKLA 3IAUA 3PDHA 4I1PA 1EVJA 2B7BA 3LV8A 3U4HA 3DOEA 1NI3A 2ICAA 4PVDA 2J31A 5JPIA 5AW3A 1QRSA 1T1SA 2FWJA 4CZ2A 2K6GA 1DG9A 3G6WA 2TMDA 3TOSA 4Z6KA 1UZNA 1KTVA 5CEEA 1V4BA 3AEUA 1R5OA 3K4PA 3NBAA 4QBFA 1C9YA 2WHYA 3GRRA 1E1DA 4LHYA 4BS9A 1N0VC 3JD3A 1L0BA 2MSKA 4L6AA 4MUNA 1HPLA 2K7ZA 5TEWA 3SOPA 1PUIA 4BKQA 1P2TA 5EUQB 3C0KA 2XT9A 4EX7A 3SIRA 2FUKA 2YHAA 4RF4A 5FPYA 4MUMA 3ILHA 3FLBA 5FTMA 2E4WA 3JAKB 1L8LA 2PQ2A 1WL8A 4OH1A 4UHJA 4ZT3A 2PT7A 5F9MA 4CIXA 4EPXA 5LFAA 5BT8A 4FGSA 4S3MA 2NTNA 2AFHE 3RHFA 1P4RA 3S2GA 2EKBA 1IUKA 1C9EA 4EPVA 4YCSA 4F86A 5ALZA 3DZFA 3SG0A 3MS4A 1ML3A 1R3DA 3OJCA 4BZZA 4WNIA 2B8EA 2WYOA 5AM4A 2XB8A 2VNJA 3PC2A 5KCZA 4HNSA 1PL8A 4HT3B 2O3SA 1SCNE 4IIYA 1SR8A 3BIWA 5ICMA 2B5WA 2HHCA 4RDCA 1TZMA 1NP3A 4AJJA 4C14A 1S0UA 4ZEMA 5G41A 4E4RA 4OHMA 4R6XA 1O95D 1INLA 2HU7A 2VZ0A 1GPWB 3KR2A 4XD2A 4A0HA 2XCQA 4AAYA 2WFAA 2X41A 3E9RA 2PWPA 5E8RA 4ZGGA 1L3CA 2BH9A 3THXB 4HYYA 3FMIA 1W47A 5DWQA 3UXHA 4J1NA 2YWRA 3C24A 1UL1X 4F9GA 1FA9A 3WQHA 2CZGA 4HAZA 1KVTA 3PC6A 2HEIA 4J75A 5K8UA 1NYLA 4U2FA 3ZWNA 1WW3A 1THZA 2I7XA 2WYVA 1E6MA 2P9BA 2WVGA 4YHBA 5I7UA 1K89A 1G8HA 4KX5A 5JS6A 4PN7A 1HKHA 1ORTA 4XA8A 1QO0D 3CRW1 4GI2A 1S3IA 3KSUA 1NXSA 1P2FA 2V98A 3LOQA 5D1HA 1JAHA 1QFYA 1K5DA 2NIPA 1M7BA 4DUGD 1X1TA 5A4AA 1QCCA 2NYVA 3JWJA 2C0CA 5CLIA 5JYEA 1R0RE 3VR2D 3KJFA 4GYJA 4M9CA 3G9QA 4PYMA 3AVPA 1AB5A 2WSLA 4DSTA 3W05A 3PC8A 4PAGA 2WM2A 2Z5GA 1OYWA 2IEBA 1YBFA 3AF2A 1KC3A 1E32A 3GFGA 3DULA 3ILVA 4J9VA 2V0GA 4K9DA 5IUJC 2R1TA 4BQNA 4CMIA 2O6LA 2GJSA 2PBLA 2PXCA 4JHXA 3MPUA 4CBVA 3GJYA 1ZA1A 3WIDA 2MSWA 2G3YA 5AW2A 2ESRA 3UMJA 3GLIE 4RVGA 4IIJF 4NU0A 4B7CA 2YFQA 1KY2A 1ZEJA 1G20E 4J91A 4LNUB 3PIIA 1ATIA 1J20A 1M34A 1UMCB 3P9YA 4D8VA 4XX0B 5D86A 5M04A 1Z4QA 2GLTA 1L4LA 4DV5B 2V9ZA 1BNCA 1TW3A 4OHOA 3CISA 4DPKA 3PZBA 1J8YF 2JEOA 4PNEA 4DLBA 1DT5A 5JU6A 3A70A 4EZEA 2H1IA 1Y82A 5GM2A 2UXDB 5FEUA 3RUPA 5HZGA 2B34A 2WSMA 2XUAA 4OLBA 3HRHA 4FN4A 3V8VA 3WQBA 5A04A 1I0LA 3BOSA 3SHTA 4BO5A 3Q2OA 3EWAA 3JQRA 2Q28A 5D3KA 2J8ZA 3UV7A 1O6CA 2YXEA 3FMFA 2YZKA 1D7AA 4Y6SA 2IHJA 3QUAA 3PNYA 2C9CA 4CF3A 3DKPA 4UMVA 2ZZKA 3W8NA 5EIBC 2AMVA 2ZE6A 3BMOB 1PQPA 1DKRA 1TK3A 4C76A 4HBGA 1MXHA 5F3WB 5ENZA 3UTCA 2BM8A 5K2MA 1A1VA 5JJLA 2TMKA 2GCPA 4M98A 2MR5A 2WQ6A 4DLZA 1SNYA 3X1ZA 4RHXA 4HG2A 3W8EA 5I9NA 1QCDA 3GQVA 1WEHA 1PV1A 2B61A 2RH8A 3SXPA 4L6CA 1DNPA 1Y3BE 2XQVA 4ZQCB 3V4FA 4Q4DA 1L4HA 5IJXA 1CR0A 5IJ0A 1XZDA 2FWMX 5EJIA 4AQ7A 1FFEA 1C4XA 1NUUA 2I6FA 1VIYA 3DVAB 3VAYA 4B84A 4ESOA 3LRPA 5K0FA 4NU6A 1QZZA 3KVYA 3NLLA 4IIFA 4UUQA 5BXQC 4LE1A 4KVAA 1XFDA 2X4GA 4WBSA 1USVA 3HY6A 3E58A 1CB0A 1FXUA 1H4TA 1K9SA 3FCXA 3GGPA 4C4AA 1E99A 1AF4A 1E6LA 1YQDA 4ZI2A 1PJ8A 4XOUA 4ZQHA 3ZLVA 1D0IA 1U0TA 3ETDA 4OXQA 1SBYA 3OUTA 5SV2A 2EVWX 4LY0A 2O2ZA 4MWZA 1Y37A 2HRZA 4HGOA 4XTCS 5A2GA 1Z8DA 1WPQA 4P3OA 5JCPA 2QYOA 2DX7A 3KKOA 1BXZA 3ZLUA 3Q9SA 5DNAA 3D1JA 4GL2A 4FHEA 1IUOA 3VFDA 5CLQA 2XUDA 2C61A 2Q4DA 1KMHB 1Q50A 3SN6A 4NIMA 4OXRA 2MU1A 3BYZA 3CIOA 3Q8KA 1JLKA 3T9CA 3IHKA 4D4LA 1PW7A 1GL6A 1BYIA 2JFUA 2X7XA 4LDZA 1KMNA 1ONNA 1W85A 1FRFS 4K9RA 3WKEA 5E3IA 2Q0QA 2DFNA 4UNIA 4C0XA 2JBAA 2O0HA 1QIGA 2BT4A 1T8UA 1P1JA 3R76A 5JISA 4F4HA 2VYQA 3UATA 3OQ6A 2FUEA 2OYRA 4RULA 4ID9A 4I50B 5B3JC 4RH0A 2IHYA 4IOMA 4QYIA 3S7TA 2IS4A 5DM70 3ABIA 3D6TB 5EA2A 3RK0A 2DBYA 3RYCA 1NC3A 3JYOA 2FPOA 1MVNA 1GILA 4L28A 3THSA 4F3NA 3KQHA 4QOEA 4NBTA 1XRQA 2ERYA 2JLXA 5EJ4A 3R6GA 3H0KA 2AD1A 2EKDA 3OX4A 4II7A 3LI2A 5AKJA 2QNRA 1OJLA 1QF7A 2E4AA 4Z3OA 4DBLC 4ZT7A 4TMZA 1BGWA 1CFZA 5EWLB 4BMNA 2YMMA 2YZ2A 1EUCA 4WY5A 2C95A 4ZOQI 1GXSA 5FA6A 5AJXA 4AD8A 1F2TB 2VIIA 4MA4A 4MW1A 4XVHA 3M1AA 2YHSA 1HA3A 2DH6A 4PYLA 1TF2A 1X39A 4JY7A 2GPNA 4KXYA 5ESDA 3ZIAA 2YX1A 2AX4A 3F6CA 2A14A 4MQEA 3V8MA 1UFQA 5HKKA 2XA9A 3A6JA 2CUNA 1OH6A 3Q6MA 1R0LA 1SM4A 3OPVA 3PLRA 2VF2A 4MVCA 4UXHA 1E0JA 1JEJA 3E4DA 4M54A 1W76A 3EVAA 3G8BA 4URUR 5E6UB 4I4IA 4MR8B 1T3TA 1J0BA 3IBFA 5KJEA 4CV1A 4E11A 5IG2A 4NARA 5KBYA 1VSQA 1AC5A 1UFOA 2Z04A 3PPVA 4ZOBA 4MA5A 4U7JA 4LHVA 1SU7A 5ESRA 4C4ZA 4RIIA 4ERXA 1FMJA 2CC2A 2HJGA 5ALEA 1NSYA 1G1AA 4CDGA 1Z6YA 3VSBA 4KQIA 1JHYA 3AETB 2K7FA 5KNDD 3DOUA 2Q6LA 2PGNA 2IGBA 3UUEA 4K9PA 2NP6A 1N7HA 3SS8A 2CLKB 3TOXA 1CY0A 3QPBA 3ZZTA 5LMCA 2B82A 5DYNA 3ZHTA 2BP7A 3KBOA 3LUDA 1A0OA 1O96A 2HNAA 4MS3A 3NOVA 3RYTC 1X7DA 2OGZA 5EZYA 4A26A 1YBAA 1SC9A 1NVEA 5BV0A 4LHZA 4DM4A 5KYKA 1XPRA 5HOQA 2W7TA 4LX0A 5H1YA 2I4TA 3OJFA 1A8IA 4OYLA 2FN4A 4KHPB 1ADFA 5FR2A 2ZIWB 3A1DA 2BTQB 3EHDA 4YRCA 5LC1A 3AHHA 1JFFA 1UBTS 1WR8A 2J46A 2Y1DA 3DZGA 3TTVA 5JLJA 2AE1A 1T15A 4X20A 4UE3S 2QN3A 3T3MB 1AO3A 1FP6A 2OL4A 3EIUA 2PV7A 1NXPA 2IODA 2BGMA 2ZULA 3GFRA 1TU3A 2PQMA 4TL6A 3A9VA 1KBQA 1Q0PA 2ZPAA 3L5OA 4IFEA 5DP1A 4O8ZA 5LBTA 3SYRA 1F2UA 1R8YA 5E3JA 4KQHA 5EGSA 9LDBA 1DOHA 5CLHA 4HY3A 3UY4A 4BB9A 5K8LA 5KKAA 5JZBA 1Q44A 4QDTA 1T6BY 1TTTA 4MCJA 3C43A 4NFLA 2X40A 3VM6A 1EZZA 1R4NB 3RFVA 4Y2VA 5TQ2A 1XHEA 3TRHA 3CCBA 3F7NA 4KR2A 1L7VC 3ZBQA 1UWVA 2DQ4A 3RFUA 4IGKA 1T9GS 5DGXA 5B3JA 2CV2A 4KB5A 4X91A 3COYA 4WOKA 2A59A 4YO7A 3ND6A 3BE5A 4L5YA 1RAHA 1R8SA 1W0JA 4UM5A 2OB2A 4PC6A 2O8VA 5JYCA 2F9LA 1U1FA 2GBIA 3K0HA 1QLHA 1PR4A 4A92A 4E1AA 4DEXA 2XDAA 1GY8A 3X2EA 4A8JB 2BFNA 2GRUA 4M8SA 3WS7A 5I5EA 4INOA 3GX1A 1QHHA 3DGEC 1YC5A 5A0VA 5LZ4A 3ZGZA 3A3PA 2GBGA 3IBGA 5AP9A 4UE6A 4WX2B 2ACKA 4YJFB 3G5MA 4CF7A 4JHLA 2I62A 3GT7A 2W2MA 4NJOA 3TB6A 3BMNA 1DRJA 3W77A 1YCGA 1RYHA 3UHJA 1QYRA 1QSGA 4KCGA 1O4WA 4RGYA 4Y1RB 4B4KA 1RKUA 1RPJA 1YZLA 3TWOA 5JC8A 3E7DA 1MV8A 1P0IA 2BGLA 5EP2A 2PJUA 4E15A 3E2IA 2HAEA 2YS6A 4QVKA 2WHPA 4PHFA 2IYEA 1ZGGA 2P9CA 4MRNA 1P72A 2QRNA 4GE0A 4XYBA 3EIOA 2WJJA 5A9SB 1ORRA 2XBLA 3AEUB 4R1PA 1T8RA 4YDSA 5DK6A 3TVTA 4ARZA 3F4LA 3D7SA 3NKVA 4OYRA 3K70D 1B0ZA 5C4GB 3MRTA 3N76A 4FZRA 4EATA 3G2LA 2O8NA 2QLNA 1W4CA 3QOFA 3ZQUA 6GPBA 3RIGA 3QQPA 5GAJA 4EY5A 2WQZA 3ZWMA 4Y1RA 5JXWA 3LCMA 4BNDB 2D5LA 2ZS7A 3T95A 1UWKA 3EGDA 2PS1A 1QKJA 1PK9A 5K0GA 1V3VA 3W3AA 4PQEA 5HFNA 1G8FA 4AY5A 1ZOLA 2O2JA 4L78A 5E1OA 5BVGA 2W58A 3D31A 3EXEA 4URHA 5CVCA 3SSOA 3J7AC 3FF4A 1JR4A 5CDHA 3M6XA 3H3JA 1UPCA 2CD9A 3KZVA 4PZLA 5TRTA 2HK6A 4CNQA 4E6EA 3PGKA 5J23A 2P0EA 4R0MA 2RHMA 5JZMA 1IAVA 3DTNA 2G5PA 2VXYA 4YCDA 1B76A 3A14A 3W90A 1ACMA 1DZ3A 2Z6AA 2AW3A 1ORDA 2O7VA 3HCBA 4Y3UA 3MJSA 1MFPA 2X9NA 5LQSA 1WBBA 3SYLA 4FN5A 3SX0A 4FLFA 5F2OA 3TGWA 2B6NA 1ZSYA 3VDMA 1C4WA 3I9NA 4MEAA 2R65A 1BH2A 4CM9D 2GPWA 2P6OA 4TUYF 5IVHA 2VK2A 4CCWA 2Z4TA 1NXOA 2ZJ0A 3CE6A 3PFFA 1KYQA 3V1UA 1UWCA 1XZFA 2NO0A 1GLGA 4HX9A 4NZ9A 1BQ4A 2X8LA 4DMHA 1HLFA 5H9VA 2D1TA 1BRMA 1YR6A 3NX4A 4KYIB 5DWDA 4CM6A 2IPLA 2W11A 3N0XA 5FQOA 4XI9A 1DHRA 3TDNA 5AW7A 3WA6A 1CUAA 4F91B 1KEVA 3GLHE 3F6EX 1EP3B 2XB9A 1FNDA 3B82A 2VPXA 3K7EA 4QJ5A 4TTVA 3KAQA 5JBIA 2JFZA 2BR5A 3P9CA 1MD9A 2GA8A 4MUBA 3A1FA 4EG7A 1Y6FA 5H68A 3QJ5A 2KS6A 2PS0A 2XHEA 2I66A 2XQIA 3L40A 4KO4S 1XL0A 1BS2A 4EAQA 5KU7A 1AZSC 5A5VA 4DA8A 3SR0A 4TL7A 4Q9JA 5K1ZA 1PJZA 1TTHA 3OCUA 4JFRA 4JGBA 4C5CA 4IFIA 1VGVA 4IVRA 2A2ZA 4YRSA 1TZBA 1P3Y1 3M6UA 1X80A 3WHLA 3EVTA 1KU0A 3ABZA 2ONJA 3MUFA 5K99A 2HU5A 3TOVA 3BB1A 3JQ6A 1RHMA 1KFBB 5E4FA 5C7LO 2ZUFA 1IY0A 2DQYA 2EEPA 3Q3GE 3K2IA 5B53A 3UB2A 3U7GA 4YAUA 1BMFD 4AN0A 3M0EA 4B4WA 5JDIA 2ZT6A 3OAAA 2BM1A 2CDAA 1Y80A 1KZ1A 1ZXBA 2N75A 2TRSB 2YN2A 4HAXA 5JLAA 3UK2A 1WCV1 1Q14A 3OJWA 5DBGA 5TT1A 2AG1A 2HHHB 1XNRB 1M1XB 2I8CA 4TT8A 1NW5A 1R4MA 3I04A 3KFVA 1ABFA 1XQ6A 2PZLA 3KQOA 4MWTA 4PHGA 5DYTA 4E2XA 1ZJ5A 1DQPA 3LUGA 1B00A 3KKMA 4P36A 1QH8B 4X7RA 3NMUF 1Z4MA 1DO2A 1W49A 3FYHA 1N1DA 5U4QA 4D8YA 4ENSA 3O8RA 1X94A 1VDZA 3PYLA 1P17A 2W6JD 5C1IA 4I4NA 4QUKA 3G88A 3GJ3A 3HLTA 4MUKA 4YUVA 3T3HA 1CY1A 2WTEA 3AHFA 3OZBA 2ZEJA 1EB8A 1GYRA 1XEWY 4QUIA 4TZ0A 2XGOA 1CUCA 2MR6A 3MXTA 2R7MA 1R0KA 4MHSA 2H57A 2VF7A 5HQ3B 3O4JA 2VK4A 3S7ZA 1L8OA 4UFNA 5AI9A 1NZFA 1X9GA 3WP1B 1IXZA 3AW8A 2JLAA 2P2SA 4YALA 5ESWA 3W3AD 4YJ3B 5ADUS 4UAUA 1ORVA 4TWBA 4MW0A 2COUA 4YAJA 2QQFA 3JR3A 2AQHA 3SS9X 3RQSA 4TSFD 5IKOA 4YJDA 2FPWA 3LY5A 4FMCF 4RIFA 2PA3A 1UC9A 4ZVTA 4G07A 4RA6A 3R9IA 5KNBD 1O94A 3QKUA 4QO7A 4IAOA 5KHLB 1W0KA 4XCQA 4NXNB 3JQFA 2WZDA 3KTOA 2F8LA 3OZUA 4MUXA 3MIZA 4TMTA 5ADWA 1XTIA 2GYWA 3ZJYA 2P35A 3CUVA 1E2MA 2B83A 3ZK9A 1IJEA 2IQIA 4GVPA 3QEBZ 2OFWA 3A1SA 4PZCA 4Y2JA 4DB2A 1QIIA 2CXHA 1Y33E 2JFQA 1LLUA 5FB3A 3VV3A 1IIBA 1K06A 4LISA 4U7FA 3CLSD 3B53X 3EPRA 1XTKA 3NC0C 5F2NA 4N5NA 2YICA 2IEDA 3ZIUA 5NULA 1H0HA 4X92A 5F5LA 1GP2A 1QAQA 1E61A 1P9OA 1N6HA 3CR3C 3DE3X 3THWB 4RDIA 2ZSBA 3KKKA 4UW9A 3G2QA 4H3SA 1QGUB 4C4RA 4HSEA 1YL5A 3LKZA 4G4SP 2XRYA 2XH8A 4PYRA 5IT5A 1P6XA 3H11B 3I5XA 4L73A 2ONCA 3DGFC 5D1NA 4DLPA 1NSFA 3EJWA 1VL8A 3GRPA 3V4VB 4YMTA 4EF6A 4FW9A 5AVUA 3OIYA 1YJBA 3MTDA 4NATA 3AF6A 3GLKA 1UMKA 3GXOA 2G04A 3ZXXA 3ZE0B 1QZXA 3FVQA 4PGMA 4G1EB 5I7EA 5KYTA 1WDTA 3Q0EA 4G5SA 4AF7A 3BJZA 1VJ5A 4D92A 1J0XO 3FYDA 2JF0A 3PGJA 4O59O 4P82A 4E13A 3MYRA 4BWVA 2VKQA 4QUGA 2MOKA 2Z98A 3HXPA 4YIHA 5CT4A 1NXTA 3VC3A 3NUZA 1U02A 2ZRIA 1WO8A 3HBFA 4FJ2A 1S2GA 2WWFA 4CF6A 1XEFA 1F8UA 5IVIA 5JEEA 3D0RA 5KX5A 5LXTB 2F00A 4KE9A 3U56A 5JMOA 1ZGCA 3T3DA 3GEBA 4YA6A 1JLLA 4ZI7B 5BV8A 3JVIA 1N9GA 2P9HA 3HA7A 1N8NA 3GMTA 4ZEWA 3ZTYA 5DHRA 1H6DA 5AI4A 3RROA 1C5KA 1CUHA 4M38A 2GM5A 4F06A 1M0EA 3A6KA 1Y1RA 2HRQA 4NNOA 4M89A 4FJ0A 2VHYA 3EZ7A 4L9SA 2G0NA 4X3CA 1BVUA 3CR7A 1C7JA 1UBGA 5TMBA 4H7PA 4OK3A 3FR7A 4XYEA 5IW8A 1S7GA 4YUZA 1QMPA 1N8TA 3DAHA 5TGDA 2PSFA 4FKZA 2ONKA 1QLWA 3UFXA 5FAKA 1JYFA 5M2QA 5FO0A 2OCDA 1YIDA 3DUFB 3Q7PA 2FJUA 3G0OA 2NW6A 3F4KA 3OT4A 3W04A 1W52X 2HEGA 3MQFA 1D04A 2R8EA 4DCGA 2GCOA 3JAWB 4PSKA 4Q24A 1MDBA 3CY6A 4ND2A 5KSZA 3CVWA 3FFXA 1G18A 4LBWA 3Q85A 5FOUA 2PT5A 3U3KA 1V4VA 1HGXA 2CLDX 2H4YA 1RRVA 1AK9A 4CEIA 1GCGA 1SD5A 5HTKA 1MHPA 3DDUA 3LUFA 2C9OA 1ODTC 1B8VA 4IIDA 4UATA 5FP0A 3ETLA 4I1OA 3NT5A 2EKPA 5ALXA 1VSVA 4P7KA 1IPEA 4WK4B 1NA5A 2FWRA 5BN4A 1U31A 3RJMA 3VPGA 3L4SO 4LHXA 1IH8A 4ZEOA 3DFZA 4LYHA 3L7NA 2WJ3A 3CLRC 3M4NA 4G8JA 5DASA 5KJCA 1U81A 2Q07A 2NTJA 4CL0A 3HB0A 1JG2A 2EW1A 2GPYA 3MJVA 4I1IA 4J2TA 4MKIA 1I51A 3DOIA 3V33A 1NNEA 2CYAA 3GBSA 3CZPA 3KQNA 2VH1A 3D3NA 4I8IA 1GPDG 1NFRA 4HDOB 1A7AA 2KX7A 4XIIA 4WWHA 1ECFA 2Q1SA 4O4HA 3I6QA 1CQWA 2QJWA 3D54D 2YINC 1CUFA 1LKZA 1US8B 4YRQA 3V8PA 2RH5A 2HW8A 3PX2A 4GMXA 4PONA 3JZIA 3LZ6A 4NMHA 4IZ6A 1QHHB 1H6AA 1WS6A 3LVRE 5HYVA 1CF2O 2W6OA 3HSSA 2LVBA 4D4KA 2JLYA 5KPJA 2YNMC 3U7EB 1ARZA 2JHPA 2HGZA 3UB3A 2WPDA 5JCOC 4XXHA 3VO9A 5KVAA 1GNPA 1KRXA 1PZXA 3AESB 4CETA 2YFHA 4V0SA 1KYVA 2CUZA 2REQB 3H5OA 5DISB 1L8AA 2WWTA 4PBSA 4RF5A 1QHEA 1BMQA 1PEAA 1W581 1OH8A 2YC2C 4L4RA 1XRRA 3QUTA 2QUAA 4H4EA 2O0LA 1KAQA 3HQ4O 4G5QA 5D3ZA 5CLFA 1QGZA 3PNBA 2O8FB 3K6RA 1AF7A 1YCHA 2BFMA 2BEUB 5CM8B 2XADA 3HFRA 5AKKA 4OI2A 4YUXA 5LXTA 3U7HB 3O1LA 3R3WA 2Z8XA 4BQQA 5JSQA 1EXNA 2CD7A 4OSPA 3IIEA 4LXIA 3VAAA 5FLYA 1GQOA 1XRNA 3FGOA 5C53B 4QGAA 4EMTA 4N9WA 3WG9A 2P69A 4Q4CA 2O59A 3HLKA 4Y9TA 1X3LA 2FW8A 3Q3CA 1N3IA 4QGHA 2JJQA 4D9MA 1EFCA 3RAFC 3EWIA 1C8KA 3L01A 4CLOA 4X63A 2W2LA 2I1QA 2RFLA 3AUKA 2WJYA 1PJSA 5EUMA 5C4MA 5JBQA 4MQLA 2ODPA 4C88A 5KNBH 4K0KB 1E6CA 3GOQA 5I7SA 3JWGA 2X0FA 5GADl 1HL3A 4DMKA 1W34A 3Q1KA 2KW5A 4QREA 1ENOA 5H70A 1SKYB 2KYRA 1KI2A 1NF8A 1T8TA 2Z56A 3M1LA 3QVKA 4J0IA 2O2HA 5CK4A 5DGIA 2JIRA 3TE6A 4M9XA 1F2VA 3B3FA 4W63A 4ENUA 2POQX 3AT1A 3LVBA 4WH0A 3RYIB 2Y66A 1UFKA 3PVSA 2JFPA 3KHUA 3DDHA 4Q5IA 1LBHA 3K0FA 3RC3A 3VR4A 2IY7A 5BVHB 4IHAA 2EWVA 2Q4RA 3TMAA 4CEIB 1VZ3A 2W00A 1GL3A 5LNK1 4RTMA 5BWBA 2OVFA 3BSSA 1P7CA 3R7WA 3DCNA 4GI1A 4AKHA 1WPXA 1SVLA 3MT7A 4XR4A 4KV9A 1EFLA 3HI6A 1RQXA 3IDQA 1G19A 3ORQA 1E1QD 3ZWVA 3O1JC 3UCXA 1HDXA 1R8XA 3L79A 3LPAA 2Q9BA 1WXDA 4J29A 1UBKS 3SFZA 1AS3A 2BRUC 2CDBA 3PJEA 5CNKA 3V55A 4YYEA 4NEHB 4WCFC 3RVSA 5IFLA 2AYYA 4MRVA 4CKZA 4JI7B 1KETA 2VPZA 5AXBA 3H2JA 4JP3A 4WIAA 4A0RA 3I61A 1WTAA 3KYCB 3ZWCA 5JMWA 3LO5A 3PHJA 2ZT8A 4XM2A 5DLYA 3X0DA 4IXTA 4DQVA 4R7GA 2J3IA 5LP6C 2WF5A 3N28A 3DWGA 3QH4A 3DLBA 4A2QA 1WOYA 8GPBA 5KI6A 5JRJA 2PIDA 4LAFA 2QTRA 4NECA 4EUKA 3NIDB 1IEXA 1SHZA 3LCJA 1OXMA 5J47A 1T5SA 3KUCA 2O0KA 4LNHA 5CGQB 2VTEA 4ZVSA 2IW3A 4F5ZA 5C8YF 1GGJA 1US8A 4Q9KA 3GN1A 3LBHA 2XTMA 1P39A 1OLXA 1NKVA 1OYOA 4QQKA 4F45A 2J87A 3EA0A 4HB0A 4JD5A 4L57A 4AS1A 2QP9X 2OP1A 3GP5A 4HQNA 3L4JA 3ZVNA 2YV3A 2C4VA 1I2MA 1XYVA 1HT0A 2ON6A 4O4LA 3GIDA 1WMFA 1U0FA 3AINA 4BGIA 4BO1A 1TYCA 4NYIQ 3WNBA 1R3UA 4AFNA 2Q3JA 5A4DA 1I7DA 2H1CA 1K0FA 4QOGA 3I2GA 4CTMA 1P7VA 2V9PA 5ICCA 5LMZA 4RZ2A 1OSNA 2QXYA 4FT4A 1ZD1A 3G2PA 5CURA 1UUFA 5BNIA 4N0MA 4JI2B 3SHFA 3BFJA 2P3LA 4WRRA 4KBGA 2VT7A 4QAQA 3VHRA 4BUCA 2I2WA 3BX1A 1M34B 1UMCA 2DMRA 3B48A 4R9RA 4ZCSA 3M6MD 4ZJPA 4N48A 1YKGA 2YJGA 3CCCA 4PRZA 1SZCA 5JYBA 1BS1A 4B8WA 1PK8A 1M5TA 1Z39A 3OWOA 4F11A 4EYQA 1DAKA 2X9LA 2GDJA 3GFBA 2IKQA 3I83A 4C30A 2PXXA 3NEJA 4B81A 4M88A 2H2FA 3LA6A 3OPMA 1QPBA 3MJFA 2CHEA 1LSJA 2FPGB 3IV6A 2QTWB 2RHWA 5FBRB 2J3HA 3CN9A 3N9IA 3VVMA 4MVJF 5MHTA 4JI0B 3HJUA 1NOKA 2ACVA 2OZKA 1YWGO 3PVZA 1PS9A 4K87A 4B83A 3CZ4A 4RY2A 5J4HA 1OXXK 1L1RA 1T4CB 4B32A 1FYWA 2XOKD 3SC2A 5IH7A 1E9CA 4BLPA 1DFHA 3JD4A 1FP7A 1U9YA 2B69A 4P3YA 1MJNA 2XMCA 4BFUA 4BQEA 4EF4A 1XELA 3Q2IA 1XDWA 1K4MA 2Q3MA 5DLDA 3S6JA 1OI2A 2D54A 4EL5A 5BR7A 1LI5A 4LYFA 3HJCA 2Q27A 4MO2A 2B0JA 4TXNA 4PCVA 3AFNA 2P7IA 4HRYA 2H48A 5DCUA 5A1JA 2FZCA 3WJ1A 4UOZA 1TFUA 1UT8A 2XF2A 4PLYA 1KYWA 4CQMB 2EF0A 4UHEA 2PQ6A 3GFOA 2V03A 3LPMA 1UDXA 4OXXA 3PUWA 1IUNA 1CEYA 1ZFNA 1KI6B 1LLCA 4HLCA 3EB9A 1AKRA 3COPA 4FDLA 2DBRA 4EEXA 4TWZA 1E1QA 1K7XB 1XMXA 2HQRA 1M2WA 1VHLA 2PLRA 2CF6A 3VR3D 4A9AA 3RRBA 2AC2A 3KWFA 4PU0A 4QT4A 1CYEA 1U0GA 1ODLA 1ZNZA 3BAZA 2C2GA 4HGZA 4F6RB 4DG5A 5I51A 3HN7A 2HJRA 2NXJA 4R9SA 1M3SA 2QPLA 3HKDB 4V3BA 5HZHA 1FTSA 2CV0A 2KB0A 4BMOB 4C3VA 2PZJA 3F90A 1SCBA 3DOHA 2PGOA 4OIFA 3OX1A 2IZ6A 3EMBA 4WOCA 4B2IA 2HMWA 2HSDA 2HWKA 3AUTA 2QX8A 1EKXA 1WNTA 3BXZA 4CDNA 4BEVA 5EP1A 2WE7A 2ZCVA 4D3ZA 5ICGA 5IXYA 1RM4A 4NABA 2R6JA 2CVQA 2NV2B 5F21A 4JT9A 3VU1A 2C4TA 3M3DA 1CY4A 1HH4A 2CNWA 4Q4LA 4WZAA 2DH5A 4DDKA 2V7QD 3PKZA 1MENA 3VH3A 3HMQA 2JBAB 1T3LA 3JASA 3RPEA 5TQ0B 2QYSA 3TVYA 2RAFA 4B40A 1ORIA 3TZLA 2RIPA 2VJAA 5HIAA 6PFKA 3AVTA 4U5XA 3PS9A 4JP5A 4RVOA 3FHTA 4TMYA 3K1TA 5GVSA 3IMKA 4UNSA 4WINA 3UF0A 4FFBB 2C2XA 2ERCA 1FP4A 3BH7A 3UMRA 1OIWA 4CQLB 2WICA 1L7EA 4EY7A 1HKUA 5J4VA 1XZEA 3S2UA 4HNUA 4FGLA 1W25A 3U80A 4PC3A 4NENA 4AKGA 2EZTA 1CUEA 3GQBA 2LCQA 3EC2A 3STXA 1ZHOA 2XE8A 3GCZA 3PXAA 2J0QA 1QO9A 4DCSA 4YHHB 2YXPX 1F51E 5CH8A 3S29A 1CVLA 1WF6A 5C7IO 1L5LA 1C3XA 4MGIR 3RSOA 2W4IA 3E53A 2BGJA 3VH4A 2M2IA 4P34A 3E22A 4RS3A 5AJYA 1WCIB 3ROQA 3CBGA 4RC9A 1AQYA 3N7UA 3U0VA 1IZ0A 1ZW6A 2FP4A 2GAJA 2YY6A 3SD7A 3VJKA 4DJJA 1QHFA 3H86A 2ERXA 3RRNA 2IBMA 2OV8A 2V4MA 1AOXA 5K05A 3FW1A 3LGXA 4EIWA 4HZGA 1ID8A 1R0ZA 3C3KA 1TZ2A 1PWHA 2AOTA 2D5IA 2O8CB 4XFDA 1D1PA 2AOUB 3U3ZA 2O5EA 1FQOA 1K6JA 5CR9A 4RQUA 5E7IA 5KYXA 3F73A 3Q0IA 2I3AA 1KC1A 2LNDA 3FMGA 3ZTWA 2VPWA 5EYPA 1AHIA 1BAPA 1JHOA 1T6YA 1XU9A 1SCKA 2I5PO 1VE6A 3IO3A 4Q3CA 4RY8A 4BNGA 3VC7A 2VI5A 1R10A 4L8FA 4GM4A 1FNNA 2GPSA 2OBNA 2DR2A 5JDCC 3A1UA 1ZGZA 4OHCA 4I9FA 3LNTA 3C3EA 1UEXC 3L0SA 1MAWA 3HXTA 4MLDA 5K8IA 1O08A 1P1IA 4R98A 1JHXA 2V6MA 5GONB 2ZXEA 5YASA 2OFXA 1ZIDA 2QLFA 5ALLA 3ZE7A 3U3RA 1PFUA 4LYGA 2WF9A 3JWIA 3KTFA 4D80A 4PIVA 1YRWA 4I2VA 2A0KA 1SBZA 1OFUX 3H7IA 3N8KA 4YCAA 4GBED 2F64A 3RYHA 3VC1A 1TCCA 1R9MA 1VG0B 4WY8A 2AB0A 2IQ5A 4PVCA 4N5DA 2WHQA 2RI6A 3IKJA 5IVKA 4IBOA 1EEHA 1KEPA 3FBGA 1HZZA 3HB1A 4KQGA 4QM7A 2DHDA 5ICFA 4DZZA 3QFTA 4NICA 2OO5A 1LI7A 4TS3A 4V02A 4J4BA 2QRVA 1IQUA 4LJ9A 4UUMA 4O4HB 2IYFA 4P2BA 4D26A 3TSAA 4YJ2F 5BN3A 5JI2E 4E22A