2B6HA

Structure of human adp-ribosylation factor 5
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
171
Chain Sequence
RGSLFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human ADP-ribosylation factor 5
rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords ADP-ribosylation factor 5
total genus 57
structure length 171
sequence length 176
ec nomenclature
pdb deposition date 2005-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2b6hA00
4MKHA 1OH8A 5E7MA 2DYKA 4WBSA 3K09A 2C2HA 4JLOA 4XSHA 1E2NA 1X6VA 1YHNA 1YKSA 4LYFA 3AVPA 3BORA 4P31A 2QPAA 2GA8A 3RS0A 1CR0A 5JJKA 3C4JA 2PCJA 2XNDD 2GCOB 1NG9A 5SZIA 4LJ6A 2BBWA 4MH0R 3CH4B 1E2QA 4PSVA 3B78A 3G5UA 2FWRA 3BB3A 2VHJA 3F0TA 4EJSC 4UNQA 3O8RA 1B23P 4WVFA 3NWJA 4Q7KA 2O0HA 3TUZC 3IILA 3GEIA 1X8LA 2D7CA 1G3QA 5L3SB 2NO6A 1E3MA 4NZYA 1KJZA 2V8OA 3AP2A 3NBYC 2BC9A 2WWGA 3CO5A 1Z2AA 4LK2A 4AY2A 1VHLA 1K5GA 2QP4A 2JLVA 3GLGB 1G5TA 2OBMA 5E7JA 1XTJA 5KNDA 1T3HA 1QHGA 4MYUA 4NTZA 4FINA 2ZAOA 4ZI2A 3PV0A 1G1MA 3KFVA 2WJYA 1NVXQ 3A1SA 2NMVA 1OFIA 1BO6A 1CULC 1Q1QA 2ZXUA 3CKLA 1NP6A 2C03A 1G3UA 1KO4A 2OXCA 2BKUA 1CJUC 3AP1A 3FYHA 3OIVA 1CXZA 3KXLA 4FI3C 4IDNA 4JL5A 3HU1A 4QL3A 1GRRA 4QXAA 4XWOA 1YZNA 1R5OA 2IHYA 4C0HA 3OIYA 2ZRHA 4HZUB 2N46A 2ORVA 3GJXC 3GJ7A 5F9HA 3TQCA 4LV8B 1WDTA 1F2UB 1A2BA 5DN6D 4ZDWA 2C9CA 3MGCA 5KOYA 1QHHB 2ZUDA 3UMSA 4RJLA 3L43A 1KK3A 3R8FA 2IYLD 1GL7A 4JSYA 3GLIB 3BIFA 2WPDD 1CRQA 3ND9A 2JLUA 2QTHA 2BM1A 4BE7B 1YQTA 1ZUIA 3BH6A 4PQYA 2WTUA 1N0WA 2QA5A 1II9A 3REGA 1OLOA 3WYFA 3L0PA 1ONBA 2QPTA 4HUQA 4QHTA 3BBPA 3E5HA 2JLXA 4YMUA 1T5IA 4LHYA 2YYZA 4B3DA 4DDUA 3RRYA 4URZR 2RGNA 4LJ8A 3FHOA 5JZVA 2O8BB 4RKEA 1Y3AA 4KVAA 4Q1CA 1D2EA 4YXWA 2V6IA 3AUXA 2LWIA 1G291 1AS2A 5EJEA 1DO2A 3LX8A 3QVVA 2A7QA 1XBTA 3GJ4A 4TMWA 2OLKA 5FBQB 2AWNA 3GFPA 4Z8YA 4B6EA 3B60A 4OQMA 2XSZD 1ESNA 3Q72A 4HUQB 4QM7A 2QORA 3T15A 4LJ9A 1E9SA 2QMUA 2Z43A 5HE9A 1R0XA 2C04A 3DL0A 3EA0A 4RFSB 1T4GA 2V9PA 4XVQA 2OXRA 4C0LA 2BMJA 4KFRA 3ZIAA 4WXPA 1P2VA 1JEDA 2CBZA 3LD9A 5CIQA 4UXIA 1XX6A 3LVRE 1NMXA 1II8B 4MKFA 4V0NA 5KPJA 5CITA 3AVOA 4JLJA 1D8TA 2DWPA 5L3SA 2IYUA 1DARA 1VMAA 2RGNC 2H7VA 2FGKA 1U99A 2QAJA 4MUBA 4ZO4A 2E87A 3VAAA 2ZRPA 3KXIA 1U2RA 1JR6A 2ASEA 2WWIA 4OBEA 1QZXA 4DLWA 4EPTA 2GF9A 3IO3A 4G5QA 1KDPA 4K8OA 1MABA 4YC7A 3ZS8A 3Q3JB 4OK3A 4I1OA 4R9UC 2V4ZA 1HT2E 1VCOA 3J81k 3IIMA 5FOWA 1DTSA 2GTPA 3C5HA 1NLYA 5F2EA 4DEXA 1P9NA 3IKJA 3CRMA 1R0ZA 3I62A 1RJ9A 4WAUA 2RGXA 4G3XA 2WAXA 4HLDA 4DXAA 4TYQA 1SKQA 3DZDA 5KTYA 2VHQA 2OBLA 4OHWA 4MYTA 2Q21A 1K5DA 4P4SA 1F2UA 3ASYA 4HLUC 3D6TB 3LBNA 4PPGA 4TL7A 1N2CE 4F7WA 2HXYA 2B7BA 4F4CA 3WXMA 4XIGS 1KDTA 1G4AE 2GXUA 3W6NA 4JL6A 1FNMA 2WKPA 1GRNA 1UADA 1XTQA 1Z6XA 2OT3B 1ZNWA 4R98A 1W49A 2Z0MA 2ZIAA 1RE0A 2ZSBA 3I32A 4UKDA 3JVUA 1P61B 3LBIA 3HPQA 4FCWA 1H8ED 1ZCBA 5FL7D 4A8JA 3LXRA 3QBVA 4PANA 1ZC4A 4KI0A 4P4SB 3DDCA 4A9AA 3B85A 1HEIA 3UANA 3CR8A 4Q48A 1E1RA 4KV9A 2G6BA 4D6PA 4V02A 1L4UA 2OZEA 3BFXA 3MG9A 5E3HA 2RCNA 4WIAA 3LV8A 1LY1A 4M8NE 5J4HA 1QHSA 3BD9A 4X8LA 4DIEA 4Q03A 4PTLA 1D6JA 3LXXA 3VR5A 4Q4JB 1SXJA 2XB4A 4DT1A 1N6LA 1VPLA 1OE0A 4TLCA 1M7HA 5F98A 1ZU4A 2F9LA 4Z1MA 4BECA 5M04A 4POAA 4LX0A 3F8TA 2IX3A 1TF2A 4F91B 2B8TA 3VU9B 3WYGA 1CLUA 4ZKEA 5JWRA 2W6ID 1DS6A 4WZAE 4JLNA 2WWFA 4HAZA 3VQTA 2YOHA 2ZS7A 2YV5A 4BFZA 1XMJA 2PEZA 1MO4A 3NVAA 3GLFB 2VRWA 3VTKA 3VFDA 5EP4A 1GWNA 4Q66C 1SVOA 2A5JA 2YINC 4Q1EA 3TIFA 3W34A 1N6RA 3I3SR 4IHQA 4AYWA 4TSFD 1E2GA 3TMKA 1XWIA 2G88A 3E70C 4G5RA 4QJ3A 1GVNB 3OEHD 2JLWA 1J2JA 3X1WA 1GM5A 1W0JA 5HPYB 1M74A 2FSFA 4NCHA 1BIFA 2G83A 1TUEA 4EUNA 2BWJA 2O8EA 5FI0B 3THXA 1LNZA 1KSFX 4V0OA 1L2TA 1KNXA 1TU3A 1TL7C 3DEFA 4TLDA 1CJMA 2QT1A 2YJTD 3K0SA 2GJAA 4EJSA 3Q5DA 1SZPA 5BWMA 5FBWB 4JZKA 2JA1A 2FF7A 2F9MA 3CIOA 2J0UA 2JEOA 3N2EA 1JALA 3K09C 3AF4A 3SE0A 1CU1A 2D3WA 5LB4A 3K0FB 4KFSA 3TAUA 2HEIA 4IDQA 1TF7A 4Q4LA 5FR2A 4EIWA 4GZMA 3KJHA 2EFGA 2ORWA 2QT0A 4G01B 4LBZA 3VMFA 4BEJA 1YZQA 2XOKD 2C78A 4BFYA 1P2TA 4LHVA 2ZU6A 3ETLA 1Q12A 2JASA 3PQCA 3RC3A 1IY0A 4MRNA 5JI3E 3LNCA 3MUFA 3NH6A 1HE1C 2PX0A 1TMKA 2BJWA 5D3MB 5J40A 2OBNA 2C9OA 3LQRA 3B8HA 1NBMA 4X8OA 3HJNA 4BPBA 4JLDA 2XOKA 1GNRA 1AGRA 3LO5A 3ZH9B 3D31A 1S3GA 1KO7A 5G3ZA 3GJ5A 2QP3A 2GCOA 3CUEF 5TDHA 4IJMA 3HYTA 3SJCA 4RD3A 5E7IA 3MCAA 2JLZA 2H57A 3PFIA 4MRPA 1CR4A 5EXPA 3I72A 1OPXA 2VHCA 4LUCA 4B33A 3QF4B 1GL6A 1OXVA 1UBCA 1NN0A 1ZJ6A 5JWOA 2IT1A 1EFCA 3VHXA 4DT1B 5JSZA 2VQSA 4GZLA 3MMPA 2WJHA 4Q9KA 1KJWA 4QRHA 2SHKA 3IEUA 3MLEA 5P21A 2HT1A 2ODEA 3VHLB 2V7QD 5B57C 3P32A 1P5ZB 2GXQA 2VIIA 3DM5A 5ELXA 3A1UA 1IHUA 3DO6A 2ZJAA 1FOEB 3OEHA 2V54A 3TE6A 4BRWA 3AKCA 1YR7A 2VP2A 4LJYA 2VP0A 2WBLC 1GTVA 1QG2A 4UNRA 2QUZA 3EWSA 3NBZC 4D2IA 5LPNA 3KQLA 4AKIA 1SXJE 4LPSA 2FN4A 4AKGA 2X8AA 4U02A 2IBMA 2FFAA 5JWHA 5D3QA 1X1RA 2L0XA 4M9XA 2J3EA 1DOAA 4TTQA 2IS4A 1QHYA 1UJ2A 4Q9HA 2V55B 3T06B 1DELA 3RSLA 1KDRA 2CHQA 2P2LA 4R2IA 2IL1A 2GJKA 1U0HC 3RWOA 5C2JB 3EG5A 2OUKA 4HATA 1IJFA 1DADA 1F3OA 3EW9A 3AQ4A 1CJVC 1QG4A 1VCIA 1AN0A 2CCGA 3DMNA 3IQWA 3C41J 4LPKA 1EFRD 4P32A 1AKEA 1ZD8A 3U44B 5IDVA 3R9XA 2C98A 1X8JA 1COWA 2P3SA 2HDNB 2P67A 2B8WA 2CL6X 2X2EA 1Q22A 4DLUA 4HAUA 4TMTA 2C9YA 5EE9A 1EWQA 1RYFA 4JLBA 1E2JA 2GK7A 3H0KA 2WHXA 4LV5B 5J5CA 2GEVA 2KE5A 4JLPA 4CEIA 4HZUA 2H17A 2WSMA 1TAGA 3GQBA 2F43A 1XD8A 4QJ5A 5SZKB 5EUQB 3UWKA 3HR8A 5CB8A 4GOXA 4IKEA 2OCPA 2O8DA 4PHHA 4FMCF 2A5FA 2QMHA 5CYOA 3W3ZB 2J45A 3UWOA 2WOOA 2VF8A 1TTTA 3SI7A 2IUUA 4DZZA 1II8A 2AXPA 1G6HA 2ZRBA 4KLZA 1J8YF 2R6FA 3KKOA 1U9IC 2UZ3A 4Q19A 3SDZA 1Z8FA 4PC7A 4LGMA 1A5TA 4W5WA 1N6KA 1AGPA 3EZ6A 4OQLA 4NYJQ 1CR1A 4MDFA 1OB5A 5JJLA 1KYIA 3ASZA 2HXSA 1HA3A 3SHFA 2QY9A 1Z3IX 2EVWX 3GLIE 2BKEA 4KU4A 1VIAA 1ZM2A 4MGIR 4IRUB 4PAMA 3SN6A 4M1TA 2YVUA 3THYA 1D9XA 1XEXB 4GT1A 3VR4A 4O2RA 3HR7A 4IOJA 1U9IA 1T0JB 2XITA 1KJYA 2D62A 1HH4A 1DAIA 2J5XA 2ORIA 3FVQA 4Q1AA 1Q3HA 3D3QA 3KKNA 2MSCB 2ONJA 2IEYA 2GCPA 2ZI3A 3U7GA 5AWFC 5HTKA 3P4XA 4O2LA 4Q4HA 1TF5A 4Q01A 5DHAA 5G41A 1D9ZA 4RD6A 1E1RD 4Y0AA 4YXWD 4NP6A 4I1UA 2IYWA 1NRJB 2A5YB 3RS7A 1PV4A 5BQ5A 2A78A 4Q1FA 2ZYUX 1TNDA 1RRFA 3QJYA 4GPTA 3K0EA 2REBA 4RD2A 2KWIA 1G3IA 1OHHA 4ESHA 3N70A 4B3FX 5B58C 3KKPA 2F3RA 2J7KA 3RRMA 3EARA 1YZKA 3QXXA 4JVNA 4PR0A 2A5GA 3THOA 2FE4A 3ADKA 2P5TB 1NF3A 1GNPA 2J7PD 2DWOA 821PA 4JBYA 4MGZR 1CEEA 2JLQA 3R20A 1HQYE 2GDJA 3SBDA 4D81A 1T5LA 3OEED 4OHXA 2WAYA 4EDHA 2JGNA 5FPSA 4PQRA 3NG1A 1XU4A 2IYVA 2FJUA 2OLJA 1WF3A 1ZM9A 1XMIA 2AFIE 3F5FA 3KB2A 1C9KA 3L0OA 2VF7A 4C9BA 4B75A 1MO6A 1IJEA 3U3RA 1IM2A 5TB5A 2Z4SA 2AFHE 4F4IA 3A6PC 1IN8A 2WWYA 3O8BA 3U60B 4KYIB 3D7MA 4CIDA 1E9RA 2RB4A 1GKIA 2W2TA 1R7RA 5JEDA 1J70A 4XOIA 5BYKA 4M1KA 3CRRA 1KO1A 1XTSA 1ZVQA 4ZPXA 4C4PA 2HCBA 3AF1A 2XZOA 3KQNA 3ZVMA 5CB6A 1FFHA 2YC4C 3QKUA 2QNRA 4LJAA 4DCVA 3AKYA 2FNAA 2DB3A 1XZPA 1RRPA 2GAOA 3B9QA 3OIUA 4TQ9A 5DE3A 1Z28A 3SFVA 1UKYA 1W2GA 3NHAA 1SQ5A 2G0TA 3RDPA 1RC8A 2HYIC 5DYIA 1ZCAA 3LFUA 1G7SA 1OYWA 3CONA 2WWHA 4O0MA 3NHBA 1UF9A 2GKSA 3ZD7A 4OJKA 4C0QC 1LS6A 5J4KA 3QKRB 1T0HB 1Y63A 3IDQA 5CJPA 5KSOA 2GEUA 1ZIOA 2CMKA 4LYJA 4PZZA 1J7KA 4C30A 2V3CC 1UKZA 1G20E 4RZXA 4BLOA 4F38A 1NVWQ 3N5CA 4HI0E 2GK6A 4TLAA 4BLSA 1HT1E 2GBLC 1XB2A 3E1SA 3SJZA 2WKQA 3FB4A 1QVAA 4JS0A 3FE2A 3RS4A 4CT5A 5DYGA 4B3GA 4U7DA 2O8CA 4XTCS 3EAQA 2XXAB 2FZ4A 5LD2C 2FSIA 3AP3A 3KJIA 2KB0A 1W4AA 2Q9BA 2OO7A 3HPRA 3NIBA 1HTWA 5TMPA 2FZLA 4II7A 1SVKA 1E2DA 1X1SA 1ZM3A 3LQQA 1JAIA 5KNBA 2QENA 1Z5ZA 5GVSA 1CTQA 1VCNA 3QOFA 4QGHA 2VP4A 3TVTA 4NYIR 5KNCA 4NH0A 1VECA 3L0SA 4JLAA 3CPEA 4B3BA 4DCUA 1E2PA 2OSBA 1TEXA 3PUZA 2X1VA 3SQWA 2X19A 2NTYC 4L5BA 5DI3B 1ZYUA 5EE5B 1FMJA 4ZIRB 1GG2A 1AKYA 4UXJA 4DLXA 1E2KA 1E99A 2JCSA 4DSOA 3EX7C 1WBBA 1YR9A 2ZR9A 1E6CA 2QAGA 5FUVA 3OHMA 1IN6A 5AJWA 4Q4JA 1W46A 2AK2A 4V03A 1ZINA 3BGWA 6Q21A 1S0UA 4M1YA 2RGBA 1XTKA 3FGNA 3L82B 2NPFA 4EQ6A 4TLEA 1D2MA 4TTRA 1MT0A 1UEIA 3QE0A 3FMPB 3RSOA 2JLRA 1SVWA 1IONA 3CX8A 3UXMA 4MRRA 3WNBA 2ZRNA 5H70A 4N0DA 1A82A 3BE4A 2IYQA 1ZAKA 3AVTA 2R44A 4Z1MD 4NL4H 1ODFA 4WZBE 3CM0A 3NXSA 4GMDA 1AIPA 1DG3A 2QU8A 2GZAA 2XX3A 1KMHB 3GLHB 4HEJA 4RD4A 4XTRA 4PC3A 4LYHA 1KK2A 1W4BA 2JDID 1LS1A 3KZ1E 1RIFA 3AV0B 1FNNA 2G9NA 4ITRC 2ONKA 1EFHA 1KTVA 1Z0FA 4M0LA 2V7QA 2VP6A 1DAMA 2CCKA 4TZ6A 4TL8A 1FW6A 4KBGA 1MOZA 4DDTA 1P6XA 3C16C 2WWWA 2D2EA 5K8IA 2CL7X 1KI1A 2DFNA 1G5RA 2YNMA 3G82C 1WRBA 3P20A 3ZLJA 3SJBA 2JLSA 4NCIA 2YWHA 4I1SA 2GJSA 2IS2A 4TSFA 4CDGA 1N6IA 1VG9B 2CDNA 1JQLB 1BYUA 1WMSA 2D74A 1KAOA 2D06A 2HT6A 4B74A 1T3SA 4ZIRA 3QSYA 1DE0A 4P33A 4EFMA 2J0UB 4OQXA 2DCUA 4BFWA 5DH9A 3NKVA 4A0RA 4YQFA 2NO7A 5C4GB 1NVVQ 1V5WA 4NHOA 5FH9A 3TKLA 4YMVA 1FTSA 1XEWX 2ZRIA 1P60A 4W7SA 3TQFA 2QE7A 2ZRGA 3TSOA 4GDFA 1W0KD 5JHGB 1E0JA 1DBSA 3QBTA 4QBIA 1M34E 2RHDA 3IHLA 2G1JA 1BH2A 1A2KC 4BASA 4NCJA 1OKKD 5EP2A 2F6RA 3GCGA 4GNKA 2O0KA 4A8JC 1M2OB 1KI9A 4PHTA 4R7ZA 3U44A 2UZIR 2GJ9A 4CF7A 3FPAA 2G1KA 1VTKA 1KI4A 2VL7A 2ZRAA 1UKEA 4NPHA 1JR3E 4ZKDA 2EU8A 1JNYA 3OE7A 1FX0A 2ZE6A 2J7PA 1Z0IA 2ZJYA 3KTAA 2FGJA 3LX5A 3AEZA 5FL3A 3K0AA 4PPNA 1TUIA 2NIPA 3FWYA 3WRYC 4M53A 2ZREA 3H1TA 4WXRA 1D2NA 2REOA 2ZI6A 2FU5C 4RZ3A 5FOVA 2REXB 5HZKA 2ZSDA 4BZXA 3FFBA 2H8KA 3CZPA 2CK3A 4IEEA 2GXSA 5JHHB 2HYDA 3PEYA 4OQNA 2GVZC 5AR1A 4HLQB 3W90A 1OIVA 3K53A 5JLJA 1Z63A 1MKYA 4Q7LA 3TW4A 4EAQA 4WOPA 2MSEB 4CEHB 2P6UA 1G18A 4QHYA 1A7JA 4HDCA 1UKVY 3C8UA 2E1RA 3WHKA 4MGYR 3WY9A 5AJVB 5AUNB 2HV8A 2IWHA 3CRW1 3WP1B 4CT4B 5DO9A 1HV8A 2DR3A 2ZR7A 5FUYA 1OFHA 1OSNA 2R62A 2DHRA 1HURA 2IXFA 3FDIA 3U3JA 2QGZA 2VEDA 2PMDA 4M4SA 3K1JA 4LZZA 2P65A 1DO0A 1NKTA 2F1IA 4LSGA 1R4AA 2J1LA 1XTRA 1G8PA 2BMEA 2EFHB 2BOVA 3B2EA 4Q18A 1T8TA 2QSYA 3GFOA 4HYYA 4DB4A 3FKSA 2J0QA 3QEOA 3B7GA 3U7HB 3CX6A 3BRWD 4IDHA 5FUWA 4DVGA 2CL0X 5FPTA 3PEVA 1KKMA 1BMFD 3OESA 1AZSC 3LW7A 1E4VA 4QFMA 4BLTA 4JLMA 2FSGA 1G8YA 4HAWA 4QNRA 2MSDB 3NDPA 4YDSA 2GZHA 3U4QA 3Q8XB 4IXNA 1Z08A 1N0VC 1OKKA 1UPTA 4NYIQ 3NEJA 3E2IA 3FMIA 1KK1A 5JS8A 2KSQA 1JR3A 4B2IA 5AJYA 4MUAA 5JS7A 1M7GA 1S3SA 1FQKA 3HU3A 1P7CA 1ZM4A 4KCGA 4C0BA 1NG1A 3KJEA 521PA 3MFYA 3T1TA 4TMKA 5CK5A 2WICA 4IDOA 2VHTA 1E9CA 1VG1A 4U5XA 5BN3A 1VYTA 4PAQA 3ICEA 1JPNA 3FTQA 4EPVA 3VNUA 1P2SA 4RFSA 3CWZA 2FPLA 4URYR 1QHXA 4UQOA 2IUSA 3AKDA 3U6BA 5TY0A 1L8QA 1OXUA 4ASUA 3BOSA 2N1BA 1E1QD 2XJ9A 3LH5A 2OESA 2GHIA 4KBFA 2UKDA 2W6JD 5H8WA 4DCSA 2YOFA 4CEIB 4R2HA 4G5OA 121PA 3CPJB 2ZE5A 4AYTA 4M9SA 5FTLA 4QGFA 1CJTC 1D5CA 5SZJA 3OZXA 1NSFA 3AGQA 3QY0A 1X8KA 1AJEA 3F3YA 4G5GA 2FMXA 1KK0A 3OE7D 4C0JA 4Q02A 4QGAA 1KI2A 3MWLA 2RKOA 3L8YA 2QBYB 2HJVA 1M1YE 2BEJA 4LY6A 1BOFA 1OYYA 3CWQA 4RKFA 2CJWB 3AVQA 3QKSA 4D4LA 1M6NA 4DLVA 4QG7A 3RANA 3FMFA 4RD0A 3SR0A 1HQCA 2OAP1 1CIPA 3AVXA 3DOFA 2JIZA 2RH5A 2TMKA 5FTMA 3AVVA 1W4RA 4AG5A 2VSFA 4PQFA 4BEBA 5CM8B 1WQ1R 3W3AA 2ZRMA 4EFLA 3PXGA 1IAQA 3QUSA 3CBQA 3NC0C 3ZYCA 1W5TA 3IGFA 4WZ6A 1US8A 2Q6TA 3EPHA 4JVLA 3IIKA 4M9ZA 2OHFA 3SJAA 1W47A 3RHFA 3JVVA 4B48A 1E0KA 3R8CA 2ZS8A 4BQSA 4AK9A 3MWYW 1Q3TA 3RS2A 1OH5A 3R9WA 1P73A 3KXKA 1Z06A 3MD0A 4BRUA 1OIWA 4E03A 2O8BA 2W0MA 2YKGA 1R0WA 1E2EA 4A82A 2LKDA 4D80A 4RCZA 1KHTA 3B6EA 3I8XA 4KFUA 4QGGA 5DLQC 1CS4C 2C96A 3TUIC 3ZVLA 4CW7A 1XJ0A 2QGNA 4OK6A 3BFKA 2Q9AA 4A2PA 5KU1A 4US1R 1W0KA 4TYPA 3SQXA 2EQBA 2BCGY 1IN4A 2QTVB 4G0NA 3GLIA 3U4QB 4IDPA 4CYMA 1KSHA 2JJ2A 3ZDQA 1E4YA 4GFDA 4D0NA 1NL3A 5H68A 2VP9A 1Z6YA 4C0AC 1E1QA 2ODWA 4WW0A 4L15A 2Y8EA 1U0JA 1NIJA 4PXAA 4US2R 1KI8A 2IXEA 4JT4A 3AF0A 1U81A 2W6JA 5IT5A 1FMLA 2RMKA 5DN6A 3WBJA 2ZPTX 4BZPA 1DEKA 4PSAA 3ADDA 2J87A 3QPVA 2ZJZA 1SULA 4TT3A 5JEEA 2C99A 2PZGA 4EPWA 3WMGA 1YZGA 2J41A 4PZYA 1E9EA 2PZEA 1TADA 2ZI7A 2AKYA 1XTIA 4LCBA 1DAFA 2ZUBA 1BS1A 1IXRC 4V0ME 1OXXK 2IA5A 2GJ8A 4DHEA 4ZDIA 4L9SA 2CHGA 3IQXA 1CR2A 3UK6A 1GKYA 4LBVA 5L3VA 4RD1A 3N2IA 5J4LA 2WKRA 5BW8A 2W0SA 4QBGB 5GJVC 2HLDA 4BLPA 4YLGA 1XDBA 4NU0A 3A1VA 2RGGA 3DPUA 4OI0A 4BFSA 4TMZA 2FDCA 4KSCA 4RY2A 3OFND 4RSGA 1XEXA 4TQAA 5DISB 3T1QA 2R9VA 4YMSA 1MR3F 1J99A 4PHFA 1U8YA 1Z47A 4V0MA 2R6CA 2GAAA 4GBMA 1OXSC 2DFLA 2QQ0A 5EE0A 3FMOB 2RGAA 3FKSD 3OEEA 2BCJQ 3DVLA 1UM8A 2ZI5A 1CP2A 2NQ2C 2BJVA 3BH7A 1K6MA 1WA5A 2FH5B 1TX4B 3AM1A 1U0LA 2ZAMA 3BXZA 1TQ6A 2G0NA 3VX3A 2O52A 3EA5A 4F93B 1LTQA 1GZSA 3BK7A 3O8CA 3LY5A 4UJ3A 3EXAA 3WHLA 2GILA 4Y0VA 1EFTA 4HSEA 3AUYA 1XP8A 2WMNB 2I4IA 3MRSA 4O25A 3VX4A 1WB9A 3NC1C 3ND8A 1U94A 1Z0AA 1NN1A 5JECA 4DC9A 4IOMA 4IFBA 2BMFA 5DSZA 1XCMA 4G5SA 1N6NA 2R6DA 3QENA 3M6AA 2K5UA 1NJFA 4PO8A 3EZ9A 3U61B 2QM8A 3O8DA 1EGAA 3QPWA 2AD5A 2H1LA 4D82A 5KYKA 3HP1A 3THWA 3CF6R 1FL9A 2YC2C 5G53C 4GI7A 1XXHE 4KAXA 3QXHA 3R7WA 1XZQA 2ZSAA 4KFTA 5L3QA 3L0IB 3CLVA 4JSTA 2PEYA 2ZQ5A 1G7RA 1OIXA 2PLRA 2HF9A 2QAGB 3A4NA 4CEJB 4HB3A 2CHVA 3QQ5A 1FPMA 2AXNA 3K70D 4AG6A 4ZDJA 2ZYWX 4NCKA 5EUMA 3LLUA 5A4JA 1E9AA 1YZLA 4IOKA 1AQUA 4CVNA 1CBUA 1M8PA 1N6PA 3GLGE 4XH9B 2RHMA 3VR1A 4DBLC 1DAEA 4NBSA 3NBXX 2R6AA 1UBFA 4ZV4A 3SZRA 3SHWA 4DLZA 1R10A 4FCVA 1W5SA 5TV2A 2ZRLA 1G64A 3P1JA 2CNWA 1LFDB 1G21E 1G17A 4DSUA 1G8FA 1E2HA 4ACAA 1W7AA 1QBKC 3SYNA 1R2QA 2VH5R 3EASA 3LW8A 2ZI4A 3THXB 4CGZA 1Q44A 1ETUA 2F1HA 4PO9A 1ZD9A 2A9KA 2Q3MA 3B13B 5C1BA 5C4MA 1I4TD 2CVHA 2Z6VA 2IYRA 4K81B 1AM4D 4TMXA 3KQHA 3TJZA 1XD2A 3KFXA 1OB2A 4PHGA 4ACBA 4H1VA 2PL3A 2VBCA 4DUGD 4BWYA 4Q7MB 3AVUA 4GSYA 1PUIA 4TYNA 4I4LA 4KHZA 2AHOA 4FMBB 4A6XA 3THWB 4QBFA 1JBKA 4OI2A 3PJRA 1OV4A 1I2MA 2PT5A 1SGWA 5G3YA 1LF0A 2OFWA 5AK0A 4OK5A 3GJ8A 1O87A 2QMOA 1SKYB 3PENA 3KUDA 3W8NA 1TQ2A 1R8QA 3MWKA 2FEMA 1UBGA 3CB4A 2IHBA 4XVRA 5A5GA 1RZ3A 5JI2E 2DY1A 1VG8A 1P4SA 3ADCA 3G0HA 4AKEA 2B21A 5JRZA 3ZVRA 2GBLA 4E22A 4PX9A 3NTUA 1R8SA 3GFTA 3TLXA 4HAYA 3VR3A 3HDTA 2AKAB 5HCIA 1A1VA 1IQPA 1F6BA 2ZSEA 5GJWC 5B64A 5ANRB 5AUPB 1FX0B 5FFMA 5FR1A 2P6RA 3ZS9A 5JBQA 2ZM5A 1YE8A 4PO1A 1GSIA 4LBYA 4IVRA 2WJVA 1W1WA 1DVRA 5UKDA 3DKPA 2JJ1D 2VSXA 4HUTA 4L8GA 4E5UA 1AA9A 4D25A 3OAAD 4X8MA 3B9PA 5J4YA 3CPHA 3RWMB 4EPXA 3TW8B 1N5KA 2PX3A 4NYMQ 4NKRA 4QM6A 4HLCA 3AGPA 3EZFA 2ZS9A 3P26A 4IEIA 4IXMA 4ZCIA 1W0JD 1LF5A 3BB1A 5DHFA 2ZJ5A 4LI0A 5CLLA 4B35A 1GL9B 5JMTA 1G7TA 5L3QB 1WBDA 2YWFA 1QHHA 3PUWA 4JYCA 2PH1A 1J8MF 4NCNA 2FFHA 3EC1A 5AJXA 721PA 2CE2X 4NMMA 2XTNA 2O8EB 4GOKA 2KI5A 4XJXA 1COWD 3IPYA 1E9BA 2NGRA 2B92A 2QRZA 2XTMA 4LJ4A 8OHMA 5KDOA 4AI6A 1KIMA 1VG0B 5AUQA 4Q1BA 2JLYA 3GLGA 3P27A 2J46A 3I61A 1ZUNB 2AD1A 5EXTA 5HZHA 3LVQE 4L4UA 2CJWA 2JATA 1XNJA 4MYHA 4FN5A 4URXR 2BMDA 2QZ4A 2ZE8A 3BFVA 1GAJA 1H8EA 2QMEA 1NN3A 3SNHA 5EZ5A 2VLIA 5CYPA 3A1TA 3CRVA 1E2IA 1P75A 2OV2A 4L16A 1LV7A 4A2WA 2RGEA 3CX7A 4P4UA 1UFQA 1GKUB 2ZRKA 3GEEA 4NYJR 4M22A 2XZPA 1JR3D 1W48A 2XTZA 4BGDA 2WZQA 1M7BA 5TVKA 1B0UA 4S2EA 2JDIA 2IS1A 4N1AA 1Z6AA 1PLJA 1KY3A 5J47A 1Q1BA 4G1UC 5HKKA 3UMFA 3GD7A 4RCYA 4RVCA 4TTPA 1KNQA 2YZ2A 3K0CC 5HR5A 4AWXA 3K9LA 3BB4A 3TR0A 5BN4A 4DCNA 1E9FA 1E98A 3BC1A 3U3OA 4F92B 4UNSA 2YWGA 4NDZA 2ZRCA 5JFGA 3JZMA 2OCBA 1EWRA 1JEEA 3PUYA 1Z6GA 3IBGA 2ZUCA 4N0EA 4PC6A 1NNEA 5JCZA 1Q57A 2HLDD 4OYHA 2ZJBA 3PR1A 2BV3A 1E0SA 1KZGB 4KVGA 4B3CA 5J4VA 1RFLA 5FTKA 2BEKA 1EK0A 4B3XA 4A8JB 3RS5A 1ZD1A 3U5ZB 2YOGA 3DMDA 2EW1A 3DOEA 3KUCA 3LWNA 3X1XA 621PA 5CDFA 2A5DA 4FWTA 5LB2A 2CE7A 5EQTA 3ZVNA 3RRZA 2WJJA 3THYB 4MGKR 1II0A 1G41A 2Q3FA 1OHHD 2PJZA 2ZJ8A 3B82A 2NOAA 3NBFA 3OIWA 4K46A 4M1SA 3RS3A 3FKQA 1WXQA 4Z8XA 1TEVA 1TU4A 3WYAA 1ZU5A 2BVNA 3QI2A 3GPLA 3PEWA 1XJCA 2J59A 1IOZA 3SU8A 2IK8A 2ATVA 4MQBA 1Q20A 4OHVA 3FOZA 4S35A 5CM9C 3QG1A 1K8RA 4C0KA 1YR6A 1IN5A 4MITA 1NY6A 2IW3A 1SXJD 5KSYA 4ARZA 2GESA 2O8FB 4RFVA 1UBEA 3SEAA 3SFZA 2WWXA 3T34A 3U7EB 4EPYA 1U98A 5GVRA 1FP6A 4BFXA 1US8B 1G6OA 2FFBA 1N3BA 2IYYA 1KMQA 5GJBA 1WE2A 2KBFA 3ZZTA 4FMCB 4AYXA 2J0VA 2B6HA 2W2XA 3Q7PA 3VKWA 3EIEA 4DEYA 5FPKA 2Q3HA 1VHTA 1YVDA 1XMVA 3S1AA 1T9HA 2IYSA 2XEXA 1IXSB 1N5IA 1AK2A 1PLKA 2NO9A 2PCLA 1QDEA 1X86B 1Z0KA 3QXCA 1L4YA 1HY3A 3KKMA 3KKQA 2IF0A 4Q9LA 1XPOA 2XSZA 2NZ8A 4JKYA 4BFUA 4LJ5A 2GNOA 2IEZA 2Z4RA 4W9MC 4U00A 4DUGA 5BXQC 1F60A 4A92A 3CZQA 2XAUA 4DIDA 2QI9C 4MKIA 2JIZD 1U8AA 3T5DA 3TAHA 1Q0UA 2DBYA 2RGDA 4LHXA 2WSSD 2XNSA 3AF2A 4ZDKA 4B76A 2QEQA 1KOFA 2P6NA 4UNPA 3RABA 4Q4AB 1ZM7A 3PVSA 1RVDA 3W5JA 1KY2A 3M0EA 4D26A 1TPZA 1Z07A 2CVFA 2QROA 2ZJOA 3TK1A 2ZRJA 3LAWA 3H86A 4JJZA 1LW7A 2IYXA 2X2FA 2PZFA 2QTFA 2FG5A 1OXTA 4A0HA 4QC2A 2GXAA 2WIBA 3W8RA 3QG5A 5KPDA 1W2HA 2OM2A 3Q9LA 1QRAA 1YR8A 4B34A 2UVQA 1SVLA 2NZJA 3R9IA 3GJ3A 3X1ZA 4M1WA 3U3MA 2W6IA 4JVMA 1XPRA 1KI6A 3K70B 3RC8A 1JXMA 1MV5A 1PVOA 4E07A 2JJ2D 5B30A 1TQDA 3A36A 4PPQA 1SHZA 4KSBA 3ADBA 2D7DA 1ZNXA 1E9DA 3AVYA 1PZNA 2ERXA 2H92A 2EFEB 1MH1A 3MJHA 1GIAA 5EP3A 3D8BA 1F5NA 1RPZA 1IXZA 2N42A 1FQJA 4W5HA 3AVWA 3VKGA 4FCTA 4BLQA 4KITB 3ZZUA 1SVIA 4DLYA 5JJIA 2QAGC 4TL9A 2R65A 2ZSFA 3MSXA 5EE1A 2O8FA 3SS8A 2YWEA 4QNMA 1JI0A 4L9WA 2VP5A 2AK3A 4A2QA 3RRNA 5AUOB 4B44A 1P2UA 4ABYA 2AL7A 1WCV1 4RZ2A 3O47A 5FL7A 4B71A 4DB2A 1CF4A 2ZYVX 3B5JA 4DLTA 3QNUA 2R6GA 1E96A 1F2TB 1KDOA 5FI1B 3QXSA 1FTNA 1KI7A 1OW3B 4A0FA 2QE7D 1NMYA 2CXXA 3K70C 4DDVA 1HUQA 4JMPA 2JJ8A 1NN5A 2ZEJA 2VYFA 2WMOB 1C4OA 5FPHA 1VYVA 4TLBA 3CR7A 2W58A 3QIAA 4XWAA 4AIIA 2XXAA 1XCGB 3B1VA 4I1VA 5IK2D 2G77B 1G9XA 4IW3B 5C46F 1UDWA 2LCFA 3GJ6A 3FHTA 2YHSA 3TNFA 1L7VC 2AWOA 4CEHA 3QEJA 2WVJA 4V0KA 3IEVA 1NIPA 2R2AA 4AC9A 1EESA 4PSKA 4LBWA 2ZRDA 1E79A 2VPPA 4DRZA 4ZCLA 4W5JA 4XSGA 2DWQA 1NKSA 1MO5A 1KO8A 2EWVA 2FPMA 5D3MA 2ZTSA 1SXJB 3X1YA 3CF0A 2PMKA 4FMDB 1I4LD 3FHCB 4PAOA 3X2SA 2QSZA 1KZ7B 5LDDC 1QHIA 4Z51A 3IPXA 4FW9A 1QF9A 3V4RA 3EPLA 1ZNZA 4TN1A 5KUTA 4JL8A 3AH8A 1XD9A 3EIHA 4Z54A 1ZUHA 4JVSB 5TXGA 1P9RA 1DAKA 1MABB 1XRJA 3CW2A 3I8SA 3X1DA 1W44A 3QF4A 1W36D 4MA4A 5FTJA 2ZANA 4FD2A 5JRJA 3PUVA 3KX2A 3H2YA 2F7SA 4MDEA 3RVBA 1SHKA 1MRSA 1ZIPA 4US0R 1KI6B 3QF7A 4TYYA 1RRCA 2Q9CA 2WJGA 1SVSA 4Q21A 1GNQA 3I1FA 3LBHA 3KQKA 3EPKA 4KYUA 4OJQA 5KDDA 1NBME 1U90A 4FWIB 1H65A 3QPUA 5L3RA 1E69A 4CRWB 4A6PA 2RGCA 3LRPA 5H1YA 4Q9JA 3TSZA 1JXOA 1YRAA 1VYUA 3TRFA 1AZTA 1LVGA 2O0JA 1YJ5A 2CLDX 5LD2B 2ERYA 4C7OA 1UEJA 1IY2A 4LDJA 1Z0DA 3I92A 2O5VA 3K8YA 1NI3A 1IBRA 1Z2CA 4MYCA 2JAQA 3VNVA 1XCPA 4JLVA 1XEWY 4OL0A 2O8DB 3K0FA 5FOSA 4B2PA 1R6BX 1GP2A 3LA6A 3CNLA 3B1ZA 5E4FA 5FOXA 3EPJA 5EP1A 3RNLA 1VDZA 3AF3A 4D4MA 4ON9A 1S4QA 4A1FA 221PA 5BN5A 1E2LA 1PJRA 2NPIA 1Z6TA 2BBSA 2FEOA 2WPDA 3TBKA 3VKHA 1QHNA 3KDSE 3UG7A 1JB1A 3CNOA 4M21A 1CRPA 1N0UA 1NJGA 5FPYA 2IC5A 1GDDA 1ANKA 3ECCA 3AB3A 3W5IA 4ASUD 4DLRA 2CLSA 4DJTA 2ANBA 1HE8B 1P9WA 3BS4A 2W00A 3B1XA 5FTNA 4JKIA 1O3YA 3OAAA 5KSPA 1NLZA 3C15C 4C0SA 3KL4A 5IK2A 1R5NA 4QOSA 4UXHA 3ZD6A 4N3NA 4JJKA 4QKQA 3PUXA 2Z83A 1XJQA 1E32A 4GP7A 2D2FA 1XPUA 4HAXA 4LYAA 3I4LA 4KJZA 4JBWA 2I1VB 2HCJB 2GZDA 4OKSA 3U2QA 4P4TA 2IXGA 2OE2A 1WP9A 4LHWA 4EPRA 2QN6A 3MAAC 1S9DA 1P3JA 2BBTA 4UJ5A 4C3ZA 4NYMR 3W6OA 5B2ZA 4C7OB 2W2VA 2PBRA 3TSWA 3WP0A 4D0LB 2VTKA 3H84A 2WM9B 1CKEA 1LB1B 3GLFE 1I2DA 4A36A 3V00A 3BERA 5IF9A 3QKTA 1G8HA 2HJGA 2X77A 2BBOA 2GEDA 4M1OA 3BWDD 4IOLA 3HYRA 4LHZA 4Q47A 2V1UA 2KBEA 1ZMXA 3Q7QA 2OEPA 4LC1A 5EXXA 3TVDA 1EFRA 1N6HA 1RW4A 3A4MA 3QKSB 4KXFB 3V4FA 4BFVA 4Q4HB 1H8HA 4B6FA 1G5PA 5CDFE 3NDBB 3Q85A 1FP7A 4P3YA 2NG1A 3T35A 3K9HA 4NONA 3U6KA 3S1AB 3SYLA 1SVMA 1S9HA 3NEYA 4YDHB 1G7CA 1GILA 1Q21A 1Q1EA 2ZU0C 3DHWC 4YONB 4EKDA 1SXJC 5AJZA 3WNDA 3CNNA 2IWRA 1E2MA 2IYTA 4OI1A 5DGXA 1S96A 2OILA 4ERNA 1OT3A 2F1RA 3FFAA 1IY1A 1BYIA 2V6JA 2VHUA 2WIAA 3T61A 3UG6A 5K8UA 4QHSA 3T1OA 1R5BA 5F9FA 3B1WA 2CNWD 2ZE7A 2CK3D 1GRQA 3WMFA 4I99A 3Q5EA 4E09A 5G40A 3P4YA 4LV6A 1MRNA 2QPOA 2WV9A 4NE2A 5FOUA 2ZI9A 4PPFA 3AKEA 4DWJA 2WSSA 5FUXA 1KSGA 1W36B 3UATA 1ZC3A 1E79D 1JECA 1ZBDA 3REFA 2A3RA 2QQEA 4YMWA 4KO8A 1P62B 5DNYB 1KAGA 4Q5IA 1V43A 1KGDA 3GJ0A 2XZLA 4Q4AA 2Q0HA 1Z22A 2NO1A 2GRJA 4ZCMA 2DPXA 5KHOC 1AQYA 1FUKA 1YZTA 1HYQA 4URVR 3A8TA 1KO5A 2C77A 5L8VA 3EZ7A 3TR5A 4B2LA 2ZROA 3H4MA 4KODA 4GMXA 1EFUA 3KJGA 2O8CB 1N6OA 1DPFA 4IVPA 4DCTA 1Z29A 1XMSA 3PCRB 3OF5A 3UMRA 2RAPA 3A37A 4ARZB 2R8RA 1S1MA 3A4LA 4AD8A 1JPJA 1JJVA 3T12A 1JJ7A 2D4HA 1KSJA 2BM0A 1SKYE 1OJLA 4LJ7A 3I5YA 2QBYA 4I81A 1G16A 1NY5A 5LBIA 4LC0A 2HF8A 3VR2A 3C14C 2H5EA 3A1WA 1J90A 3OFNA 4XD7D 4FIDA 3QKRA 2OCAA 3V9PA 4LWZA 1ZNYA 4MKGA 1RKBA 2PJRA 3W6PA 1KMHA 1IN7A 1UDXA 2J9RA 3BAFA 3GLHA 2ZR0A 1UAAA 2FOLA 2WJIA 2ZYTX 1NSTA 1H8HD 4EJSB 2IS6A 2H16A 5CIWA 2J0SA 3B1YA 4TYWA 4H1UA 4GP6A 3EZ2A 1U8ZA 4URUR 3HWSA 3WMEA 3CF2A 2JJ1A 4DLSA 4B73A 1T3LA 2OG2A 4GOJA 4ESVA 3DM9B 5FOTA 4UNNA 1EXMA 4CZ2A 2ZETA 2AR7A 4YMTA 2DFKB 3IHWA 1E2FA 3HU2A 2QP9X 4JLKA 2C8VA 3PEUA 1ZW6A 2OCYC 4LRWA 5K8LA 4EQ6B 3ICQB 1VCMA 1VIYA 2OFXA 3CRQA 1I4DD 3MWJA 4HDOB 4HDQB 2WOJA 3SC3A 3IIJA 3ZGXA 1CJKC 2C5LA 3KB1A 3TGPA 2P0EA 1RJ9B 1TQ4A 2MMCA 4A15A 1XEFA 4PFSA 3RLFA 4HAVA 5CK4A 3ZQ6A 2GWHA 4TL6A 5IHPA 4FMDF 3PG5A 4O3MA 3ZIAD 1S1CA 2ZITA 5A0FA 2XJ4A 2H18A 5DI3A 3SOPA 3UIEA 2CEAA 3K0CA 2I3BA 1EX6A 5E95A 5EE3A 5JCPA 2F43B 2C95A 2GCNA 4TQUS 3UPUA 1W4CA 2VSOA 3KQUA 4B43A 1OF1A 3U3KA 1EG7A 4KLNA 4AKHA 2EYQA 3EIQA 3JZAA 1G4UR 1G19A 3QXJA 3K0AB 2OAQ1 5EZ6B 2QM7A 4DDWA 2QRNA 4GRAA 4OI4A 1R0YA 1T8UA 3PITA 2W83A 1GITA 1FZQA 1OH6A 1YRBA 1OFTA 3L2OB 5GJCA 4TMVA 3EC2A 2EFDB 3CH5A 5CLQA 3DZ8A 2GF0A 1G8GA 5TARA 4OHZA 3PIRA 4BFTA 3VR6A 1X3SA 3K9GA 2PLFA 3L8ZA 1XXHA 3EWAA 3GEHA 4Q9IA 5EXSA 2FV8A 2VA8A 3I73A 5KDLA 4XWKA 4QJ4A 1EX7A 2VO1A 5HKKD 1S2MA 1NLFA 5DIFA 2F1JA 4M1MA 1KI3A 4EFNA 1DG1G 4P0TA 4FXPA 3BJIC 2ZVQX 4JT2A 2FX3A 4XVUA 1Q1ZA 3IO5A 1A4RA 5BYJA 2ODBA 3QVUA 3W9YA 4BZQA 3ZQJA 2ATXA 5IRCD 1G3RA 4OHYA 1KKLA 1VKJA 2PT7A 421PA 1Z0JA 2QG6A 4JYBA 4QBHA 2F55A 4C2UA 2XNDA 4C2TA 2AN9A 1G3MA 5SZHB 1OFUX 4J0QA 5KSZA 1DAHA 3LDAA 1F2TA 3ONWA 3C5CA 2BIFA 4BLRA 1W36C 3M4YA 4D4JA 2GVDC 4V0LA 3TH5A 1QVRA 3UKDA 2FPKA 3M1IA 2LKCA 3NH9A 4ZI3A 2QL6A 2BHRA 2G3YA 1NMZA 3BH0A 2EYUA 3T1VA 1XD2B 2ECKA 4JIMA 1OH7A 3R7WB 3A58B 5C18A 2OFOA 4CEJA 1BKDR 4H9GA 3C7KA 1ELOA 5FBLB 1T6NA 4HB2A 1ZRHA 4M9QA 5FBRB 5F3WB 1PUJA 1BMFA 1GFIA 2FFQA 2FSHA 3ZJYA 5FBVB 4HLUA 4DSNA 2EFCB 1YU9A 3VU9A 4BUJA 3SYKA 4Q7JB 1E94E 1FUUA 1MO3A 1XFAA 1JAHA 3K9NA 2ODNA 4A0GA 1GOTA 1XXHB 3DKVA 3SBEA 2P5SA 2ZVPX 3GLHE 3IBYA 5HCNA 2Z5FA 3KTAB 1AS0A 1C1YA 2AX4A 5JSZB 4M2LA 1RRGA 2ZJ2A 3GLFA 1NVUQ 4HZIA 5GADl 1NBMD 2IYZA 4HB4A 4Q00A 5DI9A 5K8TA 3WRXC 4RZUA 3T5GA 3IUYA 3U7FB 4TWZA 2KJQA 1JQJC 1N25A 4LOAA 2ANCA 4HB0A 4ILEA 2F3TA 2NO0A 2XB2A 3GP8A 4JBXA 4WA7A 4TZ0A 4B47A 1YZUA 4MRVA 4PC1A 4X8HA 2MMGA 2V1XA 1E0AA 4PZLA 1DAGA 4OQFA 4TT3D 5HE8A 2I1QA 4GL2A 1GUAA 2FA9A 2BDTA 2E9SA 2IUTA 4R71A 2CLCX 2A2ZA 3WBKA 1N5LA 1ESMA 5CJ2A 1ZP6A 1AS3A 3RYTC 4URWR 3MJRA 2HUPA 4D4KA 1F48A 2CCJA 3GMTA 4XD7A 4A4DA 2A30A 4B32A 1Z83A 3ZZ0A 5KO2A 3TUJC 3I5XA 1N5JA 1PLLA 4AURA 1RYHA 2EWWA 4PC2A 2GETA 3RAPR 4IVQA 3WNCA 1XF9A 2ZRFA 4Q1DA 4DSTA 2IF2A 4D0GA 2DFTA 4DKXA 1S8FA 1T91A 1NVVR 2B7CA 3LLMA 4F4JA 4MRSA 1P72A 2XGJA 4IFEA
chains in the Genus database with same CATH superfamily
1XZGA 1ZSYA 4MB6A 5JATA 1LZKA 5E7MA 2KW5A 2NACA 3K09A 2ZTVA 3HA7A 4XSHA 1Q7TA 5AKGA 3NRJA 1YHNA 4LYFA 4JQSA 1JV2B 1L7PA 2I8CA 4XB2A 1ZUWA 1JSZA 4ESEA 1UKBA 1WW8A 4FYJA 3RS0A 2AF4C 2VHXA 1CR0A 1UBRS 2CDCA 1Q0TA 4ZOLB 2Y2UA 5JJKA 4G0ZA 5SZIA 4LJ6A 1GQ2A 2QX4A 3SPXA 4CM9A 4I1PA 3PX2A 5DHQA 3G5UA 5CBPB 2FWRA 1C3EA 2W2LA 3NPMA 1PVDA 3DF9A 2N9UA 1RHMA 1YZYA 1X8LA 3K4PA 2D7CA 5DPMA 3RVJA 3UK0A 1SHUX 4IINA 2C29D 3QX3A 1QK4A 2EXXA 4NZYA 4KR2A 5HBGA 4P7GA 4EHDA 3NBYC 2BC9A 3PFBA 3TFOA 1I4WA 4S3MA 2Y1CA 1S3IA 1I7NA 4XGNA 3CTPA 3QQPA 4IQ8A 3KVNA 4L22A 2DUWA 3DO8A 1BXKA 1G5TA 1V7PC 2GPTA 2H1SA 2OBMA 3C74A 3FDXA 3QUCA 5E7JA 3CVUA 3DDSA 1RWWA 4MYUA 4RZHA 3D8TA 3IHTA 1JLMA 4L5AA 4XPZA 5GMOA 1ODCA 1VHDA 3A1SA 4Z4GA 1OFIA 2ZAGA 4MUEA 2R8XA 2Y1LA 2VOEA 3EUWA 3H8WA 3OWOA 1NP6A 2C03A 5HJ7A 3AP1A 1TK9A 2BT4A 3HU1A 5BRJA 3ITEA 5TMEA 3ZCSA 5ECYA 3RVLA 5FV4A 1YZNA 5T7BA 3DUFA 2IHYA 1Y1KE 2O7RA 4WK0B 1VMDA 4XYEA 5TGDA 1QCDA 3FPLA 3TLCA 3UHJA 4BTLA 4C0HA 3OIYA 4HZUB 5IJ9B 2N46A 2JIMA 5F9HA 1Q7RA 2P4SA 1BEZA 2JFVA 4C04A 4R31A 1WDTA 1JJBA 4Q3BA 5DN6D 3EIOA 1SOVA 3MGCA 3GUHA 3R3WA 1QHHB 1T8SA 4JGIA 3E2MA 4UZEA 5HJEA 1RAGA 4KK4A 1KK3A 2K7ZA 2PL9A 4KJXA 3R8FA 3UB4A 4OJMX 3NATA 3UFXB 1CRQA 3ND9A 1OCEA 3G0CA 1Y48E 2AQ8A 1L7EA 4U2CA 1ZUIA 3BH6A 1P4RA 2QUAA 2YRXA 5CX1A 2BLLA 2JFNA 1FTQA 1K89A 3M83A 4J6FA 4DC0A 4M7WA 4EW2A 3L0PA 1WXIA 3B48A 3GA5A 2JLXA 4MQLA 2HC9A 2DECA 3ZWDA 4BO3A 1WCIA 5B1SA 3EG9A 5BOSA 3T7AA 2OQIA 1PJ2A 4F60A 1KWKA 2PVSA 1GSOA 4KVAA 4QVGA 4BEVA 1D2EA 5K0ZA 4NCBA 3GW8A 1AS2A 5EJEA 1TAHA 3MB8A 1J2RA 2B8JA 4JJ6A 5LMZA 1XZ8A 2VHWA 4TMWA 3OTIA 3HABA 1KU6A 2AWNA 4P22A 4U63A 3W77A 4B6EA 3G2JA 3Q72A 3HYNA 4HUQB 1OT5A 3R3YA 4TX1A 2NU8B 3L1KA 2CLMB 2YYSA 2C2GA 1CJCA 1PR0A 1E9SA 1O1YA 3EZXA 4U3JB 3EH2A 1T6ZA 2ZVJA 1R0XA 3LL4A 4KLCA 4QA9A 4X5OA 4OHUA 4EJFA 1CQIA 2E4AA 4K05A 3KEQA 1PSZA 1ZZEA 3I4FA 3EJWA 4ND7A 5TPZD 3U13A 2V9PA 2OXRA 3FR7A 1NJ1A 1QGAA 4JYZA 1I9GA 1JEDA 2JGLA 2QRVB 5CIQA 4UXIA 5ETJA 3OM9A 2PLAA 3R5SA 3LPAA 4MKFA 4DZTA 2P77A 3Q3GE 4V0NA 2UXCB 3CVOA 1G5IA 3RREA 1N0IA 4PLYA 3AUJB 1LPAB 2DWPA 3FPHA 4JN6B 3KHSA 5D5QA 3SF8B 4MUBA 2UDPA 2RGNC 1KZ6A 2J9FA 1E1NA 3VZRA 1IHDA 1ISPA 3RUCA 3W2EA 2GAFA 3KXIA 3DW1X 2ASEA 4G0WA 5E6UA 1OAOA 4M0UA 5KJFA 4BV9A 3EBLA 1PO7A 1QZXA 1X1BA 5AK3A 4BV3A 4LKOA 2EJBA 4DLWA 2DT5A 4MYRA 3K5HA 4G5QA 3ECSA 1ZRMA 4DYHA 4G85A 3ZS8A 1ZMTA 1QVWA 4I1OA 4CE6A 3X1JA 2V4ZA 5JFOA 3HU5A 3IIMA 1DTSA 2WJWA 1K4YA 2XB6A 3ZNNA 1TAQA 4OX9Y 4Y0NA 1P9NA 4E6PA 4M9CA 5A4IS 4W9NA 1VKOA 1MC8A 4GPZA 4Q9AA 5FNZA 1X1QA 5EHNA 3I62A 1RJ9A 2ZAYA 2JGDB 2RGXA 4G3XA 4WN9B 4ZAGA 2JI9A 2PSDA 4O5AA 3VVCA 3E48A 2EKBA 3AJ8A 3H5AA 2XB9A 4K6KA 4M0EA 5AHXA 2XVMA 2VHQA 3A6JA 4NJEA 4OHWA 1C8VB 4CMEA 1DCFA 5CH8A 4I14A 1UUFA 3TLZA 4CQJA 4D9JA 2RGUA 3ASYA 1VBMA 2F62A 4PPGA 3JASA 1C9EA 4MV6A 2PXHA 2B7BA 2GJ4A 2HNBA 1GTZA 2NX2A 2PRJA 3W79A 4EY5A 5CD9A 1M2GA 4CJXA 4BGVA 1FNMA 1UADA 1ZCJA 4YRKA 1WMAA 3EEQA 1OLXB 4O4JB 5CEEA 6ADHA 4XWGA 2ZYHA 4KIUA 1RP1A 1QYDA 2Z0MA 3EMBA 1RE0A 1M1NB 1T1EA 1DKLA 2JAWA 1ST3A 1T6BY 2X22A 3JATA 5EQDA 3LBIA 1RYEA 1WQ4A 3HPQA 4A8JA 4AULA 4UEWA 3OWHA 1G8JA 3LXRA 3S5JA 4Y7DA 4LYGA 3SHQA 5LM3A 2R1TA 4NRDA 5D87A 4FUQA 5GM1A 1J09A 2IGBA 3CR8A 2QZZA 3FNRA 4Q48A 4Y30A 3ZR4B 8LDHA 2VUHB 2GN4A 4INJA 5BUCA 4MRMB 3PC8C 1UMDB 1XZNA 4QYIB 2FPRA 4V02A 2QD2A 4RORA 4WIAA 4CTNA 1MQ8B 4N7MA 4GECA 2W6QA 1HG1A 4BHTA 1S7GA 3CT4A 3U9LA 4Q03A 2EBUA 2PD3A 5IPFA 4R8MA 2C57A 1V3TA 3QEMA 1D6JA 3VR5A 4Q4JB 1TZ2A 1W9HA 1WCXA 3M1AA 2WEKA 2XB4A 1N6LA 3S2FA 2GWRA 1O9BA 1RMQA 3Q41A 4ND4A 4TLCA 5F98A 1CYEA 1ZU4A 1VJCA 2W5UA 4LX0A 1QQTA 1MOPA 2B8TA 3WYGA 1CG6A 1TJPB 2CUTA 3VO9A 2G8NA 5JWRA 2ZSJA 4HX9A 4WZAE 2DJIA 5CXXA 2I2AA 4DPMA 2XMPA 2JJQA 3ZDZB 3WKAA 3ILSA 3MRXA 1VBKA 1M2NA 4RA6A 5ICSA 1AA6A 2YV5A 2ZUTA 3GMIA 1XMJA 2PEZA 5IWAB 5JRDS 2VRWA 3E7DA 4RMIA 4DG5A 4CIXA 1SVOA 1XALA 1ZA2A 3I5UA 5BSHA 3I3SR 1K7XB 2DTXA 5JXHA 2ZSUA 1XWIA 2G88A 2XLBA 3WL6A 1I7LA 5IDWA 2DZDA 4NFSA 1M76A 1M5UA 1J2JA 1T9GS 2GBCA 4I4NA 4BATA 4UOZA 1M74A 2FSFA 2X5OA 1BIFA 5B3JC 1Z5NA 3U37A 2KX7A 3K6SA 3T3MB 3VA7A 4BVLA 2BWJA 3TJRA 2ZYSA 3KS9A 1JHRA 3SQWA 2RHRA 2FW0A 1LNZA 5IHXA 3W8FA 1A5BB 1TU3A 1U0TA 1TL7C 1Z62A 1PD1A 2I2WA 3W7VA 2QTRA 2C1ZA 2QT1A 2YJTD 3GFGA 4JROA 1SR8A 3IDFA 5J2UA 4QYXA 5FP0A 4JZKA 2CZGA 1KXZA 2J32A 2FF7A 3N2EA 1FYEA 3CIOA 3ETHA 1JALA 5HUJA 4HSGA 1RXWA 2OHOA 3HLYA 3HO6A 3INYA 2VNSA 2IFTA 4IX9A 1L7MA 1R9NA 3U6BA 2BH2A 5EWJA 2A0FA 1CERA 4LI3X 4IDQA 3FA2A 3DOOA 3FPJA 2OG1A 3IVXA 4MP8A 5CFQA 1RI4A 5FUBA 2YXBA 2MYTA 4YR9A 3WYNA 4DV6B 4G01B 4LBZA 1FFGA 1YCHA 3KSDO 4UVGA 1W1IA 4K40A 2HSDA 1WUKS 2QV7A 4BXOB 4W8HA 1VP3A 5CXSA 1SC9A 3O3CA 3PQCA 3RC3A 3L4JA 1IY0A 4P35A 5JI3E 2Q49A 2I0FA 3MUFA 2B25A 1CVRA 1MN6A 2C92A 2FPXA 3HBFA 3HMKA 4LOIA 5EFOA 1HE1C 4DNFA 4HNUA 2JHGA 3P0IA 2X6TA 1H2XA 2A9OA 2V65A 3JQRA 4AJHA 1E1MA 1OBHA 3PRHA 4JH0A 4F5DA 3O0TA 1A8QA 2EKDA 4TV9F 4ECEA 1YS4A 4B85A 5JIBA 3E3AA 1JIQA 1Q1GA 2A0WA 1GQQA 4MTLA 3LO5A 2XE4A 1C1HA 1JDJA 2ZIUB 2PFGA 4PAWA 2MOKA 3VYWA 5G3ZA 3L9XA 3GGOA 3PC7A 4I50B 4RSHA 4UE6A 3SJCA 1T2EA 4RD3A 3RR2A 3EQZA 4MRPA 3C3YA 5KWVA 1M5RA 5SYMA 3EIWA 2H4JA 1OPXA 5F73A 1XGKA 3IAXA 1GL6A 2OPBA 1F6WA 2ZUWA 4HXYA 2E18A 4WUVA 1PZEA 1BZYA 1WZEA 3V4SA 4BWFB 1MNAA 5AKYA 5K0EA 4FOSA 3FLAA 4GZLA 3MMPA 2WJHA 1AMNA 3CUWA 3O8OA 2H06A 3GOQA 2CMDA 3IEUA 1OGJA 1XMPA 3MLEA 1K92A 3QX8A 4OFWA 5P21A 3VHLB 2V7QD 4E1VA 5CXUA 1E3DA 2PH5A 4QOIA 3KZXA 5CA0F 1ETHA 3Q6NA 4UPEA 3G59A 4RV9A 3C5VA 3DM5A 4CGYA 5AVTA 5B7QA 2ZJAA 3IMEA 3TE6A 4ETMA 3AKCA 4CNQA 3VKVA 4LFAB 1OYOA 3ETNA 1CUEA 2WBLC 3OX3A 3ZJUA 3GUCA 1GG9A 3SXUA 3NBZC 5LPNA 1ORDA 5F7JA 3TPFA 4ALNA 1SXJE 2XH8A 2YBEA 3L1IA 4YGXB 1CF9A 2RH8A 5CHYA 2IBMA 4B40A 4UUAA 4YT2A 4HDSA 4GS5A 3RGGA 2FAXA 4I9HA 4TSKA 3INNA 3F6BX 4A8HA 2IS4A 1JL3A 1MGOA 4HDRB 4AO6A 1EZ1A 4P36A 2JBWA 3RSLA 4AROA 5ALPA 3ZY6A 2CHQA 4WERA 2P2LA 2PYDA 1DJPA 3QFHA 4R2IA 3ZTYA 2IL1A 4ND5A 1U0HC 3IE0A 4LX8A 1N8TA 3B20A 1DBIA 1QOQB 4HATA 3VR4H 3QITA 3RBXA 5L6LB 1F3OA 3EW9A 1I24A 3LY9A 4J7AA 4P32A 3EEYA 1GSAA 3IQWA 4HN4B 3WRYC 4FN4A 1AKEA 4KNYA 3U44B 2WKSA 4EQZA 1COWA 3FWNA 2BEVA 2GGSA 2HPZA 4N5DA 2FSVA 1G4HA 4KIGA 4DLUA 5F5XA 5CLFA 3LE8A 1P2DA 5EE9A 5JLJA 2H2DA 1VSQA 3KQPA 1HM5A 5ALGA 4C3OB 4JLBA 4WY5A 4ZXFA 1VA5A 1RYYA 1OOEA 2O06A 2COUA 2R8ZA 5F1PA 3F2VA 1PGPA 2GMWA 3R0XA 4LV5B 4RWEA 2GEVA 1G2IA 1TCBA 2KE5A 1MX5A 1WXGA 4JLPA 4CEIA 2JLVA 1MV8A 7MHTA 3F5SA 3Q2IA 1KJIA 4EH1A 2A0YA 2WSMA 3B89A 5FULA 4I8IA 3VHRA 4WZBB 1M0EA 3NUGA 5IVHA 4FYMA 1XD8A 5SZKB 4UHJA 2ADOA 1C8BA 1R00A 3NAQA 3N9IA 4CKBA 2IPNA 1B1CA 3SEFA 3X2FA 5K7SA 3L8HA 2VF8A 3O9VA 4GRDA 4L0DA 3SI7A 5A4DA 4GX0A 3V1LA 1I2ZA 2H3HA 4UUMA 4CETA 1II8A 3U31A 1G6HA 2ZRBA 2NQTA 4IDGA 2R6FA 1NF9A 2AMVA 4I8XA 3RC2A 2Q1XA 1TCUA 2B8NA 1PS0A 1A5TA 4W5WA 1N3YA 1N6KA 2IPOA 1O97C 3WDKA 3E4CA 3JQBC 1KYIA 2FSVC 2B1IA 3ASZA 4RMNA 2BGMA 2EF1A 2A4MA 4GPIB 4IMIB 1Y6QA 4D3FA 2EVWX 2WU8A 3VDNB 3NONA 5A05A 5AHWA 5DN9A 3GLIE 1V2HE 1VIAA 1H5NA 1MRZA 1U1GA 4GR4A 4IRUB 4PAMA 4X97A 1NJ6A 2YVUA 3O1JC 4NE7A 4QVKA 2IPLA 5ESXA 4FQ5A 1XEXB 1MDBA 2VDQB 1EBBA 1A9TA 4FDUA 1M1UA 3F4KA 4IOJA 2RK4A 3WLIA 3ER9A 1YK1A 2D62A 2J5XA 3DLIA 3DBHA 4Q1AA 1FB5A 2ONJA 5JH7F 1ZI6A 2IEYA 2X2OA 3ESZA 3U1TA 1Q95A 4FHFA 3GVCA 3O1HB 2FVXA 4B6JA 1PW7A 4ZYTA 3AHGA 3DLHA 4Q4HA 1GQFA 1VHJA 5JC1A 4RD6A 4JUBA 4YXWD 1H2BA 3O6VA 1VBNA 3DFFA 4ZRDA 2P0AA 3RU3A 1NRJB 4CM8B 3VR2D 3KZKA 2A5YB 4A91A 2BFDA 4Y2RA 1KY4A 4MKRA 5HGJA 4B4WA 1PV4A 3D4PA 2A78A 3L7MA 4Q1FA 4L8VA 4MV1A 5IBQA 4DJDC 2BGWA 2KWIA 3AXSA 1JH9A 1J1ZA 2VJQA 3VH2A 1YFKA 3PHIA 3CS3A 3QLTA 5A9TA 1TCAA 5B58C 5AW1A 3BD8A 5GOTA 2XIJA 3PSHA 3PQ8A 5E9AA 3H2IA 4PR0A 4JVNA 2H52A 4N47A 2QRPA 5HIKA 2QR3A 4CIYA 3L6CA 3AYXB 3GFQA 2FW1A 2J7PD 3ZLBA 4PN3A 821PA 2DHEA 1CEEA 3AEKB 5L45A 3R20A 4R6WA 4R8RA 1V9SA 2G08A 1B0PA 3K5WA 4JJEA 2GPWA 2MSNA 1JQBA 2WAYA 3C8MA 4OOFA 1YL6A 2JGNA 4PQRA 2IYVA 4MWTA 1IIRA 1KEUA 1KPIA 2FJUA 3SIWA 2GD0A 2OLJA 4FKBA 2AFIE 3F5FA 3L0OA 4XQCA 1A98A 4C9BA 5LYJF 4RYDA 5C8ZA 2FUG1 4KKXB 1IM2A 3ENVA 3VUEA 4F8YA 2QRKA 4J43A 1IN8A 2WWYA 2GEKA 3O8BA 4KYIB 1YVUA 3CNEA 3E1GA 1PRYA 4CIBA 4E4TA 3HKBA 1DJQA 4LNUA 3GZJA 3WWYA 1QANA 3FTCA 5A0VA 4XUCA 1J70A 3LQ4A 4OLBA 3V4LA 4Z1OA 2HDOA 4OAPA 2PNFA 3NGXA 4C4PA 3KQNA 2G6TA 2H9IA 1FFHA 3QKUA 1FQOA 2GAJA 3D7KA 2BHNA 3E1KA 1C81A 1RRPA 3B9QA 5DE3A 5FA6A 4B0PA 3F96A 1NX6A 3Q15C 1AQ6A 1Z18A 4ETNA 1SQ5A 4RTJA 4KQJA 3B70A 4OJTA 1GA1A 3WLRA 1G7SA 3E9CA 1N2EA 4D46A 4TM7A 3RYHA 2CYCA 3D7NA 3NHBA 4PGAA 1AD2A 5I47A 4A5SA 2BFFB 3ZD7A 4C0QC 1I94B 2L82A 5J4KA 1NZFA 3A0RB 4GLLA 1G2OA 1Y63A 3G2PA 2Q2VA 3LCJA 4X91A 2M6KA 3A3YA 4DMRA 2GEUA 2IU0A 1V95A 5FI5A 1TYBE 2WR8A 3GAMA 3CNBA 4UHBA 4L0CA 2FXVA 5EWMB 4PEVA 4E08A 2ZYAA 1Z6PA 4ZVRA 1NVWQ 4JUDX 1SUWA 4O4LB 4Q3EA 4F38A 5C8YB 1WV0A 1KYVA 1QYWA 5CDHA 2WNHA 4TS3A 4F86A 4HBGA 2P41A 1ZFNA 1M6VA 1XDUA 2GK6A 2GPYA 1XB2A 2QUBA 4TLAA 3SJZA 1NE7A 1QVAA 1TK2A 3RS4A 4B3GA 1RTKA 1YIOA 2O1EA 2JKZA 1TM4E 1QZ3A 3EAQA 2Z2IA 1EPUA 3QVMA 4PQEA 4XTCS 2XXAB 5CCBA 2MJLA 2JGEA 2B2NA 3AP3A 2WV7A 2Q9BA 5KIAA 2OO7A 1HTWA 1KYYA 1DP4A 1WUJS 2J3IA 4II7A 1X1SA 1H05A 3A1CA 4QWWA 4GZ5A 4B4UA 2QENA 2XYVA 2ATIA 1V4VA 3O4VA 2QMZA 1VM6A 3CCBA 5IUJC 4QGHA 5C53B 2V7PA 5FWXA 1ZK1A 3T9AA 1MEEA 3DZBA 3MVEA 3GCZA 3PWZA 4JLAA 1G21A 4M6WB 2QTBA 4EG0A 4ZYZA 1A9XA 5GQSA 1WEHA 4C14A 5JNUA 4D96A 2A59A 3C7AA 1ZYUA 2VBFA 4DKJA 1FMJA 4ZIRB 3DUWA 1AKYA 1L5MA 4BYGA 1E2KA 2XRMA 2DC1A 1RT9A 3IDOA 3W6ZA 4NULA 4QUHA 2CUNA 1XO1A 1YR9A 3BCRA 4YCCA 2QAGA 1WF6A 4KW7A 3W2HA 5FUVA 5BW5A 5MHTA 1PFYA 2C2ZA 2H08A 4BXOA 3L6RA 4BN5A 2AK2A 2VDOB 1QJCA 2RHLA 2Y1FA 1GPLA 2NV0A 3AFNA 3AEXA 3IP6A 4IQ0A 4L9AA 4RHTA 5KQSA 2XDWA 1KYQA 5I7UA 1R15A 1DWPA 1V6AA 4TYMA 1W6UA 4OREX 6Q21A 1AXEA 4M1YA 4GO1A 4BU0A 1Z2EA 1LQTA 4MUKA 3UK2A 5AXBA 1D1SA 1UZUA 4TTRA 4OGKA 1GZ4A 4PGMA 1QWOA 2ZVDA 3RUEA 4HS9A 2B3DA 4C20A 4DNOA 3IV7A 1V0JA 1C7RA 2HGZA 5JCOC 1WVMA 4CXMA 3C3JA 3G5MA 5H02A 4X85A 4ZREA 5ECDA 5M5BA 1OXBB 3GT0A 1QRRA 2IYQA 2Q7XA 4KH0A 1E3LA 1L4MA 4V38A 3AVTA 2XQVA 3D3KA 1IZ9A 4U7HA 1EX1A 3UAGA 4KGVA 4Z1MD 4D42A 4JYCA 4HEJA 1DG3A 5AJXA 4BC0A 2GZAA 5B1YA 1ZR4A 5H3HA 1JEQB 1FNDA 4PC3A 1XVTA 2YJ3A 2YV2A 4G8JA 4OF4A 1O0CA 1JZTA 1FNNA 3KVYA 1Z7WA 1EUCA 2Y3IA 3QWBA 5EKXA 2DTDA 6PFKA 3HKEB 3C6XA 4PS1A 3HLKA 4U2KA 1DAMA 1RADA 2CCKA 4N49A 4B7XA 4TZ6A 2HWYA 3O8QB 2HO4A 5IAJA 1F8XA 1MOZA 1HDGO 1SCKA 2BF4A 1YWGO 2QTAA 4CMIB 1I5OA 5KX5A 3UFXA 2D2EA 4AJLA 4MB2A 1G5RA 3IKVA 5KEIA 3SJBA 3L06A 1Y82A 3FRJA 3O92A 4JX8A 3DKIA 3VR0A 4CDGA 2GARA 1JQLB 4QE3A 4ZIRA 5KC8A 2V0NA 4B74A 5LXTA 3RRBA 2CWDA 1GNSA 3E9NA 4MR8A 4HH0A 2DCUA 4OQXA 2O8NA 1PCXA 5A3RA 4HF7A 2FETA 5CT9A 5C4GB 1NVVQ 2AN4A 5J2UB 4L4SA 4NHOA 3ROZA 5KOJA 3HGQA 3QEKA 5AI0A 4HUJA 1XEWX 5A1TA 3KEGA 2QE7A 2ZRGA 4PM4A 4F56A 1W0KD 2GA9A 2C3YA 3E0XA 3QBTA 5JHGB 2J9XB 1M34E 4COKA 2FMUA 4KOEC 1BH2A 2TS1A 3OZIA 4WKPA 5BSWA 2QKYA 5EP2A 4EKYA 1YOBA 3RJMA 3ZG6A 1FDRA 1K8ZB 4PHTA 4EBFA 3IP9A 4Y2YA 3CFYA 4AX8A 4CF7A 2H4ZA 1L5OA 1K7YA 3D0RA 5AI5A 1VTKA 1KI4A 1ZHOA 4Z7NB 4KN6A 5CG2A 4JI3B 3EXEB 4ZKDA 1JNYA 3SYRA 1IHPA 3A3PA 2X5NA 3LRXA 2FGJA 5FL3A 2R4QA 4JP1A 2NZXA 3FWYA 1HPLA 2BPOA 2NTJA 4M53A 1Y6RA 4RZ3A 2YV4A 3O1LA 4EA7A 5HZKA 2HSGA 3HJUA 1MFZA 2H8KA 5KTRA 4OQNA 2H63A 2QTWB 3VTZA 4CMGA 4MI3A 2FRDA 1JT9A 3DB1A 3RFUA 1FFXA 3I12A 4DNQA 1F5SA 5C3MA 3AFGA 2WF5A 3GQBB 5B1EA 4WEOA 3NTQA 1R4ZA 4Q7LA 3B1FA 4BASA 1PE0A 4D9KA 5LMUB 1QTIA 4WOPA 2II6A 5HRUA 2AJLI 3X2EA 4C4XA 4Q4DA 1NI4B 2OCDA 2PGJA 2CV1A 3HZOA 1AB6A 4MGYR 4MLDA 1T5BA 3WIEA 1P2BA 2RAUA 1QIMA 2WA1A 4HGQA 2EDAA 3TOVA 1F9AA 3NAZA 3F49S 4J9UE 5DO9A 1HV8A 1W5EA 2A1UA 2DR3A 1BE1A 3WIVA 2QTNA 4INPA 1OFHA 1TM5E 1TVEA 4OAQA 4YHHB 3NZEA 1NU8A 4GI2A 4GR9A 1RQGA 4V0SA 3NHRA 1L5HA 3KB8A 2YZMA 4YRFA 1L8LA 4DRXB 1GTRA 4M4SA 2Q99A 1DO0A 3DYVA 4CG2A 1H9AA 2J1LA 1OJ7A 3OZFA 2JHCA 1OWNA 3RAFC 4OIFA 2J3MA 1U4NA 2ZR8A 2R11A 4RHCA 4NU8X 2QSYA 3D8SA 2ID7A 1HBJA 2BEUA 2C3PA 3VYTB 1B16A 2J0QA 4HNRA 2TECE 4IDHA 2NT4A 1A4IA 2OGUA 3ZD9A 1DKQA 1GNLA 1KKMA 5E9JA 1Q16A 2QX7A 4FZJA 5LP6F 1U31A 5BN5B 1E4VA 1I5EA 3JPWA 1IY8A 2FSGA 2P35A 2WG2A 5CW2A 2P4EA 3KNZA 4HAWA 4OGGA 5KQRA 3K8ZA 5LLSA 5G1NA 1F8YA 2GZHA 5DBIA 3N1UA 4J9VA 4V24A 1N0VC 2CGEA 2AJCA 1UPTA 1UJCA 2H54A 2QVLA 2X9LA 3IEXA 2G63A 4NYIQ 4ZI7A 1DUSA 1S7CA 2CMHA 3U17A 5JARA 3PPXA 1ECJA 4H27A 4E5PA 1P6UA 1TUGA 3ZH2A 1JR3A 4DRYA 5AJYA 3KK0A 4HD8A 4MUAA 1M7GA 1OBCA 3QBEA 5ICGA 1FQKA 1P7CA 4C0BA 1EUYA 2R5NA 3L1JA 5IZ4A 4RY0A 2J0EA 3JZIA 4TRMA 3IURA 3L7CA 3M5DA 4EY6A 4C05A 3MFYA 3HVRA 1D1PA 3WQBA 2C5AA 4CKEB 2XKKA 1E9CA 4K6CA 2EEPA 1E3WA 5EMHA 3VNUA 3ICEA 4ZOLF 4EPVA 1P2SA 4WASA 4IYRA 4URYR 2YJZA 2YV3A 3LDHA 1UKAA 4DA4A 1EB9A 4ASUA 2G72A 1PX0A 5F23A 1BXGA 4REMA 1FRNA 2OESA 1Y6ZA 1VMIA 4MWDA 4DCSA 1GG8A 4CEIB 3GG2A 4FI3F 1YS9A 5CB4B 5L4LA 4FHZA 4WKBA 4H1HA 1WO8A 2Y93A 4AYTA 2Z3ZA 4QGFA 1D5CA 5DW3A 2UYYA 5MDHA 1NSFA 1NFQA 4CNBA 1DI0A 4I5GA 4N8SA 3LHKA 2FMXA 1KYWA 2O2EA 4U4AA 1SOUA 1V41E 4UU0A 1DV1A 2BEJA 5A7GA 2WLTA 4XQ9A 3OU2A 3FTNA 4MUIA 4J7XA 4QAQA 3ER8A 3OLWA 4RKFA 4UOEA 4GLOA 2FWIA 3FUXA 4DLVA 1GFZA 4IWYA 4QG7A 4Y2PA 4RD0A 2YJGA 1HQCA 1QR6A 4QYWA 1CIPA 1CIVA 2E6KA 1GR1A 2B1JA 4H17A 1P6QA 1JQ3A 2JIZA 1UXOA 3N2YA 4JBLA 1W4RA 3RFTA 2JCGA 3PUJA 1Z4MA 5CM8B 5K51A 1QYIA 1B26A 1WQ1R 4KXLA 4BEBA 2XKJE 4YPOA 5KQLA 3SEQA 4MW1A 3AO0B 4HG2A 3PXGA 1TMYA 3VNRA 4I5DA 4JXJA 4HLNA 1W5TA 1L3IA 2XW6A 3IUJA 2D13A 3IIKA 3M6FA 1IWPB 4JVLA 2UZ1A 4M9ZA 4X6UA 4BMYA 3RHFA 4BNKA 3AV3A 3BZWA 1XROA 3FI0A 5T8KC 1LJUA 4AU1A 3MIZA 4I08A 4AK9A 1Q3TA 1NA5A 4KYVA 3OQHA 1P73A 1LK5A 4BRUA 1QKJA 3A7EA 3G9XA 5BMVA 3DE2X 1JJIA 3KZMA 5IVIA 3S5UA 2G7ZA 1E2EA 4F1KA 2XVAA 1DJLA 1X3LA 3AOGA 5DLQC 4TLMB 1K8YB 2HD4A 1UK8A 4TV9B 1X19A 3PYXA 4LK3A 4XWYA 2Q9AA 1P9LA 3D8HA 3WLAA 4US1R 4B3MB 4IJWA 4TYPA 1NTRA 2EQBA 4YALA 1X2EA 1CNMA 4E4YA 1NP3A 3TPCA 3RAEC 4WOJA 3U4QB 2D3TA 3EQ8A 4IDPA 4R1SA 4AF8A 2OQRA 4CYMA 1ZK2A 5F77A 1SUIA 2PUHA 4NV1A 5EGNA 1KAQA 2FDXA 4D0NA 2OUIA 4H0FA 2RHGB 3JQAD 4GX2A 4I2NA 4L15A 2Y8EA 1Q0LA 1DT5A 4YX9A 4PXAA 5I48A 2AYYA 3AW8A 1UL1X 1KI8A 3LUPA 3ICCA 5KCZA 3U09A 1TJYA 1ZSNA 1W76A 4EHAA 3Q0IA 5IT5A 4XYMA 4WKOA 2FJPA 2OYSA 1Z45A 5DXAA 2BFFA 1EVJA 5LVAA 4YNBA 3T94A 1USVA 3LDGA 4G0PA 4RVFA 4YUAA 4REQB 5DM60 5JEEA 2C99A 3QYPA 4RYLA 3ZHRA 2RGWA 4IHJB 4TYYA 2BUAA 4FFSA 2GM4A 4FYHA 4PZYA 1QYRA 1E9EA 3N2KA 1BGVA 4LCBA 2R25B 3H4IA 1ZHFA 4RKYA 4Z7QB 1BS1A 1CQXA 3CLSC 4V0ME 1OXXK 3DJFA 1W581 2AOVA 1TK3A 3F1LA 2FOXA 1CR2A 1XRNA 1KMCA 2R00A 3AETB 3GGPA 3NJ8A 4H4DA 5AKZA 3TIVA 4F4HA 1GKYA 4G4SO 4LBVA 4PCUA 4RD1A 3KUUA 2WKRA 1SZDA 2QAIA 3OUZA 3DAYA 3I52A 1Q0HA 4QBGB 3L9WA 2HLDA 2QOEA 5FUMA 5FWYA 4U2EA 1GGFA 2EV9A 2FFJA 3FOFC 3N2ZB 1S02A 4B3SB 2HRRA 4QLAA 3USES 3WK4A 1NXXA 4RY2A 5JCJD 2WJAA 3DNMA 5AOBA 2R9VA 3DMTC 3PE4A 1QVVA 4PHFA 2JIOA 5ITSA 3C3CA 1NQUA 4Y2TA 1U8YA 2F9FA 4AP9A 2V59A 5L7TA 4F9TA 2NYUA 5ILGA 3DOJA 3E9RA 1C0EA 2EQAA 5LWHA 1DCMA 3JASB 3RUPA 4Y2XA 1UM8A 4WZ6A 2NQ2C 3OY2A 3AM1A 3ZQ4A 1TX4B 5HQTA 2CHFA 4J0DA 3ST7A 1ZMOA 1U0LA 2Q8NA 3SY8A 2ZAMA 5INTA 4EX7A 2G0NA 3VX3A 9ATCA 2J6HA 1ZSVA 3BK7A 1GZSA 4R5MA 3A70A 1W5AA 4C0WA 1ZRSA 4CR7A 3LF1A 4Y0VA 3TGLA 4ED9A 5CCEA 4II3A 5K45A 5I7SA 4XQGA 2JH3A 4MRMA 4PAGA 1WB9A 2X7HA 3DBLA 3I6ZA 3OQJA 4YJ3B 3FCAA 1XHLA 2E7ZA 3N05A 2ZIVB 5EEGA 1HK7A 4GYWA 3OZEA 3L0CA 4RENA 2O5EA 5KYXB 5AM1A 4I4TF 1ECBA 4PO8A 2OYRA 1P0QA 3T3PB 5M2QA 3HEBA 4O4JF 1LBHA 1HDOA 2FVYA 3TEFA 4F72A 3OQOA 4ZO6A 1P0FA 1AXGA 2QM8A 1DJNA 1MB4A 1RBMA 1YRYE 3GUVA 3OCXA 1Q74A 2AEEA 2AD5A 4C6HA 5KYKA 3THWA 1OD6A 2LVBA 2DX7A 1GQOA 4DDKA 2NSDA 1EFPB 3KR2A 5CP8A 3RI3A 5HIAA 5G53C 2D54A 3KSBC 1FUIA 3MOSA 3TCKA 3R7WA 1MVLA 4IGKA 1PR2A 3ORHA 4RHEA 3L0IB 2XRZA 2X3FA 2XE6A 2QTZA 4JEIA 4N5HX 3SR3A 2PEYA 5K0CA 3HDHA 4IF4A 1EP3B 5AK6A 3BIOA 4DCPA 1ZAYA 1OLUB 2Y67A 3KOYA 4IGFA 4C4YA 4Z49A 1J5XA 1Z12A 3A4NA 3DZKA 4CEJB 5DTIA 4MCIA 3QQ5A 1FPMA 3ZBPA 3K70D 1OWOA 4AG6A 2ZYWX 4ZDJA 5I9IA 2Q2NA 2B5WA 1HWYA 5EUMA 4ARAA 1AQUA 3HCEA 1URPA 3COYA 3D7LA 1CBUA 2HLNA 4RMGA 5EIAA 2DT8A 2FWJA 2FRXA 2PTHA 4XXHA 1T34A 3GLGE 3G0BA 5DGDA 1FF9A 5FPQA 3NBXX 1T4CB 1UBFA 2Z5LA 3ENWA 3SHWA 4OXKA 5AQ1A 4DLZA 1ISGA 5TV2A 5HZGA 1W87A 4HGZA 4GMGA 1DFHA 2DUMA 2CNWA 2AG1A 2H65A 1IWBB 1ZK3A 2QDXA 1RWMA 2JK0A 1RAEA 3FPEA 2BKXA 3WL5A 4RJ2A 3JQDA 2FP3A 3H11B 3OSZA 3EASA 3LW8A 2ZI4A 5E4YA 3TIGA 1ETUA 4PO9A 4C1BA 1ZD9A 2BGRA 1J0BA 4AQDA 5EGSA 4CM4B 4BNIA 1DBRA 5C4MA 4FVTA 4J6EA 4QEKA 2OP1A 2WIDA 1Q7GA 1VL0A 2FR0A 2Z6VA 2IYRA 3CUSA 4JT9A 4AF7A 1XKLA 1HYHA 2LNDA 4KC0A 1XXLA 2IPMA 3WB0A 1JWLA 3TJZA 1TUBA 2I7TA 3TS1A 1USGA 2LIVA 5LQCA 3WK7A 1CQJB 3LWBA 4L8YA 2QIPA 4LRUA 3V4OA 4DUGD 2POCA 2VBCA 4S05A 2HPHA 4TXNA 1OU4A 3HSYA 3UMVA 5ADHA 3QV2A 4KHZA 5FI3A 2AHOA 1FK8A 2QJFA 4FMBB 3WMWA 3U56A 3G9UA 4P82A 2HIGA 2O3QA 4OI2A 1RYMA 1P4AA 1NZJA 1Y0BA 5TQ2B 1MUUA 1EZ4A 1LLCA 2FXIA 2PZLA 2ZJ0A 2JBAB 4OK5A 3C7CB 4F3NA 1SKYB 3PENA 2D0OB 1N4AA 4OQZA 3CX3A 3T4UA 2BMAA 2FEMA 4YRBA 1Z33A 5AW9A 1K9SA 5ITVA 2IHBA 2O4UX 1PGJA 2K87A 3DLAA 1EP2B 3LP8A 4EX6A 2QZSA 3B6MA 4BE4A 2RD2A 4TTTS 1NUUA 3BMCB 4AKEA 3AX6A 4LF6B 1KRXA 2B21A 2R7NA 1J49A 2P1ZA 1JFLA 3ZVRA 1L6IA 4HQ0A 4ITVA 2XQFA 1SC4A 1JAYA 1GRVA 2VN8A 3VR3A 1PAUA 2RJOA 1F6BA 2ZSEA 2MINA 3ORFA 3NPAA 5B64A 1GZ6A 2PFKA 2PSHA 1PZMA 3HMQA 1M1ZA 3EVZA 3H8SA 4UW9A 5FFMA 4C7BA 1M5TA 3UC5A 5I4BA 3VO2A 4X45A 3ZS9A 5DM4A 3FZEA 1A88A 4X1IB 4O3FA 3D59A 3U39A 2ZM5A 1C14A 4KQCA 3AIIA 4IG4A 3ICOA 1VHQA 1W1WA 1DVRA 1NQWA 2IOQA 2PKWA 4BO2A 2CNLA 4GICA 1QV6A 2GM3A 4L8GA 4HUTA 4D25A 4C7JA 3ZW9A 1H5QA 2WFLA 2QSUA 3UT5A 1D4ZA 1G42A 2X4GA 5I45A 2PX3A 2WRZA 4HLCA 3AGPA 5D00A 4AUKA 1O8BA 4L51A 3P26A 1DUVG 1R0CA 1Z17A 3BB1A 1LF5A 2JFBA 5DNEA 2NUTB 1ZWKA 4PYQA 2F67A 4JNCA 3ZEAA 5L3QB 2CXPA 4XFDA 3LKBA 1E3TA 3W5AA 1O57A 1QHHA 4E2YA 1DQRA 3PUWA 4M83A 4CUJA 3AR3A 1AOXA 1J8MF