2B6HA

Structure of human adp-ribosylation factor 5
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
171
Chain Sequence
b'RGSLFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 5
publication title Structure of human ADP-ribosylation factor 5
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 57
structure length 171
sequence length 176
ec nomenclature
pdb deposition date 2005-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2b6hA00
4DDTA 1BMFA 3UG7A 5KDOA 1B0UA 1QF9A 1CU1A 4DWJA 4AKHA 3HYTA 1T8TA 2NO9A 2WIAA 1Z0KA 4PQFA 2VIIA 2BKEA 3LBHA 2G9NA 1E2JA 3A1SA 4TT3D 5CB6A 2D62A 5D3MA 1E6CA 1HQCA 1OHHD 2GKSA 2IYTA 4P4UA 2OCAA 2VP0A 2QROA 4MRNA 4UNQA 3QXXA 5AJWA 621PA 4IOKA 4CT4B 2NO1A 5AJYA 3JZAA 3P32A 4Z1MA 3VNVA 2FWRA 1G6OA 1NRJB 1OE0A 4B6FA 1IN4A 5DYIA 1A5TA 1KI6B 3RS2A 1M74A 4AD8A 2XXAB 4M1SA 1BYUA 5GVRA 1D5CA 2A5DA 2OBLA 5HTKA 4EPYA 3BS4A 2J0SA 3GJ5A 2AK2A 3K70D 2OILA 2D06A 2GVZC 3EZ2A 3FKQA 1NVXQ 1CR4A 2VQSA 3W6OA 4DLVA 1T0HB 2QQEA 3ASZA 1NLZA 2ZYTX 1NY5A 2FG5A 2O8DB 1BMFD 2B8WA 4QJ3A 3GEHA 4ARZA 1WF3A 2JLVA 4HAZA 2RGCA 3OHMA 1SKYE 3ZJYA 4EFLA 5KTYA 3PITA 4F38A 2CLCX 4JT2A 1E2LA 1Q21A 4LBZA 4PX9A 3TR0A 2R6GA 1NJFA 1W46A 2DFLA 1WBDA 1Z83A 5DGXA 2JLSA 2OLKA 4URVR 2F3TA 4U02A 3DVLA 1TF2A 5FBQB 4LJ7A 3HP1A 2G0TA 1XMSA 3CPHA 1XD2A 3AUYA 3VR2A 4M1OA 1QHYA 1CJVC 1P72A 3UG6A 4C0LA 1YRAA 1GFIA 4YC7A 3EX7C 1Z6GA 3EZ7A 2BM0A 2QMHA 1IY0A 3ZZ0A 3WBKA 1MABA 4A2PA 1Z22A 4PO8A 1OB2A 1W36B 3B5JA 3L8YA 4I1SA 1P2TA 2VF7A 1C9KA 3KB1A 4GBMA 3SU8A 1OLOA 4HDOB 2G1KA 2FH5B 2ZRKA 2GJAA 1R0ZA 1U90A 3K0SA 1KY2A 1E4YA 4C4PA 3B82A 1IM2A 3WNCA 4EPXA 2JATA 1DADA 1KTVA 1LTQA 3DOEA 3QEOA 4RJLA 5AJZA 3D31A 4E07A 4KVGA 4A36A 221PA 4MKIA 2QTFA 2P6NA 2H16A 5H8WA 5KSYA 1TAGA 3DOFA 5D3QA 2RHDA 3MLEA 4QGGA 4HLCA 5IDVA 2G0NA 2IK8A 4LK2A 4RY2A 2BBTA 4OQLA 1SXJE 1VIYA 2WWYA 2QU8A 5JSZA 3GLIA 4UKDA 1OKKA 3PR1A 5GJBA 4OQMA 4XWOA 2XAUA 4TLBA 2ZU6A 1PUJA 1YHNA 4D4KA 2CLSA 4R2IA 3GLGA 4A0FA 3GLFA 3SNHA 1XBTA 3NIBA 2VLIA 1A4RA 4TWZA 1I2MA 4OHYA 2H57A 1CF4A 3ADKA 4LHZA 4YXWA 3DZDA 2XGJA 1BKDR 2PZEA 3LO5A 1WB9A 5IHPA 3EW9A 2FSHA 1G7TA 3MG9A 4DCUA 1G8HA 2HXSA 2NZ8A 3TW8B 1HE8B 4WZBE 1ZNYA 1RYFA 1H65A 2XNDA 3Q5EA 4Z8XA 2XB4A 3K53A 2BEJA 3KX2A 2PLRA 4LJYA 3T12A 3OAAA 2P67A 4E22A 2C03A 2OLJA 2GXSA 4X8MA 4C2UA 1QHIA 4JVLA 2F55A 2Z5FA 1QG2A 2VP4A 3VU9A 5G53C 3AKYA 1XEWY 5SZKB 1HH4A 3Q7PA 3FFBA 2IWRA 3KJHA 3U3JA 4AG5A 5HPYB 3PG5A 4JYBA 3TLXA 5JLJA 1G20E 2QPTA 4M9ZA 3LY5A 4MQBA 4RCZA 4A82A 1UDXA 2O8EB 4EJSA 3KZ1E 1YZNA 1UPTA 3A4LA 3LX5A 4Q1EA 3TH5A 5AR1A 4FMDB 1QHHB 4RFSB 3U7EB 1OKKD 2ZRHA 4G5SA 4DB2A 2QA5A 4G5OA 5JZVA 2QSYA 2YOGA 1J70A 2ZRAA 3I32A 4PZYA 5CJ2A 5E95A 5EE1A 1N0WA 4KBGA 4TYWA 1JR6A 4M22A 4PR0A 4DCSA 2ZRPA 1VHLA 5A0FA 5TARA 4PSAA 1U81A 4XSHA 3FMPB 1KI2A 4DC9A 2YV5A 4TSFA 4LJ6A 1OFHA 4DIEA 4FINA 1W49A 1ZUNB 1G8GA 2WIBA 2R6DA 3AF4A 4QG7A 5DHFA 5KDDA 5C4GB 4HLUC 2A5FA 1N25A 4LV5B 1F2TA 1XMJA 2Q3HA 3CPJB 1ZM9A 1E2HA 1KK2A 4JLJA 2OAQ1 3NBZC 3OAAD 3GFTA 3L0SA 1T0JB 3IGFA 4M1KA 2LKDA 3A37A 4RD3A 4I1OA 1NN0A 2VP9A 3ZVNA 2GCNA 2OCPA 3SEAA 3IPYA 5DO9A 3U3KA 2GAOA 1FX0B 1U94A 1T8UA 2R62A 4HB0A 4EUNA 1XCMA 1VMAA 4N1AA 2OM2A 3TQCA 5BN4A 5IT5A 3WBJA 2IYXA 2J41A 2FFQA 4M1TA 3B60A 3GLGB 3WHLA 3MWKA 3GLFB 3QF4A 2V7QA 2RGNC 1ZMXA 2GJ8A 1G4AE 2RGGA 1Z29A 1I4TD 3L43A 1OIVA 4M53A 1VTKA 1VCMA 4KLNA 3EPHA 4POAA 1R8QA 3BB3A 4O25A 4QJ4A 1JR3A 4B43A 3IEVA 4A8JA 1NI3A 3NEJA 3RRNA 3PUXA 1ZM7A 3CF0A 1JXOA 3WMGA 3P26A 2QNRA 1MOZA 3I1FA 1KNQA 1KKLA 3QXJA 2GXAA 4GRAA 4PHFA 5BYKA 2IYWA 2GEUA 2BCJQ 1UBGA 1UFQA 1FUKA 3AF1A 4JLNA 4Q5IA 2C9OA 3RLFA 3QPUA 2HJVA 4G01B 3KKPA 3UMSA 4B75A 2CK3A 4TLAA 4DXAA 4TL6A 4EJSB 2V54A 4DLYA 4MYUA 5KSPA 5DISB 4L8GA 4JJKA 2W83A 2QRNA 1KIMA 4HAXA 4MKFA 1PJRA 1G21E 1LNZA 4LX0A 5JRJA 1XTIA 1FTSA 4YLGA 1K8RA 2JAQA 1JPNA 2V7QD 2WJVA 1Z63A 5FTJA 4V0LA 4LJ8A 1YZGA 3SOPA 4KBFA 3P20A 4Z8YA 2Z43A 1YR7A 3I8XA 2D3WA 4TYQA 2QRZA 1Z08A 4ZCMA 1HT1E 3W5JA 3KQNA 2WJIA 3NC0C 1SVIA 3EC2A 3PIRA 1G5TA 4P31A 2NO6A 3UMRA 2XSZA 1UEJA 1G291 1G19A 5E4FA 1AM4D 2CHVA 5LB2A 1XNJA 2PZGA 3FDIA 4QBHA 3VFDA 4DT1B 2WJYA 3KUCA 5HR5A 2HT6A 3KQLA 3W8NA 4CEHA 1QDEA 2HEIA 1R7RA 2E9SA 5JEDA 3QSYA 2Q0HA 4EPRA 1E79D 1DG1G 2EWVA 2OXRA 2CCJA 4EQ6B 4YMWA 5C46F 2DPXA 5CDFE 2VO1A 5KPDA 1W4BA 3LW8A 2J0QA 4GP7A 3K9LA 3QKRB 4QNMA 1ESMA 2AXPA 1CXZA 1Z06A 2CBZA 3CONA 1Z3IX 4Q4AB 2ZI3A 4HZUB 5TXGA 5KUTA 3DMNA 2ZXUA 2QP9X 3MWJA 1BOFA 3K0EA 4IOLA 1ZP6A 3BXZA 4NYMR 4HZIA 2CNWA 4YMUA 2C78A 2AFHE 1Z0DA 1J2JA 4Q9KA 4DIDA 1E9AA 4L9SA 1U0HC 3TSOA 3CZPA 3IILA 4Q03A 2F1JA 2XSZD 3DM5A 4D4JA 5JWOA 3K0AA 5AUOB 4AURA 4XOIA 4WBSA 4R9UC 1E0JA 2IHYA 1WQ1R 2ZRGA 3LA6A 5H1YA 3AKDA 1LS1A 3X1DA 3NHAA 4DZZA 2F1IA 1G3MA 1COWD 1NMXA 3DO6A 1P2SA 2C2HA 2PBRA 5B30A 3AKEA 2LWIA 2OEPA 3ZD7A 1JB1A 1TQDA 2QTVB 1UDWA 6Q21A 1AQYA 5L3SB 5FBLB 4LBWA 1E2DA 5AUPB 2NOAA 1XJQA 4KXFB 1N6RA 1MT0A 4A6XA 4NCKA 4D82A 1ZD1A 2PT7A 4P32A 5K8IA 2B7CA 2EU8A 4IOJA 1U8AA 1ZD9A 3BH7A 4IEEA 2DHRA 4PANA 3TAHA 2CJWA 3P1JA 1JBKA 1G17A 2CNWD 3K70C 5EUQB 2Q9BA 4YDSA 3IQWA 4QBIA 4B47A 2H5EA 1FZQA 1S0UA 3K8YA 1W4CA 4X8OA 5KNCA 1Z0JA 3OFNA 5JHGB 2ZRCA 1ZD8A 4Q9JA 2QAGA 1RJ9A 4MGYR 2KBFA 2ATXA 1E9RA 3RC8A 1XPRA 4A0RA 2IEZA 1CR0A 5B64A 3DDCA 4LYFA 1G8FA 4GDFA 2ZRIA 2KB0A 2VSFA 3WYAA 1KZ7B 3CWQA 4KI0A 5BQ5A 4YDHB 1CIPA 3GJXC 3KXLA 3M6AA 1P5ZB 3OEEA 2Q21A 4DCTA 3EAQA 1T5IA 4JBXA 4AKEA 2HLDD 4PAOA 3FTQA 3X1ZA 4HLUA 4AG6A 1R5OA 821PA 2IW3A 4RFVA 2B92A 4DHEA 3CX6A 1JNYA 1G5RA 3LDAA 2GCPA 5EP1A 4Z51A 3THWA 4KYIB 4Q1FA 2QBYA 3B1VA 3U6KA 3PFIA 2GVDC 2J3EA 4D81A 4C7OA 2GETA 1AK2A 3DMDA 2X19A 3CW2A 2KE5A 4GOKA 3THYA 1FP6A 4OK3A 1NP6A 4BFTA 4LUCA 1S96A 3QBVA 3BORA 4LJ9A 1X1SA 3K0AB 1P3JA 4LV8B 4RD4A 1IXZA 1PLJA 2RGNA 3OFND 2QI9C 1AIPA 2Z6VA 1HURA 1OFTA 4ZDIA 4IXMA 3NKVA 1FQJA 2ODNA 2IS1A 2JJ1A 2O0JA 3EASA 2DFKB 3FOZA 2QAJA 5AUQA 1E2FA 3H0KA 3S1AB 3AVQA 4Q9IA 1P6XA 4BEJA 2ZJ5A 3UWOA 1TTTA 1E2NA 1OYWA 4CGZA 1N6OA 3W3ZB 1JI0A 2CHQA 2ZEJA 4JLMA 4A6PA 4M0LA 4QM7A 3R7WB 1Q12A 2Q3MA 3OIUA 2UVQA 2OCYC 1GRRA 2G6BA 3CZQA 4KODA 4KFSA 2BKUA 3KKQA 3PUWA 1OH7A 1SXJA 2V1XA 3SZRA 3CRRA 3SR0A 1IBRA 2FE4A 2W6IA 4HAYA 1FOEB 3K0CA 1SKQA 4HAVA 2IYSA 5DN6D 2D2EA 3TSWA 4OKSA 2GESA 3AVXA 2YWGA 3AH8A 1CRQA 4C0JA 1OW3B 3RRZA 2HF9A 2QL6A 3H4MA 3SFZA 5LPNA 1TMKA 4QL3A 1S8FA 3T06B 5TMPA 1HUQA 1NBMD 1Z0FA 2IYQA 3I5YA 3A58B 3HU3A 4AI6A 1QHXA 1IXRC 1NKTA 2BDTA 2PCJA 1OH8A 4LHWA 2VP5A 2AHOA 2DWOA 4BFYA 2OZEA 2PMDA 1VCNA 1NG9A 4ASUA 1E0AA 5FTMA 1IOZA 2JGNA 3HU1A 3ND8A 5JECA 3ZVRA 4Q48A 3L0PA 5ELXA 4ZDJA 5JWRA 3THWB 3SJBA 3B9QA 4EIWA 3U7HB 4TL8A 2FFAA 4LPSA 1CR1A 2ZANA 3CF2A 3I3SR 2NZJA 3T35A 2PX3A 3KJGA 2GXQA 2J1LA 1O3YA 1G7RA 3CF6R 1KY3A 3WP1B 5KSOA 1N2CE 1SXJD 4NZYA 2EFDB 4TZ6A 4BLOA 3N2IA 1GWNA 1S1CA 2OE2A 2W6ID 3UIEA 4PFSA 4DEYA 2VHTA 721PA 4LYAA 1C4OA 1FPMA 3B1ZA 4IDQA 2YOFA 1GZSA 3I8SA 4PTLA 5CYOA 3KKNA 3OZXA 2BHRA 2ZYUX 2H7VA 4TL7A 1K5GA 2YOHA 3NG1A 3V00A 3CO5A 4MYHA 4HB3A 3FB4A 3ZIAD 1GL9B 1Y63A 1GL7A 1Q1EA 5CLLA 1VG9B 1N5JA 2WWGA 3RVBA 4D26A 5DI3B 5HE9A 1HQYE 1XEXA 5EE9A 4ASUD 3E5HA 2V4ZA 5KSZA 3SS8A 1QG4A 3CR8A 3NEYA 4GOJA 1J99A 4B74A 1LB1B 2ZE5A 4A0GA 1GKUB 4XJXA 1UBCA 4TT3A 5J4YA 1KZGB 2WICA 3MAAC 2O8BB 2NPIA 1JEDA 2X8AA 4IVQA 1OHHA 1TX4B 4TMKA 4C9BA 3VQTA 4BFUA 3IPXA 2ZJBA 1PLKA 1XCGB 1Z6XA 2IYUA 4DCVA 5G3ZA 2MMCA 1KK3A 2REBA 1F3OA 3CRQA 3M0EA 3IHWA 3R8CA 1B23P 2O0KA 4LYJA 521PA 3TUJC 1NVVR 4JLBA 4RZ2A 4A4DA 4D25A 3IBYA 2DFTA 2WM9B 4LJAA 4UXJA 1CJUC 2OG2A 4ZIRB 3ZZUA 1XEFA 3QPVA 4DSOA 3H1TA 1XTRA 4IDHA 4L9WA 1Z6AA 1BIFA 1E2GA 2WV9A 1G9XA 3GQBA 2DB3A 4JYCA 1TUEA 1X86B 2DWQA 5C2JB 3B85A 4Q1DA 2VHUA 2A9KA 1E2KA 2ZSBA 5SZHB 2IBMA 2A78A 2FGKA 2KWIA 1X8LA 3GJ3A 4AYTA 1DARA 4B2IA 4PO1A 121PA 4GOXA 3PEVA 4AYWA 4HDCA 2P0EA 4KCGA 2OSBA 4XWAA 3A6PC 4NYIQ 2R2AA 2JIZD 4LCBA 3TAUA 4GP6A 2JDIA 2Z83A 2FNAA 3Q5DA 3NH6A 4MA4A 1YJ5A 3IIJA 4RZ3A 3ZS8A 1VIAA 3AVTA 4XH9B 2NPFA 5EP3A 1U8YA 1KSJA 4A8JC 4BLSA 1KI3A 2QSZA 1ZBDA 4KFTA 2GDJA 2W0SA 3HR8A 3UPUA 1ZNXA 1G6HA 4R98A 3ADBA 1VYUA 4OJKA 4DJTA 5BYJA 4NONA 1F6BA 1R0YA 2OBNA 4AYXA 3IIKA 5FH9A 3K9GA 1EX6A 3A4MA 1AS3A 3G5UA 3T1QA 4EPTA 4Q7KA 4XD7A 1XXHE 3A1VA 2GF0A 4Q9LA 3AVUA 5JJLA 1KI1A 2ZJZA 2BMEA 4G5RA 4YMSA 5JS8A 2Q3FA 3QKSA 4NPHA 1P60A 1W0KA 2PH1A 2X1VA 1G64A 2I4IA 4JT4A 1XRJA 2H1LA 1ZUHA 3CIOA 2E1RA 4D0NA 1KO5A 3I4LA 1DVRA 4KITB 3AVVA 1GP2A 1YZTA 2ZREA 3L82B 2ANCA 5CDFA 3RS0A 1KMHB 2ANBA 1M1YE 1UBFA 3KDSE 5FPTA 2JDID 3KUDA 4V0ME 2EYUA 2ZS8A 4Y0AA 1I4DD 3UXMA 3EZFA 3C5CA 3B1YA 4DDWA 4LWZA 1G7SA 5G3YA 4EFNA 1XTQA 3T15A 5FL3A 3PEYA 2GJKA 4QKQA 2RKOA 2W0MA 1U0JA 2FJUA 2RGXA 3K70B 3JZMA 4CEIA 4TQ9A 2D74A 1LFDB 1ZRHA 1P9NA 5FI0B 5J4VA 3FHOA 3I61A 2IS4A 1P2VA 3ETLA 1IJFA 2JJ2D 2BJWA 1KJYA 1RFLA 2ZJYA 4LI0A 1OH6A 1AJEA 3CRVA 2LKCA 4XD7D 2ZRJA 1NBME 2GZAA 3U44A 4B73A 3LVQE 1DO2A 4CRWB 2CL0X 4S2EA 4GMDA 3UK6A 1W5SA 2VYFA 4HAUA 2FV8A 4JS0A 2JCSA 1W0KD 3GEIA 3ASYA 3CRMA 2QORA 3HYRA 1KGDA 1BO6A 4KSBA 5D3MB 5HCNA 2CL6X 4DSTA 3RS5A 3AP3A 4PPNA 5L3QA 4A2QA 3ZVLA 1KSFX 3VNUA 4DSUA 1X8JA 3O8CA 1IAQA 3NDPA 4FN5A 4KFRA 2NO0A 4K8OA 1AS0A 4IXNA 4Y0VA 2BVNA 3AEZA 5FOVA 4M4SA 4OYHA 5L3RA 2RCNA 4Q4HA 4HATA 1OB5A 5DYGA 2J0UA 1ZW6A 2ZVPX 1CJKC 1CULC 1MRNA 3BH0A 1Q3TA 3PCRB 3C5HA 1GOTA 3W90A 1ZNWA 3OIYA 5TB5A 3GLHE 1RE0A 3B8HA 1G3UA 4ZKEA 2QP3A 5UKDA 3Q85A 5CK5A 4PZLA 3MCAA 2FPKA 5FOUA 1D9XA 4B3DA 3PEWA 2O8CA 5C1BA 1XJ0A 2BBWA 2BEKA 3QG5A 3X1WA 2WSSA 2ZETA 1TADA 4ARZB 2EVWX 3L0IB 4O2RA 3K1JA 1M8PA 3W6NA 5FL7A 2ZM5A 4TLCA 1KOFA 2BBOA 1TQ4A 3C7KA 4D4LA 2D7CA 1P4SA 1ZCBA 2HT1A 2DY1A 4BRUA 1Z0IA 1Q44A 2B6HA 4F7WA 2BBSA 2IEYA 1OYYA 4UXHA 2QGZA 3HU2A 1XD2B 4I81A 5FI1B 2IWHA 2WKRA 1U98A 1ETUA 1KJZA 4Q1BA 4N0DA 4Q4JA 1DS6A 2G88A 3VKHA 3WMFA 2PCLA 5FTLA 3L2OB 4KFUA 4EDHA 5H70A 1MABB 2QAGC 4B3GA 1L4UA 2PX0A 4NE2A 2YVUA 4D0GA 1XD8A 4PPGA 5J4HA 2MMGA 4BLPA 3VR3A 5HKKA 1CBUA 5GADl 3ADDA 3A1TA 4Q21A 1UM8A 2GBLC 3MMPA 4KYUA 2D4HA 3EPLA 1CLUA 3NXSA 1AQUA 3FMFA 3BFVA 2XX3A 1W4RA 2ZRBA 4GPTA 2WSSD 4LHXA 4Q02A 4GZMA 2O8FA 1T3SA 3FPAA 5FL7D 2EW1A 2KI5A 2YWEA 1GRNA 2W2VA 1VYTA 4US1R 1FMJA 2HCJB 2P3SA 2EFEB 4AY2A 1P2UA 2ZI7A 1NJGA 5FUWA 2CCKA 2CHGA 1T9HA 4C0HA 2PEZA 5JSZB 5KYKA 3GLIB 2J0UB 3BWDD 3Q9LA 2DBYA 4ZV4A 1F5NA 1RRPA 4FWTA 1M6NA 1W2HA 3QNUA 3WRXC 1R6BX 2NO7A 1HTWA 1JALA 3T34A 2BMJA 3IDQA 3QJYA 3RWMB 5LDDC 3R20A 2ONJA 2ZITA 1DAGA 4O0MA 4JJZA 4G3XA 4IW3B 4CEJA 3MRSA 1A2KC 3B1WA 2FSIA 2C5LA 3RHFA 1N6NA 5HKKD 2CL7X 4PQYA 2IYVA 4MRPA 5GVSA 1ZU4A 3B13B 3B2EA 3WYFA 5GJCA 1YU9A 5BW8A 2FZLA 3VKGA 2OV2A 2XTZA 2GJ9A 2P5TB 1HY3A 4V02A 4C0AC 1TEVA 1J8MF 1Z2AA 2IXGA 1N5IA 1LF0A 3VAAA 3VU9B 3E2IA 5KOYA 5FTKA 5BN3A 1JQJC 4BFVA 1ZM2A 3D6TB 1A82A 1DELA 1E9DA 1XMVA 2B8TA 3J81k 1EWQA 1KO8A 4P3YA 3T1TA 1OFIA 3LLMA 2YNMA 1SXJC 1E79A 4DLUA 4HB4A 4DDUA 1Q1BA 1II0A 2GZDA 3BK7A 5DE3A 1KAGA 5EUMA 3K0CC 3T5GA 2F6RA 3EWAA 3E70C 4G1UC 5H68A 4Q7JB 1E4VA 4BZPA 1N5LA 1VCIA 1P62B 3TNFA 1VECA 2CLDX 1GDDA 4Q00A 1E2QA 1P9RA 3KTAA 3ZH9B 4V0NA 4F93B 3MJHA 4HI0E 5E7JA 4F4CA 4KLZA 3GD7A 4ZCLA 3THXA 2P65A 2ODBA 4WOPA 1II8A 1G7CA 4JLDA 3EZ6A 4LYHA 3X1YA 5F9HA 4URZR 1Z07A 1F2TB 4WIAA 3RC3A 2ODEA 5K8TA 3HPRA 4RKFA 2VSXA 1XD9A 1YQTA 3C8UA 3VR5A 5L8VA 2ZAOA 4QJ5A 4EPWA 5CM8B 2ERYA 2HXYA 4O2LA 1CEEA 5DI9A 1COWA 2QPOA 2PT5A 2RHMA 1GILA 1VCOA 1XP8A 2H8KA 2ZROA 2SHKA 3O8RA 2V55B 3DKPA 1NIJA 1ZNZA 4B71A 4E5UA 3EZ9A 4NCIA 1BYIA 5F98A 4XSGA 2VA8A 4JSYA 4OI1A 1JJVA 3QF4B 1EFTA 3NTUA 4LBVA 4B2PA 1GG2A 1OXVA 4BFSA 3X1XA 5TY0A 5AUNB 2VHQA 1S4QA 5M04A 1AZSC 4CEJB 4MKHA 3T1OA 1G3QA 4QFMA 4B2LA 5FR1A 1MO4A 1YR6A 4L16A 4EFMA 4EKDA 2VSOA 4TLEA 4UQOA 2VHCA 3WY9A 3WNBA 2JEOA 4A8JB 1RIFA 3ONWA 2IT1A 5CK4A 4FCWA 2AL7A 4HUTA 3VHLB 3TUIC 1EFUA 2OHFA 4IDPA 3V4FA 4OBEA 2HUPA 1NL3A 1ODFA 3MJRA 2B7BA 2IYYA 3EPKA 1SHZA 4Q66C 4ZKDA 3MSXA 3AF0A 1KDOA 4QRHA 3ZQJA 5SZJA 3U3MA 5IK2A 2IS2A 2W6JA 3LX8A 1H8HA 3IIMA 3RS3A 4HAWA 1F2UA 3EA5A 4I1VA 3TUZC 1E9CA 2CDNA 5DHAA 1FTNA 4F92B 2HLDA 2YZ2A 1O87A 2P2LA 3TK1A 1JAHA 5FBRB 3QVUA 3QXCA 2XB2A 2ZE6A 1UBEA 4RD6A 3ICEA 1ZUIA 1NMYA 4DLSA 3QEJA 1HE1C 2DWPA 4NBSA 4PSKA 1VPLA 1Y3AA 2WOJA 4M1YA 4DDVA 5HE8A 2KSQA 2OFWA 3LRPA 1QHSA 5G40A 3KTAB 1TL7C 1MKYA 4A15A 1OV4A 5EP4A 1XF9A 1GITA 1SVMA 4HB2A 4OQXA 3VX3A 4PHHA 4R7ZA 1QBKC 3BBPA 4DLXA 4FCTA 2YHSA 3W3AA 2X77A 4J0QA 1LF5A 3OF5A 2C99A 1G8YA 2QY9A 1MR3F 3BFXA 1WDTA 2HF8A 4B6EA 3U7FB 2CMKA 4BEBA 1ZAKA 5BN5A 1UKYA 1SVSA 1E2MA 1U9IA 1YZLA 4EPVA 3TGPA 1Q1ZA 1XU4A 1PUIA 1XXHA 1ZJ6A 2ZIAA 3QKUA 2ODWA 4ESVA 5CIQA 2WKQA 4JIMA 3K0FA 4ACBA 1OXUA 3LQRA 5EJEA 1OT3A 4CEHB 5IK2D 4JSTA 2W6JD 3QUSA 4HUQA 1H8HD 2GBLA 1F48A 2DCUA 4MKGA 2N46A 3GJ7A 1KI4A 5JI2E 2IHBA 2Z4SA 1GKYA 4DB4A 2FX3A 2GAAA 4JBWA 3GLGE 4NYMQ 4IEIA 4B33A 3M1IA 3W6PA 3G0HA 3LXRA 1Z2CA 2DR3A 1A1VA 1KMQA 4URWR 4A92A 4PAQA 4V0MA 4TN1A 1AKEA 1NN5A 4FMBB 1G16A 2XTNA 4H1UA 2MSEB 4UNPA 4BLRA 2J0VA 1Q3HA 1E1QA 5EXXA 1DE0A 5DN6A 4LHVA 1FNNA 1MO5A 3DKVA 1ANKA 3HPQA 1L8QA 4XIGS 1Q57A 2RGEA 3GCGA 4FXPA 2BC9A 2ZAMA 4JLAA 5LB4A 3KKOA 1ZM3A 2Q9AA 1N6KA 2WWIA 1JJ7A 1NBMA 2OESA 5HCIA 2WJJA 3U7GA 1PV4A 3LBIA 3I62A 1H8EA 3SDZA 4URUR 3Q72A 5JJIA 1DAMA 2YC4C 3GP8A 1DAHA 2J7PD 4PC6A 4V0KA 4WXRA 3FKSD 4CT5A 1A2BA 3CUEF 2ZI6A 2L0XA 5JJKA 1SHKA 4K81B 3VX4A 3QI2A 3IKJA 4F91B 4RZUA 3BJIC 1V43A 4NCHA 2Z4RA 2NTYC 3QIAA 4PC3A 4GL2A 4WVFA 4XTCS 4UJ3A 4BFZA 3RYTC 5FPSA 4V0OA 5P21A 1LS6A 2CJWB 4YONB 5JRZA 2OAP1 1CR2A 2C95A 3AV0B 3OESA 3PUYA 4MRSA 1D2MA 4PZZA 1ZYUA 2OO7A 1AN0A 1BH2A 4NU0A 4OI4A 5EP2A 1E1QD 1NSFA 2QAGB 3TJZA 1FP7A 1RJ9B 1KNXA 5DH9A 1Z0AA 3GLHA 1XXHB 2VRWA 1E98A 1XTJA 3CM0A 2RGAA 1TQ6A 2WZQA 1S3GA 1M34E 3LBNA 4HUQB 4DLRA 3QPWA 4XVUA 1G18A 4AKIA 4LBYA 2VH5R 3ZIAA 2ZJOA 4C2TA 3NBXX 1NLFA 4WAUA 2NMVA 4BASA 4K46A 1H8ED 3N2EA 1WBBA 1XDBA 1SKYB 1S2MA 2IUUA 2JLWA 3NWJA 4ZDKA 2XOKA 3F8TA 3I72A 3K9HA 1KDRA 3T5DA 1ZM4A 3RNLA 3TVTA 4XVRA 4B3CA 4DRZA 2WKPA 2OXCA 2QBYB 4Q47A 2AN9A 2KBEA 3LAWA 4I1UA 3SYNA 2NG1A 4C7OB 1XZPA 2AKYA 1II9A 4F4JA 1L4YA 4P4SA 3THYB 2WWXA 2D2FA 2X2EA 4L15A 4OK5A 4QHTA 1NIPA 1DG3A 4MYTA 2HV8A 3SJAA 3LD9A 1T5LA 1SGWA 4RKEA 1N6LA 4PSVA 5KU1A 2GCOA 4C0SA 4LSGA 4JL5A 4AWXA 1YR9A 4IKEA 5GJVC 1L7VC 1EFRA 2XZPA 3RRMA 1VG8A 2QT1A 4OQNA 4V03A 4MRRA 4BLTA 2GK6A 4JVSB 1S3SA 1UADA 4RZXA 2J87A 5CLQA 3BFKA 4BZQA 2JLQA 3LV8A 2YJTD 5G41A 3ICQB 1CRPA 3SYLA 1WP9A 1CJMA 2ATVA 1K6MA 3NC1C 5KDLA 1U8ZA 4A1FA 4ILEA 2XOKD 4CDGA 5EZ5A 4BUJA 2ZI4A 1T6NA 1XB2A 2FU5C 2F43A 4M9XA 2AK3A 3QF7A 3C15C 1DAIA 4QM6A 3W8RA 1SXJB 1VKJA 5KO2A 4D2IA 2CE7A 4TL9A 1OF1A 1G41A 1KI6A 2JJ8A 1NVWQ 3AB3A 3O8DA 4LJ5A 5FUVA 1E9EA 2JIZA 1VYVA 3ZGXA 2XXAA 5KPJA 1SQ5A 3AKCA 4MGZR 1UKVY 5FPKA 2GWHA 2R6FA 1XPUA 4MUBA 2AWOA 4W5HA 2FGJA 4LC1A 1KYIA 1N5KA 1FQKA 1Z6TA 3AVPA 3UWKA 2Y8EA 5EZ6B 3LH5A 2ZSAA 1GRQA 1KI9A 3AP1A 4NYJQ 1EFRD 1XEWX 3VR1A 2K5UA 5J4KA 5JS7A 2AD5A 2QN6A 4YQFA 4W9MC 4Q18A 2WMNB 3C4JA 2O8DA 1E9BA 4UJ5A 3OEHA 1XX6A 2HCBA 4TMTA 2C98A 1KDTA 1WXQA 2FN4A 1NN3A 1TU3A 1EFHA 1DBSA 4KSCA 3C41J 5FUYA 5FFMA 2WVJA 2FEMA 2V6IA 4E09A 1SVKA 3KFXA 2R6AA 2UZIR 3SN6A 4RCYA 4DBLC 1W44A 1GKIA 2IXEA 1WMSA 3B6EA 2AR7A 3IUYA 4KJZA 5IF9A 1WCV1 1P73A 2JA1A 4KAXA 4UNNA 1JPJA 3DM9B 4PPFA 2WTUA 4JKIA 1IXSB 1T4GA 3CH4B 4BGDA 3U2QA 1J7KA 3F5FA 1E2EA 1N6PA 2WPDA 4LHYA 2P6RA 5F3WB 2ECKA 4PQRA 1HV8A 1JQLB 2ZI5A 4Q4LA 2ZRDA 1W4AA 5JCPA 3KKMA 2A5GA 5FPYA 4GI7A 5B2ZA 3CBQA 4X8LA 3Q3JB 1P9WA 3WP0A 1CP2A 1OXXK 2BJVA 1IHUA 3CR7A 3VR4A 2JJ2A 3OEHD 2N1BA 2ZUDA 3HR7A 3SHWA 4URYR 5EQTA 4L5BA 1XEXB 4QGHA 5LD2C 2F9LA 2YKGA 1OIXA 2ZE7A 3WXMA 2IYZA 4FMDF 4MDFA 2F43B 2F7SA 2WMOB 2CVFA 2OFOA 2EQBA 2ZJ2A 3PJRA 5EE5B 3CLVA 5JBQA 3SI7A 4OK6A 3R8FA 5FBWB 2FZ4A 1EXMA 3V9PA 3F3YA 3PXGA 2G1JA 2V6JA 4QOSA 3U3OA 4OI0A 1W5TA 5JCZA 1OXTA 2V9PA 2IYLD 3H86A 2EFHB 1NVVQ 1GNQA 2F1RA 4A0HA 1FNMA 3A1WA 2IXFA 1QHGA 3K9NA 1ZIPA 4ABYA 4ERNA 3ZLJA 5HZHA 4QXAA 1W36D 1IONA 4PC7A 4FMCB 1NVUQ 5TVKA 2WPDD 1T91A 4TMXA 1J8YF 1GVNB 1OPXA 4B34A 3CWZA 3QY0A 5J5CA 3AVYA 2FSGA 4DLTA 1E1RA 3D7MA 4OL0A 4B3XA 3IBGA 2NQ2C 2AWNA 4IDOA 3A8TA 4FD2A 2RGDA 1MO3A 1NY6A 1RYHA 1US8A 2WJGA 2XZLA 2W00A 1R0XA 2QP4A 3X2SA 2QM7A 4TYNA 2BMDA 4H9GA 3TBKA 1Z6YA 3HDTA 4GSYA 4NCNA 3TRFA 3DL0A 4ITRC 4QNRA 2REOA 1GL6A 2EFGA 4Z1MD 2QG6A 4URXR 1GUAA 5CYPA 1QHNA 2XITA 4OHVA 5B58C 2FA9A 2WWFA 3DHWC 2GEDA 4MUAA 3JVVA 3AVWA 3BERA 3RS4A 2O8EA 4W5JA 3GPLA 1SVOA 3AP2A 4DKXA 4RFSA 1CJTC 1EWRA 1QHHA 1T3LA 4UXIA 2BCGY 2ORWA 5EXTA 5F2EA 5FOXA 4LJ4A 4C0BA 1Z28A 3THOA 4ZO4A 3VR6A 3GJ0A 3BD9A 1RRCA 5EXSA 1ZC4A 1KO7A 4P0TA 1GTVA 3AUXA 3D8BA 1E32A 4H1VA 4KVAA 3RABA 4BFXA 2PL3A 5BXQC 4QBGB 1N0VC 1DAEA 2ERXA 3VMFA 1E1RD 3SJZA 3FYHA 2ZU0C 2VHJA 3ND9A 4MITA 4HSEA 1DEKA 3JVUA 3TKLA 5KNBA 4DUGA 5J47A 1QRAA 2A5JA 3PENA 1DAKA 3QKSB 1ZVQA 1F60A 1GNRA 2QMOA 3GMTA 4Q9HA 3W9YA 2QENA 3LQQA 2A3RA 4ZPXA 2YWHA 2WSMA 1E0SA 4Q7MB 1OJLA 3N5CA 3SBEA 1ZCAA 3BB4A 3K09A 1FX0A 3EG5A 5IRCD 1V5WA 2P6UA 5FR2A 3TVDA 4BE7B 5K8LA 2AD1A 1I2DA 4TTRA 3ZVMA 4KU4A 1K5DA 2ZRMA 2BV3A 5ANRB 2IC5A 4DVGA 3W34A 2ZUCA 3KL4A 3WRYC 4JBYA 1XCPA 3BE4A 4GFDA 2QT0A 3WYGA 3ZQ6A 4TMWA 2DFNA 3AGQA 1G3RA 1R8SA 2QMEA 4QHSA 4CEIB 1R2QA 1X1RA 2EFCB 3QKTA 2PJZA 1SZPA 1KSHA 2QUZA 2CEAA 4TYYA 1MO6A 2ZJ8A 3E1SA 4YMVA 3W5IA 1UF9A 4HEJA 4IHQA 2P5SA 4OQFA 1GM5A 1U9IC 3PV0A 1R0WA 1US8B 3FWYA 4FW9A 3B78A 4D0LB 4LV6A 4IRUB 1TF7A 4C0KA 3U44B 4WXPA 1KJWA 2ZRNA 3FHCB 2GF9A 3OE7A 2XEXA 2FEOA 1D9ZA 1E96A 4DUGD 4JKYA 8OHMA 1YR8A 4CF7A 2ZSFA 4F4IA 2RAPA 1AA9A 2NGRA 4YMTA 3MGCA 5KNDA 3F0TA 2VPPA 4JLPA 5C18A 4US2R 3L8ZA 1CS4C 2WBLC 3OIWA 5L3QB 4OHXA 2FOLA 1HEIA 1W2GA 3MUFA 2H17A 1N3BA 4JLKA 4NKRA 5KHOC 2JASA 4ZCIA 4AKGA 2IX3A 4JLOA 4G5QA 1KK1A 3IQXA 1OH5A 2BWJA 5CB8A 3U60B 2Q6TA 4B32A 2WAXA 4MH0R 4YXWD 2F9MA 4Q4HB 1W0JA 2JLZA 2BOVA 4ON9A 3TW4A 1KKMA 4TYPA 2IL1A 3IEUA 4IOMA 1D6JA 1WA5A 3NBFA 2XNDD 5FBVB 2I1VB 4NCJA 5SZIA 2KJQA 1VG1A 3AGPA 4NHOA 1TPZA 2VP2A 3ADCA 4UNSA 3C14C 1D2NA 4L4UA 2J5XA 3RRYA 2PLFA 2O8CB 4CZ2A 2V3CC 5JFGA 2X2FA 2HJGA 2ORVA 4QC2A 4DT1A 2LCFA 1RKBA 3PUZA 3OE7D 2OCBA 4HLQB 4P4TA 2ZUBA 1E9SA 1KI8A 1R5NA 1QVRA 1TF5A 2W58A 1XJCA 1VG0B 2IA5A 3LNCA 1OSNA 2NIPA 3QOFA 1KDPA 3ECCA 1S9DA 4JL6A 4XVQA 3B9PA 3TR5A 4EQ6A 2CE2X 3WMEA 1RPZA 4PAMA 4M1MA 4MYCA 3RDPA 1MRSA 3QKRA 1IJEA 3UATA 2FFHA 4Q4AA 1WE2A 2N42A 4HZUA 4UNRA 2JLYA 1RVDA 5CM9C 4ACAA 4TTPA 4Q4JB 2A2ZA 4TSFD 3R9XA 1W0JD 2V8OA 3U4QA 4M1WA 4TQUS 4CIDA 2REXB 2GA8A 2ORIA 2XJ4A 4DLWA 4LZZA 1M7BA 4W7SA 4AK9A 3AQ4A 3CKLA 4PXAA 2ZS7A 5JEEA 4TQAA 1M7HA 1FMLA 2YINC 1P75A 4B35A 3WNDA 1KHTA 2PMKA 2GRJA 1W1WA 2GTPA 5L3VA 4NDZA 1CKEA 3BAFA 4LPKA 3LXXA 4TMZA 2GZHA 2QEQA 4KHZA 421PA 4AIIA 1NLYA 3CX8A 1E69A 3EIQA 4OHWA 4PHTA 4XTRA 4LOAA 5GJWC 2D7DA 2O8FB 2G3YA 3KXKA 3DEFA 2YC2C 2GK7A 4MDEA 3MFYA 4M8NE 2H92A 4II7A 5L3SA 2OUKA 2QZ4A 2EWWA 1EFCA 1XTKA 3C16C 2R44A 2R8RA 4RD0A 1FW6A 4B3BA 3GJ4A 3REFA 2VL7A 4ZI2A 1YKSA 1VHTA 3DZ8A 2ZR9A 2DYKA 1G3IA 1DO0A 2QMUA 5AWFC 3KFVA 1JR3D 3R9WA 1Q0UA 4B44A 2ZRLA 3KQUA 4N0EA 1YZKA 2IF2A 1AZTA 4IFBA 2R9VA 1DTSA 1GSIA 2Z0MA 4A9AA 1J90A 1AS2A 2CXXA 2J9RA 2ZTSA 4KV9A 1GIAA 4DEXA 2C9YA 5K8UA 1E3MA 1W48A 5FOSA 2VBCA 3VKWA 4E03A 2QGNA 2AX4A 2MSDB 3FMOB 5TDHA 3CRW1 1M2OB 1W7AA 2CK3D 1P7CA 3G82C 3CH5A 1EGAA 5CJPA 3KJIA 1KAOA 4A2WA 4OI2A 1Q20A 1EG7A 2FSFA 3EC1A 1KK0A 4BPBA 1P61B 1EESA 1R5BA 4DCNA 5LD2B 4M21A 2QE7A 4Q19A 5EE3A 2ZRFA 1VDZA 3WHKA 2VEDA 4AC9A 3D3QA 1GNPA 3P27A 3QE0A 1Q1QA 3CPEA 1IN5A 2GNOA 5C4MA 4TMVA 3R9IA 1TNDA 3TE6A 4LDJA 3LWNA 4PO9A 3EPJA 5E7IA 2I3BA 3VHXA 3U4QB 3KB2A 3NBYC 5JHHB 3UMFA 2WAYA 3EIEA 5DNYB 3U6BA 5A5GA 2JLUA 2WWHA 3KJEA 2IUSA 4GT1A 1R10A 1I4LD 1AKYA 1JAIA 3I92A 4RSGA 4RVCA 3PUVA 1RW4A 3RS7A 1KO1A 4FWIB 1PLLA 1G5PA 3RSLA 3QQ5A 3RANA 4FIDA 3THXB 3REGA 1II8B 2XTMA 3EWSA 4OJQA 2R65A 4U5XA 1BS1A 3S1AA 2AFIE 2VTKA 4QGFA 3CNOA 2Q9CA 4TTQA 3M4YA 4M9QA 1OXSC 4JVNA 3RAPR 4X8HA 4PC1A 2A7QA 4I4LA 4LGMA 3CNNA 5DIFA 1G1MA 4G0NA 1OIWA 2GEVA 3R7WA 2QE7D 3A1UA 4WA7A 2B21A 4HLDA 3GJ6A 1N6HA 2WJHA 4QHYA 4BLQA 1NNEA 2G83A 2IS6A 2J7PA 4I99A 1YE8A 3FKSA 1CTQA 2ZYVX 3BB1A 3KQHA 4IFEA 3GLIE 4WW0A 1G8PA 4Q1AA 1UAAA 4BQSA 3HWSA 5FOWA 4CYMA 3GLFE 1W36C 5FTNA 3L0OA 3CNLA 3SHFA 2GJSA 2OBMA 1SVLA 4S35A 4BWYA 3QVVA 2C8VA 3B1XA 4BECA 3AF2A 5E7MA 1YVDA 1IQPA 4DSNA 2UKDA 4DLZA 1ESNA 2ZPTX 1XZQA 1TEXA 1LY1A 2PJRA 3QBTA 5A4JA 1LV7A 2V1UA 1E9FA 1RRGA 2C04A 2W2TA 3BC1A 5JI3E 1HYQA 1F2UB 3ZD6A 2F1HA 3PVSA 4D6PA 3CB4A 1SVWA 4LRWA 3Q7QA 2WWWA 4EAQA 4TZ0A 2A5YB 3O47A 2MSCB 1IY2A 1TQ2A 2A30A 4W5WA 3IHLA 1TU4A 3Q8XB 3I5XA 2ZI9A 1AGRA 2EYQA 4MGKR 1LVGA 2ASEA 1QZXA 2HYIC 1HT2E 3U61B 3U3RA 1RRFA 4FCVA 1IN8A 3UANA 2HDNB 4MRVA 4B48A 1XWIA 5DLQC 4FI3C 3KQKA 2AKAB 4JZKA 1XPOA 1WRBA 4U00A 3BGWA 1NKSA 1S1MA 3V4RA 3RSOA 1XFAA 2RB4A 1A7JA 4BZXA 2RGBA 1S9HA 3OEED 1LW7A 1N6IA 4M9SA 1OFUX 3SBDA 4B76A 1Q22A 5BWMA 2J46A 2TMKA 1IY1A 2ZSDA 2BM1A 2PZFA 3B7GA 5DI3A 3TSZA 4IJMA 1NSTA 2ZVQX 3FVQA 3K0FB 2QTHA 5AJXA 4R2HA 3SE0A 4PHGA 3SYKA 3NDBB 5JWHA 1YZUA 2VF8A 2H18A 1XTSA 3HJNA 4IVRA 3TMKA 2GILA 1E0KA 4Q7LA 2ZR7A 4LC0A 1KSGA 4HYYA 3T1VA 5CITA 4WZ6A 3GFOA 5FUXA 1PVOA 2O8BA 3KXIA 2XJ9A 4P33A 1X8KA 2O0HA 3LLUA 1UEIA 3BIFA 3NHBA 1NN1A 1RC8A 4Q1CA 3P4YA 5AK0A 5DSZA 2YWFA 1T3HA 1XMIA 3A4NA 3GFPA 2J7KA 4NTZA 3VTKA 3P4XA 1Z47A 2R6CA 4IVPA 1U0LA 3IO3A 4R71A 2XZOA 2WOOA 2FDCA 2OT3B 5FPHA 1JR3E 2C77A 2ZSEA 3EXAA 5LBIA 4XWKA 5F9FA 2FF7A 2F3RA 4Q01A 2UZ3A 1ZINA 1E99A 1MH1A 2JJ1D 2JLRA 1NMZA 2PEYA 4IDNA 3ZYCA 3FE2A 3MWLA 1FUUA 3BOSA 3AVOA 3MWYW 3SFVA 2QM8A 4ZIRA 3GEEA 3PEUA 1M7GA 2WHXA 3AM1A 3QENA 1PZNA 4BFWA 1ZIOA 1JXMA 4GMXA 4NYJR 3SQXA 2J45A 4QGAA 1GAJA 1DPFA 1RZ3A 1YRBA 4C3ZA 3FHTA 4RD1A 5TV2A 4MGIR 3ZZTA 5J40A 3K09C 3ZDQA 1EK0A 4HDQB 4GNKA 3LVRE 3ZS9A 2J59A 2ZE8A 3RWOA 3QXSA 3I73A 2BIFA 2CVHA 2RH5A 4FMCF 4B3FX 1NF3A 4RD2A 4C0QC 2BMFA 4JL8A 1JEEA 4JMPA 3U5ZB 5AJVB 1N0UA 4PPQA 2GHIA 4NMMA 1FL9A 4QBFA 2FFBA 2C96A 3A36A 2FPLA 3NH9A 2IF0A 3QXHA 2GXUA 2ZS9A 3AF3A 4NL4H 4CVNA 3EARA 2ZQ5A 1X3SA 1E2PA 2QQ0A 3NVAA 1YZQA 4NYIR 3SJCA 4O3MA 3BRWD 1ELOA 1DAFA 4M2LA 2ZJAA 1TUIA 4ZDWA 2I1QA 1U99A 1FFHA 1KO4A 3EA0A 3N70A 2E87A 4C30A 3DPUA 3TQFA 1UKEA 2W2XA 2C9CA 3H84A 1L2TA 2AXNA 3GLHB 3SC3A 3OIVA 1KI7A 1C1YA 5JMTA 4JLVA 4Z54A 4ESHA 4GZLA 4NP6A 4KO8A 4CW7A 4N3NA 3UKDA 5HZKA 1ZC3A 1E2IA 2FMXA 1SULA 4JVMA 1IN7A 1JECA 3SQWA 4EJSC 1Z8FA 1X6VA 3BH6A 2HYDA 5FOTA 4D4MA 1E94E 1ONBA 2CCGA 2G77B 2XNSA 1QVAA 3FFAA 2IYRA 3FMIA 5EXPA 4PC2A 4US0R 2QPAA 5B57C 4ZI3A 1UKZA 1KMHA 2O52A 5E3HA 1D8TA 3O8BA 4D80A 2JLXA 3QG1A 2O5VA 3EIHA 3H2YA 1EX7A 2OFXA 3PQCA 1D2EA 2FPMA 2YYZA 4P4SB 2IUTA 3LW7A 4G5GA 4NH0A 5CIWA 1IN6A 2VP6A 1U2RA 3GJ8A 5J4LA 1MV5A 4OHZA 2ZYWX 1UJ2A 2ONKA 3LFUA 1G4UR 3TIFA 4BRWA 1W47A 4U7DA 3FGNA 1ZU5A 3IO5A 3MD0A 1DOAA 4WZAE 3CX7A 1AGPA 2GCOB 2RMKA 1HA3A 4LY6A 4TLDA 1R4AA 2ZR0A 1Z5ZA 1NG1A 5EE0A 3T61A
chains in the Genus database with same CATH superfamily
5HJ5A 4M0FA 3GN1A 1INLA 1BMFA 3PGKA 5COQA 1B0UA 4E2ZA 1CU1A 4UBKA 3HYTA 1T8TA 4E3WA 2Q9UA 1SC1A 1T8SA 2WIAA 3JRWA 1Z0KA 3WO1A 2VIIA 4OMFG 4FSHA 2P1ZA 2G9NA 3U80A 5ERGB 4NFLA 5CFMA 2J5BA 3EXEA 4UAVA 4HQKA 2DH5A 4H7DA 1QGAA 5U4QA 3V46A 3VC2A 5KINB 3QE9Y 3OCXA 3GDHA 2WIFA 3GMDA 1CUWA 3G8AA 1E5LA 1R4NB 4E4RA 5JT1A 1KVSA 1YJCA 3QTTA 2NO1A 3AHJA 2HU2A 1P7PA 2C3UA 3D3JA 3IVMA 1BRMA 4HNRA 4QQFA 4HF7A 4Z1MA 2FWRA 4TOIA 1NRJB 1OE0A 1EP9A 3WLKX 4FGJA 1B74A 2IITA 4QYXA 5D3KA 4HQFA 1EUZA 1KI6B 1YDGA 3C8ZA 1M74A 2PNFA 1WB4A 3L49A 2ZBGA 3OCJA 4JBLA 5F51A 3TXYA 4D8UA 5HTKA 4O4HA 4R4JA 5BOVA 2X5XA 3AX6A 4RJKA 1QCZA 2I2CA 1JHYA 4EPYA 3BS4A 1YA8A 1AC5A 2KLBA 1BNCA 2D06A 4PLHA 4EZBA 2XMPA 1D2HA 5EKUA 3RKUA 4AKTA 3KOYA 3LGXA 1SOMA 1T8PA 2WLTA 4FYXA 4CU5A 4UQLA 3EODA 4RK6A 5KC8A 2TECE 1D6SA 2P4HX 4M6WA 2OK7A 3BTVA 2GD2A 3KB8A 3PIDA 1T1JA 5K0CA 1B42A 2GM5A 2JLVA 3OHMA 1DXHA 2WNHA 4JLUA 1Z6ZA 4C3OB 2AQ8A 3BMXA 5D5PA 4BCDA 1B15A 2AZDA 2RG1A 5K7SA 1CUSA 3FYSA 1ZI8A 4MO9A 4PX9A 4LBZA 1JDBB 2QTAA 3FLBA 5E9QA 3PFGA 3TR0A 4N5NA 3VI3B 3FGOA 5CFPA 1H6BA 5K03A 1WBDA 4PIVA 4QDXA 2P35A 2JLSA 2HU5A 1AQLA 3AWDA 4XCVA 4URVR 1FNSA 1TF2A 5FBQB 3PC8C 3BXXA 4FONA 1M73E 2XD4A 4OGKA 1K3TA 1NW8A 3DZJA 1XMSA 2E89A 4EY8A 4POOA 1XD2A 3CSSA 4PHCA 1P29A 3AUYA 1QHYA 3T7JA 1YRAA 2JJMA 5ARDA 3F7OA 1Z6GA 3EZ7A 3ZKAA 4DTIA 4G0XA 3IS3A 4M0DA 2IQ5A 5K3CA 3WBKA 1JEYA 3W79A 4CG2A 3DP7A 4YAGA 4BUZA 4ESOA 3B5JA 4YP1A 3L8YA 4HV4A 1NX9A 1C9KA 4GBMA 2ZRKA 2FH5B 1ULHA 4UULA 1R0ZA 4FFBB 1S7CA 1RHKA 5KYXB 1SKBA 1RMQA 2X0FA 1HT0A 1BGXT 1L7AA 3L6EA 2VZEA 3QPDA 3FPFA 4N0QA 1EDDA 1KR5A 1QTQA 3IOYA 5ER9A 4MGHA 3U16A 3GA0A 1NBHA 2M2IA 4YBRA 3FPEA 5AJZA 5HXAA 4BGIA 2HF2A 4KVGA 221PA 1SQ6A 2KX7A 2QQFA 2WF7A 3BSFA 4MKIA 4QT4A 1CY4A 1WKBA 2JA2A 2JGJA 4XARA 3RUAA 4GXQA 3OZIA 3HCRA 4JQYA 2AXQA 4Z0TA 4ZCPA 3GFSA 5DXJA 1TAGA 5G0TA 5ADHA 3OBBA 2RHDA 3MLEA 5DM4A 3RU3A 1NQXA 2R4UA 2IK8A 2W6QA 3LHKA 1H2RS 2NYUA 3NHSA 1C9MA 1ECBA 1UCFA 4OQLA 3KVYA 3HDYA 4XGKA 4YCBA 1XRQA 1F06A 4LX8A 1KZYC 4P4GA 2WWYA 1KEWA 2CZQA 5JSZA 5L4LA 1SXPA 4Y0NA 2D1RA 1VLVA 3BD7A 4R2IA 2BR5A 4D4KA 1KJ8A 4OLBA 4IR7A 2J6IA 3GLFA 1XKTA 1B4DA 3Q0TA 1XBTA 4ER5A 1I6KA 5CCBA 1RQRA 3D3KA 4RHTA 1RWVA 4I6EA 1NOKA 1YXMA 1YCHA 2H57A 4M1QA 3RJ5A 4IO1A 4YXWA 3DZDA 5IKXA 1J2UA 1J07A 1I5EA 1HYHA 3CEAA 3G8DA 5IHPA 2FSHA 4KIWA 1FTWA 2V65A 3H7IA 1N75A 3DFKA 2DG2A 1G7TA 2NVUA 3ODGA 5JAQA 3LPAA 3A26A 2HXSA 1JX6A 1ZJ4A 2ZSKA 1HE8B 4RDHA 1T5HX 2HFKA 3ADOA 1NNLA 1I2CA 4KNYA 2BEJA 3KX2A 4LJYA 3IQIX 4BNIA 4HWOA 2VXBA 4E22A 2GXSA 1ZHHA 1RCUA 1ZXXA 2YY6A 4MUFA 1TDJA 1IK4A 2ZTVA 1BS9A 3NOXA 2Z5FA 4JVLA 2WQ7A 1L8AA 4CT0A 2ID8A 2PZLA 5CA1F 1M5UA 2TSYB 3TD6A 4C08A 3F73A 2HJHA 5E9AA 2VDJA 3TX2A 1L5FA 5AOCA 3P9IA 5IASA 2CDRA 3OJXA 3CVYA 4EABA 2EF0A 2QRJA 3DDZX 4GM0A 5JLJA 1OV6A 1IZ7A 2A67A 2H7YA 2B5WA 5TPWB 4LXTA 3M7IA 3TCNA 3ETEA 3FPHA 1NASA 1JLKA 2PAAA 3FUCA 1CQJA 1UPTA 1W5AA 3K4HA 2J6BA 2YWBA 3KZ1E 1O5OA 1EDOA 3CY6A 3AFMA 4I50B 3MTAA 4Q1EA 5CHEA 4BV3A 4D56A 4G5SA 5EQJB 4G5OA 1KH1A 4MVJP 3EZGA 1TJ5A 3C43A 3I32A 2P9CA 1K9SA 4PZYA 4C2AA 5EE1A 4KBGA 1IY8A 1ILEA 1BA3A 4TYWA 1JR6A 1OFVA 4DCSA 1CQWA 4FNMA 1HKHA 5TARA 4JXXA 1FLDA 4J4HA 4KOEC 4DC9A 3H5AA 1BVUA 4GC5A 4K40A 5FO1A 2OXIA 2G7MC 3A2NA 2XT9A 4DIEA 1W49A 2GD6A 3AUJB 2CF6A 3MJVA 5NLLA 4B7UA 5BNTA 5KDDA 3VR4H 5AVXA 1IZYA 2R751 2YXDA 1QZ3A 3E3OA 2CB9A 3RVJA 3B9RA 2Q3HA 3ZWWA 2ZYDA 3HLYA 1E2HA 1JB9A 1GLGA 3EMVA 5CCEA 5TGZA 2WT8A 4M1KA 2QUIA 2XV1A 3P9RA 4RD3A 3J7AC 1HM5A 3LC2O 4ARAA 4P7BA 1DZIA 5HIJA 4JMLA 5CTJA 4TSKA 3SEAA 4Y1EA 3DE7X 2CJFA 3U3KA 1J5EB 2FXIA 3OETA 1T8UA 4RMJA 4EUNA 1HR0B 1XCMA 5B6IA 2X4LA 4RHFA 5BN4A 1ST2A 4M1TA 3TJRA 1QO0A 1E1YA 3GLGB 3WHLA 1CC1S 3B70A 1WB5A 1A9XB 3PDJA 4BP9A 5BVGB 3LC1O 4L08A 3LS2A 3B3JA 3EULA 2YXLA 2ATEA 2OHVA 3OT4A 4F04A 1ZMXA 1XQVA 5EZQA 1EFLA 2I4OA 1G4AE 1GSHA 1YDHA 2J31A 4G8BA 3FWNA 2PSJA 3HEBA 4Q9DA 1SFRA 2VZLA 3E0QA 4YJHA 1VTKA 3BXGA 3ZV3A 5BMOA 3EPHA 1HDZA 1NM5C 2R1UA 3NHLA 4O4JA 3FIUA 3PX7A 3ZE8A 3ZWAA 4CMBA 3KXDA 3ZHZA 3BD8A 1ZM7A 4OQYA 1X2BA 5F5XA 4QOEA 4RIGA 1G6Q1 4RE6A 1DRKA 4L78A 3CF0A 4RESA 2AJCA 1RYMA 4JAVC 4DYHA 3H17A 1MOZA 5AKIA 1KNQA 1WPQA 1SG6A 4N41A 1NXPA 2ZIXB 5TF4A 4MW7A 2EX0A 3EISA 1UBGA 3FF4A 3IP6A 3ROXA 4E1AA 5BSWA 1RI5A 2H3EA 4JLNA 4NFYA 2VUHB 3QPUA 2HJVA 3RLFA 3KKPA 4B75A 1KQPA 1SIOA 3DZGA 1GZ3A 1UQRA 3JD0A 1PTKA 1F4LA 1Q3KA 3M6UA 4OFBA 1E6KA 4MI6A 4KQ1A 1GU1A 5BUSA 1PFKA 1XI2A 3MZ0A 5KSPA 4XIJA 4Z4FA 2CXPA 1HFEL 1Z25A 3H1PA 4HUJA 3KSMA 5AW9A 4W5OA 3F4LA 3RW9A 3NV7A 1I1HA 1R6VA 3E4CA 2OBYA 1G21E 3ABSB 1NPTO 2HPAA 1XTIA 3SS9X 4J1TA 2JAQA 4F3NA 1EXDA 1MQ8B 1XZJA 4E51A 5LIPA 3P4UA 2CKDA 3FETA 4FGZA 1SUWA 1UJ5A 2WFMA 3BJEA 4ITUA 4ARBA 1V95A 2DT5A 4DQKA 2C88A 2Z43A 3B48A 3WK8A 3PJGA 2D3WA 3JASB 3G2KA 2EAUA 3H9BA 1UBKS 4NBTA 5G0SA 3H9EO 3KQNA 5JAUA 5JSQA 4P31A 5EJAA 2YWJA 5F5NA 3UMRA 2PMCA 4OB6A 1G291 5DGDA 5ALXA 2D7JA 1UJMA 1MC5A 5I5EA 3O5AA 3MTJA 4LKOA 3FDIA 5HR5A 4WBNB 3ABIA 2WJYA 1UMCB 2GK4A 2HR1A 2QN9A 1SBIA 3HYLA 3I0ZA 4AY6A 5A4DA 2GRUA 3FLEA 4A5OA 1GGVA 2ST1A 3ZGVA 1CIVA 4D8WA 1QDEA 3B36A 4FU0A 5G0VA 4UEKA 1PHRA 3SXUA 2FXVA 3TR6A 3QSYA 4EPRA 3DXXA 3L4BC 3GEBA 3UXHA 1T0BA 4DRXA 2EWVA 5H3CA 2PKQP 4P2BA 4X7BA 2XADA 1IXYA 2VK2A 4EQ6B 5C46F 2ZUVA 1AQJA 2VO1A 5EESA 1J7JA 1W4BA 3ABRB 2IIPA 2MCFA 4E5VA 5A9SB 3K9LA 4XWTA 1MB3A 5L3RA 3O6VA 3ROFA 3RR2A 3HMQA 3TLBA 2CBZA 1TIKA 1V26A 1Z06A 2D59A 1ZK1A 2ISCA 4UAJA 5D5HA 5TXGA 1MJGM 1GCUA 5BRAA 2H11A 5KVSA 3TM4A 3OG9A 4YRNA 4AF6A 3ZCQA 5IXSA 4YMUA 3OPQA 3TLGA 1B6GA 4YIKA 2F59A 1NPYA 4KQEA 2C78A 1OLXB 4HXEB 2IIVA 1EGQA 2WE7A 2ZAGA 2B1QA 4YP5A 3ZV7A 1V3QE 4LF8B 4DIDA 1R9NA 4MZXA 1R6AA 5FF9A 4EMBA 4JOSA 1J1ZA 2V0GA 1MTOA 1OFGA 1S01A 5IDQA 5LZ4A 1IMOA 5EOVA 4WZAA 4AQ7A 5IUJC 1X7YB 2DGDA 4HX5A 4OXIA 1DQNA 2VNSA 4BDTA 2WZBA 2DQKA 2RAFA 1DBPA 4WBSA 3IBFA 2XEDA 1E62A 2P9TA 5HF6A 3LA6A 3UCXA 2GD0A 5EMKA 3ZNPA 2C5EA 5M34A 1MQ9A 1NMEA 3Q2KA 4L7QA 4CQNA 2D8MA 4NBVA 4D9GA 4HNQA 2F1IA 1L8LA 2OCLA 3AL2A 4HGYA 4PLVA 3A06A 3DO6A 1C29B 3UHPA 3VV3A 4EG3A 2AJTA 1POXA 1ECJA 3JQ7A 1BAPA 5B7NA 2B0JA 3S68A 1JB1A 1AGYA 1U9ZA 3A0RB 4IJVA 5FBLB 5KNLA 2R6HA 2E2WA 2JZNA 2P5UA 3AJAA 1B1AA 4IH4A 4CQLB 4E08A 4P0QB 5HGJA 4KXFB 1RWQA 5JH7B 1QQBA 3E61A 2ZXFA 1NATA 2PT7A 4P0PB 1ACMA 2BM8A 2OENG 1ZD9A 4JP3A 1MXFA 2XMCA 3IR7A 1EZ1A 5GZ1A 4RA6B 1C3JA 2CJWA 1MAVA 4QTTB 5L40A 3OE4A 4Y2JA 3RREA 1G17A 1UM9B 1E3TA 2CNWD 3KEOA 4Z6KA 5EUQB 5GONF 5IAKA 2I7DA 5FNZA 4HN2A 4B7CA 2AX3A 2LDXA 1ZX1A 5H9VA 2FPRA 4DIFA 1EVJA 4U2CA 1EGMB 4CUKA 2R8OA 4U5QA 2KBFA 4JJ4A 4IIBA 2QVCA 3R7AA 3RBAA 3W1VA 1KAMA 4HDAA 3RC8A 2NAPA 1SCIA 1JEJA 2VRCA 3MWDB 3O73A 1G8FA 2XQGA 5GM2A 2ZRIA 4D97A 3NT2A 2EL7A 3INTA 3CWQA 3SLRA 1VIMA 3OEEA 4K3UA 1RBZA 3PA8A 4AMZA 4GPEA 4MQ5A 4FJ1A 3EAQA 3STVA 3UC9A 4DCTA 2A9JA 2HLDD 4IJUA 3LVBA 4X91A 1UBNA 2GNAA 3IEXA 2QZJA 3LBFA 4AJHA 4I1RA 4S24A 821PA 5KWIA 1ZMOA 4RFVA 3RPEA 1JSLA 1XLUA 4KX5A 2IVZA 3FNRA 1JXAA 1IEVA 1T5DX 3FR7A 1CUYA 3PFNA 2BEVB 5JJCA 1FRFS 3LDAA 2YZ7A 3HABA 2OCDA 5EP1A 4J16A 4M8SA 4W5NA 4QXMA 5EKSA 2TMGA 2QBYA 3HHPA 3U6KA 3PFIA 4NZNA 1R4MB 1JKFA 3ITEA 4OAPA 3FYTA 3B5IA 1QG0A 1AK2A 2XW6A 5G02A 1HNWB 4CL3A 2HSZA 1L4KA 2R25B 4MVJI 5L51A 2B1RA 2M1XA 1FP6A 4OK3A 5IN5A 4BFTA 1UZUA 5JNVA 3RSCA 1PG2A 2QLLA 1N1GA 2AN4A 3QBVA 4M60A 1U2TA 4QLBA 4LJ9A 2F17A 1X1SA 2CHUA 3K0AB 4L2IB 3WISA 3MRXA 1DDIA 2PANA 1PLJA 2RGNA 4QQ8A 4KPEC 4FFRA 3R5TA 2R5FA 4BU0A 1EJ6A 1JHZA 2Z6VA 4CIXA 4U2FA 2QW0X 2XHEA 3A6DA 1WZ2A 1ECCA 3JX9A 4WMLA 1YUMA 5GWXA 2EL9A 4O5AA 2JJ1A 1BXKA 3H6KA 2O0JA 1STOA 1CNEA 1F0PA 3EASA 3HFGA 5GONA 5U1PA 5TQ0B 3FOZA 5AUQA 1TECE 5ALYA 1TFRA 3AVQA 1ADYA 5FJJA 1OTHA 4YB8A 2OYSA 5EHNA 1OYWA 3W3ZB 1JI0A 2CHQA 4JLMA 2HHAA 3DB1A 2YZKA 3EUAA 1Z62A 3K4QA 4M0LA 4QVKA 1V48A 4NCBA 3WGQA 1W36D 4UEJA 3G0CA 1AXGA 5B3JC 1IOWA 2JLBA 2PLNA 2VBIA 4PYJA 2BFDA 5LKAA 4KVZA 2RHJA 4EA7A 1OZAA 1SOWA 3KKQA 5B5SA 4ZJZA 3WGZA 3SZRA 5ITSA 2L17A 5ALWA 1SKUA 1O0BA 2DOKA 3DAOA 4Y6OA 1FFCA 3K0CA 1CUFA 2QE6A 1NUPA 2B4YA 4HAVA 2R79A 3N6VA 5IKOA 4KACA 4DLBA 1T10A 1IZZA 2HTEA 2QN8A 3EZNA 4MWBA 3R6LA 5DKFA 2O2IA 4MPTA 3RYHA 3VZSA 2UXCB 3IXLA 3O8QA 4PV7A 4ZA2A 3HKDA 5K9ZA 3LWDA 3TJMA 5CT5A 1J5PA 3LDHA 3OEWA 2B34A 2BZ0A 4WFIA 3H4MA 4QNNA 3SFZA 5HUHA 2WP0A 1CDDA 3SPXA 4IO0A 4E88A 4QL3A 1H66A 1HUQA 2IYQA 1ENOA 3PHCA 4V24A 5B2FA 3EVNA 4UDOA 2GA9A 3TKYA 3ZDZB 2FSVC 1NKTA 1JFVA 3H2SA 1S2NA 4PSCA 4ZZ3A 3C87A 4NENA 3A3KA 4KO4S 3AR3A 5ENVA 3W5SA 1RJEA 4DIUA 3OT1B 3AUSA 3KDPA 1YA4A 3AEUA 1I7DA 5FTMA 1E0AA 1IOZA 3EJ6A 2QVYX 1U0EA 3T41A 4PGAA 3ND8A 1PN3A 2Q8QA 4ZPJA 5EQFA 3L0PA 3B7PA 1TW2A 1VKHA 2HCRA 4ZVOA 1YH3A 4UARA 3W2IA 4CMGA 4GPZA 5K4GA 5EEHA 4E70A 4R54A 3ILVA 4K2HA 1K0FA 1CR1A 5JXGA 1XPJA 2ZANA 4HEA6 1J8DA 3PRHA 3AEKA 4ZT3A 3T35A 4DFDA 4XQEA 3COPA 3KJGA 5A6SA 4LSZA 3W5HA 5KIAA 1KORA 2J1LA 4EI2A 3CF6R 1VRVA 4MQUA 3OTOB 1R15A 1I24A 4HNSA 4K9RA 1XZLA 4NZMA 4LY3A 4NZYA 4ZCQA 4R68A 5HM6A 4OPMA 1I7SB 4GVLA 1S1CA 4PFSA 4JI2B 1FFGA 1ORHA 3EDYA 1FPMA 1P17A 1T9DA 3DWEX 4JY7A 1HNNA 4HPXB 4K9NA 4PBRA 1WO8A 2YOFA 4X7RA 1BGWA 1MX5A 1D07A 2D1FA 4PTLA 3HRKA 3OZXA 2H7VA 2E0IA 7YASA 3BGSA 1KBQA 1Z5PA 4TL7A 1T3GA 4P4NA 3UAVA 5IMSA 1J39A 1OROA 3NG1A 4FFWA 2Q5LA 4ND5A 4HB3A 2E5WA 4EATA 1L5OA 2VDWA 4YFVA 1GL9B 5ERYA 5LQNA 2ZDHA 3OT5A 4MLDA 2YFHA 1HDXA 4UBMA 4LYDA 1GTG1 2VCYA 1JIXA 2WWGA 3BZWA 4PN3A 4W9NC 1A95A 4LDNA 4BNNA 4B6QA 1PU2A 1U6IA 1HQYE 3DOOA 2P9BA 3HKEB 1XEXA 3K0HA 4LWQA 4PBSA 4FE7A 2IV2X 3RVOA 3UOGA 3VTFA 5F9MA 4ASUD 8AT1A 3G1TA 3N59A 3BK1A 4AAYA 3R5JA 4JCCA 3HUFA 3BIXA 4J07A 3DOJA 4Y8VA 2JGDB 3AR6A 4GOJA 3JWHA 2ZE5A 4A0GA 4XJXA 3QWAA 4TTSA 1XMXA 2EJUA 2BISA 3RSGA 3MAAC 2JJYA 4FOOA 1L3CA 1OHHA 1OYOA 1ORDA 1T2NA 1TX4B 2QX9A 3D1JA 2I6GA 4KUHA 3IPXA 4MDYA 2C4HA 5FHRA 1PLKA 1TKAA 1PV2A 2IZOA 3NIFB 4F45A 5BURA 2WKSA 7ADHA 5J43A 2ZJFA 2ZYAA 5G3ZA 4LQ4A 3UJCA 3OFVA 1JAZA 3BMOB 1F3OA 5BWOA 3RK4A 5ALNA 3HBNA 2AR0A 3TI9A 1QYWA 4UDXX 2ZULA 3UC5A 2X0IA 4U2GA 3DQPA 3VA7A 1JPVA 4A4DA 3IBYA 4WZBB 1NRWA 1YMQA 2WM9B 3MRVA 3LT4A 4LJAA 3NIDB 3VSBA 3ZNNA 4M46A 3PC6A 2Z57A 3HLTA 2CFSA 2F4NA 4DSOA 3PQ5A 5PGMA 3AUTA 3A4TA 4KUGA 1UWVA 4EHHA 4N5DA 1U4OA 4CLRA 3EHDA 4L9WA 1ULAA 1UC5B 4ETMA 4ODIA 2Q07A 3GQBA 3WQQA 2DB3A 2O2XA 3GJRA 4KQ9A 5SY4A 4ENUA 2DWQA 5C32A 3OHSX 5JIBA 2ZJ1A 4Q1DA 3OQHA 1RRVA 2SECE 3UT6A 4XAQA 4PO1A 4GOXA 1ODCA 3MMNA 4GVPA 4A2CA 4GAEA 1R64A 4AYWA 2B78A 2FKNA 3PWTA 2I7XA 2OSBA 3PFWO 2GEKA 3A6PC 3T3IA 2CUNA 2NO4A 1VHDA 3H2BA 1J6UA 2FTKE 5EIXA 1DUVG 4NYIQ 4I1YA 2RGYA 4XGIA 4Y2QA 4LCBA 1E3JA 4FGSA 2OZLA 1U7XA 3CVXA 4WINA 1G21A 1HWYA 3IIJA 4MINA 1NUAA 3AVTA 3C3BA 2NPFA 1YL6A 2UZ1A 2IYFA 1MEJA 4BMXA 3WJ1A 1Y6JA 2CLKB 1Y3HA 3A6ZA 4A8JC 2XGGA 1KI3A 3WAKA 2XXJA 4GOLD 1IUNA 2VDKB 3FN4A 3ZW7A 1OASA 3UPUA 5DFAA 1ZNXA 4Q6WA 1G6HA 2BZGA 3EDCA 2XKKA 4GM1A 4OJKA 4X41A 1KP2A 5A7HA 5BYJA 1SM4A 2BHNA 1F6BA 3KYBA 3TOZA 4AYXA 4LF6B 1ML3A 4G23A 4ZT2A 1H1LB 4EPTA 3B3FA 4CM9D 1XZBA 2OXEA 1WD7A 3QVKA 1T8WA 4FLFA 5JDIA 4KRXA 4RA9B 1XXHE 4K87A 3A1VA 4R3NA 3V42A 3AVUA 3FRHA 5AVYA 5JS8A 3KSAC 1CB7A 1WCIA 1QG6A 3MAJA 1HFWA 4PTYA 3PK0A 2PYIA 1CUIA 1G64A 1C9YA 1XRJA 2A84A 1K2WA 4IIEA 4NU6A 5AKKA 3RSQA 4E2WA 3G2NA 1U1CA 1YZVA 3VJKA 3IOCA 1RQLA 3E7FA 2C3OA 3OCWA 2I3AA 1EVEA 1NLUA 1YZTA 1IHXA 1Z35A 3OTHA 3PE4A 2BSAA 5F64A 3AVVA 4TVOA 4ARVA 3RS0A 4Y9TA 4EG5A 3O21A 1KMHB 1U7ZA 1E66A 3AHCA 1NVFA 3F67A 3PJEA 4PSUA 5IX8A 3V6LA 4RMNA 4QARA 3JQRA 4V0ME 1L8OA 2I80A 5H0IA 4CTKA 4EX6A 2NTVA 3ESQA 3UXMA 1WZIA 1YHZA 1L4EA 3B1YA 4TZKA 1FA9A 1U2SA 3G9UA 1J25A 4EFNA 5KWJA 1XTQA 2ZATA 3WBBA 1FFAA 2RKOA 2OSVA 3MTGA 1CUEA 3OZ7A 3JZMA 1IU9A 4BGUA 3OU7A 1C0KA 4R69A 4C29A 5B7GA 2D74A 1GTMA 2B8EA 1LFDB 3ELUA 3LLCA 4BU1A 1KZ1A 2GEFA 3DP9A 3FHOA 4LQLA 1F51E 2JIMA 2SKDA 1XN4A 4XYMA 1F4PA 3MYRA 4HMPA 4MUEA 5DNCA 2A4KA 3R0VA 5JPCA 2OD2A 3ETLA 2AG1A 2BJWA 2ID7A 1OAOA 3GMSA 4FYJA 4QREA 5FWYB 2ZJYA 3W5VA 4HDNA 1HQDA 3CRVA 3VNBA 3RTAA 3WK4A 2I03A 5TS3A 4CRWB 5EHXA 4KXYA 4S2EA 5TQVA 4RTSA 2DXIA 1M6WA 5KOJB 1FPQA 4PWYA 2W2OA 2VYFA 1FQWA 1W0KD 2YW2A 3MMXA 3GEIA 5HSGA 2HHLA 2WHQA 2QRVA 2B25A 3A2MA 4KSBA 3NX4A 2Y93A 4KXMA 5DM1A 3N8NA 4DSTA 1R0BA 3NUGA 4AZSA 1JGTA 4GWLA 4MHOA 5DWVA 3S2SA 3ZVLA 1E8MA 3BJRA 4IDDA 1QBGA 3RIEA 4B4DA 1MOPA 3H2GA 4HEQA 1ZSNA 3O8CA 2X42A 1V8BA 3NDPA 5B3AA 3A25A 3PJFA 5ALVA 4HQLA 4IXNA 2IP2A 4IGEA 4P80A 4X20B 1ZIYA 1E1CA 2WG0A 4Y0VA 3AEZA 3KWLA 5FOVA 3KHSA 4TWIA 4DEVA 1RKQA 3DD1A 1LCIA 3K9CA 3O4FA 5GY7A 3WL5A 2NU8A 3WP1B 1OB5A 5DYGA 1NRXA 1QM5A 1OBOA 1OR8A 1CJKC 3NBAA 1Q3TA 3PCRB 5JATA 3VNRA 4KZPA 3VC3A 3QKWA 2NW6A 1U4NA 3B8HA 3FBWA 1EZ4A 3V1YA 1N1DA 4ZGBA 5EHZA 4L4SA 5FOUA 5IP5A 3P2KA 2H4FA 2BBWA 1GG5A 1ZSVA 1VLQA 1HTBA 1FCJA 1TEHA 1V5GA 2IOFA 1V1RB 2HLHA 2WVAA 4LE1A 1NI4B 3BMNA 4O2RA 3K1JA 3KT8A 5FL7A 3IMKA 2EATA 3T0GA 2QLNA 3PFKA 3SR3A 1W9MA 3KETA 2HK9A 1NA5A 3CZMA 5FWXA 3AHDA 4RKQA 4KPYA 3C7KA 4D4LA 4PY2A 2X41A 1ZCBA 3I42A 4J7AA 5H59A 5AW3A 5C80A 1JT9A 4LVCA 1WXXA 4JLSA 1PNTA 1KOLA 2FR8C 2DQYA 1U04A 3H8VA 1B1CA 2VHEA 3EBOA 2O5EA 4I81A 2N75A 1VL0A 2BSXA 3HU2A 3EDQA 3KUKA 1VHJA 4FP9A 3RKSA 2WKRA 3QSGA 4RPGA 3TIXB 3TLJA 1IBCA 1KJZA 4N0DA 4Q1BA 4F1WA 1DS6A 3DE6X 3VKHA 2B2XA 1FLNA 2YVQA 3DE1X 3G3EA 3BCRA 3BVPA 1P6QA 5KWSA 4EDHA 5EHQA 4AN1A 1X19A 4AJ1A 3CJQA 3ASUA 1L4UA 1LDGA 3LHFA 1XD8A 1KY4A 2A1TR 4P84A 1ZK3A 1KZHA 1D7OA 3LU1A 2QRPA 2YHUA 3ORRA 5GADl 4Q21A 3EPLA 4KYUA 3H3FA 5DK4A 1UOOA 5DT2A 4YCSA 2H8GA 1VPVA 2OQVA 4XYEA 1JZQA 3UJHA 1Z16A 4CKYA 1O97D 4GEKA 1NLMA 2P0YA 1ORRA 3I9LA 1HLPA 1EJ0A 3TDMA 1N77A 1L5QA 1Y3DE 4GZMA 2O8FA 1U5BB 2PZJA 1YIAA 1TZKA 1YU6A 1XKXA 1F8YA 2A9PA 3HYSA 4U6SA 3UZUA 2WB4A 2YWEA 1UK6A 3OIFA 5HFNA 1VYTA 3RYFA 4BMNA 1ESEA 2YHBA 4DC1A 3GAMA 4QOGA 2A0YA 1AKNA 4US1R 3TB6A 3AY3A 1FMJA 2HCJB 2HBQA 1D8AA 4M8LA 2EFEB 4RM2A 2P6OA 1E1LA 3FR8A 4Z0PA 4C3VA 4EHAA 1MU0A 4AY2A 1P2UA 2COKA 3HG7A 2Q3CA 4KK3A 3T7RA 2NVOA 3E48A 4MAMA 4WN9A 2CHGA 2XWBF 2PR2A 3ZNOA 1ECGA 4EMSA 1DFGA 2H65A 3OLXA 2J0UB 4BMZA 2DBYA 2ISSD 3CH6A 3RH0A 4ESEA 2X4DA 1VJGA 3Q9SA 3UFXA 4P5PA 1R6BX 3GG9A 5EMHA 4GPIB 3T34A 1QHEA 4EYQA 2BMJA 2EF1A 3QJYA 4YV7A 5IJ9A 1OJ7A 5I9IA 4ZZ0A 6LDHA 5CJJA 5DYTA 4DMHA 4EY4A 3BRCA 1DNPA 4NAUA 4IW3B 1L1QA 5ESXA 3NDJA 1A2KC 2GHQA 3OZAA 3PQFA 4C87A 4CEJA 1NBIA 3N74A 4YI3A 2C5LA 3L7BA 2CFTA 1TMGE 1FYEA 2BTEA 3GRRA 4L9RA 5I4KA 2IYVA 5H83A 5CBKA 1FDTA 4F96A 2IYPA 1YI0A 1AKMA 3B2EA 3WYFA 5GJCA 1KQGA 4AU1A 2O3SA 1K8YB 1WUHS 1JLRA 1HY3A 2GJ9A 3AIOA 3EJWA 1ECPA 1N2XA 3KR0A 4KYVA 4QDZA 1N5IA 3MJ4A 3HMKA 4UU7A 3IB6A 1BSVA 1K6EA 4Y1FA 1PJTA 1TKRA 3DFMA 3WLRA 2PX5A 4F71A 5IF3A 2RHLA 2XYHA 2XKBA 5FTKA 5BN3A 1A8HA 2BUBA 3DBOB 3EA4A 4RLSA 3NJ4A 4TV9B 1MFZA 5CG1A 3H3JA 2VDRB 1Y6GA 4KWIA 2G76A 4IMPA 3D8RA 1N9ZA 3LLMA 5M2QA 2OLEA 4J76A 3NTOA 2YNMA 4X9XA 4QODA 4EUHA 4EHJA 4C4AA 3G8BA 2AVDA 1Z5NA 1II0A 1EM6A 2C2MA 2VNAA 2X0NA 3OE5A 2W5UA 2POQX 4M7RA 5FHQA 2EJCA 2XUPA 5LYYA 2AMJA 4BN4A 2R7AA 3HY4A 3JQBC 4M7PA 2GEBA 5SYMA 5TJHA 3ZIDA 2ZYSA 3H7AA 4BYGA 3IEPA 4Q7JB 1FC0A 1WSBA 1CLEA 1N5LA 5KTMA 2W2KB 2J9GA 4K03A 4S1NA 4E4TA 1RZRA 1VCIA 3IKTA 5FWDA 4MWCA 3TSYA 4B45A 1VECA 1BFUA 4WNAA 1BHSA 1V8DA 4CLHA 3MVEA 1P9RA 4KO2S 3E53A 4C6HA 4F93B 4ZQFA 3MJHA 4HI0E 4ZD6A 1QH8A 2YVAA 1RLOA 5HJEA 5EA2A 1Q83A 4X97A 5JD4A 4GE3A 4JLDA 1AX9A 3OZWA 4LYHA 3X1YA 1XMPA 1Z07A 3AZPA 3NCTA 2Y77A 4E5NA 3LF1A 4EHDA 4BNLA 2V7PA 4KPGA 4PLFA 2YWCA 4JI8B 2NYRA 2VSXA 3QOXA 1U5AA 5KNBH 3SVTA 2RK3A 1RS0A 1XD9A 1E5XA 1BXRA 4IQ0A 5L8VA 3AKZA 5L4NA 1OILA 2RSLA 3HUTA 2PG3A 2PT6A 2VJMB 3N2KA 4O2LA 4I5EA 4PYKA 3RD5A 2G40A 5DI9A 4MIKA 3HV0A 3IKLA 3KYDB 2PT5A 4J7XA 4RY8A 2ZROA 1P91A 5LWHA 1TM4E 3DOIA 2BFEA 1RAGA 1QS0A 3BHMA 4MV6A 4WLNA 3B9BA 3O8RA 3DKPA 1NIJA 5C8YA 3LUHA 4I36A 4B71A 2LW7A 3EZ9A 3Q15C 1K1EA 4WSOA 3OKCA 4ZAXA 3DTVA 3TPFA 1APBA 4EARA 3NTUA 4LBVA 4OXNA 1QJ4A 2QM0A 3UAGA 3JAWB 2XBUA 2JI6A 4HAOA 1R50A 4R8LA 4RXMA 3WJ2A 3X1XA 4EA8A 2NUPB 5TY0A 3UQZA 2VHQA 1S4QA 4ED9A 1AZSC 4ZTUB 1EFAA 1RAAA 2GH1A 5C8DA 1SPBS 4QFMA 2QVLA 1W5BA 5FR1A 2CNNA 4RNCA 4L16A 4IHKA 2HA2A 4EKDA 4WOJA 1M2NA 2CDAA 4BX3A 2W6MA 1XYGA 1ZUD1 2YTZA 2IT1A 1C41A 2AW3A 1CUDA 2AL7A 3ZTYA 4WVLA 3VHLB 3L0ZA 3NDRA 3WV4A 1EVLA 1GQYA 2LUOA 3V4FA 3LKBA 4QXPA 3OOWA 1V16B 4BVKA 1MEEA 1CUUA 2HUPA 3D2LA 3RIYA 4CI9A 1X70A 4DR3B 3EPKA 4MI1A 4JOBA 4QATA 5AM3A 4OMUA 1EUCA 3QV1A 1WG8A 1KDOA 1W75A 5LN1A 3B3GA 3U3MA 2J5KA 3FRJA 4S3MA 2XYGA 3GJSA 3HE3A 4I9NA 4HL6A 2XA9A 4OYRA 4ZEMA 4RQUA 3LWBA 3ROKA 1IBSA 4R5MA 4RGYA 3TK1A 1NW9B 2H07A 3IESA 2ZE6A 1UBEA 3Q10A 3ZHUA 3ICEA 1UMDB 4G5FA 4EF4A 3HZZA 3QM1A 3UWSA 4CCYA 1VPLA 3BMCB 1U1GA 2BGTA 5IWCA 5HE8A 1XRPA 3JQFA 4NS1A 4PVCA 2JBWA 2HMWA 3BFPA 3ZCUA 2Z2XA 5CDYA 1I94B 1TL7C 1MKYA 5J2UA 5KAMA 4PYRA 2Q4EA 4LE0A 4OQXA 3BZBA 2NSHA 4OV6B 4R7ZA 3VX3A 3NETA 4DV0B 1OWMA 1KRWA 2YHSA 3W3AA 4KR7A 4GBJA 4R2KA 1REQA 1O6GA 4BV2A 1GA6A 2IPAB 1HSOA 2HO5A 1M67A 3OF5A 4HWPA 3ER9A 1MR3F 2P0AA 3BFXA 1RI4A 1WDTA 2HF8A 4OOFA 2GDZA 3NTVA 1NU8A 1E2MA 1YZLA 6REQB 1XXHA 2AZ4A 3R3UA 4M9RA 5E2IA 4ESVA 2QTWB 2WKQA 3W2FA 3O8NA 1YCGA 1OXUA 4ACBA 1PR9A 5IK2D 1NBAA 1DWUA 2QDKA 2W6JD 4HQ6A 3WA7A 1H8HD 2GBLA 4GWKA 1VGRA 2MYUA 2DCUA 1ONSA 3IUPA 1Z4KA 3AEQB 1I1NA 4FOPA 4EUEA 1JA9A 3T4XA 3PUHA 3VVBA 2GAAA 4MQ4A 2AJ8A 4ARSA 1DRVA 2AI3A 3FTNA 4B33A 1A7AA 3M1IA 1H9CA 3G0HA 4QEKA 5BW6B 3WGIA 3PNVA 3F5SA 3O7MA 1DC3A 5CBPB 4JUFA 1YDFA 2AN1A 2Y99A 1Q0QA 1CB0A 4TN1A 4V0MA 5AVOA 1SMKA 1NN5A 1NOIA 3GC6A 1G16A 1V8FA 3G0GA 2XTNA 3O91A 4IKPA 4OJYA 1EEHA 1BGVA 4BO9A 4XGNA 4RTMA 1P8JA 2UYGA 4Z86A 5DTJA 5LOVA 2BFAA 1M2GA 2WPNA 3K5WA 1FMFA 4HYTA 4HC4A 2I55A 4L02A 5G1NA 4X44A 1R66A 3QWFA 1H2ZA 1FNNA 5JARA 1YS2X 1OLUB 4FFDA 3K9BA 4XCQA 3DKVA 3WRXA 2Y71A 4N9WA 3HPQA 5CDGA 3U4HA 4XIGS 2JIBA 2QOEA 2RGEA 5EEGA 3PKIA 2ZAMA 3R0QA 4YRDA 4K6GA 1I01A 2C9BA 3PUJA 5JAHA 4I1PA 1BQ3A 2B3DA 1N6KA 4I9HA 4TX1A 1EHIA 5JBIA 2OESA 3MERA 5HCIA