2B6HA

Structure of human adp-ribosylation factor 5
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
171
Chain Sequence
RGSLFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human ADP-ribosylation factor 5
rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords ADP-ribosylation factor 5
total genus 57
structure length 171
sequence length 176
ec nomenclature
pdb deposition date 2005-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2b6hA00
2P3SA 1KJZA 4RCZA 1H8HD 4IVRA 1MO4A 4YMSA 1FX0B 4UJ5A 2HEIA 4NHOA 4Q66C 2BJWA 1G3MA 2ZSBA 2E87A 4GBMA 1LVGA 2GBLC 1E9SA 2DWOA 4HAXA 3C15C 4QBIA 4RD2A 4BLSA 1XZQA 1VCIA 1R5NA 2ODEA 3RRNA 4MITA 1D9XA 5E7MA 4TYNA 3TE6A 3B7GA 1BKDR 1AZTA 5DGXA 4CRWB 2EVWX 1Q21A 2BCJQ 3A1TA 4TQ9A 3SBDA 2F9MA 5DE3A 2W6ID 1ZVQA 2QM7A 3GLHA 1UJ2A 2OSBA 3S1AA 4QKQA 4JLAA 3E5HA 4LC0A 1I2MA 4DC9A 4MA4A 3TVTA 1GFIA 3DKVA 4LDJA 4ZIRB 5JHHB 2ERYA 4GI7A 4NCNA 3ASZA 4R2IA 1PV4A 5J4VA 2P6NA 1D6JA 2YWGA 2J0QA 3PIRA 1OF1A 2JDIA 2XITA 2AD5A 2GETA 2UZIR 1X1RA 1HT1E 4LPSA 4H9GA 1F3OA 1ZBDA 1N6IA 2G1JA 5L3SB 3BBPA 1UBEA 4RY2A 5DIFA 3CX7A 3EX7C 4M1KA 4A0RA 3U44B 5FH9A 2BMEA 3I32A 1W0KD 3DHWC 3IIKA 4P4SA 5L3SA 2FPLA 1VHTA 1T4GA 3KKMA 3U44A 2WJHA 3TKLA 2H8KA 3AQ4A 4PSKA 4I4LA 2D06A 3SS8A 1U0HC 2CE7A 4JIMA 4QG7A 2BM1A 1Z2CA 4P0TA 1VTKA 2QMHA 5JI2E 1NLFA 4V03A 5ELXA 2KE5A 2DFTA 3DL0A 3VR4A 4UXIA 2BM0A 2PT7A 3MLEA 5FBWB 5FOWA 3K0AB 1CBUA 2QZ4A 4C0AC 1E2JA 2B8WA 3H0KA 2VP5A 5HCIA 3BFKA 3LW7A 3I61A 2PMKA 3THYB 1PUJA 5B64A 4JBYA 1NJFA 2V7QA 3KJEA 1XTJA 4R9UC 3BH0A 4EFNA 5JZVA 3LXRA 1A4RA 2ODBA 2Q9AA 5K8UA 4C0LA 2XXAA 2F1RA 3MJRA 4B34A 4E22A 4GZLA 1TF2A 3X1XA 2RHMA 3GD7A 3KTAB 4ZPXA 1II8B 1WP9A 3W6NA 3GFOA 4Q9KA 3LAWA 4B71A 2GXSA 1P7CA 4JBWA 1WMSA 2E1RA 4XOIA 1QRAA 5SZHB 1TAGA 3OESA 4IOKA 2VRWA 1N6HA 4UNQA 3KFVA 2H1LA 2FG5A 5JWOA 3KXIA 1SZPA 5J4KA 1CS4C 3FKSA 2DYKA 3W6PA 3H2YA 1F48A 4P4SB 1OFTA 4DCNA 3A4NA 3Q9LA 1AM4D 4JZKA 1UEIA 5AUQA 1QHSA 3P32A 4PQRA 4Q1DA 4P4UA 5HKKA 2RHDA 1GNPA 3UATA 1N6PA 4MQBA 1P73A 4RD0A 3CUEF 1CIPA 3CNOA 4R98A 2W83A 3K70B 3KJIA 3RRZA 3T1TA 3GEIA 5FPHA 2CNWD 3D3QA 2BBWA 3E1SA 5EP3A 1NSFA 2JAQA 4UXHA 3ZVRA 1GRNA 2ZM5A 5GVRA 1QHXA 4WXPA 1RC8A 2A5GA 1VG8A 1YZLA 2QE7A 3ZDQA 4CZ2A 2GCPA 1ESNA 4Z8YA 5J4YA 1Z47A 2YINC 2J0UB 2ZJBA 3H84A 3DVLA 4KBFA 1SVLA 2UVQA 3ZZUA 3UPUA 2DCUA 4JL6A 2J5XA 3IHLA 3C4JA 4XSHA 3U4QA 1ANKA 2D74A 2YZ2A 3U60B 4BE7B 4US2R 4HDCA 5D3MA 1S96A 1T0JB 2QBYA 3U4QB 2O0JA 1JALA 1Y3AA 2CCKA 5AK0A 4EJSC 2ZVQX 4EIWA 5A5GA 4RKFA 2GHIA 4QNMA 2XZOA 3P4XA 4XWOA 4GOKA 2WWWA 2G1KA 1R5BA 3IO5A 2CNWA 4LHZA 4TYPA 3OIVA 1CRPA 1WBDA 1S1CA 1KMHB 2GJAA 3L82B 2QUZA 1DG3A 3BE4A 4P3YA 4DDUA 3I73A 4E07A 2PT5A 1VG0B 1Q57A 3QEJA 2R44A 3K09C 3KQKA 2R6CA 2XZLA 2CEAA 1NI3A 1US8A 1VECA 2DFNA 3CNLA 5HKKD 4M2LA 2FWRA 2F9LA 4FMBB 5FTMA 5J40A 3SYLA 3FB4A 1QF9A 3SBEA 1FMJA 4LCBA 3DZDA 5DLQC 2PL3A 2C99A 4EPWA 3L0SA 2A2ZA 3NIBA 2O52A 3BFXA 3FKSD 3CH4B 2ONKA 4PC6A 4KFSA 4TYYA 2N46A 1QVRA 3MFYA 1U9IC 4AWXA 4B2LA 4AI6A 4GT1A 2OZEA 2XTMA 1L8QA 3QKTA 3A8TA 4BZXA 2RGCA 2QGZA 4HUQB 5FBVB 3TNFA 4P31A 3CB4A 5HE8A 4NKRA 1OJLA 1NNEA 3UG7A 4XSGA 1JNYA 821PA 2P6RA 1U0JA 3GLHE 2E9SA 1G16A 3WHKA 3BXZA 3X1YA 3BS4A 3VTKA 4QFMA 2GK7A 2NPIA 4L8GA 5EE5B 2IXEA 2AHOA 1AJEA 3VKGA 2JDID 4LYFA 4UNRA 2EFEB 3DDCA 4AURA 1UADA 1IN6A 2J3EA 3M1IA 1KI4A 4B6FA 1MKYA 1TL7C 3IKJA 4XVQA 3EC1A 3SZRA 5C46F 4HUTA 3RABA 1TADA 4YONB 2WWXA 3IQXA 4URXR 5SZIA 3AUXA 3THXA 5G3YA 2BKUA 3KKPA 1JQJC 3KX2A 2FMXA 3LVRE 4WZBE 5HPYB 4O2RA 3DOEA 2XJ4A 3LRPA 5FR2A 1OFHA 1M8PA 1RRCA 4NYJQ 4BLOA 1WBBA 1W0KA 1D8TA 2GNOA 2ZU6A 4G5GA 1N6LA 4KFUA 4OHWA 3N2IA 1N6NA 4V0NA 1NN1A 2GCNA 4KBGA 3KXKA 1GTVA 2OG2A 2GCOB 4P4TA 3GLFA 1T3LA 1EFTA 4TL7A 5K8IA 4TTRA 5ANRB 4ZDIA 2JLYA 3ZJYA 1G21E 4JT2A 2A78A 4ILEA 2KBFA 4GMXA 3AP3A 4M9XA 2HJVA 1CR4A 4CVNA 4A6PA 4D0NA 1ZD9A 2XNDA 1GWNA 3AP2A 1KDPA 3PUWA 3GP8A 3W8RA 1DO0A 5DHAA 4HLUA 1XD8A 4D0GA 1ZNZA 2GF0A 5FOXA 4OI1A 3ZYCA 3ADBA 5FUWA 2JGNA 5CM9C 1RW4A 1RPZA 2KB0A 1U2RA 3EAQA 2CXXA 4EQ6A 2J0UA 2ZVPX 3TAUA 3T1OA 2ZYUX 1DTSA 2PEYA 2F1HA 4CEJA 1OXUA 4RFSA 4FMCF 3T1VA 4DCSA 421PA 2F43B 1A1VA 4MYTA 2OBNA 4EJSB 1FX0A 3C7KA 3CRQA 4A8JC 4MYCA 2DB3A 3KB2A 1FOEB 2VHTA 4PHTA 4Y0VA 3B1WA 4PTLA 4FCTA 3EA0A 2KBEA 1ZNYA 3K0EA 4LC1A 4AKEA 2EW1A 3FHCB 2ZRJA 4B75A 1QHNA 3DMNA 4OK3A 2ORWA 2O5VA 4LGMA 3K0FA 1BO6A 1VCMA 4JBXA 1E1QD 4TLAA 4FCWA 1OYYA 4TLBA 4WVFA 3PV0A 2BDTA 5JBQA 4WZAE 2HXYA 1XJ0A 1JR3A 2C5LA 1PLKA 1DAHA 1H65A 2ECKA 4YDSA 5G3ZA 4LK2A 3GLGB 3LNCA 4OK6A 4DCVA 4DSOA 4UNNA 4G5RA 4I99A 2JCSA 2ZYVX 5B57C 4XWKA 5DYGA 1W36C 4M1OA 2Q6TA 4YQFA 3HR7A 2F55A 3L2OB 1DAMA 3LV8A 5EZ5A 4OHYA 1YKSA 2WWIA 4OL0A 4YMUA 1KDTA 3CZQA 2FA9A 1R10A 4PPQA 3HPRA 2R6DA 1FPMA 1B0UA 3K8YA 5DYIA 4D4MA 2MMCA 4M1WA 1E9DA 4RFSB 4DDWA 4Z1MD 2K5UA 2Z4RA 2ZI9A 1XEXA 8OHMA 1U99A 1OXTA 3K9GA 2VP2A 3MSXA 5BWMA 1Z0FA 3EXAA 4FIDA 3EC2A 1NJGA 2R6FA 2XNSA 2BCGY 2OXCA 2X19A 2D7DA 2QTVB 2RAPA 2VP6A 4TYWA 4L15A 3RLFA 4HAZA 1BMFA 1HEIA 1KKMA 4W5HA 1ELOA 2B21A 3NH6A 3ETLA 3I72A 2W2XA 2XB4A 4HB0A 5EZ6B 3D8BA 1KY2A 1XMJA 4DCTA 3GLFE 3B9QA 1J7KA 3THYA 1P6XA 3PUXA 4HAYA 4PHHA 1FTSA 1SHZA 2REXB 4BEBA 2WSSD 2BMJA 2C04A 2ZYWX 4EPXA 3OEHA 2WAXA 3LW8A 4QC2A 3QE0A 1JEEA 3T06B 2QRNA 1FZQA 1AZSC 1AS0A 1CU1A 1Z29A 2ZROA 4DLUA 3D7MA 4QHTA 5L3QB 1EWQA 1DG1G 2BBTA 2IYQA 3BJIC 1M6NA 4MDEA 2PX0A 4N0EA 3UANA 2Z4SA 1P9RA 1EFRA 2AK2A 1FFHA 4M22A 2A5FA 1NKTA 1V43A 1ESMA 3TSOA 3LBHA 4KFTA 1OB2A 4FW9A 1IN4A 5A4JA 2GAOA 1QHGA 1ZD1A 1X6VA 3EPJA 1P4SA 2ZS8A 4LSGA 1U8AA 1OV4A 2WOOA 4MKIA 1L4YA 3L0PA 2NO1A 5AJVB 2O8FB 2WWYA 3L8ZA 1GUAA 4JMPA 2BIFA 1MOZA 2IL1A 1CXZA 1DE0A 1J8YF 2ATVA 3C8UA 1XU4A 4HB2A 1Q1ZA 3OEEA 4FCVA 4DRZA 4EPVA 4CEIA 3K9HA 1VCNA 1P2UA 1IONA 2O0KA 3CPJB 3RS7A 4EUNA 1OH6A 1XPUA 3AUYA 3ECCA 4QJ4A 5AWFC 1K5GA 1QHHA 3GLIB 1UKVY 5G53C 5TMPA 1NG9A 5HE9A 5HZHA 3R9WA 1W0JA 2HF8A 1R0ZA 4HLDA 5FUYA 4ZCIA 1SULA 4ZCLA 1EESA 3ZQ6A 2QN6A 4ZDKA 3KQNA 1MRSA 1LFDB 1WDTA 4KXFB 4RZXA 4C0SA 1LF5A 1R0XA 4FMCB 1G5PA 4RD6A 2BMFA 3K0CA 1UAAA 3ZQJA 2FSGA 5CYPA 2GVZC 3QBTA 5EE0A 2O8DA 1KMQA 5FL7D 5AUPB 5FUVA 2RGDA 1R6BX 4A4DA 2VEDA 2W0MA 1ZNWA 2CCGA 4QOSA 5CLLA 3GJ3A 2QT0A 3B78A 3CNNA 3KTAA 1JJVA 1XPRA 1GITA 2JATA 1XXHB 2HCJB 2VSFA 3KL4A 3RS5A 3RS4A 4M1SA 5F3WB 4CT5A 2C95A 1LW7A 1OE0A 2Z6VA 5C2JB 2W6JA 3U5ZB 4MUAA 3HJNA 3GLIE 2FFAA 1CJKC 1Q1BA 4TZ0A 1CJTC 3QKRA 1M7BA 4NCHA 4TSFA 3T34A 2PMDA 4A1FA 1XMSA 1Z07A 1G291 4TWZA 2VF7A 1FP7A 2CK3A 3BB3A 5CJ2A 1M2OB 2ZRLA 4ZKDA 1TTTA 1MR3F 1N5KA 1QHHB 2FF7A 3KKNA 4BZPA 3U3KA 2NO6A 5JI3E 3PUVA 1GNRA 1CR0A 1XEXB 2GAAA 2ZU0C 4GOXA 3GFTA 2BEJA 1LS1A 3M6AA 1E99A 1QHIA 4HI0E 2NZ8A 3HR8A 2J46A 1Z3IX 2GWHA 4MGIR 3C5CA 2ZE7A 3MJHA 1MABB 4K81B 1SXJB 3IUYA 5EUQB 3SJZA 3GLIA 2H16A 4C0HA 4LHVA 4CW7A 1HUQA 4NE2A 1Z6YA 4LBYA 4NPHA 2FH5B 2PCJA 2FPMA 3IEUA 2FGJA 4HAWA 4Q9IA 2PEZA 1ODFA 2O8DB 3WMEA 4TTPA 3U7HB 4LRWA 1HE8B 2VTKA 3A36A 2PCLA 2RGAA 1ZNXA 3GLHB 1H8ED 1ZC3A 1YZGA 4WA7A 2D4HA 2D2EA 4KYUA 1YU9A 3SHFA 1Z0AA 2Q9BA 1J2JA 1E2IA 2WJGA 2IXFA 3B13B 4BUJA 4BRUA 2GVDC 5GADl 3U7FB 3A1WA 3B1YA 3L43A 1ZINA 4TSFD 1TF5A 4PO9A 5CIWA 2W0SA 3THOA 4GDFA 2EFGA 2YVUA 4OYHA 4QM6A 2ZRHA 3SNHA 3AKCA 4MGYR 2WKQA 1HA3A 3W9YA 1AGRA 4G3XA 1VYTA 1FL9A 3AVOA 1Z6AA 4NCIA 4CEHA 2QT1A 4NYJR 5C1BA 2R62A 3QI2A 3IEVA 3TW8B 4URZR 2XTNA 4IFEA 3V4RA 5FL7A 2C9CA 5L3RA 2JLUA 1ZU5A 2F1IA 3GMTA 4JLJA 5JSZB 4A0FA 2X1VA 2PLFA 1UKYA 4Q9HA 3FTQA 1T0HB 2QROA 3MAAC 4PQYA 3GLFB 2DHRA 3EG5A 5G41A 5GVSA 2CJWB 3QNUA 1YZNA 3R20A 2VH5R 2FZLA 1ZW6A 1U94A 2V8OA 2GXUA 1KSGA 2J9RA 1EGAA 2CHGA 5TXGA 4JJKA 2CJWA 4MKHA 1JR6A 1T6NA 3GJ5A 4A15A 1XCGB 4LYJA 5J4LA 1VDZA 1DADA 1RRFA 4WAUA 5GJCA 4NU0A 3WY9A 1XX6A 3ZZTA 2ZE6A 4ARZA 3LLMA 3ASYA 2ZI3A 2PH1A 1IXZA 2OBLA 1Z2AA 2ZR0A 2IUSA 2P6UA 1FQJA 3FDIA 4PC3A 4OKSA 5CIQA 3E2IA 3SYKA 3PR1A 2V6JA 5DHFA 1KO4A 1MABA 4A6XA 4OQFA 4EFLA 5FPYA 4ACBA 1S2MA 4X8HA 3N5CA 1GKIA 2NO7A 4POAA 1SVMA 1UFQA 2OHFA 4BGDA 2LCFA 3ADDA 1XBTA 1RRGA 4CDGA 3U7GA 2XXAB 5E3HA 2VHJA 1CP2A 1KI7A 2AK3A 2IBMA 1JPNA 2ZI7A 5K8LA 4B3DA 3HU3A 2VP4A 3AVUA 1QDEA 4TLEA 3PEYA 3EPKA 2QMUA 1ZP6A 2GF9A 5IRCD 3RANA 5HZKA 2O8BB 4C4PA 2ZRIA 3O8BA 3BB1A 3G0HA 1T8UA 1CR2A 2ORVA 2RH5A 4IDQA 2IYVA 3BK7A 4EPRA 4LJ4A 3GJ7A 4ASUA 2EYUA 2NO0A 2IUUA 1G5RA 3ND8A 2NPFA 1KNXA 2G83A 5FI1B 4BEJA 2AXNA 4D26A 1JR3E 1NRJB 1BH2A 4JSTA 2OESA 4LI0A 5FBRB 3SOPA 2C96A 2QENA 1E9BA 4L9WA 2J59A 2NG1A 1RIFA 3R8CA 1E2LA 4Q48A 1MV5A 4HB4A 4QNRA 3THWB 2GJKA 4DB2A 1TU4A 2YKGA 4MKGA 1VCOA 4PXAA 3AF3A 4DEYA 4URVR 3ZIAD 2YYZA 3T5DA 2FDCA 4CGZA 1U0LA 3T35A 1KO5A 2ZREA 1OFIA 1P2TA 2G6BA 1RYFA 2GJSA 5IK2A 2AN9A 3OZXA 2ATXA 2RGNA 4RVCA 3B9PA 4BQSA 2IS6A 3O8RA 3AF0A 3DMDA 2R8RA 3HU2A 4GFDA 4X8MA 5TB5A 1ZJ6A 2FSIA 3F0TA 2CL7X 4PQFA 1OHHA 4C0QC 4LHWA 3CZPA 1XPOA 3RC3A 3LD9A 3B5JA 4AYXA 1Q3TA 5KPDA 3R7WB 1A2BA 1IY0A 3BB4A 1X8KA 3VR2A 4DLZA 1CR1A 1X8JA 2AFHE 4U5XA 3RS3A 2CDNA 1E3MA 1FUKA 5DISB 3X1WA 2VO1A 3PUYA 4PAOA 5FI0B 1KHTA 5JEEA 2IYXA 2WJYA 2IHBA 4I1OA 4MRSA 3VR5A 4F92B 3X2SA 2J7KA 4DHEA 2O8BA 1TX4B 4ZI3A 1QG4A 3CO5A 2FFHA 4RZ3A 4BFWA 4NCKA 4RD3A 3ZIAA 1W5SA 4TLCA 3L0OA 5FUXA 1DS6A 2BEKA 3UWOA 1IXSB 1JJ7A 4RD1A 2R65A 3B1VA 3A1VA 4L16A 2ZIAA 1E9AA 5E95A 1JI0A 4D4LA 2ZSFA 4AG5A 2P65A 1E1QA 1TUEA 2QMOA 2XTZA 2CL0X 5JSZA 1IN7A 1AQYA 2ZSAA 1OXVA 3LQRA 4JLDA 2ZTSA 4Q4LA 1EXMA 4CF7A 1OKKD 2J41A 3AP1A 3BH6A 4JT4A 5SZKB 4DSUA 5CK5A 1KSFX 4B32A 4FXPA 2NQ2C 2BBSA 3ZS8A 1KNQA 1U98A 5JWHA 1KK0A 4NYMR 3CX6A 1AQUA 1EG7A 2QU8A 3LQQA 1G3RA 4A82A 3PXGA 3UXMA 3KQLA 3D31A 2DBYA 1TUIA 4MKFA 4BRWA 2ZITA 1E96A 2ZUBA 1WB9A 1Z0IA 3LDAA 4KHZA 5FTKA 1C4OA 3X1ZA 4ZV4A 2JLSA 4TZ6A 2IHYA 3OIYA 3QXSA 2IS4A 4Q4HB 4US0R 3TGPA 5DI3B 1YR8A 2FOLA 4G5OA 2XZPA 5FTLA 1RVDA 3KZ1E 1XJQA 1HQCA 1PJRA 1G18A 1Q44A 1S1MA 1IQPA 1FW6A 1L2TA 4C2TA 4JYBA 4OHXA 1L7VC 1Q20A 2NZJA 3VX4A 2XNDD 1S9HA 4BPBA 3CM0A 4JYCA 5AUNB 2ZJ5A 1TF7A 2H17A 2NTYC 3CF0A 3MWJA 4M21A 2B6HA 1G6HA 2IEZA 4MRNA 2GXAA 5C4MA 2EWVA 3KKOA 1A82A 1PVOA 2IYWA 1P72A 1W4CA 4G5SA 3AH8A 4GPTA 1KYIA 1P75A 4IOJA 1DAIA 5EQTA 5J47A 2HUPA 3SJCA 3TJZA 2W2VA 2Q21A 3CH5A 1Z63A 4AY2A 3UMRA 5CITA 4A8JB 1Z6GA 2HYDA 4EPYA 3PEUA 2GXQA 1KY3A 2JLRA 5DNYB 4MGKR 3N70A 1W47A 2NO9A 3VU9B 3CR8A 2XX3A 4IJMA 4LJ7A 4IKEA 1OYWA 1N2CE 4BWYA 4BECA 3NDBB 2FJUA 3U7EB 4Q5IA 3VR6A 4F4CA 5HTKA 1ZC4A 1CJVC 3REFA 2IYZA 1Z28A 3U6KA 2ZRKA 1Z83A 3QKRB 2HT6A 1R0YA 1E2FA 1UM8A 2GEVA 3T61A 1ZU4A 3WXMA 1M74A 1DELA 1UKEA 1AA9A 2ASEA 4X8LA 1ZM2A 4ZO4A 4B3BA 4ZDWA 4B35A 2WIAA 4PC2A 2JJ8A 2QAGB 4KAXA 1FNNA 1R4AA 3HPQA 4II7A 2OAP1 4AKGA 1DAEA 2O8EA 4DWJA 1RJ9B 2V9PA 1TQDA 1E0AA 3DOFA 2A7QA 1KZ7B 1E94E 4BLRA 2WSMA 2CLCX 5LD2C 1AIPA 4RKEA 5E7IA 3QKSA 1G3IA 3KJGA 3SI7A 4HSEA 4ZKEA 3PENA 2ZAOA 1XTKA 1ZCBA 5TY0A 3ADCA 1GRQA 1XD2B 5KNDA 4CYMA 1D9ZA 1N0VC 2C9YA 3QKSB 1ONBA 2X8AA 3NKVA 1GVNB 2OAQ1 2WKPA 3REGA 4LYHA 1TQ2A 4PR0A 2OV2A 1XEWY 3GEEA 1UBGA 3QG1A 3TR0A 3Q85A 2F1JA 2FSFA 2CBZA 2FV8A 2H5EA 3NHAA 1D5CA 1D2MA 3VFDA 3ZH9B 4M8NE 2Q3FA 1ZUNB 4IRUB 4O25A 4QHYA 3DKPA 1A5TA 2RGEA 5P21A 2Q3MA 1OXSC 1WRBA 1E2KA 4GSYA 1OHHD 4DSNA 4TMZA 4DLRA 3LXXA 2WWFA 3CPEA 4IDNA 2YOGA 2ZETA 5BN5A 1YJ5A 1OXXK 1OW3B 2OCPA 1BIFA 1DBSA 2WAYA 2CHVA 2IUTA 1YQTA 4PSVA 5C18A 4RCYA 4G5QA 2GJ8A 2OM2A 2IYSA 4G0NA 3B8HA 4CEHB 2JLQA 5FOTA 2ZJOA 3GEHA 3AVXA 2AXPA 4UNPA 1RJ9A 1II0A 5JECA 3NVAA 2V55B 5EP4A 1N3BA 1XF9A 3TBKA 2IYUA 2J87A 4HEJA 2VL7A 1UDWA 2VHUA 4TT3A 5DI9A 1F5NA 4KLNA 1FUUA 2OFXA 2CCJA 4DB4A 1E79D 3WYAA 3CRW1 2YNMA 5CB6A 2RCNA 3I4LA 3G5UA 2D62A 2PZGA 4HDQB 4HLCA 5JWRA 1G7SA 3CIOA 4WW0A 5B30A 1N5JA 3VKHA 1I2DA 3ICEA 4M9ZA 1AKEA 4ON9A 3TIFA 2J45A 4YXWA 3UK6A 2LKDA 4Q21A 3AVVA 1WF3A 1G8YA 4OQMA 4E09A 1NKSA 3CONA 3QPVA 3CW2A 3NC0C 4NDZA 5SZJA 4NZYA 4U7DA 1LY1A 4GNKA 1MO5A 2A9KA 3Q5EA 1GIAA 1OPXA 2J7PD 2GA8A 2KI5A 5EXPA 1W0JD 3NBZC 3K0AA 4PC7A 3EZFA 1G7TA 2VYFA 4ZI2A 1P60A 1SXJA 1CTQA 1J90A 2WWHA 2V3CC 2RB4A 1KO8A 3EWSA 3FMIA 1XZPA 4W5JA 2YOHA 4Q9JA 2AR7A 3AKYA 3K0SA 1GNQA 4S2EA 2B7BA 5L3QA 3VR1A 3Q8XB 3OEED 3I62A 4BASA 4GP6A 2RKOA 2OILA 2PX3A 5J5CA 3QUSA 2W58A 1EX7A 1JAHA 2JJ2A 4B33A 1HTWA 1OH8A 2XEXA 4B2IA 4AK9A 4M1YA 1M1YE 3RRMA 1E0SA 1P5ZB 1VKJA 3S1AB 2QY9A 2WPDD 3UIEA 1NIPA 1GDDA 1F2UB 1IAQA 1KI2A 4LZZA 1IJFA 4US1R 2LKCA 4MYHA 1ETUA 3KJHA 1COWA 2QSYA 1DO2A 2QG6A 2QRZA 2DPXA 1HH4A 3W5IA 2VP0A 4DBLC 5F9HA 3CKLA 4DLWA 2G0TA 3LO5A 2YWHA 1J99A 5G40A 3R8FA 4AYTA 2MMGA 4NYMQ 1U81A 1IN5A 1G9XA 4C30A 5JFGA 3OEHD 5TDHA 4O3MA 4FMDB 3NDPA 1ZUHA 4DZZA 1S3GA 5KNCA 3Q5DA 1XDBA 1YZUA 1YVDA 2JJ1A 2N1BA 1RE0A 3RVBA 4OI0A 1NLZA 1XNJA 4X8OA 2QTHA 3MGCA 2GZDA 2KWIA 2P5TB 4UXJA 4KJZA 3VHXA 1WCV1 4TLDA 2XJ9A 2EQBA 2OBMA 2OXRA 5DN6A 4B3CA 2QL6A 521PA 1SKYB 3RWMB 3A1SA 1VPLA 4AG6A 2ZRBA 3CF6R 4DUGA 2QSZA 5AJWA 2BJVA 4AYWA 4ZDJA 3BGWA 3RS2A 1E0JA 3R7WA 2QGNA 1XCMA 1G19A 1BYIA 1F2TA 4N0DA 4RJLA 2QBYB 1W4AA 1PLJA 4Q4AA 5H8WA 1EWRA 2H18A 4LJ8A 3OIWA 2EWWA 3FGNA 4AC9A 3RSOA 3QXXA 1AK2A 1TQ4A 3I8XA 4OHZA 3SFZA 1VG1A 1XTIA 3Q72A 2J7PA 3VR3A 4K8OA 1SVWA 1KIMA 1O3YA 1JAIA 5JRJA 2C9OA 3EIHA 1DVRA 4W5WA 5J4HA 2XAUA 4TMKA 2OLJA 3AVQA 1SHKA 4JLBA 1E2DA 3ZVMA 1X3SA 4V0MA 1DAGA 2A5YB 1Z8FA 3HDTA 1SQ5A 4Q1FA 3AM1A 4Q7MB 3HYTA 4IEIA 3TR5A 1ZYUA 3LFUA 4IOLA 1JR3D 4V0KA 5IHPA 2CK3D 1KI9A 1G8PA 4PHFA 1ZD8A 4JL8A 1G64A 1W1WA 2GKSA 4UKDA 1OB5A 4A2QA 1ZMXA 3CF2A 1YR7A 4DVGA 1SXJC 4GMDA 3THWA 2IEYA 3ONWA 4YC7A 4OI4A 1YRAA 5JCZA 4QGGA 1H8HA 4LJ9A 3V9PA 4DJTA 4UQOA 2IF0A 4KO8A 3VAAA 3QJYA 4IVPA 1E9CA 3ZGXA 1YR9A 1G7RA 2G77B 3NH9A 1KDOA 2CVFA 2EYQA 2ZJ2A 3W3ZB 1BS1A 2ZRGA 5CDFA 3V4FA 3W90A 1GILA 2A3RA 2JLVA 5JEDA 2ZI5A 2PLRA 1KGDA 3RC8A 4LWZA 5LB2A 1UEJA 1ZM3A 4QRHA 4PX9A 1E32A 2KSQA 3IPXA 2HCBA 2QPOA 4TQAA 4DT1A 1GAJA 4O0MA 3TQFA 1Z6XA 3QXHA 1GL9B 3L8YA 3R9XA 4LHYA 2ONJA 3AVYA 5JJIA 2C77A 2R6GA 4F4JA 1E2MA 3KKQA 4M9SA 3C14C 2OLKA 5D3MB 2FGKA 3HU1A 3H1TA 4IEEA 1T5LA 1I4DD 3PVSA 4A36A 1E1RD 3IBYA 3KUDA 3BOSA 3EIEA 4D4JA 2QP9X 1X8LA 4HZUB 4LV8B 2ZRPA 2GJ9A 5JRZA 2GEDA 1CRQA 1K6MA 3K70C 1ZM7A 3BAFA 3RRYA 4C2UA 3EA5A 1C1YA 4FMDF 2FPKA 3MD0A 3IBGA 2TMKA 5JS7A 3MWKA 3FHOA 4DSTA 1E9EA 3K9NA 1XEFA 1PUIA 1XRJA 2HLDA 2I1QA 4TMWA 3K09A 4QGFA 3QF4B 1OSNA 4EFMA 5KSZA 2ORIA 1N5LA 1NF3A 1ZIPA 2REBA 2XSZD 3FMOB 3B1ZA 2ZRFA 3KUCA 1W48A 4LUCA 2QM8A 3SDZA 1B23P 4BFTA 5KNBA 2YWFA 2GILA 4ERNA 4MDFA 5LDDC 4PO8A 3LBIA 1WE2A 4L5BA 3GQBA 3JZAA 1D2NA 3AF4A 4NTZA 621PA 2GESA 3T12A 5JCPA 1QZXA 2VLIA 2W2TA 2ANCA 5H1YA 3CRRA 3RSLA 5FPTA 4HYYA 4C0JA 4B3GA 2C03A 2G9NA 3BFVA 1P2VA 2P67A 4I1UA 2WSSA 1FQKA 1GKUB 3M4YA 5CB8A 3DM5A 2ZYTX 2IWRA 1R7RA 3SQWA 4GRAA 4Q19A 1NP6A 4JS0A 4XWAA 3MCAA 2QPTA 3H86A 4XVRA 2JLXA 1R8SA 4FN5A 1E2NA 1JPJA 4V0ME 3TRFA 2JIZD 2YWEA 4BFVA 1BMFD 1WQ1R 3NBFA 1IOZA 3GJ8A 3LH5A 3MWYW 2RMKA 2JIZA 4B74A 1NN0A 2HF9A 3GLGE 1WXQA 5FBLB 2GTPA 3LWNA 1E2EA 1WA5A 1AS2A 4B48A 4R71A 3P26A 3A1UA 2R9VA 1E2QA 3WYGA 3LX5A 4E5UA 4HZUA 2QORA 3WHLA 3O8CA 3EASA 5KUTA 2BBOA 5EE9A 1W36D 2FU5C 2DFKB 4HATA 2ZQ5A 4Z1MA 3B85A 3TMKA 4RZUA 3EZ2A 2ZSDA 3AVPA 3IIJA 4XTRA 2WJVA 3FOZA 4OK5A 1FP6A 2KJQA 2BHRA 1JBKA 3J81k 2HJGA 3I92A 5HCNA 3MRSA 4AKIA 3KDSE 2OUKA 4I81A 1COWD 5AUOB 5KTYA 2WM9B 2EU8A 1NVVQ 3GLGA 1N6KA 2OFOA 4A0HA 4OJKA 3BWDD 1E4VA 1AS3A 4PZYA 1M7GA 2JA1A 2CL6X 1IY2A 3CBQA 1OKKA 1N6OA 2SHKA 4HUQA 4A9AA 4ACAA 4ARZB 4FWIB 4URYR 2WMNB 3U3RA 4YXWD 1Q1QA 2H92A 5KYKA 3NTUA 2V1XA 1YZTA 2GK6A 2X2FA 1TEVA 2HLDD 5KDLA 2QAGA 3WP1B 3NC1C 3LY5A 3CR7A 3F5FA 4LV5B 2IT1A 1GKYA 4EAQA 3CPHA 3SN6A 2BC9A 4TT3D 2WBLC 3B2EA 3CRVA 2F7SA 4XH9B 3RAPR 1OH7A 3W8NA 1Z6TA 4LJ5A 4M1TA 2Z43A 2J0SA 1YR6A 4N1AA 4DDTA 2F43A 2CLDX 3JVVA 4BLPA 1N0UA 2WICA 4Q4JA 2RGBA 1Q3HA 2YJTD 2V54A 3U6BA 2CMKA 3M0EA 1AGPA 2FFBA 4A8JA 5KSOA 4BLQA 1XFAA 4YLGA 4D4KA 3SU8A 2O8CB 2Y8EA 4NP6A 2WMOB 4HB3A 3B82A 4CIDA 3NEYA 1YZQA 3P4YA 1FNMA 5FOUA 4KYIB 1G3QA 4Q01A 4KU4A 1UKZA 2GBLA 2ZRCA 3QQ5A 4XTCS 4PAMA 3EPLA 3HYRA 2QTFA 4Q47A 4RD4A 3SE0A 1EK0A 4M9QA 4FWTA 2D3WA 2YHSA 4ZIRA 1NVWQ 5EXTA 5CDFE 5FOVA 3A58B 2RGNC 5AJZA 4NONA 1W2GA 4MGZR 1Q0UA 1Z22A 1GG2A 5KHOC 5AJYA 4Q1CA 2AL7A 4LV6A 3O8DA 2ZUCA 2I3BA 3G82C 1KK2A 3ZD6A 3RYTC 1W4BA 1JXMA 1NBMD 2GRJA 4HAUA 3NBXX 4A2PA 3O47A 3QY0A 4PSAA 3GJ4A 3AKDA 1VIYA 1W5TA 4XD7A 1KI1A 3KFXA 2RGXA 3AB3A 4GL2A 1JECA 2BKEA 3LX8A 4LOAA 4RFVA 4YDHB 4JVSB 4R2HA 4IDHA 2ZS7A 4Q7LA 1UDXA 4V02A 2P2LA 1OIVA 2RGGA 1G5TA 1AKYA 2CHQA 4Q4HA 3IILA 1KI6A 4URWR 3QBVA 1HQYE 4CEJB 2FX3A 4LJAA 1GRRA 2VQSA 1XD2A 2B7CA 4JLNA 1CLUA 1R8QA 5DO9A 1IXRC 1XEWX 2ZJZA 3ZD7A 4DLXA 1E98A 2WWGA 1CULC 4MYUA 4TL8A 1G41A 2IC5A 1YE8A 3U3JA 2NMVA 4O2LA 3KQHA 1W36B 2ZS9A 3EWAA 4KCGA 4F7WA 4NYIR 3VU9A 1DAFA 2QQEA 1KI3A 2ZJYA 3B60A 4FINA 3QVUA 3BRWD 3IDQA 2F3TA 3VMFA 1MT0A 2O8CA 3WMFA 4XJXA 3WYFA 4DUGD 2WJIA 3FWYA 2UKDA 3BH7A 4IFBA 4PPNA 2QPAA 1ZCAA 2N42A 5DN6D 3ZLJA 4TN1A 4IVQA 5KDDA 3FMFA 2QAGC 2P5SA 3I3SR 1W4RA 4M53A 4DXAA 1MO6A 3TUIC 4Z51A 3PFIA 2C78A 4XIGS 2WZQA 3VKWA 4UNSA 4KSCA 3ZVNA 1KK1A 4JKYA 1HY3A 4B76A 1S0UA 3K70D 3AF2A 3QKUA 4G01B 5LD2B 4TYQA 3ZVLA 2W6IA 1HURA 5GJBA 2Q3HA 4LJYA 2CVHA 3RWOA 3TSWA 2OCBA 3FVQA 5KPJA 4HDOB 1Z08A 4PPGA 5IT5A 3WMGA 4QBFA 3WNCA 1KJWA 4CEIB 1Q1EA 1DARA 2A30A 4M0LA 1QVAA 2AX4A 4HZIA 4C0KA 2FZ4A 1KZGB 1CF4A 3CWZA 3ZZ0A 4ZCMA 2EFDB 2DWPA 4E03A 2NIPA 3MMPA 2AD1A 1S8FA 4WOPA 4FD2A 3IHWA 3ADKA 1JQLB 4JLKA 4QGAA 2OCYC 2QEQA 4C7OB 4KODA 4BLTA 2ODNA 2W00A 4S35A 3C16C 5H70A 1NL3A 5AR1A 4Q1BA 5KU1A 1N25A 1G1MA 3K1JA 5AJXA 2QMEA 2ZSEA 5B2ZA 1IN8A 2G3YA 3VHLB 3KB1A 4G1UC 4KI0A 3WRYC 1DEKA 1ZUIA 1ZM9A 3K0CC 3AVWA 1GSIA 2WKRA 2FEMA 3HP1A 4M4SA 3EW9A 5A0FA 4D81A 4DDVA 121PA 1MRNA 5FBQB 1E2GA 5FR1A 1G7CA 3BERA 1GZSA 1P61B 5IF9A 2J0VA 1P2SA 4LBWA 4P33A 1IM2A 4OJQA 5HR5A 2YC2C 1BYUA 4Y0AA 1T8TA 4D82A 1G4UR 4LBVA 4PPFA 1VHLA 4A2WA 1NLYA 2O0HA 4C3ZA 5BN4A 1XD9A 2F3RA 4BFUA 2XGJA 4LBZA 1QBKC 4TQUS 1G17A 2D7CA 2GEUA 3PEWA 1E2HA 3CRMA 4EPTA 3QXJA 3SHWA 3QF7A 2D2FA 4JJZA 1Z5ZA 1RFLA 1C9KA 1KO1A 2ZI4A 4WZ6A 4YMVA 3FHTA 2O8EB 2L0XA 1SGWA 2HDNB 3PG5A 1E79A 3U2QA 4XD7D 4BFSA 1PZNA 3VNUA 3UMSA 4AKHA 1E2PA 5BQ5A 3QSYA 1PLLA 4JL5A 3OHMA 1GL6A 3MUFA 4BZQA 2ZEJA 1RRPA 2Z5FA 3DM9B 4GOJA 1LTQA 4B3FX 4IHQA 1KDRA 1K8RA 2ANBA 2W6JD 4F38A 4C7OA 1U8YA 1YZKA 4J0QA 3RDPA 1KK3A 4QBHA 2IYRA 3SFVA 3LLUA 4B73A 4DEXA 3FE2A 4KITB 2V7QD 4BFYA 4IXNA 2V6IA 3WRXC 2IYLD 1RYHA 1XCPA 4PZZA 4QJ3A 2WIBA 1YHNA 1J70A 2ZI6A 2JEOA 2R6AA 4ITRC 3I1FA 2QP3A 1SKYE 2C98A 5JHGB 2VHQA 3OFNA 3BORA 4PZLA 1KSJA 2REOA 4OBEA 3R9IA 3WNBA 4ABYA 3PCRB 1L4UA 4Q1AA 1XJCA 3SJBA 2C2HA 2ZRMA 2EFCB 2R2AA 2OE2A 3TW4A 1KOFA 1W2HA 1TU3A 5FFMA 1SXJE 2AWOA 3FPAA 4JSYA 4OQLA 3U3OA 3ICQB 1CKEA 2YOFA 3I8SA 4WXRA 1XMVA 3LVQE 3V00A 2VIIA 1E9RA 4P32A 3QVVA 3I5YA 3UG6A 1R5OA 3RHFA 4B6EA 3DO6A 4EDHA 1SVKA 1G6OA 1NIJA 1OLOA 4OQXA 5KSPA 1KKLA 2CLSA 3C5HA 4QJ5A 4JVLA 2QQ0A 1A2KC 2AKAB 3GJXC 3ZS9A 4BFZA 2ZANA 2QP4A 3LBNA 2QAJA 2Z0MA 4JKIA 3NEJA 1U90A 4I1SA 2WTUA 3NHBA 3X1DA 3BD9A 3F8TA 2F6RA 3UMFA 3AVTA 4MRRA 1P9NA 2ZE5A 3VX3A 3JVUA 5H68A 221PA 1IBRA 1VYUA 4V0LA 4IDOA 1DPFA 4YMTA 3HWSA 3AF1A 2IA5A 1F2TB 4A0GA 5DI3A 3U3MA 5E4FA 4L4UA 3AGPA 3VNVA 4JLVA 1NG1A 5EE1A 1MH1A 3GCGA 3WP0A 3OAAD 2PZFA 4EJSA 4MRPA 4B2PA 4WIAA 2WOJA 3IQWA 1XTSA 2UZ3A 4B43A 2AKYA 4PC1A 1SVSA 5CM8B 2X77A 1TPZA 3P1JA 4N3NA 5BXQC 1UBCA 3OIUA 4QM7A 3GPLA 1S3SA 1J8MF 4LPKA 4Q4AB 721PA 2VP9A 5KO2A 4JVMA 5FTNA 1IY1A 1E69A 3QENA 5E7JA 1KO7A 2B8TA 2BVNA 1XXHA 1Z06A 1G3UA 3CWQA 4F93B 1Z0KA 3OE7D 6Q21A 4K46A 2CE2X 4NBSA 5LBIA 4PFSA 4DLTA 4ESVA 3EZ7A 1F2UA 4OQNA 5LPNA 1FMLA 4IXMA 2MSDB 5C4GB 2ZAMA 2HXSA 4LJ6A 2JLZA 1U9IA 1N6RA 4A92A 1NMXA 3TQCA 1EX6A 1X1SA 3C41J 1OH5A 1NY6A 3B1XA 1SVOA 3JZMA 5EXXA 4DIDA 1EFUA 1G8HA 4W9MC 2IF2A 3EPHA 2XOKA 1NBME 2AFIE 1ZIOA 4DIEA 1M34E 3CLVA 3SC3A 3FYHA 3QF4A 1XXHE 3TLXA 4Q00A 4BFXA 5CLQA 3FMPB 2VSXA 3T1QA 2IXGA 4PHGA 5JJKA 4MRVA 4PANA 2WHXA 1HE1C 3AV0B 2Z83A 2ZJAA 5EP1A 3UWKA 4Z54A 3QPWA 3AEZA 3MWLA 2FNAA 1XTRA 1W46A 3QPUA 4HLQB 2IX3A 1LS6A 2QNRA 3QIAA 3NXSA 4TMXA 4YMWA 1LB1B 5BYJA 2DWQA 2VF8A 5F98A 1H8EA 5JLJA 1LNZA 2IYTA 1KJYA 3W3AA 5BW8A 2GZHA 3Q3JB 2GDJA 1NBMA 3EARA 2OCAA 3A4LA 4D25A 1NN5A 1RZ3A 5UKDA 3THXB 1IJEA 5DSZA 1GP2A 1X86B 2OEPA 2JLWA 4LX0A 4DT1B 4DLYA 1E1RA 3QXCA 4Q02A 1O87A 5F2EA 2JASA 3T5GA 2ZR9A 4C9BA 4KVGA 2DR3A 5EP2A 3TH5A 2ZE8A 2PJZA 3I5XA 1II8A 4TMTA 2MSEB 4NYIQ 1V5WA 4IW3B 1NVXQ 1JB1A 3E70C 1I4LD 2YV5A 1R2QA 3BIFA 4U02A 4AIIA 2ERXA 1KMHA 1TQ6A 4Q03A 3IO3A 3K0FB 4Q7KA 1II9A 4IDPA 1Q22A 1Y63A 1P9WA 1S4QA 3AKEA 3W6OA 3PEVA 2BOVA 3GFPA 4MH0R 3UKDA 5IK2D 3TK1A 3RNLA 4GZMA 3A6PC 3NBYC 4HLUC 3SEAA 5EXSA 1E0KA 3T15A 5JMTA 2I4IA 1F6BA 5CJPA 3PJRA 2FEOA 4URUR 3FKQA 4KLZA 3DPUA 2DY1A 3GJ0A 4D2IA 4QHSA 4CT4B 2X2EA 2ZJ8A 3IGFA 1TEXA 1OIXA 3TSZA 2VSOA 1N0WA 2BWJA 4EQ6B 4MUBA 5D3QA 1GM5A 4OHVA 1E4YA 1QG2A 5KDOA 3ND9A 4KSBA 2QI9C 4LHXA 1GL7A 4NL4H 1G20E 1OIWA 2ZRAA 1XTQA 4AD8A 3A37A 2H57A 3OAAA 1G8FA 4I1VA 1EFCA 1JXOA 4D0LB 1U8ZA 5BYKA 4U00A 1KAOA 3AGQA 4B44A 5BN3A 1XB2A 2VBCA 4F4IA 4Q18A 5CK4A 2WJJA 1W44A 2ZUDA 5LB4A 4ASUD 4NH0A 4D6PA 1K5DA 4C0BA 4D80A 3W5JA 1R0WA 3TVDA 1KSHA 1IHUA 4KFRA 1NY5A 1XP8A 2NOAA 4QGHA 4V0OA 5FPSA 3TUZC 1W7AA 1LF0A 3EZ9A 1KAGA 1NSTA 1P3JA 5K8TA 3W34A 4RZ2A 2IWHA 2PJRA 2H7VA 3K9LA 1HV8A 1NMYA 5KOYA 1RKBA 1AN0A 3VQTA 3CX8A 2A5JA 3LA6A 1DOAA 1XMIA 4F91B 1T3SA 1TNDA 1KTVA 4DLSA 5GJWC 4HAVA 2VPPA 2ODWA 4QBGB 3TAHA 5EJEA 3MG9A 1ZRHA 2LWIA 3D6TB 4Q1EA 3SR0A 2B92A 3P20A 2BMDA 3KQUA 2J1LA 2A5DA 1N5IA 3NG1A 4DKXA 2FSHA 1US8B 2HT1A 1HYQA 3K53A 3GJ6A 5CYOA 2HV8A 2BV3A 4JLOA 2WV9A 4JLPA 2VA8A 1KI8A 5JS8A 1T3HA 2GCOA 1T5IA 2ZPTX 5JJLA 4W7SA 3Q7QA 4PO1A 4GP7A 2IS2A 3P27A 1SVIA 1T91A 5EE3A 5EUMA 4DLVA 4NCJA 4JLMA 3SYNA 2O8FA 3PUZA 1HT2E 3EZ6A 2NGRA 1EFRD 4FI3C 4Q9LA 5TARA 3OFND 2JJ1D 2Q9CA 5KSYA 3SJAA 2DFLA 5FPKA 2IK8A 1DAKA 1G4AE 4WBSA 2IYYA 3F3YA 2MSCB 2QA5A 4TTQA 4B47A 4DCUA 1NVVR 2ZXUA 2FFQA 1ZM4A 2GZAA 5FTJA 2V4ZA 2OT3B 4TL6A 1OFUX 1SKQA 3EIQA 4M1MA 3N2EA 3FFBA 5FL3A 3DEFA 1P62B 2WPDA 5M04A 2OFWA 1FTNA 2P0EA 4PAQA 2PZEA 1LV7A 2XSZA 5L8VA 1CJUC 5L3VA 1G8GA 1T9HA 3WNDA 1BOFA 3IIMA 4Q4JB 3L0IB 3OE7A 2JJ2D 4OI2A 1E9FA 3BC1A 3QEOA 4LYAA 3TUJC 1VG9B 1EFHA 4H1UA 2PBRA 4Z8XA 1VYVA 5GJVC 2G88A 2I1VB 1VIAA 2ZRNA 2XB2A 1QHYA 4L9SA 1NVUQ 4R7ZA 4TL9A 4RSGA 3DZ8A 5DH9A 3KXLA 5IDVA 2HYIC 1M7HA 1I4TD 2AWNA 2FE4A 2IW3A 2QE7D 3QG5A 1SXJD 1VMAA 1W49A 1A7JA 4B3XA 3PITA 1TMKA 5TVKA 4TMVA 2OO7A 4UJ3A 1Q12A 4H1VA 1CJMA 3WBKA 5F9FA 1NN3A 1OT3A 4Q7JB 4XVUA 4KV9A 3H4MA 4QL3A 2G0NA 4NMMA 1JEDA 1E6CA 2XOKD 4JVNA 3Q7PA 1MO3A 1NMZA 1XWIA 2FN4A 2EFHB 2ZRDA 2IS1A 1YRBA 1F60A 3NWJA 3OF5A 3A4MA 3WBJA 2YC4C 1UPTA 2VHCA 1UF9A 1Z0JA 1S9DA 3SQXA 1D2EA 4IOMA 2WVJA 1UBFA 1Z0DA 1KI6B 3B6EA 3PQCA 3RS0A 2ZR7A 2V1UA 4LY6A 4QXAA 1GOTA 5B58C 5FOSA 1CEEA 4EKDA 3FFAA 5TV2A 3U61B 2Q0HA 2C8VA 1ZAKA 3IPYA 3QOFA 4KVAA 4ESHA
chains in the Genus database with same CATH superfamily
1KJZA 2YASA 1B3RA 1E5VA 1MO4A 4P82A 3K6SB 4EX6A 4B17A 4UJ5A 2HSDA 1CS0A 1AHHA 2I4NA 4V1CI 4Y2JA 2ZSBA 4DAOA 2E87A 2NVOA 2GBLC 1KEEB 1ORRA 4Y2PA 1YAJA 2NVUA 2B25A 3AU9A 3KCQA 1VCIA 1RWKA 3VC1A 4CLEA 1EBUA 3A25A 4BMPB 4RK4A 1G4HA 4MITA 5DV9A 3V7YA 1AKTA 4TYNA 1I2CA 4BNKA 2PKQP 5KC9A 3B7GA 1QE3A 1WZUA 3BEDA 4PN7A 4CN9A 5DGXA 4WJKB 3BMOB 4H7DA 1D2CA 1Q21A 2RH9B 2F9MA 1R4NB 2PKXA 3UAOA 1ZVQA 3OOJA 2FMKA 4GRIA 1T13A 1IHOA 4ALMA 2WTEA 3JQ8B 2OSBA 3QE4A 3S1AA 4DMCA 2H4YA 3SR3A 4OB6A 3E5HA 4NRDA 2B36A 4NMWA 1I2MA 2MSNA 1EXNA 3TVTA 4X1KA 4BEVA 3LA8A 4HYQA 2AZDA 1OZHA 3BWXA 4GYYA 4LDJA 5A4MS 4ZIRB 2YV2A 3M9LA 5JHHB 4GDMA 1JHRA 2ERYA 3LVFO 3ASZA 4M55A 2A9JA 2YWGA 1QF7A 1QM5A 4XWYA 3QNMA 4YB8A 3VPFA 2QLJA 1P17A 1OF1A 1VDMA 3R76A 1T35A 4NE7A 1DIAA 2HNKA 5JCJA 1ZBDA 4ZODA 3WLJA 1CWUA 4OJMX 3OQJA 5ICCA 3T4PA 1TQHA 4LNAA 3RSSA 2IOQA 3MCZA 2Y99A 2AG8A 6ADHA 2QQFA 2VATA 3EX7C 3JTMA 1ZR2A 2BMEA 4HVLA 3OZBA 5JARA 3DHWC 3WZMA 1DX4A 2I4TA 3GROA 3OX4A 4DILA 4AS1A 5DCUA 1J9GA 1VHTA 1UP6A 3KHTA 3KKMA 3ROGA 4A0QA 3U44A 2QHXA 5BV0A 1H42A 4B4WA 3AQ4A 3O91A 3QBJA 2ZATA 3E27A 1E7WA 4J29A 2WTAA 3C5VA 4QD3A 2NV2B 4ND3A 3SS8A 1K2VN 2B4RO 3GC6A 4RHXA 1Z2CA 5JI2E 2FB9A 4V03A 2X4IA 2HJSA 3PHLA 3S55A 3AR9A 1T1JA 4R8KA 3V80A 2IZ7A 3BMQA 2PE5A 1C5KA 3PLNA 3LZDA 4HX5A 2BM0A 3ECSA 4K8RB 5AQEA 2GSDA 5DLDA 3K0AB 3FOWA 3M1AA 1JHAA 2ODTX 2WU4A 3E22A 1GTZA 2IIBA 3H0KA 4FLEA 3NBKA 4EB3A 1OBCA 1Z68A 3BMCA 2A0KA 3TTUA 5B64A 1P0PA 4FJ0A 3ZHRA 5JASA 2AOWA 4A23A 4YPFA 2HOQA 4LWOA 4R9UC 3BH0A 3UXYA 1JU4A 4UMVA 4EFNA 4RV5A 5EIHA 5K8UA 2Q9AA 5DX8A 3WAGA 2F1RA 2R4UA 3TJMA 4C7XA 3A31A 3A32A 3LIPA 3G5TA 2R3SA 1K8YB 1V25A 2JIPA 2YCLA 4I6GA 4OIFA 1V3QE 5LQNA 3M34A 1WMSA 4WJLA 1VL0A 1PNRA 4X1KB 2H5JA 4IOKA 4IWYA 4RABA 3UF0A 3GNTA 3T9DA 3D4PA 2FN3A 3PNPA 5FLEX 3JR7A 1CS4C 1FUEA 5J4KA 5BSFA 3FKSA 2D54A 2DYKA 3W6PA 1LRJA 2NT3A 1OFTA 4P4SB 1Q0QA 1AO3A 1R12A 1AM4D 4EY5A 5AUQA 4U7TB 1CP3A 1ABFA 2YJZA 3PQ8A 4P4UA 1NXSA 1WKVA 3EXG1 1UIRA 3FOAA 4JEMA 4YY3B 1N6PA 1JG7A 1CUFA 3OZGA 4MQBA 1AY0A 3TLAA 2AMJA 2I3DA 3UHOA 3CUEF 5BUZA 5FDFA 3DMGA 5D00A 3RV3A 5L9AA 3V8PA 3IAS6 4XIFA 4D98A 5FKJA 4PYJA 2QLLA 3V4OA 2CNWD 5JNLA 4BYGA 1T2EA 4UTZA 5EP3A 1B2LA 1U9CA 1NSFA 2JAQA 1VSTA 2ZCVA 1EH5A 4XDGA 4XCQA 5GVRA 2FPXA 3P0JA 2FSVA 2PRKA 4WXPA 5KQRA 3ZJTA 4K6OA 5BMVA 4HQ6A 4W5OA 1J6UA 1WMFA 5K4HA 3PX7A 2OTCA 4FYJA 1BEZA 4TRJA 1YZLA 1PIWA 1ESEA 4IGAA 1DB3A 1S6YA 3H75A 4WSOA 4CZ2A 1TTQB 1Z9BA 1YCFA 3FETA 4KBFA 4P93A 4UASA 3LUBA 3HXTA 4JT9A 3ZKAA 3VOBA 1OZ0A 3N3BC 3H3FA 5A3JA 4BS9A 1AHNA 3OLZA 1O5OA 4XPIB 3BSWA 2W6CX 3FTDA 2R1ZA 2YZ2A 4BE7B 3U60B 5MHTA 5D3MA 2RHCA 1KH3A 3AW8A 3TW6A 1LI5A 3U7IA 1QYWA 3CA8A 1X1EA 3MW8A 1MP0A 4Q9AA 4F2WA 3MCUA 2DFDA 2XA2A 3S81A 2CCKA 3A9UA 3IQGX 4EIWA 3RAEC 1X9HA 3GRPA 3Q0EA 3RPEA 3RT9A 4EVIA 3R9XB 2X8WA 3CG4A 4XARA 5KWSA 4QDXA 4TXMA 3P4XA 3WYCA 1Y8AA 1FUIA 1OGJA 4B3JA 4GOKA 3DZCA 2CNWA 1AUQA 1P7PA 4LHZA 2JAWA 3U16A 1V8ZA 3CEMA 1S1CA 4GYKA 4XUEA 4EF4A 3I73A 5FQNA 2HXGA 2PT5A 1VG0B 4J4HA 4AU1A 2R44A 2M2IA 3G49A 4MV9A 1JIIA 4QE3A 4V2UA 2AX3A 4PYMA 5JAUA 2XZLA 3VMMA 2OHOA 3LM8A 5E0OA 5F5NA 1I2BA 3KQVA 1I9CA 2F9LA 3HWWA 1Q19A 2GARA 3OI7A 3FB4A 4FMBB 4J7UA 5J40A 1X77A 4LCBA 3FUTA 3G9TA 4M99A 3DZDA 3LQ4A 2ISQA 4MLCA 3RG2A 1T5OA 5JROA 2PXHA 2NWQA 2PGXA 1CUUA 3ZWCA 4TYYA 3L5OA 2H1RA 2N46A 5E1MA 2QUHA 2BR3A 4AWXA 5ILOA 4Y2XA 1GSAA 1JPVA 4E5MA 2ET6A 1NX6A 2QN2A 4HUQB 2AOXA 3F3MA 1R74A 3FVTA 3GPDG 1Q50A 5LOVB 2O2SA 1SD2A 1NNEA 2AF4C 3UG7A 1MEJA 1CQJB 1JNYA 3AZPA 5KTSA 2C1XA 4XAQA 2WU1A 2I6TA 2W4IA 3GCXA 2WJ6A 3LUAA 3AERB 4I5DA 5FAKA 3L6RA 4J0CA 5B4TA 2C7QA 1QV7A 1RXCA 3DLIA 3A1CA 3OQIA 4WDRA 6REQB 3L4EA 3EUAA 4OLBA 3SIWA 5D01A 5EHNA 3VTKA 1ZGAA 4QFMA 3SKVA 4YX9A 5C7IO 4NFHA 4EG8A 2A57A 3BBLA 3AR2A 4JOBA 3FTNA 1I33A 3VKGA 2JDID 3JASB 3T7AA 4ED9A 1YCDA 1CY7A 2EFEB 1DX6A 2ACWA 3FUUA 3M89A 4RH1A 2B34A 3QELB 4YQZA 2PUDA 1Q7GA 1BXRA 1MKYA 1NRWA 5I5EA 2RGYA 2WU0A 3G7UA 3DEJA 2IPNA 1TADA 4I5EA 3CSSA 4URXR 4C01A 1WPQA 3N39C 4F8JA 5K51A 3KKPA 5EZYF 3T8YA 2XGGA 5K0SA 4J91A 3LVRE 3BSFA 1LPNA 1SIUA 3DDUA 2AS0A 3FGZA 4O2RA 4FCCA 4F56A 3EQ6A 4MWDA 2AMLA 2PD6A 1M8PA 3N0RA 3OM8A 1HWYA 3MWFA 4KK4A 4NYJQ 3VM6A 2EZ8A 1RRCA 2ZU6A 1TD1A 2Q1WA 5J3JA 1UOQA 2HZ7A 4ZCSA 1N6NA 1EK2A 1E61A 1G2IA 1NN1A 2DHCA 2I3AA 2YN2A 3I2JA 3ICWA 4V0NA 3STUA 2OG2A 3OTHA 3F5QA 4AZVA 4YASA 1T3LA 4TL7A 3LOUA 5ANRB 2H1OA 3FBTA 2XQFA 1HEYA 3HP4A 3NHMA 5DM1A 3VYRB 1R37A 2JI9A 2A78A 4ZU6X 2KBFA 2KX7A 3DDHA 4MJXA 4ND2A 5COBA 4DQUA 1CR4A 1G8AA 3JRNA 3EUEA 3K1TA 4D0NA 3PK0A 2PKWA 4KE9A 3RJ9A 4II2A 5LQKA 1GGKA 3U62A 1D1SA 3BXFA 3W8RA 1DO0A 4HLUA 1XD8A 4R01A 5ERXA 2VT6A 4O5OA 4EKYA 2F1KA 4OI1A 4H60A 3ZYCA 4AVYA 1C9MA 1RWWA 1UC8A 2JGNA 1P4HA 5ALHA 4K9RA 4NV3A 3MILA 1RPZA 1HNNA 1NVEA 4DLKA 1U2RA 2CXXA 2VLBA 2ZVPX 3TAUA 3VVCA 4L8WB 4JI4B 1DTSA 2PEYA 2YWDA 3GGPA 2F1HA 2C9MA 1P8JA 2F43B 2IZ6A 4AY3A 1A1VA 4MYTA 2R6ZA 4EJSB 1I6WA 2EERA 4RJKA 2NUTB 4AM8A 4EY6A 3NBQA 2DB3A 1ULHA 2W2NA 4PHTA 5EYPB 2AEMA 3B1WA 1Z82A 4A5OA 4QYWA 4RMGA 4ZICA 4FCTA 3EA0A 3INTA 4AKEA 4LC1A 5EMJA 3OH8A 3SD7A 2ZRJA 1Y5NA 5AKIA 2CVPA 1UFVA 1YFLA 4OK3A 1H2RS 3GWGA 2RCYA 1TCVA 4JBXA 3VSAA 2CMGA 3KP1A 2HM7A 1Q1AA 3OEYA 4WVFA 1U4SA 1BRTA 3K6JA 5TRTA 1O7JA 1O94C 1TOAA 1N2OA 2GRUA 1JR3A 4IJVA 4UE2A 3TL2A 4ZJPA 1DAHA 2MCFA 3M4JA 4HPJB 3W8DA 1ULZA 2W2MA 1QZZA 3PDCA 5ALVA 5M3BA 1P18A 3CCFA 2D5LA 5CFQA 4OK6A 5FBKA 4DSOA 3I1JA 4RKRA 4G5RA 3PNLA 2JCSA 3E18A 1H0HA 4KQFA 2ZYVX 3BA1A 2OM6A 3I52A 4E5YA 2A35A 2B7LA 1TGVA 1EBBA 2ILVA 2Q6TA 4YQFA 1M0EA 3NALA 4FZ3A 3MQFA 3WMWA 3HR7A 1KWGA 3ESRA 3T9AA 5A06A 3L2OB 4KIGA 3R3SA 4NAHA 5EZ5A 3SX0A 2WWIA 4IMPA 3RKSA 3UJNA 4ND8A 2PQ0A 1R10A 3FTFA 2YY7A 5DT2A 3S5JA 4N3AA 3OQNA 3L4JA 2A0UA 3HPRA 4YMLA 2QR5A 1E6MA 1FPMA 4YFVA 3K6RA 3BA6A 1B0UA 4HQFA 4B6SA 4XRGA 3GYGA 4TXHA 4BOYA 3U4IA 1QTQA 1Y3DE 4RFSB 1P1BA 3I5MA 4XIIA 2JVJA 2HMWA 3IMKA 3P2JA 4Z1MD 8OHMA 3E4CA 5FWYB 4A26A 4MVJA 2PUJA 4LEIA 3WLRA 3IV9A 1VHWA 1NMQA 3P7MA 1Z0FA 4K0KB 2SKDA 2EFYA 1V4NA 2ATCA 1YL5A 2BEWB 2C88A 3KZKA 4HWSA 2OXCA 2XGSA 1KVQA 1BU8A 1SZDA 2QRLA 4MS4A 3ZX5A 1G2PA 1P3DA 1E7YA 1G5HA 1U7UA 1CNEA 2CKMA 1EUDA 4A73A 4DC0A 5ICMA 4D4IA 1KKMA 3BPSA 5GZ1A 2B21A 1RHKA 3O9ZA 2QRJA 2X15A 3CLUD 3EXHA 3EEQA 3FFXA 3I72A 4MPRA 2W2XA 3KVVA 4HB0A 4S1NA 5BVGB 3D8BA 2ZM6B 1RZUA 4GKAA 5JZMA 1OI4A 3B9QA 5C53B 1J7KA 4RTJA 3GLFE 1P6XA 3VH4A 2EJTA 1QQ6A 4HAYA 4PHHA 2NNWB 1J1IA 1SHZA 2WSSD 2MR5A 1I4WA 3CNEA 3OOWA 4W9RA 2C04A 2R7AA 3N8NA 4QC2A 4ETNA 4UMEA 4YJHB 1SIWA 2QRNA 4PS0A 2EC5A 2BFBA 3FM9A 3PF8A 5ADWA 1N75A 4OU4A 4EY3A 1U3CA 1H1TA 2O3JA 4DLUA 2Q2WA 2OUIA 2BBTA 2XAAA 3BJIC 5L51A 1M6NA 2PX0A 5ITWA 2XT0A 1R6AA 3MGGA 3RTBA 2FUEA 1EFRA 3WL6A 4M22A 4O4JF 1Y9JA 3ROKA 3TSOA 4Y6PA 4E70A 2HJ9A 4KFTA 2CXPA 2YNMC 1T1SA 4R8SA 1OB2A 5K09A 3E2MA 3QY9A 1ISHA 1ZD1A 4EQZA 1X6VA 1SC1A 5KAMA 1OPRA 4WCFC 3PDHA 5IBQA 1YC2A 3FRJA 1M5RA 1URPA 4B81A 2P5UA 1YQGA 3EXEA 1ISFA 1GUAA 1PZXA 3D7SA 2DXIA 2JGAA 5J2UF 1J8YF 2ATVA 5GM2A 2K87A 2X1HA 2DX7A 3D8SA 4GHWA 3Q98A 2PS0A 4M37A 3SQOA 1BGWA 2EKBA 1ODIA 2AN5A 3C98A 1YWGO 4H0FA 3K9HA 1VCNA 3WIBA 1IONA 3CPJB 3KAQA 1BDBA 2QTVA 4ZVKA 5CD9A 3ECCA 2VPZA 3PKZA 3DEZA 3TTTA 3R7DA 3KEMA 1N2SA 1NTRA 5BNFA 3ZNPA 4WECA 3OURA 1V5GA 2V7TA 1XZJA 4YJFA 5IAKA 3STXA 1I6MA 4HLDA 4ZI7B 1O5TA 3UYLA 1BXKA 3HJCA 4FHCA 4CUZA 1VIVA 4ZCLA 3VDRA 3M4NA 2WWRA 3D0RA 5CXUA 1E1NA 2QN6A 2RHJA 1PR4A 4D0SA 3KQNA 1SXPA 3INYA 1LF5A 3TBFA 4K40A 1QYCA 5EIFA 4FMCB 4RD6A 2PZJA 2N75A 5EWMB 2EKQA 3L8MA 3H13A 1WXIA 2Z30A 2JK1A 3E3AA 3I6IA 1QTIA 1G21A 3F6EX 3JS5A 1PG0A 3WKEA 5IKPA 4P5EA 5AVZA 2Y1EA 2I22A 2PUBA 4JOCA 3IXQA 1VXRA 2I3GA 2O8DA 4LDNA 3VR6H 5FL7D 1EHCA 5LR6A 5AUPB 5CT5A 4A4DA 2VEDA 1A8SA 2VJBA 2CCGA 2R7KA 2JAHA 2YJ4A 2R6JA 4AO7A 5BV8A 1JJVA 3OJOA 1HLGA 2QD5A 4KVZA 4TV8F 3HXMA 2V65A 1SUAA 1T9GR 2ZUSA 4MLPA 2RG7A 4PIMA 4UHFA 5IW8A 3RS4A 1ENZA 1OE0A 2Z6VA 3FNEA 1GEEA 4Z2YA 1UJ6A 2R7NA 2HCRA 1GUZA 2PR2A 3D0KA 3HJNA 4CF7A 5GGYA 2Q4DA 2CNBA 4TWIA 5CXSA 1N2BA 4ZVRA 1RE1A 2XWPA 4JI1B 4A1FA 1U7XA 2Q41A 1C2YA 1L3IA 4D8UA 4F6RB 3LYAA 3VSEA 4HWPA 4TWZA 1K92A 4BNZA 5I7FA 2ZJ3A 2WWVD 5MN6A 3OZCA 1Y3CE 3N8KA 4BNXA 5CJ2A 3SEZA 5LVAA 3PLAE 3L5KA 4AN1A 2YS7A 5FEUA 5JDIA 1RRKA 2DOKA 3GJRA 1LSOA 3T7EA 3RVRA 1GPH1 3KETA 3BRSA 4FYMA 3GFTA 1G5IA 1UK8A 2ZP1A 3M6AA 3OIGA 2NZ8A 3HR8A 1Z3IX 2CF5A 1N1DA 2H0QA 2W2LA 3DWIA 1RRMA 3ZHVA 1JAXA 4B7AA 1LA2A 4IIDA 4TTAA 4D6YA 4KL8S 1SXJB 3AFIA 2JFYA 1OYOA 3DL2A 5ULLA 3SJZA 4DBLE 3DCIA 3IAS1 3HB5X 5C8DA 4MB2A 4C6HA 4LBYA 4GO1A 5CPBA 5C7OO 1CUEA 4RK0A 3TGWA 2WVHA 5BNIA 5LSAA 3R7WA 2EGGA 5JZBA 1MIOA 1R50A 2BE9A 3KPWA 2HHAA 2VTKA 4U63A 4YCDA 4RL6A 1IK6A 3E58A 3CZ5A 2BTOA 1QNLA 3GLHB 5EWMA 3V6LA 5FUMA 3SHFA 1CUHA 2QLMA 3JYLA 1ZD5A 4UUMA 1J2JA 2WJGA 1EVLA 2EKPA 1EB9A 1PFGA 1RAIA 3AJRA 3UW1A 3VO8A 1CNMA 4RZSA 4X1YA 4Z7JA 4YCMA 4Q3EA 1GU7A 3CZAA 3THOA 3H6KA 4CNBA 1RTKA 5AKYA 5EUCA 1BQ4A 2ZRHA 1A3CA 4BMNA 3QMMA 2AR9A 2FEAA 2JI8A 4P58A 3H4VA 3SNHA 3I9KA 3MXTA 3GFQA 4MIYA 2QVXX 5L7WA 2L19A 5AIAA 1P6QA 2O3UA 3KVYA 4YV2A 5HJEA 3R7AA 5FWAA 4YT8A 1HA3A 2CLFB 2R97A 2Z8YA 3HBFA 4G81A 1HC7A 2YHIB 4L51A 3W79A 3OU2A 1KEKA 5A03A 2VDUE 3IC5A 1CLEA 2RC5A 1SBZA 3TW8B 2XEDA 3TD6A 1PX0A 3GP3A 3PXXA 1CVIA 3GMTA 3HBMA 2X1VA 3W4IA 4AWAA 4LXGA 3FTQA 5I8WA 3M6VA 2Y2UA 2O2CA 2XBLA 3GLFB 4EATA 4R3NA 4Z99A 3QNUA 4O3FA 3U4CA 4GOOD 1WHSA 3H3XA 4ZU3A 3QA3E 3AB7A 4K9OA 4PG5A 2FP4B 3RIEA 4XGKA 1DL5A 3NHRA 3GJSA 3FNBA 4FR2A 4JJKA 2CJWA 2BMVA 1VP9A 2VZLA 1T6NA 3BQMB 4MR9B 4PZCA 1PK8A 1RYEA 2JBAB 2PYZA 4YHBA 3NX4A 1RRFA 4WAUA 4NU0A 3WY9A 5K6AA 1LI4A 2G5TA 2A94A 2ZR0A 3FDIA 4Q39A 1Z2AA 5F3RA 1O89A 3D64A 3S7ZA 4LF8B 3NOQA 4X45A 1NQVA 1V48A 1HSOA 3MXOA 3PR1A 4I3FA 5DHFA 5LIPA 1KO4A 1PHRA 2CLKB 3BDAA 4KWTA 3DTVB 2VNIA 4EFLA 3C85A 4GD3Q 2RAUA 3N5CA 2FPGB 4LJLA 5HP4A 2R751 1H2AS 1WXDA 3CLRD 3CLUC 3V32A 1PN3A 1XBTA 2O3SA 4A91A 4PQEA 4AO8A 5IUJC 4GM0A 4CLRB 2XXAB 4B9AA 1WUJS 3RVLA 1T5HX 2PFSA 5CVJA 4GGOA 4F5WA 2ZI7A 5TPZD 3T5TA 4B3DA 5DWDA 5H7XA 3HU3A 2VP4A 3AVUA 4QUAA 3B38A 3PEYA 1LLDA 4CXMA 4MRAA 4CF3A 2ZRIA 2I71A 4ZP1A 2HHCA 2I99A 2RH5A 1CR2A 2Z2ZA 4XFJA 5K3FB 3N6XA 3VYUB 3SZUA 1W6UA 1NASA 5F1YA 1J00A 1P2GA 3WLAA 3PQ3A 3T7IA 4BN4A 2OKGA 4ASUA 1RTTA 2EYUA 4I55A 1GFZA 5F5XA 3AHFA 1KNXA 1VI5A 3QYPA 4O4HA 4BEJA 3TX2A 4D26A 2ZWVA 4JSTA 1X7WB 4LI0A 5ES3A 1L7RA 1P0IA 2C96A 3SOPA 5A5EA 5JC1A 3HXOA 1JAYA 1UBKS 2B83A 2J59A 3K6KA 3I4FA 3NIDB 4CTJA 1RIFA 3BXHA 1UBUS 3R8CA 5DMXA 4CM4A 4DB2A 3HCBA 1B3BA 4PXAA 1I6LA 2RKBA 2B5OA 4DA6A 1CERA 3DPIA 4FSDA 2IV2X 2XYQA 3IAFA 5JYEA 3CKYA 2ZYHA 1JRLA 1ST2A 2PK3A 1U31A 1Y6JA 3AXSA 1XOIA 2ZWPA 3FSGD 3EISA 3T35A 1LSJA 2PVPA 3QITA 4WNIA 5TEWA 1SO8A 1RRVA 4HXEB 3C3KA 3EY4A 5FBHA 1RYFA 3ZHCA 4BO2A 1OBOA 2FX2A 3ACCA 4FFPA 1ZH4A 1IVYA 3K2IA 4BQSA 3AF0A 1GV0A 2ZSJA 5F51A 1EP9A 1QGZA 2R8RA 2Z5GA 3HU2A 4GFDA 5JU6A 1WF6A 2FSPA 2I0FA 1N8KA 4QU0A 4X8MA 2H31A 2FWIA 1ZJ6A 3C87A 4H7KA 5BR1A 4C0QC 2ZTHA 5CA1B 3OA2A 4MHOA 5I47A 3SOZA 3RC3A 2DWUA 2P77A 5CXXA 2FPGA 4MQFA 5KPDA 3R7WB 3WGKA 1A2BA 1IY0A 1QLWA 5IJ0B 3UH0A 2C2BA 3UHAA 2OYRA 1CR1A 3L7LA 3LPDA 1QGOA 1KEWA 3L7IA 2AFHE 2C4UA 1JG3A 3AG6A 4QRDA 2GH1A 3ZCUA 1GPWB 2KLBA 3PSAA 3DLBA 4OFBA 5DISB 3R09A 4TLMB 5FI0B 1KHTA 4UMFA 5IEJA 2QD4A 3FSGA 3KSMA 4ALJA 2ZKIA 4ENVA 4H7PA 2WIDA 5HDBB 3A2KA 3KB8A 3WGJA 2XB8A 3ENQA 4DHEA 2WFMA 4DQ0A 1ADFA 5B6PA 5JQGF 4NCKA 2GDZA 4TLCA 2QJTA 4QWWA 4WBXC 1SUBA 3M5DA 2IIVA 3K8QA 3O0TA 2TMYA 4IIUA 3W78A 4MR7A 3ZCQA 1NUAA 2DETA 3UC9A 3ZVKA 1E1QA 3QLJA 3PWZA 3DKKA 3FTPA 1U8XX 1XKTA 2XTZA 2FRVA 3TCXB 3AHIA 1IN7A 1AQYA 4BNLA 3H19A 1T1IA 1UQTA 2L69A 4JGGA 2Y1CA 1LC3A 3WSTA 4Q4LA 3WZLA 2J5RA 1UWLA 4HKTA 2I7VA 3LT5A 4RQUA 1JLMA 1U2GA 1R0LA 4JT4A 5SZKB 4K7JA 3KB6A 2BAGA 4X20A 2NQ2C 3M6MD 4R7GA 1PT5A 2F2TA 4QOHA 4ZU1X 4DG9A 1C30B 1KK0A 1AB5A 2NYVA 4DA0A 1T6ZA 2DTDA 1QH1B 2J5BA 4JGIA 4AJ9A 2RKWA 1HTTA 1G3RA 2OC4A 3UXMA 2DUNA 4R8VA 5H3LA 3QQPA 4FB4A 3Q4GA 3GFSA 1MBZA 1Q77A 4BRWA 1E96A 3MGKA 1YFZA 4UM9B 2FYTA 4R84A 4BX2A 2PLAA 3N2KB 4JB0A 5ESRA 4R2JA 1ADYA 1UH5A 1C4OA 2CUKA 3IE2A 4R83A 4ZV4A 2X6RA 3VUFA 3DAYA 3OIYA 4HBGA 4J1SA 5BQXA 1I7LA 3AM4A 3TGPA 2X58A 2WA2A 1X9IA 1H69A 1QZTA 1RVDA 3QOYA 3TLGB 4MQUA 3KZ1E 1XJQA 3N53A 2DQZA 5EFOA 4E46A 4KXMA 2ZJ0A 3MOGA 1S1MA 4RACA 3G2KA 5CA1A 1IOVA 1L5FA 4PO3X 3DUFB 1G8SA 1L2TA 4JYBA 5E6RB 4OHXA 1Q20A 1NWCA 1QPZA 2VG8A 2NZJA 1SFRA 1JEAA 2EX4A 2AW3A 2XNDD 4FBLA 3U9TA 1U1CA 3RD5A 1C50A 4NNPA 2A67A 3FNHA 1C14A 2O6LA 4CCYB 2JB9A 4NOKA 2IEZA 1G6HA 1RYBA 3GZNA 4X64B 3IL2A 1QFJA 3EQ8A 3H2IA 4BZZA 4HFRA 5F2KA 4GVLA 4F9GA 5J2TF 1D0IA 3AOEC 2CFOA 1ZJ4A 1ONNA 1NVMB 4PAWA 2FW6A 3E3NA 3LL7A 1E6UA 3OU7A 4JP2A 3VYWA 1KYIA 3SHQA 1VPEA 4HAOA 3SJCA 3TJZA 1WG8A 4FLMA 1UBOS 1PL7A 4B3MB 4CM5A 1Z6GA 3A9SA 1T4CA 3PUHA 1ABBA 2GXQA 4FE3A 2B8JA 2JLRA 1BN6A 1BX3A 1SUWA 2QRVA 3EA4A 3H16A 3QVKA 4MGKR 5T3UA 1W47A 2QDXA 3KYCA 1F6DA 5LC1A 3VU9B 1JMVA 1SUSA 1V9CA 2ZT5A 4NNOA 2IZZA 4OF4A 4LQDA 2OGTA 3NDBB 1LK7A 3U7EB 2WRZA 1B0ZA 5T8KA 4LMAA 5HTKA 1CJVC 4RVFA 2IYZA 3RRXA 3KQPA 1CDOA 5LBUA 1JS1X 1Z83A 3QKRB 5AMXA 1R0YA 2GEVA 5HUHA 4FDMA 1WEKA 4K6FA 1JVBA 1UKEA 5DASA 4ZO4A 1MAVA 5IH7A 2JJ8A 2QAGB 1FNNA 1GSHA 2ZPAA 3Q2OA 4MQLA 3K2QA 3CRZA 1AUPA 3FF4A 4YT2A 5L6LB 4HNUA 1YDGA 2P3LA 4GEGA 3A11A 5BSVA 3KK0A 5SICE 1ZJ5A 2BGLA 4B7UA 3KHSA 1E94E 1ZWKA 2WSMA 4G5FA 1JWLA 5LD2C 1A77A 5AOAA 3UTDA 2PGDA 2VS1A 3SI7A 4MNTA 3ND6A 1KA9H 2PVSA 1N5RA 3AEUB 3OY2A 3PENA 4ZKEA 4M6WA 4RESA 2PIAA 3UWDA 3ADCA 2X5XA 1GRQA 3JAKB 3HBJA 2C9DA 3E6AA 3CUKA 1V8BA 3K20A 1MA0A 1JKMA 2DHEA 4RTPA 1GGVA 1NP3A 2WKPA 3LWBA 3HCRA 4LYHA 5A7GA 2JLAA 1TQ2A 3SJ7A 3WGZA 2OV2A 5LQUA 3TYXA 2H52A 3GEEA 1PD1A 3QELA 5BWLA 3R6LA 1EE9A 2FV8A 2VUHB 3AY3A 1VB5A 1VA5A 2BL4A 4ISBA 1D5CA 1VYHA 3VFDA 4EMUA 2Q3FA 1ZUNB 3GB9A 3X1JA 5EMKA 3FF1A 1A9SA 3GNQA 3HGTA 3LCCA 3H5TA 5CW1A 3A05A 4CHTA 4EMBA 3LHDA 1YAHA 1WRBA 3ISJA 2G9QA 4X61A 5IBPA 3VO2A 2ZYRA 4DSNA 7MHTA 4JC0A 1E1LA 2CW5A 3LXXA 3K92A 1CRLA 2YFQA 3UJDA 3PTAA 1YXMA 3IALA 3ZE8A 4YUZA 2PRIA 4P92A 1NVAA 2CHVA 4LE0A 2C58A 1AVTA 1H0RA 1TK2A 2CHFA 2II6A 4UAUA 1HDZA 1N3IA 1L7XA 1M2NA 3W06A 4JDUA 2XTJA 3JARA 1S4MA 4NXNB 1DQZA 3CN7A 4YTEA 2GJ8A 3KJNA 4ZAFA 5EJ6A 2FPRA 2IYSA 4G0NA 3PTLA 1P0FA 3K1AB 4CEHB 1O6CA 1I3OA 3WKDA 2C7RA 3GEHA 2MYPA 1RJ9A 2V5VA 2LW7A 3NVAA 2V55B 3DCNA 3SZGA 2IELA 4ZAZA 2PD3A 1GT91 4FQ5A 3WIOA 2CKDA 4HEJA 2J87A 4UHCA 4TT3A 4LQCA 5HKAA 3WJ7A 1F5NA 2Q46A 3LQKA 4HDRB 4QVKA 1LX7A 4WKGA 2YNMA 3CMMA 3EY9A 4BNHA 2RCNA 2NZWA 2X9LA 2VZEA 4FOOA 1Y48E 4HLCA 3HJRA 1G7SA 3CIOA 2I34A 3C3AA 3ROXA 1UFRA 1I2DA 1Y5LA 2FHPA 3ICCA 4A5SA 1AKEA 4V0RA 2H2FA 4U7FA 3OFVA 4K6HA 1TT7A 2J45A 1XRRA 1VGQA 1RWOA 2HF7A 4H16A 1WF3A 4I6JA 1G8YA 1X2EA 3EXIA 3CONA 3RHZA 3CW2A 4KVFA 1FDVA 4NZYA 4ZT4A 3RUIA 4DWWA 2OV4A 2A9KA 1QDUA 2IFTA 2RI1A 2WJ4A 2J7PD 4ZOEA 1XKQA 5EXPA 5I9LA 2OZLB 2H08A 1G7TA 4TKMA 4ZI2A 1PQPA 3FPJA 3R5KA 4IV0A 4TN5A 1BEEA 2WWHA 2V3CC 4CU5A 2X0JA 3LG2A 5IZCC 3FMIA 4Y7DA 1FVHA 1TIBA 2YOHA 4WGGA 4FDVA 3FLMA 4QYSA 3JZDA 4UD6A 3VR1A 2I3ZA 3EVFA 5LQAA 2KS6A 2R68A 3KT6A 1GFWA 1T15A 4BASA 3CVXA 4YI5A 2BTQB 2OILA 2PX3A 2SNIE 1NA5A 5LP1A 1MLDA 2WUVA 5DULA 1M8FA 2QTCA 2BFMA 1N33B 1HX7A 5ICGA 2IOHA 1A4IA 3L9WA 3BD8A 3FIJA 4HOYA 1PZHA 2XKAA 2HPZA 2O7NA 2P4HX 4C2AA 4V0QA 3FCEA 1AKUA 1O6GA 3QLUA 3TTYA 3GNLA 4MKXA 4G0VA 2HEGA 4FGZA 2QY9A 3VC7A 1NIPA 2JAUA 4COOA 3QEBZ 1IAQA 4YJ3A 1QLHA 3AJAA 2XDAA 4MPDA 3SEFA 1V4VA 2LKCA 4Y9DA 1ETUA 1RYZA 4P5DA 2QSYA 4WL0A 2I4MA 1JEQB 1Y89A 2QG6A 1QZ3A 4IIXA 4KPGA 1CUIA 4U6NA 3W5IA 2VP0A 3WADA 4KUEA 3CKLA 4AJPA 3E1GA 2Z9CA 5F9HA 4GOLD 5G1OA 1P0CA 4FIZA 2FPPB 4KN9S 1RQ2A 5G4KB 4AYTA 3QHAA 3O75A 3TQSA 4F4HA 3G8YA 1VLJA 4O3MA 2HDWA 4DZZA 5KNCA 3IODA 4KIWA 1LK0A 4UDYX 2N1BA 2YR0A 3ONFA 1GRVA 1LV8A 4YAIA 4OI0A 5J9FA 4EKNB 2QTHA 2UYYA 3W5BA 2EQBA 3O4IA 1GN8A 3KD3A 4LY3A 2OXRA 2I1LA 3Q7EA 2C31A 1XQ1A 3KUXA 4MQEB 4XVHA 4X0EA 5F2OA 2QL6A 1SPBS 1SKYB 2EX0A 4NNJA 3V1YA 4MUKA 4AP6A 5M7EA 2ZRBA 3GG9A 3CF6R 3QPCA 4DUGA 5AJWA 4AYWA 1E3DA 2Q9UA 4G56A 1XCMA 3WJ2A 5B3JC 4BNMA 4RJLA 3R0JA 4ENQA 3ZH2A 2D2IA 4ZZ0A 2QBYB 3P96A 3R23A 4U2DA 2CWWA 4KK3A 1PLJA 2I78A 3T3EA 2F8TA 2J9ZB 1BXRB 1YTLA 3T0GA 1F17A 3RSOA 1LZKA 1BWPA 1DIHA 3QXXA 2HIGA 4WCFA 2JCVA 4LVCA 3SFZA 4DR2B 1VG1A 4EOGA 5BV7A 1NC1A 4RE6A 3W9SA 1KIMA 5CBKA 1BKSB 3QIVA 3VR4H 5JRJA 2XUAA 2C9OA 2XUPA 5B5SA 1LRKA 4OL9A 4FGKA 2M6LA 2WTBA 3CEHA 1XF1A 4MEJA 3RIMA 3VOSA 3F9IA 1GTRA 4EHNA 3AVQA 3ZVMA 3O2NA 4EYKA 4V0MA 1DAGA 2O7RA 4PG4A 3RNOA 4HNAB 2NZXA 3AM1A 4AULA 3HYTA 3AL2A 4DPLA 1UOOA 2GAFA 4L6IA 5AI6A 2FX5A 3BHMA 2Q8QA 4Q82A 5D8DA 4ZAVA 2XZTA 1XXLA 1YR1A 3T3HA 4GE0A 1RI2A 3GY0A 3H8SA 1ZZEA 4MKRA 4QU5A 4PNHA 4U8GA 4W7HA 1KI9A 3IT0A 4IL5A 1U8FO 1QGUB 4IFTA 3RF6A 5K3EA 2XNHA 1ZD8A 4JL8A 1G64A 3VHXB 1M6VA 1FTGA 1W1WA 4UKDA 2FSVC 5B6IA 5L53A 2VYQA 1O4VA 2BMAA 1YR7A 3KEQA 1S2OA 2VRBA 1BVHA 1L9KA 3ONWA 4YC7A 1IG3A 4QGGA 3AY7A 3H5OA 2N0SA 4DJTA 4O4LA 2IF0A 3NUQA 2NTJA 1U02A 3GMSA 2QF7A 3QJYA 3GK3A 1ADJA 4IVPA 1BC5A 4RANA 4AKSA 5B12A 1G7RA 3F9CA 3MWDA 4G1BA 4LS3A 2EYQA 3W3ZB 3DB1A 4H4EA 2BM9A 1B8NA 4FEYA 2PWZA 3LC1O 3W90A 1GILA 2J08A 3IT2A 5E6SB 3I9OA 5JG7A 4D56A 3CE6A 3DBHB 1EZZA 1KGDA 1ZLYA 4U4AA 2Q4TA 3FUVA 4OQYA 2GPAA 1JIKA 1P4RA 1UEJA 1ZM3A 2H3HA 3UBTA 3TRHA 3SZOA 4XCVA 1K7SN 1QIJA 3O8LA 3IHKA 4EJMA 1P5RA 3EDQA 1B16A 3JWHA 5KVCA 2I2DA 4BVJA 4RTQA 1M2HA 1Z6XA 2NV0A 3DOCA 4FT2A 1C4KA 1QB7A 1NQXA 2HREA 4IDFA 2GERA 5D7BA 5E8JA 1KWKA 2WABA 3I64A 4NECA 1Z3CA 2FGKA 2Q1UA 4IEEA 3H1PA 4I55B 1E1RD 3IBYA 2RK4A 3BOSA 2QP9X 5JSFA 4Z0TA 2XVXA 3IP7A 4GEKA 1XTBA 4BJ3A 1GTJ1 1XZHA 4MPJA 1K6MA 3ESXA 1ZIDA 1NI5A 3Q8KA 1TYEB 3GOQA 3GLUA 1P1CA 2I2XB 2Q2VA 2KQUA 3G59A 4LKOA 4QDJA 2IITA 1VLQA 2OO5A 3NVMB 3O7WA 3TZLA 4DSTA 1E9EA 2IX9A 1PJ3A 2AFIA 1XEFA 1R5JA 2AQ8A 3JYHA 4DL9A 3W4KA 2QLFA 3LUPA 1DJOA 2FRDC 3Q3IA 2I1QA 3HFRA