2B6HA

Structure of human adp-ribosylation factor 5
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
171
Chain Sequence
RGSLFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 5
publication title Structure of human ADP-ribosylation factor 5
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 57
structure length 171
sequence length 176
ec nomenclature
pdb deposition date 2005-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2b6hA00
4DCTA 1ZINA 3WRXC 1SHKA 4C0JA 1T3HA 2OG2A 1Q12A 3DOFA 421PA 1ODFA 2IEYA 4PTLA 4JVLA 4JLDA 3VR3A 3EPKA 3QXXA 3BB1A 5F2EA 2PMDA 4BPBA 4EQ6A 2QAGB 2FSGA 1ZUNB 1E4YA 1S8FA 3KXLA 1IJFA 3FE2A 4XTCS 1RZ3A 4IVQA 4HDCA 1TAGA 1TPZA 4LZZA 4JL5A 2F43B 3CNNA 4WIAA 2JJ1D 1YZUA 3KL4A 2V1UA 2EVWX 2W58A 3EW9A 2J0SA 4I81A 3S1AA 2XB4A 4R2HA 2WMNB 5C46F 4W9MC 3RVBA 4D2IA 2NMVA 1GG2A 4Q4AB 3KZ1E 5FBLB 4XSGA 3QI2A 2YWFA 4JLBA 4V0NA 4WA7A 3LAWA 1J8MF 5KDDA 4JKIA 3PEYA 3IKJA 4IW3B 5JJKA 4QJ3A 1JJ7A 3NC1C 5G40A 2ATXA 4TLCA 1A2BA 1OYWA 4IEEA 4JL8A 5EXPA 3THOA 2KE5A 4B47A 3CH5A 1U99A 4XWKA 2P3SA 3EWSA 1A1VA 4K81B 3VHLB 2I1QA 1PZNA 2JAQA 1KI7A 4GMXA 2GBLA 1P9NA 2WSSA 3O8CA 2O8EA 2RH5A 1IQPA 3AKCA 2ZS8A 5M04A 1Z06A 2XOKA 5LPNA 3X1ZA 3AKDA 2A7QA 3B9PA 1PV4A 4RD0A 2IHBA 1OYYA 1CR0A 1NRJB 1RRFA 4M1TA 1MRNA 1TNDA 2XJ9A 2PZFA 2WJHA 5HE9A 3SS8A 1E2IA 1DAFA 1T3LA 3P4XA 3GLIE 4B3CA 4KITB 4TYNA 2RCNA 1E96A 2JGNA 1E4VA 1SXJA 2CCJA 1E2MA 4Q19A 3PENA 4NYJR 4NZYA 2BKUA 1G3IA 4TMKA 1ZUIA 3D7MA 4HAXA 3AVUA 2GJSA 5KSOA 1KI6B 3NWJA 1P9RA 3GD7A 2QN6A 3JVVA 4G3XA 3F8TA 1D2EA 3BAFA 4RY2A 4HUQB 4LYJA 1XEWY 4FCWA 5TVKA 4AWXA 3AF4A 2YOHA 3NIBA 3THXA 2CDNA 4HAYA 4I1OA 2BWJA 3O8RA 1UFQA 4B74A 4BFSA 4A15A 4MDFA 2XTNA 2FE4A 2IS1A 3LLUA 2YC4C 4NKRA 2GEUA 1TL7C 3CNLA 1XJ0A 2OT3B 4F4CA 3AP1A 4OI1A 1Z63A 4TSFA 4HYYA 1KMHB 5EP4A 1DELA 2VTKA 3KQUA 1WB9A 4RCZA 2REXB 5FOTA 2J0QA 2XXAA 3FHTA 1E2DA 4LCBA 2O8FB 4EPWA 2WKQA 4CGZA 3I8XA 4QKQA 5FR2A 1OB5A 2ZI3A 2C96A 2ZI7A 4IEIA 1FX0A 4NYMR 3W9YA 2CK3D 2C77A 1EWQA 4Z51A 4EFMA 4M1YA 1RJ9B 1RFLA 4GZMA 4TZ6A 4M21A 4TQAA 1FPMA 2ORIA 2V7QD 4JT2A 4TTQA 1SVOA 3QXSA 2G0NA 1T5LA 3Q85A 4GP6A 1ZM4A 4D80A 3CONA 2G6BA 2BC9A 4NHOA 4BFVA 4HZIA 4N0DA 4UNNA 3A4MA 1AGRA 3ZQJA 3QENA 4D0GA 2O8BB 2AXPA 1G41A 5JHHB 4E07A 1HT2E 1OFHA 1U98A 4JSTA 1XD2A 3AM1A 2IYSA 1D6JA 1KO5A 4Q7KA 3GEHA 1E1QA 2MSDB 1GP2A 3FOZA 2L0XA 4LOAA 3E70C 4FIDA 4QGGA 4MKHA 2NO0A 3LBNA 5BN3A 2G1JA 1Z22A 2BV3A 1NY6A 2I1VB 1JXMA 2PLFA 3GCGA 1TQ4A 5UKDA 3TW8B 4B2LA 5A0FA 4KFUA 2QTHA 2GEDA 3A36A 5AUNB 2VPPA 1Q57A 3ICEA 3FPAA 5HE8A 1M7BA 2JATA 1W44A 5FOWA 5JSZB 1ZU4A 4Q47A 2C04A 4G01B 5TV2A 1RW4A 4Q1BA 2B92A 2H1LA 3QXHA 3D3QA 4BFXA 2FFAA 3U3RA 4EJSA 3DKPA 3SFZA 2O0JA 4Q1EA 4G5OA 4TT3D 1KAOA 4DLTA 1D2MA 4P4SA 3V9PA 1G4UR 2D2EA 1FZQA 1GAJA 4C3ZA 4C7OA 2F9MA 2FFBA 1AZSC 4DC9A 2FNAA 2F1IA 3GLGB 1B23P 2OCPA 3WYFA 1NSFA 3ADKA 2D7CA 1G17A 3H84A 5DSZA 1FW6A 1VG1A 4LYFA 2HF8A 5FL3A 5FTNA 4Y0AA 1NBMD 2F1JA 2DY1A 1P61B 3QQ5A 3R8CA 1U2RA 3V4FA 1PLJA 3AGPA 5AWFC 1F3OA 4ACAA 1KTVA 4M9ZA 1IN7A 4UJ5A 1WCV1 1S4QA 1ZC3A 2IL1A 1CR1A 4LRWA 4BUJA 1QF9A 4A82A 1FFHA 4H1UA 5HCNA 3KB1A 3AQ4A 4DLRA 1RPZA 4PZZA 1GOTA 2V55B 2XSZA 5LB4A 5CITA 1WDTA 2C5LA 1Q1ZA 1VTKA 2YWGA 2D4HA 4B35A 4FMCB 1E9RA 4YMTA 2HUPA 1XEXA 1G1MA 2YWEA 3GP8A 3N2IA 1EXMA 2QMUA 4Q7LA 3Q7QA 4BLQA 1T0JB 1NY5A 3KKOA 1N0UA 2X1VA 4FMBB 1OH8A 1A2KC 1HV8A 2JLRA 5L3QA 3NEYA 2ZAOA 1NVWQ 3LBHA 3C5CA 4BE7B 2VLIA 5KNCA 5CM8B 3K0SA 3R7WB 2XAUA 3EIEA 3R8FA 4WXRA 2ODWA 1I4TD 3GFTA 3DMNA 1UDWA 2QY9A 2ZI5A 4S35A 2ZUCA 4C0BA 2GCNA 2WAXA 4IDOA 5AUOB 2CJWA 4DLUA 1W48A 3MWKA 3MWYW 1EK0A 1QHHA 5BXQC 1IBRA 3VX4A 3FWYA 3LX5A 1JB1A 3PUZA 5L3RA 1EESA 4A92A 4HUTA 2ZRBA 3SYNA 1NN3A 1P7CA 3O8DA 4M1KA 3SU8A 1YU9A 1D2NA 2CHVA 1OIWA 1LY1A 1QRAA 2P2LA 4HB4A 2P6UA 2F9LA 3QUSA 3AF2A 1EFRD 3MAAC 3CM0A 3CWZA 3PUYA 4LHWA 1DG3A 5ANRB 1PUJA 3M4YA 4IDNA 3K0CA 4HLDA 4CYMA 2IEZA 2UKDA 3TQCA 4R7ZA 1P2SA 3B1WA 4A1FA 5K8UA 5FPYA 3SJBA 5JFGA 1LW7A 5FL7D 1UBEA 4DZZA 3L8YA 4MRNA 3SZRA 4M9XA 4HSEA 1ZMXA 3LXRA 1HURA 1G5PA 5EE9A 1SQ5A 2CXXA 3LVQE 3AVXA 2OILA 4B75A 5SZIA 2NQ2C 5AJWA 3RABA 3ZIAD 4A6PA 3WNDA 1MABA 4YDHB 1NN0A 3EPLA 4PPQA 3QE0A 4O2LA 2C9OA 2RGAA 2QUZA 3KKQA 4LJ5A 3UMRA 3WYGA 3GJ7A 2PEZA 2VH5R 2IA5A 5J4VA 1AIPA 1ZM9A 4JT4A 2BM0A 4M1MA 1E2HA 3MG9A 1DBSA 2QL6A 2WJGA 2ATVA 2JDIA 2Z6VA 3BC1A 4GPTA 4ZPXA 2YOFA 3K9NA 4JLMA 4ZCMA 2CE2X 2GDJA 4FXPA 1HE8B 2QORA 1Z0DA 2CEAA 3K0FA 3NG1A 2F6RA 4QJ5A 1Z28A 3LWNA 4L8GA 4C0SA 1JPJA 2QBYB 2O0HA 3BFKA 1Z0JA 3BH0A 1E94E 1KJWA 4IJMA 3VR5A 4RCYA 2OBLA 5JECA 3VNVA 2H7VA 4QXAA 4JLJA 3AUYA 5G3ZA 2WSMA 4KO8A 1NKTA 1M7HA 3RSLA 5TXGA 1CR2A 1G4AE 1E79D 5HZHA 5TMPA 3CPEA 1W0KD 2P6RA 1XCGB 3FFAA 2G77B 1Z08A 5G41A 3ICQB 1R5NA 3UPUA 4PSKA 3RS7A 2ZSBA 4TLDA 2P67A 1XMSA 2AHOA 5JI3E 1V5WA 3T06B 2BBSA 1N6OA 4GI7A 5D3MA 1CULC 1W47A 2Q21A 5KO2A 4CEIA 2Z83A 4TMVA 1TTTA 1DAEA 2ORWA 5E7JA 1KSGA 1XD9A 2H92A 3A1WA 3OEED 3GLHB 3NBXX 5DYGA 3TGPA 4WOPA 2HV8A 1N5JA 1T8UA 1E2JA 5CDFE 4K8OA 1E1RA 3GEEA 2RAPA 1XCPA 4JLPA 3EIHA 2RGBA 3RWOA 2VF7A 4BGDA 1GDDA 4M1WA 2WMOB 3I72A 5CYPA 5FPSA 2VRWA 3SJZA 1F2UB 3M0EA 2O8DA 3GQBA 3AVPA 2QI9C 1P62B 2GETA 1WE2A 1JR3E 2VSFA 3T12A 3NXSA 3Q72A 3FGNA 4QNRA 1XX6A 3IIKA 3GJ3A 4EAQA 1MO6A 1QHXA 1KDTA 4YMSA 5IK2A 1KK3A 4Q01A 2AXNA 4MQBA 2D2FA 4R71A 2HLDA 2AL7A 1IXRC 1XB2A 1NIPA 1SKQA 3ND8A 3OIUA 2ZJBA 3OFND 4L4UA 4M53A 4I99A 2ZYTX 1YKSA 2ZRKA 4YONB 4TWZA 2FEOA 1M7GA 3NHAA 4G5QA 3SC3A 2GZAA 4KV9A 1KKLA 4KBFA 4P4UA 2J5XA 3OAAA 4PSAA 3CF2A 2WOOA 3SJAA 4OYHA 5EXSA 4ZV4A 5GADl 3FB4A 2HJVA 2RHMA 5BYKA 4D4MA 5KTYA 1M8PA 2RHDA 1G5TA 5JWOA 2FDCA 5J4HA 4PZLA 4OQFA 4EFNA 3NHBA 4JBYA 4ESVA 4ZDIA 1R0ZA 3VAAA 4MGKR 4TYWA 2ZIAA 1OPXA 4LJYA 1CF4A 3KX2A 3PG5A 5FUVA 4YXWD 2J1LA 1W5TA 3CX8A 3LDAA 1KK1A 5FBWB 2GXQA 5J47A 2IK8A 4HZUB 4JSYA 3QXJA 2OAP1 4KU4A 2YVUA 1E32A 4OK6A 2GHIA 1BO6A 1UPTA 3GFPA 1Z5ZA 1UEIA 2QENA 4HUQA 1G64A 2J0UA 3RS0A 3WY9A 4FWTA 1TEXA 3ZD6A 1II0A 2ZR9A 4MYCA 1UBGA 2YWHA 2RMKA 3HR8A 4XSHA 4Q21A 3Q5EA 1OXVA 2HCBA 2F55A 2D06A 3NDPA 3IIMA 3VR2A 5CB8A 4B3GA 1B0UA 2V9PA 2WWGA 3QKUA 4CRWB 4MKIA 3E2IA 1S2MA 4ASUD 1W4CA 3NH9A 2W0SA 1KAGA 4PQFA 2ZRLA 4M8NE 1DOAA 2R44A 3VTKA 5KNDA 4JLKA 5JRJA 3AUXA 1AQYA 4PC6A 1VCNA 1XWIA 1XXHE 2FWRA 1E9SA 1ELOA 3GJXC 3ZQ6A 1G6HA 3ASZA 1EGAA 3L8ZA 3VMFA 2AWNA 1GKUB 2EWVA 2XEXA 1G16A 821PA 2AX4A 4Z1MD 4LJ6A 4Q7MB 1JI0A 2DWOA 4QBGB 2YV5A 3DKVA 1G3RA 2AK3A 4C30A 2ZR0A 4FCVA 3WP0A 1UF9A 2GXUA 3U61B 4EPYA 2VSOA 1XTIA 4BWYA 4F93B 1C4OA 1I2MA 4TYQA 4MKFA 4PO8A 2ZRCA 1ZNXA 1R5OA 1FOEB 3WBJA 2OLJA 2BMFA 4L9WA 4DSOA 3FHOA 4HAVA 3B82A 2LKCA 1KYIA 4F4JA 1UM8A 1YZQA 2DPXA 2FX3A 1H65A 1R8SA 4Q4JA 4UXJA 4LHVA 1UADA 4HB0A 4NTZA 4Q9LA 1JR6A 1XBTA 3PJRA 1MRSA 1KY3A 1FUKA 3EZ2A 1H8HD 1E9AA 4HLUC 5CYOA 4D26A 3ADDA 1NNEA 4OQMA 2CNWA 1OKKD 1O87A 4NE2A 3O8BA 4KFRA 4LPSA 4JIMA 2WWYA 1XMVA 1XMJA 1OT3A 4C4PA 4WVFA 4JVNA 2ZSDA 3CUEF 1WP9A 4MUAA 2OCYC 1QHSA 3EZ7A 2YYZA 3PUXA 5EXTA 3UMSA 4D6PA 5KPJA 3BJIC 3W34A 1AK2A 1ZNYA 2ZU0C 3RC3A 4OKSA 3OE7D 2Q6TA 2WKRA 3K9HA 2RGDA 1F60A 2QROA 3AF3A 2HF9A 1G21E 3K0AB 4YC7A 1E9EA 1SVLA 1Z6YA 4RFSB 4GZLA 1K6MA 1YJ5A 4WZBE 5H1YA 1SULA 1CR4A 3THYA 4BFZA 5JMTA 2VO1A 2GKSA 5EXXA 3OZXA 4HI0E 1XPRA 2KJQA 1ZD9A 2IYTA 3MFYA 3CRRA 5KU1A 3V4RA 3OESA 1UKVY 4UKDA 4AG5A 1HTWA 2G1KA 2JASA 1C9KA 1JALA 4QC2A 3W6NA 1Q1QA 1VG8A 3DDCA 2HEIA 1N5IA 1DVRA 4LJ7A 1Q3TA 4MRVA 5BN4A 3K53A 1G7TA 2EFDB 4PPGA 1J70A 2J9RA 3EWAA 5B30A 4G5SA 1AJEA 1BS1A 1OFTA 4AKGA 3KQKA 4LJ4A 1IN6A 2WV9A 3AVWA 1OHHA 3EASA 3IUYA 2WHXA 2FEMA 2QPAA 3EZ9A 2MSEB 5JCPA 1A7JA 4GT1A 2W6JA 1PLLA 3ZYCA 1G291 1XNJA 2DBYA 4RD3A 3QF4B 1WQ1R 3QVUA 2YKGA 3VQTA 3UG6A 5DI9A 4MYHA 3W6OA 1R6BX 4A4DA 2IUUA 2IYWA 1J90A 3KKNA 4AYWA 4BEJA 3U6BA 3SQWA 2WZQA 1N25A 1E99A 1Z6GA 2RGGA 3CBQA 4W5WA 3CZQA 4Q4LA 5C18A 2J41A 1Y3AA 2PJZA 4DUGA 4CT4B 2NGRA 2B7CA 2XGJA 5KHOC 4I1UA 1I4DD 1NMYA 4QBFA 1NJGA 1IONA 3AV0B 2CMKA 2PT5A 1GRQA 4DLVA 1J8YF 1E98A 2GVZC 3ZZTA 1Q0UA 1XU4A 3B85A 1MO5A 1XJCA 4HATA 4NCNA 2IYXA 3T1VA 5J4KA 3TIFA 5H70A 1VHLA 3BBPA 5BWMA 2ECKA 5EE0A 221PA 1II9A 4B34A 4CEHA 4CVNA 4LBYA 5TB5A 2E9SA 2ZXUA 2DFNA 1H8ED 3D31A 3WBKA 2FH5B 4CF7A 1J7KA 2YNMA 3LH5A 1VIAA 4MA4A 2XZPA 1RRCA 4PPNA 1YE8A 1II8B 5E3HA 3U4QA 2X19A 5LD2C 4PFSA 5KSZA 2BOVA 3CO5A 4NBSA 1YZGA 5CK4A 2QE7D 4UXIA 1AKEA 4B6EA 3U44A 5KSYA 2O5VA 1KOFA 4TMTA 4PO9A 2Q0HA 2ZRAA 4L16A 4PAOA 2OLKA 2WAYA 3BB4A 3ZZ0A 3K09A 4GFDA 2JLQA 5SZJA 2ZJYA 1ZU5A 3FKSA 4UNPA 8OHMA 1BMFA 2EFEB 2ZTSA 1XDBA 3CPHA 4B2PA 2QBYA 4CEJA 1DO2A 3GJ0A 5FUYA 5TARA 5AJXA 3B2EA 2BMEA 3OHMA 1KDRA 4XWAA 4A8JC 3IGFA 1RC8A 3LO5A 2R2AA 2W83A 4U00A 1FMLA 1S96A 5E95A 3AKYA 5AJZA 3QPWA 4QGFA 2NTYC 4UJ3A 2GA8A 4PHHA 5EE5B 3IHWA 2GZHA 3C5HA 4I4LA 1JEEA 5JRZA 1COWD 1E3MA 4YMVA 5K8IA 1XMIA 1OFIA 5J5CA 2BJVA 1HYQA 1ZNZA 1KI8A 4UNSA 5AR1A 4ZI2A 1E9CA 1LF0A 5TY0A 2ZUBA 2JLZA 2B7BA 2W6IA 3T1QA 3DZDA 3AP2A 2IC5A 3OEHD 1XTKA 2IUTA 2WWIA 3HJNA 1KNQA 2QG6A 2FN4A 4QL3A 1QBKC 2HT6A 4LY6A 2Q3HA 3W8NA 1D8TA 1XPOA 2WJVA 1TADA 1GKYA 1CLUA 1JAHA 1SVSA 1Z47A 2RB4A 3P27A 4JBXA 4MGIR 5DO9A 4ZIRA 1GNPA 3BOSA 3U7GA 3L0SA 4ARZA 2XX3A 5FI1B 2EYUA 2GK6A 3X1YA 2QMOA 2FPMA 2OHFA 2P5SA 4OK3A 3EZ6A 3PQCA 1GUAA 1P9WA 4A0HA 3QNUA 3KQLA 2QPOA 3PITA 6Q21A 4QM7A 4GDFA 1GZSA 2ZSAA 4BECA 1R0YA 1K8RA 4D81A 1GRNA 3OF5A 5L3SB 3KXIA 4GSYA 1IY0A 3L43A 5FBQB 3VHXA 1NVVR 3FHCB 4A2WA 3H2YA 1F2UA 4HAWA 3RS5A 1RKBA 4KI0A 1MV5A 2JJ2A 4MRSA 2IX3A 3EPHA 3BE4A 3HP1A 4NMMA 2ZRIA 1KK0A 3EARA 5AUQA 4LI0A 5P21A 4KCGA 5HCIA 1JAIA 3U60B 4OQNA 2I3BA 4DRZA 5FH9A 2XNDD 4RZXA 2C9YA 5KOYA 2O8CB 5JJLA 1BYUA 3LFUA 5GVRA 3SBEA 5DI3A 3FTQA 4WXPA 1Q3HA 2JIZA 5DHFA 5DYIA 5CDFA 1DPFA 1GL6A 1KSJA 3TUJC 1TQDA 2IF0A 1E2LA 1QHYA 3GLGE 4B3BA 1R2QA 2KB0A 3FKQA 4AD8A 2Y8EA 3PR1A 4Q5IA 2IW3A 3T35A 2OFWA 1AN0A 3QKRB 3BD9A 3EA0A 1YQTA 4HLQB 4JS0A 4KSCA 2GF0A 1OE0A 3CZPA 4X8MA 1EFTA 2G9NA 4DT1B 1KK2A 3I5YA 3R9WA 1JR3A 4DIDA 1YZLA 2UVQA 4PC3A 2ZI9A 4LDJA 4LYAA 1EG7A 1X86B 2BEJA 2ZRMA 4PSVA 1TF5A 5FPTA 3ZS9A 4DCVA 2EW1A 4DSTA 1CJUC 2N46A 3TKLA 4F92B 3W90A 4NH0A 1WF3A 1NN1A 3QIAA 3IILA 4DDWA 1X6VA 1JQJC 1SHZA 3WP1B 3QOFA 2GCOA 4RD2A 3U6KA 1TEVA 2HDNB 1SKYB 2GWHA 1OH7A 2EYQA 2O8BA 1NMXA 4HZUA 4V0LA 4YQFA 1JBKA 2IYRA 1RRGA 3BXZA 5DHAA 2ZYWX 3UWKA 3IPXA 3BGWA 4Q18A 3NBZC 3R9XA 5F9FA 1EWRA 1W4RA 3IQXA 2FA9A 4D4LA 1G6OA 2GJ9A 1FTNA 5CLLA 2HXSA 5LB2A 4BRUA 2R62A 5DIFA 2ZE5A 3I1FA 1KMQA 2IXGA 4P0TA 4V0ME 2W2VA 1HQCA 2ZRDA 1IM2A 3EG5A 1MR3F 3I61A 1CJMA 4IDPA 3ONWA 3JZAA 3UWOA 5E7MA 3SR0A 2VP4A 3G5UA 3MLEA 4IDQA 3SI7A 4FI3C 2P65A 3BERA 3ZGXA 2PX0A 1NVVQ 1T91A 4MGZR 2WSSD 2IYVA 3MJRA 3K0EA 3PCRB 2HYIC 1GSIA 5JLJA 2XOKD 5A4JA 4TZ0A 4V03A 2FFQA 3VR6A 1G7RA 5B2ZA 4FN5A 1XRJA 2FU5C 2AD1A 2NIPA 3L0IB 2I4IA 3TH5A 1N3BA 3PUWA 1E9BA 1F48A 1OV4A 2ZRPA 2BMJA 3N5CA 4R98A 2BBOA 5H68A 3FYHA 2WJYA 4O25A 1SXJD 4IOLA 3A4NA 2FV8A 2ZITA 3PEVA 1OSNA 4KSBA 4QHSA 5CIQA 3LXXA 1Z3IX 2OCBA 1ESMA 4C9BA 2ODNA 4A9AA 2J7KA 5FPHA 2OEPA 3IO5A 1BIFA 1KJYA 1XXHA 1SVKA 4TMZA 1NBME 5HTKA 4ERNA 1CS4C 2QZ4A 4DHEA 2EU8A 3ZVNA 3RS2A 3W3AA 1G3MA 2NO7A 2OAQ1 3TSZA 3X1XA 3GJ5A 5FTLA 3KUCA 4TSFD 1IOZA 1OXTA 5FTMA 3U2QA 3LW7A 1TQ2A 3B13B 2QP9X 2WJIA 1GIAA 4FMDF 1S9DA 2NO9A 1KIMA 1OIVA 4NCKA 3NTUA 5L8VA 5JCZA 3NVAA 5TDHA 5EZ5A 2BBWA 1DADA 4LX0A 5K8LA 2YC2C 1KO4A 3K0CC 2HJGA 4XVQA 2R6AA 4Y0VA 2C98A 1E2QA 5DH9A 3EC1A 3LY5A 4EPTA 4NPHA 3R20A 3CIOA 4GOKA 4M4SA 1Z8FA 4QM6A 2J7PA 1J2JA 4B71A 5LD2B 4U02A 3I92A 2PCJA 2A5DA 5GJWC 3SBDA 3GEIA 4XVRA 3MMPA 3K0AA 2ZRNA 1KI1A 4RFSA 1VCIA 4EIWA 3QXCA 3VR4A 4OI4A 4DCUA 2YOGA 5B64A 2H8KA 4IHQA 3RHFA 1O3YA 4B6FA 5F3WB 3QF7A 3MJHA 2CHQA 1YVDA 1NN5A 2R6DA 1E1QD 4OI2A 3WNBA 3GLHE 1US8A 3P4YA 4D82A 2WPDA 1ZYUA 4O0MA 1FUUA 1G3UA 4LPKA 1G7SA 3ZVMA 1AM4D 4RD4A 2BKEA 2HT1A 1JEDA 4OJQA 1PVOA 2IHYA 3BRWD 4A8JB 3GJ8A 4N3NA 1DAIA 2A5FA 4W7SA 4DIEA 1BKDR 1GNQA 3QKSA 1CJVC 1UDXA 3SYKA 1A4RA 2JCSA 3QG1A 4Q48A 4AC9A 1W2HA 3WMGA 721PA 3CWQA 3LNCA 3RLFA 1HEIA 1G19A 4ZDWA 2J87A 5FFMA 2X2EA 2F3TA 3CW2A 4DLYA 2VIIA 1N6NA 2OXRA 2HXYA 4KLZA 1P73A 4WBSA 1E0AA 2GJKA 1NLFA 2R6CA 4MKGA 4DCSA 2ZSEA 1IXSB 1W0JA 5BN5A 3THXB 1SZPA 2B8WA 3IQWA 5EQTA 1QHIA 1UKEA 2FSHA 1T9HA 4B32A 1GITA 1VPLA 2PCLA 1DE0A 1G3QA 1QVRA 3DHWC 2OE2A 4TLBA 4XD7A 2VQSA 4NONA 1U9IA 1W4BA 2QAGA 1YZTA 3B1YA 4MRPA 1NF3A 3ASYA 4KHZA 1V43A 4A2QA 1P2VA 4IXMA 2XXAB 1U0HC 4W5JA 2F43A 2NPIA 1KZGB 2RKOA 2NPFA 2QQ0A 5CM9C 2FF7A 2CL0X 3OIVA 3RRYA 5IDVA 1P4SA 4BASA 1G18A 2Q9CA 3QEJA 2GAOA 4CT5A 1NP6A 2QM8A 1MKYA 3MUFA 4NCIA 2XSZD 4Q4AA 1FQJA 4UNQA 4OQXA 1DAMA 3VNUA 4B2IA 3DEFA 4JYBA 2TMKA 3I5XA 3I8SA 4ZO4A 2LWIA 1R0WA 2WJJA 2EFGA 3NC0C 3I62A 3PXGA 1CKEA 4HB2A 4BFWA 3Q3JB 2ZM5A 1IY1A 1HUQA 3CRMA 1ETUA 3W6PA 2J0VA 1U90A 2G3YA 1VDZA 4M0LA 3GLFB 4Q9IA 4XIGS 3TJZA 1HH4A 4BLRA 4E22A 2BEKA 5HKKA 2ZVPX 1P2TA 1CJTC 1NMZA 1XD2B 4JMPA 1LTQA 4OHZA 3AVVA 4Q9JA 3LQRA 2R65A 4BLOA 1M74A 3B6EA 2KBEA 4X8LA 4D0LB 4ZCLA 3LLMA 1GKIA 1IXZA 4PHFA 4XH9B 1W2GA 1E6CA 3C15C 1AGPA 4DDUA 5L3VA 2WOJA 5DN6A 2OZEA 1AZTA 1TUEA 2IBMA 3N70A 3HU1A 3TQFA 1E2KA 1GL7A 4QGHA 2W2XA 4II7A 4AKEA 3E1SA 1KI6A 1GWNA 1VG9B 2REBA 4C0QC 3DPUA 3THWB 3M6AA 5CB6A 1G5RA 1M1YE 4G5GA 1FNMA 1KJZA 3A1UA 4M2LA 2WKPA 4KODA 1P75A 3NH6A 3FMIA 5JHGB 4NU0A 1E9FA 4K46A 1N2CE 5C2JB 1U0JA 5GJCA 4P4SB 4L15A 2ASEA 3I73A 3B9QA 2V4ZA 1KMHA 2NO1A 2OM2A 4WW0A 2AFIE 4D25A 4HDOB 2VL7A 2ZRJA 1QZXA 3X2SA 3KB2A 1Q21A 2O8FA 5FOXA 1DO0A 2J7PD 4ZKEA 3U3KA 1ZD1A 3IIJA 2BIFA 4JVMA 5FOVA 2IYUA 4O2RA 1S1CA 3PVSA 5BW8A 1T8TA 5JEDA 2JLWA 4JLNA 5J4LA 2JDID 2REOA 1KI2A 1NJFA 1RJ9A 2JJ1A 5FTJA 4AK9A 1CU1A 3TE6A 3KTAB 3AVYA 1P6XA 3AGQA 1CRQA 3RRZA 4S2EA 4NCJA 1P3JA 2HCJB 1N6HA 3Q8XB 621PA 4RZUA 5FUXA 5E7IA 1ZM3A 2GJAA 1M34E 4B48A 4TLEA 4LK2A 2A5GA 3WHKA 1RIFA 1R5BA 1SVWA 5HR5A 1TF2A 4OHXA 2W0MA 4CIDA 3TUZC 1HE1C 2A3RA 4FCTA 4QRHA 1VYUA 2YZ2A 3HYRA 4BZXA 2H57A 2CCKA 1XTQA 4P32A 4IFEA 2FGKA 1Q44A 5L3QB 5AJYA 2FG5A 4DSNA 5DGXA 2VYFA 4LHZA 2GTPA 4AYTA 1I2DA 2QMHA 4Q1AA 1W49A 2ZE8A 4C0AC 2ZS9A 4PHTA 1T6NA 2BBTA 1VMAA 3IPYA 4G1UC 2R8RA 3I3SR 4EDHA 2WICA 3QPUA 2IF2A 2QNRA 4DT1A 2CJWB 3L0PA 2ZS7A 3B60A 4HLUA 1Z0FA 5KSPA 3SOPA 2GEVA 3L82B 5G53C 3VX3A 5JSZA 2D3WA 3U3OA 1EX6A 3UATA 4BLPA 4BLSA 4M1OA 3GMTA 3AKEA 3SJCA 2C2HA 1E1RD 1VG0B 1NVXQ 2DB3A 4HB3A 4KYUA 1L2TA 2ZYVX 4M9SA 1U81A 4B44A 1YR7A 4BZQA 2O0KA 5IHPA 2RGNC 2ZJ5A 3A4LA 4Q66C 2CVHA 4DXAA 2E87A 4URYR 1VYTA 4F7WA 3GLGA 1XFAA 4R9UC 1R8QA 2VP9A 4JJKA 2BCJQ 5JJIA 1NG1A 1R10A 1SGWA 3BFXA 1BOFA 2V8OA 4GRAA 1N6PA 2BCGY 5IK2D 2QMEA 4NL4H 1QHNA 2ZPTX 1MABB 4LSGA 2HLDD 4LJ8A 1E2EA 1LV7A 2IUSA 3ZLJA 1ZP6A 4Q9HA 2CBZA 2V1XA 3PUVA 4MYTA 1AA9A 5G3YA 4QBIA 1ANKA 1KI4A 2O52A 2ZJZA 2GF9A 3LA6A 5EJEA 2JLXA 4I1SA 4TL8A 2CK3A 1ESNA 1F6BA 1VYVA 3GFOA 2ZAMA 2JLUA 1ZCAA 3OAAD 4F38A 1OF1A 3ND9A 4P33A 1NKSA 2V7QA 1OW3B 521PA 5JS7A 3TR0A 3EIQA 3G0HA 4LHYA 4BFUA 4MRRA 3A37A 4GOXA 3C16C 5C4MA 3CF0A 4LBZA 4KJZA 5IRCD 1EX7A 3MRSA 4Z54A 2AFHE 2WWHA 3T1OA 3SEAA 1X1RA 1GM5A 1YR9A 1YHNA 3R7WA 4GBMA 1E0JA 1HT1E 4E03A 4MITA 2GJ8A 4V0MA 3FMPB 1E0KA 4GP7A 1L7VC 2BM1A 3LQQA 2ANBA 4QBHA 4TQ9A 5CJPA 1P5ZB 2DHRA 1JPNA 4MDEA 1N6LA 2QSYA 1AS0A 4DKXA 5D3MB 3B5JA 1VKJA 4GNKA 4DBLC 1Z6TA 3BB3A 4OL0A 5B57C 5FPKA 4LGMA 2YJTD 2ZE7A 4CEIB 3EA5A 3WRYC 3ZH9B 3WXMA 2GILA 2ERYA 3PEUA 2WIBA 2PZGA 4DWJA 1S3GA 3Q9LA 3QKTA 1Y63A 1ZBDA 1TX4B 2IXFA 3D6TB 3CB4A 1RRPA 5EP1A 1S1MA 1Q22A 3A1VA 4KFSA 2IS4A 3TLXA 4ILEA 1NIJA 4JLVA 5B58C 3AVOA 5J40A 4DLWA 4BRWA 121PA 2J45A 4PC1A 5EUQB 4FD2A 2ZYUX 3CH4B 4TT3A 5FTKA 3ZVRA 2Z0MA 4B3DA 4PO1A 4B33A 1DAGA 2O8DB 2A5JA 4A36A 4NYIQ 4JLOA 1Q20A 3DM9B 1G8PA 2BDTA 2GRJA 1IN8A 5BYJA 3H0KA 1E2FA 3RS3A 1NBMA 3GJ4A 4OHVA 4DVGA 1IAQA 2ZQ5A 3CLVA 1IJEA 1S9HA 1S3SA 1TF7A 2AWOA 1OXXK 4DB2A 1Z2CA 4PZYA 4HAZA 2V6JA 4V02A 2GBLC 3KKPA 2FZLA 3LV8A 1Z29A 4W5HA 3X1DA 2QGNA 4ABYA 1X8LA 3K09C 4AURA 2QAJA 3C8UA 3OIYA 4RD6A 1RE0A 1SVIA 2CL7X 2C8VA 5F9HA 5JI2E 1R7RA 2JLVA 2AD5A 4BEBA 2J3EA 1BYIA 2D7DA 3C14C 2CNWD 2ZRFA 3LD9A 4Q00A 1OFUX 2XTMA 3B1VA 1SXJC 2OFOA 4D4JA 3TW4A 3ZDQA 2XNSA 1Z07A 1VHTA 3DO6A 4A8JA 2CCGA 3KJIA 1PJRA 1VIYA 1Z2AA 1U8ZA 1Z6XA 5C4GB 1P60A 2XB2A 4FWIB 5FOSA 2ZJAA 3F0TA 3ETLA 1OXUA 4F4IA 2QSZA 1FTSA 1GTVA 2K5UA 1D9XA 1DEKA 5EUMA 3W8RA 5IT5A 2JLYA 1GNRA 1KI3A 4PAMA 1HQYE 2V54A 4QJ4A 2QT1A 3EX7C 1E69A 1XEWX 3CRVA 5BQ5A 5HZKA 1NLZA 1LF5A 2AKYA 3GLHA 2J0UB 2OXCA 3SN6A 2A2ZA 4M9QA 1E2NA 2IYLD 3AB3A 5EP3A 1DAHA 4Q4HB 5DE3A 2WWFA 3U7EB 2ZI4A 1Z0IA 3WMEA 1Q1BA 4CDGA 1FP6A 2NG1A 2QQEA 5LBIA 3KKMA 5CJ2A 3BH7A 1EFRA 4C0HA 2KBFA 3Q5DA 2IWRA 4OHYA 4UNRA 2ZR7A 3GLIB 3BS4A 4LUCA 3JZMA 2Q9AA 2PH1A 4WZ6A 4EPVA 1ZRHA 5FL7A 1N0VC 4OHWA 2FMXA 1CTQA 4KVGA 3K70D 3VU9B 3HPQA 3L0OA 3A8TA 2HYDA 3TK1A 2DCUA 1G8GA 4RVCA 3ZIAA 1G8YA 2ONJA 1DTSA 2P0EA 3CX7A 1UKZA 4TMXA 1WBBA 2Q3MA 1E0SA 2ZSFA 2ZJ8A 3IBGA 3U3MA 1ZD8A 3PEWA 1MO4A 2P6NA 4D0NA 1OHHD 1MOZA 1SKYE 2GAAA 4DEYA 4L9SA 4LV6A 3KUDA 4DDTA 5CK5A 4A0FA 1XJQA 4YMWA 1G20E 2W6JD 4Q03A 4URUR 3ADCA 3B78A 4LC1A 2VF8A 4IOKA 3UG7A 1CP2A 2RGCA 3T5DA 1Z6AA 3GLFA 1W1WA 2ONKA 3SDZA 3W5IA 5JWRA 1ONBA 4LBVA 4EFLA 2AK2A 2H5EA 3QVVA 5JS8A 1KNXA 1ZJ6A 1XEFA 1ZCBA 2QP3A 4RD1A 3OIWA 4Q4JB 3EPJA 5EE1A 4DSUA 2QRNA 2WIAA 1EFCA 3VKWA 3LRPA 2EQBA 4HDQB 3HR7A 2A30A 2FSIA 1X3SA 4PXAA 4QG7A 4PAQA 4DUGD 1FP7A 4ZDJA 1E79A 2WWWA 1W0KA 2VBCA 1UAAA 2J59A 3CNOA 2VP6A 4R2IA 1Z0AA 2QU8A 4Q9KA 3TR5A 1CEEA 2ZE6A 4XVUA 4URXR 4DLXA 3KFXA 3SHWA 2IS2A 1TU4A 3IDQA 3CRQA 5SZHB 4EJSC 4OBEA 3THWA 4KVAA 4JL6A 1WRBA 4NYJQ 3QJYA 4JYCA 1W36C 1JXOA 3HWSA 4A0RA 2IT1A 2OFXA 5K8TA 3CPJB 3EXAA 4URZR 4TYPA 3WHLA 3ADBA 1UEJA 1FMJA 1TUIA 3C4JA 1RVDA 3HYTA 2MMCA 3OEEA 3DOEA 3RNLA 3LW8A 4AKIA 3AH8A 4LYHA 3TNFA 1X8KA 4BFTA 4KBGA 2SHKA 4AKHA 1U8AA 4NP6A 1W4AA 2CHGA 1XCMA 3TSOA 1G7CA 4J0QA 3THYB 3QY0A 4ZDKA 4XJXA 4PPFA 1DARA 2ANCA 3T34A 2AR7A 3I4LA 1Q1EA 3SE0A 3H86A 4QFMA 1DS6A 1NL3A 1SVMA 3LVRE 2DFKB 2WBLC 4QHTA 5CLQA 1EFUA 2YINC 1NLYA 4LBWA 1L8QA 3ZS8A 2A5YB 2MSCB 4HLCA 1RYFA 1KY2A 1AQUA 3K70B 1JECA 3KTAA 3FKSD 1YZKA 1BMFD 2CVFA 2FJUA 1KZ7B 4NYMQ 2Z4SA 3VKGA 1DAKA 2VSXA 3AEZA 3MCAA 2LKDA 3OFNA 3F3YA 1YZNA 1KSFX 3NDBB 1ZM7A 4DJTA 4Q1CA 2R6FA 1FL9A 5C1BA 3TAUA 5FI0B 5ELXA 2A78A 1F2TB 1OIXA 2V3CC 1YRAA 5F98A 4FMDB 2KSQA 2N1BA 2F7SA 2ORVA 1QVAA 3AF0A 1OLOA 2PJRA 2XZOA 3B1ZA 4ESHA 4IFBA 4EUNA 4MH0R 3I32A 3AVQA 1N0WA 2ERXA 4B3XA 4ZCIA 5JWHA 3U7HB 4FMCF 2E1RA 4IRUB 2W6ID 4QHYA 2QA5A 2RGXA 1GRRA 3GPLA 2PBRA 1UBFA 5GJBA 4OJKA 4TQUS 1PUIA 2Q9BA 2OBMA 2GXSA 3MGCA 4Q7JB 1IHUA 4BZPA 1OXSC 5KNBA 4DDVA 1T0HB 1JNYA 2QPTA 1QDEA 3KXKA 1YR8A 2AN9A 3D8BA 1IN4A 3M1IA 4MUBA 3TVTA 1ZVQA 4QOSA 4EQ6B 2JA1A 1NI3A 1NVUQ 2XTZA 4M22A 1LFDB 3H1TA 3A58B 4YXWA 3U7FB 3U3JA 3NKVA 1CRPA 1KO7A 3RRMA 2WM9B 4QNMA 4XWOA 1Z83A 3K8YA 4CEHB 3S1AB 3CKLA 3VR1A 4G0NA 5JBQA 4RSGA 3VKHA 4LC0A 3KJHA 1KI9A 1KDPA 2C99A 2CLDX 2JJ2D 4CW7A 3QSYA 2OCAA 2QT0A 1SXJE 4TL9A 5A5GA 5HPYB 3U4QB 3EC2A 3HU2A 2QTVB 4EPXA 4YLGA 4LJ9A 1XF9A 4EPRA 4DEXA 3TUIC 4MGYR 4C0LA 5FUWA 2ZUDA 1T4GA 2OSBA 3TBKA 3WMFA 4ASUA 4L5BA 4DLSA 2VHUA 4IVPA 3E5HA 3QPVA 3U44B 3FDIA 4TLAA 1QG2A 4OI0A 2C03A 2B6HA 2JIZD 2IS6A 1TU3A 4IVRA 2O8EB 3CX6A 1CXZA 1KSHA 1LB1B 4U5XA 4TN1A 1W46A 2VP2A 4LHXA 4KAXA 4M1SA 3RYTC 4NCHA 3UKDA 1TMKA 4Z1MA 3NBYC 3W5JA 3J81k 2CL6X 1WMSA 3H4MA 4XOIA 3FMFA 3RSOA 3SYLA 3IEVA 5GVSA 4CEJB 1JR3D 4EKDA 1SXJB 1E2GA 2IWHA 3QEOA 3BIFA 2UZ3A 3LX8A 2Z43A 3UIEA 4PC7A 3U5ZB 3FFBA 3QF4A 1W5SA 4Z8XA 2XZLA 2UZIR 3K9LA 2VHJA 4PC2A 1YRBA 3CR8A 2GESA 1XPUA 1ZM2A 1CBUA 1N6IA 4RKFA 1W36D 3TSWA 3T1TA 1XZQA 4POAA 4GMDA 4KYIB 2X2FA 4PANA 4YDSA 2PZEA 1H8HA 2VEDA 1D5CA 1T3SA 1HY3A 4TL6A 3GJ6A 1OKKA 2ZREA 3FMOB 3JVUA 2ZRGA 3O47A 2VHQA 2WWXA 2WVJA 4PHGA 4WZAE 3GLFE 1KHTA 1ZIOA 1P72A 2P5TB 3DVLA 3RDPA 5EE3A 1L4UA 2FFHA 1WA5A 4A0GA 1I4LD 1R0XA 4OQLA 4GOJA 4ZIRB 2QRZA 1G8HA 4ARZB 1U9IC 3F5FA 2QAGC 2CLSA 2MMGA 3RANA 4B43A 4IXNA 3REGA 2ODEA 3BORA 3LBIA 4ZKDA 3B8HA 4D4KA 1FX0B 3CF6R 2FPLA 4OK5A 1ZIPA 1UKYA 2R9VA 3NEJA 3QBVA 4URWR 1E2PA 1LS6A 3OE7A 3K1JA 2PL3A 2B21A 4IKEA 1N6KA 2Z5FA 4JJZA 5KDLA 2JLSA 4TMWA 1WBDA 1II8A 2DFTA 1XTJA 3MSXA 3MWLA 4JLAA 1ZW6A 4WAUA 2F1HA 4IOMA 1N6RA 2DWQA 2XITA 5GJVC 3QG5A 2RGEA 4N0EA 4RJLA 4F91B 1U8YA 2GCPA 2DFLA 2DWPA 3UK6A 2EFCB 2Z4RA 4I1VA 1OH5A 3RWMB 5FBVB 4KXFB 4CZ2A 4ACBA 2ZU6A 3BFVA 2G88A 3HDTA 1KO8A 2FSFA 2ZVQX 2DR3A 3L2OB 3WNCA 4DLZA 4US1R 2ZJ2A 1T5IA 2AKAB 5DI3B 4XTRA 3SQXA 1DG1G 2PMKA 2R6GA 1ZAKA 3ZZUA 2ZI6A 3KFVA 3RS4A 1GFIA 3ECCA 3X1WA 4URVR 3AF1A 5KPDA 4QGAA 4BLTA 5DISB 2PX3A 1A82A 2VP0A 1N5LA 3B1XA 3DL0A 4KLNA 2GXAA 3T15A 3SNHA 4Q02A 1QG4A 5FOUA 1N5KA 1XZPA 4TTPA 2FZ4A 3Q7PA 3W3ZB 1A5TA 2C95A 5AK0A 2NOAA 4EJSB 3IBYA 4FINA 5KUTA 2JJ8A 2G0TA 2GCOB 5J4YA 1W36B 3T5GA 3UMFA 2VP5A 2XJ4A 5E4FA 4C7OB 1UJ2A 3N2EA 4B73A 2F1RA 4E09A 1OJLA 2D74A 4KFTA 4X8OA 3PIRA 5LDDC 3RC8A 1IY2A 3ZJYA 3VFDA 4PR0A 1EFHA 1GILA 4GL2A 1AS3A 3UANA 4Q4HA 1K5GA 4V0KA 2C9CA 4PX9A 4HEJA 3RAPR 3BWDD 4LV5B 4RZ3A 5FBRB 2N42A 1LS1A 3SFVA 1X8JA 4B76A 5L3SA 2B8TA 5EZ6B 1L4YA 1E9DA 4G5RA 4P31A 4IOJA 5IF9A 1CJKC 2NZJA 1VCMA 3A1SA 5KDOA 1D9ZA 4Q1FA 1LNZA 2PT7A 2NO6A 3GLIA 4MYUA 1H8EA 1OH6A 4H1VA 4A2PA 4DCNA 3P1JA 4B3FX 3C7KA 3REFA 1GL9B 1IN5A 1W7AA 2WPDD 2W2TA 3DM5A 1XTSA 3ZD7A 1CIPA 1XEXB 3AVTA 3VU9A 2GK7A 5EP2A 2KI5A 3A6PC 3EZFA 2QE7A 3KJGA 3NBFA 1ZNWA 2IYQA 5DNYB 2O8CA 3T61A 4AY2A 4IDHA 2X8AA 1ZC4A 1VECA 4P4TA 4TL7A 1BH2A 1HA3A 1KGDA 1PLKA 2PEYA 2FGJA 4UXHA 4A6XA 2H16A 4DB4A 3K9GA 1X1SA 1XD8A 1Z0KA 2QTFA 5FR1A 2IXEA 2VHCA 1LVGA 1U0LA 3QKRA 5SZKB 3CRW1 4P3YA 3IO3A 1VCOA 1G9XA 4UQOA 3KQHA 2F3RA 2ZETA 3C41J 2QGZA 4AI6A 1QHHB 4JBWA 2QEQA 2H17A 2BMDA 4FW9A 1W0JD 4ZI3A 2VA8A 1XXHB 3IHLA 3RRNA 1G8FA 4JZKA 1R4AA 1JJVA 2OBNA 3EAQA 4E5UA 2FPKA 3A1TA 2QM7A 4N1AA 3TMKA 1JQLB 2CE7A 2C78A 4LWZA 4BFYA 2YHSA 4XD7D 1QHGA 2DYKA 3V00A 2A9KA 3IEUA 4JVSB 1F5NA 1COWA 2JEOA 3PFIA 4Q1DA 2Q3FA 1RYHA 5DLQC 3WYAA 4BQSA 2BVNA 3DMDA 4US0R 4NYIR 4TTRA 3MWJA 1J99A 4C2UA 2X77A 3P26A 2OV2A 5AUPB 2RGNA 2CLCX 3OEHA 4AYXA 5JEEA 5H8WA 5D3QA 3P32A 3TRFA 4AIIA 1NSTA 2BJWA 4O3MA 2OUKA 4TYYA 4U7DA 4LJAA 5JZVA 1UBCA 4V0OA 1M2OB 1MO3A 2EFHB 2LCFA 4Z8YA 2GZDA 4RFVA 2NZ8A 3KQNA 2FOLA 4AG6A 3KJEA 5CIWA 1M6NA 4ITRC 1TQ6A 3SHFA 2GVDC 1MT0A 3P20A 3B7GA 3KDSE 2ZANA 4RZ2A 2ZJOA 4C0KA 5AJVB 2J46A 2D62A 1S0UA 3TAHA 3K70C 3BH6A 3K0FB 2BHRA 4ON9A 1YR6A 4YMUA 5HKKD 1XP8A 4C2TA 3FVQA 3HPRA 2EWWA 1P2UA 1AKYA 3UXMA 3DZ8A 2IYYA 1US8B 1C1YA 3MD0A 4X8HA 3CR7A 3PV0A 4LV8B 2V6IA 1KKMA 2XNDA 2QP4A 5DN6D 3HU3A 3AP3A 5KYKA 4PQYA 3BK7A 2GNOA 4PQRA 1KO1A 2OESA 2G83A 3QKSB 1AS2A 2ZEJA 3TVDA 4US2R 4RKEA 2ODBA 4NDZA 4H9GA 2ZRHA 2ZROA 1OB2A 3G82C 1F2TA 1GVNB 1MH1A 1XTRA 3QBTA 2IYZA 2KWIA 3ZVLA 2WTUA 1FNNA 2PLRA 1U94A 1WXQA 2OO7A 2VHTA 1FQKA 1KDOA 1ZUHA 2H18A 4HAUA 3R9IA 1K5DA 1NG9A 2W00A 4JKYA
chains in the Genus database with same CATH superfamily
5BN5B 4XYMA 1SHKA 2FKAA 4LDPA 4ZU3A 3WRXC 5BPHA 1CK4A 3L8GA 1BE6A 1VMIA 3DOFA 2NTJA 4AMYA 1BDIA 2RDMA 3WRYA 2O2EA 2IELA 2V6GA 1UJNA 3BB1A 4UBLA 5F2EA 2RHJA 1ZAYA 4WFKA 1NTRA 4KR0A 4G09A 4WDQA 4HGPA 2FSGA 1AQLA 1Q16A 1JAYA 3N2ZB 4GYYA 4DV5B 2WUDA 2BSQA 4FEAA 1RZ3A 4HWKA 3E22B 4XTCS 4GVLA 5CT5A 5TT0A 3UA4A 4HDCA 1UBLS 3OH8A 4B8ZA 1T0PA 5INTA 1QRSA 2F43B 4Q3OA 4WIAA 3R76A 1VHQA 2JJ1D 1M2VA 1YZUA 3D7SA 3KL4A 1FTYA 2V1UA 1TVEA 1JEYA 2FCRA 3B2QA 4I81A 1KERA 1KE1A 1UXIA 3RYHA 3S1AA 3TFWA 4AO6A 5C52B 4EEZA 3KEQA 2A0YA 3PR3A 4W9MC 4JYAB 3REQA 3RVBA 1MA3A 3WAGA 2DHEA 2AN3A 2Q8NA 4Q4AB 3UAYA 2F48A 3KZ1E 1TI7A 3MA0A 2JIPA 4V0NA 4JB2A 4QREA 4PZPA 3P0JA 1JWLA 2I3ZA 3OP1A 5JJKA 3CEHA 1DJQA 2M6RA 3NC1C 2ATXA 3CE6A 1A2BA 5A9TA 1OYWA 5B1YA 3CLSC 4JL8A 3BIWA 2C8LA 5EXPA 2I65A 3L4BA 5DF1A 2P3SA 3EWSA 2C7VA 3L0ZA 4XFJA 5LXTB 3VHLB 1A1VA 3UGJA 4J94A 3MCZA 5A7HA 4XX0A 2GBLA 4OXRA 3QBDA 3VTFA 4BO5A 4NU5A 2J32A 2RH5A 2VEOA 3GRAA 3UB4A 3VI3B 1I2AA 2FMTA 2ZUEA 1Z06A 2XOKA 5LPNA 3DZCA 3X1ZA 1NNLA 4BRSA 1ACLA 2V7XA 1Q3KA 3E3MA 3NWPA 5BMOA 2P9EA 4F8EA 1PV4A 1S3FA 1T9AA 2LBPA 4N8DA 2X1LA 1TNDA 1CNMA 2PZFA 1PK7A 4A16A 3GLIE 5A9SB 2QUIA 3OOWA 3FF4A 1NRXA 1SXJA 1E2MA 3BD7A 3EGXA 4Q19A 4A6DA 1EPUA 4PLZA 2QRPA 1V8BA 3D7MA 3N0TA 3TQOA 3TIVA 4YRGA 1SU4A 2SCUB 4HQKA 4JCCA 3GD7A 2GVNA 1U3GA 4N18A 1AF4A 3U26A 1YVPA 1X7YB 1D2EA 1ZD2P 3BAFA 3QLVC 1AHPA 4RF5A 4LYJA 3CISA 1RCFA 4FYYA 4QXRA 4ER5A 3BL6A 2APJA 3TVYA 3NIBA 4J16A 5T4HA 2HWYA 2PX6A 1JVBA 4HAYA 2CUZA 4TKUA 3O8RA 1NM5A 2WVAA 4BFSA 4MDFA 4EG3A 2FE4A 1MUUA 1B1CA 5E0OA 3FYUB 2YC4C 2I67A 3IT0A 1KIFA 3L6DA 4BVBA 1XJ0A 2EFYA 2OT3B 5DNWA 3AUJB 3KKZA 4Q24A 4YBRA 4HYYA 1QORA 1ZK4A 2NVUB 3R7DA 4YR9A 2C5AA 3K4PA 2PGOA 4R83A 2DQYA 5TF4A 4RCZA 3KQUA 3R4CA 3RARA 3I53A 1IIBA 1E2DA 1SPXA 3GHHA 2NVBA 4JGBA 4RIIA 4EPWA 3IE0A 3O1IC 1WETA 3RUEA 2FQ1A 3I8XA 4QKQA 3C5EA 1T2AA 4GC9A 3G8AA 3ZOZA 5FR2A 5AO9A 2Z08A 3OA2A 4BKUA 3HRIA 4GXNA 2JKZA 2OY0A 3U1VA 5A5EA 1FX0A 4DNPA 4DTIA 5E9WA 1GN9A 3W9YA 3EQ7A 3LJKA 3RADC 4M1YA 1RJ9B 2VBGA 4EG7A 2HA0A 4MO2A 1YC5A 3T94A 3I0MA 4FOTA 2O2CA 2EGUA 3FCCA 1SVOA 1DUVG 1N9KA 4XB2A 2HHJA 1T5LA 4L3WA 2WTAA 3CONA 2G6BA 4NHOA 4EKIA 1EA5A 4WCFC 5DXAA 4N0DA 1NI4B 3ZQJA 5BSVA 3QENA 4C4YA 1YAJA 4L2IA 5GOZA 5LYJA 4Y1EA 4D0GA 5B12A 4P3NA 2AN5A 4F5WA 4K6CA 4OLFA 2J8ZA 2N1MA 1CUJA 4MP8A 2OHXA 4YUXA 1J1IA 2FN9A 1ORHA 2XBLA 1XD2A 4EBBA 4QYIB 3CVXA 1GRVA 1AKMA 3AM1A 1KO5A 3LF2A 1M1NB 4ALKA 2HPHA 1TD1A 3BGSA 3E70C 4RDCA 4QGGA 2Q4EA 1VLZA 1Z22A 4G0ZA 1A72A 5D6OA 2NTNA 3T5CA 2W6NA 3EULA 5JCOC 5CAEA 1WX1A 4WKGA 2PLFA 4YT5A 1TQ4A 1X9HA 1Z4PX 2F3UA 2HNAA 2ZDQA 3K70C 4DR2B 3K0KA 2NUBA 2PHZA 5CM2Z 3A36A 3IQIX 3ICEA 1Q57A 2VJMA 3F6SA 3RBZA 5F1OA 1DEAA 5CD1A 3WLQA 2PUEA 2JATA 4CCAA 5K0JA 4ZVRA 5H4HA 4PSUA 3Q7TA 2C04A 4KQ1A 1RW4A 1XMQB 2D3TA 5KQPA 3I2GA 4Q1BA 3EXHC 4RH1A 3HFSA 4HVAA 3QXHA 4BJ1A 2D7JA 3HU5A 4BFXA 2NO5A 1XLTC 2O8NA 4EJSA 1YQDA 1NP7A 4ZGGA 1FLDA 1NUUA 1X87A 3GPIA 4L85A 3RKSA 4MQEB 4DLTA 4P4SA 1NR5A 1D2AA 3OUTA 3WYCA 2WIKA 2D2EA 4FYXA 2WABA 2A4MA 2BDEA 2FFBA 2Y27A 2F00A 3JWGA 2FNAA 4HH1A 4BTVA 2EJTA 4DC9A 3CBGA 2KPOA 2D7CA 3H84A 5DSZA 4Z7OB 1IZ0A 1VSBA 3OT1A 2C97A 3V4PB 4H0CA 4M0UA 2A1UA 5A62A 2ZZKA 4FR5A 5D7NA 5FL3A 3JVDA 2RG1A 4RMJA 4Y0AA 5FTNA 1I1HA 3UNXA 3VPSA 4O4IF 5E6RA 3X2FA 2PZMA 3R8CA 1P61B 3QQ5A 4J3NA 1BMDA 3V4FA 1M76A 2ZK7A 5ALXA 1E3WB 1F3OA 4ACAA 4EITA 3E5NA 3INTA 3R3JA 4LDAA 1YRWA 3RYCB 1S4QA 1KAEA 4ER0A 4FYPA 3F5MA 3SSMA 1FXWF 1YCGA 4BUJA 3G68A 1QF9A 3H11B 1ODTC 1LSSA 4FGKA 4R0NA 5CA0B 4H1UA 4N5HX 1QO0D 5SY4A 3CY6A 1YFZA 2RAVA 4BNUA 1KOGA 1WDTA 2V5AA 2YWGA 1VTKA 2EDCA 3AWIA 4R7TA 1I9CA 1JQDA 2DFPA 2OP1A 3EGEA 1JDNA 3CVVA 2JFQA 4C2BA 4D43A 3OSZA 1XQ9A 4I46A 3SHQA 1LDBA 3MJEA 3ZNPA 5JRDS 5JY1A 1LPSA 4OMDA 2QMUA 2AEFA 3LT2A 3Q7QA 1TZBA 5FEMA 5JVDA 2BEVB 2JGDA 1QYDA 2OK8A 3EIOA 1N0UA 2X1VA 2VQ6A 3NIFB 3QHPA 1OH8A 1HV8A 4OQPA 3RIMA 3HLYA 2VXOA 4R2XA 4ESOA 2RIPA 5L3QA 1VGVA 3QX9A 1NVWQ 3LBHA 1WUJS 1DIHA 3C5CA 5L51A 1U28C 1TU0A 4UTOA 3K0SA 3TW6A 4I8DA 2C92A 1RBYA 4WXRA 2ZM6B 1I4TD 1L5RA 1TK2A 3LC7O 4CM3A 3GFTA 4A10A 2QY9A 1RAGA 2H65A 4CIAA 4S35A 1RACA 3LZCA 5F23A 4YVFA 2GCNA 1L6IA 2PVSA 2WAXA 3GT3A 4C0BA 1TD9A 5L6LB 3VH4A 1YQUA 4LMRA 1SBZA 1GGVA 4GQIA 5EJ6A 1EK0A 1XZKA 2JAXA 3KQWA 3N2GB 4FS3A 2RC5A 3HRHA 5EJAA 3FWYA 4JC8A 1GPDG 5BWCA 3RAFC 4P7KA 1I6MA 3ZU6A 1EESA 3WYBA 4A92A 3JD3A 1Z5VA 4MUEA 5AI0A 2Q7OE 4YCSA 2RK4A 3HYSA 2LCIA 1D2NA 3O2QB 2P2LA 4FYMA 3PUKA 3ZDDA 5JE8A 2FQQA 3CM0A 3E9ZA 2H11A 3ICOA 5ANRB 4E88A 1IUNA 1YQWA 2ZQYA 3K0CA 3N2KB 3JQFC 3IR6A 1P1RA 1WMFA 3TQCA 4R7ZA 1W5BA 1NVFA 3DG9A 3U37A 7YASA 1QANA 4FEYA 1PFYA 3EZNA 4AS3A 3UUGA 3SZRA 3I76A 3S1SA 4HSEA 1RIIA 3EMDA 3LXRA 4WGGA 1K68A 1Y9EA 1SQ5A 2CXXA 1QFJA 1X94A 2FP4A 2YMMA 3IUJA 4JQZA 3EAFA 1U8XX 3EK2A 4B3HA 1H3EA 3TSAA 1QK3A 1G9SA 3SKVA 1JPVA 1TTPB 2XUFA 3QE0A 4IRXA 4O2LA 4ZT4A 4EL0A 3DTVD 1ODLA 3IJRA 2RGAA 1J00A 3GLUA 3CTPA 1JBEA 2Q99A 3GJ7A 2QE6A 3KQQA 4UUMA 3W8EA 1AIPA 3GFFA 4JT4A 1E2HA 4KB5A 1DBSA 4PG4A 4D6XA 3ANNA 3BCHA 3K9NA 3KSUA 1LLQA 2B4TO 3WXBA 3C39A 2CE2X 1QU2A 2FW0A 1Z0DA 2CEAA 2CMGA 4FFDA 1I6KA 3K0FA 4FXOA 2OQ2A 3NG1A 3Q0EA 4BGEA 2CVOA 1MAWA 5ISMA 2QRKA 4WUVA 3S99A 3BFKA 2ID7A 2Y05A 1HL7A 5LQMA 3JD2A 2OBLA 1PJCA 3BXOA 4GE3A 4F4DA 3FRHA 5JECA 1E3JA 1Q1AA 3H4TA 5SYAA 4PLCA 3PC6A 4JLJA 4D9IA 1V26A 4MB6A 3NP9A 5THKA 1N2ZA 2DBZA 4BKMA 5TPZA 3FLEA 1E79D 5TMPA 3A6FA 1YOVB 3CPEA 2VOEA 1W19A 2WWVD 3WB9A 4D45A 3O3MB 2BM9A 3L8CA 1XCGB 1LTHR 2G77B 3QBJA 4PGAA 3QTTA 5CXSA 4MI6A 3GB9A 2FPGB 4Z3OA 4PSKA 3RS7A 1W25A 2W4MA 2ZSBA 1F20A 4TLDA 4ZANA 2P67A 3HDYA 3HY3A 3GGPA 1IZ8A 1V5WA 4ZJYA 1EGQA 1YIDA 1VJ1A 4IFTA 4GI7A 1ZA1A 3ZDBA 4L78A 1TM5E 2Q21A 4WESB 3R5TA 4GMKA 2YRFA 2G67A 4Q3DA 1DAEA 5MN6A 2Q2QA 2ORWA 2EW2A 1H5UA 1XD9A 3JQBC 4PIPA 1U3TA 4O59O 5F4ZA 3ZVKA 3Q87B 1DSSG 5ALSA 2X0KA 4CWAA 4Q3NA 1Y7PA 4Z49A 2HV8A 4DR5B 1OTYA 4QVKA 5DWDA 5KKNB 3U7IA 5CDFE 4YY3B 2I2WA 5LZ7A 3VJLA 2ODPA 4G63A 1UZAA 4JLPA 1DRKA 3DCNA 4D96A 4EKGA 4L8LA 1DQZA 2RGBA 3RHZA 3PQFA 3RWOA 3G8YA 3PUHA 1LI4A 1SXHA 3CUWA 4FVTA 4IF6A 3C3MA 1FY2A 1GDDA 1ZUNA 3B36A 4I08A 4N0MA 1SC9A 5A7GA 2D1RA 3VHXB 5JXHA 2VRWA 1GJRA 2X8JA 4KQFA 4RQUA 1QZUA 2C4UA 2QI9C 3AVPA 2GETA 1SZCA 2PH5A 1V35A 2DLDA 2YX1A 3OZCA 4PYKA 4R31A 5FO0A 5T8KA 3ZU2A 2J4DA 3NXSA 4YQZA 5FA8A 3FPCA 4YAGA 1MOQA 4TTIA 3GJ3A 1F4LA 3L79A 4QSHA 2GFQA 3NHKA 4JITA 4WCFB 5LR6A 1QNFA 5E4TA 3VBCA 1GU7A 4YMLA 2AL7A 2I0FA 3HBNA 1SKQA 4IG9A 3GELA 1GPYA 4H77A 4L4UA 1ZCZA 2JCBA 2VXYA 2XDQB 4I99A 4RU1A 3BGIA 5FB3A 3OLYA 3C3JA 1YKSA 2ZRKA 3NI2A 4E2YA 4W6ZA 4XWGA 2FEOA 4G5QA 2NADA 3NHAA 1CF2O 3SC3A 4BMCA 3IVAA 2GZAA 2OXFA 1LDGA 1OYVA 4AQDA 4B40A 5BWNA 2OO3A 1KKLA 2IPMA 2VR1A 3PKIA 4G4SP 1U7DA 4P4UA 5DOVA 1DBRA 3GVXA 4B83A 3R09A 5BR8B 3OAAA 5HIJA 4ZT2A 3V7NA 3QWFA 5MFPA 2AI1A 2XYPA 5EXSA 4HN9A 4BNHA 1UPCA 1G66A 3QLUA 3O82A 4D56A 3G2HA 5B36A 2H5LA 5GADl 3FB4A 2WW8A 4LVOA 2D0IA 2ZJ7A 2ZBUA 4X6UA 2XKBA 4F6CA 2LVBA 4CQMB 1G5TA 3UAXA 1C3OB 1Y1RA 3DEHA 4WGFA 1JEAA 4RAQA 3UKJA 4R1LA 2PQ2A 1RXEA 4EFNA 2WYIA 3NHBA 4FEEA 4JBYA 5GM2A 1RLIA 2X6QA 3TCNA 2WF7A 4ZT5A 2CLEB 2JLAA 4PRLA 4OM8A 4J2OA 1PFQA 4MGKR 5K45A 2AUNA 4LJYA 4NZ9A 2JK1A 5JCJA 1CF4A 3ESQA 1Z37A 1MEJA 3H17A 3L6BA 3DNFA 2HAEA 4G8BA 2J1LA 1W5TA 3EXHB 3LDAA 4MI3A 1KK1A 1PW7A 3JR3A 5FBWB 1PL6A 2O1EA 2VBFA 2XE4A 3AFHA 4GVXA 1L5WA 4L3OA 3QXJA 9ABPA 2PRKA 2YVUA 4NOMA 2DUUA 4EY4A 1GTMA 1Z4NA 1UPTA 1Z5ZA 3FX2A 4HUQA 2EATA 4MMXB 5CLFA 3PICA 3DP9A 2PWYA 4BKOA 4UUOA 2YWHA 2RMKA 3ONFA 3Q5EA 4UM9D 4V39A 4Z9FA 1S8NA 2PWPA 3RSZA 1A04A 2F55A 3GGJA 3NDPA 3F1LA 5ERXA 3ZE9A 1WVGA 1R66A 2VTDA 3ID6C 3RO7A 5K8JB 4IDEA 1SQ0A 3EY4A 4JOQA 5J2UB 2WWGA 4U6SA 4V2IA 2MCFA 5LKAA 3E5RA 2RH9B 4C88A 2WE7A 1TCCA 1FDTA 3DBOB 1VKRA 3H87A 3JALB 4H3VA 4MKIA 5FUQA 1W4CA 4GKKB 4INZA 4I66A 2I71A 5KNDA 1FDVA 2R5WA 4JLKA 2PGXA 3ZV3A 3OZSA 3ML1A 3N86A 4C6TB 5BRAA 1XWIA 4RPHA 1ELOA 1G6HA 1VI6A 3ASZA 5CFLA 4WXMA 1J9ZA 1GKUB 2AWNA 2CNOA 4HTFA 4GD3Q 2QTMA 1NV9A 3K35A 4OKIA 1X80B 3PXUA 2OYRA 1JI0A 5DBFA 5DTEA 4PZDA 2DWOA 3HY4A 3QUCA 1G3RA 2AK3A 3TIIA 4ZZ3A 1UF9A 1DBQA 3UK1A 3ONNA 1D07A 4TYQA 5DRYA 1RT9A 3ZBQA 2Z5GA 4XXHA 2ZRCA 1GZUA 4UW9A 1R5OA 2O50A 2OLJA 2BMFA 3NO4A 4W9NA 3ISTA 2H31A 3FHOA 4FI3F 4IQGA 3ZWYA 3TD9A 5E2BA 4F4JA 2FZVA 3ZHYA 3FDJA 3GDFA 4ZAZA 4Q4JA 1FUYB 3D6VA 4LHVA 1UADA 4UXJA 3KV3O 4Q9LA 1JR6A 4HWSA 3PDIA 4J03A 3EZ2A 1Q2UA 2B8JA 4BBZA 3EGOA 1E9AA 1NFRA 1K3TA 4AF8A 4D26A 1EJ2A 1Y8CA 2V5UA 2WYUA 4OQMA 3CNHA 2Y3IA 3LOPA 1O87A 2JFPA 1TYDE 3WE7A 4NE2A 4OAQA 1L9KA 3GY0A 3O8BA 2GZSA 3GMDA 3K6RA 3HSYA 5IULC 3OQMA 1XMVA 4IX1A 4Y30A 3B48A 3LO8A 3PS9A 3UMCA 1DMSA 1T9CA 2ZSDA 3KT3A 1VA5A 4N0PA 2XCTB 3O4FA 3ROGA 3K16A 1QHSA 1R3UA 1SH7A 3EZ7A 3NKFA 5DASA 4D6PA 2BFDB 3TNYA 1O4WA 1P45A 1TFRA 4QJBA 2HA6A 3P9IA 2DPHA 3DDUA 1PG5A 3IP7A 4DUZB 5H9VA 4OKSA 2GD6A 2JFNA 3UOGA 4DM3A 1DKNA 1O4VA 3T95A 2OMEA 4FGWA 4UD6A 4URFA 1A9XA 5KOIA 4DNFA 1K0FA 3NT5A 1RABA 2NYVA 4PS1A 3TM5A 1WW2A 3CEJA 3O3NB 2IH5A 1QGUB 1JHYA 1E9EA 4ENVA 2X0JA 1Z6YA 1G1AA 3IBCA 1K6MA 2IX9A 3IEPA 2OSVA 3ZTTA 5AI9A 5AESA 2RHHA 5JMTA 2GPAA 2WI8A 2D2VA 5EXXA 1AQIA 2QL5A 4KAAA 1TIPA 2E3JA 4FHEA 1N9GA 1YXMA 3ROPA 4BYGA 3V4RA 1VL5A 2XIJA 3IAS6 3SBXA 4AG5A 4O63O 3UAGA 1EUZA 2G1KA 4OHOA 3ERCA 1V3VA 4PCUA 1Z7EA 4FT2A 4XVCA 2HGSA 1LUAA 5DYYA 4PONA 3N58A 2HEIA 1DEOA 1DVRA 4LJ7A 3ENNA 4YROA 2XYGA 1G7TA 1WUKS 2EFDB 2Q5CA 1LQ2A 4YN3A 4MW7A 4J7AA 4LTNA 2BI8A 4N8SA 2OG1A 2I4MA 3M9XA 1AJEA 1BS1A 2H7CA 1QF6A 1QYXA 5AT1A 2DJ5A 4BDSA 4J4HA 2MSEB 3HS3A 4X7BA 2W6JA 5AW8A 2Z3ZA 3ZYCA 2OAEA 2DBYA 4RD3A 2H4JA 2YKGA 4KG7A 2Y4NA 1JFFA 4MYHA 4A4DA 1NVBA 2H5IA 1IG0A 4HJXA 2IUUA 5AICA 4BNNA 4S2UA 1JT9A 1MORA 1J90A 2ILVA 3I28A 4BEJA 1RZVA 1GQFA 3U6BA 2PJUA 1Q84A 2JI6A 2OECA 2QU7A 4B1FA 1L5HB 1E99A 1IRIA 2RGGA 3EMBA 2BN4A 4IUBS 4P93A 3SX0A 4YNBA 5K5EA 3RVDA 2XGJA 3GBVA 3BDAA 5KHOC 2JIOA 4I1UA 1OWNA 3BM5A 1A98A 1NJGA 4NENA 2WFMA 2CMKA 2P1DA 4AECA 1RZRD 1MXFA 3TFQA 3KALA 3ZZTA 4ZYTA 3IKVA 1ND6A 2UYYA 4IIHA 5HUJA 4JJAA 1IVSA 4J0EA 3MUOA 3TIFA 1VHLA 1QE3A 3QFFA 2A1TS 2I2DA 4DBVO 221PA 3TBFA 2B8NA 4CKEA 8ADHA 1L7EA 3JZIA 5TT1A 4BV2A 4CEHA 1HZZA 1R9GA 2IIVA 3FR8A 4LBYA 4NULA 4LF8B 1QG6A 2ZTHA 3NORA 1VRCA 3HVUA 1XAIA 2GM3A 4J3JA 5LQAA 2ZXUA 5KU7A 3TFOA 4CF7A 1NRWA 4HDAA 1J7KA 1JE1A 2ZJ1A 1VIAA 2XMQA 2XZPA 2VPTA 2J08A 3FNIA 1RRCA 3U4QA 2X19A 4ZJUA 3IP8A 2B1RA 2QTVA 2PO7A 3CO5A 3MILA 3L5OA 1NDHA 3HL0A 2FG7C 3DKRA 1PEDA 5KOHB 2PUFA 4BBPA 4LNUA 1O54A 2DF8A 1GR1A 3ETDA 2CNNA 4QUKA 4TMTA 3AB7A 4MARA 4FN4A 1S4MA 2KHZA 2ZRAA 3NKLA 3LHDA 4OP1A 2IQIA 3HKCA 2NU8B 1S2GA 3I37X 3K09A 2QMYA 1SKMA 3L4BC 3NUZA 3MFQA 1EVZA 1FMTA 1RWKA 2UYGA 3M1LA 2VJOA 1ZU5A 2ZJYA 3RREA 4EEXA 3FKSA 4X7MA 2O3RA 3WMXA 1JJFA 5E9QA 1HK7A 1PK9A 4CMKA 4YMIA 2XVMA 3OHPA 5AJXA 2I6GA 3H2JA 1G6KA 3HBLA 1RYYA 2XT9A 2W2LA 1XVLA 1RVV1 1AB5A 3LO5A 4ZMBA 3DW3X 1R6VA 4XI9A 5FFFA 3PQ4A 4FE7A 1X1BA 5AJZA 2NTEA 4U1RA 3BULA 3OMLA 4NMLA 4QGFA 2ES4A 2GA8A 3IRVA 5KYWA 2GZHA 3Q3EA 4D97A 5CIYA 4EWLA 3K2IA 1PQWA 1ZD5A 4JK3A 1JEEA 2AFVA 5K8IA 3UQYS 2QN3A 1MD9A 4G0OA 5GOTA 1HYQA 3HMKA 1KI8A 3OWOA 2FPSA 2JRLA 4UNSA 3N39C 5GV7A 1BA2A 1FDUA 4ISCA 4YJ2B 5F9MA 4XM1A 4QOHA 2ZUBA 3EPPA 4M3NA 4N7BA 5CYFA 2PS1A 5TC4A 5DB4A 5DLDA 5ILOA 2IC5A 2DHQA 1OVMA 1RM4A 5CXQA 1DIRA 2DPMA 1QBKC 2HT6A 4JENA 3D8UA 3GP3A 4OHPA 2WJVA 3RAGA 1TADA 1WQ3A 2VZEA 1AMUA 1SVSA 2C2WA 1JAHA 3P27A 4U2BA 1JMKC 4JBXA 1WD5A 2GEKA 4PNZA 3L0SA 3FNHA 2Q5EA 2P5SA 1GA6A 2OHFA 4RJIA 2QUAA 3H42B 1P44A 3PQDA 4YJ2F 1GUAA 3U1TA 3ZDZB 1JKXA 1ISHA 5KX5A 4QRIA 3PT5A 2O3JA 2QPOA 2XWPA 4M8KA 4P6VF 2GFIA 5CXXA 2ROQA 5HF6A 1A4XA 4KGXA 3U49A 4QM7A 1K8RA 1GRNA 2XMSA 4DV3B 1R37A 2N75A 1FSSA 2BTEA 1YGYA 2I7CA 2WA1A 1NVVR 3FHCB 3JQ7A 4ROSA 4UVHA 4BO7A 1XO1A 2BSXA 1F2UA 1N77A 4HAWA 3ELUA 3UO8B 1RKBA 4KI0A 2JJ2A 4MRSA 5TNXA 3LRTA 1Q5PA 3UJHA 5A1JA 3HEBA 1VMEA 2ZRIA 4MUNA 3C3CA 4MV9A 4EGSA 2WILA 1GPAA 3OTWA 5P21A 3PD7A 1HR0B 1X0VA 1XZMA 3EUWA 4YV1A 4CMGA 1FYXA 3C0KA 5HCIA 5M34A 5H0IA 4OQNA 2YJ4A 2VDUE 2CFSA 2JFOA 1VLVA 1YR2A 4WY5A 5JJLA 3U5TA 1NQWA 3KLPX 2OBYA 3CW9A 1RCUA 5ULLA 3ICWA 4RNCA 3LZ6A 4FYKA 3QP9A 4YREA 3V34A 1G59A 1KSJA 1DFIA 4WKOA 2E5LB 4R81A 1E2LA 2R66A 3WG9A 3FKQA 3HJAA 1Y8RB 1VL6A 3T35A 4CI9A 3FTPA 2OFWA 2QLBA 4BJHB 2BEUB 2IHKA 1NYLA 2AEEA 1IXKA 1B41A 1DEXA 4JS0A 3RBXA 4KSCA 1WXEA 3CZPA 4X8MA 2R1TA 4LF6B 1M2EA 2P3LA 1AN9A 1DKOA 1JR3A 1YZLA 3HVHA 4LDJA 4PSVA 1TF5A 5JJ5A 2Q8PA 4KE7A 4TPKA 5KI6A 2YXNA 1QYVA 4S05A 3IILA 1DIAA 4HEHA 1JQJC 1L4HA 4YJ3B 3UB2A 3A3YA 5BNZA 3W2EA 2GH1A 3QOFA 4IJQA 4S3MA 4RD2A 3ZJVA 1L1RA 2PNFA 1FQOA 1YJBA 3NAQA 2HDNB 4ONEA 3JSXA 5AW3A 1YA4A 4MV0A 1SKYB 3KSAC 2BFNA 2GWHA 2Y1XA 3KOZA 1OH7A 5EI5A 2O8BA 3NOXA 4YS6A 1EWKA 2P9QA 1RRGA 4G8DA 4RXUA 4ZOLB 3DULA 4H7KA 3UWKA 3LWBA 5C31A 1XROA 4XUCA 1V1MA 5D85A 5A3SA 1RJGA 1W4RA 3EPRA 1V7PC 3E58A 1XL0A 2FA9A 2JHCA 2ZUUA 4CM4A 5AW0A 3PHBE 1FTNA 2PMBA 4OJNA 3HI6A 4CG3A 3H8VA 5LB2A 4M1EA 3UAZA 5DIFA 3I1FA 4BRUA 1N5DA 3ITDA 2PRIA 4IV5A 2E0IA 1JG3A 2L42A 2R84A 4HG2A 4M36A 2WIDA 4V0ME 2ZRDA 1SN7A 4X1YB 5CHYA 1Q7RA 1WOYA 1OV6A 3AOGA 4MQ6A 1MR3F 3I61A 1DQYA 1CJMA 3O1HB 2FZ5A 3ITEA 4I19A 4IDPA 5HQTA 4XYBA 4ZOLF 4WK0B 3D7NA 2VP4A 3TX6A 1M2KA 4IDQA 1T35A 5B3JC 2PYDA 1H05A 1SBIA 2PX0A 3A9CA 3BERA 4Y1GA 4MGZR 1HOXA 1HMPA 1UOEA 3BWMA 3QJGA 1TAUA 5BORA 3EHEA 5JNTA 2WYVA 5A4JA 3RJTA 4FC7A 4JX8A 4V03A 5DCWA 5B2ZA 3DQQA 3HH8A 1Y89A 4OXXA 2IODA 1YQGA 2FU5C 2NIPA 1HEYA 1QGYA 2VYVD 3GFGA 4W1QA 1PJ3A 2ZUWA 1R0LA 5ESDA 3PUWA 3RHTA 4ETMA 1NQTA 1NBEA 5FBZA 1F48A 1OV4A 3MMZA 4B3RB 3E8SA 4CUKA 3KDPA 2DECA 2ZITA 1TCAA 3OURA 5E3IA 3L7OA 1N0IA 3NHYA 3L7MA 3R3XA 2DJIA 3ELBA 4YAJA 2AFIA 4OA5A 1KEEA 1Y5NA 3LGXA 2HIHA 2Q50A 2XE7A 2EF0A 3I9LA 4N48A 2AZDA 4UTRA 5ICEA 3LPMA 5FPHA 3DV0A 1T5BA 1FW8A 4BO8A 3IO5A 4QXOA 4GWKA 3ILYA 2WJAA 5KMGB 1BIFA 4RHUA 3GEGA 3CJRA 1Y9ZA 1GPKA 2EJVA 4RYLA 4X65B 2LPMA 1M6HA 1FJHA 2EU8A 1VE6A 1QSGA 1L4BA 5IW8A 2AZ4A 2VHWA 4Y6QA 5H02A 1EXWA 2D2IA 2AG1A 1V8PA 1T4MA 3CKMA 1M0TA 3ZGVA 1IOZA 5FTMA 3BAZA 3S81A 4MEJA 2YVQA 1GIAA 3SM9A 6REQA 5KQMA 1U4OA 1C9EA 2Z8XA 1TXGA 3ZYZA 1XTPA 4X92A 2CXOA 4X90A 5ERGB 5TQ2A 4NATA 1BE0A 1GCAA 1DADA 1PTJA 3B1FA 2G82A 1KO4A 3K0CC 4UHCA 4XVQA 3QMWA 5DTJA 4CU5A 1AE1A 2C98A 1K98A 4JB0A 4EA8A 5BMVB 1C0PA 1WABA 2PSHA 1T8SA 4NPHA 3AM3A 1NJ8A 1M2VB 1R4MA 1RHRA 1Z39A 3IR5A 2J7PA 3RYHB 1G98A 2Y1GA 1J2JA 1D7AA 2QVBA 4U02A 1PF7E 1BXRB 2Q3CA 1T9BA 2VUSA 3AZPA 1KKUA 1Q92A 3DZIA 3GEIA 3O84A 1Z88A 4YT4A 4RTNA 2BFEB 1Y4UA 5SY9A 3RVSA 1KI1A 3MJDA 3DTYA 1AH2A 1GUDA 1ZESA 2XYVA 1BWPA 2DUNA 3RJ9A 4AMUA 4DCUA 3TOXA 5K2OA 3JAKA 3TLGA 3KYBA 5KC8A 1VMDA 4PICA 5JNLA 2ZXFA 3JPYA 3H75A 5ARCA 2ZQZA 3RHFA 4B6FA 2NP7A 4KXNA 1LVUA 2AG0A 2NZYA 3QU4A 1SQSA 3QF7A 1NJ2A 2O2IA 4GHWA 2CHQA 2R6DA 1M83A 1E1QD 3WNBA 3GLHE 1DKQA 1US8A 3LDHA 5CNMA 4KMMA 9LDBA 4D82A 3QTBA 4WKCA 4XX0B 1ZYUA 3LS2A 4UDNA 3PEFA 1G3UA 1FYDA 1IBSA 3NANA 4WJZA 5HKOA 3E27A 2I3DA 2FSVA 1OT5A 3KELA 3RKRA 3VNRA 4JH0A 5FI3A 4NCBA 1JEDA 3HO1A 2VDOB 1ZMRA 2O4CA 3LQYA 4FHCA 4MW9A 4MHTA 1XA4A 2ZT8A 2JCVA 4Q6BA 1ZI8A 2GBCA 3L2OB 1SCIA 3GJ8A 3R74A 3KVYA 2CZGA 1DAIA 2D1FA 3A06A 1BKDR 1GNQA 4F9FA 3PCTA 3CRZA 2GN2A 3SIPA 4RHYA 1U1EA 2R6JA 2UV8A 1UFRA 1L8AA 3SYKA 3BCSA 2Z3VA 2JCSA 2L18A 1ZRNA 3QG1A 4Q48A 3WMGA 3IAHA 3CWQA 3HO6A 4PYLA 4CIBA 1BX1A 1TYZA 2PR7A 3AR4A 3LPCA 4EM6A 3EUFA 2O14A 4ZQIA 3QUQA 4S0ZA 3K72B 3UT0A 3FDZA 4WUTA 1N6NA 1XTZA 2HXYA 2I1WA 4DLYA 3LQ2A 1P73A 5AK4A 5ITWA 1K3FA 1AX9A 3EZLA 1E0AA 1YS1X 4RHFA 3TZCA 5JQWA 4MKGA 2R6CA 4FX2A 1TO1E 5LP1A 2FPRA 4A0QA 4BNFA 5JAUA 1R88A 5EQTA 3VOTA 5EKXA 1YBMA 2WC1A 2X3UA 4KSYA 1VPLA 5I4KA 1JILA 2P40A 1AHHA 1NW9B 4MQ4A 1LKZA 4ZVNA 3A6KA 3DHWC 3EHDA 3C3XA 3H1AA 4TLBA 4XD7A 1TJNA 1M1ZA 5JALA 1K06A 3CVWA 1E6MA 4KHZA 1Y48E 5E3JA 5C8YA 3WGJA 4PGFA 2V0NA 4I14A 1EE1A 2ZSIA 4GQBA 3TE7A 4EO4A 2C7OA 3ENVA 4W5JA 2CHEA 1XMOB 1JL3A 3RTAA 2CLLB 1KZGB 1I3NA 1H4QA 2QQ0A 1XTBA 2FF7A 1PP4A 3A04A 3OIVA 3D64A 1P4SA 3A9UA 2QTCA 1QQ7A 4M49A 3CWCA 1USGA 3JRXA 3BVPA 4CV0A 2W2KA 1E2UA 4CT5A 2AFHA 1I5OA 4G85A 4X64B 3S2SA 4A8TA 1WY7A 3DEIA 4JA2A 1NULA 3NBKA 4UNQA 3TL2A 1Y5IA 5KYYA 5GINE 1U2TA 4B2IA 4JYMA 3O92A 1RR6A 2FUG6 3GH1A 4JN6B 2H1SA 2TMKA 4JYBA 4HWPA 1JKIA 4C7BA 1IYZA 2XRYA 3R7AA 1IQ0A 3I5XA 1MHTA 2LWIA 4P81A 3I62A 4CQNA 1WTAA 1UXOA 3B9BA 4RHTA 4A7PA 2XUDA 2ZM5A 4AQ7A 3S8EA 1IIRA 2FX2A 3ZWXA 5LZ2A 5EUCA 3W6PA 1V45E 3RG8A 5LYJB 1FNDA 4G23A 1T9KA 3P0RA 1OZ0A 2VT2A 3LFTA 1UBJS 4XIGS 2B9VA 4E22A 3SXUB 3R6WA 1WXGA 2GYVA 5HKKA 2UXCB 4MYSA 1P2TA 1NMZA 1XD2B 1V9SA 4RLHA 4OHZA 3EN0A 5DLPA 4QWMA 1CUBA 1IOWA 2GBGA 4OBXA 2IITA 3ELDA 4CMAA 5IPFA 3LL7A 4TKVA 1JFSA 3P9YA 1CZUA 3LA8A 4MA0A 1GKIA 4C4TA 3IESA 1E6CA 4CLDA 1AGPA 4TUYF 4DDUA 1JDBC 4J9VA 1GAQA 2Q7DA 5CAEB 3WC4A 3G0BA 5DN6A 2C1ZA 2DM6A 1AZTA 1WF6A 2IBMA 2OZEA 3N70A 4OM7A 5EA2A 1JSRA 3TQFA 2XODA 1E2KA 2F8SA 1USUA 4DLAA 4GI2A 4WFIA 3QVXA 3WGUA 1BMTA 1RBMA 3E1SA 2REBA 4AKEA 1H2EA 4U7PB 3THWB 1ADCA 1R50A 4HNQA 4R9VA 2JJMA 4J7CA 3O74A 1ZHHA 1G5RA 1M1YE 3KTOA 2A6PA 1Z2EA 4G5GA 3S0JA 5H3LA 4D42A 5LZ9A 4D8UA 4DQVA 2EL9A 5ED0A 1DP4A 3WL8A 1RHUA 2WKPA 3AUKA 2XUHA 5F1YA 4FLEA 4IS2A 3ZJ5A 5JSQA 4YLEA 1WWKA 1CUGA 1BW9A 1OWMA 3KNZA 5AVWA 1TC1A 4DYHA 5FUBA 4KWIA 1O94C 2H1OA 4P4SB 3WLOA 1XG5A 4JR2A 1UWCA 3W3AH 2V4ZA 1RQRA 3HVKA 1QUFA 4WW0A 2QMQA 2MTBA 2XUAA 2ZRJA 1SUCA 5AYVA 3OY2A 1Z36A 1Q21A 1FVFA 2JBAA 3OT1B 4IMPA 2DHCA 3U3KA 5LQJA 3BKXA 2A1UB 5COQA 3FUUA 3DA8A 2FW8A 2LXNA 4JVMA 5FOVA 3ON5A 2IYUA 4O2RA 3INGA 5E6RB 5HK9A 1PWYE 3PVSA 4YGXB 1RXUA 1C3VA 2WP8J 4CF4A 1BU5A 4YUVA 5G02A 1KI2A 1M1YB 3LGSA 4IHJA 1ZH0A 4KXVA 2JJ1A 5FTJA 3TW0A 3AILA 4ZHQA 1JAZA 2JZCA 1N4DA 3QXGA 5J3JA 1XGKA 4Z4IA 8ABPA 3NCTA 2IYEA 3MBIA 4F2PA 1P6XA 2XCQA 2ACEA 2Y1CA 2ZJ3A 2W2PA 4P8RA 1P3JA 2HCJB 621PA 3JVEA 2WJWA 4IGAA 4XLZA 2VJKA 1WAMA 2VJBA 3GLKA 4L6CA