2B6HA

Structure of human adp-ribosylation factor 5
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
171
Chain Sequence
b'RGSLFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 5
publication title Structure of human ADP-ribosylation factor 5
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 57
structure length 171
sequence length 176
ec nomenclature
pdb deposition date 2005-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2b6hA00
3VX4A 3OFNA 3U61B 1Q1ZA 3BBPA 4A8JB 1HQCA 3TW8B 5H70A 1BH2A 2HT1A 2GKSA 3H4MA 1JQLB 3MWYW 1E9FA 1I4TD 1NY5A 3VR3A 4DEYA 5FR2A 4ZI2A 2HEIA 1EFTA 5TXGA 2R8RA 2IS6A 4TT3A 4R2IA 4W9MC 5AJZA 1HA3A 3B85A 2PJZA 2AWNA 4B3XA 1T6NA 3NBXX 1DS6A 1YZKA 4WW0A 2XGJA 2WICA 1OFUX 1MO3A 1XD2A 3T5DA 2IYTA 3NEJA 4KFUA 5E7IA 4B73A 1PLLA 3EWAA 3QKSA 3U44B 1NIJA 5L3QA 3ADDA 3IEVA 1PVOA 2G1JA 1A2KC 2AFIE 4IDNA 3P26A 3RC3A 3VTKA 1RC8A 4WVFA 3RVBA 2VP9A 4Z1MD 2A5JA 1Q1QA 4DC9A 5FBVB 2ZI3A 1S9HA 3UG6A 1G41A 1VG8A 1E2NA 2XXAB 4Q4JA 4BLPA 2V3CC 1U90A 3UG7A 1EFRD 2RCNA 3O8BA 4LJ8A 5KNDA 4HLUA 2PLRA 1Q3HA 1MH1A 1XCPA 4Q1CA 1IXSB 2I3BA 1W1WA 1XTKA 1RJ9A 2ZR9A 1DOAA 1GRRA 1VG1A 2AN9A 1X3SA 1Z6AA 2C96A 4RD1A 3ZVNA 1KO5A 3CLVA 4HB4A 1P3JA 2F3TA 5AJYA 3IIJA 3MFYA 1JJ7A 4BFXA 3B13B 4UJ5A 1XBTA 4CVNA 1E9DA 1GNPA 3GD7A 2QG6A 3SR0A 4CT5A 2ZRJA 1Z0JA 3FFAA 5FOUA 3WNCA 1HTWA 4IVQA 1VMAA 5BQ5A 4U02A 3MGCA 1RZ3A 1ZBDA 4NMMA 5A4JA 3HYTA 4AKHA 1XPUA 2ZE5A 4HZUA 1E2GA 5IK2A 4US1R 1JAIA 1TF5A 2IWRA 4NYMQ 3AP1A 2GF9A 3GLHA 4C0LA 2ZROA 4E07A 1NSTA 2NQ2C 1EFHA 4YXWA 4PX9A 5KPJA 1NI3A 3C16C 1IBRA 1IN4A 4FMCF 1GFIA 4YMVA 3FE2A 4YC7A 2W0SA 4US2R 3QPVA 1F2TB 2CL0X 5JFGA 4D4MA 1NLZA 4TMTA 5BN3A 5KU1A 1U9IC 2O8DB 3NHBA 5SZJA 5CIWA 1KY3A 2JJ1A 1FX0A 2RGXA 1YZTA 3GEIA 4N3NA 2MMCA 2QAGB 2W6JD 4JJZA 1OF1A 2YWEA 3SYKA 2QQ0A 5CDFA 3R9XA 1X8LA 4UNQA 4B6FA 1NMYA 3CO5A 2KBEA 3I62A 3KUCA 3KQNA 1XEXA 3PR1A 3ZLJA 3A36A 3R8CA 2V55B 1PLJA 2G83A 2WAYA 5AUPB 2EFGA 4IOLA 2O0HA 5C4MA 1FQJA 2G0NA 2NO7A 3DVLA 3FB4A 2IYRA 1Z0AA 1NBMA 3AVOA 2OAP1 4HUQA 2ZRFA 4LJ6A 1X8KA 2E1RA 2H16A 3C4JA 1UKZA 2XNSA 1GNQA 2CVHA 1QG4A 2FFAA 4W7SA 2ZI5A 3TH5A 2J87A 3I5YA 5F9HA 2ZS8A 4M1YA 1LV7A 1EX7A 5FOTA 3QXSA 3AGPA 3EPLA 1JR3A 2XAUA 4AIIA 4B2PA 4D0GA 3CZQA 1WCV1 3GJ5A 3WMEA 1N0WA 1SKYB 3VFDA 1R5NA 2RGNA 3CBQA 1UKEA 4KCGA 3R7WA 4LV6A 4Q7KA 4TLDA 2WWYA 1BO6A 3SZRA 2MSEB 4JL5A 3T5GA 2AXPA 3SU8A 1QHHA 3VKWA 1JECA 4AURA 3HPQA 5JSZB 4RCYA 1WDTA 1YZNA 3RSOA 4PQFA 5CK4A 4HZIA 1D8TA 3QKSB 3D6TB 5D3MB 1KY2A 2DHRA 4KBFA 1HQYE 3NIBA 4A15A 3MSXA 4BECA 4NL4H 1E2JA 2WPDD 4ARZA 1RPZA 3K9LA 3FWYA 4OI4A 4PPGA 4TLCA 2B8WA 2C9OA 5FUXA 4P4TA 4BPBA 3C5HA 3TSZA 1N6RA 3QXXA 4YMUA 3RYTC 1S8FA 2WSMA 3UANA 2ZSEA 4HAVA 3V00A 4BFSA 2F43A 5C2JB 4IHQA 4WAUA 1A5TA 4Z8YA 1JEDA 1LNZA 3GLIE 2IYZA 3VU9B 1AS2A 3U3JA 4IVRA 1KHTA 3G5UA 3Q72A 3AM1A 1CBUA 2ODBA 2YNMA 5FOWA 1XMJA 2QMUA 1GNRA 2IT1A 3QIAA 4O0MA 3NDBB 1EK0A 1NG9A 2IEZA 1HUQA 3CRW1 2ZRCA 4A0HA 1L4UA 3ADBA 5JJLA 4PR0A 5D3QA 4Z51A 5GVRA 3ECCA 4F4CA 2QBYA 5JS7A 2X77A 2Z43A 3OEHA 4X8LA 3TUZC 2PZEA 3LAWA 3CUEF 3KJHA 4LHXA 2EFDB 1BKDR 3CRQA 4G3XA 2HT6A 3EIHA 1YHNA 3M6AA 4S35A 3GEHA 1UDXA 4XTCS 1KMHA 1CJKC 1AK2A 3RRYA 3B6EA 3Q5DA 5IHPA 2H18A 2QNRA 4GP7A 2O8EB 3LLMA 3QI2A 5HCIA 2ERYA 1A82A 2OBLA 1DO2A 1Q22A 1MT0A 1KI2A 3FFBA 4A92A 1Z2CA 5F98A 2ZREA 4AYWA 2Q3HA 4RD0A 2IYXA 3CNLA 1N5LA 1Q44A 3QQ5A 1OJLA 3FPAA 3H2YA 4TZ6A 2GF0A 3B1ZA 3FMOB 4QBGB 3ZH9B 1RYFA 2IYUA 3REFA 4QGAA 3ZJYA 1U0HC 1U99A 2QGZA 4Y0VA 4KSCA 5FTLA 1KZ7B 1GKUB 1LFDB 1XZPA 2P6UA 5E4FA 5KPDA 1B0UA 3ASYA 5DGXA 3EG5A 5FUWA 3GLGE 4NHOA 1ZIOA 4XVQA 4HDQB 1J70A 3R8FA 2FE4A 2JCSA 2Q3FA 1XTIA 2DFTA 4Q4HB 1E32A 1MV5A 1XMSA 4Q9LA 1N5KA 2ZYTX 4GMDA 1OFHA 5K8TA 3F5FA 2GJ9A 2C5LA 2C95A 2OCBA 1OKKD 4PC1A 5DN6A 4EIWA 1NJFA 2BHRA 1J2JA 4Q66C 6Q21A 2C03A 1RRFA 4ILEA 4F7WA 1E96A 1MRNA 2NZ8A 1IXZA 3K09A 3QY0A 4KITB 4DT1A 4TYPA 4JLVA 4DLYA 2WWWA 3X1YA 4LK2A 1XTRA 2H17A 4UXHA 3UATA 1DAMA 4Q1DA 2JLRA 2ZRIA 3W3AA 2WJYA 1QHHB 1W0KA 2WWFA 1N6PA 1GVNB 3MWJA 4URUR 4MRNA 2D62A 2EVWX 4N0DA 2XZLA 1L8QA 1OB2A 1YE8A 2GJAA 2QGNA 2Z5FA 1S4QA 2D74A 2CJWA 1KNXA 1I2MA 4QKQA 2QMEA 3PV0A 1M7GA 4CT4B 1BMFA 3I1FA 4URXR 4DKXA 1EESA 1R0WA 2AD5A 4IOKA 3UK6A 2IWHA 2WJVA 1P2SA 1N6HA 2W6IA 3CONA 1R6BX 2B92A 5EXPA 1T9HA 4ARZB 4G5GA 4D80A 4D4JA 1SVKA 4GBMA 3VAAA 3BB4A 4CRWB 5DYIA 3RRMA 1E2IA 1Q21A 1ODFA 5FOXA 2ZI6A 2IS1A 2BVNA 2WKPA 4P4SB 4R2HA 3N70A 2OO7A 2F43B 4QOSA 4PC7A 1JXMA 5EP1A 4C30A 4LJ9A 1II8A 1ETUA 4DLRA 1OFTA 3KQUA 1OHHD 2ZITA 1XFAA 3FTQA 4B3CA 5AWFC 3KFXA 1S2MA 2A5GA 2ZRMA 1AM4D 1E0JA 5TB5A 4DWJA 4IFEA 5K8UA 3IHWA 4OQXA 4TMWA 1XEWY 2BMEA 4B6EA 1FUUA 1E1QD 4ZKDA 1U0JA 3OE7A 2IS4A 4X8MA 1KK1A 2IF2A 4IKEA 1XMVA 2ZE7A 2TMKA 2BV3A 4B76A 3K70B 4GP6A 3E5HA 3RS3A 2XNDA 3LVQE 1Z29A 2YOGA 1GUAA 5K8LA 3IKJA 3N2IA 1G291 2HUPA 2GTPA 5SZHB 3BH0A 1JB1A 5B64A 3QUSA 1DAIA 2VHJA 4RJLA 4PPFA 5CJ2A 3AB3A 1G6HA 1F60A 2J41A 2QP9X 1P72A 4L9SA 4RY2A 5EE5B 5E7MA 2GWHA 5FBLB 3UWOA 3QXHA 3T1TA 1DAEA 3ZYCA 1KIMA 3CH5A 3LX8A 1VTKA 2YVUA 2VP2A 3KZ1E 4FW9A 4NCKA 1E9CA 2FF7A 3B8HA 4JS0A 4OKSA 4LX0A 3TVDA 1GOTA 3I5XA 1VECA 3LD9A 2JGNA 4GZLA 4O25A 1P5ZB 1T3HA 1CTQA 2EWWA 1E2QA 4HB0A 3GPLA 1ZW6A 1KSGA 4RZ3A 2ZUBA 2QE7D 2QEQA 4L16A 5H68A 1B23P 4MRRA 2F6RA 4A2PA 4C0KA 2EU8A 3L0OA 3QF4A 4PQRA 3K53A 1NVUQ 5HCNA 4B75A 1T4GA 2CK3A 2RH5A 4BRUA 4JLKA 3NBYC 4ZDIA 3FMFA 2WZQA 1ZM9A 4M9XA 2B6HA 3SQWA 4TYWA 3LXXA 3NBFA 1X6VA 2ZUCA 3LO5A 4EPRA 3W34A 4A2WA 3N5CA 1ZNXA 2R6CA 3OAAD 2REBA 2DY1A 1R0YA 4ASUA 5KO2A 3RDPA 2JAQA 2OUKA 3GLIA 3GJ6A 2YKGA 2A3RA 3X1WA 4ESHA 4FMCB 1QG2A 3L0SA 2V1UA 2PCLA 1IN5A 5BW8A 1NRJB 4XVRA 3U7EB 4MGZR 2YWHA 4JBXA 4KLZA 4JL6A 1IY1A 3E70C 2D7CA 4TSFD 3OZXA 1OB5A 4FCTA 421PA 2FH5B 4OJKA 1KK2A 2GILA 3OEED 5CYOA 2ZSBA 1K5DA 1DVRA 2JDIA 1WMSA 2XITA 4BFTA 4YLGA 4V0OA 3UMSA 1R0XA 4C2UA 2BEJA 2E9SA 2JA1A 2ASEA 1PLKA 2QA5A 4QJ3A 2ZAMA 4MYCA 2XSZA 2C78A 2BOVA 2HLDA 4H9GA 4OK3A 3FMPB 2YWFA 1K5GA 1W0JD 4NZYA 1KJZA 1NMXA 1GSIA 1II8B 3WNBA 3TGPA 1EWRA 2IXFA 4ZO4A 4KFRA 1CR2A 2ANBA 5CDFE 2Q9AA 2ZI9A 1NKSA 4TL6A 8OHMA 1UKYA 5EZ5A 4AY2A 1RRCA 4MUBA 2NGRA 3SHFA 1ZVQA 1CKEA 1ZM2A 2W2XA 4M8NE 4CEIA 1YR9A 2WAXA 1UADA 3FGNA 3VR1A 1W7AA 2Z83A 2GJSA 1AN0A 4LCBA 4OHYA 3FKQA 1G5PA 4YDHB 4IDQA 2RHDA 3GLGA 3K0FB 3H84A 1Z0IA 1E2KA 4ON9A 5JCPA 3ICQB 4EJSB 4JLAA 1KNQA 1N6NA 1SQ5A 2VSXA 1XX6A 3QJYA 3U60B 1DO0A 2BM0A 4M1WA 4RFVA 1AGRA 3LLUA 4XSHA 3U3RA 2C77A 2C8VA 1E9BA 1K6MA 3W8NA 4OYHA 1SXJD 2LKDA 2OEPA 3NDPA 4BLSA 3BERA 3P4YA 1VCNA 3K8YA 2F1IA 4TYQA 1MRSA 1VG9B 4DCSA 3AEZA 3CW2A 3WYFA 3CF2A 1XPOA 3DM9B 4CEHA 3DKPA 3SFZA 1OH8A 2JIZA 1TX4B 1CULC 3U5ZB 2Q9BA 1N6KA 4DDTA 1DPFA 2PZFA 4PSKA 3TR5A 4DXAA 4IRUB 1J8YF 4BZXA 5HE9A 4A36A 4TMXA 1OE0A 2LCFA 4I4LA 5LD2C 4MDEA 3T1OA 4B48A 2PMKA 3U4QA 3UIEA 3EAQA 4MKGA 5EE0A 3THYB 1E2LA 4MRVA 3ADCA 1EFRA 3DPUA 1XDBA 2P65A 3BORA 4BEBA 4C7OA 3F3YA 3BWDD 4DBLC 4LZZA 3ZS9A 2BWJA 1FW6A 1RKBA 1KSHA 4ZCLA 3EZFA 2CCGA 1W48A 2ORVA 3QKRA 1WQ1R 3Q85A 1KI9A 2DBYA 2R9VA 621PA 5KSZA 1CP2A 2P5SA 5J4YA 3THWB 2KWIA 2ZVPX 4JYCA 2GJKA 5FPTA 4XTRA 1RE0A 3CPHA 3AF1A 2V6IA 1XZQA 4JSTA 1G9XA 1P6XA 4FMDF 1AS3A 2GAAA 4I1OA 1E79A 2JATA 2WWGA 3TJZA 2FZ4A 1W5SA 1D9ZA 3NC1C 5L3VA 3V9PA 3VR2A 1KO8A 3GLIB 1R7RA 2CXXA 4HATA 1HV8A 4UXIA 4TTPA 3S1AA 1JI0A 4C2TA 1S1CA 3AVPA 3VX3A 1E99A 1FPMA 1W44A 2GDJA 3CR8A 4BZPA 3SJBA 4Q1AA 2ZETA 5IF9A 3LBHA 4LDJA 2ORWA 2WSSA 4B3GA 3LV8A 4M9QA 2JASA 3A4MA 1KGDA 4PAOA 2W58A 1TQ2A 2R6FA 4IFBA 2WOOA 1RIFA 3R9IA 3LNCA 2FN4A 5AJWA 5AUQA 1XXHE 3RS2A 4V02A 1IN7A 5HE8A 2HJVA 2X19A 3NBZC 4LJ4A 3EPHA 1JPNA 2KE5A 5JWOA 1NN1A 1E3MA 3DOFA 5KDLA 3AH8A 4K46A 1S3SA 3U3KA 1A7JA 2BEKA 3SE0A 3A1SA 3U7GA 3LW8A 2YJTD 3AP3A 5JHHB 1SVWA 2OAQ1 1W5TA 4CZ2A 4AG6A 4CEIB 2GA8A 2OSBA 2EW1A 2ZJ2A 1CIPA 2ZJ5A 1OIXA 1ONBA 5KSPA 3A8TA 4KXFB 2ZU0C 4MKFA 5BN5A 2ZRPA 2QSZA 2YOFA 2YOHA 4LV8B 4RFSB 3VHLB 4B3FX 3BH6A 1BYUA 1H8ED 2ORIA 3T1VA 2QTVB 4HLQB 2GXSA 3B1WA 2A5FA 2Q9CA 4FCWA 4NONA 5JRJA 2BKEA 4WZAE 1U0LA 2DFNA 4LHVA 1KJWA 3X1XA 2GZAA 3KX2A 4PZYA 5BWMA 2PX0A 3JVUA 1C1YA 5F3WB 1ELOA 3PEWA 2QP4A 4GFDA 2G9NA 2WWHA 2ZJYA 3B1YA 3QEOA 1KDOA 3QSYA 1D2NA 5L8VA 4GSYA 4OBEA 3U4QB 4NBSA 1NN0A 4KYUA 3I4LA 3E1SA 2I1QA 4HSEA 4BLTA 2F9LA 4MRPA 2GVZC 3KQKA 1QHYA 2AK2A 5DLQC 3BIFA 3EA5A 1CEEA 3UMRA 1ZNYA 3CNOA 2OFWA 1ZUHA 3LBNA 1HY3A 1KSFX 1KZGB 3QKRB 4OL0A 5H8WA 4TLEA 1E9EA 1GP2A 1BIFA 1EX6A 3BFKA 4WXRA 3DEFA 3KDSE 4N1AA 1F2UB 5CM8B 1D5CA 3X1ZA 1AZSC 4LBVA 2BCJQ 4PO1A 1VDZA 1S3GA 1CLUA 4XIGS 5DNYB 1OPXA 3VNUA 2W0MA 4NP6A 5FBQB 5LBIA 3SEAA 3TRFA 5H1YA 3KTAA 5JEEA 4RKEA 3L0PA 4P0TA 2P0EA 3AF0A 4Q18A 1HE1C 4B33A 4OJQA 3LQRA 2OLKA 2O8FA 1SVSA 5UKDA 4F4JA 4I1SA 2WMOB 1KDTA 4G0NA 2YWGA 2JLXA 5HKKD 5JLJA 3D3QA 5CYPA 4EPWA 3GFTA 4M1OA 4WA7A 1NVWQ 4QM7A 2GHIA 2VH5R 4PO9A 1G17A 4OQNA 4BFUA 1M7HA 1UJ2A 2JLYA 4OI0A 3KKMA 2EFHB 1MR3F 2GAOA 2QTFA 2ZRLA 2PLFA 5JCZA 4EFLA 1ZD1A 3VR6A 1ZRHA 4EQ6B 4ZKEA 3SJCA 1U9IA 2ZIAA 5FUVA 3RABA 1XCGB 3VKHA 2IW3A 1G3UA 2QMHA 1G5TA 5HZKA 2A5YB 3AKEA 1V5WA 2IUTA 1WP9A 3ZZTA 4BFZA 3PVSA 4Q4AA 2GJ8A 5GJCA 4UNSA 4LYFA 3RC8A 1OH6A 4MYUA 1NY6A 3ZZUA 5J4LA 5M04A 2F1RA 4Q00A 1F48A 4LOAA 5AJXA 3NH9A 2VP6A 4B35A 3OFND 2XB2A 3RWOA 1CS4C 4NU0A 5TVKA 4TMZA 1W2GA 2A30A 3DZDA 4HLCA 4HAWA 2BMJA 1E9RA 4QHYA 4YDSA 3T12A 1NN5A 3K9NA 5FTJA 2J45A 1UM8A 5B30A 3FYHA 4U00A 3NH6A 2O8BA 2H92A 1OKKA 3SNHA 5KYKA 1E9SA 2B7CA 3AF3A 1XD2B 5DH9A 3D31A 1TADA 2QZ4A 1P75A 3OF5A 1JEEA 1TUIA 2RGDA 4KU4A 3KXKA 5L3QB 4ZDJA 2O8CA 5F9FA 3GQBA 4IVPA 721PA 4PQYA 4RKFA 1LF5A 4POAA 3TSOA 3BB3A 4KAXA 2XB4A 2OFXA 1GL9B 1G7CA 5J47A 3GJ0A 5FBWB 1P2VA 4F92B 4LJ5A 3EC1A 4OQFA 3CKLA 4Q4JB 3EPKA 3BD9A 2R6GA 4JVMA 4ACAA 5LB2A 2OM2A 2P2LA 1AQUA 1QBKC 2F9MA 2ZE8A 3KB1A 3MRSA 4MH0R 2ZRKA 2QT1A 3TK1A 2FMXA 4KFTA 1RJ9B 3BE4A 3VKGA 4M9SA 1TUEA 3ONWA 5EZ6B 3T1QA 3T61A 4DLZA 4KODA 1KSJA 4BLRA 3AP2A 2CL7X 3TW4A 4DSUA 3HU1A 4QBFA 3FOZA 2RMKA 2JLQA 1PZNA 3NEYA 2H1LA 4KFSA 2OZEA 2JLZA 1XEWX 2ZRBA 4TYYA 1IXRC 3ZVMA 4IEEA 4TQAA 2HXSA 1NJGA 3QF7A 4FIDA 2HJGA 2NPIA 1R8QA 3ZQ6A 2C9CA 4CEJA 4HZUB 2D3WA 2VSOA 1OV4A 3MJHA 1JJVA 3CX8A 1YZUA 3SN6A 1N5IA 3GLHB 1GIAA 4JVSB 3V4FA 3IILA 5IK2D 5SZKB 4TL9A 1XXHA 2ZYUX 4TLAA 3SJAA 4B32A 5FPKA 3WY9A 4QBHA 2AFHE 5J4HA 4RD2A 2V7QD 4YXWD 2J5XA 2QU8A 3I8XA 3LRPA 4A2QA 1E1QA 2BBTA 5KSOA 1L4YA 1US8A 3U3MA 4BZQA 2VYFA 2GBLC 2F1JA 3MCAA 1S9DA 2VPPA 1R2QA 3T15A 1FX0B 3ICEA 1IN8A 1FOEB 4DUGA 4Q21A 2WV9A 1JR6A 3SYNA 2AK3A 1D2MA 1QVRA 3IPYA 3MJRA 3DDCA 1XEXB 1ZIPA 2IXEA 1TQ6A 1UBCA 3QENA 3L0IB 5C4GB 1KYIA 1S0UA 3GFOA 5JEDA 2QQEA 2AKYA 3W5IA 1XWIA 4UQOA 4ZCMA 1JAHA 3EARA 1W4AA 1P2TA 2X2FA 4A0FA 2GBLA 2GK6A 2W2VA 1GWNA 4HUQB 2Q3MA 1P2UA 1YR7A 2IEYA 5E95A 5EE1A 3RLFA 3U6BA 1NBMD 3NWJA 3HP1A 5C46F 4EDHA 1Q0UA 3NC0C 2FG5A 2ZRAA 1Z07A 4RD4A 2ZJOA 3GLFE 4YMTA 2N46A 5DSZA 1TL7C 3W9YA 3X2SA 3F8TA 1H8HA 2XTZA 1QHIA 4Y0AA 2W2TA 5FTNA 3V4RA 1VHTA 2QE7A 2WJHA 4PXAA 2RGAA 3WP1B 4IOJA 5HR5A 1N3BA 4GL2A 1JR3D 3UPUA 3R7WB 4R98A 2IYVA 2HV8A 1Z63A 1E4VA 3THOA 1PUIA 5DISB 1OH7A 2R6DA 2O8BB 1QZXA 1IJFA 2FEMA 1DE0A 3L8YA 1E4YA 2ZS9A 4P4UA 4FMDB 2Q21A 1E2PA 4DSOA 1AJEA 5FTKA 1E2HA 1KI8A 1QHSA 2GCOA 4FN5A 2AKAB 5ANRB 5GADl 4UKDA 3PXGA 3OAAA 5AUOB 2NOAA 2O8CB 3QBVA 1GRQA 3WMFA 1VCMA 4LPKA 1Z22A 5G3YA 1RW4A 1CR4A 3PITA 1G4AE 2UZIR 4KV9A 1TF2A 3RS5A 2RGCA 4UNNA 4OI1A 3IQWA 5TV2A 4M1TA 4W5WA 1NLFA 5EQTA 1R0ZA 1NLYA 3QXCA 3IQXA 2VHQA 1ESMA 2ERXA 2OCPA 2B8TA 3CX7A 4EAQA 2OE2A 3SJZA 4TSFA 2FNAA 3VHXA 4TQUS 3AVTA 4UNPA 5DYGA 4NDZA 2OESA 1G8HA 3EIEA 1VYTA 1W4CA 1Z28A 3DMNA 1Q1EA 2C99A 3DZ8A 4QGGA 1BOFA 1KK3A 2G77B 3KB2A 2CNWA 3OIWA 1W2HA 3F0TA 3K9GA 1XEFA 5FR1A 3P27A 1XU4A 4BE7B 2ODNA 2XZPA 2XOKA 1N5JA 1TEXA 4M21A 4CEJB 1TTTA 2RHMA 1M6NA 2QBYB 1KKMA 3K0AA 3KKOA 5FOSA 1NMZA 3BOSA 4EJSC 1SHKA 4B44A 1ZINA 3OEHD 5G41A 3SBDA 5L3RA 1SXJC 5JWRA 1OYWA 2FDCA 5EUMA 3DHWC 4C3ZA 4NCHA 3K70D 1KMHB 1G5RA 821PA 4DLWA 1G8YA 2RAPA 1OXUA 1CJUC 1FP7A 5FFMA 1E2FA 4KHZA 5EP3A 3IIKA 4QHTA 1QHNA 3FKSD 4Z8XA 4LGMA 2ZRDA 2Q6TA 2AL7A 4IDPA 2GXQA 4BQSA 5DE3A 5B2ZA 2VBCA 2GEVA 1KDPA 2B7BA 1SVOA 5EJEA 3BC1A 4Z54A 2KI5A 1KI6A 4JLDA 4DLSA 1XTSA 3KJEA 5JMTA 1IOZA 3PEVA 3KQHA 3GP8A 4AKGA 1P62B 2H5EA 2ZEJA 2ZSFA 4YQFA 1OXTA 4DLUA 1ZCAA 1Z06A 4TWZA 1AKEA 1WXQA 4ZV4A 1ZUNB 4R71A 1XB2A 1M74A 3H1TA 4HLDA 3PENA 3C7KA 4JLNA 4NCJA 3RRZA 3A37A 3T35A 4AD8A 5J5CA 2BJWA 2QN6A 2CEAA 1ZC4A 1W36B 2V4ZA 4PPQA 5IDVA 1TU3A 1ZNZA 3QG1A 3TQCA 2KB0A 1G64A 1QHXA 2BBOA 2IYYA 4RD6A 3ASZA 1COWA 3QG5A 2HYIC 1JNYA 4X8OA 4K81B 5AUNB 1XNJA 4OHZA 4AYTA 4M9ZA 1XJ0A 3CZPA 3SC3A 4L8GA 3AKCA 3BGWA 3QBTA 2ZR0A 4M22A 4YMSA 1HH4A 2C9YA 2I4IA 3GJ8A 3QEJA 4D25A 2FFHA 4DSTA 4KLNA 1Q20A 3I73A 1XD8A 1DADA 5DN6D 2GK7A 2AR7A 3OIUA 1YZQA 4QNRA 2PEZA 5DI3A 4DT1B 4O3MA 1JALA 1A1VA 2J3EA 4BFWA 5KUTA 5G53C 2PJRA 4QHSA 2ZVQX 2VEDA 4CYMA 2I1VB 4M1KA 1DARA 2ZAOA 4EFMA 4LRWA 4D81A 1E2DA 2R2AA 1XJQA 4JT2A 1E1RD 1W0KD 2HCJB 3FHTA 3NHAA 1XMIA 3MG9A 2ZYWX 2GCOB 2CJWB 2L0XA 3O47A 3B82A 4RZUA 3A1WA 4DDVA 5DI9A 3THXA 2C04A 4TYNA 2F3RA 4NYJR 3JZMA 1Z08A 4C0QC 3WBJA 1AGPA 1VKJA 4TLBA 3WBKA 2IYWA 1IN6A 1LF0A 1OW3B 1GM5A 1CF4A 1A2BA 2WIBA 4C0AC 1BMFD 2OXRA 2A9KA 2FPMA 4XOIA 5EXXA 5J4VA 2QMOA 3Q5EA 3QKTA 3CRRA 2OLJA 4JMPA 3W3ZB 3MD0A 3K0CC 2VLIA 4M1SA 2GNOA 2JLVA 2WHXA 4DLVA 3VNVA 2VL7A 3BAFA 2J0UA 4XH9B 1ZYUA 2NO9A 5FL7D 4A8JC 2X1VA 3TLXA 2IL1A 1T3SA 1YKSA 2UKDA 3L82B 2CLCX 1NSFA 4EPYA 3E2IA 4L15A 4P33A 2FFQA 4WOPA 4AKIA 2AWOA 4BFYA 1Z6GA 1U81A 4DRZA 3AKYA 1KJYA 1G3IA 1LTQA 1MO6A 4BUJA 2J0SA 2QAJA 1JPJA 3W90A 3LW7A 3D7MA 1RVDA 4PHGA 4QFMA 4ZDWA 3B60A 4PTLA 5KOYA 1XP8A 1GRNA 5JZVA 3EASA 4LUCA 2HCBA 2CE7A 2O0KA 3DOEA 2VHCA 4A8JA 2BM1A 1VHLA 3KJIA 1QDEA 2QTHA 2XNDD 3CF0A 2Y8EA 5TARA 3RS0A 3PCRB 3Q7PA 4ZI3A 2KBFA 1X1SA 2YC4C 2FA9A 3MAAC 3GLFA 2HXYA 2ATXA 2J7KA 3WYGA 1W4RA 3PEYA 3GCGA 4A82A 4URVR 2VO1A 1YR8A 2BJVA 2NTYC 3ZIAD 2NO6A 3Q8XB 3L43A 4U7DA 1G16A 3IDQA 4FXPA 3HWSA 3U44A 1Z83A 3BFVA 4KI0A 4Z1MA 1FQKA 3TMKA 2Z4RA 5KNCA 4Q9JA 5EE9A 2VIIA 4O2LA 4TL7A 2CBZA 2G6BA 3GJ7A 3FVQA 4PC6A 3ZGXA 4DLTA 1XCMA 4I81A 4LJYA 2BKUA 1TNDA 2FSGA 4HB2A 3EZ6A 3GFPA 2WBLC 2HYDA 1N6IA 1DELA 2AHOA 1MO4A 2BMFA 1LB1B 2CLSA 3QF4B 1T5LA 4K8OA 4KVAA 1ZNWA 2V1XA 3K9HA 2EYUA 4EPTA 3FDIA 2QPOA 1CRQA 1P60A 4ESVA 4M4SA 4PHTA 3B1VA 4TMKA 1Z0DA 4LPSA 3CR7A 3LA6A 4Q4LA 4L5BA 1QRAA 5GVSA 1ZP6A 1TAGA 2ANCA 1ZMXA 1HURA 2VP0A 2WMNB 5CIQA 5DI3B 5TDHA 1SZPA 2DPXA 2HF9A 4NYJQ 4B3DA 1NF3A 5FPHA 5KTYA 1TEVA 2QAGC 4QJ5A 3AKDA 4G01B 3PUYA 4LYHA 3C41J 2XJ9A 3HYRA 4E03A 5HTKA 2XZOA 5SZIA 3VQTA 3WHLA 2JJ8A 2FSFA 4ASUD 2OCAA 4JLPA 5FI0B 1OIVA 2ZJZA 3A58B 5TMPA 5G40A 2NG1A 3AUYA 4IDOA 2JJ2D 1P73A 3CNNA 1Z6TA 3P4XA 4OI2A 3R9WA 2V9PA 4HYYA 1YRAA 2DFLA 3THXB 2GETA 4WIAA 1VPLA 1T8UA 2OT3B 1E2MA 2RGGA 4P31A 1F2TA 1CJVC 4B74A 3SBEA 4G5OA 1KO7A 1N2CE 2V8OA 3BRWD 4H1VA 1N0UA 4DCVA 2W6JA 1EFUA 2DFKB 3W5JA 1SKQA 2O5VA 4JL8A 4UJ3A 3M0EA 3GEEA 4B43A 3MWKA 3WHKA 1SULA 4PHFA 3K0SA 2ZANA 2E87A 5AR1A 1VYVA 2ZSAA 2YC2C 4G5SA 4BLQA 1UBGA 2XTMA 4PSAA 2RKOA 3MUFA 3PUVA 1TPZA 2OFOA 4LBYA 1GILA 4D82A 2J0UB 121PA 4GI7A 3B5JA 4FI3C 2HLDD 4ERNA 1KTVA 1FZQA 2WKRA 4GOKA 2R6AA 1HT1E 1WA5A 2Z0MA 2ZS7A 4AKEA 4MDFA 4NKRA 2REOA 1O87A 3EC2A 4B71A 4DJTA 2MMGA 4Q5IA 4GDFA 3KJGA 4R9UC 4F4IA 1WBBA 3C15C 1G19A 1SHZA 1YJ5A 2J1LA 4KSBA 1FUKA 3FHCB 4Q1EA 2OBNA 5EXTA 3PUXA 3AUXA 4GNKA 5EP2A 3PIRA 4N0EA 5G3ZA 1D9XA 3HR8A 2HF8A 1J8MF 3Q7QA 4AI6A 3JVVA 4IW3B 1SVIA 1O3YA 3OESA 4NYIQ 3GLGB 4GT1A 2G88A 2OILA 2ZUDA 2VTKA 3AQ4A 3AVWA 4OHVA 2B21A 2VF7A 1AKYA 4MITA 2YV5A 1CXZA 3G82C 3DMDA 2VHUA 3WP0A 1FNMA 3UXMA 2YINC 1M7BA 1E9AA 3TBKA 1Z5ZA 4BRWA 3NXSA 3CRVA 4II7A 3AF4A 5L3SA 3TUIC 4CIDA 3GLFB 3T06B 1L2TA 1GAJA 3DKVA 4F93B 4I1UA 3HU2A 4LHZA 1FMJA 1LS6A 4HLUC 1FTSA 1OSNA 2LWIA 2PH1A 2MSCB 3KL4A 3OHMA 4W5JA 5JI3E 4CEHB 2D4HA 2QI9C 4D0NA 4LHYA 5JSZA 5BN4A 3NKVA 3U3OA 1GKIA 4GMXA 2GCPA 3AVYA 2AXNA 4B2LA 1G3MA 2P6NA 2JIZD 2QPTA 4PAMA 4XVUA 1GG2A 4XJXA 5P21A 3RNLA 4JLMA 1EFCA 1U8YA 5D3MA 4D6PA 4RVCA 2J7PD 3GMTA 2WPDA 4JSYA 2DB3A 2ONJA 3BFXA 1IJEA 1ZM4A 3SI7A 1Q3TA 4HAUA 5KSYA 3G0HA 3R20A 2CCKA 4C7OB 3CX6A 4OHWA 4OK6A 4R7ZA 1SGWA 4URYR 1G7RA 4OK5A 2NIPA 2OCYC 4LY6A 2IF0A 3JZAA 4M0LA 4P32A 2JLWA 4DVGA 5FUYA 2A78A 4B3BA 2ZRGA 3BH7A 4C0SA 3J81k 1YQTA 4V0ME 3HPRA 3QNUA 2C98A 3VU9A 3OIYA 5LD2B 1IY0A 4JLOA 4EPVA 5JI2E 4U5XA 1M1YE 1KOFA 3EZ2A 2WM9B 2A5DA 4NH0A 2PBRA 2W00A 4WBSA 2Q0HA 1N6OA 1E79D 2IHBA 2EFCB 1OT3A 1ANKA 3UWKA 5B58C 4B34A 1Z2AA 3DM5A 3S1AB 2NPFA 2DCUA 1PUJA 1NL3A 1W47A 3TSWA 1XF9A 3MLEA 2V7QA 2BCGY 5AJVB 1FTNA 1GZSA 4HUTA 2J9RA 3PFIA 4G5QA 3CPEA 2O0JA 1A4RA 1DAGA 2ZJBA 1QVAA 4C0HA 2H8KA 2O8EA 4Q9IA 3QE0A 1Q12A 4LJAA 3LVRE 3X1DA 1NVVR 2WSSD 1OFIA 3W6OA 2SHKA 2X8AA 2D7DA 2VHTA 1ZUIA 1DAFA 5DHAA 5JHGB 1AQYA 5IRCD 1E69A 1VYUA 4KVGA 3TNFA 4ACBA 2J59A 4PANA 4XWOA 2FFBA 1MOZA 1XRJA 2ONKA 2NO0A 3QPUA 4PC2A 4QNMA 4XD7D 3GJXC 1KI3A 3B2EA 2ZTSA 3CRMA 3OIVA 1I4DD 4QG7A 3TQFA 4DZZA 3EPJA 1G4UR 3PG5A 3Q3JB 1WE2A 2KJQA 4GPTA 3RS7A 4E09A 2ZYVX 5E7JA 1WB9A 4WXPA 2RGNC 4ZPXA 2FZLA 2YYZA 4PZZA 2VP5A 4QGHA 4PPNA 4CF7A 1OIWA 2ATVA 3D8BA 3W6NA 1FNNA 4MQBA 1HT2E 3RWMB 2QY9A 3CIOA 4Q4HA 1SXJE 5C18A 1R10A 2QL6A 3EA0A 1TU4A 2QT0A 4TT3D 1VG0B 4NTZA 4E22A 3U7FB 4TZ0A 5J4KA 5CLQA 1JQJC 5CB8A 3FHOA 1J90A 2QM8A 3I3SR 4QXAA 4ZDKA 5GJVC 4BWYA 4Q19A 3IPXA 3I32A 1SVLA 2IUSA 3VR4A 4AWXA 1G21E 5L3SB 3H0KA 3KKQA 1X86B 3A1TA 3EZ7A 4KBGA 2CDNA 2JLSA 1Z0FA 4I99A 1M34E 4DSNA 1P9RA 2OXCA 1JBKA 2H57A 4JBYA 3IO5A 2V6JA 3BB1A 2CHQA 4LSGA 4JKIA 2GRJA 3NVAA 4DCUA 4EFNA 1G7TA 1IY2A 2BIFA 3A1UA 3GJ3A 4JKYA 1YU9A 5JECA 3ND9A 2ZXUA 1G18A 3I92A 2PX3A 4WZBE 2QENA 3LX5A 5FBRB 4DB2A 4FMBB 1TF7A 4NPHA 3BXZA 1ESNA 2ECKA 1VIYA 5EXSA 1Y3AA 3I8SA 1NKTA 3LY5A 4NCNA 2ZM5A 3CF6R 2QSYA 3IIMA 2XX3A 4RD3A 4DIDA 1NP6A 2QROA 2LKCA 2QORA 1KMQA 1FFHA 3IGFA 1EXMA 3LXRA 1ZM3A 3SQXA 1L7VC 1RRPA 3KUDA 1M2OB 3KKPA 2J0QA 2YHSA 2X2EA 3U7HB 4P4SA 5K8IA 1OHHA 3K70C 2PMDA 4RCZA 2GXAA 4A6PA 2EYQA 4URZR 1DAKA 4FD2A 3ND8A 3LDAA 2BDTA 3PUWA 1G3QA 3MWLA 3TUJC 1W49A 3EWSA 3WYAA 4Q7JB 2OV2A 4KO8A 4W5HA 2VQSA 2ZR7A 1HYQA 2VRWA 3IBYA 3BK7A 2PL3A 1UEIA 4F38A 1ZM7A 3O8DA 3KTAB 5CJPA 3WRXC 4EPXA 2ZRNA 4C4PA 5JJIA 4QBIA 3MMPA 3LH5A 3BS4A 4IXNA 1ZD9A 2O8FB 1LW7A 3A4LA 5CM9C 3SYLA 2FPKA 3CWZA 2JJ1D 1NVVQ 4FWTA 2FSIA 4FCVA 2G1KA 5FPSA 2GEDA 2DR3A 3C14C 3EIQA 5DHFA 5B57C 1WF3A 1SVMA 1KK0A 1E0AA 3FKSA 1W36C 1KI4A 1AA9A 2IXGA 1ZAKA 2WJGA 3DO6A 4AK9A 2CHVA 2FEOA 1KI1A 1JXOA 4Q47A 3RSLA 4UNRA 2XTNA 4EKDA 2VP4A 2N42A 1Z6XA 2IYLD 3KXIA 1F5NA 2REXB 1R4AA 4QGFA 4DDWA 1RRGA 1G8PA 2GZHA 2MSDB 1P61B 4Q01A 1K8RA 3LQQA 4HB3A 1EG7A 3KFVA 1FMLA 5GJWC 1IQPA 2R44A 1CU1A 2FGJA 3SOPA 4B2IA 4Q4AB 2D2EA 2ZU6A 1NIPA 3AF2A 2Z4SA 2QRNA 3K09C 1I2DA 1D6JA 2FSHA 3PEUA 1YVDA 4LBZA 4LI0A 2ZPTX 1LY1A 2BMDA 4Q1BA 1R5BA 4NCIA 4G5RA 5FOVA 1GDDA 3ZZ0A 3P20A 1WBDA 1P9WA 4ZIRA 2K5UA 3TIFA 1R5OA 2WJIA 5DIFA 4A0RA 4JJKA 4L4UA 1UBFA 1HE8B 3CH4B 2PT5A 1J7KA 1KO4A 2ZE6A 3W8RA 2XEXA 2WOJA 3EW9A 4MRSA 4KJZA 2KSQA 2G0TA 3TVTA 5JBQA 4AYXA 2FX3A 1UDWA 3CPJB 4IEIA 3TE6A 4Q1FA 1YZLA 1GTVA 1CJMA 1IONA 2C2HA 3L2OB 4BFVA 4V0MA 3IEUA 1W4BA 2IK8A 1E1RA 4Q02A 4X8HA 1AZTA 2FWRA 2H7VA 2RGBA 1II0A 3LBIA 3SDZA 3ZDQA 3O8CA 3BJIC 3ZS8A 4C0JA 1UBEA 3UMFA 1G7SA 3I61A 1U8ZA 3AVVA 1C4OA 4M2LA 1BYIA 1GL6A 3HDTA 2EQBA 2PT7A 4GOJA 1XTQA 2OBMA 3OEEA 4Q7MB 1CRPA 2IHYA 4HEJA 5GJBA 4P3YA 1KAOA 3QPWA 2CVFA 2ZJAA 5BYKA 1GL7A 2IX3A 3RS4A 2ZI4A 1S96A 1ZU5A 3B9QA 4HDCA 3CM0A 4PAQA 4D26A 5KDOA 2WTUA 3TAHA 1Q57A 4URWR 1UFQA 2XJ4A 4HI0E 2QM7A 1X1RA 5FI1B 2IBMA 1W0JA 5J40A 5BXQC 3AVUA 4MYTA 5FL7A 2BBWA 4XWAA 1EWQA 3UKDA 1UEJA 4BGDA 221PA 1XXHB 4H1UA 3RANA 4JIMA 1M8PA 2YZ2A 1UKVY 3RAPR 5HPYB 4LYAA 3WNDA 3KKNA 2BBSA 1US8B 4QJ4A 5TY0A 1NNEA 4I1VA 3L8ZA 3O8RA 5JS8A 2N1BA 2QRZA 1E94E 1GKYA 4DCTA 3U2QA 5BYJA 4LYJA 1IAQA 5DO9A 4BASA 1MABA 2PEYA 1MO5A 2JEOA 4HDOB 2VA8A 3VR5A 4HAZA 4PO8A 4CW7A 3K0FA 1OLOA 5IT5A 1QF9A 4EJSA 4DUGD 2CE2X 3ZVLA 3C5CA 1CJTC 4MKHA 3HJNA 1LVGA 1ZD8A 1SXJA 3C8UA 1E0SA 1Z47A 3CWQA 1WRBA 5KNBA 1CR1A 3QVUA 2ZJ8A 1KI7A 1Y63A 1MKYA 2RGEA 3A1VA 2P5TB 3H86A 1G3RA 3TKLA 3ZIAA 4ITRC 4DIEA 1W36D 3AGQA 4MYHA 2QPAA 4UXJA 1SKYE 4M1MA 1UF9A 2A7QA 4QM6A 4V0LA 4C0BA 1NVXQ 4CDGA 4MUAA 4Q9KA 3W6PA 3THYA 1P4SA 3PQCA 3B78A 2ZRHA 2NO1A 4D2IA 5FH9A 1H8HD 1X8JA 4EUNA 3EZ9A 1QHGA 2FU5C 4PZLA 1D2EA 4XSGA 3RRNA 2WVJA 4D0LB 5KDDA 1Z3IX 2IYSA 5FTMA 4TMVA 4ZIRB 1VCOA 2GXUA 1N25A 1FP6A 5HZHA 4RSGA 5EUQB 2P3SA 2VSFA 4MA4A 1V43A 2UZ3A 4A1FA 3K1JA 3P1JA 1U8AA 3P32A 1KDRA 4PFSA 4LJ7A 4AG5A 1DG1G 3QKUA 5FL3A 3THWA 1YR6A 4NE2A 4CGZA 1J99A 1T5IA 5AK0A 4OQMA 4PHHA 4DB4A 2GCNA 1H65A 2J0VA 2ZI7A 3Q9LA 3B9PA 4V0KA 1OH5A 4IXMA 3M4YA 4QC2A 4ZCIA 1U98A 2CCJA 1KO1A 2WJJA 3IBGA 4DCNA 1T8TA 4MGYR 2JJ2A 2W6ID 1OXXK 4GRAA 2AX4A 2GZDA 1U94A 4LV5B 5FPYA 1P7CA 4JBWA 4JZKA 5C1BA 4JYBA 3ZQJA 2GEUA 2IA5A 1G1MA 2F1HA 2IC5A 4HAYA 3FMIA 5KHOC 3A6PC 3EXAA 4JVNA 4D4KA 1AIPA 3IUYA 3GLHE 1NG1A 4LBWA 1T0HB 4A6XA 2CMKA 4D4LA 1ZU4A 1R8SA 2WKQA 4OQLA 1Q1BA 4RZ2A 4PSVA 5LPNA 1DBSA 4V03A 2OHFA 1UAAA 1YZGA 1E6CA 2R65A 1TQ4A 2CHGA 2CNWD 3RHFA 4TTQA 4Q03A 2GESA 2WIAA 3K0AB 1YRBA 2WWIA 3K0CA 2XOKD 4MGIR 4LC1A 1G20E 1VCIA 3NG1A 1Z0KA 3LWNA 3OE7D 1W46A 3TR0A 1RFLA 3AVXA 2QUZA 3WXMA 4S2EA 1Z6YA 2R62A 3T34A 1S1MA 3TAUA 4B47A 1E0KA 5LB4A 4J0QA 4WZ6A 3SHWA 2F55A 1BS1A 2JLUA 1T0JB 1U2RA 3EX7C 2AD1A 5JJKA 5ELXA 1OXSC 3PUZA 3K0EA 1DG3A 4MKIA 4Q9HA 4NYIR 4O2RA 1MABB 2VF8A 2FGKA 1FL9A 1KI6B 1XTJA 1PV4A 2F7SA 1H8EA 1NBME 1OYYA 4JLBA 2W83A 4RFSA 5CITA 2D06A 2HDNB 1SXJB 1GITA 2DWQA 2EWVA 3B7GA 1RYHA 4V0NA 2OG2A 4AC9A 4DHEA 1N6LA 3A4NA 4FWIB 3KXLA 4TQ9A 4XWKA 2P67A 2GVDC 3AVQA 2XXAA 3WRYC 4E5UA 3REGA 1I4LD 1JR3E 4YMWA 4LWZA 3QOFA 4QRHA 5CLLA 4KYIB 2FJUA 4DDUA 2FV8A 4YONB 1COWD 3WMGA 3HR7A 1P9NA 2NZJA 4PC3A 5EE3A 2J7PA 4L9WA 2IUUA 2ODEA 1ZCBA 1KKLA 2CL6X 4C9BA 2DWPA 3CB4A 2CK3D 3QVVA 4M53A 1Z8FA 3ZD6A 3SFVA 2Z6VA 4A9AA 2RB4A 2IYQA 3HU3A 2WWXA 2EFEB 2DWOA 4Q7LA 4RZXA 5E3HA 5CB6A 5JRZA 2QP3A 3ZVRA 4TN1A 5A5GA 5LDDC 1XJCA 4IJMA 4LHWA 1HEIA 2ODWA 4HAXA 3IO3A 1ZJ6A 1NN3A 1F2UA 2O52A 2DYKA 1UPTA 3U6KA 1ZC3A 1TQDA 2NMVA 1IM2A 4US0R 4A4DA 1KAGA 1DEKA 4Q48A 1TMKA 4BEJA 1DAHA 1N0VC 1F3OA 1CR0A 1XD9A 1E98A 2O8DA 4QL3A 3DL0A 2ZSDA 4NYMR 5HKKA 5JWHA 3QXJA 2G3YA 1G8FA 1AS0A 2FPLA 4GOXA 3I72A 4TTRA 2QAGA 3B1XA 1LS1A 3SS8A 3GJ4A 3ADKA 2CLDX 4OHXA 1T3LA 3M1IA 2P6RA 2JDID 2UVQA 4FINA 1T91A 3IHLA 3ETLA 3PJRA 1C9KA 1PJRA 5F2EA 4JT4A 2XSZD 1G8GA 1IHUA 3N2EA 1XPRA 3AV0B 4F91B 2PZGA 4DLXA 5EP4A 4A0GA 1G6OA 3KQLA 2D2FA 5CK5A 4EQ6A 1EGAA 4IDHA 4JVLA 4MGKR 5A0FA 2FOLA 4G1UC 2A2ZA 4TL8A 1OXVA 4IOMA 1II9A 4XD7A 521PA 2V54A 3LFUA 3VMFA 4LC0A 1VIAA 4BLOA 3NTUA 2BC9A 4ABYA 4JLJA 4DEXA 2ZQ5A 2PCJA 2IS2A 1F6BA 4GZMA 2J46A 1DTSA 1E2EA 3ZD7A
chains in the Genus database with same CATH superfamily
4EY8A 4PYNA 5FWNA 1GU0A 1NQAO 1TMGE 3GCWA 3OFNA 3DEYX 3VI3B 3JVDA 3KVNA 2G28A 2IOFA 3QYJA 4A8JB 4KREA 1F8UA 5H70A 4ZZIA 2IFTA 4ZV9A 3H4MA 3I6BA 1KTIA 4ZI2A 1NY5A 4P5EA 3G0GA 1YU6A 1SK8A 4PFKA 4J0JA 4GPAA 3N6XA 3MLAA 2P30A 4TS3A 4R2IA 4BZWA 1LVHA 4CM3A 5JBIA 1HA3A 3DAPA 5EOVA 1SXGA 4EJ6A 1XE3A 4OMCA 4B3XA 1T6NA 1MFZA 1DS6A 1JG3A 3MCWA 2XGJA 1SQ6A 4XX0A 3HBAA 2JIBA 3NM4A 1QO9A 3I6QA 1BH6A 1OFUX 1MO3A 3LKVA 2VOJA 2ZAGA 3TLMA 1LQ2A 4PZAA 1PJ8A 4H31A 4B73A 3CLHA 1LZKA 3EWAA 4LZJA 5IVIA 3QKSA 1M6EX 4M98A 2O2IA 3SC2B 3T9AA 3UJ6A 2PTHA 1PVOA 3BCUA 2D8MA 3QPBA 1XN4A 2RB5A 2X4DA 4YP5A 5CT6A 5DYNA 3RVBA 2EKPA 4QJBA 1BWRA 2C4MA 4Q39A 3Q41A 4WKOA 5FBVB 4O2AF 4LF9B 2Q3JA 3EGEA 1VG8A 1N8SA 1OY1A 1MC8A 3JQRA 4PTZA 2XXAB 1KJQA 1O0SA 4Q4JA 3ZXSA 4UQPA 2FI1A 1VZ3A 3GLTA 1EFRD 3QU9A 3O8BA 4EVIA 1AQIA 2B5VA 1WCYA 1DLJA 2DX7A 2PLRA 1N4DA 3U3DA 5CA0B 1MH1A 2WE7A 2B2CA 3DONA 1XJ5A 1RJ9A 4OQQA 3KEFA 2FZKA 4UHDA 2NU9A 2WG2A 3TQTA 3EAFA 3LCJA 2C96A 1KO5A 2B4YA 3CLVA 3DDZX 4HB4A 5T57A 3TM5A 1B8PA 1Y8CA 5JAOA 1P3JA 2G8LA 2ZTHA 4KOAA 3ROGA 1G8JA 3DAOA 1K2VN 3HDVA 2QG6A 1EUCA 1S02A 3FFAA 1Z0JA 1J24A 1T34A 2WJAA 4CM8A 1QP7A 3D3WA 3ABZA 1DC8A 4IFTA 1TB4A 1B1CA 1DZIA 5AM5A 1RZ3A 2E4ZA 2YXNA 3ZX4A 3IR5A 4PIPA 4X45A 4KXNA 2ZE5A 1E2GA 5IK2A 1IZZA 2OO5A 2FN8A 1O0BA 4L27A 1PGPA 1P1BA 1T5SA 3AP1A 2IWRA 2GF9A 2MIIA 1NSTA 1E5DA 4LFAB 3PQEA 3SF8B 4EHDA 1JDBC 1ODIA 3FE2A 2W0SA 4JNKA 4US2R 3FFTA 5IDXA 4MROA 1KL7A 2BFBB 3NV7A 3IR6A 5JFGA 4KK4A 2OG1A 4DTCA 3NHBA 2EJBA 5IEJA 3AY3A 4BMXA 2MCFA 2ZQZA 3VYTB 3ELWA 4G0XA 3D4LA 3I0NA 3OJOA 4P80A 4EELA 1L5WA 3GEIA 3H42B 4GMKA 4Y30A 2MMCA 1N4AA 5B6IA 2W6JD 5BQPA 4WKPA 4BQPA 4LXUA 2RJOA 4RXUA 4DIUA 1IVYA 3G0CA 3R9XA 3PUJA 4UNQA 3IERA 2PA3A 3CYFA 4L8YA 1NMYA 1RWMA 3CO5A 3D3NA 4XQ0A 5FCDA 4B6FA 7REQB 3T8YA 4GLFA 3KUCA 3KQNA 4C04A 4MS4B 3VH2A 3RQSA 1Q0ZA 3K9BA 2Z1DA 3LWZA 3N7TA 1GFZA 2G83A 3STXA 1IZ7A 3K30A 3WL3A 2AV6A 2EFGA 4IOLA 2O0HA 4M87A 1G42A 2OY0A 1Q17A 1VJ0A 3G0OA 3S2GA 1L7EA 4QARA 3LLSA 4D02A 1A9XA 1SPBS 3G8CA 1D1QA 5HGJA 1NBMA 4D9MA 1XMOB 1M2VB 4I50B 2B4QA 2I71A 3DTNA 1X8KA 2HX1A 3R1IA 1Z8HA 2C2GA 4WKGA 1UKZA 2DHCA 1GNQA 4W7SA 4LOIA 3BJRA 2HQSA 2I2AA 4TM8A 4OVKA 3NHFA 4HC4A 1X7YA 1HR0B 2XAUA 2F64A 4D0GA 2DUMA 1LPPA 3AIIA 2RG1A 1LXCA 3WMEA 1N0WA 1E0DA 1SKYB 2BFPA 1YB2A 1QGAA 1CY8A 3Q7EA 1UKEA 2HB6A 4R41A 2P9ZA 3OCYA 4LV6A 4XDYA 2B9EA 2QV0A 4V38A 1T8RA 4EUHA 2JARA 4L4XA 2CL5A 2DCMA 3SZRA 2MSEB 4JL5A 4PY2A 3ZV5A 3SU8A 1EFVB 1L3CA 1Y5IA 1SCQA 3EDCA 4O0LA 5EZYB 4EZEA 5EESA 5IAEA 1Y80A 1VB5A 1TCCA 3L04A 1ZD5A 2FJPA 1RQNA 4RY8A 5J2TA 5TE9A 1V2HE 2LTAA 16PKA 4MWOA 5CK4A 5KB3A 3HA3A 1XK7A 1LDGA 4EY7A 4OD0A 2WIDA 1D8TA 4EHKA 3WHPA 1TZJA 3SQLA 3UK7A 1KY2A 3MRTA 4A15A 2CJYA 2Q46A 4HNAB 3B6ZA 3A26A 1Z6PA 4ND1A 2WPDD 4ARZA 2JLCA 4X7BA 4DAOA 1RPZA 3FWYA 2BFEB 3PNSA 4KXMA 1XTVA 3UCXA 5BXYA 1CY7A 4P4TA 1LK7A 2BD0A 3CNBA 1SBZA 5FWYA 3C5HA 4HVAA 4DA0A 3T0IA 5L4SA 1C2YA 4YMUA 5CFZA 2PIDA 2PS0A 2AC2A 3QKWA 4LHEA 4MINA 2ZSEA 3BN3A 4RS3A 3G5AA 1NZDA 3UANA 3V00A 5ALPA 3OQ1A 5DK6A 4KQHA 5TQJA 4BHTA 1LNZA 1WXGA 3CCFA 1GQFA 5TF0A 3C8DA 1CCWA 2AOTA 1KRXA 1AS2A 3DVAA 2N3ZA 3D0KA 3KYIB 4S12A 3SQNA 5HCUA 3UZUA 2I80A 4ZVVA 1Z17A 3Q72A 3SD7A 2YNMA 3Q4GA 1XMJA 4EKYA 4I1YA 4ZCRA 4UUQA 3S6JA 3EGWA 4EEKA 2YWRA 3LDFA 3PR3A 2O3UA 4REQA 5HSGA 2K2QB 3E9CA 1JU9A 4KPGA 3B48A 4Z51A 5H7XA 1KQGA 4X60A 5HFJA 4F4CA 5KTPA 4Q7QA 1G98A 5FWAA 1Z2OX 3S8MA 2BGIA 5EJ6A 1DRUA 1PQUA 4LZPA 4BX8A 4TX1A 1CJCA 3P94A 2WIKA 4FHDA 1BKDR 3QNMA 1WVMA 3EIHA 5IZ4A 1UMDB 3STTA 5F73A 1E2BA 1CQPA 4S35A 5C34B 1UOEA 1KMHA 5I4CA 1OX4A 1U9YA 2FG7C 4M83A 3NVKI 2H18A 1N2OA 3AY6A 3HNOA 2C5FA 2WJWA 4IF6A 4Y2GA 4YAEA 5A4DA 1G20B 1OROA 2CLLB 1O8BA 1QE5A 1RLMA 1DO2A 3L8HA 1RLJA 3MMZA 4KXQA 4G1MB 1Z2CA 2PX8A 5F98A 3VR6D 4AYWA 5F1OA 3ZWAA 2P27A 4G0MA 1JAZA 3L6CA 4I4TA 4KACA 1NW5A 3ETJA 1U3GA 3ZKAA 5C8DA 3B1ZA 4BWVA 1WMBA 2N47A 1RYFA 4RTOA 2MYTA 3C2QA 2AI1A 1YVRA 2YMLA 3L8DA 1O94A 3EGXB 3I2FA 1KZ7B 3HEMA 1GKUB 1OZFA 5A9TA 3E2MA 2YJ4A 3SR3A 3IEMA 1Y8RA 5KPDA 3WGZA 5ALTA 1N0IA 3A9RA 4ALIA 1V4NA 3H04A 2BFWA 2A6PA 3BZWA 4HDQB 3W79A 2QQ5A 3ZCVA 3ZK8A 3EZLA 2FE4A 3RH0A 1ZCJA 2YFKA 2FMIA 4G41A 1E6WA 1XTIA 1ZWKA 1TVCA 2DKFA 1ZH4A 2ZJ7A 1U0BB 3DWGA 3JR3A 1W93A 3RTAA 2BYTA 2YR0A 3OPVA 3CUKA 3C7AA 1U0TA 3NWBA 3W5AA 3OA2A 3ID6C 1DBQA 1K4MA 2GJ9A 4MP3A 1T3TA 2C5LA 2CGEA 1OKKD 3U1VA 4CM9A 5AT1A 2Z5LA 4EIWA 1M0EA 1J2JA 1C5KA 6Q21A 4K2HA 5EKSA 1T9CA 1T4BA 1HDZA 1YMUA 3LX4A 5DTMA 1MRNA 1IWPB 3F47A 5E6RA 1Z4OA 1IXZA 2NZ8A 3QY0A 3JQAD 1BHJA 1D8AA 3UJCA 1YB4A 3HCWA 1ZCZA 5IUJC 4DT1A 4ETMA 1NASA 4RJ2A 4DLYA 1KS2A 2WWWA 3ML1A 2EOAA 3ONNA 2D1TA 3IQGX 4MWDA 5GZ1A 4GXNA 1NXQA 1XTRA 4BWFB 3OKCA 1DAMA 2VJKA 2ZRIA 3IMFA 3N8KA 1CQIA 1UIRA 4QUEA 5H9WA 1KIFA 2P3OA 1A5ZA 4D3ZA 1Q0LA 3MWJA 1FXWA 4MRNA 4N0DA 2XZLA 5DGCA 3A04A 2XKBA 5J5VA 1QG6A 1L8AA 2GJAA 1Z2EA 2LE0A 2QGNA 3AETB 1EH5A 1S4QA 1GDHA 4R9SA 3FTCA 4QKQA 1TXGA 3I9LA 3Q3HA 5KYXB 4S1WA 3UK6A 3EWNA 2AHRA 3WMWA 3CONA 4B4VA 1AF4A 1R6BX 1VKHA 3EWIA 5IAOA 3AKZA 3FZYA 4EHIA 5EXPA 3IODA 3PFCA 3LF1A 4PYIA 4D4JA 4GBMA 1NNSA 3AIOA 1I94B 4CRWB 5DYIA 1J9GA 3PA6A 1Y33E 4QD3A 1X7ZA 3DE2X 1E2IA 1REQB 2QX8A 4TS1A 3OT4A 1AMUA 5FOXA 3UEOA 4DA4A 5IF3A 2BVNA 1QGOA 1RADA 2VH1A 2F43B 2NTNA 2QRLA 1WUTA 3F7NA 4K5QA 4ZVPA 4BGUA 4KR6A 4X24A 5EIBD 1ETUA 4M55A 3TLGB 3KQUA 1T8WA 2C8LA 3GT4A 2C94A 1CQZA 2WB4A 3FTQA 3CA8A 4C5CA 4AQDA 2A5GA 1U0SY 2FW9A 2ZRMA 3PC6A 3PJEA 1SIWA 4RPHA 4QOIA 3OQMA 1YIDA 5C5DA 5B7GA 1OOEA 2XOXA 5K8UA 2WWRA 2UVPA 2P2DA 1U3UA 2Z2KA 3FPGA 4P58A 4PU0A 5E1MA 5BWLA 1RRKA 3NNNA 4IIJF 2CXPA 2XVYA 1KK1A 3K6JA 1NVBA 4IKEA 4X8MA 4TLMB 4D92A 3KZKA 5K0EA 2BV3A 3GLVA 4IGKA 3ZEIA 3RC1A 3RS3A 4HCJA 4BX0A 1Z29A 4GYKA 3Q15C 4IHJA 4XX1A 4DFDA 5C52B 1KFBB 5TIIA 2AVNA 2BE7A 5AHRA 4BMOB 2GTPA 1QO0D 2X3UA 2NSHA 4CL0A 3E7PA 3JATA 1PZMA 4FLEA 5JFOA 3QUSA 3HYCA 1MG5A 1RWKA 4Q05A 3EG9A 4JQCA 2LDBA 2LDXA 4IIXA 5LQUA 4RJLA 4PPFA 5CJ2A 1ONSA 3VC7A 1QDUA 3AB3A 5A9SB 4DMRA 3N8HA 3IRUA 2QP9X 3HP7A 4L9SA 1GADO 3UWOA 4Y2HA 1N36B 2IZ7A 1A7KA 4D3SA 3NM5A 1NXSA 1RMQA 5ITVA 1Y6QA 2YZ7A 4FW9A 1H2AS 1U0EA 4HQLA 2GARA 4GC5A 1IWOA 3DPIA 1JEQB 1P5FA 3JQ7A 4LX0A 4MW5A 3GJSA 4HDRA 4WZZA 3UWSA 3KJNA 4CMIB 4FOLA 4N65A 3ZNNA 3LD9A 4ONEA 2YDYA 2M6KA 1GUZA 3ZUGA 5D1NA 2VUIB 2HLPA 3ZQ4A 4N8EA 2EWWA 2FW6A 4RPKA 1E2QA 3AI1A 3DZJA 2XEDA 1K9VF 3TGWA 3PQ2A 4BJ6A 2XCSB 2QE7D 1I4EB 3BILA 4FI3F 3DT9A 4L16A 2BH2A 1VDMA 1UDCA 4CV3A 3R7SA 1NV9A 4R5HA 3W8EA 3IULA 3QF4A 1QIDA 1NVEA 2I4NA 5DDIP 1QOPB 2I8LA 1KARA 3FCCA 3OJWA 3Q8WA 4HMOA 4K9OA 4Q4DA 5HCNA 3TQRA 4AICA 4D9GA 4BRUA 5BW5A 3NBYC 1NOJA 4H59A 1J4AA 1ZM9A 3E53A 5B3JC 3Q8LA 2ISSD 2PUDA 1BA2A 3ZE2B 2B6HA 2QF7A 4X54A 2PWZA 3T0GA 1X6VA 3HZOA 3W34A 2R0QC 3THRA 4ENTA 3N5CA 3GLIB 3ORSA 4TRRA 2IEIA 2XD9A 3KLMX 2DY1A 2QUKA 2ZPAA 5T3UA 1TJNA 3EY4A 5TVGA 2JAQA 3FXAA 4YGYA 1EGQA 3MBIA 4ZREA 1GTL1 1R0KA 2HMAA 3TL3A 4BAZA 4A27A 1FP4A 5C4IA 3C7DB 2PCLA 1IN5A 4RMIA 3KC2A 4N03A 2B6NA 1TM7E 4BCBA 5JNRA 3C1UA 1RCTE 4ER0A 4PZUA 2GEKA 3DO8A 4JL6A 4DCMA 2GJ4A 1YTLA 1IY1A 1MQAA 3WRWA 5HJ7A 1LEHA 4WCDA 1Q15A 1P1JA 1WTAA 1OB5A 3KSUA 421PA 1R4NA 5IP5A 2XUJA 1ZHOA 4QG3A 2PLAA 2G9RA 3MM4A 3NHSA 3G1WA 5CYOA 4W5OA 1P8AA 1K5DA 3IALA 1XWFA 2HPHA 2JDIA 2W8BA 3AHIA 3DXZA 4G89A 1J7JA 3RG2A 1PBNA 2HV9A 3JS5A 2E9SA 4U6QA 4Z86A 4OFXA 5A06A 1RI3A 5DCUA 3OLCX 3V1MA 1JL3A 3KZOA 3FMPB 1X1DA 4NEGA 3IV7A 3LUCA 2W2MA 2YMQA 2IXDA 2E3JA 2QZPA 2BGJA 3GDHA 3E9EA 1II8B 3KU1A 4XLLA 3DL2A 2H2AA 4I4IA 1O4WA 3S68A 1KQPA 3EPPA 3HUEA 2A86A 3HN7A 1WB6A 1EU1A 2FW0A 3I28A 5CDFE 4TLLB 2ZI9A 3SLGA 8OHMA 3ICOA 3BMNB 2JBHA 3FNIA 4LI3X 5EZ5A 4F7WA 1RRCA 2NGRA 4FYIA 3SHFA 2PZMA 1V1MA 1PKXA 1ZVQA 1CRLA 2W2XA 4M8NE 1DJPA 1N9GA 1XQYA 2WAXA 3E15A 2B1RA 3VR1A 5A4IS 2PN1A 2AOWA 3H2JA 3WICA 4LCBA 4OHYA 3IP3A 1P1RA 1W88B 2CBXA 2O48X 2QUIA 4X64B 5TPWA 3V7FA 4IDQA 1CB7A 1MOSA 1OMOA 2H2GA 1AKWA 1Z0IA 3H7IA 4RVUA 2F8MA 2FZWA 2WAMA 1BWQA 3PXCX 1MEEA 1KNQA 2WHYA 3S0JA 4E2FA 1XX6A 2CFCA 1ZIYA 3DOIA 3K3PA 3WBFA 4M1WA 5GV8A 4RFVA 3WFIA 3E7XA 4BV8A 4YUXA 4XPZA 4KXUA 4HNHA 5JZ9A 2YIMA 4MULA 2E4UA 4XSHA 3RTDA 4NCBA 2C8VA 1RM5A 1YJ8A 3P9SA 2QTVA 4FYXA 1NSYA 3RSSA 2OEPA 4YJHA 3NDPA 4BLSA 3NWOA 2UYCA 1ZEJA 2YTZA 1XL1A 3B6MA 3HLKA 1J20A 3P4YA 3NEAA 4NFHA 1VG9B 4YCCA 3AEZA 5C1OA 3DM9B 2HQOA 4BMZA 2PKEA 3DKPA 4RH0A 4QGSA 4K6MA 1DDIA 1T9KA 1TX4B 2FZEA 1FLVA 2O4UX 3RYIA 4Z7NB 3OTHA 2QXUA 1EEXB 1RBMA 1N6KA 5AKKA 4PSKA 1TYCA 3M6LA 1G21B 2P9FA 3O26A 4DXAA 3BBLA 2C58A 1BVRA 2LCFA 3SJ7A 1TZCA 3ZCPA 5NULA 3L0DA 3ZGYA 1D2RA 2RHWA 3THYB 3GZ4A 4N5LA 1GO2A 3UW3A 3TTTA 1JQAA 2G67A 5ALQA 3JARA 1A8UA 3WBBA 3DPUA 3E4CA 4JYZA 5REQB 3G85A 1QXSA 5PNTA 1Z74A 4NI5A 3UT0A 3WWOA 3P2MA 5HS4A 2UUCB 1JIQA 2BRUC 5IWAB 5D01A 3ANMA 4DBLC 1C3OB 1U2TA 1V0JA 5IT4A 3R3ZA 1AZLA 2BWJA 3U0BA 4XFJA 4V1CI 4PNHA 3G2PA 3QKRA 4PLCA 3TF5A 3V7WA 1AVTA 3Q85A 4UFNA 3V1KA 1KI9A 3UWPA 4YMIA 2R9VA 3Q2OA 1TW2A 2P5SA 1U5BA 3CRZA 1S8OA 3I04A 1U2DA 4JYCA 1OT5A 2G08A 2F3QA 2W8ZA 1OGYA 2Y9PB 1XZQA 3OIDA 5FBKA 1XRMA 2X23A 5J2TF 5LUAA 2GAAA 4MW6A 1E79A 1T8PA 4WKNA 4DR7B 3E84A 1C3EA 1CUAA 1PZFA 3K1TA 3HSKA 4MIKA 4NS1A 4Z9YA 5C8YB 2K4MA 4FP9A 4JWKA 3MHTA 1IMOA 4MUJA 3QHPA 2AG6A 5CH3A 1HV8A 1XPJA 2IHVA 4UXIA 1GA6A 3G8DA 3IKVA 1A2QA 2P77A 3B51X 4M37A 5FHRA 2PUAA 1JI0A 1G55A 4C2TA 4YRZA 4EA7A 4DMUB 3M70A 4LDPA 4ZVNA 1E99A 2B5WA 4MQFA 2FUNB 3CR8A 1AH2A 5JCXA 3KVYA 2G5TA 3R5SA 4Q3LA 3M2PA 4B3GA 3AESB 4MCIA 1QF7A 3LV8A 2BGUA 1N92A 2JASA 2P9EA 3VV2A 4CXMA 2IPLA 2XXBA 2D1QA 1FB5A 1UK8A 3HCRA 5ALSA 5FADA 5HIJA 3B8EA 3GMSA 5IEBA 4PCUA 3CVOA 1F4VA 2W58A 1RLOA 3GT0A 4J0CA 4MVJM 2WOOA 1RIFA 4DV2B 2FW7A 3I0ZA 2FN4A 3A9WA 3WJAA 4EGSA 2CV0A 1TPYA 1XQ6A 4MYDA 3AFIA 1PFVA 1MX1A 2YZKA 4LXQA 1HYHA 2V7EA 4NICA 5KJCA 1AUPA 4LJ4A 4FDTA 1FRQA 2KE5A 2WNSA 3GJTA 5JWOA 1H0RA 4O6VA 2IIVA 2FWIA 3WNVA 4C06A 4ND8B 3ICCA 4K46A 2Y92A 1KEKA 1M5TA 3LOUA 4LNHA 3M4ZA 1ZOPA 2YXPX 1S3SA 1UJMA 3R5FA 2BFCB 2VHVA 1WXWA 2BEKA 2PZAA 3ASVA 3U3KA 4J03A 5TX7A 4B6PA 4C29A 3U7GA 2W48A 3LW8A 5LD2C 2YJTD 2VUSA 4MCJA 1HE5A 1L0BA 1SNYA 3JQPA 3MINA 4PGAA 4QVGA 2PSJA 2OAQ1 3ZGNA 4MUIA 1Y8ZA 4NX2A 4AG6A 2WD7B 2GA8A 3O0TA 1R27A 4DLAA 4XM2A 2P41A 4R40A 5AI5A 1JFSA 4DV4B 3HV0A 3ZKWA 1JVSA 1BD4A 2IRWA 2XRFA 3PKJA 4JGBA 5A0VA 1V47A 3OUTA 4IZOA 4EW2A 1OIXA 3ME5A 4NAVA 2E4XA 4OB8A 4W1SA 2WYHA 1SD5A 2JCGA 2VTEA 1DJQA 2ZU0C 4WCFA 3NS7A 3OBIA 1ZK2A 2QSZA 3EXEB 4CPDA 1Z73A 2V4UA 3KWJA 4LV8B 2H7CA 3MWDA 3R3SA 2JZNA 3BH6A 2TRSB 4I4TF 4B3FX 3AJRA 3I9MA 5I9BA 2ORIA 3AY0A 1T5BA 2IEAA 3T1VA 1N32B 5GONA 3ZR4B 4I3FA 3PI6A 2HZBA 2Q9CA 5IAKA 4K1XA 2EGUA 4L2IA 2FPIA 3GIDA 4MK4A 4LN1A 2VUTA 4K88A 2EX0A 4NBVA 3WK6A 2J4DA 3X1XA 7MHTA 2MINA 3AK4A 4PZYA 1D03A 3DAGA 3OLZA 1Z4KA 3QVGA 2FAXA 5BWMA 3EODA 3GCXA 4ZT3A 1ELOA 2C5EA 3P2KA 1F1JA 2W2QA 1KBZA 1XTZA 2PKWA 5CAEB 1ORDA 4AO6A 2WWHA 2XI4A 1D2NA 3HVHA 1ULSA 3TZQA 3FY4A 3NHMA 4MWTA 4OBEA 1ACMA 4YV0A 3H17A 4YJKA 5DGTA 5FIUA 4TSRA 2O5CA 4FZRA 1DTWB 2HWKA 2V7UA 1GT91 2F9LA 3NIFB 2A4MA 4MRPA 3PDWA 4FHFA 3TEFA 1JLLA 2LP4Y 2IV3A 4B4KA 5KJFA 3WNZA 1QYWA 4EHJA 1QHYA 4OMUA 5DLQC 4J4BA 4FNGA 5ES4B 2ZVDA 3BIFA 3ESXA 4DGQA 1VMKA 3A1FA 1TIKA 2FRDC 2I33A 3KD3A 3LBNA 2WD9A 5F12A 4K9MA 2P1DA 3KZCA 4B7ZA 1FJ2A 1Y81A 5H8WA 3LDGA 3P52A 1USGA 2JKYA 5KQGA 4C5BA 5EMKA 2VYNA 1R37A 3X1ZA 3TQIA 1AZSC 3E9YA 3M1AA 4FBLA 1SZDA 4QYTA 2CXHA 4LBVA 4RACA 1VDZA 1S3GA 2PIAA 2BHTA 1FXWF 2R25B 3IAEA 3QVTA 1ZBQA 5LBIA 2YJ3A 4JJEA 3RVOA 4B7XA 1Z35A 4L78A 5C5CA 4TKUB 5JEEA 3FTFA 5LWHA 4IUDS 4EY3A 3N8GA 1ORIA 2GKOA 4Q18A 2QR3A 3L1KA 3U5TA 3LK6A 3NXKA 2OLKA 2VUHB 4UBIA 3IUEA 3OD5A 1KDTA 2BZ1A 2YWGA 4GBED 2DHQA 1IZ9A 3K2IA 3UW1A 5HKKD 5JLJA 1M72A 3S8YA 4AZ3B 2Z58A 4NXMB 3LQ2A 3GFTA 4M1OA 1WMDA 1Z4PX 1VLQA 1TM3E 1NVWQ 3N0TA 4QUKA 5HK9A 4QM7A 2GHIA 4PO9A 3HZHA 1T36A 3GDOA 4OI0A 1TCAA 3T41A 3X1KA 4D0SA 3ZE7A 1XNGA 2GAOA 1XZJA 2P2SA 3RW9A 1UDRA 1FFBA 1PJBA 1ZD1A 2FPSA 2IP1A 2OL4A 1R3DA 3PNLA 3R2JA 4ZKEA 4E94A 3GXBA 4K9NA 4R4JA 3OM0A 4Q82A 3ZBTA 4AJKA 4L3OA 3L6OO 3LCMA 1L5SA 3RGWS 5EHXA 2IW3A 3BXHA 1FSFA 3GCZA 2AEMA 3RVSA 1G5TA 3VRHA 2RD2A 2A5YB 2AR9A 1DTEA 2CN1A 1V5WA 4GHWA 1Y8QB 5FHQA 2HUNA 4JLSA 4XEUA 5G0VA 4BFZA 4Q4AA 2EJUA 2M32A 5GJCA 4HL6A 4LYFA 2VDUE 4R0VA 1NJ5A 2XBLA 5DP2A 1G8KA 3PDIA 4Y0NA 5LCXA 1B41A 1S6YA 2V6FA 3T0FA 2VDPB 3MS7A 1C4XA 5ETJA 4QRDA 2O8NA 2VP6A 2QAIA 3C7CB 5DNVA 4EFKA 1VKNA 1RAIA 1XZHA 4BZZA 2IHTA 4QFBA 2GSDA 1T1EA 4XDHA 3DZDA 3HCDA 4HLCA 1J0BA 3KUUA 4IHJF 1NVDA 1E9RA 3CCCA 4YDSA 3NBUA 3T5CA 1R1DA 3BTVA 5FTJA 2VJLA 4ZEXA 3PNKA 3S40A 3TDNA 5B30A 3FTDA 1QMPA 4OGFA 4BIMA 2H92A 2C7QA 2BSQA 2O8BA 3LY9A 1GN9A 4RDXA 1GPKA 4BDSA 5HKBA 3LCRA 1JBQA 4C76A 3QVSA 2C8KA 3ET4A 4S05A 3LUFA 2D6FA 5DH9A 3FAKA 5DW0A 1TADA 4OP1A 5KYVA 4XJTA 3TWOA 4KU4A 2RAUA 4LDZA 5D00A 5HK8A 2NU8B 2OZVA 2HJSA 2QRVA 5KQMA 1JDPA 1PV2A 4M0MA 3TSOA 4G23A 4R81A 4KAXA 3G49A 1VE9A 2RC6A 3NIGB 1GL9B 1G7CA 4XUCA 3FB1A 2I03A 5FBWB 2HF7A 4F92B 3EC1A 3V1YA 4D98A 1SAYA 3D6UA 2NWQA 3K20A 2IP4A 3BD9A 4DRYA 4YUZA 3QE2A 2JFFA 4K6HA 5EIBC 1AQUA 3QUTA 2IE0A 4HUJA 4BNUA 1T9GR 2F9MA 3IEPA 5AOCA 3G9ZA 4MH0R 3O4HA 2QT1A 1Z5VA 3TVDA 2EARA 3WA7A 3AEUA 2Q6KA 1PFKA 1P6QA 4M9SA 1SPXA 1O58A 1BDMA 1J0AA 1TUEA 2F4NA 3NTOA 5D7NA 5H3CA 3T1QA 4DLZA 5IYZB 1V45E 2FMTA 2OGSA 2CL7X 4QPDA 3TW4A 1PWHA 2JLQA 5HRCA 5L4LA 4DV1B 1OTYA 2EHJA 1EDOA 3KJFA 1V2GA 1JPUA 1GCGA 4AJJA 1P2GA 4UEWA 4PZ0A 3IEIA 3O9MA 4TQAA 1JZQA 1UC4B 4NWIA 3QF7A 2HJGA 3N2KA 2EBFX 2NPIA 3ZQ6A 4BNMA 3HBFA 2PLWA 4CEJA 3A31A 2D1RA 1NF8A 1L1EA 3UAYA 4L8WB 1UDAA 4M0UA 1UQTA 1JJVA 4M54A 5KOJB 2EGGA 5CNKA 3SN6A 4M88A 1J21A 1UIMA 5ECWA 1X7XA 1SBIA 3IILA 3C6ZA 2I1LA 3DTVA 5SZKB 3MMXA 4DG9A 3P19A 3AEXA 1CUVA 2ZYUX 1XG5A 1ZG3A 4TLAA 5DTIA 3WY9A 3IMKA 4QBHA 1LLFA 2IHUA 2V7QD 5TT0A 4BB0A 3LRPA 3I8XA 4WACA 3WXBA 4A2QA 3QLVC 1E1QA 3GGOA 3C8MA 3O3CA 3VAZA 3T5AA 1L4YA 1ODJA 1N2BA 3U3MA 1RC0A 3HMQA 4BZQA 1Y1RA 3N7UA 5IJ9B 2GBLC 3MCAA 1DBIA 3COVA 3EIUA 3DBRB 1E3WB 1R2QA 1UP7A 1FX0B 3LHDA 5TEVA 1VQ1A 1CK4A 1JQDA 5CHYA 3PGVA 1UFRA 3V4VB 3L9WA 2ZZKA 2DPLA 3R7BA 1ULBA 5JCOC 2VRBA 4R7GA 5JS6A 1FS4A 4R83A 2PH5A 4CJXA 5CLJA 1WPQA 2AK3A 3L9XA 3OY2A 4U7JA 4BATA 5IT0A 3EMKA 3MJRA 4MR7B 4RM3A 1FDUA 1XEXB 3CGGA 3LYUA 3PL1A 3I5UA 1TQ6A 1E63A 1UBCA 3W4IA 4D79A 4FEEA 3G1TA 4BVKA 1O9HA 4MV9A 4Y6SA 4M76B 3OT5A 3W5IA 1PR1A 4UQOA 1XRQA 3OOYA 1E61A 4JUBA 3O4GA 5TQ2A 1I1QB 3EARA 1L1FA 4X1IA 2X2FA 4A0FA 3B1KA 4GLLA 1J22A 4WH0A 1JV2B 2D54A 2HAEA 4OXYA 3D64A 4HUQB 3D6FA 1KU0A 1AV6A 4U0JA 3SMVA 3GROA 5E95A 3MK31 3NWJA 5BMVA 2V5VA 1USIA 2CVZA 1RYEA 2FG5A 1THZA 2W93A 3U40A 4ZHQB 1IIRA 2N46A 1TL7C 1OTXA 3X2SA 2XTZA 2PGLA 3KZVA 4FK8A 4JZYA 1B6RA 5FTNA 3ETGA 3V4RA 1JLKA 1F2VA 1CRZA 1VHTA 2OWDA 2G7ZA 2WJHA 2TMGA 3U7JA 2P6PA 1PL7A 4D9NA 1I2ZA 4PF1A 4AJPA 3CG0A 5H3LA 4A91A 1JR3D 4MYSA 2XA1A 1YB5A 5HR5A 3QYFA 5CMLA 3R7WB 3UPUA 2HQBA 2O1EA 4HX9A 2DECA 3MT8A 4D3XA 3THOA 3ZJUA 3Q0IA 4UUAA 3IQHX 4A0SA 5C7OO 1WQ3A 3UT5B 1Y6FA 3QW2A 1KVTA 4XGNA 4ALLA 2YUIA 3KQVA 1ZQ9A 1QZXA 2BGWA 2I4TA 1DE0A 3L8YA 1GPNA 3K5PA 5LOVB 3BFJA 3HCCA 1G1AA 1H6AA 1YRWA 2BTQB 2CF6A 3SXPA 2V5UA 1E2PA 4G1FA 3EXHA 4RH1A 1KI8A 1QHSA 3DR3A 4UKDA 3GA0A 5E1DA 4DXDA 1JFLA 1ZGGA 1GRQA 4LXXA 4MJXA 1BDBA 3WMFA 1Z22A 3ILYA 1CR4A 2FCAA 2Y1OA 1UWVA 4IZHA 4UNNA 4OI1A 3T94A 2FMFA 3NRJA 4BRZA 3AHCA 4ZAGA 1NLFA 2IU6A 4QUHA 1NLYA 2R4QA 3UFBA 3FR7A 3IQXA 4YNBA 2VHQA 4BIIA 1Z0ZA 3FF1A 4RADA 1FUIA 4DRXB 1W9HA 5JTTA 2OCPA 4RJTA 2B8TA 3CX7A 4H1TA 3RFVA 1TW3A 1GGNA 4PCLA 2GD0A 4WOKA 2DWUA 3H5WA 4KLAA 4L5AA 5DYGA 1ZK1A 5A2GA 1JYFA 1VYTA 5DCLA 2YJNA 3DMNA 4DBLE 3DZ8A 4YI5A 5EVCA 5AJHA 2GAJA 4J75A 2PKXA 3KB2A 3ETEA 1LRLA 2VAXA 1TCBA 4LK3A 1RHUA 5E1OA 3V8QA 3KB8A 1XEFA 2PX2A 5FR1A 4BE7B 1Y5RA 3SKXA 2XZPA 4Q6WA 1TEXA 4R1UA 3ZDRA 4F06A 3MTJA 4R8VA 1TTTA 1CUIA 2QBYB 5KKAA 1X87A 3CJRA 4WRRA 2WF6A 1JDJA 4Z7OB 1YS9A 5KAMA 3BOSA 4F04A 1Y5MA 2Q8PA 1E1DA 1SHKA 4KPUB 1BVYF 1F8FA 2HQRA 4AO8A 3JQGA 2VQDA 2HNBA 3OEHD 1U3FA 4P98A 5G41A 5K3CA 3SBDA 3W5DA 3MJEA 1B00A 3FZEA 2DUNA 4QDKA 4FT2A 1XVVA 4NCHA 3IP9A 4Q16A 3DXYA 1AUXA 2QX4A 3UGQA 3OE1A 5FFMA 1CJUC 3WWZA 1YXMA 3DE6X 4NZMA 2EX4A 2ZWIA 1YAJA 4ZT2A 2EF1A 4WV3A 4KX5A 2IXBA 2Q6TA 2ZRDA 4IDPA 1FTWA 1I32A 3Q9NA 4LGMA 3QEBZ 3T7JA 2ZQYA 5FJJA 1XMXA 2I2FA 1XAJA 3HB0A 4MGHA 2CLIB 3I0MA 3J7TA 4JLDA 3DDSA 3L8CA 5JMTA 2VS1A 1V7CA 3L0ZA 1AGNA 2H5EA 3KUKA 3MCZA 3PWZA 1O5TA 4Z4HA 1A72A 4ZOBA 1K98A 1FP1D 1AKTA 1TAHA 3ND6A 4LXYA 2YJ5A 4EHFA 4R71A 1YVPA 1XB2A 4BO1A 2EW8A 4MTCA 3WWDA 1P29A 4O29A 3T35A 2ENWA 2QN6A 4P3KA 4ZI7A 2VDJA 5DBGA 3VAYA 2L69A 3S1SA 3GVIA 3I2KA 1BXKA 4Z0TA 1QOQB 3CUVA 5A6VA 4EH1A 1U9CA 1I5RA 4GD3Q 4RD6A 4MB2A 5JQGB 4LTMA 7ABPA 3ZCTA 2HYIC 2JRCA 4YIHA 1JNXX 2AC7A 1XNJA 3PRYA 1EB9A 2WA2A 4ZQHA 2C97A 3UVEA 3R09A 4XXHA 1AOXA 2XYQA 2ZB4A 2GN6A 4LZAA 2H31A 2IZ1A 4M22A 2DTDA 5AI0A 2C9YA 3MJDA 2I4IA 2WTNA 2IEBA 3QEJA 4GOMD 2Q5OA 1HDYA 4HY3A 4RTQA 2GFQA 4C7XA 4DSTA 3BMCA 4ZV7A 2R8OA 1FJHA 3OQ6A 4B85A 1XD8A 3A4YA 1DADA 3QNWA 2IQIA 5DN6D 1LDNA 2B0CA 3OIUA 5LLDA 4UFOA 1JALA 3ZWPA 1JN0A 3IDOA 5G53C 1UZUA 2VAWA 3WQSB 2WU8A 4MB0A 2JCVA 1CVIA 4PICA 4CYMA 1JQ5A 4RV9A 1V1RB 5F4BA 3SIWA 3RSFA 1W5BA 3IHTA 4MS3B 4F6CA 2PQ0A 1IH8A 3FH0A 3W2EA 5GONF 3O2NA 1FDOA 1K66A 3P8ZA 5B1IA 1W0KD 4QPJC 3DE0X 4EP1A 4TQGA 1XMIA 1T1RA 5B4TA 5JANA 4JJFA 3W2GA 1ZOSA 4F9FA 2ZYWX 2L0XA 1SUBA 5B3JA 3B82A 2M98A 3CW8X 4UATA 5DI9A 2C04A 1P9LA 5E7QA 1TKAA 1Z08A 3QU7A 1WL8A 1Y5LA 1AGPA 2Y1DA 4I2NA 2BFAA 1ZIXA 4HQOA 1E7QA 4YACA 4RTKA 2J3QA 5LIRA 2UZ1A 2GA9A 2WIBA 4C0AC 4KSYA 2DT5A 4U7WA 1NMEA 1LLUA 3E2PA 5J4VA 2F90A 3BQMB 1EZ1A 3IJEB 3LKDA 1WVGA 3ZOZA 3DB1A 4G8DA 5BV0A 3CRRA 4P2GA 1D5WA 3K0CC 4M1SA 2OZLA 3K9QO 1KDVA 4KO1S 4RA9B 1KFCB 3DYVA 1QO7A 1FFDA 1Z2PX 2AN3A 2BP7A 2AUNA 2WZCA 5T4FA 3KLOA 5HUJA 2HW8A 4EI2A 1ZYUA 3OP1A 3NGLA 1CQJA 4GPIB 1DFHA 3DEAA 3G59A 3KYCA 1JAXA 1SOAA