2B6HA

Structure of human adp-ribosylation factor 5
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
171
Chain Sequence
RGSLFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords ADP-ribosylation factor 5
publication title Structure of human ADP-ribosylation factor 5
rcsb
source organism Homo sapiens
total genus 57
structure length 171
sequence length 176
ec nomenclature
pdb deposition date 2005-10-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2b6hA00
4E22A 4JLPA 2OFWA 2GF9A 1QVAA 4PHGA 2PEZA 4A2PA 2PCLA 1W5SA 2CE7A 4PZLA 4NDZA 2V9PA 3MWJA 4TYQA 2ZRIA 1DAFA 5JECA 2QE7A 1WE2A 1M1YE 4B32A 4IVRA 2QBYB 1R4AA 1HH4A 2ZUBA 3SI7A 3BFKA 1LTQA 1GKIA 4Q19A 3ZZ0A 4TYNA 3OFND 3B1VA 1OXXK 1G7RA 1Q21A 3OEHA 5BN5A 3AGPA 1P2VA 3TVTA 4ZI3A 1VCOA 2QUZA 2F1HA 1AA9A 1VTKA 3AP2A 1BKDR 4QGHA 4B3FX 1HY3A 5LBIA 2XSZA 4URXR 4AG5A 2GK7A 4MYUA 5C46F 1XX6A 1TQDA 4HDCA 2Z6VA 2OV2A 5FBQB 4LBVA 4PC2A 2ZETA 1N6RA 2VP9A 1G6OA 3W6OA 1KZ7B 2J0UA 3QENA 1NLFA 2WHXA 4R71A 4N0DA 3UWKA 3WHKA 1CR4A 1ZNZA 2RGNC 2R8RA 3QPVA 4Q1CA 2N42A 4PQFA 4JT4A 2RGXA 4H9GA 1E9RA 4JL6A 3SYNA 5CITA 3PEWA 5KTYA 4OKSA 1DAIA 2BJVA 2G3YA 3DMNA 4Y0AA 2CJWA 1OIWA 1XCMA 3Q5DA 3RLFA 2Q6TA 1XMIA 2VYFA 1CRQA 4BFTA 3KJGA 2GWHA 3KUDA 4Q1DA 2ZU6A 2FSFA 4BRWA 4RD0A 1TU4A 1XEFA 2JJ8A 4G1UC 4F91B 2A5YB 3L8YA 3NHAA 5BYJA 3B1XA 2F6RA 1Z2AA 2RGBA 1RZ3A 3PEVA 4FINA 2J5XA 1MO3A 2XITA 1IXSB 1CBUA 1W0KD 4HYYA 4JMPA 4RD2A 3OIWA 1PLJA 4ZDWA 1CR1A 3OEEA 3V9PA 1P2UA 1N0UA 3B7GA 4II7A 4AKHA 1Z0KA 3THWA 5EZ5A 1R8SA 1NBMD 4JSTA 3LW7A 3VR4A 3GLGE 3NBYC 1T0JB 4EJSA 2W00A 1KK1A 5G41A 3BXZA 2PLFA 5TY0A 5GJWC 1E96A 3LBIA 4B3BA 3NDBB 1ZC4A 6Q21A 3QOFA 1G19A 1VG0B 1XTRA 2X2EA 4MKHA 1G21E 1JPJA 1YZGA 4L4UA 2ZRKA 2O8BB 2YJTD 1IONA 1ELOA 1G8FA 1W4RA 2XZOA 5B64A 1E0JA 1MABA 1SGWA 4V0OA 3PXGA 4LBWA 1II0A 4LC0A 1JQJC 4XTRA 2ZU0C 1I2DA 1XDBA 3A58B 4AG6A 4HEJA 2VF8A 1N5KA 4PC3A 3WP1B 5A0FA 3TUJC 1ZU4A 4FCWA 4IVPA 2DWPA 1DO2A 2WICA 4C30A 4LZZA 3TNFA 4HSEA 2B7CA 2Z5FA 2V3CC 3LLUA 1KI1A 1HV8A 4AC9A 2R6AA 3FHOA 4O25A 4DLZA 2ZI9A 1GILA 3TGPA 4PO1A 1TF7A 1HUQA 1KSJA 2GDJA 4WXPA 1NG9A 1OFIA 5SZHB 1M7BA 3X1ZA 1E2GA 1FQJA 1H8HA 2AD1A 1DG3A 1T3LA 1JBKA 5HPYB 1TEVA 1CULC 1ZNYA 5HCNA 4F7WA 3NBZC 4OHXA 3T1TA 1KY2A 1ODFA 3IPYA 4GNKA 4BZXA 4QC2A 3SYKA 4V0NA 5DN6A 4EKDA 2WTUA 2DWQA 1V43A 3QKSA 4JYBA 4NU0A 1XTIA 1BOFA 4LWZA 2WSMA 1WP9A 5EP2A 1TQ6A 4GPTA 1Q1BA 2IA5A 4ITRC 5EUMA 4Q66C 4BRUA 3QKUA 4HAYA 2GAOA 5DE3A 1W5TA 3A1VA 4YMSA 2GCOB 2JGNA 3IQWA 5FFMA 4PPFA 2OCAA 2UKDA 3W3ZB 3SC3A 1Z0DA 1KO4A 1OW3B 5FTKA 2QTHA 1NI3A 1X3SA 3VTKA 2NPFA 5J40A 2FPKA 1KK0A 4WAUA 4US1R 1PZNA 3VR3A 1TQ4A 1ZD8A 2WAYA 4ASUA 3JVVA 4B3XA 4TL9A 4KBFA 1G7TA 3U44B 3LQQA 5D3MA 4AYXA 2Z83A 1W4BA 1I4LD 2CL0X 3FKSA 2R6CA 3HJNA 3SFZA 1OXSC 1A1VA 2RGCA 3KKNA 4P4TA 4M0LA 4P0TA 1RRCA 2FEOA 3DL0A 3R7WA 2ZIAA 2C95A 3B9PA 4D80A 4LOAA 2X1VA 2YNMA 4ABYA 1FMLA 1BMFD 2CBZA 1AS0A 2OG2A 1KDOA 5CYPA 1RKBA 5GJCA 2OLJA 1W2HA 4D0LB 1B23P 5IRCD 2KE5A 5AJWA 3CRRA 4XD7D 4D81A 4JLJA 1LVGA 3PG5A 4HAUA 1XJ0A 4DCVA 5DIFA 4CEHA 3VKWA 2CLSA 5JZVA 3NDPA 2N1BA 4PSKA 3L43A 5DSZA 2QTFA 2VF7A 3AF3A 1Z29A 2BHRA 2F1RA 3SQWA 3GJ8A 3AF4A 2QAJA 2BVNA 2CVFA 2FFBA 4PFSA 1IM2A 4YC7A 3AVWA 1P6XA 1OSNA 1ZBDA 1QG2A 1ZVQA 1C9KA 4NMMA 3BB3A 3ZIAA 3ND8A 2WJVA 3AUYA 4MRVA 3SNHA 3KJEA 2RHDA 3GLIE 5AJVB 2BCJQ 2QENA 2ZRMA 5EZ6B 3PUXA 5E4FA 1XZPA 4DLYA 1A82A 1E79A 3LVQE 1E9CA 4OYHA 1LV7A 5AUQA 2VTKA 4LK2A 5CYOA 3VKHA 4O3MA 4U7DA 3CB4A 4DHEA 1U2RA 5SZJA 3IHWA 2JCSA 4EPXA 4CEJA 2Z4SA 5BYKA 3M6AA 4XIGS 3CRW1 1NJGA 2BM1A 2D4HA 3NBFA 3GLFA 2SHKA 3TLXA 3WRYC 3FMIA 4D6PA 2QROA 4B2IA 4P33A 3F5FA 2UZ3A 4RZ2A 3UMRA 1T4GA 3ZLJA 1F2UA 1N2CE 1HTWA 1XPOA 2XGJA 5IK2D 3THOA 2PJZA 2YWHA 4G5RA 2IYSA 2Q0HA 4KJZA 1LF0A 1JEEA 1GKUB 1S1MA 3IBGA 1CJMA 2N46A 3DKVA 4DB4A 3R9XA 4HZIA 2GVDC 3EG5A 2BIFA 5KPDA 1IN4A 4DDWA 2CXXA 3K1JA 4P32A 4EPRA 4XTCS 4DCTA 4CW7A 3RSOA 3P26A 1N6HA 4BE7B 5AJXA 5L3SA 3T5GA 2ZJ5A 3CONA 2E87A 3W9YA 2PMDA 1SXJA 1B0UA 4QJ4A 3VNUA 2JLQA 3SS8A 2D7CA 4DC9A 3ICQB 1UKYA 1VCMA 1G5TA 2EVWX 4YXWD 3HYRA 3UANA 4MRSA 1DE0A 1ZRHA 4WVFA 2BBSA 1Z08A 1EFHA 3IGFA 4X8OA 3THYA 1XMVA 1QHHB 2P2LA 2ZRNA 3CF0A 4TMVA 3UWOA 3TUZC 2CCGA 1MRNA 1N0VC 2OCYC 1TU3A 4PO9A 2BKEA 3GJXC 3Q7QA 4NH0A 4B71A 1RC8A 4F92B 3CPEA 1LW7A 4TLCA 4QGGA 1XMSA 5HCIA 3REGA 3R7WB 2XTMA 4A4DA 5DHFA 2PT5A 5KNCA 3E70C 4Q9HA 4UNSA 1Q1EA 2XXAB 3F0TA 3B8HA 4NYIQ 2TMKA 2ZRLA 2FNAA 1FOEB 4OHWA 1Q0UA 3T34A 1G9XA 4ESVA 3U7HB 3GJ5A 1GP2A 3LX8A 1KMHA 1QF9A 2GJ9A 4R2IA 4KYUA 3NHBA 1RJ9A 2GXSA 3PJRA 1NMXA 1VYUA 3FFBA 3AGQA 3LV8A 4ESHA 1G18A 4KODA 1N3BA 2OFOA 1KO7A 4DUGD 4FCVA 4TT3D 3MMPA 3VR1A 4DLRA 2W6JA 1TEXA 3Q85A 2AWNA 1AK2A 4JL5A 3NBXX 2OSBA 3ASYA 5FBWB 3R8FA 2JLRA 4UNQA 2B21A 3TAHA 4W5HA 2FMXA 3F3YA 2GCNA 4DKXA 2A3RA 3AP1A 1E6CA 3DKPA 3IILA 4QJ5A 3DVLA 2QPOA 1J7KA 1EX7A 3DOFA 4WZBE 4IW3B 5JSZA 3U7GA 4MDFA 4KSBA 2QTVB 4GOKA 3QSYA 4PPQA 4I1UA 4IRUB 1X8KA 1E2FA 1E2LA 4IFEA 3RVBA 1G17A 3SDZA 5C1BA 1W48A 1A5TA 3K70D 3GP8A 4RY2A 2XAUA 3TE6A 2J3EA 4AI6A 3EC2A 2XZPA 3RRNA 5AUNB 3QI2A 4V0MA 1NP6A 1F3OA 2A78A 2AL7A 2OESA 3IO3A 2H5EA 2YKGA 1VHLA 5C18A 4Q1AA 4TQ9A 4G5QA 3SBEA 2IYUA 2OE2A 4QM6A 3AF2A 2FFQA 4JBYA 2YHSA 2OCBA 1IJEA 2ZUCA 3AVQA 1W2GA 1HE8B 4N0EA 4W7SA 2XX3A 4CF7A 1Q3HA 4U5XA 1XPRA 5F98A 3W8NA 2J0VA 1DS6A 1GITA 5J4VA 4HATA 4EIWA 4RFSA 2IS4A 1XCPA 3GCGA 3B9QA 1WB9A 1VIYA 4DDTA 2ZAOA 4ZDIA 5FOTA 1G4AE 1G8PA 2QE7D 4LPSA 1P2TA 4DLXA 5IT5A 1GIAA 1G8GA 3R9IA 3UMFA 4JLBA 3EZ9A 2FWRA 1DO0A 1GNRA 2EWVA 4ZCLA 1Q1ZA 3OEHD 4G3XA 3CWQA 4LDJA 5H1YA 1SXJB 1Q20A 1QBKC 1HA3A 4OI2A 4ILEA 2Q3HA 2OT3B 4A2WA 2ZJAA 1JECA 3AM1A 2ZR7A 2XSZD 3QJYA 4JLVA 4LPKA 3FOZA 2V55B 3ZJYA 1CJUC 2HDNB 3BH0A 5JWHA 5FPKA 5FBLB 1ZJ6A 1X8JA 3O47A 3SQXA 2VA8A 3THYB 4D26A 1KZGB 1NVXQ 4GDFA 3OF5A 3CNNA 2GZAA 4I1SA 3CRMA 2DFTA 1DADA 3ASZA 4G5GA 4LY6A 1SXJC 2ZROA 2B92A 4E09A 3LNCA 4IDPA 4ZO4A 2HXYA 1KI6A 4DSNA 2R6GA 3AVXA 2H57A 3PFIA 2ZI7A 4AKEA 1X1RA 1MH1A 1XBTA 5TMPA 3RS0A 1XB2A 1H65A 1U99A 5FUXA 2QA5A 4P3YA 1WRBA 1KMHB 2BDTA 3KXKA 1JAHA 2NPIA 3NC1C 3VHXA 1ZUIA 2IYXA 1PV4A 3EZFA 3WYGA 4Q7LA 4C0AC 1CF4A 3AKEA 4HB2A 1ZAKA 4YDSA 1COWA 2IXGA 3OEED 4L5BA 1U98A 2ORIA 1VG8A 1NY6A 3CX6A 4QNMA 4CGZA 3NH6A 1ZM9A 4B33A 3R20A 1VYVA 3RC3A 8OHMA 2F43A 2G9NA 4TMTA 2JDIA 1E69A 4NZYA 2ZRPA 1AKEA 3A4MA 521PA 3X1WA 2O8DB 4Z51A 1G1MA 4Q1EA 2FOLA 4GI7A 1G7CA 1W4AA 3RRZA 1IN7A 3TR0A 3FPAA 4DWJA 2HUPA 3K0FB 1E2KA 4LGMA 1TF5A 2GF0A 1JQLB 1FW6A 1P5ZB 2HV8A 2YWGA 3EZ7A 4JKIA 1YVDA 4DCNA 4BZPA 1YZNA 2QBYA 1OB5A 2QM7A 1DBSA 2GJKA 4C0KA 1Z3IX 4QBFA 5HR5A 2C8VA 2WAXA 2VBCA 2OUKA 2RGNA 1D2MA 1NNEA 4CRWB 2J7KA 1F6BA 3HWSA 3PVSA 4PAQA 2OBMA 5FR1A 221PA 1NG1A 1XFAA 1SQ5A 2WJIA 1AZTA 1EWRA 1H8HD 3K09C 5EE1A 2G6BA 2X2FA 3I73A 3RSLA 1KY3A 1MV5A 1U8YA 4IXMA 2RH5A 4LX0A 4DLWA 4D25A 3VX3A 1UBGA 1QHGA 4Q1BA 1ZP6A 1Q44A 4ZI2A 4UNRA 3PUWA 5DN6D 1RRPA 4NYJR 4BLTA 3PR1A 2NG1A 1EG7A 1QG4A 2ZS8A 3FHTA 3B82A 3GLGA 4JLKA 3IHLA 4TYPA 1OFHA 2E9SA 2ERYA 4XOIA 3QF4B 4XWAA 1ZM7A 2BMJA 4FN5A 1GRNA 1R5BA 4MITA 3FGNA 5FUYA 3LQRA 2J7PA 4FI3C 4BEBA 2WSSA 3P20A 3VKGA 4NBSA 4PSVA 1WBDA 1I4TD 1E9AA 2C9YA 4XVQA 5JEEA 3IQXA 2ZYTX 2KI5A 3BFXA 4M9SA 4WXRA 2ZM5A 2GBLC 3WNDA 3BIFA 4M9QA 1RVDA 4US0R 4Z1MA 4BFUA 4QBIA 3KQHA 1TADA 4OI1A 4C7OB 5FTMA 5B58C 1D5CA 3GJ6A 2YYZA 2IEYA 2WJJA 1YZTA 3EZ6A 4YMWA 1NKTA 2GAAA 4EPYA 1ZC3A 5FBRB 5J4YA 1LS6A 4ASUD 4MYCA 3OAAA 4IXNA 3Q5EA 1XTQA 1XNJA 2BMDA 4KFUA 3CKLA 2C98A 3FKSD 3GEHA 3QIAA 4JLDA 3BC1A 3I3SR 4LJYA 4JLMA 4PHTA 5EE0A 2O8BA 5EXTA 3T61A 1PJRA 5FOUA 3T1QA 3TK1A 2RGGA 3NG1A 4GZMA 4B2LA 4DBLC 2ZITA 4EFLA 2QZ4A 3B1ZA 4XVUA 2C9OA 4XWKA 2XZLA 2HJGA 1XWIA 3PUVA 2J59A 3QUSA 1YE8A 3EPJA 4LSGA 2W58A 3K0CC 2XOKA 4JLAA 1Z63A 3CF2A 1Z83A 1CU1A 4YONB 1JAIA 3EXAA 3WNCA 4BLQA 5JJKA 5CJ2A 2VSFA 3D6TB 2Q9BA 4LC1A 4M1SA 4QBHA 3FHCB 1ZINA 4IOMA 4PAMA 5KO2A 1ZMXA 2FPMA 2QRZA 4WOPA 3EIHA 2EYUA 1M74A 3L8ZA 4GP6A 1R5OA 5D3QA 1VYTA 2V8OA 1GL9B 2ZRGA 2V1UA 4M4SA 3CO5A 4YLGA 1HT2E 4YMVA 4CT4B 1MO5A 2P5TB 2RCNA 2GZHA 1V5WA 4MUBA 3ZIAD 2VP4A 2GZDA 1KNXA 1K6MA 5AUPB 1R5NA 1S0UA 4DLVA 2IF0A 3KFVA 4IOJA 1XP8A 1E79D 3P1JA 1Z47A 1FP6A 2A7QA 1JJVA 1LF5A 4B3GA 2ZSAA 3FYHA 1R6BX 5JBQA 3WYFA 2MSEB 1G8HA 3X1XA 2ZUDA 1NVVQ 4K46A 2JLWA 1YZKA 1T3SA 2VO1A 3A4LA 3AV0B 4FWTA 2WMOB 4DLSA 3GEEA 4HLUC 2W2VA 2IHBA 2VLIA 3BJIC 2GCOA 2D2FA 3LFUA 3C16C 2I3BA 3CZQA 1D9XA 4NE2A 2IWRA 2Y8EA 4CVNA 1ZCAA 4V02A 4URYR 2VSOA 4UXIA 4GMDA 2YC2C 3QVVA 2JASA 4LHZA 5CB8A 1W7AA 3G5UA 3VU9B 3GQBA 3GLGB 3RS7A 3EX7C 3EASA 3RDPA 3I4LA 1EFTA 3EPLA 5JJIA 4MYHA 1UPTA 4KVGA 3U44A 2PT7A 1N6NA 3CZPA 2O8CB 3L0IB 1NJFA 1XD8A 3I8SA 4URZR 3RNLA 5KDLA 3SR0A 2C99A 3ZVMA 1KO5A 2QU8A 3GJ0A 3L0PA 3C8UA 3CWZA 1UBFA 5CLLA 5FL7A 3AVTA 4MKFA 3HR8A 2IF2A 4ACAA 4ZIRB 4J0QA 5JI3E 3KKPA 2ONJA 1N5LA 1SXJD 3EA0A 4TTQA 2P5SA 4IHQA 4MKIA 4L15A 1OYWA 4DEXA 1KAOA 1AZSC 2AK3A 2W83A 3UPUA 3IUYA 3GLIA 1QHSA 1E9BA 4Q9LA 3FWYA 3LBNA 5E7MA 4PC1A 1YQTA 2CNWA 1JB1A 3U3RA 2D06A 1W36B 1FX0B 2ZI6A 5EXSA 5TV2A 4NYMR 2DCUA 5IDVA 2O0KA 1N5JA 5J4KA 4BLPA 4P31A 4JVLA 1OHHA 1AS3A 4RCYA 1HQYE 5UKDA 1FNNA 1GL6A 4B75A 3O8BA 4JLNA 4A8JA 3PEUA 3K9NA 4C0SA 1U0HC 2GXAA 4UNNA 3BOSA 4PZZA 4WW0A 3ICEA 1UDWA 5EE5B 4ZCIA 3AUXA 1W36C 1XTKA 2PX0A 1G3QA 4XH9B 2C96A 4PQRA 2R2AA 1CR0A 4DDUA 3N70A 1NRJB 3C15C 3LVRE 2P6NA 3OIYA 4DT1B 1OV4A 4JKYA 1R2QA 1YR9A 2REBA 2W6JD 2GTPA 2OCPA 3LXRA 1N6IA 2QQEA 1CLUA 2D2EA 2ZJ8A 1DVRA 1JI0A 4AYWA 2QQ0A 3CNOA 3NWJA 1BO6A 2Q3FA 3SU8A 3KKOA 3TIFA 4KYIB 5F9FA 1G41A 3UMSA 2ZI5A 3KQUA 4EDHA 4DCUA 1II8B 1AGPA 1NKSA 1KO1A 2JATA 2OO7A 3UG7A 1SVWA 1DELA 1YZQA 2C78A 2QSZA 3N5CA 2WWFA 3KKQA 3PENA 4TMXA 3BGWA 3QNUA 1Z22A 1KNQA 2NIPA 2XTZA 4TLDA 2ZJOA 4WBSA 3O8CA 5FBVB 2RGEA 5G40A 4M22A 3K9LA 1WXQA 3KFXA 4WZAE 4EPTA 2I4IA 5L3VA 1W0JA 1IQPA 1HE1C 3X1YA 721PA 2A5JA 3WY9A 4IDQA 4TYWA 2GEVA 3BORA 1GAJA 3F8TA 5GJBA 1J90A 1DAKA 2ATVA 4BFVA 2YWFA 1YKSA 1OFTA 2Q3MA 2D62A 1Q12A 2GVZC 2KWIA 2YV5A 3EARA 1T0HB 3NVAA 3A6PC 3EAQA 3H2YA 4LHWA 2P6RA 1C1YA 1SVIA 2IXFA 2CL7X 2PEYA 5AK0A 3CH4B 2WWHA 4IDHA 3S1AB 4B47A 1S3GA 4IOKA 2FSIA 3BS4A 5DNYB 3Q7PA 3QXHA 4IJMA 5CK5A 5LDDC 3GFOA 1KI8A 2ZE7A 1XEWY 4MUAA 1QHHA 5DLQC 2VHTA 2J41A 1AM4D 4JLOA 2DHRA 4KLZA 5BN4A 2ZVQX 2ZYUX 3VFDA 1J8YF 1CKEA 2IYWA 5K8UA 4UKDA 4Q4AB 4M1WA 2MSDB 4Q9KA 4D2IA 2ODBA 2C5LA 4Q4JB 3ZH9B 1N6OA 4Q48A 3LD9A 2XXAA 4O2RA 2IYZA 3HDTA 4A6PA 4Q9JA 1XXHB 5GADl 3QKRB 3GLIB 1PUIA 5KDDA 1Z2CA 4I1OA 4WIAA 3KDSE 4V03A 4Q01A 1UDXA 1P7CA 3A4NA 3PV0A 2YZ2A 4TQAA 4C0HA 2O8EB 4OK6A 4TYYA 1HYQA 2IUUA 5KSOA 4OK5A 1TMKA 1O3YA 2C04A 3LAWA 3ZZUA 4FMDB 1IHUA 4LYHA 2DBYA 1U8ZA 1AJEA 2BEJA 1Y63A 4RFVA 3K0EA 2BC9A 4A8JB 1CJKC 1Z6AA 2NO0A 1US8A 3WHLA 4A82A 1DPFA 4FMDF 1UAAA 5CDFE 1RYHA 2BM0A 1DAMA 1G3MA 1XXHE 3AB3A 4U00A 2Z43A 3U3OA 5P21A 1UEIA 3AKCA 1SKQA 4B44A 3BRWD 3CW2A 1NIPA 2AX4A 5JI2E 1IXZA 3IBYA 2K5UA 4LHYA 1T3HA 1KYIA 2QSYA 3TQCA 1NN0A 1WF3A 1ZM3A 2ZRFA 3DMDA 3GJ7A 1COWD 2RMKA 3DHWC 2G1KA 1L4UA 5C4MA 5HZHA 3KTAB 1D9ZA 1XMJA 2AHOA 2JJ2A 4A8JC 1OKKA 3TJZA 4ZKEA 2GKSA 1CEEA 3AF0A 1KJYA 3I32A 5DISB 3ZVNA 2GHIA 4BLSA 5E7JA 2JDID 2OLKA 1H8EA 4W5JA 2XNSA 2VHUA 3IKJA 2VSXA 3CNLA 2AKYA 3B1WA 3AP3A 4RD6A 4IVQA 1SHZA 4LHVA 4LV5B 1UM8A 4TSFA 3SYLA 3SHFA 2GRJA 5KSPA 2CL6X 4FCTA 2PZEA 3RWMB 1ZIOA 2ORVA 2HYDA 2DFLA 2O52A 4NCKA 3KJIA 5DYGA 2ZSFA 3TSOA 2RGDA 1DAEA 5JLJA 2QRNA 2ZAMA 5JWRA 1M7HA 4EPVA 1KDPA 1EFRA 4QJ3A 1XTJA 3ZYCA 3ZS9A 3G82C 1IY1A 5EE3A 3D3QA 4AY2A 4LCBA 2QN6A 3U6BA 4BASA 3W6PA 1RFLA 3AKYA 4AD8A 3EW9A 5CJPA 4PQYA 3BE4A 5EXXA 5EXPA 1OB2A 4IKEA 5BW8A 1HEIA 4D4LA 1XEXB 4LYJA 3ZZTA 1EGAA 3EC1A 2IEZA 2NO9A 5J4HA 1GNPA 2FN4A 3THXB 3KX2A 1F48A 2ANCA 4EAQA 3U4QB 1PLLA 2BCGY 4TLAA 1CP2A 3P32A 3WMEA 1YR8A 3H0KA 2CMKA 3A1UA 3U61B 4TN1A 4NONA 4Q18A 4KXFB 2JJ1A 1GNQA 2J7PD 2ZJYA 2WSSD 1KSGA 1TAGA 1DAHA 3V00A 2A30A 1VG1A 3NXSA 2Q9CA 2QP4A 4QGAA 4QKQA 4G01B 2CVHA 4B6FA 1VG9B 3ONWA 2R9VA 1VIAA 4LHXA 1LNZA 4TMZA 4Z1MD 4ACBA 4OHVA 3W5IA 2FGKA 2QMHA 4E5UA 1NF3A 1GUAA 1NN3A 3KXLA 4JBWA 3T15A 1Q3TA 4NYJQ 1D6JA 1MO6A 2QAGB 4JYCA 4L9SA 4M8NE 3RANA 4Q4HB 1US8B 4HUTA 1SKYB 5TXGA 3CPHA 1L4YA 3OAAD 1Q22A 3MJHA 3VX4A 2GESA 4RD3A 2O8DA 4LV6A 5LPNA 1ZCBA 3W3AA 3VNVA 3GEIA 4FWIB 4YDHB 1G3RA 4JVSB 3K0FA 1RE0A 1ETUA 2ORWA 4BECA 3TMKA 2JLYA 4UXJA 4QL3A 5TARA 2QAGC 2UVQA 4FXPA 1P9NA 4M21A 5JMTA 1W46A 3K09A 1IBRA 1JR3E 5SZIA 2REOA 2XOKD 2WKPA 4ZCMA 4NP6A 5TB5A 3BERA 1GRRA 1SKYE 1E9FA 1SZPA 5DHAA 3LA6A 2G0NA 3U5ZB 4BUJA 1EX6A 4B3DA 4Q7KA 1UFQA 2Z0MA 3PUYA 4G5SA 1E2MA 1E2PA 2ZJBA 1XD2B 2QG6A 1TF2A 3E2IA 3K0SA 3FB4A 3GLHB 4K81B 4K8OA 5KUTA 2X77A 5CB6A 2FFAA 5FPYA 2PLRA 4BQSA 3TR5A 5M04A 1G5PA 3ADBA 2GEDA 2ZRCA 2P67A 2IL1A 3L82B 4QNRA 4EPWA 3V4RA 4EQ6A 4KO8A 1Q57A 1Z6YA 1F5NA 4AKGA 3PUZA 1BIFA 2ZE8A 2CE2X 3QG1A 1X1SA 2P0EA 4Q4LA 3GFPA 4FMCB 5E95A 3UXMA 2AFHE 3VAAA 1WBBA 2XB2A 1UADA 1NN1A 3T06B 1XPUA 2GBLA 2ZR9A 3BAFA 3MRSA 3KQNA 2GCPA 4DSOA 4RKEA 5FTNA 4G0NA 4FMCF 4B43A 4B6EA 1KMQA 2O0HA 2ZSBA 3QF4A 1KJWA 3GLHE 2LWIA 1KO8A 2EFHB 2OAQ1 2IYVA 2ZSEA 4KCGA 3MJRA 3CR8A 4HUQB 3WRXC 1R0XA 2F3TA 1YZUA 2FEMA 5B2ZA 4S35A 2WV9A 3T35A 1VDZA 1W47A 1JXOA 1E2IA 3H1TA 4QOSA 1SVKA 2XJ4A 1GL7A 2WPDA 1XEWX 2NTYC 1GVNB 3TAUA 1E2JA 2WOJA 3SJAA 3L2OB 2IS1A 4Q21A 3JZAA 4A92A 2BMEA 1AQYA 4IFBA 2Q21A 2V6IA 5K8TA 4C7OA 1Z0FA 1X8LA 2W2TA 2OFXA 4KLNA 1NY5A 2QT1A 1CJTC 5FTLA 3LH5A 3C41J 4XSGA 3K0CA 4HZUB 2KB0A 4I4LA 5JCPA 2Z4RA 3OESA 4EFMA 4KFTA 1SVSA 2NMVA 2EU8A 3U6KA 5L3RA 2ZJZA 2VQSA 1N6PA 5FL7D 2HF8A 4UNPA 3WXMA 1FZQA 5E7IA 3ZQJA 2ZE6A 2VHCA 4HB3A 2IW3A 4JZKA 4QG7A 3LW8A 4R9UC 1E9DA 2WJGA 3PIRA 1FMJA 1Z0IA 5DYIA 2QP9X 3WBKA 1GDDA 3REFA 1E94E 2C03A 5JS7A 1GOTA 5EJEA 1NBME 2WZQA 2CNWD 3OZXA 2FE4A 1Z28A 2KJQA 1L7VC 3ZS8A 4Q9IA 2YOHA 1XJQA 1P60A 4B2PA 3Q9LA 4JVNA 3I72A 3U60B 2VP6A 4AIIA 3FMPB 1OHHD 2PH1A 3EPHA 2QMEA 4L8GA 1KI4A 1KSHA 5B57C 3ZD7A 2ZVPX 3QPWA 5FOXA 3T1OA 4NCIA 1P73A 4D4KA 4F38A 2IS6A 2V6JA 1ZD1A 1MOZA 4QGFA 5BN3A 1D2EA 2NGRA 3TRFA 4HLUA 1MO4A 2RHMA 1YRAA 4GZLA 2FV8A 4DZZA 3C14C 3QF7A 1DG1G 3JZMA 2WBLC 4NYMQ 1EXMA 5CLQA 3R9WA 5AJZA 4LYAA 4MYTA 1FTSA 4NL4H 1BYIA 4Q1FA 4I1VA 5HZKA 4M1KA 1RYFA 2QPAA 4A0FA 3TW4A 3K8YA 2F55A 4GFDA 3LDAA 4O0MA 2NQ2C 4O2LA 4EQ6B 5KYKA 1T8UA 4OQXA 1TQ2A 2H17A 3K53A 1GWNA 3I5XA 4M2LA 1P4SA 5FPTA 5J5CA 2DB3A 1NMYA 1G3UA 1TUIA 2OZEA 3B13B 4NYIR 3WYAA 4NCJA 1GG2A 5DI3B 1N0WA 5FOSA 3VU9A 4M1YA 2ZS7A 1YZLA 2NOAA 4M9XA 3A36A 4W9MC 2GJ8A 4GRAA 4HB0A 5G53C 3SJZA 2O8CA 5FL3A 1EK0A 2QEQA 1NSTA 1W0JD 2VL7A 1M7GA 1OXVA 2UZIR 1EESA 3W5JA 1A7JA 4KAXA 4BWYA 3BH7A 1E1QA 1T9HA 1ESNA 2OXRA 2CHQA 3UIEA 2EWWA 4MRNA 1N6LA 4HAZA 4UJ3A 3TW8B 2EW1A 1RPZA 1T6NA 1JJ7A 1KI9A 1SVMA 4TWZA 4TL6A 4ZIRA 3E5HA 5JRZA 3H86A 4KU4A 1VKJA 2EFEB 2ZSDA 3NIBA 1U8AA 1W4CA 4WA7A 5KNDA 2W6IA 2QGNA 4V0LA 4PO8A 4YMTA 4XVRA 2CK3A 2J46A 4RZUA 1T5IA 4P4SB 1P9RA 5DI9A 3SEAA 1FX0A 4OQLA 4C0QC 4B35A 1VCIA 3C5HA 4KSCA 4GL2A 4C0LA 2J87A 2FA9A 3RS4A 1E2QA 2JIZA 3EWAA 1Z07A 3K9GA 2ZPTX 4URUR 4D82A 2O8FB 1XD9A 2XTNA 2FG5A 3N2EA 3A1TA 3BBPA 5ANRB 5AWFC 3QG5A 1BS1A 2VHQA 4M1MA 4LJ5A 4TTPA 1L8QA 3QEOA 5KDOA 3TSZA 1KI3A 1E1RA 4A2QA 2ZR0A 2WWYA 2HF9A 2IBMA 4TLBA 1VPLA 3RS5A 2VPPA 1S3SA 3GFTA 3KZ1E 4Z54A 3ZD6A 2JLSA 1ZUHA 1S9DA 4URWR 2GA8A 4DT1A 1OH5A 5CK4A 1CRPA 1QHYA 1J99A 1AS2A 4IDOA 4D4MA 2G1JA 5HKKA 3T1VA 3IIKA 5HE8A 3LXXA 2CEAA 1QDEA 4KBGA 1QHIA 5K8LA 2YWEA 2GXUA 3ETLA 2PMKA 1U94A 5KOYA 4E03A 2ZJ2A 1M2OB 1II8A 3CRVA 3KXIA 4LYFA 3SJBA 2W0MA 3MUFA 3MWYW 3CUEF 3B5JA 3QXSA 1U9IC 2D3WA 3TH5A 1UBCA 1UF9A 1I4DD 4OI4A 4C9BA 4BFWA 3DZDA 2WWXA 3OE7A 4N3NA 1YHNA 2H8KA 2JJ2D 4FD2A 3SE0A 1IXRC 1OKKD 3G0HA 4AKIA 1OIXA 4C3ZA 5DGXA 3VHLB 1NN5A 5JFGA 1DEKA 3AH8A 3KUCA 2R6DA 2FZLA 5KSZA 4RKFA 1X86B 5EUQB 4M53A 3NH9A 3E1SA 1H8ED 5DH9A 1D2NA 2C77A 1QRAA 4F4JA 3SFVA 4LI0A 1KI7A 4NPHA 1Z5ZA 3UKDA 4OJQA 4DIDA 1E9SA 1HT1E 3KKMA 3QPUA 5FUVA 3S1AA 3AVPA 3PEYA 1DAGA 4TSFD 5FI1B 5C2JB 2CCKA 4B48A 3EWSA 1TUEA 1F2TB 1P61B 2QM8A 2IC5A 1G5RA 1XU4A 3P4YA 1SULA 1AQUA 3V4FA 2R65A 4DEYA 2LCFA 1IJFA 2IK8A 3MGCA 3WBJA 3FE2A 2ZRHA 1X6VA 3U2QA 3C4JA 4US2R 1J70A 1OLOA 2EFDB 5KU1A 3Q8XB 1J8MF 3RAPR 4Q4AA 4DCSA 1N6KA 2H92A 2MMCA 4B76A 1N25A 1UBEA 2V7QA 3J81k 4Q4JA 2FJUA 3FMFA 1EFRD 2G0TA 5CDFA 4RJLA 4F4IA 1YRBA 3LO5A 1XXHA 2I1VB 4NHOA 2D74A 4B74A 2ZI3A 2ATXA 3QKRA 5HE9A 1A4RA 1FQKA 2J9RA 2PX3A 1ZIPA 2BJWA 3CH5A 3QXJA 5H68A 3WP0A 3I5YA 3MFYA 5CIQA 2XNDA 4PSAA 1E4VA 5BXQC 1RRFA 2GJAA 2ONKA 3L0SA 3L0OA 1Z6XA 1SVLA 4HLCA 2O8EA 3MSXA 1KSFX 2QPTA 1Z8FA 1K5DA 3Q72A 1A2KC 2VP0A 1LFDB 3MD0A 3AF1A 2QP3A 1GZSA 1S2MA 2ZRAA 2J0SA 1GKYA 3RHFA 2BBTA 1E0KA 3KQLA 2DFNA 1JR6A 2V1XA 2AKAB 1MKYA 3FVQA 2JJ1D 2AK2A 3W6NA 1PUJA 1SVOA 5L3QB 4ZDKA 4OL0A 3R8CA 2A5DA 4MRRA 4D0NA 2NO1A 1M6NA 5G3ZA 1KHTA 2P65A 4HAWA 2VHJA 5G3YA 2HCJB 4Z8YA 1YU9A 4IEEA 1IOZA 3CBQA 3KTAA 3TKLA 2H18A 4HAXA 2WOOA 4BEJA 1P3JA 4TLEA 3K70B 3MCAA 4ZPXA 1OPXA 2JAQA 4R7ZA 1OH8A 4ARZB 4QHYA 2FF7A 4LJ6A 3I62A 2Q9AA 1UEJA 3DZ8A 3ECCA 3HPRA 1CS4C 5SZKB 1T8TA 2KBFA 1R8QA 2BMFA 4KFSA 2ZI4A 3EIEA 1TPZA 4OHZA 2REXB 3ADKA 1A2BA 4S2EA 3SZRA 3ZVRA 3CM0A 3WMFA 1OF1A 3OIUA 1P62B 4XWOA 1MT0A 2FSHA 1E32A 5DO9A 1NMZA 3K70C 4C4PA 1NLZA 3SN6A 3DEFA 1FTNA 2YVUA 1BYUA 2CHGA 1KAGA 2ZE5A 4DLUA 2FGJA 2BBOA 2VH5R 5FTJA 3AEZA 5JHGB 2AWOA 2HXSA 4JT2A 4X8HA 5H70A 4LBZA 1NVWQ 2AN9A 3IIJA 1XTSA 5FI0B 1T91A 1E2DA 5A5GA 4IOLA 4ERNA 3NC0C 5K8IA 1Y3AA 3MAAC 3ZVLA 4LJ4A 1LS1A 1OXTA 1YR6A 3BB4A 2HLDA 1MRSA 3EPKA 3CX7A 3HU3A 4AURA 2FSGA 2QNRA 1RIFA 2L0XA 3M4YA 2WMNB 3B2EA 5HTKA 2ZRDA 5IF9A 4TL7A 4Q03A 3X1DA 4BLOA 5EP4A 3FTQA 4RZ3A 3P27A 1ZD9A 5F2EA 4DDVA 3HPQA 1NIJA 3B60A 2J0UB 2G83A 4TL8A 4CIDA 2WWIA 4IEIA 1XEXA 1VECA 1E3MA 1R0ZA 4LV8B 1P75A 3THXA 2GJSA 3U4QA 1XRJA 3ND9A 2V4ZA 2ZQ5A 1E0AA 4PX9A 2CJWB 3D7MA 2X8AA 4CDGA 5EP3A 1E9EA 1EFCA 2BBWA 5LB4A 1ESMA 1S8FA 2ZYVX 5KHOC 1KKMA 3H4MA 2ASEA 4QRHA 1E2NA 3IEUA 2IYQA 2WPDD 3IEVA 2DY1A 2OBLA 1QHNA 1J2JA 3K9HA 1KI2A 2MMGA 4LRWA 3KB1A 1W44A 4Q7MB 3AVUA 4PZYA 4BFZA 2H16A 1XF9A 1JR3A 4OI0A 2QAGA 3U3JA 4EUNA 1P9WA 2CLCX 1JXMA 2WKRA 1OJLA 4Q4HA 4MKGA 5FPSA 4BGDA 3K0AA 3THWB 3OIVA 1OT3A 1KKLA 1WQ1R 2AXPA 4GSYA 4EJSB 2IS2A 4CYMA 3CIOA 2RKOA 3DM5A 4V0KA 4URVR 1FNMA 1KGDA 2JA1A 4MA4A 5FUWA 1DARA 3HR7A 2G77B 1NVVR 2WIBA 4B3CA 5JRJA 1FUUA 2ZRJA 2BKUA 4FW9A 3A8TA 2B7BA 4FIDA 5ELXA 4BPBA 1Z6GA 4MH0R 2RAPA 2ZS9A 1MABB 3A1WA 2C2HA 1NLYA 4M1OA 4RCZA 3GD7A 5JJLA 3QY0A 2BOVA 4GP7A 4EJSC 3PCRB 2NZJA 3B85A 1KDRA 4KI0A 2X19A 1ZUNB 2C9CA 5JWOA 1AGRA 2ZTSA 4JSYA 4OQFA 1EWQA 3OFNA 3MWKA 4OQNA 1XD2A 5BWMA 3DO6A 4AWXA 1U90A 4BZQA 3GLHA 2ODWA 2QGZA 5FOVA 1KK2A 1P2SA 1KIMA 2IYYA 3BB1A 3B6EA 5FPHA 5H8WA 2JLUA 3TUIC 4DLTA 1ONBA 3ADCA 1ZM4A 4UJ5A 1EFUA 1G8YA 1KDTA 2H1LA 4MGKR 3RABA 4AK9A 2XEXA 3QKTA 3NEYA 4QM7A 2AFIE 2ANBA 1U0LA 4BFSA 2FFHA 2EFCB 4E07A 4JJZA 2IYLD 2EYQA 4L9WA 3CX8A 3QKSB 2WIAA 2QT0A 2LKCA 4HUQA 2JLVA 4TZ6A 3CPJB 3O8DA 4LJAA 2DWOA 4LUCA 4Q47A 3W34A 2FPLA 1RW4A 1WCV1 2GETA 3SJCA 1PVOA 4LJ8A 4D4JA 2IUSA 1W0KA 3C5CA 5FOWA 1FFHA 4PTLA 3UATA 2F1JA 1XZQA 1AIPA 1IN5A 3PQCA 3HU1A 4W5WA 3SOPA 4HLQB 4MRPA 2CHVA 5EP1A 1NBMA 3IIMA 1OE0A 3VR2A 5JHHB 2R44A 4HZUA 2F1IA 3I61A 3BK7A 3VQTA 4G5OA 2KSQA 5D3MB 3D31A 3LBHA 1E1QD 1YJ5A 1ZU5A 5J47A 2VP2A 3NEJA 2A5GA 2NO7A 5AR1A 4AYTA 2QMOA 4RSGA 4RZXA 1S9HA 3KQKA 2F9LA 2ZEJA 3H84A 1VMAA 4MQBA 2W6ID 4X8MA 2FU5C 1WDTA 1ZNXA 4ON9A 3QQ5A 1CJVC 2CK3D 5CIWA 4A0RA 2NO6A 1RRGA 3T12A 3K0AB 1E2HA 5KSYA 3QVUA 1W36D 1QHXA 4JS0A 2KBEA 3U7EB 3GMTA 4KV9A 2IYTA 4CEHB 1G6HA 1II9A 2JIZD 4F4CA 1P72A 3KL4A 3FFAA 1U81A 4TMWA 1KOFA 1D8TA 4P4UA 3NKVA 1QZXA 2RGAA 5CM8B 4M1TA 1WMSA 1E1RD 2HJVA 1L2TA 4DRZA 2IUTA 1O87A 2XB4A 4HB4A 4RVCA 2G88A 1FUKA 4X8LA 2A5FA 5KPJA 3OHMA 1Z0AA 3TSWA 2ZYWX 3CR7A 5AUOB 1ZYUA 4I99A 3PITA 1E4YA 4GT1A 5E3HA 4F93B 1G20E 1T5LA 1CXZA 4KHZA 3Q3JB 1KJZA 3VR5A 1FP7A 2GK6A 5HKKD 1UKEA 3A37A 4CEJB 1I2MA 2NZ8A 4WZ6A 2ZXUA 3RS3A 3B1YA 4UXHA 3VMFA 3EIQA 1OH6A 2J45A 5F9HA 3IO5A 3M0EA 3GLFB 1KTVA 4JVMA 3QE0A 2J1LA 1HQCA 2AD5A 2HT6A 2JEOA 2QL6A 1ZW6A 5IHPA 2HYIC 4KVAA 4ZKDA 1FPMA 2AR7A 1W1WA 1F2UB 1E99A 2R62A 4IDNA 5B30A 5DI3A 1GFIA 1XJCA 4C2UA 2B6HA 1S96A 4A6XA 3ZDQA 5A4JA 3RRYA 2OXCA 4YQFA 1DOAA 3FMOB 2IX3A 2HT1A 4D0GA 3D8BA 3DM9B 3OE7D 3BWDD 2I1QA 4NCNA 1IAQA 5JCZA 4R98A 4CZ2A 4CEIA 2PZFA 5C4GB 2FDCA 2IT1A 1GSIA 3GLFE 4A15A 4PHHA 3TBKA 2YOGA 5BQ5A 1R10A 1E2EA 1ZNWA 5AJYA 3ZQ6A 5L3SB 2XJ9A 4GOJA 2WWWA 5LD2B 4A0HA 2VP5A 2MSCB 5F3WB 1IY2A 1BMFA 3MLEA 2IWHA 4C2TA 4DXAA 2E1RA 3I92A 4DSUA 4P4SA 3LLMA 3AVVA 5JEDA 4OJKA 3M1IA 2CLDX 2WJHA 5LB2A 1HURA 1G4UR 2ODEA 1WA5A 4XD7A 2P3SA 2BEKA 5GVRA 1IN8A 4Q00A 2ECKA 4BFYA 4TZ0A 2FZ4A 4QFMA 4POAA 2O8FA 5JS8A 1Z6TA 4EFNA 3EA5A 5EQTA 4RD4A 5LD2C 1VHTA 4PC6A 1G3IA 2JLXA 2V7QD 1CR2A 2GXQA 3DDCA 3HU2A 4MGZR 3AVYA 4OHYA 2FH5B 1U0JA 4PXAA 4C0BA 1UKVY 2PBRA 1SXJE 2B8TA 1FL9A 1AN0A 3MG9A 4PC7A 3AKDA 4C0JA 1E98A 4HAVA 4Z8XA 2OBNA 1G64A 3CF6R 2RB4A 2OM2A 2XNDD 2R6FA 2EQBA 4A9AA 1JEDA 1W49A 1K5GA 1RJ9B 1M34E 1U9IA 2ZANA 2PL3A 3TQFA 4N1AA 3UG6A 1BH2A 3RWOA 1JNYA 1LB1B 4CT5A 4XSHA 3SHWA 3AVOA 1YR7A 1OYYA 2WKQA 2D7DA 2VRWA 1OXUA 3RYTC 4DJTA 1K8RA 421PA 2ODNA 4Q02A 3KJHA 2O0JA 1JALA 2W0SA 3X2SA 3JVUA 3ZGXA 3DPUA 3AQ4A 2QMUA 3IPXA 2DR3A 1NVUQ 4GMXA 5JSZB 3GPLA 3MWLA 3LRPA 4I81A 3CRQA 5IK2A 2F7SA 4XJXA 4PPGA 1M8PA 1GRQA 4LBYA 4B73A 4NKRA 3HYTA 1JPNA 3HP1A 1CTQA 4JJKA 3QXCA 3RC8A 2YC4C 2F3RA 4TTRA 5KNBA 3FDIA 4Q7JB 4MDEA 2GNOA 4U02A 3QEJA 5FH9A 3TVDA 2W2XA 1GTVA 3UK6A 2HEIA 3W8RA 3ADDA 2IXEA 4OQMA 4PHFA 2WM9B 4PANA 4TQUS 1DTSA 2VIIA 4R2HA 4JBXA 5TDHA 4DVGA 5GJVC 4FMBB 4LJ9A 2ERXA 4JIMA 2PJRA 4A36A 1UKZA 3BFVA 621PA 1F2TA 2IYRA 2CDNA 4YXWA 3LY5A 4RFSB 2FX3A 1C4OA 2QI9C 1VCNA 4CEIB 1PLKA 4MGYR 4QBGB 4LJ7A 1F60A 4V0ME 4PPNA 2DYKA 2EFGA 3IDQA 1R7RA 2O5VA 4KFRA 4OK3A 2PCJA 2DPXA 4BLRA 4UQOA 2BV3A 4DIEA 4YMUA 2VEDA 4NTZA 4GBMA 1E0SA 2QORA 3U3MA 3EZ2A 2HLDD 3QBTA 3RS2A 1OFUX 3NTUA 4Y0VA 2OAP1 2OILA 4B34A 5GVSA 821PA 2HCBA 3WMGA 4M9ZA 2YOFA 1R0WA 4H1UA 2CCJA 2LKDA 4TMKA 2GILA 3U3KA 4HDQB 1OH7A 4GOXA 3GJ3A 4ZV4A 1G291 1NL3A 2WWGA 4Q5IA 4H1VA 1R0YA 4L16A 4HLDA 1TL7C 5FR2A 2JLZA 4PAOA 5CM9C 4MGIR 3VR6A 2PZGA 1GM5A 4DUGA 3A1SA 4TT3A 2WJYA 4DB2A 3U7FB 4BFXA 2J0QA 5EE9A 3BH6A 2WVJA 4HI0E 1ANKA 1KK3A 1N5IA 4RD1A 3BD9A 1IN6A 3SBDA 1KI6B 1XCGB 2A2ZA 3N2IA 3I8XA 3RRMA 2OEPA 4OBEA 2AXNA 3DOEA 1CIPA 2A9KA 2GEUA 2IHYA 3FKQA 4DSTA 5L3QA 3WNBA 4HDOB 4NCHA 1G7SA 2QY9A 3QBVA 3GJ4A 4PR0A 2P6UA 1TTTA 121PA 2V54A 1QVRA 3W90A 3LWNA 3P4XA 1S1CA 1MR3F 4A0GA 1S4QA 2F9MA 3CLVA 1ZM2A 2BWJA 3LX5A 1AKYA 1JR3D 5TVKA 5J4LA 1Z06A 2H7VA 3I1FA 4ZDJA 1Q1QA 4ARZA 5L8VA 1OIVA 2DFKB 4KITB 2YINC 3KB2A 3T5DA 1TNDA 2B8WA 1G16A 3QXXA 4JL8A 4QHSA 2ZRBA 4QXAA 1NSFA 2F43B 1SHKA 4A1FA 1Z0JA 4QHTA 1IY0A 3B78A 2ZREA 3O8RA 3C7KA 1TX4B 2OHFA 1LY1A 1UJ2A
chains in the Genus database with same CATH superfamily
4DA6A 1BXZA 1I3NA 1NFQA 1U7UA 1UJBA 3D8TA 2V58A 2X7XA 2GF9A 5ALQA 1QVAA 1T35A 1LK7A 1M2NA 2VJAA 3OUTA 3QLVA 4XW2A 4A2PA 1Y3FE 1W5SA 4BO3A 3IUNA 4G6ZA 4PZLA 4EHFA 5MGBA 1BGXT 1ETHA 4GECA 4IHKA 3RYFB 3PGVA 3FNEA 1PFQA 3AFGA 5DTRA 5JECA 2QE7A 1WE2A 1RU3A 2LNDA 4ZAZA 3L6OO 4NBVA 4ZO9A 2OWDA 1I80A 2ZUBA 1HH4A 1VJ5A 3JQAD 4XFDA 4C4OA 4DLNA 4EGJA 3VDXA 1X15A 2AX3A 3AGPA 2G8LA 3TVTA 3JQ9A 4FUQA 4BU0A 4DG5A 4ZI3A 5H80A 2AS0A 4BO8A 3HBAA 2AN4A 3AP2A 3DGFC 3FNGA 3P9XA 1B3RA 1EU1A 4AG5A 2BGRA 1E64A 4ZOLB 3VUFA 4F84A 1B73A 3PNBA 1OYOA 1L1RA 2GZMA 4HDCA 3BWMA 3KCQA 4D44A 4U7WA 3UHAA 2JL1A 3PDUA 4DMUB 1U3CA 2J0UA 4M8IA 4MB6A 5CB4F 4R71A 1ZOLA 5KZMB 1CR4A 2RGNC 3WK4A 1TJPB 3MOGA 4B80A 1XELA 1T26A 5JXWA 5KTYA 4OKSA 2P9BA 1QQ5A 2G3YA 4YJGA 4C5BA 4L3WA 1YOBA 1XCMA 2IOFK 2Y1XA 2XYHA 3R5KA 4WV3A 2Q6TA 1V0JA 1XMIA 2M6SA 4Y6SA 3KJGA 4Y9TA 3RSCA 3RUEA 4BFTA 3WIOA 1PFUA 2X41A 3DVAA 3MK31 3UMVA 2ZU6A 4BRWA 4YA6A 4N3GA 1M6VA 2HD4A 3E3MA 2JJ8A 2IPLA 4G1UC 1FJHA 2A5YB 1A69A 3R3JA 2B98A 2PG3A 1PTJA 3T8YA 1V8OA 3B1XA 2F6RA 1Z2AA 2RGBA 3DF7A 1RCUA 3UT0A 1HE5A 1YS1X 5FBKA 3SEFA 3G85A 1GPKA 1JEYA 2IHZA 3IUMA 5CVCA 3VYRB 1N3LA 3IP9A 3OEEA 3V9PA 4MVXA 1QO0A 2NLOA 5E8RA 1TLLA 4PLZA 5K3AA 4NFYA 4NZPA 4EENA 3THWA 3O91A 3ZIUA 5M2QA 1V8PA 1FYDA 2DQZA 4RORA 4N47A 1U02A 2FEXA 2W00A 1KK1A 3G2IA 3JPWA 4FIZA 4FBMA 1JG4A 3Q7IA 1K3FA 1Z5NA 1TKAA 4LZLA 3S8MA 1I7PA 3K30A 4ND7A 4ZI7A 4G67A 4ZODA 3QOFA 4I50B 2O9JA 4L50A 1RLIA 1U7TA 3AERB 4ZVUA 3KPYA 3PI6A 2X2EA 1ZISA 1A9ZA 1U3GA 2DWCA 5AICA 4ZQIA 3RTCA 4IKOA 1G8FA 5DTEA 2BHLA 3OJ0A 2GSDA 2NVUA 3CE9A 5AHRA 4CF3A 5DHTA 2YVQA 4BWGA 4C2BA 4LFAB 1ZOPA 3WGZA 1N2XA 4XQ0A 5KWJA 4FFLA 1GJRA 3SM9A 2ZU0C 3EVDA 1I2DA 1VLVA 1XDBA 2PQMA 2R68A 3FPBA 3NHPA 4K88A 4UCQA 1X1CA 3SJUA 5IDXA 3UBTA 3TRIA 4P81A 4LECA 4AM8A 1ZUNA 1ZU4A 3G13A 1VSUA 1UOOA 1DO2A 4RC9A 2P4SA 2WICA 4C30A 2B83A 4IV5A 1I7QB 4FM9A 4NFHA 5DTMA 1VA4A 1HV8A 3A3OA 3GNTA 4GE3A 4KKVA 2R6AA 3FHOA 4O25A 1ADJA 3LUKA 1NQAO 2ZI9A 3MBOA 2ZXFA 5DCLA 3FYCA 3ONFA 4Y0NA 5FAKA 1TF7A 1HUQA 2ZBGA 4I08A 4WXPA 3UAYA 5IT9A 3V1LA 3AF6A 1NG9A 1GZVA 1B8OA 2EX1A 3FCXA 2M9MA 2X8LA 4K86A 2BI7A 1QS0B 2Q1UA 4HDMA 4L8FA 3UXEA 4OXIA 5LLTA 1C7RA 2AG8A 2HA7A 5K3FB 4E5DA 2HI0A 1TEVA 2YN4A 3WWOA 3QMPA 2PL5A 3OEWA 1KY2A 4P3XA 4RHYA 4GNKA 4V0NA 3CPSA 3O21A 2WTUA 5KAMA 4P08A 2XXBA 2WJPA 3ZE6A 4UDYX 1B8PA 2CXTA 1XTIA 5K0JA 3KUUA 5INTA 4P35A 3EFHA 4NJEA 1VKZA 3Q6IA 2EL7A 2QUHA 3FMGA 5K45A 5EP2A 1TQ6A 2BEWB 1R4ZA 2GBCA 3D54D 1I3MA 4N6OA 1Y3DE 3AILA 1NA5A 4MVJF 5D6OA 3QKUA 2NSLA 2GAOA 1ZN8A 1O2DA 1H0HA 2OC9A 3FSGD 2GCOB 2CFIA 5A71A 3W3ZB 3F6EX 4BVAA 3QBJA 1VM6A 4QG3A 3ML1A 2I6SA 3KCNA 4OQPA 1M33A 5FTKA 4JJEA 1VL6A 3UY4A 3VTKA 5KNLA 3ASUA 2N47A 3R6WA 4YJGB 4RPKA 5U1PA 4P83A 3LVBA 2PZJA 1UBUS 2BGLA 2DCMA 4B3XA 4ASUA 3DVAB 2PL1A 4KBFA 3U44B 3EBLA 2ZB7A 5DVZA 1ODJA 4R01A 1W4BA 1K89A 2PFKA 2CL0X 4X9XA 1MB3A 4DLKA 3WHIA 3HJNA 1A1VA 2RGCA 3KKNA 4BY9E 5ALDA 4E7PA 2FEOA 3DL0A 5AKIA 1X7DA 4X91A 2C95A 3L6DA 1L7RA 5EN4A 4ZYVA 3H1GA 4NNPA 2YNMA 4D9KA 5CYFA 1FMLA 2AC4A 2CD9A 5T8KA 4BMXA 5DRTA 5CBPB 5GJCA 2QVZX 2ZULA 2X4DA 4B3JA 4ALLA 3PL1A 1HE3A 3GEMA 3P0IA 3I42A 4PTYA 3UUGA 4D81A 1LVGA 4YDQA 3PG5A 1NXSA 2HCRA 1XJ0A 5DIFA 1IN1A 3VKWA 5AD1A 2CLSA 2WP0A 2EP8A 1NDUA 3PE4A 5H3HA 3G9ZA 3WKCA 3PX3A 3G59A 1GG8A 4BMYA 3L7IA 4MZXA 2NV2B 3SWWA 2W2OA 1QP7A 1POWA 4KN9S 4JODA 1Z29A 2BHRA 2RBEA 1T4CB 5TPWA 2BVNA 1OMOA 1FS4A 1YNOA 2LV8A 2AMYA 1PFVA 1WHSA 2VJQA 3A11A 3FF4A 4PS1A 5F2OA 4IQ8A 1YCGA 3RJZA 4EAAA 4EMUA 4F96A 2E2WA 2PAAA 5HWSA 4G09A 4TKMA 1L5WA 4B4OA 2G7ZA 2H1IA 3UQZA 4A5OA 3Q40A 3PUXA 4RQTA 3LVQE 2CXNA 2KW5A 4OYHA 2V7PA 3KJZA 2JK1A 2X0IA 4DR7B 1O94D 2VTKA 3PZBA 1WQ3A 5F76A 4CLOA 4O3MA 2JCSA 1D4FA 1OBOA 4OU5A 3TDNA 2XYPA 4ZCSA 5HUHA 2Z8XA 1LDMA 6AT1A 2NXJA 2TS1A 1NJGA 2BM1A 1C1XB 2MIIA 5BWCA 1PR4A 1P4HA 1W1IA 2NT4A 3M5DA 4H7IA 3R5XA 3TLXA 3VPHA 5L9AA 1F7VA 4D6PA 4MIEA 5ITWA 1UBNA 1PT9A 1RWXA 1SBCA 4P33A 4RZ2A 4S1WA 3UMRA 3TZHA 1M83A 1T4GA 2AOUA 3G7SA 3HB1A 2D1SA 3O9MA 2PQ2A 2G70A 4K1LA 2EF1A 5D51S 2RJOA 5KOHA 2PKYX 1CE8A 3G2PA 2YY6A 2PJZA 2YWHA 4AF6A 4EHAA 1NVGA 1J42A 1LF0A 2L17A 1YBFA 1JEEA 1BE0A 1N7JA 1CUUA 1Y8RA 1UJMA 3BQNB 3IBGA 3RUAA 5KC9A 3R9XA 3OZBA 4EECA 1IM8A 3B5IA 1KFBB 2GVDC 5K0GA 2RAVA 1QYRA 2Z5VA 4FC7A 2HHJA 3K5IA 2PT9A 1JU3A 3U4GA 4K2HA 4C06A 3TVYA 2E4XA 2XWPA 4EITA 4DCTA 5CFMA 1I5OA 4A23A 4DG8A 3OQOA 1RWKA 2EHDA 5DHSA 3V4ZA 1CW2B 1X94A 1B6GA 1DBRA 1IOLA 2PMDA 3RVRA 1A4IA 1IVNA 3EUAA 4OA5A 4HWPA 1QGUA 1XC7A 2JLQA 3CLKA 3SS8A 4RD1A 4H2DA 4C6HA 3IL2A 3G3EA 4B8WA 2JGDA 4ESEA 4WTOA 1XA4A 3HYRA 1CVIA 3UANA 1UZAA 2HRDA 3PK0A 4QBKA 3SK0A 5K0SA 2NTJA 2B3DA 5BMVB 2OYSA 3OZTA 4C04A 4MTLA 1RXEA 2I87A 3D0OA 3FLEA 3TIGA 2P2LA 1V41E 1IIBA 1BS9A 1X8XA 4D57A 1Q7EA 1M8FA 2OC4A 5BN4B 3TUZC 3HCOA 1WZUA 1TU3A 1ISHA 3R3UA 3HXLA 2HBZA 2Q0XA 4KL8S 4B40A 2RAUA 4TLCA 2YYSA 4LRQA 2P9CA 3P9IA 2NZ2A 1HSZA 4O3FA 3FWPA 4Y67A 4EMTA 4UNSA 3QUCA 4NU5A 8GPBA 1DAPA 3F0TA 4YUWA 3B8HA 3FWHA 2TMKA 2RBKA 2ZRLA 4FFMA 4HF7A 2FNAA 4NYIQ 1MB0A 1Q0UA 3G0CA 4NIMA 4OHWA 4RMGA 4ESVA 2OGZA 1GP2A 3LX8A 4WOJA 3EVZA 2GJ9A 3I83A 1W34A 4UREA 5AVSA 1WVGA 2OBXA 4H59A 4Y2RA 2GXSA 2FB9A 3PGKA 3FFBA 4YYEA 3AGQA 3H7IA 4L4SA 2FW9A 3PI7A 3VR6D 5F23A 1N3BA 5TQ0A 4DUGD 2WQ6A 4TT3D 3TIXB 4DLRA 3AHHA 4YIKA 3QK7A 2P2DA 3Q85A 4LZJA 1W9HA 5TPWB 1NP3A 5EJ9A 1RQPA 1VMIA 4RQUA 2ZT8A 3I04A 1NW9B 4GBED 5A5DA 2DRIA 2B21A 1MB4A 4TWBA 5FF9A 2VEOA 2QD1A 1E6CA 1YV9A 4LYGA 3PSHA 4QJ5A 3DVLA 1EX7A 3DOFA 3N9IA 4KSBA 2QTVB 3CEPB 1IH8A 4I1UA 1E3IA 1GA6A 3PXUA 3IPRA 3E1GA 1S6YA 1G17A 4CKBB 5ICEA 3NALA 2BFBA 3KB8A 5E8JA 3GRYA 1T6XA 4AI6A 3AL0C 3AUTA 1ZCJA 4FYVA 2FWMX 3QGMA 3RRNA 4KNYA 1ULUA 1NP6A 1H2XA 2YKGA 2HMWA 2OESA 3IO3A 3CISA 4Z49A 1KVRA 1S4MA 3WRWA 1ZIDA 4JEHA 4G5QA 3KVNA 3SBEA 3B1JA 5B1HA 2OE2A 3EISA 1T9ZA 4GMHA 2WHRA 1T9GR 4NX2A 3PE3A 4JBYA 2VJBA 2YHSA 3ZWCA 1XJ5A 2EBUA 2HJHA 1CE8B 2Q41A 3OKCA 2GO7A 1Q3HA 2ZSKA 3CH6A 3BDIA 2WQ7A 1QQAA 4U5XA 3AJDA 3A2MA 3U4DA 3VVMA 4AW9A 2ICAA 2IV7A 3HUDA 3ONEA 3PDIB 3QPAA 1NQ5A 1BHSA 1XCPA 4AY4A 3WNVA 4EIWA 1CP3A 5E1MA 3T5CA 1U8XX 2Z2IA 3VXKA 1IYZA 1B14A 5FOTA 1AQJA 3ZHOA 4D4IA 2VOEA 1G8PA 2JC3A 1EBBA 1G8GA 4H6XA 3R74A 2NVBA 3UMFA 3OSZA 4RHCA 3OA2A 4JLBA 3EZ9A 3JWPA 2FWRA 4XYBA 4BVJA 2J09A 4G97A 3EXHA 2I1WA 5JSYA 3HK2A 2Q8NA 3I52A 1DCKA 4D0RA 1VXRA 4EJ2A 4RSMA 1NVEA 3MTBA 2Q1XA 1QGUB 3L84A 4ILEA 4DRYA 4MVJD 4E3WA 4CCAA 3JZFA 3PVZA 2ZR7A 3N7TA 3VPFA 4JLVA 2GFQA 4LPKA 4L3OA 4KBYA 1GCOA 5AJHA 1R1DA 2OKGA 1K88A 1TXGA 1SC9A 1Y8QB 2UVPA 2V55B 2O1WA 4MMXB 1CJUC 1YL6A 1SCKA 2Q6LA 1MV8A 1P18A 1QC5A 3EFEA 4UAUA 2OYRA 5DEIA 3TCXB 3TNYA 2CXUA 5FBLB 3O47A 3AWIA 3KZVA 1R50A 3RLIA 3C43A 3RVKA 4CM7A 3IAFA 4GDFA 3OF5A 4I1SA 1S01A 4LDAA 5TT0A 1D4AA 4XDGA 1Y5NA 3WJAA 4NF2A 4E09A 5IAEA 3DBRB 3ZJ4A 2BZGA 3E81A 3PPVA 1WUKS 3AX6A 1AX9A 3NHUA 3MAJA 3RU9A 4DAOA 3AVXA 4O4JF 3PFIA 4RJTA 2X5NA 4RNDB 2XB9A 1X1RA 4RXUA 1MH1A 4FSXA 1B0ZA 3UAXA 2XKBA 3UJ7A 4DMFA 3A6EA 1H65A 5C51B 3BRWA 4AKSA 2ID4A 3ZX5A 3QMWA 1JAHA 1HFWA 2EF0A 2GD2A 1LCIA 1U2PA 2NPIA 2NQTA 4OXXA 3VHXA 2IYXA 4MLPA 1AQ6A 3E9DA 3WYGA 1PV4A 4C0AC 3UTDA 5CX1A 1OZHA 4EF5A 1COWA 4UFOA 3N7AA 1DBVO 3QHQA 5ULLA 4D1YA 4MMZB 1U98A 3BGSA 2ORIA 3EGDA 4W82A 3DLTA 3RUDA 3CVOA 3ZHXA 5K2OA 3EFOB 1U6IA 1VG8A 5I9SA 1AKVA 1YMVA 2CL5A 3CLHA 1YA8A 3CX6A 4IDEA 2XVYA 5C1IA 5HM8A 2ZJ1A 1RIIA 1ZM9A 2FQXA 4B33A 4BCCA 3GMDA 1VYVA 1R0RE 2Y4OA 4PG5A 2G9NA 2ZB3A 2JDIA 1Z4JA 4KPGA 3KHUA 1Z73A 1TLFA 2ZATA 3ANSA 3H5WA 4IICA 521PA 5J2UB 3K05A 3X1WA 4B6OA 4DLPA 4BGEA 2GJ4A 1XVTA 1G7CA 2QM0A 1K3TA 3FPKA 2PNFA 5LA6F 4BTVA 3I1YA 3L7LA 2BZ0A 2QYSA 2VBFA 3AR2A 3WK7A 5AVTA 1UKAA 4DWJA 3U39A 5LC1A 4BNJA 4X44A 3Q8MA 1F4VA 4FHDA 4HXYA 4UHHA 3RUIA 3S2FA 4EI8A 1YULA 3NTRA 3C3EA 2GBFA 5KQLA 3UXHA 3UYKA 1FW6A 3SBXA 3INGA 1Z4IA 2ZIZA 4KWTA 4S1OA 4ENQA 1QGOA 2HV8A 2YWGA 2Q3EA 1R0BA 4QFCA 2C2KA 2PX6A 4BZPA 2FDXA 2Z6AA 5HJEA 1SHTX 1V5IA 4KOAA 5IJ0A 3SZ3A 5L7WA 2QV7A 4PZCA 5HR5A 4JB0A 4D9FA 2OUKA 3WDLA 2I33A 1Y9AA 4BWVA 4RVGA 3M2TA 2EW2A 3E84A 4CWAA 5A06A 4I2VA 1N2JA 4F11A 4DJFC 3WOVA 3PVSA 1F5SA 1JYFA 1R6UA 2HSGA 3OMXA 4BE4A 221PA 4WK6A 5DWDA 3HA3A 1L4KA 1AZTA 1K8XB 2PGDA 3HABA 1PNVA 3F90A 2BSQA 2JHCA 1H8HD 1USUA 4JQZA 4UUMA 5EE1A 4MCAA 4EEXA 5ILGA 3ICVA 5ALUA 1MIHA 2ZBVA 3DOIA 3EQZA 1TYZA 1U8YA 4KWEA 5AW5A 3F7OA 4AZVA 1EGQA 2B20A 2O2YA 4P3NA 5EZYA 5ITZA 4B9AA 4BQPA 2J30A 3AY0A 3NASA 3K0BA 3E8MA 4FI3F 4ZVMA 2DHQA 3A70A 4EJ6A 1NQXA 1ZLYA 2Q0QA 4I14A 5J58A 2ID8A 3LCUA 5A3RA 3BE6A 2Z6QA 2R2GA 2IOQA 4QA9A 4AUEA 1SUPA 3RUHA 2E9SA 3VI4B 2CV0A 4JV5B 4XOIA 1IG0A 2BMJA 3COWA 4IUYA 4S2UA 4ZOCA 2PXAA 3SXUB 1AMOA 1R5BA 4MITA 3WOHA 3ZIDA 4WBNA 2W6CX 3LQRA 3QM1A 1QYCA 3O8QA 2UVPB 3R7SA 5AVUA 4MWGA 4PSVA 3HKCA 1V16B 1I4TD 2FN9A 3EQ9A 1E9AA 4YP9A 3ZI7A 2VPTA 2OHGA 3N1UA 2AH5A 3QIVA 5JEEA 2J3DA 4Z7OB 3IQXA 1GZ7A 2ZYTX 2KI5A 3BFXA 2P2ZA 1S89A 1HDYA 2ZM5A 2GBLC 5DKFA 2LPMA 2JARA 3H8VA 1GG5A 4US0R 3AIIA 5B1IA 2FAXA 3RYCA 3I5UA 3NAMA 4MPTA 5LVAA 4ZYYA 2PPLA 4F5YA 4C7OB 4IH1A 2VJNA 4Y2TA 1JEAA 5DX0A 1SELA 3WLOA 4YMWA 3E35A 3G79A 5K3DA 1DX6A 3ZY4A 4BZWA 2Q4DA 1L7EA 1MIOB 1U1EA 3FCCA 3GWGA 3PXXA 4JU9A 1LS6A 4AS1A 1LNSA 4XGNA 3OAAA 1J20A 1XTQA 1CUJA 4UEQA 4GWKA 4RK1A 3FKSD 3QIAA 2B2CA 3WGHA 3IAM1 4JLDA 1M75A 3NNNA 3I3SR 4PHTA 4JLMA 1NXTA 5EE0A 5EXTA 3T61A 4O4HB 4XPZA 1A8IA 2RG7A 5A9RA 3HDVA 4GQBA 3WBFA 4GYJA 4HDKA 2IODA 4BMOB 5KC8A 2PH7A 3H2IA 5MN5A 2HJGA 3H6KA 1ZR4A 1IUPA 3O26A 3Q41A 1YE8A 2RGYA 3QUSA 3FCAA 2W58A 2QSJA 3L79A 4BP3A 4XI9A 3RGWS 5K3EA 2VXYA 1XMOB 2SCUA 4TKVB 3KT8A 4YV2A 3M9LA 1EXWA 3HUTA 3HB5X 4KN6A 3WNCA 4TV9A 4BLQA 2F1OA 1IMOA 2HN9A 2EEPA 3EEBA 4LC1A 4M1SA 4N9QA 5GZ3A 2W98A 3CEHA 1N8KA 3M6MD 4RDCA 1EK5A 2QRZA 2GYVA 3EIHA 4ZEXA 2EYUA 1XZLA 3F8SA 5COBA 5KYYB 4RTKA 2BONA 2QL9A 3L8ZA 4GP6A 4J6FA 5IUJC 5DXJA 2JI6A 5K6TA 4IJ5A 1P8JA 1V9SA 1VYTA 1GL9B 3IV6A 4UE3S 1TLTA 4M4SA 3QVGB 1KEPA 4DBVO 4MEJA 1MO5A 2P5TB 2RCNA 5KKCA 1XK7A 2Z8ZA 4TV8B 4QTUB 1UC8A 2AQKA 2GARA 3WLPA 2VP4A 1KNXA 5DULA 5EIBC 2BGWA 5JQGA 5K05A 4EZEA 3OE1A 3DLPX 5CCXA 4IUDS 4IOJA 3TQHA 2WF9A 2BFNA 4PYIA 3WLMA 1XAGA 3ZE1B 2SICE 2BP7B 1ZJZA 2XHEA 3B3QA 4HWSA 4O4IA 4RMHA 1JJVA 1KP3A 3K9BA 3UJCA 4KX3A 3WVNA 3E9ZA 3EQ6A 4B85A 1I32A 4EVIA 4K9SA 1LA2A 1HFJA 1R8YA 1NTOA 2ZBEA 4OXQA 5PNTA 4K7JA 3U3ZA 2IH4A 2JLWA 1YZKA 1T3SA 2IXDA 2PYIA 2VO1A 5H5JA 4GD3Q 1HNZB 5F4BA 1WPQA 2I4LA 2C5AA 1OPRA 1OWLA 3BD7A 3HRKA 4FNAA 3B8EA 5BSTA 2DAPA 1U2QA 1E92A 2HLPA 2VLIA 4FR2A 5ITZB 2R8PA 1YFKA 2GZ2A 4ND2A 3H4TA 2XDYA 3OHSX 4LOLA 1NW4A 4FE3A 3ZY6A 3AUSA 2VQFB 3M1LA 1XZDA 4V02A 3TZBA 2QN3A 3TL2A 4GMDA 2JASA 4F9FA 2QZZA 3JD0A 3VU9B 4ETIA 1ZJYA 2VS1A 3EASA 3P9YA 2JPDA 4E30A 1C9EA 1EFTA 3IV9A 4ZQBA 3A4VA 4MYHA 4IPTA 2PT7A 4GVLA 1KR5A 4YAEA 1D1SA 3I8SA 3RNLA 3KWLA 3O8QB 2C99A 2NADA 1UXOA 4PR3A 2QU8A 3W2TA 1EVEA 2CLEB 3WZMA 1QE0A 4LF8B 3AVTA 2FZVA 4FGWA 3D5EA 4JLUA 1ORHA 3H99A 4YAFA 2YN0A 4COKA 4BO9A 3KXDA 1MG0A 2NXEA 1UMKA 5IUNC 1QKIA 5DOZA 4WERA 1C1DA 3DBIA 3BE5A 4LXGA 3OLXA 3VPBA 4ZT2A 3MUOA 1KAOA 3A6ZA 2P9GA 3X2EA 3PXCX 1JQDA 1QHSA 2Q2WA 1R0KA 3LBNA 3SKYA 1WZ2A 3QTBA 1MW8X 5E7MA 3A9WA 3WIEA 1ID8A 1YQTA 2CNWA 1HFEL 1WKBA 4GE0A 3RSHA 3U3RA 1L5FA 1DC6A 3FOBA 2FSUA 4U7HA 5DTIA 3WAKA 3WLQA 5TV2A 3TMYA 1THMA 1PJLA 1D03A 3H87A 4EY6A 3Q4GA 1A5BB 1QDUA 2Z95A 5J4KA 4BLPA 4RTJA 1VB5A 3AEUA 1XL1A 2HQRA 1GTSA 4U3JA 2AMLA 2J6IA 3QU2A 4RCYA 1OASA 3OT1A 3R3HA 1FNNA 1SJ9A 4JLNA 4PW0A 4ZRMA 4A8JA 1DWQA 3A7DA 4AY6A 1I5EA 2AOVA 3RNOA 1U2TA 4I8XA 3CB2A 2GXAA 5HOQA 3I9V6 1Z6QA 1UDWA 2PBZA 3MBKA 3N87A 4I5IA 3ZZ1A 4ZCIA 1XTKA 4AQYB 1VE9A 4XM2A 1SBNE 1RM0A 1G3QA 2R5WA 3I9LA 3WK6A 4TV9B 2R2AA 4U7PB 3OF3A 2ZPAA 2OPBA 4DDUA 3N70A 4OSOA 3D81A 4EG1A 2ZTMA 3D3JA 4WOKA 5EJ2A 2UAGA 1J56A 3GY0A 3OIYA 4P36A 4PGHA 2G71A 3C1OA 2H2AA 3O4HA 4IUCS 2LGJA 2G5CA 3DQPA 1Z5PA 3PTZA 1CLUA 4WZAB 2AZ4A 4WHMA 3VNBA 1DVRA 2FPIB 2C0PA 3FTDA 4AYWA 2QQ0A 1BO6A 2Q3FA 1ISJA 3KKOA 1BU5A 2QZ9A 5F9FA 1G41A 5ALGA 2OAEA 3TN7A 3VGJA 3CH7A 3ND7A 3ZC3A 2CB0A 1II8B 1C4WA 3QPDA 5JQGB 2JATA 1KO1A 3TZ6A 3SF8B 1SVWA 1DELA 4G63A 4LXYA 4REMA 2VQ3A 5B2FA 1M0TA 4BMZA 4NI5A 4QATA 2G4CA 3HXTA 3KKQA 1PHRA 2QYHA 3PENA 4JZYA 1O6ZA 2XUQA 1GQRA 4OP2A 2A1UB 2NIPA 1CCWA 3X1MA 3HP4A 4O2BB 2EZ8A 4WBSA 4C2AA 1FNBA 2RGEA 3B9RA 3L0BA 5FA8A 2XUIA 4MV3A 4DV4B 3H3JA 4JI1B 5K6RA 4WXMA 3KFXA 4WZAE 5L3VA 1HE1C 3OU7A 4EHIA 2A5JA 3CZCA 2QJTA 2Q5JA 2JI9A 4RSHA 4IDQA 4O8ZA 2UZ4A 1DKRA 1VBMA 4KREA 3KKEA 2YXEA 5GJBA 1J90A 1NJ6A 2RHLA 2FYTA 1J97A 2AC2A 2ZLBA 3O95A 5ALKA 5B3KA 1VC2A 2Z04A 2W6ZA 4RH0A 2Y68A 4AVYA 2Q3MA 2D62A 1Q12A 2KWIA 4ZQHA 1IK6A 1T0HB 3PD7A 3RREA 3QEKA 1R3UA 3EAQA 2P6RA 2V0GA 4RZQA 3HKEA 2IXFA 1J2EA 1T3TA 5E7QA 5EIEA 1K0UA 3OJLA 3ROEA 3EG9A 1S3GA 1L5KA 4IOKA 4UHBA 1RZUA 5JADA 1KDVA 1SUBA 4L5CA 4EHNA 5CK5A 4ND8A 4F04A 3EHDA 4WLOA 1HLPA 4HMQA 4P80A 5EKSA 5BUQA 1W19A 1KQOA 1U8FO 4L8WB 5G0VA 3F2VA 2MU1A 2F3UA 1AM4D 4G8CA 2DHRA 4KLZA 3WICA 1QIGA 2IYPA 2VNKA 2ZQYA 4QYWA 4EGFA 2QF7A 4DQDA 3ITDA 1CKEA 1GPJA 2DY0A 1DCTA 3WC4A 2OFFA 2RHRA 1H2RS 5AESA 2FMKA 2D13A 3NAQA 4Q4AB 2FLKA 3M6WA 4LRYA 2PKRA 3RC2A 1C9MA 4Q4JB 5EJAA 3PKJA 2ZSHA 3AY7A 3GVXA 3MTDA 2WYHA 4A6PA 2AYXA 4JA2A 4Q9JA 4ESOA 3DLBA 1J2UA 4ITUA 3VDQA 2OV3A 4W8GA 1Z2CA 1BH6A 2SKEA 3NDJA 3IVMA 1B15A 3H05A 3Q88A 4EKEA 5DGCA 4KO4S 3S81A 3S44A 4BJ3A 1RJGA 1UZLA 3C8MA 4GX0A 3IMFA 4IDFA 4KN8A 3PV0A 5SYNA 3S2SA 1E6EA 4C0HA 1JR2A 2O8EB 3C5VA 1WWKA 4AXXA 2X0NA 2GRAA 4TYYA 1HYQA 1PWYE 1TMKA 1O3YA 3LAWA 4KWHA 3O2SB 2VYVA 1IHUA 1ZGCA 2VTVA 2XCIA 5CT9A 3TQRA 5JNUA 1KWGA 3DOCA 2E7ZA 2H7YA 4O5AA 4A8JB 5ERXA 3RV3A 4A82A 1QLJA 2X58A 4CJXA 1UAAA 2BEUB 4AO6A 1X92A 1UPUA 3GXBA 4L8LA 1DAMA 1RAAA 2QYOA 4PEVA 3AB3A 5DW3A 5EPOA 3U3OA 4B44A 1H2HA 3HNPA 5K0CA 4HJRA 5AM4A 1NIPA 3JSAA 2IGTA 4CM3A 5JI2E 2IXTA 1XL0A 2K5UA 2ZGVA 1QFYA 1SZJG 1T3HA 4LHYA 2QSYA 4FFPA 4TVOA 1WF3A 1T5DX 3TQCA 4BVBA 4NAHA 2I7XA 1PYOA 2ZRFA 5F5LA 4E1BA 1IL0A 4JP1A 5CFOA 3EA4A 3IJEB 4FLEA 4LK3A 4WKCA 1QVWA 3T7RA 2AHOA 1C9JA 2WKSA 4JY7A 3LBFA 5FNZA 1Z0ZA 3MTQA 3TZKA 4LZPA 1SNYA 4G84A 4AJIA 1T4BA 5EJ6A 2GKSA 2BHSA 4GU5A 3IEKA 3EH1A 3W7BA 2PGXA 1XLVA 1XXLA 3ZVNA 4UULA 3N2GA 2RC6A 3VV2A 5JFOA 1OBHA 4W5JA 3P9NA 1R74A 2HBRA 4QXMA 4KQCA 4HGNA 3IAAA 2VSXA 1GL3A 2AKYA 3QVWA 4LG1A 1U4SA 4IVQA 3T94A 1FBNA 4ZVTA 4TSFA 3ZNNA 3DAPA 5EWLA 1U31A 3PGLA 4FCTA 1TC1A 1G55A 5CXXA 4U2BA 1MW9X 1NJ2A 3QVSA 2C3YA 3UWMA 1P7PA 2DFLA 1A98A 3W77A 3CUKA 2G9UA 2RHJA 3KJIA 4BO0A 5A4KA 5LUAA 1DAEA 3UAWA 3E7PA 4U7GA 1JHAA 2BEVA 3HB4X 1F6DA 4KOEC 3WO1A 2HRRA 3NT5A 2QRNA 1TJYA 3TSAA 5JO0A 4GKKB 1HQKA 4ZEWA 4BATA 3HKEB 2QU7A 3TLMA 3L9XA 3LHDA 3A6JA 3ZYCA 4EVSA 3RS9A 4EUFA 4LF6B 1MAVA 2ERCA 3EG9B 5JO9A 1Q50A 4W5RA 2VPZA 3HJRA 4CBVA 4MO9A 2QN6A 4ND8B 3U6BA 3QU9A 3ELDA 3PPIA 4BASA 5TEVA 4AJ9A 4AF8A 3AKYA 4AD8A 3DAGA 4XFKA 5I4IA 2ZB8A 4UCWA 1U9CA 3PTLA 3GLVA 1BWSA 4RACA 3R23A 1A95A 5COQA 5EXPA 5LP6A 3DCIA 4ZCRA 5BW8A 1LRJA 1XEXB 4BVLA 1EGAA 1K6XA 2NO9A 1JJIA 3IQDB 4UDOA 1P0FA 4EAQA 3UVEA 1OY1A 4TLAA 1CP2A 1ND6A 3WMEA 2IH2A 4I4TF 1YR8A 4RH3A 3ZXXA 3H0KA 2CMKA 4OGKA 3U61B 3SAJA 4TN1A 4EZBA 3L8GA 5A2GA 3TG8A 4BX8A 2WSSD 3R3XA 5AOAA 5BV1A 1TAGA 1CK4A 5REQA 5JOQA 3JZIA 2QG4A 4JBGA 5B1EA 4MJ3A 1ENPA 4CKCA 4DNOA 5H82A 3ITEA 1J8QA 1XRQA 1PDOA 3ONWA 3KO8A 3O83A 1MHTA 1TK9A 1VIAA 4LHXA 2RHHA 1O54A 4GP9A 4TMZA 2PXHA 3UJPA 1O6BA 4OHVA 4TMYA 3SSMA 4ACBA 4EX7A 3W5IA 3N58A 3JQBA 3IAS6 1NF3A 3JYHA 3KEOA 4M1QA 1RHUA 1MO6A 1MTOA 4M8NE 4UHEA 1O96B 4HUTA 3AEKB 2B61A 3UOAB 1U2EA 2G08A 3MJHA 5BQPA 1PL6A 1EFVA 4ZHQF 4TTVA 3OOHA 3R6DA 4RD3A 3D9QX 3DQQA 1HEYA 2VWGA 4G9EA 3VOTA 3C1AA 1F2DA 4MWZA 1E18A 2Q3JA 4RELA 1G3RA 3RTEA 1N36B 4MR8A 4S3MA 2H07A 2NX2A 1V9CA 1RE0A 1ETUA 4HK4A 4EM6A 2ORWA 3U56A 3WKDA 4BECA 3GPLA 1PWEA 2JLYA 3WL7A 3FSEA 2RCYA 4OATA 2AOTA 1TE2A 2P5YA 5D3KA 2I3AA 5DT9A 5F1YA 1SBIA 3KUXA 1EB8A 1KZ6A 1N0HA 3AV3A 1DV1A 5SZIA 4LDPA 2R5FA 2L42A 2XOKD 3WXBA 3FCSB 2P79A 1J07A 3AIKA 3K15A 4NP6A 3BERA 5EIOA 1J0AA 5G02A 5DHAA 1QAMA 2G0NA 1GU0A 3L92A 4GRIA 3U5ZB 1EX6A 1UXJA 1Y5MA 2EXXA 3H5VA 3E2IA 3ZZNA 4GMFA 1XD2B 4R4JA 5BV8A 3JQ7B 4K81B 4UFNA 3VTFA 2B5OA 3ZEIA 4AZ3B 5AW1A 5KUTA 1Q83A 4ILKA 1BCSB 4Z9FA 5JZOA 4DREA 1G5PA 1K66A 1PBTA 1COZA 2P67A 2IL1A 2QVGA 4WL0A 3TB6A 1HO3A 1PVDA 2P2GA 3TPCA 3UJ8A 4UUQA 2OBBA 2G28A 3HGTA 5AXAA 4MJ7A 2BAGA 4J43A 3HS3A 4AKGA 5CA0A 3PUZA 1BIFA 2ZE8A 3QG1A 3LSTA 1P5RA 2LW7A 4FMCB 1SBTA 3BA6A 3OT5A 3QSGA 4H7KA 2OCGA 3VAAA 1WBBA 2HDWA 2O6LA 2ZJ4A 1NZJA 2BTOA 2IW1A 2ZR9A 2A8YA 3BAFA 3F9IA 3IERA 3OTHA 1H6CA 3HG7A 4HHEA 4RKEA 5D01A 1QOPB 3S7TA 5HNKA 2CNOA 1NBEA 4B43A 3MSCA 4B6EA 2BSXA 2F3QA 2P9QA 1Z35A 4H3SA 4IG4A 2OAQ1 4NH4A 3UHJA 3EMDA 4U0JA 2BFDA 1DFIA 3U3DA 2EWMA 4S35A 5B2ZA 3T35A 1VDZA 1JXOA 4PAWA 5DLDA 4QOSA 5JVDF 2Y4NA 4BBPA 1GL7A 4J0JA 2H6EA 3G8AA 1NFRA 5E1DA 4AU1A 2P4UA 2XCTB 1JBEA 4GPZA 3AJEA 3L02A 3ICCA 4C05A 2VTDA 2ECFA 4IFBA 4REOA 5TMEA 1GZ6A 4FDAA 1NWCA 2F2TA 4YAGA 1S2IA 3P9RA 1Z0FA 4UUPA 5EMHA 2OFXA 4X66B 1KORA 1GGHA 1QIEA 1YRYE 2QT1A 4GGMX 3DHYA 4IH4A 2CFOA 4EGQA 5FTLA 2R4TA 4XSGA 4JBLA 3GRPA 2PD3A 3FDFA 3IELA 5CNKA 4IQ0A 5IJZA 4PQEA 4I4LA 1X80B 2EU8A 3BL5A 4BCBA 3H19A 1HXHA 5K0FA 1T1RA 4XCXA 5FL7D 2PV7A 3ESCA 4JSRA 4H0FA 2D5LA 4KXQA 4DWVA 2M6LA 3ILXA 4GWGA 2ZE6A 3KU4A 4DJEC 4ZU6X 3F2IA 3WR5A 4FJ0A 3LW8A 4OHUA 3SQDA 2IZ6A 2V74B 3PIRA 4CMHA 1FMJA 1Y3BE 2EJWA 5DYIA 5KYTA 3WBKA 1R4MA 4JH0A 1E94E 4QQFA 4IZ6A 1GOTA 5KYUA 4LRXA 2C9ZA 3GRUA 1Y7IA 4MYDA 2FE4A 1Z28A 2IP4A 4CKXA 2BLLA 2KJQA 1EJBA 5E9JA 3ZS8A 1PK8A 2J3QA 2YOHA 1FLAA 4PCVA 4B2PA 2OO5A 3Q9LA 3ASVA 3INRA 4F12A 3U60B 1O95D 3I72A 3UB3A 4AIIA 5K4HA 1I7DA 1OHHD 2R751 3OZAA 1KSHA 4MR8B 2KX7A 3STXA 3S2EA 4RYLA 5IC6A 4NCIA 4BNFA 6LDHA 3W78A 3LLVA 4D4KA 1QR6A 2AOTB 9GPBA 3ETEA 3VU8A 5HFNA 1NUSA 2I4NA 1MOZA 4BX2A 1ZRSA 1M72A 5BN3A 1S2NA 3CXUA 1DRVA 5EXEA 1D2EA 4P4NA 4YV0A 4QYIB