5DE3A

The crystal structure of chlamydomonas reinhardtii arl3 bound to gppnhp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
166
structure length
166
Chain Sequence
b'ARILVLGLDNAGKTTILKALSEEDITTITPTQGFNIKSLSRDGFNLKIWDIGGQKSIRPYWRNYFDQTDALIYVIDSADSKRLSESEFELTELLQEEKMTGVPLLVFANKQDLVGALAADEIASTLDLTSIRDRPWQIQACSAKQGTGLKEGMEWMMKQVKLEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
publication title The Crystal structure of Chlamydomonas reinhardtii Arl3 bound to GppNHp
rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase
total genus 52
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2015-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5de3A00
2PEZA 2JAQA 5F9HA 3RDPA 1TQDA 1U9IC 4URWR 2PEYA 5K8IA 1A2BA 3HR7A 1E0JA 2IYRA 2QENA 3HU2A 3ND9A 3AF2A 1CKEA 1W46A 3LW8A 3SDZA 3THWA 1YZNA 5HKKA 2V6JA 2OLJA 5FTMA 2JLWA 4NBSA 1Q44A 4TTRA 3K0AA 4D82A 3BD9A 4M9SA 4HDCA 1NP6A 2EFDB 2BMJA 5KYKA 3X1XA 1UAAA 1VPLA 4Q4LA 2FFBA 1BMFD 4RZ2A 3LRPA 1RJ9A 2QSYA 3B78A 4AYWA 3OIVA 1OKKD 1SULA 2H17A 1IBRA 1R6BX 3A4LA 3I92A 4A36A 1Q57A 4DZZA 1A7JA 1BO6A 4M8NE 3SNHA 1LV7A 4JLPA 2FH5B 2DR3A 2N46A 1E99A 3PG5A 1NLFA 2GEVA 4JLNA 1HTWA 1N6PA 4L16A 4RZUA 1CTQA 4MUAA 2NO9A 4URYR 4AD8A 1J2JA 2IBMA 1G7TA 3AVUA 1P61B 4L9WA 4Q4JB 4TSFD 2XOKA 2ZJAA 4LJ9A 4DDTA 3VKGA 4R71A 1E2PA 1XMIA 3K09A 2NGRA 3OESA 4Q7KA 4G5OA 3U4QA 5CM9C 1IY2A 4DXAA 4MA4A 3O8BA 5DHFA 1GKYA 5E3HA 4NCNA 1QHXA 2WOOA 3LW7A 4EFMA 1ZM3A 3CZQA 1QDEA 2ZRGA 4AC9A 4D4KA 1P7CA 1EFHA 2OFXA 3QE0A 4JL6A 2ZI7A 4JIMA 5HZHA 3I72A 4UKDA 3T1VA 2OAP1 4NONA 3IHWA 4A8JB 3T06B 1A4RA 2IS2A 1W48A 4HAWA 3FMIA 4TTPA 2WTUA 3TNFA 4IXMA 4QGFA 5EE3A 3VR5A 1S2MA 2GCPA 1TTTA 1XEFA 2WWIA 5DN6D 5L3QB 4GI7A 2F55A 1N3BA 3SZRA 1JECA 4OI4A 4Q7MB 3VX3A 4KXFB 4PHTA 3TSWA 3C7KA 3FFBA 3BFVA 3RC3A 3RLFA 2GXAA 2V3CC 5A4JA 3RYTC 2O0JA 3AF0A 2HCBA 1JR3A 2QP4A 3C14C 5HCIA 4DCVA 4DWJA 3NEYA 4Q4HA 5B30A 3QF4A 1YR9A 1TEVA 5DI3B 3CPEA 2QBYB 2BWJA 1XEWY 3THYB 1KDRA 4DSUA 3B7GA 1OIXA 1M7HA 4HI0E 4JLBA 5FUWA 5LD2B 1NI3A 5JSZA 4Q19A 4ZDJA 2W6JA 1AM4D 1T9HA 2VH5R 2NG1A 5FI0B 1COWD 1MO3A 3TLXA 3QG5A 3QOFA 3HWSA 1SXJE 3ZQ6A 4Q66C 3KDSE 1OLOA 3QG1A 4KFRA 4DBLC 2RHDA 4LJ8A 4CZ2A 5KUTA 2O8BB 3DZDA 2H92A 4FD2A 4FMCB 1V5WA 1YU9A 1GITA 1YZKA 4L15A 5EQTA 4E03A 1OYYA 1KO7A 2KI5A 3KUCA 4OK6A 4DLSA 2FEOA 3GLHB 2FZLA 2ZRHA 1CJUC 1PVOA 1RZ3A 2ONJA 2HJGA 2V8OA 3ZVRA 4LHYA 3MUFA 3DL0A 1G3MA 2HLDA 3NVAA 3AV0B 3AP1A 2XXAB 3L0OA 2V54A 4BFTA 4ESHA 2WWYA 3IPYA 2Q6TA 3W6OA 3AGPA 4LBYA 4JVSB 2HXYA 4V0NA 1OT3A 4RZXA 3PEUA 2R9VA 4LZZA 4TMVA 4RD6A 1VHTA 1ZCAA 1Q1QA 5JJLA 4I4LA 4EPWA 5H70A 3ADCA 1V43A 3DDCA 2PLRA 2OESA 4MDEA 2BBTA 5A5GA 4Q18A 1XNJA 2PCLA 1ZUNB 2WHXA 5HZKA 1IQPA 4LJYA 2IYXA 1Z47A 3V9PA 4AG5A 5EJEA 3QQ5A 3CM0A 4R9UC 3TMKA 1U0HC 2QNRA 1IONA 3QVUA 1J70A 1KO5A 1KTVA 1QVAA 5J4LA 4TYYA 4GOKA 4W5HA 5FOVA 3IUYA 5AUNB 4F92B 1RKBA 4MDFA 1P2TA 2GRJA 4LK2A 2PT5A 4V03A 3QSYA 4TYWA 1JXOA 2WMOB 4IDQA 5JJKA 1FMLA 1FQKA 3QKRB 2J0QA 3P1JA 4G01B 4Q1AA 1YHNA 3K9HA 4DCTA 1FFHA 1Q1BA 5JRJA 3NDPA 3WHLA 4U5XA 2IYQA 2WWFA 2BMFA 1KI9A 3WMEA 4I1UA 2GCOA 4K81B 5GJCA 1NLYA 4HZUB 2L0XA 3EPLA 3CLVA 1DAMA 2WPDD 3QBTA 1GUAA 3BFXA 4IOKA 1SVSA 1Y63A 3AVYA 3TSZA 1QRAA 5CIWA 5AWFC 1GG2A 1PUJA 2VLIA 3OE7A 4JSTA 2EWVA 4F7WA 3I61A 3H86A 2ZSDA 2ZYUX 3NBYC 1E79D 4M21A 5JLJA 2J7PD 2UKDA 4DLRA 3FHTA 3BH7A 1S3GA 1G5PA 1E2LA 4O0MA 3WXMA 3TE6A 2FGKA 4C0QC 4DC9A 1CULC 2CK3D 1YVDA 1ZC4A 2VHJA 5IK2A 3W9YA 2NIPA 2ZVPX 3VFDA 1MKYA 2ZR7A 3C41J 3T5DA 3K0SA 4UJ5A 3KKMA 2ZYWX 2Q9AA 1T5LA 3R20A 4G5GA 2OSBA 5CJ2A 4AY2A 5C4MA 3P26A 5EP4A 3KQNA 3CNLA 3LX5A 4B3FX 4EIWA 1W4CA 3TAHA 5IF9A 1XEWX 2A7QA 4NYIQ 3A1SA 4MRNA 3EC1A 1W47A 1CJMA 3OZXA 4JT2A 1SVKA 4TTQA 1YZQA 3NDBB 5AR1A 4II7A 3UK6A 1JB1A 1TEXA 2QSZA 4TMWA 1DPFA 1OSNA 2RCNA 1E2JA 3AH8A 2WSSA 4P4SA 3GLGA 2ZS7A 2WKPA 3SOPA 5GJBA 3QIAA 5FOTA 3VR6A 3WYFA 2F3RA 2NO1A 2JIZD 2NZJA 3KUDA 3R9WA 4FN5A 4QJ4A 4KFUA 3NC1C 4BFUA 3A37A 1FNNA 1NVVQ 4LYJA 4Q4AB 2ZROA 3MRSA 3VU9B 1G3IA 3L0SA 3ZS9A 1CIPA 4M1TA 2Z4RA 3IHLA 1P60A 3BOSA 3C4JA 1DAGA 2EYUA 4K46A 3I3SR 2HF9A 4GRAA 1NNEA 3AVVA 3RS5A 4D6PA 3PR1A 5K8UA 5BYKA 2PL3A 2QAGC 4RFVA 4B35A 1R8SA 1Z0JA 4PO9A 3SJBA 2YHSA 4C3ZA 3BB4A 1N6RA 3QI2A 3BB1A 3UANA 3VX4A 4XTRA 3AM1A 2P6NA 1KSFX 2AD5A 3KX2A 2VO1A 2ZUDA 5KTYA 4DSOA 3LX8A 3CPJB 2EFEB 4ON9A 4ZKEA 3B1WA 1CU1A 1S9HA 3ECCA 4A2WA 3TGPA 3KQUA 4Q1DA 3HPQA 2CHQA 2DFNA 2IHYA 1GL6A 2RHMA 2Q3HA 1FP6A 1KYIA 3A1WA 3IPXA 3GQBA 3I8SA 4PC3A 2X1VA 4PC6A 5LB4A 1R0ZA 2YV5A 2G9NA 3L82B 3BB3A 4KYUA 3SU8A 4LI0A 3GEEA 1R5NA 4KSBA 2QE7A 1EFRD 1AS0A 1E9RA 1DEKA 2YVUA 4IEEA 4NPHA 3TAUA 3IEVA 3ICQB 2OHFA 1GTVA 3K8YA 1KOFA 4EUNA 3KJHA 2C9CA 3WBKA 3K1JA 3N2EA 1OH6A 1M1YE 2GJAA 2KB0A 2IC5A 3KXIA 3O47A 4Q1FA 1L4YA 4AURA 2ZANA 4EAQA 3KXKA 1BOFA 4LJAA 4NU0A 2QRZA 2Q9CA 2ZI5A 1SVLA 3PUXA 2YNMA 1TX4B 3Q3JB 4S2EA 5L3VA 4YXWA 1TF2A 4DLYA 3EZ6A 4C9BA 1NRJB 3X1ZA 2IXGA 1KY2A 3LFUA 5JJIA 2PCJA 1G3RA 1KO4A 5FUXA 3IKJA 2CCJA 4JL5A 4WBSA 4KODA 3ZH9B 3K0FB 1CR2A 3QENA 5FR1A 3ADBA 2REOA 4QOSA 4OI1A 2C96A 3QKSA 4B3CA 4JKIA 3EA0A 3QXJA 1U8AA 3MG9A 3TUIC 1G16A 2GBLC 4Q01A 4P4UA 4WZ6A 2ANBA 3QKUA 2E87A 4GT1A 3CUEF 4IKEA 2XAUA 5FOUA 1E9EA 1G8GA 3T34A 4D26A 1KJZA 5TXGA 3AVQA 1D9ZA 1E69A 3OFNA 2G6BA 2WWWA 1W0KD 3SBDA 3SFVA 4IXNA 4E09A 5KSZA 1E9AA 2PX0A 1G7SA 1Z3IX 1E2IA 1Q1ZA 4TQUS 3GLIE 2QORA 3FB4A 1W36B 1KO8A 2BEKA 5BN5A 4JVMA 1US8A 1KSGA 2YKGA 1Z28A 2WJYA 3Q85A 3L43A 4G5SA 3RS0A 4PZZA 3QPVA 5B58C 2J0SA 3AGQA 2ORWA 3I32A 1UEJA 3CRVA 2IXFA 3MJRA 3A1VA 5J5CA 1KK3A 1NMYA 4F93B 1OFIA 3LDAA 3RANA 4PHFA 3RS2A 4PAMA 4L9SA 2Z83A 4V0OA 2QGNA 1MR3F 2F1HA 2G3YA 3U7EB 3X1DA 3FWYA 3E5HA 4ACAA 2P0EA 3VMFA 4M9XA 2QP3A 4GDFA 4MUBA 2ZSAA 4NL4H 4DLXA 1XTQA 1OPXA 2X19A 3ETLA 3I8XA 3UKDA 3AKYA 4DEXA 4YQFA 4OQMA 2ZXUA 1GILA 1VYTA 1QG2A 2CCGA 4RD1A 4FXPA 2H18A 2VP6A 4HATA 3GFPA 1NF3A 3Q8XB 4URZR 4ZO4A 1D5CA 1Z0DA 1OXVA 4RY2A 3PIRA 2QQ0A 3TSOA 3C5HA 2G83A 4JLKA 2ZAOA 3MMPA 1QF9A 4JYCA 1M7BA 3NC0C 2CE2X 2QQEA 4M1SA 4NYJQ 5FOWA 2DB3A 3U7GA 1HT1E 2DBYA 4BFZA 4LC1A 1BH2A 3KB2A 4UNRA 3LBNA 3HU3A 2JDIA 2Z5FA 1G5TA 2F1IA 3K70C 4OKSA 1KMHA 4IDNA 2OFWA 2FOLA 2F6RA 1D8TA 1NJGA 2EFGA 4L8GA 4LY6A 1SHZA 1SXJA 1XXHE 5CYOA 2ODWA 1DTSA 2QM8A 2HYIC 1T0JB 2ZR0A 1AS3A 2DYKA 3TK1A 4ZDWA 2EW1A 2UVQA 1UKVY 2WIBA 1MOZA 4XD7A 1EK0A 1E9DA 3F3YA 1H8ED 3BAFA 4LBWA 3TR0A 3ICEA 1HQYE 5G53C 2AHOA 1FPMA 5H1YA 1TNDA 4EPVA 2VP4A 1XX6A 5EP2A 2J0UB 4YONB 2IYWA 4Z8XA 2D06A 1OFUX 3DMDA 3PXGA 4C4PA 2WICA 2RGBA 2VEDA 1MABB 2ZJOA 3B6EA 4GP6A 4HB0A 4BECA 3B1VA 3ASYA 2C04A 4JLMA 2OO7A 4AK9A 3EPKA 2AX4A 3IDQA 4QBFA 5CDFE 1JPJA 4MH0R 4XVRA 1WRBA 3J81k 2OBMA 4Z1MA 2BVNA 2HF8A 3EWAA 2XZPA 4OQNA 5EP1A 1W5TA 3EX7C 1AS2A 2ZYVX 2V1XA 3GEHA 4M1KA 5JZVA 3OEED 4Q47A 4V0ME 3H2YA 2VSOA 4NMMA 4DIDA 2P65A 4N0EA 4MRSA 1II8B 2QROA 3KQLA 1BKDR 1DO2A 1DADA 5G3ZA 1XU4A 5FBQB 2ATXA 4YLGA 4LOAA 2JJ2D 2VQSA 4RFSA 5EUMA 3GFOA 1KKMA 1AA9A 4M22A 1R10A 4BZQA 1RRGA 2D4HA 2XX3A 2O0KA 2D2EA 4DSTA 4XWAA 3RSLA 4C30A 1KSHA 4L5BA 4Q9JA 1PLJA 5L8VA 1E1QD 1ZJ6A 2XEXA 2YWEA 4A0HA 4FMBB 2GAAA 5L3SA 1FMJA 4JMPA 4MKGA 5EXPA 3K0CA 2UZIR 1K5DA 1T8UA 1KIMA 2JA1A 5FTNA 2XJ4A 3ADKA 3WBJA 2DWPA 1WBBA 2G88A 4KI0A 4IW3B 4LHZA 4C0BA 1IM2A 1C4OA 4OHXA 3K09C 2R65A 3T61A 4DCSA 4HLQB 1IY1A 4C0AC 4XSHA 2QTVB 2F9MA 4MYHA 2GAOA 3AQ4A 3MSXA 1VG1A 3QXCA 4Q00A 4QG7A 4WZAE 3IEUA 4DCNA 1TL7C 4CEHA 2BMDA 1OHHD 1IXSB 1ELOA 4A0GA 3CRRA 4DHEA 3THWB 1WQ1R 3S1AA 3SR0A 3K0AB 2IYLD 4Q02A 121PA 4PXAA 1OXSC 5J4HA 3TVTA 2ONKA 1Q3HA 1RJ9B 3IO3A 5DGXA 1KHTA 1BMFA 3R7WA 3CR8A 4H1UA 1Z6XA 4WA7A 1L7VC 1OKKA 4Q48A 3QPUA 4DDWA 4NCIA 4B47A 3ZDQA 3L2OB 1U90A 4XH9B 1U94A 2ZRNA 4LCBA 4OQXA 2VP9A 3MWLA 1G8YA 4A82A 1FZQA 3U44A 2JEOA 4NYIR 5E7MA 3UIEA 1ETUA 1DAEA 3B8HA 4BZPA 2ZUCA 3I1FA 2VHUA 3BWDD 1HURA 1T0HB 3DHWC 3CKLA 1G17A 3SYNA 4F91B 1HY3A 3TVDA 3FYHA 4TSFA 2AKAB 1ZNZA 1N6IA 1HUQA 4QJ3A 5DYGA 1VIAA 3CWQA 2R8RA 4JLJA 4ZCLA 3R9IA 2O8CA 2FSFA 2BCJQ 3MGCA 3U4QB 4F4CA 4NTZA 1N5LA 3P32A 1UDWA 1VG9B 3HR8A 2Z4SA 2X8AA 3T1QA 1Z07A 3KXLA 2CVHA 2C77A 2OV2A 3CNNA 1E9SA 2EQBA 2NO6A 2ZE6A 2HUPA 2LKDA 4QJ5A 1DE0A 2G1JA 2QPAA 5C18A 1NVVR 1NKTA 4ZDIA 2C5LA 3IQXA 1GSIA 1W49A 1NY6A 3WRYC 5ELXA 1G8FA 1Q1EA 1S3SA 3KB1A 1X8KA 1YR8A 3KJGA 4OHYA 2Y8EA 1IXZA 1E2KA 2OLKA 5E4FA 4A2PA 1XTSA 4A8JC 3ZQJA 1PZNA 1R2QA 1ZAKA 2G0TA 1Z0IA 5TY0A 2BM0A 4D4MA 5FPSA 1GWNA 2DHRA 3R9XA 3PITA 2ODNA 3VHXA 1RW4A 4Q9LA 5BN3A 5KPDA 1W7AA 5HCNA 3ZIAD 2GVDC 4QC2A 4RD4A 5G41A 3DKPA 5DN6A 4X8OA 1IXRC 4JVNA 621PA 2FX3A 3W6PA 3CW2A 4EJSA 2NO7A 2XNDA 4NCJA 2HCJB 4UXIA 1QHGA 3Q5EA 4PZYA 4QHSA 1QZXA 3OIYA 1XCMA 2CNWD 5FPYA 3IIJA 5HTKA 1AKYA 4GPTA 3UWOA 4B6FA 3K70D 2A3RA 3LQRA 3DOFA 2ZETA 4Q4HB 2IHBA 3CH5A 3QF4B 5C46F 2IYTA 5LPNA 3ZVMA 2OBLA 4MRPA 1CR0A 1I4DD 1XRJA 2GZDA 2H16A 4M0LA 2LCFA 4ARZA 2J7KA 4TQ9A 3W8RA 2XTNA 4BEBA 3W5JA 4C7OA 1N0UA 2J5XA 5JSZB 4M2LA 5CLQA 1GRRA 3UMFA 1ZM4A 2BIFA 5LD2C 2A5YB 2YOHA 1COWA 1G64A 2OE2A 4URUR 5JS8A 3UG7A 2A5JA 3LLUA 4BEJA 2QT0A 3RC8A 1Z22A 4ITRC 1YRBA 4HDOB 1F2TA 2ODBA 5CK4A 2ZI6A 5F98A 1TF5A 3BJIC 3WNCA 1A1VA 2YINC 1DARA 2K5UA 2FZ4A 2N42A 3GPLA 5JMTA 4IFEA 2QMOA 3AP3A 3VNVA 2XNSA 1N0VC 4TL7A 2IT1A 1S1CA 3OAAD 1KNXA 2C99A 3EASA 3U6BA 3K9LA 3QVVA 2Q21A 1ZMXA 3C8UA 5CYPA 5GJWC 1W0JD 4AWXA 1N6OA 4KFTA 4OYHA 4TN1A 1E9CA 2W2XA 3BC1A 3GLIA 3DKVA 1XD2A 1EWRA 2REXB 1T91A 4FCTA 4HAZA 2MSCB 3EW9A 3TBKA 3U3MA 1Q22A 2Q9BA 3B60A 4JT4A 4JVLA 1E98A 2ZJ8A 5EE0A 3FMPB 2OEPA 2O8DA 1FUKA 1XZQA 1Z8FA 4D81A 1KI8A 2DFTA 1GNRA 1T8TA 4QGHA 3QJYA 2OUKA 3KKPA 4K8OA 5EXTA 4AG6A 4M1YA 3JZMA 4MITA 2V6IA 2VP2A 3GP8A 3X1WA 3CF0A 1JXMA 1ZRHA 2TMKA 1E2EA 1SKYB 2H1LA 3UATA 3NBXX 4KSCA 4OI0A 1JQJC 1Q21A 1WMSA 1ODFA 3QEOA 1W4RA 1LS1A 5KHOC 4UXJA 1CS4C 5IDVA 1IOZA 4OQLA 1WA5A 3AKDA 1QHSA 1Z06A 3GLFE 1YJ5A 2GCOB 1IN7A 1Q0UA 4LV6A 4QNRA 3FFAA 5CB6A 3R8CA 1NG1A 4M9QA 4B34A 1U8ZA 1QHYA 2GF9A 2A78A 2D74A 4U00A 4GMXA 1AK2A 3WMFA 1ZU5A 2G1KA 1U9IA 5FPKA 2B92A 2CDNA 4HLCA 1EX7A 1LW7A 4IDPA 2IYYA 1KK0A 4B32A 3WYGA 2P5TB 4HLUC 1UBGA 1E79A 3CX7A 2R2AA 1DELA 2A5DA 1P3JA 2JJ8A 4QHTA 5JCPA 4FI3C 4QL3A 4BLSA 5EZ6B 1E0SA 5CLLA 4CGZA 4NKRA 2ZVQX 4QHYA 3O8RA 2I4IA 4GZLA 2ZI9A 1OW3B 1Z2CA 1E0KA 1XXHA 221PA 1JAIA 2PMKA 1SVWA 3U6KA 1G3UA 4KAXA 4Q9IA 2W0MA 2XZLA 2YC4C 1ZYUA 1DG3A 3LD9A 3BFKA 1YZTA 1ZIPA 4NYJR 4MKHA 1KO1A 3T15A 3HDTA 1KJWA 2CHVA 1FL9A 2ZIAA 2WBLC 3FE2A 3JZAA 2J0VA 4RKEA 4CT4B 5CITA 1JR3D 5JWHA 4DUGD 1G18A 3K9GA 3U3RA 4E07A 2QRNA 1FX0A 3SEAA 4P4SB 3GLGB 4BFYA 2QU8A 5TB5A 1OH7A 3VNUA 2ZRLA 1TU4A 2JIZA 3H0KA 5KU1A 4POAA 3NEJA 1TF7A 3D3QA 2IS4A 3D8BA 2KE5A 5BXQC 3M1IA 1IY0A 2OZEA 1M7GA 5CDFA 1VCIA 4I1OA 4A1FA 1DG1G 1NVWQ 3N2IA 2GWHA 2IL1A 3D6TB 4QRHA 4JS0A 4B74A 4A15A 5E7IA 4WW0A 4JLOA 5KNCA 2AXNA 2JJ1D 4RVCA 4V0MA 2QI9C 3THOA 2EVWX 2JLXA 3A36A 3PENA 2HLDD 2RGXA 3ZZUA 2VBCA 1ZINA 1ZNXA 2VHCA 2WAYA 3W90A 1NIJA 2IW3A 2AXPA 5EE9A 3WP0A 1OH8A 2NQ2C 4DEYA 1UFQA 1NG9A 4HYYA 3BRWD 3MAAC 1BS1A 2IUSA 4FIDA 1HE1C 4EQ6B 2ZITA 4TYPA 1TU3A 1G8HA 2O8FA 1Q12A 1Q20A 3MD0A 1CBUA 4P4TA 2PX3A 4HUQA 4XWOA 3NHBA 4JYBA 1N5IA 1FNMA 3OIWA 2P2LA 1TPZA 2BDTA 3LWNA 1GVNB 1Z6TA 2GK6A 4GL2A 2QZ4A 3THXA 3VKHA 1ZM7A 4R98A 1S1MA 1W4BA 4Q21A 3L8ZA 3CR7A 1A82A 1R0WA 2P5SA 1KDOA 2QM7A 1P72A 4HZIA 3E1SA 4HUTA 2ZE7A 3DVLA 3AF4A 3ND8A 5F9FA 4KBGA 2VA8A 2C2HA 1CR1A 3IIKA 1JEDA 1SHKA 1PV4A 2F43A 3I5XA 1VG0B 3QNUA 2HXSA 3A4NA 3UG6A 3QXSA 4MGIR 3FKQA 4W5JA 2AKYA 4BQSA 2ZRDA 4LGMA 5AJZA 5DISB 3IO5A 1XPUA 4LUCA 2H5EA 2I3BA 2R6GA 1ZC3A 1DOAA 5FL7D 3RRMA 2XSZD 2R6DA 4B44A 3JVUA 3FKSD 1W2HA 1N6NA 3KTAA 5B2ZA 3WHKA 2I1VB 1OXXK 4Q03A 2FDCA 1PJRA 3WY9A 4XVQA 2B7BA 3QKSB 1YR7A 5F2EA 4PSKA 3B1YA 3LXRA 5D3QA 3CNOA 2WWXA 2BC9A 4LJ7A 1EG7A 1F5NA 3RWOA 5E95A 1AQYA 4WAUA 4NP6A 3EG5A 5CIQA 1GRQA 5FI1B 1NBMD 1NVXQ 2GZHA 2KBFA 3CRQA 1L8QA 1W0KA 2ZSEA 1H65A 2V9PA 2J3EA 1XD9A 4N3NA 2BCGY 4XJXA 1QG4A 2RGCA 1RRFA 3RWMB 1DVRA 1SVIA 1US8B 2VP0A 1E4VA 2EYQA 1OB5A 3FMOB 4V02A 1W36C 2GEDA 1X1SA 1RVDA 4MQBA 5JI3E 4JZKA 1N2CE 1UJ2A 2IUTA 2W58A 3AF1A 1O87A 4DT1A 1GL7A 1KAOA 2IF2A 5J47A 1OXUA 4IDOA 4F4IA 1DO0A 2Q3FA 4G3XA 4HB2A 5AJWA 5DI9A 2OXRA 2HV8A 3NG1A 2IS6A 1JI0A 4DLWA 3MWYW 4B3BA 4MGKR 2ZM5A 3LVQE 4Q9HA 2RGEA 1XF9A 4LPKA 2HEIA 3ASZA 2VRWA 1CJVC 1QHIA 4TMKA 4JLAA 3W34A 1EX6A 1GRNA 4C0SA 4AKIA 1M6NA 1P5ZB 3GJ0A 1F3OA 3U3JA 3BIFA 1R7RA 3AKEA 3U5ZB 1GZSA 3Q72A 1UBCA 1ZD1A 3AVOA 3MJHA 3F5FA 4TYNA 2JLZA 1WF3A 2CVFA 2PZGA 2PJRA 1P2SA 2P3SA 2CJWA 2JLVA 3AEZA 3FVQA 1YRAA 4URVR 3AVPA 4JLDA 1A5TA 1UKYA 4UNSA 2ERXA 2IYUA 3TKLA 1N5KA 1XPRA 1DAHA 3EPHA 4Z51A 2D62A 4B3DA 5L3RA 1E94E 2GJ8A 3OIUA 2GXQA 1LTQA 4M1MA 3Q5DA 3QKTA 3MWKA 3P27A 2C03A 1ZM9A 2VHQA 3FGNA 4BRUA 4AI6A 4IFBA 4DSNA 4X8LA 4C0KA 2R6AA 2FNAA 3GCGA 3EIHA 1JPNA 4N1AA 4TQAA 2MMGA 3VR3A 1AGPA 3LA6A 2AFIE 3DM9B 4PQYA 1AGRA 1IHUA 4BGDA 4QM7A 3PUVA 4GOXA 5FTKA 1SXJB 1HH4A 2J59A 3OEHD 1DAKA 2ORVA 4PPQA 4DRZA 1KGDA 2PLFA 3CIOA 4F38A 1KZ7B 2QPTA 2I1QA 2N1BA 1TMKA 2OT3B 3M4YA 5CM8B 1KNQA 4L4UA 3W5IA 5TVKA 4YMSA 1VDZA 1AZSC 5LDDC 2FN4A 2ECKA 4KCGA 2DFKB 3TIFA 4I1VA 4FINA 4LWZA 4V0LA 5SZHB 2FPMA 3DEFA 2A30A 3H84A 2ODEA 4DLUA 4A6PA 1F2UA 2ZJBA 3B1ZA 2KSQA 1U2RA 2XJ9A 4A0FA 2GTPA 4QGAA 3HYTA 3RRNA 2AK3A 3QEJA 4AYXA 5HR5A 3KQHA 3EC2A 5K8LA 2J1LA 3KJEA 5JRZA 5KNBA 5C1BA 4MRVA 2X2EA 1RFLA 1P62B 1MRNA 2RGGA 4FWIB 2IK8A 2C8VA 2QAGA 2FU5C 1XWIA 3X1YA 1E32A 2BM1A 3FTQA 1KI3A 4OJKA 3VTKA 4D0GA 3DZ8A 4Z8YA 2V7QD 1D6JA 2ZI4A 2D2FA 1XZPA 5FUVA 4OJQA 1NN0A 2B8WA 2WMNB 1D2NA 3OEEA 4IOMA 3T1TA 3FOZA 3GJ8A 4NH0A 5HPYB 3RRZA 1H8HD 2YOGA 1G7RA 4W7SA 4JSYA 5TDHA 3KKOA 2IA5A 1I4TD 2FV8A 1U8YA 4IOJA 3T35A 1L4UA 4RFSB 3TR5A 2ZRJA 2BJVA 1E2GA 2JJ2A 1D9XA 1J8YF 3OFND 4P31A 1VYVA 3SN6A 3TRFA 1P75A 3UMRA 1AZTA 1IN8A 2BEJA 2DCUA 4TLDA 3GLFA 4I1SA 1Z6YA 3SQXA 4DLTA 1P9WA 1T3LA 4DLZA 4QM6A 3LBHA 1R5BA 1E1QA 5L3SB 4LHVA 1J99A 1YZUA 2H57A 4X8MA 3DM5A 1SZPA 5GVRA 5M04A 3T12A 4A0RA 5HE9A 3CRW1 1N6KA 1GDDA 2ZJYA 4ZPXA 5TARA 2A5FA 1O3YA 2QA5A 4LHWA 4H9GA 4KJZA 2WAXA 2YWGA 4DVGA 1UKEA 1VHLA 1XEXA 1YE8A 2ZRBA 5BW8A 1I2MA 5GADl 1Z29A 1R0YA 2IYVA 1WXQA 2GCNA 2VSFA 4PQRA 5FBVB 4CEHB 5A0FA 3ADDA 1W5SA 1CJKC 4RCZA 3WNDA 1OHHA 1MT0A 4XSGA 1NVUQ 4ILEA 421PA 1KKLA 2FJUA 3S1AB 3TJZA 1GM5A 1GNQA 3I5YA 2GVZC 1Z2AA 1XTKA 2BHRA 2Z0MA 3TQFA 2W6IA 2GBLA 3GLHE 1XCPA 3QXXA 5AUQA 4UQOA 4PR0A 5KDLA 1K5GA 5J4VA 1LY1A 4B3XA 4CIDA 1HE8B 2WJHA 3R7WB 4ZKDA 3ZLJA 3ZZTA 2NZ8A 2ZJ5A 2QP9X 1JEEA 5JS7A 2FFHA 3Q7QA 3HJNA 3X2SA 4KLNA 4HLDA 2CL6X 1OIWA 4DLVA 1R5OA 4TT3A 4RZ3A 4GOJA 1OJLA 2GJSA 1S96A 1W36D 2GJKA 1KI1A 4PHHA 4AKEA 1P6XA 1E6CA 3EXAA 4WXPA 2DWQA 4O25A 1XMJA 1NBME 3OHMA 4O2RA 3R8FA 4WOPA 4BFWA 1KI6A 3TH5A 2AR7A 3PQCA 3EZFA 1KSJA 5FBLB 3C5CA 2O8CB 5FL3A 4FCWA 4E22A 1U81A 5AJXA 4KVGA 2AL7A 3U61B 2RKOA 3AUYA 4LHXA 1RRPA 1Z83A 2A2ZA 2JATA 5AUPB 4MKFA 5KDOA 2DY1A 4B76A 3TUZC 4GNKA 3RABA 3L0PA 1F48A 3EWSA 5J4KA 4CEJA 3JVVA 3LAWA 4AIIA 3U3OA 1TAGA 2ZU6A 3HP1A 4BLTA 1U0LA 2XTMA 2PH1A 4TMZA 1X86B 4PC1A 3PV0A 4TMXA 1DS6A 2J9RA 1XDBA 2XITA 4JBXA 2WSMA 2FEMA 1EWQA 3Q9LA 1UM8A 5H68A 3FHCB 5DIFA 1LNZA 4A6XA 1MO4A 5KNDA 4QNMA 5TMPA 2PZEA 3ZIAA 1QHHA 5D3MA 4AKHA 3GJ4A 4EJSB 3FMFA 1LF5A 1KY3A 1RYHA 5FR2A 5KOYA 2GEUA 2PT7A 1I4LD 1XJ0A 2W00A 3LH5A 4Z54A 2O8EA 2FPKA 2CNWA 1P73A 2WZQA 2ZJ2A 4B2PA 1SVMA 3QY0A 3B13B 1ZNYA 3NBZC 1RRCA 1QHNA 4PC7A 1VIYA 1W44A 4MRRA 2ZRPA 2QAJA 2R6CA 4ARZB 1E3MA 5P21A 1JJVA 3T1OA 4C7OB 2WIAA 4BUJA 1G20E 4LSGA 3LV8A 2JLUA 2BOVA 5KSPA 4YMUA 2CBZA 4MYCA 4NHOA 3RS3A 1G7CA 1GKIA 1BYUA 1G291 5DLQC 2OM2A 2WJGA 5EE1A 1JBKA 4PAOA 4YMVA 2BJWA 3NWJA 1XMSA 1GL9B 3FHOA 1EFUA 3SYKA 4HAXA 1Q3TA 3A1TA 3IILA 1F2TB 3WP1B 3CZPA 2VL7A 5GJVC 4LYHA 1XMVA 1KMQA 2RGNA 2CL7X 2XTZA 4DJTA 2R62A 1BYIA 2NOAA 3REGA 3T5GA 4TL6A 3RS7A 3K53A 4CF7A 3V00A 3OAAA 5KSYA 1ZBDA 1NSTA 2H7VA 5C2JB 3KKNA 2J87A 5KO2A 3SC3A 4ESVA 1IN4A 4LDJA 2GILA 2ZQ5A 4F4JA 1W0JA 1FW6A 1IJFA 3CF2A 3GFTA 3GLIB 3RAPR 1XD2B 2GK7A 4M53A 1KI4A 5EUQB 4BPBA 2F3TA 4UNPA 2PJZA 1CRPA 1SQ5A 3WNBA 4UNQA 5CB8A 1L2TA 4WVFA 2O8DB 1MV5A 4DIEA 2QG6A 4TWZA 2OFOA 4EDHA 4TZ0A 1OE0A 2BMEA 5LBIA 4ZV4A 5GVSA 2WJVA 2QUZA 2J45A 1WE2A 3NBFA 1BIFA 3NH9A 1DBSA 3CONA 5G40A 1FUUA 2FPLA 2QMEA 2EFHB 2NO0A 3PEVA 1N25A 1UPTA 3P4YA 1ANKA 2IUUA 1ZD8A 4PAQA 5JBQA 1XTIA 4ZIRA 3RNLA 1NN5A 4KVAA 4CEIA 2ZAMA 821PA 1JR6A 4CYMA 2PMDA 4IVQA 5E7JA 5JECA 4QBHA 4NE2A 4RD3A 2ZTSA 5FH9A 1XTJA 1HYQA 1VCOA 4YDSA 2W0SA 4ASUD 1VG8A 3NH6A 1E1RD 1UBFA 3QBVA 4D4LA 3A4MA 4E5UA 3H1TA 3NHAA 2HJVA 2ASEA 5DHAA 3LVRE 2QL6A 1NLZA 1ZIOA 3A58B 1D2MA 5AJYA 4KHZA 1IN5A 2QGZA 1NMZA 2C98A 1MO6A 4TMTA 5HKKD 1FP7A 3B1XA 4J0QA 3LBIA 2ZYTX 1J8MF 3CPHA 4B2IA 3EZ9A 5KPJA 2OBNA 2V55B 5H8WA 4OHVA 1M74A 2J41A 1TADA 3KFXA 2CLCX 1XXHB 4CRWB 1S4QA 3M0EA 1TUIA 4JJZA 1UF9A 4P33A 4OL0A 4HSEA 4BFXA 5DE3A 2B21A 3EZ7A 1KJYA 4OBEA 2W83A 2XNDD 2WV9A 4HAUA 1G9XA 2DPXA 4BLRA 2EFCB 4PO8A 2BKEA 3C16C 4HB4A 5FTJA 4LJ6A 4ERNA 3SYLA 2Z43A 5AUOB 3A8TA 1TQ4A 3BH6A 1JJ7A 1GIAA 1ZUHA 3LQQA 4GMDA 2WVJA 4LBZA 3SJZA 4DUGA 2LKCA 1FX0B 2CLSA 1II0A 1XP8A 2XOKD 2IEZA 4Q4JA 3PCRB 1ZUIA 4S35A 4D0NA 4R2IA 2ZRCA 1E2QA 2IWRA 4CW7A 5J4YA 4LV5B 2FMXA 4ZCMA 1AIPA 2V1UA 2DFLA 3SFZA 4NYMQ 1R0XA 3B9QA 2GNOA 2WPDA 4BE7B 1AKEA 1TUEA 2VSXA 5JFGA 3B5JA 3VKWA 4PPNA 1E2NA 1VECA 4PX9A 2OILA 5JHGB 1Y3AA 2GDJA 1K8RA 2ZRMA 4R7ZA 3O8CA 2OXCA 5JHHB 4NCKA 3I4LA 4D80A 2J7PA 3GD7A 2VF7A 3ZJYA 2W2TA 1KK2A 1U99A 1CR4A 3BH0A 4US1R 2YC2C 5BQ5A 3V4RA 4A8JA 2JJ1A 5SZJA 2CK3A 2CHGA 2ZRIA 1ZNWA 3B82A 1T4GA 1NN3A 2ZUBA 2QMUA 3A1UA 1G21E 2FF7A 4RD0A 3O8DA 4PC2A 4PTLA 5JWOA 2GKSA 3EAQA 1J90A 3KFVA 2JLYA 3HU1A 4OK3A 5L3QA 3UMSA 2CLDX 1P9RA 5EXXA 1E2DA 4GP7A 2O8FB 3AUXA 3L8YA 3WYAA 3E2IA 3B9PA 4LBVA 1VCMA 1SVOA 1JAHA 4HUQB 3ZS8A 4OQFA 2WWGA 1MO5A 3W3AA 4XWKA 2D7DA 2XB2A 1B23P 3DMNA 4O3MA 1VMAA 1XD8A 1ZP6A 4YDHB 1OH5A 3AVTA 3THXB 4HEJA 1N6LA 4B48A 4D25A 4US2R 1XBTA 3EIQA 5DI3A 3LXXA 3V4FA 1E2MA 2YYZA 2YOFA 3THYA 1RPZA 2QBYA 5ANRB 2ZI3A 2G0NA 1SGWA 2ORIA 4RSGA 3EIEA 2W6JD 2F43B 3M6AA 1C1YA 4OHWA 3W8NA 1GFIA 2X77A 4G0NA 3AVXA 2E1RA 5IRCD 1NIPA 4EPRA 2D3WA 2IYSA 4JBYA 2PZFA 4AYTA 4EFLA 2QPOA 3E70C 1GNPA 3ONWA 4US0R 2CXXA 1X3SA 2O8BA 3MWJA 4FMDF 2ZE5A 4QXAA 4GZMA 2VF8A 3HPRA 3GLHA 4PQFA 4JJKA 5FL7A 1MH1A 4TZ6A 4D4JA 2XSZA 3GJ7A 4W9MC 3KTAB 3PEYA 2V4ZA 3FKSA 3RRYA 2XXAA 1VTKA 1WDTA 2RGAA 1FOEB 3GMTA 4JLVA 8OHMA 2FA9A 4BRWA 2RH5A 3QF7A 5JWRA 1VYUA 4BWYA 4PZLA 5FPHA 3VQTA 3VHLB 5B57C 1P2UA 5EE5B 1UKZA 2CE7A 4XOIA 2WJIA 3BXZA 1E4YA 1FTNA 1Z5ZA 4NCHA 2D7CA 2IEYA 3BORA 5FOSA 2YWHA 1S0UA 2OAQ1 3GJXC 3QUSA 4AKGA 1N6HA 4KYIB 1NBMA 3ZD7A 3PUZA 5IHPA 1Z0AA 5C4GB 3SI7A 1OB2A 1UBEA 2GJ9A 3B85A 2BKUA 5JI2E 3AVWA 3N70A 4M9ZA 2WOJA 3MFYA 4EPTA 2IWHA 1EFRA 4JL8A 3SE0A 4EPYA 3CRMA 4NZYA 1G6OA 1Z6AA 4DT1B 3BERA 1R8QA 5F3WB 1NY5A 2OCPA 4NDZA 4IVPA 4U7DA 4MYUA 3QKRA 1P9NA 3QPWA 1JALA 4C0LA 2XB4A 3AP2A 721PA 4DB2A 3N5CA 4PSVA 4CDGA 4FCVA 1G5RA 1EFTA 2R44A 2HT1A 1CP2A 1S9DA 5AK0A 3GEIA 2ZE8A 4HZUA 2WWHA 2G77B 5SZKB 1KDPA 3NIBA 1WCV1 1EESA 3KKQA 5BWMA 3LNCA 2GHIA 1HT2E 2FSHA 1Z0KA 2VP5A 3TUJC 4Q1EA 1GP2A 2AN9A 3OE7D 4QBGB 1OV4A 4HLUA 4OHZA 3TW8B 2CJWB 2VPPA 3DPUA 4C0HA 2OCAA 3SQWA 1GKUB 3P4XA 4IOLA 2B7CA 1E96A 2NPIA 4BLOA 4MGYR 5IK2D 1C9KA 1N5JA 2J46A 2IS1A 3Q7PA 2NMVA 2P6UA 2WJJA 1R4AA 1TQ2A 2A9KA 5UKDA 2VIIA 4P32A 1XFAA 1OYWA 3FDIA 3CF6R 4IVRA 1RE0A 1XPOA 1EXMA 2CCKA 1M34E 4LC0A 2OCBA 1J7KA 1ZVQA 2E9SA 3AB3A 1ZD9A 1IAQA 1T3SA 5KSOA 2NPFA 4B3GA 2JLQA 3UWKA 4EQ6A 2C9OA 2IX3A 2CEAA 5TV2A 1Z63A 3I73A 1D2EA 4IDHA 4G5RA 1XCGB 4FW9A 1P4SA 3OEHA 1E2HA 1XB2A 4HAYA 4XTCS 1N0WA 1SXJC 3GJ5A 3IBYA 4LPSA 4DCUA 4HAVA 1LFDB 521PA 4MYTA 4ZI3A 3G0HA 4YC7A 2WSSD 1G4AE 2AWOA 3IIMA 4B43A 4B6EA 4Q7JB 4QKQA 2C78A 1LS6A 1AQUA 4B71A 2F9LA 5JEDA 3W6NA 2PBRA 3REFA 2UZ3A 2O52A 2ZSBA 4Q7LA 4DKXA 1Z6GA 2QN6A 1F2UB 4OI2A 4PPGA 1VCNA 2FE4A 1M2OB 4Q4AA 4UXHA 3VU9A 1GAJA 3K9NA 3H4MA 2A5GA 3SJCA 4BASA 3RVBA 5CJPA 2BBOA 4BLPA 2QAGB 5LB2A 2CL0X 4BFVA 3IBGA 4A92A 2KJQA 2IF0A 1ZCBA 2X2FA 4GSYA 3LY5A 1HV8A 2WKQA 2HYDA 3L0IB 1NJFA 2V7QA 5IT5A 1E9BA 2ZEJA 3I62A 2XGJA 3D7MA 4ZCIA 1E0AA 1DAFA 4UJ3A 4V0KA 2P6RA 4FMDB 1FQJA 2AFHE 2ZJZA 4EFNA 1GOTA 1NN1A 1W1WA 2GXSA 1H8HA 1KMHB 1IJEA 4PHGA 1X1RA 1K6MA 2JCSA 3P20A 1E2FA 4Q1BA 2FWRA 1NSFA 1UDXA 4B75A 2QMHA 2ZRKA 5FTLA 3G5UA 2FSIA 4U02A 4CVNA 4PANA 3GLFB 2EU8A 3KQKA 1H8EA 1U0JA 2QE7D 4LYFA 4G1UC 2FFAA 2ERYA 1MRSA 3WRXC 1YR6A 1JR3E 1G19A 1NKSA 2GZAA 2YZ2A 3K0CC 3KJIA 4KLZA 3K0EA 4Q9KA 1PLLA 3WMGA 3SS8A 1G8PA 2ZR9A 4C2UA 4C2TA 4IRUB 3CO5A 1FTSA 2F1RA 4D0LB 1WB9A 1AJEA 1XEXB 2RMKA 2ZRFA 3PJRA 4YXWD 5FUYA 5EXSA 2QY9A 2YJTD 2JGNA 3BBPA 4A4DA 2VTKA 3BGWA 3D31A 2Z6VA 4H1VA 3IGFA 1T3HA 3DO6A 2ZS8A 4PPFA 1F6BA 3NTUA 1M8PA 1QVRA 2AWNA 3K0FA 3PVSA 1ZW6A 2GF0A 3RHFA 4CT5A 6Q21A 1E9FA 2CMKA 1KDTA 2NTYC 4B2LA 3PUYA 4O2LA 1LVGA 2QTFA 1G3QA 4KV9A 2FFQA 1G41A 4RCYA 4DB4A 5FOXA 2DWOA 2FG5A 1XJCA 5B64A 4EKDA 2QT1A 3A6PC 3LLMA 2KWIA 1OIVA 4M1WA 3SBEA 3NXSA 4A9AA 2QEQA 1YZLA 4I81A 1G6HA 4WIAA 4ZI2A 4PSAA 4TLCA 3G82C 1CRQA 5G3YA 2BV3A 1CF4A 3W3ZB 2MSDB 3VR2A 3U7HB 1KI6B 1NL3A 1PLKA 4P0TA 3GJ3A 2XZOA 1WBDA 5EP3A 4ACBA 4I99A 3AKCA 4KBFA 5KDDA 2KBEA 4TLEA 5FBWB 2VHTA 4ABYA 3RS4A 2ZREA 3UXMA 4A2QA 2C95A 5BYJA 4M1OA 1IN6A 1JNYA 4P3YA 3VR1A 2ZPTX 1VKJA 3B2EA 3CWZA 2GETA 2OCYC 4XIGS 3ZYCA 5JEEA 1SKYE 3SHFA 2Q3MA 4NYMR 4TL8A 4GBMA 4CEJB 4IJMA 4TLBA 4LV8B 1QBKC 1W4AA 4JBWA 5J40A 2AK2A 4B73A 1KI7A 4OK5A 1X6VA 1ZU4A 2Q0HA 4RKFA 5SZIA 5K8TA 3ZGXA 3MCAA 2RGNC 2B6HA 3LO5A 3ZVNA 1KI2A 4IEIA 4LJ5A 3EA5A 4QFMA 4BFSA 2W2VA 1A2KC 2O5VA 2JLSA 3RSOA 3CH4B 1QHHB 5D3MB 4FWTA 2GESA 3VAAA 4URXR 5AJVB 2REBA 1CJTC 4WXRA 4HB3A 4DDUA 4BZXA 5FFMA 2R6FA 4YMTA 3U44B 2B8TA 4LYAA 1KK1A 4EJSC 1F60A 2HT6A 2O8EB 2YWFA 1EFCA 1HA3A 2JDID 3SJAA 3K70B 4HDQB 4IHQA 5DNYB 4MGZR 2VYFA 5DO9A 2IXEA 1RYFA 2JASA 2LWIA 1SXJD 1U98A 1X8JA 2O0HA 2MSEB 4LRWA 1ZM2A 1OXTA 3HYRA 1TQ6A 2AD1A 4XD7D 4Y0VA 4ZDKA 1II9A 2IYZA 1T5IA 4W5WA 3FPAA 1OF1A 4TLAA 3TW4A 3CX8A 1CLUA 5DYIA 4QBIA 4Q5IA 1B0UA 1YKSA 1NMXA 1I2DA 1KAGA 3NKVA 2P67A 2OG2A 1AN0A 1ONBA 2J0UA 2H8KA 2GXUA 2F1JA 1JQLB 1KZGB 4Q1CA 1PUIA 2RB4A 4YMWA 1YQTA 3GLGE 1XTRA 2ANCA 2GA8A 2BBWA 4LX0A 3VR4A 4PFSA 1MABA 1S8FA 2ZU0C 1UEIA 2EWWA 3C15C 3CBQA 4RJLA 4D2IA 2FSGA 3DOEA 1HEIA 1LB1B 4TL9A 1OFHA 3U60B 1RC8A 3U3KA 3KZ1E 4B33A 2WKRA 5BN4A 3KL4A 2JLRA 2RGDA 4QGGA 4GFDA 3ZD6A 4MKIA 1Z08A 4KO8A 4EPXA 1OFTA 3BE4A 4KITB 1ESMA 4Z1MD 1HQCA 3PEWA 5FBRB 4Y0AA 4X8HA 5HE8A 2MMCA 2W6ID 3ZVLA 1LF0A 1EGAA 3SHWA 3F8TA 2F7SA 1ESNA 3CX6A 1II8A 1P2VA 4C0JA 5EZ5A 5DSZA 2QTHA 2ZS9A 3QXHA 2ZRAA 4R2HA 3EPJA 3AF3A 1CXZA 1X8LA 4LJ4A 2HDNB 4FMCF 4XVUA 3OF5A 4WZBE 3U7FB 4TT3D 3ZZ0A 1SKQA 1YZGA 4KU4A 3GJ6A 3PFIA 1DAIA 1Z0FA 1G1MA 4ZIRB 4JKYA 3U2QA 5JCZA 4G5QA 4CEIB 5FPTA 3UPUA 1CEEA 4BLQA 3BK7A 3MLEA 2WM9B 3TQCA 4RD2A 2C9YA 1G4UR 2RAPA 4TYQA 5CK5A 1RIFA 2ATVA 1WP9A 2SHKA 2ZSFA 4KFSA 4N0DA 4DDVA 5DH9A 2BBSA 3F0TA 3BS4A 3PUWA 1UADA 4PO1A 3EZ2A 4ASUA 1T6NA 1W2GA 1XJQA 3EARA 3IQWA 4M4SA 1E1RA 4UNNA 3CB4A 2FGJA
chains in the Genus database with same CATH superfamily
3GL9A 2OCIA 2IRWA 5FRDA 4EG1A 1TYAE 2QTVA 1H6DA 4I5IA 4JC4A 5EJ7A 4YT4A 1RNLA 1AK1A 2XD9A 1JFRA 3C5WP 1YMVA 3TSCA 2P9BA 4PE5B 4BO1A 4WLVA 2FMIA 3T7JA 3AF2A 3KSBC 4G0VA 3BXGA 4F5DA 3THWA 1YZNA 3DBRA 2YHAA 4ZJYA 3WLTA 5KWJA 1MDFA 4UFOA 1AMOA 1Q44A 4IVNA 3K0AA 4D82A 2WG2A 2IH2A 1FDOA 4LJRA 1W6UA 1NP6A 4Z4FA 3Q11A 1ZSYA 2E4WA 4LYYA 4MCIA 3DUFB 3O93A 4WD3A 1YRQA 4MIYA 4BE4A 1GTZA 1VPLA 4Q4LA 2H1SA 3T52A 2IHTA 4ZMBA 3T5PA 3B78A 4AYWA 4DJJA 1OKKD 3AHDA 5IBRA 1Q57A 1U7TA 3FUVA 3NUQA 4F2PA 4DIKA 1IEXA 4DR6B 1LV7A 3PGVA 3P8ZA 5CDHA 4BQEA 2AGVA 3PHIA 4D45A 4MDYA 3D7LA 3NCHA 4RMHA 4GECA 3PG5A 2GEVA 4EZIA 3K1ZA 4FOOA 2H07A 5J2TF 2PSDA 2IX9A 4NAVA 2KM1A 1NDHA 3HDGA 3LQKA 4G37A 4AD8A 3TQQA 4EJSC 4ZYVA 1S02A 3BEDA 4Q4JB 4TSFD 2XOKA 1KHHA 1U3DA 3TW0A 4FSDA 1P0FA 3MZ0A 4JI8B 1CHDA 4R71A 5B7QA 5FWNA 3ABQB 4HQRA 3N7TA 4FWBA 3IX7A 4HX9A 3U4QA 4P7BA 5CM9C 4MA4A 2QSJA 2GDZA 5DHFA 1GU1A 3HWX1 1E2UA 1UOPA 3GDWA 1GGNA 4HN2A 3OA2A 2WOOA 4Z9YA 4BRSA 4EFMA 1ZM3A 3CZQA 3H5TA 2PUEA 4G07A 2PKRA 1EFHA 1OH8A 4AN1A 3F7NA 4P80A 2Z3VA 3GAZA 3H8WA 4WLOA 1TYDE 5E6SB 5HZHA 5AHWA 3UBTA 1U7OA 3W78A 3KU1A 1WUJS 4ICIA 1VE5A 2W5UA 3OLXA 1JLRA 5C8DA 2IS2A 2P2NA 4KUGA 1Y4DE 5GWXA 2A0WA 1L5KA 1QHFA 4HAWA 4AX4A 2BUCA 3FMIA 4TTPA 1WDKA 5LOVA 1WM1A 3B7WA 5JZMA 1NYTA 4JB0A 4ZQEA 1K86A 2IZ5A 2AG1A 3USCS 4TKUB 7GPBA 2F55A 3HA3A 3SZRA 2FMFA 2HDHA 1ONOA 3WJAA 1NF2A 3TJMA 4KXFB 4QUKA 1VJGA 4PHTA 2JIPA 4YEDA 3JQQA 1Y7PA 5IFKA 5CX4A 2R25B 1PL7A 3IA2A 1L7PA 3PQ3A 2YASA 1KYQA 3AF0A 4PZAA 4CLRB 1EZ4A 2XMSA 2RFLA 4UEQA 5HCIA 2FW9A 3URKA 2WYWA 2DBRA 1SU8A 3OVMA 4HP8A 3QF4A 1TEVA 3DTVA 3ZZMA 3CPEA 3IQZA 5IEBA 1XEWY 3M1LA 1K6XA 3VRHA 1Y89A 3B7GA 4IIGA 4N6OA 2QVLA 4XXHA 5BUQA 3KC2A 4LGYA 1M7HA 3IPCA 1BXZA 4K5QA 4ZVSA 4ZDJA 5JSZA 1QH8B 4HEA6 4KE6A 4PYRA 2Q1YA 2YZ7A 4WWHA 1T9HA 2VH5R 2YN4A 3GP5A 2D54A 3HDYA 3UW3A 4C7VA 3SOZA 1COWD 1MO3A 3KR1A 4TT8A 4Z3DA 2O5EA 5EAIA 3HWSA 3JR7A 1SXJE 3ZQ6A 1RBZA 2R4TA 4OB6A 4W8GA 2X0DA 3WRYA 3WSWA 1TU0A 4D9GA 2VK2A 1UANA 2O8BB 1C30B 2QQ5A 1YL7A 4FMCB 1U7XA 1GITA 1SC9A 5CPFA 2C94A 2I80A 3FVRA 4TKZA 1TJ3A 2C57A 2AOTB 4QAJA 4BNWA 3GLHB 2ZRHA 4WOKA 5J1SB 1PVOA 1RZ3A 2PQMA 1QTNA 2J3QA 2Q46A 1EAYA 4BN4A 2ROQA 3MJVA 1K7SN 5HKOA 4RK0A 3QEKA 2BEUB 1VJRA 4WK2B 2V54A 4LFCB 2PUVA 2VI5A 3WLIA 1XRRA 3GFVA 3QUBA 3RYCB 4FYXA 4FB5A 2Z5VA 3GZNA 3PD0A 3T94A 2AJCA 2NP6A 3ZK9A 3HKEB 3W6OA 3OKFA 4IEFB 1QDUA 3ZWOA 1E1YA 2HXYA 1OT3A 3PEUA 2APJA 1C7EA 4LZZA 1VLVA 3G02A 4Q3LA 4H0NA 2V65A 2C7PA 4GVLA 3RM3A 3EEFA 1E3QA 4GRIA 2IU6A 3V8NA 2BBTA 2X40A 2PBLA 2CV0A 2PSFA 1XNJA 3HUTA 3UXYA 3E3OA 2H5IA 4LF9B 4MVWA 5HZKA 3ME5A 4LJYA 3E9EA 5CLFA 4N5MA 5TT0A 4AG5A 2G4LA 3QQ5A 4U2EA 3TMKA 3NHWA 1I30A 3GXOA 6YASA 5SY4A 3B3JA 2PRSA 3FPFA 4OP1A 3B51X 4GKKB 3IAEA 4F92B 1Z8NA 2W6CX 1QIGA 1GY8A 3K32A 1S3FA 3CW8X 5C37A 5K6TA 1XK6A 4S12A 5EMHA 1P2DA 3DE1X 2PT5A 1K8QA 1YK1A 3GF4A 4HY3A 3ZXYA 4N49A 4EKIA 3MBKA 5H4GA 4IUCS 3PQ8A 1FMLA 1HORA 4YRJA 4U9HS 1FNBA 1GVHA 4Q1AA 4QDJA 4DCTA 6GPBA 1FFHA 1Q1BA 3E22A 4H7EA 4U5XA 2AR9A 4OPMA 2IYQA 2QMZA 2WWFA 4GPIB 4NY1A 2NVUA 2YICA 3ZV7A 1T15A 4XPZA 3SSOA 1NLYA 3DFMA 2L0XA 4HZUB 4M83A 4PO3X 5ICMA 1SOVA 2I6SA 3WG9A 1GUAA 3BFXA 2QL9A 2BFPA 5LMCA 1HEYA 3AVYA 3ZJ4A 1CZNA 3KAPA 1EFLA 3E9NA 4LXXA 3TW6A 4AY5A 1ZONA 3VAYA 1AF4A 3EJ6A 2NO5A 4F7WA 1UPBA 2ZYUX 2UZ4A 2UKDA 3KS9A 3FHTA 3NYIA 2V45A 4PPYA 4QU0A 3SHQA 1E2LA 3TE6A 5HHTA 2ZPUA 4NULA 4AP5A 2CK3D 4RKWA 2VHJA 4AJ2A 3KVNA 4X92A 3MJCA 4BO2A 5JJCA 2P7HA 4EHIA 2ZR7A 3C41J 3T5DA 4OXQA 3KKMA 3PCXA 3V4LA 1T5LA 1UBJS 5CJ2A 2E4XA 3E03A 3EIOA 4AY2A 2ZYDA 5C4MA 3O4GA 2YCBA 4HWRA 4UEWA 1G20B 3CRZA 5CCEA 3KQNA 1RS0A 3LX5A 2ETXA 3TAHA 3T9AA 1CJMA 3O4VA 3QLJA 1R5JA 1FNSA 4JT2A 1QGYA 2JFQA 4TTQA 1MVNA 3C4QA 3FOCA 2QWXA 4Y9DA 5G0VA 3N5KA 1ZUWA 5AR1A 3UXEA 2XF2A 4G9EA 2QJRA 4AX8A 1F51E 3PPXA 5CURA 1AGYA 1JYFA 4DG8A 3WOVA 1KAQA 4R1QA 3E5MA 4TMWA 3HA5A 3ZCQA 1E2JA 3AH8A 2WSSA 3GLGA 5EWJB 4BP3A 1PP4A 3NYRA 4OXXA 3HEBA 4QQKA 1K7FB 4QQRA 2Y0BA 3R7BA 3UMGA 3KUDA 3RUDA 3FRJA 3WYFA 5ILOA 2Y27A 3R9WA 1FYWA 4EJ6A 4IRMA 1U80A 3C1TA 2C29D 4KFUA 4B1FA 3HXKA 1T5HX 3Q2KA 1P1RA 4AF8A 1NVVQ 2VQDA 3I01A 2G17A 4KRXA 3VU9B 2V9CA 1IHXA 1NVDA 1R8JA 1AZWA 4M1TA 4KGVA 2BFWA 1S2GA 3BSSA 3P9IA 5TQ2B 2H1CA 2VF2A 5SY6A 4LVUA 1KBZA 1L5SA 2HF9A 2HH9A 2YN0A 5K3CA 4EI2A 1PX2A 3AVVA 3S5JA 1E1KA 1DJPA 5FBHA 1KOGA 5DDIP 4QYIB 5B3KA 1IUOA 4TXJA 3G8AA 5EIAA 4CV2A 5JYBA 2RHOA 3HHEA 1R8SA 2FN7A 5GOTA 3RK1A 2QTCA 4ZOCA 2B3DA 2R7AA 2KPOA 4LNUB 3IVCA 2VP3A 2XUZA 2IHVA 2PWPA 1NVAA 3FWKA 4EG4A 4Y2TA 3QI2A 3BB1A 1ADBA 2JAUA 1ILEA 4PYNA 2AOWA 2AF3C 3GLTA 3SC2A 2CNLA 4PLGA 1U65A 4CU2A 1NAHA 3CCCA 5KTYA 3KX2A 2VO1A 2ZUDA 3LX8A 1Z33A 3CPJB 4ON9A 1GRVA 4ZKEA 1MB4A 4HQLA 1S9HA 3ECCA 4Q7EA 5F9MA 5L6MB 1M72A 1E0DA 3K16A 2JLCA 4HYEA 2W2LD 4B81A 2DFNA 2X9QA 5BSRA 5HIAA 3A1WA 3RVPA 1AKQA 1KXJA 1O8BA 3I8SA 3IPXA 2X1VA 4PG7A 2AJBA 3SXJA 3TRHA 4MPRA 4DPMA 5JW6A 1YZHA 2IDKA 2DKNA 2QTTA 2P4SA 3SU8A 2VQEB 2P9GA 2HPZA 1Y37A 3NHFA 1W2WB 2VAMA 4IEEA 2XECA 4R84A 1WHSA 3K92A 1CC1S 4NPHA 4J7UA 1PNRA 3IEVA 3ICQB 5MDHA 1GTVA 3OQIB 3K8YA 5LQSA 3HZHA 2IE8A 4D56A 4HXFB 1ML4A 1K9VF 2GRAA 2IYFA 5EJ5A 1AQIA 4MUMA 3JXEA 3N2EA 5LZ2A 4GU5A 4X3CA 4HQ0A 2IC5A 4FTWA 3CTMA 1IG3A 2HA0A 3H5AA 2ZANA 4NU0A 3HUFA 4FFBB 4I1RA 1RXWA 5JOQA 1P77A 1SVLA 3A6JA 1XOIA 2YNMA 1TX4B 3F7MA 4S2EA 3K8ZA 1TF2A 4DLYA 1C81A 4C9BA 3X1ZA 1KY2A 1ZQ9A 4IH9A 4EO9A 5LQMA 4O4JB 2LTAA 3D8TA 4UHDA 3IKJA 3O1LA 4WBSA 4ZAXA 3ZH9B 5JXGA 1CJSA 1MAHA 3K6SB 2BLLA 3ADBA 2REOA 1CCWA 1XQYA 3HO6A 4CKZA 1P2GA 1ZY2A 3TIVA 3LZDA 1GQYA 1E9VA 1WSAA 1HYGA 4Y6LA 5DFAA 4B3CA 3QXJA 1U8AA 1REQB 1UP4A 2PBZA 3IUMA 1EVQA 1K3TA 1G16A 3KIPA 3MG9A 4P4UA 4WZ6A 1CQIB 3P0EA 5DX0A 3FETA 1RJEA 1PK9A 4IKEA 4YRPA 2FR8A 2BPOA 2Q3DA 6NULA 2VN8A 1GPWB 4P81A 1E3IA 1R0RE 2GZ2A 1KJZA 4F6LA 3EH2A 5CYGA 3PUJA 4ZO6A 2Q6KA 5LJLA 1QKKA 3TDKA 2JCYA 4IXNA 3ZHUA 4E09A 3EVGA 3R0VA 4Y98A 2XQGA 3G8YA 3UAYA 1GZ3A 1E5VA 1V1RA 3QX8A 3KVYA 4IAOA 4YI3A 2OM6A 1TGVA 4NDAA 1P1IA 2IU4A 1SUFA 1Z28A 5LIRA 2WJYA 4C7XA 4G5SA 5DLDA 3E81A 3N7UA 3V8MA 4WKPA 4P4GA 1C0LA 3GH1A 5A4KA 7MDHA 5HF6A 3R4CA 2XKKA 1UEJA 3CRVA 1DSSG 2EBWA 3MJRA 1XALA 1Z82A 5H83A 1A27A 5KQRA 1LK0A 4FKMA 1KK3A 4WKBA 3CURA 3VTFA 1UBHS 4I7EA 3RANA 4OXNA 5FOQA 4MCHA 1I7DA 3AXSA 4M8SA 2Z83A 5JZBA 3ZCRA 3L9WA 3M9LA 4B4DA 3VR0A 2DBZA 1DLIA 2XNHA 3WBFA 4TKVA 4UMVA 2P0EA 3VMFA 3V4OA 1FVHA 4MUBA 4NL4H 4Z0NA 1BG6A 4U8HA 4YQZA 1BXGA 1XVAA 1OPXA 3WFIA 3WNZA 4CLHA 4C6HA 5AK6A 3VOBA 1S7CA 2X19A 3JD1A 2HXGA 3JATA 3UKDA 3HNOA 3L7LA 3U9LA 3CY6A 3GR6A 4OQMA 2XNJA 3OX1A 5HGJA 2ZXUA 3DHNA 4B84A 2ZB2A 1QG2A 3A3YA 4RD1A 4FCCA 2H18A 3AUKA 1ECPA 3UAZA 1N3LA 1LRKA 2Y67A 2D6FA 3W7BA 1L4FA 5LZ4A 1D5CA 1T8YA 1R1DA 4E5MA 1B6RA 2BGTA 4RY2A 2WTEA 3B48A 5JTUA 5FPQA 4UASA 2E4AA 5JC8A 3HFRA 5KYTA 3P9SA 1SBZA 3JQ8B 1MQ9A 2CXOA 1TIBA 1VLMA 3PQ4A 3NC0C 3T7TA 1R88A 3WJ2A 1HRKA 4F5EA 2DB3A 1ULAA 4OGKA 4MYDA 3LBNA 4G5YA 4WINA 2FE1A 5CVEA 1G5TA 2F1IA 1KMHA 2ZWPA 3EE6A 4IDNA 5CT8A 4KPFC 3QVGA 5I9LA 1NJGA 1AUQA 2EFGA 1CUCA 4L8GA 1SHZA 1UFRA 4EHKA 3A14A 2O7RA 3BM5A 1VKOA 2E4UA 5K3EA 1FYDA 3H0CA 1C3JA 4H15A 4JKOA 4ZOBA 3VR5H 3KCNA 3PQEA 3BF7A 3N8IA 2EW1A 2UVQA 3M6WA 4LMBA 3TK1A 1MOZA 1U9JA 1EK0A 3F3YA 3UV6A 5TGDA 4JK3A 1K1EA 5G53C 3JQEA 2GBPA 2G71A 2RIRA 4QTTB 5F7JA 1T8SA 4L6IA 4DVJA 4F6RA 4DV1B 2XADA 2J0UB 3BGDA 3P94A 4M0MA 5D51S 5ESXA 4CMEC 4HYTA 2WP0A 2WHYA 2ONYA 3DZIA 3BCHA 3DMDA 3QA9A 1PNQA 4XFKA 4ARUA 4JZYA 5K0BA 3HY6A 4NXMB 1T6YA 2WICA 3BWCA 4ZI5A 2RGBA 1AKNA 3O4HA 1FNDA 4QREA 4BB5A 2C3UA 4DNFA 4EECA 2NZYA 4IDEA 1ORDA 4HB0A 4XLZA 5IARA 2QLMA 4HLNA 5BWLA 2XYHA 3B1VA 4LDQA 2X42A 4LJLA 4UUAA 3AR3A 3DAOA 4JLMA 5CT5A 2O7VA 1MVLA 2OO7A 3AESB 2AX4A 3IDQA 1UMBB 3K72B 3NTOA 3FCYA 4I3GA 4GM1A 4QBFA 3MQFA 4XPIA 1A96A 3TM4A 1P0QA 1FF9A 2VK8A 4BUZA 1G5QA 2C4MA 4BJ5A 4NV0A 4UC0A 7AT1A 4H31A 4IJ5A 1C0IA 1XAHA 4JEHA 2XZPA 4X1KA 5E1OA 2V0NA 4ED9A 2DR0A 1GKKA 2NSLA 3VM6A 3NBMA 1U0RA 1ZH6A 5JZVA 4Q47A 2L42A 5TS3A 2R0QC 3Q41A 5CFQA 5A4FS 5G3ZA 3C97A 4ZQFA 2Z56A 3A10A 4G41A 2E5LB 2JJ2D 1YJQA 2B4RO 2VQSA 3FR7A 4H6PA 3MRVA 3VOSA 3BRCA 1PT8A 2IVZA 3EVDA 4RTMA 4QQFA 4WXEA 1Z56C 3ZHTA 1HRDA 1NJ6A 2D2EA 5BVGB 4C30A 2WRZA 1OTHA 4P5DA 3RK4A 1UKCA 1E1QD 4TS9A 2Q6LA 2BMWA 2ALJA 4LCEA 4RHTA 5DM4A 3RJTA 4A0HA 2DR2A 1IB6A 2O2IA 1L6RA 2IVFA 4JMPA 1W35A 4LNHA 4M49A 2O2HA 3K0CA 4J1QA 4N0MA 1YHYA 1ZEMA 2UZIR 4W5NA 3L7NA 4GM4A 2JRCA 1XQ6A 2A59A 2XJ4A 3ADKA 4OLHA 1XVLA 3OQPA 2FRDC 3WBJA 2DSNA 2G88A 2WHPB 1VL8A 5LLTA 2OVBA 2PH5A 5FA5A 4FBLA 2WYVA 4C0BA 1IM2A 1XMOB 4RPCA 1LTKA 3ZE9A 1Y42X 1TKRA 3ZE7A 4BWGA 2YL2A 4O2AB 1T8WA 4KIGA 1Y80A 3KTDA 2LBPA 3NB0A 4R1TA 4IQ0A 3AHGA 4FEAA 2O3QA 4XSHA 3FRIA 3RU7A 2F9MA 4CM4B 1T3GA 3G5TA 4QG7A 5ECGC 3E35A 4BO7A 4CCYA 4JWTA 3IEUA 1TL7C 3PTLA 3JAKA 4FE3A 5A0TA 3VZSA 1UC9A 1OHHD 1IXSB 4A0GA 5CDGA 3CRRA 4CM8A 4ETNA 5AKIA 5LVAA 1U5CA 2W98A 3ITNA 1R12A 2JIOA 4UQPA 5AKZA 4J4BA 4WKCA 4BP9A 1T9DA 1B6SA 4ZAWA 3ZHOA 5GIOE 4DY4A 121PA 1H0HA 1NRXA 1EP9A 2HO4A 2WILA 2ZWMA 4PXAA 3SKXA 4MWDA 2Q27A 1G8AA 5JSKA 4EB0A 5J4HA 2NLOA 2ONKA 5JNWA 5JZ9A 2PZBA 2LGJA 1U2QA 1RJ9B 4NE7A 1TKBA 3R7WA 2D1QA 4H1UA 4BFCA 2CFIA 1O4WA 2JCXA 3EYWA 3IP1A 2ZQYA 4R0NA 4DDWA 3P9YA 4DA7A 3X3HA 1U90A 1UAYA 4C7MA 2XRMA 2ZRNA 4IDGA 2M1ZA 1JIJA 4ALLA 4A82A 5IC5A 1FZQA 2VQ3A 4JUAA 1PKEA 1PWYE 1JG7A 2JEOA 2X7JA 3OCVA 5JCOA 3UIEA 2NYUA 3B8HA 5T67A 1CUAA 4EG6A 3CT6A 4JLUA 4BNGA 3ULKA 2GX6A 3TVDA 2AKAB 3KDPA 1ZNZA 3DXYA 4PBRA 1N6IA 3WYDA 1FFYA 1VMDA 4QJ3A 5AVXA 1P1BA 5DYGA 4D57A 1VIAA 2BEVA 3W4IA 3R9IA 4UVHA 2FSFA 1U1FA 3MGCA 1SIBE 1NQTA 5IZCA 2V74B 4RC9A 1R4NA 3P32A 2JANA 2AOXA 5M3BA 1NW3A 1W19A 4U5QA 5HUQA 1WTCA 4MGHA 3HR8A 4O02B 3EQ2A 3Q1KA 2CVHA 4HWKA 1C1XB 2OV2A 5ERYA 2EQBA 5DOZA 2ZE6A 2HUPA 2LKDA 1DE0A 1W1UA 1KMNA 3IAUA 4IV0A 2PH3A 3HC7A 4K1XA 1JMVA 2Y76A 3B3GA 1O1YA 1XA4A 3IQXA 3PQ7A 4KXVA 4CM5A 4AO7A 2PD4A 3C2QA 3D4LA 3NBKA 4OUDA 2RB5A 1KA9H 1C7ZA 3KB1A 1X8KA 1HSOA 1YR8A 5D5QA 5B1YA 1E2KA 3NO4A 2BFMA 4OP2A 5E4FA 1R2QA 4KZPA 3SSAA 1Z0IA 3EFHA 1DQPA 3DKRA 1X9IA 3HH8A 4G63A 3ONEA 5FPSA 2DHRA 1WTAA 3FPBA 1UODA 3RASA 2CXPA 3VHXA 3MFQA 2RONA 5KPDA 1LLFA 2BGRA 4KB5A 2VXYA 3GDFA 5DN6A 5FLEX 1IXRC 3OCZA 2PJUA 5BR8B 1B15A 2VJCA 1L4LA 2YVQA 3CW2A 4FGZA 1NQ5A 5GY7A 3WK5A 3B53X 4A1OA 4LN1A 1RWNA 2HCJB 5A7GA 2HSDA 4ZVTA 1W8IA 3LCJA 3OIYA 5J9FA 4B35A 5HTKA 4EHLA 1EWYA 4GPTA 4KL8S 3DE7X 3UWOA 3AHFA 2IIPA 3K70D 2HSGA 5C46F 1W4LA 2IYTA 5HOQA 2YJGA 4KKVA 3ZVMA 1M1YA 4PHCA 1ZUD1 2M6RA 3C1AA 3KU4A 3QYAA 2H16A 4M0LA 3W8RA 4BEBA 2XTNA 4DSAA 1GAEO 2MYNA 2A86A 2AN5A 3BIXA 3EDCA 3T3DA 4R2WA 3AR7A 4UM8B 5DBFA 4A16A 1KRHA 4S1NA 3ZGOA 2A5YB 3T5BA 3QPBA 4MUGA 4HUJA 4EYQA 1NOIA 1G42A 2YMMA 1V8OA 3D3WA 1JQEA 1UOQA 3LLUA 1MIOB 1Z22A 3UG7A 5KJFA 2GM5A 4EJ2A 2Q07A 1Q0SA 1OGYA 1F2TA 1Q91A 3U26A 1CZHA 2CGEA 1TF5A 3BJIC 3ABSB 4KZKA 3A26A 3F97A 4F06A 2YRXA 4BC1A 2YINC 3L4BC 2H31A 2N42A 5CFZA 1P0IA 4IFEA 1LC3A 3VNVA 3SQLA 3EGXA 5I9BA 2XCOA 4E4RA 1P6UA 3EASA 1X1EA 1ZMXA 5CYPA 1KQGA 4N7RA 2HSJA 3H6KA 3LI2A 3N8HA 1W0JD 3GI1A 1AQJA 3VC7A 3FSGA 5IJ0A 3FOAA 3G2PA 4P7FA 1E9CA 3AT1A 5EY5B 3RI3A 5LYJF 5BWCA 1EWRA 2REXB 3IUBA 1R9NA 4GR5A 4HAZA 4LVNA 4RYDA 2AMYA 4DQKA 2JC3A 1Q0QA 4B3IA 3TBKA 4B3HA 2O57A 1E98A 2ZJ8A 3JAMA 3FMPB 1AT1A 3K5HA 4U8GA 3UJ3X 3ZY5A 3UJDA 4ESOA 3TF5A 1CQZA 4IHJA 1XCJA 5D1NA 4D81A 5B5SA 1SOUA 1KI8A 2DFTA 3DS8A 1LPSA 4GICA 4JYMA 1Z2OX 4EW2A 3UAGA 4AG6A 3QFRA 4AMGA 3HA7A 1J6UA 2XYRA 3JZMA 4M1YA 4MITA 5TX7A 1D2HA 1EFPA 4CV1A 5C5DA 4MR9B 4QVKA 2GBCA 1X7ZB 3LRXA 4ARAA 3VU0A 2P90A 2FMHA 3QHAA 3SXPA 3GP3A 5SYNA 4OI0A 1JQJC 4GLFA 1ODFA 4Y6RA 2BP7B 4JGIA 1CS4C 4MYSA 5KZMB 4JYPA 4HDNB 5DLYA 4EKYA 1DG9A 2NU6A 4EG7A 1DKQA 2CDRA 1Q0UA 2GCOB 3CHYA 4LV6A 4M0FA 4QNRA 1U2EA 3CRNA 2XB6A 1LI4A 3W5HA 5CB6A 2EP8A 3R8CA 4B34A 2KS6A 2Z2YA 1QHYA 1QIEA 1VXRA 2GF9A 3CW9A 5FLKA 2D74A 2EQAA 1DQNA 1AK2A 3LVBA 1A9ZA 3EGEA 4XFDA 4BLUA 3A31A 2B92A 2CDNA 4HLCA 5ALNA 1EX7A 2B69A 1B74A 4INAA 4MUNA 2BH9A 4P1ZA 5FXMA 3RIEA 3SEFA 2JJMA 5IT4A 2XDQA 4KQXA 4LA4A 4P8RA 5DMXA 2I87A 4MUJA 2P5TB 3DG9A 1AA6A 1E79A 4BVLA 3CX7A 1TECE 3HB4X 4QHTA 4RCVA 5BMOA 3BKWA 5CLLA 5HBRA 2ZVQX 3O8RA 1Q7BA 2I4IA 4L02A 2PGDA 2A1IA 3NOXA 4CWAA 4CV0A 4YJHB 1PS9A 3LCVB 4J0DA 2ZI9A 3HB9A 4CIWA 3IAS1 1Z2CA 2DHEA 4KQWA 1SEPA 4RH0A 1E89A 2HPAA 3S6JA 3K6KA 3V7FA 2AG5A 3H1GA 2XUPA 1ZYUA 2X2OA 4MKRA 1SIWA 1UBKS 1WETA 1YZTA 4ZZ3A 3IKVA 3BREA 4MKHA 4NYJR 1L9XA 3T15A 2EG9A 1DXYA 3GLVA 4M1QA 1Z5GA 4RY0A 3FE2A 3RK0A 4CT4B 1HF3A 1LJ8A 3D3NA 4L8YA 3C24A 4X1OA 5JWHA 1GGVA 3DVAA 3E7PA 2PL9A 4RVUA 3U3RA 4D02A 4H7JA 4WXHA 4BVFA 2DQYA 2CW5A 6REQA 5A3SA 3RSQA 3ZW7A 1YUBA 3AI7A 3A1CA 4G81A 4PY2A 4YJ3B 2QTZA 5IH3A 4IIUA 1E6KA 1IHDA 2YY5A 3WGYA 4BCBA 4ZYUA 2QU8A 1Y81A 1SVNA 4Q0MA 3O3NB 1VE6A 1Y8RB 4OVKA 2VAXA 2ZRLA 4WUVA 2OQRA 1XMXA 4MB2A 4POAA 5IVPA 4P0QB 1VMEA 1MX3A 1O94A 1OXKB 2CVOA 3R5HA 4H4EA 4UM7A 5BXQC 2R7KA 2D1YA 1VCIA 3W06A 3LPLA 1BJTA 3PD7A 4FFSA 1NC3A 5LN1A 4F12A 4K6MA 3F8SA 4X5OA 4Z2AA 1CJCA 4B74A 5F2OA 4MS3A 1ST2A 2OCXA 3KLMX 3SKVA 2C82A 5G2OA 1E6LA 2PVCA 4R0VA 3LQ1A 1Y9JA 1F8FA 3AY3A 1CDEA 2IZOA 4V0MA 4E7OA 1G9SA 4N0QA 5ICFA 1G5IA 1ZJZA 2HWWA 4MWOA 3ZTTA 1T2EA 4I5GA 3ENKA 2GPTA 1Y3DE 2WAYA 2X23A 1XIVA 2FEKA 3LG2A 1NU8A 3MJSA 2W8BA 1SY7A 2Z8ZA 5EE9A 1FDIA 3NHZA 1JSLA 1TAQA 2NQ2C 3WP0A 1UFQA 2NSJA 5BSHA 1Z0UA 2Z5GA 1SXGA 1GN8A 4L27A 4UVGA 1KP3A 2N0SA 2Q50A 3DWIA 1OBOA 5KNLA 1MFPA 2UUBB 3NHUA 1F0KA 3IFSA 1TU3A 4BNLA 2ZBGA 3BMOB 4Y1RB 2Q8QA 1O95D 2OV1A 1TT5A 5DYYA 3NHBA 4KXMA 1U9YA 1FNMA 5AXDA 2EBHX 1A9XB 3IDSA 2ZK7A 1ONNA 4GL2A 2HQOA 2QZ4A 5AVYA 5EHQA 2C84A 4XIYA 4HO1X 4BMVA 4R98A 2GPYA 2H6EA 1W4BA 1WMFA 1O4VA 3H65A 3L8ZA 1M3SA 1ZIYA 1R0WA 3DZKA 2P5SA 3M3HA 1XJWA 2E3JA 5B1DA 1P72A 1K2VN 4CGYA 5IBCA 4HFRA 3DVLA 3ND8A 1GL3A 2A9VA 4HFJA 3S29A 2J8ZA 1FK8A 2VA8A 2Q49A 1CP3A 2EATA 2FZVA 3CZCA 4FFRA 5H7XA 2F43A 3RFVA 2I7DA 1PV4A 1WUHS 3CUUA 4WZAA 1PL8A 2O23A 1ODIA 2PMFA 1QS0A 4GR4A 4ZEWA 4ABTA 4RELA 3V1MA 3UG6A 2B94A 4XWYA 3QXSA 4MGIR 4W5JA 1ZK3A 2H2HA 4Y2GA 2QRQA 5DHQA 3M7IA 1UJBA 3DV9A 3GMSA 4L3OA 3LKZA 3WKEA 5DISB 3IVMA 1O8CA 4N5IX 4OA5A 1ZJWA 2OOKA 3IO5A 3DTYA 3AL0C 3PSHA 4LUCA 5HX7A 1DNPA 1WVMA 2R6GA 3EZGA 1MZVA 2FJPA 4PR3A 4RQUA 1V16A 1B8OA 1P81A 1XDZA 2XSZD 3THRA 1M83A 4RH1A 5J2TA 2VJNA 1ND5A 1W2HA 1IY8A 3SJUA 3IEKA 2FDCA 2I1VB 3BMQA 2V7UA 2C1ZA 2BF4A 1F7UA 1Y1QA 1QC5B 3ISVA 4CN8A 1QLJA 1E5XA 1JHDA 5JMWA 3ZCVA 5CDSA 3GN1A 3IYLW 1J0DA 4WACA 1KVQA 3E27A 5DXJA 2IOHA 4XGNA 2WWXA 3DV0B 3VH1A 1UMCA 1ND6A 5DLPA 2IEAA 4QLAA 2DQZA 3AUTA 1EG7A 1KYVA 2VZ9A 4DJDC 2VUIB 4DBVO 3H11A 3IKTA 3SICE 1KAMA 1M0SA 1FLNA 1AQYA 3HVIA 4HWPA 3VNBA 4MQUA 4NP6A 4U2GA 4X7PA 5A2GA 1GRQA 1N5RA 2GEBA 1YQGA 2BGLA 2H4JA 2DETA 2KBFA 1A1SA 2G07A 1GT91 3ER8A 1H9CA 1NXVA 3FWPA 2V3VA 2XMGA 4C4YA 5A5VA 2DUWA 3IQIX 4K9DA 4N3NA 4KUEA 5BN5B 3RWMB 1JYEA 3UQZA 4BZZA 1US8B 3F7TA 1C4KA 2EYQA 2VXBA 4WSOA 2G67A 1FBNA 5AOCA 1XVIA 3BSWA 2C5FA 3WLKX 1HLPA 3NT4A 3RJ5A 3DYVA 1IBKB 4LECA 2ZATA 3AF1A 1IE3A 1TK3A 2ZAYA 1PFYA 1Y6QA 5J47A 4O8CA 4IDOA 1DO0A 4G3XA 5AJWA 3TWOA 4UUMA 5DI9A 2IS6A 3EGIA 1CNMA 2F8SA 2QF7A 4HSGA 5LM3A 3QW2A 4NESA 1ACJA 1WZEA 4KACA 3ECSA 2WSBA 1CJVC 3E7WA 4E2YA 3VVLA 3O3CA 5IYZB 4V1CB 1EX6A 1KBQA 2NT4A 4AKIA 4JJ6A 1M6NA 5DX1A 3OQMA 3GJ0A 1RVV1 4RL6A 4DQUA 5A9SB 2MDTA 1VL5A 4GQIA 5DJ5A 2DXIA 1QP8A 1GZSA 3K9BA 4V0RA 3UPDA 2J3DA 3I12A 2WAOA 2IIBA 3G6WA 3AVOA 1JV2B 3U0BA 2ZUFA 3BDVA 3H9CA 4XFJA 4TYNA 3KOOA 1F9EA 1EB9A 1TVKA 1P2SA 4IJVA 4JODA 4G2NA 3V8RA 3AERB 3INGA 5KBYA 3UWPA 4TUYB 3OP4A 3A70A 3IPRA 3ZIUA 4U2CA 1C8KA 1L5LA 2QNBA 4TKLA 1UKYA 4J2OA 3R0ZA 1OXMA 3TKLA 1XPRA 2FSPA 3CLSD 1CB7A 1DAHA 5FLYA 5D2CA 3EPHA 2DKOA 3IAXA 3EEQA 1M8FA 3DTTA 1PJ2A 4QXQA 1IJKA 3OIUA 1LTQA 1P5JA 2ZJ6A 3QKTA 3P27A 2EERA 2GF2A 4LW8A 1TZCA 5I45A 2HB6A 2QD1A 4BRUA 5BOSA 5C5CA 5HIKA 2L17A 1JPNA 1XT6A 2QZZA 3D6VA 4BRZA 4JWKA 4L1KA 4IIFA 4PQYA 5SY9A 3VYRB 4OHCA 1ODKA 2ORVA 1F6DA 3BQMB 4FOLA 4BBPA 3AUUA 1EWTA 4RESA 3WGQA 4WCDA 2AUNA 4F38A 4WJKB 5CM8B 2K4MA 1KNQA 4MSUA 3JD4A 3VR2D 3GFSA 4YMSA 5TVKA 1W88A 2WYUA 2Y71A 3ILYA 3WGUA 2FN4A 1YKGA 4RDHA 3QVXA 4TV9B 1RWOA 3LT4A 3WO1A 3SM9A 3BWYA 4FINA 4I1VA 2FPMA 3DEFA 3O5AA 1W30A 2FMUA 3MIZA 2JFUA 2ODEA 4A6PA 5JXWA 1SCIA 3RYHA 5ILGA 2ZJBA 1EM6A 1CK4A 4BMCA 2KSQA 1KPGA 3R5SA 1U2RA 3ZE6A 3WAGA 5JCJA 2CMFA 2R7MA 3I9V1 4I9FA 5HIMA 3JS5A 4TS3A 1P74A 2R00C 2ZAGA 2QTMA 4EABA 3KAQA 4FUTA 5HR5A 3TECE 2QJTA 2J1LA 4QOIA 2PT9A 5JO9A 5AM2A 1P8AA 2QRMA 5C1BA 2VHZA 4FGKA 2XE7A 4J90A 4TV8B 3E2PA 1OYOA 4F8YA 5ICCA 3BULA 4DNPA 4CPDA 1D7AA 1U0OC 2OO3A 2AZTA 1GDHA 2WG0A 3X1YA 1NOJA 4E6PA 2JGMA 1YSCA 1I80A 1KI3A 3FTQA 3LY9A 3HK2A 4D0GA 3DZ8A 4Z8YA 2EJUA 2V7QD 4IIJF 3ETNA 4TWBA 1D6JA 1FFSA 2RCYA 2EZ8A 3DYIA 4YRTA 3TSAA 1V1MB 1ZO8A 1PJ3A 5FUVA 5AVJA 1P5FA 1YQDA 1X94A 3U4HA 3T1TA 3RRZA 1H8HD 1S8NA 2YXPX 4OXRA 4NFLA 5TDHA 2PQ2A 3KKOA 3UA4A 1OROA 1GZ5A 1TLLA 1I4TD 1XFDA 2BD0A 1U8YA 2FV8A 2QG4A 1L4UA 2V7VA 3A04A 1FP4B 4G4SO 4PCVA 3TR5A 3UK7A 1WNFA 1E2GA 1KE1A 4MP8A 2R8EA 1U8EA 1P75A 1VI2A 2Q9UA 2NUAB 3WLFA 4LY3A 1IN8A 2BEJA 2BEWA 2R1TB 4BP1A 1Z6YA 2B0JA 1T3LA 4QM6A 1R00A 3LBHA 3QZUA 1BEEA 1R5BA 5COBA 4G23A 5L3SB 4BMDA 5T4FA 1SUIA 4R5HA 5FUBA 1IVYA 3I05A 4BMOB 2H1VA 1YZUA 3FZQA 1OT5A 3K2EA 3DM5A 1TZ2A 4N5HX 1XZCA 4A6EA 1W0CA 3M4XA 5M04A 4Y9RA 1TK9A 3TFOA 4CUKA 2JFBA 3BF8A 1GDDA 3FI9A 2QZSA 4JP8A 3EA4A 5TARA 2BAGA 3OE4A 4PYJA 1HQDA 3ELBA 1EMDA 3QTLA 3JASB 1LDEA 3ETJA 5F73A 4EG0A 1RAGA 1ECJA 1W59A 3IPAA 2Q1XA 4P9NA 5IN5A 1UKEA 1XEXA 2ZRBA 5EQDA 4DVGA 5LMUB 3JRNA 4E3ZA 5DF1A 2AOVA 3RUAA 2HY7A 2IYVA 4L8WB 5FLXA 4AT1A 2P2ZA 3KT0A 2J0EA 4G8DA 1QTQA 1Y4ZA 2GD1O 3JX9A 1GGHA 4HQKA 4I4IA 5E6RB 3WNDA 3Q6NA 2VDJA 4KQ9A 5DOVA 4W1SA 4XSGA 3W0LB 1YS6A 1KKLA 1RM5A 2FJUA 4HNHA 3OEYA 2HK7A 2Q3LA 3I5YA 3LP6A 2JL1A 2BHRA 3A6ZA 4F60A 1GM5A 4BV2A 2W6IA 1QU2A 1XCPA