5DE3A

The crystal structure of chlamydomonas reinhardtii arl3 bound to gppnhp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
166
structure length
166
Chain Sequence
ARILVLGLDNAGKTTILKALSEEDITTITPTQGFNIKSLSRDGFNLKIWDIGGQKSIRPYWRNYFDQTDALIYVIDSADSKRLSESEFELTELLQEEKMTGVPLLVFANKQDLVGALAADEIASTLDLTSIRDRPWQIQACSAKQGTGLKEGMEWMMKQVKLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
publication title The Crystal structure of Chlamydomonas reinhardtii Arl3 bound to GppNHp
rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase
total genus 52
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2015-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5de3A00
2IA5A 5HZHA 4AKHA 2GF0A 3MMPA 4OK6A 4DKXA 2AFIE 1HYQA 3AP2A 3QXCA 3RVBA 4NYIR 2W00A 1FQKA 1N5JA 3K0FB 1ZINA 4P4SB 1UBGA 3SU8A 3CH5A 2ZU6A 4FW9A 1P9WA 1RJ9B 1AQUA 3QKSA 1N5IA 1AS0A 3I92A 4NE2A 1G20E 3UG7A 4EQ6A 5EE3A 3WNDA 4N0EA 5IHPA 4A8JC 2JLZA 4QNRA 3GLFA 5A4JA 3NKVA 1E9RA 1B0UA 2UZIR 2XB2A 4PSVA 2V9PA 3SR0A 4TLAA 1C4OA 1KI9A 2QMHA 3OEED 4Q7LA 3J81k 1NNEA 2IWHA 1KO5A 4P33A 1CLUA 2ATVA 3NXSA 1O87A 4C0AC 2ZJ5A 1KI2A 5JMTA 1XXHB 4B76A 1JQLB 1Q44A 4QBHA 1KNQA 2J0UB 4Q4JB 5F9HA 4JLPA 4LPKA 3CX6A 2GJ8A 3GFPA 3H4MA 4U02A 4NYJQ 3M4YA 1I4LD 1XB2A 3QF4A 1YR8A 4BFSA 2ORVA 3NC0C 5CK5A 1G8GA 4HDOB 3PUYA 1Z6GA 4OJQA 4AYXA 3BH0A 1NLZA 1XPOA 4FINA 4ZIRA 1AA9A 2RKOA 3RAPR 4LK2A 2IYTA 1UF9A 4TSFD 4DLWA 2VYFA 2R6DA 3A1WA 5G40A 3X1YA 4DXAA 1U90A 2FH5B 3FE2A 5FUWA 4M1OA 1E79A 1NN1A 4PC2A 3O8RA 1X8JA 1ESMA 4D2IA 5KPDA 1CR4A 4HZIA 2BMEA 2FWRA 1XCPA 4TT3D 2PZFA 1ZUIA 2Q6TA 3DMDA 2JLQA 4CT4B 5FTLA 4V02A 1TNDA 1UKYA 5CM9C 1N0VC 1MT0A 2IF0A 4TL7A 4IHQA 4DVGA 4Q9HA 2D2FA 4ESVA 3VFDA 1M7GA 3NG1A 1Z29A 3BFKA 4FCWA 3Q7PA 1E2MA 2H57A 3WRYC 5AR1A 1T4GA 4IW3B 4BFVA 1L4UA 3AF2A 3L0PA 3RANA 2F9MA 1H65A 5FBVB 1U8AA 1XD2B 5IK2D 3AVPA 3C5CA 4KFTA 4QGGA 1GG2A 2EFGA 3DZ8A 2O8EA 4IEIA 5HZKA 5L3QB 5C18A 2DB3A 1R7RA 1NBMA 3SBDA 5K8UA 3EA5A 1E1QD 4C9BA 1QHNA 1TUIA 2WMNB 3CZPA 4IOKA 1NN5A 5AJYA 2FJUA 1VHTA 4I1VA 5TY0A 3AB3A 2FE4A 1H8HA 4JLVA 3TAHA 1M7BA 4MITA 4OHZA 1OB5A 2GZHA 2KWIA 4CEJA 4M1TA 3BH6A 4LBYA 4YMSA 1TQ6A 5G3YA 1VDZA 5FPYA 4V0MA 1YZGA 2VHTA 4R98A 3OFNA 3EW9A 1DARA 2V7QA 3FMFA 4PZLA 3A1SA 4QBFA 3DOEA 1PUIA 2ZAMA 2PT7A 4B48A 2XJ9A 1WQ1R 5HR5A 4A0GA 1FZQA 2JEOA 4GMDA 2HF9A 4EPTA 1GM5A 1NLFA 1DG3A 1AGPA 4O2LA 4DSNA 2Z43A 4NDZA 2IHBA 3VR4A 1S1CA 3AH8A 3CLVA 4Q4HB 4IDPA 4XSHA 4MKGA 3U2QA 2WWFA 4G0NA 4LHWA 1P72A 2CCKA 2D7CA 2BKUA 3MJRA 4LGMA 4TMTA 3T1OA 2QORA 1A2KC 4GP6A 4XTRA 6Q21A 3AVOA 2GAAA 4LJ9A 2YKGA 4M1WA 5FOXA 1UDWA 2OCBA 2RCNA 2AR7A 5C46F 3K09A 2VO1A 4LJ4A 3GP8A 2ZSFA 5KHOC 2V4ZA 3W3ZB 3PV0A 2W6JA 4KLNA 3MG9A 2QT1A 3GJ4A 3B6EA 1XJ0A 3LV8A 4G5OA 1YHNA 1NSFA 1XCGB 1E96A 1KJYA 3IBGA 4YXWD 3GJ5A 4EFMA 1JI0A 1Z2AA 3AKDA 1OFIA 2EYUA 3QVVA 2GCPA 1CRPA 1S1MA 4NH0A 3KJHA 5F2EA 5FBLB 2W0MA 1R6BX 3BRWD 4Z51A 4MA4A 5GJWC 2JDIA 3ASYA 1P6XA 4BEBA 1B23P 4S2EA 4YDSA 4A0RA 4DIEA 3AVUA 3FMPB 4Q4AB 4D0NA 3AP3A 3HWSA 1PZNA 4D25A 4QHSA 4ZKDA 1H8EA 2ZEJA 1GFIA 1V5WA 4UNPA 1I4TD 1P9NA 1TEXA 3HYTA 1G8PA 4JLOA 5M04A 1G1MA 1E79D 1KMHB 2FEMA 2ODBA 4IRUB 1EWQA 1DG1G 1RZ3A 1XFAA 1F2UA 4L8GA 3ZGXA 5DN6D 2G6BA 4A2WA 4JT2A 1GZSA 1Z2CA 3HPQA 1CR1A 2QTVB 1T5LA 3CH4B 4RFSB 3RSLA 2NMVA 4O3MA 1OFUX 3TIFA 5FR2A 5E4FA 1EFHA 3U61B 5TB5A 5AJZA 1KHTA 2OAP1 3HYRA 1AM4D 4XSGA 5FI0B 4P3YA 3GFOA 4LBWA 2IF2A 1CTQA 4TMZA 4HB2A 3CNNA 5J47A 4HUQB 1MR3F 2B7BA 2C77A 2QAGC 3R7WB 1NKTA 1AKYA 4DSUA 3EG5A 3NTUA 2NO9A 3C14C 4HYYA 4PSAA 4ZI3A 1ESNA 4GOXA 1NVUQ 1E69A 4IDHA 3IUYA 4AKIA 2J59A 4LC0A 3L43A 1RRGA 2CE2X 1Z6XA 4Z54A 2MMGA 2R6GA 5KSOA 1UAAA 5GJVC 1XZPA 1P3JA 4BASA 1XMIA 3B60A 1U98A 2HLDA 3OIWA 4LRWA 2ZM5A 1WBBA 4POAA 2WWXA 1CULC 2CHQA 4GOKA 3SZRA 2GCOA 4P31A 1KSJA 4BLQA 3OFND 4KI0A 1YZTA 2OEPA 3QQ5A 3K0CC 1EFUA 1JB1A 4A6PA 2O5VA 4L15A 2O8CB 3SJBA 1JR3A 2IYXA 5C4GB 3IILA 4A8JA 4DC9A 3WNCA 1ZCBA 1JPJA 1XTKA 1W1WA 3FVQA 3L8ZA 4QHTA 4CW7A 1MO4A 2OBLA 3X1DA 4MYUA 3CBQA 1IN5A 1GL9B 4B73A 2UZ3A 4UJ5A 2BJVA 4HEJA 3BFVA 2VIIA 4B32A 3QI2A 221PA 1FX0A 4YDHB 2NO6A 1P7CA 3TNFA 3R8CA 1IJEA 3OZXA 2FSGA 2JJ2A 4Q02A 1YZKA 2J41A 2Q21A 3HPRA 3IQWA 4MUAA 4ABYA 1W36D 2GXAA 4OHVA 1AK2A 2W58A 2NTYC 3LXXA 4RD4A 1G8FA 2G0NA 2QPOA 2RGGA 2H1LA 4DT1B 1XZQA 2YHSA 5CM8B 1KK1A 2ZJ8A 3KQLA 1G41A 2ORIA 3VX3A 2O8DB 5BW8A 1LB1B 4X8MA 4F38A 1E2GA 3B9PA 1VG0B 2JJ1D 1J70A 2YOHA 2DR3A 1D2MA 1G6OA 5FTNA 3X1WA 1OFHA 5EXSA 3FKSD 4HATA 3AGPA 2BCJQ 1N0WA 4OK5A 4EAQA 521PA 3TQFA 3NDBB 1AKEA 4BZXA 1SVIA 4BFTA 4W7SA 2QZ4A 3GLGB 2GZDA 2A5JA 3T1QA 2WVJA 3AF0A 1KMQA 3DHWC 4LYHA 4MRPA 4B3XA 1KZ7B 3N2EA 4IJMA 1PLKA 4O2RA 3LW7A 4BLPA 1M1YE 2KSQA 4WOPA 1BMFA 2O0KA 5DI3A 4F91B 3R9XA 4M9XA 3OEHD 1HE1C 4NONA 2IYYA 1KO7A 1DO2A 2ZSAA 2ZR9A 4PO9A 4TL9A 3CO5A 4P32A 3KTAB 4JBYA 3ZVLA 1HV8A 2NIPA 4BFZA 3V4RA 4Q03A 4RD2A 2JIZA 2OV2A 4EPVA 2FZLA 3AUYA 3Q7QA 2WBLC 4AKGA 2R9VA 3RRMA 2F55A 4URVR 4DDVA 2NO7A 1E99A 4NCJA 5L3SB 3BE4A 2XZOA 3I61A 1Q57A 4CEIB 1DBSA 5EP2A 2BBOA 2GNOA 2DCUA 2ZRKA 1IY1A 1HH4A 3K70C 2QROA 1W5TA 2ZRMA 2GVZC 5JECA 5BN4A 2HDNB 2QTHA 1BIFA 3TVTA 2CNWD 3MWLA 4PZZA 3QSYA 1KKLA 2AXPA 3MSXA 1ZUNB 2R8RA 5SZKB 4OHYA 3H86A 4FMCF 4DCSA 3OIUA 2R44A 3ZVMA 1XF9A 4QC2A 2W0SA 4TYWA 1N5LA 4F4CA 2LWIA 2WAYA 2PH1A 4C0BA 4QXAA 4OJKA 1ZVQA 1SVMA 3U44B 4I99A 3T34A 4JLAA 4Q48A 2F1JA 1W0KD 2QPAA 1DAFA 1Q3HA 1RE0A 3JZAA 3W8NA 2IEZA 2W6IA 4LOAA 3AF3A 3WBKA 4I1OA 2ZJYA 4B6FA 3A1UA 4G5QA 2XB4A 1G5TA 1T0HB 2CK3D 2OUKA 1X1RA 1ANKA 2CMKA 4LDJA 2BBTA 4GZMA 4AD8A 3AQ4A 4EPXA 5JWOA 4Q00A 3W90A 2DFTA 3KUDA 1E2KA 1A1VA 2QEQA 4ARZB 4KV9A 2EWVA 1Q20A 4TL8A 5JSZB 2JLRA 1XEXA 3RRYA 4KU4A 2VRWA 1R8SA 1KTVA 3BBPA 2WSMA 3CWZA 1T3LA 1FUKA 2G77B 3KKPA 5DYIA 2P6RA 3LX8A 3NWJA 1R0XA 3THWA 4WIAA 1HA3A 2I3BA 1PV4A 4B3BA 1KI4A 1G4UR 1EX6A 4B3GA 1F60A 1MH1A 2E1RA 2VP6A 3E70C 3CB4A 3IPYA 1E2QA 1T8UA 3T15A 2CVFA 3A4MA 2GAOA 1JECA 1GKUB 4U7DA 2P67A 5AUPB 1ZC3A 4K8OA 3PFIA 1BS1A 4AYTA 2HT1A 5BQ5A 2WJVA 3E5HA 4BEJA 1UBFA 2REXB 2GZAA 3I5XA 3FOZA 4LZZA 1HUQA 2REBA 5AWFC 4QG7A 4JJKA 2WM9B 3TGPA 1WA5A 1N6LA 3EC1A 3WYFA 2ZI5A 4M53A 5D3QA 1XTQA 3L0IB 2Z4RA 1YRBA 1SKQA 4MGZR 4H9GA 1SVOA 3DM5A 3DL0A 2PJZA 3CF2A 2D62A 4PPQA 3ZS9A 2O8FB 2QAJA 1SZPA 3GMTA 3FMOB 1XNJA 2E9SA 3D31A 3GEIA 4QGHA 5KUTA 4TN1A 2P6NA 2YVUA 4I1SA 4M2LA 3ZIAA 1GTVA 2QAGA 2G83A 1PUJA 2ERXA 1A82A 3TK1A 3C16C 4KFUA 3V9PA 4Z8XA 1EFTA 4XTCS 2JLWA 4KLZA 2MSDB 1I4DD 1W4RA 2ZIAA 4IOMA 4ASUD 2VP2A 4XVRA 2A78A 4C7OA 1R5NA 1QHXA 2BM0A 3FMIA 1CKEA 3KB1A 1Y63A 4AYWA 2FG5A 1E6CA 2GHIA 1P2SA 1I2DA 4BZQA 3TUJC 1KOFA 1VMAA 1NVWQ 1P75A 4B3FX 1T3SA 4RD0A 1P2UA 1W7AA 3U7FB 5D3MB 3N2IA 1NSTA 4ACBA 4V0KA 2DPXA 1CJMA 3DKPA 1WCV1 5EP3A 2IL1A 2XOKD 4Q9IA 4WZAE 3K0CA 1U99A 3GEHA 4YMWA 4UXIA 3QPWA 4PC3A 2IS2A 3LDAA 2I1VB 4URZR 2YZ2A 3BERA 3U3JA 2LKDA 3ZD7A 2ZE8A 1OXVA 3EASA 2A2ZA 1NVVR 4PPNA 4P0TA 1F2TA 1BYUA 3QKSB 1FP6A 1G7SA 3K1JA 4A92A 3JVUA 3BH7A 2EU8A 4EQ6B 4J0QA 5FOTA 5CDFE 3U3KA 2YV5A 3NDPA 4JSYA 2IYRA 1KSGA 3GLFB 3A58B 1QHSA 3T1TA 3WHKA 1KDPA 3I1FA 3RWOA 2F6RA 1ODFA 1R5OA 3X2SA 4PPFA 1OH5A 4BQSA 4BLRA 1NMXA 3OE7A 4LCBA 1E9SA 3B5JA 1OLOA 5L3RA 1VKJA 4LJYA 2AX4A 3TKLA 1P5ZB 3PUVA 3QF4B 1EK0A 2J3EA 1Z0IA 5KDDA 4KVGA 3IIMA 2FX3A 5CLQA 4OI1A 1Z6AA 3LX5A 5J5CA 4ZIRB 5TDHA 1RRPA 2C9YA 4CVNA 2IEYA 1NLYA 3RABA 4H1VA 3GLHE 1CBUA 1GUAA 4PO1A 2NGRA 3TJZA 1P2TA 4PQRA 1EFRD 3SI7A 3AP1A 4RZUA 1J99A 3AM1A 3VR2A 5FOSA 3B1ZA 5FL3A 1BKDR 2QY9A 4AURA 4BE7B 4I81A 2QRZA 5FL7D 1XEWX 4DUGD 2PL3A 2GWHA 2W83A 3QF7A 3P4XA 3VU9A 1P61B 3IO5A 3LNCA 4WA7A 1VCIA 1M74A 3K0EA 2VP9A 2CL6X 2H18A 4M9SA 4Q4LA 4TQAA 3SDZA 4B2LA 4BFWA 5GJCA 3ZJYA 4FMBB 1Z22A 2CDNA 1N6PA 1Z6YA 3IIJA 4QM7A 3KQKA 4AY2A 1G64A 4GSYA 4LWZA 3F8TA 5JJIA 2GILA 4ON9A 2O8EB 3B1XA 2A5FA 2A5DA 1OYYA 1N2CE 4MDEA 1G8YA 1W48A 1OE0A 2R6CA 4C0QC 1G6HA 2ZSEA 1E0SA 5CYPA 4U00A 4TZ0A 1GSIA 1NIPA 1KI1A 1GRRA 2ZRFA 2ZE5A 4CIDA 3C15C 2XNDA 2NZJA 5KNDA 4CEJB 2OXRA 3PEUA 4YQFA 2EW1A 3K8YA 1VYUA 4GI7A 2FSIA 3WMFA 1M34E 3OIYA 5FBWB 2ZSDA 5B30A 2CLDX 2VHCA 4G5SA 2BMJA 2ZR7A 3EARA 4P4TA 1VIYA 2GK6A 4WBSA 1CP2A 3I8SA 4V0LA 4E03A 4Q18A 1AIPA 3LY5A 3NH6A 4FMDB 3AVYA 1E9FA 3SN6A 3W6PA 4Z8YA 2P5SA 5CIWA 1KAOA 2JA1A 1VHLA 1MOZA 1XD9A 1ZNXA 4IDQA 3W3AA 4TMKA 3LRPA 2GEDA 2R62A 2ZXUA 1XX6A 1ZU5A 4ACAA 1P2VA 4MRNA 3T1VA 1ONBA 1ZM3A 5FUYA 3X1ZA 2BJWA 1XBTA 5HCIA 3T12A 3KKNA 2ZJOA 1JJVA 4OQFA 1CJKC 1HEIA 2QMEA 1OIXA 1E0KA 1IN4A 1TF2A 2AL7A 1E2HA 1GL6A 4TQ9A 1OH7A 1GILA 2D2EA 2Y8EA 4XJXA 3H0KA 3MRSA 5KO2A 3EWSA 1YZQA 1G5RA 3PG5A 4YMUA 5KOYA 3RHFA 3TW8B 2ZS7A 3ASZA 1KI3A 1UEIA 1VIAA 2VA8A 3IIKA 1ETUA 1GRQA 1D8TA 2QU8A 2WWIA 4WW0A 5TXGA 1W46A 4GT1A 5B57C 3NHAA 4GNKA 2G1JA 2LKCA 1N6KA 5DLQC 4DLXA 3VX4A 2G1KA 3EPLA 3T5DA 4TTQA 4LSGA 5AUOB 3QG1A 5E95A 2WJIA 4LBVA 3RS2A 2V1XA 1LNZA 2Q9CA 2Z83A 3LQRA 2WKQA 3T61A 3K9GA 2DBYA 5KU1A 1F2UB 5SZIA 3BFXA 4ZCLA 4OL0A 2XXAA 2F9LA 1D5CA 2H92A 3P4YA 4MKIA 2ONJA 5C1BA 2J46A 1WP9A 3OAAA 1DADA 2F1HA 2OM2A 2ZYVX 3B8HA 5E7MA 2QP4A 3CRW1 4II7A 4ZO4A 1EX7A 5FBRB 2AKYA 4JBXA 2WTUA 3RRZA 3V00A 3U7HB 3HP1A 4PC7A 2A7QA 4LHXA 5L3VA 2XEXA 2AN9A 4NCHA 1N6IA 5LD2C 3EZ9A 1GNPA 1VCNA 2IYSA 4PSKA 1F5NA 3GEEA 3GJ7A 1U0LA 3Q3JB 3WY9A 3RLFA 3UANA 4NCNA 3GJ6A 5FPKA 1MABA 2C98A 4DB2A 4DLRA 5FOVA 4QBGB 2GCOB 2WSSA 2ZSBA 3B82A 4LJ5A 1TTTA 2XTNA 1OIWA 2GA8A 3QKUA 4OBEA 2YWEA 3BB1A 1XCMA 2ZYTX 2VH5R 2JGNA 2ZUBA 4HI0E 3D6TB 2DWPA 3EZ2A 4NYMQ 4QJ5A 1SKYB 4KAXA 5CK4A 3SS8A 1JR6A 4A8JB 4A0FA 4JLMA 3VHXA 3I62A 3SQXA 3Q85A 4M21A 5EE0A 3H1TA 1LY1A 1CRQA 3P1JA 1FQJA 2BVNA 3U7EB 3SBEA 2CCGA 2DWQA 2G0TA 3ADDA 2OAQ1 1E1RA 3AF1A 1G3RA 1JAIA 4MYHA 4DCVA 1KAGA 1MO3A 3PCRB 4RZ2A 1FX0B 4W9MC 4PFSA 2EFCB 4WXRA 5LDDC 4US0R 3M0EA 1Q12A 1YRAA 2RGNC 3AKCA 4RY2A 4MKFA 4YMTA 1SXJE 1G18A 3A1VA 2WJYA 2PCLA 2ZJ2A 5DYGA 2IBMA 5G41A 4JL6A 2IS1A 1JALA 2FEOA 1FNNA 1KI6A 2WJJA 4G01B 1YQTA 1OH6A 2V3CC 2C96A 2OLKA 2XJ4A 4IDOA 1UEJA 2ZRHA 1J90A 2GBLC 4MRRA 3A8TA 4G5RA 3IQXA 4M9QA 1RVDA 3RRNA 1RYHA 4C0LA 4DEYA 1TX4B 4Q1CA 3I73A 1E94E 3KFXA 5DI9A 2FFQA 4UNSA 4JIMA 3W5JA 3AVXA 4XD7A 4XIGS 3KKOA 3LAWA 4QFMA 2XSZA 2N46A 5CDFA 1DAGA 1RC8A 1EWRA 2NPFA 1ZM4A 4OQNA 4ZDJA 2FPMA 2PT5A 4DDUA 1CIPA 1KIMA 5DI3B 4UKDA 5H68A 4DIDA 1Z28A 2ASEA 4PTLA 4W5WA 4ZV4A 4XWAA 4QNMA 1RKBA 1COWA 3LVQE 2NQ2C 5B64A 4G1UC 4LV8B 2JLYA 4L9WA 1QVRA 2R6AA 4D82A 3VKWA 2NO1A 4IEEA 5HKKA 2P3SA 5L8VA 3A1TA 2QRNA 3A4NA 3EIQA 1C9KA 1P4SA 1TQ2A 1KDRA 4NZYA 2FFHA 1NI3A 3CW2A 4NYIQ 5FPHA 3E1SA 1U2RA 2WPDA 4LX0A 3OAAD 4LI0A 1SXJC 3THOA 3AUXA 1HY3A 4DHEA 2VLIA 2K5UA 4KXFB 2CBZA 4URWR 4JT4A 4CGZA 2PCJA 1NBMD 2MSEB 4JLKA 2BCGY 4BGDA 3E2IA 2EFHB 2B6HA 3GLHA 4URUR 1TPZA 2VTKA 5FTKA 1LF5A 4PC6A 3CKLA 4EJSC 1H8HD 1W47A 1E2EA 1NKSA 5HCNA 4DRZA 4DSTA 2PBRA 1N6NA 1Z07A 1ZD9A 3U6BA 2J1LA 4OI4A 3ZZUA 3HJNA 1NJFA 2HXSA 3CPHA 2GJSA 4RCZA 3K9LA 4DCNA 1JNYA 4RVCA 2V7QD 4NU0A 2W2XA 1ZMXA 2JLSA 2B8TA 3WBJA 2IYQA 4OHXA 3QXSA 4PHGA 2AXNA 1F48A 2HYDA 2QMOA 3CNLA 4FCVA 5FUVA 3WP1B 1J7KA 1UKEA 3QKTA 1AZSC 4K46A 3REGA 3H84A 2GEUA 4LBZA 3TBKA 3GLIA 1BO6A 5GVRA 1LF0A 1IM2A 2WHXA 1W0JA 3ZLJA 4UJ3A 3B1YA 4NL4H 3VNVA 2Q3HA 2WIBA 1VPLA 5JHHB 5FOWA 2GK7A 4Q47A 5BXQC 3QBVA 1NY5A 4B3DA 1IXSB 3KXLA 2WJGA 3UATA 4Q9LA 5KNBA 1XEXB 5J4KA 2BDTA 1E2DA 4TL6A 2QA5A 2QM8A 3LFUA 2BC9A 2IWRA 1S9HA 4V0OA 5KPJA 1E3MA 2W6JD 1GRNA 1E1RD 1OYWA 1ZYUA 3BORA 4PANA 2FNAA 3BS4A 3WHLA 2VHQA 3RC3A 3ADBA 3THWB 2J7KA 4JS0A 621PA 2BMFA 4IKEA 1N6HA 3JVVA 1DVRA 4RKEA 3W8RA 2OT3B 2YWFA 4I1UA 2OFXA 3K9HA 821PA 5JRZA 4JVNA 4Q19A 1G17A 2IYLD 1MRSA 2JDID 2XNSA 1VG8A 4D4JA 1JEEA 3FFBA 2X77A 3Q72A 1G19A 4BLSA 1NMYA 2FFAA 2VL7A 3TQCA 4AG5A 1N0UA 2HCBA 3IO3A 2PEYA 3NEYA 1H8ED 1G7RA 4Q66C 5G53C 1X8KA 3O8BA 1G7CA 1N25A 4KCGA 1F6BA 1JJ7A 2HXYA 1W5SA 3C4JA 5DSZA 3SHFA 5CB8A 2ZUCA 2H5EA 2AD5A 5FTJA 3RWMB 1XMJA 2OESA 3QKRA 4B43A 4D4MA 4GP7A 4ITRC 3ZZ0A 721PA 2CL7X 5KNCA 1QHHA 2QSYA 3U3OA 1OXSC 3R8FA 1TUEA 1OH8A 2GJKA 3BB3A 2ZETA 2QAGB 5JCZA 4RZXA 3NHBA 3QENA 4LC1A 5EUMA 2FSFA 4PC1A 2OHFA 1I2MA 2C78A 1JBKA 3AGQA 4FWIB 4JYBA 1GNRA 3BC1A 4LYJA 2HUPA 1ZP6A 1N5KA 3T06B 3V4FA 1FOEB 1G3MA 2B7CA 2OE2A 2F3TA 2WAXA 4RZ3A 3U4QA 2C5LA 4C7OB 2PLRA 3PUZA 1Z5ZA 2B8WA 3AVQA 3KL4A 3LO5A 2I1QA 2IUSA 2ZE6A 4TLBA 1QG2A 1DPFA 3GJ0A 2J7PA 2ZI4A 4CT5A 2EFDB 1DEKA 1KY2A 2WIAA 4IVQA 3GLFE 3CR7A 3REFA 2VEDA 4GOJA 4YONB 3RNLA 1AGRA 2CLCX 3LBNA 4DLYA 3TR5A 5EJEA 4AK9A 1OV4A 3T35A 4HZUA 1U81A 3AVVA 5FFMA 2HLDD 5DISB 3AV0B 4QJ4A 1CJVC 1A7JA 1DAKA 2AD1A 4Q9JA 3EPKA 1S9DA 4DDWA 1W44A 3U7GA 1AS3A 5BYKA 4BFUA 1RIFA 4A2QA 5JEDA 2BBSA 1X6VA 2GKSA 2X2FA 4JVMA 4R2IA 1XJQA 1F2TB 1JR3D 1NIJA 2ZROA 4O0MA 3SC3A 1TEVA 4IXNA 4C30A 4B44A 2ZRNA 5H1YA 1TF5A 4Z1MA 3S1AA 4PPGA 2IX3A 3VAAA 2Q9AA 2VQSA 4OI2A 3QIAA 1CJUC 1IQPA 3Q9LA 2ATXA 3W6NA 2QI9C 3PEVA 1W0JD 3KJGA 2VP4A 2RGNA 2FFBA 1W36B 2QP3A 2QNRA 2WOJA 5A5GA 4PX9A 1IN7A 5JI2E 1XTRA 4QOSA 4MYTA 5FBQB 1XRJA 2CVHA 1Z0AA 4EUNA 4PXAA 4GMXA 2B21A 2OBMA 3EC2A 2WWGA 2F3RA 2ZUDA 1KK2A 3G82C 2V8OA 4UNRA 5ANRB 3D8BA 1R2QA 3K9NA 5LB4A 2JJ2D 3D7MA 1R0YA 1SVLA 2C04A 4U5XA 2D3WA 2J9RA 1XJCA 2P2LA 2QPTA 2RB4A 2ZE7A 4C3ZA 4G5GA 4ZDKA 4F4IA 3VR5A 1NG9A 3TE6A 4PAQA 4Y0VA 1VTKA 2DY1A 4HB4A 4XOIA 2ZREA 1T9HA 1LS6A 4MYCA 2IK8A 1T8TA 4IFEA 1S0UA 1KGDA 4US1R 3PUWA 2RHMA 2VP0A 1US8A 4C2UA 1Q1BA 2TMKA 3KUCA 1ZNWA 1Q3TA 4NP6A 2Z0MA 3K0AA 3TMKA 4NMMA 3CRRA 1TMKA 5IT5A 2N1BA 3FB4A 3QEOA 1NJGA 2YC2C 2MMCA 3VU9B 2P6UA 4PAOA 5G3ZA 3SE0A 5H8WA 5HE9A 3BJIC 3DEFA 5BYJA 5HTKA 1GDDA 4RKFA 5BWMA 1Q22A 5KSYA 1BMFD 1P73A 1KJZA 3O47A 2EFEB 4DWJA 4OKSA 4ZDWA 4AIIA 1F3OA 2YYZA 1YJ5A 4TYPA 3KXKA 1SXJA 1GVNB 3O8CA 4TZ6A 2WMOB 4W5JA 3DPUA 4XH9B 3AVWA 5SZJA 4TLEA 2IXFA 5KSZA 3NBZC 3VKHA 3VNUA 4LV5B 2JIZD 1UBCA 3AKEA 4NYJR 3K70B 1IONA 1M8PA 3GJ3A 4QBIA 4EJSA 4CF7A 2VF8A 5DHAA 2V1UA 1UM8A 1E9CA 4RSGA 1UFQA 1W2GA 3ZS8A 2KI5A 4NCIA 4US2R 2VHJA 3L2OB 4LJ6A 5IF9A 3GQBA 4B71A 4D4LA 4HAUA 1X86B 3TVDA 2Z6VA 1YZLA 3QPUA 2NZ8A 4V0NA 1GITA 5CB6A 1FMLA 2YWGA 5EUQB 3UIEA 1RRCA 1YKSA 4WVFA 4LHZA 1XXHE 3HDTA 2J7PD 4KJZA 1KNXA 2QQEA 2R6FA 3BOSA 5EP4A 3NBFA 2AKAB 2Z4SA 3TW4A 1DELA 2WJHA 4CEHA 1E2NA 2JLUA 3HR7A 1BH2A 3RS4A 3ZD6A 1OKKA 1EG7A 3THYA 3BB4A 4RJLA 2HT6A 1R0WA 4HAZA 2KJQA 4NKRA 5KDOA 1E9BA 3BIFA 3OHMA 2W6ID 4Y0AA 4BZPA 1W4AA 3R9IA 4OYHA 3NEJA 4BRUA 4GZLA 4B2PA 5LPNA 5JI3E 1KK3A 2DFNA 2L0XA 3RDPA 3SOPA 4D0GA 4HLQB 1HT2E 4HUTA 1V43A 1UBEA 3PENA 1WE2A 2Q9BA 4D26A 5EXXA 2OXCA 4CYMA 3VKGA 3UMRA 3P20A 2OZEA 3QY0A 3SYNA 1SHKA 4Q01A 5JBQA 3MFYA 4LYFA 4Q7KA 4JMPA 4KBGA 3QUSA 3ZDQA 3PJRA 1G21E 4LJAA 4TMXA 3OEEA 2YOGA 3VTKA 1FTNA 4QL3A 2C8VA 2XAUA 2ZRCA 4D80A 4ZCIA 3P32A 1E2PA 1ZM9A 3CX7A 1E2JA 1U94A 4AKEA 3EIHA 1TQDA 3DKVA 3IEVA 3OESA 2WV9A 4HDQB 1W36C 5FPTA 3KKQA 1T91A 4R7ZA 2ZJBA 1L2TA 4LPSA 4E09A 1P9RA 3FHTA 3LXRA 3ICEA 2SHKA 1P60A 4A2PA 4ILEA 4TSFA 2GXUA 2ZI3A 5TARA 3LBHA 1WXQA 3F3YA 3B1WA 2CHGA 2FA9A 2C99A 3I8XA 8OHMA 2A5GA 4YC7A 1Z83A 2ZI7A 1G5PA 2ZI9A 4F4JA 4NYMR 4P4UA 3L0OA 4LHVA 1E0AA 1E32A 1S4QA 3EA0A 4MQBA 4WXPA 5JWHA 5J4YA 1OT3A 2O0HA 1FTSA 4OQMA 4R2HA 2KBFA 3B78A 4RD3A 1G4AE 1KYIA 1II8A 4IFBA 2GRJA 2IHYA 2HJVA 1IY0A 4LYAA 3ZYCA 2XXAB 4N3NA 3HU1A 2W2VA 3QG5A 2OCPA 3VR1A 4EIWA 1ZNYA 5KYKA 3W34A 2F43A 2HYIC 4QM6A 4HAVA 4MRSA 3FWYA 1XDBA 4Q1DA 4FCTA 2PZEA 3CR8A 4XWKA 5DO9A 2VF7A 2VHUA 4CDGA 3D3QA 4F92B 4DZZA 3KX2A 5IK2A 1JXMA 3ZIAD 4PHFA 2GESA 1ZNZA 2GTPA 1UKZA 3HU2A 1II0A 3CPEA 2Q3MA 4R9UC 4QGAA 1SKYE 4KYIB 1DAIA 1E1QA 4KODA 1JXOA 1VYVA 3A4LA 2F7SA 4FMCB 2BHRA 3PXGA 3PITA 2BOVA 4JKIA 4UNNA 4PQYA 5FUXA 2J0QA 4LUCA 3UK6A 2GF9A 3M1IA 1WDTA 3SYKA 4OQLA 3FHOA 3BAFA 1DS6A 1G16A 4HB3A 2X19A 3HU3A 5HPYB 4Q7JB 1QF9A 2EVWX 1MABB 2OLJA 5JJKA 4KHZA 1BYIA 3ZQJA 5F9FA 5JS7A 3GJXC 4DSOA 2QUZA 1M6NA 4A1FA 3BXZA 1DE0A 4WAUA 4Q1FA 2C95A 4RD1A 1NP6A 3THXA 1Z06A 4HLDA 4X8LA 5E7JA 3ZQ6A 2PMDA 2X2EA 1Z0KA 2RHDA 1A2BA 2CJWA 3ZZTA 2PJRA 4HAWA 2XZPA 4O25A 2GXSA 4FI3C 2FDCA 1YR7A 4A9AA 1SVKA 3TUZC 1EGAA 1ZIPA 4KFSA 4JJZA 3QNUA 5FPSA 3KDSE 2RGAA 1S2MA 2BBWA 1HE8B 4C0KA 1G291 3FKQA 4X8HA 1XD8A 2YOFA 1OXUA 2QQ0A 3EZ7A 4PHHA 5CJ2A 2ECKA 1AQYA 4TMVA 1G3IA 3FYHA 4XWOA 3OE7D 3UPUA 4DCUA 4YXWA 2CLSA 2DFKB 1LTQA 3EIEA 1KDTA 5A0FA 2IS4A 3DM9B 2QTFA 1KI6B 2VP5A 2XTZA 3KXIA 4OI0A 2HV8A 2J0SA 2Q0HA 3A36A 1U8YA 3EAQA 4FWTA 1E4YA 4FD2A 1XTSA 5TV2A 2HJGA 1S8FA 1FW6A 3CRQA 1GNQA 4GFDA 2ZI6A 4Q1AA 3FFAA 5J4VA 2BEJA 2QG6A 1GAJA 4TYQA 1VECA 1Z47A 3BK7A 2GETA 4M22A 3PEWA 2QL6A 3IHWA 4XVQA 2QBYA 1NVXQ 5ELXA 2C9CA 1OHHA 5JHGB 1KSHA 1L7VC 2F1IA 1IOZA 1LV7A 4ERNA 3KQNA 5LBIA 1JQJC 1ZIOA 1QHIA 2WWYA 4RFVA 1IJFA 3RS3A 5DN6A 3CONA 2REOA 3LVRE 1TL7C 3C8UA 5IDVA 3BWDD 2ZRLA 3ECCA 1G8HA 2BEKA 1E4VA 2J5XA 2XITA 3NBYC 2QM7A 1AJEA 1CEEA 2PMKA 3ADCA 1NVVQ 2BKEA 1XEFA 3RC8A 3SEAA 3NH9A 4PO8A 4BUJA 5DE3A 4AWXA 1WMSA 3UKDA 1Q1ZA 2IW3A 1OPXA 4LV6A 1Z0FA 4BLTA 1OF1A 2P0EA 4KSCA 3K70D 5BN3A 2NOAA 4M9ZA 2PX0A 2O8BA 4RCYA 2OFOA 3GLHB 4A36A 3GJ8A 2ODWA 1OB2A 3SHWA 3IKJA 2IYUA 4HB0A 3CPJB 2VSXA 4L5BA 1IY2A 1NRJB 2XNDD 3WRXC 1E9DA 1EESA 2EYQA 5UKDA 2D7DA 1CU1A 3PEYA 1G9XA 4JZKA 3GPLA 1T5IA 3TSWA 1W4BA 3VHLB 4JVSB 4JSTA 4UNQA 121PA 1FFHA 5C2JB 3UWOA 1Z8FA 1KY3A 3R20A 2FU5C 1E2FA 3T5GA 1XU4A 4BWYA 3ADKA 1QHGA 1EFCA 1Z3IX 1AZTA 1AN0A 4PQFA 3SYLA 1ZAKA 3GLIB 3B2EA 4HLUC 4LHYA 2E87A 2NG1A 3PQCA 1FPMA 5TVKA 4LY6A 5DHFA 3FGNA 1PJRA 1R5BA 3K0FA 1SVWA 2J87A 4P4SA 3GLGE 3PR1A 1GOTA 1RJ9A 3QXXA 4ZKEA 4B34A 1OFTA 1YVDA 2V55B 4TLCA 3FPAA 1VG9B 5E3HA 1JAHA 3IHLA 3HR8A 1DAHA 1EXMA 5JCPA 1XMSA 2IYZA 4DBLC 4CRWB 4MRVA 4QRHA 3I5YA 2EQBA 2FPKA 4C4PA 1RPZA 4NHOA 2D4HA 2WICA 1R8QA 4AI6A 4DLZA 4HAYA 2WKRA 3LLUA 1ZM7A 3ONWA 1D6JA 1XP8A 4EPRA 1XXHA 1FMJA 5FTMA 2A3RA 2AHOA 2J0UA 4JLNA 4Q4JA 1MV5A 3IDQA 4IVRA 1XMVA 1DOAA 2CXXA 2HCJB 3G5UA 2JJ1A 2LCFA 2C2HA 2WWHA 3FKSA 3PVSA 3IGFA 1OXTA 1A4RA 3IPXA 2FN4A 3ZVRA 1XTIA 1E2LA 2WOOA 1ZJ6A 2ZRPA 3Q5EA 4IOLA 1G3QA 3BGWA 3I3SR 4LJ8A 4UXHA 2JCSA 2HEIA 2N42A 2RAPA 2VSOA 2F1RA 2Q3FA 5GVSA 3WMEA 1K5DA 2ANBA 3R9WA 1UPTA 3QKRB 4JL5A 1BOFA 1NN3A 1OHHD 1T6NA 2GJ9A 3OEHA 4M1SA 5FI1B 2IUUA 3TUIC 4DCTA 2FF7A 4XVUA 4URXR 4TYYA 3VQTA 2D06A 1QHHB 4FIDA 3WMGA 2C9OA 3EX7C 4KITB 4F7WA 3TH5A 3TSOA 4B3CA 2WKPA 2VPPA 3ICQB 1NY6A 1XD2A 2DHRA 1QZXA 4GL2A 4MUBA 5LD2B 2KE5A 3EPJA 3U4QB 2KBEA 2ZVQX 4M1MA 5L3QA 4E07A 3ND9A 2BIFA 1TU3A 3RSOA 3C5HA 4URYR 1KJWA 2IUTA 4DB4A 1QG4A 4S35A 1KO4A 1LW7A 1UDXA 1ZD8A 2BWJA 3TLXA 2GEVA 3KJEA 1QHYA 4Q1EA 4LJ7A 4W5HA 3QE0A 2CNWA 1L8QA 2GJAA 3GCGA 4HZUB 1XPUA 3VR3A 1WRBA 2XX3A 5KTYA 1KI8A 5SZHB 5AUNB 2YNMA 4N0DA 2G3YA 2H16A 3KJIA 3UWKA 2WSSD 4TTRA 4DLSA 3KB2A 4R71A 4KO8A 2ZRIA 5FH9A 1VG1A 3QXJA 3DO6A 1W0KA 1Z63A 1Y3AA 1N6OA 2FOLA 1RW4A 3Q8XB 1IN6A 1TAGA 3GFTA 1T0JB 1Z08A 2RH5A 2ZQ5A 4Q1BA 4AG6A 4GBMA 3S1AB 4Q7MB 4TYNA 1HT1E 1FNMA 1S3GA 1DO0A 1X8LA 2CK3A 2G9NA 1CR0A 2CHVA 4Q4HA 3M6AA 4JLJA 4B47A 3L0SA 5P21A 1Q1EA 3H2YA 2OO7A 4C0SA 3I72A 2ZRDA 4IVPA 3WYAA 2ORWA 2IC5A 2V6JA 2AK3A 3AF4A 1HQCA 1Q0UA 3P26A 4TWZA 1II9A 1U9IC 4UXJA 3LA6A 1Z6TA 4OHWA 1RFLA 1QVAA 2FGKA 3CUEF 5CITA 1KI7A 3F0TA 1ZUHA 1GIAA 4MKHA 3C41J 3IBYA 5HE8A 1KSFX 3SJAA 1WF3A 1X1SA 1VCMA 3RS0A 4MDFA 2QMUA 2MSCB 4JLDA 2JATA 3QJYA 2ZU0C 1UJ2A 4NBSA 3QPVA 1QRAA 1VYTA 1HQYE 2ZVPX 1GKIA 3B85A 3PIRA 3TRFA 4D81A 1CR2A 1SVSA 2QN6A 2G88A 3QBTA 4D4KA 3FHCB 3KKMA 4MGIR 3O8DA 4B33A 5TMPA 2X8AA 3F5FA 2UVQA 1LS1A 1MO5A 1TF7A 4HLCA 3SQWA 1US8B 4OQXA 1R0ZA 4Q4AA 3MAAC 2ZJZA 3KQUA 2O0JA 1S3SA 3QVUA 1X3SA 1ZM2A 3C7KA 1QDEA 3K0AB 5DGXA 4XD7D 1M2OB 1XPRA 1R10A 3BD9A 3VMFA 1YR6A 5IRCD 4WZ6A 4B74A 2DFLA 2NO0A 2XSZD 4HDCA 3U60B 2OSBA 2FV8A 4TTPA 3MGCA 4KFRA 1IAQA 1KMHA 2OILA 2IXGA 3RS5A 3CF6R 4FXPA 2H17A 5K8IA 3GD7A 1M7HA 1COWD 4G3XA 5KDLA 4B75A 4EPWA 2D74A 5EP1A 1SXJB 4GDFA 5GJBA 1RYFA 2QENA 1U0JA 3QEJA 4HAXA 4JYCA 3N5CA 4RFSA 5HKKD 3W6OA 5AJWA 3ETLA 4DLTA 5CLLA 3K0SA 1E9AA 2A9KA 3SJCA 5K8TA 5J4LA 4A4DA 3LQQA 2ZR0A 2OBNA 1GWNA 4DJTA 1ZW6A 2WPDD 2CCJA 4EJSB 1O3YA 1DAEA 1UKVY 2FZ4A 2GXQA 3CM0A 5LB2A 4ASUA 3EWAA 1UADA 2YINC 4HUQA 5J4HA 4PZYA 4V03A 4Q9KA 3R7WA 1FUUA 2XTMA 2BM1A 1K6MA 4GPTA 3IEUA 4F93B 1HTWA 1KKMA 1Q1QA 2DYKA 3A37A 1OJLA 4ESHA 2ZRAA 4C2TA 4IDNA 4OK3A 1GP2A 3SNHA 2XOKA 3TAUA 2BMDA 2OFWA 4CEHB 1ZBDA 5EXTA 4KSBA 1MO6A 2ZRJA 4EPYA 2IYVA 4HLUA 1TU4A 3WNBA 3THYB 5EE5B 421PA 2ZITA 3MUFA 2QSZA 1KDOA 3CIOA 1WBDA 4RD6A 3CNOA 1YR9A 1J8YF 3MD0A 1NG1A 2H8KA 2ZTSA 2O8CA 5EQTA 5BN5A 3NVAA 5F3WB 1R4AA 2CEAA 3WP0A 4M1YA 1E9EA 2A5YB 4FMDF 3FTQA 4KVAA 4E22A 3X1XA 3WYGA 4B35A 1Z0DA 2A30A 1ELOA 2GBLA 5EE1A 3L8YA 1TQ4A 3MWKA 3I4LA 2FPLA 4CZ2A 3K53A 5B58C 2ZS8A 1KK0A 3N70A 4ZPXA 4JLBA 2B92A 3P27A 3I32A 5F98A 1OXXK 4DT1A 4I4LA 4BFYA 3MLEA 2PX3A 3RYTC 1W2HA 2RGCA 2DWOA 2ANCA 4QHYA 5AJVB 4L9SA 1YZNA 4B6EA 5JRJA 3CF0A 3NIBA 5JZVA 4A0HA 2O8DA 1NBME 1G7TA 5CIQA 4QJ3A 3W5IA 3EPHA 1OSNA 5J40A 1N6RA 2AWNA 4N1AA 2VBCA 1EFRA 2HF8A 4ZCMA 1JEDA 1NL3A 2RGEA 4YLGA 3L82B 2XGJA 4E5UA 4D0LB 2AFHE 2ODEA 3GLGA 1TADA 3AKYA 4M8NE 2YWHA 4PHTA 4V0ME 1II8B 4DEXA 5FL7A 3AEZA 2X1VA 2I4IA 1PLLA 4DUGA 4WZBE 1KO1A 3AVTA 1XEWY 2F43B 3DOFA 1E0JA 3U6KA 1G3UA 1GL7A 1SGWA 3EZFA 2JJ8A 1P62B 4JBWA 3LLMA 3KZ1E 1ZU4A 4C0JA 4BECA 1OW3B 2ONKA 1PLJA 3A6PC 3MJHA 3KTAA 4TQUS 4UQOA 3TR0A 5AK0A 4H1UA 1GKYA 4M0LA 5CJPA 4BFXA 4TLDA 4L16A 1L4YA 4DDTA 2FSHA 3DDCA 1MRNA 1RRFA 1IXRC 1C1YA 2RMKA 1QBKC 4JL8A 1XTJA 3WXMA 2FMXA 4ZI2A 4A6XA 5L3SA 3DZDA 5EXPA 3U3MA 2ZYWX 4CEIA 1JPNA 3B13B 4KBFA 2IXEA 1E2IA 4EKDA 1ZD1A 3CRVA 3UG6A 2QE7A 4MH0R 2WZQA 2RGDA 5JWRA 2RGXA 4PAMA 2GVDC 1IN8A 1N3BA 3QXHA 1AS2A 3DMNA 2C03A 2CL0X 2J0VA 2ODNA 2PZGA 2YC4C 3ND8A 2O52A 2QT0A 4MGYR 3THXB 2ZJAA 3LD9A 2Z5FA 2RGBA 3PUXA 3NC1C 5AUQA 3U44A 1VCOA 2CJWB 1LVGA 3EXAA 3KFVA 1HURA 1ZC4A 2BV3A 3VR6A 2PEZA 4B2IA 2R2AA 1KZGB 4Z1MD 1IXZA 4C0HA 3U5ZB 1T3HA 1U9IA 3OIVA 3G0HA 4TMWA 1Z0JA 2FGJA 1IBRA 1SQ5A 5CYOA 1SHZA 1W49A 1WB9A 4ARZA 2JAQA 1W4CA 5JSZA 2ERYA 5FR1A 2IS6A 5JJLA 2P65A 3DVLA 4M1KA 4FN5A 4A82A 1ZRHA 2OCAA 1J8MF 2NPIA 4L4UA 1YU9A 3K09C 4MGKR 5B2ZA 2ZANA 5EE9A 1SULA 3UMFA 3CWQA 2PLFA 4HSEA 2QGZA 1CXZA 4DLUA 4YMVA 4DLVA 2IYWA 4GRAA 1D9XA 2EWWA 5KSPA 1MKYA 2CE7A 3B1VA 3ZVNA 1D2NA 1D2EA 1NMZA 3SFVA 1LFDB 2GCNA 1DAMA 4M4SA 5DH9A 5JS8A 2JLVA 3CX8A 4TT3A 2QP9X 2QBYB 5E7IA 1KO8A 3SJZA 3JZMA 1D9ZA 2OG2A 2XZLA 3CZQA 5DNYB 3ZH9B 4QKQA 2ZPTX 4JVLA 3KQHA 1J2JA 4EFLA 2JASA 1K8RA 1E98A 2GDJA 4Q21A 4D6PA 3FDIA 3EZ6A 3CRMA 1ZCAA 5JEEA 3TSZA 1YE8A 3UMSA 2J45A 2O8FA 4X8OA 4Q5IA 5GADl 4BRWA 1SXJD 2IT1A 5AJXA 5EZ6B 2ZRBA 5JFGA 4IXMA 1JR3E 2YJTD 1FP7A 1U0HC 4K81B 4NCKA 5H70A 5JLJA 4KYUA 3MWJA 5DIFA 5EZ5A 1NN0A 4QGFA 4PR0A 3W9YA 3GLIE 2QGNA 3NBXX 1CJTC 2WWWA 2ZAOA 4EDHA 3QOFA 2O8BB 5K8LA 5C4MA 1Q21A 3B9QA 1CF4A 2OCYC 5FOUA 4BPBA 1OIVA 1YZUA 2R65A 2AK2A 4A15A 3LBIA 3RS7A 3MWYW 2JLXA 2ZYUX 3OF5A 2ZS9A 2KB0A 1U8ZA 3LWNA 1IHUA 3U3RA 3LH5A 3UXMA 4EFNA 4IOJA 3SFZA 3Q5DA 4NPHA 1FL9A 3LW8A 3MCAA 5D3MA 2QE7D 1XWIA 1K5GA 4JKYA 2V54A 1NF3A 1PVOA 4AC9A 4NTZA 2UKDA 3B7GA 2AWOA 2ZRGA 1DTSA 2H7VA 2VSFA 2W2TA 1CS4C 1A5TA 4BLOA 1S96A 2V6IA 4ZDIA 1OKKD 2P5TB
chains in the Genus database with same CATH superfamily
4RTJA 3A4YA 3DV9A 3TYXA 4OK6A 3GLKA 5CNIA 4REQB 1JBEA 1Q0TA 5BNTA 5LP1A 4NYIR 3HB9A 5SY9A 2K6GA 4P4SB 3N0XA 1UBGA 3EEFA 2ZU6A 1E62A 1UFOA 3PGA1 4IHKA 3R7SA 4DYVA 3QKSA 3EQ6A 4QUKA 2RFLA 3WGOA 1QC5A 4EG5A 2DP4E 5JCOC 1Y1QA 2OVFA 3GNLA 3UMGA 1G20E 2WAOA 4Z4HA 5CB4F 4KR6A 4EQ6A 4OTZA 3K0HA 4LXYA 4V38A 1EEXB 3TTSA 5L3ZA 2GS9A 4RMNA 3GLFA 2J3KA 2J8ZA 4GM0A 4BN0A 1QH1A 1UC8A 2ADOA 3NKVA 2Z1DA 5HS4A 1NATA 4AXBA 1WB5A 1JIQA 1U4OA 3OOSA 2A57A 3V1TC 4V1CA 3OEED 2A0KA 4GOOD 3R7NA 1KO5A 2I03A 4P33A 3TQQA 1JHAA 4XDYA 1KI2A 3OJLA 2QMZA 1UBLS 2FRDA 2YL2A 4IHAA 4X1KB 5EIFA 3R3HA 4Q4JB 4WL0A 5H83A 4LPKA 3CX6A 2HDOA 1UXKA 4P08A 3ZE1B 4PFJA 3GFPA 5DM0A 4JJIA 3WLIA 1YU6A 3A1EA 4YPFA 5ALFA 2ZAYA 1YR8A 2LD4A 2PRZA 2NU7A 2OBFA 3DVAB 5DBHX 5DBGA 4A73A 3HUUA 5CK5A 3ZD8A 5JZSA 1HFEL 2FPPA 3CZMA 1MCZA 1JU9A 4OJQA 1VXOA 5FPQA 1AA9A 3OFVA 3RAPR 1UF9A 4HRYA 3WDLA 4DLWA 4R2KA 4NZ9A 1PWYE 2FH5B 3EHEA 2IIQA 2ZT7A 3VXKA 1NN1A 2AOXA 1TO6A 2VT2A 1GTG1 2XMBA 3ZX5A 3I1IA 5J58A 3I4CA 2AC7A 4M1EA 4HZIA 4XIJA 4JU8A 2GEKA 2QF7A 5A06A 1XCPA 2PT6A 3FFWA 3P0FA 3ADOA 1Z73A 4L4ZA 4V02A 5EIHA 2I9KA 2C4VA 2CKMA 1FUEA 2J9XB 1WCYA 4MW6A 4TL7A 2AR0A 2VJBA 3Q9NA 4OHMA 2D2FA 1ZISA 2VRNA 2E48A 3Q7PA 1W59A 2X1HA 4IXTA 4UVEA 2AG8A 1AMNA 2D00A 3QX7A 1CHNA 5EJ6A 2OV1A 3OZFA 3NHFA 4G0XA 1UZLA 1H65A 3RUFA 5KTTA 5TR9A 3TMAA 3EH1A 3C5CA 3NHWA 4KFTA 1VI5A 4ZVKA 5CFQA 2CV1A 2O8EA 1ZMOA 3P19A 2B0CA 1E1YA 2QKYA 1KJIA 4IEIA 5HZKA 1Z5NA 5C18A 5L3QB 3QPCA 5C31A 1XV5A 1NBMA 2ILVA 3CG0A 3KB8A 5BPFA 5K6AC 1EHYA 1E1QD 3DFIA 2WMNB 3BXHA 3I12A 4DDKA 4W8HA 3RASA 5AVVA 5E7QA 2H8GA 3ZDBA 3G5MA 4JLVA 3TAHA 4CCSA 1Y5NA 4QRDA 4RXUA 1YJBA 1M7BA 1NBHA 1W2WB 3MBKA 3COVA 4IX9A 4MQUA 4EOGA 1OB5A 4LBYA 2AFHA 1TQ6A 3HA3A 2YN2A 1VDZA 3M9XA 2X1LA 2GFIA 1YZGA 5EJIA 2VHTA 3L4KA 4M49A 4IJ5A 2V7QA 4MIYA 3F7NA 4PG7A 4GQAA 3ZOKA 5AM4A 5CXQA 1PUIA 1BVHA 1E1KA 3G9ZA 4R40A 4RDXA 3ASVA 4I9UA 1N1GA 5BWBA 2JG3A 1FMTA 1Y6RA 1FZQA 1QIEA 5B1YA 3ZYZA 4GMDA 5FNVF 3SR4A 1T5SA 3N58A 3E27A 1GM5A 2RH8A 1UMBA 1NLFA 4FDTA 1DG3A 4MZXA 4O2LA 4X6UA 4KUGA 3UMVA 1MQ9A 4NDZA 4I3GA 3HXMA 1YL7A 2W2PA 4E5SA 4Q4HB 2XLCA 2VYNA 1CUUA 2DLDA 3BJRA 2WD8A 1O6BA 2PV7A 4BMYA 1P72A 1YTUA 3KYIB 1OX4B 2EX1A 3AIIA 2Q5QA 16PKA 2EL7A 3AKZA 4XTRA 2ARKA 4G09A 4UMDA 1KZ4A 2QRKA 1XL0A 3QY9A 3EVCA 2ZK7A 4LJ9A 4UOQA 4KX3A 3OQMA 2AR7A 5C46F 3EXG2 2VO1A 1F20A 3MNFA 2IP1A 3QVSA 5FPPA 3W3ZB 4KLNA 4G0VA 3MG9A 1YJAA 3H9CA 4FFDA 2HMTA 5DXAA 3ABQB 4H08A 4KLAA 3UHOA 5J2UF 5FKJA 1JMVA 1XCGB 1E96A 3QITA 1QIKA 1JI0A 5KKCA 4QDZA 4R69A 1C8VB 2D13A 4AP9A 1CB0A 2CEKA 2DKFA 3IMKA 4MWBA 4I2VA 4TTIA 1S1MA 3RH0A 3VPAA 2ZUTA 4E1AA 5JAHA 1CRPA 1ISJA 4O33A 3KO8A 3HM9A 1R6BX 5DDIP 3HY4A 3OCWA 3RFXA 4P7GA 4QUBA 1P6XA 1B23P 5J1SB 2RAUA 3C4VA 1W19A 5FWXB 2R6JA 1GYPA 1B8VA 1Y7LA 2IV2X 4D0NA 3AP3A 3GELA 4GGMX 2VYCA 4L07A 4K8RB 4MJ3A 1USWA 4N8DA 4YEDA 1PJ8A 3TB4A 5CVUA 3VPHA 1EE9A 4JR0A 1Z5VA 3OETA 4S1TA 4QXPA 4XGNA 2EX4A 2NUAB 2UU9B 1OVMA 4MPTA 4CDNA 1EDBA 4I50B 2AYXA 1DWQA 3A11A 4KH1A 1E5TA 1TEXA 3HYTA 3N74A 4JUBA 5ALRA 2BM9A 1C7RA 3RU7A 4BIIA 5JSHA 1HZZC 2EKBA 5DTEA 1DG1G 3KV3O 3QWAA 1USIA 4G89A 5L4SA 2J9GA 4LZLA 1JXAA 1YIOA 1AG9A 2V9CA 4LOKA 2DY0A 3NP7A 2HMVA 3CEAA 2NMVA 2NAPA 3TQIA 1OFUX 3UJ3X 4O3MA 2KS6A 5FR2A 5E4FA 1UM9A 4L02A 3QX8A 2YBEA 3U4CA 5TB5A 2QDKA 5LDDC 4ISCA 2HJRA 1P77A 3GFOA 4LBWA 4LZAA 3DUFB 5BWOA 4HMQA 2I76A 1CTQA 1LFAA 3FWHA 2H7CA 2C77A 3QTLA 4Z99A 3FMVA 3O4VA 1O97D 1DBRA 3KOZA 2CB9A 3EG5A 3NTUA 3C14C 3W5HA 1GTMA 4RNDB 3ZGVA 1XZHA 1MPTA 4K9MA 4ZI3A 1ESNA 3T4EA 3PXXA 1FFWA 4IDHA 4JJGA 3IUYA 1U9JA 2HMAA 2I80A 2YXDA 4LC0A 4UPVA 4J3NA 1YKGA 5I9NA 2XA1A 4MVWA 2OG1A 2WHEA 3GAZA 4YQEA 4HJXA 1IUKA 2MMGA 2R6GA 2W2NA 5KSOA 1V4NA 2FLWA 2JAUA 5AKYA 5KOHB 2MYPA 1P3JA 3VC3A 4OQYA 4BASA 1NQWA 1JDNA 4L3WA 3FY4A 4MS3A 1EA5A 3B60A 5ALEA 4LRWA 4AJPA 4BLUA 1WBBA 4KHPB 1ZVVA 2CHQA 1XYVA 1U8TA 4KREA 3RK1A 4GOKA 2SICE 4BYGA 2GCOA 4P31A 5K3SA 4DQDA 4YCSA 1GA6A 3TZCA 1GTSA 1D5WA 1OC4A 1YZTA 2OEPA 3MZ0A 4QDJA 5H16A 5CDUA 3ER9A 3UK0A 1HEYA 4G2NA 2ZTUA 1GXSA 1EFUA 2G67A 1KWKA 4MVJF 5JCOA 2XCSB 2JGKA 2JFNA 1IRXA 2CYBA 2IYXA 1NBWB 4UM7A 4YRZA 3U49A 3IAM6 5K3CA 1K63A 1QCCA 2G5GX 3F7TA 4TSKA 1DFHA 1ZCBA 3WNCA 4DC9A 5LQRA 2BZSA 1W1WA 3L8ZA 4IICA 2XNKA 3PCXA 4CXMA 2IHNA 2J3MA 1MO4A 4J6FA 3V2HA 3LTEA 4B31A 1XMQB 1W5AA 5DGIA 3MB8A 2UXCB 3CBQA 1IN5A 2R60A 1IUNA 3A6DA 3PX2A 4B73A 4BUCA 4B6GA 4N39A 4G84A 3WO1A 3BFVA 4PBSA 4DG9A 4B32A 5SYMA 1T15A 2NZYA 3QI2A 3V8PA 1FX0A 3RAGA 2F67A 4GX2A 3SLGA 4YDHB 1W581 5THXA 3TNFA 3JQ8A 1MAHA 1SUDA 3AZOA 3MTIA 4HMPA 4LWOA 3R8CA 2JJ2A 1H6CA 4I8IA 3HH8A 1YZKA 2J41A 3IQWA 1UJ4A 2IIVA 2VUUA 3HPRA 1E61A 3ITKA 4ABYA 4ILKA 2GXAA 1L4KA 2VH2A 1G8FA 2QPOA 2P2CA 3ESCA 4L51A 1GFZA 3IURA 4DV6B 2WU1A 1N7GA 1V3TA 4F84A 4KAJA 1A9RA 2PL5A 3FLMA 4I14A 2ORIA 4OMUA 4BVJA 2O8DB 3M82A 4X8MA 4CQMB 1ZGBA 2H4FA 4QUGA 2GZ3A 1J70A 2YOHA 4BNMA 4RSHA 3RFVA 2Q5IA 1XDGA 1Z8NA 3RK4A 3AGPA 2BCJQ 2GAFA 3WKCA 3TQFA 3NDBB 3KJNA 1SVIA 4DS3A 1VSUA 4OH7A 1FSGA 2XWQA 2H9YA 3ZZNA 4RIIA 2WVJA 2E4ZA 3PIIA 2EP7A 3EH2A 1M2KA 1A98A 3HHEA 3TZLA 3LUBA 3Q88A 3DTTA 1XALA 1PLKA 3QYFA 4MAMA 2AZMA 1M1YE 1QLWA 2KSQA 3NC4A 3R9XA 2FW7A 2B3DA 1GPYA 2ZSHA 3IODA 4M9XA 4RF5A 2ZBRA 3AR2A 1U04A 3L40A 1KO7A 1DO2A 1WHSA 2F4NA 2QD2A 3H75A 4D0RA 4IIYA 2ZTLA 4JBYA 4LSWA 1HV8A 4BFZA 1I2BA 4E21A 1NV9A 2PNFA 4LXGA 4AU1A 1OVGA 5K6AA 3EZYA 3C24A 5CHEA 1T6ZA 4EG4A 2CLLB 4FT2A 1DKOA 1MXHA 4AKGA 2G6TA 2WR8A 3RRMA 1K98A 2PS1A 4TLMB 4DDVA 3VZQA 5BMVB 2NO7A 3RJ9A 2X8JB 1E99A 4R9NA 3I83A 1XQWA 3G17A 2GN8A 3CZRA 2ZB2A 4NDAA 3DZFA 3HEMA 4P80A 5LYYA 4ZMRA 3BCHA 3RQSA 3GVCA 2GNOA 4IKOA 3OT1B 1IY1A 4OB7A 4UTXA 4Q6BA 4MV7A 2QROA 1GG9A 1UJ6A 1W5TA 1SU6A 1S01A 1IJKA 2Q0QA 3JSAA 4K5QA 4L72A 3R9KA 4E4RA 1X80B 2HDNB 3ES9A 4JWKA 4D98A 3TJRA 3TVTA 2BI4A 1AUVA 2GHTA 4F3RA 4QWWA 2H4ZA 3PB3A 3L0ZA 3MSXA 2NAFA 4NAHA 2R8RA 1LVUA 4OHYA 3H86A 4FMCF 3FAKA 3FPLA 1RJFA 4C5AA 4D8UA 1KFJB 1XF9A 2W0SA 3PUHA 1N5LA 1L1RA 2SBTA 4F4CA 3CF4G 2PH1A 1QB8A 2RHLA 1EVIA 1U3VA 1Z4NA 1SVMA 3X44A 3K9BA 4I99A 3WGGA 3U44B 1QORA 1Z82A 1AUPA 4IDDA 2O2HA 1DAFA 3NUGA 1FTGA 3JZAA 1YI0A 2PFKA 1B0PA 1VRVA 2AQ8A 2XDQB 2OYSA 4AF8A 5AXCA 4KRGA 3F47A 1G5TA 1T0HB 2QQ5A 3SXPA 2CMKA 1BFUA 2ECQA 4FYYA 1WUIS 4GZMA 4AD8A 1H2FA 3AQ4A 3SKYA 4HVAA 3CMMA 3D5EA 3W90A 1T29A 2DFTA 4PZUA 2QYHA 5CR9A 4ZXFA 1E2KA 1CLEA 4UD2A 4AAYA 3G9TA 1L5LA 4KR9A 2PUJA 2QEQA 4ARZB 5KC9A 1G0NA 4DXDA 2EWVA 2Y0DA 3EY9A 4X6XA 4TL8A 3MMNA 4ZI7A 2YASA 3RRYA 5JSZB 2AKEA 3F71A 3IDOA 4TV8B 1L5GB 2WY2D 1XAJA 2QX4A 2AMLA 1T3LA 5HBRA 4X91A 3ZK9A 5C51B 1YNSA 3KKPA 3MOIA 2L42A 3JVIA 5ETJA 4XPIB 5EWJB 4TWAA 2FZ5A 5ABPA 4DQUA 1PV4A 1RPNA 1JDUA 2NPOA 5K4AA 1PUXA 1G42A 3NTOA 4C22A 1EX6A 4OXQA 3BXOA 4TMFA 4QBTA 1JHQA 4IO1A 3DYBA 4UHKA 3UK7A 1LPSA 2E1RA 3VOAA 3CB4A 4B3GA 5CLFA 2G1UA 3T15A 4ZOAA 1X7DA 4JQSA 3OKFA 2BEUB 1U7XA 1GKUB 3T38A 2PKYX 3DMRA 3MERA 4U7DA 5AUPB 1M2EA 2LP4Y 4AYTA 1BS1A 1OR8A 4AM8A 1HZZA 3HSKA 3GDFA 4YV7A 3ZPXA 1UBFA 3KHKA 4BEJA 1TO2E 1TQHA 3BT7A 2XYRA 1OLXB 1J09A 1PGNA 3O8OA 2EP5A 1A7AA 2REBA 3GAMA 4QG7A 2WM9B 4L8LA 3LYLA 1WA5A 1N6LA 4PQEA 4RLQA 5EJ2A 4XJSA 3WYFA 4F1KA 4M53A 5D3QA 1XTQA 3L0IB 1YRBA 1DTEA 2I33A 1XNGA 3CINA 5I9BA 2B61A 2VJDA 3GUZA 4PPQA 2O8FB 3MT8A 4I55A 3GMTA 1D2GA 2C2KA 2OZPA 2P5UA 2YHUA 1XNJA 5CA1A 1GLVA 3GEIA 1XIVA 2DLNA 3KCNA 4ZYXA 2P6NA 2R4QA 2YVUA 4I1SA 1D7AA 2QU7A 3NWOA 3TLGA 1PUJA 4IUYA 1W29A 2RBGA 1IATA 4FDUA 3TK1A 3WGJA 1EFTA 5CLJA 3ZEAA 2WD7A 1I4DD 1W4RA 3QVXA 4Y1GA 1OQAA 3MYRA 4D46A 4DMMA 2PAFA 4C7OA 1R5NA 1ZGCA 4BE4A 3EHDA 3H05A 2XGJA 3KB1A 1UBJS 3HUFA 2RG7A 1M5RA 3DTVD 2FG5A 2GHIA 1LDEA 1P2SA 2Y67A 3L5KA 1I2DA 5F7OA 3TOVA 4KKVA 1KOFA 5FBKA 1NVWQ 4B3FX 4H1WA 3OSUA 4RD0A 3K2QA 2HHLA 2JFZA 3RM3A 3N2IA 5AHXA 1F1BA 2YRXA 4K2HA 4NJMB 3WGIA 2M2IA 4KC0A 1GDHA 1O97C 4W9RA 4NCAA 2IU6A 4R05A 3DDNA 5EP3A 2IL1A 1G98A 2XOKD 3DMFA 4LOHA 4WZAE 4XVHA 4D3SA 1U99A 2EJVA 2Q2WA 1DJPA 1QCDA 2GEJA 1X13A 2BI8A 2PGXA 3D1JA 4UXIA 1XZKA 3ROKA 1TUBA 4XWYA 3OH8A 4Z7QB 4BXOA 3P96A 4PC3A 1ZN7A 2B98A 4WQMA 3H4VA 2IS2A 3K2BA 4URZR 1BC5A 1LBTA 2IZ7A 3BERA 3OJOA 3FCYA 3ZD7A 2DWUA 3EASA 1P1FA 2A2ZA 1XE3A 1NVVR 5ITVA 2WVAA 4L9AA 4D97A 1A9TA 2VXYA 1FP6A 1THGA 4QEDA 3JVUA 1OX6A 4UEWA 1YZHA 4J0QA 5IW8A 1QF6A 1DRVA 2OHXA 3U3KA 1AF7A 1QB7A 1OCEA 1X7YA 2J6BA 4JSYA 3VU8A 3A58B 1X7ZB 3T1TA 1CUIA 3DKKA 4TRRA 2XUQA 3FKJA 4A3SA 5FCDA 3TRKA 1KDPA 1P7ZA 3CUTA 3NHZA 4CG3A 3N0RA 4ZT3A 4OHKA 3AUFA 1M54A 2QXUA 4BO4A 2H06A 3OOYA 1GFWA 4WERA 4F8JA 5L3RA 1VHQA 4LJYA 4N40A 3TKLA 3UFBA 3VM6A 1I9CA 2P78A 4NZZA 4CL2A 4IH9A 1QGOA 1ZX1A 5MGBA 1FFEA 2PT9A 3BMOB 3C6KA 5BW4A 1AU9A 2XMCA 3VV3A 1ZOOA 3C3PA 5JG7A 1EFVB 1Z6AA 1NAHA 3VSCA 3AL2A 3WFZA 3QMVA 4HGPA 2PHZA 3FBTA 3GLHE 4H1VA 4U2FA 1CBUA 1GUAA 4XYGA 1GGNA 3T0GA 4D8VA 1EDZA 4F04A 2C3YA 3C7AA 2FUEA 5I47A 3FCOA 2AEMA 3S70A 2HK7A 3ISVA 1V8OA 2DOKA 3IBCA 2WTMA 1E4EA 1M6WA 4RJJA 5CMLA 1CNEA 3UAYA 1HE5A 1IBCA 1R12A 1UZNA 2ZOSA 3F4KA 5FOSA 5EHZA 4RTMA 1Z33A 1OT5A 3JWPA 5T5QA 1J39A 1ULTA 3HABA 5KJEA 3JYHA 3IDAA 2QY9A 4BE7B 1QV7A 1TLLA 5FL7D 1C1XB 2PL3A 2W83A 4YJDA 2OBXA 3P4XA 4J0EA 3A6HA 1L8XA 3HKEB 3LWDA 3KPJA 1RYBA 3MWEA 3HCRA 3L01A 4WA7A 1ODTC 3T94A 5C4IA 3ENWA 1FE8A 2Y1WA 4WJKB 3DKIA 3PRKE 1XKLA 2N9UA 2Y2UA 4Q4LA 4I4TF 1GZ7A 4B2LA 2PGJA 4FMBB 4ZYWA 2B94A 1H2XA 1Z6YA 3EVTA 3IIJA 2Z2IA 3NM4A 3ZN2A 3F8TA 1RQXA 3VZBA 4Y2QA 5LQNA 1RQRA 2GILA 3PYXA 3IAEA 2WTBA 4RENA 5FYQA 4AUEA 1JVNA 4JQYA 5BVGA 4RTPA 2A5DA 1OYYA 3IP3A 3EWNA 4PCAA 2I4NA 2UYQA 4X97A 4FKMA 4MDEA 1W48A 1P33A 3CUVA 3I76A 1O58A 2XNJA 2YXEA 3KSZO 1E0SA 3QELB 5ALYA 5HQTA 2YXBA 1PL0A 1KI1A 1RYYA 5KEIA 1GNSA 2NZJA 4K9SA 5F7JA 2WFLA 4B6SA 2EW1A 1PX2A 3K8YA 4GI7A 4RBNA 4UUBA 2FSIA 1PL8A 4U4AA 1AUXA 4K3VA 4XYEA 4O4IA 4R81A 1RT9A 1SIUA 1M2HA 1M34E 5FBWB 4D8TA 3OCCA 4UU8A 1Y3HA 1NULA 1UZMA 1XZJA 4BGEA 3EQ9A 4NF2A 3VHQA 4DBZA 4LA4A 1ATZA 1XZGA 2H54A 2VPWA 1CP2A 3DCYA 3D3NA 3TLJA 3I8SA 2E2WA 3N6XA 4XIIA 1RYDA 4Q18A 4KNYA 3LY5A 1VJCA 1GQ2A 5LMZA 3HDQA 2EG9A 5JSFA 4Z8YA 4AIRA 2VYVD 2ZB7A 3H1EA 5TIIA 3UPDA 3GMDA 4CKCB 1VHLA 2W2QA 2A0WA 2QV7A 4OB8A 1S6YA 1DTWB 4MS4A 3TSCA 3WHIA 1SUWA 4POOA 2Q1YA 4E88A 3N53A 2IYEA 1TXGA 1LI7A 2A88A 4MRNA 5JH7A 1ISHA 4Z4EA 4OQ4A 2GA9A 1HLDA 1TMGE 1UJNA 1Z7GA 2FFRA 2LDBA 2Y1LA 2ZIXB 3G2KA 1J24A 1H3FA 2JF0A 2NSYA 1NBOA 1YC5A 3AG5A 3BQ9A 4PRZA 4AL4A 1Y8CA 4FC6A 1L7BA 3S29A 1JJVA 2DTDA 1CJKC 2XYVA 1O94C 3KQMA 3VNQA 4DM3A 5BURA 2W2MA 1U1FA 3SWWA 1P5FA 2H3HA 1RHKA 1TF2A 3K5HA 1WD7A 1DKMA 2DU8A 2AL7A 2FWAA 1T1SA 2KW5A 1FRFS 2C31A 4GPEA 1N36B 4BO6A 2W71A 2J0EA 1VDMA 2Q8QA 3PFHA 1A3CA 1L4NA 2I6QA 2HB6A 1SFRA 1UMDB 3H0KA 4JQOA 3VTZA 3U1TA 4WSOA 3K71B 5KO2A 3AHGA 4G4IA 1G5RA 4RACA 3VVCA 1RC1A 3IL2A 3PG5A 2B1IA 5AVZA 3TZHA 3RHFA 3TW8B 5KOYA 1B26A 2HDWA 1LRKA 1JIIA 4R1NA 1X1BA 5DW3A 5E6UB 3FPEA 1KL7A 1UEIA 1V2GA 2VA8A 3IKVA 3TQOA 1ZMTA 4CLRA 2PX5A 2QU8A 1RYNA 3H2HA 4MCHA 3ZJUA 3RO7A 4GT1A 3ABZA 4ND7A 4TVSA 5CCEA 2VJCA 2LKCA 4GNKA 1BHQ1 4JBIA 4P22A 3LC0A 2WA1A 4CTNA 3ESXA 3T5DA 4XM1A 2XKKA 2IU4A 4LS3A 2OQIA 2V1XA 1ADGA 5DASA 1IUPA 2P9GA 4MROA 2J33A 4B6RA 3AC0A 1TYEB 3LQRA 5FHQA 3A6ZA 3KP1A 3T61A 1K75A 2DBYA 2O2ZA 3ZWVA 4GX1A 1YTLA 4KQCA 2AF4C 3GGSA 4CWAA 4MQEA 2G1PA 2OQVA 1P44A 3U1VA 1E5LA 4XCXA 1JDZA 3W2FA 2KHZA 2DPMA 4YRNA 2HH9A 3FOCA 4PHCA 3RRFA 4EI7A 5FAKA 5KWJA 2V6FA 5FXMA 2EHJA 2BDUA 5F76A 1DADA 3NWBA 3T7IA 3A9RA 4H15A 1WVIA 3U4DA 2ZYVX 3HCDA 3I52A 3KPYA 3ONVA 3G68A 1DBIA 1E3SA 2V4UA 2XB8A 1CE8B 3ANLA 3ZDAA 1F4PA 1UXGA 5EKDA 2AKYA 4E7PA 1U5BB 3IQEA 4J0KA 1T2FA 1CUBA 2Z56A 4KRFA 3DHYA 4LHXA 3TM4A 3VC1A 2AN9A 2V7XA 3ONFA 3VR5H 4MULA 5EJ9A 5L3VA 5C1PA 3WLSA 5LD2C 2WG2A 1VCNA 1AZLA 1WMFA 1QHFA 2OP1A 3V8MA 1OAOC 4QAQA 4PSKA 2FZVA 2D5AA 1A5BB 2XEDA 4HH3C 5FEUA 2VP3A 3NBQA 3WY9A 2ZM6B 4FEGA 3FYTA 2IHZA 1Y1TA 2ZBQA 3I42A 2IEDA 3K9WA 2JGIA 3FNBA 3AFGA 3H1AA 4CM8A 3DLAA 4QBGB 2UYHA 1RJEA 3B82A 4NWIA 3WIOA 4DKJA 1YQXA 4BNGA 1Z75A 1OIWA 3QKUA 4JB2A 4OBEA 5DT9A 4ND8A 4F9GA 2AH5A 5ALIA 1XCMA 3EGDA 3WAKA 1JJBA 1NR1A 4TV9B 2WYOA 4FK8A 2Y77A 4DAEA 1QRDA 4NYMQ 1WF6A 5CK4A 1EM8A 4Q39A 3SS8A 3RVKA 4B4OA 5AVOA 2AJLI 1SELA 5IBRA 3D4BA 3I62A 3Q85A 4OAQA 2CLEB 5HKAA 3CISA 4PRKA 5H81A 3NV9A 3FETA 4X7BA 1GPBA 3SVZA 4ZYUA 2X4IA 1RIIA 5BW6B 2VSQA 4KE9A 4WNYA 4FZRA 1H2HA 2I8CA 1Z6PA 1OWNA 1WD5A 3ADDA 1FLAA 4TTSA 2R79A 1G3RA 1GGHA 3LT0A 1PDVA 4RZ2A 1EWKA 1KPIA 2CBXA 1XDUA 4EHFA 1YUMA 5JZ9A 2VHEA 3BTUA 1NPYA 4NPAA 1H5NA 4D41A 5IX8A 1OBHA 3TTWA 1ZD5A 2IBMA 2R68A 5G41A 1T8RA 3FUWA 1U0FA 3H0CA 4C88A 1KI6A 1TIPA 4WI1A 1CUWA 1SZDA 1YQTA 4GOND 4WZAA 4E32A 4WCVA 3T7RA 2C96A 2V3CC 2GHRA 3IJ5A 4CQLA 4IDOA 4DFDA 1UEJA 3LP5A 1J90A 4RK5A 4LHSA 3DGEC 4MRRA 3A8TA 1RQGA 2XDYA 4EW1A 2HWXA 4YRCA 4ZRDA 2GI4A 1NVTA 4PPYA 1E94E 2IH5A 4DMUB 4IR7A 1E3DA 1IH8A 1YMQA 2QL5A 3B6MA 3H7AA 4UNSA 5MF6A 2BE9A 3AOGA 3OEYA 3AVXA 1OLSB 4XD7A 3F6RA 3P0JA 4PLFA 4HAOA 1JSRA 1WDLA 1IK6A 2H1HA 4N5NA 2WJAA 2I2BA 3SJUA 1DP4A 1H94A 2N46A 1R8XA 1RC8A 1UEXC 4EYQA 1CQJA 4OQNA 2FPMA 4B6OA 1K2WA 1JLRA 1T9ZA 3BGDA 2ZGVA 1P2BA 3O4JA 1XG5A 4UKDA 5DI3B 4ZV4A 1RKBA 3QVOA 4BVAA 1EIWA 2JFHA 2X0NA 4LV8B 3DD5A 1NJ2A 4FX2A 3ZC3A 3N8IA 3QA3E 2VRBA 2VPXA 1L0BA 3IV9A 4KQXA 4BLVA 1WVMA 1GVHA 4IEEA 4JJ8A 2P3SA 2QRNA 4IGKA 4DLNA 1A1SA 1P4SA 1NXTA 2FFHA 5D85A 3VVBA 2ZRQA 5GOTA 4IL5A 4X63A 5HF5A 5SYAA 3EBOA 1Z4IA 2AC2A 2Q46A 4I9NA 4IZOA 4LX0A 3T4XA 1MX3A 3HKDA 2K5UA 2CBZA 2AXEA 3IVRA 2PCJA 2MSEB 3TL6A 3ZTWA 1R6UA 3GLHA 4DR5B 5JC8A 5CG2A 3CEHA 4PC6A 4S1VA 1H8HD 4MIOA 4RE5A 3I9FA 5BN4B 3UWPA 5AVTA 4QASA 2H4XA 4DSTA 4LC9A 1Z07A 5CLHA 2NVWA 4KR2A 5DFAA 1JJAA 3ZZUA 3HU5A 2W4MA 4HXFB 3WOHA 2AJCA 4EMUA 5CPFA 2Q1SA 4TUYB 3OKPA 2EJUA 5LZ2A 4BGVA 3FOBA 4H0NA 4XB2A 2G17A 2O05A 2VJPA 3GUHA 1M8GA 3QXSA 2I4LA 1ZKDA 1F48A 1W4LA 4GQIA 3F6EX 5J5VA 3CNLA 3K4HA 4FCVA 4X61A 2AVDA 1SB8A 5ENDA 4D6XA 3DC2A 1NMSA 1LSSA 3QKTA 1NZDA 4BVEA 1G5FA 4RDCA 1IHPA 3GLIA 5KOJA 2IIBA 1DRUA 3BL8A 3NEPX 1BO6A 1E7WA 4ZRMA 5GVRA 3WGVA 1IM2A 4PG8A 1KRXA 1WSDA 2QN1A 4LMRA 4EHKA 2XUJA 3P9KA 3CUUA 5I9IA 4XGQA 4YUXA 2Q3HA 1MT3A 3QOWA 2O2YA 3K8OE 5I6DA 4D9GA 4RYDA 2M9MA 4NATA 4F45A 5K3DA 1N5OX 1O94A 3F4BA 1ZKMA 4Q47A 1TCAA 1Q2XA 3QBVA 3ZCXA 5MFPA 5FO0A 4B3DA 1IXSB 5B5SA 3STWA 3TTUA 3G9XA 1CDOA 1EBFA 1NE2A 4KP7A 1ZG3A 5KNBA 1IPEA 4MSUA 1GR1A 1LBEA 2HPHA 2BDTA 1OUMA 4LF6B 2QA5A 3MTJA 3LFUA 1R4MA 3PFCA 2PM8A 4N01A 1S9HA 4U9UA 4KXQA 4V0OA 4B4DA 4RQUA 5KPJA 1GRNA 1E1RD 3BGIA 5DEIA 3DBHA 1SC9A 3RBXA 1SUCA 2JFBA 3TR6A 5AW3A 1DJMA 3HMKA 3WHLA 1M34A 4CI0B 1A77A 4JS0A 1Z2PX 4O2AA 5F9MA 1YBVA 3H3JA 4Q82A 2OZLB 1SHTX 3OCVA 3LT5A 4I1UA 4H3KB 821PA 5IYZF 2BGKA 3A3NA 3PSHA 5EJ4A 4LF8B 1KYVA 1U1EA 2V45A 1KMNA 2O1EA 2VWQA 4GKVA 4JUDX 1MRSA 4MRAA 3ZDRA 4AY3A 1ZWKA 3K8ZA 4UBJA 2NQ8A 3ZKWB 5IT9A 2BF7A 5T67A 1XK7A 1LLUA 4IIVA 3CG4A 4KPUB 4BNNA 3MJTA 1WQ3A 4C05A 3BJMA 4M37A 1NMYA 1C8LA 3O1LA 4DNXA 1M8JA 1N0UA 1KGSA 2HCBA 2PEYA 3IO3A 4RIGA 3D2CA 2HHAA 3PC8C 4AO8A 3IJPA 1T1IA 3RODA 3I64A 1BX1A 1LD3A 1PKEA 1ZGHA 2P27A 3DBRA 1F6BA 1JJ7A 4ICIA 5TRTA 4AZ0B 4LF4B 4TVBA 1KEWA 3Q41A 1J6UA 2H5EA 3B3GA 4O5OA 2Y1DA 3RV3A 1NVKA 3LO8A 5T57A 5B7QA 2WIJA 1XMJA 4KR7A 1ZA2A 4Z7OB 1D1TA 1V7QA 2JI8A 3CEPB 4GP7A 4YJ3B 1YL6A 3Q0TA 1SM4A 3PE3A 2QSYA 1I7PA 1OXSC 4P82A 4D74A 1TUEA 1Z62A 2RH9B 3N3AC 2QAGB 1VFPA 2WC1A 3LPMA 4GXNA 4UQPA 4PC1A 1P18A 3O1IC 5DHQA 2PYIA 4KQWA 3AGQA 4YP6A 1GV1A 1CJSA 1GNRA 3DG9A 2DFVA 1ZP6A 2RJOA 1N5KA 1H4TA 2DSNA 2MYNA 1FOEB 1G3MA 2OE2A 1LTHR 1OAOA 2Q6LA 2VZ0A 1F6WA 3OTIA 1L7RA 4FPXA 4N7RA 4GXQA 1YR1A 4HNVA 2O06A 1F06A 4NLLA 1Z5ZA 3U4GA 2ET6A 4KQGA 5LLDA 3LO5A 3QX9A 4ZAYA 3GJ0A 1FYXA 5C3UA 3I0MA 3P9YA 4MV6A 4BGUA 1B0ZA 4R8RA 5K4HA 4CT5A 3C8HA 3V3KA 2ID9A 3W1WA 3KAJA 2VEDA 2Y9PB 2DBRA 1A8HA 2Y27A 1AGRA 1CD5A 1QHEA 2CLCX 3HFJA 4JFRA 4YONB 3RNLA 3GUUA 1Z18A 4NY1A 3JQCA 1OV4A 5DW0A 3VKUA 4AK9A 4XI9A 1U81A 2EFYA 4K2AA 1WW3A 1M2VB 3HC7A 3AV0B 1C9EA 1CJVC 2C7QA 1H9CA 1WO8A 4INPA 4Y2SA 4EM6A 4EB0A 2YWBA 1S9DA 1UMCA 3AIMA 3O2QB 1AS3A 4M76B 4HVCA 4GUAA 1RIFA 2EJCA 3T5MA 2HSWA 3E7WA 4PGGA 1O6ZA 2XUAA 4QEKA 2GKSA 2RONA 3FG9A 3V8NA 1YXMA 3VJLA 1F2TB 4BPRA 4O0MA 2ZROA 3ACBA 4IXNA 2K4MA 3UT0A 2ZRNA 5H1YA 4Z1MA 4F5WA 4IX1A 4RVGA 3JQGB 3VAAA 4AO6A 2Q9AA 2VQSA 4NZMA 5ITZA 2VSNA 4GH5A 4LEIA 2JFGA 2JGLA 1V9SA 3WQQA 3W6NA 2QI9C 2V7EA 3PEVA 3ZHXA 3GFQA 1TM7E 3QJGA 2B8JA 1KERA 4EAAA 1TCVA 2FUG1 4P3KA 1JXQA 3IQGX 5JI2E 1MGPA 4EUNA 1Z0AA 1XXLA 1ZL2A 1HG0A 3LKBA 2OBMA 4LE0A 1Z4LA 2ZUDA 4MPPA 2WU3A 1E1NA 1QGDA 1ZVKA 2V8OA 3BA1A 3G82C 3HB1A 3HRKA 4HO1X 4Y2RA 5DLYA 5TQ0A 4UNRA 2PUGA 1CQIB 1SZCA 1Z3CA 3KTOA 4PSCA 2FPUA 3TE7A 4BVKA 5T7BA 3GEPA 2J9RA 5JQWA 3NKFA 4G5GA 3CS3A 3PNYA 4JNCA 2ESRA 3GFSA 5T4BA 2Q6OA 1BD4A 4F4IA 5BVHB 3E6AA 1BH6A 1VTKA 2DG2A 4HRAA 4XOIA 3TIXB 4NOMA 5ICMA 5M34A 1NF2A 1SXPA 3GZNA 4UHDA 1T9HA 3H9QA 4YFVA 2FXIA 1JSLA 4EW3A 3IVAA 4Z4CA 2QW8A 4US1R 1U4NA 5GINE 3CLUD 3UQZA 4C76A 1J0BA 3NDRA 5DX1A 3PHLA 3M1AA 1SO8A 1Q3TA 2REQB 5FJIA 3T6KA 3TMKA 4AMYA 3CRRA 2UUAB 3G1UA 3AR6A 3WLJA 3TVYA 4FEYA 1O5IA 2OMEA 3KJFA 3QEOA 2YC2C 3TJMA 3Q6NA 3LBAA 3ZBPA 3SE0A 2V0GA 4GVXA 4LSMA 1NDUA 5HE9A 3BJIC 3H97A 1GYQA 3H5OA 3PHIA 4W1PA 3VR4H 2E6KA 5BWMA 1BMFD 5KSYA 1P73A 1KJZA 1MB2A 4HVLA 3GL9A 3BIJA 2V96A 4OKSA 3IVXA 4AIIA 3P94A 1B6RA 2W2KA 5BMOA 1XHLA 4Y6QA 1GVNB 1NUQA 4P92A 5JD3A 2NU8A 3U80A 4H3HB 1QO0A 4JI8B 1ZJ5A 3DPUA 5LU9A 4TLEA 2Q50A 3HEBA 3PRJA 3R7AA 1A2OA 4TOIA 4YYEA 3VKHA 1QP4A 4LV5B 5D5HA 3OTQA 4MTLA 4GLFA 4NYJR 3ZDZB 3GJ3A 2WDPA 3BRSA 4DLKA 1D0IA 2VF8A 5DHAA 3TRHA 1D4FA 2J6CA 3AEKA 1UFQA 1Y7PA 3FXAA 3KV1A 3NDIA 4X66B 3PTZA 2WUWE 4JXXA 2BSQA 2VHJA 3FI9A 2NUTA 3NBMA 3D9QX 2CJFA 4DQLA 3TVDA 5FP0A 2OHIA 1MB0A 4MWCA 5E9AA 5LA6A 1HTBA 3OMWA 4IO0A 4QRIA 5CB6A 4P6VF 4XE5A 2FMKA 3WKAA 1YKSA 2J5RA 3LQYA 5K01A 3FVVA 1XXHE 5LR6A 4JENA 4KJZA 5I7RA 4MO9A 4UAVA 1UFVA 2AKAB 3RT7A 1CERA 3DE5X 4U63A 2L19A 3EA4A </