5A0FA

Crystal structure of yersinia afp18-modified rhoa
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
178
structure length
178
Chain Sequence
AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tyrosine glycosylation of Rho by Yersinia toxin impairs blastomere cell behaviour in zebrafish embryos.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords TRANSFORMING PROTEIN RHOA
total genus 63
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5a0fA00
2X2FA 2QSYA 2NO0A 3AVOA 1OB2A 1IY2A 2EYUA 4JLJA 1F6BA 2QPAA 721PA 2WWGA 1EFTA 4JS0A 2ZYTX 5K8TA 2ZJZA 3KDSE 5CK5A 2EFDB 5J4HA 4CIDA 5FL7D 3DMNA 1F2TB 2QMOA 4IKEA 4Q4HB 4A82A 2F3TA 1ZM3A 1XD2A 4Q4JA 1GL9B 3U5ZB 3K8YA 4QL3A 3PVSA 2HDNB 1D9XA 1G5PA 1VECA 2IF2A 4GP7A 2G88A 4JL6A 2EFGA 3W5IA 2V55B 4Q21A 1DELA 1Q1ZA 3GJ3A 2DR3A 4P4TA 4PANA 8OHMA 3CWZA 4HAYA 3LAWA 1W0JD 3I8XA 1EFRD 4Q1DA 5KDLA 4P31A 4XJXA 3AF2A 3DOFA 4DCVA 1DAIA 1AZTA 4EKDA 3MCAA 4TYWA 3GJ0A 3EX7C 1M1YE 1P7CA 1KSHA 3OIYA 1LV7A 2GZHA 2OCAA 5CK4A 2BIFA 1H8HD 2OFWA 2O8CB 4M0LA 1CULC 2C78A 3CW2A 3CM0A 3FYHA 4US1R 4MRVA 3C14C 1MRSA 3WMEA 4B76A 2NO7A 4FMBB 1NIPA 1HTWA 4DDUA 3U6KA 1SZPA 5P21A 4TLEA 4QM7A 3E1SA 3B9PA 3AM1A 2H17A 4AURA 1E2PA 1Y63A 4ZCLA 2LCFA 4XWOA 4AKGA 4OK5A 3SBDA 4XTRA 1H8EA 3N2EA 2FU5C 2W6JA 4LPKA 1TL7C 2JJ1A 2ZREA 3DZ8A 4WOPA 521PA 3SHFA 2YKGA 3FOZA 1R0WA 1US8B 1AA9A 1ZINA 3FHCB 3NHAA 3TRFA 1JR3E 3KQNA 1H65A 1Z29A 1R7RA 4M1KA 1IOZA 1G21E 2GJSA 1MRNA 2F1RA 3CRMA 3KL4A 3WYGA 2C9YA 2V8OA 1GL6A 3FFAA 4BFWA 3A1TA 4DIDA 3GEEA 2ZROA 2NIPA 2MSCB 3CH5A 5KHOC 2PMDA 4DCUA 5BW8A 3ZZTA 1WA5A 1BS1A 2FZ4A 3T34A 2IS6A 2IYYA 5FTNA 4IHQA 2CLCX 3X1ZA 3BOSA 2X2EA 2BC9A 4MKIA 4MUBA 1W36B 4A2WA 1GRNA 2AKYA 2GHIA 2GBLC 2QE7D 3SDZA 1Z8FA 2ZSDA 5D3MA 2QN6A 4FINA 4LYHA 5ANRB 4DSUA 4CEIA 2ZSAA 4BWYA 1N6IA 2EW1A 2D4HA 3LNCA 3KUCA 3ZVNA 1NL3A 1W44A 4B44A 2ODBA 2XB2A 4M21A 4JMPA 2V1UA 1WBDA 2ZR0A 1DVRA 4UNPA 1B0UA 4B34A 1AS0A 1CJTC 3GFPA 2N1BA 2WJYA 1QHSA 1XD9A 2J5XA 3BGWA 3NIBA 4HLDA 1EFUA 4PC6A 3A36A 1RC8A 4Q01A 1P2TA 4A9AA 3RRMA 1YZNA 1LVGA 5BN5A 4BGDA 1DEKA 4RD3A 1L8QA 4KYIB 4ZO4A 4NYIQ 4NU0A 1YZKA 1SVSA 3AH8A 3AKYA 2ZAOA 1K8RA 2WOOA 1E2JA 3D3QA 4GMXA 4ZI3A 3FKSA 2C9CA 2V6IA 4C0QC 2WWHA 1SVLA 3MJHA 2J87A 2QAJA 4HZUB 2HXSA 4FCVA 3W3ZB 2JATA 4CEHB 1JPJA 1M7HA 3ZIAA 2VSXA 3K70B 1FTSA 1JB1A 1GP2A 1DAEA 2C95A 2V9PA 1VYUA 2RMKA 3LRPA 3BAFA 4MGYR 4K8OA 3AP1A 4DDTA 1D8TA 2D2EA 3TH5A 4C30A 1JR3A 3I73A 3IQXA 3QIAA 4LJ5A 3H84A 3B5JA 5FOVA 1NSFA 4PX9A 3IO3A 3OEHD 5GJWC 4L9WA 1R6BX 4NBSA 5J40A 1YZGA 4OK6A 2JIZD 1S9DA 1WE2A 4KJZA 4TLDA 5GJCA 1EFRA 2H18A 4TMKA 1CXZA 1UBFA 4OI2A 2O5VA 1I4DD 4MQBA 1OFTA 1Z0DA 4D2IA 1H8HA 1FUUA 1OYWA 4WAUA 4JLOA 2Z83A 2XXAA 2VP9A 3Q7PA 2WJJA 1DPFA 1I4TD 3TK1A 1M74A 4US2R 4HYYA 3EW9A 1UKZA 4KITB 2BEJA 1W4CA 4L8GA 1CR2A 5FL7A 3DHWC 2ZE8A 3T5DA 4M1TA 1N5KA 1QG2A 1UFQA 4LCBA 2H7VA 5HPYB 1X1SA 4PZLA 1JALA 3U3KA 1FNNA 3IPXA 3JZMA 1PVOA 3CRW1 4ARZB 2BOVA 2ZR9A 4HB2A 3KXLA 4YMUA 3LX8A 2FGJA 2GAAA 5FUYA 4OHZA 4JSTA 621PA 1S96A 4KHZA 4YDSA 4RFSB 2R2AA 2ERYA 1XEXA 3QVUA 1E2MA 4B48A 1AJEA 2OESA 2C5LA 1JBKA 4MKFA 2D2FA 1KZ7B 2H1LA 4HLUC 4PAMA 4V03A 3M1IA 5F9HA 4Z51A 3G0HA 3QQ5A 4A6XA 2WZQA 5LB2A 3GLIA 2OAP1 1Z6YA 2ATXA 3QPWA 2ZE5A 2YYZA 3MWKA 1GAJA 4TYQA 1E0AA 3U4QA 2W2XA 4QRHA 1KSJA 1E9EA 5FI1B 4BLPA 4NL4H 1ZAKA 2IYQA 3M6AA 1OFHA 1HH4A 5HR5A 1CR1A 3BH0A 2PX3A 3QENA 1KI2A 1G3QA 3O8BA 1KMQA 3T61A 1W36C 3SQXA 3FPAA 3C16C 2EFCB 4URWR 4DVGA 2RCNA 1Q1QA 2OEPA 4OBEA 3LQRA 1YZTA 1CJUC 1DOAA 1E6CA 1QHNA 4AWXA 4FWIB 1E1RD 1TQ4A 4PQYA 4A0RA 1G3IA 2F9LA 5CJ2A 3EIEA 1GZSA 5E4FA 3GMTA 3SJBA 5JFGA 1NLYA 2K5UA 3X1DA 3NG1A 3EA5A 2G6BA 3T5GA 4O2LA 3KKOA 1J2JA 2P5SA 2FG5A 3VX4A 2DCUA 2PZGA 2REOA 5JHGB 3DKPA 1M8PA 4CW7A 2OCYC 4K81B 2ZRKA 3FMPB 1QBKC 1CEEA 3WYAA 4DEYA 2PJRA 3HU1A 4D25A 4TZ6A 3U60B 2FA9A 5FPHA 4UJ3A 5L3VA 3K9GA 1KO8A 2IXFA 4HATA 3EARA 4FN5A 2QGNA 3RC8A 3TVDA 4MYCA 1EX7A 3PUWA 5M04A 1EFHA 5DN6D 2QBYB 3DM5A 4A1FA 1ZMXA 2ODWA 4M1OA 5LDDC 2ZRLA 5FOTA 3EASA 4Q03A 1G8HA 1L2TA 4D0LB 4MRSA 5JCPA 2BM0A 4CDGA 1T5IA 4IDQA 4R98A 4JLKA 2A30A 4B3GA 4EDHA 2VF8A 3K0CC 1GDDA 2DY1A 3CRVA 4EAQA 4DZZA 3U6BA 1R0XA 2ZETA 4PR0A 4IRUB 4Q1EA 5FR1A 3QKSB 4TSFD 5KSOA 1ZD9A 2KSQA 3IBGA 1KNQA 1VCNA 5D3QA 4AIIA 1OPXA 4BQSA 3P27A 1RRPA 2R65A 1ZW6A 3IUYA 4JIMA 4U02A 4I99A 1IAQA 5HE8A 2VHQA 4R7ZA 1EWRA 4B6EA 3BE4A 3BORA 1TQ2A 5EJEA 2QBYA 1TMKA 1M6NA 1KO7A 2YC4C 3SNHA 1FMLA 4TSFA 4IFEA 1S9HA 5CM8B 4IXNA 4EFLA 1ZRHA 1KTVA 4B3DA 2CVHA 2OBMA 1E2FA 2XZLA 2VHTA 5TMPA 2F6RA 2EQBA 1TF2A 1YRBA 5J4YA 2O8EB 3BFKA 4C7OB 2W83A 1Z5ZA 2PEZA 3AF3A 2W2TA 3LLUA 3W34A 3ZH9B 5TV2A 2QQ0A 2ZJ2A 1RRCA 3VTKA 3WP0A 1NY6A 4XOIA 2J0QA 4F4JA 1NI3A 1KJYA 1TUEA 1G7SA 1SXJD 5H68A 3W9YA 4DWJA 1RW4A 3Q5EA 3MGCA 1Z2AA 3L0PA 1JJVA 3A4NA 1SULA 1KNXA 2GJ9A 4B71A 3B1YA 3DL0A 3VHXA 4OI4A 2BMEA 3VAAA 2A5DA 4N0EA 5BWMA 3AVUA 1GIAA 1YR7A 1XRJA 3CB4A 1L4UA 2VP4A 4GT1A 4PPFA 1CLUA 1VIAA 4B3BA 4EPTA 4ZDJA 1G8PA 1VCOA 2QMHA 2V7QD 1JAHA 4LY6A 3I32A 4GPTA 3T35A 1ZCBA 4PZZA 2ZAMA 1HT2E 2YWGA 1P9RA 4Q1FA 4QBIA 1N6RA 2KJQA 3PEWA 4BPBA 3QKRB 3LX5A 1CBUA 1CF4A 1FFHA 2C2HA 3IO5A 1R5BA 4C0SA 4OHVA 2IYZA 2OHFA 3JVVA 3N2IA 1VKJA 5DHFA 3CNNA 1IN4A 2MMCA 2WICA 3SFZA 2ZRHA 3KKPA 4M1WA 4TQ9A 3GLFA 2GKSA 2PZFA 4QJ3A 5J5CA 5KPJA 1CP2A 4Q7JB 1E2IA 5E7MA 3EC2A 1U98A 1E2KA 4CGZA 3B82A 1GILA 2R6DA 4P4UA 4DUGD 4D26A 4JVNA 1Z28A 1NMZA 2DYKA 1P9NA 3NVAA 1NF3A 4GFDA 4KU4A 1OXTA 1IM2A 1DBSA 1E94E 1FP7A 4FD2A 2AK3A 1Z0KA 2GETA 2PCJA 1B23P 4FCWA 4BFYA 3OIUA 2ZTSA 1P61B 4IVPA 4POAA 1XEWY 2HF9A 2NOAA 2NTYC 2LWIA 3K09C 4JLNA 4JBYA 1P9WA 3FWYA 3OF5A 2IUUA 1F2TA 1E9SA 4URXR 4LOAA 5CDFA 1EXMA 4OQFA 3EIHA 2X19A 4ZDWA 2ZI6A 3U7GA 2OG2A 1IHUA 4KFUA 2NPFA 2IHYA 3LBHA 2BMJA 1Z0FA 4FIDA 5GJBA 4TZ0A 1IN7A 3A58B 4JLBA 5IF9A 2GZDA 1E4VA 4TL7A 1VPLA 4AG6A 3BBPA 4V0LA 4ZDIA 2WSSD 3K0AA 4GZMA 4BRWA 4DJTA 2RGCA 1FZQA 1KI7A 2J59A 2ZJBA 3P20A 5LB4A 4R71A 2H5EA 2OXRA 4NCIA 4DLSA 3ZD7A 5F9FA 1ZYUA 3RVBA 3R7WA 5LD2C 1FW6A 1T5LA 4N1AA 1PLJA 1XD2B 4Q4JB 1T3SA 5UKDA 2RHDA 4D6PA 3I3SR 3A1WA 2B8TA 2YOGA 2JJ2A 1I2MA 4FXPA 2BCGY 4MA4A 5K8UA 4V0NA 1SXJA 1OT3A 2VP5A 4JBXA 4KLNA 5A0FA 4XVQA 1WDTA 2CE7A 5E7IA 4JLPA 1Z6TA 4OHXA 4LJ6A 3QF4B 1HE1C 4ESVA 1T9HA 4JT2A 1NP6A 4WBSA 2ZANA 2PMKA 2O0HA 2I1QA 5JBQA 2WIAA 2ZRJA 3BB3A 3ZS9A 3K9LA 2AHOA 4PHGA 4B3FX 5GADl 2GJAA 5EP1A 2YINC 1ZU5A 4DDWA 5L3SA 2BDTA 2R9VA 4LX0A 2WPDD 2Q3FA 1NBMD 5FI0B 3W8RA 4MH0R 3ONWA 1R0YA 3D6TB 4TN1A 4B32A 4DB2A 4URUR 2QAGA 5J47A 2AXNA 3VNVA 1SKYE 1G8YA 2HT6A 4CEJA 4UQOA 1OLOA 3OFND 1XTJA 1E9CA 4PAQA 4PO8A 1NN5A 4QBFA 3UG7A 1MABA 4HB3A 4CYMA 1SGWA 1MO6A 1Q22A 1Q1EA 2AD5A 4JVLA 2OILA 1E9FA 2QMEA 1KI6B 1D2MA 1X8LA 3WRYC 3DM9B 2XITA 1XPOA 1U99A 3D31A 4RD2A 2A5YB 3ECCA 4W7SA 4TLBA 4HDOB 5TVKA 3AF4A 4TYPA 1W4AA 5B58C 1P3JA 4PO1A 1OYYA 4RVCA 1N0WA 2OE2A 1HQCA 2O8DB 1G16A 3AB3A 4H9GA 2XXAB 4TMXA 3AP3A 5KYKA 2O8FA 2VHCA 1GTVA 2D7CA 3MSXA 4TMTA 1VG0B 5FPTA 2H16A 4BFUA 1XXHA 3RS2A 3SOPA 4GRAA 3AUYA 4O3MA 1Q21A 1RIFA 2WM9B 5JRJA 2F9MA 4ZKEA 1UKYA 3KJIA 4YXWA 1TPZA 1SVKA 4I1SA 3UANA 2GRJA 2QTHA 3R20A 2Z0MA 1OIXA 3CUEF 2PCLA 4I81A 1E2NA 4DHEA 4OQNA 4E22A 4CT5A 3V4RA 4JLAA 5IT5A 2BEKA 3HYRA 2XOKD 2J1LA 5DI3B 4Q1AA 3BC1A 4ON9A 3K09A 2OAQ1 4D0NA 5L3QB 1AZSC 5FUWA 5FUVA 4DXAA 1W5TA 2P0EA 3RSOA 1A1VA 2IX3A 3LD9A 3U3RA 2Q3MA 4Q9LA 1XBTA 2AL7A 2N42A 4FW9A 2IK8A 2XX3A 2CHQA 1GSIA 2A3RA 1KJWA 4TTQA 3AKEA 1GKYA 2D62A 2FOLA 2GZAA 2QTFA 421PA 3CF6R 1JJ7A 2J0UB 4XD7A 3FKQA 1XEFA 4B2PA 4F7WA 4HLUA 4NYIR 4C4PA 4M1YA 1IXZA 2ZRBA 4Q48A 3C4JA 1CJKC 2PLFA 1ESMA 1N0UA 3PEVA 1C9KA 1RE0A 2JLVA 4N3NA 1ZM4A 2ZSEA 3VKWA 4D4JA 4E03A 4M22A 1W0KA 4MGIR 3MWYW 4ZV4A 1XTQA 3LXXA 2XTZA 4LYAA 221PA 1X86B 1N6PA 1P5ZB 2ZRMA 1NVVQ 2WHXA 4QHTA 1U81A 4W5JA 4QGGA 2FE4A 2CVFA 3AF1A 1G8FA 1QHIA 2E1RA 3C7KA 3L2OB 5DIFA 3UWKA 3X1XA 2CMKA 4H1UA 1RZ3A 5CJPA 3TUZC 2ZYUX 3O8RA 1L7VC 5FPSA 1QHHB 4D4LA 2YHSA 2VEDA 2XNDD 2ZJ5A 3ZVLA 1E2LA 1P75A 3B60A 2GXAA 3C41J 1E96A 2JASA 3ASYA 1GG2A 1JQJC 3BRWD 3B85A 1AN0A 4F93B 1XP8A 4KXFB 4QBGB 3ASZA 1CJMA 5HZHA 5EZ6B 4F4CA 4C2TA 1XZQA 4A8JC 1E2DA 3EWAA 1NY5A 1TAGA 1S4QA 4ZPXA 3VR1A 3O8DA 4PC2A 2IF0A 5AJWA 4LHYA 3BERA 1KY2A 3ETLA 3U3MA 1OJLA 3V00A 3LWNA 2RGEA 2BKUA 4XTCS 5GJVC 1VTKA 1ZP6A 3HYTA 3RRZA 2RGBA 1E79A 1DO2A 4PC7A 3R8FA 1DAKA 1G41A 1KHTA 4CEIB 3SZRA 2G83A 3NBZC 1OF1A 2YWEA 1ZD1A 1EFCA 3NHBA 2JLUA 1CRQA 1W2GA 1KMHA 1VYVA 1ZM7A 3W6PA 1NVXQ 5F2EA 3OZXA 3U7HB 1PUIA 3MRSA 2QRNA 2IYSA 4YLGA 2HJGA 2CJWB 5FTKA 3O8CA 1UDXA 4DCTA 2AK2A 1E1QD 2WV9A 2BMDA 2CJWA 2NO6A 1F2UB 1Q12A 3BB4A 2CEAA 3H1TA 4LV8B 4NP6A 1WXQA 2Y8EA 3NXSA 4JL5A 1E79D 1S2MA 1KMHB 4QOSA 2O8DA 3ZIAD 3QVVA 5E7JA 5JHHB 1YZUA 3DPUA 3QPUA 1A7JA 1NKSA 2QSZA 3IEVA 1A82A 5JJKA 1R8SA 3RYTC 2C96A 4FMCB 4OQMA 1SKQA 1QHHA 3VR4A 3RS4A 4XWAA 2HCBA 2YV5A 4DT1B 4Q7LA 1RYFA 1I2DA 2WWXA 3GLHE 4YONB 2QP9X 2WPDA 1U8ZA 2W6JD 1Z2CA 2QROA 2W2VA 3I61A 5TDHA 2B92A 1X3SA 4EPYA 4J0QA 4Q5IA 1VG9B 2Z43A 3CIOA 3LV8A 3B1VA 2ZS8A 4E09A 4ASUD 1HV8A 4UXJA 2O8BB 3QPVA 4AKHA 1ZM2A 4B75A 3VMFA 5KDDA 4EFMA 3SI7A 3TUIC 1QVRA 1X1RA 2YNMA 3L0OA 4WZBE 3RSLA 3TGPA 2ZJYA 4NMMA 2FPKA 1VMAA 4HAVA 5DLQC 3S1AA 4URVR 5JS8A 2XAUA 2B21A 3LXRA 2IS2A 1OB5A 1G19A 4L5BA 3TSWA 1XPRA 2KI5A 4DLTA 1LY1A 1LB1B 2H92A 1N0VC 3AVWA 4NPHA 1Z6GA 1ZNYA 1Z06A 4QNRA 4AG5A 4D81A 4RY2A 4NE2A 1OH6A 5CIQA 2P5TB 2QE7A 3SR0A 3EPHA 2HV8A 1BH2A 4QGHA 2W00A 2BKEA 1WBBA 2ZEJA 1E0SA 3QXHA 3RS5A 3RHFA 1U0LA 2ANBA 3GD7A 5DYIA 1BMFA 2XB4A 2GAOA 5FTLA 2DBYA 1P6XA 3L82B 2G77B 2R6FA 2JLQA 4UKDA 1Z3IX 2LKDA 3A4MA 2QNRA 2WWFA 5HTKA 5A5GA 3CZPA 4C9BA 1GKIA 2CHGA 1ZCAA 3EZ2A 3IKJA 2WVJA 1JR6A 2ZM5A 5LPNA 1QHYA 1JECA 3I5XA 4YMSA 3U3OA 1GM5A 2OBNA 3GJ8A 5KNCA 3VU9B 1M2OB 2XGJA 1VYTA 2V1XA 3PV0A 4UNRA 5J4LA 2AWNA 4NCKA 4OK3A 4C0KA 2Q3HA 3CX6A 2IEZA 1BIFA 4GDFA 1KAGA 3RRYA 4TMZA 5JI2E 2ZIAA 3GLFE 4RZXA 2GJ8A 1II0A 4OL0A 1P2UA 2I4IA 4Q7MB 2R6AA 1IY1A 5EP3A 1E2HA 2G0NA 2J7PA 4RZ3A 3ICEA 3SBEA 5EE1A 2JDIA 1KKMA 4MDEA 2A5FA 3U7FB 2JEOA 3AVYA 4BLTA 1KIMA 3PCRB 5C4GB 3QXXA 2J0VA 3GLHA 1NVUQ 2C9OA 4JZKA 3QJYA 1NN1A 4P33A 1SHKA 4HI0E 1XXHB 2P65A 3B1WA 6Q21A 2JAQA 4JKIA 2CK3A 3SE0A 1Z07A 1LS1A 4U7DA 2O8FB 3WRXC 4NDZA 1FNMA 4URYR 1O87A 3KJGA 2V4ZA 3CRRA 1E2EA 2I1VB 3T1VA 1AKEA 3TIFA 2GF0A 3GLFB 1NBME 1OHHD 2P3SA 1CJVC 1KI9A 2ZRNA 3QNUA 3A6PC 2F1IA 3FDIA 3KQLA 1UM8A 3ADBA 1Z0AA 2KB0A 3RS7A 1F2UA 3QKRA 1KI4A 3F8TA 2VL7A 1J90A 3EPJA 3ZVMA 2FSHA 4L15A 2REBA 3TJZA 4MYHA 2B7CA 2FGKA 1NBMA 1U0HC 4KYUA 4B3CA 4HB0A 4XVRA 3AF0A 4V0OA 1WP9A 2O8EA 3TAHA 3BFXA 2P6UA 1ZNWA 2GVDC 4JSYA 4U00A 2G9NA 3CO5A 3T12A 1RKBA 1YZLA 2P2LA 2ZS7A 4WZAE 4EJSA 3PEYA 3R7WB 3W6NA 4FMDB 3GFOA 1IXRC 3LA6A 1NLFA 2D06A 1JR3D 1JEEA 1W2HA 2QAGC 2A7QA 1S3GA 4PSVA 3FGNA 2BV3A 1IJFA 1CIPA 5DHAA 5ELXA 2NQ2C 2P6RA 3U61B 2WMOB 5BQ5A 2GILA 3EIQA 4HLQB 1G3UA 5EP4A 1ZNXA 1UJ2A 3U44B 4TTRA 4NYMR 4C0JA 4AKIA 4HDQB 3R8CA 5JCZA 3C5CA 3HP1A 1N6KA 1GKUB 3BD9A 4M53A 2PT5A 2ZE6A 1NSTA 1JQLB 2ZPTX 3L43A 2EWVA 5CLLA 5AJVB 4HZUA 3WBJA 1YKSA 2G1JA 2IYTA 1UEIA 2CK3D 4WW0A 1T8TA 3NBFA 2RAPA 3K53A 4LHZA 2XNDA 4UNNA 3UATA 1UDWA 1Z47A 5EUQB 3ZZ0A 3ZLJA 3SJAA 1TNDA 4M9ZA 4KI0A 3DO6A 2C8VA 1XX6A 1NMYA 2VHJA 3ZGXA 2EFEB 3QKSA 2J7PD 1WF3A 1AS3A 1ZIOA 4DLWA 1XB2A 1RRFA 3ZQ6A 2RGNA 3TQFA 2ZE7A 3MJRA 1BO6A 1V43A 2PLRA 3KKNA 3FHOA 2CNWD 2P67A 2PJZA 1XU4A 3NC1C 3OIVA 3Q9LA 5FPYA 1JI0A 1XCGB 1OH7A 2ASEA 2OSBA 1OW3B 1A2KC 2GEDA 3KXIA 4FI3C 5EZ5A 1G3RA 5A4JA 3I4LA 2DFNA 4LC1A 4LBZA 4DUGA 2BBTA 1G64A 3UWOA 4LJ8A 4GNKA 1ZD8A 4PPQA 3TW8B 3QKTA 1IY0A 1E9AA 1XMJA 2FJUA 2RGDA 4LI0A 3UMFA 1UBGA 3KKQA 4DB4A 1E2GA 1RFLA 4Q9KA 4R2HA 2ZRFA 1MO3A 4JLVA 2WSMA 1NJFA 4QM6A 3V4FA 1D9ZA 1XWIA 5F3WB 3NEJA 3UK6A 3KJEA 1U94A 4Q66C 4HUTA 5FTJA 1YJ5A 1O3YA 2CL0X 2A2ZA 5DISB 4ITRC 2ANCA 3MUFA 4MKGA 4BFXA 4TQAA 4YDHB 4HAUA 1KK3A 1P60A 3ZJYA 4ZIRA 2HYDA 1MH1A 1PUJA 2WBLC 3BWDD 3HWSA 2JLYA 1XMVA 4M1MA 4KFSA 1SVWA 2FFHA 2QMUA 2C04A 4ZIRB 2ZRGA 4PTLA 3A8TA 1N5IA 3QBVA 1X8JA 5JZVA 5AJZA 4Z1MA 2PX0A 3TMKA 2ZRAA 5C18A 2KE5A 4TWZA 3WYFA 3THWA 1H8ED 3THOA 2J9RA 1DG1G 4DRZA 5KTYA 1UKEA 1PZNA 2CNWA 2ZRIA 2QENA 2VBCA 4LHVA 4C0AC 5KU1A 4A36A 1IN5A 2IYRA 2OV2A 4FCTA 1W4RA 4C0HA 4ABYA 5IRCD 5HKKD 4RCYA 5JEDA 4QC2A 3GPLA 1Q3TA 4BE7B 3GLHB 2ZU0C 4QBHA 1OH5A 3NH6A 3KX2A 5FOXA 3M4YA 2L0XA 4MGKR 1T91A 1Q57A 4BLQA 3B9QA 1P4SA 1R0ZA 1UF9A 4HEJA 4A8JA 2ZI9A 4JLMA 1Z63A 2BBSA 2VSOA 3G82C 1F48A 2XZPA 4Z1MD 3CWQA 4KV9A 3I5YA 4L9SA 1SXJC 1ESNA 4RFVA 3W8NA 1KDPA 1XEXB 4B47A 3WMGA 5TB5A 1MR3F 2ZSFA 4LWZA 1KK2A 2J46A 2RGXA 1A5TA 4RKFA 3SEAA 2GXUA 1OFUX 3PENA 4M4SA 1M7GA 3AVVA 1BKDR 1DO0A 1FX0B 3P4XA 4Q02A 4TT3A 5JJLA 3Q7QA 3WXMA 1OXXK 4OHYA 1HA3A 4LZZA 1ODFA 5BXQC 2IA5A 2WJHA 1XDBA 2E87A 2OFXA 3DMDA 1NVVR 3QUSA 5KOYA 1K5DA 2YVUA 1OV4A 2ZUCA 5AWFC 3QG5A 2JLZA 2ODEA 2FDCA 3PITA 1W1WA 2JLRA 3F5FA 3PIRA 2ZYVX 1VIYA 1CKEA 1R5NA 1ZVQA 3L0SA 1ETUA 1WCV1 4DCSA 3HJNA 4BLSA 3RAPR 5KDOA 3QBTA 4ESHA 1FX0A 1UPTA 2C77A 3VFDA 2EU8A 3Q3JB 2AD1A 1GITA 1G4AE 3GEIA 5B2ZA 3X2SA 2EWWA 1R8QA 4LBYA 2D3WA 3S1AB 4LHXA 1F3OA 1L4YA 1DAMA 2B7BA 2W6ID 1N6LA 4BEJA 4FMDF 2OFOA 1YR9A 3K9HA 1SVOA 5JSZB 2WKRA 1ANKA 2F7SA 2MSDB 2WAXA 4QG7A 2V6JA 1GWNA 4KVGA 4P4SA 2R8RA 1XTRA 3HR7A 4MRPA 1LF5A 3OAAA 1WRBA 4A8JB 4GBMA 3E70C 4C2UA 2WWIA 4NTZA 1M34E 2VF7A 1DAGA 3KB1A 4Y0VA 4PZYA 4RZUA 1E69A 4AC9A 1FTNA 3CR8A 1NG1A 2RGAA 4Z8YA 1RJ9A 4ZDKA 5B30A 4RKEA 1CS4C 4S2EA 5J4VA 3CKLA 4JVMA 1G5TA 4QJ5A 4WVFA 2UZIR 4LRWA 4F92B 1G18A 2QRZA 1RPZA 4B3XA 2CHVA 3TE6A 2O8BA 4LC0A 4F38A 2YJTD 4IOJA 4TL6A 3GFTA 3AUXA 1COWD 3SYLA 1SHZA 2BJWA 2FWRA 4LBVA 4CT4B 3U4QB 4Q18A 2QQEA 3C5HA 4AI6A 1AGPA 2ATVA 4DSTA 2EVWX 1G20E 3AV0B 3B78A 1I4LD 3CH4B 3SHWA 1IN6A 1GNRA 1MT0A 4PPGA 3T1OA 1HYQA 4KBFA 4M9QA 1KY3A 4YMTA 4C3ZA 2X8AA 3VNUA 2IXEA 5FPKA 1XJCA 2BMFA 2IWRA 2BBWA 3I1FA 4II7A 4RD0A 3ADKA 4UXIA 3WP1B 5FBVB 1W46A 4LYFA 1G9XA 1F60A 4UJ5A 821PA 2NPIA 1ZU4A 1XF9A 2FSFA 4ZCMA 3THWB 2G0TA 5KUTA 3N5CA 4B33A 5JRZA 4OHWA 4A0HA 2AWOA 3CPHA 4OYHA 2WIBA 4NYMQ 2QM7A 1G7CA 3VHLB 1Q44A 2P6NA 3EA0A 1FPMA 1XTIA 2RHMA 3DKVA 3CNLA 4IVQA 3KB2A 3PUXA 3AQ4A 2IW3A 4S35A 2R62A 4HDCA 2ZQ5A 4OJQA 5JECA 3GJ7A 4C7OA 1J70A 1TX4B 2XEXA 2UKDA 3QI2A 4UNQA 3TR0A 4GL2A 4KVAA 1KYIA 2JIZA 4AY2A 3G5UA 4WZ6A 1W49A 1V5WA 1R2QA 4W9MC 3FHTA 2FPLA 3WHKA 3R9WA 2WKPA 3FTQA 4GOKA 2VP2A 1VCMA 4KSBA 1FP6A 1MO5A 3QKUA 3BH7A 3FMOB 3LH5A 2TMKA 2O0KA 3CRQA 4I1UA 4TL9A 1CTQA 4K46A 4DC9A 5C1BA 2VP0A 4PQFA 1W48A 2IUSA 5HKKA 2OCBA 1WMSA 3A1VA 2IXGA 2FH5B 2X1VA 4BECA 2YWFA 2ZUBA 2W0SA 3ND9A 1JXOA 1NG9A 1Z83A 3RNLA 1XNJA 5DSZA 1UBCA 1KDRA 3BS4A 3VR3A 5BN3A 3GLIE 3THXB 4HLCA 2ZR7A 2VP6A 2JJ8A 4BFTA 1TF5A 1BMFD 1OSNA 1IBRA 1OH8A 4M8NE 2F43B 3J81k 4DLVA 5FOSA 2VYFA 4OI1A 5BYKA 1YR6A 4N0DA 5KNBA 3THXA 4U5XA 2WWYA 2GXQA 3TVTA 2GEUA 2ONJA 1HUQA 3NBXX 5G3YA 5SZJA 3LFUA 3KQUA 2FX3A 1E3MA 2HJVA 2A5JA 3UIEA 4AD8A 4IDNA 3P1JA 3U44A 2CLSA 5KNDA 5FBWB 1D2EA 4C0LA 4LJ7A 4Q7KA 4LSGA 5EXXA 1OIWA 2IC5A 2Z4SA 2AFHE 4R9UC 3AP2A 4OI0A 2QU8A 4H1VA 2CL7X 2NO1A 1LF0A 5EXTA 3THYB 3MLEA 1ZBDA 4G5QA 2QPOA 5SZIA 5AUPB 2PZEA 3KTAA 4EPXA 1D5CA 1RVDA 2ZVQX 2ZI3A 2IWHA 3RS3A 3QXCA 4EJSB 2LKCA 3OEED 2RKOA 5AUQA 3VR6A 2BCJQ 1KJZA 4D0GA 1E1RA 5DE3A 5D3MB 1FQJA 3ZVRA 2WJVA 2GCOA 1MV5A 4NCNA 4Q47A 4BEBA 3W5JA 2KBFA 5GVRA 2PBRA 5DO9A 2V54A 1AGRA 2W6IA 2OUKA 1IJEA 3GCGA 1DG3A 5G40A 1CR0A 2OZEA 5G53C 4OQLA 1G8GA 2AN9A 2C99A 4PAOA 2GESA 3TUJC 4DDVA 3WY9A 3HU2A 4HSEA 2H57A 3ZDQA 2IHBA 4PFSA 2WAYA 5TARA 1ELOA 4BZPA 5H8WA 3U2QA 1D6JA 3QE0A 1Z6XA 2QUZA 2Z6VA 3LDAA 2QY9A 2J0SA 4WXPA 1N6NA 4A0GA 1KDOA 3K1JA 1WB9A 1NLZA 3MAAC 5SZHB 2VO1A 4AYTA 3E5HA 4NKRA 3HPRA 5JMTA 3TNFA 2Q21A 2XTNA 3W3AA 2R6GA 1YVDA 4HB4A 2J7KA 2ZSBA 3A37A 2ZVPX 3TR5A 4EPVA 3BFVA 2GCNA 4B74A 4QHYA 1T6NA 1G291 1OKKD 4A4DA 2ZRCA 3VR2A 3HU3A 3FB4A 1P73A 4OKSA 1OXVA 3LBIA 2ZUDA 3JVUA 1Q0UA 3QOFA 3PXGA 4G5SA 2FN4A 5SZKB 1YZQA 4WXRA 4JYCA 5JWOA 1E0JA 4LV6A 1A2BA 2GCOB 2OBLA 1Z6AA 4A0FA 1XJ0A 2QA5A 2MMGA 2QAGB 3JZAA 3ZYCA 4C0BA 2HXYA 2OM2A 3LW8A 2N46A 2O8CA 5FTMA 4BLRA 3EZ6A 3TSZA 4TT3D 4NONA 2QP4A 2QORA 1MOZA 3CBQA 1JXMA 2ORIA 2XOKA 3CF2A 3IIMA 5G41A 2GTPA 5FL3A 3RS0A 4D4MA 4LHWA 1G6OA 1KGDA 2GVZC 3SS8A 3UKDA 4BLOA 4YXWD 2NZ8A 5EE9A 1F5NA 3QF4A 2FSGA 1OHHA 4HUQB 2C98A 5HZKA 2OO7A 4P4SB 4AKEA 5L8VA 1QDEA 4B6FA 3ICQB 5BN4A 2GBLA 4QJ4A 1EESA 1YQTA 1R4AA 4IDHA 5JSZA 2XJ4A 1ZC3A 3OEHA 4TLAA 3WHLA 1KDTA 2QGZA 1NMXA 2YZ2A 1PLKA 3LQQA 3FMIA 3GLGE 1W4BA 4JJKA 1ZUNB 4PO9A 4QXAA 3Q5DA 3U3JA 2IBMA 2QEQA 1N2CE 1RYHA 1N5JA 3GQBA 3OESA 4MRNA 5AJYA 4V0MA 1HT1E 2ZRDA 4GP6A 1KOFA 2J45A 1CR4A 2GJKA 3UG6A 3UMRA 3IGFA 2Q9CA 4P0TA 1XTKA 4OJKA 3OE7A 2Q9BA 4L4UA 1S3SA 1TU4A 4M9SA 5HE9A 4DSOA 1Q20A 4Q00A 3BK7A 3K0EA 2FEMA 3K70D 2VQSA 5IK2A 3Q72A 5EP2A 1JPNA 2I3BA 2QZ4A 4NCHA 2DWPA 3K0CA 2DFTA 3P4YA 4I1OA 4IXMA 3K0FB 1DAFA 2O0JA 4V02A 1J8YF 2XNSA 5H1YA 1QF9A 2CLDX 2GDJA 1DARA 2FF7A 3WNCA 4DLYA 3AGPA 5FBLB 5B57C 1QZXA 1GRQA 3M0EA 5FUXA 4QFMA 4F4IA 3C15C 1OXUA 1FL9A 3IHWA 1AM4D 3GJ6A 3NDBB 2BHRA 2PEYA 1T0JB 1GNPA 1X8KA 4F91B 1II8B 2XZOA 4A92A 2ZXUA 4D82A 1KI8A 1KZGB 1X6VA 2DHRA 3CONA 3FE2A 3K70C 4M2LA 4D4KA 1E99A 4TLCA 2WJGA 3LVQE 3RC3A 4RJLA 1E98A 5DGXA 1ZNZA 3HR8A 1MKYA 2F3RA 3CX7A 3Q85A 2CCGA 3EZ9A 4G0NA 4ILEA 1E2QA 2RGNC 2X77A 2CCJA 5DI9A 3QY0A 4E5UA 2VH5R 3HPQA 2ERXA 2OLKA 3VX3A 3W6OA 4MYUA 2JLSA 3TQCA 1R10A 3GLGA 2XSZD 3DZDA 3KQKA 3SU8A 3HDTA 3OIWA 1EWQA 4JT4A 3H2YA 4Q9JA 1CU1A 3B7GA 4O2RA 1TUIA 1J8MF 2EYQA 1NVWQ 4PSAA 4HAWA 4I1VA 1SXJE 1PJRA 2FMXA 4JYBA 3PUZA 4KFTA 5KPDA 4IOLA 1W47A 3THYA 1II9A 4EIWA 4YQFA 4KO8A 3FMFA 2WTUA 2NGRA 5AJXA 1RRGA 1GVNB 2JCSA 5FH9A 4JVSB 3C8UA 1C1YA 2CBZA 2E9SA 2IS4A 3L0IB 2BWJA 2QPTA 4JJZA 3KQHA 1HURA 4B73A 4LPSA 3VKGA 1RJ9B 1E1QA 1HQYE 5J4KA 3IQWA 3NKVA 4JLDA 3ADCA 4ZCIA 1OE0A 4PXAA 1E0KA 121PA 5CITA 1IXSB 2J0UA 3U7EB 4PQRA 1UKVY 5EE0A 3SQWA 2HLDD 2F1HA 2FEOA 4BRUA 3QEOA 2ZYWX 1XJQA 1SVIA 3T06B 5JWRA 3N70A 3TKLA 4BASA 4DEXA 5CYOA 1DS6A 3UXMA 3RABA 4D80A 4BZXA 1DADA 3QXJA 4NYJR 3PUYA 1AKYA 5L3QA 3CNOA 2IYLD 5EXPA 5CB8A 4X8LA 4FWTA 1XXHE 1GL7A 4Q4HA 1E9RA 3EWSA 1LNZA 1U9IC 3A1SA 5DI3A 4DSNA 2AR7A 2GXSA 1FQKA 3T1TA 4RD1A 1U8AA 4PSKA 2XSZA 1GRRA 2ZU6A 2IYUA 2ZI5A 1VDZA 3GJ5A 1C4OA 1DE0A 3F0TA 3BIFA 1FMJA 1P2SA 1QG4A 2QT0A 3KFVA 4GSYA 3OEEA 1E32A 3QSYA 5AK0A 2IEYA 1U0JA 3B2EA 3NH9A 4X8OA 3F3YA 1Z08A 1G5RA 4KSCA 5EXSA 2AKAB 1GUAA 3PEUA 1PLLA 2F1JA 2WKQA 4BUJA 2GK7A 1G3MA 1QHGA 4PHFA 5JWHA 2EFHB 3DVLA 2HYIC 4KCGA 2NZJA 5DH9A 5K8IA 3MMPA 3ZS8A 3KFXA 1BYUA 5CB6A 2Z4RA 4WA7A 4CEJB 3NEYA 3L8YA 1BYIA 4Q4LA 3DOEA 5JLJA 4X8MA 1T3HA 1W0KD 2NG1A 5H70A 4TMVA 1P62B 4Q9HA 4ARZA 1U8YA 1ZM9A 1T8UA 3CX8A 1G17A 3GJXC 4GI7A 4KFRA 2FZLA 4RSGA 3TBKA 4B35A 5IK2D 1OXSC 5LD2B 4BFVA 4DCNA 2V7QA 4NH0A 3DEFA 5IHPA 4YC7A 1EK0A 2REXB 4Q4AA 1UBEA 1HY3A 3IHLA 1Z0JA 4GOXA 3ND8A 3CF0A 4LV5B 5DN6A 3PQCA 4G5GA 4KAXA 4Q4AB 3RWMB 5CDFE 3CPEA 4M9XA 3KUDA 2IUTA 2BBOA 2OXCA 3UMSA 1LS6A 1EX6A 4IDOA 1VHLA 3REGA 1COWA 2FSIA 2DB3A 1AQYA 4V0KA 3NBYC 1EGAA 5L3RA 1U2RA 5IDVA 3NWJA 3ZQJA 4Q1BA 3B8HA 4Q1CA 2CCKA 4ASUA 3H0KA 1E9DA 2RH5A 4EFNA 1IN8A 2ONKA 4Q19A 5L3SB 3K0AB 3LO5A 3LY5A 2ODNA 3RANA 4IVRA 4X8HA 2B8WA 5FBQB 5B64A 1MO4A 3MWLA 2GA8A 4GZLA 4MUAA 3EC1A 4IOKA 4XH9B 3CR7A 4O25A 4PPNA 4DKXA 2FNAA 5AUNB 2XTMA 1KI1A 1ONBA 4LJAA 4G1UC 1PV4A 2VA8A 3FFBA 5TXGA 4DLRA 5F98A 3P32A 2W58A 1ZIPA 2OLJA 2WOJA 1K6MA 4A2PA 3NTUA 4B43A 1KI3A 4BFZA 3BB1A 4LK2A 4HUQA 3IILA 3KKMA 1NKTA 3AKDA 5BYJA 3SJCA 3FKSD 4O0MA 3FVQA 1W36D 5FOWA 5DNYB 1EG7A 3IEUA 4LBWA 1Q1BA 3I8SA 1YE8A 1XPUA 1VHTA 5LBIA 2A78A 3WBKA 5EE3A 3O47A 4TL8A 4V0ME 4URZR 1XFAA 1Q3HA 2WJIA 2OT3B 4QKQA 3SFVA 2ZITA 3WMFA 2HLDA 3B13B 5AR1A 1SKYB 1XD8A 4MKHA 5EUMA 4CRWB 1S1MA 1VCIA 1E9BA 2FFAA 4IEIA 1GFIA 4KODA 2HUPA 3KZ1E 1AQUA 1OKKA 1J7KA 2CE2X 4G01B 1NJGA 3WNBA 5JS7A 2CDNA 3PFIA 3EZ7A 4IW3B 3AEZA 2Q9AA 1G7RA 2DFLA 3VR5A 4CVNA 2Q6TA 5KSYA 2FFBA 3D7MA 1P2VA 2YC2C 5AUOB 3H4MA 2JLWA 4L16A 2HT1A 3WNDA 2GF9A 1KO4A 1TEXA 4A15A 1IONA 5KSZA 4G3XA 1NN0A 3V9PA 4AK9A 2GCPA 2JJ2D 4P32A 4NZYA 4AYWA 3AKCA 4RFSA 2RGGA 3EPLA 4LJ4A 2Q0HA 2ZI7A 3K9NA 2Z5FA 4US0R 1ZUHA 4HAZA 3RRNA 4G5RA 3H86A 3MD0A 5C46F 3TSOA 4QNMA 1LFDB 2DWOA 2XJ9A 3KJHA 4XSHA 3RDPA 5E95A 1E4YA 3OAAD 4IFBA 3LW7A 3IIJA 2A9KA 4MRRA 4EPWA 2ZI4A 4QGAA 5TY0A 4ACBA 1D2NA 3AVXA 1YHNA 4EQ6B 2VIIA 1XMSA 1TEVA 2UVQA 4DBLC 5GVSA 4TYYA 3T15A 1HEIA 1G4UR 3EPKA 4HAXA 2JJ1D 2KBEA 4AYXA 3IPYA 1N25A 3LVRE 3PJRA 2JDID 4FMCF 1TQDA 1XMIA 2PH1A 3D8BA 5FBRB 3AVQA 3L8ZA 3R9IA 5CLQA 2BM1A 3B1ZA 4UXHA 1Y3AA 1XZPA 2IYWA 3KXKA 5KSPA 1JAIA 3IBYA 4MITA 1T0HB 3QXSA 1OIVA 1P72A 3RLFA 3TLXA 4EQ6A 1GOTA 3AVPA 2MSEB 4P3YA 4QGFA 2CL6X 2HCJB 4ZKDA 2GWHA 3MG9A 4KBGA 4MDFA 4R2IA 2GK6A 4ACAA 2YOFA 1ZUIA 4IEEA 3K0SA 2IYXA 3GJ4A 3BJIC 2D74A 4CF7A 4B2LA 2ZJ8A 1R5OA 4IOMA 3LLMA 1KK0A 2JLXA 4I4LA 1G1MA 1W0JA 1T4GA 3QG1A 4IDPA 3GEHA 4KLZA 1XCPA 4XD7D 2JA1A 1VG1A 4JL8A 4UNSA 3X1YA 2ZRPA 3ADDA 5HCNA 1TU3A 1S1CA 4RZ2A 5EQTA 1Z22A 1GNQA 4B2IA 2HF8A 2PL3A 1TADA 3EG5A 1TTTA 2VTKA 5C4MA 4LJYA 4TQUS 1IQPA 4G5OA 1NNEA 2H8KA 2OCPA 2JGNA 3QEJA 4M1SA 2W0MA 4Y0AA 3NC0C 5FFMA 4EUNA 1M7BA 4OQXA 3REFA 4EJSC 1J99A 4XWKA 2AX4A 4DIEA 2AXPA 4JKYA 1A4RA 2PT7A 4NCJA 3PR1A 3TW4A 3VU9A 3EXAA 3DDCA 3PG5A 2SHKA 1DAHA 5E3HA 4LUCA 1W7AA 1YU9A 4PC3A 4ZI2A 3Q8XB 3GP8A 3TAUA 5CIWA 2IL1A 4E07A 2VHUA 4LGMA 1U90A 4DLXA 1N6HA 1KAOA 4JBWA 4LDJA 5K8LA 5FR2A 2VPPA 3AGQA 1XEWX 4PHHA 2R6CA 1AIPA 3GLGB 3I72A 2GEVA 1TQ6A 3BXZA 4MYTA 4RD6A 2DWQA 1BOFA 1JNYA 3LBNA 5HCIA 1G7TA 1N5LA 2AFIE 1KSFX 4DLZA 3E2IA 3IDQA 1N6OA 1T3LA 1QHXA 3RWOA 2VRWA 4ERNA 2BJVA 1ZJ6A 5CM9C 3IIKA 4IJMA 4MGZR 1JEDA 4Z54A 3OFNA 1YR8A 3ZD6A 3I92A 4TYNA 1II8A 1TF7A 1XCMA 2GNOA 4LYJA 2J41A 1KK1A 2ECKA 2J3EA 2NO9A 2QP3A 3UPUA 2CXXA 2RB4A 4XIGS 4HZIA 4RCZA 5FOUA 2V3CC 1NIJA 3NDPA 2F55A 1SVMA 1LTQA 1YRAA 2VLIA 4Q9IA 5JEEA 2QT1A 2QG6A 1US8A 4NYJQ 3MWJA 3W90A 3AVTA 1FOEB 1AK2A 2A5GA 4PC1A 1QVAA 1KO5A 3VQTA 3K0FA 1WQ1R 1N3BA 4GOJA 4QHSA 5CYPA 2VSFA 4EPRA 1OFIA 2ORVA 2IS1A 4GMDA 1NRJB 2G1KA 3BH6A 4DLUA 4LJ9A 2IYVA 2WSSA 4DT1A 3GLIB 1VG8A 2QTVB 3SYNA 2ORWA 1KKLA 2QI9C 3X1WA 2KWIA 3A1UA 2FV8A 3A4LA 4TTPA 4BZQA 5JJIA 3SN6A 3CLVA 1HE8B 4BFSA 1U9IA 2YWHA 4TMWA 3CZQA 4XVUA 5C2JB 4W5WA 4Z8XA 1UAAA 3KTAB 2FFQA 3B1XA 3B6EA 4PHTA 2WWWA 1QRAA 3T1QA 3OHMA 1NN3A 4YMWA 3SYKA 3CPJB 1KI6A 5JI3E 1FUKA 2NMVA 1K5GA 4A2QA 2B6HA 2ZJOA 3EAQA 3OE7D 4W5HA 1MABB 1XTSA 2QL6A 2YOHA 3R9XA 1S8FA 1SXJB 4WIAA 1CRPA 1W5SA 4YMVA 2BVNA 2QM8A 2G3YA 1UEJA 1KSGA 3PUVA 1Z0IA 2WMNB 3SJZA 5EE5B 2FPMA 5DYGA 4RD4A 5KO2A 3ZZUA 1ZC4A 2ZS9A 2R44A 2ZJAA 4CZ2A 1AS2A 1LW7A 1KO1A 2DPXA 2D7DA 2IT1A 1UADA 2UZ3A 1SQ5A 3P26A 3QF7A 4CEHA 4XSGA 4A6PA 1S0UA 3VKHA 1G6HA 5G3ZA 2F43A 1DTSA 3SC3A 3I62A 2DFKB 2C03A 3EZFA 3MFYA 4NHOA 2HEIA 2O52A
chains in the Genus database with same CATH superfamily
2UYYA 5C52B 3AR7A 2XUIA 1T5HX 1B16A 3AVOA 1OB2A 5BNTA 1F6BA 2QPAA 3AX6A 721PA 2ZBVA 2XRYA 3PSHA 4JS0A 3KVRA 2ZJZA 2VJDA 1CUSA 4XYMA 4XPIA 4ARSA 1Y9EA 4CMGA 1WG8A 5AOCA 2OZLB 5J4HA 1RS0A 2CLLB 3FN4A 4FW8A 5FL7D 3WSWA 1SUAA 1E6WA 2FSSA 2HZBA 3OTQA 4IUYA 2H1IA 2IPNA 4LY0A 4Q4HB 2F3TA 1BXGA 1O1YA 4NJMA 3GFSA 2FZ5A 4Q4JA 4W8HA 2ZKIA 3YASA 3U5ZB 3GYGA 2OWEA 3EFEA 4KV7A 3Q12A 1LC0A 1M2VA 1BCSB 4L0DA 4GP7A 4JI8B 1ODTC 1O7JA 1XQ1A 1ZQ9A 2V55B 2ZR8A 3AO0B 2BGJA 2QTAA 3LI2A 3IS3A 1L5VA 1QV6A 5CMLA 4FKMA 2ASVA 2PQ0A 3Q8WA 3ZWXA 1W0JD 4W6ZA 4Q1DA 2HNBA 1J42A 1ZK2A 1KR5A 3EBLA 1QGYA 1Y8ZA 1YZ3A 1AZTA 3L5KA 5DHTA 1PR9A 4QQKA 3T0IA 3UTCA 4TYWA 3OG9A 4KE9A 1FMFA 1P7CA 1TO6A 1KSHA 2PS3A 2CFCA 5EZQA 4AUMA 5CK4A 4TUYF 2Z8XA 2LW7A 1FA9A 1U5BA 1OGYA 1XV5A 3E1KA 2IE8A 3CW2A 4L5AA 3SSMA 3TX6A 5CG2A 4MRVA 1A88A 4OA8A 1BN7A 3MB8A 4R8LA 4FMBB 3C1OA 4HH1A 5DIZA 4BPRA 4QQRA 4KHPB 4P9NA 4YT2A 5CB4A 3EISA 2YUIA 4WUVA 1I9GA 3FNFA 3B9PA 5CXSA 4CNQA 1AKWA 1RXYA 2V58A 3JQRA 5KVQA 2RGYA 5I9IA 3AM1A 1M1YA 4HADA 4ZCLA 1GV1A 4AKGA 1KDVA 4V24A 3DMHA 1Y42X 2Z5VA 3N2EA 5L7YA 2FU5C 1U3WA 4DY4A 4NU8X 2F64A 4P36A 4WOPA 1TL7C 5K3FB 2WFLA 3QUTA 4D9EA 5JXGA 2YKGA 3L0BA 2DUUA 3WISA 1MZVA 3FHCB 3HO8A 5KWSA 1GPDG 2HF2A 3NHAA 3CLRC 5D5PA 4OFWA 5CYFA 3KQNA 1VM6A 1YDHA 3O8QA 4OXNA 2J31A 5EPOA 4FLMA 4RQUA 3ZD9A 1C9JA 1IOZA 1HT0A 1G21E 5ECDA 5IJWA 1VL8A 4C05A 1SH7A 4WSOA 2C9YA 4I50A 5ALHA 3QRWA 4DIDA 4PWZA 2NIPA 2MSCB 1DB3A 5BW8A 1KXZA 3QPAA 1T0IA 1UR5A 1ARZA 1PVVA 3AR4A 3GWGA 2HO4A 3FUCA 5HJEA 1SY7A 3LLCA 2FP3A 1LU9A 1C7IA 1EZ1A 1NW6A 2CLCX 2EG5A 4WLVA 4MKIA 4MUBA 1RLOA 4DA6A 4NICA 3PFBA 2WIKA 2GHIA 3Q9SA 2BZ1A 2HSGA 2OOSA 2QE7D 1W6RA 2F1KA 1MB2A 4OMCA 3SDZA 4DNQA 1AMNA 3N6VA 4RUKA 4FINA 5ANRB 5ARBA 1YMVA 4LNAA 4ERXA 3QLJA 4DMHA 5FWXB 2BHTA 4XGNA 3C6QA 1ZXXA 2WE8A 4BEVA 4C20A 4D41A 3LNCA 4WASA 2D4HA 4HFNA 4CHTA 3H83A 1W44A 1K1EA 1P3Y1 1D5WA 4B44A 3GR6A 4FI3F 4INJA 5B55A 5HKAA 1KEVA 2QS9A 4J7XA 4KN9S 4LGVA 5A05A 5MN6A 3CZMA 3HA5A 1C2YA 3OM0A 3CJQA 3LQ2A 1U0NA 1DVRA 3QX8A 4FK8A 1B0UA 1UFRA 2H2AA 3FWNA 4QQNA 3WYDA 4B34A 1AS0A 4FHCA 5LR6A 3C4QA 2WJYA 2W42A 4GKKB 3H19A 1B8VA 4HQRA 1MXHA 2ZWMA 4HLDA 3ZCTA 5BNWA 1M73E 1RAEA 3V7YA 4Q01A 1P2TA 2PUHA 1G66A 2FLVA 3LT0A 2ZSUA 1LVGA 3O73A 4O1HA 2H2IA 4EG4A 4L4SA 5F7ZA 1T2VA 4EYGA 1B41A 5ADHA 3RVPA 4B7CA 3QYPA 4NYIQ 3R40A 4NU0A 4MK4A 5AKYA 1T5TA 2QLNA 4D1YA 4C87A 3GDGA 4XQEA 2QN7A 3DHVA 1E2JA 1PFUA 4GVLA 4WY5A 4GMXA 1K98A 2PWYA 1T15A 4Y2GA 2DPYA 3IPCA 4KBYA 4ZQCB 5BSGA 2V6IA 3JSAA 4FEEA 4KACA 4A26A 1U28A 1A9XA 3CQ9A 4I19A 1VL1A 1GPYA 1QWSA 1L6IA 3AIOA 1CEXA 4HZUB 1JPJA 3JQ9C 2VSXA 3QU7A 4OOFA 1XAJA 3BMNB 1FTSA 4LWPA 5EHNA 3K70B 2O5CA 2Z56A 4PZEA 3BFPA 1NRIA 3LKZA 2V9PA 5ALMA 2NYRA 1JKIA 4J4BA 3V1YA 3T7SA 2YN2A 1JR3A 1L5SA 2ZB8A 3WRYA 1U1CA 4QSMA 1O6CA 1NR5A 3AL2A 3IO3A 2PKYX 1R6BX 3OMWA 4NBSA 1QWOA 2BGIA 2AE1A 3WIBA 5AVSA 1S9DA 4KJZA 3QTTA 2RG1A 5I4KA 2H18A 3GDOA 3RJMA 8GPBA 2A8YA 3FYTA 4GPEA 3E9CA 3C3DA 3GCDA 1J00A 1OFTA 3ILSA 5LIRA 3FAKA 3GJTA 1H8HA 5FPQA 2CVZA 1OYWA 1KFJB 4JLOA 2Z83A 4LOIA 3Q7PA 2ZOSA 1DPFA 3FFXA 4PLGA 4Q0MA 2OECA 3BL5A 4R1MA 3ZLUA 1PNRA 3LCRA 4DJJA 2YFYA 1A9ZA 1H22A 4TTIA 3RV4A 3ZBUA 4ID3A 5JD5A 2YN4A 3C3MA 3OKPA 4RTSA 1W4CA 4NR0A 2QN1A 2A0FA 5HFNA 1CR2A 5P8WA 2OAGA 2DPMA 2EARA 2YNMC 3G79A 3ZDEA 4ATNA 4DG5A 3I42A 2VSQA 1J6UA 4M1TA 2FOXA 4WD3A 4E14A 1EJ2A 3IEVA 1UFQA 1X1SA 1FPQA 4Z7NB 3QLVC 1FNNA 3HO6A 4N3CA 4RIIA 2BOVA 4YMUA 1NOKA 2D1QA 4OAPA 2I78A 4AP6A 3LX8A 3HNOA 4V38A 3OM1A 5JNLA 5KJEA 3PHCA 4OHZA 2FUCA 1PUXA 1S96A 2X8LA 1SUFA 2ZXEA 1NC3A 4WOBA 3UKOA 3C8DA 1FUEA 1Z88A 1GPUA 1QP8A 1UBHS 4RFSB 5JYEA 4H08A 4R9SA 1D2HA 3DHNA 1HFEL 4CF3A 1VL2A 1AJEA 3MB5A 2BPOA 3UV6A 3PDWA 1J23A 2D2FA 4G81A 3KUKA 4ME6A 1KZ7B 3H1PA 2P9FA 3MT0A 4H0NA 4HMOA 4UQLA 1BEUB 4GR9A 1C3VA 4LS3A 4ZVTA 2AKEA 5ADVA 4Z51A 4MWTA 1RYEA 1JIKA 1GA4A 3RCBA 3NAQA 3GRZA 3Q1LA 4XYGA 1AXGA 3U4CA 2XAAA 1P2FA 3M4JA 4QRHA 4LY3A 4KOAA 4NL4H 1U7XA 4MQLA 3AJRA 3FTNA 3TFWA 4JQCA 4KIGA 4NARA 4ZI7B 4I0WB 1OFHA 2ZIEA 4GZ3A 4ALLA 4HDSA 4ZVQA 4U5QA 1BDBA 1XYYA 4XWYA 3O8BA 1R66A 3E7WA 1NI5A 1L5HB 4ASUA 4IYRA 3D3WA 3S1SA 2J3KA 4DCPA 1CZHA 4K9QA 1M2OA 2EW8A 2EFCB 3AESB 4UE6A 4UHHA 3VDMA 2LRHA 1KRWA 1N9ZA 2AMFA 2GD0A 2D1TA 3AC0A 2OEPA 4M0UA 4AO7A 4DZTA 3Q7EA 1DOAA 1QHNA 4P7KA 3K0KA 2VJKA 3K6SB 1E1RD 1TQ4A 3DUWA 3FPKA 2EZUA 5I7SA 2UUCB 1PWXA 5CJ2A 3EIEA 3O8NA 5B6JA 3ES9A 3ZWCA 4GE3A 2DKFA 5K0TA 1JFFA 1AKQA 3SJBA 4MV4A 5JFGA 4YBRA 1A71A 3A32A 4IG4A 1ZMBA 1AKNA 3H87A 3EA5A 2G6BA 2YXEA 3EYAA 3T5GA 7REQB 1QF6A 1H69A 5D7NA 1J2JA 4G4IA 2P35A 2J8ZA 4BO4A 5DNCA 3OSZA 4KKXB 1N7IA 3F5SA 4HMPA 4I5DA 2OCYC 3TCXB 4K81B 4CW7A 1NQVA 1UWLA 5BW5A 5C3MA 3NGXA 3H5LA 1E7SA 4M8KA 4NY1A 4DEYA 1CEEA 3ZH2A 4C4OA 3TZKA 4D25A 4M0KA 3U60B 5CU7A 5EG5A 2FA9A 1MF7A 3FCEA 3R7NA 5IWAB 1C3XA 4QYWA 5TS3A 1UJMA 1KO8A 4HATA 3VV3A 1BU8A 3EARA 4FN5A 1YT5A 3SMQA 4BNZA 4D02A 3RC8A 4Q3BA 5ICSA 1PFGA 1EX7A 3FVVA 3H7IA 4L6CA 3MGGA 2WWVD 2QBYB 2O19A 3ABOB 3TX2A 4M1OA 3U26A 1U2GA 5CT6A 4ZA2A 2CBGA 2JIOA 5KAPA 2ZRLA 5HX7A 3NKLA 5JFTA 4Q03A 2QRHA 3EMDA 4IQFA 1A4IA 4IHKA 1T5IA 4R98A 1ZONA 1VPTA 3A0UA 5GV8A 3T5MA 3KTDA 4X3PA 2VF8A 2VQ6A 3K0CC 3PXXA 2DY1A 4BU0A 4EAQA 4ODIA 4Z9XA 4E5NA 4DWOA 4UTRA 2ZJ7A 2JL1A 4IRUB 2C94A 3I9KA 2VK2A 4OLBA 2HJHA 2AOTB 4QLOA 1QZTA 3LCJA 1GPLA 1U3CA 4QD3A 1KNQA 1HQKA 3PJDA 4OXKA 4F5DA 1RHJA 4REOA 2R65A 1IOLA 1ZW6A 2IHJA 4CMHA 1WDLA 4D9MA 1HRKA 2J5KA 4WKGA 3U39A 1CRLA 3K7EA 5CEJA 1TQ2A 1UJNA 3WB2A 3HP4A 3ZWDA 2XMRA 3HN7A 1GXSA 6GPBA 2B2CA 2V6GA 3NRCA 2O2ZA 2QNIA 4TSFA 1PDOA 2BFCA 2OV3A 3OCUA 4XUCA 4M0EA 4QTTB 3UJHA 1ZRHA 1EP1B 2BP7A 4G5HA 4DJFC 2CVHA 2B9EA 4BZWA 2VHTA 2F6RA 1ZH8A 1TF2A 4AMZA 4MS1A 1PT6A 3LRTA 3L84A 2ECOA 1I1QB 3E0QA 2Z2YA 1PR3A 1LJLA 3LLUA 3ZH9B 4BC1A 2QQ0A 5K0ZA 5C80A 2P77A 1NY6A 4FR2A 1O5IA 5DWQA 1NI3A 1KJYA 3O4RA 3FCSB 2AHRA 3ETJA 3C3WA 2PL1A 3A4VA 4BNVA 5C9ZA 1RW4A 4ZAZA 1Z2AA 3L0PA 4HC4A 1Q0PA 1E0DA 1RAHA 3A4NA 4O4LA 2WTBA 1DTWA 2Q5CA 4BDSA 4W1RA 2YTZA 3MWGA 4OI4A 3VHXA 3VAAA 2Q62A 5BWMA 1IUNA 4WNCA 5FNVA 3WVNA 4QUDA 1CB7A 1GCOA 1RPJA 3V8EA 1L4UA 5DTQA 2XA9A 4WN9A 1G8PA 4MOWA 3RH0A 5BW4A 2QMHA 1DKPA 2GVNA 3SF0A 4J76A 4UE3S 4UOQA 2E7ZA 4IQ0A 2OGTA 3MEQA 1WIWA 3M5CA 2Q5QA 3I32A 3CHYA 3QVJA 4GPTA 1ZCBA 2BHNA 2BSXA 3G49A 4AMUA 3I37X 5KTOA 4Q1FA 4KAFA 4Y6QA 3OQPA 1OA1A 3LX5A 1YSCA 1WUTA 3OMXA 4DR1B 2IBSA 1OBHA 3ACDA 1NR1A 3M2TA 4OHVA 1OC2A 3JVVA 3C8ZA 5HCUA 1VKJA 2ZLBA 3CLRD 4G8JA 5L45A 1IN4A 4I8XA 1FMTA 5AW8A 2GB4A 1NQWA 5C53B 3LXUX 1A2OA 4JBGA 3M8KA 1YDFA 4TQ9A 1YQUA 1QOPB 2B4AA 4EHNA 1JXAA 5J5CA 4KPFC 1OQAA 2OGZA 1GZ4A 2DQ4A 3NTVA 5E7MA 3WK8A 4UAJA 3W2EA 4NNJA 1BDHA 1ZI9A 2R6DA 4F97A 2VPTA 2XCRB 5EKSA 4JVNA 1Z28A 3KVYA 4B09A 2XDAA 3OZAA 5BR7A 1C3EA 2HNAA 4FHFA 4KU4A 4UQPA 5L6MB 1IM2A 2UYCA 1BJRE 1MZPA 3G7NA 1NUHA 2HGZA 1E94E 1NAHA 3BTOA 5DZSA 2GETA 2XB6A 5CDSA 2VRNA 1OZAA 1YI8A 5AKXA 5M2QA 4ZVKA 4ZVPA 2FPXA 3D43A 1AKVA 4R41A 4ZK2A 2R47A 2ZTUA 1W0CA 3JATB 2LWIA 4FU0A 4QXQA 1VJ5A 4JBYA 3RVQA 1QIKA 1IK6A 2ZSIA 3OF5A 5JAQA 4ML3A 1UC5B 4LOAA 4LRTB 2DWCA 3WDKA 1V35A 4F12A 1KC1A 1EJ0A 4WK2B 1T0UA 1LDNA 2X19A 4NEGA 3U7GA 4IGIA 3RLIA 2OG2A 5CT4A 3ZEAA 3EW7A 4RHEA 1N7JA 3MCTA 4V1CI 1F1BA 3TM5A 3PNYA 3GCZA 4TZ0A 1IN7A 2K2WA 3OHPA 4JLBA 4YIKA 4YIHA 2QM3A 1VPLA 4GVPA 3BBPA 2PMFA 3H9UA 3K0AA 4MWGA 4TXNA 4AG6A 5EGNA 4ZDIA 1K5PA 1Y3FE 3I52A 3ACBA 4ZHSA 2Z6AA 3CE6A 2RGCA 3GA5A 5LQNA 3P20A 1D3AA 1YAJA 3PA6A 1XFDA 1MV8A 2OXRA 4R71A 3DXZA 5DRTA 2Q3JA 3ZD7A 4CQLA 2PRYA 3N05A 5DX1A 1GLGA 4BN5A 2V3WA 3OQHA 4UCQA 1KYVA 3CURA 2C82A 1LGYA 3D6AA 1Z6QA 1T5LA 2CNNA 9LDTA 1XD2B 5CLIA 1RMQA 4ED9A 2BL4A 1I2MA 2JAWA 4YNBA 5K8UA 1DUVG 1SVUA 1OT3A 2VP5A 4JBXA 4Y1RB 1SM4A 1U3TA 2GZSA 3NAMA 4R1NA 4H6PA 1WDTA 3KG2A 2I3AA 4JK3A 3JZFA 4UBNA 4B81A 1H1TA 4JLPA 1DCFA 1Y8CA 2C7QA 4Q3EA 5JJCA 5ETJA 2OV8A 3OKCA 1NP6A 3N5KA 3H11A 4L4RA 1NA5A 1ZDMA 2ZANA 5KC9A 3UJ3X 3DV9A 3ZS9A 2JI4A 3M70A 2GUWA 2XMSA 5EP1A 3TYXA 1KR2A 2OVFA 4D44A 1K68A 2C0QA 2V6MA 5L3SA 4I55F 2VUIB 2PZLA 3DFZA 5IKEA 1CZLA 2R9VA 4BQQA 3L49A 4IICA 3V1LA 5KVCA 2Q4RA 4JJGA 3IR5A 4GEGA 5FI0B 1NBMD 2WTXA 2ACKA 2PMEA 3W8RA 1P77A 1R0YA 2A1TS 3ZJ4A 1YXMA 4RORA 3DV0A 1DINA 1ZVKA 4JHXA 3S70A 1U6IA 2TRSB 2O2EA 4QARA 5LYJB 1N2SA 3M83A 3DW3X 1PZXA 1XT6A 4R9VA 4RSRA 3DE6X 2XE7A 1NN5A 1F3LA 5EPUA 1JHUA 4HB3A 4CYMA 1T9DA 4F6LA 1Q22A 4JDPA 3MUEA 2OZPA 4UMFA 4X44A 1CPYA 1Q1EA 1PZMA 3GHHA 2AD5A 4ZEOA 3T4UA 4OPMA 4MW2A 1KI6B 1D2MA 1TUGA 3ET5A 3UCXA 3WRYC 1CUEA 4KG7A 3D31A 3JWPA 2XOXA 1HC7A 3ONVA 1DKNA 1GU7A 2DBZA 2YRXA 4RD2A 1IDN1 5EJGA 5G0TA 5JAPA 2RGWA 5TVKA 4AG3A 4B3TB 1WBJB 4BU1A 4CQJA 1W4AA 3M34A 5B58C 4OJMX 3QVMA 4PO1A 1OYYA 3RK4A 2H08A 1KRHA 4K0KB 1HQCA 3C8MA 3WZLA 5JATA 2ACWA 3D1VA 4MMZB 3AB3A 2C92A 4WZAA 3JS5A 2VHCA 2BGTA 4TMTA 2O8FA 4MGEA 3QYJA 3P0RA 4E13A 3M4XA 2P9GA 5CH3A 5GINE 1YJBA 2QMZA 3M3DA 3RS2A 4S04A 4O3MA 3AONB 4HX5A 1PDVA 3TLAA 3T1YB 1XOIA 4Y2XA 2O5EA 3W2HA 1UPUA 4ZKEA 3GRAA 5KREA 3KJIA 2FX5A 1LDMA 3R20A 3KJQA 4BO8A 2MSLA 3IKLA 4KRGA 2G9RA 1VSUA 3V4RA 2P7IA 3QXGA 3D0QA 1MEEA 5JG7A 4IIVA 3U56A 4H0FA 4UU8A 3TS1A 5IT5A 2BEKA 1B6GA 4BNUA 2J1LA 3FMGA 4RZHA 3KV1A 4ON9A 4AY6A 1SCAA 2RJ3A 4MJ3A 2XT6A 2FR1A 2E6UX 1AZSC 1U8TA 5FUWA 3UGQA 4DXAA 1A1VA 3U3RA 5H83A 4Q9LA 1E3TA 4M8IA 2ACEA 3FTFA 2YASA 2G6TA 2AL7A 2FSVA 4Y6RA 2A3RA 1P1FA 4NECA 4DC0A 4TTQA 3AKEA 5FRDA 1QAMA 4S1NA 1DQNA 2GZAA 1UXJA 4GPAA 1PWZA 1SK8A 4II2A 4XVCA 1AQJA 1XP5A 2GERA 4B2PA 3G6WA 2YH2A 4JQSA 2C3OA 2WU3A 1EQ2A 3SM3A 5IJ0B 1EA5A 1IXZA 1VLMA 2J09A 4ZWNA 3C4JA 2FMIA 3G2HA 3PEVA 1ZMRA 4NNOA 3CLTC 4E03A 4H2DA 2WJPA 3WIUA 3A3YA 4M22A 4D4JA 4QA9A 1PF7E 2HA6A 1OJ7A 4ZV4A 1IEXA 4MARA 1M0WA 1CVIA 1A4XA 4ND2A 3AFIA 1RHKA 5JAUA 5KI6A 4D42A 2IIPA 3I23A 4YCBA 2HN9A 2PAAA 3ZNNA 2GARA 3R0JA 4B6OA 1U81A 4W5JA 4B6JA 4KVZA 1JRLA 4BGVA 4DM3A 2Z3ZA 5BVHA 1LBEA 1EXWA 2IZ7A 2PV7A 3L2OB 3C7KA 4YECA 1PJSA 3UWKA 4DRZA 5A4MS 5JR3A 1VA5A 2QUBA 1O97C 4MYDA 2D59A 3I3OA 4H1WA 4RETA 4EG8A 2SKEA 3RTGA 2ZT5A 4GOND 1KF0A 2XI4A 3WWCA 5KHLB 5GVSA 2BFPA 1VJGA 2YHIA 4IJ6A 4IHJF 3BTSA 4BVHA 1ACLA 1E2LA 4MWOA 4ZHQF 1ZOPA 2RAFA 3C41J 1E96A 1N9GA 2JASA 2P9TA 2PZBA 3LQFA 3OCZA 1GG2A 4WMLA 4ZALA 1JQJC 3BRWD 2QV7A 3AYZB 2Z8ZA 3ABZA 2F4VB 5DULA 5CA0F 4KXFB 4QBGB 1CJMA 1ZSYA 3BICA 3HNPA 4EK9A 3RODA 1JG3A 1RLMA 1XDUA 3BQNB 1V6CA 1NY5A 4MVJI 1B76A 1EUCA 3LL4A 4DUYB 1NXSA 5FXMA 3WOHA 3I4FA 3HBJA 4E12A 1H1LB 3BL6A 2IF0A 5JROA 3I12A 2O3UA 4RIHA 3ENVA 4G1EB 3T9AA 1KY2A 3ANNA 5E4JA 2BKUA 4OF4A 5FT9A 1RXUA 1VTKA 1ZP6A 2NUPA 3HYTA 2GBPA 1K8YB 1E79A 2VDNB 1O94C 5DHSA 3FDZB 1DO2A 4QDOA 1XKQA 4PC7A 1DAKA 1G41A 1P29A 1ZZEA 2AA3A 2B94A 2YQZA 4LZAA 1GT6A 5FI3A 1GCIA 1DFGA 2G83A 3OCWA 3NBZC 4D8UA 1OF1A 4GC9A 3C39A 4IDAA 3OIDA 1QP4A 1JU3A 3JAWB 1P0PA 1W2GA 1KMHA 1VYVA 3NP7A 4BYGA 1CUBA 1PUIA 4N9WA 1YI1A 5G4KB 3VJKA 5A0TA 2IYSA 3LP6A 3E4DA 2E1PA 5KNBD 4QULA 4WESB 2CJWB 4HAIA 4NMXB 3GEMA 3QJ5A 4J9VA 1XCLA 2EF0A 3SP1A 3RT9A 3WL6A 2XVZA 1ONOA 1ODJA 2DGDA 2PS1A 1E1QD 5IBPA 3FMVA 2CJWA 3ENWA 3FPEA 3QE9Y 4DE5A 5EMKA 2GN9A 1NUAA 1JHXA 3MUNA 4BAGA 4JL5A 4NNPA 4IJ5A 1THZA 1S2MA 1KMHB 3GB9A 4QOSA 3TNYA 3D6NB 3K1TA 5BWLA 4G63A 5IZ4A 1MW9X 4CMIB 1N34B 5E7JA 4OH1A 5EHXA 3UJDA 1A82A 2VDQB 5ALFA 3EFBA 3KVNA 5AW5A 3D64A 4LKOA 1FDSA 2Y3IA 4BMNA 4EUFA 2EX1A 3KLOA 2R3SA 4XWAA 1T43A 1Z37A 3S40A 2HCBA 4OX9B 1H05A 3DF7A 2QR2A 1GZ6A 4LSZA 5JARA 4D56A 1ZUNA 3LT2A 1Z2CA 2FZEA 2QROA 2W2VA 4EPYA 5T41A 1RI1A 2JI6A 4GSKA 2HL6A 2PXXA 4KQMA 1K6JA 4IIEA 3KIPA 2O8BB 4P2GA 2OORC 3GF4A 1GQQA 3L6OO 5KDDA 3WMXA 1NDUA 4NI5A 3VPSA 3L0OA 2YNMA 4WZBE 4K3VA 4XSVA 2GOYA 2MINA 3A3OA 3OBIA 1H2EA 1K0UA 4MQFA 1GGJA 1JHVA 4QYMA 1XKLA 5ALWA 4HNAB 4C1NA 1WXXA 4J6FA 2AQHA 5ALSA 3FCCA 2CT8A 1KGSA 2Q2NA 2YHUA 3H3JA 4RPKA 5K0CA 1OB5A 1ZNQO 3TSWA 2KI5A 4DLTA 5KNDH 1CETA 2FMHA 3PTLA 2H2WA 3IB3A 3M4ZA 1T1GA 1QLJA 2ISQA 1P8AA 2JH3A 1ULHA 3H11B 5FBKA 3VMMA 1SXPA 1Z6GA 3AVWA 2EBUA 3LC1O 1P45A 4HX2A 4AG5A 2FMUA 4RY2A 4WKPA 5CIQA 3UHOA 2O23A 2BKEA 4X0EA 1WBBA 4BAZA 4IQGA 2G7MC 3EODA 4GNRA 1Q0RA 5SV2A 3HM9A 3EEFA 1U0LA 3I4CA 3GD7A 1DDIA 2FWPA 3LT1A 3N75A 4JROA 2AJDA 5JVDB 5F77A 1TTHA 1P6XA 4K3UA 4KQ1A 5BV0A 2JIDA 5CM2Z 4UKDA 4CM9A 1RI5A 1RIIA 1Z3IX 5JSKA 2LKDA 1VE3A 2WWFA 4L9AA 5A5GA 1AK1A 4B82A 3CZPA 4H4CA 3KLPX 1GKIA 4OLAA 1YHZA 3BF7A 3GNQA 1Z4OA 2ZM5A 3GPIA 4G0OA 1FP2A 3BJRA 2C2ZA 3D2BA 3DTTA 2IYAA 2J3HA 2JEYA 5A4DA 3ZDBA 2EP7A 1I33A 3DWEX 2C5GA 1WTAA 1J2TA 3GEPA 3VU9B 3SDBA 1PK8A 3QKIA 4JYAB 1JG6A 4UNRA 2QVZX 3IMGA 4KPEC 4O02B 4RH1A 1FS6A 3E3OA 4ARCA 1F9EA 4P2BA 2LD4A 4ZCQA 3ZW7A 1HE2A 5JI2E 1FDRA 3UQYS 3GLFE 1WXWA 4NENA 3QFRA 1CUCA 4MINA 1RQXA 4N8SA 1RQGA 1L4MA 1H3FA 2FWIA 2ZUVA 4NE9A 3T7DA 2A5FA 4D9FA 2JEOA 5CBPB 4AQYB 5SYNA 3AVYA 4I3HA 1WZCA 3G2LA 2C07A 2HHHB 3QXXA 5CCEA 1M6YA 4MVJF 4JZKA 4RVDA 2Q6IA 2AX3A 3QW4B 5E2BA 1QGED 3HH8A 4X85A 5U9CA 1ZGJA 1CZNA 4EB3A 1RQLA 1Y6QA 3IXLA 3L4JA 4U6SA 5AW7A 2QTMA 3L6EA 1WPXA 4RH3A 3KL2A 3SE0A 1Z07A 3LECA 4FE3A 3UZUA 1O87A 1YS9A 1P6QA 2X58A 3Q7SA 2DR2A 5EJ7A 3T1VA 1AKEA 1BCRB 2AQ8A 2GF0A 2C1EA 3KKLA 1PFVA 3KQOA 4EUKA 1AHIA 1CP3A 2W22A 3PHIA 5AKIA 1RM4A 4FEYA 1T34A 2BUAA 2VTVA 5THKA 5CDGA 4J0HA 4RMJA 2Z1NA 1UMDA 4RZIA 3Q3IA 2QRPA 1WJGA 2AQIA 2RK6A 3GRPA 4LXUA 4FFPA 1QU3A 1NRWA 2O7NA 4ND8A 5IG2A 1VJRA 2UVPA 2FGKA 1YR1A 3JQFA 3ROFA 2Z2KA 2D5AA 1Y3DE 1HFKA 1BKYA 2MTBA 3BMOA 1N7GA 3AF0A 4XVRA 3GG9A 5HK8A 2ZUTA 1ZOSA 4A03A 4YT5A 2P6UA 4BMCA 4KZKA 1ZNWA 2GVDC 3H2HA 2BFEB 4JSYA 2B4KA 1C41A 1K3TA 3HCOA 3C6MA 4FKBA 4NAUA 2H4ZA 5FNVB 2DUJA 4YQZA 2P2LA 4CV0A 2ZS7A 4TS4A 4G1BA 3H5IA 3PEYA 1WD7A 2HK8A 2HPVA 1B0ZA 4FMDB 1ECPA 5KKAA 1NLFA 2D06A 2V7WA 3GELA 2JRLA 4AW9A 1E18A 2PUVA 5D84A 3TJRA 2LCIA 3W1WA 2TSYB 1Y9ZA 5I8PA 2XD4A 2BV3A 4QU9A 3E81A 5AHXA 2NU9A 1VKZA 3F7TA 3TZ6A 2WMOB 2J30A 2GILA 4OXXA 1KWGA 4RHUA 3VPGA 5LBUA 5DYYA 3CMMA 3Q0EA 3ZKWB 5B1EA 1N32B 1ZNXA 2ZJFA 3LHKA 2PN1A 3CZ9A 3L7CA 1UJ2A 3DMTA 2I29A 3DFKA 2O8VA 4TTRA 2FW6A 4NYMR 1ITZA 2H4XA 5T3UA 3C98A 4F9EA 1NW7A 3R0QA 5FF9A 5JCZA 4O8ZA 2UXBB 3L7JA 1GZ7A 1N6KA 3BD9A 5C34B 3EEOA 4L2IA 5B6PA 4U8HA 1MQAA 2EWVA 1JA1A 2XA1A 5HG0A 4ZJPA 2NTJA 3DUFA 5BR8B 2YHAA 1IU9A 4WOJA 1Y6JA 4R2WA 1PJZA 1TQHA 2JK1A 5T64A 3KOUA 2BY4A 4OU5A 4LOJA 3F6YA 1TRHA 2VWQA 3V2GA 3ANMA 3OUTA 2H00A 2XNDA 4UNNA 2A86A 3FF4A 1DIGA 2JCYA 5U4XA 3UATA 4EJ2A 3ZLJA 1RLIA 4M9ZA 1RCUA 3W79A 5C8YF 1NMYA 2VHJA 3QKSA 1M8FA 4JAVC 3AFMA 2YWCA 4QGBA 2NX2A 4QTZA 2QX6A 4L3VA 4YJ2F 1WF3A 1BGWA 5DNVA 1WZIA 1ZIOA 1DDGA 1YB7A 1ZITA 3OX2A 3VSCA 4ZYYA 4RHFA 3ZQ6A 3ZWOA 3PNSA 1K88A 5KYNA 2R5NA 4IL5A 2PLRA 2P67A 5FPYA 4D3DA 1JI0A 1OW3B 1A2KC 2Y66A 1HMPA 2NW6A 1N2XA 3FCUB 3R6GA 3BTVA 1GY8A 1R5JA 3FSRA 2C97A 1Z8HA 3RT1A 1HRDA 1Y9DA 3H9JA 5FWYA 3UMFA 1E9AA 1X39A 5DLPA 4LI0A 3TLZA 3FPHA 1UBGA 1Z2DA 3KKQA 2X14A 1O08A 1ML4A 5AVTA 3CPSA 3ED5A 4BJ5A 1AXRA 1U8EA 3V4ZA 1MO3A 1YBHA 2QSUA 2X8WA 2IYNA 2WSMA 4ITUA 5KJ1A 3ZE0B 4IUDS 1UJ6A 2C2YA 3ETDA 1Y5NA 3KJEA 3FNEA 2FQXA 4Q66C 5MN4A 2BONA 1K92A 5DISB 3ZQ4A 3MUFA 2LVBA 4MO9A 3T3PB 2WHEA 3K6JA 2ONCA 3FVTA 5TQJA 4E7PA 4ZQEA 5EWMA 4TQAA 3VUFA 2HMSA 2W2NA 4YJ3F 2P1DA 4HAUA 1KK3A 3UMMA 1V5EA 4DQXA 1CUDA 1T1IA 4ENUA 2HYDA 1MH1A 1PUJA 2VZEA 2WBLC 3HWSA 1CE8A 3DE7X 5DCUA 3TLCA 4PINA 1GSAA 1AK9A 1JDZA 1SVWA 3FDJA 4KFSA 4M1MA 4WJKB 4FT2A 2ID9A 2NZUG 3ZGNA 4WQMA 2V9CA 4KN5A 3K0BA 1RMTA 3UC5A 3PI7A 3QBVA 2HXGA 4FDMA 2BGRA 3F6SA 5AJZA 2TMGA 4FD3A 4UBOA 4BO7A 3WYFA 1WVIA 2GN1A 4L5CA 1UKEA 4D8XA 2ZRIA 2H4YA 4C0AC 3QA3E 4D9KA 4TS3A 2PXAA 4FCTA 3ROGA 3GIWA 1Z73A 2RH9B 2ZSJA 4Z7JA 5D6NA 1YQ9A 3C87A 4QC2A 5JEDA 1SCKA 4R7TA 1Q3TA 3GPLA 2L19A 3AILA 3HKDB 3VHRA 4AROA 2X3FA 3HRIA 4K6KA 4EJ0A 1I7NA 2ZU0C 4JKOA 2DETA 4QBHA 1EB8A 1BMTA 3LUPA 5FOXA 2Y9PB 2IZ0A 5F7OA 4KUGA 2A59A 1T91A 3EXHC 2WSYB 5HILA 4BLQA 3B12A 2AMYA 1R0ZA 3FUWA 3KZNA 3PYXA 5EJ6A 5IDWA 2ZI9A 1WAMA 4IV5A 1Q1NA 3I1JA 2DLDA 2DTEA 4LA4A 1EG2A 4M6WA 3LPCA 4R1QA 3UK0A 4AZTA 5C4IA 1UT6A 2P9QA 2E4XA 1JTFA 5EKUA 4D98A 4L9SA 4TUYA 3CUSA 3WMGA 3CT6A 4HN2A 4ES6A 1QXSA 1ZLYA 4NCAA 3NDIA 1KK2A 4UMVA 1HZZC 3V34A 2J46A 2RGXA 2VJPA 4DMUB 3A3NA 2CXOA 3LE8A 2W6MA 2H5JA 5EINA 1ZHHA 4E15A 5J23A 1Z36A 2FZGA 3PENA 4HV4A 1ZD5A 1X2BA 4M60A 3KZMA 2OG1A 2HGSA 2QVCA 2B8EA 2KS6A 4PTZA 1ZRSA 3IAS1 1A3CA 3O1JC 4Q02A 3B3AA 3ZWMA 2IEAA 2EAUA 3GG2A 1OXXK 3FJOA 1HA3A 3OCVA 3NV9A 2WFAA 2WJHA 3T7KA 1YL7A 3EN0A 1DRUA 2OFXA 3OOEA 4UDXX 4TGLA 1NVVR 1TYEB 1YV9A 1GRVA 3GBVA 5CVJA 2YVUA 4DN6A 4OFXA 5AWFC 2IZOA 3ADPA 2E4YA 5TX7A 3WBBA 1V8PA 1R4NA 3F5FA 4ZGWA 4OXIA 1CS0B 2OWDA 4NC9A 4AJNA 1CKEA 1R5NA 4ZANA 1C3OB 3EIFA 1KFEB 1WCV1 3SHOA 1C7EA 2IYOA 1TLTA 5ALYA 2WNIA 3PGJA 4FFSA 1ZR2A 3RBXA 5AW0A 3LZDA 3ZDYB 1IE3A 3IEIA 3HS3A 1RTKA 4MP8A 2AD1A 2EP5A 1TZKA 2ZUWA 3B7PA 3FNGA 3IV7A 1EIZA 1C3JA 1FNCA 2G07A 1JLKA 4LBYA 3S1AB 3TIIA 2I80A 5B4TA 2KLBA 1JJIA 3L4BA 2INGX 1L4YA 4MJ7A 2B7BA 1GPJA 2OKGA 4YUXA 4I4CA 4UOZA 4XDGA 1YC5A 3R7LA 1P4JA 1ANKA 1J33A 3JYHA 2FJ0A 3ESDA 2MSDB 1EGHA 1ZOLA 1KJNA 3A25A 5DDIP 4KVGA 2V03A 1XTRA 3HR7A 4MRPA 2PUCA 2XBLA 1ID8A 2P91A 1F4VA 2QHXA 1D4ZA 4C2AA 1QGZA 1X0XA 1FVOA 1I7LA 2GN0A 2I1WA 3P8ZA 3Q9UA 4KE8A 3U4HA 4Y0VA 4PZYA 4BQNA 4RZUA 2O1XA 2QZJA 1FTNA 3ROTA 1NG1A 2E5FA 3V7WA 2RGAA 3HC7A 1DIOB 3UHPA 3WGUA 3PGLA 5G0WA 2GM3A 3OLWA 4Q3CA 4LGCA 4REQA 2OORA 5TMDA 1QIFA 2PGIA 3UC9A 1JIXA 4CMIA 4DKJA 3TAXA 1KJ8A 3AESA 3VR0A 3QMWA 1UZNA 4CJXA 3NUGA 2UZIR 1R6TA 2EQAA 4FQ8A 4EB0A 4YRCA 4YDQA 4BNNA 2B4RO 4FS8A 4B3XA 4ER3A 4YRGA 1RRKA 4IOJA 5HXAA 4KE7A 3H8SA 3C3JA 3GFTA 1XTBA 3W5BA 5AVZA 1HKUA 5KOHB 1SZJG 5AK3A 3ZY6A 2I54A 5JISA 1YJQA 1AA6A 4I8DA 1TJ4A 3SYLA 2FWRA 3U4QB 1ISSA 5LZ7A 4AS3A 5LQKA 1QO0A 1QKJA 5MGNA 1MX5A 2O4UX 1G20E 3ML1A 5ITZB 2BUBA 3VRHA 4M9UA 1SQFA 1YMQA 3WRWA 2LZ0A 2QX8A 4JR1A 1IRXA 4KBFA 2OYRA 4DMCA 4KNYA 4FNMA 3BKWA 3DZBA 3MGBA 1BWRA 3PF8A 2IXEA </