5A0FA

Crystal structure of yersinia afp18-modified rhoa
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
178
structure length
178
Chain Sequence
AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords TRANSFORMING PROTEIN RHOA
publication title Tyrosine glycosylation of Rho by Yersinia toxin impairs blastomere cell behaviour in zebrafish embryos.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5a0fA00
5JEDA 3U7FB 2ODBA 3GFTA 4DIDA 3AF1A 4YONB 3AM1A 4C2UA 2C78A 4M9ZA 1PJRA 1CR0A 2E9SA 4IKEA 1KAGA 4KVAA 5EXTA 3KL4A 3UK6A 1DS6A 1U81A 2EYQA 2JJ8A 2VF8A 4P4UA 2Z0MA 3CW2A 3A1WA 1N5IA 2D3WA 4MDEA 1JEDA 3NBZC 5KUTA 4A4DA 1EFUA 3PEUA 221PA 2GILA 4LJ9A 1IY1A 3VHXA 4PC6A 4BEJA 2XSZA 3GLHB 3S1AB 1ZIPA 2EQBA 1G8YA 4QHSA 2XB4A 1CTQA 3SYLA 4O0MA 1X1SA 3FMOB 3U3OA 5CK4A 4EFLA 5DI3B 3LY5A 4TMVA 3EAQA 3CRRA 1J70A 4DEYA 2O8BA 2ZJ5A 2NPIA 1SVMA 4ITRC 5DE3A 5FPYA 3TNFA 4LX0A 4EPTA 4L15A 4NDZA 5KSPA 1I2DA 3ZVLA 3F0TA 1S3GA 3AKDA 3PEVA 5ELXA 1SHKA 4GZLA 5BW8A 3K0AA 3HR8A 1D2EA 3LV8A 5LD2B 5F98A 2WPDD 2VHQA 3HWSA 5HCIA 4XVQA 3SFVA 3U6KA 1U94A 3QXHA 3UG6A 2IC5A 4LC0A 2IYRA 3QUSA 2AXPA 4PPGA 1W4AA 4JS0A 4TL9A 1TF7A 4HLUA 5AUOB 2REOA 2REBA 2ZUBA 2QY9A 1WDTA 5H68A 1RRPA 3ZZ0A 4LPKA 3CH4B 1GL7A 3CBQA 3DDCA 4G5GA 5FTJA 2BM0A 4D4KA 5KO2A 3TUJC 2XAUA 4RD1A 1Z6TA 1HQYE 4CEHB 2HCJB 4B47A 2QNRA 4NMMA 3SHWA 5CM9C 1FP6A 2WSSA 4PSKA 3LRPA 2AK2A 2KE5A 4JLAA 4QRHA 4HSEA 4CEHA 4LJ6A 4HAZA 5FUVA 1DBSA 4BLQA 4Q5IA 1KSGA 5L3SB 1O87A 2C9YA 2OCPA 5P21A 3ADCA 2H8KA 1ZUHA 2BJWA 3MFYA 3ADDA 3K9LA 2ZS8A 2A78A 4X8MA 1KI7A 1U0JA 2VSOA 4C30A 3KQNA 5KNCA 1FQKA 1T8UA 1NVVQ 3IO5A 4PHGA 4W7SA 3NG1A 2BMDA 4FWTA 2EYUA 4BZQA 1OH8A 2CCKA 2G0TA 2MMCA 4IVRA 4AG6A 1UBFA 1II9A 4IEIA 1TU4A 2P2LA 1JBKA 2H16A 2ZS7A 1G7SA 2WAXA 4MYTA 2GA8A 3OFNA 5JI3E 5JHGB 1TQ4A 3B6EA 4PSAA 4BFUA 2C77A 3JZMA 1DADA 3K0CA 2VPPA 4G5SA 5AWFC 1VDZA 3BFKA 2P6NA 1LS1A 4LYJA 1TQ2A 5GJWC 3O8CA 2XITA 4P4SA 3ZS9A 3M4YA 4UXHA 1E9AA 3KUDA 2OCBA 4TTRA 4Z1MD 3BB1A 4OJKA 5FPTA 4LYAA 1YR7A 1T0JB 2J1LA 3TH5A 4AYXA 1VPLA 3NBFA 1XZPA 4QHTA 2B7CA 2KJQA 4XVRA 5KSYA 5FPHA 2ATVA 3U6BA 1GL9B 2OUKA 2B92A 3BB3A 1YQTA 4QM6A 1KNXA 5DIFA 5G3ZA 5AUQA 4E5UA 3SJAA 1OIVA 2YNMA 4DB4A 1T91A 4LSGA 1YZTA 4GP6A 4OBEA 4DDVA 5IK2D 2GZHA 2OAP1 4DLWA 2IT1A 1WBBA 3RAPR 3KUCA 4NCNA 4JL6A 4YMUA 2QP3A 4XSHA 4D4JA 1KNQA 2W58A 3GQBA 1WE2A 2J7PD 4CEJA 1X3SA 2JLRA 2Y8EA 4LHZA 3L82B 4NCKA 1JEEA 1ZJ6A 3CX6A 1KJZA 1Z22A 1P62B 3AF3A 1KO7A 3CIOA 2NO9A 1XCGB 2GK6A 1ZUNB 2OILA 1I4DD 4B34A 2WKRA 4KLNA 3P27A 3QI2A 3UANA 1Z6YA 3DO6A 4UXIA 3VR6A 4NZYA 3FYHA 1N3BA 4E07A 3QVVA 1P6XA 3LBHA 2QAGB 4C0QC 1XTRA 2IUTA 1GDDA 4KAXA 5HR5A 3Q9LA 2HYDA 3LBIA 1OH5A 2FEOA 4LGMA 5B64A 3QSYA 2G1JA 4RKFA 3U4QB 1LTQA 1OF1A 5FBLB 4Q19A 5FOSA 1HEIA 2CCGA 3LO5A 1ZINA 2JJ1D 4WAUA 5BQ5A 1AQUA 1ZNYA 2GK7A 3L2OB 1XPRA 1Q1ZA 1KI6B 1U8ZA 4EPYA 2ZUCA 2UKDA 3SZRA 4EQ6B 2GAOA 1G4UR 4OQNA 3MJRA 4Q7JB 3TGPA 4LPSA 2WWXA 3A8TA 1E9BA 4KI0A 4QC2A 4WXRA 1E9DA 1HTWA 1D9ZA 2ZJ8A 3HU2A 3NH9A 3QF4B 3NEYA 3RLFA 1XMIA 1W7AA 2DPXA 2YZ2A 1MO6A 3ZZTA 2YC2C 4Q4HB 1Q12A 2C99A 2ZVQX 3QF7A 4Q02A 1RJ9B 4NYJQ 2ZRPA 3VR2A 4OL0A 3QF4A 1GP2A 3DEFA 3HDTA 1ZC4A 4DSUA 3GJ7A 5JHHB 3SI7A 3OEHA 4JLDA 1NN3A 1RJ9A 4EPRA 1G3IA 3K9GA 1OXSC 3PENA 4YDSA 4EPVA 2R6FA 1JB1A 4FI3C 3V4RA 4YMSA 1IAQA 1NF3A 2WWGA 2WIBA 2YVUA 3NC0C 1QG4A 1KI2A 5SZHB 1P7CA 4RD0A 1HQCA 2WKPA 5SZKB 4A1FA 4Q01A 5L3QB 1Z07A 5AJZA 2R62A 3HU1A 4NCIA 2GBLA 1U90A 5EXSA 2W6JA 4PR0A 4MYUA 1MOZA 1KDRA 3QKSA 4HLCA 3FTQA 4ZV4A 2QI9C 5TXGA 2LCFA 2QE7D 1R2QA 3B1WA 3LW7A 1IBRA 2FN4A 4OYHA 1NJFA 1B0UA 4M8NE 1R5NA 3LVQE 3B1ZA 3AB3A 2PCLA 1OFUX 5KPJA 1EWRA 1NP6A 1P9WA 3B1YA 4CEIA 3R8FA 2K5UA 2OHFA 4Q4JB 3ZIAD 2WOJA 3EG5A 1FOEB 2V7QA 4F93B 2XZOA 1YKSA 4U7DA 2HYIC 5J40A 3AF2A 2H57A 1Z08A 1KJWA 1KI4A 1B23P 4DLTA 3HPRA 5FFMA 2O0HA 1Q1QA 2BCGY 3T1QA 3O8RA 3AVYA 2ZANA 5E7JA 4Q4JA 1M7HA 2ZRLA 3B8HA 2GCNA 1KDTA 2WICA 1Z6AA 4DVGA 1H8EA 1TF2A 2X1VA 3SFZA 1YR9A 2B7BA 4TSFD 3SEAA 4R7ZA 2Q21A 2XZPA 3PXGA 4CF7A 1TTTA 1ZUIA 1WBDA 4BQSA 3RHFA 3QIAA 3ZZUA 3N5CA 2ZRHA 3HP1A 1SVOA 5J4YA 1N0VC 1R4AA 3FGNA 5HKKD 4IVPA 1BOFA 2QBYA 3RS0A 4D82A 3C7KA 4M1OA 3THYA 2VH5R 3KQKA 1PLLA 2FSHA 2HJGA 4DSTA 3AVQA 3NC1C 1WF3A 1OT3A 4A36A 2R8RA 2IS1A 1DTSA 4KJZA 4UNSA 4DIEA 3MWJA 1RPZA 1W36D 3EPLA 1GAJA 2XNDD 1PLJA 4GRAA 1Y3AA 2FSGA 3DOEA 5DH9A 4LJ4A 4EFMA 1Q1BA 2CE7A 2VP0A 3W90A 2FWRA 5EXXA 4A0FA 3R9WA 3CM0A 3T1OA 5DSZA 1E69A 1XNJA 4A0RA 4KFUA 3ZD6A 3FVQA 4CT5A 2GJSA 2WAYA 2CHGA 4RCZA 4F92B 1T6NA 3PCRB 5FL3A 4IDNA 1GNRA 3X1XA 1HT1E 3P26A 4KYIB 1EFHA 1M7GA 1G8FA 3TRFA 3NKVA 5LBIA 3Q7QA 2C8VA 1W0JA 3JVVA 4LHYA 2ZJBA 3T34A 3I3SR 3P20A 3B5JA 1UKVY 2C98A 2IYYA 5EE3A 4YLGA 2GJ8A 1RRCA 1YHNA 3UMFA 4NE2A 1JQLB 1CF4A 3HYTA 4X8HA 5C4GB 2MSDB 1NLZA 1RYHA 3GJXC 2XSZD 4BLRA 3RWMB 3VHLB 2BKUA 2MSEB 4B3XA 4K46A 3VR3A 2G9NA 1GILA 4M53A 3W34A 2ORWA 1V5WA 3P32A 2FPLA 4YMTA 2ZJYA 5AUPB 2PJRA 4W5WA 4NH0A 4HAXA 5D3MB 4DSNA 1G3MA 5KDOA 1L4YA 4UKDA 3VAAA 4NYMR 4JYBA 2ZM5A 5CLLA 4DCNA 1IJFA 2LKCA 1E2FA 2Q3MA 3C8UA 5GVRA 1XCMA 3RNLA 4ESHA 4PC7A 3GLGE 2BMFA 3GCGA 1GRRA 1OH7A 4FN5A 2GESA 2CHQA 1D9XA 2WJIA 1WQ1R 1XPUA 2WWFA 3KTAB 4QBHA 1F2UA 5K8LA 2EWVA 3NIBA 2O8FA 4PO9A 3LQQA 1ZNWA 1S0UA 4L9SA 4BGDA 1AGPA 3NDPA 2FGJA 2NMVA 2DCUA 4Q18A 3RWOA 1ZM3A 1IN8A 2P5TB 3FB4A 4OQLA 2JLWA 4AI6A 4JLPA 2OE2A 4LBZA 3UKDA 2D2FA 721PA 4L8GA 1E94E 2ZRJA 2WMNB 3PVSA 5FPSA 2BWJA 1DAMA 2DFTA 2CJWB 1UFQA 1VG0B 3K53A 2RB4A 3OF5A 4RZ2A 1JAHA 2GRJA 1RRGA 2QUZA 2OBMA 2EWWA 4BEBA 3W6OA 3RS3A 2CBZA 2ZXUA 2A5GA 2QMEA 5FR2A 1A2KC 3IIKA 1NN5A 2VSXA 4HB2A 2CJWA 4LK2A 3ETLA 3RC3A 5JS7A 3OHMA 4XOIA 5KYKA 3KQHA 1VG9B 2IA5A 1IQPA 2QSZA 2ZAMA 3AKYA 4OKSA 5CJPA 3SYKA 3ZS8A 4XWKA 2JCSA 3SS8A 1Z0KA 4V0MA 3NWJA 2ZRFA 5J5CA 4PQFA 3PEYA 4DKXA 4N3NA 3OIWA 2ZU0C 4IFBA 1X8LA 4A15A 2D7DA 2PX3A 2VTKA 2OCAA 4GOKA 3U7GA 4QGFA 3PFIA 2Z5FA 3EC2A 4BLPA 2Q6TA 2KBFA 1NN0A 3ZJYA 5LB2A 1SVLA 5CIWA 3AUYA 4JVLA 3ND9A 2RGDA 2RGAA 1MT0A 2W0MA 1Z28A 4Y0VA 3TW8B 5TMPA 4HI0E 1GRNA 3EIQA 1EESA 3OFND 5CB8A 4AKEA 4Q1EA 1UKZA 2B21A 4LBYA 2A7QA 2NQ2C 4O2LA 3RVBA 1PV4A 2VEDA 3CNLA 2J45A 4BFXA 2FMXA 1R8QA 1W0KA 3ADKA 5JBQA 2VLIA 2A5DA 4IVQA 4P31A 2IUSA 1Z2CA 2RCNA 1TQDA 4D80A 2NOAA 4NCJA 1FQJA 2AK3A 3BH0A 3GJ0A 4HB3A 2IYXA 4QKQA 2O8DA 1E98A 4Q7LA 2JEOA 1ZCAA 3BBPA 4A8JC 1DO0A 2ZJ2A 3T61A 2FEMA 4MGZR 3KXIA 1R0XA 2V1UA 2I1VB 2G1KA 1H8HA 3SN6A 1EX6A 4V0OA 4MKGA 2DBYA 2H1LA 5EE9A 5J4KA 4G1UC 1YZQA 1JPJA 4Z8XA 2HT6A 3A4LA 3VFDA 1AQYA 5BYKA 1KKMA 3N2EA 2WVJA 4XTCS 2MMGA 4MGKR 4RVCA 2IWRA 1AIPA 2BEKA 4V02A 4QL3A 4Q1BA 3TW4A 5FTLA 3M6AA 5JFGA 2ZRCA 2C95A 4B33A 2IL1A 1P9NA 1C1YA 3BE4A 4DJTA 3PUWA 4RZUA 3EC1A 3U44B 3CF2A 1DELA 5A0FA 4LBVA 3K70D 3IGFA 3EASA 3OAAD 1VCOA 1BYIA 4RZXA 1E2KA 2P0EA 4Q4LA 1FPMA 4B44A 2AKYA 4PFSA 3CR7A 3FPAA 3U44A 3BXZA 1S8FA 2NO0A 3H2YA 3I61A 1ZU4A 1CEEA 3AEZA 1S1CA 1XEXB 1MO3A 2J3EA 2HLDD 2R9VA 3AH8A 2NG1A 1NSTA 4FIDA 1T0HB 2QAGC 4HDOB 4MYCA 4TYPA 3CONA 3R7WB 2X8AA 3BFVA 3ZGXA 3AV0B 3WNBA 1XZQA 1ZM4A 1SXJA 2JIZA 2ONKA 4LHWA 1XEXA 2GVZC 3QXSA 2HEIA 2V4ZA 3AVPA 2HF8A 2V55B 1ZVQA 3R7WA 3CF6R 1YE8A 4BRUA 4ERNA 5JJKA 2GXSA 1KSJA 1XD8A 1ZU5A 1TL7C 4HLQB 4TLCA 1N6OA 2CLDX 1E0KA 1G291 1XXHA 1U9IC 4QGGA 4RCYA 2O8EA 3WNCA 3RSOA 1IJEA 1SQ5A 5C1BA 4DLVA 4OQMA 2EFEB 2E87A 3ZVMA 2J0SA 3HR7A 1UBGA 2OG2A 5KDDA 3WP0A 2NO6A 4DCSA 4ARZB 3N70A 4ZPXA 3CR8A 2NZJA 4PPNA 2IYWA 3DZ8A 2R6CA 3PV0A 5KSZA 4PO1A 2QA5A 1Z06A 4URWR 4M9QA 1XCPA 4D2IA 1FX0B 4DLSA 1J2JA 1QF9A 2RHMA 2L0XA 3HPQA 4U5XA 1NBMA 1S96A 4L5BA 2W6JD 3QVUA 3CWZA 4RD3A 1T9HA 1XEWY 2QMOA 4HB4A 5FUWA 1W4RA 1FX0A 1P5ZB 4YMVA 2C9CA 4DCTA 1U8AA 1JAIA 1W44A 2H18A 2J7KA 3MD0A 4KFTA 4XTRA 2ASEA 3C5HA 3LD9A 3VX4A 4RFSB 4LV8B 1JQJC 4QOSA 2OSBA 1XX6A 4JMPA 4W5JA 1K6MA 1G5TA 4JLVA 3CKLA 1F2TA 2XEXA 2O0KA 4IOMA 1CR2A 2JLQA 3FKSA 3QG1A 4NCHA 1FUUA 2V7QD 4KODA 4MKIA 2G3YA 1FNMA 3QKRB 2ZQ5A 2WKQA 4PPQA 1Q44A 1AGRA 4BE7B 3CWQA 1I4LD 1XWIA 2ORVA 4IDPA 1ZP6A 1UADA 2RGNC 1KK1A 5JEEA 3BAFA 1H8ED 3A6PC 3EX7C 1DEKA 4D25A 4LYHA 1XXHE 1R5OA 3L8ZA 4I1SA 4M1TA 4Z8YA 3NEJA 1MABB 4IRUB 3B9QA 5JRJA 3EZFA 1OFHA 3IPXA 5J4LA 3ZVRA 1QHNA 5FOXA 2GXUA 5TARA 3GLHA 3S1AA 1RYFA 4N0EA 3TE6A 1E2EA 1JNYA 4HAUA 2J9RA 2ZSAA 2VF7A 2X2EA 3TUIC 621PA 1VYVA 4JLNA 4MRVA 3NBXX 2Z6VA 1G7RA 1COWA 5DI3A 4DRZA 1DAIA 1E2DA 3FFBA 4KBGA 5KPDA 2QU8A 4GI7A 4CT4B 2BDTA 2MSCB 4DHEA 4DWJA 3J81k 1NBME 4TLEA 1CS4C 3A58B 5EE5B 1SHZA 4Q03A 4HUTA 2Q3FA 2Z4SA 3MAAC 1QHGA 2IHYA 4TT3A 1E0JA 2WWWA 1CJUC 3QKTA 4OQFA 1Z5ZA 3IDQA 3WY9A 1WA5A 2ZS9A 4GOXA 4MQBA 2PL3A 1TPZA 2QMUA 2OLJA 1P2TA 2QP4A 3KDSE 3QXCA 4ZI3A 1XBTA 1E1QD 1G8PA 1ZD9A 2GEDA 4MH0R 3TAUA 1GTVA 1GWNA 1KI8A 1Q20A 4GP7A 2W2VA 4XSGA 2C04A 1EWQA 3U3RA 1LNZA 3KFVA 5DO9A 1TAGA 3W5JA 1US8B 3X1ZA 2OLKA 4A2PA 4JT4A 2F3RA 2Q0HA 1Z6GA 3DVLA 1W0JD 2EFGA 2ANBA 3DM5A 5IDVA 2ZE5A 1US8A 4H1UA 4TQAA 2F1RA 2V1XA 3VTKA 3ZDQA 1WMSA 2ZRBA 1XTJA 1J99A 1UF9A 4BLTA 1XTIA 1Z0FA 1QBKC 1GKIA 3NBYC 2GETA 3L0SA 3BIFA 4G0NA 4NPHA 1E0AA 5AJVB 1RW4A 2PCJA 3CRMA 5L3SA 1J7KA 4I4LA 3TK1A 1SULA 4BLOA 1G7CA 3QENA 4TMZA 3OEEA 1EX7A 4IXMA 5LDDC 2IF2A 2CLSA 5F2EA 2FDCA 1VECA 3MWLA 2FA9A 3V00A 3W8RA 1U99A 2GCPA 2A5YB 4IOKA 4PTLA 2CL6X 5UKDA 1QHXA 3QPUA 5FTMA 4MKHA 4KITB 4DUGA 5HZKA 4A0HA 3TAHA 4D26A 1KO8A 2V6IA 2ZJZA 2J0UB 1P61B 4M21A 1BO6A 4S35A 3IEUA 2GTPA 3WRXC 1GM5A 2ZYWX 3A1UA 4KLZA 2W6ID 4LJ8A 4A8JB 1FMLA 2J0UA 1G3QA 3B13B 1KK2A 4FW9A 4AY2A 3KKNA 3Q5DA 3Q5EA 2DWQA 2IYSA 1P2SA 2VP9A 1WP9A 2ZSEA 1HE1C 2I3BA 1OB2A 4A8JA 1SGWA 1VYUA 3BWDD 2ZI3A 2A5JA 1NIPA 2HUPA 4WIAA 2NPFA 2PMDA 4DDUA 5HPYB 5FH9A 4OJQA 4AURA 4CW7A 3P4YA 1MO4A 4Q1DA 3U3JA 1R0WA 3AF0A 4YDHB 1FL9A 3Q85A 3QG5A 1OW3B 5EZ6B 1G19A 2DFNA 1N6HA 3H84A 4KSBA 1GOTA 1UDXA 4LHVA 4PXAA 4B2LA 3AVTA 5EJEA 1ELOA 4DXAA 2QGZA 2WV9A 1X6VA 1JR3A 1E2GA 1QG2A 4DCVA 1P72A 2IS6A 4KVGA 2A30A 3T5DA 3IKJA 1CJMA 3I32A 2ZR9A 1OYYA 1DAFA 1G18A 2RGGA 4EPXA 4NL4H 1G6OA 3UMSA 2YKGA 5F9HA 1JJVA 2QSYA 3BH6A 4M1KA 3FMPB 4QBGB 4AYTA 3TUZC 5G3YA 3MWYW 5B57C 3QQ5A 2YC4C 4CGZA 4LV6A 4Z51A 2H5EA 4PPFA 2X19A 4DBLC 1KO5A 1Z29A 1XDBA 3OESA 2DFLA 3QEOA 2QAGA 5TB5A 3R9XA 1KMQA 2QAJA 1J8MF 2VHCA 2EVWX 1VMAA 4BFWA 3QE0A 5HZHA 4JLJA 3KQLA 3U4QA 3OE7A 4PAQA 1QHYA 3SU8A 1CLUA 1W0KD 2JASA 4DLYA 4QNMA 3U7EB 4UJ3A 1E79D 1JR6A 1KI6A 3F5FA 4MRPA 2OFOA 4NU0A 3VU9B 2ZR0A 3I8XA 4EQ6A 3K9NA 1U9IA 4B3GA 4P3YA 3CZPA 3I72A 4M4SA 2P6RA 1A1VA 1Z47A 2GDJA 3DOFA 2VRWA 4Q4HA 1UEIA 4TL6A 4NYIR 4C0BA 5IT5A 4FINA 1H8HD 2VHUA 4CIDA 5EP4A 1JJ7A 2GF0A 3I1FA 3LX5A 5SZIA 4WZ6A 4LOAA 2UZIR 3EZ9A 1LF5A 3G5UA 4I1OA 4O25A 4HYYA 2RHDA 3O8DA 2WSMA 3QXXA 4M9SA 5HTKA 2XTZA 1Q57A 1KJYA 3GJ8A 1AS2A 1JR3E 1N6KA 1AA9A 2OBNA 2ERXA 4Q21A 4Q66C 5L3QA 4TYNA 2YYZA 2QN6A 5KTYA 1HURA 8OHMA 3VKHA 3D3QA 3NXSA 1ZIOA 2R6GA 2OFXA 1N0WA 3IBYA 4FCVA 4V0KA 3KKMA 1MH1A 3UXMA 1AKEA 1J90A 5F9FA 2E1RA 2F9LA 2XJ9A 2G88A 4RD2A 3V4FA 1R0YA 4V0NA 4B3CA 1Z8FA 2WWIA 1FP7A 2VHJA 4KBFA 1UKYA 4DLRA 1SXJD 1CJKC 2WMOB 1XFAA 3DKPA 3VKGA 3KJHA 1C9KA 2AFHE 2OO7A 4BZXA 1XU4A 4XJXA 5FUXA 4OHWA 2QGNA 3A1VA 3T5GA 1KAOA 5FL7D 4JVNA 4MRRA 2RGNA 2IWHA 4UNPA 3UG7A 1NKSA 3L0IB 3I4LA 5JWHA 1E9SA 1RFLA 2PT7A 1WB9A 2A2ZA 1KZ7B 4FMDB 4DT1B 1Q21A 1N0UA 1W49A 4HAYA 2GKSA 2QT0A 2D2EA 1N6RA 2REXB 2CMKA 5DYGA 4OQXA 4AD8A 3GFPA 4TYWA 1HYQA 2QL6A 3W3AA 4HATA 4YC7A 3FWYA 1X8KA 3CRVA 1KI9A 1G3UA 4R9UC 1OE0A 1EFRA 2V3CC 4B32A 4R98A 4FXPA 3REFA 4BLSA 2FFAA 4AKGA 3KQUA 3A37A 1XD9A 4IOJA 1NBMD 3GLGB 2DHRA 3EW9A 2EW1A 2GJAA 1HH4A 1XMSA 1XP8A 1TMKA 2JLYA 1AS3A 4M1MA 3I8SA 1IXRC 4LC1A 3IBGA 3AVUA 1NMXA 2YOHA 5FUYA 4BASA 5EE1A 5A4JA 3ZH9B 1JECA 4GL2A 2JATA 1FZQA 2QENA 5E95A 1S2MA 2UZ3A 5EP3A 2XX3A 3GEIA 2G83A 3Q8XB 4MA4A 4PC1A 3RS4A 2GZDA 1XJ0A 4PAMA 4FWIB 3UATA 3K8YA 3T06B 1BKDR 4AG5A 4CDGA 2IK8A 2XB2A 3FKSD 1L7VC 1G17A 4ZKEA 4C2TA 1YR6A 5L8VA 5C2JB 4QG7A 1OXUA 3VMFA 1KO4A 2UVQA 5KNBA 1E32A 2GVDC 4GNKA 4D81A 2JLUA 3VNVA 2SHKA 1XF9A 3A4NA 1DG3A 1G8GA 2ODWA 3EPKA 1IXZA 4KU4A 3KKOA 3GLIB 5FOVA 1Q1EA 2BCJQ 2F1HA 4YMWA 2OAQ1 3GLFB 1BMFA 1XRJA 3HJNA 3K0EA 1SKYB 3IILA 1ZAKA 1SZPA 3B1VA 4LJYA 3VR4A 3UPUA 3RS2A 4B2PA 2GJKA 2J46A 2V6JA 4C3ZA 3GLIA 3ZD7A 1F5NA 4WXPA 5J47A 4B71A 1E2QA 4CRWB 5JCZA 5CITA 3GLFA 4O3MA 1S4QA 1T5LA 2AXNA 4QGHA 4BFYA 4B74A 2F7SA 1ZD8A 2XOKA 4NTZA 1KMHB 3B78A 1NMZA 3K9HA 1CJTC 1G1MA 5GVSA 4H1VA 4WZAE 4Q1FA 5D3MA 1A5TA 1LS6A 3WP1B 4D0GA 2HJVA 4GT1A 4A2WA 4G5QA 3THWB 1PLKA 2WBLC 5DGXA 2XZLA 1LVGA 2CXXA 2FPMA 1P75A 1Q0UA 1UJ2A 3MLEA 3O47A 3QXJA 5DLQC 2QP9X 2BHRA 5CIQA 1LFDB 1KK3A 1OPXA 2XJ4A 1VCMA 1M1YE 3UWKA 3MSXA 2YOFA 3FMFA 1BIFA 1NIJA 4TT3D 3KTAA 3A1SA 4WW0A 1JALA 1A2BA 4HLDA 4A6PA 2BBOA 3RRMA 3BD9A 2C96A 3LLMA 2KSQA 1DAGA 5H70A 4OHYA 3QKUA 3K09C 2RGXA 4I1UA 4TMXA 5CDFA 4B3DA 1E2JA 1RVDA 5TVKA 3WBJA 5JRZA 2QT1A 1NVVR 3EWSA 3M0EA 3FDIA 1IN6A 3FE2A 1VG8A 3IPYA 1TEXA 3NH6A 2RGCA 3L0OA 2C03A 3IQXA 4B6FA 1IN4A 1E2NA 2WSSD 5EE0A 1E96A 1ANKA 4Z1MA 3U2QA 4EJSC 1H65A 1NVXQ 1KIMA 3BC1A 3ND8A 4ZDKA 2BMJA 2QROA 4US0R 2P67A 4PHFA 1W5TA 4TZ6A 2WWYA 2ZE6A 2F3TA 4PZZA 1U0HC 4C4PA 2JLSA 1NSFA 2AWNA 4HAVA 4D4LA 1Y63A 4B73A 3CPHA 4TLBA 1G7TA 2AHOA 2QPOA 3AVOA 4QM7A 3LNCA 2AD5A 2R2AA 3KXKA 3TR0A 4EDHA 4P4TA 4JKIA 2ZPTX 5AR1A 2GEVA 3OEED 2XTMA 2F6RA 1GSIA 3AP2A 3Q3JB 1OLOA 2XTNA 1MKYA 2BC9A 2OBLA 2ZAOA 5A5GA 1OXXK 3C4JA 1S1MA 4WZBE 1E9FA 1OHHA 3NDBB 3CF0A 2BKEA 4DUGD 2PZGA 5BN5A 4PANA 3MGCA 1HV8A 4C7OB 4C9BA 3GEHA 2RGBA 4G5OA 2H92A 4B2IA 4ZCIA 3AVWA 2AX4A 4LBWA 5BN3A 1CR1A 3ADBA 1ZC3A 5H8WA 1ZNXA 2EFDB 2ZEJA 4R2IA 5AK0A 2FPKA 2DB3A 2D7CA 5C46F 3X1WA 2NO7A 4B6EA 3EWAA 1EFCA 1SVIA 3B1XA 2FX3A 1EFTA 1KYIA 3QNUA 4BFTA 3EIHA 1IOZA 4E22A 3L0PA 3K0CC 1LB1B 4TTQA 4LI0A 4N0DA 1UBCA 5CDFE 3U60B 2BMEA 5ANRB 4FD2A 4WBSA 5JS8A 4NP6A 4A2QA 1N6IA 1AZSC 1OSNA 4LJAA 4TTPA 1RRFA 3IIMA 1SVWA 4JLMA 2QM8A 2QQEA 1E9EA 4HAWA 4OK3A 1PVOA 4KFRA 2PLFA 5EZ5A 1G4AE 3PUZA 1KZGB 2WIAA 1E9RA 3X1YA 1Z0DA 3TIFA 5EP2A 1JR3D 1P4SA 4V0ME 1ZM9A 421PA 5FPKA 2IEYA 1AZTA 3BRWD 3D31A 3VX3A 1VCIA 4KFSA 1CXZA 4OHXA 2VL7A 1AJEA 3X1DA 5CB6A 1XD2B 1VTKA 3DKVA 3I5XA 1NG1A 1A4RA 2CL7X 2YV5A 3ZQ6A 4TYYA 1II0A 4BFSA 3KB2A 2FOLA 1N6LA 5FBVB 2QE7A 2H7VA 2OT3B 4KO8A 1TF5A 5DYIA 3TQCA 4L16A 5JJIA 2IHBA 1XD2A 1T3HA 1L8QA 4OI4A 4Q48A 5CM8B 2EFHB 5E4FA 3U7HB 2NO1A 5AJWA 1OB5A 4JBWA 2CVHA 2ZE7A 3OE7D 2VO1A 5JLJA 4HUQB 1QRAA 3CPJB 5KU1A 4ESVA 1GNQA 2G77B 2CLCX 4K81B 1HT2E 1NN1A 4XD7A 4NKRA 3W9YA 2IS4A 4TQ9A 4JJZA 3U3MA 5FR1A 3ZIAA 1MO5A 4Q7MB 4XWOA 5G53C 2WZQA 2FJUA 1S9HA 3EARA 4G01B 4TLDA 4D0NA 2FG5A 2IS2A 4OK5A 3IO3A 3MMPA 2BBWA 4GFDA 1GVNB 2VHTA 2FSIA 4K8OA 4FCTA 2ATXA 3OEHD 4DDTA 2Z83A 4TL7A 2CCJA 1E2MA 4Q9IA 4XH9B 1D5CA 4Q00A 3SJBA 4QFMA 3QJYA 4ARZA 4Q9LA 4BPBA 2D62A 2QQ0A 1DG1G 2WOOA 2IEZA 3DM9B 1J8YF 2HV8A 1OFIA 1TUEA 3PR1A 4OI0A 2XXAB 2YJTD 3SDZA 4IDHA 1HUQA 1JXMA 1YRBA 3TMKA 5FI1B 3I5YA 2D06A 4HZUB 1E3MA 1OKKA 4ACAA 3LA6A 2EU8A 1W36B 3WNDA 1E2IA 3QOFA 3WYGA 3G0HA 3KJEA 3WMEA 3OIVA 2KI5A 1G3RA 4LHXA 5JSZB 1U0LA 4HZUA 2YINC 4IHQA 4RD6A 2Z4RA 1GKUB 4LWZA 4RFSA 2ZUDA 4TMWA 1OIWA 3LXRA 3A1TA 3B85A 1FUKA 3W8NA 821PA 3REGA 4M9XA 3KJIA 2GXQA 3K1JA 1NKTA 2VP5A 4F7WA 2YHSA 3NHBA 5JSZA 1TX4B 2AD1A 5B30A 4GZMA 1SXJE 1TQ6A 1MV5A 2RKOA 3CNNA 4EPWA 4C0AC 3L8YA 1OH6A 6Q21A 4A92A 1T5IA 4ON9A 4EUNA 521PA 1GFIA 3QEJA 4TQUS 5J4VA 2O52A 4ACBA 1IONA 4NHOA 2DWOA 1N5LA 3OIUA 3QKRA 5FTNA 1G5RA 5CYOA 1NG9A 3WMFA 4AWXA 4GSYA 1G21E 3SNHA 3GP8A 4QJ4A 2ZE8A 1NVUQ 4FMCF 1M74A 4D4MA 3GJ4A 1W1WA 2FE4A 1ZBDA 2ZSDA 3LQRA 3CPEA 2AKAB 3PUYA 2BOVA 3E2IA 4ASUA 3P1JA 2NIPA 4TMTA 1MRSA 3ZYCA 2F55A 1MABA 2JJ2A 3AKCA 3AKEA 4JSTA 2ZYVX 3SC3A 4TWZA 2PT5A 2P6UA 2O8BB 1P3JA 3W6PA 1EFRD 4QBIA 4D6PA 4JVSB 1EGAA 2I4IA 1SVKA 1RKBA 5JECA 3I73A 3KXLA 4B3FX 1FNNA 2BV3A 3U61B 1ZM7A 3EZ7A 1P73A 4ZCMA 5DNYB 2IYVA 1X86B 3Q72A 4MUAA 1Q3HA 3K0AB 3RDPA 3G82C 3TKLA 2JLVA 3I92A 2D74A 2ZJAA 4US2R 1AN0A 3SBEA 1P9RA 1XJCA 2QRNA 3R20A 3AP1A 1BH2A 1VHLA 2QTVB 1U2RA 3CB4A 3NHAA 4JZKA 3WYFA 1TUIA 1PUJA 4GMXA 4M1SA 2ZI4A 3AF4A 3EPJA 4ZDIA 4EJSB 1DAEA 1ZW6A 3K09A 4IDOA 2TMKA 2ZI6A 1KK0A 2F1JA 4U00A 4OHVA 2JDIA 1IY2A 4PZYA 5CLQA 4M2LA 4B75A 5E3HA 4IJMA 3GPLA 3B82A 4ZCLA 1YR8A 4EJSA 4NYMQ 3FOZA 2J5XA 4JLOA 4B43A 1Z83A 5EUMA 3IIJA 2ORIA 2O5VA 1NLYA 1AKYA 5IRCD 1G8HA 2CK3A 2ZROA 1RE0A 1ESMA 2ANCA 4QHYA 2WJGA 1BMFD 5HE8A 1Z0IA 3EXAA 4WVFA 1OXTA 4QXAA 4C0KA 3PG5A 1F3OA 2BM1A 2XNSA 4GOJA 1LV7A 5H1YA 4GMDA 2QRZA 2FFQA 2P3SA 2ZRGA 2ERYA 5E7IA 2CVFA 1M6NA 4B76A 2FFHA 4AKIA 1IY0A 1T3SA 4PC2A 3GLHE 1G20E 1N25A 1CRQA 2XOKD 1E2LA 1KHTA 2HXSA 2DWPA 3FFAA 3DPUA 4JLKA 3U3KA 4R2HA 2AL7A 4ILEA 1VIYA 5FTKA 2Q9CA 4IFEA 2ZREA 5HCNA 3T1VA 5C18A 4LJ7A 2DYKA 2PEZA 3BGWA 1UM8A 5IF9A 1YVDA 2ZJOA 4TN1A 1EXMA 4MGIR 3ICEA 1KTVA 1G41A 2C2HA 3TBKA 1EK0A 5E7MA 1QDEA 2GXAA 1YZUA 2QG6A 2ZVPX 2WJVA 2I1QA 3SOPA 2W0SA 5GJCA 3TSZA 4C0LA 3DMNA 3MCAA 3O8BA 1Q3TA 1QHIA 2HDNB 2OXCA 3B9PA 4P4SB 5JJLA 1CP2A 3W6NA 1SVSA 1KI3A 1GRQA 3CUEF 4PX9A 4JL8A 3TSWA 4BZPA 3TVTA 2C5LA 3RSLA 3UIEA 3ZLJA 1S3SA 5TV2A 4OHZA 1K5GA 3H1TA 2H17A 1XB2A 2AR7A 2ZYUX 1G9XA 1KOFA 1Z0AA 4Q47A 5FBWB 1N6NA 3VKWA 5DHAA 3IUYA 4Q7KA 3AGPA 4IOLA 5BWMA 1FTNA 1NY5A 1W4BA 3BS4A 5CJ2A 5TDHA 3B2EA 1E2PA 3BB4A 3E1SA 2OESA 4P33A 4WOPA 3C15C 3BJIC 4FMBB 5EP1A 1AS0A 5CK5A 3AQ4A 3R9IA 4CEJB 1NL3A 3AUXA 3B60A 4IXNA 2Q9AA 4JBXA 4URZR 2FZLA 2Q9BA 4LY6A 4Q4AB 2J41A 4MDFA 4CYMA 4P0TA 3K70B 5AJYA 1T8TA 4GBMA 1R8SA 4PQYA 2BBSA 2PEYA 5C4MA 4TMKA 2IXGA 4EFNA 1FFHA 1OHHD 4G5RA 2P65A 1N2CE 1E6CA 4Q4AA 3N2IA 3LW8A 2PLRA 1VYTA 3M1IA 4MUBA 2QMHA 2IBMA 2ZU6A 3OAAA 4MGYR 4PAOA 4PHHA 2GAAA 4Q1AA 1DE0A 2FSFA 3THOA 3LH5A 1XJQA 4PQRA 1W5SA 2RAPA 1ZRHA 1KY3A 2W2XA 2N42A 3CRQA 3K0FB 2GNOA 3MG9A 3W3ZB 1EG7A 2CNWA 2X77A 3IEVA 2BEJA 3JZAA 5KOYA 2HLDA 1AM4D 5FBQB 3ASYA 2VA8A 3ZQJA 4C0JA 4KYUA 4IDQA 4Q9HA 4OI2A 3MJHA 2RH5A 3K0FA 1UEJA 1U98A 5K8UA 2V8OA 2IYUA 3VU9A 1E1RA 3WBKA 3I62A 2ZRDA 4OI1A 2QM7A 2OCYC 3LDAA 4M1WA 5KSOA 2VP6A 3TR5A 1KDPA 1KSFX 1XEWX 4QBFA 1U8YA 4UJ5A 1M2OB 3PUXA 2CE2X 4V03A 3RABA 1YZGA 1UKEA 3DL0A 1YU9A 3C5CA 1CR4A 2KBEA 2YWFA 4YQFA 2C9OA 1HE8B 3AVXA 2J59A 1IXSB 1FTSA 1UBEA 1YZKA 5JWOA 3X2SA 1GIAA 1P2UA 1ZM2A 4KXFB 4XVUA 4B3BA 4I81A 3LWNA 4DEXA 2GJ9A 4AK9A 3QPVA 2IYLD 3GJ5A 3H4MA 3QKSB 1CRPA 1CIPA 1KO1A 1TEVA 3FKQA 2J87A 5G40A 4YXWA 2A3RA 1ZCBA 4DC9A 5CYPA 3TVDA 1DARA 2IYQA 4D0LB 3EA5A 4DCUA 3K0SA 3BOSA 1NJGA 4TZ0A 4EIWA 3EIEA 1WXQA 4JVMA 1MR3F 2DR3A 3T15A 1NNEA 4Q9JA 1OIXA 4CEIB 4A9AA 3NVAA 1E2HA 2JIZD 1QHHB 2BIFA 5HE9A 5DISB 1JPNA 1Z6XA 1KKLA 1UPTA 4FCWA 4JKYA 2GZAA 1A82A 5DN6A 3SJCA 3FMIA 4RD4A 3IHLA 4HZIA 4DDWA 2B8TA 5M04A 2HCBA 4F4JA 2ODNA 4XD7D 2FNAA 4RZ3A 2J0VA 2NGRA 1QHHA 2F9MA 3DZDA 4BFVA 1DOAA 4I99A 2G6BA 4GPTA 1LF0A 1II8B 1SXJC 4BWYA 1Z3IX 1PUIA 3RRYA 3VR5A 4L4UA 5KHOC 4IW3B 2GEUA 5GJVC 2V9PA 4F4CA 1YJ5A 1Q22A 1QVRA 1R6BX 4PC3A 1DPFA 1NY6A 2X2FA 2DFKB 4POAA 3RS7A 4R71A 4G3XA 1II8A 2ZRAA 3C16C 2WJHA 1CBUA 3BFXA 4DT1A 2WHXA 3MRSA 1YRAA 4RKEA 4MRSA 1GZSA 2QBYB 1L4UA 2Z43A 5JZVA 3PITA 1T4GA 4QGAA 4Y0AA 3THYB 1E99A 3PEWA 2ZI9A 3GJ3A 2CEAA 1GUAA 1D2MA 4F91B 1V43A 1G16A 4MKFA 4QNRA 3W5IA 5EXPA 4A82A 5BN4A 3CO5A 3VQTA 1SKQA 4DLZA 3L43A 3A36A 2IX3A 4DLUA 5F3WB 2CHVA 4M0LA 5JCPA 2R6AA 4W9MC 1OKKD 1WRBA 5L3RA 1N5KA 3GLGA 4QJ5A 1GL6A 3UWOA 1QZXA 2HXYA 3AP3A 3BERA 3CRW1 1D8TA 4BUJA 1W47A 1W36C 4UNNA 2WPDA 3H86A 1TU3A 1IHUA 2A9KA 2BVNA 1G64A 4PSVA 2OFWA 4UNQA 3NTUA 3LX8A 4ZO4A 5FOWA 1GNPA 2HT1A 4LDJA 4MITA 1ZNZA 4C0SA 4BFZA 3KKQA 3BK7A 4LRWA 1XMJA 3R8CA 5IHPA 1X8JA 1E1QA 3PQCA 1GG2A 1OFTA 1W4CA 2ZETA 4AYWA 1VCNA 3WMGA 4B35A 2FZ4A 4MRNA 2ZSBA 3WXMA 3PJRA 2ZRIA 5J4HA 3KZ1E 3TSOA 4I1VA 2W83A 2AWOA 2LKDA 2QORA 4DLXA 2R65A 4XIGS 2ZTSA 2AFIE 3WHLA 1KGDA 4ASUD 4LCBA 5B2ZA 4M22A 1NLFA 1E4YA 2JJ2D 3D7MA 3RC8A 2ZI7A 2NZ8A 1COWD 1LY1A 1K8RA 2GF9A 1ZYUA 4E03A 3GEEA 4BRWA 2Q3HA 1ZD1A 1KMHA 4JIMA 1KY2A 3D8BA 3IQWA 1GITA 1Z2AA 5SZJA 3RS5A 5LPNA 1DVRA 1OJLA 2FU5C 3D6TB 2ECKA 4KCGA 4ZI2A 1BYUA 2PZFA 2OEPA 4EAQA 3AVVA 4RFVA 1F2UB 3THWA 1XMVA 1F6BA 1AK2A 3RYTC 4URXR 2O8FB 1IN7A 1MRNA 2ZIAA 3FHTA 3OZXA 5D3QA 4CVNA 4AKHA 1TADA 2O0JA 2W00A 4JSYA 4A0GA 3THXB 2WJJA 1NMYA 3KFXA 4FMCB 4PHTA 2CDNA 2VP4A 3QBVA 2W6IA 1XTQA 5LD2C 3LXXA 4L9WA 4B48A 4HLUC 4LJ5A 4MYHA 3EZ6A 1N6PA 2JDID 2OZEA 3LLUA 5FI0B 3SE0A 3CH5A 1RIFA 3THXA 1D2NA 4DB2A 4US1R 4V0LA 2VBCA 1S9DA 2F1IA 2IXFA 1R10A 1W2HA 2P5SA 3QPWA 4WA7A 2CK3D 5B58C 1QVAA 2ZRKA 4KHZA 3SQWA 1W46A 1VKJA 3F3YA 5IK2A 2ZITA 4S2EA 3WHKA 1NI3A 1PZNA 1X1RA 4IEEA 1T3LA 5GADl 5FOUA 3CLVA 3CZQA 2OXRA 1E9CA 3GLIE 1JXOA 2PBRA 5JI2E 3GLFE 1ZMXA 4C0HA 5LB4A 2J7PA 3GD7A 4II7A 1SKYE 1HY3A 1M7BA 1I2MA 2ONJA 4URVR 1F60A 1NVWQ 1OXVA 3WYAA 3T1TA 1P2VA 2AN9A 2YWEA 2ODEA 1ESNA 3KKPA 2JLZA 5FOTA 3WRYC 1M34E 3AGQA 3TJZA 2QPAA 2KB0A 1RC8A 3JVUA 4JLBA 4GDFA 4KSCA 4RSGA 2NTYC 5BXQC 3UMRA 5K8TA 1YZLA 2PH1A 2ZRNA 3P4XA 4LV5B 121PA 4X8OA 3SBDA 2O8CB 4AIIA 1DAHA 1A7JA 3T35A 1CJVC 4C7OA 4NBSA 4O2RA 2RGEA 4Q9KA 1VG1A 4ZKDA 4RJLA 1XTKA 3IHWA 2F43B 1R7RA 4N1AA 2JJ1A 1KDOA 4H9GA 4Z54A 3KJGA 5DHFA 1XTSA 4JL5A 4TLAA 2O8CA 2B6HA 2FH5B 4LUCA 2OV2A 2FF7A 3EPHA 3SJZA 2OM2A 2O8DB 2GHIA 3DHWC 3ASZA 1XEFA 3Q7PA 1DO2A 3QBTA 4UQOA 5DI9A 2F43A 2IUUA 2QPTA 1UAAA 3HYRA 1E79A 1VHTA 4XWAA 1Z0JA 2N46A 2W2TA 4M1YA 2JA1A 3BH7A 5FBRB 3V9PA 1E4VA 3FHOA 2IF0A 3TQFA 1CKEA 4HDQB 3EZ2A 1WCV1 1D6JA 4ZIRB 3KX2A 3CX8A 1CULC 2B8WA 4KV9A 2J0QA 2YWHA 5KNDA 2XGJA 1G6HA 5AUNB 4LYFA 1IN5A 3C41J 2G0NA 4AC9A 4ZIRA 4UXJA 1GKYA 3LFUA 3U5ZB 4ZDWA 1XPOA 5JMTA 4HDCA 4W5HA 3SHFA 5TY0A 2IW3A 4BECA 2JLXA 4JJKA 1YZNA 2R6DA 1QHSA 5AJXA 2VYFA 3MWKA 4LZZA 2D4HA 2QTHA 3GMTA 4NONA 4NYJR 1JI0A 3E70C 2PJZA 2R44A 2RMKA 3GFOA 2ZSFA 2WJYA 3K70C 4X8LA 3ONWA 4FMDF 4CZ2A 2LWIA 3ZVNA 1O3YA 2JAQA 4ABYA 3VNUA 2FV8A 3SQXA 1OYWA 2ZI5A 4NYIQ 1CU1A 1KSHA 3CX7A 1ONBA 3KB1A 5GJBA 1VIAA 2JGNA 2VSFA 2WM9B 3VR1A 3SR0A 4RY2A 1OV4A 1SXJB 3TLXA 4Q1CA 2GWHA 1R0ZA 2CNWD 1M8PA 2BBTA 1R5BA 2CL0X 1TNDA 3PIRA 4E09A 2ZRMA 3EA0A 5JWRA 3DMDA 3LVRE 4TL8A 4DZZA 3OIYA 4OK6A 4HB0A 2FGKA 2VP2A 4HEJA 3CNOA 4HUQA 2ZR7A 2YWGA 5EUQB 4F4IA 2FFBA 5G41A 4JT2A 1IM2A 1XXHB 1E1RD 2O8EB 2WWHA 3LAWA 3A4MA 1W48A 4EKDA 3FHCB 1LW7A 3C14C 2GCOB 3HU3A 5FL7A 1W2GA 4TSFA 4JYCA 1HA3A 2EFCB 3RRNA 2IYTA 4F38A 2WTUA 5KDLA 2IXEA 1P60A 4DSOA 3B7GA 1E0SA 3E5HA 2GCOA 5BYJA 2PMKA 4URYR 4UNRA 5HKKA 3GJ6A 5K8IA 4URUR 1G5PA 3ECCA 2ZYTX 2DY1A 2BJVA 1NRJB 1L2TA 3RANA 5L3VA 2YOGA 1BS1A 2XXAA 1F48A 3F8TA 1K5DA 2HF9A 3SYNA 4JBYA 1N5JA 3T12A 4TYQA 4QJ3A 2PZEA 4YXWD 2A5FA 1C4OA 1RZ3A 4P32A 1KI1A 2PX0A 1UDWA 2GBLC 4PZLA 4PO8A 5EQTA 3LBNA 2N1BA 2QTFA 4A6XA 2XNDA 3BORA 2IYZA 4J0QA 4U02A 3RRZA 1ETUA 3QY0A 1DAKA 3MUFA 1FMJA 3H0KA 1Z63A 1FW6A 2KWIA 3ICQB 2QZ4A 1F2TB 1I4TD 2VIIA 3PUVA 2V54A 1ODFA 2QEQA 2VQSA 4ZDJA 5DN6D
chains in the Genus database with same CATH superfamily
1DO8A 3GUZA 2ODBA 4O59O 4RENA 5I8WA 4YONB 3RIXA 5ALUA 5T4EA 2MOKA 4A8HA 4KK3A 3PGLA 5TT0A 4C89A 1U5BA 3SC6A 1BMTA 1PJRA 5KTKA 4P32A 5GWXA 1NDUA 1QRRA 3IVRA 1KAGA 4IKEA 4UM8B 5F64A 5B7GA 5K3OA 5HQJA 1DJMA 3IXLA 1R50A 2D0IA 2XB8A 2C07A 3NVKI 2B36A 2VF8A 4JQOA 2Q45A 1Z17A 4U3JB 1UM9B 3L0DA 1ZA1A 2D3WA 3IQHX 3P4UA 4DXDA 1SCDA 1JEDA 1G9TA 2P9FA 1KOLA 2HHAA 1MF7A 1Y1PA 3A3NA 4IDGA 4NJMB 1EFUA 4ZQCB 1GSAA 221PA 4B0PA 4RADA 4MB2A 1DXHA 3G2KA 3L84A 3VHXA 4S1OA 1DEAA 2R96A 3VNRA 5BR8B 1VPTA 2VJYA 1E4EB 3BMCA 3GLHB 4YGXB 3S1AB 4XCVA 3RK0A 2M2IA 4QHSA 4JXJA 3CEPB 2AN5A 4EL0A 4QG3A 3U3OA 1ZXLA 2GPAA 5CK4A 2P6PA 4MR7B 5DI3B 1ONNA 3ORHA 2FEKA 1NBIA 2O8BA 1U3VA 1VB5A 3IURA 4MUYA 4XJSA 1M1UA 1SVMA 5DE3A 5IBCA 3TNFA 3BZBA 2JCYA 2Z5LA 3DBIA 1CDDA 1I2DA 1HYGA 1B43A 2JD0A 1S3GA 2O9JA 2W37A 2VR1A 3AKDA 4OJTA 4PW0A 4R41A 4RY9A 3UMGA 5CB4B 1J42A 2C5FA 3I9LA 3I58A 1SWVA 3K6KA 1CF2O 1D2EA 4NFYA 5LD2B 4PNEA 3EA4A 1PL8A 1FYFA 5HCIA 1J0CA 1ZO8A 3DB2A 4EY3A 3STYA 1WDLA 3QXHA 3UG6A 3OQIB 3IS3A 4M49A 4A8PA 2NQ8A 1FSFA 2QTVA 2VEOA 1UBMS 2WSIA 1XEAA 3AILA 3BE8A 4JS0A 4MLDA 1U8TA 4HLUA 1XZHA 4M88A 5AUOB 1UXGA 1KU6A 3W4KA 2QY9A 1I30A 3O7MA 5H68A 1JPUA 1RRPA 3KYCA 3ZZ0A 5LYJF 2B20A 5ER9A 5FTJA 5AQEA 5JYCA 2P4EA 4FYXA 1REQA 2XAUA 4E4TA 2ZAYA 4K28A 2VQEB 2WJ6A 2HD4A 2ZBPA 2FSUA 2R6R1 4MAMA 2VG8A 1M66A 2C31A 2EBUA 4CM5A 1DIHA 2J3MA 4GVXA 3FUVA 1FP6A 3T7IA 3ZDXB 3W2FA 3ZWOA 1U9ZA 2AK2A 2KE5A 4JLAA 3TX6A 1RZRD 3T99A 3PHJA 4CEHA 4LJ6A 2J9FB 1C3LA 5A4MS 1NRXA 5ELLA 1KSGA 3BICA 4I50A 3ROGA 1RXEA 2H8KA 4JWTA 3KOZA 1JILA 4S2UA 1D4ZA 3A6FA 3LQ2A 3GLKA 2C2OA 1QIEA 1QIJA 2DHEA 2HRBA 1Y98A 4I5EA 4X8MA 1U0JA 1ZL2A 3AB7A 4YRKA 5F3DA 1B0ZA 1UXJA 2WYWA 2WTAA 3M5DA 3KQNA 3H9JA 2JD2A 3MMZA 4BMDA 1T8UA 2P91A 4G1CA 1DT5A 3CEHA 1BCRB 1NVVQ 4FFRA 5IW8A 4OLAA 3KSZO 3NG1A 2IITA 5DBFA 2HDHA 4CCSA 4FBMA 4AG6A 1UBFA 4BQQA 1EXVA 1II9A 4BMXA 3OQMA 2EGUA 2WYUA 1L4FA 2EJBA 1JBKA 2ZS7A 5E4JA 2F4NA 2WAXA 3V8MA 2ZUVA 3B3QA 1WV0A 2QW0X 4GZ3A 4X93A 2CHFA 3OFNA 5JI3E 2VPIA 3JWPA 4LHSA 5JHGB 2NVWA 4FUTA 4G0QA 4JWKA 3ZY3A 2WVAA 2QXYA 4YCDA 4O4JB 1VGVA 1D2GA 2C77A 1WB5A 4UBKA 3SM3A 5AWFC 3TXXA 1VDZA 4L72A 4HNTA 1IBSA 1WX1A 3K73O 5IAEA 3R0QA 4LYJA 1TQ2A 5GJWC 5LQSA 4GO1A 2BAGA 4OQYA 3LYAA 1E9AA 1JL3A 4KVFA 3VSAA 5B36A 4FYVA 5J9FA 4DR1B 3BB1A 1LUAA 4WK6A 5FPTA 1YR7A 3SZ3A 3IAFA 1UCFA 2B7CA 4XVRA 5D00A 3U6BA 3C6QA 3A4VA 4H59A 5CXUA 1TA9A 3UHOA 3BB3A 4TWRA 4D8UA 3MGGA 3HYNA 1CEQA 4CKBB 1DIRA 1KFBB 2FDXA 1EHCA 4I1YA 4ALMA 2PD6A 2QRVB 2IYNA 4JFRA 3HU5A 4HH1A 4XM1A 1QC5B 5ETJA 1T91A 1NUHA 1A1SA 1YZTA 4LOLA 4DDVA 4IDCA 3G0OA 4QOGA 3D6MA 4PZAA 4RIEA 2BFPA 1YI8A 2Y99A 2ZQYA 5IK2D 1A5ZA 3R5JA 4J4TA 3H7AA 4NCNA 1SBIA 4X94A 2C7VA 5D3KA 4HS4A 2FPPA 2C42A 4XW2A 1EVIA 2FPUA 1CUXA 3GQBA 4G41A 1WE2A 3DF9A 2Q1UA 2Q2WA 1TA0A 4KR2A 1X3SA 1C7ZA 2Y8EA 2ZTUA 4YO7A 3P9XA 4OCZA 4O1MA 1PD0A 5JNUA 1RXIA 2AMFA 3UT0A 4D4GA 3H9GA 5JQWA 2GK6A 1E1LA 1PSZA 4NMXB 4OMDA 4CTKA 1BX0A 2WKRA 3DZJA 3P7MA 2Q8NA 3BRWA 1W4ZA 1AKMA 1Z75A 1O03A 3U3XA 1ZAYA 1YIDA 2ZB8A 1DLIA 1HE2A 2FP3A 2P5UA 4ML3A 2YBDA 5FNZA 3FYHA 5A03A 3QVVA 3L1JA 1C1XB 5F1PA 1ESDA 1EFVA 4WEOA 1WUIS 4MW4A 3OQPA 5ECGC 5AM3A 1OH5A 4NZMA 4XQ9A 1VE1A 4LGMA 3WS7A 1LTQA 1T6ZA 4Q19A 5HJ7A 2CCGA 1GPMA 3ZH2A 2Z5VA 3W7AA 2GK7A 1AURA 2QTNA 4L7QA 4JJ8A 1U8ZA 1KI6B 2QSUA 3VSCA 1XPRA 2OK8A 1K7YA 2ZUCA 3H9BA 3PQ4A 4QUAA 3SZRA 4HH3C 4Z7NB 3U37A 4YALA 2OHXA 4AJ2A 5JDCA 2OVFA 4WXRA 1EE9A 1HTWA 1D9ZA 3KKEA 4JVOA 4QUKA 4QFDA 3NM5A 1EX1A 1Q0RA 2HHHB 3NEYA 1PJAA 5AKJA 1HFWA 3N75A 3MK31 1I14A 2DPXA 4PLTA 2LD4A 5DJ5A 3TWOA 3OKPA 2HGZA 3PE3A 4LKRA 4Q4HB 4AO8A 1QGZA 1T5DX 1LSSA 1NAHA 1ND5A 2ZVQX 2ZRPA 4FYJA 2PX6A 4MQ6A 3W5VA 2AJCA 2I2CA 1PJ4A 3QF4A 1V35A 2YV3A 5LLDA 5D5HA 1EVYA 1ZC4A 2I2WA 3DR5A 3SLGA 1KYQA 2EG5A 1E6UA 3V2GA 4HH4A 3HJAA 1EM6A 1H0KA 3ND6A 2VSYA 4L5JA 3THXA 1TIBA 2ZWPA 2XT9A 5THXA 1T8PA 4DTIA 4YDSA 4EPVA 2R6FA 5BNIA 2PX4A 2W43A 1XZAA 5AKYA 3QKWA 3R3UA 1SJ9A 1EZ4A 4P7KA 4R8SA 3QP9A 1UIRA 3V1TC 3Q9UA 5DNAA 3JAKA 3PDUA 1D7OA 2OV8A 1T9AA 4PR0A 4MYUA 5AI4A 2EJVA 4L78A 3T0FA 2GTHA 1J0BA 3QYJA 1B8PA 4HLCA 5IX8A 2QI9C 1TCAA 5TXGA 3U13A 1HYHA 2I4TA 4LWPA 1XCOA 3B1WA 2FN4A 3AHHA 3LW7A 3WGVA 3NHZA 1NJFA 2ARKA 3IA2A 1CZKA 2VK2A 1UZMA 4X97A 1QFMA 1CUFA 3B1ZA 3O6VA 3Q88A 1B73A 3O4VA 4EUFA 2PCLA 2EEZA 4N7JA 5KPJA 5E6UB 3RTBA 4KLRA 3HR4A 1NP6A 4A91A 1YC2A 2ZUFA 2WHPB 3DKIA 4J1TC 1TK9A 3E9DA 1UZNA 2XVXA 1DV1A 2M32A 2RJNA 3NAZA 1LBTA 5LQMA 4U7DA 1ISPA 1JB9A 3CJQA 4JUBA 5BSUA 3DHYA 4GI2A 3PQ5A 2VOJA 2Z2JA 2P27A 3H11A 1EVJA 3O9MA 3HPRA 5FFMA 1Q1QA 4RS4A 3W5AA 3AVYA 1LTHR 1K8XB 4Q4JA 1M7HA 4P82A 2N0SA 2V98A 2ZRLA 3E3OA 2D7JA 1VIMA 4FX5A 4LGCA 3TLKA 1KZ6A 3EGDA 5CG2A 4Z4HA 1G42A 1XTPA 2QYHA 3GCZA 2X1VA 3DUFB 3IR6A 5KVQA 3TZLA 3ZNOA 3W9UA 4ZEMA 2I8CA 3SEAA 1IL0A 1VBFA 3HGTA 4ZV7A 2GYWA 2Q21A 2XZPA 1OU4A 3ZIDA 4HO1X 4CMEC 2CV2A 1N32B 2CJFA 3KEQA 2XA2A 5BQFA 4BQSA 3QIAA 3F7OA 3TOXA 3HP1A 3KSMA 1ZXBA 4KV7A 4UDNA 1N0VC 1NQWA 3CZCA 3LHSA 1KYXA 3OP1A 3LC0A 2QBYA 4ZCRA 2WZBA 3C7KA 3FZGA 4ARBA 2YQ5A 4K26A 3WOVA 3KQKA 1PGPA 2FF5A 3PCXA 2Q5HA 4C29A 1PLLA 2YVKA 4MV3A 1ICIA 4BMPB 1CLEA 4YVFA 1I0IA 2MTBA 1WF3A 3IVGA 2H51A 4KWTA 4A36A 2R8XA 1DTSA 2XUZA 3DNPA 3OFKA 4KJZA 3BA1A 3MWJA 3I6QA 2YJNA 1T3ZA 1GCGA 3HCCA 1H4TA 5DH9A 1M1YA 1HE5A 1MC4A 1X38A 2QRLA 1T1EA 3DNFA 5GGYA 2E5FA 2FWRA 3QU7A 5EXXA 2GAIA 1EDEA 1K08A 4C2AA 4IJ6A 3GVCA 4K6HA 1E69A 4MB0A 4KIWA 5CH3A 2E6KA 1NXXA 3M6LA 2WAYA 2CHGA 1T6NA 4GMGA 3PQDA 1PWZA 1HNXB 4JR2A 3EXHC 4HEA1 3HS3A 4LY9A 5LJIA 1RI5A 4X7MA 1W0CA 2HLPA 2OQRA 2VT3A 2RD2A 3RAJA 3D8SA 1M7GA 4IIJF 2HM7A 2BHSA 3Q7QA 2I67A 2D1RA 4RV9A 2GBGA 2NO4A 2C8VA 1NATA 1W0JA 4LHYA 2ZJBA 3RASA 4CIBA 4WLOA 3I3SR 3JVEA 4JLSA 1QM5A 1Q0LA 2IYYA 1KBQA 5H0IA 4YLGA 1MENA 4K3VA 5HMMA 3MTGA 1C0PA 3GPIA 3NDIA 1YHNA 3DVAA 3Q3IA 2ECQA 4HPXB 4J4BA 4NE2A 3UMFA 3V34A 5J2UF 4X8HA 5C4GB 1JQEA 4F6RB 1I1NA 2B35A 3OLQA 2Q50A 4PS1A 3GJXC 1F8FA 1UPFA 4R84A 4B81A 5FBKA 4QXRA 2BKUA 2DJ5A 1UFOA 3VPFA 2RAFA 2W9XA 3TJRA 3P32A 5AFSA 2FPLA 3V4PB 1YH3A 2ZJYA 1ZK3A 2UVPB 4J7XA 3UYLA 4XYLA 2NVUA 5A06A 5H4GA 4W5WA 3QHPA 4CN9A 4B8ZA 5CYFA 4EL5A 1NRWA 5KDOA 2C4NA 3OCJA 3CXRA 1KEWA 2GD0A 2XMSA 3A9TA 3JVDA 1IJFA 2LKCA 2RKBA 4QUHA 4WZBA 3UAVA 1X9GA 4UUAA 1XCMA 3R0IA 3W2TA 4ESHA 3W5UA 5CFMA 4KMOA 3ULKA 2I71A 2IUYA 2A9RA 2QX8A 3OTWA 1OH7A 4CM9D 3WO1A 2GESA 1N33B 1D9XA 2BHNA 2WJIA 2W7TA 1I36A 4Z53A 4YIHA 1SOAA 2EWVA 3GT3A 2CFTA 3M1AA 4EB6A 2O8FA 5LA6B 1SH7A 2VKQA 1CY4A 1DC8A 3TTXA 2OBXA 4X92A 3WMWA 4A5SA 1O5TA 2I6SA 4BGDA 3OU2A 4DB2A 1AGPA 3ME5A 2IX9A 2GN4A 3AY7A 3WLMA 3K4PA 3RWOA 1ZM3A 2P5TB 2JLWA 3VSEA 1X0XA 4UU1A 5MFZA 1X7ZA 5LOVB 1QGED 1JDJA 4PLHA 2MR6A 4HBGA 2D2FA 2E4XA 3CS3A 1PR1A 1Q16A 721PA 1OZFA 5BO5A 1F3LA 1RXSA 1OTYA 1KDYA 2O2ZA 3IMGA 2FP4B 3PVSA 2BWJA 1DAMA 2D3TA 5AHRA 1UFQA 4XX0A 1GV0A 4RZ2A 1NX6A 1JAHA 2OHJA 1Z26A 1RRGA 2P2YA 2QUZA 3AEUB 3O92A 4LFCB 2ZLBA 2K6GA 3HWWA 5KYNA 4BKOA 1YVPA 1RU3A 2NADA 2E4WA 2F00A 3UK7A 4U2FA 5HTOA 3TCKA 4LK2A 1L5YA 3ETLA 4QUIA 3NT2A 3A26A 3R6DA 4COOA 1K2VN 5L4NA 4J9VA 3SY8A 1YWGO 3QLVA 1VG9B 3AETA 1FJXA 4AZSA 3AKYA 1FDVA 2G9ZA 1MAWA 1MZVA 1CUHA 2IHKA 3SS8A 1U5CA 4QYMA 2HEGA 4MV4A 4YJFB 3Q6NA 4OTZA 1XDZA 5J5CA 1DIAA 2VAPA 1KTIA 2VYCA 4E6EA 5IG2A 2Y1EA 1H4VB 2Q9UA 4MVCA 4PZUA 4IFBA 2NAFA 3ORSA 4G63A 4PLZA 3ZIUA 1M2GA 4RULA 4J2OA 3U7GA 5EHZA 1Z38A 2BGGA 1YB2A 4ID3A 3GNQA 3FUCA 4L08A 1MORA 2FI1A 2EF0A 3S28A 1T8WA 2IFTA 3M2PA 1SVLA 1V11A 2GEKA 8ATCA 2JI9A 1KERA 1XYYA 2RGAA 1MT0A 2JJYA 3Q6MA 4Y0VA 5K0SA 5TMPA 4HI0E 1PU2A 4R40A 5CB8A 3LUHA 4AKEA 4Q1EA 2JF0A 3R0XA 5DP1A 4I4CA 4F8JA 4M86A 4ZOLF 5TPWB 1GQYA 1DCTA 4ND8A 3RVBA 1BVHA 4BXOB 3HQ4O 3UB4A 3ETJA 3KSDO 3ZDFA 1QGUB 2FMXA 1R8QA 2VLIA 2A5DA 1EK1A 4ZAWA 4DV5B 7YASA 1U3FA 1D04A 4Q16A 4Y1FA 1TQDA 3NHMA 4EJ6A 1TKAA 2NOAA 3DT8A 3PYMA 3DOUA 3GPCA 4M98A 2GLUA 3VV2A 3T7DA 4DM3A 2O8DA 3O1IC 3BK1A 1QOPB 4MI3A 4EKIA 2FEMA 1ZNQO 4G0XA 5L9AA 1T9KA 1R0XA 2XKJE 1U8XX 1QG0A 2B7LA 1RJEA 2IDMA 3ZJTA 1UJBA 3RARA 4FDLA 2B3DA 3P94A 3L05A 2QS9A 4K6GA 4V0OA 2F2TA 2H1LA 4XAQA 3HEMA 1M1ZA 5AJTA 3OJXA 5J4KA 1I94B 3NJRA 4D97A 1YZQA 1FS6A 1JPJA 3LCUA 4IZIA 3A4LA 3MHTA 1Y9DA 4N5DA 5ALYA 3VFDA 3AY0A 3N2EA 1FDWA 1SFRA 2X3YA 3I2KA 1PEDA 4UARA 5IBQA 1IOWA 2IWRA 1EP3B 3N6XA 2O7QA 4V02A 1CIVA 3CZRA 2WUEA 4WHMA 1KP2A 4I5GA 3AOEC 3AY6A 5CDUA 2B94A 1G6Q1 3HVIA 5A0FA 1C41A 3IGFA 4ZVRA 3U09A 3SF0A 5K3BA 4RZXA 2OP1A 3VR6D 1P1BA 2P0EA 5BORA 4CCYA 4OREX 2AKYA 2GWRA 1QU2A 2W2LD 4ZQEA 3WLIA 4K87A 1S8FA 2RHOA 5DT2A 4HWTA 1KIAA 5FHQA 4MOWA 2P8SA 5JC1A 3W9SA 3AEZA 3VNBA 4BVEA 5F2OA 1XEXB 1B1AA 1EPUA 1MO3A 3NBKA 2W2KB 5HUHA 2HNKA 4P53A 1NC1A 1BXGA 1XCBA 2QAGC 2QLBA 4BKPA 4RESA 2X8AA 2I4RA 1IRIA 5EOVA 3F6BX 1IHDA 1XZQA 1L1RA 2FDRA 1E1KA 1N2HA 1ZM4A 2B9VA 4GE0A 5F5XA 3S29A 5BSVA 1SBYA 1Y34E 3EFHA 2FPGA 4ADSG 2FMUA 4WNAA 4BAGA 5JSHA 2HEIA 3P2KA 4IIEA 1ZICA 1ORVA 3AVPA 1IOLA 1ZVQA 4LX8A 3CF6R 4DJJA 5A6VA 2WWRA 1GTL1 5EJGA 1DQYA 1XD8A 1ZU5A 3D4OA 1TL7C 1UC5B 1VJTA 3CU5A 3EXFA 4YCCA 2CLDX 1HZZC 4ZJYA 3HDGA 5CT8A 1SOUA 5GY7A 4JYZA 3VPAA 3WNCA 1CJCA 4Y2SA 4G67A 1SQ5A 2VJNA 1PT7A 1OAOA 1XLTA 3JYLA 4CDRA 1EK5A 4FOTA 1J33A 1GPLA 3ZVMA 2J0SA 1Y3CE 4PGAA 2NO6A 2DSTA 3BL6A 4CLDA 4F2WA 3C7DB 1B6RA 3DZIA 3O8QA 4JUDX 3A4YA 4HDSB 4ZPXA 3WI7A 4EVIA 1OREA 2I55A 2XMRA 2HBRA 2JZOA 2Q5IA 4PO1A 1TK3A 2QA5A 4HDRB 3P45A 4BKUA 4RTMA 3F73A 4UTOA 3SKVA 4FYYA 1J2JA 2C7QA 1AQIA 4JEHA 4O33A 3DV0A 1PJCA 1T9DA 4U0JA 4U5XA 3W1VA 4DNOA 1NBMA 4L5BA 1T4BA 1XZFA 2W6JD 1RQXA 2WZDA 1IVYA 2PSDA 2D5AA 1KORA 2H4FA 3OE1A 1NW5A 4RD3A 5I9TA 1B41A 1H1LA 4ER7A 1FX0A 3KT6A 4NG4A 5BV7A 4YJ3B 3DFUA 4X61A 1HSZA 1HT3A 3AIIA 3M1YA 3VH4A 3H2GA 2J7KA 3IJ5A 4AROA 4NBNA 4TV8A 3LD9A 4DYVA 5H9WA 2YJ4A 5G1NA 3D0OA 4CNQA 4FCCA 4EHKA 3TI9A 4QOSA 3M3PA 2JFZA 5ESXA 2NV0A 1ZK0A 4MA5A 1ZG3A 2COKA 4JMPA 3N8HA 3NI2A 3ZGOA 3GJYA 3ZXSA 4JLVA 3CKLA 4FFNA 2AB0A 1ZHOA 1EZZA 1ONOA 5EHXA 3QWIA 2GZMA 3QG1A 3TOCA 2V7QD 3ZV6A 3EBOA 5I7OA 3FPCA 1R6AA 2WHQA 4X7BA 5JPIA 4GX5A 1CNMA 4YBRA 1XOIA 1CS0B 1T5SA 4QOEA 4MA0A 4Z4GA 2YZ7A 3PD7A 3HLYA 3CWQA 4YTEA 1TZCA 1I4LD 1N7HA 4GYWA 1OLUA 2ZWOA 1UADA 2DRIA 5HJEA 2X6QA 4S1VA 1PEKE 3BD8A 2A0WA 3IRUA 2J31A 1V96A 5K6AA 3P0RA 5K9ZA 4QSHA 4D9GA 4U3JA 3ZWCA 1XXHE 1FZTA 1PJSA 3EWIA 4R2LA 4Q0MA 4M1TA 5IU6A 1OBVA 2VBFA 3VPCA 4RANA 4REMA 3B9QA 4NJMA 4HFMA 3HUUA 4LEIA 3IPXA 4G0MA 4O4IB 3HNRA 3B7PA 2GXUA 4I2VA 5HQTA 3UKOA 3GLHA 3UXEA 1E4EA 3S1AA 4BV9A 4ND4A 4N0EA 3TE6A 5EIHA 1JNYA 3FBGA 3GVPA 1HWYA 2C5BA 1GTZA 2FZ5A 2J9RA 2VF7A 3B52X 3ZW9A 1CY6A 3ENWA 621PA 4HAOA 5DI3A 2Z6VA 3G9TA 3A6JA 4KR0A 1N4DA 4DRZA 5JBIA 1KYTA 3RT9A 3S2GA 3M6UA 1U2EA 5KPDA 1YA6A 1W59A 3O26A 2EDCA 4GI7A 4CT4B 2BDTA 2JFQA 5KYGA 3NUQA 1YMUA 2AZTA 4Y2XA 4MV5A 5BSFA 3UWSA 4KWIA 1DG9A 2A94A 3OIDA 2IJGX 5H83A 1MC8A 3VYTB 4JELA 3G5LA 3R76A 2X13A 3RF7A 1LX7A 2D4AA 2I8AA 1YS9A 4XYBA 1JVBA 2BMVA 4UM9D 1D0SA 2FMHA 4QPJC 3CKYA 2HNBA 1TPZA 1PL6A 3JZIA 2V7UA 3QXCA 5A0VA 1TM1E 1UWLA 2H2DA 3KDSE 3AI7A 4QPDA 1E1QD 4MH0R 2PH7A 5TIIA 5KYYB 1BXRB 3AXSA 4GP7A 1MZPA 5DXAA 2W2VA 2C04A 3AZPA 2G5GX 1LNZA 2QMYA 2XKBA 4N7RA 2VHEA 4A2PA 1YRQA 1DPGA 4HVAA 3R3YA 2NU9B 3UUEA 2YY7A 1WM1A 1JKJA 2QTMA 2VRCD 3F8SA 3HKEB 5G1PA 4CM7A 1NXWA 4O1IA 4DN6A 1UUFA 4CKYA 2ANBA 4EY8A 2AXEA 3B53X 1KJ8A 4N3BA 3BA6A 5IDVA 5K0LA 2ZE5A 3DXXA 1US8A 4JJ7A 4JITA 4R3UC 2J4DA 4K88A 2ASVA 1XTIA 4Z4FA 3D6UA 1PNTA 2C2ZA 1PKEA 1YL6A 1YQGA 5CT4A 2VRNA 1J21A 3O74A 3NBYC 2J9FA 3QVXA 3KVYA 4G0NA 5KREA 1NLUA 4PZEA 5AJVB 3ZE2B 3ZWAA 1J7KA 1DWQA 2ZVJA 1SULA 4BLOA 4R5MA 1G7CA 3PVZA 1MQ8B 4TMZA 1N2CB 1EX7A 4IXMA 1JFSA 1UPCA 3K92A 3MWLA 3MXTA 1KRHA 4QX6A 1B4DA 3BXPA 5KNLA 2A59A 4HX5A 3AJ9A 5CVVA 4IOKA 1BEUB 1C1DB 4PTLA 5KKAA 5TJHA 1MVOA 4EA6A 5UKDA 4RTLA 1MGOA 2G70A 2PO5A 2W4QA 3NTXA 4MWDA 4BLVA 1TW3A 5EZYF 4DCMA 1UZLA 3OVMA 4J91A 1ZZGA 3SLKA 3PIDA 1KO8A 4HVCA 5KVVA 2J0UB 1VSBA 1JEJA 2XBUA 3NV7A 5KOJB 4X62B 3L06A 1BO6A 1HPLA 2YIVX 4MVJH 3TZCA 3DJYA 2DUMA 1J5XA 3WRXC 1Z2EA 4OP2A 3H99A 3ZW8A 1GM5A 3SXPA 2ESRA 3LCRA 4B6SA 1I4OA 1UC8A 3WJ1A 4LJ8A 4Q24A 3IAM6 2POCA 1ZH2A 4XGIA 1FMLA 1WULS 2VF4X 2QWXA 3KLOA 3LTEA 3MTQA 3R3WA 5EIBC 1SBCA 4O4JA 1BU5A 4UUQA 1SKBA 4U7TB 2PSSA 2O5CA 5FWAA 3DTYA 4BB9A 3NHUA 3Q5EA 3O5AA 4QLAA 5M3BA 3DFMA 2DWQA 1QNLA 4RL6A 2ZSEA 4G65A 1HE1C 4S3MA 3WSVA 4A8JA 1SGWA 4DR4B 1FS4A 1YC5A 2AG6A 2JRCA 2ZI3A 4D98A 4INJA 4MYSA 5FCDA 5TQ0B 3RC9A 2I22A 4DDUA 3MT7A 5LMUB 1SU6A 1E5DA 5ALJA 3U7JA 4AURA 4BX2A 1G55A 1VPEA 5BVGB 1MO4A 2G40A 4D3FA 2AT1A 4YCSA 1PZXA 3HMQA 3OQOA 3LUAA 3ZV5A 4CKBA 3ANNA 3QZUA 1R0WA 4EUSA 3ZBUA 3AF0A 1A77A 1NZJA 2H08A 3HGQA 2QRVA 1EUYA 3E18A 3L46A 3MJEA 3P9KA 3FETA 1E6LA 3H84A 4KSBA 4MUFA 4QU5A 3RI3A 4B4KA 2J09A 4KO2S 1XQXA 4LHVA 3D8UA 3MMSA 1Y4UA 2JBAA 2F3SA 4K9PA 1HTTA 4PXAA 5IZCA 3AVTA 2P6OA 2WV9A 4OMFG 1HYEA 1X6VA 2H85A 1E2GA 2C9BA 4V24A 2QT9A 2ZGVA 2V9ZA 3I34X 2PWZA 1P72A 4ZI7B 4P22A 5D51S 5BY2A 3BWCA 2PUTA 2H4HA 3I32A 2VK8A 1NQXA 5DBHX 1VQ1A 3NNNA 2UUAB 1FYXA 3RG2A 1X7WB 5IDXA 4Y6OA 1BH6A 3CZMA 4LXQA 4OJYA 5AJHA 1G6OA 3RU9A 1ZGBA 3FGZA 4R05A 1JJVA 5I51A 4I14A 3R4VA 3MCWA 1YU6A 3TUZC 3MWYW 5CBPB 4H31A 1AU9A 3WL3A 5D6OA 2V7EA 3I42A 4ZHQB 2RG7A 4Z51A 1PE0A 4B3MB 1RP1A 4R31A 5AO9A 1XDBA 2YHIA 3OESA 4BAUA 3MUEA 4IXDA 1ILEA 5JQGB 2GYUA 4J16A 3IE1A 1J8MF 3DQZA 3PEFA 5E38A 1VMAA 4GUAA 3NM6B 4IIDA 2J5RA 4IWNA 3ZI7A 1YO6A 2B1QA 4BS9A 1Z7GA 4AS1A 1JVNA 1TECE 3OE7A 3SU8A 3G5MA 1H2AS 4N3CA 3H5IA 4RE5A 4PGFA 3U7EB 3IRVA 3RVNA 2QUAA 4X66B 5GPBA 1JR6A 1KI6A 4MRPA 2ZR0A 2X7XA 4UUPA 3NONA 5E4TA 4G4GA 2ID4A 4PS0A 1HK7A 1NDHA 1T2DA 4C3VA 3LUFA 1RR6A 5T57A 4BVKA 3FZQA 1Y8ZA 4N65A 5B7PA 3JQ9A 3SX4A 5AXAA 3NAQA 4M4SA 5B1HA 2Z6UA 2H07A 1ADJA 3H75A 1M2WA 1R9JA 4DMCA 2CNBA 4C76A 3IPCA 4OO3A 3ICPA 4Q4HA 4NYIR 5IT5A 5C7YA 3GPDG 4FINA 1Q6ZA 2VHUA 3ZEAA 1RWNA 4ZVSA 4L85A 3TLZA 1V5GA 1BMDA 3HCEA 5EP4A 1GPUA 1UKAA 2XLCA 3DTVD 2P90A 1HTBA 2UZIR 1NW4A 2GN6A 3EZ9A 1VMKA 4MUGA 4P86A 1Z0SA 3VU3A 4NE7A 2ZVDA 3MQFA 4XYGA 4I1OA 5LSAA 1GYRA 1PR9A 3NNSA 4M60A 1OX6A 2EXXA 1RLJA 1FFGA 1V5EA 2QX4A 3FNIA 3GY0A 4K3UA 1R15A 2WHEA 3GJ8A 2WV7A 2AFVA 3JYHA 3SBOA 3DLPX 4U7FA 2WTBA 1JR3E 3B9RA 1N6KA 4EEZA 1SXPA 3ZNPA 5ESRA 1TM4E 1O7JA 3TAXA 2FPWA 1BE0A 4PWYA 1T6XA 3EH1A 3K0KA 4QXOA 4ZTUB 1XWFA 5KTYA 3F2VA 4JQZA 2B4AA 4ISCA 1RHJA 1QVVA 4JASB 1TVKB 1PYGA 1YOBA 3CHYA 1EVKA 1UPUA 3FSGD 4HYTA 5EC8A 4DM4A 4P1ZA 4V0KA 1DKPA 1EWTA 4YUAA 1FDSA 2A3NA 3F49S 2HKIA 3H87A 4PINA 4KXMA 4DMFA 2XQIA 1AKEA 4EKEA 1J90A 4DMGA 1B2RA 3OX1A 2RKWA 2XJ9A 5E6UA 5F9FA 4UAVA 3RYIB 2QL9A 2VXBA 2WHPA 4JK3A 2WR8A 2CMGA 4NCBA 3VKGA 6YASA 2FFRA 5K45A 4X7PA 2JLAA 3EXIB 3VO8A 5K09A 3G49A 5D1HA 2AKEA 2OM6A 1D6SA 3MPUA 3QGMA 4HTAA 4AJLA 1C0IA 4BLWA 1KAOA 2HSJA 3E03A 3QFTA 4UNPA 4Y1RB 4OLFA 1TPYA 2XE8A 4QNNA 5BSHA 3BWVA 4MGEA 3A9UA 4NBRA 3AJDA 3L1VA 1Y8QA 1ZSNA 1WVMA 5JWHA 4U7JA 1E9SA 3UJBA 3LQ1A 4WK4B 4L4SA 1KZ7B 3DUFA 1Y4DE 2Y4OA 4MQ5A 1U9CA 1CB7A 1W49A 3PHIA 2ZUTA 4QDOA 1USVA 3N0XA 4B3HA 4FKMA 4GKVA 4YMGA 4JIGA 4XLTA 3I64A 3R7LA 3IHKA 2ZBQA 1XRMA 1NXQA 2QL6A 4Z49A 3V2HA 1GAWA 1L5WA 4TKMA 1UJCA 1RBZA 1EAYA 4GOMD 4GUDA 2BGWA 1Q1AA 2HQRA 4Q34A 1KU0A 3REFA 2JKVA 3JYQA 4MRAA 4AKGA 1DC6A 1WCWA 2W4IA 3A37A 3NWBA 3ZE9A 3L5OA 4I50F 1GPH1 1QB8A 3EW9A 1HL7A 5KWSA 3WV5A 2UUPA 1XMSA 5ALOA 4M1MA 1KAQA 4EY7A 3F6YA 1IXRC 3T3IA 3NIFB 5EZSA 1VLQA 1VE7A 2JPDA 2FCRA 3NAMA 5FUYA 2XY4A 2A0UA 5EEHA 5A4JA 5K0JA 3I9V1 2JATA 1IK4A 2QENA 3A6GA 3TS1A 5HS6A 1S2MA 3FWPA 3P5SA 3WJ2A 3Q8XB 2C7RA 4MA4A 4EOGA 1ORWA 4CKWA 2GZDA 1B0AA 2B5WA 1BFDA 4RJ2A 5G4LA 3R3JA 4NV0A 1BKDR 2IK8A 1N8SA 4CMIB 2WE8A 4PYJA 5D01A 3S40A 4ESVA 4TV9A 4QYTA 2FZWA 2X0KA 1SUPA 5L7YA 1AKWA 1Y6JA 2COEA 3OF2A 4IXTA 3UMJA 4BNFA 1D4FA 5KNBA 4U9HS 4CV3A 2JLUA 3D3KA 3VNVA 2JGEA 3HKCB 1DG3A 2XCUA 3EPKA 2QD3A 1PG0A 5FOVA 5C7LO 1PX0A 1U3CA 1XRJA 4FT2A 4BN5A 3G88A 1XMOB 1SKYB 3E84A 1VL8A 3PL1A 4MS3B 5F12A 3IILA 1ZAKA 1SZPA 3B1VA 4I6EA 3WYEA 2BTEA 2CJYA 4NNPA 3RS2A 4B2PA 2GI4A 3L7BA 4H0CA 4DG8A 3ZD7A 4RVFA 4B71A 3D6FA 1YOVB 4QPZA 4F6RA 5CITA 3GLFA 3WGMA 3BE6A 4QGHA 3FFWA 4BFYA 3K6SB 3T54A 5FFFA 1DKMA 2F8TA 5F3RA 1XZGA 4EHNA 3U17A 1FSSA 1JDUA 4DS3A 2RB5A 3K9HA 4GVLA 5HIKA 4RHEA 4ARVA 1O4VA 4WZAE 4I9UA 1A5TA 1LS6A 3WP1B 1LBEA 2HJVA 1IATA 1M34A 3GP3A 4BO1A 2GPTA 4L4RA 2G1PA 2G4CA 3VYUB 1GRVA 2WLSA 1PLKA 5DGXA 3TSAA 2CXXA 4YP6A 3N8IA 1P75A 3GCDA 5AVXA 3OPMA 2BHRA 1L3BA 1LFDB 2IKQA 3BL8A 1WMAA 2XXJA 2XJ4A 1VCMA 2XT0A 2YOFA 3KQYA 1BIFA 3P5BA 3SOZA 4WW0A 4NBVA 2HUNA 1B3RA 1JALA 1A2BA 3GFRA 3IT2A 3JRWA 3KJXA 3KHKA 3LPDA 5LA6A 1HZJA 3PFWO 3KAPA 2Q29A 2C96A 4ID9A 3A1NA 3D8HA 4IR7A 4BYMA 3OPQA 3ZBQA 1RBMA 4NG5A 1SUWA 3D3EA 3OD5A 3ZHXA 4DR2B 1Z5OA 2OWDA 2HU5A 4BKMA 2MINA 1Q0QA 4C4OA 4F21A 1OASA 2B4KA 2BKXA 1ZWLA 2X14A 3EVNA 3FDIA 1PKXA 4BMSA 1WUTA 3OUTA 3IQXA 1N5MA 4KDFA 4MP8A 3WZMA 3K2BA 2AX3A 4W5NA 4ND6A 2BMJA 3DZKA 4US0R 5FWXB 4PHFA 2AE1A 4MCJA 2WHYA 3AEUA 4IJQA 1GLVA 1Z18A 2ZE6A 3T38A 1VLZA 3L8MA 1GPWB 1ES9A 3ESRA 3EWNA 3PQ7A 5FPQA 5JXGA 1G7TA 2D2IA 3AVOA 5DFAA 5DMXA 3IOMA 1DUVG 4QM7A 4E30A 2HB6A 3WL7A 3ZCXA 5F77A 3BFJA 5HEKA 4KACA 1Y5IA 4IIYA 4LSZA 4PY2A 3RSHA 1O5IA 1Q0HA 3E5MA 4RGBA 5GM1A 2XWPA 2HI0A 4OIFA 3BMNA 3OQHA 1OYVA 1KZ4A 4FOSA 4GF5A 5HHTA 4LZNA 3KSUA 4YCMA 1S1MA 1Z16A 1RYYA 1UT8A 4K6MA 1JLHA 1U0SY 3L0YA 5GZ6A 2VDJA 1WXWA 1PT9A 2BKEA 1FLAA 1K97A 2PZGA 2Y05A 3JARB 3PC3A 5BN5A 5L4SA 2ODTX 3MGCA 1HV8A 4NHEA 4RMNA 1J6UA 4HQNA 1P17A 2HPZA 2YYYA 4C9BA 1ZR4A 4YYEA 2JI4A 5LQUA 3AVWA 2QXTA 1UQTA 5EY5B 2UVDA 5JAUA 1QKKA 5H8WA 3RFUA 1PJTA 4ZV9A 1M2FA 1G98A 5A4FS 3X1WA 3HUEA 1JVSA 2NO7A 3MINB 1EFCA 4CCAA 2PGIA 4BXOA 1ECGA 3EVGA 1BNCA 3EAGA 5DIZA 1M5TA 4GGOA 3R09A 5E8JA 4D9MA 4ENWA 3TX2A 1O9BA 5C1PA 4NVRA 4FC7A 3N2KB 5KQGA 1KVRA 1DT3A 1WD7A 2GLTA 1CUEA 1OSNA 1GQSA 4TTPA 1DCKA 1SVWA 2IQ5A 3LDFA 3SR3A 5LNK6 1P1CA