5A0FA

Crystal structure of yersinia afp18-modified rhoa
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
178
structure length
178
Chain Sequence
b'AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN RHOA
publication title Tyrosine glycosylation of Rho by Yersinia toxin impairs blastomere cell behaviour in zebrafish embryos.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 63
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5a0fA00
3AQ4A 3OE7D 4JMPA 1TEXA 1Z5ZA 5G3YA 5B58C 2J0SA 1R5BA 2OZEA 1GILA 2CE7A 3WMGA 1IN4A 1LNZA 1SXJD 2CK3A 1H8HD 2VSXA 1UJ2A 2EU8A 2ODBA 3LXXA 4IVQA 4Q03A 5EZ6B 2HT1A 3CRRA 4XD7D 1MO5A 1J7KA 3MGCA 4HLUC 2WPDA 3Q7QA 1GUAA 3ZGXA 3TGPA 5JRZA 1E2NA 3BH6A 4GZMA 4PAOA 2WSSD 1DADA 4GOKA 2I1QA 3SDZA 3TR5A 1N6NA 4UJ5A 2IYRA 5HR5A 3GJXC 1Q1EA 1OFUX 2A5DA 4Q66C 4TMVA 1JR3A 3I73A 4BFUA 1GKUB 1W4AA 1RYFA 3CR7A 1D8TA 2VHUA 2F9MA 1FTSA 2CCKA 2IEZA 3H2YA 3U6KA 4OI1A 2FDCA 1TEVA 1XWIA 2I3BA 1MRSA 5DYGA 1E2QA 4A82A 4BASA 2VP0A 2ZE7A 5KUTA 4AI6A 2EFDB 4GOXA 3FOZA 3LY5A 2Q21A 2A9KA 2JIZD 4KJZA 1Z22A 1U9IA 4IW3B 3OIUA 1E2MA 2CVHA 4GMDA 3U2QA 1OH8A 1MO4A 2JDIA 3NIBA 3ONWA 1ESMA 4DT1A 1NBME 5DIFA 4NH0A 1VCNA 4LBVA 5GVSA 1KK2A 1E0JA 5HKKD 1E9DA 3QKSB 3C5CA 1K6MA 5M04A 5FOUA 2FH5B 1S4QA 1N5IA 3T15A 2VSFA 5L3SA 3P20A 1N6PA 5GVRA 2QY9A 4ACAA 3PENA 4CW7A 2P6RA 5E7IA 3OZXA 3BB3A 4B6EA 2F9LA 2FOLA 2V1XA 3AVOA 5EXXA 3HPRA 2G3YA 3B1XA 5EE5B 3GJ5A 3FHCB 2YOFA 3CZQA 1KI1A 3HP1A 4QOSA 3IPYA 4PQYA 3A1VA 1GL6A 2ZRDA 4C2TA 1KI9A 1KO4A 3P27A 1QHYA 4B47A 2E1RA 1SVKA 2IS1A 1G5PA 2PX0A 3AF3A 2IT1A 4V0OA 2B92A 3ND8A 3DL0A 2KI5A 3B82A 2RGCA 2KJQA 3AVYA 2CHVA 2OUKA 2V7QD 5AUQA 1BMFD 3L2OB 3AF0A 5FBWB 4QGHA 2GK6A 3N5CA 3LVRE 2EWWA 3PUWA 1ZNXA 2CCGA 2CJWB 1RRCA 1E4VA 3F0TA 4QNMA 2XSZA 3OAAD 1AS2A 1I4LD 4B44A 4ZDWA 2PH1A 1LY1A 2ZRMA 3QVUA 2O52A 5CYOA 3E5HA 3ZS8A 1FQJA 5KNBA 3EPHA 2BM1A 3HU3A 3J81k 3LX5A 3SHWA 2IYWA 4A6XA 4V02A 3VNVA 1V5WA 2ZI5A 1X3SA 3OEHA 3GLGE 3NC1C 4Q19A 1S0UA 4HAWA 4Q21A 1OE0A 1TF7A 3FB4A 3TW8B 1KO8A 1G5RA 2N42A 3LX8A 3PVSA 3QBVA 2AK3A 2ORWA 3QPVA 2OSBA 2J7KA 4EJSC 3VFDA 4BFWA 2O8FA 4PXAA 4ZDKA 4M53A 3Q3JB 4K81B 2PJZA 3CF2A 1D2MA 2MSCB 3LNCA 2AL7A 3CO5A 4KBFA 2FG5A 1KZ7B 3VX3A 5JWHA 1KNXA 2CBZA 4W5HA 2ORVA 1E69A 2PL3A 3QXHA 2QE7A 4BFXA 3GLFE 4MDEA 4XTCS 3A36A 4AK9A 1IY1A 1FX0B 1OXUA 4JL6A 3R9IA 4KVAA 2O8BB 4HYYA 5IK2A 1CR1A 2ZR7A 4ZIRA 2W00A 4GP6A 2W6ID 4I99A 3T35A 4KITB 2DWQA 3Q5DA 621PA 2IYLD 3Q8XB 2Z6VA 5JI3E 1OHHA 2OAP1 1VIYA 1JAHA 1PZNA 1TF5A 3U3OA 1QZXA 2ZREA 1PUJA 3EIHA 2WKPA 3ZLJA 1LV7A 3LO5A 3AVPA 3FHOA 3L0OA 1NRJB 4UNPA 2NO0A 1ZD1A 2ZJAA 1KK0A 3S1AA 2O8CA 1CJKC 1Q3TA 2WVJA 3BC1A 1W7AA 1HYQA 2V6IA 5JHGB 5FBVB 5JS8A 4KBGA 3K70D 1PVOA 2GCNA 3DPUA 2LWIA 1GZSA 4PHHA 2HYIC 1XDBA 1E2IA 3RDPA 2QNRA 3HJNA 4WBSA 2J45A 5JEEA 1E1QD 3AUXA 4URXR 2NMVA 1G5TA 3EW9A 1W4CA 3AVUA 2A5GA 1N5JA 1OXXK 1E2HA 1T0HB 3NBFA 4DLVA 5HE8A 3AKDA 4YMWA 4PZLA 2ZRBA 2ODWA 3LA6A 3LH5A 4F91B 4AD8A 4DLZA 1DG1G 4NCJA 3Q85A 2GZAA 4M9XA 1N6OA 4IDQA 1AS0A 4PFSA 3CIOA 4HI0E 5KYKA 2ZI7A 2WBLC 1JPNA 1KHTA 4PPQA 5DI9A 4BRWA 1LS6A 1G64A 2P5SA 1Z6YA 3O8BA 4HAUA 4FCWA 3U3KA 2QM7A 2GHIA 1QDEA 3TMKA 4HATA 5JCZA 3SU8A 4QXAA 1GG2A 4N0EA 3RRNA 1EX6A 1KAGA 4HB3A 1G16A 4A0FA 5LPNA 1B0UA 4QM7A 2GDJA 4PC3A 2VP6A 1S3SA 1RE0A 1UPTA 1FMJA 1YR8A 4RY2A 2QA5A 4MRSA 3CX8A 1R0ZA 1YZUA 2OFOA 2BMJA 2XNDA 5GADl 1DE0A 3DZDA 2KWIA 4DEXA 5KO2A 1XMVA 1UAAA 1ZUNB 2RGAA 3GEHA 4DZZA 2GILA 1ZMXA 3ZDQA 1XMSA 4Q9HA 2LCFA 2PZFA 3TKLA 4MITA 3NXSA 1PLJA 5JCPA 3QPWA 4KYUA 4TN1A 1WCV1 1G41A 4CYMA 1T91A 5CIWA 1ZP6A 3TVDA 4P4SA 1DAMA 5JWRA 2BOVA 3QKRB 1R0WA 1UF9A 1NL3A 2HXSA 4M2LA 2IXGA 4NTZA 4AYXA 5SZJA 1BIFA 2ZSBA 2VA8A 3WNCA 4IVPA 1K5GA 3PUYA 4XOIA 2EFEB 3T1TA 4M0LA 5FBLB 2Z0MA 2ZRKA 4HAXA 3I5XA 2EFCB 2VP2A 2YOHA 2ONJA 4Q1EA 3B8HA 3P4XA 2WWGA 3RWMB 4JKYA 5CITA 1ZIPA 1KKMA 1AZSC 5EUMA 3SFVA 2YNMA 4A8JA 3VAAA 1RFLA 4ZKDA 3U44A 3IIJA 1CP2A 2W0SA 1P7CA 2X2FA 4B2PA 4DDVA 5TXGA 4CEJA 3NVAA 1HQCA 1EFCA 4D6PA 5LD2B 3FGNA 5C4MA 3U6BA 2I1VB 3D8BA 1G7CA 3B1YA 5D3MA 2HF9A 4HZUA 3WP1B 3TR0A 5FPKA 3AVXA 2GJ8A 2PZEA 1CS4C 1VIAA 3IGFA 4WZ6A 1WMSA 4ZI2A 1A1VA 5FPTA 1G3MA 2ZS9A 4NL4H 5JRJA 3LW8A 2VLIA 1US8A 5CLLA 1FQKA 1G291 5CM9C 1DPFA 2WWHA 2GWHA 1B23P 4RCYA 4NE2A 5HTKA 4OHXA 4Z1MD 3M1IA 4D0LB 5TARA 1NVWQ 5L3VA 3WY9A 2HT6A 4EPXA 2B8TA 1U81A 1UKYA 1Z2AA 2WHXA 2ZSAA 5FTNA 3QKUA 3VR3A 3UIEA 2ATVA 4E03A 5KHOC 2BBOA 3BOSA 4MGKR 4URZR 1E94E 4HDQB 1EG7A 2QGZA 2VH5R 3MG9A 1TQ6A 3TK1A 2FMXA 2A2ZA 3A1SA 2RAPA 2CLCX 2ZE6A 5TMPA 5CJ2A 2AD5A 5EQTA 1S8FA 5KPDA 4IDNA 2GVZC 2IXEA 1JQJC 3ASYA 4IKEA 1ZINA 5C1BA 3BH0A 4Q1AA 2IA5A 4IDOA 4MGIR 4MQBA 1KI4A 1XMIA 4AWXA 1MR3F 4D26A 1AIPA 5JFGA 1PJRA 1G8PA 1ZJ6A 1D2NA 1AKEA 4TMWA 4DDUA 3HPQA 1TPZA 2QSZA 4AKEA 2WMNB 1QBKC 4PSKA 5AJXA 3SHFA 3UPUA 1BOFA 5DI3B 1JXOA 2IX3A 3NBYC 3FFBA 4O0MA 2XOKD 4Z8YA 3VHLB 5TV2A 2ZYVX 3DM9B 1N0UA 1R0XA 4M4SA 4DCVA 2PEYA 1XEWY 4Q1FA 1CULC 3CZPA 1FFHA 1VMAA 3DMDA 1P9RA 4I1OA 1II9A 1E79A 4B3FX 3B1WA 4LJ8A 1XCPA 2XEXA 2A5YB 5GJBA 1J8MF 1Q3HA 2QTHA 3DO6A 4OHZA 3AH8A 1F2UB 2ZVQX 5SZHB 3TAUA 4DDWA 3VKWA 4DLUA 4R2IA 2PMDA 4JVMA 4TTQA 1RW4A 4EDHA 1DTSA 1XJQA 3KX2A 4WA7A 4Q01A 5LDDC 4D25A 2OV2A 4P31A 1N6IA 3IQXA 1Z29A 4QKQA 4BPBA 2PCLA 2CLDX 1SXJB 4ESVA 1TF2A 3NTUA 3PXGA 4DLSA 2RGGA 3ZD7A 3AGPA 4NBSA 1HT1E 1NVVQ 1DAEA 3UANA 4PO9A 3TVTA 8OHMA 2FZ4A 5C4GB 1Z3IX 5KDOA 1IQPA 1UDWA 5DHFA 2IYYA 2ZROA 2IF0A 1FP6A 3NHAA 1XF9A 3WRYC 3OHMA 2NIPA 3MD0A 4D4MA 1IBRA 2ZIAA 2BWJA 4XVQA 4TSFA 5EP2A 3I72A 5UKDA 1LB1B 2ZTSA 4M1OA 1UFQA 3L8YA 3SNHA 3U4QA 1YU9A 5J4LA 4CEHB 1JPJA 1D5CA 2OCBA 2QAGA 1E1RA 2OG2A 4L15A 3SN6A 4RZXA 4C4PA 4W9MC 1YR7A 4G0NA 4LHVA 4Q9LA 5BW8A 3W8RA 2GEVA 1II8B 2XZLA 1X86B 3NG1A 1VHLA 1ZM4A 3KKQA 2J3EA 2R6GA 3QXXA 3R7WA 3UATA 4DJTA 2JLVA 2G1KA 5KPJA 4C0BA 1E2EA 1X8JA 1XEXA 2H18A 4ASUD 1HEIA 1YE8A 2DR3A 4BFTA 4I1SA 3IO5A 1FMLA 2QMUA 1Z28A 2ZR0A 1OSNA 1YRBA 3LW7A 3TH5A 2IS2A 3EWSA 3KQHA 5FOTA 1RIFA 1KKLA 1W5SA 1XCMA 2J1LA 3UKDA 4A2WA 2GJAA 3B78A 4B2IA 4JLMA 1TNDA 2FPLA 2O0KA 3L0SA 5FPYA 3K09C 4YC7A 2GEUA 3LRPA 5L3RA 2EFGA 4JYBA 5K8IA 2WAXA 2PJRA 1PLLA 1YRAA 5KDLA 3RHFA 3H86A 4LBYA 1GL7A 1W1WA 5CDFE 1K5DA 1UBFA 1RC8A 1U0JA 1T3LA 2AN9A 1Q12A 3DEFA 3MSXA 5CK4A 2ZJ8A 5F3WB 2AKYA 2DFLA 3B1ZA 3ASZA 3LBHA 2W6JA 5FL3A 2IYTA 1P9WA 2ZE5A 5AUOB 2RGNA 4NYJR 2Q3FA 2YWGA 1BO6A 4KSCA 2ZR9A 4KFRA 2JJ2A 5J4KA 3PEVA 2NQ2C 4MRPA 4EFLA 4DCUA 3V4RA 2WJJA 4Q4LA 4E22A 1NIJA 2IEYA 2WJYA 4OQNA 5FTJA 1L8QA 4W5WA 2JLXA 3EPJA 2A3RA 3R9XA 1UKZA 1AK2A 1Z83A 1YZLA 1T8TA 2DHRA 3IIMA 4GMXA 2ZI9A 3QENA 3ZJYA 3SBDA 5TB5A 1S9HA 1ZRHA 1KK1A 3D3QA 1G7RA 1A4RA 2IUSA 4IOKA 3V4FA 3GLHB 4MKFA 2GEDA 3OEED 1HURA 4FMCB 4FD2A 2BKUA 4R2HA 3UG7A 1DAIA 2JA1A 2QMOA 4B75A 4DXAA 2GKSA 2ERXA 4ZO4A 2WTUA 5ELXA 2JLUA 1G8FA 4EQ6B 1IOZA 1OLOA 2W0MA 3MAAC 4A9AA 3KUDA 1NY6A 3FKSA 4UXIA 4YMTA 2OT3B 3SC3A 1HA3A 1QHIA 1R6BX 1S96A 3U60B 1NBMA 3BFXA 4ESHA 2CL0X 2H7VA 1W0KA 1LFDB 3AM1A 5EE0A 2UZIR 4QBHA 3ZZTA 2J7PD 2J0UA 1G8GA 4BZQA 2B21A 1G18A 1ZNWA 2C9CA 4QBGB 4NPHA 3CONA 1H8ED 3R8FA 2PZGA 1SXJC 2Q9CA 3O8CA 3GQBA 2CNWA 1NN5A 1NP6A 1XD2B 3AVTA 4TT3A 3B60A 1CKEA 2KSQA 1U94A 3RRZA 3SYLA 4JIMA 4JLJA 2RH5A 1D9ZA 2WJVA 5K8LA 1Q44A 1BKDR 1A5TA 5KTYA 4NYIR 5FUXA 2ZSFA 2IYXA 1CJUC 2UZ3A 1TQ2A 3QXCA 1NMZA 2C03A 3B13B 4GRAA 4B3BA 3KJGA 1TL7C 2YWFA 3C16C 3MRSA 3BBPA 3ICEA 1KI8A 2IHYA 4LJ5A 1UBCA 3EC2A 4OQLA 2CE2X 1KZGB 4PPNA 4EPRA 3TSWA 4EPVA 2QM8A 1VECA 3BB1A 1P2UA 1LTQA 2O8DB 1AS3A 1E0KA 3KJIA 4YMVA 5FTMA 4IHQA 2W83A 1E4YA 3VKHA 4G5SA 1G9XA 3MCAA 1IM2A 1NN0A 2OXRA 4DT1B 2BC9A 2VBCA 2G9NA 4PTLA 5FUYA 4TLEA 2XTMA 1AA9A 4Q5IA 4LWZA 4J0QA 3I8SA 3KB2A 5L3SB 4HLUA 5GJWC 1DG3A 4DLYA 1XJ0A 4LY6A 4OJKA 3V9PA 1I4TD 2A7QA 1EFRD 5G53C 4BFSA 3MWLA 2FSFA 1NSTA 4DLRA 1ESNA 4JSYA 3WYFA 2PX3A 2R2AA 3PUVA 3EXAA 4B74A 5EE3A 1KY2A 4LBZA 3QG5A 4HEJA 1WB9A 4I1VA 3L82B 1OH6A 1MT0A 3VX4A 421PA 1Z6GA 5FUVA 5EP3A 1DEKA 1OW3B 1W0JD 2OILA 2FEOA 4O2LA 1NKTA 4BFVA 1GRQA 4JT4A 1ZU4A 1L4UA 1U0HC 5F2EA 2NO7A 2WOOA 3LBNA 4YXWA 2A78A 2FE4A 2R8RA 1Z08A 4NYMQ 4IOLA 3ADDA 4LRWA 4LYAA 4PQRA 1QHGA 3GLFA 3UWKA 4N3NA 5B64A 4RZUA 4C7OA 1ANKA 2ZITA 1KYIA 4LJYA 3ZVRA 4P32A 5J40A 3FWYA 3BJIC 1KMQA 1G4AE 2OLKA 1SKQA 4FMCF 1UADA 5KSZA 1AZTA 3BORA 3CRVA 1WP9A 2ZI4A 821PA 5SZIA 4G5OA 4JZKA 3U5ZB 3GLIE 2QP4A 4URUR 4D4JA 2BIFA 1F2TA 1GRRA 1KIMA 1OF1A 5BN5A 1SQ5A 1Q1ZA 3JVUA 4ARZA 2GXQA 1AM4D 4LCBA 1J99A 4OQFA 1RRPA 1CLUA 1Q1QA 4AC9A 3H4MA 1ZCAA 2ZRHA 4LX0A 1S9DA 1SXJE 2ZEJA 3IBGA 1HT2E 2VF8A 3WBKA 2O8FB 1X6VA 4MRRA 1DO2A 3GJ3A 2BMFA 2XITA 2AXNA 1P75A 2A5JA 3SI7A 3K0FB 1T3SA 1GTVA 3KKPA 4YDSA 4DEYA 3TUIC 4Z54A 2IWHA 1S1CA 4LJ7A 1XTQA 1GNQA 4WAUA 5HZKA 2OXCA 4QHSA 2F3TA 1G19A 1W4BA 2N46A 3K9HA 3L43A 3LQRA 4RD2A 3FFAA 1P5ZB 3ZIAA 5DN6D 1W4RA 1NG1A 5FBQB 1ZD8A 3AGQA 2IXFA 3OFNA 3WRXC 1YVDA 5AWFC 2WWFA 2XB4A 1YZTA 4UJ3A 4UXJA 1QHXA 3LV8A 4HLQB 1ZCBA 3VMFA 4M21A 1DO0A 1XXHA 4MRNA 1KJZA 5BQ5A 1Q1BA 3KKOA 3U3RA 2XZOA 2VHTA 3NWJA 1CRPA 4R9UC 4PX9A 1JJVA 3CWQA 2E9SA 1T0JB 2HJGA 1EWRA 3CX6A 1JAIA 2R6DA 4P0TA 2Z43A 1UKVY 4M22A 221PA 3W8NA 3LBIA 2JEOA 2BM0A 4Q7MB 5AJWA 2F43B 4EJSA 5IF9A 4MKIA 4OL0A 4A15A 4NYMR 1VYTA 1ZU5A 4NCNA 3T5GA 1P2VA 1EFHA 3AKEA 4MKHA 2BMEA 2O0JA 5HE9A 3QEJA 4CT4B 2WIBA 3B2EA 2CK3D 3K70C 4TL8A 1P2TA 3AF2A 4Q7JB 3C41J 2MMGA 3CRQA 4P4TA 1Z6TA 521PA 2WPDD 1FL9A 2NOAA 4P4UA 1KDOA 3T61A 3A1UA 2WV9A 1EX7A 2ZM5A 1Y3AA 4LJ9A 2ZSDA 1FNMA 2QI9C 3THWB 2CXXA 2Q6TA 4LJAA 3NHBA 2VSOA 1JR3D 3OF5A 1SVOA 3Q5EA 4A6PA 5BXQC 4TL6A 1J90A 3NBZC 3EWAA 4LV8B 2AD1A 1EK0A 4ITRC 3A4NA 4BLOA 2JJ8A 1MO3A 4KAXA 1MOZA 2BJWA 2HCBA 5FR1A 3I61A 2FFHA 3IDQA 4TTPA 4DIEA 4EPTA 4IOJA 3RSOA 3THXA 3KUCA 3EZ7A 2G83A 4RD0A 4XJXA 3OESA 1U8YA 3GJ0A 5DYIA 4TYWA 1OIXA 1U99A 1FP7A 1VPLA 3QF4A 1XBTA 4JJZA 3WHLA 1CR4A 1OV4A 1E9BA 4F38A 4DCNA 1KJYA 3AKYA 3BGWA 2JDID 3V00A 1E2KA 1G3RA 1M74A 4LC1A 4P4SB 4TQAA 3QKSA 4EAQA 4II7A 3RSLA 2FFQA 4LJ6A 1XTRA 2Z4SA 3EASA 1HH4A 2NZ8A 4I4LA 5FOXA 2OEPA 4BLRA 3B9QA 1ZC4A 1Z06A 3PG5A 1N0VC 2V1UA 5H1YA 4QJ4A 4DSUA 5BYKA 1Z0JA 4C30A 1QRAA 2AFIE 1WA5A 4PAMA 5JLJA 4AYTA 1XRJA 1ZYUA 2HCJB 3SQWA 1JR6A 4KCGA 4LPKA 2JATA 2N1BA 4X8LA 2PLFA 2ZJZA 3RS4A 2BDTA 3ZZ0A 1G3QA 4U00A 5FTLA 1IY0A 4YMUA 3R8CA 1GNRA 2GCOB 2ZJYA 1RVDA 3NDPA 4FN5A 4BLPA 5KDDA 1F48A 5E7MA 1A7JA 2HDNB 4OBEA 4CEIB 2FJUA 4FIDA 4S35A 1KI6A 2YVUA 1U98A 1KTVA 5C2JB 4HB0A 2EYUA 1ZNYA 2CJWA 4PC6A 1C9KA 1XXHE 5D3MB 4PPFA 1CU1A 1G6OA 2SHKA 4HZUB 2GNOA 1SGWA 4DSNA 2IHBA 3N2IA 5FOWA 1Z0AA 3SFZA 5C46F 1YZNA 2XSZD 5FI0B 4B6FA 2ZRFA 3ICQB 4BLQA 5K8TA 3BK7A 4LBWA 1ZM9A 2GXSA 3PR1A 4QHTA 3T1OA 3U61B 4DDTA 5FUWA 3WYGA 1BH2A 3RNLA 5CB6A 3AP1A 3GEEA 1VYVA 4A92A 4HLDA 1DELA 2IYZA 2QAJA 3CF6R 4XVRA 1E9SA 1U8AA 1Z6XA 3OEHD 4ZPXA 1SVIA 3A4LA 4QC2A 4BECA 2EFHB 4MYHA 4O2RA 2QTVB 4TYQA 4DRZA 2RHMA 3RYTC 3CRMA 5J4VA 5JJKA 4L8GA 1VKJA 3E70C 2K5UA 3N2EA 4QM6A 1KOFA 2Q9BA 3PCRB 4PZZA 1V43A 3NDBB 3IIKA 4D81A 1VCMA 2G88A 2DFNA 5SZKB 3AUYA 2EYQA 1H65A 4TMKA 2FPMA 1FUUA 1P3JA 2ZAOA 4PQFA 4V0NA 3ZYCA 1OYYA 2XGJA 2QE7D 5BN3A 2XJ4A 1KMHA 5CIQA 4X8HA 4BRUA 3DVLA 3EIEA 3ZVLA 5EJEA 2IYSA 2ZI3A 4US1R 3DM5A 5IK2D 3PITA 4W7SA 1AQYA 2YYZA 4KXFB 4CDGA 3I4LA 2RGXA 2C77A 3X1DA 3I1FA 2WICA 3CF0A 1XFAA 1CEEA 2QG6A 3U3JA 1OHHD 2D3WA 1GITA 4Q4AB 4XVUA 5AK0A 4DSTA 1NN1A 1FNNA 4MH0R 3GJ6A 3B1VA 4X8MA 4FW9A 4Q9KA 2RMKA 2OE2A 4LC0A 3EA0A 2D62A 4B35A 5FL7A 5KNDA 4TMZA 3UXMA 4DUGA 4GFDA 1GP2A 1UBGA 2IC5A 3ADBA 3LWNA 4NCHA 2F1JA 1CTQA 3I8XA 3C4JA 4PANA 4DHEA 3TNFA 1W36D 3T12A 1NNEA 4FMDB 4W5JA 2QPOA 4LI0A 4B76A 2O0HA 1Z0FA 1Z8FA 2C5LA 4EFMA 2FNAA 3M4YA 4F7WA 4LYJA 3IILA 2D7DA 5KSOA 1M8PA 3HDTA 4KFUA 4QFMA 3X1WA 5B57C 3BH7A 3LAWA 5FOSA 3K1JA 2QZ4A 1SKYB 1XD9A 2H17A 2ONKA 1MV5A 3VR2A 2OBNA 5AJZA 1IJEA 3E1SA 3MJRA 1G1MA 4B33A 4JKIA 3ZH9B 4A36A 2FEMA 2QROA 5JWOA 4QJ5A 2XTNA 3A4MA 2G1JA 1W49A 2VHQA 4PC1A 3P32A 3FMPB 2ZANA 4WZBE 2QMEA 3K9LA 3U4QB 5CDFA 2QBYA 3X1YA 3RC3A 4GZLA 3IKJA 2GK7A 1F5NA 2QAGB 1EFTA 1RZ3A 5CK5A 3TAHA 2XNDD 1X8LA 3KJHA 2FSIA 4Z8XA 1QHHB 3EZFA 4DVGA 1KSHA 1P6XA 2ZYWX 4NHOA 1GL9B 1KDRA 2ZS8A 1R4AA 5J4YA 1DBSA 3M0EA 2ZRLA 4Q1CA 5E3HA 1E32A 4YQFA 1XEXB 1KSGA 1UM8A 4IFBA 1T3HA 2CL6X 1X1SA 3W6NA 4F4JA 4XIGS 2ZVPX 4M1SA 4LHYA 4WW0A 3REGA 3CNLA 1QVAA 3SE0A 1VCOA 3PQCA 4N1AA 4MRVA 4A0GA 3A1TA 1RJ9B 2HV8A 3IHWA 1AQUA 4HUQA 4KHZA 4B73A 3TE6A 1W2HA 1ZBDA 2ORIA 4P33A 1XPUA 1OKKA 2B7CA 4TLAA 3KXIA 3VR1A 2PMKA 1L7VC 4PR0A 2B7BA 4DB2A 1XB2A 3W90A 2ZUBA 3TJZA 2TMKA 4KSBA 4TYNA 4TZ0A 3WHKA 5DNYB 2VTKA 2IW3A 4ZCIA 2WKQA 2ANCA 4NYJQ 4HAYA 3PEYA 1O3YA 3MUFA 5BWMA 5GJCA 4IDHA 1G7SA 4BEJA 4EKDA 1XJCA 2WWYA 1OFTA 3AVWA 3SEAA 3KXLA 1XPRA 4PHFA 3W6PA 2G0NA 2BHRA 1OH5A 4HSEA 5TVKA 3IPXA 3C8UA 4RKFA 4CGZA 1NSFA 4LV5B 1VG8A 5JMTA 4GPTA 3TIFA 2VP4A 4BEBA 1P2SA 2VP9A 2NO1A 3DHWC 5HZHA 1W44A 1WE2A 2KB0A 5L3QB 2W2XA 3CM0A 1NKSA 1HTWA 2X1VA 1RRGA 4WOPA 3GFPA 3TW4A 4NP6A 4L16A 5JHHB 1WF3A 4DCTA 4M1YA 3CR8A 2HLDA 1FUKA 4AKGA 2QENA 2WWIA 2FU5C 4DCSA 4L9WA 4F4IA 5B2ZA 1F60A 3FTQA 4FWTA 3K0EA 3FYHA 1FW6A 5LD2C 3RS7A 3UMRA 2AWNA 1N6KA 1S2MA 5KNCA 1C1YA 3NH9A 4NZYA 4NMMA 2JJ1A 3K09A 3ZD6A 2FGKA 3VKGA 2ERYA 1ZD9A 2REBA 2JGNA 4DLWA 1K8RA 3EZ6A 1E98A 4GNKA 3BFKA 4IXMA 2KE5A 1L2TA 1J2JA 4A1FA 3PUXA 3VU9B 4L5BA 2J0UB 3T1VA 4RSGA 1TQ4A 2R6FA 5EXTA 1VG9B 2C04A 5E95A 1U2RA 1KO7A 2DFKB 2XNSA 3GFOA 4NYIQ 2GF9A 2X8AA 2GBLC 4TMXA 1WBDA 5G3ZA 2FA9A 2QSYA 1S3GA 4OHWA 2VQSA 1ZUIA 4QL3A 3EARA 5IHPA 3PEUA 4JL8A 4L9SA 4Q4HA 2C98A 1XTSA 2ODNA 2GXAA 5JECA 3P26A 3GFTA 1R7RA 5ANRB 4R98A 5H8WA 4EJSB 2IF2A 4YMSA 2IYVA 3PEWA 5DI3A 2IS4A 4GOJA 3OIYA 4F93B 1KI2A 2AHOA 3IUYA 4TL7A 1GOTA 3SZRA 4BZPA 1KDPA 2IUTA 4V0KA 5HPYB 3ZZUA 1VG0B 1YR9A 3FVQA 4F92B 1U90A 4AG5A 1I2DA 3IEUA 3AP2A 2FWRA 1MABB 1NF3A 2H5EA 4WZAE 1IJFA 5DHAA 3HYTA 1Z2CA 3DOFA 1E79D 2H1LA 1F2UA 2C99A 3GLIA 2A5FA 3TBKA 3W34A 1BYUA 2H92A 3KQNA 4TQUS 2NGRA 5EXSA 3GLGB 3RS3A 3OE7A 1ZM7A 1XZPA 3VR6A 3THYA 4C0JA 2JCSA 4YONB 5F9FA 1X1RA 4M1KA 1IXSB 1Z0IA 4HUTA 2C95A 2ECKA 1SXJA 5CJPA 1H8HA 1ZVQA 4Q4JA 1LF0A 5JJIA 4XD7A 3W6OA 2ODEA 1VCIA 1U0LA 2JLQA 4C0HA 1OXVA 4RCZA 4TLDA 3C14C 4YLGA 3DKVA 2WSSA 3WYAA 5JZVA 4US2R 4POAA 2D2EA 1ZC3A 3K8YA 2ZYUX 1I2MA 2R9VA 1G7TA 3KL4A 2XXAA 4XSGA 3GLFB 1ONBA 4KFSA 4RFSA 4TMTA 4E07A 4BLSA 2DYKA 3QE0A 3LD9A 1E2LA 4M9SA 4Q1BA 3U7FB 3IHLA 3RWOA 1G8YA 3TQFA 4MUAA 4MKGA 4V0ME 3KTAA 4AIIA 1G6HA 4LJ4A 4LZZA 3KQUA 4TSFD 3SJCA 3OIWA 5F9HA 5DE3A 2D74A 3O8RA 2QUZA 3GJ4A 2J46A 3IO3A 3KFVA 1E1RD 1II8A 1GKIA 3FHTA 1IHUA 3GJ7A 3MFYA 2HJVA 1XTIA 1F2TB 3CBQA 2ZJBA 3AB3A 4ARZB 1N25A 3LFUA 4KLNA 3QXJA 2JIZA 3REFA 1ZNZA 2XAUA 2ZUCA 2HF8A 4G5QA 2Z83A 3TQCA 4RD3A 3CRW1 1YR6A 4Y0VA 4NCKA 4LDJA 1VG1A 3Q9LA 2LKDA 3K53A 2WJGA 2IYQA 1OH7A 1XTKA 2YC4C 4HAVA 2MSDB 5HKKA 4Q48A 4BQSA 1HE1C 4TQ9A 2XZPA 3W5IA 5FBRB 4B3CA 2WZQA 5AUNB 4XTRA 3JVVA 3A6PC 1OJLA 3K0CC 2G77B 2J41A 2VO1A 2PCJA 3CWZA 1KO1A 3AF4A 2OBMA 3EZ2A 3DDCA 3GJ8A 1IONA 5L8VA 2BVNA 4QGAA 4U7DA 2FSHA 2MSEB 4Q47A 3VR4A 3ZVNA 2W6JD 1Q57A 5JJLA 3A37A 4D80A 3U3MA 2JJ2D 3HU1A 2KBFA 3SYNA 2QEQA 3QUSA 2V7QA 5KOYA 2O8EA 2P6UA 1BMFA 1I4DD 3X1XA 1SHZA 2CEAA 2RCNA 2F6RA 2ZUDA 4H1VA 2RB4A 1O87A 2D4HA 4MYCA 3RS2A 5LB2A 4YDHB 2XX3A 5FH9A 3OAAA 4BZXA 2AR7A 4K46A 2P6NA 2VYFA 3TUZC 4C9BA 2F3RA 3K0AA 3C15C 3THOA 4KU4A 1JBKA 5P21A 2E87A 3AEZA 4A2PA 2GZDA 2ASEA 3W9YA 4EQ6A 3F8TA 1OT3A 4JLNA 4OK6A 1NN3A 2BV3A 4Q1DA 1R0YA 4MGYR 4OK5A 4DWJA 2PBRA 3VTKA 5KSYA 1TUEA 3FKSD 5J5CA 4PPGA 3QPUA 5GJVC 4QGGA 1NBMD 2YJTD 3KFXA 1FTNA 2YHSA 1NI3A 2R6CA 1W0KD 2F7SA 4GT1A 2JLSA 4KODA 3LVQE 2QP9X 2V8OA 4JVLA 1E9RA 3CPHA 2GJKA 4JLVA 1YZGA 3L0IB 3WXMA 1XEFA 3F3YA 1M1YE 1D2EA 1KO5A 1XD2A 2HUPA 3AV0B 5KSPA 5HCIA 2X19A 4RVCA 5DO9A 1IN7A 1E9AA 1NJGA 1P62B 2CNWD 2QMHA 4UKDA 5BYJA 3RABA 2REXB 1W48A 3TUJC 4TT3D 1DVRA 2AWOA 2Z5FA 1KI7A 4KLZA 5CLQA 1N5KA 4TYPA 3LXRA 4Q9IA 2W6IA 1GRNA 1E96A 1ETUA 4NONA 4AKHA 3THXB 4KI0A 4ZIRB 1DS6A 2G0TA 4EPWA 2O8DA 2ZRNA 2OLJA 3QF4B 2QORA 3BAFA 1MO6A 1R5NA 1TAGA 1YHNA 3EG5A 2WM9B 4HAZA 2YOGA 3SJAA 4TL9A 3SR0A 1M7BA 2BMDA 1JECA 1E0AA 1RPZA 2EW1A 1CJVC 2QP3A 3KB1A 3D6TB 4JLOA 1D6JA 2DBYA 4XWOA 5JSZA 3S1AB 2O8CB 2GAOA 1R8QA 4H9GA 2ZJ2A 3KKNA 4PAQA 2C9YA 3GP8A 1T8UA 1DAGA 1ZM2A 1U9IC 3HWSA 4RKEA 4EPYA 1J8YF 3AVQA 2WKRA 1E1QA 3UMFA 3BXZA 4KV9A 4B2LA 2Y8EA 1W36B 3R20A 2ATXA 2VEDA 4JLPA 1C4OA 3MWJA 1G3UA 1XZQA 1Y63A 4US0R 2P65A 1S1MA 2AXPA 4R71A 5CM8B 1M2OB 2F1IA 2ZI6A 1IXZA 1OIVA 4FWIB 3NKVA 2CHQA 4Q7KA 5DSZA 4DLXA 4ZI3A 5AJVB 5AR1A 3GMTA 4JVNA 3AKCA 4ZCMA 4IEIA 1XMJA 2AK2A 2WIAA 2ZE8A 4BWYA 3VHXA 1KI6B 2C8VA 2ZETA 4LK2A 4ON9A 4YXWD 1OXSC 1OIWA 4OQMA 1WXQA 3HR7A 2D2FA 4K8OA 1M34E 2GCPA 2VHJA 2JLRA 4GDFA 4DKXA 1AJEA 3RS0A 2GJ9A 4IVRA 2QU8A 3SYKA 2PT7A 1GFIA 4P3YA 4G01B 1NLYA 3HYRA 4FCTA 1NMXA 3KDSE 2UKDA 3MWKA 3U7GA 1Z63A 4M1WA 5JI2E 3VQTA 5E7JA 2DPXA 3QSYA 2VRWA 4FMBB 1KSJA 4RFVA 2BBSA 3GLHE 1N6HA 4O25A 2OAQ1 2B8WA 3BRWD 4HB2A 2VF7A 4PHGA 1E0SA 1OFHA 2ZSEA 2YKGA 2GJSA 2WAYA 2J0QA 3C7KA 1W46A 3MLEA 4ZCLA 4D4KA 1Q20A 6Q21A 4UNRA 2C96A 2YZ2A 1LF5A 1IXRC 1TX4B 1ZIOA 3FKQA 3ZQ6A 4AG6A 2VHCA 1R10A 3X2SA 2OFXA 2Q9AA 2W2VA 2ZJ5A 3K0FA 4UXHA 4FCVA 3IEVA 1VTKA 3SJZA 3PUZA 5J4HA 4TZ6A 4JLKA 1JEDA 1HY3A 3W5JA 3I62A 3A58B 2BEJA 2QTFA 2WJIA 1CR0A 5EE1A 1G8HA 2QQEA 3BIFA 4C0KA 2JLYA 3EX7C 1N2CE 4D2IA 5H70A 3RANA 1KMHB 2RGEA 3FDIA 3PJRA 2I4IA 4M8NE 3ZIAD 1JR3E 2RHDA 1TTTA 2FN4A 3PIRA 4URWR 3OFND 2JASA 1SULA 3U7HB 1HUQA 1QF9A 4TLBA 1E6CA 2PT5A 4B71A 4GSYA 2EQBA 4QNRA 2R44A 3CH4B 1E2GA 5AUPB 2GF0A 4ZKEA 5B30A 4GBMA 4A8JB 4IOMA 5DLQC 5JS7A 1ODFA 3U44B 1M7GA 2C9OA 1E2PA 1EXMA 2VL7A 3NC0C 3I92A 2NO9A 4CEJB 4NDZA 5EP4A 1EESA 1Z6AA 2ZU0C 4Z51A 4Q02A 1XCGB 2F43A 3BS4A 1AGRA 2J9RA 1P4SA 1M6NA 4DC9A 4HB4A 2P3SA 2B6HA 3MJHA 5C18A 2V54A 1KAOA 4B43A 2ZRIA 3TRFA 3KQKA 3T34A 3R9WA 3SJBA 1TU4A 3H1TA 3LLUA 3AF1A 4IRUB 1XP8A 2ZRAA 1DAFA 1CIPA 2OFWA 3HR8A 3A1WA 3FMIA 4TWZA 3AP3A 2BCJQ 2HXYA 4BGDA 3K9NA 4IEEA 4MYUA 5BN4A 3WBJA 1US8B 1PLKA 2P67A 2REOA 1RRFA 2OM2A 2X2EA 3C5HA 3QKTA 4Z1MA 1TUIA 1UDXA 1YQTA 1A2BA 4OHYA 3KKMA 1W36C 4HDCA 2NPFA 1XTJA 3ETLA 3PV0A 3THWA 4U02A 4CT5A 4A0RA 4CZ2A 1G4UR 1KGDA 1GKYA 4JJKA 3WMFA 2ZRGA 2WSMA 4ABYA 1JJ7A 3TSOA 4JBXA 1NG9A 3EPKA 1ZM3A 3EAQA 3RVBA 2GZHA 4U5XA 3CLVA 2EWVA 4RD4A 2V4ZA 2BCGY 4RJLA 4AURA 4C0AC 3GPLA 1JEEA 2FV8A 1EWQA 2YINC 1JNYA 4JBWA 4JS0A 5G40A 4ZV4A 1FX0A 3TLXA 1D9XA 1W47A 4V03A 1XEWX 3WMEA 2QBYB 2D06A 2O8BA 2RKOA 2WOJA 3VNUA 4M9QA 3QIAA 1OXTA 2OESA 4Y0AA 1R2QA 3JZMA 4JLDA 4PO8A 4OQXA 1UBEA 1N6RA 2CL7X 2QPAA 4DSOA 1QHSA 2V9PA 1M7HA 4C0LA 1SVWA 3ZS9A 1NVXQ 3ZVMA 3P4YA 4JBYA 4GP7A 3NEJA 1CF4A 1LVGA 4JYCA 2J87A 5K8UA 1RKBA 4KVGA 4WIAA 4EUNA 3QVVA 2JAQA 1T9HA 3P1JA 2GA8A 1Z0KA 4JL5A 2WWWA 4JLAA 4GL2A 2XOKA 2Z4RA 1DOAA 4KYIB 1NY5A 4HUQB 3Q7PA 5FI1B 1CXZA 1E2DA 4ZDJA 2CDNA 3DOEA 2JLWA 3RRYA 2BJVA 3KQLA 2IS6A 4X8OA 4O3MA 1GIAA 4HZIA 1FZQA 2FGJA 5DISB 5FPHA 2ZS7A 4IXNA 4Q18A 3CKLA 3HU2A 5IT5A 5DGXA 2GCOA 1PUIA 3QXSA 1JXMA 1NJFA 4MUBA 3PFIA 2JLZA 4BLTA 4HLCA 1PV4A 2QQ0A 4RZ2A 4CEIA 1T6NA 3FPAA 2FZLA 1ZUHA 5F98A 1CR2A 2QPTA 3K0SA 1SVLA 1QHNA 4JVSB 4DLTA 1NIPA 2GTPA 3BE4A 2V3CC 4OI0A 4RD1A 3B85A 4ERNA 3G0HA 3NH6A 4B3DA 3A8TA 3I32A 1IN6A 2QRZA 4NCIA 5EUQB 4EFNA 1Z47A 3L8ZA 2IYUA 4UQOA 4A8JC 4B32A 1GVNB 1TQDA 1OYWA 2PLRA 1N5LA 3I5YA 2F55A 4H1UA 1IY2A 4Q9JA 3VR5A 4LOAA 1J70A 2ZQ5A 2PEZA 1YZKA 2YWEA 3QG1A 1W5TA 4FI3C 4QBIA 3BERA 1G20E 1GSIA 3G5UA 3ND9A 4A2QA 4LUCA 4MA4A 2YV5A 1WQ1R 3NBXX 4OKSA 5H68A 1TADA 3QF7A 3QNUA 4TTRA 2W2TA 1SVMA 2OO7A 2D7CA 3R7WB 4ASUA 3EPLA 2CMKA 5FTKA 5IDVA 1F3OA 2FF7A 2GESA 4R7ZA 5HCNA 3D7MA 1YKSA 3QKRA 3K9GA 4B34A 1JB1A 2IBMA 2F1RA 1GM5A 4DIDA 3BD9A 3CNOA 1KSFX 2FSGA 1VDZA 5FR2A 4E5UA 1EGAA 1G17A 4LYHA 4QJ3A 2GRJA 4G5GA 1EFUA 1RYHA 4EIWA 3U7EB 3OIVA 1MRNA 1KI3A 3E2IA 1ZAKA 3RC8A 1FOEB 1E2FA 1N3BA 5CYPA 4KO8A 2C2HA 4CF7A 2ZPTX 4PSAA 2XJ9A 3QJYA 3ADCA 4Q4HB 4Q4AA 2OCAA 4IFEA 4URYR 1HV8A 2DY1A 4N0DA 3GEIA 3T5DA 4B3GA 2DWOA 3Q72A 2NZJA 4LPSA 1KDTA 5FPSA 1HQYE 2R65A 5JBQA 2WMOB 3DZ8A 2GVDC 4C3ZA 1QVRA 2OCPA 4CRWB 2C78A 3SS8A 1OB5A 5LBIA 4D4LA 3EIQA 1P73A 4I81A 1WRBA 5FL7D 1BS1A 4HDOB 2NG1A 4RD6A 4V0MA 2AX4A 4DUGD 5A5GA 4TYYA 4BE7B 4PZYA 2QGNA 2XTZA 2QRNA 1KJWA 2EVWX 3EZ9A 4G5RA 4B3XA 4M1MA 1WDTA 2FFAA 4XSHA 5EZ5A 1GAJA 2P0EA 3DKPA 3ADKA 4MDFA 1JQLB 5IRCD 2J59A 5EP1A 3GLIB 4FMDF 3OEEA 2CVFA 3SBEA 1G21E 1LW7A 1Z07A 2OHFA 4G3XA 3LLMA 1G3IA 1OFIA 4OJQA 2BEKA 2QL6A 1A82A 3KXKA 4L4UA 3THYB 1AKYA 1CBUA 4XWAA 2ZRJA 3I3SR 4Q4JB 3RRMA 721PA 1HE8B 1COWA 1NVUQ 3QEOA 2GBLA 3LQQA 2ZJOA 1UEJA 1LS1A 3F5FA 2ZAMA 4LHXA 4LYFA 4FINA 3CPEA 2XXAB 2J7PA 5G41A 3UG6A 3B9PA 3EA5A 4RFSB 2QT1A 3CB4A 5LB4A 2VIIA 1Q22A 1E9CA 1MH1A 3FMOB 1H8EA 4E09A 3ZQJA 1W2GA 3GCGA 3KTAB 4M9ZA 3WP0A 5FOVA 2RGBA 4V0LA 2P5TB 2H57A 1OB2A 1CJMA 1QHHA 4PSVA 2BKEA 2AKAB 1FPMA 2V6JA 3B7GA 1IN5A 3D31A 4D0GA 1YJ5A 4F4CA 2F1HA 2W58A 1IN8A 3M6AA 4LGMA 4PC2A 2WJHA 3CH5A 3MWYW 4WXPA 2DWPA 2R6AA 1E9FA 1N6LA 1T4GA 2H16A 2MMCA 4ACBA 1R5OA 3RAPR 3B6EA 2ZYTX 3G82C 4LHWA 121PA 4CVNA 4IJMA 4NU0A 4LSGA 4ZDIA 4BUJA 2Q0HA 4AKIA 3QQ5A 4QGFA 1E2JA 1MKYA 5D3QA 4Q7LA 1RJ9A 3T1QA 4C0QC 3UMSA 2V55B 1Q0UA 1VHTA 2QAGC 2WWXA 3DMNA 4PO1A 1E9EA 4MGZR 5TDHA 4TLCA 4G1UC 1T5LA 4UNNA 3CX7A 3KJEA 1Z0DA 4UNQA 5E4FA 1XU4A 3CPJB 1NLZA 4RZ3A 1OKKD 3BB4A 4GI7A 4MYTA 2VPPA 1EFRA 3IBYA 2GETA 1SVSA 3WNDA 4M1TA 3MMPA 3UK6A 3X1ZA 5JEDA 2J5XA 3GD7A 2NO6A 4WXRA 4OI4A 1Q21A 2YWHA 3RS5A 4QHYA 2CHGA 3TSZA 1KNQA 3CW2A 3ECCA 1JALA 2Q3HA 2ANBA 4B48A 1F6BA 5DH9A 1JI0A 1W0JA 3N70A 4IDPA 2ZXUA 1OPXA 1P9NA 2XB2A 2QN6A 5L3QA 4PC7A 2O8EB 3EC1A 1AN0A 2X77A 1AGPA 4C0SA 1KK3A 4ILEA 4S2EA 1NLFA 2IL1A 2FX3A 4A0HA 1NVVR 3JZAA 3RLFA 1A2KC 1XD8A 2FFBA 4C7OB 1TMKA 1DARA 2OCYC 3NEYA 1SZPA 2HLDD 4QRHA 1VYUA 5EXPA 4LHZA 3K0AB 1BYIA 2R62A 2DFTA 2RGNC 1L4YA 4OK3A 4QG7A 4CEHA 1GDDA 1GWNA 4CIDA 5AJYA 1KY3A 1WBBA 1II0A 1COWD 4BFZA 2JJ1D 4KFTA 2G6BA 2L0XA 2UVQA 2NTYC 3CUEF 1DAHA 5KU1A 4QBFA 3O47A 3H84A 4AY2A 1SHKA 3H0KA 3K0CA 4WVFA 5FFMA 5EE9A 3VU9A 4D0NA 2IUUA 1DAKA 1SKYE 2HYDA 4NKRA 5CB8A 3W3AA 2DB3A 5A4JA 3KZ1E 4OYHA 1XPOA 1ZW6A 1IAQA 1P60A 2DCUA 4FXPA 4Q00A 3UWOA 3W3ZB 1E99A 2YC2C 4LV6A 2HEIA 4XH9B 2J0VA 1E3MA 4I1UA 1XX6A 2A30A 2ZRCA 5DN6A 1U8ZA 4BFYA 3CNNA 2CLSA 2BBWA 3FE2A 5J47A 3SQXA 2BBTA 2FPKA 2GXUA 4A4DA 2Q3MA 1GNPA 1UKEA 3FMFA 2AFHE 2LKCA 3LDAA 3WNBA 1ELOA 3IQWA 1CRQA 4JT2A 1P61B 2IWRA 3SOPA 4URVR 1X8KA 3QOFA 1YZQA 4UNSA 2ZU6A 3L0PA 4D82A 4OHVA 3QY0A 4DB4A 3QI2A 4JLBA 2QT0A 2NPIA 1XXHB 5A0FA 4XWKA 1P72A 3BFVA 5TY0A 3AVVA 1N0WA 1MABA 2H8KA 5JSZB 2KBEA 2O5VA 4DBLC 3K70B 1XNJA 2OBLA 3B5JA 3BWDD 1NMYA 4JSTA 2GAAA 4OI2A 4C2UA 1T5IA 3QBTA 1QG2A 3O8DA 3GLHA 3GLGA 4AYWA 2RGDA 2CCJA 1TU3A 1UEIA 2VP5A 4PHTA 1R8SA 2IK8A 1QG4A 1CJTC 2ZRPA 2P2LA 3T06B
chains in the Genus database with same CATH superfamily
5A05A 4G0ZA 3BWEA 3U4IA 2HK7A 2QX4A 3INGA 4QU0A 3EAGA 4P5DA 3VR6D 1CY8A 1XZAA 3H5RA 5G3YA 1R5BA 1QCYA 1QFJA 2ZCUA 1EUZA 2VSXA 3IDZA 1UJ2A 2EU8A 2ODBA 3LXXA 4Q03A 2BHSA 1PV2A 3AEQB 4JLUA 2F8SA 1A77A 1J23A 3CRRA 4E5NA 1P17A 4TXLA 1MO5A 1LJLA 1GLGA 1J7KA 3DE6X 4HLUC 4PX5A 4RU1A 2AA3A 5G0UA 1CDZA 2WPDA 5SICE 4UM8B 3WRVA 5DEOA 1ZJ4A 1DADA 1SC4A 3R7NA 3UO8B 3SDZA 4CIYA 5JAZA 4UJ5A 4MV7A 4IRMA 3GOQA 5HR5A 3C3MA 5AP9A 1SQ6A 2C9MA 3S2UA 2ZUSA 1XZLA 1MORA 2BGWA 1JR3A 4Q6BA 4H17A 4DR2B 3RT1A 3NRJA 1UMBA 3QVTA 2P6MA 4EYGA 2VDQB 5K45A 5FO0A 3SWWA 3NW9A 1QK4A 2IEZA 3D0KA 3OFKA 1KDZA 2Q28A 1TEVA 1XWIA 3IVAA 3OEYA 4HL6A 1U7XA 2NADA 3BD6A 3V1LA 5DT2A 2WM2A 4BU0A 5BMVB 4CDMA 3KSZO 1TVKA 4WGFA 3T3OA 5KUTA 3K5WA 1ZZEA 4GOXA 5JAPA 4BMOB 3IMKA 3SEZA 3IP8A 1RYYA 1IQ0A 4OQEA 1JV2B 2Q21A 2VK1A 3FF4A 4XX0A 4AZSA 1ZZGA 2WA2A 3VMMA 4IW3B 4DLLA 5JISA 2QSJA 1E1MA 4YJGA 2CVHA 1H4VB 1OH8A 1PUXA 1QFZA 2HAEA 3NIBA 3HB7A 4CKWA 3JZFA 4DMKA 3ONWA 5IXJA 4L8LA 1C81A 2XGMA 1YS9A 4NH0A 1VCNA 3K5IA 1MJ5A 4RH1A 3PPYA 3TEMA 4TZ6A 4HNVA 2GZ2A 1K6MA 3C5CA 1O9BA 4TVKA 5BNFA 2AX3A 2OOKA 1H5NA 5M04A 4DV1B 2Z98A 2H5JA 4G97A 3NJ4A 4Y30A 3PENA 4V3CA 4BQQA 2P6RA 1NR5A 4HWSA 5E7IA 1Z0UA 3IB6A 3T4PA 2JGMA 2FOLA 5EXXA 5B1YA 4GAEA 4DC1A 1TJ3A 3HPRA 5F7OA 2VI5A 1K3TA 4K28A 4MI3A 2G3YA 3RTEA 1V7CA 3FHCB 1FFEA 2YOFA 4OVKA 2PX4A 4ZZ0A 2BM8A 4DTCA 4UZSA 3U0BA 1OFVA 4XX1A 4PR3A 1GL6A 4XM1A 4M7PA 2E7ZA 2ZRDA 3DF9A 4C2TA 5AJTA 1LQTA 1SCNE 2E1RA 2IS1A 2YW2A 1UFOA 3AF3A 2IT1A 3LC0A 4FNAA 3V1KA 2KI5A 2G1AA 2KJQA 3ZI7A 4RF4A 5CD9A 2HR1A 2DPYA 5BW4A 1K3UB 3WJ1A 2GK3A 4JSRA 4Q3EA 3EF1A 4B80A 1GGHA 1T29A 1UDRA 2GK6A 4QGHA 1UUFA 2A58A 3WK7A 2ADFA 3C1OA 2LE0A 3AR4A 4RWEA 2MINA 2CCGA 3JQPA 2FVXA 3USCS 4QNMA 1RRCA 1NX6A 1ZUWA 2BN4A 5EKXA 1AS2A 4RC9A 4B44A 3CE6A 2JFQA 2CKDA 2A0WA 1LY1A 2Z8YM 3HKCB 3QVUA 4QPZA 1W34A 3PRHA 1P7VA 1L5NA 2H5LA 3GFFA 3I42A 2OD7A 4XWGA 3IQZA 1DT5A 1LJ8A 4CJXA 1QPZA 2M6SA 4D1YA 2CN1A 3LX5A 1L1FA 5C9ZA 4WFKA 1CUSA 3EAFA 1X3SA 4IIDA 4LMBA 1RBQA 3LZDA 2X4IA 4MMXB 2CUKA 4MV0A 1CZHA 2HC9A 4O2AB 1HDEA 3B1FA 4Q19A 1OE0A 4R84A 4RX1A 5NLLA 1OX6A 2N42A 3NETA 1EVIA 2SBTA 3F67A 3VR4H 4BNHA 3FWPA 3NM5A 3UJ6A 2J7KA 2W7TA 2B98A 3G0CA 3HADA 4HOYA 4BFWA 4DLNA 2O8FA 4Q4CA 4AZWA 4EHNA 1CQXA 4M53A 3U7RA 4K81B 1ST2A 2PJZA 3PUKA 1BHSA 2AN3A 2G5CA 3ONDA 3R0VA 3CO5A 1BCSA 2DPHA 4K9KA 5SY6A 1EFLA 1KZ7B 4W8OA 4X1KB 3DCIA 2I6TA 1L8LA 3PC6A 1AKWA 1Y8QB 3Q3EA 5ALNA 2QE7A 4BFXA 4D98A 3GGPA 1Y9ZA 3OZSA 4GPZA 1DC7A 3UAYA 1FX0B 1JWLA 3R9IA 3OBIA 4QOGA 2O8BB 1U3DA 2WF6A 2NYRA 1NBWB 5JQGA 1SQGA 1LWNA 3TMAA 3BKWA 4BJ1A 2W6ID 4HVCA 3T35A 4YX9A 1FSPA 1J0EA 2WYIA 4NOLA 3Q8XB 2Z6VA 1UAYA 1OHHA 1ZRNA 2OAP1 3CUYA 3QVWA 2AZTA 5I7SA 2WMDA 1IBKB 3ZHVA 1DJOA 4KQGA 1QZXA 2QRHA 1CZNA 4C0XA 4IDFA 4J6FA 2A92A 3ZLJA 2VJBA 3GRRA 2JAWA 4L2IB 1EEXB 2JNWA 3FHOA 1NRJB 1Q15A 1DCMA 1K8YB 3K9QO 4IV8A 4JOQA 3WK4A 2BH9A 1KK0A 4QQ8A 4D26A 4W9NC 1Q3TA 3C43A 1N2IA 2ZAGA 3W2EA 1OQAA 1PJ3A 2MR6A 3W4KA 1FRZA 2J3JA 2AEFA 3L6BA 3DPUA 3UWSA 3UJPA 2H1OA 4LE2A 3NWBA 2OZVA 4X54A 1Y5MA 2OGSA 4L85A 1NDUA 3Q6NA 3MXOA 5PNTA 4YR9A 3MCTA 3HJNA 3PGXA 3KT0A 1E1QD 2ASVA 3EOZA 2NMVA 4RJIA 4URXR 3EXIB 3AVUA 2JFVA 4EL5A 1PKXA 1RPJA 3TD9A 1JLSA 3M9LA 2OGZA 3NBFA 4MSUA 4DLVA 1W85B 3I39X 4RQAA 5E1BA 4WBNB 2Y0CA 1VPDA 2JCBA 2B2NA 2JHCA 3PTZA 3RC1A 2NZ2A 4ZQEA 2D7JA 2ZRBA 1PK9A 2HZBA 4J3FA 2ODWA 4EYEA 2BFEA 3H9QA 3LH5A 1UKAA 4GQBA 2XQIA 3VBEA 2JFNA 2CVOA 2GN6A 1DG1G 3WWEA 4XFDA 5KYKA 4IDQA 1AS0A 4HI0E 1P8AA 3GO4A 4Y67A 4DG5A 4ZD6A 5KMGB 4M1EA 1CY1A 1X1EA 3PSHA 5A4DA 4LF4B 3BTUA 5FV4A 2IFTA 4QUJA 3AM3A 4YHBA 4FCWA 1P1JA 2K7ZA 2QG4A 1TCVA 2GHIA 3DTYA 3L0DA 5MN5A 2H54A 1EP9A 1GT91 1NAIA 2II6A 2YJ6A 1RAAA 1NMQA 5KB3A 4A5SA 4N0EA 1VLJA 1ZD3A 2FKNA 3DD1A 3KDPA 4HB3A 4NXNB 2ZOSA 1VIDA 4INOA 3W6UA 2GDJA 2F4VB 2R8PA 1CY2A 1Z2EA 2BONA 1O77A 1OMOA 1RE0A 2B99A 3HQ4O 3HEMA 2CDRA 4J0DA 3CX8A 3VTFA 1R0ZA 2JVIA 3OC6A 2ZBPA 1YZUA 3PHBE 2BMJA 1FRFS 1DE0A 1P4JA 4ECEA 2KQUA 1IQUA 1Z36A 4YO8A 3G2HA 2OHIA 2G7MC 1A98A 2O3RA 2GILA 3WZMA 4BRSA 4FB5A 1ZMXA 3I3OA 1FFGA 2F64A 3SC4A 4U2GA 5CH8A 5IZCC 1G0OA 4O1IA 4MITA 1C8BA 5JCPA 4HXGA 1NMEA 4RVUA 1WW3A 4AMZA 2Q6IA 2IXDA 3OTGA 1PR2A 3HY3A 4JJIA 4KKXB 1CJSA 3H18A 1O89A 1NZJA 2ZBRA 5CIWA 1ZP6A 1DAMA 1RMTA 1R0WA 3ORSA 5MN4A 2CLIB 3ED5A 4G07A 5FORA 1Z2NX 1HDXA 4RIEA 4AYXA 1YZ3A 4YRAA 1ZNQO 4DOMA 4B9AA 2H8GA 3UOAB 4LZNA 1JVBA 2YWJA 2VA8A 3RC7A 2OAEA 3PUYA 1T9GS 5CLIA 3CEMA 2J3KA 4KL8S 3T1TA 3FXAA 1DC6A 1KEVA 5FBLB 5CCXA 5K0NA 3T7KA 2I2FA 1VJ1A 1E89A 1LVUA 2H59A 2WWGA 2G72A 3B8HA 1X70A 3P4XA 3RWMB 3U56A 1A9OA 5G1NA 3FGPA 3SJ7A 1F9EA 2Z57A 4NBWA 3GLVA 5EYPB 5JAMA 4YAWA 1RKVA 2IEDA 3LGSA 3GGDA 1RWOA 4CMEC 4G8JA 4HQLA 1HNWB 5TR9A 3L46A 2DCMA 3KQTA 4QYIB 2ET6A 4RDXA 5IWAB 2Q5CA 3KIPA 4R31A 4UM9D 4CLEA 4NOJA 3H2BA 1HQCA 2PA0A 1T43A 1L4NA 1XZDA 1I1OA 4U7JA 1NC1A 4R9RA 5TC4A 1UFKA 4DIOA 4IDGA 3B1YA 3B6KA 3I9V6 4N5IX 3RBAA 1PT5A 2HF9A 2O0LA 2OVFA 1ILWA 1N33B 4PCUA 1M54A 1Y1RA 3NDRA 3CNEA 2QD2A 1LSUA 2W6CX 5EMHA 4UOQA 1IZYA 1CS4C 5ALRA 5IDQA 3ASVA 4OJYA 4HR7A 2NXCA 4IFIA 4IPTA 4MLCA 1G3MA 5JTTA 3G13A 3IUQA 3GN1A 2VLIA 1K6EA 1QYVA 3AMVA 3C6ZA 2H4FA 4FZ3A 4XSVA 4YS6A 1DPFA 4G9BA 2WWHA 4PYQA 5KJ6A 2A5LA 2J9FB 4R2WA 3SC2B 5EQDA 5HOQA 4B4DA 5DLPA 2O2GA 4BWGA 5TARA 1XKTA 3OMLA 2JFPA 4G2NA 4ZPJA 1X7HA 4ZAWA 3T9DA 2HT6A 5CX1B 2B8TA 1W35A 1UMDB 2UYQA 3S40A 2Q6KA 2IGTA 2Y0BA 4D8YA 4IZOA 4DZTA 2VNJA 3TNYA 1CUAA 3GDFA 1OROA 1RHMA 3DMHA 3A9CA 1BE1A 1B8OA 1E1KA 1L6RA 1A9SA 1RACA 2NU6A 2VAWA 3G88A 2WFLA 1IYZA 3N75A 1JIVA 3OP1A 4G65A 4ZEWA 1EG7A 2YZ7A 4IIGA 1SKBA 1S2OA 4BJ5A 1JIJA 2VH5R 5TPWB 1O0BA 3TK1A 1V3TA 1KJ8A 1CCWA 1PR1A 2A2ZA 2Z1MA 1OU0A 1S8FA 4GMFA 4NMWA 4RZHA 3NHYA 3B52X 4EY7A 2VYND 3O91A 4POOA 1C9EA 2P4EA 4RHFA 4IDOA 4MQBA 2K6GA 2PNJA 4H27A 4II3A 3E22B 4GWGA 2XHZA 1I10A 4OUDB 1FB5A 4TZTA 5F4BA 1QV6A 3ISTA 2O1SA 1AIPA 2Q46A 3HB9A 3O2SB 1H3NA 1ORRA 4I55F 3WMRA 4DS3A 3RRFA 3KEMA 1RIIA 3CV3A 3FLMA 4TMWA 3VPHA 4D44A 4DDUA 2AW3A 4I1PA 4Y3UA 3QEAZ 1YHZA 3UJHA 3KV1A 3TD6A 1G2PA 4LDAA 1CC1S 4MUFA 3IOEA 4QXMA 4EYSA 3T54A 3MS4A 5HVNA 1NSYA 2FP4B 3PLNA 1JXOA 2HH9A 3NBYC 3Q40A 1SG6A 4QTTB 1TYEB 1T5TA 2XOKD 3LGAA 3DL2A 4GL4A 1MJHA 4JC8A 5TV2A 3ZBPA 3SQOA 3ZE9A 4OHCA 1R0XA 5CNKA 3U4AA 2PEYA 1F6DA 1ZLXA 1XEWY 2BE7A 2CXTA 2VJCA 3C3EA 3LT1A 4MVJM 5HIJA 1FFHA 3W5SA 5C5EA 1NJ5A 3WAKA 2BTEA 4QXRA 1T2VA 4IQ0A 1P9RA 4U8HA 2B3TA 1E79A 1IBSA 2R4TA 3IP6A 3PC7A 4UFNA 4B3FX 4MWDA 1XCPA 2XEXA 2PH7A 4QPNA 1ZGZA 2HNKA 1FFBA 1OLUB 3K5PA 1YQQA 3DO6A 2CF5A 2FPPA 3GPCA 3BSSA 3NHRA 3AH8A 3PD1A 3Q7SA 4LQCA 4YI5A 5HM6A 1XPJA 5SZHB 4DDWA 1FLNA 3VKWA 4P58A 5JH7B 3ZC3A 4FS3A 3V4VB 4B6QA 3LC2O 1SUDA 3RFXA 1D03A 1FDIA 2HLNA 3D6NB 3F4LA 3KX2A 4IZHA 4WA7A 3QLVA 5LDDC 5IEBA 4FDUA 4YUVA 2AS0A 3RIGA 4P31A 3RVRA 3RVOA 3RVPA 3UJ7A 3ZU2A 3A25A 2CLDX 2FPXA 3P0RA 4NG5A 2FETA 2J09A 2P1DA 1KZHA 3V7UA 3MTQA 2H3HA 3ZD7A 1DHRA 3PQFA 3V2HA 1HDCA 1NVVQ 1MEJA 1WZIA 3DNPA 4O2BA 3T3GA 3NWEA 1UC8A 4U9HS 1E7MA 1M1YB 2VJDA 3G5TA 3F47A 1EUQA 1Z3IX 5KDOA 1IQPA 3U31A 3UY4A 1QOZA 2IYYA 4D8VA 2P27A 2ZB8A 3FCXA 2VTDA 3M6WA 5ALUA 5L7YA 4BNNA 1KKUA 3FSGA 3R75A 2Q49A 5EIHA 1Y4UA 1ZONA 2BWJA 4W1PA 5EP2A 3I72A 4UEKA 3E5MA 1M1XB 3D0RA 1UFQA 3M5WA 3SNHA 3WTCA 3ETJA 3CTPA 2CSXA 1JPJA 1D5CA 2Q4EA 2ZIXB 3E9YA 4K5QA 3RVDA 4C4PA 2OG2A 3KU1A 5SYMA 4NS4A 1LPBB 4G0NA 2X0FA 1AC5A 1CUUA 1JTEA 3UMMA 3Q11A 3OZRA 2JHAA 3ZCTA 1MNQA 1VHLA 2Y1FA 2J3EA 3EVBA 3JYNA 3KKQA 3QXXA 3DQQA 4EQZA 2G1KA 2W43A 1J8VA 3CJQA 4L6AA 5IJZA 3ASUA 3L77A 3ZY3A 3T5TA 3SR4A 1XEXA 2H18A 4LVNA 4OQPA 3K94A 2V5UA 4L51A 3CVOA 4E08A 4EKIA 2X15A 1IN1A 1FMLA 1JHMA 5SY9A 2CMDA 2QMUA 3OY2A 3QV1A 4EF5A 4HJXA 4N5LA 5YASA 5JJBA 4Z6KA 4JWKA 5EJ9A 3ZV7A 5I7EA 2A1TR 4WRRA 1KKLA 4AS1A 3B78A 4MYDA 2RGYA 1TNDA 1ADBA 3EMDA 2GEUA 5C8ZA 1RNLA 1QHFA 5GV8A 1NQVA 2HF7A 2DT8A 4FGSA 3HUDA 4Z53A 2E82A 2ECFA 1OJ7A 1DRWA 5IYZB 1PLLA 5B4TA 4I1IA 1BU5A 2XMDA 5KDLA 4CG3A 4LBYA 4BQNA 1GL7A 1W1WA 3ZGZA 2HD4A 5CDFE 1K5DA 2EWMA 3CW8X 4QUAA 4YAUA 2G9QA 4K40A 4X7RA 3DUWA 1E66A 4A7PA 5CK4A 1IY9A 4ZOLB 3RF6A 3R2JA 5JYEA 1PU2A 2VUUA 4JU8A 3A3NA 1AMOA 2C9ZA 3LBHA 5CXSA 1SC6A 5FJJA 2V74B 5AUOB 2RGNA 4FOSA 1TAQA 5AK4A 3RG8A 5A6SA 3C70A 4FS8A 1SRQA 4M99A 2WJJA 3ZQ4A 5H81A 2PBLA 5AI0A 3GQVA 2WJYA 4NENA 1BROA 1XVTA 3DBHA 2E4UA 2FLVA 2IZ7A 5JRDS 3P9RA 1ZI9A 1ZH8A 3OVMA 4CBVA 2DHRA 2VXYA 3GVHA 3CWCA 1USKA 3QENA 3ZJYA 1P1BA 1PJCA 3ESXA 4KPUB 1G60A 4ZJPA 5HUQA 4KSYA 2R6ZA 1XHLA 2GPJA 2Q0SA 2XEDA 1E0DA 3OJEA 3VPDA 1X1QA 4HDAA 3QEMB 5C1PA 5KIAA 1HURA 4Z3KA 4FMCB 3JSXA 3UJ9A 3IVGA 2QMOA 5A0TA 2HFKA 4B75A 4BE9A 4OY3A 4ZO4A 5ELXA 3R7DA 5E1OA 3DLIA 4YRQA 1GG8A 2D0DA 1QV7A 1SM4A 1U7TA 4UUAA 1PTKA 1M2KA 4ND4A 4IIBA 1RYEA 4PFQA 4WACA 4BVEA 4EQ6B 5C81A 2W0MA 3MAAC 3W77A 1NY6A 1FU4A 3FKSA 4PZPA 3SC3A 4ER7A 1EE9A 3ZHZA 1QHIA 3RFCA 4C1BA 1U2DC 5KTOA 4NU5A 4ESHA 4RMIA 2CL0X 2H7VA 5LWQA 1EWKA 5LQJA 5CW2A 1B15A 5B1IA 3TBHA 4U8GA 3NLLA 2J0UA 2YN0A 1G8GA 2O3JA 1FYXA 3T5BA 3HGTA 3X2SA 2B21A 2FEAA 3PQDA 4QBGB 3WXBA 4NPHA 1GTRA 5I48A 2PZGA 4DDHA 1YQ9A 1XT6A 3WB2A 1UMBB 3NRBA 1L5HB 3PBKA 1YS1X 3L4BC 1NN5A 1KC3A 3PK0A 4KACA 1NRWA 1XD2B 2TECE 2YY5A 4QX6A 1CKEA 1NQOA 3OPVA 4FTWA 4PCVA 4JIMA 3AETA 3RRZA 3VTAA 2W9XA 2WJVA 4IXTA 4RXMA 3OQIA 3EBPA 4NYIR 5FUXA 1TVKB 4DV2B 4O4HB 3QMPA 5KVSA 2J32A 4GRAA 1NMZA 4WH0A 3H16A 4J0HA 1MHTA 3IUEA 3QWBA 4AMBA 3ENNA 3BBPA 4XX0B 1RBYA 4KK4A 4PPNA 7ABPA 4EPRA 4KQXA 2H4HA 4FW8A 2X6QA 1FSSA 3GAMA 5MF6A 3FCEA 3PHIA 1N7HA 3BB1A 4ZARA 1RZUA 3N8IA 2O8DB 2YN2A 4CKYA 5CD1A 3KJIA 4YMVA 4IHQA 5LYJF 4CR7A 2J9YB 3I2YX 2O2HA 1NN0A 1HFEL 2BC9A 2G9NA 3BGSA 1UOEA 1YBFA 1JQEA 3JQBC 4AY6A 1HBJA 1HG0A 1KYVA 3V1NA 1C1DB 1YA8A 4YI3A 5A9SA 2UDPA 4Q5IA 1HOTA 2QW1A 3STUA 3UFBA 3KB2A 1POXA 5LZ8A 3V4LA 4AWBA 5AI4A 2FQ1A 3V9PA 2A0YA 3OQMA 4L76A 1N5MA 4K3UA 1EFRD 2GHTA 5C8DA 4PYLA 1OYVA 4QTUB 5EHIA 2PX3A 2JBHA 1GL3A 1C3EA 2R2AA 3EXAA 4JQYA 4RKQA 4TTAA 1EUYA 2G8LA 4G1VA 3WMXA 3C4VA 3F2VA 3U1VA 5FH9A 3CUVA 1JIQA 4FFWA 4BCDA 1OH6A 3I1JA 3NKLA 4W1SA 2XT0A 3DV0A 1SN7A 3H5TA 1Z6GA 5BUSA 3A14A 3NOOA 4PIVA 4QFBA 4AVYA 4K9QA 4O8CA 3FPGA 1PTJA 1GRQA 4KXQA 4JT4A 4OIMA 4GZ3A 5IX8A 3FSEA 1U0HC 5F2EA 2WTEA 3RSGA 5A9RA 2NO7A 3CG0A 3LCVB 3Q0TA 4GSLA 2VK2A 4YXWA 1YKFA 3DPSA 2FE4A 5CNMA 2H7CA 1Z08A 3PGKA 3PJDA 4PQRA 4M6WA 4DV3B 2E1PA 5JANA 4C7OA 3KQYA 5JZOA 4MS3A 5H7XA 1TJYA 3LOUA 2GTHA 4ND1A 1FFDA 4U2EA 5J40A 3ZVRA 5CB4B 1WXGA 1ZISA 2EOAA 3NOQA 1DINA 3HVJA 1KMQA 3MWEA 4KXWA 5KTTA 4LRQA 1PK7A 3M2TA 3RVKA 2WUFA 2LV8A 3I09A 1AZTA 1X7YA 4DNQA 4JHLA 3CRVA 3A1DA 5CA0B 2ZB2A 1O03A 2HK9A 3KVRA 4YRZA 3C7CB 5SZIA 4WNAB 4G5OA 4ZJUA 1KVUA 3WGKA 4M7RA 4D4JA 1RKXA 1BDHA 1KIMA 1FDOA 1J49A 2HMAA 2XV1A 4UDYX 5BN5A 3AW8A 1JDNA 2GXQA 1MX5A 3QTBA 1AK1A 4LCBA 4OQFA 1C3VA 1CLUA 1T24A 1ZDMA 3F74A 4GGPA 4L6CA 1P7WA 4MICA 5HF9A 3W9UA 4BMZA 1S9DA 2ZEJA 4YWHA 4HC4A 4J2OA 4OOEA 5KYYB 2O8FB 1X6VA 4PBTA 2BMFA 3SI7A 1W2WB 1E1CB 3RV4A 1FS6A 5MDHA 3FZQA 3EODA 3ORRA 1BCSB 4AJKA 1WMBA 3TUIC 3WYEA 2IWHA 1JQ3A 1RHRA 4EO9A 5D7BA 1Y9DA 1RLTA 1Z38A 4JDPA 1RZRA 4QOEA 1HPLA 2AOUA 1G19A 1W4BA 4RD2A 3ABRB 5F35A 3EC7A 3B1KA 3HWX1 3TOSA 5FBQB 5BYAA 2WU4A 3AGQA 3OFNA 2V3WA 3WRXC 1FXUA 1GKLA 2DQ4A 2HRDA 3LUDA 5CYFA 5DN9A 1NUUA 2RH8A 5AWFC 5DHRA 5TMBA 3WWOA 3WSTA 4M9RA 4D97A 1PF7E 4FFVA 3CGWA 1JLLA 2A84A 3WL5A 1W5AA 5K3CA 4UXJA 4AY5A 1QHXA 2N75A 3ROEA 3K2QA 2BR4A 5EHQA 3L7OA 4GH5A 1YZHA 2C9DA 1CVLA 1T4BA 1VSQA 3O95A 5BQ5A 4QUKA 4EFDA 5FLEX 3RVMA 1OGYA 5EJ7A 2W4QA 4LK3A 1G42A 4YVFA 5AK5A 1YIDA 2R0QC 2MHCA 1IC6A 1JJVA 1Q91A 3PVCA 4AZTA 1KH2A 5JSYA 4QDUA 2IW1A 1UBOS 1EWRA 3ETGA 3GZNA 4UM9B 3COPA 3A6ZA 2WHQA 4X85A 1F1JA 1I5OA 4QE3A 1UKVY 3R4VA 2YFQA 2XYGA 2X0JA 4GG1A 3AUTA 1EFDN 2OTCA 2UUPA 1YL7A 4EY6A 4BQFA 4O33A 3UOGA 3VDNB 3C3CA 2C2WA 1UXJA 2ZT6A 3E3AA 1JBEA 2CHEA 3NYRA 5E3IA 3TGWA 3JARA 4EJSA 2HI0A 1GQQA 2BZGA 2P78A 3T7DA 5JG7A 4G0UA 3N0VA 4NYMR 1ZU5A 1U8XX 2GCEA 4WY8A 3LRXA 1SIUA 3AKEA 1GA1A 2C2YA 4R40A 4CG1A 3BBLA 3PL5A 2BMEA 5EFOA 4CI9A 3MHTA 2ECOA 3SBXA 4TUYF 3IAHA 3WYNA 3DXZA 1XZMA 3H5VA 2VQEB 3S27A 5K4HA 4B87A 4CT4B 4E15A 2CK3D 4IMIB 3IVMA 3IXMA 3HJRA 4FK8A 4PVDA 5EHXA 3K70C 3CRQA 2MMGA 1Q1NA 2GN0A 1YZYA 2AUMA 1Z6TA 1B6GA 1ZS9A 1K98A 2C94A 2QX7A 2YWXA 3DEJA 4RA9B 4WNYA 2Q4DA 3MJFA 2Z2KA 4U1RA 1KDOA 2O8VA 3A1UA 4ZVPA 4S2UA 4FVTA 3F6CA 2PRYA 1Y3AA 3OZGA 1T6ZA 2ZSDA 4J90A 3THWB 5CA1A 3CZCA 1P5FA 2CXXA 4PNPA 3ND5A 2Q6TA 5HK8A 4MW7A 3VSDA 2VCHA 1H4SA 1ZI6A 4IJ6A 1ISMA 4LJAA 2IQIA 4C7XA 3D0OA 1RXCA 5JOQA 1JE1A 1V8BA 4LRTB 3EWAA 3EOAI 4G23A 2AD1A 3DMPA 4ITRC 1D6NA 2D2IA 3B51X 4LV8B 4U3JB 4XKJA 4C7MA 4RHUA 4MYSA 2GPNA 5TSDA 1ABEA 1RI3A 4QUHA 1MOZA 1NUAA 2BJWA 2RHBA 5IT9A 4LDQA 1XLVA 2ZB7A 2PZAA 3EZXA 4L28A 3RFUA 1O6CA 1F06A 4REMA 5D7NA 3GVXA 4RV4A 2DFPA 2B6NA 4DJ5X 1P18A 1PJ8A 4EPTA 5AHOA 4I9UA 3IUPA 2IODA 4GYJA 5LBTA 3DLCA 5ULLA 1U8YA 1LDGA 1O94D 1I8TA 4ZCRA 1O1YA 1FP7A 3WHLA 1PR9A 3M6FA 3A11A 1CR4A 4CMIB 3WVNA 4F38A 1WL8A 3HI6A 1ID1A 2B7LA 1JX6A 1UK8A 1Z12A 2RE8A 5D1HA 3C5VA 3V00A 1JEQA 1M74A 1K4YA 2BEVA 1N7IA 2Y4OA 3QKSA 4UCWA 1YDGA 3NI2A 1ORTA 4ZHQF 1GZ7A 1MP0A 3SNKA 2E49A 1FXWF 2GAIA 2P77A 2QZ9A 3PG5A 1N0VC 4ZXPA 1OX4A 2DMRA 2AFIE 3CRZA 1NFQA 1OZAA 1E8DA 3DR5A 4IO1A 4J49A 4MB6A 3UCFA 4RTOA 2UUBB 2HT1A 1D0SA 2HCJB 2IRWA 3MLBA 3GLRA 2GD6A 4EF6A 4J29A 1W8DA 5JIBA 2E55A 4H3KB 3I9FA 2BDTA 5IKEA 3ZZ0A 4DV7B 1AURA 4TRMA 3O3OB 1C4XA 3MK31 2V7XA 2JAHA 1IY0A 1NW6A 4P80A 3S2ZA 4A0QA 4YMUA 2JRCA 4PGMA 4YBZA 4F6CA 3D8UA 4MJLA 4RZSA 3RK4A 4CV0A 2PD4A 1XEAA 1EI9A 3NDPA 1O6BA 1ORIA 5K2MA 3UW1A 2BE9A 1IK6A 1F48A 1WDLA 3A6GA 4QT4A 4BXOA 1A7JA 4Q24A 1U0SY 2P30A 4OBEA 4ZOAA 3PIDA 4CEIB 2FLKA 3L49A 5GAJA 4S35A 5SYNA 3BE5A 1KI6A 2QVYX 3AG6A 3QUQA 1Y4ZA 4DIMA 1UH5A 4AX4A 1KTVA 5C2JB 4HB0A 2RIRA 2PWYA 4TZKA 5E9JA 5CFOA 5KX5F 5ECDA 1XXHE 3EHEA 1CU1A 4GOND 4YP0A 3LKBA 5BW6B 2EX0A 4DSNA 2IHBA 3K4HA 3N2IA 4MV9A 4CUKA 1C9JA 5FOWA 1Z0AA 3PPVA 4UBLA 2XSZD 2CBGA 1PW7A 3OU2A 4IR7A 3Q9UA 5I51A 1EX1A 2UVPA 5EWMA 3BK7A 2Y6VA 5D2CA 4QHTA 2GXSA 2P3QA 5LU9A 1J0BA 3L7LA 4R1PA 3HFRA 2WZDA 2EHJA 4GXTA 3AP1A 3PWKA 1I5EA 2GF2A 3S70A 5F52A 3BUSA 1SVIA 2XODA 1OBCA 1QE5A 1VSVA 1T13A 2LIVA 3C8MA 3EFBA 4QC2A 4YP5A 4BECA 4E5MA 4WJZA 4XLLA 3H1EA 3FJOA 4TYQA 2FSSA 1UBSB 2WVHA 3OWOA 3RARA 2G4CA 3RPEA 5J4VA 5JNUA 5JJKA 3L6DA 4D3FA 1C7QA 3DKKA 4ETNA 1VKJA 3ZPXA 2K5UA 4Z7NB 3IBCA 2M1ZA 2G5TA 3SDBA 3PCRB 3ZJ5A 2NU6B 4RV9A 2PHZA 2CSUA 2Q1UA 2GASA 3OSZA 5EVJA 1VCMA 2WFLB 5BNIA 2V7VA 4KR3A 1E7YA 3KOMA 4BQIA 2AN1A 2FPMA 3VPSA 4V0NA 2AOTA 1UOPA 3ZYCA 4HH0A 2PE5A 1EDDA 1CNMA 1E3IA 1U9YA 2XJ4A 3JWEA 1TA0A 4X8HA 2I7DA 1QRUA 4UE2A 5EJEA 2IOQA 3PRJA 2FCAA 2IYSA 2XYVA 2ZI3A 4K6OA 4F6LA 3G0GA 5IK2D 5LCXA 4W7SA 1YQDA 1AQYA 4NICA 1H2XA 3ZHSA 3A6JA 4Y1RA 3MT0A 3X1DA 5DTJA 5D5HA 1QCCA 1HQDA 1XFAA 2OCLA 4AZ0A 2WYOA 1LLDA 3O4IA 2D3WA 4S1TA 2GBFA 2F00A 2BFOA 2GD1O 3V4PB 5BRAA 4MH0R 1QGDA 4IF4A 3H8VA 5KBYA 3D8SA 1J0XO 3B1VA 1FX1A 1J0CA 2PO5A 3LK7A 2GERA 2VPIA 3O4FA 4GVPA 3FUTA 1LBHA 4KQKA 3WLEA 1HZJA 1MJNA 4OFXA 3UGKA 3CLUD 5F1OA 3KNZA 5U9CA 3U19A 1PR4A 4QD3A 4DUGA 1UBGA 2XA9A 4HWRA 3ADBA 2IPLA 3OOYA 4M89A 1U7UA 2F1JA 1CTQA 1WY5A 5I8PA 1PFVA 4DF3A 2XW6A 2FZVA 1V4BA 3I45A 3C8ZA 3UC5A 4C43A 1G2IA 1BWSA 3IQDB 3QVLA 2FPPB 1B14A 4FHCA 4LDPA 4LI0A 5L7TA 1LLCA 1PI3A 2O0HA 2G5PA 3JW8A 2B37A 2IU3A 4M1QA 1PX2A 1HFWA 3LUGA 3RTCA 2HA2A 4F7WA 3BK1A 3TZQA 4TROA 5IASA 3HNOA 2XF2A 2RJNA 1NQTA 3KQSA 2HXGA 4J91A 4RACA 5H16A 3C3WA 1KE1A 3ZKAA 2D7DA 2JARA 3QH4A 1F38A 4FU0A 4DJAA 3X1WA 2YQ4A 5B57C 5C7YA 3BH7A 3LAWA 5FOSA 3K1JA 1GTMA 1ATIA 1NF2A 1ZCFA 4HH4A 4O2BB 3VR2A 4CG2A 2OBNA 3EYAA 5AJZA 2UZ1B 3FMVA 1SXQA 1ENZA 1VZ3A 2QLMA 3E1SA 1Y98A 1K27A 2GVNA 3EEFA 3O7MA 4UAVA 3RSZA 3BA6A 4A36A 2BP7B 1GHTA 4KGXA 5EZQA 5TPZA 1BS9A 3N0XA 5K99A 4RGVA 4PC1A 1XZHA 3G2KA 3U09A 3P32A 3FJ1A 3FMPB 1SZDA 1NVDA 3N2KA 2DQZA 4K9DA 4TN5A 4H1WA 3TBFA 5F5NA 5CDFA 3C3AA 4XB2A 3RC3A 3AHJA 2GK7A 1F5NA 4H1HA 3TAHA 3C2QA 1Q0QA 4P2BA 2F8MA 3BRSA 3X1MA 3VZBA 4L5AA 1QIGA 3B9BA 1KSHA 2H9YA 4I55A 2L17A 1P6XA 2ZYWX 1VYHA 1GL9B 1P77A 2PBZA 3ELUA 1NVGA 3EN0A 4JGGA 1E5TA 5ALYA 1JJBA 1FTGA 1H93A 5E3HA 5DKFA 4J4BA 3ENZA 1XEXB 5IULC 4GEGA 2PMEA 1MDFA 3R24A 2HBZA 3P19A 1CUEA 3I9OA 2N3ZA 2HHCA 4WESA 1DT3A 4M1SA 1JU9A 3GUUA 5TS3A 1ULHA 3SE0A 2IE0A 1EP2B 4N1AA 4F11A 4Z49A 2J9ZB 5JAUA 1TM4E 2DZDA 2B61A 2HV8A 2ATIA 2Z8XA 1WULS 2WVAA 1AQUA 3NBUA 3S2GA 4MVCA 2H4ZA 3ZOZA 5K6AC 4B73A 1W2HA 3AYZB 3HL4A 1WPXA 3C3KA 1NAHA 4CTNA 5C35A 4X5OA 3V1MA 4XARA 1D1QA 4C6RA 4MJ7A 4DB2A 2B7BA 4Q82A 1C9YA 3N3AC 3GRYA 5CJJA 1J0DA 3TJZA 1L7NA 2TMKA 3F1KA 1CJCA 3GLUA 3DHNA 3IOCA 4LZOA 5DNYB 4S1WA 2IW3A 1U0BB 4J0IA 3IBFA 1YI1A 3E9EA 2Q6LA 3G49A 4JP5A 4FILA 1O3YA 1VJCA 3WRYA 4K05A 4WUTA 5GJCA 2IPXA 1NPDA 1OFTA 4IUBS 1FS4A 1WHSB 3KXLA 9LDBA 1XPRA 4EJFA 3W6PA 1ADCA 2C7BA 2QTLA 5K09A 1OH5A 4HSEA 4ZRNA 1GU1A 3L7MA 1Q7GA 5A6SB 2I9KA 3HMQA 5JMTA 1VG8A 4FGLA 1JFRA 3JTEA 5REQA 1P0PA 1VLMA 3F7OA 2RHJA 1P2SA 4ICIA 5I01A 1HE4A 3DBHB 4LKOA 1W44A 1WE2A 4WNCA 1SQFA 3KOUA 4CLXA 1NKSA 2Y77A 4B6SA 2QE6A 1BDJA 2GPBA 2Y3IA 1TEHA 2X6RA 1JSLA 3MELA 4Z4QA 3CR8A 1QPBA 1FUKA 2Q3JA 2FU5C 3EVDA 2V45A 2JLCA 3D4PA 5B2ZA 1TCBA 3DMRA 6NULA 4FWTA 3E4DA 5KOHA 1LI4A 1JDVA 1LSSA 1E5DA 1MW9X 1PGPA 3FYHA 4MWZA 5DFAA 5LLDA 3EIUA 3F9IA 4H4EA 1C1YA 2X0EA 1AQJA 3CXRA 1JPVA 4HS4A 4N12A 1UPBA 1E64A 1UJNA 4WCFA 5GGYA 3VKGA 5LZ4A 2QGFA 1ISSA 1ZD9A 2REBA 3EVGA 3IP3A 1KY5A 1K8RA 3PQ8A 1DTEA 2F2TA 3EZ6A 1GUYA 1XJ5A 1M33A 4IG9A 3NBMA 2FVYA 2D2VA 4LOIA 2KE5A 1RJGA 1XP5A 1L2TA 2XA2A 2EIXA 5AVXA 3PNOA 1VBFA 1N1EA 3VR3D 3PUXA 3EPRA 4EEZA 2C2GA 2PQ6A 3GP3A 5AVQA 5A02A 2J0UB 4RSGA 2YJNA 4XYBA 4QYXA 4DREA 1Y8ZA 2R6FA 1NC3A 2C04A 1WY7A 3NT5A 2HMUA 1TCAA 1KO7A 2XNSA 4MQEB 5IVDA 4NYIQ 5ALZA 1L1QA 2IH5A 2IXTA 1I9GA 2GF9A 1U7OA 1O95D 1W73A 2EG5A