5A0FA

Crystal structure of yersinia afp18-modified rhoa
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
178
structure length
178
Chain Sequence
AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING PROTEIN RHOA
publication title Tyrosine glycosylation of Rho by Yersinia toxin impairs blastomere cell behaviour in zebrafish embryos.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 63
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2015-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5a0fA00
2GXQA 4N0DA 5GVSA 3ZIAA 5AUPB 2BJWA 1WCV1 1ANKA 1WB9A 1D5CA 1OKKA 2PZGA 4RD2A 5BWMA 1NN3A 1EXMA 2V1XA 2RGAA 1MABB 2JGNA 1SGWA 2CNWA 1D2EA 3VMFA 3ND8A 5FFMA 3CIOA 3B6EA 5J4KA 2BVNA 3OEHD 5LPNA 1DTSA 1Q1ZA 2W6IA 4UXIA 4FN5A 4U5XA 2WPDD 1KK2A 4GPTA 4RD4A 1E1QA 3QQ5A 3P32A 1KK1A 1OSNA 2VP0A 3CO5A 4ESVA 4MKFA 4TYQA 1G41A 1G3QA 1XP8A 2IX3A 3LV8A 4JIMA 1GNRA 3B1XA 3PITA 2GVZC 4M1OA 4Q4HA 3GJ8A 1G3RA 1VCOA 1J99A 5KHOC 2ZE8A 1NLZA 4X8LA 4LPSA 2O0HA 3TW4A 1G4AE 2F9LA 1XMVA 3ICQB 1PLJA 1CJVC 1KNXA 4NBSA 1UPTA 3F3YA 4KYIB 4R71A 1IN8A 2WKQA 4UNPA 4GP7A 1Z0JA 4PPNA 3OFNA 3BORA 4LZZA 2IA5A 4PR0A 1FX0B 2ZSFA 3GEIA 3EC1A 3EZ2A 4DLXA 4M8NE 3S1AB 4L8GA 4AYTA 2GEUA 2AKAB 2XSZA 1KO7A 1IY2A 4EKDA 5JJLA 3CM0A 4Q4AA 5TVKA 1UEIA 4QNMA 4Z1MA 5FOVA 1W48A 2VO1A 3DZ8A 5AJWA 3KQNA 2PL3A 2X19A 4B34A 1CBUA 1AS2A 1ZCBA 1M74A 4Q7JB 2OXCA 4XH9B 1AK2A 1TEVA 2GEVA 3ZH9B 1YZUA 3X1XA 4MUAA 3GLHE 4RSGA 3THYA 2AWNA 4I1VA 2C04A 5SZHB 3FVQA 3GLFE 2ZVPX 4KJZA 2J5XA 2GZAA 1HE8B 4PHFA 2ERXA 1SXJC 5KYKA 3GFTA 4MRVA 1ZMXA 3IIMA 2WMNB 3IIJA 3RC8A 5CK4A 2ZITA 3FFBA 2Q3MA 4YMSA 3I61A 1E98A 3KKPA 4BEBA 2FU5C 4PSKA 4P0TA 1BYIA 3LWNA 4V0LA 1DELA 2JJ1D 1KIMA 5KSPA 3I73A 2XZPA 3WHKA 5D3MA 1KOFA 4B75A 3EZ7A 4BWYA 4LHZA 4TTQA 4OI4A 1QHGA 3NEJA 4MQBA 4Q4HB 3K8YA 1HQCA 3QSYA 1G19A 1ZW6A 4QHYA 3EPHA 4QG7A 1RKBA 4QXAA 3NHBA 4EJSC 1XPOA 4PPGA 1YR7A 5IRCD 4Y0VA 2CLSA 2IEYA 4B2PA 4OHXA 4EDHA 2A2ZA 1IJEA 1FMLA 1S8FA 2GHIA 2ZROA 6Q21A 2ODEA 1NVUQ 3K1JA 1TF5A 2F1HA 4IOJA 2WOOA 4B76A 4YQFA 3K53A 4G1UC 3MJHA 5JMTA 3U3JA 4TN1A 1OV4A 4G5OA 3DPUA 3AP3A 1UF9A 1UKYA 2PX0A 2CK3D 1XEWY 2G3YA 2H1LA 3IEUA 2ORVA 2FFQA 1JQJC 4F4JA 1KI8A 3RRYA 2Q0HA 4LHYA 4XTCS 2IF0A 5ANRB 2VPPA 2O8EA 4Q4AB 2GK6A 5G3ZA 2IXFA 2RGNA 2FGKA 5C2JB 4GOXA 1EWRA 1VHLA 1ZNYA 5JJIA 1GNQA 3QXSA 4M22A 2NO0A 4UNQA 3K0FB 4JLJA 3GFPA 2H8KA 1TUEA 2WJJA 3J81k 3ZYCA 4TMWA 2VRWA 1M7HA 3WYFA 4URVR 5A0FA 2EFGA 2JA1A 4DSUA 1W0KA 4BLPA 1OXUA 1U94A 3CRW1 4M9XA 5FPYA 1YVDA 3U6KA 1CR2A 3QVVA 3PCRB 3PUYA 3DVLA 5CM8B 3GPLA 3THYB 2ATVA 2G83A 1E2QA 4AK9A 2CJWA 1N2CE 2ZYVX 1E2FA 1I4DD 3C8UA 5L3SA 2JLQA 1AS0A 2F9MA 2VHQA 2OBLA 2G88A 4DLVA 2V54A 4A36A 3LDAA 3VKGA 4HLQB 2Z4SA 5DNYB 3DO6A 1P2SA 2IYWA 2WZQA 1VCNA 2WKPA 2ZREA 3PXGA 2B8WA 4HAYA 4J0QA 4BLQA 4N0EA 3KKMA 5HTKA 1R8QA 3RS7A 3WHLA 1G3MA 4BRWA 1KO8A 1X3SA 1R5NA 1UKZA 4DDUA 1KY2A 3LX5A 3TSWA 4OQNA 1P73A 1FTSA 2QPOA 4H1UA 1Z6AA 1UAAA 3Q72A 1JPNA 4DZZA 1Z3IX 4NCJA 3KX2A 2R62A 4ZI2A 4EPXA 1JNYA 3FYHA 1JXMA 2V9PA 4KVAA 3KQLA 3AVXA 3C5HA 3TAUA 4Q66C 1X1RA 4YDHB 2QI9C 4CEHA 3ETLA 4IRUB 2FPMA 2ZE5A 3U6BA 1JJVA 1WQ1R 1P62B 4LJAA 2L0XA 5KU1A 2R6DA 4MGKR 1XWIA 1T8UA 5HCIA 1Z83A 1DADA 4NYJR 3CUEF 2O8EB 4NYIQ 5LB2A 2QRNA 3W6OA 2YHSA 3M4YA 1ZD9A 4NL4H 5H8WA 1IXSB 2YV5A 1CR0A 2ZI9A 3IHWA 4JLAA 1OH6A 4CEIA 3SHWA 1QVAA 1MRNA 3KJGA 4Q01A 3UMRA 4C0AC 2HYDA 3E70C 3H2YA 5EJEA 3NH6A 2FSHA 3VKWA 1E2KA 3ZGXA 2FN4A 4NCIA 3AKCA 1TQDA 4NCKA 5GJCA 2AX4A 4D4LA 4OKSA 4TSFD 3IBYA 4MYCA 2ZS9A 5GJVC 4V0NA 4LYAA 4NMMA 1GM5A 3EZ6A 4GI7A 3I72A 2JLVA 4PC3A 2QA5A 3SC3A 1K5GA 2P3SA 3GLHB 3REGA 2FF7A 3BH7A 2R2AA 2VHUA 1UFQA 1LY1A 3X1YA 621PA 3GLFB 3CZPA 1R8SA 1W44A 5C4MA 5L3QA 2F3TA 2GRJA 1Z07A 2GILA 1N25A 2VHCA 3TR5A 3U7GA 1U81A 5HE8A 5F3WB 3NBXX 4TYNA 4DVGA 2WSMA 2ZRDA 3CKLA 3W3AA 4EFLA 5CK5A 3SJCA 3L0OA 5FL3A 1Z6XA 4NKRA 2FZLA 2AK3A 2KBEA 1G6HA 2PMKA 2GJ9A 2FNAA 2G0NA 2ZRFA 2N1BA 2Z0MA 2IC5A 2EQBA 3KTAB 1HURA 1ZD1A 1E4YA 4JVSB 5CYPA 3GJ7A 1Q12A 1N6IA 2V3CC 2QAGA 2GKSA 2WWXA 2IT1A 1E4VA 1Z6TA 5IT5A 2J3EA 3A1WA 1IBRA 2E9SA 3IIKA 4CEHB 2IEZA 3U7HB 3ZS9A 2GESA 4RZUA 1JR3D 3M1IA 4KFRA 2QTVB 4IDHA 2OCPA 1U90A 4B32A 2QQ0A 3DMDA 3WYGA 3B1VA 1AZSC 3U3OA 3I5YA 4PPQA 2IYUA 3LD9A 4IVRA 1KZGB 3EIQA 3KKNA 4C0QC 4CEIB 1HY3A 3FKSA 3IQXA 3N2IA 1KKMA 1XD9A 2G77B 4L9WA 4PHHA 2XOKA 2AXPA 4DB4A 1NLYA 1VG8A 3U7FB 1W46A 2RAPA 5AUQA 1R0WA 5B2ZA 4E03A 3MGCA 3U7EB 1QDEA 5H70A 4OHVA 4TT3A 1W2GA 2JDIA 2OG2A 1G9XA 2V4ZA 3I8SA 4JBYA 3V4RA 4ASUD 1W0JA 1GTVA 3EIHA 3OE7A 4II7A 4W9MC 3CF2A 2P6RA 3TSZA 1IAQA 1SVKA 1YQTA 2WJHA 4GOJA 4HDCA 1I4LD 1KO5A 2QE7A 5L3QB 4QJ4A 5F98A 2ZRPA 3UATA 3CRMA 3PFIA 1TEXA 1OB2A 1T4GA 4P3YA 1QHHB 1RE0A 3LY5A 4M1SA 4X8MA 5CM9C 1ZCAA 3SJBA 4DDVA 2P5SA 3DOEA 3FHCB 1YZGA 1NMYA 1II8A 1Q1BA 1ZNZA 4ERNA 2VLIA 1WXQA 2WKRA 4HZIA 4P4TA 2CL6X 4DSTA 4UKDA 4D0GA 2O8CA 1N6OA 4PAMA 2ERYA 4D4JA 5KNDA 1MT0A 1GUAA 4KU4A 2RGNC 3K0AA 4MKHA 4A2QA 1PV4A 3V9PA 2ONKA 1UADA 3SE0A 1XD2A 5AJZA 3LW8A 4G3XA 4RFSA 4JLVA 1OIVA 1E2JA 3O47A 4KVGA 1NY5A 1TL7C 2W6JD 1WA5A 4JBWA 3A6PC 1X6VA 1YZQA 1CF4A 4S2EA 4D6PA 3L8YA 4CEJA 1OE0A 1Z29A 2VTKA 3ZQJA 3TAHA 4RJLA 4GL2A 3ECCA 4NPHA 4NH0A 1FQKA 1IQPA 1RPZA 2EYQA 4C0HA 1NG9A 2CXXA 3MMPA 4FD2A 3FPAA 2OFOA 3B1ZA 1GKIA 5LD2B 2F43B 2PCJA 1KSFX 4LI0A 5AUOB 1DVRA 3RS3A 3CZQA 1FNNA 2X1VA 4R7ZA 4M1TA 4BFYA 2O5VA 5DGXA 5CLLA 1CLUA 3KXIA 1TF7A 1T3SA 4PC1A 4FMCF 1E1RA 2FFHA 1DBSA 1AS3A 1RRGA 2A5YB 2QMEA 2XNDD 4FXPA 3ICEA 5FTMA 5FR1A 1N6NA 3AF2A 4LV8B 4Z54A 1SHKA 3NBFA 2QSYA 5FBVB 1KJWA 3FGNA 3D7MA 3DKPA 1CR4A 2OCYC 4JYBA 3VX3A 5J4YA 1W7AA 5FPSA 1F2UA 5E4FA 5DIFA 4B47A 2NGRA 1GL6A 2QEQA 3OIWA 4BPBA 4D2IA 1K8RA 3EZFA 4QGHA 3T06B 2OO7A 4CIDA 2QMOA 2AWOA 4UNRA 1EWQA 3VKHA 2OXRA 2H5EA 5CJPA 2MMGA 1XU4A 1AKYA 2ZI7A 4YMVA 2QT0A 4MKIA 1UBCA 3TQCA 3RLFA 2J0VA 3A36A 2IXGA 5F9FA 2VHJA 3FMFA 1KSHA 2O8CB 3R8FA 3FMOB 4I1SA 1S2MA 3EIEA 3FFAA 1M2OB 1QF9A 2P65A 2WTUA 3JVVA 2IK8A 1P60A 2NQ2C 1W47A 4NZYA 5JRZA 4JL8A 3GLIA 4O25A 3NC0C 1DEKA 5EP3A 1CIPA 1P9WA 4RFSB 2B7BA 2PLRA 5KDOA 1IN4A 4HAWA 2EFEB 4X8OA 2E87A 2H92A 1NNEA 1DO0A 4NYMQ 3CB4A 2R9VA 4HDOB 2A5DA 2IYVA 4Q00A 2E1RA 1OHHA 2DFNA 3IBGA 3VHLB 2O8BB 1G20E 2D06A 3AP1A 3AV0B 2HYIC 2JJ2A 3CPJB 3SR0A 2ZJAA 1G1MA 3G82C 1W1WA 4QRHA 2JIZD 2ONJA 5AJXA 1T8TA 3KB2A 1P9NA 4DDTA 4Q18A 2XXAA 4GRAA 3QF7A 3NDPA 2DWPA 4B73A 2QROA 1GSIA 3ZVLA 3HP1A 1AGPA 4BUJA 4EPYA 3AEZA 4HAZA 3OIUA 3LXXA 3RS5A 3TUZC 2BBTA 1R7RA 1NJFA 2IYZA 3LBNA 5E95A 2IS1A 1XBTA 2VQSA 5LB4A 3LNCA 1SXJD 2FE4A 1XEXA 5FTJA 4JLOA 1F2UB 2OAQ1 2IS4A 4IXMA 4TL9A 2GA8A 5JCPA 3FHOA 4MGZR 3TUJC 2PJZA 2V7QA 2BCGY 3OAAA 3P1JA 4IOMA 4JJZA 1ESMA 1S96A 2ZANA 1Y3AA 1GL7A 3CONA 4XWAA 2JLXA 3D3QA 2ZPTX 1HT2E 4F91B 4DIDA 4LBVA 3RNLA 1N6RA 4XSGA 3DM5A 4KCGA 1F2TA 4P31A 1IONA 1H8EA 4RVCA 4WZAE 4FIDA 3RSOA 5J4LA 5LD2C 2D2FA 2UZIR 1G8FA 3ONWA 4AKIA 1KTVA 3QXHA 5JJKA 4M21A 4Q03A 4DUGA 1CJTC 2CL7X 3CRRA 3H4MA 2VSXA 5KO2A 4GZMA 3R8CA 1NIPA 3OHMA 2EWVA 4JL6A 4URUR 3QIAA 3BIFA 4A9AA 3VR3A 4JLBA 3ZJYA 3AVWA 2FH5B 4TL7A 2AD5A 4H9GA 4BFZA 1EFCA 1XJCA 4NU0A 4KLNA 1TX4B 3DMNA 1NN1A 5BXQC 3U61B 1A2BA 2B8TA 1UBFA 5CYOA 1E2EA 1MH1A 1XB2A 3LBIA 4TTPA 4PHGA 4RD1A 2XJ4A 3AUXA 3QOFA 4W7SA 1ZM4A 4F4CA 1GRRA 2Q6TA 3TGPA 4Q1EA 4R9UC 3PIRA 4FWIB 3FB4A 4QBIA 3QG1A 1NIJA 3UMSA 1L4UA 3A4LA 1GDDA 4HZUB 1OJLA 4M1YA 1F3OA 3QY0A 1N6LA 3BFVA 4LYFA 1XXHE 1K6MA 1Q20A 4IDQA 4DJTA 1NSTA 4EPRA 3EASA 2B7CA 3RABA 1QHYA 3WY9A 2ZR7A 2JLWA 1US8B 4RD6A 2HJGA 2FMXA 4KO8A 1KI9A 2ZAOA 5EE5B 1FNMA 2ZI5A 4BEJA 1S0UA 2IBMA 1IY1A 3C14C 3IPYA 1CULC 4FMDF 2OCBA 1GAJA 2QM8A 3QKSB 4A0HA 1E0KA 1F2TB 2ZEJA 1QZXA 1G64A 4LX0A 4FWTA 4BASA 3GJ6A 4KLZA 4D0NA 3QENA 2FFBA 3DM9B 4BZPA 1GITA 3KXLA 3B1YA 4M1KA 3D6TB 1NP6A 4W5HA 1JR6A 4NYJQ 2WJVA 2N46A 4LWZA 1EX7A 1CRPA 2VBCA 1RJ9B 5TARA 4K81B 3ZIAD 2O8DB 3P27A 1Z2CA 4IFBA 3EPLA 3EPJA 4TLBA 1OKKD 3DDCA 4PO1A 3W5JA 4TTRA 5TY0A 2CNWD 1E79A 3E1SA 3TMKA 4KFUA 2ZRCA 4LUCA 2W6ID 4YMTA 1Q44A 2NO9A 3B78A 4OQXA 4IKEA 4V0MA 5AK0A 3O8DA 1E1QD 4MYTA 4C7OA 2EYUA 1XRJA 1TMKA 1X8JA 3VX4A 4D25A 4PQFA 3BB3A 4WXPA 5KUTA 3GP8A 1VECA 2ZJ8A 5L3RA 3AVUA 5FPTA 2XB4A 2ZI6A 4DCTA 2WAYA 1NVWQ 4TL8A 3RWMB 4A6PA 2Z43A 4LC1A 4Q47A 1OW3B 1V5WA 4JT4A 2KB0A 1VYVA 3T1TA 1OH7A 1RYFA 4EAQA 3BD9A 3IKJA 2ANCA 2VF7A 4B3CA 4D4KA 4AY2A 2RGXA 5IK2A 1MO6A 2QAJA 4C30A 1E3MA 2HT1A 1SVMA 3WRXC 1OFIA 1FUKA 3R9IA 3HR7A 4JKIA 5HKKA 1XXHA 4ZDWA 2HJVA 4DHEA 5HZHA 5BYKA 5JEEA 1J7KA 5GJWC 2ZR9A 2ZQ5A 3OFND 3O8BA 1W4BA 3H86A 5G3YA 4L4UA 3DEFA 1AQUA 1P5ZB 3BC1A 4L16A 1PUIA 3EXAA 4XD7A 1ESNA 2XSZD 3M6AA 5TXGA 4C4PA 4DLTA 5B30A 3PR1A 3MRSA 2A5FA 2VP9A 2GCOA 2XNSA 1AM4D 2BEKA 3PUWA 4XWKA 2O8FA 4Q4JA 4RD0A 4Z1MD 3RSLA 5EXSA 2OCAA 3K09A 2C98A 2RMKA 1IHUA 1DG3A 5KSOA 2UKDA 3ZS8A 1PVOA 2QPAA 1JAIA 4RCZA 3MWKA 3T12A 2OLKA 2LKDA 2ODWA 1JAHA 4G0NA 1I2DA 3UWOA 1NLFA 5FOWA 2ORIA 4WAUA 2G0TA 2HXYA 3NXSA 1NVVR 5DLQC 4DSOA 1AJEA 2BOVA 2OZEA 3K9HA 4B33A 2AR7A 4A8JA 2I4IA 2JLUA 2GZDA 2WWWA 1DAKA 3FTQA 4LOAA 1SQ5A 3W5IA 4OI0A 1R4AA 4LHWA 3K9GA 2IUSA 4TMTA 1Z5ZA 1XTIA 3C41J 3NHAA 1OLOA 2GJKA 3C7KA 4CDGA 4Q1BA 4LRWA 1XCPA 1EGAA 1T0HB 1S4QA 3EWSA 4B3DA 2IS6A 1E0AA 4V02A 3JVUA 4WXRA 3C15C 5EZ6B 3L82B 2VL7A 2IYLD 4B2IA 2KWIA 3ASYA 4OQMA 3L2OB 3GJ4A 2JJ1A 2Q9AA 4G5SA 4AURA 4MA4A 821PA 1AN0A 1F60A 4PQYA 4MYHA 1XDBA 3RVBA 2HV8A 4XVQA 2JATA 3B82A 2D2EA 3CX7A 5M04A 3MD0A 1Z06A 4KV9A 1RVDA 1G8GA 2P5TB 1XXHB 3MJRA 4IEIA 1FW6A 4QHSA 1T6NA 1SVWA 1BKDR 1X8LA 4M2LA 2Z4RA 5JSZA 1DAEA 2WM9B 1KZ7B 3BAFA 2JEOA 3NWJA 2BM0A 3KUCA 5EUQB 4Q02A 1M7BA 1ZRHA 2ZRAA 5FOTA 3ZVRA 3B5JA 4LJ6A 1YR8A 1FOEB 4ZI3A 3MUFA 2VP6A 3U5ZB 1A82A 3WP1B 2GWHA 3I3SR 2GCOB 3SN6A 4ZDIA 1JB1A 2HXSA 2QZ4A 3TE6A 4JLNA 4HLDA 1KGDA 2AXNA 2WJGA 4POAA 4M1WA 4LV5B 1GZSA 1Z0KA 3TVDA 2PMDA 1OXTA 2A9KA 2GJAA 5KDDA 1GIAA 3QNUA 4C3ZA 3BRWD 5IDVA 4EQ6A 2QORA 2ZRHA 3CNLA 3THXA 1Q3TA 4LJ4A 2ZU0C 3U3KA 3KQUA 1W0KD 1LNZA 2PEZA 2RH5A 3CWZA 5JI2E 2DYKA 3GJ3A 1BO6A 2F3RA 4ZCIA 1CXZA 1BMFA 2VHTA 2W0MA 3SQWA 3IO3A 1T9HA 4DLYA 3QXJA 3R7WA 1E9SA 1MV5A 5E7IA 2I3BA 2OV2A 2ZSDA 3IPXA 4OHZA 5BQ5A 3BH0A 4Q7LA 2ZJZA 3AF1A 2QSZA 3AP2A 4GNKA 1HT1E 2DR3A 2B92A 2PH1A 3D31A 4QGGA 4HLCA 2R8RA 5D3MB 3OIYA 4FCVA 4PFSA 5EQTA 5C1BA 3LVRE 3KL4A 5UKDA 1KSJA 4IW3B 4P4UA 4M0LA 1FZQA 4HLUA 3C4JA 1P72A 2FX3A 1VG1A 421PA 2D74A 1X1SA 1R0YA 3SU8A 3ZZUA 2GTPA 3K0EA 1ETUA 2IYQA 2ZJYA 3W6NA 4OQLA 4H1VA 4RZ2A 1A2KC 3GEEA 3A1UA 3SFVA 3EG5A 1Z28A 1E2LA 1XPUA 1G16A 5J47A 1OT3A 4TWZA 4US1R 2ZXUA 3A37A 1SZPA 1E32A 1MRSA 1U8YA 4HDQB 3SHFA 3QPVA 5D3QA 4OQFA 3B9PA 2C9OA 5G41A 4TYWA 5KNCA 3OIVA 2CBZA 5JLJA 1Z0IA 3LQQA 2BBOA 3A1VA 3P20A 2PZEA 1N6KA 2ZRGA 5EP2A 1OIWA 5TB5A 4M1MA 4U7DA 3Q5EA 4TMVA 4DB2A 2PX3A 2DWOA 3CRQA 5FTLA 2AD1A 2OFXA 4BE7B 3QBVA 5FOXA 3VR5A 3T1OA 1OF1A 3RAPR 2J1LA 2WJIA 1R0ZA 2Q9CA 4U00A 2ZUCA 1M1YE 2DCUA 4XVRA 4CT5A 4OYHA 2IHYA 1SVIA 4WVFA 1D6JA 2V6IA 5L3VA 3P26A 2V1UA 1S9DA 2CJWB 4LHXA 3KJHA 1W4AA 5L3SB 2JCSA 1VYTA 3ZLJA 2ZUDA 2QNRA 2EU8A 4RKEA 1A7JA 5EZ5A 1LW7A 2ZUBA 2QGNA 4TSFA 5SZKB 3WMEA 4G5QA 4RKFA 3NVAA 2SHKA 3AF4A 4GP6A 2IUUA 3VAAA 3ZVNA 3AH8A 4A2WA 3SI7A 4Z51A 4B43A 3O8CA 3Q8XB 2GDJA 1YE8A 5K8UA 2CCJA 4DC9A 1VG9B 1YRBA 1FUUA 4QFMA 3ZZ0A 3HU2A 1R5BA 4JLKA 3UG6A 2JJ8A 1G4UR 1HTWA 1W5SA 3B60A 3CX8A 4U02A 3GLGA 1KDTA 1XTSA 4LJ8A 4OBEA 4Z8XA 1E69A 1U9IA 5H1YA 2FZ4A 2YJTD 4V0OA 4DLSA 2MMCA 5F2EA 5GADl 1N5IA 4YC7A 2F1JA 3ND9A 3FWYA 1OB5A 2GJSA 2C9CA 3NKVA 3HU3A 1QHIA 4KBGA 2P6UA 4Q4LA 2FV8A 2EVWX 4QGFA 5DI9A 4DIEA 3CPHA 4QM7A 3FKQA 2OEPA 1S9HA 2YWEA 2ZJOA 3A4NA 2W2XA 5CDFE 5H68A 1FP6A 4B3GA 1GRNA 4LV6A 1D9XA 5CITA 1JR3A 3GQBA 4Q48A 4B74A 4YXWA 3KKQA 3VU9A 3CWQA 1PLLA 3SFZA 4O3MA 4PTLA 1J8YF 1COWA 2FOLA 3FKSD 3GJ5A 4QNRA 1ZM2A 5FI0B 2EFHB 5FTNA 1UKEA 3IGFA 1HEIA 2XOKD 4IJMA 3QBTA 2J41A 2CCKA 4ZDKA 3UMFA 1JECA 5FL7A 1P2VA 3SYLA 1EFRA 3CPEA 5DO9A 1PUJA 3IUYA 4RZ3A 1UDXA 1D9ZA 1B0UA 3TKLA 1W36D 5DI3A 1E2MA 4DRZA 1H8HD 2D62A 3UG7A 2EFDB 2XB2A 4Q7KA 1R2QA 2Q9BA 4TT3D 2JDID 1NKSA 3W8RA 1W0JD 3ZDQA 3IEVA 2BIFA 3OE7D 1OH8A 4Q9IA 1P9RA 1BOFA 2DFTA 4E09A 2ODNA 1QRAA 4PX9A 4TZ6A 2D4HA 3BH6A 1CS4C 3WNDA 2ZRKA 5GVRA 1B23P 2WWYA 1W4CA 1S1MA 1PLKA 2QE7D 3QPWA 1Q57A 1G8YA 5EE0A 3I32A 3PG5A 1LS1A 2JLZA 1UDWA 4LJ9A 4HAUA 2VH5R 1ZU4A 1P6XA 1DPFA 4IOKA 2MSDB 4JL5A 4DLZA 1JEDA 3GLIE 2GXSA 3CLVA 3OEEA 3SYNA 1SKYB 1IN7A 2C2HA 1E96A 3W6PA 2A3RA 4A0FA 3UXMA 4PHTA 1LF0A 2PT5A 1VDZA 1DS6A 4URXR 3PEWA 2GJ8A 3TIFA 3FOZA 2QAGB 2ZETA 3MWJA 1JPJA 3LBHA 4JT2A 2OAP1 3K0CA 2IUTA 1M34E 4AC9A 2H18A 1AGRA 2RGEA 5K8IA 2O0KA 1G7SA 1RC8A 1P61B 1NMZA 2BHRA 2OE2A 3JZAA 4QBFA 4AWXA 3FHTA 3CF0A 1DARA 3WP0A 5E7MA 1CJMA 3BFXA 1TTTA 2QTFA 4X8HA 3K70B 2FSFA 1XF9A 2BC9A 1NBMA 1YKSA 2WAXA 2PLFA 1SVSA 1J2JA 2O0JA 1K5DA 1NF3A 2C03A 3KFVA 3T35A 2REOA 1F48A 1ZM9A 2IXEA 4DKXA 2FPLA 1LVGA 4Q21A 1Z08A 2FEOA 2ZRNA 2CMKA 4LCBA 5FUYA 2CVHA 5CDFA 4QKQA 1GWNA 1PZNA 2WHXA 3EA5A 1CRQA 1W36B 3N5CA 3BERA 4Q1AA 1NI3A 1E1RD 1SHZA 1ZU5A 2HF8A 1DAGA 1KJZA 2A5JA 5G40A 3AGPA 5TV2A 2W83A 3HPRA 4JSTA 1XTJA 2XTMA 2K5UA 2J7PD 4DCSA 3T34A 2BBSA 2YWGA 2CVFA 3QKRA 3W3ZB 1NG1A 3MCAA 1GOTA 5HR5A 2DHRA 3A1SA 2J0SA 2UVQA 1ZNWA 3HDTA 2GCNA 2VSFA 5B57C 1N3BA 1XZQA 4HB4A 1AQYA 5JFGA 4HAXA 1EX6A 3NH9A 1Q21A 2GF0A 3BFKA 1Z22A 4C0JA 4JZKA 3CX6A 2CEAA 2F1IA 4WBSA 2FPKA 4BLOA 4DDWA 1II8B 4BZXA 1U0HC 2YYZA 1P4SA 3BGWA 2QG6A 1Q3HA 3U4QA 1TAGA 3NDBB 3OZXA 4B35A 4WW0A 4ZCMA 4PPFA 5AJYA 4B2LA 3F5FA 2KBFA 3K0AB 5JI3E 2P6NA 4LDJA 1YR6A 1XD2B 4ZIRA 4MITA 4OK3A 4V0KA 1ZC3A 4JVNA 1TQ2A 2OT3B 3AQ4A 1ZJ6A 3I4LA 2R6CA 4NHOA 1F5NA 2QP4A 4G5GA 5BN5A 4CEJB 2BKUA 3TH5A 3WNBA 1W4RA 4UXJA 2OSBA 2NPIA 2C77A 3Q85A 2KSQA 2FSIA 2FGJA 2CLDX 2HCBA 1EFTA 1XCGB 2CDNA 3N70A 4DCNA 2ZU6A 1ZP6A 4NYIR 4UJ5A 4M9QA 2YWHA 4Q9KA 4AKEA 4BGDA 1XNJA 1OHHD 4GT1A 4DCVA 3ZD7A 1C9KA 2BCJQ 1EFHA 2H57A 3SBDA 1KHTA 2CE7A 5FR2A 1NKTA 4HB3A 2JJ2D 3WBJA 1QG2A 4URZR 3X1WA 1YZLA 4EPTA 1NVVQ 2PZFA 2V55B 1CJKC 4D81A 2WWHA 3BS4A 4W5JA 4O2RA 5CLQA 3H0KA 1E9EA 2QRZA 3CBQA 4ZKDA 4LBZA 1FP7A 1EG7A 4ABYA 5JS7A 3CH5A 1KI7A 1P3JA 1F6BA 3VR2A 3QKRB 2G6BA 4G01B 1H65A 1U9IC 4NCNA 4YMWA 3SEAA 2NZ8A 2QAGC 3B1WA 4R2IA 2TMKA 1U8ZA 4P33A 1WBBA 3B13B 3KDSE 5J40A 4IEEA 5KSZA 1N6HA 4TLEA 2V7QD 3OAAD 4JYCA 4BLTA 2MSCB 4B48A 4LK2A 5EP1A 4MKGA 4G5RA 1FTNA 2ANBA 3MSXA 4Q1DA 5EXTA 3IHLA 3K70C 1IJFA 3QXXA 5CIQA 1G5PA 2HLDA 3T5DA 2V6JA 1G291 1W2HA 1X8KA 5JEDA 3GLIB 1H8ED 3KJEA 4ZIRB 4AIIA 1TU4A 5L8VA 4N1AA 4PO9A 3TJZA 5EXPA 2GXUA 3KZ1E 3NC1C 2G9NA 1E2HA 1TQ4A 4OHYA 1A5TA 4DUGD 5J4VA 1AIPA 3CR8A 1W49A 1W36C 3P4YA 3H1TA 3HR8A 4V0ME 4B44A 3T5GA 3W34A 5KOYA 2EW1A 4JS0A 3EWAA 4UQOA 4W5WA 5AJVB 1VPLA 5FPHA 3H84A 3L8ZA 1GG2A 4MRNA 4ESHA 1BYUA 2LCFA 5DN6A 4NONA 4CYMA 2KJQA 2HEIA 2YWFA 3QI2A 1A1VA 1KY3A 2ZS7A 4HSEA 2BDTA 4HEJA 3QG5A 3U3RA 2XXAB 1XJQA 1LS6A 1L7VC 4C0KA 4B6EA 2AL7A 4FMBB 4A4DA 4OJQA 5F9HA 5SZIA 4BFTA 4PAOA 3KFXA 1YRAA 3SNHA 2UZ3A 4BFSA 2DPXA 4ITRC 1VHTA 4Q7MB 2REBA 3EZ9A 2PCLA 1XMJA 2CCGA 1XEXB 4QGAA 4DEYA 2GEDA 2NTYC 4US2R 3F0TA 1DAHA 3QE0A 1UM8A 4L15A 1DAMA 2V8OA 2GF9A 4KITB 3PVSA 4KYUA 1VIAA 1KDPA 2GXAA 2WSSA 3K0CC 2HUPA 1QBKC 3PENA 3QPUA 4RD3A 2BKEA 4MUBA 1KDOA 2F6RA 4IXNA 1YZKA 2OFWA 4PANA 1XEFA 1DAIA 3U2QA 3FMPB 4ZDJA 5SZJA 4IVQA 4US0R 4Q9HA 2F55A 1QVRA 1SULA 1Z2AA 2RGDA 2A5GA 3R9XA 1ZIOA 4CGZA 2IW3A 1KMQA 1QHXA 4F92B 2Z6VA 2QU8A 2P67A 2ZTSA 4PAQA 2OBMA 3LA6A 4XIGS 1JALA 2ZRIA 1IOZA 3DOFA 3U44A 2OESA 5HE9A 4N3NA 5AWFC 1VCMA 1FQJA 2QPTA 4OK6A 1G6OA 4TMXA 3Q7QA 4XVUA 3MLEA 2ZRJA 5JHGB 2IYYA 4YMUA 4KBFA 3W90A 1UBGA 4FCWA 2FSGA 2JAQA 2OUKA 3C16C 3RANA 1KJYA 1NN0A 2FFAA 1OXXK 4A82A 1TADA 2JLRA 4AKGA 2ORWA 2X8AA 4FINA 3HU1A 1E79D 1T5LA 3OEHA 4C2TA 2J87A 1LB1B 3RRMA 1IXRC 3AKDA 2WPDA 3JZMA 3PV0A 3PUXA 1E6CA 2GCPA 1GVNB 2X77A 5CJ2A 5FUXA 4AG6A 4CRWB 1JQLB 1E2DA 1M6NA 3LVQE 4PZLA 3KQKA 3SJZA 2WWIA 3EARA 2NZJA 4JLDA 3LW7A 4LGMA 5EUMA 3W9YA 2C99A 2ASEA 1YU9A 2R44A 4OI1A 1IM2A 4WA7A 1VMAA 4DLWA 121PA 5IK2D 2XZLA 3B85A 2J0QA 4TYPA 3P4XA 3SQXA 2XX3A 3ADCA 3CNOA 3LH5A 4LBWA 3QF4A 4NDZA 5HKKD 2ZM5A 5P21A 4BLRA 2AN9A 2VEDA 2AHOA 4V03A 2VP4A 1P2UA 4F38A 3V00A 3AUYA 1L4YA 2WV9A 5EE1A 4A15A 1G18A 3RRZA 2VF8A 4XD7D 4DWJA 3GMTA 3DHWC 3L43A 3B9QA 2EWWA 2QMHA 2REXB 3VR1A 1LTQA 3BBPA 1XFAA 2H17A 4C0BA 1CR1A 1N5JA 4ZV4A 1XD8A 3U44B 1JBKA 1Q1QA 4R2HA 2ZJ5A 1NJGA 1T0JB 3CNNA 1MO5A 4DLRA 3I62A 1KI2A 4JVLA 4TZ0A 4ILEA 3IO5A 1TF2A 1XJ0A 4AD8A 4NYMR 4HAVA 2WVJA 1WF3A 3A1TA 3K0FA 4HB2A 4QC2A 3TSOA 4WIAA 3SOPA 3IDQA 3QKUA 3Q7PA 3MWLA 4A0RA 1KO4A 1GFIA 5DISB 1GKUB 4TQAA 4BFVA 2XZOA 4JLMA 4OHWA 3B2EA 2BWJA 4C7OB 3BXZA 5ELXA 2YVUA 3T15A 1KI1A 3LX8A 4O2LA 4I81A 2HCJB 1XZPA 4QJ5A 5JHHB 2ECKA 3RRNA 4JLPA 5DYIA 4PQRA 1TUIA 5FUWA 1ZUHA 2J45A 1D2MA 3FDIA 1S3GA 1UBEA 2DFKB 3U60B 1NMXA 4PZYA 3VFDA 2PEYA 4MH0R 3LLMA 2O52A 3SZRA 4B71A 4K46A 4IHQA 5DHAA 4NE2A 1E2NA 4EFMA 4LC0A 4KSBA 3KXKA 4UXHA 2WMOB 3PUVA 4GFDA 2Q3HA 4KHZA 5TMPA 1XCMA 2XAUA 4XOIA 1NN5A 2IS2A 3QF4B 1ZD8A 2VSOA 2A78A 3MAAC 1QHSA 5FBLB 5BYJA 4S35A 4DXAA 1N5KA 5E3HA 3THWA 2GBLA 4O0MA 4BZQA 3AGQA 5FH9A 4LJ7A 5FOSA 2O8FB 2CK3A 1HUQA 2AFIE 4Q4JB 3L0IB 3ZQ6A 3C5CA 2A30A 1IY0A 3RS4A 2QM7A 2IYSA 2W0SA 4TLCA 1U99A 1KNQA 4KI0A 4CZ2A 1MR3F 3R20A 3BK7A 3RS2A 1KO1A 1L2TA 1BIFA 3AM1A 4QOSA 1O3YA 4M9SA 5IHPA 4GMDA 3PJRA 2IL1A 1ZM3A 4BFXA 2D7CA 2LKCA 1NY6A 5FI1B 3BB4A 1U2RA 1JEEA 3NBZC 4PC6A 1XMSA 3X2SA 1VKJA 1E2PA 2ZRLA 1WRBA 3I1FA 4B6FA 3VQTA 5C18A 4Y0AA 2B21A 4A8JB 1CJUC 1BMFD 3L0PA 2OBNA 4OL0A 4DSNA 3SS8A 5KSYA 3EAQA 1M7GA 5EE3A 3B8HA 3FMIA 4TMKA 5B58C 1SKYE 1E2IA 2I1QA 1E9BA 1OFTA 3K9LA 4BRUA 3GLGE 2FG5A 1X86B 4F7WA 4EFNA 4B3FX 1OYWA 4URYR 3GLHA 2RHMA 1G5TA 4M9ZA 1W5TA 4PXAA 2CLCX 3GLFA 1N0VC 2D3WA 3VTKA 2J9RA 1GKYA 3Q3JB 2PT7A 1DE0A 4I4LA 4E5UA 4GSYA 2IWRA 2FDCA 2RHDA 1GILA 1E9AA 2NPFA 3UK6A 1OXVA 2DWQA 1HV8A 3CW2A 3KUDA 3K0SA 4AI6A 1E9DA 521PA 1I4TD 5CIWA 3L0SA 4JKYA 5CB6A 2RKOA 3LLUA 4M4SA 4ON9A 3TUIC 3TLXA 4IDPA 3TNFA 1V43A 4PSAA 4XJXA 5JSZB 4EPVA 1JR3E 3KTAA 4JMPA 5FOUA 4ACAA 1LF5A 1P75A 1ZC4A 4BLSA 4IDNA 2W2VA 3THWB 4LSGA 8OHMA 3IILA 1XMIA 1G7CA 2QN6A 3T61A 3WMFA 4P4SA 1RYHA 3Q9LA 2ZRBA 1RFLA 4FMCB 5FPKA 5KTYA 3B7GA 1Q1EA 1VG0B 4MGYR 4NTZA 3QEJA 5AR1A 4HI0E 4EQ6B 3THXB 4FW9A 2KE5A 4HYYA 2BV3A 3LRPA 5JECA 1BH2A 1XTRA 4ZPXA 2NMVA 1HE1C 4QBGB 1G7TA 1U0LA 3KJIA 3O8RA 3BE4A 3I92A 2YOHA 3KKOA 5HPYB 3R7WB 1G3IA 4JJKA 4Q1FA 2RGGA 2CE2X 3UANA 1UKVY 1D2NA 1U98A 2X2FA 3AKEA 3WXMA 4P32A 4NP6A 2FJUA 3QEOA 4Q9LA 2W00A 5FBWB 3PEYA 4Z8YA 3EX7C 1FMJA 1UJ2A 3MWYW 3ADBA 3CR7A 1ZAKA 1R0XA 2VA8A 3X1DA 3GFOA 4JBXA 2WOJA 5A5GA 4GMXA 1JJ7A 4ZCLA 1QHHA 4L5BA 4E07A 2C5LA 4HUTA 1TNDA 3K09C 5CB8A 2C8VA 1NBME 1GP2A 2IYTA 1QG4A 1VTKA 5KDLA 2NO1A 5JWRA 1E99A 5DHFA 1P2TA 4JSYA 5BW8A 4OJKA 4PO8A 1EFUA 4ARZA 3RWOA 4IOLA 1SVOA 4I1OA 2ZYUX 4AG5A 1P7CA 1Q22A 1XTKA 2YOFA 3K70D 4KAXA 2ZJ2A 1Q0UA 1DOAA 1CTQA 4A8JC 4TQ9A 4PSVA 2ZIAA 4P4SB 2JLSA 3TBKA 1OPXA 2DFLA 1Z0DA 1R5OA 4YXWD 3ZD6A 3EW9A 1WP9A 2RB4A 5C46F 1YR9A 1KDRA 5TDHA 2YZ2A 2R6GA 3G5UA 4M53A 1RRFA 1COWD 1N5LA 2VIIA 2F43A 3TRFA 4RCYA 4GBMA 2C96A 1J90A 2ZVQX 1OFHA 4HB0A 4UNSA 5BN4A 2ATXA 3LFUA 3WMGA 2ZE7A 5FL7D 1EFRD 2GVDC 3WYAA 2YOGA 2GK7A 5LBIA 1NRJB 4C0LA 3AVQA 5JCZA 3T1QA 1Z47A 2Q3FA 221PA 2ZS8A 1AKEA 3VR4A 2NOAA 1J70A 5DE3A 1CP2A 4ASUA 2HDNB 1FL9A 1TU3A 1H8HA 4ZO4A 4LJYA 1LV7A 2BMFA 1G8PA 4Q1CA 1J8MF 1R6BX 2KI5A 4TL6A 4D26A 2CHGA 3QUSA 1G3UA 2PBRA 4MRPA 1XPRA 3GLGB 4CF7A 4CT4B 3MG9A 3REFA 2ZYTX 2GBLC 2QQEA 3N2EA 3OEED 3AF3A 2IYRA 1D8TA 3NEYA 1GRQA 2YC2C 4FCTA 5JBQA 3K9NA 4LYJA 1EESA 2F7SA 1T3HA 1JI0A 2QY9A 1R10A 4EIWA 1Z6GA 4IVPA 4TYYA 4RFVA 3DL0A 5KPJA 5EXXA 5EP4A 5JZVA 4ARZB 2XEXA 3ZVMA 4DBLC 3TQFA 1NVXQ 2W6JA 3QVUA 4AYWA 1Z63A 1RRCA 2J46A 1U8AA 1II9A 2WWGA 4Q5IA 2GAAA 2J59A 3QKTA 4OK5A 1NBMD 1XX6A 2DBYA 2ODBA 2R6FA 3IQWA 4XWOA 2WWFA 4RY2A 3A58B 2WBLC 4IFEA 1E9RA 3VU9B 1CKEA 1G17A 1N0WA 1CU1A 3WBKA 1G21E 4ZKEA 2G1KA 1E0JA 3UPUA 2BM1A 3E5HA 5DSZA 1HA3A 1S1CA 3U3MA 1YJ5A 2O8BA 1M8PA 2DB3A 1II0A 5DI3B 1KSGA 1DO2A 4HLUC 1BS1A 2R6AA 4R98A 2C95A 4D80A 2XNDA 4TLAA 1SXJE 1E9CA 1WE2A 2WIBA 4LJ5A 4A2PA 4ACBA 4K8OA 4DT1A 5FTKA 4KXFB 2X2EA 2R65A 1RIFA 2IYXA 2RCNA 3HJNA 2ZSEA 3KB1A 4XSHA 5HCNA 2VP2A 1HH4A 4KSCA 5J5CA 1ELOA 2FEMA 3G0HA 1G5RA 3AB3A 3D8BA 2DY1A 2J7PA 3EPKA 1ZUNB 1ZUIA 2IHBA 1G7RA 1A4RA 2W2TA 4YLGA 5B64A 2YC4C 1KI4A 2Z83A 3VNVA 4FMDB 3LO5A 5E7JA 4D82A 5K8LA 4Q9JA 2XTNA 3VR6A 2BBWA 2Y8EA 2C9YA 3BOSA 4C2UA 4DLUA 1L8QA 1IXZA 2BMDA 3QXCA 2QENA 2WICA 4Q19A 1Z8FA 1ZINA 4YDSA 3NTUA 3ADDA 1Z0AA 2XGJA 2QP3A 1ZIPA 2Q21A 4LYHA 5A4JA 1YHNA 4JVMA 4TQUS 2YINC 1E9FA 3WRYC 3PQCA 4DCUA 1OXSC 1LFDB 2NO7A 1KAOA 2BJVA 4MRRA 2C78A 1N0UA 2BMEA 4MGIR 1T3LA 3VHXA 4B3XA 1O87A 3AVYA 3OESA 2B6HA 5K8TA 2IF2A 2QBYA 1KI6A 1MO4A 4LBYA 4FI3C 1KK0A 2NIPA 1S3SA 4E22A 3R9WA 4BFUA 2XTZA 3FE2A 4HATA 4B3BA 4A6XA 2GAOA 5JS8A 3HWSA 2NG1A 4BFWA 2CHVA 2JLYA 1ZBDA 1G8HA 4MDEA 3Q5DA 2QP9X 1FPMA 1UEJA 1YZNA 3AKYA 3NG1A 4L9SA 3GJXC 1OIXA 3AVPA 2H7VA 5DYGA 3E2IA 4HUQA 3WNCA 4NCHA 4F93B 1DAFA 3A8TA 1I2MA 2JIZA 5IF9A 5JRJA 4I1UA 2EFCB 1C4OA 2AK2A 2GZHA 2RGBA 3SBEA 4CVNA 4YONB 4OI2A 4KFSA 5EE9A 4DT1B 3T1VA 3SDZA 1Z0FA 2YKGA 3UWKA 2AFHE 3CRVA 4LY6A 1HYQA 1SXJA 3ADKA 4MDFA 1TQ6A 2P2LA 4LHVA 1E2GA 4HZUA 3EA0A 1ONBA 5LDDC 3LXRA 5DH9A 1E94E 1IN5A 3CF6R 1KKLA 3QJYA 2QUZA 3ZZTA 1NL3A 1E0SA 5KNBA 2ZRMA 1HQYE 4KFTA 3RDPA 2CHQA 3U4QB 1MO3A 3GJ0A 2I1VB 3PUZA 2J0UA 3RC3A 1OFUX 4BQSA 4D4MA 4CW7A 1PJRA 4D0LB 5BN3A 5KPDA 1RRPA 4GDFA 3HYTA 1KMHA 4QL3A 4QM6A 1US8A 2VP5A 2JASA 1T5IA 4URWR 2HLDD 3HPQA 1AA9A 1OYYA 5G53C 3SYKA 3PEVA 1VIYA 3OF5A 1KYIA 2QL6A 4EJSA 1NSFA 2W58A 1ZM7A 5FUVA 2GETA 4C9BA 3QKSA 4QHTA 4TLDA 2AKYA 4TMZA 4A92A 4QJ3A 3DZDA 1VCIA 3TW8B 2OHFA 2QBYB 1KI6B 3W8NA 4PZZA 2OLJA 3X1ZA 1YZTA 2BEJA 3NIBA 4WZBE 4A0GA 5GJBA 4EUNA 2GNOA 4DEXA 1TPZA 2J7KA 1ZVQA 1IN6A 1FFHA 1U0JA 3PEUA 4C0SA 1C1YA 1XTQA 1RJ9A 2H16A 1EK0A 1MABA 2O8DA 3SJAA 1ZNXA 5DN6D 1DG1G 3I5XA 1WBDA 4PC7A 4F4IA 2ZI4A 5HZKA 1WMSA 2YNMA 1VYUA 3TVTA 2QTHA 3A4MA 4KODA 3BWDD 4LPKA 1SVLA 4UNNA 3TK1A 2D7DA 4BECA 1QHNA 2ZYWX 4HUQB 3M0EA 3GD7A 2OM2A 3THOA 2VYFA 4GZLA 2FWRA 5JWOA 5FBQB 2N42A 2RGCA 2CL0X 5C4GB 4QBHA 1SKQA 5AUNB 2BMJA 3BJIC 2LWIA 3GEHA 3VNUA 5JWHA 1ODFA 1T91A 4IDOA 4I99A 1RZ3A 4WZ6A 2WIAA 2ZJBA 1AZTA 2FA9A 3CH4B 3UKDA 1OH5A 2HF9A 1KK3A 2F1RA 1GL9B 3AVTA 2XITA 3ASZA 1XEWX 2OILA 2ZE6A 2ZSAA 1SXJB 3LAWA 3UIEA 3DKVA 3AVOA 2WSSD 1N6PA 3V4FA 2ZI3A 1MKYA 1Z6YA 3AF0A 1KI3A 2A7QA 3RHFA 4AYXA 2MSEB 1CEEA 4XTRA 5FBRB 3TR0A 3MFYA 2J0UB 4WOPA 3HYRA 2QGZA 1ZYUA 3LQRA 1Y63A 2QMUA 3F8TA 1FX0A 3RYTC 1KMHB 2P0EA 2G1JA 4MYUA 3S1AA 2WJYA 3KQHA 2ZR0A 3EC2A 3RS0A 2ZAMA 3AVVA 4AKHA 1JXOA 1WDTA 4EJSB 2HT6A 2NO6A 4UJ3A 2IWHA 3NBYC 2QT1A 4RZXA 5J4HA 3BB1A 1RW4A 2ZSBA 3GCGA 4EPWA 4PC2A 4A1FA 3I8XA 721PA 1MOZA 2Z5FA 2PJRA 1GNPA 1KAGA 4MRSA 2XJ9A 4GOKA
chains in the Genus database with same CATH superfamily
4N0DA 4D9CA 1U2GA 3ZIAA 5E2BA 2ZIGA 1ANKA 2ENUA 2NYAA 4PFJA 1TVCA 1NNUA 1EGVB 3IQGX 3ACDA 2GVNA 3OM8A 4OUDA 1NN3A 2RGAA 4FGLA 1MABB 1PYDA 3L84A 2VF5X 3CIOA 3ISTA 3B6EA 2BVNA 4JR1A 4YCDA 4MP6A 5LPNA 1YGPA 3GO4A 4UXIA 3TZLA 1DTWB 4LFAB 4FZ3A 1OGIA 1YS9A 3GGOA 1E1QA 4AF8A 1D5WA 4F3CA 2VP0A 3PWKA 1O7JA 4FGJA 5IF3A 1YTLA 4IINA 4DTIA 3U7JA 1XP8A 2IX3A 1CQZA 2Y6VA 3LV8A 4YJHB 5C8YA 5EYPA 4HXEB 3T41A 1RYBA 2FMTA 1TKCA 3AC0A 4BO8A 1PFYA 3I0NA 4Q4HA 3EEFA 3GJ8A 1VCOA 1YZFA 2R79A 3H2HA 4UBOA 3BZWA 1JEAA 5KHOC 4A8TA 3WO0A 4LYEA 4X8LA 2O0HA 5ADVA 2RH8A 1J1UA 3AHDA 4X93A 1SHLA 3F5MA 3KR9A 1ATZA 2F3PA 1Q17A 4ENPA 1UPTA 3F3YA 3QEAZ 1TM1E 4CKXA 5E4JA 3J80A 1IVYA 1LW6E 4GF5A 4Y2GA 4R71A 4RULA 3HDJA 1PJCA 1PZMA 5CA1F 2PYIA 4DA7A 1HNWB 1FX0B 1LLFA 2R1TB 4M8NE 1XNGA 3ZWWA 3S8YA 2CT8A 1UL1X 2PLNA 2GEUA 1WTAA 2AKAB 2XSZA 1IY2A 1RJFA 3F90A 4RF4A 3F7TA 2RAUA 2OHXA 3NRCA 2QN7A 4BE4A 5AKXA 4QNMA 3SG0A 1T43A 1C9MA 3N0VA 3LUBA 2VWHA 1E6LA 2PH5A 4L75A 4P98A 1BE8A 1E6KA 1CUCA 1UFVA 3SHVA 3ZE8A 4EGJA 1BU5A 3MINB 4HN4B 1GGJA 4JP8A 2DLCX 3AM4A 1HDOA 3HA2A 3JR3A 1TK9A 2WF7A 3EXG1 1NPTO 3D4PA 2WU4A 2JIBA 3E84A 4XH9B 5FP0A 5HOEA 5DBHX 4DR3B 3ZH9B 2WZBA 2XBUA 5FLKA 3ONFA 3PR2B 4EITA 2AWNA 2GD2A 2DX7A 4ZC1A 4I1VA 9LDTA 1TFUA 2C04A 3FVQA 1IXYA 2V59A 4ZQCB 4KJZA 2J5XA 2FQYA 4MUIA 1X87A 1D3AA 1T5DX 1V1JA 3LKDA 3GFTA 4MRVA 3HXLA 4CXMA 1PWHA 3AB8A 3RCBA 4FE3A 5KJEA 1NXQA 3N8DA 4G24A 3RC8A 1SBQA 1KZYC 2QRLA 1VLMA 5F1KA 2Q3MA 2AMVA 3QVJA 1KQFA 3I61A 2OY0A 3NP7A 2JRCA 1EJ2A 2ZBVA 3STWA 2Q8QA 1CRWG 2Z56A 3LWNA 4V0LA 3TL2A 3C87A 3I73A 2XZPA 3O94A 3P2EA 1KOFA 5G02A 4MJXA 4OI4A 1QHGA 3NEJA 2PS3A 2GZ2A 3IH5A 3DV0A 3QOWA 5H5JA 4DDHA 4D44A 1ZMRA 2O59A 4I3FA 3EPHA 3I42A 5K01A 1R8JA 1VBNA 4RMGA 4WXEA 4B87A 3ORQA 4C87A 2OO5C 2I2DA 5IRCD 1V5FA 2FSUA 3LX6A 4Y0VA 4CL0A 2IEYA 3QYPA 5I7EA 3OE5A 4IF6A 1IJEA 1FMLA 3LE8A 3ZY3A 2M32A 3DBLB 6Q21A 3BHJA 4KUHA 1NVUQ 1TF5A 3P0RA 1D2HA 1F4VA 3PCXA 4K9OA 3EXHB 1I01A 3G3EA 1YB6A 4G1UC 5JMTA 3WJAA 5BNIA 4HYQA 1XAJA 1X0VA 2PX0A 2CW5A 1XEWY 3IEUA 2QZSA 3ZDEA 2FFQA 4RPLA 4GPBA 3CTMA 1HTTA 2Q0HA 4MPRA 3AFGA 3VZCA 5L7WA 4INJA 4DDKA 1M2NA 2IXFA 2ONZA 3H4TA 1BG6A 3AU8A 3DUFA 1Y1PA 5C2JB 3JZIA 1XEAA 5FPQA 1VB3A 2NO0A 4QOJA 3GFPA 3WHIA 2JGAA 2WJJA 3EW7A 2YS7A 4HNVA 3I64A 4W8GA 2C82A 4BV9A 4CR8A 4TMWA 1FB5A 4MR7A 2HA4A 3INGA 1A5BB 1N3LA 4DV2B 2OD9A 2VSQA 4LDAA 5AK4A 1U0GA 3MT0A 5DKFA 5ALYA 3EVEA 2DUJA 2RBKA 5I01A 3INTA 3RPEA 1C0KA 1HSOA 3CUKA 3TR6A 3U6KA 4KX3A 4PONA 2X7JA 3DVLA 2IZZA 1L4HA 2H1FA 5JXIA 1JP7A 4AK9A 2CJWA 1N2CE 1EA5A 2D5IA 4MWCA 1E2FA 3C8UA 4PRKA 3UTCA 5A4KA 5IABA 3VKGA 2VHQA 2PMWB 4FFBA 2BZ1A 4HLQB 5K20A 1WNTA 4HN9A 1E3TA 4GYKA 2DETA 1PX2A 2WM8A 4EG0A 5BN1A 2GUGA 3SNKA 1YUMA 3HKDB 1SCDA 2FRXA 3IPCA 1VCNA 3RC1A 4BMPB 2WQ7A 3WMRA 4LDRA 3EUWA 3HUEA 1AV6A 2B8WA 3TIIA 1KFBB 2Q2NA 2WVGA 1GGKA 1RYMA 5HTKA 1KZHA 3ZUPA 4XB2A 1JRLA 3ZJUA 3JPYA 3KELA 2PO7A 4BRWA 1X3SA 1R5NA 1KGSA 3L01A 4S1WA 5JNSA 5CTAA 1T2NA 1KY2A 4ENTA 3GBPA 1NM5C 2GZMA 1ULUA 3K7EA 3N3BC 3D7SA 3ZPXA 2YMQA 1FLDA 1FBTA 1VB5A 5C34B 4B6QA 3GPDG 4CM6A 2A14A 1X74A 1JPNA 3EF0A 1XCJA 3C48A 1RCFA 3I83A 4NCJA 5DYYA 3OJXA 3QRWA 3T3HA 4X97A 3NVDA 4EL0A 4ZI2A 3FYHA 1JXMA 1NURA 1ZCZA 2PD6A 2QY6A 5G0VA 1YVUA 3AYZB 1DX9A 3HXPA 4LZWA 1R5JA 3C5HA 1PT8A 4TXMA 3RB8A 4Q66C 2V3WA 5AFSA 2FPMA 3TVYA 4YN3A 5A0VA 5KU1A 4JBLA 5AHRA 5IZ4A 1USVA 5KS2A 1XALA 1T8UA 4TVBA 3PC7A 5HCIA 4JQCA 4H6XA 3MLBA 2O8EB 1Y34E 1WXGA 2CNDA 5EZYA 5LB2A 4YRKA 2CFRA 5C37A 1WXIA 3O92A 4IYRA 2F17A 4RK1A 1MJNA 4GMGA 2AHRA 3M4YA 4H0CA 2XGMA 4F5EA 3EGDB 4COOA 5CT5A 4CEIA 2WQ6A 3ZWNA 3H2YA 2AE1A 1A9XB 3FZGA 1IDN1 4N7RA 3DOJA 3DUWA 3NH6A 2FSHA 3PJDA 1E2KA 4BB9A 3ADPA 1CZHA 5DLPA 1HDRA 3W8EA 4KR9A 2ZWPA 3HBLA 1M2HA 2EATA 2BKXA 2AX4A 1EHYA 2PD3A 3HA5A 4I5EA 5JDIA 2WJZB 4OBXA 1E1KA 4P53A 5ECYA 4RA6B 5CFNA 4WBNB 1XLTC 3LHDA 1W34A 4M89A 1DEXA 3I72A 4E32A 2QA5A 3ICCA 1Y9JA 2X6TA 3GLHB 4HWRA 1BEZA 3A4VA 3BH7A 4G9EA 1VJRA 2OHHA 5JD4A 3X1YA 1H0SA 4FOPA 5JTUA 2J9XB 1JG4A 3DZIA 1U3CA 4GM0A 3D0OA 2GILA 1N25A 4H7JA 5IJWA 3WJ2A 1BCRB 1U81A 1USWA 2JC3A 3U7GA 2ZYDA 1X2BA 1LLQA 3NBXX 1TMYA 1Z5UA 3RUIA 1NAIA 1NRWA 3BEDA 4DRXA 1OI3A 3QMWA 4YCSA 1K6XA 1C3XA 1Z6XA 4ZQGA 4EB3A 2NTEA 1EI9A 4J75A 1G63A 2WFLA 1H9AA 3DEJA 1RSZA 4WMLA 2Y2UA 3VKVA 4HNSA 1JA0A 1FP1D 4M7OA 2EQBA 2F1KA 5B3LA 1JU3A 3NTVA 4YNBA 4C6TA 4JVSB 3HJBA 5CYPA 4L7QA 4D8XA 3C39A 2R7LA 5HQ3A 5DWDA 4NFLA 5F52A 1YZHA 3U9TA 2QAGA 2GKSA 2IPXA 5HWSA 2WWXA 1E4VA 2IT1A 3QW4B 3BXFA 5IT5A 1JQBA 2J3EA 3G2MA 3S81A 2E9SA 2O2HA 4HXGA 1Z3CA 2PTHA 2YXNA 3M6UA 4QXQA 5C1PA 1X13A 1T9DA 1ITZA 4BUZA 4CEHB 4O63O 4WWHA 2GESA 2ZJ1A 4LK3A 2PKEA 2Y05A 3PLAE 1KU6A 2ZJFA 2JCGA 3M1IA 4KFRA 2QTVB 5KVCA 4TMFA 2OCPA 2Q1XA 1DLIA 4HDMA 2NXEA 4L5IA 3RH0A 4JYAB 3HGQA 3LZ6A 4QYXA 3UPDA 3ZNPA 4BXOA 5TT1A 4W82A 3I5YA 4PPQA 1H2RS 2NWQA 2XDQA 2IYUA 3MCUA 5JVDA 1I24A 3G5LA 4XUEA 5K0BA 3KKNA 3GF4A 4H7HA 1FLAA 2C8LA 4XQGA 1XXLA 4BRSA 4XIIA 1XD9A 3LKBA 4OKIA 3CEAA 4QAQA 1OBHA 2C5HA 4O5OA 3OA2A 1DBRA 3PHGA 1M8JA 2B83A 2CUKA 2PWPA 3GOQA 3KB6A 3QMPA 1X7YB 1YAJA 3GU3A 1MJGA 3VISA 1QYXA 2X5OA 2GBGA 1EFAA 1FP4A 4V0RA 3VR4D 2QN2A 2V4ZA 5ADHA 3FNBA 4IP0A 3DE2X 1R6UA 1GTVA 3NYIA 4BBJA 5JALA 4TRNA 1KU0A 1M2VB 3OE7A 5LP1A 2AA3A 2QQ5A 2YRXA 4DBVO 1TJNA 2G80A 4I5GA 1ISJA 3TSZA 3CGWA 2IPLA 4KXMA 5JSKA 3WL8A 4QJ4A 1S8NA 2ZRPA 3VKFA 5BV0A 4S1PA 3DDZX 1TEXA 3PFIA 4MA0A 2OQVA 3NWBA 1QHHB 4M1SA 3UCXA 4X8MA 4UM8B 2EQ5A 1GO2A 1QR6A 2QVCA 4R7TA 3UW1A 3WL5A 1RNLA 4MQUA 2Z4TA 2FKAA 1TJ5A 2G5PA 3KC2A 4L1KA 5F5LA 4AJ1A 3IP5A 3KYDA 5NLLA 1IQ0A 5IJ9B 2QW0X 2XTAA 2H07A 1H5UA 4HZIA 3WQQA 4BQPA 3UH0A 5K3CA 3OM9A 2O8CA 3BMOB 2EG5A 4X54A 4G8DA 4FJ0A 4OU4A 4PAMA 4BQIA 3SVTA 3OTOB 2FWIA 3OTGA 2XRZA 4EYEA 5AVQA 3RBVA 1MC5A 4GS5A 4A2QA 4YR9A 1UADA 2HPVA 5AJUA 1NNSA 2RK4A 2GX6A 3QVOA 3SICE 1KJIA 1WXHA 2IZ6A 2V97A 4G3XA 4JLVA 5E1BA 3WIBA 1E2JA 3R3JA 2GCEA 1JU4A 1TL7C 2W6JD 1OBOA 1WA5A 1CF4A 1W9HA 1X6VA 4CM7A 3KV3O 4D6PA 2ZIVB 3INYA 5BWLA 3L8YA 1H22A 4CEJA 1OE0A 1Z29A 2TMDA 2NUPB 5EHXA 2XUKA 3LVBA 4BZWA 1A3CA 2HU5A 1IQPA 2VZ0A 1MX3A 1C9JA 1H2AS 2CXXA 3FPAA 1E3LA 2OFOA 2ZB2A 3B1ZA 4X63A 2Z8XA 1JPVA 4LI0A 1KSFX 3MRVA 4ZQHA 2RJNA 2EV9A 3CZQA 5D84A 4DRYA 4XLLA 2PJUA 2DR2A 3MXTA 2C2ZA 3UAOA 4C14A 4E4TA 4IQGA 3EMKA 3KEGA 1RZRD 1MDFA 3KXIA 4LI3X 3GBVA 1DQNA 1TF7A 4YV1A 5A7FA 1E7QA 1NBAA 1NXPA 2OHJA 5CLGA 1RRGA 1BRMA 3ICEA 4FXPA 1FSSA 2Q3DA 3ABQB 4LV8B 3HL0A 1A9PA 1I3CA 4ABTA 1FJGB 4CIYA 3AUTA 4WLUA 2X8WA 4H15A 4U6QA 3UC5A 4NMXB 2CUTA 1U9CA 3HQ4O 4NVRA 3PRKE 4TOIA 2OCGA 3DKPA 4GX1A 2QRVB 5IMSA 3NNDA 1MB0A 4JYBA 1NVDA 1W7AA 3N6XA 1RXCA 4TUYF 5E4FA 5DIFA 2YCLA 3OIWA 4UTNA 4P5EA 4OHKA 1K8RA 4QGHA 3L9XA 3D7LA 2NU8A 3H5RA 2AWOA 3UENA 3KVNA 3CMCO 3OZUA 1LNSA 2R3SA 3SHWA 3L4KA 2EJCA 1KP9A 2MMGA 1DEOA 1Y82A 1ODIA 2WJ4A 1XU4A 1YE5A 1JBEA 3QOYA 1AKYA 4YGXB 1A5SB 1RLUA 1NUQA 3CLSC 3NAMA 4P6VF 3T54A 2QT0A 4BP8A 1O9BA 1L1EA 2QGFA 4X85A 1UBUS 4CKZA 2IXGA 2UXDB 5HQJA 5JCOA 3ZE7A 5IXJA 2VHJA 1MZVA 4KQFA 1QGDA 2X4LA 4PSUA 5BSHA 2YV2A 3AR3A 3BTSA 3ZBTA 2JFBA 3FFAA 3IELA 2Q45A 1ODCA 4M55A 5EWJB 4EH1A 4ZJPA 2IK8A 4IWNA 2H4HA 5A5VA 4NZYA 3DP7A 4W4TA 5JRZA 3OQIB 4AY4A 1PR3A 3ILXA 1QC5A 5EHZA 4J0EA 2PLRA 1NC3A 1Z35A 3QMVA 3UXYA 5JUWA 3QE9Y 2OGUA 1IN4A 4ZZIA 3A3NA 4B9EA 3RU9A 2WJAA 3I09A 3KALA 1DO0A 3IUJA 3RAGA 4NYMQ 2G36A 4M98A 4PG5A 3PFNA 5TR9A 4U9HS 2P9CA 3OD1A 1JKXA 4E15A 2SCUA 3WV4A 2VJBA 3GLQA 3U17A 2E1RA 1J7JA 4WY2A 1NQ5A 2DFNA 1WL8A 1RXVA 2G9UA 3IDAA 2ZRQA 4EG4A 2BR3A 2ZJAA 3E23A 1O94D 2OVBA 3COPA 3G82C 4Q24A 1BOOA 1S7GA 3GDOA 1F8YA 3D7NA 2ONJA 3KB2A 3S5JA 1P9NA 1L4EA 1RWWA 3I6YA 3OQMA 4QAJA 3D0KA 4EUFA 4L7VA 3ZVLA 5B7QA 1V3VA 1ZXXA 1AGPA 1JG1A 4LNUA 4HAZA 2J67A 3K0KA 3OIUA 1O8BA 5T41A 2BBTA 5TX7A 5I4IA 3TUZC 2QTTA 3LSTA 2WMDA 3SX4A 2IS1A 4XM0A 3VV3A 1XBTA 2VQSA 1SXJD 1I10A 1L4KA 4ZZ2A 4UFPA 5FTJA 1YR1A 3Q6MA 4EJFA 3GNLA 4N03A 4PZPA 2HBZA 3V6LA 2EG9A 4G4JA 2VQ6A 5KNBD 3SXJA 4X20B 2ID9A 3K0BA 1OI7A 4KVFA 3TTVA 4D8VA 1CUFA 2PJZA 2BCGY 2PR7A 4QU0A 4YRAA 3IPRA 1Z4KA 3AJ8A 4IOMA 2GBIA 4G36A 4JT8A 4Y30A 4DNFA 1M1NA 4Z53A 1UBTS 1GL7A 1F0KA 1QTRA 1XVIA 2E82A 1YA8A 3D3QA 1HYHA 2ZPTX 1HT2E 1O6FA 2I4LA 2P1DA 2CLKB 3K5HA 4U7WA 3VO9A 1TYZA 3RNLA 3L5OA 1N6RA 3DDSA 1NKVA 1DRVA 2HSWA 3AERB 4FDVA 4J07A 4FIDA 2XYQA 5KTSA 1T2EA 3FRIA 3DD1A 1KTVA 2M1XA 3QXHA 4QIHA 2H0AA 2H06A 4ID9A 2B4YA 4GC5A 3GFVA 1IHXA 3EUFA 4KQ1A 2GPYA 4D6XA 1VFPA 2HDOA 2XRFA 3H05A 3RVMA 2HA2A 5BOSB 3H4MA 2PRYA 1FFCA 4J7AA 3SR4A 2HQRA 3T5BA 2XADA 1PL7A 4QTUB 2OYRA 2VPTA 1JHPA 1QIKA 3R8CA 1NIPA 1O2DA 4R2JA 3I2YX 4I08A 5JROA 3W0LB 2ALJA 2YIJA 5HK9A 3BIFA 5TNXA 2VYNA 3PWSA 1ZN8A 1NW9B 2JFZA 1JIJA 1OXKB 5E0KB 3AVWA 1I2BA 3CTPA 1CDDA 2AD5A 4MCIA 2ZFUA 4G07A 5B4TA 2BRUA 5JATA 1HO3A 1BXGA 1XVVA 2XQIA 1P7VA 3FSEA 4RNDB 5F21A 1KQNA 4AFNA 4DIMA 4DNXA 3U61B 4KR2A 4AKSA 5JPCA 4L74A 1E2EA 1XB2A 4F04A 3BF7A 3LBIA 1FYFA 2OHIA 4ITUA 4N65A 2XJ4A 1R00A 4MVJD 2CF6A 4MW0A 1GRRA 4LXYA 4YS6A 4INAA 4PRZA 3QKIA 4MQ5A 2W42A 3PIRA 2COKA 4U2KA 5EERA 4QBIA 4WNCA 2I6QA 4MQLA 3RAEC 2FN3A 3W1WA 3PXXA 5K3SA 3QPDA 2IP1A 3V1YA 3QY0A 3ETJA 4ZALA 1YQWA 1C8KA 1VJ0A 1K97A 3SQNA 3WWEA 1EE9A 4IDQA 4YDRA 3IAM6 4PLZA 4EPRA 3IHKA 1A7AA 3O2SB 1KEKA 2B7CA 1WXFA 3DNFA 3RABA 1JUDA 2R5FA 4F45A 2OA0A 4W5QA 4PNZA 1JIVA 2GTIA 4Z2YA 1PG2A 1A8QA 2R97A 4WNIA 3WJ1A 5G0SA 1E1LA 4BN4A 2DERA 2ACKA 3AZOA 3GA7A 1K7FB 2Y92A 4BEJA 1S0UA 2IBMA 3AXSA 3IPYA 4GM1A 5HIAA 2QM8A 5LQAA 1HPLA 2QLFA 2ZEJA 3TS1A 2L18A 4LX0A 4BNKA 1TT5B 3QVKA 2EERA 2YRFA 5F51A 4D0NA 2FFBA 3DM9B 4Y9DA 1YQGA 5HDQA 3COVA 1CUSA 3KXLA 3BCSA 5EXEA 1B73A 1JR6A 1NP6A 4NYJQ 4GECA 5KTNA 2E6KA 1YC2A 2VBCA 4KI7A 1RJ9B 4YT5A 2R60A 3MTEA 3P27A 2OYSA 1MQ8B 3EPJA 3CX3A 4ENWA 1RLOA 4UE6A 2NXCA 1RPNA 4FFNA 5CX1A 2WT4A 3OTWA 4JR2A 3IDFA 4PO1A 4QTTB 3W5JA 5TY0A 1JGTA 4C5AA 3UXEA 4OH1A 2CNWD 2VJAA 4RMJA 4AZ0B 1CY7A 1PGQA 1WXXA 2MHCA 4KFUA 2QV0A 2IP4A 1E63A 2D4AA 2OV4A 3V46A 4BMVA 3A7EA 1CNFA 1U2DA 1KEZA 2QYTA 2SKEA 4F9EA 3A10A 4GI1A 1CUXA 1EPUA 4YJGB 4MWBA 5LDGA 1T1SA 4MYTA 3RIHA 3ZJ5A 2CC2A 1YFJA 1X8JA 4Z4GA 4E51A 3RFTA 3U0BA 4D25A 1EJ0A 1E4EA 2OTCA 3DQZA 1PP4A 1T2CA 4YXFA 2NVBA 2ZJ8A 1CJSA 3BTOA 4BP9A 3AVUA 4Q4CA 2AEEA 2WAYA 4E1BA 2B2NA 3MCTA 4RGVA 2Z43A 4Q47A 4ESEA 1DDOA 1FDWA 1OU0A 1OW3B 2W2OA 3CLHA 4JT4A 5ADUS 5D51S 1DAPA 1YKFA 4S1OA 1N5RA 1G60A 3WADA 5BVHB 2VF7A 2D1TA 4LXGA 1D2GA 3LDGA 4C30A 1E3MA 1BDBA 3WRXC 5G1PA 2G40A 3OOJA 4I1RA 5BVGA 1CLEA 3HR7A 1JLRA 4JKIA 1EGMB 1K68A 1KQOA 2V4MA 4DTCA 5BYKA 3PGMA 3KU1A 5AICA 1J7KA 3DG9A 1WCWA 1NHGA 2ZR9A 3JD4A 3OFND 2ATCA 3PYXA 3VOSA 4G1MB 5FNVB 2P7IA 2C92A 3DEFA 4R8KA 1V71A 7REQB 1BVYF 4RORA 3WLTA 1K7EB 5FAXA 3RJ9A 1W75A 4C4PA 2OC9A 2VP9A 2GCOA 1IC6A 2J32A 2C42A 4BMZA 3FYUA 2AMJA 2ZSIA 4RD0A 3ROQA 4AZ3B 4MS3A 2ZIFA 4P4GA 3LYAA 4FTWA 3RSLA 3FDXA 5EXSA 4QPCA 4CNBA 4R1OA 2ID8A 2C98A 1IHUA 1DG3A 4Q34A 4LWOA 3ZS8A 1OBFO 3FZNA 3NKLA 2QPAA 4WZAB 2R87A 1GEEA 3S55A 3EOZA 3ESQA 4IIGA 3UVEA 3LSYA 4GO1A 1DC6A 5J2TA 1NT2A 2OLKA 2ODWA 3FCXA 3GZ4A 3HB5X 2Q4TA 2BL4A 2C61A 1WQ3A 4J4HA 1JAHA 5CTJA 4QG3A 2IOHA 3CLUC 1BS2A 3DJFA 1HQDA 1NLFA 2ORIA 1RQXA 4WAUA 3UWOA 3IEIA 3HB0A 3KLOA 2BOVA 1LRJA 1U0BB 2O2SA 2WIGA 4J7XA 4PHCA 2YZ7A 2AR7A 4A8JA 2JLUA 2JCVA 4OY3A 3GJSA 2LCQA 1MXHA 3FTQA 4LOAA 4L76A 2R1VA 3AHCA 4LHWA 3U37A 2IUSA 1XTIA 4HWPA 1UANA 2GJKA 3PX3A 2HCFA 3DOUA 4Q1BA 4LRWA 1I2AA 1PN3A 3KYCA 3FRJA 1T0HB 2YJNA 1S4QA 3AHJA 3PNYA 4B3DA 5BUQA 1CHDA 3MMNA 3KS9A 4XIYA 3C15C 3PHIA 1Z37A 1ORHA 1SOVA 3ONDA 3BKWA 2VWPA 3Q7TA 5LYJA 1QX3A 3L82B 4WV3A 3K1AB 2R66A 4B2IA 3SC2A 3EQ7A 1M10A 4ZRMA 4PIMA 4G5SA 2QW1A 821PA 1OPRA 1AN0A 1EB8A 2VZ9A 2X22A 1PEKE 5DBEX 4KR3A 1XDBA 1PAUA 3TCNA 2XTJA 2XUAA 2QJRA 3OECA 4IDFA 4IV0A 2IGTA 2ODQA 4Y9TA 3VPFA 5B7PA 5M04A 1Z06A 3TG2A 1G8GA 2P5TB 4MULA 3KPWA 4MVYA 4PBRA 5SY4A 3PGVA 4EKYA 4FYMA 1UFKA 3H4VA 5CNIA 5I51A 1NQTA 1PTKA 2Q1WA 3OJLA 4O6VA 2WM9B 1TZBA 3IP9A 1X7WB 3D6HA 4Q02A 5AK6A 2ZRAA 1TC2A 3EQZA 3HDYA 3DHVA 1YR8A 5K4GA 3TLAA 1RM4A 1PT5A 4LY9A 3BMCB 2IIVA 2GWHA 4BNGA 1F0NA 3MBKA 1UP6A 3D2LA 3SN6A 4DJJA 2UVPA 2HXSA 2QZ4A 3EHDA 3TE6A 5CB4A 4KK4A 2I7DA 5LP6A 2ZZNA 2WJGA 4UBKA 3TRKA 3HR4A 5C5DA 1QUEA 3ICPA 1MO2A 1TW2A 3KR1A 4CMCA 3B1FA 5B7NA 1O03A 2EKQA 1PNVA 3TDMA 1PS9A 1GIAA 4M7WA 1BX1A 4B3IA 5I7FA 4RTMA 1MEJA 2GARA 1H85A 4N6OA 1KFKB 2IY8A 4AMUA 4LJ4A 2ZU0C 4CMEA 3NHUA 2XVXA 1GAWA 4JIGA 4P2GA 2R8YA 1FSPA 1HE5A 5A1JA 1UJ5A 1QAMA 4XQ9A 4BWGA 2F3RA 3ELWA 4QZVA 4R6WA 5FWNA 2W0MA 2Q1YA 3G5TA 1Q0RA 1ISSA 3DS8A 1Z4PX 1SUBA 1YWGO 4MW9A 5TQ0B 3DVQX 4RK7A 3IPXA 4Q3KA 4OHZA 5C53B 2F4VB 3O03A 1LDNA 1LVUA 3AF1A 1GV1A 4EHBA 3E3LA 5AW4A 3D8HA 1GQFA 2HC9A 3AP2A 5IN4A 3LP5A 1T0UA 4NOKA 1Z2EA 1RQLA 2PH1A 3HM9A 4HLCA 3OVMA 4EG6A 5D3MB 2RDMA 3OIYA 4FCVA 1MXFA 5EQTA 1O6ZA 1LC3A 3NIGB 4YECA 2G08A 1SBHA 3T5PA 4QQ8A 2BGMA 2NV2B 3AEUB 1QYCA 4P4UA 4XM2A 4DMRA 1I7QB 1OAOC 4BKOA 4HLUA 1WPXA 5B12A 5CG2A 4X1IA 3NVKI 3G79A 4LE2A 1R0YA 3ZZUA 1WHSA 3K0EA 4UHBA 3TQTA 2C2XA 3VDXA 3CLKA 3RFFA 2FJPA 4BNHA 3CQ9A 2Q50A 1QDLB 2OO3A 1RWNA 4EY7A 5F5NA 4Z49A 3ASVA 3EG5A 1E2LA 1SQSA 1G16A 1YQEA 2AYYA 4TWZA 3KHKA 4FOSA 1YIOA 4US1R 3WS7A 5J47A 1DUIA 1OXMA 4UMVA 3TCKA 4CM4B 2AJCA 4UOQA 4G37A 3DAYA 5FUQA 2P6MA 4D9HA 1J25A 1HC7A 2OGTA 3EZXA 4V0QA 3SHFA 3U4HA 4OQFA 1XFDA 5JS6A 4TV8B 2F3UA 2FETA 3HVHA 5HJ7A 4TYWA 1KIAA 2YW2A 4XCQA 4RV9A 3LQQA 2EDCA 2BBOA 3A1VA 5BXYA 1EX1A 3ZLVA 1ZOLA 2ZRGA 3DMYA 5EP2A 1KPGA 1P0CA 3FGOA 1B26A 3O9MA 1K0UA 3D3NA 3MJFA 2W2LA 4AXXA 1VL0A 4EQZA 2PMEA 2ID4A 4X66B 1JKFA 2C4UA 2GFHA 2O1EA 3KZKA 3NZEA 3CRQA 5FTLA 2OFXA 3FOBA 4LSWA 4B5LA 3HA7A 3VR5A 2VUIB 1EFVB 2CVZA 1RM0A 5A4FS 5MGNA 1R0ZA 3I6ZA 4U00A 1LDBA 4DWOA 3MTIA 4OYHA 3GWZA 2Q9UA 3KBBA 4GX0A 4Y3UA 2AN5A 5J9FA 1D6JA 1E3QA 1B7GO 1LSUA 2V6IA 3FCYA 3P26A 4EMUA 2V1UA 1UKCA 5L3SB 2CWDA 3NCTA 4N47A 3CVUA 2ZATA 1Z4QA 2H51A 4X94A 5JD6A 3TI7A 4RKEA 1YJQA 1A7JA 1K3TA 4MI6A 4LXUA 4D3SA 3NM4A 1PT9A 4XX0B 4G5QA 4RKFA 3RF6A 2QI9F 2WHPB 3AF4A 4GLFA 1NBOA 1NLMA 4AUNA 3BD6A 5AMXA 2NU6A 2P77A 3LT2A 2BMAA 3SI7A 2A5LA 4B43A 1N2XA 1MQAA 4DLPA 3O8CA 4KQ2A 2HTFA 2VT7A 2ZB7A 3OUZA 4EKIA 1WNFA 3C43A 3CZAA 4D5GA 4MIEA 4BNUA 4V1CA 4P08A 1FUUA 2QTLA 3FLAA 3ZZ0A 2IUYA 2PANA 4XB1A 1RC1A 1VBKA 3UMJA 4MW1A 4O8CA 1JNXX 4I9UA 3RD5A 3U4CA 1A9RA 1Y81A 4JJIA 5B3JA 1HTWA 1Q1NA 2O7RA 3CX8A 3P2MA 1SQ0A 4YAGA 1XCOA 5J5AA 4Z8XA 5ALNA 1FJ2A 2UV8A 3JQFA 1E69A 1MGPA 1CPYA 1TM4E 3VPGA 3EVNA 1UXHA 2FZ4A 4NPCA 4G84A 4K6OA 4EMTA 4DCGA 2WDPA 3TQHA 4YC7A 3T7CA 1QS0B 3ASUA 1UBJS 2G1AA 1XMPA 2G09A 3IX7A 3AUUA 3FWYA 3H75A 3QTLA 1GZHB 3A6ZA 3EBOA 4Z9XA 5EQJB 2GD1O 3SXUB 2B1JA 4D9FA 4K6CA 5COAA 5AVSA 1ENOA 5FDFA 1EVZA 4O4LF 1WSBA 5FWXB 4RVHA 4N8SA 3HKBB 4COKA 2FPIA 1UJBA 2EAUA 1JHUA 3JYOA 4K9SA 5T3UA 4DCCA 5IBCA 2IGBA 3A4NA 4MEBA 1IUOA 2VDJA 1YOBA 4R8SA 3DYIA 3HJCA 3THSA 1WMEA 1EIWA 5K4HA 1JIQA 3R6GA 1XN1A 4HMQA 4LV6A 1Y1TA 4QU9A 1YO6A 1DKUA 1MAUA 1IZZA 4HNHA 4TSRA 3UAGA 5CDHA 5J63A 4YXWA 5F12A 1V1MA 5E38A 4C4RA 4PTLA 1COWA 3FJOA 4QNRA 1KBOA 3DBIA 5ED4A 1L7DA 2EFHB 3BA6A 1HEIA 3IBFA 3V7FA 3FSRA 3QBTA 4KC0A 2CXTA 3TX6A 1GG8A 4RH3A 2OZLA 2Z1MA 4HAIA 3OETA 3CPEA 2XWJI 4RZ3A 2K87A 4XJVA 5K0ZA 1YJAA 5BMVF 1ZHOA 4HMOA 4IG9A 4RLQA 1W36D 4LRQA 1H8HD 2Q9BA 2I1LA 1NXSA 1NOKA 4QYMA 5GPBA 3LOPA 1PK7A 2HA6A 4FEYA 3SBXA 1G8JA 3W8RA 1JTFA 3ZDQA 1OH8A 4Q9IA 2CVQA 1TQHA 4GRIA 4KQMA 5JY1A 3RJZA 2ODNA 1QRAA 3W7VA 4R0VA 2NU7A 3WNDA 2VUUA 5K5EA 5BSRA 2QE7D 2R7AA 2XQGA 4A3SA 1XA3A 5JSQA 5IMBA 1CSEE 1PGOA 1ABEA 3I32A 4KW7A 5EE0A 2QQFA 5ESRA 2BFPA 4BU1A 4ZAGA 5BSVA 1DPFA 2AQ8A 2FMUA 3GLIE 1JEDA 2GXSA 1Q7EA 3NXKA 1IN7A 3RJMA 2C2HA 1ZESA 3G1WA 3UXMA 1T5SA 2TMGA 1LF0A 2RHTA 4YRIA 1DJMA 1QFJA 2O3JA 4GSLA 3FOZA 3FPJA 5GTDA 2DVMA 3MWJA 3LBHA 4JR0A 3BBLA 4JT2A 2AI3A 2OAP1 4AC9A 5MN4A 1AGRA 2RGEA 3U1BA 4F8EA 1U7HA 5ALJA 3TIVA 3WO1A 4EJ2A 5HUQA 3H13A 2EBWA 2WG2A 4A23A 1ZN9A 2O1SA 2Q5FA 3EXFA 3WP0A 5I4CA 1CJMA 2QM0A 3IVMA 2EKZA 1XYYA 3EBLA 3G2IA 3NEAA 2QTFA 3NTLA 4HKTA 2XYPA 2FSFA 1NBMA 1ZI8A 4GWLA 4NEHB 1J2JA 3BCUA 5EKTA 5BQFA 4MI9A 3KFVA 4PZCA 3R3UA 3WBFA 2FWAA 3MBIA 2CF5A 1F48A 3WLRA 2IXEA 4BBZA 2FPLA 4DKXA 2O3UA 3A2LA 3DO5A 2VDQB 5FYDA 3EMBA 2FEOA 3LPDA 2ZRNA 3E6AA 1D1PA 4B2YA 1K8QA 1GQYA 1BJRE 4HMPA 4QKQA 1SK8A 3H1EA 3E9RA 5I8ZA 5HF5A 2HMVA 1DQRA 4GGOA 4OHMA 3I2GA 1CW2B 3EA5A 1DO8A 3K72B 3N5CA 4LS3A 4JQYA 4OSEA 1NI3A 3CT6A 4C21A 4EP1A 5AW6A 2H08A 1DAGA 4M1EA 3O2QB 1TM2A 1NVKA 1WCYA 5TV2A 2W83A 4JSTA 3GVPA 1M1YB 1MIOB 2ZWAA 4V39A 2Z8YM 2J7PD 3DCJA 5CM8B 4NMLA 5DSTA 4CMIA 2CV0A 3T5CA 1DCKA 4QEKA 1RADA 3QKRA 3W3ZB 3GRYA 5EWLA 1Q7TA 1UT5A 5HR5A 1T34A 1EAYA 4U2GA 1O9HA 4LZLA 2R86A 1AQYA 3F2IA 5TPZA 3I1IA 3TM4A 1Q21A 5G2OA 3CX6A 3U7IA 2FPKA 4BLOA 2X7HA 3DYBA 1EK1A 4DDWA 1YHZA 1UOQA 2GAFA 2W90A 1JDVA 2QG6A 3O3MB 2B4RO 3DBRB 4GPIB 5ENDA 1MQSA 1TAGA 2EHDA 3NDBB 1QU2A 3QU2A 1E9VA 3CZRA 3P45A 4PPFA 1P5JA 4B2LA 3KHUA 1R3DA 2KBFA 1I6MA 1ZQ1A 3W6UA 2YKGA 4FGUA 1A50B 2P6NA 1P0QA 3JVEA 5BWNA 1HDYA 2HRQA 5CT4A 1YR6A 1D4OA 4ZIRA 2RK3A 2JAPA 4J0FA 4K40A 2CBXA 2QX6A 4R1LA 5DYWA 4L27A 3AQ4A 2AF4C 4M6WA 2VAPA 1LPNA 5IT0A 2O19A 2PIDA 2OXIA 2IV3A 5EG5A 4ZCPA 1F5NA 1P1CA 2VCHA 3ZTTA 4OATA 3TH5A 3WNBA 1W4RA 1M0SA 3L1KA 3R7FA 2E4AA 4IIJB 1NVMB 1ZL0A 3LF1A 1QQBA 4PG7A 2HCBA 4Y9UA 4DIKA 5LZ5A 4ZT7A 5GQSA 2CDNA 1WM1A 2PWZA 5DNAA 3HY6A 4KXNA 4MYDA 5B1SA 3W5HA 4NYIR 4UJ5A 4PYIA 5CHYA 4BVGA 1B76A 4KL8S 4AKEA 4BGDA 1MOSA 3A9UA 3RV4A 4GT1A 4RF5A 3WSTA 3I9V6 1NQOA 1V9LA 2DUWA 4HDNA 3VV2A 3HUDA 4BN0A 4FEGA 2RI1A 3Q98A 1Y8QB 3EQ2A 3W79A 3ADOA 3ZG6A 2CE7A 1BWPA 2QRHA 3WBJA 1HLDA 4NBTA 2CD9A 3NO4A 3OP1A 3O5AA 1NVVQ 4P80A 4RU1A 3X1WA 1Z25A 3D6VA 1HG1A 1XDWA 1UC9A 2Q5IA 3CGGA 1EQAA 1JQKA 4PXSA 5DHRA 4MA5A 2D0DA 2GYWA 2OM6A 5CLQA 2Q5QA 1E9EA 1OZ0A 1Y3IA 2QRZA 4MYRA 2Q7DA 4LBZA 4PXYA 2SECE 5JS7A 3CKYA 3D7KA 2I4RA 3DBOB