4ZYUA

Human gar transformylase in complex with gar and n-{4-[4-(2-amino-4-oxo-3,4-dihydrothieno[2,3-d]pyrimidin-6-yl)-butyl]benzoyl}-l-glutamic acid (agf50)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Enzymatic Analysis of Tumor-Targeted Antifolates That Inhibit Glycinamide Ribonucleotide Formyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Trifunctional purine biosynthetic protein adenosine-3
total genus 64
structure length 200
sequence length 200
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4zyuA00
4YFVA 4ZZ0A 3LOUA 1RBMA 2YWRA 4PZUA 1FMTA 1GRCA 1ZLXA 2BLNA 5CJJA 1MEOA 3AUFA 1MENA 4ZYVA 3Q0IA 3OBIA 1RBYA 3DCJA 4Q12A 4TS4A 4ZZ2A 2GARA 1GARA 3TQQA 4ZYTA 3O1LA 5J9FA 4ZYUA 3DA8A 1RC1A 4YFYA 1ZGHA 2CFIA 2FMTA 3NRBA 1ZLYA 4DS3A 4QPDA 3KCQA 1MEJA 4EW1A 4EW3A 4IQFA 3AV3A 4ZZ1A 4QPCA 4ZZ3A 1NJSA 4S1NA 1YRWA 1S3IA 1RBQA 4TT8A 1C3EA 1JKXA 1C2TA 3P9XA 4ZYXA 4ZYZA 2BW0A 1CDEA 4TTSA 3TQRA 3R8XA 1RBZA 3W7BA 1CDDA 3N0VA 4EW2A 4ZYWA 4ZYYA 1RC0A 4NV1A 3GARA 4R8VA 5J63A
chains in the Genus database with same CATH superfamily
3BSFA 5GJCA 3L06A 3MWLA 1YHZA 2V1UA 1QG0A 2C07A 3ONFA 2JAQA 3PPXA 1U0OC 3A6JA 3QPDA 5I4IA 5G4KB 3ECAA 1QVWA 1J56A 3P20A 4II7A 4NVRA 4NZYA 5CVTA 3KD3A 3O8QA 3VSEA 2PFSA 4O4JA 1W96A 4HDMB 5LZ5A 4BGIA 4WY8A 2O5RA 1NG1A 2R48A 4K2AA 5B58T 1BWRA 4KAFA 6REQB 1N7GA 3NTRA 4GZLA 3JQ8B 4LEIA 5EEHA 4DL9A 4YWJA 3MTJA 3R44A 3W90A 2C9CA 2CFSA 3ACCA 3DKIA 3PCXA 1KAQA 2ANBA 2YV4A 1JIJA 3IV9A 4IDAA 4F4UA 4FGSA 2NYUA 4RH1A 2ODBA 2OAEA 1L4EA 3L92A 1HI9A 2Q3JA 5FR2A 4RV5A 2W58A 5BWBA 3L0SA 2ZTHA 3KZNA 2Q0XA 3I04M 1ZONA 1C30A 1U8AA 1XK6A 2JJ1D 1BX1A 1Q0UA 1Y8RB 3LT1A 4MRRA 1G7RA 1V8BA 3U4MA 3P4XA 1QFZA 3KHKA 1HL7A 3PZRA 4J0GA 1X3SA 4PQRA 4URHA 4GW3A 5ELXA 5F78A 1I3LA 3ZBUA 2YFYA 4F2HA 2IQ5A 1L7BA 4LRYA 4LYAA 4CDRA 1E32A 3GUHA 1K66A 4ENUA 3GLFE 2W8BA 2WUDA 3P9PA 3EF1A 4WINA 1YDEA 1YHNA 2OZKA 4C30A 1JHRA 3LPDA 4G86A 4AN1A 1ZR4A 2DC1A 5AVRA 3P0IA 2BFOA 1MO5A 1VRWA 3JATA 4PANA 4OB7A 4DQ0A 2MSNA 3EGEA 1P9WA 4MVJD 1A7JA 3QMVA 3KZMA 2H59A 1L7NA 1A96A 1UKCA 3HCDA 3I5UA 3KJZA 5KQLA 2Q4TA 4XWWA 5DHFA 3NT2A 3WL8A 1YUNA 4JLDA 4AG3A 3TINA 4NOLA 2XEDA 2WU3A 3AR4A 3HKCB 4D9NA 3KUKA 5IABA 4H1VA 3NBMA 4Q3OA 2ZUEA 3OQNA 1EFLA 3TFOA 1TZMA 4BGEA 2QJOA 1TLLA 1E3IA 2P9HA 4PICA 5D3QA 1SC1A 4UTOA 1JZQA 2DUMA 2BMVA 2WWXA 4R3UC 3D0RA 5FV4A 2NV6A 2DPGA 3F6RA 2CW5A 2D2EA 3VR5H 1D3AA 3VAZA 2DR2A 4Y2YA 1P77A 1GARA 2BM0A 3WGQA 5MDHA 1SRRA 2KM1A 3AYZB 3D7NA 2K6GA 1GR0A 1B6SA 4H15A 3FSGD 4WERA 4YMIA 4EM6A 2X5OA 1YA6A 2PJRA 2I62A 3L0OA 2WPDD 4BRWA 2HGZA 1Z4PX 2W0MA 3EZGA 4HADA 2H63A 3SBEA 1LTKA 3VOTA 4E7PA 5CXSA 1UJ4A 3TCKA 3AP2A 4PC7A 1JAYA 5JZOA 1GAQA 2AW5A 3BBLA 2QW0X 3MF4A 3QFSA 1QGED 2CNOA 4E7OA 4X62B 3DDWA 4KGZA 4ZDKA 2FETA 4G81A 1O8BA 1D2MA 1WP4A 3QJ5A 1U0HC 2D74A 2NW6A 1AF7A 5A4FS 2CC2A 4TS4A 1MAWA 3PVSA 4TOIA 4B2PA 1COZA 4FMDF 1GKLA 1ESNA 2VJDA 1IXRC 4GD3Q 2JIZA 4HAVA 4DNOA 5B53A 5BR4A 2Y0DA 4RGVA 5HKAA 4MV6A 3N58A 1G8PA 5CA1F 1TQ2A 1YONA 2GCOA 3RKUA 3F97A 1L7OA 2P40A 3RK1A 1GAJA 3OQ6A 1OX4B 4ND3A 1YCFA 4C7MA 5CX4A 4XRRA 5CFPA 4FHGA 3CUWA 2CNWA 3IOEA 2DPMA 3NTUA 1ZL0A 3THWA 4IH1A 1XCMA 2P90A 1GR1A 2MHCA 5K4GA 1T2NA 1WHTA 1ZD1A 3SXUA 2VG8A 3NHKA 1X7XA 3F5MA 3UK6A 3JD0A 3TNFA 4OHKA 1EEXB 2NO9A 3ZQ4A 4ID3A 5AVSA 3C8ZA 3SHTA 3UUFA 2GAJA 1E6CA 2HDOA 2YHIB 4F2GA 3KQNA 1K92A 3AEQA 3PHHA 2CFIA 1U7DA 4YP9A 5FWXB 4KXXA 4WUVA 1BVRA 4FYYA 3V1NA 4QO8A 4WCDA 1IN5A 4HKTA 2C57A 3EOZA 4NJMB 3UWSA 2Y93A 3VH1A 2O5CA 3PA8A 1KY2A 4JP3A 5F52A 3RUPA 4PFJA 4DYHA 1BIFA 4XH9B 1JEQA 3VO2A 2QR2A 4ZYXA 5BURA 5BPFA 2J9RA 1TKCA 4OSOA 3KPJA 1B14A 1WLSA 1UBNA 2FWMX 1Y8AA 3R23A 1GAXA 3E8MA 4J29A 3RAFC 1EXMA 1ZJ5A 1P0IA 3LI2A 1W6RA 1ODSA 3DNMA 4MUBA 3E1SA 3NBFA 4MCAA 2IUUA 3RHTA 3LOQA 4ZVVA 1V7CA 1E8MA 4R9SA 2F62A 3BD8A 3G59A 1ZL2A 3URMA 3D02A 2HWKA 3R24A 4B34A 1QIGA 4ZAXA 4ZHQB 1FFYA 2B0CA 3EGDB 2OORA 3Q15C 2CJYA 2COUA 1RPJA 4UEQA 3TUIC 2EJCA 1L5FA 4DJJA 5JSKA 3X2EA 3MS4A 4E5NA 1VPWA 3ZTTA 4RHXA 1PHRA 2CVZA 4YMGA 1JJIA 621PA 2XBLA 3FRIA 1UUFA 3MOIA 1E7WA 3BWYA 4J0IA 3V1LA 1WEHA 2BF4A 2EWMA 3SYRA 4UHHA 3GZNA 1C4OA 4OXYA 4PXYA 10MHA 1CUDA 4LJLA 3SC2B 4YBZA 3C14C 2IYNA 3EVTA 4WGGA 4KPEC 3KYDB 3I72A 1E60A 1KIAA 2Y1LA 4OUDB 5A3JA 4ZYTA 4YI5A 4G0WA 3O6VA 3OOHA 2PKRA 3NONA 1DAKA 4CUZA 4F8YA 3PTAA 1X9IA 1ZI9A 3BD6A 3IULA 5DTMA 4NG5A 5DZSA 1DCKA 1G6OA 1SU6A 2FSGA 2NM0A 2QYHA 1H6AA 1R0RE 1T4GA 3RR2A 3GLTA 4Z0PA 1Y98A 1HE1C 1Z7GA 2B3TA 3IVMA 5SYMA 3AUTA 1D6MA 2BKUA 2QLLA 3OQIA 2JATA 3BXZA 2R5NA 2J0SA 5FI3A 1W5BA 3MGBA 4Q7JB 2IBMA 4PGAA 2WU8A 3R3SA 1P9NA 4FB4A 3DO5A 4BNNA 1TMOA 2HIAA 4MUEA 2P4EA 2P9ZA 3KEGA 2FN7A 4Y67A 5MHTA 1U1GA 3AC0A 4RCVA 5C4GB 5BSKA 4TM8A 3VPFA 5EHGA 1I5OA 5FBRB 1PNOA 4ZYUA 4OQPA 4QVIA 1W36D 1E3SA 1I9GA 2IEIA 3A31A 1Y4DE 3CLHA 3QY9A 3PJGA 1ENOA 1QH9A 1N3IA 5B4UA 4BO8A 5K6TA 2PL1A 4YRMA 5AXBA 4MRPA 3LF1A 4YMLA 3RF6A 1ST3A 2CEAA 2VHQA 1Q15A 4X20A 3RAJA 4A26A 4B6PA 4CF3A 4CLDA 3KSMA 1QFMA 4NMXB 8ABPA 2UYQA 3R7SA 1J8YF 4UUOA 5HR5A 5LZ4A 2HCTA 2XA9A 3UCFA 5AJZA 3B8HA 4RADA 1BE8A 2ZZKA 3RTAA 3IHTA 4JC8A 2FN4A 1M67A 4O59O 2CXXA 3TDKA 4INJA 4L7VA 1TQDA 2QROA 2OOSA 5FFFA 2FKAA 4D45A 4RTQA 1A27A 3ZBTA 2BHNA 4QEDA 1SVLA 3MTEA 1U28A 3R3UA 3L2OB 4FE4A 3OJEA 1PEAA 3AU8A 1RABA 1T3LA 4R2IA 4QLBA 1NF3A 3G2KA 5DP1A 2H1VA 5EE3A 3H7IA 5TQ2A 3LCMA 2R97A 1GJRA 4HH4A 5EJ2A 3ZZ0A 5CEFA 3OP4A 3JZAA 4UD2A 3SYNA 3KEOA 4LC9A 3WB0A 2IGTA 1C2YA 1FIUA 1AZWA 4CCYA 5ALFA 4XLZA 2PUHA 5G40A 4AJ9A 4G25A 4RTMA 1L4BA 1Z88A 7ADHA 1NF2A 1QXSA 2WWYA 1IBRA 4YP1A 3X1JA 1SVKA 4LJYA 4OKNA 1XEWY 4JXZA 5CD9A 3AI2A 2HU8A 1UJBA 1ACJA 2JIZD 4PLPA 2HF8A 4BMDA 1IBSA 1XZCA 2FNAA 2FOIA 1ZUD1 3A6DA 4F7DA 2V98A 3U60B 4O2BB 3JAKB 4JD5A 4OIFA 1SOVA 1BWPA 1ZXLA 1Z4OA 2EKDA 4K5QA 4FCTA 2DB3A 4ZVOA 3DDCA 4RGYA 1TADA 3UKJA 4H27A 1MJ5A 2TMYA 2P41A 3U7GA 3L0BA 1QV9A 4XGNA 1TAGA 1W36C 1DRWA 4QJ3A 3QE3A 1PJQA 3LC7O 3CNEA 1B16A 2V6BA 1RLUA 3AJEA 5CK4A 1JIKA 5C8DA 3L3BA 3V2UA 4WDQA 2ZWPA 2IE8A 2ZUWA 4F3YA 4NFLA 4U0KA 1Q84A 4YLEA 2AN9A 4DCGA 4YJGB 3HKBA 5K0LA 4MQEA 4L5CA 1QH0A 3AVYA 5ELMA 1E1LA 2VZEA 4Q6WA 3QYJA 4BQIA 1OBFO 2RKWA 1WXEA 3H5VA 4HMQA 1ORDA 2WIDA 3DGEC 3GNQA 3PQ7A 3IEMA 4LQLA 1DAFA 4EO4A 3OIGA 3L8MA 4CM6A 3QUQA 4JI2B 4E94A 3GLHE 5KYWA 3MTGA 1AKMA 1FS4A 2BOVA 2V7GA 4PPGA 5EZYB 3SDZA 2JA2A 5DKFA 1G7SA 1LLFA 3UV3A 1EG2A 3HN7A 4EBBA 4FDVA 3ZJUA 5HF5A 1JEQB 2AJ8A 3KTDA 2R62A 4YP0A 2P65A 2FFQA 2W8BB 2H65A 2OILA 4B3DA 3ETDA 4EMBA 2HXGA 4PBRA 1JT9A 4MZDA 3ZHZA 2IHZA 3FMGA 3KM0A 4AJOA 1TRHA 1WUJS 4OSEA 4OFZA 4ZVUA 4IZOA 4JMPA 3U16A 3RU9A 4ZRMA 3R3YA 3AONB 3ECCA 5EUMA 5AO9A 1GKUB 4WAUA 3M5PA 1B41A 2BKAA 3PA6A 3NT5A 4KZPA 4U8GA 3DLHA 2Z04A 3PQ2A 2E82A 5BT9A 1Z3IX 4MS1B 1TM3E 3KV1A 3QITA 4K9QA 4A73A 5JBQA 2COEA 2GVZC 4L8WB 5ALKA 2B94A 2VTKA 3IEKA 4JENA 1P44A 1NZJA 4R9NA 3WJAA 1G21E 1IQPA 3ZU5A 1EZ1A 4F11A 4IDOA 2X9NA 4D1YA 5JXHA 2HNBA 2H1HA 3NM4A 5D86A 4DC1A 3H2SA 1E0JA 1E94E 4X93A 2G6TA 1WPRA 2ODWA 2R2AA 3MPOA 3TECE 2J9GA 3Q87B 4R31A 5KJFA 3DC2A 5BMOA 2H11A 4EG4A 2W43A 5FQNA 4MWTA 1F17A 1TA4A 5I9BA 2FMIA 4I9NA 4PFKA 3MYYA 2HA0A 3OWXA 1EVZA 4FBLA 5SZHB 5BSGA 3IKVA 1W0KA 4S1NA 1VL8A 4RAOA 1PT6A 3BDIA 3ED1A 1FZTA 3E9DA 3QELB 1N32B 1EWTA 1VXRA 3ZE9A 1O5IA 4RF4A 3NWOA 4LSMA 3SF8B 2X0DA 3U61B 2NO0A 1Y7PA 1L5HA 2CNBA 4R2MA 1RRPA 4WXYB 2FPPA 4XYGA 1RQXA 4QBFA 5A4KA 1IBKB 2IYAA 4U7GA 5A5DA 3EC7A 3SHVA 1BQ3A 3GGPA 5AVUA 2R1TA 5SY9A 1U5CA 2B7BA 3HLTA 3N5KA 3WLFA 3FN4A 1JQBA 1N5KA 3BFJA 4WCFC 1BHSA 3L41A 1RTTA 3U4QB 2O5VA 2DG2A 4ZT6A 1U8ZA 1KDRA 4QJ5A 4U00A 1JA1A 5KKCA 5FPPA 1FFXA 4AZ3B 2MSCB 5IANA 3BB3A 2XZTA 5EP1A 2UZ0A 2GPTA 1RHMA 2QVBA 2R4UA 2XDQB 4C0BA 5F21A 2GYVA 3Q5GA 2RGBA 3IILA 3K09C 4TXLA 5E6SA 2IS6A 5H3HA 1R4ZA 4UVIA 3UXYA 1VSTA 4Y2XA 3TN7A 4Q1CA 2VEOA 3O8NA 1RHKA 1Y0BA 3VTAA 2BTQB 2GGSA 3E4DA 1EB8A 1JSXA 3GLHB 4EOGA 4HNGA 2CV0A 5FNVF 3MSCA 1E6LA 4U2FA 4WCVA 3OM9A 1KRHA 4HEQA 1S8FA 3I1FA 4IJ6A 3NYRA 2BUBA 4A10A 3K9QO 5K01A 2MR5A 2OCDA 3CZ9A 2J3QA 4D9IA 4BGUA 5J4KA 1H2HA 3H13A 4KV7A 2Q9AA 3TLCA 4MDFA 1EFRD 3V34A 3U6BA 3KETA 3ISJA 3GJ6A 3DXYA 3B9BA 1YVDA 1JX6A 3OPMA 4M8SA 4M9ZA 1EK6A 4EJ2A 3WYAA 3JTEA 1W25A 4K1LA 1G3RA 1ZVJA 1QGYA 1X1DA 1PUIA 2DU8A 1U90A 2ZDQA 1HFKA 1XD8A 1AIPA 1MAUA 1FF9A 1NIPA 1Q44A 1Z07A 3K4HA 5FYQA 3WLTA 5FEUA 3DLIA 3R74A 1OYWA 3IE0A 2C4WA 5JUWA 4J0JA 3A3NA 1HKUA 3VHQA 3T7IA 1P0FA 4RJ2A 2V6FA 5ALSA 3DFKA 4QSMA 4E46A 1TA0A 1GIAA 4XB1A 2R6R1 2I5PO 1J23A 2B4TO 4CMEC 3ADDA 1SUSA 1R1DA 2AVNA 2M6LA 2QUZA 3DBVO 4WFIA 1HPLA 4Q4CA 5L95A 3I2FA 2RHRA 2VF7A 3AQIA 1OLOA 1Q0RA 4MB0A 4WZBA 4JLSA 3N7TA 1QX4A 2WICA 3STTA 3UAWA 1OXVA 2V7TA 3AHFA 3WA7A 2ZZMA 2O0MA 3L77A 4LF8B 3KVOA 3G5AA 4HI0E 4RK0A 1R5JA 2F67A 4UTNA 4P5DA 4ZVPA 1ZK0A 4MCJA 3GJ4A 2PMEA 2HQRA 3I58A 1GT6A 3U9LA 4OLFA 2YN0A 1E1QA 2FWNA 5T8KA 3U4HA 1II9A 4YCCA 1NVAA 2ADFA 4ZO4A 4PC3A 5FD8A 5HF6A 3FHJA 2QLJA 2B9EA 2BFDA 2YQ4A 3QV2A 4BU0A 1R9JA 1U1FA 4FMDB 4CM9D 1L1EA 3KVYA 1LKZA 1QV7A 3AUJB 3BMOA 4MYDA 1U8EA 4X24A 1LLDA 5I7AA 3UT5A 4UMDA 3AM4A 3KWMA 3O8BA 4DMRA 4GI7A 3DCNA 5CCDA 3G85A 7REQA 1H93A 4K28A 5AW7A 2A9KA 1Y82A 1BXGB 1Q0HA 2DUJA 4B2YA 1QYVA 1WPGA 4EMSA 1QIKA 4BVHA 2ENWA 2YNMA 4ZEMA 1NGSA 2EARA 5AOBA 1LQ2A 4TRNA 2JGEA 3TRIA 4EL5A 1ABBA 4BKPA 3LPCA 2Z8XA 4M7PA 4MTLA 4MKXA 4QPNA 2Q6VA 4WD3A 1QQBA 1ZX1A 1DXQA 3GJRA 4B6RA 1HTTA 3HZOA 2CXRA 3SS7X 5JS8A 2DH5A 1GPUA 3IIEA 2ZTSA 4CIYA 1UK8A 4JYAB 4U6SA 3KKOA 1N7IA 1QE0A 1O96A 5IYZB 2O8FB 1ULSA 2RGWA 4BX9A 2C84A 1NBOA 3H8VA 4P83A 4RC9A 4I9UA 3WWCA 1JHUA 5FP0A 1M34A 1UMBB 4PAOA 2CMHA 4L57A 1ZHFA 1WUKS 2CSUA 2AA3A 4UBOA 3N75A 1FU4A 2VPPA 3TLJA 4IAOA 1JAHA 1ZISA 1UBMS 4S35A 4E5PA 2QHXA 3EQ9A 2OXRA 3PXBA 2H1CA 1SUEA 2FE1A 1IAVA 3LXXA 1DOZA 4A2PA 4YUVA 2I3ZA 1P5ZB 3MYRA 1AT1A 3THRA 1SU4A 3PUYA 2CT8A 1OIWA 4XTCS 1XVUA 1TOAA 4LWQA 2VYND 5HHTA 2BP7A 2G1AA 4EVRA 2ZYIA 4PGFA 3L46A 3T3PB 5IVDA 4BNUA 4C7KA 4D81A 5ETJA 4WY2A 3C6YA 4M0UA 4RZXA 3RVSA 3TIXB 1DAOA 3EXG1 4OIMA 5BSEA 4W9NC 3Q1KA 2EJWA 1QAMA 1X86B 3C39A 1PS8A 1NV8A 2IWRA 3ZHTA 1DEHA 1M3SA 3GQBB 4NHOA 1U7XA 3N7AA 5K6AA 4XR4A 2C3MA 5LNK6 1PFWA 2A9FA 3K6KA 4WKGA 3FFXA 1CIJA 1RWWA 4DQDA 4AD8A 4YAIA 4RM3A 4FJ2A 4KRYA 5DISB 2WWTA 1ZUHA 1OV4A 4GNRA 4LZJA 3DLCA 3NHLA 2PU7A 2QUJA 1K8ZB 2HC9A 1NQ5A 2O9JA 4XPIA 3LDFA 1PFGA 4HYQA 1P0CA 1R50A 1IMJA 1PNTA 3N5CA 4BYMA 4Z6KA 1PL8A 3N1UA 3BTUA 2B2XA 2PVSA 4GRAA 3VR5A 1JF8A 3RVOA 4XJVA 5LOVA 1TUGA 3KKLA 3U4QA 3VC7A 3NEJA 4YK7A 3REQB 1QE3A 1G8YA 4NF2A 4UD6A 3IT2A 3ZE7A 1T26A 3FMIA 1N1EA 3JQGB 5E1MA 5HA5A 4KNYA 2ONJA 4IJWA 1PR5A 4AURA 1Z2DA 1W85B 4HP8A 1D9ZA 2HK6A 1UK6A 3L1KA 4GGOA 3F5DA 3DAOA 1NLZA 1Z6PA 1JYEA 3QHQA 4RS3A 4A6PA 2OFPA 1KDPA 2JFXA 3WGOA 2ODAA 4F5WA 4RTSA 3RVPA 2F17A 3HSSA 1X2BA 2EFJA 1GZUA 2REQA 4N0MA 2IH4A 4C2BA 5JAMA 3NAQA 2QQFA 1NURA 3QFRA 4YAUA 2PIAA 2RGDA 1XMQB 2HF7A 4EEZA 2Q29A 1RJWA 1VIMA 3SX4A 4D44A 4N76A 3T7TA 2R9VA 5K3FA 1GCOA 1XQXA 1SOUA 1NVVR 3H3FA 1XAJA 4RD4A 5C3UA 4LYEA 3A3OA 5J40A 4BFZA 1JG7A 2ICAA 4B7CA 4C5CA 4N49A 3OCWA 1YT5A 5FJJA 3C7DB 1JSLA 2ECPA 1EI9A 2FPIA 4HTAA 1NW9B 2RKOA 2B4YA 1J09A 1E3QA 1DDIA 2D5CA 2FP3A 4NOKA 4P7FA 4FLEA 4D5GA 4UOEA 5FAKA 3CF0A 3CPHA 4MULA 1HDIA 5FOTA 5I4CA 2IPOA 3KJHA 4PQFA 2GDJA 4JOBA 3AFHA 3T1TA 4PG4A 2PBFA 1VOTA 1YJ8A 4CLRA 2PL3A 2EFGA 3ANXA 3THXA 3WIUA 4XUEA 4X1IB 1QPBA 4GE3A 4JL8A 1G5PA 1FXWF 3HB1A 1WDWB 5IJAA 5KOHA 5MF6A 4Y98A 3CN9A 4GXQA 3PU6A 4HCJA 4WOCA 1J5XA 4PCAA 3DM9B 1ZBQA 4FXPA 4NPAA 2Q3LA 1WCYA 1QBGA 4GGMX 1ZOPA 3A3PA 1Q0LA 4BZXA 1A5ZA 5G02A 2A67A 4O4IB 1KFEB 3CR8A 1D2AA 3ADOA 3FSJX 1L7VC 4HH3C 1AGPA 1U0NA 4MPPA 4PLTA 4UEKA 4D0RA 3KHSA 3BBPA 2Y1DA 1Z39A 1J25A 1H6DA 2IDJA 4MLZA 3TZEA 5B36A 5CB0A 2IYRA 4WESA 3WL7A 5IX8A 4U7FA 2PYIA 4O4LA 1C1DB 2WUGA 3IAS1 4IEFB 1BTOA 4JGGA 5ITWA 3UGKA 1F6WA 4MRAA 4WI1A 1ZVKA 2OBXA 2O0KA 2QZPA 1L7AA 3EDQA 3D6JA 1V26A 1U11A 1XZBA 4AJLA 4ZZ1A 1UXKA 4RH0A 3GJSA 3H1FA 2JAOA 1FYVA 2C42A 4CFYA 1MT3A 1NPYA 3OZFA 3OLQA 3RBAA 3RVKA 1B15A 3D6VA 3KXPA 421PA 1U8CB 1KP2A 1R0CA 3K6JA 2OGSA 4RCZA 3AEQB 4S12A 1E6WA 5THKA 3OBIA 5HQ3B 5HIKA 5KVCA 4D9BA 2QMHA 3I2IA 2A0UA 3FPBA 2BBOA 4AO8A 4LF7B 1SR8A 1SCNE 2OZVA 1MB9A 3CZCA 3ES9A 3DZHA 4GHWA 5SY6A 4KBGA 3VJRA 5REQA 2ZYTX 4BRZA 1EGVB 4I55A 2I8LA 2VJNA 3IPCA 3WTBA 5ERGB 3PEEA 1MA3A 4B80A 5SZIA 3KQWA 4H7EA 2CL0X 2JI8A 3LHKA 4JWTA 1JR4A 1X13A 1DBWA 3CY6A 4N5LA 1NUUA 4NNOA 2M6KA 1EFUA 2L18A 1VSBA 1AN9A 1W5TA 4L5IA 3UAGA 4BN4A 2NQTA 2WMDA 5DMHA 4C7OA 5IZ4A 2O2ZA 3NHYA 4LX8A 3V1UA 2VUHB 3JD1A 3IR6A 5KQSA 1Q7GA 1ZITA 2IOQA 4R1LA 2AS0A 1EWRA 3UMBA 4HV4A 3NOQA 4LUCA 1U1EA 4XSHA 3I8XA 1ISIA 1K5HA 1TNDA 3ZW9A 4JJ6A 3B36A 2BBSA 4GH5A 1INLA 4D9FA 3SX0A 4MVCA 1NQWA 3A25A 4WJZA 2HUPA 2Q49A 3OT5A 1Z6AA 3L18A 2FUNB 2XCTB 3JWHA 1CQWA 1RM3A 1UFOA 2AFIA 3S7ZA 2ZZNA 3PX7A 1ULUA 3E7DA 3IODA 3O2QB 4IVQA 4W8HA 4Q4AB 1JI3A 1WXXA 1ZWLA 2I3AA 3HCPA 3QKIA 2I7VA 1MVOA 3S7TA 1YUBA 3LDAA 2H92A 5AOVA 3ZU6A 3HYCA 5FL7D 3RYFB 1T0JB 3WAGA 1KPHA 3GP8A 5CYFA 3F7OA 3OZWA 1VPTA 4OY3A 1E18A 4QRDA 2I8AA 4FFBA 2E4XA 1Z5OA 4GXNA 2WWRA 3WWZA 1PZXA 2VAVA 5DW0A 2PX5A 4G36A 4AG5A 4EJ0A 1N6LA 4CDMA 4JMLA 1IN7A 1AKEA 1D2CA 2FDRA 2ZIGA 4V0LA 4A2QA 2IYPA 2NZWA 3I1IA 4AC9A 4A2WA 5HKKA 1M6NA 4BBJA 1DEXA 3QVWA 4OJNA 2O8FA 4QUEA 2WD9A 1C8LA 1ZH8A 1HDOA 3ZCPA 4J2HA 4UCXA 1YK0A 1E5QA 3FTDA 4ZVRA 3WWEA 4L95C 1U3WA 4JBYA 5EWLB 5DI9A 1YDGA 2Q7OE 3AB3A 3K2QA 2IIBA 1Y42X 3F49S 4P53A 4Z2AA 5KS2A 1D0SA 4LJSA 3T5CA 4UQOA 3VHXA 1MVLA 2CB9A 5DT2A 3PVCA 4ZAGA 3L6RA 2QAGC 2C9BA 4HLNA 1SOMA 3L0DA 4L4UA 4M0FA 1TTPB 1A71A 1MO4A 1ZSVA 5JADA 1XG5A 1N0IA 3WDLA 3L84A 4EAQA 1KEKA 4CM8B 2NMVA 3HGMA 3WHIA 1YL7A 3OZAA 4Q21A 2M98A 2LRHA 3PRJA 2ETVA 3S2SA 3SXUB 4MVXA 4RHCA 3GUZA 3STWA 5AI9A 4ROSA 4YJDA 2P9GA 4OUKX 2FSVA 1JAIA 3UANA 2IW3A 5J1TB 4DJFC 4UJ3A 5IBQA 4MUFA 1T1SA 5KJ6A 2VUSA 3OE1A 4GLLA 2PNJA 3QIAA 2GBCA 3P5SA 2OBLA 2ZBQA 2H4JA 1G5TA 1ZRSA 4GZ5A 5JSYA 1P17A 5JBNA 4EFMA 3EGDA 2ZB4A 1GVNB 2VJYA 2ZDGA 3A05A 3JQQA 5ALZA 1CD5A 1BE0A 2QRLA 4TWBA 2ERCA 4RD0A 1N2CA 2R7KA 4QODA 4ZDWA 2ATEA 2FSFA 3OOJA 4TL8A 4UM8B 3L4EA 1V8ZA 4RHFA 2R47A 2JLWA 4LW8A 4XB2A 2PUFA 4XJSA 5LBIA 4U4AA 1E6UA 1U7HA 4ZRDA 2FLKA 1AF4A 4DYDA 4Q4JB 1VBFA 3DE2X 4EHJA 3TTWA 1YK1A 1YE8A 4R1MA 3RC3A 4N5NA 5D7NA 1PGQA 4MO9A 1J8DA 1JQAA 4QXRA 2VT3A 5EEGA 4PYNA 4WL0A 4AF7A 4BVBA 2VCEA 2AC7A 3BMQA 3E05A 4U1RA 5HXAA 1BN7A 2CDAA 4J0CA 4EKGA 1KQ3A 4UPVA 4BO3A 5ANRB 5ALYA 1XCJA 3ZYCA 1TF5A 4B4UA 4BZQA 1SMKA 4MROA 3QXCA 5ITZB 1YMVA 1NJFA 1QRSA 3GLQA 3T9EA 2OV1A 4DR2B 4MUKA 4X8MA 4YQYA 4Y9RA 3NT4A 2I2BA 4H9GA 4HDRA 4E5UA 5L3VA 2EKQA 2JFPA 2HW8A 4BV3A 4ENVA 1OB5A 1KI6A 1JEJA 2P4SA 3EULA 4Y7CA 5C34B 2PT9A 3CH5A 3IBGA 5ECWA 1TD9A 3NNNA 4YRLA 4BB0A 4DV0B 2FX5A 2D0OB 3HK2A 3KUDA 1UXHA 1NRWA 2EL9A 1XNGA 1WA5A 1YZ3A 1MHTA 3K5PA 3OCUA 1Q0SA 4JA2A 2IS1A 4MWDA 5BVHB 3VHLB 4ARVA 1OR8A 4FFMA 2H51A 3UQZA 3QWBA 4MS3B 1M1YA 3JAKA 2CL6X 4K9LA 3RH0A 1GT91 3SJUA 5HOEA 5K0BA 1W36B 4ADSG 2NZJA 1YSCA 1Y1KE 3Q6MA 4P82A 2WMYA 4JJIA 3W3AD 4DKJA 1DEKA 1RKUA 2H7CA 4H6XA 4MUNA 5FWAA 4CYMA 2G71A 3GRCA 4D92A 4DMFA 5H81A 4IS3A 2B34A 2Z6VA 1G8HA 2ZSEA 2IU6A 3A1FA 3HJBA 1TXGA 3L6OO 2QY9A 3BMNA 3CPSA 4KR6A 1I3OA 3ESXA 3FZNA 1DELA 3EVGA 4G0XA 4TZKA 4HLUA 5FX2A 4AI6A 4CKBB 1NXVA 3EUFA 4ZVLA 4ER0A 1QE5A 2HSZA 2AQIA 1SBYA 4GVLA 2QPAA 4ROTA 2BDTA 3EY4A 1Z73A 4RM2A 4YJ3A 3W3AA 1J6UA 3L8YA 2W8ZA 4IWNA 3QY0A 4DDWA 4PG8A 1NMZA 1G0NA 2HGSA 4KQ6A 4AUNA 3ERCA 4Q7KA 3CUYA 4KMSA 1PVOA 3ROQA 1G8FA 1FX1A 3W2EA 4YCBA 3WYGA 4Y9TA 4MHTA 2WJAA 4MLDA 4QREA 2D1RA 2HM7A 1GZ7A 2PYDA 2G06A 2FF7A 4BQNA 2AD1A 4DQUA 1FPMA 2J41A 4Q3DA 2P0AA 3BGWA 3GEGA 1VI2A 3UG7A 3TZLA 1G9SA 1K6XA 1SZPA 1VLVA 3QYAA 2EU8A 1V5WA 3H04A 1XCGB 4CHGA 3VH3A 1VMDA 4DLYA 3BCHA 2J4DA 3UICA 3F7NA 3MCZA 1YQWA 5AVJA 4CTJA 1KFCB 5C8YF 2G9VA 3QVMA 3A1TA 3I5MA 2P79A 4DLXA 1GNVA 2IYOA 3KT3A 3U3JA 1EVEA 2CBZA 1EE9A 1Y3HA 5BYAA 3AJDA 1RBMA 1WTCA 4IVRA 4WVFA 1HE4A 4CJXA 3ZWNA 2B4KA 4AS1A 4WEQA 4HXYA 4KXLA 1YXMA 5IHXA 4JNKA 3IAAA 2YYSA 5B7QA 4C6TA 1SBNE 2Q5QA 2R7NA 2E5FA 1O03A 1L4LA 3PEYA 2FKNA 3AETB 4GDMA 3W05A 4JR1A 1HE8B 2K2WA 1DPFA 2P2ZA 1ADCA 2OC9A 3ANMA 2PG3A 4RXMA 4BE4A 1KE1A 1A04A 4GL4A 3TEMA 2QMUA 1XZIA 4LF6B 3FHCB 1IHUA 1NF8A 2VP5A 4EUKA 1TZBA 1TE2A 4KN6A 3M81A 1AOXA 1OPXA 2DFVA 1WQ4A 3SYKA 3ZCUA 1GZ5A 1DHRA 5JPDA 3OQOA 3VAYA 1DMSA 5KSWB 3DBHB 2PD6A 4NH4A 1I6MA 1S02A 1ZIXA 3NEPX 3WGMA 4YRAA 5LZ9A 2OA0A 4O2BF 2A78A 4UCQA 3I9OA 3NVMB 2ZDHA 3O3NB 1K89A 2XOXA 1A3CA 5T6BA 1Q57A 3KKMA 1JR3D 1UANA 2ARKA 4GM0A 3O8RA 3R7NA 3PFBA 5CM2Z 4PX5A 4RXUA 1JPUA 2XIQA 5C7LO 1F0YA 2VT2A 1OT3A 2XVXA 2ZI9A 4X8LA 4CF6A 1T8RA 4E03A 2P62A 2GWHA 3E58A 2Q3HA 1U2SA 1MEJA 5DHAA 4KXQA 4RPIA 5TQVA 3S5UA 1P91A 4MDHA 5BR7A 5ILGA 4DIUA 3TPFA 4BLVA 1OD6A 2JI4A 2JLSA 1Z15A 7YASA 2WUWE 1JDSA 4Q4JA 4TSFA 4BLSA 1XA4A 3I9MA 4HB0A 5HKBA 5KNBD 2P3SA 4JLNA 5IRCD 2OAP1 3DZJA 4GEKA 3C43A 4LIPD 5H59A 3WJ1A 5IULC 3JAWA 1AKNA 1SVIA 4ITUA 3PUKA 4YRSA 4HGRA 4W6ZA 4KDEA 4LY0A 2BD0A 3QU7A 4REOA 5IZCC 1OAOC 4O1HA 4IRUB 1J8QA 5EESA 1SXQA 3QVTA 3WO1A 2O0LA 3N2IA 1E64A 4J49A 4IFIA 2KLHA 2O3JA 2X3YA 1MO3A 1P5FA 1U1IA 3WX0A 4B5KA 4IVPA 1MQ9A 3AESA 3SR0A 3UHOA 3ELDA 4I1UA 5FORA 1VGVA 3VBEA 4OXIA 2AZXA 2EJTA 1F2UA 3QFTA 1O7JA 3FPCA 1FQKA 4F06A 1VYTA 2J3DA 1GUZA 1NC3A 1OBOA 4DPMA 3FOEC 3OM0A 1LPMA 1CCWA 1MAAA 1X42A 1JSCA 3AI1A 1M2NA 1RAGA 1C1YA 1Y5NA 2J31A 3OLYA 4R1QA 3JQEA 3NASA 3RIHA 4LE2A 5LSAA 4FHFA 5DASA 4JBHA 1ID1A 4UZSA 3NB0A 2HHHB 2I65A 1EWYA 2H8KA 2HSGA 4B8WA 2QD5A 4PO1A 3G9ZA 4N3AA 4C0KA 3GD7A 2OL4A 3H9QA 5LLDA 1ZM9A 4GAEA 3QW2A 5JE8A 3IB3A 4GGPA 3A6HA 1CIPA 4FWBA 5DLQC 4D57A 2DWPA 4HAXA 1OXUA 3PD7A 2P5YA 4HNAB 4KFRA 2NTYC 4TT3A 4WECA 1RIFA 1TQHA 3U39A 3LCVB 3TDMA 1EPUA 2NV2B 4CIVA 1N75A 3PX2A 4MQFB 4IF6A 2ZSUA 1E9DA 1HYQA 3WVNA 2ZSKA 5JNTA 1NP7A 4N9WA 1FU8A 3UHFA 4AJIA 2MSWA 2ESRA 4FQ5A 5WRFA 1IXSB 1YHYA 4QYIA 3BTOA 5K3CA 2HZBA 3PUIA 2C82A 5LZ7A 3OU7A 3RPEA 4G4GA 1KI3A 2X58A 5KDLA 3D5EA 3UB4A 1PQUA 4FFLA 3OPYI 1SY7A 5EIOA 3SZLA 4B3FX 3VKGA 2FLVA 4DBLC 3KU4A 1K9VF 3RSCA 5BRAA 1A0OA 4X00A 3H1PA 1M2KA 3V6MA 4XWOA 4IOLA 4MVJM 1ZIDA 3RSSA 1BCSA 4DV1B 3BFKA 3THYB 2BKEA 3EARA 4CQMD 2HBZA 3W5JA 2WTXA 2QPTA 1EGHA 3QGMA 5K8JB 3QG5A 1KYXA 1JNXX 1Y5RA 2D1FA 7ABPA 2VKTA 4ND1A 1XJQA 4JAVC 4LXYA 5EIBD 1OKKA 2XITA 3N87A 3HDJA 3DMNA 2X0JA 1XLUA 2QNRA 2OD7A 4AM8A 3DFIA 1UP6A 4EAAA 3WJ2A 2I1LA 1QUEA 4BJHB 2MYUA 3W1WA 3ZNPA 3IDOA 4IQ4A 4MITA 4CG2A 2UXCB 5KKNB 2F8LA 3OFND 1FVXA 1IOVA 1DIOB 2CFOA 2AFIE 2JAWA 5M3BA 4HDKA 2V5UA 1F14A 4D41A 1GQ2A 5C46F 2VTBB 1XZLA 3CTPA 1ZVMA 3OTWA 1V2GA 2GAOA 1ESMA 2H2WA 2VNSA 2ZWVA 3A70A 3M5DA 5EJIA 5EI5A 5T4EA 3TPZA 3PIRA 4QHSA 3QK7A 3E6AA 1FRQA 4JSYA 4J0FA 3MFQA 4TT8A 5DU2A 3GRAA 4ALNA 1NMYA 2FWIA 5BVHA 5KAPA 5F7OA 1UDXA 2PCJA 3LVRE 2J09A 2R751 4WLEA 1F7VA 1N7JA 5HBRA 4Q9DA 1NZDA 1BHQ1 3FHOA 2AFHB 3ZE2B 4IDQA 2QRKA 2O57A 4Q9HA 3QI2A 1U8YA 4UNRA 1MBZA 4R69A 4G5RA 1Q0QA 4ISBA 4FGWA 1E2HA 1UEIA 4Y1RB 1NVMB 5EG5A 3RV4A 3H83A 3DZIA 4D9HA 4DG8A 3L0IB 1UXIA 2O48X 2YJ5A 2QLFA 2FWBA 5TJ9A 1NBME 2X13A 4AUMA 1GTZA 1OTHA 3KUUA 2QTWB 1IEXA 1A8PA 4E5DA 1YL5A 3F0TA 4KVAA 1ZINA 2JA1A 2Z3WA 2OXTA 4EKEA 1Z13A 3ZY4A 1JFFA 4W5QA 3NBAA 1RXUA 2DOKA 1LX7A 2OB1A 3IVCA 4F3TA 2IUTA 2IYTA 4DLUA 2VJCA 1CUEA 1GZ3A 1JWAB 1WULS 3AF2A 5CHYA 3H2HA 3IKTA 3DE7X 3J7TA 1ADGA 1YR1A 3I23A 3OLZA 1NXPA 4KPFC 1AY0A 3HKBB 4J3FA 5K0EA 2BI8A 1M2VB 2OHIA 3JZIA 4P93A 3EPRA 2W2MA 4S0XA 5I7OA 3C7CB 3M1YA 1TMGE 3AFNA 4JBNA 4QIHA 3MJCA 3UW3A 1JQDA 1LDMA 2CDNA 1MABA 2HWWA 1N25A 3MLBA 3IR7A 2YR0A 4YV2A 2Q28A 5EFZA 4LHEA 4ZRNA 3IESA 3RVNA 2XE7A 2ZR8A 5GMOA 4NXMB 2HJHA 2DBYA 2QGFA 3EA5A 4JLUA 3BCRA 1XQVA 3KHTA 4CTMA 4X5OA 2F4VB 1WKCA 4AY5A 3K6RA 3HXMA 4KOAA 1SB8A 3ONWA 1PJLA 4EHKA 4EY5A 5C7YA 4DCOA 2WFZA 3IMKA 4BEWA 1F4LA 4CMEA 1LS6A 3PHIA 4Y6SA 221PA 2MOKA 4EY7A 2V3WA 5DYYA 2VK8A 1X9GA 2GPBA 1EVJA 2R25B 3DBHA 4IM7A 1U4OA 3G5UA 4UVHA 5CBKA 3GLHA 5AUPB 3K96A 4XVUA 1SK9A 3GXOA 1VMKA 4UXJA 3W7AA 2B5VA 4F97A 2E5WA 4QM7A 4AMZA 1QRAA 4ZGGA 3K9WA 3PQ6A 6NULA 3H11A 4NJEB 1K98A 1Y34E 1EHCA 1LA2A 3AF4A 4O0LA 2OP0A 1QGUA 1XMVA 2IC5A 1DWPA 1SXJB 3V97A 5JSUA 2C20A 4KXFB 1TVKA 4KXUA 3OUTA 1DC4A 4KDFA 2B8EA 4NENA 4R9RA 4XEUA 4AF8A 4URUR 2RH8A 2NNLD 2XXBA 2E9SA 2YHIA 1O6BA 2A1UA 5AJVB 1V3UA 1PDOA 1N8SA 2Q0QA 3WWYA 5ALTA 5JRZA 3AEKA 1V11B 3C2QA 3I42A 2IS4A 1T6YA 4ZQCB 3WFZA 1PZHA 3H5TA 3K0KA 3KZKA 4I1PA 4XD2A 4NYIQ 1BX0A 1W5EA 3ZVKA 4IYRA 3LRPA 5JJ5A 1MQ8B 3BHNA 1GCGA 2NU6B 4UXHA 4P3OA 1GEGA 2O8EB 1OHHA 4OQ4A 5IJ9A 3ER8A 1II8A 4K3VA 4K9PA 3TOCA 3KQTA 3OZCA 2A0KA 2HI0A 3O4FA 4V02A 1I3CA 1ZD5A 5C5DA 1UODA 1JHVA 1OHHD 1EFPA 1ZAKA 3GDGA 4HWSA 4WQMA 4AY3A 4HBZA 2V7UA 3BZBA 3E35A 4D96A 1SCDA 1AMNA 4GRDA 2C99A 3Q3GE 3QRWA 5CW2A 3OT4A 1TAQA 4CL0A 1UPAA 1XVAA 1I1HA 1ZM3A 3TUZC 4ER6A 1TO2E 2I1QA 3L40A 4RD1A 2I7DA 5DVZA 3REOA 1T5IA 2PX2A 1P9RA 1HXHA 1NBIA 2OM6A 4FDLA 4KFTA 5TQJA 2PGIA 1BS1A 2J6BA 2JEYA 2YKGA 3KRTA 3A2KA 2WAMA 3KDAA 3FNFA 1GKIA 2G4LA 3COYA 4QXAA 2QMYA 4CLOA 4LRSB 3ZKWB 1X7ZB 4GQBA 4HQLA 5DGTA 3I05A 2KB0A 2MCFA 4LOLA 1DQSA 3DJFA 3ETCA 3M9WA 5CGQB 5D6NA 2VT6A 3JARB 1PZFA 2Z1NA 1KZGB 5DLEA 5F3DA 4UEOA 1WABA 3LV8A 4V0OA 2WY2D 1VIAA 4V0MA 4PN7A 3UPTA 1RRGA 2ZQYA 1N2XA 5HIIA 1FFXB 4E4RA 4ENPA 5AKKA 1SD1A 1WZUA 3MIIA 1SN7A 1N2GA 1ODTC 1RPAA 3LF2A 5E3IA 4DLWA 4AZVA 1O94D 2VYFA 4ZV7A 1AC5A 4NCJA 1S2DA 3ENNA 3TM5A 1JG6A 2WG0A 2C59A 4G84A 3VZDA 1O95A 3A1EA 1H1LB 4I5DA 2X6RA 3MB8A 3CH7A 3F46A 4QECA 1XJCA 3PI7A 5DNEA 1OXTA 2R87A 2EFEB 1G8SA 4B40A 3DR3A 5EINA 1JFFB 1Z47A 2MSLA 3C5VA 3R4VA 5AQEA 4UE6A 3TSYA 1KMQA 2RHGB 3N2NA 1CUFA 3WKDA 4TRMA 2JDID 3VO9A 3HFRA 2GAAA 3E61A 1L3IA 4U9HS 4AVYA 1HNWB 2YMPA 3WL5A 5C7OO 3G5MA 1TF2A 1WSWA 3D3JA 3HI4A 2X5XA 1L5YA 4PSVA 1SCKA 6AT1A 1MF7A 1CY0A 1WTAA 3PX3A 3WWOA 3Q7IA 4U0JA 4DJ5X 4KE6A 1IATA 1WRBA 3IIIA 2XOKD 5CA1B 5KO2A 4ZC1A 4TN5A 1NLMA 1JEYA 1L8QA 4JOCA 2GVNA 1T4DA 2JZOA 4MVJE 1Z7WA 1VJ1A 2UUPA 2QTVA 2L0XA 4DWVA 5IMSA 2Q1SA 1WB6A 1NVBA 5B6JA 5KREA 3LLUA 5GONA 1GTSA 4O4HA 3O90A 1P4GA 2PLAA 3MTAA 3QKSB 3TSWA 3UMMA 1IXYA 4WSOA 2J9ZB 4ND8A 3W3ZB 1RR6A 2Y0EA 4OLHA 1JP7A 1Q0ZA 3TPCA 2IT1A 3CV3A 5THQA 1DJMA 3BKXA 2FW7A 1H65A 4PVCA 1EK0A 4Q3CA 2XCIA 4QJIA 3RUAA 3ZDCA 3P1JA 1U1CA 1Y6RA 1UFVA 2PA3A 2Z2JA 4ZQFA 2ZBPA 3EVAA 2BONA 3OFVA 2VVTA 4KJZA 1U2GC 3KZOA 3Q40A 3V2IA 2Q27A 3K8YA 1HO3A 1XJ5A 2Z9BA 3OSUA 4RXTA 1C7ZA 4ZO7A 2HHLA 2QZ4A 3A8TA 2ZKIA 3BFVA 3G49A 4W4TA 4YR7A 2F1KA 1M6YA 3IAM1 4U6NA 3WKCA 4C0HA 4Y1RA 1PG2A 4I46A 3UJ8A 4CNQA 2JFNA 3FI0A 1TW2A 4Z0HO 2VSQA 1QS0A 1XDDA 2PS9A 2RGEA 1VKNA 5EN4A 1LNQA 3CEJA 2PNFA 2VDVE 1DUSA 3NETA 2I1WA 3PR3A 1MC8A 3HSYA 3CMCO 4MWBA 2RI1A 2B99A 3WO0A 2NYVA 2H1RA 1QG4A 1XU9A 2CLLB 2G70A 4O33A 5CVVA 4RSMA 3QLEA 5ESDA 1ITZA 4N5DA 5CT5A 5DO9A 1WOMA 1THMA 2RGXA 3JYPA 2JAHA 1COWD 3L8FA 2FOXA 2MDTA 4ZREA 5FO1A 4DDUA 1CYEA 1SURA 2PANA 3GDHA 2VNJA 4WE3A 4ND2A 2MWMA 2O3RA 5FBQB 4ZHQF 5AK4A 2PKYX 4GR4A 1ACLA 1E2EA 4BDSA 1IY1A 1IUKA 3FROA 5F76A 1PR1A 2V7PA 3PC6A 3QM1A 5GOTA 4JGBA 4AFNA 4W82A 2C61A 2LKCA 2O0JA 4ZALA 3IA2A 1Q1ZA 4CNBA 5HK9A 3JPYA 3ZY5A 5DGXA 1C29B 3G2JA 2EJUA 4ZYYA 3LY7A 3RS5A 3HR7A 5IT0A 3I9JA 4FPXA 4G3XA 1WQ3A 3A04A 2Z5FA 4QX6A 2QUHA 4ZIRA 5JAHA 3LBFA 1RADA 1XAIA 5CD1A 2WR8A 1IWOA 2CLCX 4WK2B 1GGMA 4MDEA 1WHSA 3FXAA 3IHKA 4L1KA 3C8UA 1X94A 3JARA 4LV5B 4G5OA 4OK6A 4YAEA 4NDAA 1E9CA 2RHTA 4I8IA 1SHUX 3ESYA 3AIOA 3WLLA 4HZUA 5ESXA 4B31A 2GJ4A 1K7EB 1OX6A 4L4RA 2V5VA 2OCPA 2VDJA 2XDQA 3F3SA 3HKEA 4IMRA 4JUCA 1A8SA 2HRCA 2FEPA 3TRKA 2EQBA 5C18A 3NOVA 2Z3ZA 4EJFA 2WAYA 5HWSA 1QVAA 1FDTA 2Q5OA 3DHWC 1U7UA 2GDZA 4IGIA 1ND6A 4M38A 3KC2A 3A11A 1A72A 2PUJA 4OMDA 4P4UA 4BO1A 5CTAA 5I47A 3RRJA 3K5HA 1IZ9A 3OX1A 3B6KA 1NMQA 1ZCZA 4F3KA 3LX5A 1A97A 1I8TA 1SCQA 4WGFA 3LXRA 3LFTA 1JMKC 3ROTA 4BPBA 1NXSA 2DX7A 2PM8A 5E7JA 3F6YA 3L02A 4TS1A 2VPIA 4Q39A 4Q9AA 1PK7A 1VJDA 4N01A 4AZTA 2GCNA 2BI4A 4Z7OB 5I8WA 2Z1DA 2BWJA 2CF6A 3FSGA 5AXAA 5HZMA 3TNJA 2MINB 4EQ6B 4U2GA 3TEJA 1VMAA 1BDBA 3GPLA 3NKLA 1R9GA 1YGPA 2FFAA 2P9YA 3R6DA 1HYGA 1S4QA 1V2HE 1TIPA 1M1UA 5K8VA 1M9NA 2PN1A 2OV3A 2WSSA 2DUUA 3RVBA 3IGFA 4NCIA 4BTEA 4F85A 4R2XA 4RTNA 2VZLA 3LWBA 2AKAB 2CXQA 2NV0A 4HEA6 3L0CA 2BELA 2J7PA 4HNHA 5DN6A 5KQRA 4K9KA 5E7QA 2RG7A 1QP8A 3NC0C 4ZOEA 1E3MA 1CVLA 1CHNA 1XXHA 1ZMRA 4RLSA 3JYOA 4M9QA 3W5IA 4BQRA 4C43A 3A1WA 5ENDA 1LW7A 1PKXA 3OZRA 1T9KA 1HRKA 4CMJA 4GC5A 3AIKA 1PUXA 3D7SA 4UMFA 1A9ZA 2I4TA 3H05A 2C3YA 1PRYA 3FYCA 1SBTA 1FRZA 1KU6A 4M99A 4GBMA 3CLRD 1SU8A 1DI0A 2YXDA 1H6BA 4KR2A 4B4DA 2XQJA 1T8SA 4Q82A 4PG6A 1E2UA 4ID9A 1CDEA 1T3GA 2I2DA 3CH6A 4PTYA 2H4ZA 2ONCA 5A9SA 2AG6A 1NXOA 4RHEA 5AM4A 1XCLA 1FC0A 2ZJ3A 2JGKA 3GELA 5J63A 2PUDA 4LJ8A 1DQYA 4NBRA 1L8XA 1U7ZA 2PGAA 4BKOA 1GYQA 4NNPA 3Q11A 3HM2A 3EA0A 2ZT5A 2G7ZA 3A9TA 1XP5A 5E6UA 1VKJA 3II6X 3I4FA 3RU3A 4MRSA 3EYWA 4EX7A 2JBWA 3E1GA 5JD5A 4ARAA 2EEZA 2XQVA 4C6SA 1X8LA 4MQEB 3TTUA 1JLLA 2R79A 1CNFA 1KI9A 3K0SA 2EYQA 2B4QA 3PC8A 3K8OE 1ZW1A 3CRMA 2NQ2C 3ETEA 3OY7A 3KZCA 1Z4JA 1JBQA 3EIXA 4Q9LA 3IT1A 3VPDA 1E9VA 1Y5IA 1CPYA 2CN1A 1RKXA 2C97A 1BNCA 2QM7A 3H2YA 4EA9A 4EG0A 4CIWA 1WE2A 4MLCA 2OZLB 3GD5A 2PQ2A 2WF8A 4ZVMA 5H5JA 4CDNA 4F46A 2FUG1 4Y6OA 1V7QA 3I12A 8OHMA 5GINE 1PE0A 3TMYA 4B35A 1KJZA 2XCQA 2XMDA 2ZBVA 2QW1A 2PD4A 2ZTUA 1NJ2A 2LIPA 1RJGA 1RMTA 4G4SP 3ZH9B 2PWBA 4A8HA 1E3EA 1NN3A 2NLOA 2RBKA 5JIBA 3IAFA 3G17A 5ALGA 5FI5A 2WVHA 2ZPAA 4QYSA 1KFBB 5JAQA 5BSTA 3S1AA 4ZAWA 4J07A 3AERA 2FPGA 5DSXA 1OAKA 1OI3A 2J4CA 4LHWA 4POAA 1QWOA 3ME5A 4CIXA 3IP6A 4UAGA 2AR0A 5KNLA 2W6CX 4E0BA 3NAGA 4RPJA 2AFHA 1MIOB 1WNFA 4JLJA 1YZVA 2ASEA 4M0DA 1J1UA 2G1PA 1E98A 1EJ0A 2JH8A 1XDBA 3CIOA 3EZFA 4CT5A 2BMEA 5JAOA 3C41J 3KCNA 4OXNA 1LK5A 3KYIB 1Z5WA 2A6PA 2VDKB 3PDIA 1YIOA 4KX5A 4IEIA 1NQUA 2L69A 1XO1A 1BGWA 2XXJA 3VR4H 4AJ4A 1NU8A 4H31A 4Z49A 4F21A 4CN8A 1IVYA 3MTBA 3SBOA 3C87A 4TVOA 2PRIA 3DW3X 3IVAA 3NH6A 1OA1A 3RWMB 3VSBA 3M4XA 3NR2A 1DBPA 4W63A 2QM3A 4W9RA 4G0QA 2BEWA 2B6NA 4N0QA 1W94A 4RGBA 3LDUA 3RKRA 4F1KA 1Z0IA 2QD2A 2ZT7A 1KWGA 3OC6A 1EM6A 1KXZA 3RT1A 3HY4A 4HAUA 2JS7A 3HDTA 1Y1QA 2H3HA 2QNBA 2ZGVA 5D1HA 2GYYA 1T2CA 1JR3E 1FFDA 2BHRA 1RQNA 3Q7QA 4LMAA 4ND8B 4JHLA 5D87A 3KPUA 3NHJA 2OHXA 1JECA 2EKZA 3LS2A 3QELA 5GZ3A 3LECA 1QHIA 3PFIA 1O08A 3R3ZA 4LX0A 5HJ2A 1K4YA 1WW3A 4PYKA 1U9JA 2GYUA 5ESRA 2FP4A 4MV4A 3PT5A 4AU1A 1JWBB 1N5JA 1DRJA 4LKRA 3UXMA 2VYQA 1FTWA 2P8SA 1R0YA 4A03A 1XWIA 4RKRA 2O06A 4BMOB 2HMWA 2R60A 3AMVA 5B30A 4QDXA 1JLRA 4MVWA 4TGLA 1KOGA 2ZVPX 5IP5A 1EHYA 3KSBC 4Y7DA 1T9CA 1GGJA 4GPZA 3VBCA 4B33A 2PXCA 3LY5A 4YJKA 3KJQA 1KEUA 3W7BA 4W5RA 1VP9A 1V5FA 1QZUA 4U2DA 4CMCA 1UC5B 3H5OA 3KWFA 4R5MA 3TLBA 2Y92A 4CG1A 3NTOA 1QQ6A 3IOBA 3RD5A 1GHTA 1IY8A 2WG2A 3H2IA 1YRYE 1O0BA 2O1XA 1LXCA 2XOEA 1TM1E 4ZYVA 1AB6A 3MWDA 2O7QA 5T4HA 5EJ5A 4JLAA 1JWLA 1JFSA 1BQEA 3IPAA 3LRTA 5B3LA 2FHPA 1RLMA 3F47A 2HB6A 2WFMA 3BMCA 1LB1B 1CZRA 1TJYA 3OIVA 5TB5A 4YJFA 3WDSA 1BYUA 2QWXA 1TO1E 3O2JA 1DXYA 5C5CA 5KTTA 3GG9A 1ZNXA 5IDYA 3HBLA 3ICQB 3KZVA 4DDKA 1QX3A 4Q47A 5CMLA 4Z4EA 4RD6A 4R0VA 5A6SB 1U2QA 3T7AA 5IBCA 2D3WA 4ZI7B 2ZR7A 4MIYA 2EW2A 2J30A 2Y2VA 1FFGA 1NU6A 3FF4A 5TLSA 1R12A 1ZW6A 4F6LA 4E33A 1AG9A 2IV2X 5C51B 4YPVA 4CL3A 4YJ2A 3PYLA 1TW3A 2RK6A 3IMGA 3MELA 4FC6A 4NS4A 5ED0A 3T9FA 1KC1A 4U7HA 1R8YA 3G8DA 1XU4A 2X1LA 3GFRA 4FUTA 3K7EA 4X1YB 2Z09A 2KWIA 4JEMA 3LZDA 5H0IA 4NZOA 4UU1A 5BV7A 4GVPA 5H4GA 1ATZA 4EA6A 3C6XA 2WZDA 4TUYF 4N0EA 4IFBA 4X9XA 4UQLA 1FRFS 1F5SA 3AFIA 1GQQA 2JB9A 2J5XA 2W6JA 4PEVA 1UK7A 2EC5A 2JK1A 5IEBA 3REGA 5IHPA 3TZBA 5CLFA 4G0UA 2WVAA 1R15A 3TQOA 1E7SA 1N2EA 4L27A 4NBNA 3ADCA 3KQYA 4PPNA 4KQEA 3RREA 4R7GA 1RWOA 3GGSA 2X8AA 3U7QB 4EZIA 1RJ9B 5JROA 1ONPA 5CG1A 3PTLA 3FCYA 3RQIA 2JLQA 1WXDA 4IWXA 4M22A 1VL6A 5ALRA 2H16A 4QGGA 4XX0B 5A9SB 5HRUA 3BRCA 1UBRS 1X8JA 2XF2A 2JZCA 3NRCA 2EWWA 1SIBE 2CXNA 2XKAA 2BFEB 3N2KA 4RE6A 3UK2A 2YNMC 3P8ZA 5EIWA 2P7IA 4YMVA 1E9EA 2RIRA 1KARA 1OFGA 1RXEA 3ISTA 5IEJA 3HJTA 4UUBA 4PPQA 3DMDA 1YZKA 2FDCA 1SAYA 4QTYA 4EPXA 4V1CB 3T3NA 3D7KA 3H99A 1LWOA 1ZGGA 2ACWA 3BF8A 3KXLA 3FMVA 5LQSA 5EJFA 1C9JA 1ZNQO 1N2OA 1RRVA 2FE4A 2LXNA 3HYSA 3IT0A 4J7AA 5DXAA 3TJRA 3RNOA 1YV9A 1KSJA 1Z0JA 2OECA 5L3QB 2HCBA 1Z6TA 4G0PA 3PUZA 4PZUA 3JVEA 1QLHA 3GJ0A 4ILKA 1URPA 2I0FA 2Q4BA 4KMRA 1IHDA 2Z9CA 3OEEA 3DMTC 4RK4A 4CODB 3Q9NA 4RKQA 1UC9A 2PGJA 3RROA 3DF9A 1XTRA 1CBUA 2FEXA 3EEIA 4Y8VA 5DYWA 3TKYA 3TH5A 4UHCA 1D9XA 5DCWA 1G3UA 1AKQA 4QKQA 4BKQA 3LY9A 4KMMA 3G0HA 2CV1A 4IV0A 4WKBA 2GN0A 3ETJA 1CNMA 2ZT6A 3HHEA 3K9BA 1DARA 5DGIA 2RMKA 4TYMA 2C4NA 4LRUA 4LZNA 4BFTA 4BNMA 1CT9A 4HRYA 3V2HA 3ZUPA 1Z0KA 5ERXA 3CSDA 4TV9F 5K99A 3AZOA 5TIIA 2FXVA 4ZCSA 5AI4A 4MICA 5EKDA 1N1DA 4DT1B 4YRGA 1QFYA 2ISQA 1F7UA 1YQXA 4QFCA 4V39A 3CUSA 5JWHA 4Z99A 4TLEA 3A6ZA 3ZGVA 3M4ZA 5K3AA 2HJVA 2Q5JA 4RZ2A 3T38A 1AM4D 6ABPA 1HBJA 5JI3E 2VP4A 4Z0NA 1E0AA 1Z56C 2NVBA 2JASA 1I51A 3OZVA 4W5JA 3AKEA 3PQFA 4BQOA 5BV1A 3MINA 4R51A 1W581 4BB9A 3FGOA 3RTCA 4G0ZA 3PJRA 1NJSA 2IOFK 1ZOIA 3SP1A 2R4TA 3ZTWA 4AZWA 1I94B 1M6EX 2G0TA 1T8WA 3M8KA 1RRKA 1ZOLA 3R7WA 1OGYA 4BV2A 2DHDA 1CQJA 4L4XA 4Q18A 4OXRA 3SYTA 1ZLXA 5CPBA 2D6FA 2FPLA 1XFAA 3H2KA 4FBMA 1PGJA 2ZWAA 4L5AA 4DA9A 3K71B 3FCOA 1BS2A 3KPVA 2VBFA 4NU0A 3WLSA 2QBYB 1FTQA 1JVNA 1QSGA 3EHDA 4C3OB 3NQ41 1N6KA 4RLFA 1TCUA 2AF3C 4ZD6A 1EBFA 3UENA 3EXHA 2OHVA 2YXPX 4G1BA 4BASA 1JR6A 1R27A 1HX7A 1ANKA 4I4CA 1YVRA 3BRSA 3FOBA 3OIWA 5LP6C 1QFSA 4Z4CA 5BT8A 3G7UA 3HADA 3OY2A 2FAXA 2FSIA 1PEYA 1VLMA 2AYZA 2FZ5A 5EKSA 4I6EA 1SBHA 4ZK6A 1M0EA 1RAEA 1E6KA 4EHBA 2A9OA 2YIVX 1KEWA 1Y33E 1KZHA 3KFXA 3LOUA 4CM1A 5AHOA 3MAJA 3V7UA 1JG4A 4FVTA 4E2WA 2VIIA 2EX0A 5IUNC 3GJ3A 3G7SA 2IZ7A 4O2LA 3EGIA 4TTTS 3NGLA 1DMRA 3BSSA 2PTHA 3DOEA 4PHTA 4ZEWA 4I8XA 5CP8A 5LDHA 1BDIA 1U3FA 1OWLA 1T4MA 1Z35A 3P9CA 2X14A 3Q3CA 3SJBA 2A0XA 3CF2A 3UCXA 4JH0A 1UEJA 2ZANA 4QPDA 3D59A 3MCAA 1JG3A 3ABSB 2EBHX 1AMOA 2B6HA 3MUOA 3T7JA 1RZUA 2GM9A 4I8DA 1GQRA 1OASA 3CJQA 5LWQA 4G5GA 3SQWA 3R0ZA 3KXKA 3GOQA 1M2VA 4UDYX 1PZNA 3DHVA 5EP3A 3CUEF 3RLIA 3WOVA 4B83A 1ZWKA 2OGTA 3CLSD 1PT8A 1TU0A 2EP7A 4LDPA 3U56A 5JMWA 1FTNA 2D5BA 1JSRA 2CHVA 3AHEA 3HSKA 1UZNA 5ICGA 2YW2A 4FHCA 2PRJA 4HPWA 1MABB 3O8DA 3RE1A 4B2IA 4AW9A 2FQXA 1T5OA 2O8BB 3HVKA 3QX3A 4EECA 2E21A 1Q3HA 3U2QA 1JU9A 4MR8A 3DEKA 4ALIA 5JZSA 3PXDA 3LQ2A 1GPLA 1CUCA 2HNAA 2WYHA 4BLTA 3NRBA 1HLGA 5P21A 2WJIA 2XUOA 2G0NA 2R3SA 3VH4A 4EMTA 4DPLA 2A9RA 2XECA 4Y2VA 1G98A 2NTVA 1N8TA 1SKBA 4KLNA 1ONOA 2WJJA 1A5AB 2N46A 1K1EA 3BFPA 3CLRC 2V4MA 3GRUA 4I50B 1J9ZA 4GPTA 2NG1A 3AR2A 5H82A 2ATVA 4FWIB 2O8BA 4OQMA 3WISA 2FSUA 3RIEA 5F9HA 3N2KB 2P0EA 3OQHA 3RS2A 1X70A 1F2VA 1T13A 2VATA 2XRZA 4PAMA 1VHJA 3O0DA 3DUWA 3INYA 1I30A 2EP8A 1CERA 1M5TA 3OPYB 2DQ4A 3DEIA 1U28C 1K8QA 1KMHB 3HCOA 3EVFA 3WC4A 4A8JC 2W42A 5JYBA 4C0AC 2PZMA 2QLBA 1F20A 2ZUSA 4PW0A 1QANA 1OA0A 2GZHA 3QVVA 1H4TA 2LR0A 4HYEA 2QL7A 1NXTA 1GPKA 2XYPA 4Q15A 5AVZA 1MN6A 2NSYA 1PX2A 4CKCB 3ICWA 3A3KA 4QG3A 5J58A 4GMHA 3S8EA 2W6OA 4OK5A 3EASA 1C1XA 4MV1A 3GZNB 1OPRA 4N6OA 2OD9A 3R0QA 3JR3A 4UM9D 5FADA 2H1FA 2D1QA 2QRUA 1MG5A 2Q5IA 4TKVA 4TV9B 4N5IX 2TS1A 3MJVA 2XUDA 3VVBA 3BZUA 4XYEA 1WZNA 2KHZA 4AL4A 3GFFA 1P29A 1GFZA 3QFFA 4IIHA 2FW8A 4NY1A 1FTYA 4OH7A 4PLGA 4DGQA 4ZEVA 4ZFNA 1CE8B 3GAMA 3K6SB 4RLHA 5BNIA 2PZ8A 2QLNA 3PSHA 4Q03A 2XE6A 1CY6A 4W5NA 3GF4A 1U6JA 3TGPA 3SIPA 1RI4A 3IBSA 1L7MA 3SK0A 2O7SA 1G3MA 4AJKA 1SHKA 2ZYGA 3MT9A 1QCDA 4PBSA 1GL9B 4Z8YA 3U3RA 2QTHA 4DT1A 3PL5A 2BGNA 5JQGA 2ZCJA 2ZSBA 1E5LA 1CEQA 1FSSA 4BUZA 2KQUA 4F2DA 2F3PA 1AHIA 1DU4A 1RKQA 4QRIA 1MA0A 2HIMA 2FQWA 2P9QA 3OOYA 3ZDAA 4EFKA 1C3OB 5EWMA 4NSNA 1TIKA 1F2UB 2G9UA 2AJLI 2YL2A 3QLVA 3I52A 4OQQA 5A05A 3VYSB 4J0KA 4BO7A 1RZRD 1RE1A 3QLUA 4F4JA 1GU0A 4I9HA 1TMYA 1KKLA 2IE0A 3RRYA 5I51A 5DMXA 2X0FA 3SEFA 1Z8FA 4Q02A 5H70A 1T1RA 4JB2A 4JQCA 1B93A 1S01A 3L93A 3TD6A 3JQDA 1E1RD 2OBMA 2NZUG 2QENA 3FH0A 1G19A 1RHUA 3PFKA 3O4JA 1QLJA 4IUYA 4PX9A 5FHRA 1V1MA 2P9BA 4HX9A 4ZV4A 3CM0A 4YACA 4ACBA 3QYFA 1EWKA 4YP6A 1E58A 3GLRA 4NICA 4R0MA 3FVRA 1P7CA 3MUFA 4Z9XA 1BW9B 2NO4A 3LBYA 3MRXA 3NWEA 4FLFA 1OX5A 2DQYA 2FN9A 1V3TA 4FZ5A 2G28A 3BEDA 3O1HB 5FLEX 3RGWS 1ZU4A 2FU5C 1EAYA 1DBSA 3NWBA 4FFDA 1NW3A 1L5SA 3OJFA 4P4SA 1CFJA 3M6FA 4DRXB 3R5TA 4PRYA 2IPXA 1QRRA 4YHBA 4FN4A 1F4VA 4J0QA 2QDKA 2Y1CA 3QXXA 5HUHA 1S5PA 3DNFA 3T3IA 2UAGA 3WLPA 4BMZA 2FZEA 2HO5A 4ZO9A 3KXIA 4BKRA 1ZQ1A 3D8HA 4ZCPA 5ITSA 1RHRA 3ONEA 3H9GA 4G5FA 5DT9A 3TNYA 4W7IA 5JJIA 1J7KA 2BCEA 2ON6A 3L0ZA 3RYHA 3M4NA 2BR3A 3OIYA 3WE7A 1U2GA 4K05A 1CP2A 1VE7A 2C1EA 2NSJA 4JVLA 5M5BA 2QN6A 5KYTA 1CS4C 1YVPA 3FTQA 4NQZA 2QI9C 2EJVA 5EZYA 1GZDA 2YZNA 4L3VA 1OWMA 1YS1X 3G0GA 4A5SA 1E96A 3MN1A 1NN1A 5FA8A 2JAUA 2YN2A 4M8NE 3DA8A 4DV3B 4PN3A 3OZBA 2NZYA 5FIUA 1AZSC 4DJTA 4G01B 4F5YA 2GK6A 1FLDA 1SK8A 1XZHA 2WTBA 3SQOA 5CRIA 5G4KA 4I55F 3TQSA 1HR0B 1C3VA 4QGBA 1FP2A 2A5DA 3WGJA 4MAAA 1JBKA 1YBVA 1GNQA 3PNLA 5CM8B 1H1DA 2Y1XA 2Z2ZA 1RXVA 2DJIA 1GTJ1 1UP4A 4YQFA 2DPLA 3QBTA 4I1RA 5A1TA 1Q7CA 1U9CA 5DEOA 5JJBA 4YA6A 3OHSX 4AMBA 5D8DA 1EKXA 3RTDA 1WS6A 3BSYA 3E22B 5LUAA 1THGA 3R3XA 3U7JA 4QBGB 2GD6A 1IM8A 4B3XA 2YH2A 3GUCA 3HCFA 2YS6A 1SQ6A 2V7XA 1M2OB 3QPAA 5G53C 5JSZA 3BYZA 3FNQA 1T0UA 3DVRX 4KVZA 4A0HA 4LXXA 4FZJA 1R0ZA 1DNPA 3K70B 2YHSA 4DIOA 5FPYA 4NCAA 5EUCA 5CFNA 5GAJA 1TD1A 3E3LA 2Q6IA 2C7GA 3STUA 2CJFA 4CKZA 3TOZA 1CB7A 3AKZA 2MYNA 1N0UA 2HMTA 3TLEA 3ROPA 2B8NA 2VJPA 1UL1X 2WSMA 2OQIA 5ES3A 1KZYC 4HNAA 2AOUA 3H2ZA 4HAIA 4OU5A 4NQRA 1Y3BE 3OUUA 3NBYC 5ITVA 3M6AA 1E79D 1VLZA 1WBBA 2IHYA 4HH0A 3CQ9A 1E77A 3DXFA 1RPZA 4WFKA 4IDEA 3ZHBA 1P4RA 1YACA 4B9AA 5CDSA 2WTMA 3RV3A 6Q21A 1CUVA 2D5IA 3FOAA 1KJJA 1CJTC 1UKBA 4WOJA 1O6ZA 4NC9A 4DZRA 1T10A 2YFQA 1ULBA 3K70C 4DV5B 4F2WA 5J2UB 2BGGA 3HTXA 1E2PA 3LW8A 3ENKA 2H4HA 2BZGA 2JLCA 2ZRAA 3BF7A 4RTJA 2P4HX 3KKPA 3Q9LA 2GUWA 4IQ0A 2ZB3A 4G0NA 1J1ZA 5AKYA 4A8PA 4M1QA 3DCYA 2YINC 1E3WB 4KUHA 5K8IA 1ISJA 3HWRA 4URWR 3RHSA 4F84A 1T9ZA 1PGPA 4HTFB 5JH7B 1UBKS 4LFAB 2FMHA 1SIWA 3KQOA 4B09A 4QGFA 5IK2A 2PKXA 4BRSA 4EFLA 4DV6B 4F96A 4RY0A 4LJ4A 2BSQA 3MJFA 4IUBS 1MJHA 1SH7A 5DHQA 1N4DA 3WLOA 2BLLA 3HYNA 5FA6A 3TXAA 2V6GA 1BJTA 5TVKA 4EVSA 2DR3A 3M89A 3DTYA 3B2QA 2E4VA 1JG1A 1Y9JA 4DC9A 1YR7A 4MIOA 2F9MA 2FEOA 3OEED 1ADBA 4FSHA 5F35A 1RJFA 3C3WA 3PHCA 4BJ6A 3W34A 3G8YA 1XRLA 2PQ0A 1FDOA 4KFSA 2GN2A 4QU5A 3EXG2 3JW8A 5CNIA 3HU5A 3SR4A 2Q21A 2E4ZA 1SBQA 1X0XA 2F9LA 2ZE5A 1KKMA 1ZC3A 3EA4A 3NUGA 5GOZA 3R0JA 5KSOA 4GZMA 3G82C 2AKEA 3SF8A 3HJFA 4P7JA 2R00A 1L5NA 4A23A 4UPEA 4TWRA 1HFEL 4C4PA 2XXAB 4WXPA 4RUKA 4H08A 5IT4A 3MRVA 1S8OA 4MW5A 1YA4A 4XGIA 3MFYA 2CVQA 1W4LA 2Y0PA 4PIMA 4C4XA 3AG5A 4ARIA 1U6IA 1E1CA 1Z0ZA 2WDZA 1WW8A 3ORYA 4P2GA 1PWEA 3ICPA 4PONA 5U4XA 3SFZA 5KDDA 1JHQA 1QIJA 1GN9A 3IAXA 4QGHA 1J0AA 1YOVA 3GEIA 4UDNA 2RHHA 4ZA2A 4IJ5A 1ZOSA 4ZAFA 3IQWA 8ADHA 4FIZA 1N2IA 1RC0A 2I67A 5C9ZA 5JATA 3U5TA 4O2RA 4LECA 2JG3A 1JHYA 2B5WA 2LPMA 4OQEA 1R5OA 3PEFA 1QYDA 3O9ZA 5KEIA 4AZ0B 1NQAO 2NU7A 4GT1A 3IBTA 4U7DA 1UPXA 4S24A 4WACA 2AEMA 2Z95A 4D9GA 1Q1BA 5IARA 4ETMA 4TV8B 2P9JA 2WJHA 3LE8A 4YNBA 2H0RA 4QLOA 3SLGA 5C35A 1QUFA 2CLKB 2YCLA 3QVGA 4DA6A 1RJEA 5EXDA 3EOAI 5HKOA 3IDZA 1GP2A 3OLVA 5JS6A 1Y3DE 3OLXA 2WP8J 4ASUD 2QJWA 1IZYA 1U8XX 4I55B 5BWCA 1A4RA 2QVZX 3FBTA 1M74A 3X44A 2IZ0A 1RQPA 1PFKA 3G5TA 2F00A 1WBDA 5LD2C 4ZCQA 3A06A 4ZZ0A 1DKQA 2WTEA 3HWSA 3K9LA 1S89A 4IP0A 3CSUA 4UHBA 4UMVA 5D5PA 2Q6KA 1GGEA 1OLSB 4RJTA 3CVWA 1TU3A 3O9MA 2PS0A 1XN1A 3AWDA 2B21A 1KL7A 1QYWA 3W3AH 4P80A 4B73A 1N8KA 2P6UA 2AMLA 4DMMA 4JI7B 2HRDA 4YALA 3B20A 4I4NA 3UGJA 4FNMA 4K6KA 1IOZA 2OZPA 5B1EA 2CXOA 3O94A 2QRVB 3HEBA 1EFHA 2GCEA 1GXSA 3A2LA 3C8MA 4BAGA 1DJPA 2B1GA 5B64A 4L8GA 1NM5C 3DOCA 2JIRA 3GEPA 4IXDA 2VWPA 2PSJA 2CCKA 3UY4A 1WHTB 5M04A 1U0JA 4H7JA 1UPUA 1G38A 2FSHA 3I28A 1OBHA 3LUAA 1MJFA 1ISRA 4IG9A 4UASA 3QEBZ 1T9GR 3GUYA 4LGMA 2P2GA 4OA8A 4RZUA 2W2PA 3I9V6 4WN9A 2RE8A 5HYVA 3PJEA 4V0ME 3I6ZA 4P7KA 4KQ1A 1GPBA 4YONB 1P60A 4BNZA 4YECA 1AXGA 2C9YA 1QIMA 2UVDA 2WRZA 5E2BA 4AWAA 2NXCA 3QA9A 4OJKA 1NAIA 1TYCA 1VGQA 3LBHA 4OTZA 5IZCA 5ER6A 3RWBA 2ZI4A 3SM9A 5EE9A 1B4DA 3D0KA 5IMBA 4E1BA 5AW3A 1NX9A 4PYIA 2XB9A 1OKKD 1Z3CA 1G0OA 4LZPA 5JU6A 3IXLA 1FJGB 3Q85A 1KJIA 2C2ZA 2C8LA 2RHWA 5HOQA 1BRTA 1A8UA 1FP4A 1VJRA 3FFAA 4OL9A 4J0DA 3K31A 2FEAA 4TMYA 5BUCA 1N5IA 1YIDA 3RF7A 4FEEA 7GPBA 2ZJ0A 3L05A 1AD2A 3LCCA 2JCYA 1G2QA 1A9XB 1MB3A 1QRDA 2ST1A 2YZGA 3H7AA 4ZGWA 4OLAA 2CFRA 2JFWA 5KTPA 4QFDA 4JVOA 5KYYA 5B57C 1XKLA 1Q50A 3AU9A 1N5RA 3V1YA 3IBCA 5A5GA 3IVXA 4MINA 4XYMA 3H3XA 3E53A 3VHXB 3FUCA 1K7CA 1J0BA 1FUYB 4MHSA 1BD4A 3C5CA 2SKEA 5KWEA 3S55A 4N65A 2BDEA 5FDFA 1QVRA 3LHSA 1RXWA 3ASVA 4YUXA 3E03A 3MUNA 1CDDA 1C81A 1PW7A 2ADOA 4KVGA 5IJ0A 1N0VC 1NT2A 2ZE7A 4JQSA 4ANFA 1P0MA 5CU7A 1RS0A 3PJFA 2WTUA 3JQCA 1QK4A 4MXDA 1G16A 2JJ1A 4KGDA 3VKHA 4KR0A 4DRXA 2E3JA 4WEOA 2OCBA 4G6ZA 3K0AA 4LCBA 3ZVLA 3AVTA 2XMGA 2QXUA 1Q19A 1QGOA 2A7QA 2MYTA 1KEZA 1X7XB 3FBGA 4K8RB 2GF2A 2Q4EA 3D3QA 5CB4A 1YDHA 4Y2RA 3WRYC 3FYUC 2GB4A 2QUBA 2R2GA 3N6RA 1GITA 1OIVA 2VI5A 4LVCA 3NHMA 3L7NA 4QPCA 3IL2A 3DWFA 1C7QA 1E7YA 3T52A 1G4UR 4H18A 5IBPA 3TL2A 1QH1A 5IPFA 1SU7A 3ON5A 3NTQA 3SIWA 3ABZA 4MJ3A 4X7BA 2YVAA 4XQEA 2F90A 1P5RA 1VYUA 1N9GA 2GPYA 2JH9A 3BQMB 1DG1G 4UEWA 3VYRB 3KQQA 1PT5A 4GR9A 3EJWA 1HT3A 3H84A 4OMUA 3WGZA 2NX2A 1CUSA 2V4UA 4UNIA 3D54D 1KR2A 5B3AA 3HDHA 5H9WA 2PFGA 3F2VA 1U99A 1Y81A 1H0KA 2PXHA 3QBJA 5D5QA 4EVIA 1Z34A 5CB6A 2BEJA 4RW0A 3LZCA 2J5RA 5JH7A 3ND5A 4G0VA 3NS7A 1XLVA 4OL0A 2PMWB 3ZKAA 3F6CA 4P31A 3K15A 5TF4A 4BNYA 4R2WA 1BMFA 5MN6A 1OFUX 2UXDB 3LYAA 1FFCA 1QWSA 4N3BA 5DXJA 4R54A 1NWHA 2NOAA 3CLTC 4BZPA 1US8B 2EKLA 4H59A 3WK9A 5ALVA 2G4VA 2GKSA 2WD7B 2BTOA 3HA3A 2YUTA 3P9IA 4JYCA 3PRYA 1AUXA 1OWNA 1T4CB 1MRSA 1KYTA 3FPFA 3MBKA 2ZAGA 3KQMA 1FYDA 3UW1A 1GQYA 4BVFA 1RI3A 5JS2A 3PXEA 4CBVA 4F5EA 3GRVA 1MR3F 1D04A 4BFYA 3GI1A 2CZQA 3MZ0A 3FSRA 1QQ7A 3N2GA 2E4UA 1C7JA 3MMNA 2OWEA 2QSJA 2G5CA 4B6FA 4MYTA 4GS5A 5FOSA 5IDXA 2XGGA 5C1PA 4CLRB 4R8KA 3RODA 1NQVA 4ZVTA 4FBGA 3LOPA 4A0FA 1P80A 3V4SA 4HFMA 4PAQA 2Q4OA 1EFRA 1Y1RA 2NO7A 4OI2A 4D82A 4E15A 5KNDH 4LSZA 2WZQA 5EXSA 3DDZX 1NUAA 4ZP1A 4Z0TA 1KE2A 4L85A 1J70A 1G2PA 3C8HA 3FRJA 4IXWA 2F1RA 1R37A 2CZGA 4UBKA 5DCUA 2JFGA 5EMKA 1M73E 3D7MA 5CDTA 3F1LA 1DT3A 4XWGA 5ALWA 4UHJA 3ZWPA 2M1ZA 4BCCA 2PY6A 2Q2WA 1R16A 2XJ4A 3UYLA 1E5DA 3WMXA 3R9KA 3HV0A 4Y9SA 4MW6A 3GUUA 4UU7A 1ZA2A 4CTKA 4ZI7F 4GMFA 3VOBA 4MARA 5K0CA 3L6EA 3CVYA 4TLDA 3NPAA 4N82A 2LVBA 4I14A 4Q66C 3UT6A 1J9EA 3LHDA 3U6KA 4Z3OA 1GGVA 4XM2A 1SUAA 1P5HA 5C8YA 2IYUA 2QN9A 5JHGB 1EXDA 1Y7HA 1LSJA 4O4IA 1XT6A 1QMGA 2WYOA 4GPBA 4FNGA 2H7VA 4ETNA 3CKYA 4HB4A 5JDCA 1NVVQ 4HEJA 3HHPA 4QFBA 5JBIA 2ETXA 3MJ4A 2QVGA 5M7EA 4HMPA 3DQPA 4HN9A 3TNDA 2QV0A 3NU1A 2IV3A 2ZTMA 5A4JA 1T34A 1PFVA 3ZI7A 4KAJA 1G3IA 4P22A 4TTIA 4IY1A 4TMZA 3KWJA 3UV6A 3WYBA 3GNSA 2REOA 1UM9A 1MOQA 4DJAA 3IQHX 2WIKA 1EVIA 2WSYB 2VCYA 4XJXA 3E7FA 3UUGA 5CCBA 1TEXA 4LQCA 3H1GA 5AW9A 3WSVA 2C9MA 2G8LA 4DCTA 2GSWA 2O8CA 1A2OA 4W7SA 5TGDA 2HQSA 1D5CA 2MMCA 3K20A 3QX8A 5JS7A 1GPWB 3JCZA 4EA7A 1JB1A 2X4IA 1X1TA 1Q74A 3JWJA 2ZUDA 1HLPA 1P72A 3Q6IA 1O77A 2P30A 5E3JA 3T9BA 5KPJA 3ZCQA 1A5SB 1NY6A 4CKWA 4JB3A 3O82A 3AZPA 3P0RA 1R00A 3FGZA 1WVGA 3DDOA 1EU1A 4K6GA 1YBAA 2ZIXB 2HN9A 1J4AA 3BTVA 3UWDA 1LLQA 1SUIA 5TPZA 1FP7A 3HU2A 2W2XA 3GEDA 4LJ7A 2X0IA 1D0VA 1KOJA 3CX4A 2NU8A 4I6GA 2Q2VA 5BV2P 5M2QA 2AJDA 1X80A 4N5MA 1M7GA 4S04A 1T5SA 5EWLA 1EMDA 3I45A 5GV7A 2HCFA 2CXUA 2WKSA 5TC4A 3RAPR 3V4FA 3ZLUA 1J8VA 2FRXA 1ACMA 3X3HA 3R7WB 2OCAA 3DLPX 1JU3A 4Z4GA 4FHZA 3ESBA 2I76A 3MLEA 2ZIEA 4KQMA 1QK5A 5DM60 2BSAA 4W1PA 4QTTB 4B7ZA 3GBPA 1ISPA 2HDWA 5CDYA 5H7XA 3UAXA 3IAEA 1BMQA 3I53A 4TTJA 1CLUA 1OC2A 3N8IA 1H0HA 4PAWA 1G2OA 4WCFA 3SHQA 1H5QA 5IBRA 2Q1YA 1KEEA 3S2ZA 1E8DA 4EX6A 5CDGA 4FYKA 1CDZA 1UBSB 1WXFA 3UUWA 4HWKA 3W4JA 3LPMA 4B82A 1CY7A 3RYFA 1KAMA 3EG5A 4XM1A 2C5FA 4D8YA 4QWWA 4J6EA 1JEYB 4O5AA 1KETA 4KJXA 5HDQA 3ZV5A 3FDZA 3UKDA 2QYTA 3D7LA 1UKVY 4INAA 1F3OA 1U3UA 5KUTA 1DZ3A 1GA4A 1KKUA 1GYRA 3CNQS 5DBEX 5IXJA 5HM6A 1A76A 1SVMA 2R8ZA 1X7YB 4Q1VA 3LA6A 4RGQA 4UBJA 1XDSA 1GFWA 1PSZA 2V7WA 5D5HA 3AV0B 1NASA 1Q6ZA 4O8CA 2YJGA 1E2QA 1C4WA 3KKNA 4R6WA 5FPSA 3H65A 1OFHA 2FK8A 3PQ3A 3SEZA 1A9OA 1U0GA 2NVUA 5IM5A 4K87A 2PV7A 3BD7A 3E2PA 4NFSA 3QUAA 4WTOA 1YRQA 3OKPA 1TGVA 1CUBA 2VH2A 3ZWKA 3L8HA 4NV0A 2VJAA 3RYIA 2BGJA 2PLFA 4AXBA 1NDHA 2I54A 3I37X 3NOXA 1YDMA 1Y6FA 3RBVA 4RYDA 2DWUA 2X77A 2YTZA 2O14A 3Q8LA 2GS9A 1N1GA 3TQTA 3HP4A 1SZCA 1OB2A 2I6UA 4H7KA 1K5DA 3H19A 4HQ0A 3G0OA 3WA6A 3CX7A 4NEHB 4R4JA 3P45A 4OOEA 1Z22A 5CTJA 1CC1S 3Q7SA 1YJQA 2JBHA 1KF0A 3T35A 5M29A 1YKGA 4DLZA 1BA2A 3KSAC 3C1UA 1PQ4A 1I3MA 4I4TB 3KYDA 2G07A 1TCVA 3ADPA 5LA6A 3RC7A 1BJKA 4G4SO 1MZVA 1RKVA 4XD7D 1SUPA 1W47A 5BOSA 4JXXA 2VOEA 3L1HA 2G1JA 2EWVA 3