4ZYUA

Human gar transformylase in complex with gar and n-{4-[4-(2-amino-4-oxo-3,4-dihydrothieno[2,3-d]pyrimidin-6-yl)-butyl]benzoyl}-l-glutamic acid (agf50)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Trifunctional purine biosynthetic protein adenosine-3
publication title Structural and Enzymatic Analysis of Tumor-Targeted Antifolates That Inhibit Glycinamide Ribonucleotide Formyltransferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 200
sequence length 200
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4zyuA00
1RBMA 4ZZ0A 1ZLYA 4ZZ1A 4ZYVA 1ZLXA 4ZYWA 4ZZ2A 4TS4A 3LOUA 1MENA 1C3EA 3O1LA 1RBQA 4IQFA 1RC0A 4ZYTA 4YFYA 3N0VA 1GARA 4YFVA 4S1NA 1ZGHA 1S3IA 4R8VA 1RBZA 4Q12A 3TQQA 4QPDA 4EW1A 1MEJA 3R8XA 3W7BA 4ZYYA 1YRWA 1C2TA 4ZYXA 3AV3A 3GARA 1JKXA 2BW0A 4QPCA 4ZYZA 1RC1A 2FMTA 3OBIA 4TTSA 1CDDA 2YWRA 2BLNA 5J9FA 1RBYA 3Q0IA 1GRCA 4TT8A 4ZZ3A 4EW3A 5J63A 4DS3A 3KCQA 3AUFA 5CJJA 4PZUA 1NJSA 2CFIA 3NRBA 3P9XA 1FMTA 4NV1A 4EW2A 2GARA 1MEOA 3TQRA 3DA8A 4ZYUA 1CDEA 3DCJA
chains in the Genus database with same CATH superfamily
3EGEA 1E20A 4RIEA 1AA6A 8GPBA 5I9NA 4L5BA 4ZZ1A 1WA5A 3CV3A 3TO5A 1RJFA 3UA3A 2NVUA 3UTDA 4CIYA 3WB1A 5CPBA 2PX6A 1C30A 1R5OA 3DZCA 4L27A 3LAWA 4LE1A 3UG6A 1U6KA 3WRYA 2OYRA 4KQGA 5TGDA 2QLMA 2PT5A 4RS3A 1YDHA 4MPPA 3OZRA 4EFLA 3WLMA 4MWGA 4RIFA 4UNPA 1QFXA 4WZBB 3TNYA 5TSDA 1VMDA 1Y8CA 2WZQA 4JGGA 5A4MS 4LHVA 3MRSA 3P2YA 3RVQA 4IX9A 4EFNA 3HLYA 3ABOB 2GN8A 2WJ6A 5FWYA 3DHWC 5LQAA 2WWRA 3PUHA 1N33B 3VR6H 5DHPA 3L4EA 2IU0A 2PGAA 2ZUSA 2DUWA 2VDWB 3KYCB 4JLDA 2FMHA 4LRSB 4R3NA 3ZWDA 4ENRA 1F2DA 4KWCA 2I66A 3QA3E 2EW2A 2UDPA 3NVMB 4M1OA 5DIZA 3IMGA 4F9GA 2VJKA 1NE2A 1ZK3A 3L0DA 2HCTA 4FYVA 4BKOA 1CIVA 1DJQA 3BMXA 4MQLA 3KR0A 2KB0A 4UFPA 2VH2A 3Q9UA 4B5LA 2BKVA 3ZHBA 1U2RA 2R1VA 1KBOA 4XPIA 4PN7A 2OCXA 4WXMA 2W2TA 3MWEA 4IJUA 2EBHX 5FNVF 4BECA 1QC5B 3NTXA 4EHNA 4KXUA 3CZQA 3KYBA 4JEUA 3E8MA 4LG1A 1E5TA 2XADA 3ZHCA 4C29A 4FGJA 1EI9A 4Q7EA 4RVUA 4YRQA 3SXUA 5G0TA 5JS1A 5E1DA 4FFSA 3M5PA 3ZIAA 5CVVA 4LS3A 1N7GA 1C2TA 2HPHA 2IIVA 4FD2A 4M8SA 3DL7A 3OPMA 1VXOA 1L4UA 1IQRA 2A2ZA 1X92A 1Z07A 2J0SA 1Y7PA 3C43A 3FKQA 3ZI7A 5T3UA 3TNFA 4A6EA 3NBYC 1TE2A 3QW4B 4B2IA 5BQ5A 3PI7A 3ZEAA 4WE3A 3WX0A 4I1OA 3WYEA 5LL6P 1WBDA 4TM7A 3S0JA 4P2BA 3EGOA 4FS3A 5T67A 4TN1A 4HEQA 2B35A 4IHJB 2AN5A 3AEXA 1ST2A 2ZVDA 2YQ4A 1JXAA 3ITNA 1JQJC 2DETA 3N8HA 4RKEA 4IOKA 4YACA 3BE4A 4ND5A 1FTYA 1NNLA 4OX9B 3F47A 3LFUA 5G02A 4PNHA 3RV3A 5BQ3A 2IIPA 3VZDA 4K6GA 2JIBA 4AJNA 1ZRHA 5CM8B 3ZZ0A 2VPWA 1US8B 2WILA 1Z8FA 4MYTA 4OQQA 4P98A 4Z9YA 2Q3LA 4AN4A 5L4NA 4WECA 1NPDA 4MW1A 5AJVB 4DIDA 1D2RA 3QPAA 2F3SA 1PJ4A 1E1RD 2W98A 2ZJ5A 3SHQA 3ZJ5A 1Y9DA 3QSYA 5AJYA 2V8OA 1VJDA 4P3OA 1WVIA 4AZTA 2OCLA 5FI5A 4BLUA 2WDZA 2FZKA 1MO2A 5EHGA 4EPYA 1QVRA 4OLAA 4Q3EA 3K6SB 4BEJA 4HQ0A 1IPFA 3B82A 4RPKA 1XG5A 1ZIDA 1DOZA 1YZVA 2I2XB 4JA2A 2EQBA 2CLFB 3GI1A 1BFDA 4D3FA 3AKCA 1ESCA 4QM6A 1VFPA 2HQ1A 1TK9A 4JXZA 1C7IA 1CF2O 2VHVA 4NKRA 3RS3A 3JR3A 1WZEA 2XUJA 1NFFA 4DDVA 2VKTA 3TGWA 7ADHA 5TQ2B 1X8JA 4YT5A 3T4UA 2Q9AA 4MB2A 1HY3A 1SVNA 5L4LA 4QVGA 2VUSA 3EA5A 4Z49A 1H4TA 3NNDA 3I2JA 5C1DA 1KYVA 4CKWB 4C2AA 3GXBA 4EG6A 5C7IO 5HJ7A 4UBNA 4XFKA 4EY3A 5E3JA 3RC2A 4M83A 1JA1A 1BE8A 2AKYA 3BMNA 3CIFA 1VE6A 2JAOA 3EZGA 4IEFB 4QUEA 4MJ3A 2WIKA 1E3DA 5IBPA 3EQ9A 3OWOA 1VMKA 4Z4CA 5JNLA 3RJ5A 1JA0A 5L51A 2PZBA 3L18A 1XMSA 1FLDA 4BPRA 4FTWA 1JVNA 1H9CA 3OZUA 4RXUA 5JY1A 4KNYA 2V7XA 2G9QA 1NBHA 5A2GA 4OATA 4RPHA 2P7HA 5D01A 4AMYA 4UD6A 4O4LA 5A5GA 1AHNA 5LUBA 2QYHA 3RVJA 4CI0B 3Q6MA 3V2HA 3ZK8A 3HB1A 3H1GA 1CE8B 3UT5B 5JSZA 1I8TA 2HWXA 4F6RB 9LDBA 3LY8A 4UNQA 4D6PA 2Y0DA 1OR8A 2I87A 3G0GA 4N5IX 1Y5IA 5K01A 3OCUA 5IH7A 1JG4A 3D3NA 1JEDA 4BBAA 5F35A 2GPJA 3EVGA 4RK4A 4B45A 4B80A 3ASZA 3HS3A 4RTRA 1OBVA 2JDID 5AVTA 3IE0A 5DTJA 5F7JA 3OZDA 1FFAA 3KQSA 4F4IA 4G1UC 2K4MA 1X3SA 2R00A 3PFFA 1ZY2A 4R0NA 5HX7A 2GZSA 4OI4A 4F4FA 4IR7A 1MOSA 1J33A 4KQ6A 4M60A 4QWWA 5H4HA 3EX7C 3DFUA 4BN5A 2XVMA 1JQ3A 1YR3A 1BA2A 1QX3A 1LA2A 3GRYA 5JLAA 1PQUA 3RF7A 1E32A 4BB6A 7REQB 1C9DB 1HE5A 1TTTA 2EWWA 1NW9B 1QO7A 1DC8A 5EZQA 2XZTA 3JAKB 3ICEA 3Q2IA 3OKCA 1JFFB 2QOEA 3LW7A 4DEYA 3GPCA 3Q0IA 3AW8A 1Z5VA 2ABWA 3CEPB 2MYUA 5JMPA 1W6RA 4H6VA 4CQMD 4C7XA 2GXAA 2IY7A 1I6MA 3RU9A 3OPVA 2G06A 3U6BA 3ICOA 2JD1A 3T7IA 2JJQA 3IQWA 4C87A 3VC2A 3VRHA 5JG7A 4HOYA 4RAQA 5J5VA 4O1HA 3NDJA 5DWVA 1MBZA 4FMDF 1UWVA 1O08A 2WHPA 2ONZA 3QFFA 4JEMA 3DF7A 2QJTA 5GTDA 3P94A 1KI9A 3NHRA 3UPUA 1W8DA 2VPIA 2BRUA 4YJ3F 1V4NA 4A6XA 2CHQA 3R6TA 2B8EA 4P5DA 3ZY4A 5CA1B 4ZCMA 3V1LA 1QANA 1A9TA 1G55A 1QGUB 2O23A 1UOPA 1B7GO 1K06A 2G5PA 3DXYA 3EAFA 3HU3A 1WF3A 1ADJA 1DDOA 2VRCD 3BMQA 3DOFA 4UU1A 4TSRA 5ERYA 3R7AA 3UO8B 4Y2JA 2A0FA 1O57A 4AP9A 3DAPA 1L6RA 1XUOA 4QQFA 3W2EA 3R0ZA 5JSUA 1GDTA 2KMLA 2QMZA 3C39A 2WM9B 4D3ZA 5AKJA 2YMQA 3PGMA 1IZ9A 1IHPA 4TWJA 3R76A 1KSHA 1XEFA 1XWWA 4L4YA 4OXYA 4BCBA 1QU2A 4K40A 3E4DA 3FYSA 3H65A 5A4AA 4CKXA 2ZRGA 1WOYA 5DGTA 2IBSA 1G3IA 1XCJA 4IIHA 4LI3X 4ROTA 1U11A 4FZVA 5D8DA 3GRUA 1GKIA 3GPBA 3VR5H 4Y30A 4ZZ2A 5DK4A 4XWKA 1NI3A 3J7TA 3ZDYB 3O0TA 3OZGA 5EIBD 3GZNA 1DPGA 1MENA 1TMGE 3CX3A 1YC2A 3E2IA 4O02B 3C1UA 3TTUA 5FBVB 2HWYA 1DCTA 3B7PA 1I7LA 1A5ZA 1OA1A 2JAPA 1LLDA 1EK5A 2AF4C 4W1PA 4CLHA 3GLIB 2Z8YM 3L84A 2XZPA 3KBOA 5G0VA 2YY7A 2H4ZA 3MMPA 1VCIA 4B3MB 5DTIA 2OTCA 3GFQA 2JI8A 4I1SA 4YB8A 1E66A 1VLJA 2G83A 3ZBTA 1M1NB 4S1NA 4B3DA 4D4KA 3LHSA 1D7AA 4GR5A 4TSFD 2DJ5A 1YBVA 5E6UB 5A9TA 1UOQA 4KVAA 1QPGA 2YW9A 2P1DA 2HXYA 2FFBA 4NH4A 5DU2A 221PA 1GCAA 1XKLA 1X2BA 2PH7A 4F56A 3OOSA 1IOVA 4CMEA 3H0KA 3FCCA 3P0EA 3EEFA 4ZP1A 2N42A 4WVLA 5FJIA 5BWCA 2G1UA 4YR9A 1GPH1 4F06A 2VDQB 8AT1A 4ZT2A 5ESXA 3TRKA 2AC7A 3QV2A 1E4OA 1H2RS 1I80A 4Z4QA 3DLBA 4GQBA 2O5VA 4IHJF 2EFHB 2D8AA 2ZATA 2IPNA 3EPRA 3OAAA 5CNKA 5C46F 1E6LA 3DNFA 1YIOA 5DNAA 3JQDA 2CSUA 2FFJA 4KFUA 4AJOA 4AD8A 3FUCA 1N9GB 2WWGA 5AHKA 3IHKA 2LZ0A 2YY6A 3AESA 1H0RA 1ZGGA 2PH1A 1ULAA 2X8LA 3Q10A 4MV1A 3RVRA 1XTVA 4MUKA 5EJGA 2VTVA 4BYGA 1FNNA 3V1MA 1N2GA 3ICCA 3CJRA 3WMXA 1Z15A 2OZPA 3A6GA 1E3JA 4QOJA 3RKSA 4C6TA 2CNDA 1NYLA 4W8OA 1N2CE 1RXIA 1JYEA 1O1YA 1P1KA 3FOCA 3SGLA 2GEKA 2WF9A 5ECDA 3FYHA 2VSXA 1FFYA 3W5HA 1B26A 4DLKA 5IUJC 1ORHA 2B1GA 5HQTA 5IZCA 5DGHA 1E9EA 4D9CA 4BGUA 1B8VA 3OIDA 6GPBA 2BHTA 1KPHA 1F0NA 5J63A 5CCXA 3LTNC 3CVYA 2COKA 1PZFA 1W5SA 3FY4A 4W8GA 1JGTA 5HIIA 4FR5A 4CL8A 5CCBA 1UK9A 1IWBB 1W5TA 4Q3LA 3WGMA 2ZIFA 1EA7A 1ZU5A 2EERA 4L07A 3RI3A 4PTLA 4EBFA 3DH0A 3U7IA 3CUKA 4HJXA 3A1DA 4HNRA 1GGHA 1ICIA 3GGOA 4RK6A 4DJDC 1Z28A 2PSEA 1NN3A 3G59A 3BHJA 3FCYA 3GIDA 2WG1A 3VHXB 5F23A 1NYRA 2YFKA 2ZR8A 2ICAA 3PUWA 1O6BA 2WWTA 3X1XA 2GBLA 3C2QA 5K0SA 2F55A 2GBPA 4ZQBA 2QLFA 1O94A 4UTNA 4JP3A 5B1HA 3PDHA 3GRFA 4DLVA 3VPSA 3TLMA 5IK2D 1QIGA 3VR3D 2FEKA 2X0KA 3M4ZA 4MW2A 3EOAI 4HDSB 4QUAA 3VU9B 1NAIA 1DUVG 1MG5A 2D3TA 3WNVA 1L5VA 2IEIA 5DVZA 4C4PA 5LXTA 3D5QA 1ZUHA 3IV9A 4DPKA 2PZGA 1AV6A 1PT6A 3G1TA 1CUUA 4TTTS 5J5AA 3OIWA 2V4MA 2QG9A 2V54A 4UJ3A 4F5WA 2FQ1A 1K68A 3H9BA 2GZAA 3IKTA 4I4IA 1ZEMA 1W49A 4G25A 5FI0B 4F0JA 2I7DA 3T7JA 2DKFA 4YJ2B 3MMSA 3M34A 1W0JD 1FZTA 1TLFA 1SBNE 3IDQA 2P4HX 1T5IA 2BFAA 3HU2A 3CWZA 4LJAA 4GOKA 2OKCA 2XNSA 2FEMA 4KP7A 3F6SA 4KLCA 4BNWA 3OFJA 4IW3B 3U4MA 1KO1A 1X7WB 3HSKA 4G0PA 4M46A 4RPJA 2GEVA 1JKJA 3I61A 1XDUA 2Y1DA 3JAMA 5KNLA 1RYNA 2QTZA 1Y3HA 1CZNA 1SUWA 2VBIA 1QWSA 1B6SA 1RPTA 3B6EA 3EE6A 3OOHA 4LYAA 4Y9TA 4AUMA 1EWTA 2ANBA 2RB4A 4EHLA 2O1XA 1KYXA 2Q0SA 1P4GA 5AICA 4EUSA 4TQ9A 2HSJA 2ONCA 1U98A 3B53X 5HIAA 4UCQA 1N0VC 4FYJA 5JNUA 3IMKA 5GZ3A 1PV4A 3F6RA 3FDFA 2C4WA 4FQ5A 5DGDA 5DTMA 1GUYA 1VGRA 1UZAA 2ZVJA 1DBRA 4N0QA 4A92A 4BWGA 2A5LA 5F33A 4I8XA 4JJEA 3UXMA 1PJRA 3IBCA 2XA9A 2FUKA 3V4LA 4FILA 1PNOA 1P7PA 3DOCA 5A5DA 2VWHA 1NZDA 4AFNA 4NRDA 3WZ2A 4ZOBA 5B3KA 4EJSC 3KXIA 2R86A 5B1YA 2I03A 2PSDA 3HBFA 2UUOA 2QMHA 3MJ4A 4TTRA 4E2FA 4EA9A 1IN8A 4EO7A 2P0EA 3NP9A 2EF0A 3OEHD 3R6DA 3ZCSA 4LXQA 1NJ2A 2RGGA 4KX3A 1FP2A 1JX6A 1OLSA 4MGYR 5A5EA 4CKCB 2Q2WA 2E9SA 4M7RA 4Q00A 1G8GA 4DM4A 1TEZA 5IM4A 1U3TA 2ZDQA 1BS2A 1DCMA 2D06A 2HGZA 4X1YA 3WWZA 4Q19A 1LI4A 3VISA 2D1TA 4RJLA 3E1SA 3AM3A 1AS3A 1M2OB 4WGFA 2PUHA 2Y1KA 1RLTA 1AZTA 5U4QA 3U13A 3ZVKA 4N8DA 1CY7A 4P4SA 3D1JA 2H4JA 1USUA 1XF1A 2HDHA 4MVJA 3DOEA 3ZD9A 4GBJA 4O3FA 4M98A 4OH1A 4CBVA 1IUNA 2QM0A 4M21A 1VMIA 5JBQA 4PXSA 3RAPR 1Y8RA 4QNRA 3DFIA 1XMPA 3L4SO 1ABFA 1TYEB 4PYMA 4ECAA 1BJRE 4ONEA 4UREA 2Z1DA 2FTKE 2GB4A 2W6ZA 2V9ZA 1NW7A 1GAEO 2GCGA 2MSCB 3E9MA 3H11A 3IOMA 4F84A 3K9GA 3OZBA 2AHRA 3ZE6A 3H6GA 5H3LA 3ZVMA 1NNSA 4LXIA 4WA7A 4D4IA 2FMXA 4HAVA 4R9VA 4ERNA 5EUCA 1EDBA 4Z2AA 3VUEA 4YAWA 2VEDA 4KXFB 1RWQA 2QYOA 3D54D 3FYCA 5CP8A 4G0YA 1E94E 5DNCA 3BILA 4GQIA 5DYTA 4IRMA 3THYB 1XL0A 4ROSA 5BW4A 1E9VA 2N3ZA 5ALVA 3BE6A 3BL6A 4MKRA 1F14A 3AM4A 4A7PA 2ZUFA 3KX2A 3UWPA 2QW0X 3LVFO 3GLFB 5DJ5A 3OU7A 121PA 1JKIA 3TIXB 4H1VA 3VC3A 1MQSA 3KKPA 5EC8A 1SB9A 1K63A 1U1GA 3DCIA 2WFLA 1ESDA 3LBYA 4RLSA 5ICSA 4J7AA 5CYGA 3OFND 3NWEA 3QEOA 1P2VA 1SU8A 4H77A 4UE2A 2UYHA 3WE7A 2FJPA 2O2IA 2WPDD 4OLFA 3ZXIA 3N8GA 4OLHA 4B35A 4FX2A 1YUMA 3LQ1A 1T8SA 4R1NA 4O2BB 4L6IA 3F3KA 4FHEA 2OQIA 4I46A 3WIBA 2ZDGA 2KE5A 4HYTA 1S3IA 4GOND 2L17A 2YXPX 2A8YA 4YJGB 1XD2B 4REQB 5K45A 1F12A 3WA6A 3U4QB 1DKUA 3PGXA 1VHLA 3EXFB 1V5IA 1VJ1A 2FZGA 3GDGA 4KO8A 1OI4A 1FL9A 4PGMA 2X8JA 4R0MA 2G4VA 2Q5JA 1GSAA 3K1AB 4DJFC 1KDPA 2J5XA 1YJXA 3OZEA 4QYTA 2BFWA 1XZCA 2XUHA 3RYCB 1UOOA 4EPVA 1VSTA 1P72A 1ZX1A 3KKKA 3S8MA 1FNDA 3C4QA 3SF0A 3EC7A 3LBHA 3HBLA 3BMCB 3O8OB 4LY0A 4ZAZA 1G21A 4PLGA 5KEIA 5AKGA 3D7SA 3P9SA 5BR7A 2YZGA 4BZWA 4QEZA 3PGA1 1UT8A 3ZHYA 2YDYA 4M99A 2Q99A 4ANFA 1AKRA 2EW8A 3UMMA 3MINB 3TJMA 2VF7A 2H1CA 2O2DA 1JHAA 1TTQB 1XCPA 2DTXA 2PKQO 2W22A 3KZXA 4TRRA 3SXPA 4JZKA 1N32B 4K26A 1SCBA 3A3OA 2GAIA 5ALLA 3E18A 4EI8A 4Q4LA 5AJHA 4CEHB 1FDUA 5MFPA 4LQCA 3JQ8B 1Q2UA 3H4MA 4PC1A 3WLRA 3CMCO 3MGCA 4QE3A 2W6OA 1G8KA 3HP7A 4C0KA 1ULHA 3BCSA 3GPIA 4C4SA 4CM8A 4BIMA 2HCJB 2NV0A 4HWPA 5CDGA 4JT2A 2XRYA 4DV5B 3AUYA 1T5BA 4OB7A 3URKA 1G6Q1 3ZGLA 3LYUA 1UBTS 4ER5A 1XEXA 5EJEA 4PFKA 4NYMQ 4QGSA 4H7KA 3V1NA 2D62A 3I39X 2E5LB 3VBCA 4GPAA 4E12A 3ZX4A 1FDRA 3GC6A 4YI5A 2EIHA 4EF5A 3MMXA 5BRAA 1GDHA 3PEFA 1EFHA 3DW1X 2TRSB 1JTVA 1Z39A 2C4UA 1KZ9A 3B70A 2XB9A 3BXFA 2AI3A 3G79A 3BA6A 2GN0A 4LF6B 1NXTA 1GADO 1HFKA 5KCMA 5K3SA 5IKMA 3R6WA 3FFWA 2AWNA 4S1OA 4Y7CA 3WBFA 4DILA 3R40A 2BTOA 3HDGA 1Y7IA 2Q50A 2Z04A 1GCGA 2EYUA 3AHFA 4XWGA 3PVZA 4KN6A 3O2NA 4YJ2F 2YOGA 1Q1NA 4BVFA 5DCUA 2WJHA 2HA2A 1CRZA 2MDTA 5CGQB 4D57A 1MC5A 2HMYB 2P9TA 4MW0A 4K9KA 4S0ZA 1VFNA 1SKYE 4BX9A 1YOVB 5JQGF 2R8XA 1R5JA 1T2EA 1DMRA 1EUZA 2HDNB 3IIMA 2IYAA 4V39A 2FETA 1BYUA 1UBUS 5HS6A 5DN6D 1SU7A 2WPNA 3FUVA 4FNMA 4ME6A 1H6AA 5KB3A 4ZVTA 1NLMA 4PQGA 4K9PA 4PG6A 4GPZA 1IWOA 3DEAA 4LYDA 4BNFA 4BE7B 4DRYA 1MX5A 2BE9A 5FB3A 2IS2A 1WOMA 1WXEA 3CLKA 1SIUA 1U9JA 4KRXA 1X86B 4E2XA 4PHFA 1DCKA 1XRLA 2DFDA 4YQZA 5KJEA 4FYWA 1PJAA 2WMDA 1ZDMA 3BIWA 3EF1A 5TQJA 3PXGA 4EY5A 3E5HA 4WEQA 3QTTA 4ZTZB 3AV0B 4I2VA 3N2KB 5CT4A 2F3QA 5B3LA 3CR8A 2Z3VA 4YCNA 4IQ0A 4UTVA 3EIUA 5EE0A 4AN0A 1H1LA 1RM0A 1F17A 3E6AA 3O0DA 1UXGA 1DWPA 2P65A 3PNYA 2YRFA 4PN3A 3O31A 3HZOA 4FNAA 3RJZA 2OXEA 3FNIA 2EU8A 2J9ZB 3K1TA 4G81A 5T41A 1TC2A 3DMDA 4RSRA 1I0LA 2OOSA 1IQUA 3C6QA 3V8NA 2NSHA 3GLQA 4D56A 3TLJA 3GF4A 2X5JO 3NYQA 1BH2A 1SEVA 4Q3OA 5A71A 3I9FA 3SI7A 3T4XA 5KCZA 2VT7A 5CA0B 4JSRA 1N1DA 1W48A 5EEGA 3BRQA 3KSRA 1L4YA 2WKQA 3C1TA 2OC4A 4EENA 3HDQA 4JJAA 3BSSA 5CNMA 3TTXA 5EA2A 2DEUA 2JGDB 3ZGYA 1O5OA 1KJ8A 1AQLA 1NF9A 3MGAA 4X6UA 2RK4A 1AO0A 2XNDD 1H4QA 5UKDA 2Q5QA 1PS0A 5KTPA 2QTCA 2Y1LA 4B2YA 2ALJA 4HNGA 1RRVA 4ALMA 1N5MA 2IX3A 2FZCA 4YQFA 3CVVA 2FP4A 3BB1A 5ESWA 2CVZA 2V1XA 1V1JA 1EX1A 3OIYA 2NAPA 4P82A 4Q7KA 3SBOA 3KETA 3L4BC 4DR6B 2QQFA 1PNVA 1XXLA 5G4KA 4BLTA 4NNPA 3MRXA 2HA5A 1ZJYA 3IHTA 4JOSA 4U2DA 2R8BA 5DP1A 2QWXA 2A9VA 1MJGM 5LZ7A 4LF7B 2H4WA 4TLDA 1C1DB 1D03A 4DE5A 5LZ2A 2FSGA 2H2HA 3IDFA 2FSUA 5ALNA 3ISVA 1SZCA 4J16A 5F9FA 3WICA 5KTTA 4XQ0A 4ZO7A 4F8EA 1SHUX 3G2OA 4MICA 4EO9A 1SD1A 4ZOLA 1APBA 3HZZA 1R0YA 3SFTA 5A4IS 3KE9A 1UJ6A 3SD7A 1HYQA 4HN9A 2A33A 4C7MA 1FSZA 3R8XA 5ALPA 4B17A 4R31A 4IP0A 4W1SA 4G1MB 2JRLA 4F3KA 1A4RA 1XEAA 4YBRA 4R71A 1ZCZA 2V3WA 2JIMA 2WKRA 2IBMA 1LCIA 3KT8A 1BJKA 4G4JA 1Q3TA 2C3UA 4TS9A 3FVRA 1W5FA 4PWYA 4ZU6X 3ZDQA 5A1TA 3EVNA 1FY2A 4EARA 4BO5A 4BGVA 1JBQA 2F43A 3FOWA 4LF9B 1I3CA 2MJLA 3KYDB 2FSIA 4MKZA 3DVAB 1MG0A 4CCWA 2PFKA 4QL3A 3N05A 4UEWA 3NVKI 1RJ9B 2WZBA 4ENWA 1OVGA 1DRUA 1XEWY 1W85A 1C9KA 1PJ2A 1J7KA 1UEIA 2C92A 2JFOA 3LP5A 4GICA 2AEEA 2FK8A 4KQKA 5FJJA 1P7ZA 2C9OA 4FE3A 4FFDA 1QK5A 3WDMA 4BMPB 2Z4RA 3WO1A 1MQ9A 2PKXA 4K1LA 4EJFA 1V6AA 2ACWA 5HS4A 2M2IA 5TQVA 4X6XA 4WX2B 4L22A 2OBBA 4FR2A 4F7DA 1NX6A 1FQKA 4LXXA 2AJLI 4QJ5A 4XIIA 2FWMX 1OA0A 1DAOA 3TMKA 3LFHA 3V8VA 5LJIA 2ZTHA 2AUTA 3AL2A 1Q1EA 3VUFA 1TF2A 4XGKA 3T3MB 4W5TA 1ZW1A 3K09A 1NGSA 1M74A 1NF8A 2WZDA 3LX5A 5GADl 1V9LA 2NSYA 3II6X 3TUZC 5M3BA 4IO1A 2L69A 3E58A 2RHDA 3KOUA 4PVCA 5KWSA 4HS4A 2H4YA 3A6LA 2AVDA 3BXZA 3RK1A 2C7VA 1DRVA 4GBGA 2X3FA 1XHLA 5DMXA 4I3GA 3LUKA 4I7EA 2LD4A 4RA6B 2VK1A 1K2VN 1T5OA 2OM6A 2OQ2A 4PC2A 2XTZA 4QG7A 4AY2A 3EPHA 5K09A 1SNYA 4XD7D 4AY5A 4BZPA 1KDRA 5BSHA 1WXHA 4D0SA 2RI0A 2Z9CA 3B1WA 3ABSB 1J99A 1MGOA 1KQGA 3C5WP 4W9NA 1SPBS 3A6FA 1DC6A 3E9DA 3KBBA 4NX2A 1XZPA 4OGKA 5BR1A 2OFOA 4EI9A 4PTZA 1BE6A 2QRNA 4LV8B 4M0FA 5FA5A 2OHGA 3C14C 4RF3A 5AKYA 3TX2A 4NATA 2ILVA 2ZSFA 3C3KA 1YA8A 3RC9A 5L3RA 3KPJA 1LPAB 1CY8A 3Q8WA 3Q7EA 1GV1A 1HOXA 1QCCA 3HDYA 4C30A 3TLGB 1XK6A 4N0PA 3V8QA 2BYTA 1A95A 2R1UA 5CAEB 1QVZA 4V02A 2EFYA 1UMDA 3O82A 3MYRA 4JU9A 4M1TA 2JAXA 1X3LA 3MBKA 4IMPA 2NU7B 3GJ5A 1MT0A 4QD3A 4FB4A 4JI8B 1S2IA 2DFLA 3L7MA 1SM4A 4DCCA 1SURA 4G5OA 4V0QA 3NDPA 3AINA 1KPGA 2HNKA 3Q9NA 4DW8A 4IEIA 4EATA 1EBBA 5E4YA 3ADOA 3SZRA 4K6HA 2BKAA 1A5AB 2PGJA 1HE2A 4WV3A 5G3ZA 2I6GA 1EDZA 3DBLB 3JWJA 1UAYA 3PUJA 1GGKA 4CQMB 1C0EA 2JKZA 3CF6R 1TA4A 3LSYA 3NALA 3P32A 4IGKA 5D00A 2FN9A 3PNPA 1XR3A 4DQDA 3OLCX 1GZDA 2W2LD 4QGFA 4BP1A 4HEJA 2Z2YA 4FHGA 1IEWA 3CQ9A 1THTA 3HJNA 2B36A 3GJ6A 3JYOA 3Q9LA 1EDOA 1F2TA 4GSLA 4WLOA 3NKLA 1A8PA 1NOJA 2OUKA 4OHOA 2NU9A 3NAGA 3QVGB 1WABA 1CUIA 1QCDA 4C05A 1HNZB 2XKKA 3EHDA 1BVRA 1K8XB 2PWBA 3E2MA 4IIJF 4IDBA 1BCRB 3F0TA 4ARZB 3GUCA 2G17A 3WRVA 2H29A 3JPYA 1QV9A 3C3WA 3AL0C 5CM2Z 5KPJA 1G5TA 1RLMA 5EMJA 1ZD9A 6NULA 1WDWB 2VZLA 2WFZA 3E5RA 4GX5A 1K75A 1W581 4AJ9A 3LPMA 4AY3A 1QH0A 1SHZA 4P0TA 4GDFA 2W2KB 3EQ2A 2QNBA 4RU1A 3O4RA 2QZJA 3WWPA 4YRIA 1U7XA 2XZDA 3NTRA 1BFUA 4NDNE 4NBUA 4Z0NA 2XY4A 4JENA 4H4EA 4LXYA 3SN6A 5HM8A 2CDCA 1JQKA 3S81A 2JHFA 1TXGA 1H4VB 1SVUA 4I5FA 2WSYB 5K20A 1EWQA 2AOUA 3FA2A 3GW8A 4MPJA 4BGEA 3GV0A 1ISJA 4NSNA 4ZCQA 3CMMA 4NEGA 4OI1A 2VPZA 3GY0A 2IYYA 3D2AA 4MKXA 3RS7A 3LX4A 4HPXB 5ADVA 2IU3A 4EMTA 3ASUA 4EEXA 1ZKMA 4IXDA 2H1WA 3WRYC 3TZLA 2I76A 2O0LA 3QIVA 4JHLA 2AI2A 2B61A 2AOWA 2YIMA 3WL7A 1EJ0A 2JVKA 4G3XA 5CA0F 1Q1QA 3ON5A 4E5PA 4YDQA 1GPBA 5JBIA 1AK2A 1GQYA 2C07A 2VSOA 3DE2X 3P2MA 1T0PA 3R3XA 4QYWA 1EAYA 4D8XA 3BHNA 5EERA 1J2JA 2REQB 2WOJA 3H4VA 3G2JA 5DH9A 4DB4A 3N5CA 1NKSA 4K0KB 1P7WA 1IIBA 3MOSA 5BWMA 4RMNA 3ZNQA 5I9IA 3D6JA 2NU8B 1Y3IA 4R2HA 2PBLA 5FWDA 2CHFA 3SQLA 5FYQA 4E14A 4YCCA 3BL8A 3FIUA 3OBIA 3IEVA 1XAGA 3O4FA 1KA9H 1OX4A 1QBGA 2P9FA 1NC1A 3T3DA 1UMKA 4ABTA 5AH0A 1CFZA 2IHZA 3IE1A 1DTWA 3QLUA 2XWPA 2OYSA 3UV6A 1UMCA 1B3BA 2WJ4A 3N9IA 4I9GA 1FEZA 2WIAA 4NS4A 3QSGA 3VR4A 3WWEA 2R1TA 4DHWA 4QOHA 4JROA 1AD2A 1N2CA 4UBJA 2AS0A 2O2CA 2Q8QA 2IW3A 3GVHA 5LC1A 4CMHA 3ZW9A 3K9LA 2OP0A 1ATZA 5MHTA 2ZJ8A 2Q5IA 4RA9A 2O3UA 2P0YA 2PQMA 3U7JA 4WFIA 5DM60 2I4MA 1GG5A 3VHQA 2HRCA 2G36A 3CH6A 2XYHA 4Y2PA 1C7ZA 2QAIA 1THZA 3F1LA 2AFIE 5EPEA 4Q4AA 1DHRA 1JAYA 1U6JA 2JEYA 4TL9A 4WSOA 5A05A 3SJAA 2IXGA 4TZ0A 3BZBA 4RMIA 2IUUA 3ZXXA 1PW7A 1R12A 3MJCA 5BR4A 4GL2A 3PHLA 16PKA 4RIGA 5JZ9A 1B73A 1U94A 3UJ8A 4AY4A 3KHSA 5K3FA 3I4CA 4LF8B 4KN8A 5AK6A 5K6AA 1XWIA 1U7ZA 3O92A 2OLKA 2F3UA 3SVLA 1J1IA 4GI5A 1EXVA 3ZU4A 4LDRA 1WZNA 4IS3A 4YBZA 2Q21A 1V41E 2QL6A 1DQYA 2DFPA 2VAMA 4LWOA 3FSGA 2ZSDA 3X43A 5B7PA 1ISGA 3CBQA 3PXCX 1BJTA 3OP1A 3OQOA 3IOCA 4G5FA 4HQRA 2ZZNA 5MN5A 3NZEA 2JLUA 2IHYA 4FXPA 3H75A 1HDYA 2W58A 4N0EA 4MWDA 3ROZA 3WQRA 4QRHA 2DWCA 5REQA 3TQOA 3W5DA 3DD5A 3RFFA 1NSFA 4AY6A 3MQFA 3OZWA 3U1TA 2XCTB 4QULA 3MCVA 3LYHA 3KHUA 4LSGA 5D3MA 1Y63A 1ARZA 4DJ5X 2UZAA 1PJTA 3UMYA 1HO3A 3CIOA 3EQ8A 3NBFA 3QQ5A 3INTA 3PX7A 3D8TA 2XUIA 1HTTA 1SWVA 5CBKA 4HSEA 3R3UA 1R7RA 1GSOA 1N0UA 2SCUA 2H4XA 1PT7A 3HE3A 4WFQA 2UXCB 4X6LA 1WVGA 2VYQA 2ES4A 2JAQA 4N5DA 3IIEA 4KPEC 4HD8A 5EXXA 6PFKA 5HDQA 1DELA 5EPOA 1X1AA 4XFJA 1E3IA 2H5IA 2HUNA 3BFVA 4CUJA 1ONOA 2I0FA 2Y76A 1F2VA 3JARA 1MABB 3O83A 3TRFA 2ATCA 1ZM9A 4LZNA 4BP9A 3WJAA 1B6RA 3L8ZA 1XZIA 2WJIA 3IVRA 3LNCA 4FOSA 3FGZA 4KYIB 3CH5A 3EAQA 3OQBA 5L8VA 3BQ9A 4C2TA 2ZE6A 1FUKA 2XHEA 1ZD3A 2J8ZA 2Q4DA 2YBDA 5AR1A 2W42A 2EDCA 2GXUA 2QSZA 5EQDA 4YRKA 3P5BA 1NW3A 5JD6A 3CZ9A 3GCWA 1EX6A 1P18A 2LIVA 3A1VA 3DO6A 3FFXA 3LGAA 2H2FA 5EE9A 5FTJA 4A6DA 1I7QB 3CPJB 5IF9A 2J0EA 2LNDA 3GUVA 4ZREA 2WT4A 4LGCA 4Q9IA 3WNBA 4KREA 1P8JA 3C5HA 3EW9A 2ZAGA 1Y7HA 3D5EA 2ORIA 2YYYA 1J2EA 5JJLA 2Q6TA 1NR1A 2OECA 1YA4A 4EG1A 1RXSA 1THGA 3K94A 4A8JA 5LQNA 4BVHA 2MYNA 3UXEA 2R4QA 3DS8A 2K7FA 1PR2A 2VTKA 1MN6A 3T7AA 3NC0C 2PV0A 1E3LA 1NVMB 1RWWA 4RV9A 4LY6A 4Y2HA 2OXCA 2Q1WA 4OYLA 3BE8A 2XMPA 4ZFNA 1YR7A 3GZJA 2I4RA 1Q7TA 3LVRE 1BROA 1DVRA 3VBEA 1ORWA 2HA7A 2O7SA 2R00C 3LK7A 5KYUA 5KJ1A 2WUVA 1PFKA 2CCKA 4GUDA 4Q1EA 3VU8A 4NXNB 3ZI4A 1NN5A 1VKNA 5BNTA 3OF3A 1H6DA 1BHO1 1P7CA 3GU3A 3K96A 4FBGA 4MR9A 5KKAA 2XOKA 2ANCA 1F2UA 3VR2A 1SOVA 1P60A 3H1PA 4KRGA 2B4RO 5DLPA 1KXJA 4QRDA 3WLAA 2ISQA 4JBIA 2P8JA 3D0OA 3EF3A 4PG8A 5L45A 1MO3A 4LE2A 4QTUB 3ZLUA 1N5JA 1JAIA 1KC3A 1XIVA 2A0YA 1IUKA 4JT8A 5CLHA 5THXA 3UICA 4AJJA 4ENUA 4RTLA 4L72A 2Z2JA 1USKA 4NE9A 3AFGA 4U6QA 3A1CA 4NP6A 3RO7A 3E9RA 3RSSA 4MO2A 5FH9A 2O3QA 1HEIA 5K0CA 3K30A 4FCCA 5JXHA 2AYXA 2GXSA 2P9ZA 3WLJA 3M81A 3VZPA 2PS0A 4DANA 3QWHA 1HL7A 2IHBA 1XQXA 4JXXA 3NRJA 2QAGB 4HVCA 2BRUC 4RF4A 4RMHA 2XDYA 1MAHA 5E7IA 1A8QA 1XEWX 3VMFA 2FSSA 1LLUA 4GYYA 1K8YB 4DYDA 1CUFA 3EXHA 2YC4C 1UJ2A 3QU4A 3A0UA 4UOZA 2BI8A 3Q85A 5C4MA 4MW6A 1AGYA 5CJPA 2DBRA 3SLGA 3AERB 2QMOA 2XGOA 1I3KA 1Z25A 5IM5A 4BO7A 2X5XA 4LGMA 2BFFA 3AR5A 1OV6A 3L01A 1DB3A 1UKVY 1Z5NA 2F7SA 4MWTA 5NLLA 3N2ZB 5KOHA 1EUCB 5K3CA 4J9VA 3OPYB 3K20A 1C4XA 2I8CA 2G1AA 4IO0A 4U5XA 1KEPA 4RZIA 5SYAA 2EZ9A 1ZGHA 2JGEA 3NWBA 4UD2A 2IC5A 5DISB 4CCYB 2WT8A 2Z8YA 1QFZA 5LSAA 3D1VA 1CQIA 1ZD8A 5K8LA 3KDSE 4PSCA 3K6RA 2OVBA 1K6EA 3GJZA 2XNKA 5EJ2A 1C0KA 3W6NA 5BUCA 1JL3A 4G8CA 1Z16A 2A1UA 3A1TA 5GJCA 5BT9A 2QRMA 2WKPA 3INYA 5B58T 3UHAA 4I66A 3B2QA 3GBPA 1ADYA 3DO5A 3KJQA 3T34A 1DAKA 3CEHA 5GP1A 1R8SA 4EL5A 2QORA 4D79A 1U0GA 1JWBB 3A9TA 4MVJI 4QFBA 5AXAA 3TOXA 4LSMA 4RLHA 1L5OA 1P1BA 1W1IA 4JNKA 2LCFA 3I30X 4RACA 3DVRX 5BVGA 3WAGA 2E4VA 2WKWA 3EH1A 2I4IA 2ZJ1A 2C8KA 4LBYA 4Q3NA 3TH5A 1HFEL 1PQYA 1RWVA 1BQ4A 3K6KA 4OPMA 1KZ4A 3ONFA 2B37A 1ODCA 1MP0A 2NYVA 1JHDA 4J29A 4R8SA 3X2SA 3RJ9A 3HCFA 3HGMA 2CDNA 3GRZA 3F5DA 4Y8VA 4BKMA 3AT1A 3OQ1A 4YYEA 5JUWA 4A8HA 3KSUA 1EFDN 3DZHA 3PU6A 1LXCA 2B7LA 3PFHA 4NFSA 4Z4HA 5EQTA 4Q1BA 2VYND 3R0JA 2E89A 3C5EA 2C5SA 1JHQA 2BMAA 3UWMA 5E7QA 4EDHA 5JD4A 3E3AA 5KC8A 4HX2A 1RYEA 3HVRA 2CB9A 1JIUA 1MA3A 2QVYX 2B9EA 3PEYA 3H86A 4GHWA 4IKEA 1K9SA 3ZBPA 4CMEC 4DADA 5LR6A 3ZIDA 1AGPA 4J0CA 3ZHSA 3RUCA 1SGWA 2HIGA 4U7GA 1AVTA 2Z9BA 1R0RE 4HQLA 4X8OA 2OESA 3ECCA 4QJ4A 5EZ6B 4H7IA 1ZMBA 3TTSA 4BVLA 1JYFA 2INGX 1TAGA 2OGWA 3B1XA 3Q40A 5L3SA 1KEEA 3NPAA 3OMXA 1NPTO 4HLQB 2AW3A 4I4TF 4OKNA 2Y1GA 2H08A 2QT1A 3BHIA 4OQZA 4YPVA 4CT4B 1ZISA 1YA6A 1MB3A 4DV3B 2H8KA 5EHZA 5KSOA 1E4VA 1RIIA 4D45A 4BIIA 5EXDA 3NEPX 1AUVA 1QH8B 3VHLB 4JI2B 3EDQA 3EGVA 2GRUA 3KVYA 1T35A 2FQWA 4UDOA 3UH0A 2NUTB 4OHVA 5PNTA 3RUAA 1AG9A 2L0XA 2POQX 3MWDB 1XSEA 2ZR7A 3D3WA 4A0RA 1PBTA 5LYJA 3DEFA 4FW9A 3RBXA 5F1YA 1E9RA 4EW2A 1WETA 5IZCC 2EGUA 1U3VA 1Q84A 4JYZA 4YROA 3PF9A 1M6VB 2YWJA 4OK5A 1E0AA 1ZA2A 1YRBA 4RCYA 1XDGA 2HW8A 1E6MA 1YR6A 1SU6A 1FMLA 4MW5A 3TRDA 1KBZA 1C7EA 3OOYA 4AJEA 3U60B 2CF6A 2YVLA 3DLAA 3H2GA 4OU5A 5CFLA 3LO5A 3QMMA 3SHFA 2GERA 3DMYA 3KM0A 1ZU4A 2IDJA 2J59A 1U2DA 3IBSA 3UCFA 1KARA 1T6NA 4QBHA 4BO9A 2APJA 3FTQA 2ZB2A 3KSDO 3NWJA 3EUAA 1UBRS 4TGLA 1EGVB 1ODJA 5AYVA 4E22A 4NOLA 3J81k 1KYWA 1LJLA 5AESA 1RAAA 3AR9A 4F6CA 4R1UA 1L7MA 1RWOA 1K0FA 2GBLC 2QXYA 3DGFC 3M33A 3WMGA 1PR5A 2YYAA 3PHIA 3MN1A 4HQOA 3O74A 1O4WA 3JQFA 4DABA 3KQHA 3K4PA 1N4DA 4II2A 2IV7A 3UANA 2C99A 5H8WA 4RF5A 1R4MA 1ISRA 2GF9A 1U1CA 2GFIA 1IVNA 2ZIAA 2MMCA 2ZWPA 2TECE 3NU1A 4Q48A 3VV2A 5T7BA 2QGZA 2HV8A 3L7KA 4DMFA 4JKIA 1L6IA 4KBFA 4OFWA 4V0RA 1EVQA 1PSDA 5IVPA 4BFTA 1UKAA 3K70B 5T8KA 3S2EA 3FB1A 3ZKAA 3EIHA 2EX0A 4HRAA 4BWYA 4HDCA 1TUBB 1LK7A 2G9UA 3AF5A 3I9JA 2NP6A 1DQNA 3WMFA 1EM8B 5KX5B 3QNMA 5KYWA 5DM2A 3LJKA 3W1EA 3OH8A 2QGNA 4DIUA 3OQ6A 4C3UA 2IU4A 5B36A 3PE3A 1TTHA 1U90A 1UDBA 2BCEA 2Y2UA 2HF8A 3BTUA 2MSLA 3EUEA 2ATXA 2TMDA 3QEKA 4RETA 4N7MA 5B64A 1JILA 1QP7A 4NMMA 5F7OA 3V4PB 1N6OA 2A6PA 4JX8A 3WLKX 1G66A 1DO8A 4BEWA 2PHZA 5KYYB 3ZJYA 5AKHA 2GFHA 4FDTA 3NFRA 1KVRA 3OJXA 1NMEA 4AYXA 1U2TA 2VXCA 3NTLA 2VPPA 4JLPA 1PV1A 4B7UA 4UOEA 3OOWA 3BIOA 2XUFA 1QKJA 3I01M 4GXTA 4Q7LA 3TEJA 3FRJA 1EE1A 4BGDA 1HR0B 1ES9A 3VR0A 1ZNQO 3UYKA 4EGFA 4R7GA 2GCIA 5BWOA 5GIPE 1Y4AE 1BEEA 1L8OA 3SMQA 5K8CA 4D6YA 4GXRA 5KO2A 3H3JA 1NX9A 4ZK2A 3A4YA 4MUFA 3RS2A 2FN7A 3KYIB 3L7DA 4I1YA 1W4RA 4RZ3A 1MPTA 2H18A 3E7DA 4P33A 3SC4A 2HK9A 4DV1B 3OICA 1E3WB 1WRBA 2B5VA 3VPBA 4ER6A 2NUPB 2V5AA 3ZE7A 1GYQA 2I34A 2PDAA 3VNRA 3THXA 4XYBA 3SSMA 3KAPA 3COJA 1RI3A 1FFEA 3WLIA 4DDWA 5JOQA 3BGDA 5C8YA 2MINB 1P6QA 1J5PA 3FPSA 3O9MA 1EP9A 1PR0A 1H23A 1SU4A 2CXPA 2J4CA 4P8RA 4XR9A 3E9EA 2YN4A 4XASA 3R3WA 2VN8A 3ESCA 3SPXA 1IDOA 1HUQA 3ICQB 3K8ZA 4JYBA 2IEZA 4R68A 3RFXA 2MSKA 2D5CA 3GCGA 5DOZA 1I7DA 2WMYA 2ZRKA 1DP4A 4K05A 1U5AA 4C3ZA 4K3UA 2AYZA 1YC5A 3V34A 1B8NA 1RAHA 3D43A 4FZ5A 3JQCA 1ECFA 1QFYA 1VE5A 3KB8A 4YFYA 3VO9A 4MS4A 1FQJA 2EGGA 3JVEA 4YUZA 5AQEA 1MV5A 2G82A 2ZYAA 4TROA 3EVCA 2FFQA 4KGZA 5HFNA 1A8IA 2ORED 5BW6B 1VMEA 1LPNA 1YWGO 1M2FA 2PS1A 4P22A 1Z88A 3HKDB 3KE8A 3NHWA 5GV7A 4QSHA 4EEZA 1JHMA 4UM9D 4HNHA 1COWA 5FRDA 2CVHA 1NNEA 4LQDA 3O4GA 1W88A 5I9TA 2PQ0A 2VF2A 4H16A 3MWGA 4B8ZA 3OZXA 4YAOA 3SM9A 2ZI5A 3RLIA 4UUBA 1CJBA 1JJVA 5C1IA 2B2XA 1T0UA 4HDNB 4P2GA 4XDZA 1PFYA 2LXNA 4DR1B 2WYVA 3H1EA 3R5XA 3MXTA 1G8MA 4H7PA 3CWCA 2XECA 5FLEX 1KEWA 3TBKA 3FOEC 2FEXA 3HPRA 3E8SA 4PZAA 4F45A 3DBVO 5EJFA 2OO7A 2WUFA 1OXTA 1NI4B 3ILHA 1C8KA 4H4DA 3AY0A 5JD3A 4RVDA 1TQ8A 1I3OA 3ADCA 2PCLA 2ZSEA 4I8DA 4EDFA 1G19A 4KFRA 5LP6A 4KB5A 4JV5B 4WZAE 1N2SA 4HWKA 4C0SA 2JLAA 2AUNA 4TLEA 2OO3A 3S4YA 4C0QC 1VDZA 3OQPA 4TKUB 4E4TA 2XTNA 2ZIGA 1VE7A 4WNCA 3P26A 1EWKA 5AUOB 3O38A 4MW4A 1OHHA 1TYDE 1Z75A 1LSSA 4BLRA 5LU8A 2DBZA 5JJKA 1N7IA 3DT9A 1XU4A 4O6VA 5ALYA 4GNRA 2VAPA 3AVUA 1XTZA 1OREA 1XCGB 3GA0A 5KNCA 4BQIA 4KUEA 1D2NA 3JQAA 4HO1X 3PRYA 1A9PA 5AW8A 1T36A 5ETJA 3OFVA 4IXMA 3LI2A 1FMJA 2R11A 2W0MA 1Q3KA 2XTAA 3ICVA 2XCSB 3REGA 3R20A 3PL5A 5BYKA 3I1FA 3OQIA 3C8HA 4QG3A 3BXOA 3EG9B 4AJPA 4F1KA 4A91A 4KMRA 1RRCA 1VDMA 2Q6IA 3FLAA 1Z6XA 4PFJA 3ZEIA 5I9LA 1G98A 2HMUA 3A6PC 4TZ6A 5JJCA 3A70A 2ZJFA 2BR3A 4GWGA 4IDPA 1DBSA 1Q7EA 2YWHA 1XQWA 3ADKA 2B6NA 2P9CA 2Z1MA 3BK2A 3D3QA 4NQRA 4AF7A 3QEMB 3MC1A 4QLAA 5FV7A 4WJLA 1V45E 1FK8A 1Y9ZA 4B34A 5JQGA 1UJ5A 4MYUA 2P6PA 1EFLA 1BX0A 3KJEA 4I08A 1TYAE 4KCGA 1E2HA 2WSBA 1IPEA 5EHXA 5KU7A 1N5KA 3GLKA 3CRNA 2QU7A 3LCRA 1I4TD 1WUHS 2GEUA 2PR7A 3LL4A 4Y2XA 4C76A 3S68A 1YSCA 4DWWA 1M0WA 2VXBA 4US1R 1OXBB 2AN1A 5K2MA 1LY1A 2Q4EA 2VR1A 4RFLA 3TW8A 1NN1A 4BNDA 4DUGA 1GR1A 2WSLA 2D5IA 4NCXA 2FPIA 3ETNA 1AUQA 2P78A 1W94A 4RADA 4DMMA 1V7QA 2QS9A 2G80A 3U4HA 5B3JA 1L4KA 4E15A 1XCOA 1K7XB 3ULKA 3ESYA 4AUEA 2BH9A 4KI0A 4F72A 3W9UA 1CY2A 1DOAA 1WLSA 1YULA 5H3CA 4IMJB 2UAGA 4ND4A 4XIGS 5A3JA 1B0AA 3PNVA 3RSQA 5KUTA 1HOTA 2NLOA 1FNBA 3UKDA 2DT5A 4P38A 2D4HA 4NFLA 5EMKA 5JRZA 4WJZA 3LT0A 4IZOA 4M1YA 2PUBA 2B30A 5FOVA 3SQDA 1ZH0A 2NZXA 5HRAA 3I12A 1SR8A 2Q8NA 3AB3A 3UVEA 3HYCA 3KR9A 1K6XA 3M4XA 3UGQA 1M2WA 4ZIRB 2JLSA 3PKJA 1U9CA 1E92A 4PSDA 1I7PA 5HF8A 3QW2A 3MQ2A 2GLUA 1XB2A 2X77A 1G17A 2Q28A 2OILA 1VA4A 3FRIA 2WIJA 4FBMA 4Z5XA 1DX9A 1GQFA 5KX5F 4TRNA 3RANA 3N6VA 2Q3CA 4NC9A 4G85A 1ESEA 1FNMA 4O2AB 4RVNA 4ZQIA 2O7NA 4RO0A 5ILQA 5JCJA 5I7OA 4HUTA 4H08A 4RULA 1H4SA 4I3FA 4FM9A 4P6VF 4JI4B 1AX9A 4KGDA 3K0AB 3CT6A 2EV9A 3UXHA 2PQ2A 1PZEA 4UZSA 1BWPA 1M76A 3DXXA 2XE7A 4EFKA 3ZDCA 1QQ7A 2E3JA 5G40A 3H8JA 2Y3IA 1OFGA 1V39A 2VK4A 2GYYA 5CIWA 5BSEA 3H87A 5EJ6A 2EBWA 3I0ZA 4Y6PA 2KS6A 1N34B 2P2SA 3ENNA 3K9CA 5KVCA 5B4VA 3L77A 5CDTA 3HRHA 3CW8X 2C97A 1Z82A 4GGOA 4LOKA 3QZUA 2GNPA 3H84A 4PPGA 4B44A 3WGZA 2DH5A 4H0CA 5SV2A 5FPYA 4NCHA 1IOLA 2I1VB 3D2LA 2FN8A 3KK0A 5K6TA 3U7EB 3WQSB 4JI7B 3K4HA 2J48A 2QD4A 2WJ3A 5K8UA 3P9RA 3B1VA 1WCWA 1N92A 4JD5A 3GQVA 1YS1X 3SOPA 5LIRA 2RGRA 2VK2A 1DV2A 1SBYA 4NDAA 2FJUA 5F1KA 3UWDA 4OLBA 4ACBA 2A1TS 1G3QA 2XT0A 3IILA 4NZNA 3IBTA 5A7FA 3UG7A 2CFIA 4QUDA 3G13A 2N9UA 3UMBA 1Q0ZA 5BMVB 3ABRB 2JGJA 3H04A 3IP6A 3T06B 2IZ5A 3UNXA 4N4AA 4NXMB 2B8JA 2FPWA 1SIBE 3ETJA 4XOIA 1NZJA 1MJGA 3BMOA 4NK5A 1NVXQ 1V43A 3ZV6A 3HA2A 5IW8A 3K35A 4AM8A 5AI6A 4AZVA 3BXGA 2C7QA 1OZFA 5CT6A 3KKLA 3DZFA 2AFIA 4JR0A 4A26A 4MA5A 2CNBA 3TQFA 1EFVB 3SIPA 2XW6A 3DAOA 2F3RA 3H2KA 2FWNA 3IUEA 4RMJA 2QPTA 3LO8A 5TS2A 2Q0QA 4N5NA 1CUBA 3OT5A 1P4AA 3ER9A 2NP7A 1MOZA 4BQFA 2D1YA 3BOSA 1IAQA 4A16A 5J5CA 4XWTA 2XOEA 4HBGA 4PCVA 2C2HA 3TLKA 1I2BA 1SKQA 2PX3A 1DU4A 3PA6A 2W11A 2A9FA 3DEJA 3ZWCA 5CITA 4UAVA 3W8RA 2X0NA 4L5IA 2Q5EA 1XZKA 3T5DA 4C0JA 1IOZA 1EXMA 1ZWLA 2PGDA 3TLEA 2BEVA 3AWDA 1RC0A 2GD0A 3FPGA 4WI1A 5T4FA 4OXXA 3U3OA 3NWOA 4L7QA 1DUIA 2H1LA 4IQ8A 3N7UA 4O5OA 4TYWA 1CZUA 2O8NA 4RD2A 1N7JA 4PLTA 4AU1A 4ARCA 3K1YA 1SUSA 1BOOA 3PDIA 3FHCB 4LEIA 2V5UA 3GJXC 4MV3A 1X7XA 4BJ6A 2EQAA 4BYMA 4ENQA 4WL0A 1JNXX 3QFTA 3ICPA 3CNBA 2G04A 4Q4JA 4WLUA 1MOQA 2VNJA 3L92A 4RIHA 1UXJA 1DFGA 2BV3A 2X40A 4FGZA 4W63A 3VYWA 3ZIAD 6REQA 1UBCA 1V1MA 4EUKA 4M3NA 2P5SA 1QIDA 1BVUA 1EHIA 3K9HA 2Q4OA 4ML3A 3DEKA 3OD5A 5C7OO 2VTDA 3CPSA 5FPTA 1ZZEA 4GVPA 2H1SA 3ZGOA 2GBIA 5E4TA 4Y9SA 4QU5A 3G7SA 1I32A 5FFNA 4I3HA 1TM3E 1FUUA 2G0TA 2JIOA 1T25A 4DMRA 3P9QA 2Q6LA 1KNQA 1CERA 3G5AA 4QXQA 3L6BA 5E1OA 3WSWA 2V55B 3T9CA 3EN0A 3QU2A 1HX7A 5AKXA 5IARA 1VCHA 1TC1A 2G88A 2H54A 2ZUDA 3LT4A 3L1KA 5G1PA 5H82A 3QE2A 3VYTB 4B6SA 4RVCA 4CNQA 4QJBA 4BMXA 1ZJ4A 2GASA 1VRWA 4MJXA 5AW6A 2O59A 3CCBA 1R4NB 2IQ5A 2D8MA 4UUQA 3Q3HA 1RLIA 1Q74A 4PQRA 1KZ6A 4E1AA 3RG2A 2WSIA 3CRMA 1X77A 3M2TA 4BFVA 4ZJUA 3KR2A 2P2CA 3CISA 3KQPA 4TWBA 4EL0A 4Y6RA 1KK3A 3UZUA 3ICWA 1O4VA 3DKPA 2IX9A 4BNNA 5B6JA 4UEKA 5CLIA 1G20E 3DJFA 5DBEX 4YVFA 5FX2A 2IUSA 1MNAA 3A9UA 4NMXB 2OO5A 5JY6A 1QTRA 3B1JA 2COUA 4JI3B 3V55A 1KXZA 2ZUTA 1IK6A 3UUGA 4IVNA 5BUSA 5I7RA 1RRPA 3JD3A 1EPUA 4CRWB 2BTEA 1Z6PA 4YRGA 4ZI2A 2Z3ZA 3S1AB 3DKRA 4W9NC 2J9YB 3D7LA 4YONB 4IIJA 4B6OA 4YUYA 4MV9A 3PLNA 1MB4A 5BYBA 1Z5OA 2QUIA 2ZB7A 3VYRB 2IYEA 3C3DA 3IEPA 1E61A 1P6XA 3HV0A 4JVOA 4NOKA 5DM1A 3V8EA 3CRW1 3EVTA 1H6BA 1JJ7A 4GX0A 1ZGAA 4DIEA 2AEJA 1DBPA 3AEQB 3GBSA 2ONJA 4HGZA 2QX8A 3RIGA 4LN1A 1CDOA 4UDXX 4MROA 3TIVA 3HO6A 5FBHA 2DUNA 2J9GA 3LP8A 3WKDA 4QHSA 1Y80A 2P9GA 4W9MC 4KPFC 3RUEA 1PL7A 1PR1A 4FIZA 3VO1A 3WKEA 2JD0A 1SA0A 3FCXA 1R3DA 5DHAA 1LVUA 1Z0ZA 4LVOA 3AJ9A 1M9NA 4H7EA 1T5HX 4N3AA 5IANA 4CMKA 1HI9A 2ZW9A 4AG3A 2AN9A 2IXBA 3IJ5A 4Q05A 4PRLA 1RPZA 3IQXA 1RDFA 3AEYA 1BXZA 1FYVA 4YWJA 2GVDC 3KPVA 1ZK2A 2BUAA 3WSVA 1G5FA 1RR6A 2MSEB 1PT9A 4LWPA 1FTQA 2BM8A 4C0AC 2RGUA 4ASUA 1YJ8A 2F90A 1P81A 1P4RA 3IXMA 4UC0A 1NHWA 4MQBA 2CKMA 2PGLA 3GMSA 3D2BA 1U5BB 3CVOA 4UVDA 4LDJA 2BHNA 1UBGA 2MSDB 1DXOA 3D81A 5JE8A 5A5VA 4LOIA 3DMHA 3V4OA 3QXJA 4HHEA 4JY7A 2RAPA 2OG2A 2FEPA 2FVXA 1ZS9A 3MS2A 4PX3A 3WI7A 3N39C 3A9CA 2I71A 1HT1E 1Q0SA 4G26A 4CHGA 4IDEA 3LV8A 5FLYA 3O4IA 1EUYA 5DX8A 3VYUB 5DYNA 5DT2A 1WY7A 3UW1A 3EWIA 2REOA 4QDJA 2ISCA 1GNVA 2HADA 2JF0A 4LRWA 1SN7A 3SFZA 5I4KA 5DRYA 5A3VA 2YHSA 1VBNA 4U02A 3GARA 3ACCA 4CV0A 4JCCA 1ZVJA 2C3MA 2IEYA 5C2JB 1DJPA 3R3VA 3G2IA 3AILA 3K15A 2C7PA 4MKIA 2XMRA 3O9ZA 5AW5A 5BN5A 3IOYA 4IIFA 2ODAA 4J94A 4XB1A 3DV0A 1G1MA 3KPUA 4N3BA 2XDQA 2ZRHA 3TQCA 5K8JB 1GPWB 2JH8A 4ESHA 5JAIA 1ZH4A 5WRFA 4QC2A 4D1YA 2CVQA 2GZ1A 3E53A 1FUEA 3H16A 5M5BA 1I6LA 2AHOA 5M04A 4CLRB 3S29A 2EVWX 2IDMA 2J6BA 1IXRC 2Z43A 1YRAA 1U0TA 2FPGA 4LQLA 4MR7B 4TV8A 3CX7A 1CYDA 1Z2AA 3BD8A 5ICEA 4EQZA 1A27A 2XSZA 3JWPA 4MCHA 1FP4B 1PUXA 3AIOA 2M6KA 3REQA 2X42A 1DG1G 1Y1SA 2XGSA 5IC5A 3CEAA 3IAM1 1UEJA 2IEAA 3PFGA 4OL9A 3EZ9A 3E23A 3THSA 2M6SA 1Y6FA 1NTRA 4HUJA 3EAGA 1QDUA 1TF7A 4UEOA 4F60A 3LP6A 1SC1A 3OZ7A 5AM3A 4OD0A 4JP1A 1R0LA 2YMMA 1S2NA 3JVDA 4M0KA 4KXWA 4XPZA 5JCOA 3W04A 4W1QA 2IYOA 3P9YA 3PSHA 5LNK1 1OBHA 2X7XA 2YV4A 3QLUC 4OSPA 3NJ8A 2V98A 2J6CA 2TS1A 4U7FA 4P32A 1FFDA 2VQ6A 4X20B 3KV1A 2C2XA 1ZK1A 1ZCBA 3QX9A 4HSGA 5DDIP 4PR3A 2QYTA 2VBGA 2PU5A 1KJ9A 1IB0A 3GJYA 4BNMA 1EJBA 3OLQA 4ZVQA 2OB2A 1IBKB 3PSAA 3MB8A 1O95A 1SC3A 2DSTA 5I01A 4KLNA 2Q1XA 5DBGA 5JCPA 2GF0A 2ZBUA 2R48A 2E4ZA 2GZDA 1L5HB 4JBNA 4RH3A 3RFTA 1JPJA 3TCKA 3V48A 3VV3A 3WTCA 5JO0A 1SUIA 4CMIB 4JC4A 2OBLA 2OQRA 3U7QB 4QXOA 3CS3A 5P21A 3MPOA 1KK0A 4QGBA 4PE5B 3A06A 4J0KA 3PJRA 4F9FA 4TYMA 1UPTA 1QHIA 4B31A 3MRVA 3HA5A 4E6EA 1SBIA 1I13A 1QYXA 2CYCA 3CRZA 3S7TA 4I4LA 3UJCA 1ZI8A 3L1VA 1ZN9A 1POWA 3MBIA 3I8XA 1Y8ZA 1S8NA 1Y6ZA 3LSTA 4J75A 3ZCTA 1NSYA 3SYNA 2X0JA 4KE8A 2BMEA 1K3UB 3PENA 1PO7A 2IFTA 1UBFA 4R3WA 4TVBA 3W4JA 1FSFA 2VFAA 4I36A 1JG1A 4DR3B 4I81A 2FSHA 1RZRA 1BDHA 1Q0QA 4Y18A 1GOTA 3NAZA 3S28A 2E5WA 3COPA 1RHKA 4O08A 4RENA 5F3RA 1BH6A 1KAQA 1YI1A 2AI1A 1XJ5A 2X4IA 3PT9A 3LGSA 4JBLA 4Q4HA 3OAAD 2QL5A 1PG0A 1UBLS 4ZO9A 3R7WB 3GMTA 3GUZA 3R09A 4CE6A 1D3AA 4E7OA 1QQ6A 4OQMA 3HY4A 1SZPA 2DUJA 2W4IA 1XZNA 3RUFA 3RU7A 3IVMA 4CM9A 2QY9A 2J67A 3U3RA 4TWZA 2Q0XA 4ZK6A 1ZNZA 1L4MA 1YCFA 5HTKA 2ZJ3A 4NV3A 5FQOA 4GOMD 1PZGA 5ADUS 1WD7A 1ZD4A 3L5OA 4S24A 3REOA 8ATCA 1NXVA 1XQ6A 2B98A 3BFKA 1Z4NA 2PRSA 5IAEA 3WRWA 2P9HA 1U8XX 1AOXA 3H8VA 3OE1A 4HEA1 2GKSA 2X13A 1GCUA 4GOJA 4YRCA 5AO9A 2W4MA 3KV3O 5ERXA 4E5NA 3OSZA 3HXMA 1OOEA 3V9PA 1NULA 4DLSA 1JI3A 2DZDA 2VJDA 2XYGA 3IQHX 3Q41A 1UUFA 4HN4B 3UMCA 4A0GA 3RROA 2NUBA 1R6UA 3AFMA 3MLEA 2JCGA 3F96A 3I53A 3G7NA 4IFIA 3PD7A 4O4JA 3VSBA 4COKA 4B09A 4CTOA 3HM2A 2WJWA 3O2SB 1AO3A 1RZ3A 3QUCA 5KYTA 4ITVA 1XJWA 3SWWA 3PQ5A 4YIHA 1C3XA 3KJHA 2G70A 1K3TA 4D4GA 5J4YA 4KLAA 3X1DA 3VHRA 4B7XA 4DS3A 1IBMB 4G89A 1K2WA 1II8B 4O3MA 2D6FA 1FTWA 3UKOA 3HHPA 2J41A 4A2QA 4KDRA 4IEEA 3T7EA 4ZOEA 1GTRA 4OQDA 1EESA 4LW8A 5GQSA 2ZSUA 1KKLA 4HAZA 1V3UA 2JVJA 2OA0A 2QW1A 4D3DA 4RLFA 1O6GA 1O94D 4DAOA 3W7AA 4G1CA 1NG9A 2JZOA 4OQYA 2ZS7A 4BNXA 3TDNA 2H57A 1JVBA 3W90A 4UBOA 2NM0A 1B15A 3TZHA 3LCCA 4QQRA 3R3JA 3HZRA 2V7WA 7MHTA 2VYVA 2H06A 1K5HA 4BNKA 3BQMB 1EB8A 4PONA 4UXIA 4FUQA 1E3SA 4LUCA 4PAGA 1L1EA 3OQMA 1ULTA 2CW5A 2GBGA 3RUPA 2B3TA 3E9ZA 1GSHA 5FWNA 2XMBA 4KH0A 4JI1B 4MW9A 3ZHXA 4BC1A 4C0LA 1OXXK 1AHHA 5F1OA 5HF9A 2E48A 1GQSA 1L7PA 1JEOA 1EQUA 3FRHA 3IR5A 4LRYA 4A1OA 4M0PA 2E5FA 4Q9KA 1LF5A 3KOXA 2XTJA 3RRJA 5ESDA 4OFXA 1CXZA 1BX1A 1U3GA 4IOLA 1O7JA 3UJBA 1NXSA 3RSOA 1K97A 5L3QB 4F5YA 1W0KA 1WU8A 1V95A 2QPLA 3C7AA 2ERCA 3E35A 3FVQA 4UVEA 4AO7A 3O8CA 1L5SA 2JEZA 3N0XA 3U09A 5LP1A 5JDCC 4H0NA 1GT91 2F8SA 3ZWAA 1L8XA 3EC1A 4DCSA 1P6UA 2CVFA 3I52A 1W75A 3JWEA 4BQPA 5J23A 3RNLA 3GFOA 1ESMA 1W2HA 2ZT5A 3OO1A 5BN3B 5CYFA 4TYNA 3PS9A 2C77A 3TMYA 3GFSA 2W8BA 5AK3A 3RYFB 2M9MA 2DB3A 5EWMA 2C0QA 3DFKA 1P2FA 1JMVA 4ZV4A 3OZCA 4DBVO 5JEDA 4YAJA 2NZUG 3CLSC 3H5VA 2DR3A 1YB5A 5HSGA 5I7AA 3HA3A 3HJUA 3UAZA 4G0OA 2FW7A 3HKBA 1GNQA 1V7CA 1QVWA 3L6EA 3RHTA 1EUDB 3U4GA 2E4WA 4NCBA 1ODTC 4X7MA 2CHVA 1I14A 3NIGB 4UM9B 1Z4PX 3HQ4O 1GTJ1 1T9BA 5FL7A 2A1TR 2VBCA 4K6MA 5K4GA 2PJRA 1JKXA 1M6NA 1RRKA 2CUKA 4WQMA 2WM3A 3L3BA 5B53A 2IK8A 2OZVA 3KB6A 3LNTA 3G2MA 4CQLA 2WD9A 4AKHA 4RPCA 4ZVRA 2JFXA 1H1TA 1CUSA 3PZRA 4WK4B 1UBSB 2GFQA 2RHTA 1OH8A 2VNHA 1NXQA 1JNYA 3CVXA 2FPSA 3GVIA 4WZAA 2YFHA 5HRUA 3NBZC 2XCRB 1RACA 4MVJD 5ALDA 1FP1D 4D4JA 2H2DA 1E8DA 1GRCA 1N57A 2XJ4A 1E1DA 3EXG1 4H18A 1SC4A 4KPGA 3NHAA 4WA8A 1R8QA 4LIPD 1SBZA 3H5LA 3R5TA 3ELYA 4RE5A 3LHFA 5KYVA 5ITZB 5K0BA 4I50B 5AVVA 2WRZA 3AM5A 1ZITA 4MUYA 2NO5A 5DNDA 4WY5A 2M98A 4K9MA 3NTOA 1MJHA 1KIMA 1E2IA 4WLEA 1WMAA 1C0PA 2PVSA 1DBIA 4HDRA 4K0RA 4CLDA 3Q1KA 4R2LA 3JQRA 1KNXA 5FKJA 1VSUA 4CKYA 4WY2A 2ZJ7A 4HLDA 4A6PA 3TINA 2NZVG 1A7UA 1E2EA 1LUAA 1GNPA 1UDWA 2PRJA 3G0CA 3DLPX 4FOTA 4MR8A 4OHUA 4IIVA 4JI0B 1M2HA 1EH5A 2VA8A 3ND6A 1C0LA 2ZANA 4UEQA 1R8JA 4RJ2A 2Z5GA 1Y1TA 3PFWO 3JZIA 4YLEA 1KEZA 4TOIA 4DMGA 3PQ7A 1IPHA 1CULC 4G8JA 2GBCA 3FLMA 3DZIA 2P67A 3TE6A 2HAEA 3A6JA 4PFSA 2Q3DA 5JLJA 3HTXA 1I6KA 2NU6A 4FC6A 4WN9B 5DHUA 1A5TA 1P9RA 1UZUA 1EFUA 3R4CA 1XLTA 3FWNA 3QLVA 3IKMB 3TOVA 1S2DA 4UQPA 1EHCA 3X1KA 5CEEA 5KOYA 2CZQA 1VL2A 2NADA 3ITDA 2QENA 3ZQKA 1Q95A 3N3BC 4PRKA 4QFDA 3MS7A 4WNIA 4G5XA 4YRPA 4KWHA 3ESRA 4UTZA 5CB4B 5JW6A 2IS1A 3W78A 1L7OA 4QNNA 2WA2A 3QELA 2R6JA 5CRIA 3W6OA 1CZLA 3O9VA 4YO8A 2GLTA 3BYZA 1USIA 1RC8A 3DGEC 5HW0A 4OMUA 1CHNA 2QR5A 4JLVA 3C16C 3DKKA 2P4EA 1KY5A 4J4HA 4K9QA 4OBWA 1CCWA 2PT7A 1E0KA 1NJ5A 3W3ZB 1OXKB 2QLTA 2D4AA 1RW4A 3CU5A 3L7LA 1A69A 4Q12A 4QUBA 4RV4A 2IL1A 2VTEA 1NBIA 3DUFA 3H2HA 5IFKA 4PBRA 1T8PA 2CVOA 4EB6B 1U2DC 4X8LA 1P29A 5A6SA 1TB4A 1JDSA 1GPLA 2V7VA 3P8ZA 3UK1A 3ZQUA 4ZI7A 1WDTA 2VEOA 5AI5A 3GCDA 5A9SB 1JAXA 2EP8A 1FFXA 3GJ8A 3OSUA 3I4FA 1O0CA 1U7TA 2NX2A 2PPVA 3HCWA 4TPKA 3ZBQA 2G6BA 1D5WA 3G82C 1NRWA 2R25B 3PCXA 5HKAA 1ZR2A 4D0NA 3IC5A 3QIAA 2O2SA 2KYRA 2B92A 2Z0MA 2V6FA 3Q15C 4RW0A 4TQAA 4BMVA 1HEUA 3JQFC 4DDHA 3TEMA 4MP6A 4RGYA 1CNEA 1IZZA 2B4QA 2V6BA 1JEAA 3GJQA 3HKEB 3TFWA 1Y4UA 1JB9A 2NOAA 5LM3A 1NWCA 4H7HA 5IVDA 2QU8A 3RHSA 2EZUA 2V0CA 3KU4A 1YMQA 3GGCA 3EMBA 3FMGA 3HSSA 3P2EA 5ECYA 1RI5A 5K3DA 3UAOA 1B41A 2X58A 3I5XA 1T9HA 3P9NA 2D5LA 4DZZA 5JAQA 2HLDA 3FN4A 2GCNA 1JHYA 3HXLA 4U3JA 5EUBA 5T8KC 2I7TA 2J3QA 2FEOA 4CLOB 3W77A 2E6KA 1QGDA 1MJ5A 3EA4A 4KO4S 5AM0A 3CGWA 1ZMTA 4YV1A 4F96A 1AKTA 4KR0A 1DDGA 2I80A 4M1KA 2R4TA 1DQPA 5TMBA 1BRTA 1FOEB 3I01A 2RHHA 2NUAA 4M55A 1W34A 3DBRA 3D8HA 1WMBA 3AR8A 4DR2B 1GNLA 4EF4A 3TG8A 1GJRA 3C5VA 3TZKA 4WVFA 3P0IA 3FAKA 3OU2A 1QG0A 1FXWF 3DR3A 2AKAB 1YJ5A 3ZD8A 4I55A 5FT9A 4EBBA 4PPFA 3I5YA 1KWKA 3TB4A 1VGQA 2I55A 3MNFA 4RZ2A 4WDQA 3DV9A 3NUZA 3VQTA 1NR5A 1AGXA 2BMFA 3KP1A 4BGIA 2XGJA 1DQRA 2DLNA 2ZBPA 3DMRA 4YJFA 3CW9A 4OBXA 5IULC 1IULA 2ZJ0A 5KPDA 2VDRB 4C7JA 3S70A 2DY1A 3AIMA 2QUJA 4DC0A 3QKWA 1IN4A 2JLZA 4N40A 1QQBA 3LRPA 4MTCA 4O8ZA 4H7JA 3CKMA 3OTQA 1WB5A 4ZGWA 2BGMA 3NM6B 2YJ5A 3LU1A 4CT5A 3SYLA 1UBOS 2NVUB 1L5GB 3ROMA 1C30B 1QK4A 1NURA 4ND7A 1X0XA 1M6YA 3W4KA 5IKEA 1SUEA 1T9GS 4LBVA 5ER6A 4DDTA 3ILXA 2RSLA 3BJRA 1N5DA 1B76A 1NW6A 1VA5A 1VE1A 4JLWA 5DHFA 3T15A 2PUVA 5EP2A 1BGVA 2RJ3A 2ZP1A 3WLTA 5D84A 3MFQA 3TN7A 2ATVA 3IVAA 5CNIA 3K5IA 5FWYB 3U1BA 5I6DA 1RAFA 4R54A 2A5DA 4KV9A 5JS7A 1Y3DE 1JIVA 2ZRIA 1ADFA 5BSGA 2HK8A 2JGMA 1S4QA 3HUDA 3B3AA 4ILKA 4ZVOA 2XUOA 3W6UA 2C2OA 1W4CA 2VF4X 3OZAA 3U3ZA 2PKEA 4OXRA 2F1RA 5AUQA 1PTJA 1XV5A 3TLBA 2FVYA 1Q50A 4XJTA 4DCTA 2R1VB 4XPIB 2Y67A 1CC1S 1LI5A 4B87A 4A73A 4LDQA 4EELA 3MWEB 4EJ6A 2B7CA 3SQXA 3RYTC 4D41A 1E6EA 1ZN8A 1FDIA 3E0XA 2OK8A 3PIRA 3ZDFA 3DMNA 3HC7A 5KVQA 3ZZNA 1DG3A 4E21A 4IG9A 4ZO4A 9ATCA 1DARA 3SXUB 2QIPA 1G3RA 1SCNE 4X61A 5KHLB 3DD1A 1DO0A 2DLDA 3LRTA 1I4WA 2GRAA 1RKVA 1XU9A 4BB9A 4CMBA 3UT0A 4MDEA 1EINA 2X23A 1LQUA 4WD3A 1A4UA 1WP9A 4MWZA 4X3CA 1XJCA 1M5TA 4PZYA 3Q5EA 3G17A 3TD9A 3TBFA 5AW1A 5HXAA 1ONNA 1OBFO 2F8LA 4W5JA 5LMZA 4CQNA 1Z6AA 2QL9A 2FAXA 3CZRA 4ZVKA 3WQHA 1JTEA 4MKGA 3R9XB 4YRBA 5GIOE 1EE2A 1KAEA 1XFDA 3U48A 2POCA 4BMCA 1KQ3A 2R6R1 4RD0A 2Z8XA 2FWJA 4EO4A 4CV2A 2BGGA 4QBTA 4HH1A 4GC9A 2GA8A 3H5WA 1LJUA 2FXIA 4DARA 3DB2A 4C6RA 2O1WA 1R6XA 3GJTA 4KO3S 2ZIXA 4FYPA 1I9CA 1SCAA 3R7NA 3L9XA 2RBGA 3MT0A 4Z4EA 1BWQA 2RJOA 2Z4SA 2O6LA 4MUMA 2B25A 5KJCA 4DMKA 1G20A 4GMDA 2BSQA 3EPKA 1M5UA 3ZUGA 4L8GA 2I8AA 1A2KC 1MB0A 3RC1A 1LPBB 1YQEA 3MRTA 3RWBA 3TUIC 4BVAA 1YF3A 1IHUA 1TJ3A 1U0HC 3GQBA 3FLEA 3LUAA 3U44A 1PJQA 1KHHA 2GH1A 4J03A 1IN5A 2JBAA 2W83A 1I5OA 1RADA 2DKNA 1XVTA 1YH3A 1JS1X 2C61A 2CLKB 1KTVA 3KRTA 5I8ZA 3VSEA 1HE4A 4HYYA 5JNRA 3AOEA 3LQ2A 1PU2A 5CB4F 3T9BA 5DN9A 2GYUA 1P2SA 3BREA 5CTJA 4HQNA 4PO8A 3NMUF 4RZHA 2VHCA 4IIDA 5CTAA 1ECBA 1EGHA 3GA5A 4I5IA 2FV8A 3BRWA 4MWEA 1Y33E 5EJAA 3GNSA 2W6MA 4BE4A 5BOSA 3GZ4A 4R2MA 3IODA 3WS7A 1K88A 2CUZA 1E2PA 2H9YA 2C1EA 1QOQB 3CTPA 1YQGA 3BA1A 3B1YA 3ZTWA 2CBXA 2ZYIA 3G9UA 2IUTA 4HLUA 2OHXA 2TSYB 4ARUA 2WNIA 1SZJG 2D2FA 3FUUA 5HA5A 1MIOB 4N82A 3IQIX 4A82A 2R751 4D9MA 1QPZA 5JYCA 1EGMB 3MJTA 3MAGA 3Q7QA 1SOAA 2ZRDA 4IFTA 2IIQA 2YNMA 2GEJA 2GDZA 1HE3A 1XYVA 4PINA 2Z3WA 2VDKB 3M70A 4MV4A 4H4CA 3ME5A 5DWQA 1U9ZA 3WJ2A 3FYUA 3PZBA 2AZDA 1WX1A 2IXTA 5C7LO 1EG2A 2P91A 4HUQA 3M5DA 1YS4A 3BIXA 2KBFA 2I2AA 1C3JA 1UAGA 1GKUB 2ZIVB 4ER0A 5TRTA 1MKYA 4O4LB 2IHNA 4XZ3A 3ZCVA 5B3JC 1NVDA 4F2GA 1W44A 2Y92A 3VZRA 1ZH6A 5C1OA 3UUEA 5IJWA 4YCBA 3VKHA 3CRQA 5JSZB 4NCIA 2CD7A 1RM4A 2FMIA 2HSDA 1LC3A 1U0OC 2SKEA 3I05A 4ID9A 3CHYA 3CLRD 2AV6A 1G8YA 3HACA 2IKQA 4QPNA 2P77A 3SJCA 4H9GA 5KOIA 2V9PA 2DHEA 4FFMA 1XTUA 2NZWA 3X0DA 2BGWA 1J25A 2OM2A 1SQFA 3JQEA 4IH9A 2UU9B 2QDKA 1BXGA 4K6CA 1N25A 5CYPA 1QR6A 2ZI9A 4ILEA 1Z3IX 1S2LA 4MS1A 2G1JA 4PWZA 1A7JA 1W4BA 1NN0A 1UKYA 4D0RA 1KDOA 2WMOB 2V45A 4Z9XA 1N5OX 4NYIR 1LPMA 3GJRA 4HG2A 2AX3A 2P0AA 4QPZA 1WHSA 2P5UA 1RQ2A 1E2FA 3NANA 4DLUA 4FKMA 1CUYA 3A14A 3KQNA 3FROA 2Z5VA 4HC4A 2G08A 4Q3DA 1TAQA 2QROA 1ZCJA 4G0ZA 4FX5A 1EFRA 3DB1A 1JG6A 3O4JA 1E1KA 4Q93A 4PNZA 4NG4A 5TMDA 1T10A 3HL4A 4RTNA 1FDSA 3WY9A 4OFZA 1JXOA 4I8IA 1Y4ZA 1T1EA 4BCDA 3B7WA 1G16A 1U6IA 2B4YA 4QDUA 2BFDA 4TTIA 5EMMA 3WJ7A 5LJLA 3S8YA 1NW8A 4HRXA 3UOAB 2WHPB 3SZLA 1WKCA 2XR1A 3PI6A 1U2GA 2KQUA 2OCGA 4GIBA 4X5OA 4BKPA 1S8OA 5B1IA 1P3Y1 4LFBB 3DAYA 1J06A 2WJZB 4QUKA 3F7NA 1ML4A 1BA3A 1UFRA 2YINC 4ZQGA 2I2DA 1IG0A 4L6AA 3OIVA 4KAXA 3DTVA 1DEHA 1X1BA 3N2NA 3BMQB 3ZQ6A 1MEOA 1TGVA 2GTIA 4ZQFA 2IY8A 2ZM5A 4OCZA 2OB1A 3KWFA 2NVOA 3E61A 3SR3A 3ZCXA 4BNYA 1T3TA 4P4NA 1OMOA 1LV7A 1ZVQA 3UGKA 2BEUA 4L6CA 1YZFA 1V2GA 4R2JA 3VDMA 1FUIA 3UGTA 3O93A 3K6SA 3ZV7A 3AKZA 1PL6A 1F4LA 4FKBA 1HTBA 1SHKA 4I6GA 1G6OA 3T1OA 4L08A 3NJRA 3I4LA 1ZXBA 3A2MA 1K6MA 2QD1A 1YZGA 1LI7A 3LT2A 1KY3A 3AZQA 1L5KA 3WNDA 3WK5A 3ZQJA 8LDHA 2VQSA 4MUXA 3R23A 3GL9A 2C2ZA 2QR3A 3GZNB 1DWQA 3JAWB 1U5CA 4N12A 6AT1A 1GN8A 5AVOA 3JRNA 5IDXA 7MDHA 3NIWA 4P93A 4I14A 2JGIA 2XCIA 2G7MC 4YMWA 4MEAA 5FULA 1X9IA 1B74A 1T43A 4V0KA 2A5YB 2DPHA 2C03A 4PAQA 3CJQA 3QLJA 4QDKA 4PLZA 1U0RA 3AUTA 5CNJA 1EWYA 3ANYB 3NI2A 2BMWA 3CZMA 4X8HA 4V1CA 1ZIYA 5LMUB 2WC1A 2OORA 3UQZA 4RDXA 2B78A 3W9BA 4ZEVA 1WPGA 4OK6A 1RM5A 2I8LA 4DV0B 3JD0A 3SX2A 2QTGA 1AA9A 2WM2A 3E9CA 4RD3A 1WKVA 3WYAA 4EVSA 4DR5B 1U0LA 3DKIA 1HZJA 3BD6A 3EXEB 4LOLA 1NVEA 2C7RA 3KAQA 2QVLA 1R27A 4YC7A 3NH6A 2DQYA 4QTTB 4D9HA 4MGHA 4YUAA 1B00A 2GNOA 5JECA 3AUAA 2P1ZA 1L8QA 1SXGA 4TV9A 3VR4D 4GQAA 2P9YA 2GVNA 1ZWKA 4G01B 4LZZA 2ZJ2A 1RWNA 1EJ2A 3SK0A 2ZJ4A 3AESB 3L6RA 2IV3A 2BLNA 3N58A 2DFKB 5FFFA 1X74A 2I4LA 2GCPA 1WPQA 3I5UA 2Y05A 3W3AH 2IYZA 1WLYA 2EZ4A 5H9WA 1PNTA 1B0ZA 1SKAA 3BFJA 1CJUC 3D4LA 4C6TB 3CNEA 1DKPA 3DWFA 3ZHVA 1HDEA 3U6KA 1LEHA 5BPFA 3WAJA 3LXMA 4YX9A 5GZ6A 3IR6A 3OURA 3LT5A 2WW8A 3A4LA 4X6YA 4EMUA 3GCXA 1CF4A 2CDRA 4E6PA 7REQA 2GWRA 2QN8A 3DAGA 2QTTA 4UARA 2Z6QA 3QXXA 3MCAA 4K1XA 3ZDZB 2MOKA 2C95A 2RI6A 4ZCRA 1V37A 2CFTA 1RWPA 1DZ3A 2QUHA 3N87A 3R1IA 3C6KA 4XJSA 2HIAA 3MXOA 2RIRA 4BTVA 4E3ZA 1EVKA 2VI5A 3GFPA 2BAGA 2XMGA 2YS7A 4M4SA 5EVCA 3WOHA 3ZE9A 1T9KA 2DPYA 3M83A 4OQLA 1SIWA 2NTEA 2PWZA 4R6XA 4IGEA 2O6HA 3QX7A 3H9CA 4KU4A 1AKMA 2I5PO 3AR4A 4WKBA 1XMJA 1U7OA 2ZAYA 3V8BA 2O8CA 3JWGA 3FNGA 2ATEA 3FSGD 3KOOA 3FETA 5BVHA 1SEPA 4ALJA 1M2NA 4MQ4A 2JIDA 1F1BA 4EAAA 5K0NA 1GM5A 5KIAA 3PQ3A 1D0IA 2BGNA 2PM8A 4E2YA 1CJCA 3RABA 2QJOA 1SJ9A 4CQJA 2VA9A 4JB3A 4CR6A 2AE2A 3DCYA 4LNUA 2OO5C 3CNLA 1CP3A 3IAM6 3T5BA 1IY2A 1JSLA 1T5LA 1YI8A 3KZOA 2PA0A 5EUMA 3ERCA 2X6RA 1J5EB 1WUIS 4BP8A 1H65A 2DWPA 4RQUA 2XZLA 3UMVA 3EARA 2EGHA 1I3NA 2ACEA 4GI3A 4CG2A 3OX1A 1OFUA 1Z2CA 2JGKA 3BGSA 4JBXA 4KWTA 1WZCA 5EGSA 3U37A 1X7ZA 2GEBA 2WU4A 3AGPA 3F4BA 4REMA 4D2IA 2D0PB 3NQ41 4O4LF 1VJRA 2IGBA 4H3SA 4CG3A 1C1XA 2PIDA 2A5FA 3OMLA 1SKMA 1FS4A 1NVBA 1C0IA 1FDOA 2QZ4A 821PA 2QTLA 4JVMA 4CMGA 1E5XA 4GLLA 4YFVA 2CZCA 3RRBA 1BGXT 3CXRA