4ZYUA

Human gar transformylase in complex with gar and n-{4-[4-(2-amino-4-oxo-3,4-dihydrothieno[2,3-d]pyrimidin-6-yl)-butyl]benzoyl}-l-glutamic acid (agf50)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
200
structure length
200
Chain Sequence
b'ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trifunctional purine biosynthetic protein adenosine-3
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
publication title Structural and Enzymatic Analysis of Tumor-Targeted Antifolates That Inhibit Glycinamide Ribonucleotide Formyltransferase.
pubmed doi rcsb
total genus 64
structure length 200
sequence length 200
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4zyuA00
5J63A 1NJSA 4Q12A 4S1NA 2BW0A 1GARA 5J9FA 4YFYA 2CFIA 1S3IA 1ZLXA 4ZZ0A 4TS4A 1CDEA 1MEOA 3W7BA 1C2TA 3TQQA 3AV3A 5CJJA 3DCJA 3NRBA 4ZYWA 1C3EA 4QPDA 3Q0IA 3O1LA 1RBZA 1YRWA 2GARA 2FMTA 1CDDA 4ZZ3A 4ZYUA 4IQFA 1MENA 3TQRA 4QPCA 4YFVA 1JKXA 1RC1A 3AUFA 4R8VA 4DS3A 4ZYYA 4EW1A 1ZGHA 4TTSA 4ZYXA 1MEJA 1RBYA 3LOUA 1FMTA 4PZUA 2YWRA 3DA8A 4ZZ2A 1RC0A 3GARA 1RBQA 2BLNA 3N0VA 4ZYTA 1ZLYA 1RBMA 3P9XA 4EW3A 3OBIA 4TT8A 4NV1A 1GRCA 4EW2A 4ZZ1A 3KCQA 4ZYZA 3R8XA 4ZYVA
chains in the Genus database with same CATH superfamily
1CJUC 3CMMA 2IOHA 2CUZA 3PIRA 1GR0A 4GBMA 4JB0A 4NESA 4QNMA 3M3DA 3ULKA 3W1EA 3QXHA 4GL2A 2VHXA 2Y1WA 4RHYA 1GVNB 1X3SA 5IXYA 4HYQA 4GZ5A 2W2QA 2JCBA 3GJXC 1KL7A 3O8QA 5HFNA 1E4OA 3VH4A 2R79A 5I9IA 5JROA 2Z5VA 1X8XA 1J99A 3AERB 1WD5A 1SRQA 3SDSA 4NLLA 3UJ3X 1XI2A 3MF4A 1XTQA 4K2AA 1J42A 1OIXA 2F3TA 1PNRA 1WP4A 2FWMX 3ZI7A 1G8GA 4R83A 5CRIA 3UGQA 2R65A 2ZTVA 3WB1A 2FWPA 4LRYA 3QEAZ 4C0HA 1FSFA 2OLKA 4LYHA 5IX8A 1XRJA 3D6VA 4HKTA 4I1PA 5JJLA 2TMKA 3LS2A 2B4RO 3U7GA 1WMEA 2E6KA 3AUUA 2XRZA 1XRPA 3FVTA 3TOVA 4YREA 4FLFA 4LJSA 5IPFA 1N1DA 4P4UA 4QG7A 4B2LA 4B48A 1RMYA 4KYUA 4EUKA 3ZY6A 1JE1A 4QHYA 1AKTA 1WKCA 5DEOA 3WGMA 5H81A 4BASA 3BF8A 3CKMA 2RAPA 3GOHA 4HNUA 4PBRA 2AEMA 2IUUA 1VL1A 5KNCH 3OJOA 4Y2VA 3DM9B 3HHEA 4F12A 1E3IA 4FONA 2MOKA 1N5KA 2QTAA 5EFZA 3KQNA 1I51A 3CN9A 1LLUA 2CWDA 3A6JA 1L4EA 1X87A 3KEFA 2CZQA 1KHHA 1XD2B 4CG2A 3QTLA 4AT1A 1JVSA 2FFJA 1FTQA 2Z3VA 3P26A 2M6SA 4MMXB 4NXMB 4GOJA 5D01A 4IR7A 3QIAA 2X6RA 1FYWA 2A5GA 5DE3A 3DVSX 4UZFA 5COQA 2W2TA 1WCWA 2WY2D 1KOGA 1YRHA 1SUEA 3EIEA 3AF6A 2WJHA 3HEBA 4LY0A 4TLAA 4X00A 4PFKA 4C4SA 3AHDA 1RMTA 5JDCA 3SCZA 3PPYA 1RZRA 1YE8A 1ACJA 1FNMA 2QW0X 1C5KA 3RS3A 5GVRA 4GEGA 2H31A 1Z4QA 2ASEA 1KI9A 3FHJA 2CMKA 3V2UA 3UMYA 3V4ZA 3AHJA 4QAJA 1D3AA 2Z5LA 3WICA 1ADGA 1WXEA 3HPQA 1HZZC 2DKFA 2C7RA 1Q16A 1WTCA 4FYMA 3H99A 1JLSA 2OAQ1 1QV9A 1WXDA 4HAYA 5H4GA 2WUVA 4MR8B 5JTTA 5IJXA 2DHDA 2W6IA 4J7UA 5BYKA 5CVTA 4Y2YA 1QP4A 1RZVA 2VRWA 3PQEA 4Y1RA 2P3QA 3FSJX 4WPGA 1U02A 1U3WA 5F4BA 4QPDA 1PUXA 2OO3A 2PLWA 4ZOLB 2J87A 1JF8A 2QP9X 4Z0TA 3ESRA 3WNZA 4OLFA 1O6CA 2GCGA 3R7DA 1PVVA 4JXXA 2VDUE 1UZAA 3F96A 1KYQA 2I4NA 1AO3A 2DUJA 3FYTA 2JIDA 2J7KA 4K8RB 2ZYHA 4L9AA 4PIVA 5CIWA 4TYNA 2GO7A 3CVWA 3MGGA 1D1QA 2W2KA 1DBQA 3HI4A 4FOPA 2BHLA 5EA2A 3K70C 3IQEA 1XTUA 3ZH2A 3RRZA 2ZJ1A 4M1WA 5BMVB 3X1DA 4EJ2A 5JQGF 2E9SA 1SMKA 2QG9A 1J2EA 1DIOB 3H8SA 2Y1CA 1ZM4A 3GDWA 4ND4A 5B36A 3O1HB 3HB9A 5G41A 1B74A 2GQ0A 4GPD1 4NZOA 2X0IA 3P2EA 1N5LA 4RDIA 4XJSA 3WLNA 3LCMA 3ZLTA 1DXYA 1QHFA 2IDKA 4QQKA 1CZNA 1P0IA 1O8CA 2XX3A 3IVMA 3MUEA 2G9RA 3OVMA 2ILTA 2VG8A 4ZOBA 1I3OA 4LYAA 3VR0A 1LFAA 3TN7A 2PUGA 3EZLA 4TYMA 1H1LA 1LDGA 1E1QD 4JT8A 1FSZA 4GLJA 2PZFA 2EOAA 3GAMA 2B25A 2B4KA 5HKOA 2OCXA 3LIIA 4QODA 2NNLD 1MABA 3R7SA 1N2CE 1F0NA 3U7EB 1T9BA 1V71A 4KQHA 3TPFA 3ZX4A 1TCUA 5IM4A 4XDGA 3IERA 3IXQA 3E3LA 3GCXA 4F2HA 1UJ4A 8GPBA 5J1SB 3LL7A 2R8YA 4DCGA 4FI3F 1EX6A 1N6IA 1SEPA 2Z56A 4J03A 3RRNA 1EDOA 1X14A 4LJLA 3I04M 2EQBA 2QMQA 2WMYA 1U31A 1D04A 2ACKA 5G2OA 1QJCA 4JROA 4TV8A 1OLSB 3EG5A 3EPPA 3OMXA 2OCBA 3S2SA 1VG9B 2CV0A 4NARA 4OI2A 3IP6A 1M66A 2GZHA 1U4OA 1V1MA 4KQWA 5KNDA 1DADA 4C14A 5F7OA 5JCJD 2I4OA 1TTPB 4IIBA 4R5MA 1TQ2A 5HS6A 4QL3A 3EG9A 3NANA 4ZAFA 4JIGA 1TC2A 1MKYA 3FR7A 3MS2A 4XJXA 3D9QX 1UXOA 3CJTA 4JSTA 4ZWNA 1S2DA 1MJGM 1QFMA 3N70A 2I6TA 2ZT8A 4Y0VA 4INOA 4E3WA 3BILA 5JXJA 1FFXA 4NG4A 1QVVA 2PBRA 3OX4A 4UHCA 3EMKA 3D3WB 3TD6A 2O7SA 2BFBA 4REQB 5KJCA 1AF7A 4PRYA 4C0SA 3CINA 5JYCA 3BMQB 2H1LA 3ZPXA 3EASA 4I9HA 1V6CA 3A1NA 4INJA 1F48A 1O95A 4EYGA 4JI7B 4M49A 5JV5A 1JAHA 2WF8A 4E5DA 1PZFA 2XHZA 5K6AC 1TZ2A 2G5CA 1E20A 2EYQA 2QYSA 4BO8A 2XZLA 2DP4E 4J94A 2I1WA 4PIMA 1H5UA 2XTAA 3H11B 2RHRA 4LHSA 5H9VA 2COEA 2OORC 2G7ZA 2XUPA 2CHUA 1NBME 4JLOA 1RR6A 5GP1A 5IVPA 3MK31 5JASA 4NCJA 1JHPA 1P77A 1XZNA 2A78A 3OF3A 4CGYA 3MGAA 3Q3CA 2QVBA 4KI0A 1ZVKA 4F91B 5KTRA 4J75A 1L1QA 3FJ1A 5HCUA 1OQAA 3S81A 1PZMA 2HMAA 3WV4A 3RABA 1YMQA 3O47A 4GKVA 3A9RA 1N0VC 1CU1A 4EELA 3CUKA 1IEXA 2YXDA 4W7SA 1PJRA 4PGFA 2Y3IA 4YRNA 4WNYA 4HB3A 4R1SA 1KDVA 3DFUA 5LP6C 3T1VA 4PY2A 1CR6A 5TMEA 1CRZA 1DOZA 3PUWA 3DZ8A 4BFYA 3SBOA 1ZL2A 2QD4A 2XUZA 3PT5A 2HLDA 2MTBA 1DPFA 3GEHA 1U9JA 2OGTA 4G4SP 4JY7A 1O08A 1OD6A 1P5JA 3D2AA 2EKPA 4UUBA 2B34A 3PRHA 1R8YA 2C20A 2X9VA 1R15A 3AUSA 4MV5A 4OLAA 1BXZA 4YMWA 4BNHA 4B4UA 4S0ZA 1JHZA 1TZBA 3MOIA 4BMOB 5AVTA 1VXRA 3V4VB 1UMDB 3W6ZA 4F0JA 1GGKA 3IUBA 3ND6A 3L93A 2GK6A 4H7DA 2C42A 1YKSA 3V4FA 5FWNA 5EI5A 1E79D 1NY5A 3GAFA 5KNBA 4DA7A 4KQ9A 1Z5UA 4LF4B 1NVGA 4LDNA 4YJ2A 2IP4A 5D3MB 1AUXA 1TW2A 4JX9A 5DNCA 3PPIA 5A71A 3DOCA 1XZEA 3VRHA 1K97A 1Z3IX 2ZUUA 4XSVA 5J2UF 4D8WA 2HLDD 1IQRA 2FV8A 5ALPA 4S1VA 3UMSA 4UARA 4RVGA 4FHZA 4BO9A 3L1JA 2XSZD 4RS4A 4P80A 4Q9LA 4JA0A 4OIMA 4TVOA 5E6UA 3LBYA 1Q7BA 1PJAA 1DRKA 3KYCB 2HBZA 2EFYA 1ADFA 1W6RA 2GXSA 4R1LA 4PPFA 4QO8A 3E61A 3VR5D 1BHQ1 2V65A 3PHJA 3OSZA 3WRXA 1U99A 2FN9A 2CBZA 3ZOKA 1TF5A 2C92A 5AESA 5AKEA 2H1OA 4IHQA 4EY6A 4A8PA 3I8XA 2W58A 3GUCA 3NI2A 4YRFA 5SZJA 3L0DA 5FXMA 3LHSA 4TT3A 2R11A 3UAVA 1SZPA 3PA8A 4YMTA 1N2CA 5GGYA 4XWKA 1U0SY 2ETVA 3HFGA 5IZ4A 3C24A 4TQUS 2JLUA 5A3SA 1NAIA 3RAPR 1JNYA 3FUVA 5TVGA 3MXTA 4QYSA 3I5UA 2F3RA 1W96A 1XZLA 2CCKA 1CFZA 3ESDA 4FYIA 3UF0A 1GG9A 4EUSA 5L3VA 1P2DA 2AS0A 1O94D 3ITKA 2JGNA 2V8BA 1L5HB 2EZ9A 2P4UA 1JQEA 2XQFA 5CVUA 4NDNE 3MTDA 3TLCA 4MJLA 2QT0A 2O3TA 1XNJA 3HKBA 1SVUA 5CFZA 3DL0A 3FFBA 1OI4A 1P74A 1NQAO 1P80A 2HRZA 4HR7A 3OZXA 1H05A 5CNKA 4E0BA 5NLLA 5I4CA 3BL6A 2VN8A 4NQZA 3JQAB 4BS9A 2HOQA 2PH7A 3V3TA 1B73A 4U8HA 2DERA 1W5TA 4BFWA 1SC1A 4FEGA 3A6ZA 4QOIA 4DWVA 1T9HA 1X38A 3VC3A 1RHMA 4ZO6A 2PBZA 4GM0A 1OI7A 3SQDA 3X0DA 5DVZA 1K89A 1X94A 2JI6A 5C1BA 1CUSA 2QX7A 4WN9B 1FFWA 2YFKA 4K7JA 4B3HA 1VPVA 5CFLA 3ZXUB 3ID6C 4D6YA 1YQTA 2RIPA 2O2IA 2WM2A 3JAKB 3OF2A 4QOSA 1QZUA 4YRRA 4BB0A 3PPXA 4JAVC 5JQGB 1OKKD 3BFKA 2EFHB 4Z2YA 4A2WA 2ZAYA 4D25A 2OWDA 1U2SA 3SBDA 3ZK8A 4E2XA 1N8KA 4ABYA 4DQDA 2IYTA 1FVOA 1Z56C 2YYYA 5D8DA 1PW7A 2G08A 2NXEA 1OAKA 2OM2A 2VT6A 1DNPA 3C8HA 3OWHA 1OU4A 4REOA 1PYOA 3ON5A 2H51A 3CH4B 3P9QA 1LDBA 3G2MA 3DAHA 3WWZA 1KJZA 1V26A 1VJCA 2W2PA 2CDNA 5ALMA 5I7HA 2XGSA 1U0OC 3ZWCA 3JYPA 4LJ9A 3DEKA 4FFSA 4R69A 1EE9A 4H59A 1PR3A 2DFNA 2HTEA 4XQGA 2B78A 1NXQA 1SQ5A 3LUKA 3H7AA 4QOFA 2ZRLA 2XQVA 4IV0A 5CB4B 1DRUA 5JBNA 1YMVA 1Z62A 1TGYA 1Q83A 3BWCA 3IEMA 2EVWX 5CHEA 3CNEA 3HR8A 4G5YA 2N42A 4QDUA 5KPJA 4CQLA 3OT1B 4N9QA 2DOKA 4WMLA 3NYWA 5B2FA 1TM7E 1TAUA 4PTZA 1QYDA 1E6UA 3FNEA 4UU7A 3AVUA 1RWPA 1QK3A 4GZ6A 1T2UA 2PZ8A 3DZIA 2FJ0A 3DDZX 1SY7A 2C82A 2J5QA 2MINA 4EJSB 1BYUA 1RI2A 3KKMA 4IF6A 5HR5A 4K8OA 3TKYA 4TZ0A 3MMNA 3HRIA 4RZUA 4K03A 1NJGA 1WABA 2JLZA 5TC4A 5AVUA 1OFIA 3H83A 3LFHA 3R8XA 1RXCA 5JH7F 4R7GA 2DBZA 4IWXA 4S35A 1KZ9A 4B5KA 4OQEA 5AW2A 3WJ2A 1A9YA 1RACA 2I6GA 4YECA 2WJ6A 4FR2A 4X24A 4BGUA 5I7EA 1W36B 3MCTA 2A0KA 1L9KA 1T4MA 2P9GA 5BW4A 5JG7A 1ULHA 5JD6A 1Y8QA 3KFVA 4AICA 3BZUA 5GZ3A 1QTNA 4WL0A 1H2AS 1Q7CA 2BISA 3GBSA 3T35A 5K99A 4BY9E 1DEKA 2VP0A 2Q5FA 4GPEA 4WVFA 5ARCA 2O0LA 5HX7A 5LP6A 5FB3A 2CXQA 2IZOA 1GGFA 2PZGA 1ZD5A 1SU7A 2GN1A 3E3NA 3NIBA 1WCIA 3QTBA 4MINA 2H2HA 5D7NA 3FLMA 3O26A 4IDAA 3RFVA 2PSFA 1PYGA 1MAHA 1A0OA 5KVVA 3LT2A 1IAVA 1JIVA 4WOJA 1D0IA 3A27A 3TUJC 4LF6B 1LRLA 3RIYA 3O3CA 1EB8A 1AKNA 1AD2A 2FRXA 4G89A 2R00A 4L27A 4M98A 1I1NA 1YRQA 2QSUA 4O4JB 4R9UC 4TN5A 1Q20A 1N6HA 3I1FA 3WLAA 3TCNA 4ZCMA 3A9UA 3BXEA 2J3LA 1QDEA 5AQEA 3RU7A 3WP1B 4RVHA 1UK9A 3N1UA 3ZY5A 4ATNA 4WV3A 4CM9A 2HRCA 3ND9A 5IHXA 5KTYA 2ERCA 5LLSA 1XCGB 1N9ZA 2Q3MA 2WU0A 1HFWA 3ZQ4A 4LJ6A 1B3RA 1R3DA 2VDPB 3EEIA 3UUFA 4FCWA 2NNWB 2O7VA 3F47A 5ALKA 2PL9A 1H2YA 3E05A 4HUJA 4B47A 2ZIGA 2PUBA 5C3UA 3WVNA 4KDCA 1IZZA 2XT0A 4A7PA 1KMQA 5BORA 2JRLA 3EPKA 3U5TA 4ARVA 3CVYA 3D8HA 1T9CA 3DQZA 4ZAYA 4HRYA 8ADHA 2CHQA 2NSJA 2P68A 1SUIA 3FTQA 3ILSA 5EQTA 1W2WB 4DCPA 1RHQA 4RJIA 1Z9BA 3DOUA 1OAAA 2G6TA 3ADOA 3QPDA 3V2HA 3FDIA 4QJ3A 4Y6SA 3PSAA 1DJLA 4NE2A 3E22A 1KH2A 3A1EA 1JSXA 4I7EA 2EJBA 4G0XA 2XF2A 3G2LA 2BGJA 4JBWA 1ADYA 5HW0A 1SQSA 2ERYA 8ATCA 3DMGA 2EJCA 4DPKA 3AILA 2WM9B 3B51X 4ZVSA 3DBHA 3G5MA 4C4ZA 3TLZA 2BBSA 2JVKA 5A3VA 1YVRA 3FZYA 4YAJA 5KX5F 2UKDA 1SBTA 7REQA 4CKBA 3ETDA 1SPBS 2I78A 4UM9D 4EG7A 1WOYA 3F71A 4RLQA 5DBEX 1QG4A 2F1KA 3L8FA 5DOVA 2XCQA 1H93A 1YDHA 3EXFA 4JC8A 3COYA 5AJWA 4DW8A 4YGYA 1LC0A 3OKAA 4RK5A 5CIQA 5LP6F 3CW9A 4QDTA 4K26A 1ATIA 3D0OA 1MEJA 3AM5A 3OQ6A 1XTBA 2WAAA 3NAGA 1CUVA 2ZYSA 3A10A 3GI1A 2DSTA 4L28A 4QG3A 4IV8A 3QVSA 1QO0D 3WA7A 2A58A 1QU2A 4FDVA 3P71T 3K6JA 3COWA 4IF4A 1T6ZA 2P2NA 4DA9A 1CUIA 4YXWD 2D0IA 2A8YA 3DQPA 2JEYA 4MK4A 3SJUA 2H0AA 3V8BA 1AGNA 4C1BA 2WZCA 4TQ9A 5KYTA 1S7CA 3OQ1A 2AQ8A 1A2KC 2F1HA 3EDYA 3OPYA 5B7GA 3THYB 4PZDA 1TVKA 1WPGA 1Z08A 2GN6A 3CLHA 3Q6NA 3X1YA 4RTRA 3KHUA 3IIJA 2IPMA 3DOFA 2CXTA 3BGOS 1L8XA 4JXJA 3TM5A 2X58A 1HMYA 1I0IA 2QUBA 3AOEC 4GT1A 1ZH4A 3G0BA 4CI0B 3EPHA 4MDFA 2DECA 3TAXA 5K3FA 1ISRA 4A26A 3FSGA 3IE0A 3TXXA 5JS2A 1YZYA 3AHEA 3WZ2A 4EL5A 4WZBE 4CEJB 3LF1A 1D2MA 2CYAA 1SWVA 3LX6A 2RI0A 2V97A 2BEUB 4A8HA 3QX3A 1J39A 4RD6A 1S2LA 3V8PA 1YR3A 2IXBA 2YC2C 1YS9A 2EFJA 1WDTA 3TTVA 5L7YA 3DEZA 4BKRA 3ZE6A 3GCGA 2WJVA 2QIPA 3O03A 3PWZA 4ITUA 1X1SA 4R8LA 5CJPA 3UXHA 1KJQA 3TGWA 4L3OA 4PEVA 4LWOA 1CY6A 1KYYA 2XCLA 1UMDA 1VYHA 4CZ2A 1EWQA 5F77A 3GELA 4YRPA 1X7ZA 3NO4A 3TD2A 2P9BA 2CFSA 4CTMA 3A6LA 5U4QA 3Q7QA 3DMHA 3KJIA 4O2AF 5BUCA 1X39A 2HU2A 1Z2CA 3KPWA 4MICA 1W88B 1AVTA 3GJ6A 3L0SA 3MQ4A 5IDVA 4YMHA 3EUEA 3IHKA 4AM8A 3HLYA 2C9OA 1ODLA 1FEZA 2QXUA 2YJNA 3M6WA 3QKIA 4D4KA 2GEVA 5L7TA 5EE3A 2A1TR 1BFDA 1BJRE 3PA6A 4MUIA 4A5SA 5K4HA 3V34A 2PJUA 1YL6A 3AR4A 3UGTA 1T8WA 5K6RA 1O8BA 4RY8A 4DJEC 1K6JA 2PZAA 2OP0A 3WLIA 1YZGA 3RNLA 1YCFA 3NGLA 1KMMA 2B4TO 3WHPA 1KFCB 1GKLA 3X1MA 1H5NA 2YV3A 2ZBEA 5HRUA 1OZGA 1RQGA 2VJLA 4OSEA 2GR9A 4Q9AA 3TIGA 1TZCA 2DPGA 4C0QC 4E5NA 3GH3A 5AKYA 4UEJA 1OLOA 3DO5A 2Q5CA 2WHYA 3RRYA 1QMGA 1GAWA 4XYMA 1KFBB 1LGYA 5EIOA 3KDAA 4V1CA 2WU4A 3GVCA 5FJIA 3H11A 1NA5A 3EFHA 1G5PA 4C4XA 4HO1X 1J00A 3A28A 3TQQA 1TJ5A 3VU1A 1ECJA 4FHEA 4N5MA 3K5PA 1UC8A 2Q3CA 4MWZA 2HNKA 3A2LA 4HMOA 2NZVG 3TLJA 1X7GA 1A2OA 1VE3A 2BMDA 2PV0A 1CUJA 1FX0A 4KGDA 3H2YA 3MINB 1MOZA 3SIPA 4UBOA 2J85A 5FUYA 2W4QA 3RLIA 2P9TA 4PYMA 3AO0B 2P11A 2XJ4A 3O31A 3RYIA 2DLNA 1C41A 1YHYA 4XWOA 3L1UA 4PR3A 5LZ7A 1RPZA 1Y8RA 2ONKA 4YJGB 2NPOA 5F35A 5DK6A 3RFFA 3T8YA 1M67A 3ASVA 3PQ8A 2DPXA 4U7JA 4A27A 4BN0A 2LW7A 3DUFA 5F78A 1UT5A 4YPOA 3GPLA 3OG9A 3G9UA 4G07A 4MKFA 4XEUA 1O3YA 1PGQA 1D2HA 1SU6A 3RSQA 1LSSA 2QDXA 2H1CA 1Q84A 2EHDA 1DT5A 3RS4A 3UH0A 1NPTO 3OLCX 4U2DA 4AKTA 1H0HA 1B1CA 2HCRA 2V0NA 2CL5A 2ORYA 1UC4B 2LD4A 3MCWA 3NASA 4NWIA 3PPVA 4QU0A 2WDZA 1JTVA 4AO6A 1V43A 1Y3FE 5DX0A 4M8KA 3O8LA 4O2LA 3TD9A 4L8WB 1BO6A 4GSLA 2NTNA 2BGKA 3L6OO 3CFYA 1ZCZA 5AXCA 4EO9A 1BHO1 3FG9A 1WPXA 1QONA 2I4IA 4PN7A 5KYUB 5D3MA 3VJKA 1M2VB 3MPOA 1GAJA 1NU6A 1QWSA 2F00A 2H2WA 4MJ7A 4KDRA 1PR9A 2CXRA 4IP0A 1WDKA 1GG2A 1NF8A 4BO5A 4HATA 4RHEA 1E9VA 3D0KA 5D6NA 3UJPA 3E4CA 3V97A 2YZ7A 3IQHX 4FIZA 4HX2A 1AMUA 2QKYA 3BDAA 1UDBA 4HAZA 5EXEA 5H4HA 5LXTF 3WL6A 4LNHA 1E58A 1J7JA 3H2ZA 3GIDA 4M1QA 3W5SA 5AI9A 5KQPA 2PGIA 4Q1BA 4ZO8A 2J7PA 3FI0A 4L95C 5HJEA 1IY9A 1HDRA 1U3UA 2QZ4A 3NCTA 3ONEA 4KL8S 4X97A 2IYYA 5A4MS 1B43A 1ZM2A 5EE5B 4EY8A 1P73A 4QUIA 5CA1B 1GCGA 1Z0FA 4XSGA 1LEHA 3SK0A 2B7BA 521PA 2NO4A 1NONA 1OT3A 1NTRA 3GFPA 5B7NA 2MINB 4HI0E 5EHXA 1K5DA 4BJ1A 3TM4A 4KMOA 2VT2A 3QYJA 4QXAA 3VI3B 3WWOA 4LZNA 3O8RA 4QIHA 2P6PA 3GMTA 5H3LA 4EY5A 3B1YA 2XODA 4EMBA 3QWBA 3E81A 3RWMB 1D4FA 1IMJA 1R4MA 5HDBB 1PV2A 3W8EA 3V80A 1U3FA 1YQUA 3OZRA 4HTAA 4I08A 2AD5A 1YCDA 4X3PA 5K0GA 4QQRA 1F0KA 1G6HA 2WB4A 4YV2A 3PC3A 3DNPA 1BS9A 1QG2A 5FAKA 4Z7QB 1NJFA 3K35A 4RY0A 1IU9A 3W0LB 5JS1A 1BFKA 1Z4OA 2F90A 2ZTSA 4Y7DA 3AEXA 2BFPA 1P9NA 1DC4A 4BC0A 3L5OA 3OPQA 1HORA 1QGOA 3A1CA 1HPLA 4M0DA 3WYCA 1L5FA 1VPTA 3H16A 4TTVA 4KC0A 2GXUA 1RC8A 1CQPA 1ZAKA 2FH5B 3BGVA 3CEMA 3BMNB 1NI3A 2O6HA 2QA5A 3K1AB 3P2IA 3L49A 3RSFA 1M2OA 4KLNA 1T36B 1L8LA 3ECAA 1FNDA 1MA3A 4K40A 3SWWA 4RJJA 2RAVA 3KL2A 1JWLA 3AFHA 1MRSA 4H3VA 4WY8A 1ZOOA 3RC2A 1TF2A 1RT9A 4YRCA 3T7JA 4AY2A 4O4JA 2FPIB 4BHTA 3ZNOA 4D9FA 2CNKA 3TL6A 1P5RA 4PVCA 2HX1A 3N8DA 3C1UA 2XVXA 4YJHA 2YWDA 2QT9A 3AR7A 3CTPA 4RMHA 4EPVA 1C9KA 2IYSA 2Y67A 4R9VA 1OF1A 4K6CA 4JR2A 3IAUA 3M3HA 1UFOA 4FILA 4I19A 4K6FA 1KO8A 3EQ6A 2PX5A 3NHLA 1K8XB 2Q2WA 4HXEB 4I5EA 4W1QA 2I87A 3EGXB 3DE6X 4N40A 5FJJA 3I58A 1VJ0A 3NUQA 2BM9A 3ZWQA 3WBFA 2ZWMA 5C9ZA 1E3SA 2RHDA 2XVZA 4JBHA 1FP7A 2ORED 2ZXEA 2FWNA 2B92A 3VISA 5AM3A 4OLBA 1GA1A 1XZDA 2QQEA 4MNTA 4KXFB 1BW9A 5P8WA 5KDLA 1F7UA 3QVGA 4IOJA 1GQFA 1E3QA 1K6EA 4ZZ3A 1BYIA 1DV2A 1G4HA 1ZONA 2HWUA 5JFGA 1FNNA 1NJ2A 3TRIA 5A3JA 5JAQA 5AW3A 1ANKA 1H2XA 2HJ9A 2INGX 3EAFA 3L05A 2OQRA 2B8WA 3SYRA 2D0DA 5EJGA 2Z04A 4QAQA 2V6FA 1HSOA 1U2TA 1KU0A 4KSCA 1T0UA 1Y6QA 1ZM7A 5IAGA 3BMXA 2GLTA 3QEKA 2KLHA 5KOHB 4LXIA 4LSGA 2HL6A 1ORDA 4PG8A 2OVFA 1A2QA 2YJ6A 1WCYA 1J22A 2JK0A 3FPLA 3ZW9A 4DA6A 1Q1EA 2HR1A 1GQYA 2WIAA 4FFMA 2I7VA 4TV9F 2Q5EA 1O54A 4BXOB 4TXLA 3LLVA 3WMWA 1U8AA 1QS0B 2GA9A 4DSUA 4K1LA 3LVQE 1VSUA 2G71A 1SCJA 1URPA 2CHGA 2ZTMA 2GHTA 3DMFA 3O8QB 4F3CA 4HXFB 4ZVTA 3HKCB 5CPBA 4BJ5A 4CMCA 2I3ZA 2H1SA 2W90A 3BIWA 3WK6A 4XAQA 3IBSA 1U6KA 1I4EB 3GQBB 3V8NA 3WYEA 3H65A 3OPNA 1GTSA 5F3WB 1RFGE 5DBFA 5FPYA 2FI1A 3WG9A 3CR7A 3O2SB 1E3TA 3ROEA 4HNTA 1LF5A 1WCIB 1U5CA 1D0SA 3KQTA 4QGBA 1ZLXA 2DWQA 5JH7A 1O89A 1EUDB 2WU8A 1CY0A 5IJZA 4DCCA 4Y1FA 2VQEB 4JEMA 1BWPA 1ZP6A 3RV4A 1HEIA 3NW9A 1MHTA 1WXFA 3KQQA 4M36A 2ORWA 1XTZA 4PC1A 4JB8A 1PK9A 3OP1A 1U0FA 3F5FA 2Q5QA 1IN8A 2BOVA 2BT4A 2WUWE 1DUSA 4LFBB 4JYBA 2CSXA 1E2HA 1DKRA 1C1XB 2OZKA 2R2GA 2ZWPA 4MQ6A 5DO9A 5EHQA 3GPCA 3W4JA 3JY6A 2XVMA 3V8EA 2Q99A 3KYJB 3CF6R 3WIOA 5E6SA 3EQ7A 3N0VA 1DIRA 1Y4AE 5A4DA 1MEEA 1YUNA 1DAOA 1M75A 4B44A 5HCIA 3MLBA 4DLLA 4EFDA 3DCYA 5CB8A 5CDHA 3NEPX 4YCBA 3LDUA 5H8WA 2OR3A 5J23A 1BGWA 1G8HA 3M4XA 5ALOA 2XWSA 3M5DA 5CJ2A 5JS7A 4H6WA 3TI7A 3IEVA 1K68A 3SHQA 4DT1A 3M4YA 4ZMBA 1HLPA 1N7JA 1TJPB 2BEUA 2Q3HA 3ENNA 4JITA 4L72A 4ZVPA 3U7IA 1F20A 5K0EA 2H5JA 1UDWA 2RGNA 4NZMA 5BT8A 3OY2A 4MYSA 5D1HA 5DM60 3A6DA 3ZCXA 4H6XA 3UZUA 3LY8A 3V48A 4AO7A 2DY1A 2OXCA 4C7KA 3QKRB 4ZYXA 4XM2A 2NP6A 3KZNA 4YONB 2IF2A 1VJRA 4D0RA 1QUFA 2JLAA 5LQJA 3KSMA 4Q9IA 3QU4A 2FCRA 1E9DA 1CJKC 5ILOA 1TTTA 1NW4A 1KNQA 2R1ZA 2F3PA 3OZUA 1T34A 3Q11A 1DC3A 3LX8A 3RG8A 1PIWA 2J6IA 4C5AA 3ZDZB 1KIMA 3I1JA 5ELLA 1SBQA 2ZJYA 5BW6B 5IASA 2XVYA 5HK8A 3PIDA 3LH5A 4URHA 3OWXA 1VFNA 1E79A 1RHJA 4BQIA 5JY6A 1WMBA 1D6JA 2QQ0A 1JAXA 3FDFA 4WCFA 4J8PA 3SSMA 4BV2A 1YZFA 3BF7A 4FZ5A 2V7VA 5CA0F 4OUDB 1UBRS 3AYXB 5MGNA 1QBKC 2IGTA 3WYAA 2G82A 3KJZA 3CNLA 1KEPA 2EEZA 1VTKA 5BWBA 4EIWA 5JAIA 3HBNA 3GLGE 4JVMA 2C8KA 1ZR2A 2GB4A 1PJ4A 1D2RA 3AQ4A 5BR7A 4WKGA 5DXJA 1RM4A 4EBFA 4RTSA 2WMOB 1W0CA 5JHGB 1W9HA 1IN4A 3DZJA 4WBNA 1K66A 4QT0A 5CEFA 1KR2A 1MNQA 4HWTA 2H65A 5EKSA 4NAVA 1TD9A 1OZ0A 5F7ZA 4J0IA 1EA5A 4M0FA 4MUGA 3RIEA 3RVLA 3AXTA 3UMVA 4LNAA 5A4KA 2YMPA 5BOSB 3TGPA 1K7EB 4FGLA 1EI9A 3AP2A 2C04A 3JQDA 5JJIA 1QLHA 3LUGA 5CTJA 2XNJA 3O4JA 5E8JA 3PEWA 4GC9A 3HBFA 1N77A 1XR3A 2A9PA 2AGVA 2D74A 2H85A 1UXIA 5K2MA 2XD9A 3PNBA 5BQPA 4C03A 2Q2VA 1E4EA 3IUJA 3UFXA 1AIPA 4FFNA 2MYTA 3TQFA 4WINA 2FUKA 4BZXA 3Q1LA 4PHGA 3VI4B 2AOUA 5IVKA 3BFPA 1C1HA 2JVIA 2O9JA 1BKSB 4I3HA 1PQUA 4B4WA 3FNQA 4PZLA 4S1WA 5HOQA 1JPVA 4DEYA 1NDUA 1Q1QA 3ANNA 3T5DA 3QIVA 4LPKA 1FU8A 1ZNZA 3IBGA 4CF7A 2XOXA 3UHOA 1S8OA 3HO1A 5FPKA 1B8PA 4EG6A 2VUHB 4QUGA 4BGVA 3UGKA 2X40A 4EP1A 1N9GA 4ZPJA 1E60A 1MOSA 1XZQA 3VTKA 1FUIA 1E3LA 2WSSD 1HH4A 1FMLA 4BDSA 1G17A 3VSDA 2Z5FA 3JYHA 1MGPA 3PZBA 4MHOA 1SKMA 2C9ZA 4PO8A 3EOZA 3RF6A 2XZDA 4JVLA 3NHJA 3GJQA 4MO2A 4EHHA 3C6QA 2QT1A 1D5WA 5L4LA 1YZ3A 2ZE7A 1NLYA 3HMQA 4CTNA 3W8NA 3VHLB 2HTFA 1MB9A 2YTZA 4M46A 3UYKA 5KYXB 1FDUA 5HRAA 1JILA 1REQA 3LA8A 4BVEA 2ZS7A 3P4YA 2YVUA 1TKRA 2COUA 3FE2A 3RWBA 2FA9A 4MR7B 3W6NA 2QB5A 2EKLA 4EB3A 4HY3A 1KI6A 1T2AA 1JG6A 1XA0A 2J0UB 2YOHA 3UJ9A 3BE5A 1YK1A 3B89A 3MM4A 1YZVA 1YHZA 4X91A 4NL4H 4ZVLA 3ROXA 4AXBA 1GZ3A 4EBBA 2QAIA 3TQCA 1OVMA 3VO2A 1FDSA 2ECKA 4XH9B 3TI9A 5GMOA 3WRYC 3EF3A 2DR0A 1IXKA 2GJSA 3D2LA 2C9MA 2GNOA 3N53A 1QRAA 5KMGA 1AUQA 3WK8A 4MO9A 3RUHA 4PWYA 4ZVUA 4CKWA 1H1LB 1JDUA 1ILWA 1FX0B 1W44A 2NSYA 2A3NA 3IKJA 3SR3A 5C5IA 5FBVB 4YT2A 1RABA 1DKMA 4NULA 5H70A 4AN4A 3IEPA 3UMCA 4YAIA 5D7BA 1E89A 1JG7A 3K0CC 2X0EA 1XCMA 4PLFA 2J30A 2I66A 2R6R1 3FCSB 3JCZA 3NNSA 2LDXA 3BFVA 1H5QA 2W6PA 3OO1A 1YZKA 3E3MA 1E9SA 3N0XA 2DBVO 4LS3A 4W5HA 5TX7A 4WLVA 4GUDA 5A62A 4RFSB 4MWEA 4IJ5A 4RTLA 2EHJA 1J33A 1E2FA 5T6MA 1E7QA 3EC7A 5EIEA 1OLSA 1WW8A 1D8TA 4ZAVA 4F60A 1ZVJA 5KKAA 2VSNA 4KN6A 2DQZA 4RTJA 2YWBA 3B1WA 4ED9A 1ZUWA 2ZKLA 2D0PB 4MW4A 5CFNA 4AYTA 4LFAB 3H8WA 1V9SA 1AGYA 1DUIA 3NKFA 2JLYA 4DZZA 3KB8A 2V45A 2HK9A 2HSJA 5DTJA 2ZU6A 2FSGA 3QWIA 1ETUA 2ACVA 4R4JA 1K4MA 4BBJA 4UDYX 3ANMA 2AJBA 5J63A 2H4JA 3L2OB 4NZPA 5D84A 2X7JA 5DT9A 1E6KA 2JAUA 5AJXA 7GPBA 2PGXA 1TU3A 2Z30A 3BHNA 4R1TA 4TYYA 2RHLA 5BWOA 2Y76A 1O9HA 1N7HA 3EXEB 3FX2A 1RRGA 5GV8A 5CA0A 3RVQA 3TR6A 4BQRA 4D9HA 5MFPA 1T6XA 3DGEC 4HZUA 3AVTA 1KRXA 1VMKA 4FM9A 1NNUA 3AR6A 1XAGA 1K2VN 1M72A 4NJEA 2GZ3A 4FI3C 5FTWA 1GZ5A 4TWJA 3NMUF 4IQGA 4UUPA 4N7MA 3AVXA 4S1PA 5K5EA 3SKVA 2HDOA 4ZOEA 2QYOA 4U5XA 2BMVA 1FIUA 4EG5A 5LKRA 3LRXA 4J4TA 4ZVOA 5JY1A 2ZRPA 2PLRA 3BWBA 2VDJA 3TNJA 3EDCA 1EQUA 3Q3JB 1YRLA 4N54A 4OB6A 4MUNA 2WJIA 3JQFA 2HV8A 3R3SA 3LCVB 1KP3A 3PK0A 5CLFA 4ZDJA 3GLHB 3MW8A 1K6IA 3JQQA 3VSBA 2XZPA 1JLHA 1GLVA 1IVYA 3PFHA 5AKXA 2ZUWA 1QGUB 4GSKA 3NV9A 4X1IB 3RTEA 3JQAA 3TR0A 2UUAB 1YQGA 1E9FA 4Q3BA 1QS0A 1R5OA 2I1LA 2VPPA 1E3WA 3FETA 3K2BA 3MJ4A 3OFND 1Q1NA 1WXXA 1EWRA 1F5SA 2HA3A 3ETEA 1UDXA 1YC2A 3P9RA 2BMAA 4MI9A 5ALTA 4RORA 3RUPA 3VZCA 4HCJA 5F23A 4URZR 4B2YA 4ZDKA 1EP9A 2PS3A 2OO5A 1UMBB 1U5BA 3DWFA 1DSSG 1GG8A 1R6UA 4MI3A 5DFAA 5HFJA 5TLSA 4CEIB 3IGFA 3ZVKA 2GWRA 3E8SA 3IVRA 3N05A 5A4AA 4PPQA 4I55F 4BNMA 5I4KA 1J90A 2QD1A 1P18A 1XCJA 2W2XA 1PLLA 3DE1X 3W5JA 4DC1A 4HDSA 4J4HA 3HYRA 4LYEA 3WC4A 3H6KA 2UUBB 4FX5A 3PLAE 1LVUA 1WDLA 3PVZA 4P3XA 1VJ5A 3K1AA 1UWLA 4V3CA 4YCAA 4J0DA 4QXMA 5DTQA 2R85A 3BSWA 3QEJA 1UBMS 2O0KA 4IQ4A 5EJFA 2G5PA 3HO6A 1T4DA 2R84A 3HUFA 4LRTB 4LF5B 3H5TA 1WXHA 1Z0KA 1ZGZA 3EQ8A 5CBKA 3ABSB 5C32A 5DCUA 4MUHA 2JIRA 3KT0A 4ISBA 2H00A 1UJCA 5CFMA 1X7XA 1XBTA 2XI4A 4NEHB 4P53A 1CJVC 1A9TA 3PKJA 1Y3BE 1P4HA 2A0FA 2IIQA 5CLLA 4TZKA 3BC1A 4X61A 5FBWB 1T2FA 3EIOA 2VQ6A 4K6HA 4AZ0B 2Y1DA 3QEMA 1W76A 3LUJA 3W05A 3MLEA 1U7TA 5HSGA 2DHEA 4DDKA 3K1TA 3ELWA 3P9KA 3A14A 5AJTA 1RC1A 3AI1A 3BULA 4NOKA 4TV9A 5FQOA 2AKEA 3C3EA 4KHZA 3IS3A 4K0RA 5HJ7A 1UM9B 3MN1A 4QNNA 3E35A 5JPDA 1VCOA 2BSXA 2GTIA 4QATA 5AVYA 1W0KA 3KJHA 3MJSA 3AJRA 3EWNA 4XUGB 1T24A 4GOXA 2OCLA 1R7RA 1S3IA 2C84A 2PUCA 1ISFA 2QN8A 2NUTA 1VA5A 5FA6A 1XZCA 4HG2A 4HVTA 3U37A 3K9GA 4ZI5A 2Z09A 4UPEA 2Q7OE 1XA4A 3QMWA 2B4QA 1NUHA 4IXDA 1GCOA 1JIQA 4MW7A 1GQOA 1E1RD 1DFGA 3QVWA 5DLYA 5JNSA 3JYOA 1S02A 3AUFA 1SQ6A 4W1SA 1VJGA 2HQOA 3TPCA 5DI9A 4Q00A 4ZI7B 3NEJA 5DM4A 2FEWB 3B1XA 3CF4G 2XDAA 3AUJB 3KAJA 5LP6B 3KLMX 3PLRA 3WIDA 1RC0A 1EFKA 2VCHA 1NI5A 4R9SA 2OV4A 4DKJA 1Z33A 4Q34A 5G3ZA 1S9HA 2A5FA 3DCIA 3G8CA 1R0BA 3E8XA 1DFHA 4C7VA 1O96A 4DQXA 5CEJA 4CIXA 1P3DA 1IK6A 2FCAA 4AECA 4Q4HA 4UZEA 3FVQA 1VMEA 4ZVVA 4EJFA 4ZOAA 4UNSA 1Y80A 5ER9A 3LUCA 1FJXA 3LVBA 4DTIA 4UNIA 2VZLA 3UMFA 2W00A 1B0AA 4JELA 3ZDEA 1E8NA 3RC9A 5B55A 3U62A 2A7XA 3CW2A 3CNQS 1GCUA 1GNPA 2PFKA 1Q11A 1NL3A 1IUOA 2NTEA 1IJEA 4IO1A 4IUCS 4GBGA 1GKIA 4HQRA 1I14A 1XB2A 2H06A 2XMDA 4V38A 1KAOA 3A6EA 4W5JA 4YJDA 1EZ1A 2P6UA 3GMDA 4I50A 2OO7A 4X94A 4MQMA 5I7SA 1FW6A 3M82A 4A15A 3RU9A 1F2TA 3N2KB 1XYVA 1H3NA 4LRSB 4LMRA 4GKJB 1RDFA 5IC5A 1EWYA 1AZSC 5BXQC 1CW2B 4ZO9A 3F5QA 2PLNA 3H18A 2AIRA 5DHSA 3TNFA 4EY7A 5IANA 3DR5A 1E7MA 5EMJA 4A23A 3I9FA 4BO7A 5LWQA 3FBTA 3N2GA 3SHVA 4A6DA 2OGWA 5EJMA 3OLWA 2FDCA 2Z2XA 2JI4A 3BAZA 1O0SA 1UJBA 1Y3AA 3EQZA 4M83A 4NCHA 3U49A 3W6PA 1G1MA 1SXJD 2O2HA 2QVGA 1U2GA 4OHPA 1P44A 4P7FA 3D54D 3C3WA 4QUAA 4EWLA 1EJBA 1YVEI 2KB0A 4PGGA 4Q6WA 4EJSA 5KTPA 4RPCA 2WTAA 5FV4A 4DV2B 3OMLA 1P72A 3KD3A 4KWIA 1AV6A 1C8KA 1PLJA 2IY8A 5HUQA 5EKXA 1XWWA 4LCJA 1O5IA 2ODQA 2AT1A 3M3PA 1JEEA 3PL5A 2P40A 4MV6A 3CC8A 4GQIA 3LBHA 5FHQA 3UYLA 4HRVA 4EQ6B 1UQTA 2OGSA 1QCCA 3C3JA 5FA5A 2WKPA 4OM7A 3ZWKA 1GADO 3NBMA 4BVHA 4I9GA 4WHMA 4O2BB 5BV1A 1AZTA 1EMDA 5IJ0B 1W85B 3HFRA 3IPXA 5IT9A 3KT8A 2AZTA 3K32A 1AUOA 4MEBA 3UJNA 2YASA 1WHSA 3WGJA 1L2TA 3PICA 3OJFA 2E7ZA 2WD7A 2HI0A 3G68A 2ZCVA 5CBPB 4P8RA 5FTJA 2ASVA 2V7WA 2RKWA 5JR3A 4JJEA 2IU0A 1T10A 1FDTA 2VKQA 3DA8A 5ILQA 3L6BA 4ALKA 2OP1A 3CRVA 4TTAA 3RVNA 1GUDA 1E4EB 3VOTA 1EU1A 5BWLA 4I8IA 4UEWA 3KAQA 4X3OA 4D6XA 3C3BA 3LKVA 1BVYF 1KYVA 5LDDC 3OURA 2HWYA 3LW7A 4N1AA 4E11A 3RJMA 2IY7A 3GGJA 4RQUA 1CUGA 5CHYA 1SM4A 4D5EA 2ODWA 5GOTA 1CX9B 1NX9A 1W0JA 3CY6A 4DG8A 3BMOB 3GB9A 4K81B 3UC9A 4YMVA 4A16A 2GCOB 1XLTA 1UMCB 2J5BA 3GT7A 3DFIA 5F9MA 3HNPA 4J3NA 2F59A 1MDBA 1MVLA 4WOKA 2WHEA 4UU1A 3AHGA 4G3XA 2VH1A 2X2OA 1KO4A 1RI4A 4LOIA 4BOYA 5LZ9A 1G59A 2ZWAA 5KVCA 3WGGA 2NZJA 2X8LA 1PKEA 4HH1A 4DR5B 1KZ6A 2A9KA 4I9FA 5CYPA 4DRXA 1JNXX 1U0NA 3DTTA 2BYTA 2QD5A 2XXBA 4LBZA 1EUCB 2JFNA 3E5NA 3GBPA 3AZPA 1L5KA 1LX7A 2IZ5A 2VJQA 3B7GA 3A0UA 4N3GA 5DNWA 4FS3A 3WMRA 2ZI5A 5KTOA 3ETJA 4E3ZA 4DM3A 3L7OA 3P0FA 3Q8WA 3PLNA 3RHZA 3FMIA 1RADA 4RCZA 3ZHZA 1YJBA 3OIYA 4FC7A 4RBNA 5FTNA 4OBBA 1I4TD 1BCRB 5HF5A 3CBQA 5B3AA 1BN6A 4D0SA 4FN5A 1II8A 3WYNA 3E22B 4DEXA 1CIVA 4EJSC 4IDPA 1YI0A 1F3OA 1N9GB 3R2JA 1I10A 4I14A 2QY6A 4JLNA 4Z0NA 3GLUA 2W6MA 4HJRA 3I0NA 2HQSA 2F4VB 3A26A 3K15A 4OBEA 4NDZA 3MMXA 4IW3B 1RTKA 4IKOA 4L5JA 1KC3A 4DXDA 1M34E 3ZWWA 1YD7A 1NJ5A 4TT3D 5E4FA 2XKJE 1AK1A 3MLAA 2NX2A 4YQYA 3AINA 1EIWA 1JU9A 4CDRA 1TVCA 2IWHA 1U63A 1CJMA 2ZB2A 4TUYA 3I32A 2O1WA 4L5AA 5DHQA 5EPUA 2P1RA 5EJ7A 5JDCC 3S29A 3QU2A 2Z1DA 4EY3A 3OU6A 2R25B 3LUFA 4ER5A 2D1RA 4Z4GA 3NH9A 2WU3A 2ECPA 5AUQA 1Z8FA 5IM5A 1U0JA 2R6DA 4IVNA 3DL2A 4KN5A 4BIMA 1A8IA 1NYQA 4WZAB 2XRFA 1W4LA 2WBLC 5EGNA 1E9EA 4X8MA 5AK0A 4C88A 3HXLA 4I2NA 4LY6A 4EKEA 1GU7A 1TK2A 3W9YA 3T1TA 3L4BC 2XMCA 3UWPA 4IGFA 3UT0A 4E09A 1M6VA 1SVSA 3OLYA 5ER6A 3TG8A 2NZ8A 1HDOA 1IH8A 3UPDA 1QHHA 2PUDA 4ESVA 1F17A 3JR7A 4KO1S 3UO8B 3KE9A 3W06A 3T1YB 3ZU6A 4B2PA 4E94A 3GW8A 4PANA 1A1VA 4J0HA 5H7XA 5HG0A 5KJEA 3W2IA 2JA2A 2YJ3A 1TVMA 3PFBA 2DT8A 1E5LA 4FHGA 4GP9A 1TC1A 5KMGB 4NFYA 4GMFA 4HJXA 4XW2A 2XJ9A 3VSAA 3JPWA 1QGDA 4MUJA 4YAUA 2ZSUA 5IG2A 1OIVA 3ZWDA 3DAGA 5TEWA 2P6RA 1Q92A 3CXUA 3AI7A 3QBJA 2PEZA 3GLQA 4M7OA 1DC8A 1DXOA 3A8TA 2IEZA 3DUFB 3PNSA 4AZWA 2DEUA 2O05A 3RWOA 4GZMA 4YT5A 1W35A 1PK7A 4G85A 2PT7A 3IRUA 2Z2JA 1O4WA 4MLZA 1F1JA 3VXKA 3RADC 2GBLA 2AXNA 2AD1A 4NJOA 3BH7A 1DX9A 3V8MA 3U7QA 1NM5C 2RHMA 5CH5A 4FKMA 2J3DA 2AZDA 3MMPA 2J3QA 1OW3B 3CIOA 4G5SA 1H2BA 2ZYTX 4JMPA 4WFIA 3I9LA 5JCOA 3LTNC 4E4YA 3GEIA 4U2GA 3K0FB 2XQKA 2JD2A 2OYRA 3ZQ6A 4PAOA 5CG1A 1HDXA 5FOQA 3C3MA 4LRXA 1O77A 4MLCA 1JZSA 2BAGA 3LUHA 4HWGA 4MR8A 5FRDA 3MGBA 3N0TA 1N6PA 3O8BA 4QVIA 4AY6A 1DKOA 1B6RA 2BEKA 3ITDA 2X6QA 2VP4A 3KUDA 4PLVA 2DH6A 1CHDA 2L82A 4PNHA 1J2RA 5TNXA 4IGKA 4AO8A 2PWZA 3W3ZB 4HTFB 5GZ6A 2GAOA 3AERA 4LA4A 1RVV1 2ATVA 2FNAA 4JWKA 1T43A 4O08A 1E2MA 1IBCA 2WIFA 2ZT6A 3OBBA 1YJQA 5HF9A 4B7AA 3ZXXA 1P7VA 2HHCA 1OROA 3UT5A 3QVTA 4M60A 2ZRGA 4X0EA 3I3OA 3N2LA 2GESA 2GEJA 4EEKA 4LF8B 3QVKA 3BKWA 1RPAA 5KSZA 3GEEA 3MFYA 2G6BA 2VHTA 4AYWA 4F9GA 3D0RA 2ZUSA 1JDPA 3BJIC 3IC5A 1ORIA 5KI6A 3V1LA 1P8JA 2IXAA 2F55A 2FAXA 5DW0A 5NULA 3WL3A 2V98A 4O4IA 2A67A 4D1YA 3COJA 2Z6UA 1M2JA 2ATXA 2YN2A 4K3UA 2DVMA 3CX7A 1J4AA 4IFBA 4PYKA 1MJ5A 1M2KA 1DCKA 4RELA 5JDIA 3BG5A 1RJWA 1A5TA 1ZD1A 2R7NA 1STOA 3G9ZA 3GNLA 2BH2A 3Q5DA 4JEUA 1Z0AA 5TSDA 4EG3A 4YMGA 5AKIA 2GZRA 1G41A 3JASB 3NHUA 1Y48E 4YRKA 5F64A 3NJ8A 1OFTA 2GPWA 4QA9A 2ZUDA 5BMOA 4HS4A 1RHUA 2WD8A 3ENKA 4WW0A 5CVDA 5G4KB 1EZZA 3EDRA 5L3SA 4DV6B 3CURA 2EF0A 2BZ0A 2V3WA 2WSBA 4G81A 4I3FA 2QR2A 1AHHA 2ONJA 1HDYA 4O3MA 5JZOA 4X7MA 4OXIA 4CN8A 3SQXA 4ILKA 4H4EA 1LBTA 1XHEA 3QXJA 1Q12A 1AM4D 1L8OA 1RAIA 3FUXA 3OQIA 3U7JA 3INRA 1JKFA 4Y6PA 5EEHA 5FF9A 4ZT6A 2XVAA 1Z5PA 2GCNA 4BU1A 1PKXA 4KRFA 1UT8A 1QNFA 2QTWB 3DONA 3F3MA 3E8MA 2DUMA 4OQFA 4W4TA 3NRBA 4HVCA 4IIJF 2E48A 2E5WA 4X64B 4POAA 4G2TA 4ER0A 4DG9A 1K5PA 4KZKA 3B85A 1SC9A 5ERGB 1P4SA 4KWTA 4TS9A 2XBMA 5LQMA 3RS8A 5E7QA 2J5XA 4BVKA 3O2JA 1T5BA 4DZRA 2VNAA 4JP5A 1H4SA 4G26A 1NVEA 1M5RA 1ZQ9A 4G1MB 1GOTA 3NBUA 1DO8A 3VAZA 3ZBUA 3VVBA 3N5KA 3UJCA 5LQKA 2ZR7A 1JWAB 1P31A 3QFHA 3OU7A 4FW9A 4EYEA 7YASA 2WQ6A 2IBTA 3BMQA 1EE1A 4H0NA 4W8GA 3U3JA 4ESOA 2QK4A 3C98A 3N6VA 4B17A 4PX2A 2AJCA 1DKLA 1SQGA 2AFHE 3O7WA 3COPA 2GKGA 2ID4A 3QPCA 1G20E 4RSGA 1HX7A 1DMRA 2PG3A 3E9RA 2GCIA 3HS3A 3JQ9A 3SZGA 3EEOA 1AT1A 3PE6A 5FEMA 2BI4A 5ICFA 4QYIA 3TTSA 5D00A 2VBGA 5BRNA 4DCUA 5DF1A 3T12A 4BQOA 4DNPA 4ZTUB 2CLKB 3I30X 4OHXA 5FAXA 5DSXA 5CA1A 2WJGA 1ZRHA 1R18A 4P7BA 3VPHA 5JMWA 2B30A 2BN4A 2IPNA 4RSRA 4IX1A 1KH1A 2BKXA 2XHEA 3EXG2 3PC8C 5T3YA 4ZYVA 1SB8A 3B6KA 1WA5A 5CB6A 4YFYA 3PI6A 1KMHA 4QASA 4UFNA 4D9KA 4EABA 4FNMA 4IAOA 5DP1A 2BRUA 1ND5A 1A8QA 2LKCA 4LHWA 4OH7A 2ODNA 3TIVA 1L4YA 1WY5A 4C6SA 3QKSB 5FWAA 1SC3A 1Z4JA 1YA4A 4HPJB 5H3HA 3WBJA 3GFQA 4ACBA 3NORA 3MJEA 5AJHA 2BJVA 2II6A 3LPNA 1QHXA 2P6MA 3D2BA 4MITA 1QYCA 1QIKA 4MVJP 2AXPA 3DO6A 1UBFA 5C2JB 2H2DA 5JECA 5K2OA 1Y7IA 4R68A 3K0CA 2AMLA 2PUTA 3CRRA 4TROA 4LDJA 3IPLA 1FNSA 1EM6A 3L77A 1ISSA 4NBSA 4E1AA 1AK9A 5K1ZA 2XGOA 1YRYE 4C2AA 3W4KA 4M0PA 1F2TB 5E7IA 4F9EA 1K9VF 2BGGA 2OD9A 1L4NA 221PA 5KAPA 2AFRA 4KO8A 4NV0A 3MQ2A 3IDSA 3UK1A 5CFQA 1BDMA 2J4DA 1PYDA 3L6DA 5G0SA 3THWA 3Q0IA 2Y2VA 3HHPA 2G0NA 2BGIA 1Y5LA 2OENG 4IH4A 2C00A 3AF5A 3EJWA 5JXGA 3PENA 1Z8HA 3BCSA 5EQJB 5ICCA 2WTEA 1W1IA 3PDWA 1USKA 3P0JA 3QA9A 4D3DA 2AC4A 2RAFA 4YK7A 2QTNA 3O2NA 2LPMA 2WK1A 2GZSA 1QGAA 4P2BA 2FUCA 4GAEA 4NENA 2LR0A 4QOHA 4WESA 4E5KA 5LOVF 3RS9A 5I48A 2XB4A 3DVLA 1E0JA 4HN2A 4RGBA 4YR7A 1PNOA 2FVYA 1N6LA 1TYEB 2NVOA 1Q0UA 1RLOA 3FRHA 3BL5A 3PC4A 1AXRA 4PHCA 2R66A 4FW8A 3E2MA 1GSHA 5GPBA 1H2EA 1I6WA 2A4MA 3LQ4A 2J9FB 4QUDA 4OA5A 3A06A 5KQRA 1XEXA 2VUTA 4DRXB 3IOMA 5KPDA 3G0IA 1ECBA 1E18A 1OFUA 3A70A 1TFUA 4M0UA 3TXAA 5C4IA 2OHXA 5IUKC 3UICA 2D7CA 4KV9A 5BP7A 2CEAA 2RSLA 1TQ4A 5ESXA 1GP2A 2WF6A 3QKRA 3VQTA 4F92B 1TT5B 1UWCA 1EJ0A 4XGIA 5GJCA 2QPTA 1M6NA 2ZWVA 1QVZA 2FR8A 2QI9C 4ZCIA 4HZGA 3FZEA 4NY1A 4RIIA 3TJZA 4YRDA 3F90A 5JI3E 1JHOA 1Y1SA 2VSOA 3ZK7A 4DHEA 4IDBA 3LCCA 1OH8A 4FDLA 4LGVA 3ROQA 4O1HA 1LDNA 1N2OA 5LLDA 4XFJA 2PYZA 2OXEA 4NYIQ 3SNHA 5FADA 5KWVA 3K0HA 1JHRA 2GO1A 2VBFA 4J0CA 2HV9A 3SIRA 4FWTA 4P0PB 1VHLA 3PJEA 4EYSA 2DG2A 3OOYA 4H3HB 1KEEA 3NBQA 1LI7A 2DWUA 3G0DA 3BSYA 5C1OA 2DTDA 4LYDA 1V6AA 4IXWA 3ECCA 2PR2A 1T15A 4M4SA 1WUKS 1UKCA 1JB1A 5AW1A 2BHRA 1G3MA 1WB9A 2B9VA 5BUZA 4PG5A 2PSJA 3KR1A 1NXWA 2VDVE 3LOQA 3IR7A 1GZHB 1OLUA 4DYDA 2G4LA 3RANA 1EDEA 1VRVA 1JIKA 4II2A 3ZLJA 3HJTA 3NUGA 4AZ3B 4DY4A 1YONA 2DF8A 3HXQA 5LMUB 4XDYA 2RGUA 2W2OA 3QKUA 5M3BA 2K87A 3QQ5A 4D8XA 4PCAA 2I22A 3W4IA 3GPBA 4YRJA 3V55A 2VJNA 3VC2A 3H42B 1V4VA 2I54A 4G9GA 1LJ8A 4Q39A 3PQ7A 4FPXA 5JW6A 1XTVA 1DUVG 1W2HA 2ZXFA 1O4VA 2VPIA 3NC0C 3KCQA 4M99A 4F5DA 4UVGA 1YCHA 2C2MA 5B30A 1WPQA 4CR7A 5I9SA 4CLDA 1P29A 2PL5A 3M89A 5BSTA 2WG1A 2X4GA 3LIPA 1DV1A 3EXIB 2AX4A 1VZ3A 1THZA 1Q57A 2Q6LA 3BMCA 3PFKA 4Q7LA 4G8BA 4P5PA 3HXPA 2HCFA 3L04A 4OH1A 5SICE 1Z6PA 3W6OA 2FPLA 2ACWA 5F2KA 2PS0A 1N32B 1JEOA 1Y4SA 2VAMA 4UJ5A 5ALUA 3U7QB 2O8BB 2QTTA 3PF8A 4QC2A 7MHTA 3G6WA 1JH9A 3K31A 2PQ2A 4HH3C 4OKIA 2XDWA 4H4DA 2X7XA 2Y1GA 4Y9SA 2BMJA 2C5EA 1PJSA 3G9XA 2H57A 2VAPA 5CYOA 3C70A 2PX0A 2CJWB 2FUG6 1WB5A 3O21A 3R1IA 3T3NA 2G5TA 1GQQA 5IBPA 1VLLA 1G1AA 1G8JA 1ZGJA 4UBKA 3C48A 4PCVA 5FLEX 3UA4A 4B0OA 4Y2UA 2P30A 3W6UA 1NOIA 3F3KA 3PYLA 1EP1B 2D2FA 1SU8A 1U0TA 3A1UA 1R0ZA 3HUUA 5DULA 1JQLB 4D96A 4QM6A 4BIIA 2OILA 4PQGA 2UUCB 1VPLA 4EYKA 4J9VA 1GPUA 4QUBA 4HT3B 5C8YB 3QBVA 5LJLA 1DTEA 4BWVA 2V1XA 1K88A 2IOQA 1SOMA 4CMHA 1ZNWA 5LYJF 2YW2A 1XAJA 4NOLA 3NWJA 3RK4A 1TLTA 2HPVA 1W0KD 2HXYA 2XWPA 4GP6A 3HH8A 5F21A 1FNBA 4L4UA 4DZTA 3HVIA 3K30A 4RAQA 5ETJA 1QYVA 4AZTA 3NAMA 3QPVA 3WNVA 3G89A 3CPSA 4GXNA 4FMDF 2VSFA 5DH9A 5KNBH 3VPBA 3SR0A 1P8AA 1V1RB 1NSYA 2D62A 1NY6A 3EB9A 3MRVA 1TJNA 4LHZA 2VNIA 4ZEWA 4RJLA 1U8YA 5BWCA 1LLQA 4Q93A 1ZAYA 2B82A 3X2SA 2CLCX 3A9SA 3W34A 3GLFA 3BXGA 1HQCA 3MUOA 2V54A 3SXJA 5ALEA 1CY8A 1AKVA 4YLEA 1X7YB 2OBMA 2RK4A 2JJ2A 1XLVA 4Q5IA 1DBRA 4YROA 3LUDA 3WI7A 2DR3A 1ENYA 4HMPA 5BOSA 5ANRB 2I6FA 1N5OX 1MO2A 4BV3A 1SA0B 3K0FA 3HBLA 1KJJA 2PKQP 4BNNA 2BEVB 2QJTA 4J0FA 4LXHA 3WA6A 1JDSA 4L07A 2Q4EA 3DL7A 2VNSA 2Y71A 4P1ZA 4ZCSA 4UREA 5EXTA 4QDXA 1TK9A 2A3RA 2FRDA 1RKVA 2OV1A 4KR0A 4ZVMA 4C4OA 4U3JB 1ZL0A 4CQLB 1JHQA 5B5SA 1NW5A 1GNSA 5FNVA 5T64A 3X3HA 3EZFA 4J0GA 1KYTA 3OZDA 2A33A 4JBIA 1YB5A 2YY7A 3P19A 4IYRA 4KEAA 3PITA 4Q4DA 4LG1A 1DO0A 3NTRA 4HAXA 1L4LA 4J4BA 3WDMA 3ZGYA 4E7OA 4EX6A 1UP4A 4RK4A 4CU5A 3ZY4A 4YP9A 4BO4A 1Q1GA 1H65A 3O84A 5IF3A 4MULA 3R6DA 1FU7A 3KG2A 3H2BA 1FJ2A 4QFCA 4N0QA 3TB6A 4B40A 5EJ9A 1RM0A 2IYEA 4KTVE 4R1QA 3FSGD 1ULSA 4GKAA 2H1WA 2P3OA 4IZHA 1CT9A 1YQDA 1JZTA 1BG6A 1XQXA 4OXQA 3A4LA 5L3ZA 3BK1A 2YV4A 4IVPA 3P0EA 3TNYA 1GN9A 1Q7EA 4UC0A 4BKUA 1HZJA 2F9FA 4DIKA 2PA0A 1OT5A 2C1ZA 2F1IA 4JI5B 4YUZA 1KI2A 4TSRA 5M34A 4QJ5A 2ALJA 1SN7A 5IFLA 5KHOC 4MIKA 1ONPA 5D3QA 4KR7A 3FNGA 3JQRA 1RWOA 5ADWA 2A92A 3KR9A 2MMCA 2N46A 3IJRA 1VXOA 2E4AA 3DE5X 1YDGA 4XVQA 4ZI3A 1P19A 3HXOA 1PR1A 4UXHA 5IEBA 1TNDA 1GYQA 4TSFD 5BQFA 1KA9H 2PWPA 4FDTA 3ETCA 4BMVA 2V7BA 4CL0A 4J1TA 1XEFA 1H9BA 4Q4JA 3QFTA 1I1HA 1M2GA 5ALIA 3BOSA 4A91A 4GPAA 1R0KA 3B6EA 4DM7A 3VH3A 2VP2A 3GVHA 5K7SA 4RO0A 4YB8A 2CL6X 2WZBA 4ARAA 1H6AA 1FJGB 2JD1A 3RRFA 2YZMA 2D5BA 3QNUA 4ZQFA 2NUBA 4IUDS 2Q8QA 3C4QA 3DVAA 1ZUD1 4P08A 2GEBA 2E4ZA 3D7NA 4RPJA 4X1IA 1IM2A 3NG1A 3LV8A 3NJRA 1F6DA 2BLLA 5DTEA 5EINA 4CL3A 1FVFA 4D92A 3T7SA 5EZYF 4JBYA 4D9JA 1BQ4A 1YBMA 3V1YA 4BBAA 2AJLI 1MOQA 2G63A 1T8SA 1U8TA 3SMVA 3W7AA 2D2XA 3GUZA 4MTCA 2XBLA 4L4RA 1GDHA 4EW2A 1DAHA 1GGVA 2TYSB 2H8KA 1C2YA 3A3OA 3EWSA 4A8TA 1P1JA 1JA1A 1IFXA 2ZOSA 3LLSA 4S24A 1Q77A 4EATA 5EHZA 2ID7A 4FOOA 4LYFA 4ZC1A 5A5GA 4WY2A 3LXRA 5HIKA 4DHWA 5E2BA 1X1EA 4BN4A 1M6YA 3ZKAA 2RHWA 1A4UA 2TRSB 5K0SA 4CBVA 3T06B 3C5HA 1MDFA 1R6BX 1S2OA 1VHTA 3DV2A 4Y8VA 5FPPA 3SDZA 4JNCA 3AG6A 1Y98A 1E6EA 3THWB 1MQSA 4JC4A 1OUMA 2UUPA 3BHMA 1Z22A 3QE3A 1X1CA 4URVR 4N18A 3QLEA 4CT4B 4XX0B 4A10A 4DMUB 3SC3A 2KW5A 2IW3A 2PMFA 4DC0A 1GQRA 2Z2KA 3GLTA 4JFRA 3TDKA 2XB8A 3DZHA 1C9MA 2QX9A 1OXKB 2R62A 3C3DA 3A9CA 3VJLA 4YQEA 4TYPA 3KT6A 1US8A 2DQYA 2CCJA 1G7SA 2GN9A 3BXXA 3F1KA 3NXKA 1RM3A 3LWDA 3QRWA 3TLAA 2X19A 4BRSA 1XJWA 1P7WA 1V8FA 4BUCA 3WAGA 4P2GA 5A5VA 3TOZA 2FQ1A 2ISQA 4A73A 8ABPA 3P0HA 5L4SA 4IH9A 5LSAA 4IFEA 1LTHR 5DYTA 5KX5A 2HK6A 3GPDG 2CMDA 3C45A 3OFJA 1FSPA 1PS9A 2J8ZA 1UPTA 1Y8QB 4S1TA 2WSIA 3UJDA 3C7TA 5K8CA 1W1WA 3G3EA 1GA6A 4F5EA 3SS8A 5JMOA 3OX1A 1YB4A 3JQBA 1JSRA 4B3XA 7AT1A 4HMQA 2V0GA 4QLOA 1U3CA 3DB1A 5BSEA 3IAM6 2W22A 5JFTA 2A14A 2IQ5A 1TVKB 1R0LA 2AI2A 1CDEA 1SCUA 3HC7A 1Y5IA 3OT4A 2VDRB 3JVVA 4KGXA 4D9EA 1HT2E 1WS6A 3Q6IA 2O57A 1LK5A 1D5CA 1G64A 1PU2A 5H82A 2AX3A 2PPLA 4A9AA 4E6EA 3WK7A 1JXQA 5C1DA 3TRHA 3VYTB 4B79A 4IZ6A 4XQ9A 3OUTA 4KH0A 4NDAA 1WO8A 4AJ9A 3M4NA 4FHFA 5JAHA 2ZRIA 2JF0A 1XRRA 2X1VA 5C8YF 1ZIXA 1NE7A 5JZ9A 1XU7A 1JXAA 3LP5A 1AF4A 2A5JA 5LB4A 3IAS6 4HAUA 5LYYA 5AD1A 2DLDA 2GVNA 1ZMXA 4MIOA 4XIJA 3RKSA 5TPZD 2D1QA 1PGOA 2GLUA 3Q8LA 1B16A 2A84A 5BRJA 5C0OE 1C3EA 2OZLB 4LJ7A 4FZJA 1KAMA 4DM4A 4C29A 2YHIA 2VJMA 3VNBA 3H9GA 2Y9MB 3D0QA 4RVNA 3KVYA 4FEAA 1IVSA 1UUFA 3T99A 4URUR 4X6XA 2DT5A 2PQ6A 3FZQA 3I73A 3PDCA 4F8EA 3TIIA 1T5LA 4R8KA 2UZ4A 1GHTA 3MEQA 3ZHUA 3U40A 2ZRAA 1TT5A 2PU5A 5KHAA 4DN6A 3ME5A 3AFMA 3CUSA 1NJ6A 2FG7C 3R3WA 5AYVA 2PMEA 4K9RA 3DAPA 4NZNA 4CIWA 5IF9A 2AJTA 3E03A 5BR8B 4MHSA 3TTTA 1X6VA 3IIKA 5A4IS 3IV6A 3QHPA 1CP3A 1NF9A 3GFFA 5TMPA 1JHMA 4DREA 4ZV4A 3OM8A 1FQJA 2HRRA 2X9GA 1PEDA 4Z9AA 4HUTA 2HA6A 2UYYA 4OOFA 4DMHA 2IUSA 3DBHB 2Y4OA 4P9NA 2H08A 2PFGA 3G2QA 3NC4A 3LY7A 2VNHA 3T7AA 3IVAA 2BKVA 1FP1D 4ID9A 3QNWA 3S0JA 3LVFO 3HWRA 5KDOA 1AY0A 5EN4A 3FRIA 1LDEA 3I12A 5CK5A 3REGA 3K9WA 4Z49A 2OFFA 5FD8A 1ZXBA 4FN4A 4YRIA 1MG5A 3LCJA 2J3JA 4O6VA 3VM6A 3UGJA 2FW6A 2ZRMA 4F84A 4ERXA 4NV1A 1BDBA 3ZW8A 1DKNA 2Q5OA 3HL0A 3KU1A 4N3NA 2JBWA 3IB3A 2PT5A 2RI6A 4FGJA 1TGVA 4ZT4A 3KFXA 2NQ8A 2NPIA 2DKNA 3PEVA 3E27A 1L3IA 4F6LA 1BE8A 1KWGA 2F64A 3VU9A 4YAGA 1ZC3A 5JBQA 2BV3A 3AVWA 4UCQA 4F2WA 2BFDB 4OB7A 3TEJA 5HPYB 1VBNA 2Q3FA 2ZBVA 4EZEA 1ZUNB 1QH0A 2ZPUA 1YH3A 1QP8A 3D6FA 5IMBA 5AM0A 5CBPA 3MVEA 5G0WA 3KSRA 3DVQX 3REFA 4BB6A 4KLZA 4AJ4A 1WE2A 3ITNA 4AP5A 4E5UA 4EUFA 2O23A 5D5HA 4O8ZA 1QB7A 1LJUA 1XN4A 2B98A 3PHHA 4BUJA 1SUAA 2EWVA 4PV7A 1IPHA 2YIDA 5DM70 3RG2A 3E7WA 3RNOA 2D6FA 1E4YA 2F48A 2JEZA 4Q1DA 2AOTA 4WT7A 1TDJA 2DFLA 5F5XA 1Y8AA 2AMJA 3DV9A 3DC2A 3HSYA 4DDWA 4H35A 4BWFB 1WUIS 4X6LA 4YP5A 1K4YA 4KQJA 2YBDA 5CNIA 2D5CA 4DF3A 2Y2UA 5F73A 6REQA 4AF8A 1IZ8A 1OC4A 1TIKA 2VHYA 1H94A 1JFVA 3IESA 4UD6A 5EAIA 1O6BA 2REQB 1BE1A 2HUPA 2IYVA 3AOEA 1XN1A 3BKXA 3DB2A 3I2GA 5TQ0B 1AQUA 2VA8A 4LTNA 3OEHA 2HBQA 1A2BA 2ESRA 4JQCA 1X7HA 4CLHA 3FW1A 2Q7XA 1VL8A 3DUWA 4KSBA 5K20A 4MKZA 5FV7A 3D6HA 1KHTA 1CTQA 2XCUA 3KD2A 4EAQA 3OEHD 4V0LA 2YRWA 1F6WA 1JUDA 2OL4A 3KLNA 1L6IA 4M7RA 1Z36A 2EP7A 2M6KA 1F9AA 1Z8NA 2BDEA 3U31A 1G8AA 1UXJA 3OZ7A 1U28C 1VBFA 4ZU3A 3SIXA 4ZEVA 1NSFA 1L5LA 2AOVA 1MXHA 1OTHA 4JLBA 3AM4A 1O6ZA 3L43A 3AL2A 3NDIA 4QGFA 2ETXA 4OJMX 5HDQA 4RD0A 1Q6YA 4HB0A 5KQSA 5BN1A 4DQUA 4RD2A 4MUEA 3K09A 3K70D 2IZZA 5LIRA 2F3UA 2OHVA 4S2EA 3UAZA 5IC4A 1L3CA 1WDMA 4QICA 5AOCA 3ZDQA 1U8XX 1UPUA 1FFHA 2QLFA 2JJ8A 2QAGB 4RIEA 5KOJA 2ZYRA 2P5YA 5DX1A 5M04A 1FK8A 3R3ZA 4HGPA 4GMGA 2FMKA 4FYPA 1PJCA 1QVWA 1MU0A 3SD7A 3WGLA 1OY1A 3CCCA 1LQUA 1KAQA 1PFWA 3QF4B 2Z6VA 3A37A 3Q0TA 2AR9A 2O7QA 5DXAA 3HCDA 1BGVA 2QXTA 1D6SA 2V9CA 3D1JA 5AQ1A 2V55B 1UBKS 3EVFA 1BCSB 5EMLA 5FQNA 5K0JA 2P2ZA 3PEFA 4V0QA 3FSRA 3TBKA 1EDBA 1K8ZB 2W6QA 1PWZA 5JISA 1PTJC 3EIQA 3FMGA 1ZH6A 3KXPA 2IKSA 2XY4A 3LQFA 2HD4A 4PCLA 5C8YA 3J81A 2QZZA 4PXAA 2ZXUA 3E58A 3V32A 2O8CA 1YV9A 2XPCA 4BVGA 2ZDGA 3H6HA 3EEQA 4DLTA 4DSOA 2HSGA 1AC5A 1DKUA 2J3MA 2GHQA 2XECA 3IQGX 1KEWA 4NYJR 4W9NA 5TT0A 3WQHA 1VSBA 3CUTA 3EGEA 4DUGD 1Y8RB 3K8ZA 4GZLA 4KG7A 4YJGA 2PBLA 1YJAA 1QVAA 5FORA 1M2OB 1Z2PX 5T41A 5ICMA 3C85A 1TM4E 1V7PC 3AW9A 2J09A 3ADKA 1HLFA 2E5FA 4HZIA 1J25A 1YQXA 2NVWA 2PA3A 3SC4A 3T5AA 4RTMA 3C1AA 1Y6JA 2G7MC 4LOAA 2VQSA 1ILEA 2Y1LA 3CA8A 4Y2RA 3BRWD 4JYMA 1X7YA 3ADDA 2R48A 2VP3A 1BA3A 3B1FA 5ITWA 1GA4A 3JSXA 4FYYA 4EW1A 2LE0A 2E4YA 4IQ8A 1WMAA 2WSLA 1CE8B 2P8JA 3R7LA 4N12A 4CNBA 1BJKA 3PR2B 4V2UA 1D6MA 3CX8A 1SA0A 1OREA 2ZK7A 5C7YA 4Z7NB 3N8HA 3R7NA 3BM5A 1KJ9A 1B7GO 1C8VB 2X3FA 1O03A 1DC5A 1M2VA 3CZQA 1GFSA 3JTMA 4IXNA 4I8XA 4MRMB 1GNLA 4U1RA 4DJTA 5HUHA 2P2SA 4AJHA 3W5CA 2EW8A 2VRCD 4EY4A 3F73A 2MYNA 2PJRA 3T34A 4HB2A 3UV3A 2ES4A 1QFZA 2R751 5JCJA 5A6SB 2FW0A 1KARA 1I2CA 2HYIC 1VB3A 3B3FA 5EZ6B 3DWEX 5F9FA 3H1EA 1UJMA 1OI2A 2IEAA 1GRQA 1XU4A 2WFAA 5ALNA 4MRNA 2FZKA 3LY9A 3KXLA 3VKWA 3ZVNA 3R76A 3OFSA 4CFZA 1KRHA 4HAVA 2GN2A 3E9NA 2RH5A 1SURA 3BK2A 5BYJA 2VF2A 4DXAA 1FLAA 3N8KA 1F4VA 1MH1A 3N07A 1KJNA 2BKLA 1AZLA 2JHAA 3EEBA 4OMUA 2GASA 1QG6A 2HHJA 3CLSC 3UXMA 1USVA 4YUAA 2H3EA 1E2IA 1Y1RA 3NWEA 4I4TF 5EHGA 1U65A 1Y34E 2YWXA 4EHFA 2BP7B 5J43A 1DQNA 2VSXA 3AGQA 4WCFB 1P2GA 3RS2A 2R4TA 3DLBA 2JGMA 3ZEIA 3COSA 2X42A 1RYFA 3UAOA 2PVCA 1RXUA 2QZ9A 5ADVA 3HKCA 1ADCA 1H66A 1ZN8A 3BH0A 2YCBA 1QH9A 1P1BA 3HEMA 2HU8A 3I9V6 1J70A 3LWNA 4UXJA 5LZ5A 4D2IA 2YN4A 1VE7A 3NLLA 1KMIY 4B32A 2OHFA 5HBGA 5L4NA 5SZIA 2DLCX 2OTCA 1X1TA 1YJ5A 3J7TA 4LSMA 4N6OA 3QZUA 2DB3A 1G19A 2QMHA 2GDZA 5K8IA 2FZCA 2JIPA 1JA0A 4FR5A 4RM3A 1YBFA 2CVPA 5IAAA 4JB3A 1RBMA 2EW2A 2BKUA 2XMRA 4ZZ1A 1IJKA 3HACA 2I03A 1H8HA 3CRW1 3PD0A 2DQ4A 1L7EA 4KQFA 1H2RS 4I66A 3WTCA 1Z7YA 2AKAB 2JJ2D 1G38A 2IEIA 2XCOA 4J1SA 3OC6A 5H0IA 4DV0B 3WZLA 1QHHB 2O0HA 4QFDA 2DJ5A 3D4BA 1QPZA 1D9XA 3GJ3A 3CH6A 2QX4A 1KI4A 1GKUB 5IAEA 1C50A 1G8KA 1CRLA 4DR2B 3GGSA 2ZB7A 4Z6KA 2PKXA 4L2IB 1HO3A 1LVGA 3EIXA 1N5RA 3CEAA 3OZAA 2MMGA 2GILA 4N8EA 1U7WA 1V39A 3OD5A 3UHJA 1T6BY 2JS7A 4G97A 1YUBA 3GO4A 4LOHA 1X86B 1T9DA 3O1IC 2DXIA 2W37A 4JC5A 1G5QA 1SIUA 1W8IA 2J59A 4N8SA 5K3AA 5M5BA 1CEQA 2Q0HA 3JRXA 2JK1A 3QPBA 1Q0PA 3BXHA 2QQGA 4Z5XA 5KZMB 2QLMA 4LSWA 2JFUA 1P0PA 2EEPA 4Y1RB 4CMEA 3OPVA 3ZCQA 3QYFA 1B26A 1KSHA 2RIRA 4ASUD 3L41A 1WPRA 1HXHA 1X92A 1U2DA 3MILA 3PFFA 3GMIA 4HWPA 4JI8B 5H3CA 1YXMA 4R8RA 621PA 2YHIB 3NYQA 3DYBA 2IYPA 2A5LA 3ENQA 3LBFA 3ZV3A 4M9UA 4YV1A 2FK8A 3IT2A 1O87A 2CF5A 4QUKA 13PKA 4L1KA 4PC7A 1V5EA 1P9OA 2QS9A 4UEKA 3IAHA 3OIWA 4JLMA 3HBJA 2O19A 3WNBA 4ZEMA 5FTLA 2ZULA 4L6CA 3D1LA 1Z2AA 5AK3A 1J23A 2EWWA 4R84A 5KREA 1U0EA 5CPFA 2QROA 1MAAA 3CSUA 2ZIXB 3Q85A 2NTYC 1UXHA 1D4AA 1UWKA 4ZGGA 2Q3JA 3KQHA 1GWNA 4MS4B 4RTNA 3VMFA 3VYUB 4JWTA 4MEAA 4E08A 3ZVMA 1BTOA 4IIEA 4KJXA 1R4ZA 4FSDA 3GCDA 2UXDB 3I05A 3LT0A 3QI7A 1Y4DE 3QVMA 4ZAXA 5TEVA 1KI6B 3TEMA 2ZTLA 3LKZA 5KHLB 1MAUA 1P2BA 4D56A 2PS1A 2VF7A 1RI3A 1X2BA 2GBGA 1JEQB 5KTKA 4FNGA 3MJHA 2BLNA 2Y0EA 3D5QA 3V4PB 3ZLVA 3EVEA 5BW5A 1YIOA 3QU9A 4FQ7A 4TMVA 5DTRA 5C5EA 4DV1B 4AWBA 1DAPA 3LO5A 3SJCA 3RTDA 2YIJA 4UNRA 3KQUA 4X8HA 2AC2A 3G1WA 3G0CA 1ECFA 4MAFA 2IU6A 2WUEA 1WKVA 3CO5A 4KQMA 3LAWA 3R7BA 1LQTA 1UBHS 3BQ9A 2QMYA 1CUHA 3C1TA 4BNIA 4C4TA 4II3A 5BVHB 4AMYA 5K8JB 5JH7B 1DJOA 1EBUA 1S8AA 3NHRA 4HDRA 5K51A 3ZU4A 2VXCA 3KV1A 4D7AA 3ENZA 5HJ2A 2ZUFA 2YN0A 2DSNA 4Q3OA 1JLLA 3WSVA 2PRIA 5AR1A 2B3TA 2POQX 3TW4A 2O5VA 3FB4A 4M1KA 2J3HA 4XCXA 1DBSA 5AH0A 3ROGA 3WO1A 4E70A 1KFKB 3WV5A 5CTAA 2FXVA 3FZNA 4YACA 1H4QA 2FQWA 4RPGA 2X6TA 2FYTA 3HU2A 2ZRNA 4DPLA 4TQGA 1N57A 2FLWA 4Z86A 1D4ZA 1W4CA 3S28A 4LQCA 4O02B 1EXWA 1NC3A 1VKOA 5IKMA 3COVA 2WHPB 5LWHA 1THTA 1A4RA 1RJ9A 2EDAA 3EGDA 4KVFA 4Z1MA 5IRCD 4JOBA 4K2HA 1FL9A 1XUOA 2I67A 2ZYGA 2IE0A 4GMDA 3R0ZA 2RFLA 2PDAA 1DB3A 1Z12A 3H9JA 1KOFA 1ECCA 4B46A 4BBPA 2ANCA 4ZREA 2B1JA 3RS7A 4QPJC 4C0XA 5AVWA 4K9KA 4DIUA 2F9MA 4FYKA 1E1NA 3PXAA 5J2UB 2IXDA 3I9KA 2VCEA 2VYVD 5KVQA 3ZJTA 4LX0A 1U1DA 2PSHA 3DMDA 2ZETA 4P84A 1OX5A 5KO2A 4C07A 4QQFA 2QF7A 2FETA 2Z8YA 4G65A 2RMKA 3C8ZA 1B23P 2DE0X 1NNSA 2CLIB 2HZBA 2R8PA 4U63A 4M87A 2V5VA 2X5NA 5CA0B 4KYTA 4JCOA 5CGQB 1XKLA 1ZIOA 5EWLB 1RWQA 2XUQA 2VOJA 4CM3A 2HLPA 1P9RA 1FFEA 2JB9A 3I37X 3H7IA 5KKNB 2CLFB 1GM5A 1VIAA 1XZKA 3QW2A 1Z2NX 1BDHA 2X76A 4R51A 1KBOA 1EB9A 5KVSA 3P9CA 1XZMA 2C2OA 2DQKA 3CH7A 3D3QA 4BWYA 2O8FA 1FYVA 3D4IA 4LF7B 3D8TA 4QBIA 2AWOA 3U3DA 3SE0A 4MUAA 1ULBA 1C3VA 3WGZA 5K0CA 5LNK6 4EG1A 1TJ3A 2VDLB 1N8NA 2FKAA 3GK3A 3PNLA 4JV5B 2TSYB 1LLDA 4NNPA 1CQIB 2EATA 1O0CA 2H7XA 4AK9A 2YZKA 4CGZA 5KS2A 4HDNA 1BEZA 1RYYA 1QBGA 2AOTB 3DTVB 3NYIA 2ATIA 4DCVA 1OWNA 4Z54A 1SR8A 2AZ4A 2VOEA 3G8AA 3RAFC 4WXEA 4I4TB 5C7LO 1XNGA 4FDUA 2OC4A 1FDRA 2VTVA 3DNMA 3B5JA 4AWXA 4B81A 3G85A 2ZT5A 3FVRA 4GW3A 3VR4D 3IMCA 2I91A 4V03A 3E9ZA 4ZMRA 3ETGA 4LZZA 2ILVA 5CXQA 3IP8A 5IYZB 1HT1E 1PWEA 2CK3A 3U44B 2VIIA 2XDQA 3V1MA 4FCVA 4ZODA 4ZJPA 1WXQA 4CEIA 3FRJA 2NAPA 5JJ5A 1KEZA 4PF1A 4Q66C 2PMBA 1KKUA 4MW9A 1EWVA 3QVVA 2A1TS 3E0QA 3H0KA 3FJOA 4PSVA 2QYTA 3M81A 2UZ0A 3L84A 5CURA 3OQJA 4N82A 3T9BA 1BKYA 3KBOA 3GA5A 5HRCA 3KJGA 2OCAA 1BE0A 3ZNNA 2XBUA 2JFHA 3AZQA 4BUZA 3P2MA 3ZHRA 3H3JA 1Y63A 4JYCA 3MT9A 4PC3A 5DNDA 1GKYA 1IHXA 3KHKA 3UWMA 3CLRC 2FDXA 4YDRA 3ZQUA 5GY7A 2HHAA 1T5IA 1F0PA 4AUMA 3STHA 4Y2PA 1BAPA 3ZVRA 1B4DA 2NADA 2C9YA 3KP1A 3QFFA 4UHHA 5TQ0A 3DT9A 3GLKA 2BZSA 4J0EA 1MD9A 1TAQA 2HLHA 4O1MA 5D5PA 5BQOA 2YUTA 3EISA 3HYTA 2OCKA 3WOHA 1EGMB 2PVSA 1G21B 2I3DA 3LA6A 1V41E 3QBTA 1PDVA 1ZSVA 2DFTA 3TPZA 1NMQA 1V8OA 4OJYA 3FNFA 4BB9A 1W6UA 1TEXA 1FYXA 3IEXA 2GK7A 2CFRA 2ZR8A 3L4KA 1FXSA 4P7GA 4TV9B 1JN0A 1EEXB 2ZB8A 5KQMA 1JA9A 1QGZA 2Q9UA 2NU6B 1D6NA 3WDLA 4CV0A 2NW6A 2GAFA 3CN7A 2HIMA 4NEGA 4C9BA 1WUJS 2C7BA 3FJYA 2PX3A 1MBZA 3WMFA 4DLUA