4ZYUA

Human gar transformylase in complex with gar and n-{4-[4-(2-amino-4-oxo-3,4-dihydrothieno[2,3-d]pyrimidin-6-yl)-butyl]benzoyl}-l-glutamic acid (agf50)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
200
structure length
200
Chain Sequence
b'ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Trifunctional purine biosynthetic protein adenosine-3
publication title Structural and Enzymatic Analysis of Tumor-Targeted Antifolates That Inhibit Glycinamide Ribonucleotide Formyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 64
structure length 200
sequence length 200
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4zyuA00
3DA8A 1GRCA 3DCJA 1ZLYA 1RC1A 1GARA 4R8VA 4TT8A 1NJSA 4DS3A 3Q0IA 4Q12A 4NV1A 3LOUA 1FMTA 1MEOA 1RC0A 4EW2A 1C2TA 1CDEA 1CDDA 1MENA 2BW0A 1RBQA 4ZZ1A 4QPCA 4ZYWA 4EW1A 3R8XA 1JKXA 4YFVA 4ZYZA 4IQFA 1C3EA 2FMTA 4ZZ0A 3TQRA 3TQQA 3N0VA 4YFYA 4TTSA 3AV3A 4ZZ3A 4ZYYA 4ZYUA 2YWRA 4S1NA 2GARA 5J63A 5J9FA 3NRBA 1ZGHA 2CFIA 3OBIA 5CJJA 3P9XA 4TS4A 4ZYTA 3O1LA 3GARA 1YRWA 1RBZA 4QPDA 3KCQA 4EW3A 3W7BA 4ZYVA 1S3IA 1RBMA 4ZYXA 3AUFA 4PZUA 1ZLXA 4ZZ2A 1RBYA 2BLNA 1MEJA
chains in the Genus database with same CATH superfamily
1S1CA 2P1ZA 4LJ8A 5TPZD 3SFVA 3B1ZA 2YUIA 1UBGA 3BJEA 5EKDA 1E7RA 2KMLA 3AB8A 3E3OA 3FDFA 2FVYA 2RGAA 4K6KA 4PGFA 2ZSJA 5K3SA 2AK2A 5ED0A 3U3DA 3CNOA 2OD7A 2PS3A 4EEKA 3O93A 3RU9A 3DZDA 2V03A 2Z4TA 3N70A 3L7LA 3P9CA 1QUFA 4INZA 1E32A 2AT1A 1C8KA 1N2GA 2RGDA 5CJ2A 4BGIA 5JH7F 4CMIA 2J30A 3IE1A 2IHNA 1F0YA 3E0QA 3F46A 3GNQA 1W59A 3URKA 1VCIA 3BRSA 2O0HA 3PHGA 4BNJA 2J6IA 4FGZA 2AG5A 4XEHA 1PJAA 2IZZA 3N0RA 1YZFA 4YP7A 2V6BA 4DCVA 5JCZA 3CUEF 4I3HA 1Q22A 2CNWA 4ENPA 4YIHA 1HNXB 3FVTA 3IERA 5A62A 4LJKA 3ZXYA 3HBMA 2AQKA 2D7JA 1IJFA 2DJ5A 2OZEA 1I2CA 2VDOB 3O21A 4KOAA 3U4GA 3VQTA 1GGMA 4XSVA 5AJWA 2GPNA 4Z2YA 4RBNA 2Z6VA 2RGCA 2NAFA 3IILA 3WWPA 5KVSA 3CVOA 1RVDA 4O1MA 4Z4HA 3OC0A 2PRJA 1PT5A 1WUJS 4N12A 3N53A 3CBGA 4F1WA 1JJAA 1E99A 3M6MD 3TDKA 3ZJYA 3UK1A 4DV0B 4IHKA 3IRVA 1KJWA 4NU5A 2FMTA 5K0ZA 3K05A 5BW4A 3ISVA 4GLFA 2AN1A 2FEAA 1MHTA 1AQNA 4GW3A 1FFHA 3H3FA 2P9HA 3HR8A 1NDUA 4MVJF 4Q9LA 3KZCA 4EGCB 4D5EA 5IZCC 1K8ZB 1IFXA 2A0YA 1Z34A 3DLTA 3EJ6A 2JFHA 2RKBA 4YXFA 1W19A 1GFSA 1KSHA 1Q5PA 2BAGA 1ZOSA 2Z58A 3HCCA 2IV7A 1S2IA 3PQCA 4ZCPA 5HHTA 3S2GA 3X3HA 1PV2A 4EJ0A 2HCJB 4DBVO 1QPBA 3SKVA 4IL5A 1L4HA 4FHCA 4LKRA 1JG1A 2DQ4A 1XEWX 2HSJA 3DDOA 4ZCSA 2AEFA 2XY4A 4A6EA 4MMXB 1T3LA 3EDOA 4QG7A 1NN3A 2RBGA 2OBMA 3MLEA 3GVIA 4RHYA 2CKMA 2V65A 3K53A 4OM8A 4RVHA 3OLCX 3W4IA 4H1UA 2HIHA 2OZKA 4KLZA 3WQSB 4BO1A 1XP5A 3RS2A 3SXPA 1SXQA 2I66A 3MSCA 3NV7A 1AKYA 3GCGA 1U0JA 1W8DA 4E6EA 4CKEA 3HRKA 3R3HA 2F1IA 2ZULA 1Q92A 5IP5A 3EFOB 4I5DA 2F1OA 4TKLA 1BGWA 1UMDB 1NLZA 2IXAA 4WK2B 1SQ6A 1ILEA 3DLAA 2GBIA 4WMLA 5FLEX 1UJMA 4A73A 4X60A 4BFWA 1ZL2A 2O7SA 4DJTA 1W5BA 2ECFA 4CCAA 4BMNA 1B15A 3EX7C 1JYSA 1U3UA 1TE2A 4MQEB 3NC4A 1N6HA 1E2PA 3CZ5A 3KHSA 4XDGA 1KDZA 1BDHA 1ECFA 1THGA 4AT1A 1QIKA 3JQAB 2AZXA 3FOBA 3AZQA 4AY6A 1YZLA 4FMDB 4OSOA 2ECKA 4O4IA 1GRCA 1OFTA 2NZWA 1HEIA 3UAZA 1WX1A 1XZPA 2C61A 2EZTA 4X1KA 4BC0A 4C7VA 5I7WA 2EX4A 1WU8A 4DNOA 3IBTA 1U28A 2WAOA 3RV3A 1NBWB 3F6YA 1P7PA 3CTMA 3V4LA 4C4XA 7REQB 4JY7A 1GYQA 1E9CA 1Q0UA 3MIZA 1J9GA 1GPBA 2VXYA 4CKWB 2ZSEA 1CUHA 1YZKA 1XWFA 1OYOA 1SOWA 4JYCA 5F2NA 3H5IA 4H7HA 2DR3A 2EARA 2Q6KA 4H1TA 2ANCA 2Q6IA 3OTGA 4C0JA 4RJTA 3MWEB 1V1MA 1T6YA 2H06A 1FZQA 2Q1WA 2XZDA 1NHGA 1MA3A 3IMGA 4R2KA 2J6CA 2PFGA 3G2QA 4LFCB 3UMRA 1ZRNA 1W76A 4XR9A 2WTEA 2BGLA 2FW0A 4ZK2A 2MINA 5I8PA 4G81A 2HGSA 4IDOA 4JIMA 2ONCA 1BEZA 4RJ2A 4R84A 1U9IC 4YA6A 3RUPA 4EX6A 3AFNA 5KNCH 3DD1A 4FE4A 1MO6A 3F7NA 2YVKA 1PD0A 1T43A 3HB0A 3NALA 5FOTA 3ZE0B 5T67A 1D4AA 1KZHA 4UOZA 1GNVA 2FSIA 2JFFA 4YWJA 1SC3A 5I7AA 4WVFA 4KIGA 1NMZA 2A9KA 2FX3A 2HLNA 1X42A 4LFAB 1QRSA 2WJGA 2JZOA 1ND6A 4KRXA 3RS5A 1HI9A 1ILWA 3VU1A 2HDOA 1QYXA 2PK3A 3CUYA 1U1EA 1DQPA 4UTPA 2I4LA 5LMCA 2B1QA 4S12A 2QUZA 1JTFA 3RSOA 6ADHA 5AJZA 1PVVA 4UNRA 3PPYA 1U2RA 5AVRA 3WMXA 2AYXA 5B2FA 5I9IA 1ZVVA 2PR7A 1P91A 2NX2A 1A2QA 2FG5A 3FROA 1AKRA 1L5MA 3CO0S 3ANNA 4G9BA 4XVRA 4N0DA 4Y2UA 5K03A 2AWOA 1IB0A 3A1CA 3BMNA 4L08A 1IY2A 2C2XA 3AOEC 5DH9A 3W8RA 2RG7A 5EXPA 4D74A 1XQVA 2XWBF 3BSWA 4JROA 1RYZA 5J9FA 2QI9F 3L7JA 3QSYA 2BR4A 5JNRA 2ACVA 1QB8A 4FX2A 2QLMA 4KYIB 1OW3B 4OI2A 4DT1A 1JR4A 2GAJA 4Y2TA 1XCPA 2QX4A 2FFQA 2YDXA 1BMTA 4KJZA 4DAEA 5HW0A 1J24A 1XRPA 2IY7A 2P90A 3F7TA 3QMVA 4K28A 3G2IA 3QKIA 1ZR4A 2Q2QA 3DXFA 1K08A 3DOEA 2ZWVA 5I4BA 4IDDA 4BPBA 3HWX1 5H9VA 5JMWA 3CUKA 3MJRA 3FNHA 3GFBA 1MABA 3ELWA 5UKDA 3WLRA 4YMUA 5HKKA 2EEPA 3QQPA 5B4TA 4FNGA 3D4LA 5KU7A 2WFLA 5DMHA 1P2FA 5K6AC 4J0FA 3QU7A 2ZT5A 3KQQA 4EG0A 1HDGO 2HSWA 3C7TA 4DMFA 1X7YB 4DIOA 4DDTA 1Y6JA 2AG8A 2I2WA 3OT5A 4L3OA 4EF6A 1MB2A 2MTBA 2B8TA 2JIQA 1H2AS 1NQVA 4JI3B 2XIQA 1ADCA 1HE4A 1W5AA 3WMFA 5BW6B 4EGQA 2BL4A 3IFSA 1PE0A 3S29A 4QZVA 1KRWA 1E6MA 2R00C 4S1PA 4E03A 5C81A 4LWPA 3Q41A 1P3Y1 2H11A 3GAZA 3UWPA 1IHPA 3VYSB 3LPMA 3O2SB 3M6WA 3PHCA 4M0KA 1QVRA 4CMJA 1VQ1A 1NQ5A 1L4FA 3DAYA 5I6DA 1YASA 4FBLA 3LU1A 2KE5A 5KYYA 3SAJA 1LJUA 1Q91A 2WM3A 4JQCA 2NU9B 2FPIA 1YCGA 1Q0SA 1LK7A 1PQPA 1TAGA 1SQ5A 2PWYA 3QJ5A 1HR0B 1R0RE 2H18A 4R71A 1ZD9A 3GA5A 4O2AF 4NNPA 2ZJ6A 4RD6A 2P1RA 3MJEA 4RFVA 3ZK9A 2WJZB 4PC3A 1IL0A 2IKQA 2Z3WA 4DUPA 4E30A 2B1JA 3JR7A 4KIUA 3GUYA 3IMEA 4KN9S 2QNBA 4LGCA 5FKJA 5IJXA 1EWQA 1F9EA 3KJIA 2CNKA 3IQFA 4L8FA 4M0UA 5ECYA 4E08A 3SIXA 4C0QC 1RJGA 3DHNA 1CT9A 2WW8A 4X8LA 1R0CA 1VHLA 4XDHA 1BHJA 5E8RA 4B3RB 3KEOA 2A2ZA 2QPAA 2HSZA 3THYB 2PKQO 5HNKA 2WMYA 1G8GA 1W85B 1ABFA 3HDVA 1NNUA 3EGDA 4D3YA 3KZOA 4C4RA 3A70A 3NHMA 5LKRA 4TLDA 5GJVC 3IEVA 1H23A 3IBSA 4CIXA 5FUMA 1W44A 3TRIA 2IBTA 4D9EA 4OTZA 1NLYA 4OX9B 1ZXXA 4E4YA 5CFQA 4NCIA 3VC1A 4ETWA 1UT6A 2ET6A 3GLIE 1FPMA 4DQ0A 4E5VA 2FPXA 3KZNA 2BFFA 3CISA 3NBAA 1K98A 3CYFA 3BH0A 1GTL1 4BLTA 1NXWA 1DCKA 1JEQA 2IGBA 4EFDA 1FTQA 5C7OO 4HZUB 3SQXA 3G13A 1M66A 2JLRA 4M0LA 3F5DA 2H5LA 3HUTA 5T4EA 2FUG1 5KMGB 3M6UA 2IP1A 3UVEA 2PGDA 2IYRA 4N5IX 2NWQA 3ZVNA 1RQ2A 5DRTA 1GTVA 3SR0A 2EFYA 3F98A 1RZRA 2O7QA 5MGBA 4UDXX 5AI9A 1QPZA 1LPNA 5CJJA 5L40A 2O8BA 1JG2A 4NKRA 2NZ2A 2F43A 1FS5A 3MMZA 4NCHA 5KQGA 3CT4A 3JAWA 4LQDA 4RPIA 4RV4A 1JH8A 4PFKA 2J87A 4RXMA 1I3NA 1ZESA 3RWOA 3ZY3A 4QYXA 2F8LA 5FI5A 4JELA 1Z2EA 1LU9A 1XRJA 4ARVA 2POQX 2V5AA 1A7AA 4RV9A 1BE0A 2C1XA 4LZZA 3JQ7A 5IC5A 3TGLA 4X85A 3NW9A 3RYFA 3TIXB 1RHUA 3A6FA 1ENYA 4AZ0B 4CT0A 4L15A 5J2UF 2CFSA 1OIVA 2WHPB 3O2NA 3TNYA 3VYTB 4COOA 4O4JF 1NIPA 3G3EA 4KSBA 1UKYA 2P11A 1EDEA 1NG9A 1JAZA 4CBVA 4ZVUA 2I3GA 3T4EA 2PLRA 2VHQA 4N3AA 3QOXA 4LI0A 4P86A 2CNLA 1KKMA 5ER9A 3WIBA 2ESRA 5D3ZA 2XA1A 4ETIA 1OWPA 1J9ZA 4QULA 4WXPA 5CM2Z 1KOLA 2OYSA 2BT4A 2MCFA 4IF6A 4YP5A 5CU7A 2B1RA 1Y7LA 4OQNA 5JWHA 3G1WA 4MB6A 1US8B 3RU3A 3W9UA 2LWIA 4R0MA 2J8ZA 3GQBA 5JS8A 3GHYA 4C0XA 3UGJA 2DP4E 3OOEA 5JYDA 2XTMA 3T7RA 4R8VA 1ETUA 1YFZA 4FYIA 4M3NA 3NHAA 1KDOA 3I28A 1G6OA 4R8KA 4X8MA 3OEYA 2YJ6A 4M37A 5BYBA 1A7JA 2JA1A 3TZQA 3MYRA 1UMBA 2HXGA 4HX2A 4POAA 3ZY2A 1ZMOA 2RB5A 1AKUA 2GNPA 3FMIA 4L50A 5C4MA 1QV6A 4WLFA 3AUTA 4NR0A 4ZQGA 4QOFA 3QTBA 4L8WB 4GGMX 1PGPA 4ML3A 5FJIA 1P1BA 5BUQA 5EWMA 3DOHA 1VXRA 1BWQA 4JB0A 3K6JA 5D3MA 4ZI7F 5F76A 4QOHA 3EVGA 1XTKA 2G9RA 2QXTA 1IMOA 2WF9A 3RVNA 5CT9A 2C2BA 3A31A 4GYJA 3GT0A 4QGHA 1ZNWA 4Z7OB 1Z37A 3GZJA 4GICA 5DX0A 4FUQA 4EB8A 1U0FA 1VJGA 4KLNA 4HFJA 4WADA 2X40A 3RC1A 5M29A 1L8LA 2VJAA 4ZARA 4TM7A 1TLTA 5CM8B 4CL8A 3TLEA 1QMGA 2ODQA 2ZXEA 3LCUA 1LWOA 2VUIB 3MBKA 5ELMA 1SCDA 2XTAA 3ZE2B 1HH4A 2W43A 2BFBA 1QHYA 3LQ1A 4PW0A 2ZSFA 3AIOA 3AVYA 3E7DA 3WGHA 1NUSA 4D97A 4TRRA 3WLAA 5DDIP 4C1NA 2PXAA 2CE7A 1XRSB 4X71A 2A5JA 4OFBA 1AGNA 3O4HA 4IY1A 3ER8A 1FTSA 3LVFO 5IT0A 1K2WA 2CDCA 2GPAA 2O57A 4R31A 4RD0A 1VL1A 3F6CA 1BX3A 3LY5A 3OT1B 2Y4NA 1UZAA 4DSAA 2QRZA 1IUPA 1I13A 4URVR 5J63A 3KVYA 2FSVC 3GCDA 3H9CA 1UFKA 3JZFA 2ZUUA 3T0GA 3W77A 2JK0A 4B74A 4RMHA 2GLUA 2HJ9A 3RUHA 4EYKA 1G8FA 3GFVA 3CCFA 3MEQA 4RGYA 2I1WA 4ARSA 1PHPA 1RKVA 3NRCA 3W34A 3ZNNA 5MHTA 1IXSB 1I1OA 1UCFA 4RPCA 4DIMA 4K0KB 2GJAA 2WJYA 1N2CB 5FBLB 3B8HA 3PI6A 1G21B 2PL3A 1X3SA 2VWQA 3I9NA 4LJLA 4B0PA 4E5DA 5B36A 3KSMA 1JE1A 1KYWA 3P9RA 4Z0PA 5E9AA 2WAXA 3TGPA 4EJMA 4IFTA 1QP0A 3NVKI 3NAZA 4GBGA 2OKGA 3SSNA 3OY7A 4IHJB 1P7CA 1TUBB 2V8BA 4L1KA 2QDKA 4XYBA 2Q6OA 3AUXA 3M34A 5JFGA 4YJ3A 1JDBB 2KX7A 3WYAA 3IYLW 3EB9A 2D00A 1MFPA 4HDQB 2HA7A 2GXQA 4PCAA 1MZPA 5KOJA 2P40A 3FUCA 5A0TA 1YS9A 2MMGA 3GPBA 5KWIA 4UHEA 2REQB 2RGYA 5G1OA 1YVPA 3AI3A 2JGDB 2BLNA 1MOZA 4LSWA 1OPRA 4LE1A 4LX8A 4I50B 2JLYA 2O5CA 2AWNA 3PVCA 1DBSA 3WLEA 4F9GA 2AEMA 3PWSA 4AO7A 1IOZA 2P77A 1JJVA 4OGFA 3AHDA 3C4VA 4J0DA 4NQZA 2V59A 4B83A 4BZWA 3EEBA 4QDJA 1ZSNA 5AKIA 5K2OA 1WOYA 4DJJA 2FH5B 4V1CI 4M8IA 4AJPA 1WUYA 4RK0A 3N05A 5D6NA 1XGKA 3MAGA 3ZG6A 4PO9A 4IKEA 5DX8A 1N7IA 4FMBB 1EHCA 1MO4A 4NV1A 5EZ5A 2DSNA 1JIXA 1BOFA 4FWBA 3LZCA 4IIEA 4QWMA 1TFUA 4F46A 3W2EA 4R1LA 1QQTA 2RHCA 3HSKA 1PLKA 1EMDA 5B1IA 4BB6A 5ADHA 2GBLA 4HEA1 4EMTA 1P0PA 3KYCA 2BM8A 3OMLA 5LZ8A 4NYJQ 1B8PA 4I3GA 2P4HX 5B7PA 4CHGA 3U6KA 1PNVA 1YS7A 4XYGA 4BX2A 3N07A 5IAOA 2PRIA 1JQKA 4FHZA 5ENZA 4HNUA 4BXOA 2A14A 1A7UA 4KO3S 5EHGA 2OAP1 1OC4A 2YYSA 3U31A 2RGUA 1RI1A 1BXGA 3GFTA 2C82A 4PGHA 2W4MA 1LQUA 5DBEX 3V6MA 2EX1A 4H77A 2JI8A 1I32A 1A3CA 1K6XA 1YFLA 1VJCA 1G0NA 2GCIA 1HEYA 1GPUA 4BX9A 1CP2A 4EZIA 4X92A 2GPJA 3RYTC 3KE8A 4DYDA 2FFJA 4G4SP 2ZRAA 4BQNA 1AQUA 3OF2A 3M5WA 4YCNA 2GNOA 2WWIA 1X7DA 1XU9A 3KV3O 4XOIA 4OK3A 4W5TA 3E9EA 3RUAA 3KFLA 4G25A 4N8DA 4FYPA 3FPFA 3LXRA 3VZDA 4C5BA 2V5UA 1EVYA 3FVRA 2HY7A 4HQLA 1Q1ZA 3HNRA 3VZPA 1Z73A 3A3NA 3H2KA 3OCVA 2CUKA 3ILHA 5EYPB 1JKFA 2PPVA 2V3VA 4MIKA 4YQYA 5AI4A 1JG7A 3ZE9A 5KC9A 1B00A 1DEXA 4UQLA 1WVGA 3T5PA 1FYDA 2B21A 3E27A 2V7GA 3FOCA 1KPHA 1H6CA 2AQHA 4IIGA 2C0PA 5EPEA 2NTYC 5DM60 1HNNA 4FNOA 3TZKA 3N3BC 4DIEA 3FETA 3QWIA 1NP3A 2O2SA 2G06A 3WICA 1O6BA 4OUKX 1E3EA 3KR2A 4ZU1X 1G16A 3NV9A 3LP6A 3INGA 1N36B 1IEQA 3BWDD 2HV8A 1PWHA 3LIPA 3RVBA 5A1TA 4ZI5A 1KYVA 1CUBA 2GS9A 1NXXA 2R65A 1NI4B 3T1QA 1R88A 1SVIA 3HUEA 3SHQA 1TDJA 1Y89A 4M46A 2PMCA 4Z9YA 4BAGA 5BURA 2HEGA 2LKCA 4INPA 2C1EA 3R76A 1ISHA 2ZBEA 4CG1A 3EZLA 2POCA 3AJ8A 2R11A 5LP6F 1IPHA 1XRMA 2IDKA 3FGZA 4IIDA 2C07A 4HGPA 2OZVA 1V6CA 2Z5LA 3EF3A 3Q8MA 1PLJA 4OK5A 3UMJA 2CNOA 1BHO1 2CZCA 4IWNA 4XX1A 5FLXA 5DNVA 1R0SA 2IOHA 2CUTA 2JH8A 4KPUA 2R85A 4JN6B 1PR2A 4WVLA 1UM9A 2BY4A 2I7CA 4PYKA 1W29A 2DUNA 3RSHA 4RTLA 1Z74A 1E9AA 2RGEA 1IJBA 3FZYA 2NU7A 1CV2A 3NM5A 2LCIA 1DEKA 2BPOA 3C6ZA 3MMXA 2YINC 1NKSA 3HWSA 2NLOA 2X2OA 4RF2A 4JWTA 4RORA 5DU2A 4MDYA 4R1UA 3ZS9A 4DLXA 4YUAA 3H97A 1O0BA 4QREA 3OPXA 5DXFA 5BRJA 1CRWG 1TMKA 4G0ZA 3OTOB 1U8ZA 1OASA 3QEMB 4P4NA 1WCYA 2WHEA 3ITKA 4OJMX 3Q2IA 2CCGA 4DPMA 2CHEA 4WN3A 4EKEA 4MICA 5KX5B 4BNMA 2WKQA 1KZYC 3GWGA 2GI4A 3A3YA 3N0XA 4FWIB 3RVSA 1SVWA 3QG1A 3KHKA 3L5KA 2EDAA 3P4YA 2OBNA 2DR2A 3EOAI 3FAKA 3K8QA 5DB4A 2MSKA 4D6XA 721PA 2GN0A 1QCCA 5DKFA 3R8FA 3T3NA 3EUEA 4W82A 1HG0A 2GZHA 2QAJA 3NBMA 1KY2A 3NBFA 1VSUA 3ICEA 3L82B 1RS0A 1MC5A 5DOZA 5IDWA 2BISA 4Z7JA 3BSFA 1O4WA 3V97A 2J5BA 4MCHA 1R0LA 1ZNXA 1LJLA 5K51A 5BN3B 1P0CA 3KT0A 3MPUA 1WTCA 2G07A 4RH1A 1PL6A 4J07A 5DJ5A 2CLIB 1JNYA 1BCSA 1GU1A 2Q4TA 2Y67A 5CCDA 1P4GA 1F1BA 1JXMA 1RXIA 1XVLA 1Y9AA 3E2MA 4OVKA 3TLZA 2FA9A 3KOWA 2OPBA 5DT9A 3UB4A 2Z2IA 1Y7IA 2R7NA 1KO4A 3NFYA 1DJPA 5E6SA 3QM1A 1L6RA 1YC5A 5HF9A 3NUQA 1Y7PA 1QFMA 3PFWO 3DL4A 3KBBA 4R7TA 3WLNA 2PGAA 4DWWA 4WESA 2BZ1A 3DOFA 4C3UA 3RKUA 1R5NA 3HFRA 4N3BA 3K3PA 3RVRA 3ZU4A 1FSGA 3G9TA 3ZCPA 1NFRA 2H4XA 3HLKA 4CZ2A 2I55A 2KYRA 1U9JA 1YS1X 4V2UA 2QT0A 2PU5A 4RO0A 1J2JA 4B6FA 1E6LA 2H2IA 3FYUA 5ALHA 3TQHA 3VTZA 5EIWA 2UUOA 3ND5A 3LQFA 4BFXA 4IIHA 1DC8A 1EFKA 3TFWA 2X0RA 1TAHA 3DVAA 2JBWA 2K4MA 3TNDA 2NIPA 1KEKA 4EIWA 1PR0A 2R6JA 2XMDA 2ZYWX 1U7HA 1VG9B 2QA5A 3KB1A 5D5QA 3HBLA 5E9JA 3SN6A 1FFXB 3IKLA 1APBA 1VMKA 4WJLA 1P7YA 2A58A 3FDXA 2JAPA 3E9YA 1QYRA 1DXQA 1QO7A 2ZJ7A 4ER3A 5EPUA 1A9SA 1MQSA 3LX4A 5EMMA 3G89A 1EINA 5A9SA 2XCRB 4KI7A 4UUNA 2AJLI 2WJAA 4BYMA 1NBME 3IP7A 1B6GA 1K7EB 1YFKA 1X13A 2XQJA 3IBGA 3KT3A 1U90A 4UU1A 1SCAA 1PK7A 1T1GA 1VYHA 3E70C 2Y8EA 2Y05A 2JHFA 4E13A 4RMJA 5CTAA 4HQ0A 3A25A 4HGRA 2DUUA 1USKA 1YHYA 2QY9A 3B9QA 1KFKB 2GFIA 2VC2B 4ZOCA 3U48A 1CEEA 1D4OA 4IV8A 4KUGA 1QE3A 1BFDA 1OXXK 1QHHB 1YZ3A 3LFTA 4CQMA 3BBPA 1XJWA 3WMRA 1PK9A 1O95D 3AVQA 4TMWA 1HYQA 4ASUD 3UENA 5ANRB 2QT1A 2B8JA 2C20A 2EBFX 1KWKA 2VP6A 3A9CA 1A8HA 4QM6A 2PMWB 5EXSA 5IRCD 4K9MA 3L1KA 2ODEA 1H2ZA 3JD0A 1V8DA 2PMKA 2YASA 1EZ4A 1Z6GA 4H35A 3NVAA 3EGIA 3RAEC 2YVQA 3P2YA 2A1TS 3JQ9C 1TF5A 3R0JA 4YRAA 3OM1A 2Q3BA 2ODTX 1ZKDA 4FFLA 5E1DA 4UZSA 3RASA 5L8VA 1R3DA 1SAYA 1VKJA 2PAAA 2O9JA 3UTCA 1EA5A 2X9VA 1AZTA 4M0PA 4MVWA 3EUWA 4J29A 3O0DA 4TSKA 3LZ6A 1T9KA 2C5LA 4CLRB 4BQIA 1H0KA 3AQ4A 4CKZA 4NBWA 3D59A 2ZYSA 4Y6GB 1HETA 2Y6UA 4BLPA 1L4LA 4C05A 1JEEA 1G66A 1RE1A 1WQ1R 4JBGA 3NYQA 1VKRA 2PFKA 3F2IA 3Q3CA 3I1FA 2GF2A 4QYWA 3OJLA 3VJMA 5LQRA 2D5AA 3L7NA 5EZSA 5BW5A 1ZM2A 1TIBA 1N92A 1U0SY 1XKTA 1YJ8A 2RHJA 3PFKA 3E3MA 3QFTA 1HORA 4P7FA 2CXQA 1PSZA 2YN4A 2JCVA 4P1ZA 4BFCA 4JWKA 1EFHA 3BD8A 4JDUA 2QNRA 4B3MB 3O82A 4QT0A 3PGA1 1DXOA 2I6TA 1D7OA 3DHEA 4ZAVA 4YO8A 1OV4A 2OHIA 3HJUA 1RM3A 3ONVA 3L7DA 1JKJB 1E62A 1WMSA 1WB6A 2GVNA 2R2GA 2ZR9A 2WIFA 2XWSA 2FKNA 1JLMA 2E87A 3IT0A 3M70A 3WDKA 3QZUA 5BV8A 3LM8A 4BTLA 2MYTA 2FLWA 4JVSB 4XI9A 3THWA 1HZZC 4RW0A 2H0QA 4LDZA 1KJNA 2GFHA 3KZVA 3SNKA 4U7GA 1NAHA 4LRXA 3S55A 4NLLA 4XLZA 1I6LA 4QDZA 2ZRKA 3KIPA 4WNAA 3TOZA 5CCEA 1E5QA 3GAMA 3H9BA 4B73A 1PAUA 3EF1A 5JG7A 1X19A 3TNJA 3BD6A 3P2MA 3VR3A 5E2AA 621PA 2OCBA 5J2TF 3N5CA 4BMPB 2BEUB 1TT5A 1K8XB 4OOEA 1DARA 2R8ZA 4BOYA 1GXSB 5LIRA 2ZW9A 2GF0A 3KCQA 1NUPA 1COWA 1Z4NA 2ILVA 1EK5A 2QN8A 2WU3A 3EXHA 3I4FA 1Z0IA 1A9XA 2PX0A 3OLQA 4IDQA 4QDTA 3OU7A 3J7TA 4DA0A 1E6CA 3OFVA 3RYIA 2CVPA 1UBOS 2HLPA 1ZI9A 3OZGA 3QP9A 5BWMA 4RPJA 4O3MA 4RA9B 3RRBA 1WZUA 4JP3A 3R2JA 3RVPA 1M1ZA 1Y6QA 5IHXA 5JPCA 1MU0A 1UR5A 2J08A 3WS7A 2X15A 2C7PA 3KXDA 2GD6A 1KHTA 1PR6A 3ZGVA 2I99A 2VYVD 4BP3A 1IPEA 4OL9A 1ZIXA 2P9CA 4M9SA 3EAQA 5DK6A 4JJFA 1U0EA 5AVQA 2A30A 5GINE 1KJZA 2G5PA 2QRKA 2PL5A 2VF5X 4G0PA 3SC6A 3VSBA 4TGLA 3SX2A 3W78A 1YQ9A 4C7XA 5L45A 5KYXB 1WXXA 3DUFA 1ADFA 2H85A 3G0OA 2J3HA 2NQ2C 2R4TA 3JASB 1N3IA 5KJFA 1TM3E 3FF1A 1VG1A 5DBHX 3D7MA 4WKBA 1UH5A 1C3LA 3I6MA 4BVFA 1AMOA 3HJAA 2I9KA 4YRIA 3REOA 1U2GA 2A9JA 1NXQA 3NTRA 3HCDA 3RS7A 3WXMA 5TQJA 4CODB 1ZISA 3PZBA 1CS4C 4EGSA 3N0TA 2HWYA 2IIVA 1O8CA 3K0CC 3MRTA 5JCJD 2ZREA 4F3TA 4HRYA 5ALXA 3CH6A 4CKBB 2EKDA 2AI2A 2I6UA 1GZVA 4L2IA 2P9YA 1UKBA 5K8UA 1RAGA 4J49A 1R0ZA 3GELA 5ITSA 1K86A 4AP9A 5JSZB 1JU3A 2H52A 1XTZA 2VUSA 4YUWA 1GCUA 3A14A 4L9RA 5JDIC 1WCV1 5U9CA 4IIUA 4XGNA 4W5QA 4JSRA 1BXZA 5E4FA 1E1RD 3RC9A 3QI7A 3IKVA 5EUQB 1JILA 4O0LA 1BROA 3K9LA 4ZAZA 3K8OE 4V1CB 1TQ2A 1SXPA 1IN7A 3GIDA 3HJBA 1KEEB 3H2ZA 3PGLA 5AIAA 1OI4A 3DHYA 2ZQ5A 4QIHA 4Z86A 1R0XA 2P8SA 2ZTLA 1GSAA 2QTFA 3QYAA 4LN1A 1OKKA 5DN6D 2IYEA 1JB9A 2CVFA 2PWAA 2R6DA 3NDPA 5TQ2A 3V2HA 2JI6A 1T8UA 1KYXA 3DT9A 2A3NA 3LHIA 8ADHA 1KI9A 1V16A 4L5CA 3G9QA 3FRIA 3CRW1 4MO2A 1P1KA 2D06A 4QSMA 4BO7A 3RANA 3BJMA 4TKVA 4Q9IA 3ZGOA 3KTAB 2WVAA 3AEZA 3Q9LA 3TR0A 5LU8A 1QP7A 2Z8ZA 1KRXA 1NE2A 2HNAA 4A27A 1P2TA 1I10A 1Z6AA 1GZDA 3Q6NA 3ZW8A 1IM8A 2IOFA 2QRPA 2F90A 1UUFA 4JC8A 1NWHA 1R0WA 3O4IA 3PHLA 3UB3A 1YDGA 3GJXC 4MRMA 2WT9A 5CGZA 1K1EA 4QPZA 2WC1A 5HZKA 3CB2A 3O75A 2Z56A 4OHFA 4YRZA 2W6MA 2WSSD 3G17A 5L6MB 5KNCD 4ZZIA 3HCBA 3B9BA 1A9OA 4P3KA 2HIAA 1NXVA 5AOBA 1AF4A 4Q3LA 4BVEA 1NASA 2EKZA 3IB6A 3D7KA 3UXMA 2Y77A 2C7VA 1A71A 2ZROA 3B1WA 1CQIB 1I4OA 1NN0A 3R5JA 5JY6A 3T1HB 2PEZA 3HKEA 4FOSA 3W7BA 1Z0UA 2PE5A 3HYTA 2ZZKA 3I05A 3SLKA 2GERA 2IITA 3GUCA 3BS4A 5BOSA 2CLKB 3UAXA 5E6RA 3ZCTA 5HBRA 1LX7A 1HQDA 1VECA 1G9TA 5JH7A 1PEYA 3MMSA 1AS3A 3RUIA 1C7IA 3LRTA 4FHGA 1T9GS 1CFZA 2C2GA 5ADUS 1Q1QA 1J0EA 3G49A 4NG4A 4K9PA 2HMYB 4RIIA 1KZ9A 2ZPUA 1YRYE 1KL7A 3FZQA 2IU4A 3B38A 4XDZA 3AR3A 5TMDA 3SF8B 3TIFA 2QW8A 3MS2A 3IEKA 4GR9A 5AUOB 3G9ZA 4JNKA 4NABA 1HV8A 9ABPA 2QLNA 3LDHA 1EUDB 3AP1A 2WD7B 2ZWMA 1GAJA 2XHEA 1ZK1A 1MO5A 5YASA 4MR9B 3KJQA 1ZHFA 4Q9DA 2ZWAA 3AEKB 3DZIA 3C48A 3WKEA 3GJZA 1XRLA 5FIUA 3LOQA 1QZXA 2IXEA 5B3KA 5HUQA 1XL0A 4K05A 1SR8A 3FW1A 3SOZA 1UQUA 1PV1A 5JI3E 1GO2A 1KMHA 1HX7A 2DPGA 2M98A 1H66A 4MVJA 3TCNA 4ZHQF 4IIVA 4P0TA 1SVMA 4H4EA 4C6SA 3M49A 1V7CA 3OCUA 3PG5A 4M1MA 3LUBA 1DTSA 1KI2A 1M76A 3JVDA 4OHXA 4MROA 1EDDA 3Q8KA 4G4IA 3K71B 4KHPB 1OFUA 4BFUA 2VK1A 2KS6A 4HAZA 4ZQCB 3VR6A 1CVLA 2WMNB 4TTTS 1UC8A 4E11A 4TV9B 2FPUA 1IXRC 3DH0A 5FNVB 4L0QA 4TLLB 3U3OA 4LC1A 3WFIA 3AESB 1P1RA 4U2FA 4F21A 4DSNA 3GLFB 3QE4A 4YGYA 3FWZA 3KBOA 3LVQE 3T4UA 2PCLA 1RPTA 4ARCA 2ZDHA 4YFVA 4DPLA 1JBQA 4JS0A 3WK5A 2HR1A 1EVEA 5ES4B 1TEVA 4EY6A 3AVTA 4HEQA 1PNRA 2IHTA 4HNHA 4ZU3A 2YCBA 2FW1A 3LT2A 3RUEA 4D0LB 1ISPA 4AQYB 2Y71A 4O8CA 3VVLA 1EE2A 5LZ4A 2B8NA 2JEZA 3QG5A 5DBFA 2VRBA 3WIOA 1R18A 2XCOA 1NJ8A 3F8TA 4KV7A 3GFRA 4ZYYA 1YR2A 1XMJA 4B4WA 2QM8A 4LIPD 1QC5A 3O1HB 3UY4A 1PWXA 4WINA 1V1RB 4EG8A 4ZDKA 1MQAA 3EC1A 5DCUA 1E3JA 3LQYA 2NSLA 1TIKA 3FHOA 3NIWA 4RIEA 4EA6A 3PNMA 1VZ2A 2RHHA 5E8JA 4NCJA 4GIBA 4K9DA 1M1YA 2HX1A 3R6GA 1U2DC 2R6GA 4UZEA 1PTKA 1R5OA 1RM0A 2AMFA 3WLJA 1JEYB 4E51A 1I7SB 1EBUA 4JUIA 3H2SA 2QJRA 2C4TA 4X1IA 4B17A 1VFNA 3WYNA 3ZD9A 2I1QA 4OREX 2JD0A 1OLXA 1KYIA 1NAIA 1TGYA 3CR7A 5BXYA 4X65B 4CU5A 1H1DA 1G9XA 1K97A 1P9LA 1VIDA 2O4UX 5D1NA 1QYWA 4NVRA 1UBFA 2IF0A 3PKZA 5ALYA 5FOVA 3COPA 2V7BA 5H81A 3UM9A 4CCYB 1PDVA 2ZT7A 2ZYTX 3K8ZA 3PK0A 4MWGA 1NX6A 4NZZA 4RLQA 4OFXA 5L7TA 2YHSA 4PSAA 2QQGA 2V6GA 4R98A 4S1VA 3VKFA 1Y5LA 4A5OA 4A8JC 5HS4A 4RJKA 3FOFC 2GB4A 1JU4A 1NW8A 2OEPA 5J4LA 1Q3TA 3BK1A 1XZHA 3N6XA 3PDIA 4P38A 3RBXA 4CHTA 5AVSA 4CIYA 5BQ5A 1X86B 2XMSA 3AIKA 2RCNA 1J2YA 5DYGA 1DIOB 3OQPA 4L9WA 4AJLA 1WULS 4EHDA 1QVAA 3UJCA 1A50B 1INLA 3KOZA 2UYOA 4H7KA 2E6UX 1BVUA 1ESMA 4M0CA 4PG5A 2W11A 3V3TA 3DULA 2Q0QA 4Q03A 3FKSD 3L0BA 5DF1A 3H65A 3HCRA 3A2LA 1PNOA 1L5HB 3G9UA 4HBGA 2ODBA 2R4UA 2AZ4A 4F60A 1JHVA 4KWHA 4PPNA 4KGDA 4F0JA 5HUHA 4TRNA 4MV1A 4PZLA 1ECJA 3NHBA 1ECLA 1B0UA 1XVTA 3FSGD 1UPFA 1I9CA 1GARA 3NVMB 2QAIA 5TDHA 4L3VA 3TIVA 3W04A 3ICPA 1S9HA 3TG8A 2A0UA 4C5AA 3DE7X 2BKVA 3F9IA 3IOBA 4BO8A 1KFJB 2RJNA 1QS0B 2YMPA 5AKKA 2ZJ1A 4KHZA 1ZITA 1PFWA 2HCFA 4MKZA 1NSYA 4RFLA 4CI9A 3OSZA 3KETA 4GPTA 3AH8A 3OKCA 3C3PA 3OIYA 4QUGA 3UPTA 1YR9A 5CJPA 1QDEA 4IIXA 4J4TA 5IZCA 4ISBA 3LJKA 1QNLA 1U0NA 1U04A 3Q8WA 3E22B 3FUVA 4OHMA 5EERA 4BNDA 5IMBA 3M1YA 1KKUA 1WMAA 2TYSB 1OFVA 3L02A 1WZEA 4GKJB 3CZQA 3OZRA 4X95A 1TLLA 4MQMA 5F64A 5FTMA 2PUBA 4Z3OA 1YXMA 1D8TA 2AZMA 2J0EA 2QRVA 4QG3A 1QZUA 1WUTA 3PD0A 4MYDA 4FFDA 4DR2B 1JXOA 5CB4B 1J1UA 1ID8A 4XCVA 3P2EA 3PGXA 1L3IA 2O8FB 1QKKA 3BMOB 2W2XA 4AB1A 4LZNA 3K6KA 1I4TD 3HCAA 1TNDA 3NEYA 4NNOA 2LIPA 5SY9A 5FNZA 4UQPA 3TQRA 1LNQA 3ZUGA 4IOLA 1ZU4A 2QV7A 1EFRD 3DFIA 5JALA 3VFDA 2A0XA 1Y1SA 4U3JA 2B2XA 3CJTA 4E32A 3AT1A 4US2R 1YDMA 3M3PA 4H17A 1VA5A 4IVQA 1KY5A 2E5FA 1VMEA 5JAOA 5E7MA 5GJBA 2OD9A 1GTMA 4Q1FA 3ZJVA 5I7RA 3JPYA 4PX5A 1SUSA 2A8YA 3V2IA 4H7DA 3NPAA 3IE0A 2OV6A 1DTWB 1RM4A 1K6EA 1B1CA 3B1KA 1FVOA 3NKVA 3NI2A 5C3MA 1ZWLA 2X9NA 2Q21A 1AN0A 3D4NA 1RHRA 4KXYA 3T3EA 1FMFA 1XOIA 3GG9A 3PQEA 5EINA 1FYVA 1WKVA 4EAAA 1SU8A 4DIDA 4I55B 1E9RA 3DDSA 4Q82A 1S8FA 4LDJA 3TD6A 4RVGA 4CEJA 3KU1A 2YL2A 3OM0A 3L5OA 3BKWA 4BJ1A 5FLKA 3NXKA 3GARA 3GJTA 3K1JA 2JHPA 2CDNA 5G02A 5HGJA 3ZQUA 4BMVA 5IKPA 1GGHA 2BFCA 1Z5OA 4R3NA 5AKXA 1W88B 4MWDA 1GSOA 4C06A 3IEPA 5C1IA 4C22A 2Q3CA 4O2AA 4UEOA 2GHQA 3PVSA 2Q1UA 1VLJA 2E55A 5FWAA 1C8LA 1R5BA 2IX9A 5KYWB 1YK0A 1Z7YA 3MUOA 1VGVA 3T7JA 2A1IA 3OKFA 4DSUA 3T9AA 1D5WA 2DR0A 3IOYA 3BFJA 2DHEA 5CURA 4QVIA 3IAFA 4D56A 3LPAA 5DYYA 3HWWA 4C3OB 1V8ZA 3HCWA 1GYRA 3EULA 3RTGA 2E7ZA 3GLHB 2DWPA 4UC0A 4CLOB 2PGNA 1R8YA 5LNK1 4B8ZA 2P67A 4D4LA 4G2NA 4ZK6A 1VRVA 2XGSA 1RZVA 5DP2A 3PRKE 1W0CA 2J32A 7ABPA 2OCXA 1GSHA 3QK7A 5T3YA 1ECBA 1GT6A 2PBFA 4OQZA 3ZX4A 4KQ6A 4F6CA 4NBKA 5AT1A 1CYEA 2B4KA 3MT0A 1B8OA 2Y1OA 5AQEA 1NYTA 4JOSA 3L1IA 1ODIA 3P4UA 5CYFA 1F3LA 3MWDB 2DG2A 5EE0A 3D6NB 3WL7A 1YE5A 4K03A 1ZNQO 5JSYA 4H6XA 2VEOA 1QLHA 1QZZA 2G63A 2IYXA 2R6CA 4KIJA 2OPHA 2SCUB 3AL3A 3ID6C 4JAVC 1CNMA 5FI0B 3RARA 3U0BA 4D4KA 3TZBA 2A5DA 2NSYA 1MW9X 3HR4A 3BKXA 1N6RA 2JPDA 4GLLA 3IALA 4P34A 5BNIA 2WUDA 3W5CA 4Y67A 1J2RA 2OGWA 4OJNA 3WLOA 1V96A 3SMQA 3FR7A 1VRWA 2OZLB 3MCAA 3TUIC 2P0YA 3BTOA 3VNUA 3AOEA 4ND8B 1HQCA 1S3GA 3FZGA 4Q9NA 2R6HA 5F2OA 2QP4A 3IUSA 1S8AA 3KSBC 1X39A 4GZLA 1OLUB 4UAGA 4YACA 3VJLA 5J3JA 1V7ZA 4MLDA 4X66B 5CA0F 3GMTA 4M1WA 3P1JA 3WYDA 4JYPA 5KQPA 3DL0A 1D4ZA 4AICA 2B2NA 3I32A 2Q5IA 4URHA 3FYTA 3LCRA 3TL6A 3OQIB 4D3DA 1AZSC 3BMXA 5TPWB 4AM8A 4RGBA 1K27A 2GJ8A 4BFSA 2BSQA 5J2UA 1YKSA 1FQJA 1QG0A 3DQQA 3LBIA 3PNVA 4M9QA 1N5LA 4MS4A 4U5QA 3ZIDA 4D3FA 4IAOA 1T6BY 2E1PA 4O4JA 4HWTA 4H0NA 4AUKA 3A1EA 1MW8X 4J94A 5K6AA 1YBMA 1MR3F 1VPVA 2QVGA 4GL4A 4FGSA 3FN4A 4PYRA 4YC7A 1YIOA 3JPWA 1A76A 2XCUA 3DMHA 5HIIA 4D44A 2A5GA 4MYCA 1WMBA 5EVJA 4Y7DA 2X6QA 2AW3A 3A1SA 3N2IA 1AO3A 3TTWA 3LK7A 1IRXA 1M7GA 3PD7A 3RR2A 4EVIA 3GH3A 1U3DA 2ZUVA 3MK31 4GBMA 4KRYA 3TB4A 1DC4A 1YB7A 1YU9A 2R00A 4FE7A 1DQSA 4RV5A 3MQ4A 4H7FA 3IVXA 3WRWA 1WVMA 4AMBA 2XZOA 2PV7A 4KCGA 4EPTA 1SU7A 1XC7A 2D8AA 1AUOA 5K20A 1Y9DA 3D4IA 5AVKA 1E3DA 4B3FX 2AC7A 1NM5A 4CTNA 3E2PA 5K3EA 4KX3A 1FU7A 5AW5A 4QPNA 3PQ8A 2CWWA 3L8EA 1AKVA 1Z7WA 2OC9A 3TQOA 1T26A 1P39A 4D0GA 1P31A 3AIMA 1LZLA 1ZN8A 4GOMD 1T2FA 4GI1A 4WDRA 1DAHA 1A5BB 2G1UA 1QG4A 1XR3A 4HYTA 1FSPA 3V4RA 2G1PA 4Q16A 2V0CA 4JBNA 4MO9A 4ZI7A 4RTKA 5HXAA 5BN5B 2R8OA 5FWXB 3JALA 4YY3B 4G5HA 5HRAA 4C78A 1II9A 5JVDB 2FOIA 1JA0A 2OB1A 1XCMA 5DCYA 2P75A 3ENKA 3Q1KA 4GPEA 4AYWA 1SZDA 2W6OA 2H7YA 1YJAA 3F67A 4FR2A 3WGMA 5F9MA 1JMYA 3G2JA 4OMUA 1ZNYA 4FFBA 4P31A 5FL3A 4O2BB 5G53C 1Y3FE 3VMMA 4C2UA 1UK8A 2VUUA 4D02A 3ZQKA 1BDBA 1F8GA 1K7YA 1RAFA 4BMCA 3LWZA 4R68A 4Q0MA 1P5JA 2VHVA 2VXOA 4R69A 3VPSA 3ZI7A 3D2LA 1IWOA 3NIDB 5BYKA 2EBWA 2SKDA 5HPYB 2PS9A 3CNBA 2H4YA 1CULC 4M0EA 3JWPA 3BA6A 2FR1A 4KXMA 2XCSB 5JAQA 3VO1A 2A1UB 3ABQB 3WA6A 5CLIA 1C0PA 4R1OA 3CVJA 3WDSA 4AP6A 1WDMA 3EDCA 3OJCA 2WA2A 2PCJA 4KWCA 4LJ9A 4RK4A 3ZU3A 2HRBA 4I4TF 5JLAA 1SCIA 4TTIA 4IQ8A 2JIMA 1DEAA 1QTIA 3E18A 2FPGB 1KXJA 2IPAB 4J1NA 4MYHA 4HVCA 1R8XA 4BVKA 1KI7A 2EJCA 3G0DA 4B4DA 1NBIA 2WB4A 1ZCBA 4RIFA 3W05A 4X64B 4KZPA 1E3LA 1RBQA 5LOVF 2QE6A 4F7DA 1TC2A 1QYCA 2WYVA 4OX9Y 1LPBB 1S3FA 2XUIA 4R8RA 5FTKA 4I9NA 2RH5A 2YOHA 1WBBA 2EX0A 3E7PA 1CY8A 4DY6A 4PGAA 1BU8A 4DQKA 2WG1A 1U1GA 1J49A 4L22A 2JF0A 4F1KA 4YX9A 3L7KA 3DBLB 3WK7A 4F1JA 2VSXA 4Q47A 4MUBA 5BMOA 4WLVA 1T5SA 2YOGA 3RFFA 2XXBA 3IP8A 1KXZA 1AY0A 3FOAA 4WXYB 2QJOA 1IPFA 4GVPA 5DHFA 3ZDDA 1YKFA 2Q1YA 1M6YA 1E58A 1GQOA 3GD5A 3MFQA 3FTCA 2VHYA 2YVUA 5E95A 4I4IA 4DRXB 1C7FA 3K96A 1IOLA 2PVSA 3JVUA 4RVFA 1GDHA 1J7JA 2NVUA 1FP7A 1LRLA 3ORSA 4QA9A 1DPFA 2I6FA 3OEHD 2R6FA 3DO5A 3I9KA 1JMKC 3QU4A 4Y3UA 4OJKA 2I4RA 2NZ8A 4MR7A 4HT3B 2RHWA 3GIWA 3CVWA 1EHIA 2NM0A 3L4BC 3BGSA 2OTCA 3U9TA 2R84A 3IQZA 2Z1MA 4H31A 3IUMA 9LDBA 4C0BA 5JMPA 2ZI9A 9MHTA 3D3WB 1CP3A 3T52A 2AFHB 1YR7A 2HMTA 3AFMA 4F4CA 8OHMA 1W2GA 3NHKA 2FI1A 1LW6E 2ZSUA 2EKQA 1EJBA 2FPOA 2VOJA 2HWUA 3QXCA 1LX6A 4CW7A 4OHWA 4HX5A 1S3IA 2QTVB 3QXJA 4HFMA 1XMXA 2D5BA 3HJRA 4XE5A 1QIGA 3TW8A 1RCUA 3N76A 3NBXX 2CBXA 4ZMRA 5CYGA 1H4SA 2PQ2A 3N7AA 5A0FA 4IS3A 3ZGYA 2E21A 2I7TA 1XEXA 3PNKA 3ZDFA 1G64A 3C45A 1CTQA 3CC8A 3ZDRA 3COVA 2NUAB 1T4CB 3OQBA 1FSFA 1EBBA 4CGZA 1V9CA 2A67A 3QVJA 1W36C 2Q4DA 1I7NA 3BRWD 4P4SB 1ZD2P 2CCKA 4UEQA 1V4VA 3CG0A 4B6QA 1RJWA 4RGVA 4CMEC 4ZQIA 5LXTB 4MV5A 4FD2A 1U8AA 5B4UA 1L4BA 1Y3BE 3BQ9A 1RKUA 4JT9A 1NPTO 1P9NA 1G59A 4XYMA 3RS9A 1QGAA 1TAQA 2ACWA 3PFBA 4FLFA 2IU3A 4FGUA 2WFAA 1EM8A 4G67A 4KFTA 3VKVA 4LRWA 1PNTA 3UB2A 2YWFA 3HADA 1CEQA 1IAQA 4FDTA 5EGSA 1M54A 1VOTA 4AD8A 2NVWA 4HGQA 2O20A 3VI4B 3WWZA 3LKBA 1UWKA 1Z2AA 2QMZA 1DHRA 5PGMA 3VPBA 1H42A 5LYJF 1KDRA 1SY7A 3UMVA 1H2FA 5DHPA 3D5EA 1D2HA 3GJSA 3IE2A 3ORHA 3PYMA 5DLPA 1KI8A 1QRAA 3NOXA 3WL8A 5DTRA 4CJXA 4LDAA 1C2TA 2HSDA 4D9IA 3FM9A 3KUUA 4DJAA 4M21A 4LHXA 1KO1A 2WRZA 5B2ZA 5K3OA 2ZBVA 4G97A 1SBTA 3JD2A 2DPMA 3OX1A 5I01A 5FV7A 3OQ6A 3QF4B 4E0BA 3QOYA 1IQPA 1JZTA 4XIJA 3HQ4O 1W0JD 3UHOA 1NP7A 1FQOA 1GKLA 4GGOA 4TT3D 2M9MA 1KE1A 421PA 1UJ5A 2ZRLA 2OOKA 1H8ED 3BAZA 3JQBC 1D6NA 3UT6A 5IYZB 2ZTHA 5KWSA 3DR3A 3AGQA 3HY6A 4LJSA 4M7PA 4EBFA 3GFOA 5AIBA 2GPYA 4LJ6A 1NMEA 2B4AA 2HOQA 3OZIA 4MI9A 1JFSA 4DM7A 1IBMB 4IQFA 5AXCA 3NVDA 4HBZA 1B93A 2HIGA 1BWRA 3AJAA 1M1XB 4PHFA 3S2IA 1L9KA 4DEYA 2OT3B 1WVIA 2IKSA 3LNTA 4OXKA 1KZ7B 2C3PA 2VHTA 5EE3A 4HYQA 3ZDYB 1O94D 2IIQA 1V5IA 3EWIA 3HMQA 4JC0A 2BBTA 3O94A 5AM5A 4TZ0A 2PX6A 1H3FA 1WTAA 3F8WA 5H9WA 5FPTA 1DV1A 4HNQA 2QRJA 3GUHA 4U9HS 4F06A 1RNLA 2QAGB 5LP6A 4JI4B 1U6KA 3WWYA 4ZALA 5TVGA 2XADA 5ALFA 1JDUA 3VTAA 3MXOA 3D7LA 1YOBA 1J8QA 4B48A 1NPDA 4L4ZA 6Q21A 1TYEB 4MUYA 3U44B 1YULA 2D0PB 3TE7A 1JUDA 2IS1A 1VCNA 1YMUA 3D31A 1Z4KA 3LDGA 5LB2A 4RTPA 4N65A 1GV1A 1TM1E 4UDYX 5DBOA 1G8PA 5EG5A 5IAJA 3SYMA 3S1SA 4V0MA 2P6UA 2VDUE 2XGJA 5I47A 1FOEB 1U81A 1S0UA 5CAEB 2WYUA 3HZHA 3Q0EA 2XMQA 2NSJA 3HVIA 5EHQA 2EJVA 1SQFA 1U1DA 4ONEA 4F4DA 1IU9A 4P8RA 5BSGA 4HDSB 3LP8A 5I4IA 1Z17A 4K9LA 4CF7A 1NR1A 4LBWA 3S2EA 4RGQA 1HFEL 2FFHA 3OZDA 1JSXA 4Y6SA 3TSWA 2D1FA 1EVJA 1SKUA 5ER6A 5L53A 4WZBB 3TL2A 1SVLA 5G1PA 1UEXC 1JFTA 4DLPA 1DO0A 2X4GA 3NONA 3ABRB 3VC7A 1Y6FA 2VAVA 2DXIA 2ZQYA 4BV3A 2NUTA 1UKZA 4N82A 5CIYA 3OAAA 4XSHA 2QYTA 5A5FA 2VJPA 3N8KA 4YAOA 5KVVA 1DG9A 5DTEA 4G41A 1V11A 4UZFA 3WGGA 2RIRA 1KI3A 2AH5A 2WM2A 3NYIA 4ND5A 4AJIA 3LY9A 1AV6A 2QTGA 3IDFA 3UK6A 4XUGB 4KYVA 5P8WA 1ZD4A 3DEIA 3PNBA 3WAKA 1PJ8A 3COWA 3LQ2A 3R3YA 2VNAA 4JASB 3JQFA 2B35A 4IV0A 4C7MA 2L42A 1WSBA 2FG7C 3NTLA 4P0PB 1XN4A 1K89A 4UCWA 3GNTA 4JBIA 1H0RA 3RGWS 1D2AA 1SFRA 3BK7A 1A77A 1VJDA 2HSEA 3FJOA 1CZUA 3UWOA 3IEXA 5CDUA 2FR8A 4TXMA 3BM5A 5EIAA 5BSVA 2DOKA 4KVFA 1KKLA 4IKPA 5H5JA 2YNMC 4JEIA 4XR4A 3THOA 4JLWA 1K06A 1GWNA 4HDOB 4EHAA 4WCFC 5L6LB 1G6KA 1RJEA 2NXCA 3KVVA 3D1VA 3U39A 1A95A 4PBRA 2BEVA 3KOYA 3QWBA 3T54A 4EY4A 1XQ1A 5EJ7A 5EA2A 2G09A 3LLVA 1KJ9A 2AJCA 2C4UA 4MAAA 5LFAA 1VSVA 3B3FA 1YA6A 2HMVA 1J39A 4DLLA 3HDJA 5EJ2A 3I2HA 4HJXA 3KQOA 4HX9A 2JLXA 4KE8A 1DADA 3BMQA 2QP9X 4KQGA 1TW2A 5TMBA 1FMLA 1T0HB 1NBEA 2QD5A 3HEAA 4M36A 4CM7A 5JD4A 4F5ZA 4RULA 1KH3A 1T8SA 2C9CA 1SOMA 4QAJA 5J5CA 5FDFA 1I6KA 3WE7A 2CVZA 2X3YA 4P2BA 1JX6A 2X2EA 3TEFA 1Q7CA 2BTQB 2IPLA 3T4PA 4BRSA 2IHKA 3ZHVA 2UUCB 3ZCQA 4M9RA 3AINA 1QX4A 1P4SA 5T41A 2MU1A 1Z82A 3BCHA 4I4NA 4J0JA 3U4IA 4LOKA 1I3MA 4CN9A 4Q5IA 5TJ9A 1UFRA 4RHCA 1DZIA 4DTIA 1IUNA 4LK2A 3UOGA 2WD9A 2H63A 4XB6B 1EX6A 3V8VA 3FPCA 2V0GA 1SD5A 4MQ4A 1ZS9A 1SOVA 4NE9A 1BA2A 1ZVMA 1HL3A 2DZDA 2EIHA 3H11B 3IQHX 1K8YB 4I5GA 5EJGA 1NFQA 2FEXA 3I9LA 3K9BA 4RVOA 4II2A 1MQ9A 3PB3A 4UCFA 2HUNA 2Z8YM 4ZC8A 4L4SA 4M54A 2RARA 2P5TB 4PHCA 3SLGA 5EIOA 4YAGA 3V1LA 2C97A 1JAYA 4AWXA 4DWOA 3AX6A 4CEIB 4OAPA 1ESZA 3GXBA 3ZTWA 3U3MA 4A7PA 3LLMA 4C08A 2HSGA 2HUPA 1GRNA 1N2OA 1CQJB 2WZCA 3GP5A 4UXHA 2RGNC 2WJJA 4BU0A 1SOUA 1E7QA 1YONA 3K2BA 3AKCA 2F2TA 1ES9A 1Z8FA 2HJSA 2ZSIA 3AMVA 4JBWA 3CLUD 3PFNA 1BRTA 3WK6A 3GLQA 4F2HA 2AKYA 1Y3IA 2JFNA 3C5EA 1G60A 3IESA 4PO8A 3OX2A 4AJ4A 4C01A 5E38A 2WG0A 4PGMA 2VVTA 3O1JC 1JDPA 4ID3A 4MRAA 5DYWA 3MRXA 2H5IA 2VT2A 5F4BA 2PUEA 1SHLA 4DC0A 2YV4A 3RBZA 5A5DA 1O2DA 3KLPX 4Y2XA 4KBGA 3HM9A 4GBJA 4EKIA 4KAXA 4R4JA 2JZNA 1WCWA 3VR4A 1OHHA 3AUKA 2OBBA 4MB0A 4NBLA 3SM3A 4UAJA 1SHZA 3T9CA 1TO2E 1EP9A 2AOXA 3IR5A 3P9IA 4QM7A 2X7HA 2Z5GA 2PX4A 3GA7A 3KB2A 5JZOA 1G1AA 2F3QA 3O8CA 4TROA 2J7KA 1DPGA 1Y4SA 4IF4A 1LK5A 4XB1A 2A33A 3SDZA 3WNVA 4D96A 4AURA 2H1VA 1RDFA 4L7QA 2CJPA 3BF7A 3HCOA 3VRHA 5DYIA 1P77A 2E2WA 1T3GA 2VAPA 2QGNA 1LF0A 3N75A 4UD2A 5FR1A 4AS3A 4Y7CA 2V6FA 5EWLB 3FY4A 1GL3A 1E2BA 4NU0A 2D3WA 4DNFA 1Q20A 4W9NC 4E15A 1ZGZA 2XB9A 4G5YA 2DT8A 4NJOA 1Y8ZA 5J2TA 4J7AA 3Q7TA 3ZNQA 1RP1A 2CXSA 3V1NA 2B9EA 4EG1A 1JAXA 2JJ2A 5JDCC 2FDXA 4G1UC 3TRKA 3O9MA 4LC9A 1YB6A 3JTMA 4XX0A 2XGMA 2PFSA 4PYQA 4G4SO 3NTUA 4Q1AA 3U7GA 4DG5A 3R7LA 1E9BA 4D8YA 3QLVA 4POOA 3OPQA 3PE6A 1SIWA 4DLSA 2WQ6A 3EQ8A 2BP7B 2BD0A 1N2EA 5G2OA 2PDAA 1KPGA 2XF2A 3ZV7A 3GF4A 3VR2A 5BPHA 4F4HA 3DPSA 1LDMA 2C3YA 4XQEA 5FCDA 2LP4Y 5SV2A 2MWMA 3OP4A 1J07A 1PFKA 3OETA 3BWYA 3QEBZ 4Z53A 4KW7A 4J1TC 4BFTA 2C92A 3AVXA 3DKVA 1I2MA 3ZVRA 1L7VC 1YVEI 3EXIB 5JFTA 2GJ4A 2VPWA 3ROTA 2V9PA 5BPFA 3CX3A 1C1XA 2YXBA 4NZMA 1DAOA 4AY5A 1F14A 4LDRA 4BKPA 3GJ0A 2WA1A 4LY3A 2QTLA 3UMBA 1WE2A 5HIAA 4I08A 3SHTA 2CNWD 2FP3A 5IKOA 3F74A 5DHRA 1J0CA 1N2ZA 5JCOA 1CW2B 1JA1A 3FDZB 2CLHB 3DOOA 3H0EA 5JXHA 5B1HA 3P0FA 1A1SA 2VRCD 5CR9A 3IURA 4AWBA 3LRPA 4C21A 1FW6A 2B20A 1W25A 3LP5A 4X9XA 2DFDA 3ILXA 4CI0B 3WOHA 4D25A 4KXNA 2HLDD 4RPLA 5LUAA 3I3SR 3EMKA 2IYQA 4NFSA 3ZDCA 1NN5A 3SX0A 2QMOA 3EISA 3ZNOA 4BN0A 2G76A 1C7QA 4KXUA 4WBNF 2CD7A 4G9EA 4ND1A 3QRWA 3C3JA 1Y34E 1UPCA 3N2KA 4HDNA 4YAFA 1FNNA 1GGKA 2BKXA 1HEUA 2WT4A 2GYYA 4BAZA 5CD9A 1DMSA 2V7QD 2X0FA 4P83A 1XTTA 4IILA 2IU0A 3K6RA 2G77B 2CFTA 2Q8PA 3AGPA 4I9GA 4P9NA 2B3DA 4EKNB 5JJCA 3U2QA 2XVMA 3OVMA 4G89A 1VM6A 4BP8A 3GMIA 4P92A 5EMNA 2A5YB 2WJWA 2RJOA 3OPYA 5DEIA 4Z2AA 1XA3A 1ODJA 3FPAA 6CHYA 121PA 4LYJA 4N6OA 1SVOA 4IIJB 3KL4A 1LLCA 1ZMBA 1SURA 4GECA 3ROFA 4F3KA 4FKBA 4DB2A 1Y4ZA 3AILA 1CVIA 3OE5A 4OY3A 3ZJTA 4FDVA 1E79A 2BEWA 3PHBE 5CTJA 3A7DA 3D5QA 1FNBA 1VLLA 1ZJZA 2X19A 3ANLA 5CVCA 4KKVA 1NQUA 3NIBA 4QLAA 5CYOA 3FUXA 1DL5A 3ODGA 1JL3A 2I2DA 4IBOA 5CHYA 5SICE 2YIJA 4A8JB 4EFLA 2BGWA 2Z43A 1O1YA 3O5AA 1XPJA 4WGFA 3OZXA 4IVPA 4S3MA 1C50A 1JTEA 3EC2A 1F7UA 4N7RA 1IJEA 4RVCA 1DWPA 4WW0A 4M22A 5EIFA 1HZZA 3MHPA 3L1JA 1V95A 4YHHB 4F71A 3G6WA 5F1KA 2HK6A 3UKDA 4IFEA 1TZMA 1GIAA 1Y1RA 2NNLD 5ALDA 3CN9A 3EAGA 1ZJ5A 3HZRA 5CXSA 3ZHRA 3ZHUA 1HNWB 3UNXA 1JI3A 3AVUA 5EP1A 3A4TA 2I3ZA 3IPRA 1W48A 4CIVA 1N0UA 3KZMA 3LUFA 3E7FA 3JQ6A 2Z98A 1XEFA 1E1YA 4GPD1 4HUQA 1OUMA 4KMSA 3DE4X 3FNIA 3DBHB 5AKZA 1PFVA 1PI3A 1WZNA 3WV4A 3O7WA 1FY2A 2AR7A 1HE5A 1P18A 2COEA 2NTVA 3A4NA 2A9RA 2HT1A 4KDFA 4KREA 2QTAA 1NTRA 5EUCA 2AQIA 2G67A 2E3JA 2NZVG 3DXXA 1AGXA 4LVNA 3ROXA 2XYPA 1J23A 4LV6A 2EV9A 3QUCA 1T2EA 2WSLA 2YV5A 2ISSD 6GPBA 2BJWA 1IHUA 3EXEB 4XWGA 4I1RA 5JSQA 2DAPA 3FSRA 3IIKA 3D3NA 4J16C 2I29A 3JVEA 4GOKA 3BK2A 4ZEOA 3CR8A 3JRNA 3PGKA 4BX3A 2CFIA 1KAEA 2ZIZA 2HQRA 4B85A 2O8CA 4XJTA 5P21A 4ALJA 2P2NA 8ATCA 3VSCA 4HZIA 5BWNA 2R48A 1AT1A 1S3SA 2Q3EA 2X9GA 3BJIC 3CCCA 3PFFA 2XDYA 3HEBA 3UAWA 1V4BA 3BXGA 3FYCA 3DL7A 5KNDH 4LHWA 1A4UA 1HFJA 2WNSA 4EY5A 1EM6A 1X7WA 2QYSA 2YJZA 4GU5A 2XOKA 4DV3B 1Q3HA 1X92A 3QKSB 4JGBA 1RYMA 4ZHQA 2FGKA 3TTVA 2B82A 2PKRA 2XKAA 1P75A 4Y2SA 2AEEA 2R96A 4HWSA 4XIFA 5SZKB 3WWEA 4D4MA 4RTNA 2EJTA 3LC2O 3UT5B 3QLUC 1R9MA 3WMEA 4OQYA 4XUEA 1X8XA 3UHAA 2IBSA 3K0CA 4ZCMA 4ZZ2A 1D03A 3AHEA 3KUXA 1D2MA 1VE6A 5I5EA 2E37A 1ZOIA 3G68A 4NPAA 3EY9A 3TLJA 4PR3A 1I7DA 3AY0A 1EFPA 3KKMA 1QH1A 1N9GB 1A7KA 4IJQA 4J2HA 2WHYA 1PQYA 4EELA 1ZGAA 4D5GA 5EIBD 1YBVA 2G6BA 5JDIA 4NS1A 1CETA 4IZ6A 2VXCA 2F9FA 3RNOA 2G08A 4DCJA 4EFNA 3T3PB 1SK8A 4IRUB 2Q9BA 4IX1A 4F86A 2YZ7A 1FUKA 3MAJA 4Q1EA 5KTTA 2W83A 1VPLA 1I2BA 2R1UA 2AOWA 1PDWA 4NCKA 4DANA 3FGNA 1JHDA 5DW0A 4G07A 1BHQ1 4OQQA 3IXMA 4QYTA 3RK4A 4DGQA 4DQVA 2IUTA 2QG6A 3HP7A 3Q3GE 1XI2A 4HWGA 4A82A 1Z0KA 4WE3A 3BEDA 1OI7A 1DXYA 4B35A 1FTNA 1P5HA 2PXHA 3FWPA 4XTCS 4Z6KA 3NR2A 2GA9A 4PYJA 3LSTA 2GA8A 1PTJC 2A9OA 3OSUA 1BE1A 5EOVA 4FR5A 5BSHA 1E1CB 3GLUA 4ZODA 5G4KA 1R15A 1KP3A 2HN9A 2VJMB 3FKQA 2LUOA 2QT9A 4Y18A 1XKLA 2DBQA 4B87A 2HEIA 3THRA 1WF3A 1F2TB 2XOEA 4DIKA 1IEVA 1UKVY 1SC9A 1DKNA 3UFXA 4R0VA 3TUZC 1T24A 1GLVA 2G0AA 4UNQA 3OOWA 5EWJA 4JI1B 2VA8A 5C35A 1E3QA 1AB5A 2X6TA 2ASVA 4LDNA 1HT1E 2H2HA 3RG2A 4YUXA 2KBFA 1CKEA 1Q0QA 2XXAA 2D74A 3GLIB 3DVSX 1IBSA 1OFIA 3N28A 2P9TA 2F1RA 5GP1A 4EECA 4ZCTA 3B89A 4G0OA 5F1YA 1H3EA 4ZP1A 5U4QA 3EPHA 3BGWA 3HA5A 3T7TA 3AKDA 1X7XB 4OGWA 4RK6A 1MJGM 3I61A 4M9XA 4R2MA 1AS2A 1Z8HA 4R1NA 3NEJA 4ZCLA 2C2YA 1CHDA 4AY2A 1H4VB 1TKCA 2QR5A 3LQQA 4HAYA 3WGLA 4UUMA 3IP6A 3LW8A 5IJAA 3RSLA 3I2YX 4PNEA 4DR1B 1DAGA 1UQRA 4FBMA 3C4QA 2ZIXA 2IL1A 2JKYA 2YMLA 3D4BA 3FRJA 3I73A 2FQQA 2Q41A 3I9OA 3NAMA 4LHYA 1Y5MA 2AOTB 1A8QA 1RJDA 4C14A 4PXYA 4O63O 3DVRX 5T6MA 1ZWKA 3GT4A 1JVBA 4UPEA 1ZHOA 1BS2A 4C0WA 3D54D 3L77A 3Q98A 5MDHA 1A9QA 4H60A 3UYLA 4QO8A 1VL8A 4Q18A 3U62A 3NDJA 4Y2RA 2VKQA 5DVZA 5E2IA 3PXBA 2WIBA 1D6JA 4Y6OA 4ZCQA 4GZMA 3RNLA 1GDTA 4X5OA 3F8SA 3CUVA 5JS6A 1SC6A 4FSDA 1GCIA 1TTHA 3FLEA 3JV7A 3WJ7A 2ANBA 5IM4F 3ROPA 1TD9A 4JFAA 4X6YA 2PT5A 5JQGF 4YYEA 2C2MA 1D3AA 1VE3A 4CUKA 2PX3A 4A8TA 1TMYA 1N75A 4RDXA 4E3ZA 3IPYA 2J3MA 3HU5A 4FGWA 1DQYA 3DMFA 1HMPA 1WXFA 1X0XA 2B8WA 4REQB 1JEOA 2C3UA 3M5PA 1GVHA 5BVHA 3EVTA 4IJVA 4NDNE 4J8PA 1DC7A 1I1NA 2C0CA 2FF7A 3P94A 2OFFA 5JE8A 4OGKA 1SB8A 2OFPA 3AUYA 3HGTA 1OLSA 1BFKA 2QMYA 3UJ3X 2C2KA 2WZBA 3H86A 4Q37A 2Z9DA 1NYRA 2ZRHA 2R25B 3PEUA 3O4FA 3RIYA 3FBTA 2EF1A 3QPAA 4LXQA 5REQB 4D9HA 2VQSA 2Y3IA 2PMEA 1B8NA 5G3ZA 5IANA 5H3HA 4LYYA 5AO9A 4C0HA 2QQFA 1B23P 2ZIFA 3F3KA 4RSHA 4F91B 1NF3A 3BHJA 2JJYA 4HG2A 1ISIA 3DBRA 1BN6A 2ILTA 4RQUA 1O9HA 3U7QA 1G3RA 3HBJA 3HY3A 3E5NA 3JWGA 1KAQA 3KYDB 5DGDA 5EHXA 3RFCA 1S89A 1WW8A 2XGGA 3D8BA 3RROA 3GZNA 1VPDA 2NG1A 5E1MA 3LC1O 1V8OA 5FOQA 1IK6A 1OTHA 4QU0A 3G0BA 4Z4QA 1JLLA 1PVDA 5EN4A 1JZQA 2G5CA 4DLNA 4CEHA 4Q48A 2J5KA 4L5BA 3UMYA 4MTLA 3QSGA 1XPRA 1WEHA 1LBIA 4G0WA 3VDQA 3QW2A 4PG8A 2F3RA 3ZR4B 3JAMA 5AQ1A 2Y0EA 4UATA 1XLTC 2W6IA 5NULA 5IJ0A 1K3FA 3EUAA 3OJFA 1EE1A 1CSEE 1FYXA 3JZDA 3JQ8B 3N2ZB 2FR0A 5ILQA 3TR5A 2FEPA 4UEWA 2F1KA 2IODA 1H5NA 3Q7PA 3ZBTA 1DJLA 2XCLA 2AE1A 1CJUC 1OBHA 4U7PB 2JJMA 2OBFA 2ZI3A 1XIVA 2DWOA 4PTLA 1B6RA 2P4EA 3MF4A 4GMKA 5CFLA 3IO5A 3JAKA 2C0QA 4AZSA 3E3NA 1WD7A 4LS3A 1Q0ZA 1T8YA 2HWKA 4UXJA 3PUHA 1GP2A 1R10A 2CUNA 2C54A 3CB4A 4LSZA 1T9CA 5AYVA 1CUZA 5EEHA 1FUYB 1U7ZA 5L9AA 3AL2A 1OT3A 3NNSA 4YNBA 5KTYA 3BE8A 2LBPA 2UVPB 3EIUA 1QP8A 1NR5A 3EG9B 2ZSKA 2O1SA 5DSTA 3WK8A 1JNXX 1T36A 2I03A 2QRQA 3CEHA 5ALKA 3VO9A 3WRXC 3L8GA 2DBRA 4E1BA 2C59A 5KINB 4ZOBA 4D9CA 2GHRA 2BHNA 1IY9A 1BHSA 4ILKA 1RHMA 2C4NA 3U7FB 2Y1WA 1J0XO 1RRCA 2YY6A 4UDNA 1DWUA 2FETA 3ZW9A 2ZYGA 4BP1A 4BZXA 4AJKA 3QF7A 4I1IA 4RK7A 3S2SA 3K9QO 4EZEA 2ATVA 4PYIA 1GGJA 4GKAA 1TF7A 3JQAD 2BDTA 5TEWA 2QSUA 5JZ9A 4I9UA 2IT1A 1QIMA 5MFZA 1M2NA 3AYZB 1Y6ZA 3FCXA 3M4ZA 1CUEA 1ISSA 4JQOA 4I5FA 4JP1A 4Y1GA 4DEXA 4CG3A 4TKUB 4F3CA 4CETA 5TT0A 3AKZA 1EXDA 3FX2A 3I45A 3NNNA 4OUDA 2RHDA 4L4XA 3SM9A 4OQXA 1ZX1A 4QNNA 3QVUA 3L0OA 1X1QA 2FU5C 2ZE6A 4V39A 4FVTA 5CX1B 3TYXA 3AL0C 1BRMA 2FRDC 2AG1A 5GVSA 4YJGB 2PZMA 3G02A 3AQIA 3T5TA 2VSQA 1F8FA 2M6LA 2W42A 3V2UA 5CA0A 3PDUA 1UAGA 4KPFC 5I9MA 4G0YA 2ZIUB 4R5MA 1P3DA 4MNTA 1NRJB 2AXQA 5HQ3B 5IJWA 3N2LA 3O9ZA 3P0EA 3PYLA 4JCCA 4R2LA 4Z4EA 3I9JA 1NC3A 1QRDA 2YVLA 3DYBA 1JT9A 1BEUB 1KC3A 3VPFA 1L5WA 1DCTA 2IEAA 1NW5A 3ET4A 4QXPA 4CYMA 2HBYA 2HHJA 3RT1A 3WLMA 1HOTA 2YQ4A 1RE0A 3GR6A 2J3IA 5I8ZA 2GZAA 4Q4HA 2BSXA 3VTFA 3KQVA 5DV9A 3BFKA 5BN3A 3VJKA 2O2YA 1BVRA 2Y0CA 4JLBA 4RJLA 1E8NA 1FNCA 1XZMA 1T5LA 2J4CA 2VUTA 2COKA 3EF0A 3PA6A 4LYDA 4LYFA 1VKZA 3AM4A 4NATA 1L5GB 2R0QC 3QIVA 1NN1A 1E1DA 2GNAA 3OG9A 3UG7A 4KN5A 3Q9SA 3V8RA 1W36B 3K2QA 3AZOA 4RSMA 2C98A 1V45E 5JTUA 3LY7A 5DBGA 3OWXA 1NQTA 1CZHA 3H1TA 2JGIA 4ZO8A 4MULA 4R8MA 4CE6A 4YECA 9LDTA 2PG3A 3CURA 1V0JA 4C89A 4H3SA 3S99A 4BKQA 5AVYA 3MOSA 3AJDA 1DIGA 1TRKA 4RXTA 4YRFA 1ZGJA 5AHXA 4IFBA 3ORYA 5IDYA 1Y8CA 1PV4A 1KI1A 1LA2A 3U3KA 2QVXX 1Y1QA 1YZHA 1CUCA 3NCTA 1NZFA 3PYXA 4LXXA 5C53B 3KHTA 3JTEA 1GA6A 4IIFA 4QQ8A 4G26A 3PQ2A 3DLHA 5KJ1A 2HV9A 3JQCA 4MUJA 4I5EA 4JQYA 5DHAA 3GO4A 3LAWA 1I30A 2J59A 4MVJE 1Z0FA 1J4AA 1EJ0A 4OGLA 4C2BA 5B3JC 5BN1A 5JAIA 1W5SA 3FF4A 1IB6A 2A94A 2W2MA 4Y6LA 2G40A 1F48A 2JGMA 3DQZA 3FSEA 2NXJA 3E9MA 3IVRA 4L4UA 4LSGA 4D46A 3AU8A 5LQNA 3ET5A 4GLOA 5KTNA 5A4AA 1YV9A 1GCOA 2WD8A 2UZ1B 4KQXA 4WK4B 1G5RA 4C4YA 3DP9A 1SN7A 3DTVA 3IVMA 1L5QA 3AEXA 3N39C 1H9CA 2QIOA 3VNAA 1ZSVA 2XVAA 2AL7A 5DZSA 3VVMA 4JOQA 5IJ9A 1SUEA 1X1DA 2RSLA 3IDAA 1ZQ9A 4GL2A 1JG3A 4BQEA 3ZXSA 3TCKA 4QTXA 4O25A 2IHJA 3A1WA 2H8GA 4FWTA 4H4CA 1WPGA 4I4TA 2I62A 5BWCA 1PIWA 2ZXUA 2F64A 1XAHA 2J9GA 3DS8A 3ZWDA 5KHOC 4TYYA 3AR4A 2EJBA 3MQFA 4LHEA 4ESEA 4M4SA 1N1DA 4MKGA 1YR6A 3ZS8A 4ZO6A 5GONB 5FWNA 1DKMA 4JVLA 5F2EA 3W5VA 1CK4A 3SHFA 3B51X 4HEJA 5LOVA 3CLTD 2P79A 3C3XA 4OFWA 4YASA 3K70C 4MGKR 1J70A 1E0SA 3GGSA 1Z9BA 4LRTB 3UJ6A 5GJWC 1RVV1 2QHXA 2TECE 4LZJA 2OLEA 4RABA 5TX7A 1KI6B 2XNDA 1M1YE 3ZWNA 4ESHA 3KQTA 4KJXA 1OBVA 1MJFA 5EE9A 1P62B 2A6PA 2I80A 5CIWA 1XJ0A 1YE3A 1ZH4A 2YZKA 3DAGA 1YL6A 1OXBB 4LRUA 5A7HA 2ZVJA 2O19A 3HHPA 2O8EB 1U28C 4Z8YA 2B92A 3JWJA 1CIVA 2FXIA 1C3OA 3TVTA 3VPHA 1HURA 4ZTBA 2BJVA 1USUA 4FOPA 1V1JA 2PRZA 2HREA 1NTOA 3IP3A 4G24A 2CB9A 2EWMA 3EQ7A 1MX3A 5E6UB 5IAGA 4ZFNA 1M33A 4M8KA 5IDXA 1E3WB 4Z7NB 2IE8A 1B2LA 1ZK4A 3MPOA 5KPJA 3MILA 4N47A 5AW9A 1Q15A 4LXIA 4B81A 4TZ6A 2VAXA 1RACA 3UJHA 4TS9A 4YJKA 3VVCA 1KFEB 1T2CA 1PGOA 4N7MA 1LNSA 1FP1D 4N3GA 3DEFA 5AMXA 3OJOA 5IVIA 1XDBA 2HRRA 3PHJA 5C18A 1JKJA 1PJQA 2P2ZA 4LG1A 3GEDA 4BO2A 5AW8A 1B8VA 4TQ9A 1XPUA 4YRLA 2FMUA 2OCKA 5K0TA 3K0AA 2EQBA 5AP9A 1LBHA 2GEUA 3OIGA 1KHHA 1A27A 2WKPA 3G1TA 3K72B 5EIHA 4Q66C 1J97A 4JBYA 4BMOB 2E18A 1ZH2A 2FNAA 5F7JA 1QG6A 4TYQA 4XIIA 3TO5A 1I33A 2JCBA 3ZWKA 3CCBA 4UTOA 3P9KA 4GX2A 1F12A 2BCJQ 5TQ0A 4Z8XA 3K32A 3SQDA 1Q0PA 4YV7A 3ZQ4A 1GA1A 2KB0A 3HRIA 3O26A 3M9LA 2GT1A 5DLDA 3HV2A 3A6JA 3CNEA 3TD2A 4HATA 2IS4A 3ND9A 4XEUA 1MO3A 5C32A 1K68A 3Q2OA 1JDSA 3DNFA 4KDCA 4QX6A 4RWEA 4BTVA 3ICQB 1V35A 2ZAMA 3LT5A 2IUSA 3UUGA 1B41A 1AKQA 2PRYA 3JRWA 4RA9A 4TS4A 5B3LA 1TKBA 1KY3A 1L7XA 4GH5A 1FYEA 1RJ9B 2VA9A 2WMOB 3GEHA 3W4KA 1UBTS 1QF6A 1ZA1A 2CNBA 1SVKA 3V34A 3WZ2A 1C30A 1N6LA 1M74A 2LDBA 3RAPR 4U7JA 4N0PA 2JBAB 3R3XA 5LYJA 3JY6A 1K7FB 1TW3A 4FFOA 1H2EA 3ZLBA 3AM3A 1D7AA 3T1VA 2A84A 4G0NA 3LGXA 4WOKA 4NENB 3HBNA 1B16A 2BJHA 3CA8A 2HPHA 4OXYA 5ESXA 5LDHA 4A3SA 2OILA 1SCUB 1EXVA 3M89A 4F4FA 4YAWA 1XLWA 8GPBA 3B9PA 5CW1A 1JR3A 4MDHA 4BKMA 3A04A 4GLBA 3E9RA 1NI5A 3CX7A 2Q8NA 3GPDG 4KMMA 2I4TA 4ZO9A 4UVGA 3T35A 3T6KA 1KORA 4MPDA 1UOPA 3GNSA 1LJ8A 1RYYA 2GTPA 2L18A 5KQLA 1CF2O 3W6UA 3X1JA 1GPH1 3H84A 4DCTA 1I6MA 3I5AA 4ZVTA 5GIOE 1WSAA 2WB2A 1CHNA 1UBSB 1RQ7A 1GADO 2Q1TA 4O4HF 5J5AA 1JS1X 4WKPA 4G1MB 5DCLA 1TQ8A 2VH1A 3ECCA 3H83A 2FP4A 4BO6A 5ELXA 4K0RA 3BFXA 4QPPA 4Q34A 5EC8A 3MOIA 4QQRA 1OZFA 1N3LA 4BV9A 4XD7D 2ZU6A 2QPLA 4YTEA 3MYYA 2F7SA 4J6FA 4M99A 1KFBB 2IQ5A 4Z9FA 3F5FA 3LL4A 1ORTA 4BQFA 1XRNA 1BXRB 1TTPB 3KJXA 3LXUX 2O2CA 3EGCA 3B2QA 2B0CA 4HR7A 4MWTA 4XLTA 5LD2B 2AI1A 1JALA 1I51A 1UADA 3ACDA 4WL0A 3EVDA 4YPVA 5CA1B 5T4FA 2NYAA 5IS2A 1EFVA 1JHPA 2I7XA 3CE6A 5ESWA 2QN1A 2OHOA 1MPXA 2H1SA 2RH4A 2OYCA 4H3HB 3LHSA 4DCCA 4ED9A 5IMSA 3U5TA 1GUFA 4AK9A 2QY6A 3QKTA 1OX5A 3SU8A 2NUPA 3LBHA 3ODPA 3SFZA 1JZSA 1T13A 1X1CA 3DYIA 5JJIA 3ETGA 3L4BA 1WHTB 1IN6A 2VDLB 4Q05A 3LZDA 1RLUA 2FGJA 4XRRA 4A6PA 5F3RA 4C4AA 4II7A 1ECPA 4GMHA 2I1VB 4D8UA 3PEWA 4NQRA 2GMWA 5JQWA 4G5XA 4BEVA 4EKDA 1KR5A 3A1FA 1MB3A 2GOYA 1PFQA 2RHOA 1TU0A 4WECA 4CQMD 4MA0A 1WXIA 1TO1E 1SPBS 5IH3A 3MJCA 3F9RA 1DKLA 1XZAA 1XD9A 1ZK2A 3SBOA 5ADVA 5K8CA 4DADA 3C8UA 1R2QA 3L9XA 5DYNA 2PD6A 4ZYUA 1I2DA 2BBSA 3A2NA 3OEWA 5CX4A 2HMWA 1ZONA 4M9UA 4MRVA 4CLHA 5LP1A 1O87A 3IDSA 1PZGA 2YHIB 3OIVA 3QEKA 1GTG1 3DOUA 1VYVA 1ZGHA 4WPGA 2O3JA 5FBQB 3TPCA 4EAQA 3NOOA 5G0UA 3PKJA 4TLEA 4YLGA 1M6WA 5EP4A 3PJEA 2QRUA 3AVOA 2EYQA 2WT8A 2QZ9A 2ZVDA 3GV0A 2ZP1A 4AJEA 1BMQA 4IVNA 3TLAA 2CJWA 4MGZR 1IDOA 1YI0A 4KP7A 5KAPA 3BIJA 3THXA 1F4LA 5AVXA 1FJXA 3JVIA 5IF3A 1HG1A 3GJQA 4D80A 4PYOA 3K09C 2HDNB 1B0PA 2W6QA 2NOAA 3H1EA 3IA2A 4LJAA 4JR1A 2AA3A 1QZ3A 1TO6A 4EHIA 2OUIA 5ALMA 4ZVKA 4A6XA 3GBSA 3KQNA 4BBZA 2AW5A 2DFLA 2AXPA 2WD7A 4X54A 3SCZA 4WHMA 1OLOA 4JDPA 4DCSA 1AUQA 1P0QA 3VISA 3MNFA 3IKMB 3WYCA 4HXGA 4UCQA 1T1IA 4PQRA 4AO8A 4BBJA 1TZCA 1SC4A 1VIMA 1I6WA 1NA5A 4O2LA 5JC8A 4RFSB 8ABPA 1S7GA 1NOIA 2WF5A 3EG5A 1XQ6A 3EVBA 1SKYE 5FOXA 3STWA 4YAKA 4Q4AA 4EH1A 1WNFA 5JYEA 3GN2A 4I7EA 1SULA 2W58A 3DBVO 221PA 3OP1A 3KVNA 3U3XA 1TZBA 2MSDB 4DIFA 4FLEA 2PZBA 1T15A 4XD2A 3E15A 3LGAA 3STXA 4G5FA 3VUEA 2KLHA 1UEJA 3DCJA 5HIKA 5C2JB 3KQLA 2XWJI 3LTEA 2AD1A 2JASA 3LRXA 1G63A 1X6VA 3GG2A 3I9MA 4W9RA 1IOWA 2WOOA 4YRRA 2Z57A 3ZGNA 4C4ZA 4KXXA 1OH8A 1RYHA 1JLSA 2IS2A 3KP1A 4QEKA 3EPLA 4UUBA 4TMTA 3I2FA 2XD9A 5C3UA 1COWD 2GSWA 2FG6C 4RY2A 4BAUA 4DB4A 1F1JA 5ALJA 4P4GA 5I51A 3HVUA 1QGDA 2WSBA 2O52A 3WO1A 4OQ4A 1EVLA 1O97D 4BNWA 2NN3C 2CLOB 2P65A 1Y8RA 3V5NA 5FUWA 3BN3A 5ARDA 3EHDA 5JAUA 5L95A 1GNRA 1V5GA 3H18A 1KETA 3PXXA 4M6WA 3BB4A 4MP6A 2ATIA 4ETNA 1SXJA 3EZ9A 1J25A 2AMVA 5EQJB 2HCRA