The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
83
|
sequence length |
268
|
structure length |
243
|
Chain Sequence |
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDASVVYCDPPYAPLNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVDELLALYKP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural Basis of Selective N-6 adenine methyltransferase Inhibition by Transition State Mimic
rcsb |
molecule tags |
Transferase
|
source organism |
Escherichia coli
|
molecule keywords |
DNA adenine methylase
|
total genus |
83
|
structure length |
243
|
sequence length |
268
|
chains with identical sequence |
E, F
|
ec nomenclature |
ec
2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific). |
pdb deposition date | 2012-08-20 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
D | PF02086 | MethyltransfD12 | D12 class N6 adenine-specific DNA methyltransferase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Adenine-specific Methyltransferase; domain 2 | Adenine-specific Methyltransferase, Domain 2 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Vaccinia Virus protein VP39 |