4GOLD

Crystal structure of e. coli dna adenine methyltransferase in complex with methylated aza-sam
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
268
structure length
243
Chain Sequence
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDASVVYCDPPYAPLNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVDELLALYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Selective N-6 adenine methyltransferase Inhibition by Transition State Mimic
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords DNA adenine methylase
total genus 83
structure length 243
sequence length 268
chains with identical sequence E, F
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4golD02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4golD01
4QTUB 1L1EA 4KDRA 4M37A 3ELWA 3TMAA 1O54A 5DPMA 4C06A 4Z2YA 4AZVA 1NV9A 4DCMA 5D1NA 4WXHA 3GDHA 4FP9A 3KKZA 2AVDA 5LQUA 1I9GA 3KR1A 1L3CA 2OZVA 2ZIGA 2WA2A 5DRTA 4E2ZA 5F2NA 2Z6AA 3DULA 3MTIA 3R0QA 3GRVA 4A6EA 5DXAA 3HEMA 3SSNA 3NMUF 2B25A 1M6YA 2B3TA 3NJRA 4RVHA 3B7PA 1YFJA 4BLWA 3LSTA 4RTMA 2AOTA 2AOTB 4ZTBA 4HGZA 2FYTA 4CXMA 2PJDA 3BWYA 2JJQA 3Q7EA 1RI3A 5ICEA 3PFGA 1YF3A 3G8BA 3K0BA 4E2WA 3G8AA 2IDKA 2IH2A 1U2ZA 3FTCA 3EVGA 3LGAA 5CVUA 3GO4A 3I64A 2PBFA 3ELDA 1INLA 5CVDA 4QVGA 4AZSA 4PGHA 4KW7A 2P3QA 3CJTA 1D2CA 1Z3CA 1JG2A 1X1CA 3HVJA 4KDCA 3M6VA 1QAQA 3LKDA 4FT4A 3DLIA 1SUSA 3R3HA 5T67A 4GOND 1DUSA 2P3LA 3TQSA 2VP3A 5FWDA 3OPNA 3GU3A 3X0DA 1KPIA 1XTPA 4RTRA 3PX3A 3BT7A 3QOXA 1R6AA 3FUTA 3KQSA 4H0NA 3OFKA 1TW3A 4C05A 1JSXA 1Q0SA 2P1DA 2PX2A 2I9KA 1AV6A 1DCTA 5K0FA 1JTEA 1R74A 3BXOA 4EK9A 3IYLW 3OU2A 2G70A 4PYQA 2C7OA 3R6TA 4IKPA 3GRUA 4X61A 2UYQA 3GCZA 3LDFA 3KHKA 3OE4A 4GOOD 1FP1D 2ZW9A 3FYDA 2OYRA 1VQ1A 3GGDA 3LX6A 2AR0A 3M70A 4FS8A 4LG1A 3M6UA 4PIPA 4ER0A 5LQJA 1UIRA 3A26A 3G89A 5KYGA 2P35A 1AF7A 3BUSA 1QANA 5DSXA 5E9WA 2GA9A 2ZWAA 3A25A 3UJ9A 2HTEA 3LBFA 3OCJA 3UJDA 5HZMA 4OX9Y 3NVMB 2P7IA 3GWZA 2C7RA 1VIDA 5GM2A 4YMHA 2O07A 1H1DA 3ID6C 5DXJA 2ONYA 4F84A 1B42A 3BKWA 5EVJA 2VS1A 1JQDA 4R6XA 1QZZA 3G2QA 1FJXA 3GIWA 1EQAA 4F86A 4RWZA 3H2BA 3B89A 2IH4A 3FRIA 4RVDA 4YV0A 3DMHA 4WVLA 5FUBA 5IH3A 2FK7A 5HIKA 5FADA 5CD1A 1G8AA 3KR2A 1X1BA 5BW4A 1R00A 5GWXA 3FUXA 2OB1A 3LDGA 4QPNA 3EPPA 2PX4A 3DXZA 2ZZNA 2O0LA 2QM3A 3P9KA 1WZNA 1FBNA 3RODA 3MCZA 2WK1A 5FA5A 3UZUA 4RTKA 2PWPA 3REOA 5K0NA 1ZKDA 3MERA 1XCLA 3R24A 4OQEA 1FPQA 4FZVA 5EC8A 2AOUB 4ER7A 4DKJA 2DULA 3B3GA 3MB5A 1YZHA 4PGGA 3UA4A 5DRYA 3ME5A 4IWNA 3EGIA 3C0KA 4YV1A 5FCDA 2ZSUA 3TLJA 3BZBA 1I1NA 5FULA 1N2XA 1ZHFA 1NW7A 1EG2A 1QAMA 2PXXA 3ELUA 1NW6A 3G5LA 3SXJA 1AQJA 5GIPE 2C7PA 1KXZA 1I4WA 2UYOA 1WG8A 5EKXA 3U81A 3V97A 3JWJA 1NE2A 3DMFA 1F38A 4DQ0A 3PFHA 1F3LA 2PXAA 5CVJA 3K6RA 5EZQA 5DX1A 2DPMA 2ZBRA 4OBXA 5DLYA 3BGVA 4EKIA 5HILA 4P7GA 4QVKA 5EOVA 2G8NA 2XYRA 4BP3A 2ZIFA 2IFTA 4F85A 2NYUA 3ER8A 4X60A 5K0BA 2HWKA 2PT6A 2YUIA 3UWPA 9MHTA 1RI5A 3S68A 2G72A 4HC4A 1L9KA 4YUZA 1L3IA 2AOUA 3OE5A 1XXLA 1M6EX 4NECA 2LD4A 4O29A 2NXEA 1RJGA 1MJFA 2VDVE 1KPGA 3THRA 2C7QA 1ZGAA 3E8SA 1ORIA 3GNLA 3UA3A 3ELYA 4YV2A 5DM2A 2E5WA 3DR5A 3UJBA 3P8ZA 3PT9A 2BR4A 4QDJA 3KR0A 4XUCA 3AJDA 5KVAA 1SKMA 3HA5A 3FZGA 3G2OA 10MHA 5GM1A 4EKGA 3O7WA 2YTZA 2IH5A 3KQYA 5E8RA 3TRKA 4DZRA 2ESRA 5JR3A 2G1PA 3FUWA 4C04A 1EJ0A 4JXJA 2PX8A 2YXEA 1NT2A 3SSOA 3MQ2A 1X19A 4HG2A 1NW5A 3LBYA 3QV2A 4QQKA 3KPWA 4EMSA 5IKMA 3FPGA 3JWGA 4HTFB 5DT2A 4YMGA 2BH2A 2GS9A 3EVCA 1T43A 3UJ7A 5DTRA 5EMJA 3FUUA 4YUVA 4G56A 4DA4A 4L7VA 3NVKI 3OZTA 1NV8A 2I7CA 4RSRA 1KYWA 4GEKA 2Z6UA 5EKUA 3MCTA 4RTOA 2AZTA 3ORHA 1D2GA 3G7UA 2BR5A 3D2LA 2XVMA 4P7KA 1G38A 1KIAA 4YUXA 2ZWVA 3TKYA 1WXWA 4PNEA 5C9ZA 1RJDA 3DUWA 3EVFA 3HCAA 2XBMA 5DSTA 5HIMA 3EVZA 5P8WA 1JG1A 4MTLA 4HTFA 5K0EA 4GC9A 5BW5A 3JWHA 4XUDA 5K8VA 1EIZA 3O31A 1G8SA 3HCBA 1O9GA 5GP1A 3GXOA 1NW8A 2QY6A 5LQKA 3P2IA 2K4MA 4YUWA 1FP2A 2UYHA 3IHTA 5HOQA 4AZWA 5DM4A 5E9JA 1DL5A 3V8VA 3BWCA 3VYWA 4GQBA 4DF3A 2JG3A 4CKCA 3C6MA 4RTQA 1PRYA 2WA1A 3CVOA 3LCUA 1VP3A 4GBED 2EJUA 3M6WA 3UFBA 3EVEA 4P7JA 3A4TA 1XCJA 4EQZA 1NBIA 1WS6A 1YB2A 1G6Q1 2NXNA 4UOEA 2AS0A 2JH8A 4B17A 2BM8A 1TPYA 5GIOE 3HVHA 5K0LA 5K0CA 1SVUA 3R9XB 5CVEA 1X1AA 5HIIA 3LL7A 3FUVA 2XYVA 5EMMA 4YUYA 4CKBA 3RW9A 4MIKA 4CTJA 4M38A 3QOWA 4HSGA 2YX1A 3DLCA 4HH4A 1EJ6A 2P8JA 4LECA 3TR6A 2ZBQA 2JHCA 5EGSA 1SQGA 2JHPA 5FA8A 1G60A 1WY7A 5FTWA 2IBSA 4R8RA 3RIEA 3GJYA 4KWCA 5K09A 1ZQ9A 3HVKA 3OZRA 3PVCA 3EEYA 5DM0A 1AQIA 4OA5A 2ORED 3KQMA 3I53A 2IP2A 2O05A 3KPUA 1Y8CA 5E1MA 1HMYA 1VP9A 2B78A 2H1RA 2ZULA 4LWOA 3KQOA 4R8SA 4AZTA 4RVGA 2NP6A 4XUEA 4FSXA 3AXSA 4RTJA 3C3YA 3SM3A 2ZTHA 1YUBA 2EX4A 5E8JA 5K0JA 2HMYB 2Q41A 4KVZA 4A6DA 1KR5A 5M5BA 3P9IA 2B9EA 2Z6QA 3HVIA 4QDKA 5F2KA 4DCGA 2GPYA 2OY0A 2PV0A 2YXDA 3NWEA 3PS9A 1SUIA 3HA7A 1N7IA 2FHPA 3BGDA 4PONA 3B5IA 2P3OA 4E30A 3DP7A 4OA8A 4MHTA 2OXTA 2AN3A 3VSEA 3AY0A 3FTDA 1ORHA 1PJZA 4IV0A 1JTFA 4C03A 5B1SA 3CCFA 3KPJA 2OPBA 3SMQA 3OZSA 5C0OE 2NP7A 3C3PA 4PCLA 3F4KA 1IY9A 4ER5A 1VE3A 3LPMA 3MGGA 3PB3A 4GUAA 2IDJA 3E23A 3T7SA 3FPFA 3M33A 3B3FA 4GOLD 1YZ3A 4ER3A 1RI4A 5T6BA 5GOZA 5ICFA 5DTQA 2YVLA 5EMKA 3KQWA 2UYCA 3HTXA 2AN5A 4QTTB 4BP1A 4RVFA 4RV9A 4U7TB 3SGLA 3TPZA 5ICCA 1M0EA 3HCEA 2V7EA 3A7EA 4X1OA 4V0QA 2IGTA 2QRVA 4PINA 2VZ9A 4K6MA 5U4XA 4CTKA 2AOWA 2ZZKA 1JG3A 3A7DA 1IM8A 2EJTA 2XVAA 3JWIA 4PYNA 5EIWA 5T64A 3GRZA 3ERCA 3FPJA 5E1OA 5E2AA 2PX5A 3SVZA 2OBFA 2P40A 2Y1XA 2BM9A 3BWMA 5E1BA 5CCXA 3G5TA 3HP7A 2GAFA 3UJ8A 2B2CA 5EHGA 1L3BA 3I5UA 3EVAA 4C07A 3OU7A 2GH1A 1G55A 3LCVB 3P97A 4ISCA 5GINE 2HR1A 2PLWA 3SR4A 2G71A 5K03A 5DX8A 2OB2A 4RTPA 3DXXA 3I58A 3P2KA 1ZG3A 1NW3A 1UWVA 2H00A 2ZVJA 4BY9E 3FPHA 2N47A 2PSSA 5FHRA 4V0RA 4R6WA 5E9QA 1JG4A 1VLMA 1VPTA 3G2MA 2IIPA 3MTEA 3P2EA 4FT2A 4Y30A 5MHTA 8MHTA 4RYLA 3T0IA 2ERCA 2O06A 5FWAA 4XCXA 3KQTA 3HCFA 3FTEA 2IBTA 4AUKA 3B3JA 3EMDA 1X1DA 4POOA 3PLAE 4GF5A 3KR9A 5CVVA 2FCAA 5CUQA 4C08A 4E2XA 5LR6A 1QAOA 2CL5A 2I6GA 1VBFA 2R3SA 3EEOA 2CWWA 2CKDA 1QYRA 3EGVA 3HA3A 2FPOA 1O9HA 3E05A 3EVDA 2PY6A 4P7FA 2AOVA 2FRXA 4DM3A 3BGIA 2EFJA 3PX2A 3SX0A 3CJRA 5BXYA 5LQAA 3GRRA 5K05A 1SQFA 3P71T 2PWYA 4PYMA 4X41A 3ER9A 1KHHA 1BOOA 2ADMA 2ZFUA 2IPXA 3P9NA 1JSZA 1RI2A 5EPEA 3L8DA 1KPHA 3C6KA 2ZLBA 3KPYA 3M4XA 3KU1A 5DTMA 5FQNA 3E7PA 3TM4A 3UBTA 4E33A 2UZ4A 2ZCJA 3LCCA 1RI1A 1EAMA 3AWIA 4M7RA 4OQDA 1NKVA 1YFLA 3DOUA 5LQNA 1P1BA 2A14A 1JR4A 4BLVA 5JUWA 1IXKA 2NNWB 3MAGA 5K01A 1XDZA 3DH0A 1WXXA 2AOXA 3NDIA 4BLUA 5KQSA 3AXTA 1SG9A 1KYZA 3OFJA 1R18A 3LDUA 2CMGA 2AN4A 2OO3A 5CM2Z 4CWAA 3DTNA 1KP9A 3FTFA 1XDSA 3LECA 4R05A 5EG5A 4M36A 1P91A 3FYCA 2QRVB 1UFKA 2Y1WA 4EVIA 4KIFA 4KRGA 2BZGA 2YXLA 4PCAA 2PGXA 4RTSA 2ZIEA 4MWZA 5FHQA 1NBHA 3CJQA 3CBGA 4P58A 2AVNA 1Q0TA 3WSTA 3HCCA 2R6ZA 3KQPA 4PYOA 2OKCA 3BWBA 3EGEA 3LHDA 3CKKA 7MHTA 4RX1A 5HFJA 2FK8A 2GB4A 4PYIA 3TFWA 5DM1A 4ER6A 4U7PB 4E70A 4PYLA 1RJEA 3T7TA 4LWPA 3IV6A 2NXJA 2VDWA 3HM2A 5E1DA 2HNKA 5LSAA 2V74B 2QE6A 4X63A 5CCBA 3KQVA 4GOMD 2VDUE 1BC5A 2I62A 3THSA 5KS2A 2ZBPA 3EVBA 3MHTA 4FSDA 5EEHA 4AX8A 3TM5A 1V39A 3SSMA 5FQOA 1P39A 2KW5A 2PKWA 3A27A 3BKXA 5DWQA 1ZGJA 3TKAA 3G2PA 1TW2A 1XVAA 5HIJA 4MQ4A 3O4FA 5EIFA 2H11A 5ERGB 4E2YA 3IEIA 3PTAA 3NWBA 2BR3A 2EG5A 5EEGA 2JHAA 4FR0A 4Y2HA 3VC2A 2O57A 3UJCA 1HNNA 5E2BA 1R8YA 5KQRA 1VL5A 2F8LA 1BKYA 2QYOA 3OU6A 4OBWA 5F2OA 4C4AA 4DMGA 3M6XA 4RTNA 3NDJA 2NXCA 2PT9A 3KQQA 5D1HA 3FRHA 5G02A 4E32A 5DX0A 3NW9A 4E31A 3I9FA 1R8XA 3GRYA 1JQEA 5EHIA 3EMBA 5LQCA 3DMGA 2XYQA 4QPPA 1XDUA 2YQZA 2CMHA 3ANXA 5HEKA 3T7RA 3NTVA 2HV9A 1BHJA 1N7JA 3VC1A 5C1IA 4CKEA 3FPEA 4KIGA 2ONZA 5ICGA 2JH9A 3CGGA 2PVCA 4HRAA 5K0GA 5LQRA 5CIYA 2P41A 5BP7A 4IV8A 1OR8A 5H02A 1MHTA 1P1CA 2P7HA 3HCDA 1RJFA 3LKZA 1XJ5A 5EMLA 2ZZMA 3UJAA 3HNRA 4PWYA 1D2HA 4PIMA 3Q87B 3G88A 4GC5A 2GLUA 3TOSA 1JQ3A 4PYJA 4HGYA 4PYKA 2PXCA 3DXYA 3KPVA 3P9CA 3CC8A 4FGZA 4ATNA 4QQNA 4RTLA 5EZSA 2YR0A 5EQJB 3UJ6A
chains in the Genus database with same CATH superfamily
3GUHA 3ELWA 1NBME 2X9GA 4EUKA 3OLCX 4Z2YA 4BNYA 2AQKA 5D1NA 3T35A 3R5TA 1TK2A 2G4LA 3KT6A 4WMLA 3GDHA 1TZCA 1JDBC 3GFVA 5JROA 1NX6A 5DRTA 1G8HA 1MC4A 4FQ8A 3H9GA 3BMOB 3FNRA 3ABIA 2ODTX 3NH6A 4A6EA 1A2QA 3IBFA 3C3JA 3Q5GA 2RHWA 1QCZA 3EDRA 4OY3A 4M1MA 4WKCA 2Y0DA 1JKJA 4NFSA 2GA8A 2QAGC 4HWSA 2QW8A 4YAJA 1B8VA 4HGZA 4BP9A 4H0CA 1NTRA 2HIGA 2PIAA 4YFYA 1G8PA 4BB0A 3GLFB 2JJQA 3WADA 1UJMA 1BCRB 5ICEA 1CZUA 2VBGA 1MX3A 1RXIA 3P9SA 1L7QA 4KGXA 3GHHA 1SZCA 3CVYA 1XZKA 3KWMA 3I62A 4I4TB 2I80A 3H1FA 1Z56C 1NXWA 2ECKA 3QELB 4GGPA 3DDHA 3QEJA 4HNHA 5BN4A 1RZRA 4RJTA 2MT9A 4B34A 3UK7A 4RPGA 2IZ7A 5KOYA 2P2LA 4G6ZA 4B9AA 2OV1A 4BFSA 2YH2A 4KQCA 1DIGA 2J3KA 1N5OX 4YJHA 1A04A 3RYHA 3A9CA 1T0HB 2A59A 2R8BA 4EAQA 4MO9A 4Q7KA 4ON9A 3BAFA 5AVXA 4N12A 4E1BA 3AJ8A 4DV0B 1X7YB 3NHFA 4ESOA 3C87A 3K9HA 2QVBA 5IN4A 5GAJA 4RD6A 1F2DA 2HHJA 2YZKA 4BAUA 4LHXA 1DBPA 4BEVA 4D4JA 5EJMA 4X61A 4BYGA 1D6SA 3KLNA 5JJIA 3OE4A 1MB4A 4G9BA 3FYDA 1P4JA 2IUSA 1OH8A 2RGRA 4HUQA 4L9SA 1WXGA 3LY5A 1B16A 1WW2A 2HY7A 4M0CA 1UJ5A 1UMBA 2HSDA 4RLFA 3T7JA 4DCJA 2F8SA 1X3LA 3QITA 3P0JA 1S0UA 4RIFA 2X2EA 4Z4HA 1ZSNA 4RJIA 621PA 2I91A 3F90A 4ALIA 4G9GA 3II6X 1IB0A 4DCUA 1TO2E 1E2GA 3M6MD 5DYTA 3BDIA 5KSWB 1ZP6A 2NSLA 1NQVA 4D4KA 1FYEA 4MVJF 1JQDA 1DJNA 1MAWA 1EUQA 1PFGA 1WMSA 1DG1G 4RMGA 3ZLTA 4HLQB 4DQLA 3E48A 1II9A 3FCOA 3IB3A 4QD3A 2REQA 1DBRA 1Z07A 2Z8YM 5SY9A 3BPSA 3CH4B 2D62A 2IHVA 3Q7IA 2AD1A 3KR2A 2Z83A 1ZBDA 5HGJA 3EVNA 5KYXB 2F43B 4LF6B 5E6RB 4GX5A 1QVWA 5D2CA 4ZCRA 3DXZA 1LSJA 4WESB 3D4OA 5FXMA 1KU6A 3RODA 1B74A 1YDMA 4WUTA 1X15A 3H6GA 4JEUA 5G1NA 4E08A 3VMFA 4MPDA 1GM5A 4UCQA 1YJ5A 4UZSA 2I4TA 3U39A 2Q6LA 4O5OA 3ZHCA 5A6SB 4QATA 2IU6A 5AHRA 5H0IA 2VSQA 4HADA 1MIOA 3HKCA 2B94A 1E0DA 4H0FA 3JAWB 3FVQA 2ILVA 2P4QA 3AZPA 5JI3E 3IMFA 3JTMA 1Z2OX 5FIUA 1V3QE 4EMBA 2WVJA 4DIOA 1DI0A 4FEAA 3B6MA 2J6CA 2I29A 3GVXA 2OVFA 2P4EA 3W79A 4C7XA 4PAQA 5HG0A 5UKDA 2XMBA 3NRCA 3DBIA 4CMGA 1K66A 1JEDA 2B7BA 3QMWA 3C3BA 1WEHA 1TD9A 3PXEA 1G21B 3E84A 5EJIA 3WKCA 4HH1A 5JRJA 5KB3A 5BVHA 1FW6A 2DPMA 4MV3A 3KHSA 2B6NA 1DAEA 2CXXA 1ZRMA 1GFIA 1SKAA 4Q3LA 2C2OA 3GAMA 1TI7A 3IVAA 3R8XA 3TL6A 2D13A 2OFWA 2ZRPA 4WKGA 4M1KA 1PYOA 2YUIA 3TDMA 1DCMA 3VAZA 9MHTA 1HE3A 1ZO8A 1YOBA 2ZI9A 2KB0A 4D9CA 1NX9A 1EDDA 1QK5A 2ZXEA 4KQ2A 4YUZA 4R4JA 2O3UA 4MVCA 1IOZA 3H5VA 4W5JA 5EP1A 1PV1A 3AEUB 5FLYA 3EMVA 2A58A 2PJZA 1ORIA 1Z7YA 2R7AA 3E8SA 3GNLA 1PVOA 5E7JA 3IQWA 2HHLA 1ZCAA 4CL2A 1CV2A 5HQ3B 4BQQA 1RRFA 4GM1A 1LDEA 2CFOA 3QX7A 3DL7A 4RJLA 2MHCA 4KVGA 2H92A 4MV5A 3B5JA 4PZEA 1LD3A 2HJSA 4RY2A 1HDZA 4M1WA 4M87A 4D42A 4BKOA 1ZM3A 1DC8A 4FC7A 4YP7A 2A57A 3W7BA 3HB7A 4L7QA 4ITVA 1CVIA 4S1VA 4C04A 1ZUHA 5HW0A 2NYRA 2SBTA 3BREA 3I3OA 2XMGA 1QYXA 1NW5A 3PUKA 1KKMA 3TSOA 4CM8A 5JS1A 4MQLA 1I4TD 2R9VA 5L4SA 4M54A 2BH2A 3PJRA 2A0YA 4FGWA 4BE9A 5DU2A 1M0SA 2GRAA 2I22A 4I4TA 3ENNA 3ZW9A 3VU9A 4GLFA 1R5BA 1RHRA 3BE8A 1L7XA 5EKUA 4A1OA 1M1YB 1Y7IA 2EKBA 2GF0A 3CF0A 3L0DA 1PJTA 5F76A 2BR5A 4DXDA 4Z1MD 3V3TA 4EZEA 2VPPA 3BWXA 1EUCB 1DDOA 3W8NA 3TWOA 4PNEA 1FU4A 2I34A 1C8KA 3HCAA 3U0VA 4TXLA 2P6UA 2BGWA 2PO5A 3EG9B 1CUJA 3HNPA 2GWHA 1D8AA 4IIJB 3TIIA 2V3WA 1K7XB 4F4HA 3L8CA 4AY3A 5IVHA 1G8SA 1NMYA 4W6QA 3GXOA 2OMEA 1P3JA 1ZOOA 1R12A 1T1IA 1XZ8A 2DWPA 2F7SA 2Y27A 3GPCA 3LPDA 4GSYA 4H4EA 1G2PA 3WLSA 4RKQA 1QFXA 3BWCA 3T4UA 5EN4A 4I66A 4N40A 1BVYF 1Q0LA 1JSRA 5TQ2B 1L4KA 1L6IA 1LXCA 3KNZA 1CUEA 3LVFO 2FMUA 2ZIWB 1PK8A 4GG1A 2J8ZA 2CMDA 4KN8A 1U4OA 1PL8A 3OQ1A 1QS0B 4DT1A 4N41A 1Y33E 3QE9Y 1MZVA 1SFRA 4XA8A 1GGVA 3W5UA 5CFRA 3BBLA 1UODA 4F8EA 5F7ZA 5HIIA 5THXA 4ZYUA 3T54A 4Q6BA 2VP2A 3RW9A 3WMFA 5GGXA 4BZPA 3CR7A 4BBZA 2AZDA 2JL1A 1J0EA 1NU8A 3W3AH 3RYTC 1H2BA 2IYZA 1EVQA 4FYPA 3BTUA 4DTIA 1UZNA 1UDBA 3KE8A 3RTGA 1IPHA 1AQIA 5TS3A 4Y1FA 2VK8A 3K94A 4X7RA 4XTRA 3C39A 4ZCQA 4DLLA 3DC2A 3IP1A 4Z0HO 3D8RA 3NALA 3KQOA 1KI6A 3LM8A 3E53A 3GJXC 1GSHA 1KEWA 2FG6C 1S7CA 4FSXA 3ZU3A 4A6XA 4IJQA 3IPLA 4FN5A 2R65A 4XDHA 3UAXA 1S8FA 4F8YA 1GZ6A 4IEIA 2HDNB 2WQZA 4R9UC 5KNCD 3HVIA 4EECA 4UQLA 4BNTA 3AF6A 1D2NA 2PA0A 2QG4A 2HM7A 5T3YA 3T4EA 2V6BA 2PMWB 2R00C 1OXUA 3JQAD 5DHSA 1OIVA 1Y1PA 2XMSA 1TUGA 4ZICA 3B5IA 1VKOA 1SHTX 3KB2A 4OOEA 2Q3BA 3IDFA 1ZLYA 1B1AA 1FEZA 1FDSA 4H7DA 3GVIA 4UM7A 4XAQA 1PJZA 1JQ5A 4LFCB 5AM3A 3VVBA 1OB2A 1A9PA 3ANYB 3HC7A 2GN0A 3UJPA 1OWMA 4IMIB 1J07A 3DTVA 2NP7A 3WKDA 3CVUA 1ZOIA 4L6AA 4DXHA 2XHEA 4GOLD 4RO0A 4B3JA 3LBIA 2D6FA 4AJ9A 2C0PA 5JAHA 1DX6A 2JAOA 4KDEA 2WVGA 4U7TB 4N49A 4WKNA 3ZUPA 2F3PA 3A7EA 4I5EA 3NYRA 2IKQA 4K6MA 3VHRA 1S2IA 1T8UA 4OXYA 1KK0A 2CYAA 3JWIA 3DHEA 1JWBB 3ERCA 1H4TA 1ZN9A 5H16A 1ML3A 2M32A 3T3HA 1IATA 5I3ZA 2VA8A 2NVBA 2Y1LA 5AOAA 1HDIA 4ZYTA 5HXAA 4C2UA 1DRUA 4EVRA 2R6JA 2II6A 2EWMA 1DZ3A 4GRIA 3CEHA 1II0A 3VUFA 3AG5A 4C3ZA 5KC9A 3EVAA 3H5AA 3N2LA 3PD0A 4L72A 2WMNB 1XQ9A 2FGJA 2IIBA 5TVKA 2R6HA 5IHPA 5KC8A 4MWDA 1YIOA 3WGQA 1U8XX 1DWUA 4KH0A 3CEPB 3GCXA 1E1KA 3LK6A 5AT1A 4N7RA 4H1WA 2O8BA 3PXAA 4P3YA 2FOLA 2N47A 4G0OA 4XOIA 2VOJA 4C6RA 4C6HA 3I5MA 1IONA 2RHOA 2RK6A 3CX4A 5JIBA 4OGGA 3OH8A 4J0CA 3UT5A 2WTAA 4MVJA 2O06A 1X86B 2X77A 3HJRA 4XCXA 4HEA1 2NUTA 4QWMA 3MUNA 4XX1A 3EAGA 2VJMA 3SDZA 4ENPA 1GLVA 3MWEA 1OHHD 1SIBE 2O2EA 3PXCX 4B3XA 2X4GA 2HK8A 2XLBA 5BRNA 3RARA 3ADDA 1ZGCA 1H3EA 2BPOA 3G9ZA 4L75A 5JFGA 3W0LB 1DIBA 2BEKA 1IHDA 3DOJA 4HVAA 1J5PA 3BGIA 3AI3A 2HSEA 3THYB 1XTIA 3CVJA 1W0KD 4BNXA 2PWYA 5AP9A 2HV8A 2I2BA 1F8FA 1HYHA 1BW9A 3V4PB 4EEZA 2G9UA 1U0EA 3PFKA 1RI2A 2CEAA 2Y3IA 3EGCA 4NRDA 4X97A 2ZJYA 3DMRA 1OX6A 4BNFA 3EF3A 4D6YA 2W11A 4Z2AA 3K96A 1SQ6A 3GFFA 4YR9A 1NL3A 2PH1A 2Y99A 3A6HA 1X6VA 4Q3OA 4ZVNA 2WIBA 1P1BA 4BLVA 2AF4C 2IEAA 3A1WA 4LCEA 3UAGA 2HBQA 3U56A 1BVHA 1EE1A 3AB8A 2J9XB 3C8ZA 1UP7A 4DLUA 4UU0A 4ZI7B 4IUCS 4Y3UA 1E2PA 3FFBA 1ZL2A 3O4RA 3ZLBA 4K1XA 2WAMA 4X1YB 5CM2Z 4JAVC 2PYDA 3ZCQA 3GJZA 3ASYA 4YHBA 3GLHE 3TLKA 4A8TA 3EQ6A 3JTEA 1RQNA 4W9MC 16PKA 2WYWA 1Y6RA 4KO4S 4WASA 1KQGA 2OOSA 3S29A 1W25A 4ZTUB 1AO0A 4JCCA 4L4SA 4P1ZA 4ML3A 2QQFA 1NJ8A 1Q0TA 4AKHA 4ITRC 5HYVA 4X7BA 1WQ3A 4PYOA 4CETA 2AC7A 3QUAA 4BFVA 1SOVA 2WKSA 3K4QA 4WLEA 5HFJA 3FWNA 4JQZA 1QOZA 4Z9FA 1WB5A 3SIWA 4B45A 3GZNA 2QZPA 3E9QA 4B3RB 2QTWB 4NS4A 4FEYA 4C9BA 2A9PA 4JJ6A 1S02A 2V74B 1TT5A 1S1CA 3PR3A 3GDWA 2WSSA 3PICA 2I54A 4Z5XA 4CV0A 4W9RA 1HETA 2CJFA 3EVTA 3GGOA 4FSDA 5ES3A 3AP2A 2GYVA 2PDAA 3PSAA 3RJTA 1L8XA 3RRYA 4NP6A 3ZEAA 4DDTA 2KW5A 1C0PA 4WT7A 2ODQA 1W8DA 1XVAA 4JFRA 3MSCA 2AD5A 3L82B 1OLOA 2R1ZA 3CS3A 2QLNA 4NBNA 3KL2A 5HDBB 3ZHQA 5K9ZA 4EUHA 3TXXA 5C8YF 5LQUA 3EWAA 1ZCJA 2NM0A 5ECYA 2XECA 4RESA 4CW7A 1BHQ1 2YS7A 3G82C 1WUHS 3WWDA 5L3SA 3OZUA 1F17A 4NENA 2V5UA 4MSUA 4NPHA 4XX0B 3BMNB 2TMGA 2UYGA 3K31A 1EKXA 2YZ7A 3AX6A 4ME6A 1L5FA 2YQZA 2H0QA 5AH0A 3ZE0B 3JCZA 3ZJ4A 4IS3A 5E9AA 3NTVA 4C4RA 4ZVTA 4CKEA 4I1PA 1C7JA 1DWQA 3L06A 4PZAA 3K6SB 5KPJA 4P84A 5M2QA 1AK1A 5IBQA 5HJ7A 3I9V6 4DG9A 2JGNA 4HDOB 4IDFA 4DAEA 2V96A 2CL6X 3AOEA 3LKZA 2V8OA 5CT5A 1XKTA 2FP4A 1IWPB 1D2HA 1FUKA 3Q87B 5TQ0B 1YR6A 3CEJA 3DUFB 1GCGA 2FPMA 5DNVA 5EVCA 5B5SA 2VTBB 3M5DA 4U7DA 1RZVA 4YAFA 2A5DA 2V7BA 1Z6TA 2H9YA 1WCIB 3KSBC 3JQBA 4REQA 3M82A 2JLVA 4ZD6A 7REQA 3TQTA 1M72A 1XVTA 1DELA 3VH2A 4C06A 2SKCA 3QKUA 4POAA 1DKNA 2XE4A 4GL2A 1DG9A 2GD0A 4KITB 2VF8A 4DQKA 4YCJA 1W0KA 2WWYA 1BG6A 3R0QA 4HYYA 4A26A 4F4JA 5LZ2A 2PUJA 4UEQA 2ONJA 5KCMA 2OHVA 2W6MA 1KEVA 1AB6A 1FRZA 3L8GA 4BLWA 3TFQA 1YR3A 1OBFO 2NTYC 1KYQA 4BO7A 2H5LA 1T5LA 3HU1A 4P5EA 5JZOA 1QHGA 4GX1A 5H83A 3T5PA 2VDKB 2BGJA 2HFJA 2WSLA 3BXXA 1AD2A 4WOPA 4GKJB 4XVRA 2MWMA 3AHIA 3HI6A 2WHYA 1K8YB 3ESYA 4X84A 3TEJA 4TWIA 3KJXA 4BAZA 2UAGA 4MRSA 3WLRA 4TT8A 3ESXA 3F6CA 3HY6A 3L84A 3I30X 4FMPA 4JQOA 2WP8J 3BFPA 5EZYB 3MGKA 5B1DA 4NNOA 2WNSA 3CZPA 2GNPA 3L8HA 1DUVG 1H8ED 2NIPA 4PGHA 4EW3A 1D2CA 2WG0A 3C3WA 3GJ5A 4GI5A 2EOAA 2P69A 3S2ZA 2HRCA 1JHZA 4ANFA 1H9BA 2QK4A 2DPGA 4C2AA 1FFWA 1Z4PX 2RH9B 3TQSA 4KPFC 1JPVA 3UMBA 1M6VA 1D04A 2C1XA 2J9FB 2XV1A 4C6TA 2PUEA 2IL1A 1Z6ZA 4LDPA 1I0IA 2REBA 1S2OA 1F06A 3OFKA 1WKCA 2VQ3A 1JSXA 3W6UA 4YUAA 1LV7A 3HL0A 1UQUA 3Q9SA 4FIZA 1JTEA 2J0UB 3G02A 2GILA 3OU2A 4ZEWA 1YZQA 4BQSA 3VVLA 5JHHB 3SAJA 5A2QA 1N8SA 1ZVKA 3RC8A 1LJ8A 1BXKA 1HDYA 1VQ1A 2UVQA 3LX6A 4C7JA 4HZUB 5FWYA 5JYBA 2Y0EA 3UANA 4ER0A 1JYEA 1NYQA 3GZTB 1RRKA 3R7WB 1PQ4A 2ZWAA 5CCDA 4EDHA 2NLOA 2HTEA 1ZMXA 2CB0A 3IP6A 5DT9A 3D1JA 3WWCA 4JSTA 3UWMA 2IUEA 4TL8A 2Z04A 4U6QA 3OIGA 4BMZA 4F84A 3STWA 1ULHA 3PIIA 3WLJA 3G0GA 1XJCA 3SNKA 1GQOA 4WJZA 3JD2A 4MVJE 1SCAA 2P79A 2IYUA 4TVBA 3B9PA 5KYUB 5EQDA 4BN4A 3V1NA 5E3JA 2VH5R 2FK7A 1R4NA 4EPYA 1SXIA 1VIMA 2AZ4A 1Z36A 2J3MA 3G0CA 1GSAA 3IIJA 1NDQA 2OO5A 4B3DA 3ESDA 4U00A 5BV1A 1JMYA 2BH9A 5KBYA 3SOPA 1E2KA 1P5ZB 1ACMA 3WKAA 2NO0A 4ZAGA 1EXDA 2AMYA 1RLJA 4RK1A 3VU1A 4N7BA 3QMPA 4LOHA 2A9QA 4XPZA 1IPFA 5CA0A 4X45A 3P2JA 2ZB7A 4E4RA 5HKKA 4W5OA 4YPVA 4E5UA 1XP8A 1XD2B 5EC8A 1TQ2A 2QN1A 3HBMA 5ERXA 3GIDA 3IPRA 2AWOA 4LX0A 5ALOA 2H2DA 4AUNA 1W47A 2W4QA 3PHIA 1WSBA 5DRYA 1R0RE 2W2PA 4DW8A 4MV8A 1T29A 4QZVA 2W0SA 2NTEA 1R2QA 3HB1A 2ZAYA 3HCOA 5HFNA 4JBXA 2VAMA 3TQRA 3U4AA 3OAAD 4HD8A 3S55A 1Q7BA 1BE6A 1H3NA 2Q2NA 2M1ZA 4UTVA 2BI7A 1F38A 1XFDA 4RK6A 3IO3A 1YRHA 3K6RA 2GN9A 2HDOA 2P90A 2ZBRA 1MW8X 4H77A 1U6KA 3IVXA 4TVKA 1HURA 1QRUA 1LA2A 3VU8A 2IV3A 4BU0A 2J5KA 5ALTA 2VWGA 4TTVA 4WXRA 4RSHA 4Y8VA 3U3ZA 5IC6A 5TGDA 4MJXA 3SKYA 2YWBA 1LS6A 2NYUA 3L9WA 4Q1EA 4TLCA 2PT6A 2D4AA 4OHFA 2ZAGA 3AOGA 5IARA 1N2GA 4IDEA 2G72A 5LNK6 1XEFA 2JA1A 2FW0A 1FQOA 1T3SA 3V7NA 4FIDA 2PYIA 1O95C 1AKUA 2B4YA 2OV4A 4WA8A 2EYUA 4DJ5X 1RWVA 1V3VA 5DM2A 2ECOA 3KE9A 5E6SA 3VOSA 3OM8A 3UJBA 1JWAB 1DIAA 1M2KA 2G5GX 2GJKA 4NIMA 3PT9A 4TLAA 4WKPA 2BR4A 5DBHX 2ES4A 4CDMA 1K5GA 5KDDA 1TQ4A 4W63A 1ULZA 1V9LA 1LVGA 1ZOPA 2GD1O 3OJ0A 1KJWA 4JA2A 2A5LA 4OFWA 2RGEA 4A10A 1NVDA 3ZG6A 5KJCA 1IAQA 2ZJBA 2OQRA 4M0LA 4MX8A 1EMDA 4R41A 1Z2CA 3T3DA 3T3PB 5DNCA 4FKZA 3C5EA 2ACKA 2EKPA 2YRXA 1VSBA 1LUAA 2GPBA 1BXZA 3CPHA 1THGA 4JXJA 2E0IA 1MF7A 4IAOA 1KO8A 3NOXA 4E03A 5I8PA 1YDHA 1DKLA 3RSZA 5K0SA 2MSWA 1E2BA 4HYEA 1Q20A 3UT6A 2VXBA 3KKQA 4RF3A 2GS9A 3HUUA 1KAOA 1PR0A 1VDMA 2PPVA 1BS9A 3JAKB 4MQEB 4QBTA 4CG0A 2O5RA 2PKXA 2JJYA 3DM5A 3P7MA 5D5HA 2O1SA 1X2BA 3R3SA 2ATEA 5WRFA 2AZTA 4YYEA 2OAQ1 4MR7B 1DX4A 4KBFA 5HZKA 2PAFA 5EYPA 4A2QA 2FF5A 1VKRA 1CUVA 4J6EA 1QZTA 1QCYA 1WXWA 3ASUA 2QF7A 2IXTA 1Z5OA 4AJEA 4EHJA 2QD5A 1EA5A 2IXFA 2VJAA 2BCGY 2RGXA 2OHIA 5IYZA 3WLQA 2DPLA 5H4HA 3ZJUA 1ZRHA 5DI3B 2M9MA 4XLTA 5DNYB 5I4CA 3HCBA 4KZPA 1O08A 3PXGA 1RAAA 2P1ZA 5DV9A 2BOVA 2YJ4A 5B3KA 4G97A 3N5KA 2DFKB 2OBMA 1FP2A 3QVLA 5LOVA 5JDCC 5HOQA 1NN0A 5ED0A 3T3OA 3UQZA 5DF1A 1G2OA 4U7HA 3G7SA 3WL6A 4G1FA 1I51A 1DBQA 1F20A 1PFKA 4GM0A 1IG3A 1FS4A 3OZIA 3LT5A 2ZM6B 1M1YE 1GV1A 4QDUA 1IEXA 3T52A 4C4ZA 4E88A 3M0EA 4BU1A 1P7CA 4HFNA 4LCBA 2D74A 1GNTA 2FJUA 1XTSA 3KBBA 1P44A 5EA2A 1FRNA 1XKXA 2CY0A 3OE7D 1RT9A 1GXSB 1RYMA 4WCFB 2K5UA 3NHPA 3RVBA 1QVRA 5JS2A 3ZDFA 4TUYA 2JCSA 3ACDA 3FCUB 3IT1A 4CKBA 4MIKA 4DR5B 4ZEXA 2I3ZA 1CWUA 1NXOA 3MC1A 1N1GA 1I2BA 4QKQA 1JZTA 4UNSA 4BCDA 4KR3A 3IQDB 5IM4A 4YECA 2DRIA 5C8VA 5EIHA 5CDUA 2E4WA 4AQ7A 2HAEA 3I53A 3PC3A 2BV3A 4DSOA 1M2FA 5JD6A 1JR3D 4LWOA 3BJIC 4IM7A 3RSHA 3Q3VA 4FYWA 2IEZA 2H1HA 2ZVDA 4IDDA 4PAWA 3UCFA 1B4DA 1YB5A 2FWAA 3G6KA 1KZ7B 5E8JA 3WQBA 3F6YA 1GPKA 3WIOA 1N33B 2OLEA 2QUZA 3PSHA 3KOMA 1AXRA 4R1SA 1HEYA 1QQ7A 2J33A 1E7QA 1UEIA 1ULSA 2PNFA 3CM0A 3TJZA 3THYA 3H2SA 1CZNA 2IXEA 1A0OA 5B55A 4L74A 2NSYA 3I72A 1TYAE 4RM3A 1NR1A 4UOQA 5JADA 1RXVA 1RM3A 3C85A 4X8OA 5IYZF 4MVJD 1ISSA 1JU4A 4JI8B 2BHSA 3DBVO 3ZDEA 1LJUA 4BV3A 5B1SA 4CF7A 2OPBA 3PC7A 2KYRA 2JFHA 4OQYA 1I2AA 2XDWA 1LFAA 1O6FA 3NT4A 3G6WA 1J97A 4LZWA 1SXJD 4IRUB 4QECA 2BELA 3U5ZB 1QGUB 1J22A 1CCWA 3NU1A 2SCUA 2OFPA 4X1KA 3TF5A 5T6BA 4OPMA 3SDBA 2XOKA 3QHQA 2YVLA 3PLNA 5JTTA 5EHZA 2VH1A 1RYNA 2DFVA 2I71A 2AH5A 3KYDB 2TMKA 2I3BA 4KR7A 5H3CA 4A03A 4IZHA 2LCIA 4MYSA 2C1EA 2YYZA 3OSZA 4NFYA 7MDHA 5AJHA 3STUA 3RVJA 2IELA 3LX5A 1UXJA 8ABPA 3FHOA 4CG2A 2X0IA 1T3ZA 1FIUA 1UJBA 4BLRA 2ZRQA 5EHGA 1DU4A 1FTSA 3IT0A 4KGDA 1N32B 1D7OA 2HNBA 4K6CA 3RS8A 1U6JA 4CNQA 1G55A 3ORFA 1XMJA 2IF0A 4DV5B 3IIIA 4HUTA 4EI9A 4AF8A 4DGQA 1C30A 4C43A 2PMKA 4PRLA 5KOHA 2I4MA 3LRXA 2FR1A 3VH4A 4NU5A 2GBPA 2C61A 1A7AA 3OWOA 1RLIA 3P2EA 1NURA 3DOFA 4RF4A 2CL0X 3GLFE 1M2HA 2YN2A 2EQ5A 3I9V1 2ATVA 3UC5A 5FWAA 1F6BA 2WUFA 2K6GA 4XJXA 2QGZA 4ARAA 2VDPB 5BMVB 1KQOA 2D2EA 1ZFNA 3EMDA 1DHRA 4BFZA 4Z53A 3LCRA 2JGFA 4BECA 3SLGA 3ZQ4A 4JVOA 1JNYA 3B6EA 4RQBA 2WQ7A 1S3GA 3O1JC 3N2YA 1IHOA 4EYKA 4CN8A 4DM3A 4ZXPA 1H0KA 3V7WA 2OSBA 5BR4A 1T35A 3P71T 4IUDS 1KERA 2ECFA 1E8NA 3H7IA 3HUDA 1KDRA 4QDXA 3OCVA 4B79A 4EF6A 5KX5A 4DEYA 5KYXA 13PKA 1NKTA 3ZZ1A 1VPDA 4LVUA 1F51E 3C6KA 3C3XA 1UOPA 3AKEA 1R4NB 5D5PA 3ESQA 4IJ6A 3RHSA 2Y66A 1KP3A 1GTVA 4Q7JB 3N3AC 1NBMD 2ODAA 4FHGA 1GKIA 1BX0A 3GQVA 4NV1A 1O5TA 3AT1A 3B8EA 5AI8A 3ADBA 2JK0A 3BICA 4GKVA 3EIWA 4YWHA 2LP4Y 3H5OA 4Y2YA 2C5LA 1PR5A 3DWIA 3VPFA 5LXTB 5TB5A 4C0WA 2R8XA 2RHGB 2YICA 3MLEA 3PQ3A 4P93A 2TRSB 2VQ6A 3KZKA 1AKVA 5EWLA 5KWJA 2OO3A 1C0KA 5KNDD 5HS4A 2AYZA 1NI3A 1W0CA 4L27A 5H8WA 1KP9A 1SQ5A 1ZC4A 4CQNA 1NA5A 1UFKA 3JQ6A 3REGA 5BYAA 2QDXA 2IHKA 3JD3A 5C4MA 4TX1A 4CM7A 4QPZA 3KQKA 5FHQA 4URUR 5CLGA 2AC4A 3AUJB 1Q92A 4ZQEA 3WAKA 2Z8XA 2RE8A 2VDLB 3A2MA 1SCUA 3KQPA 3ORYA 4PLWA 4Q4HA 3VKGA 2GCNA 2F1KA 3CIFA 4Y2PA 4EG5A 2GB4A 2R84A 2W6ZA 3E22A 1XCPA 1LKZA 3KB1A 4OSPA 1DO8A 4Q18A 4R9NA 5BSEA 1DBWA 1WAMA 1RJEA 4ARIA 1F6WA 3EFEA 1DXHA 1CHDA 2VJYA 1R4MA 5E1DA 5G0UA 3VI4B 5CDHA 2VDMB 3I2KA 2HF9A 2Y1KA 1W34A 5J43A 1SBHA 1EX7A 3RASA 3O8OA 4GPAA 1R15A 1AKWA 1X1RA 2WJWA 3VZCA 4MV0A 3LRPA 5HS6A 1KSHA 1OYWA 3EC1A 1VE6A 3BKXA 3ITNA 3IOYA 4JJKA 5KSOA 2TMDA 5C80A 3ACCA 2JGDB 3H7AA 1MW9X 4N9WA 4NZ9A 1OTXA 4Q66C 5FI1B 3V8QA 2WWHA 1E7YA 4RADA 1ILEA 3PEWA 2PRYA 3DF9A 4Y2HA 4WFJA 4BFTA 2CMFA 4N3GA 4UHCA 3LOUA 4XCQA 2YY5A 5HE9A 4UHHA 5DEIA 1WMBA 4E32A 1R0BA 4G25A 4OJTA 3T9FA 4O02B 3I9FA 3LHIA 3TTSA 1V6SA 3D6NB 4TV8F 1DTEA 3K1YA 2RHJA 4L5AA 5ECWA 1HDEA 3HM9A 1CS4C 3VV3A 2XYQA 4L73A 1OWPA 1CUXA 4JOCA 3FMGA 4FMBB 3A11A 1AK9A 3V6LA 1F4LA 5D7NA 1PKEA 3KDAA 4QM7A 2GF2A 2ONZA 1AK2A 3EQZA 3OEYA 3P2OA 4DA6A 2O2IA 2PR2A 1ZJ6A 2M2IA 1PG5A 4RL6A 2DR2A 1QNLA 4OMFG 1MIHA 2QTNA 3FYUB 2BEWA 4FILA 1B6TA 3ILXA 4ZAFA 4HBGA 1WPGA 2JLBA 4L8GA 1P33A 1E5VA 2QLBA 2JFGA 2GLUA 3G88A 4RJ2A 5ARBA 3TOSA 1VTKA 3AVTA 5CXQA 2RI0A 1H6DA 1KEEA 2C77A 4K1LA 3LMKA 1AV7A 1G63A 2ZCUA 1W5SA 3GH3A 5BN4B 1JKIA 2GEFA 3C6ZA 3ZDRA 3IR5A 4DQUA 3Q7RA 1GUBA 2X0NA 2COKA 4RKYA 5BYBA 4O4IF 4EO7A 3WBFA 3AVYA 1J56A 4OAOA 1Y7HA 4H6XA 4RORA 2WZBA 3L5OA 4RS4A 4BL5A 3DYIA 2P4UA 4G5YA 3JATB 1CY1A 4DBZA 2Z6AA 3HL4A 3L7IA 3LGXA 2GBLA 1XYVA 3MIIA 1JU9A 4PLFA 1NIJA 1Y7TA 3IRUA 4Y2JA 4BCBA 4YRSA 2FR0A 2VTKA 1VMEA 3IBTA 1YFJA 2Z8YA 5J4YA 2GUWA 3DWGA 3LSTA 1EIWA 4M0PA 1NN1A 1PZFA 1DAFA 2WU8A 4UFNA 4OLAA 3C7KA 2VF2A 1YQ9A 3CGWA 4PN7A 5AM2A 2XA9A 3SEZA 3LJKA 4IIYA 4NBKA 4DLZA 5IDXA 3EPKA 4UKDA 3H16A 1MAAA 1UPBA 4MYCA 3K0BA 5DBFA 4QA9A 4R1QA 4JXXA 2IS6A 3AFOA 3FTCA 4B9EA 3L07A 4D99A 1IYZA 4G1BA 2WIFA 4HV4A 1M7GA 3TRIA 3QWBA 3TVYA 2ANCA 3CEAA 1SCDA 2QX7A 4NVRA 2W2MA 2Z95A 5CVDA 5B6PA 2OFXA 3C5VA 2PVSA 3UMMA 2ROQA 4QVGA 2CXOA 2HDWA 2FNAA 1BXRB 1JG2A 1XN4A 1ZM7A 2VYCA 4FFRA 4OU5A 3ZGLA 3ZLVA 1W36D 2O2XA 1G20E 3C8MA 4MYUA 2ZT5A 1KO5A 4OFBA 3LT1A 3B51X 2O50A 1Y7PA 4JV5B 3PQ8A 1CJMA 2JKZA 4MS4A 4JI2B 1RP1A 2AR9A 3W8FA 3D4NA 1ZYUA 4CE6A 3KV3O 1UWKA 3AR8A 3T7EA 4GMKA 3FNIA 3CIOA 1IVYA 3R6TA 1JIUA 3PUWA 2LKDA 4CM4B 1FFDA 3MK31 4TWZA 4YI3A 3T5DA 5EMNA 4EITA 1Q91A 4KHPB 5C8YA 2AG1A 3KD2A 2OP1A 4GQAA 1SMKA 3KHTA 2YJNA 1J42A 1FDWA 3A26A 4DCNA 1RCUA 1X77A 5GJWC 3M8KA 3OKAA 1N1DA 1OFUA 4NESA 1PZEA 1HA3A 1UXGA 2ORWA 5DSXA 3VPGA 1XQYA 2V6JA 2PMEA 4DDHA 2ODEA 5AQ1A 3EB9A 1JE1A 2EFDB 4DC9A 1KI3A 2W37A 1RQPA 2EW8A 2NYVA 4DCVA 2KHZA 3JAKA 5CW1A 3TIXB 4O4IB 2NQ8A 3AHFA 3CNNA 5F64A 5IKXA 4M76B 4JEIA 5A4KA 5HZHA 4QLBA 4ZAVA 2AGVA 4WY2A 1QZZA 2GNAA 1EQUA 1CRLA 5ALVA 5JOQA 2DY0A 3ZU5A 1KVTA 4COKA 4FHZA 2IH4A 1Z4KA 4NCNA 5FUBA 3VZSA 5TLSA 1K68A 4HUQB 4BLSA 3FNGA 1R00A 4M9RA 5CXXA 5KKAA 1RABA 4F38A 5G4KB 1DIOB 3EPPA 2TECE 1W59A 3HLYA 3Q2OA 2NUAB 4C5AA 2PRSA 3OX4A 1Q0ZA 1NP3A 3JW8A 2JLQA 1GPAA 1QGUA 4IKOA 4N18A 5CDTA 2CNOA 4PSCA 1N2CB 1N3BA 1T5OA 3BD6A 3UZUA 4R40A 3OFVA 1EM6A 2AMFA 2PWPA 4QOFA 1K97A 2DQYA 1F8YA 1JHYA 4M9QA 4NHOA 1C1DB 2G0AA 4IZ6A 5AK3A 1G6OA 3GROA 1RWNA 3FH0A 3RREA 2A1TS 4OLJA 3VKHA 3G9UA 4ER7A 1QXSA 4FZJA 1I1QB 3C1UA 3WZMA 3GBPA 2C2XA 1PYDA 4HDCA 2QMOA 2GM9A 3H1GA 4YCNA 3N9IA 3NBMA 3V2UA 4WK2B 1ZJYA 1UK8A 4UUBA 4QIHA 4RM2A 1OV4A 3C0KA 1EDBA 1TJYA 4J7AA 1GUZA 1FFHA 1I8TA 2VYND 3EEBA 3HYCA 2XCQA 5FULA 3SYMA 3RNOA 1NW7A 2Z3WA 3ZN2A 1MX1A 1WCXA 2GVDC 2DLNA 2O2DA 1G3QA 1SR8A 1DXQA 1X8XA 2IYOA 3R5SA 3VBCA 1WG8A 2K2WA 4CL0A 4HNAB 1WJGA 2W2KB 1XDGA 3PC2A 3X1WA 1FSPA 3BJZA 3D6TB 4LRWA 3U9TA 1OXSC 4Q37A 1R8JA 1FFCA 1N8TA 3I9NA 3NBFA 3SSOA 1MB9A 3UMCA 3I01M 3SZLA 4EKIA 2RGUA 1GPDG 1Q83A 3AV3A 4YX9A 3TE7A 1RWWA 4RMNA 4QGGA 4RCZA 1TM2A 1V8ZA 2CFRA 1IBRA 2J3IA 3E1SA 4LXYA 1J1IA 4LRQA 4XSVA 4B3HA 5BSMA 5FOVA 4BMVA 3I8XA 2J0QA 4F2GA 3C7AA 1EXNA 1SBYA 2VDVE 2BW0A 4G0MA 3WISA 5J4KA 1K7FB 1VG0B 3UA3A 3IUPA 4OJYA 4CKYA 4JJGA 5JS8A 1P2GA 3GELA 5AK5A 1EVYA 3CNLA 4A23A 1FTWA 5IUKC 1YNOA 3WL3A 3NV7A 3L6DA 4ZO7A 1SBTA 1YVRA 4TMXA 3QTBA 3EQ9A 4IIXA 3PUHA 4D0RA 1AN0A 1E1YA 1AIPA 3SD7A 2HT6A 3N53A 2L82A 3KYCB 1KI7A 1JQLB 3O3NB 3PRJA 2AKYA 3B85A 4KO1S 1OI7A 3IAXA 1M1XB 2IWRA 3TOZA 3WA7A 5J2UA 2FW8A 3HKEB 2GMWA 1TIPA 1ZW6A 2G76A 3QKTA 3MZ0A 1Z35A 3CLRD 3PQ6A 1H66A 3MQ2A 1K7SN 2ZSHA 2I3GA 3L1UA 3E7WA 5FDFA 3JZMA 2IS4A 1QH1B 2WIKA 3OCCA 3T41A 3WX0A 2XQFA 4YRLA 4LUCA 5KTSA 5C5DA 4IIFA 1N9KA 3BCUA 3FUUA 3ZWVA 2H4JA 4BVKA 2HPVA 3EC7A 1QIKA 2Q6VA 3DW1X 1FUIA 4PRKA 5FORA 2JLZA 3NBZC 5CB0A 1DLJA 1UBMS 1YUNA 4JLMA 4RFSA 1BFUA 4CKWB 1XYYA 3N0RA 3ORSA 3TKYA 1MJ5A 5LCXA 5BURA 2EGGA 2IF2A 4C4PA 2EDAA 3EYWA 4AO7A 4KUHA 3A4MA 5F35A 1S96A 1WSAA 2QNIA 3ZZTA 3SK0A 5BW5A 1CETA 2F1JA 3KVYA 1SG0A 4KYUA 4MRRA 4RHEA 3W3AD 2O8EB 3RSLA 4UHFA 2HLDD 5GP1A 1U0LA 2F3UA 3A2NA 4LJKA 1CEXA 5KUTA 3D7MA 1Z5ZA 3L7JA 1T4DA 3NTRA 1Y1QA 3EF0A 1THMA 3QOFA 5E6UA 4ZWNA 5E9JA 4DY4A 5L45A 2EF0A 5D51S 1L5WA 4CKCA 3M6AA 2OWEA 3UF0A 3IUNA 2CL7X 3R7FA 4NE9A 4CQMD 5DN6A 1WVGA 1GAXA 3N2EA 1BWPA 4AFNA 4G67A 4GXNA 1EUYA 2QR5A 1H0HA 3JVUA 3B1WA 3M4NA 1R8SA 3NRBA 4XIGS 4C0QC 2XGMA 3RWOA 5GV8A 3HVHA 2C1ZA 2X7JA 4NABA 1NSTA 4MV9A 2Y1GA 3WA6A 4REMA 4YUYA 4UVGA 5F98A 3VYUB 5BOVA 1C3EA 1UP4A 1I36A 1AQYA 4MW4A 1TKBA 4XGQA 5BO5A 4N0EA 4YGYA 3KSUA 4BLPA 3D3NA 5GOTA 1E4OA 3WYDA 3N2KB 5EWMA 3H1BA 3ML1A 4O1HA 3PVCA 1OKKA 2JPDA 5IT9A 1GU7A 3DZGA 2VDRB 1GPLA 1XEXA 4LE1A 4MUJA 1IWBB 1UKYA 1D09A 1UOEA 3QYJA 4G65A 1FFEA 1X7WA 4V02A 4JYAB 4TOIA 3I2FA 3QQ5A 3WG9A 5J2TB 1JDVA 3K1JA 4QTZA 1CJKC 1C1YA 2HMYB 1F5NA 2Q41A 3FWPA 4L4XA 5K0JA 5DWDA 3ZWKA 2XVXA 1GLNA 2XNDD 2D1SA 3OWXA 3C98A 3ONEA 3MLAA 1JSCA 4D3SA 1RC8A 3HJGA 3S28A 3ULKA 2QL9A 1I2CA 1N7IA 2CJYA 1XK6A 3H2IA 3CKMA 3I6ZA 1TVCA 2CCJA 1P62B 1Q15A 2J9YB 4U6SA 3U40A 1TFRA 4O4LB 1QPBA 4BVFA 4MHTA 1Z16A 1JX6A 2AN3A 3GJ6A 3HR8A 4R1PA 1FSSA 2GF9A 3TECE 1Y6FA 4C0HA 2DR3A 3PNPA 1WUKS 3QX8A 1XVVA 2QSUA 5I9MA 4E5MA 2ATXA 3CVXA 2QTBA 5FTNA 1G59A 4R2HA 1XZMA 3F6EX 2FXIA 4D96A 4AS1A 4B7ZA 1QLJA 1Q95A 4MDEA 3DLAA 2OG2A 3NHRA 4NE7A 5I51A 2GJ4A 4G4SP 3E23A 1P9OA 1VB3A 2CNDA 2E4ZA 4L5CA 3TSWA 3U4DA 1J20A 3DBHA 1QCDA 1PHPA 4L8VA 3C1OA 1CSEE 1O8CA 2WUVA 3CYFA 4FMCF 4A16A 4AN1A 1MLDA 3EISA 3ZXUB 3BMNA 3SX4A 3RHTA 2Y2UA 2RJ3A 2VK1A 3HCEA 2V6FA 3I23A 5L3SB 1L0BA 4MUYA 4PYNA 1EK2A 4A8PA 3ZX5A 1XTRA 2FA9A 1BXRA 2PX5A 3T9AA 3SVZA 2A92A 1KS2A 3SI7A 1MV5A 1T9GS 3PQ5A 3RCBA 3TFOA 2CHEA 1GRVA 2AFHB 3VSCA 2H1WA 1WABA 1WHSA 4FD3A 4I5IA 5F7OA 4FTWA 3OU7A 1ZN2A 1SVNA 2CXPA 2GH1A 2I4LA 2YMPA 1M2OA 3FMVA 4DDVA 2G71A 5D3KA 3GRKA 2IOQA 3BJMA 4L8YA 4QYSA 3IUQA 4RK7A 2ZVJA 2XTZA 4DVJA 3GI1A 3OEED 5KDOA 3UK6A 2WFLA 4IG9A 2J30A 1EX9A 2WFZA 2XHZA 4D25A 4NR0A 5FHRA 1PZGA 2D7JA 2WY2D 3CW2A 3X1JA 3GLRA 3UK0A 4GI2A 1QFJA 1T5BA 5C7IO 3UJ3X 3RFVA 1GSOA 3OIFA 3VSDA 4YP0A 1OWLA 3GCDA 3QYFA 1TRHA 4L2IA 4NYJQ 1GQQA 3V4SA 4AU1A 1TVKB 1CFZA 1YACA 3CLHA 5EINA 3UW1A 5DCWA 5EWJB 4AUKA 4POOA 4RULA 3ETHA 3RH0A 4AN0A 4E2XA 2XNSA 1VSQA 3I0NA 1UOQA 2W8BB 2XE7A 4YMVA 4NBRA 2CHUA 1ZD4A 4RLQA 3MT8A 3ZHYA 4BXOA 5AVQA 2EDCA 4X6XA 1PWYE 2EFJA 1XALA 2X40A 3GFQA 1FDIA 1PS0A 3GNQA 3TLGB 3GGJA 3LYLA 5JNSA 5ICSA 2RD2A 4U5QA 1BOOA 3FCEA 3LDAA 4JP8A 1QRTA 2OKGA 3E7FA 3Q7PA 1O57A 3U49A 4D6XA 3LWBA 5IKPA 4GQIA 1GTRA 4OOFA 2GKSA 2YXPX 3BRWA 4FWBA 4B40A 5DNAA 4HAYA 1EJ2A 4UFOA 3HP1A 1YHYA 4GVPA 2HL6A 3LCCA 4YDHB 1GGJA 3VO1A 2XZLA 3WL8A 1X9IA 3B3QA 1ZMTA 3OX3A 3VPXA 4NV3A 1NWCA 1ADFA 1OTYA 1SCIA 1CUGA 2OBBA 1KGSA 1W46A 2FN3A 1U8FO 2VHZA 4WFIA 4EX6A 1XCGB 4JB3A 2DLCX 2WWIA 2KWIA 4HX2A 2NQTA 1R4ZA 3I2IA 1A71A 3OO1A 3FG9A 3VMMA 4NCXA 1OKKD 1V4NA 2NZJA 4PANA 5FOSA 3RV3A 3LECA 3TLEA 2CE7A 1AKQA 2QZ4A 1DG3A 3DBRA 4I9GA 1E3DA 2JIZD 1VPEA 5JXGA 5JASA 1FPMA 1Z6GA 3IIKA 2ZIEA 3L02A 4MWZA 4ND5A 1NJSA 5B36A 1CDDA 4WACA 1L5HB 4ND2A 4KUEA 1HXHA 3GB9A 4TYNA 3L40A 3GF4A 3QIVA 4QQFA 4HAZA 1BDHA 4M7WA 1I10A 2V5VA 3HQ4O 3S1LA 5JATA 4PO3X 1WB4A 3INNA 3L05A 2GPNA 4X63A 2MTBA 1V8DA 4Q4LA 1P45A 4ZCSA 3D5EA 3UB3A 1QOPB 4MNTA 1Q22A 5I9IA 3B1KA 3ETEA 2YYSA 5EXPA 3WL7A 3D7KA 3KU4A 1ESCA 1V39A 4RGYA 4BFWA 2C5FA 3PGKA 3GEMA 1SBIA 1WSDA 3P4UA 4CXMA 4NYIQ 1NF8A 3CTPA 5A5EA 5LMNB 1XO1A 5FUMA 4A2PA 1MOPA 1D2AA 4I5DA 4RKEA 3DMNA 4JOQA 4FFVA 4GYKA 3U3KA 1M73E 4TMVA 4PXYA 3RVSA 5CLQA 4PFSA 4FR0A 4PF1A 1XFAA 3IJRA 3UMSA 2NPOA 3NAZA 1EXWA 4BQNA 2DUWA 4DCSA 3IAHA 3OP4A 2ADOA 1KARA 2FSFA 2BTOA 3L8MA 2PPLA 2A5YB 4RZXA 4OBBA 4MJLA 2BCJQ 2OCBA 4KC0A 3DFZA 2R6GA 2QEQA 3QTTA 4JT2A 1O0SA 1KS9A 3IMCA 4Z4GA 1UH5A 4I6JA 4XWTA 1ZMOA 1YU9A 2HA4A 1Q11A 5HEKA 4ZKDA 1V8PA 4J1QA 1BHJA 2LBPA 1V25A 5SY4A 3VJMA 5JXWA 1ZU5A 2QPLA 1PIWA 4OJQA 1B1CA 5I45A 2PVCA 5K3OA 2OT3B 2OCKA 5C34B 4RMIA 4QDOA 3TGWA 3OZGA 3DF7A 5COQA 5CG2A 5CT4A 4AK9A 3JR7A 4NU8X 4LWQA 4BQPA 3LKVA 1T3GA 6GPBA 1T9KA 3C6YA 1GTJ1 4PIMA 2OHFA 3N76A 1VOTA 5CTJA 5FBZA 5ALDA 1Y4UA 1OBOA 4DEVA 1OV6A 4ND6A 2YC4C 5K8LA 4YT4A 1OC2A 5KJEA 2X3YA 1SK8A 3COPA 3WYNA 1PG2A 1YMUA 1EFKA 2F9LA 2P0YA 2YR0A 2I6XA 4PBRA 1IBLB 1V7PC 2ZB2A 1LQ2A 4KXVA 3CLUD 3FYSA 5REQA 4D4MA 3U7HB 3AF4A 1ZEJA 1CY8A 2AVDA 2ZSKA 2B21A 3JQAB 3DULA 2J6IA 2P2DA 1EINA 1AXEA 3NONA 4ECAA 1FB5A 3H9JA 3DHYA 2Q8NA 3KLOA 4KL8S 4XWOA 1EFPB 1OFVA 3SEAA 1G8KA 2ZIVB 3ZV4A 3WKEA 4PG8A 4FX2A 5KNCH 1RHKA 4QOJA 3FWYA 3U17A 2E1PA 3K92A 1E3MA 4B3SB 2E4AA 3NHUA 3DDNA 5KYVA 3R74A 1PUJA 4LDRA 1UADA 5K2MA 1YF3A 2GEVA 2ZT8A 4JU9A 3WGLA 2MSCB 5F5XA 2ZOSA 3G2JA 5FUYA 3A0RB 3LH5A 1IN8A 5AHOA 4DCTA 2QSZA 3FX2A 2RAUA 3EXEA 3GFTA 3I5YA 2OG1A 3HXTA 4TQAA 1F7VA 3IR6A 3PJDA 4ISBA 3MCUA 4J0IA 2F9FA 3VZPA 2QX4A 2ATCA 5FUVA 4TTIA 4UOZA 4YRDA 3RC2A 1UBGA 5GPBA 1EB8A 1VB5A 1JAYA 2TSYB 3DFUA 3VM6A 2XB9A 3PR1A 1N3YA 2N42A 4WCDA 5EZYF 4HFJA 5C81A 4AXBA 4P0PB 4HUJA 3B7WA 4H9GA 3ZLUA 2ZTLA 5BSTA 3WTCA 2ZXFA 4FYMA 2BBSA 4PPGA 1KPIA 1K5HA 3ABSB 3SQNA 3ZQKA 3DFFA 1PNRA 3MOIA 1U3DA 2PEYA 3PUZA 5BWOA 3I4LA 1N34B 1R74A 3C97A 2X4LA 4V0LA 2X0EA 3LXMA 3S27A 1ZVJA 5IM5A 3GCZA 3V1LA 5JU6A 4BBAA 3KHKA 4B71A 1FS6A 3I4CA 1XNHA 3FDZA 1WCV1 3I1YA 3O4HA 4M0DA 2OYRA 3WJAA 3KFVA 1SA0B 3M6UA 4RAOA 1TCVA 2JI7A 4JXKA 4QBIA 4QUKA 4UM9B 5KOHB 1QZ3A 2P35A 1Z4QA 5LBUA 1NOJA 2GA9A 2V7PA 3KKLA 4Z3DA 2XEXA 5EIOA 1YASA 4XFJA 1AY0A 1LBQA 3VHXA 4Q21A 2E4VA 1YCFA 3HCRA 2P2SA 4PS1A 5KO2A 1GSIA 2ZRCA 1O6ZA 4DPMA 5KMGA 3NRJA 2JFOA 2VCEA 4EHIA 2I4NA 3KUCA 3R5JA 3ZVNA 5AK0A 5I7AA 4ZXFA 2YVAA 1KJ8A 1Z7BA 3G2QA 3ECAA 3LOPA 4MRVA 2D2FA 2NVWA 2X5OA 5CFNA 2P77A 2X9LA 5IH3A 5JS6A 3LQRA 2HIHA 3QPVA 1GA6A 3GJRA 4XVCA 5LUAA 4UU7A 2QYSA 2XXAB 3O4GA 4PFKA 1PU2A 1SB8A 1UFOA 2I2FA 4G8BA 5IDWA 4HRYA 1F2TA 2WSSD 3CCCA 4OLFA 2ZUUA 3H6HA 3HBJA 2F00A 3MTGA 3QXSA 2JLWA 1HE5A 2Q4TA 1GPJA 4WI1A 1HC7A 1U0RA 3KC2A 5BPFA 3R7AA 1CS0A 3TYXA 5KHLB 1EGHA 3B8HA 2ZANA 1MA3A 1CUWA 3W9BA 1P61B 2H08A 1F1JA 4LX8A 3H1EA 4FKMA 4TRNA 5T8KA 3ZNOA 5CK5A 3KTDA 3T34A 3KJNA 3RGWS 3MB5A 2FG5A 3RAPR 1ECFA 1GRNA 3D1LA 5DTIA 2FQQA 2QUJA 5HCUA 1IQPA 4KE9A 2E5LB 4HN9A 2EFHB 2WTBA 3C8DA 3IO5A 1ZHFA 3N7UA 2QVLA 3BERA 3S7TA 1AQJA 3A4LA 1GGKA 5L7YA 1ZI9A 2RB4A 4KN6A 1P1IA 3ONWA 3AFNA 5G3YA 3PFHA 1F3LA 5ELMA 2HA5A 1VCNA 1JIQA 2B4KA 5BOSA 5FBHA 3K2BA 4OBXA 4W1RA 3IPXA 2G5CA 1TB4A 4XVHA 5A5DA 3LOQA 2GCPA 4Y0NA 5IF3A 5KVSA 2QTHA 5IU6A 4HWKA 5K45A 1J4AA 1LSOA 3WJ2A 4HLDA 3Q3HA 3R9KA 3MTAA 3OOSA 1YAJA 1TMOA 2SHKA 1WTCA 2DECA 3U31A 3JAWA 1F7UA 2J3QA 2QP4A 2QN3A 3CH5A 5EYPB 2LVBA 1SOWA 2B8NA 2ZJ8A 3ZNPA 4CMHA 5JSQA 5IWAB 2ETXA 3CRVA 4BS9A 1QF7A 3OLXA 1MJFA 1XL1A 4Q7QA 4YP9A 1JV2B 1MJGA 3OMWA 3DKPA 1QP0A 3T7KA 1QVVA 1H69A 3X3HA 5ALZA 1PUIA 4X92A 4WJLA 3TBHA 1G3UA 3N1UA 1HLGA 2ZYSA 3R3ZA 3KB8A 2CXUA 3EHDA 1WZ2A 2MIIA 2G80A 3EARA 3PGXA 2Q4OA 3QPWA 4N1AA 3AERA 1PP4A 4KX3A 4M86A 1UJCA 2QL5A 1C7EA 3FOWA 2B7CA 3DMTC 3L7LA 1DTWB 4L16A 3H8JA 2X9QA 1N8NA 2PMCA 3OM1A 2PGOA 5JAPA 2JZOA 4PPQA 5LOVB 1EP9A 3FUWA 2CCKA 4XLZA 4P31A 4CBVA 3T5TA 2ONCA 3QI7A 2PKRA 3GLHB 1R50A 2ZJOA 3VR1A 2A94A 3ZZUA 1PZXA 4Q4AB 4JLOA 2AFHA 4U7JA 4ZRMA 2IGBA 4N6OA 4D43A 1OFHA 1UDWA 4P3PA 5DTRA 1WL8A 2WF7A 3GR6A 4Z0NA 3RC7A 4C0BA 2AX4A 5ARDA 4FKBA 4GUDA 5FV7A 2FUKA 2VJPA 3JVDA 1RYFA 2OVBA 4ZOEA 1NVAA 5J2TA 1XRLA 3LUAA 3OFNA 3ORHA 4MWGA 3KKKA 3DAYA 1ESMA 2HF7A 3TNLA 1QG6A 4J4TA 3V6MA 1DCKA 1V8BA 3PXDA 2OV6A 3QMVA 3TLAA 3EXIA 4DSTA 4MUIA 4LV6A 4N39A 1ZIDA 5C9ZA 1IUKA 3DBHB 4WOKA 1UZAA 4XWGA 4YRNA 5HA5A 2UKDA 3M3DA 3IV7A 4MTLA 3VKVA 1Y8AA 5B1YA 5K0EA 1SC9A 3DL2A 1Q21A 4NBUA 4F9FA 4YLYA 2J5RA 4OJMX 1Q7GA 2PTHA 2G1AA 3GPDG 3ILVA 1E9BA 2NV2B 5TQJA 4EM6A 2K4MA 2OCXA 3PU6A 3AJAA 3WDMA 3A58B 2GJ8A 3F6SA 1DMRA 4M83A 3NDPA 1O58A 1K8ZB 1PRYA 2WKRA 4LRUA 4HSEA 3TQCA 3ZZNA 1ZD5A 3GX1A 1XZJA 4P7JA 3RT9A 1ZGZA 4GP6A 4YMWA 1EWRA 1NBWB 2IC5A 4WY5A 1T10A 4EQZA 1VRCA 4UC0A 3FW1A 4KPUA 1ONOA 1ULAA 2QT0A 4NE2A 2OV2A 1XZDA 5GONF 2QP3A 1UJNA 4NAVA 5L3QB 2WD7A 3QM1A 4YBZA 4W4TA 1JHRA 3W5AA 1JDSA 1GA4A 3IVGA 4JHXA 2ZKIA 1MEEA 1BCRA 2QRUA 3TB6A 4JUDX 2IEDA 2JHCA 4NZOA 1C9MA 1U80A 2CCGA 4B7UA 1IDN1 5HJEA 1HKHA 2NU7A 5L7WA 2ZQYA 3U09A 3OI7A 3VX4A 2CXTA 4ESEA 2GN1A 1BS1A 1U31A 3MSXA 4JYPA 5IBCA 3VU3A 1QCCA 1EFLA 4C5BA 4D5GA 2DB3A 3JALB 1VJGA 2BGKA 2ZULA 5TMBA 1PT8A 1Z5GA 2EFGA 2P67A 2WIJA 4R8SA 3JD4A 2BFAA 1N92A 3OD5A 4EHKA 3CH7A 4A6DA 1DARA 3ZWWA 2Z09A 1BAPA 1M54A 1NYRA 2OXEA 4R1OA 3OEEA 3TOVA 3PVSA 4TM7A 1L5NA 3VC7A 4H3VA 3UHPA 5JVDF 1AN9A 3DEZA 4IOMA 3BGDA 1I3CA 4N0DA 3KZOA 4QNNA 2P3OA 2X1MA 1ICIA 5CAEA 3LC2O 3LQYA 4S0XA 4GLLA 5CT8A 3R8CA 5AUPB 3QNUA 4NBWA 4CYMA 1CB7A 1OLSB 2Q3EA 1A50B 5A9SB 1AE1A 2BSXA 5F4ZA 4W5RA 3EBLA 1U1CA 4MWSA 1NPYA 1MX5A 2HF2A 4Q1FA 5ED4A 3QY0A 1X8JA 1E2FA 4C7BA 1UMCB 4HNRA 5KTOA 3TR0A 1MFZA 3ETCA 3QKRB 3QMMA 1ZIYA 3LYUA 3IP5A 2CDRA 4LKOA 4ASUA 3WBJA 4KQMA 3DE2X 1V7QA 4MUXA 3BCHA 5IAAA 3ANMA 2M6LA 3OZXA 1KJQA 1SULA 1WEKA 4KNYA 4DEXA 4ZK2A 1SD1A 3IKVA 3FPJA 5E1OA 2JGRA 4FDMA 2AR7A 5E2AA 1VJ1A 2ZRFA 1ETUA 3P0IA 3WZ2A 3S8YA 4P54A 3T9CA 4E11A 5A3QA 2W43A 2O7QA 4ZI7A 3RUIA 3MTBA 3C7TA 1U8YA 5SZHB 3SHTA 4H7KA 1IZ9A 1DAHA 1VBNA 3EPRA 2X41A 3GN1A 3O1HB 4J76A 4MLDA 3MCVA 2LZ0A 3HYLA 4AJIA 1NDHA 3P97A 3LCVB 4TSFA 3ZHUA 5HP4A 2GJSA 3W7AA 5KNDA 3NI2A 3C74A 3I58A 3WBKA 2F3TA 1J0CA 4ZV4A 2ZT7A 4ENQA 2C96A 3CUUA 1KFJB 2XNDA 3FRJA 1UZMA 2X5KO 4I1VA 3TL2A 3LQ2A 3S2EA 4TLBA 3ZYCA 4R6WA 3U62A 3HLTA 1TUEA 1MENA 2CFCA 1AQNA 3FJ1A 3LLMA 1U7PA 4DLVA 3UATA 2WAYA 2VPXA 4QT0A 1GGHA 1ZGBA 4YRZA 1U63A 1HDGO 3MMSA 4FBLA 1GZUA 4WN9A 2DPYA 2FXVA 3RS9A 1FDRA 2GBGA 4ZVUA 2CEKA 2VVTA 2IHZA 5L4NA 1RHMA 4LNAA 3KR9A 1VL2A 1A5ZA 3UAWA 2UUBB 4G36A 1QAOA 4F3RA 5CA0F 2QTLA 3WK6A 1G3RA 2V0NA 3EDMA 1UJ6A 4I55A 2QD1A 3HA3A 4YQEA 1ZK2A 4PHTA 1K4YA 1NXVA 2Q4BA 5CAEB 3S44A 2QAGB 5E7IA 1HTTA 2H9AA 4OQPA 5HQJA 3ORQA 5K05A 5BR8B 2Q1XA 5EJ6A 5F1OA 2QTCA 2WHQA 1CUHA 1G2QA 5TQ2A 2JDID 3E27A 1K7CA 4ABYA 3SZUA 5ALQA 5F78A 1UT8A 2WMOB 3L8DA 4KV7A 4M99A 4C7OB 1BXGB 4ZK6A 2JLSA 3QXHA 1NUTA 3E9EA 1SU4A 5ALYA 5CLJA 2B30A 1UC9A 4Z4CA 5FOQA 2XAAA 1ENOA 1YZKA 1RXCA 3O3CA 3T3MB 1MNQA 4AN4A 2ZI7A 4MK4A 5I7VA 4PCUA 2BFFB 1IXKA 4BRWA 1WXXA 4QJ4A 4UUMA 3VPDA 1QQTA 1RAIA 3DBLA 1QKJA 3SQDA 3LDUA 3M2PA 1WF3A 1XDSA 1J2EA 4M0EA 4R05A 2FI1A 2YJZA 5DISB 3NS7A 1GZ5A 3AHJA 3OO0A 4M1YA 4QUIA 2WWRA 1VRWA 1NNUA 2C84A 3RLFA 4A5OA 4RTSA 3W78A 2PSFA 4JWTA 1CULC 2CV0A 1VLJA 4TUYF 4YRAA 1TCUA 3CT6A 4LYDA 2BKUA 5CTAA 2H63A 5JDIA 3DL0A 4ZCMA 4REQB 3CONA 3UT5B 2ZJ4A 1BEZA 4AMZA 2FMTA 1OF1A 1VE5A 3KX2A 3NASA 5J2TF 2MYUA 3CE6A 4K9RA 3GV0A 4NDZA 2IHJA 4KLRA 1ADJA 2OAP1 1KY4A 5AKEA 4QO8A 1FNCA 4IIEA 6AT1A 1II8B 3H04A 1OC4A 4MPRA 4TWRA 2VH2A 1O9BA 2L18A 4M49A 2IBMA 5JE8A 1SVOA 2Q28A 3AP1A 4RACA 1FFXB 4I1UA 1SEVA 4ND8B 3E5HA 3T15A 1A9RA 3LTEA 1T5DX 2JFPA 2ZRDA 5HIJA 4R71A 4ZVLA 5FX2A 3DAOA 1NOIA 2PGJA 4AZ3A 4BTLA 5JXJA 1OOEA 1YXMA 2P11A 4I3GA 2PGIA 3FDIA 4O4IA 1KMHB 1Y3AA 4HY3A 1T0UA 1J8QA 5CURA 1SCUB 4YAIA 3V1KA 2WG1A 2C2WA 4W1SA 3FGOA 4HWOA 1Z0FA 3ZHRA 3M6XA 1HT0A 3U44B 3NDJA 1JIXA 2PT9A 3EC2A 3OJLA 3FRHA 5D1HA 2BYTA 3FMFA 4G2TA 3OHSX 1R8XA 3SIRA 5AVJA 2OCLA 2ANBA 1NWHA 1VGVA 3LVBA 2WSBA 1TUBA 5IEJA 5J63A 5J3JA 3VC1A 3F73A 3RU9A 1PTJA 2QZJA 2WR8A 3VR4H 4DR7B 4LNHA 5K0GA 2V54A 2CSXA 4G5XA 4X8LA 3U9LA 5LQRA 2GD2A 3IAS1 4O2BA 3ZI4A 2BEUB 3HU3A 1GZ7A 1J6UA 2G08A 1YBFA 4ZC1A 2ZJ0A 4FYKA 2ZZMA 4DG5A 4Z8YA 1W5TA 2WTNA 5B7NA 4DNQA 1A9ZA 4HB0A 1E9DA 1I6LA 2WIGA 3V5NA 4EI8A 5D87A 5A3JA 2OR3A 2WJYA 2EGUA 4CQMA 1B41A 3TTUA 2ZYHA 2O5CA 1XGKA 1BDIA 2PJRA 2X7XA 2R11A 5GY7A 3UAZA 2CLKB 4JN6B 4I08A 1VYUA 3GJ4A 1AUVA 3S5JA 2VATA 4MUHA 3QXCA 2Z2IA 2NSHA 3KOUA 2H8KA 4J07A 3KKZA 5AHXA 2X2OA 4F91B 2ALJA 1NUSA 3WGZA 3H9BA 1SM4A 1Q3HA 5D6NA 1Q74A 3MWEB 5F23A 2PZEA 4BKUA 3N59A 5E4TA 4B7CA 2AJDA 1M6YA 4GNRA 4D3DA 2DKNA 4M0KA 3LD9A 1A7KA 3B7PA 3LQKA 4J6FA 1X1TA 4DR2B 2DG2A 4BRUA 4E1VA 2YASA 5KHAA 2OD7A 3OA2A 2KBFA 1FYFA 4K6OA 2XE6A 1YMQA 5I8ZA 2BGNA 2XWJI 4Q3BA 5BT9A 3TNDA 2C4MA 2NV6A 2B8EA 4O4JF 1JP7A 1UPAA 3PDCA 2YWJA 3K0KA 1ORWA 1C7FA 2WD7B 4JSYA 4X6YA 1CQWA 4FUTA 1GG8A 1SIUA 2P6NA 3HDJA 1AKYA 1YOVA 2X1LA 3I64A 2B4TO 3R6WA 2I6UA 2QV7A 2YV2A 1K6IA 4DC0A 4RVUA 4XH9B 4ND1A 1GAWA 4WCVA 4KVFA 4AZSA 4I50A 1QHIA 4RS3A 3LZ6A 1CQZA 1T9DA 1G2IA 4NXNB 3HVJA 4DJFC 1EEXB 1QAQA 4FT4A 1RMYA 1U9ZA 3DUFA 3SMVA 3N8NA 4D4IA 5GMOA 2NTJA 4CUKA 4HT3B 2O2JA 4UAGA 1X7XB 3K16A 3SFVA 1XTPA 1F14A 2F62A 3TK1A 1GITA 3TDKA 1TW3A 2H65A 2HU2A 4Q4CA 2G40A 5AHWA 1H4SA 3EH2A 3O73A 1IMJA 2GO1A 4K9SA 2CGEA 5HCNA 1ZD8A 2AG5A 2AXQA 3GLKA 2NUAA 4RV4A 5AW5A 4R8LA 5COAA 3DWFA 4EOGA 4ESHA 1HFKA 4S05A 1CRPA 3RVKA 5KCZA 1GU1A 4B44A 2AR0A 3A9VA 5JAQA 1DRJA 3LT4A 2QQ5A 1PFUA 3JWPA 4L4YA 3N2GA 4NCAA 4I1SA 3WNDA 1OIWA 2WHPB 2VP6A 4RENA 2RBGA 3JQPA 5IUNC 3ZBTA 2NVUB 4HNVA 4M1SA 2GSDA 4P4GA 3H1TA 1H1DA 3SBOA 3H9UA 3OT1A 1DB3A 4O2LA 3SYNA 4C1BA 4UE2A 4INAA 2O8FB 3VHXB 5EVJA 4PTYA 2ZS8A 5JZVA 1F3OA 2CXHA 4HOYA 3JQQA 4H18A 1YE5A 3ECSA 4YJ2F 3S2UA 3I6MA 1PD0A 2BFDA 4P4LA 4EB0A 3ES9A 3SJBA 1KKUA 4I36A 1RQ2A 3V4LA 5IASA 4D3XA 3A1VA 3PRKE 3QEBZ 2PUTA 4LGYA 4CM4A 3QWFA 1L9XA 5DYNA 1HYEA 5B53A 5ADHA 1N6OA 1ZWLA 2YIDA 2JD1A 3JQFA 4D9NA 5HKBA 4OQQA 1DBIA 3QLEA 3OTGA 2VL7A 2FPIB 4OX9B 1GRRA 4HNQA 2FEMA 5AJWA 2R8YA 2WM8A 2BGMA 3KO8A 4EWLA 3OAAA 1XCLA 1NTOA 4OQEA 1V5WA 3ZCXA 5LP6A 3WJ1A 1EK5A 4F0JA 1ZUD1 3LWZA 4BHTA 1HG0A 3W6PA 1ZM9A 5TGTA 1SVIA 2C2GA 1QE0A 3MWDB 2H1LA 1SBZA 1ZI6A 1G0NA 4IMRA 3VPBA 4YEDA 4MMXB 4B6QA 3GARA 1JHPA 3C16C 4OV6B 5IJ0B 1I1NA 4AIIA 1QP4A 1DBVO 4HJRA 1O4VA 2BFEA 1Z25A 1YQDA 3WMGA 3RVDA 2D1YA 2R60A 2AKEA 4OQMA 3QVGB 4B7AA 4ZDWA 4MQ5A 4FDAA 4XGNA 5CVJA 3TUIC 1SXQA 2HR1A 5KKNB 4D9BA 2IXBA 3DJYA 5LWHA 3BFXA 3EGDB 4E6PA 2Z2KA 4O4LF 3UY4A 5JCXA 2QPAA 1GZ4A 4AG5A 3MJSA 5DK4A 3KYBA 1G4AE 1YL7A 1JZQA 3KOOA 4CUJA 2PRJA 2J41A 1O89A 4QM6A 1U0NA 4NBTA 2CD9A 5K3FB 4Z54A 1H23A 3S68A 2RDMA 4NARA 3BB3A 4UNIA 1E2NA 3DV9A 4C0JA 1C7IA 1ZGAA 2IYNA 4J1SA 4KEAA 2B1GA 1J33A 1WV1A 2CLLB 2C3OA 3GEIA 4KXNA 2HCFA 4A6PA 3LPCA 1CB0A 1W85A 5CLHA 3D4IA 1GTMA 2FQWA 4PNHA 1VCIA 1FSZA 1XCBA 2EJBA 4I8XA 4ROTA 4XKJA 2QX8A 5GJBA 4TQ9A 3P1JA 2NUPA 2XCRB 3CRNA 2A5GA 4JL6A 4UDYX 3K05A 3K9CA 3O7WA 2D8MA 2ZIUB 3PC4A 5DB4A 3I8SA 4KPYA 3NHJA 2YHUA 2A0UA 3QV1A 2G1PA 3ZY5A 4EFKA 4D8XA 4H60A 4P4UA 4CLRB 5BWCA 3L3BA 5LYJB 1N6PA 3H4TA 4QQKA 5MFPA 4F9TA 5DW3A 2ZI5A 3FPGA 5I4KA 2J9GA 3RFUA 1JAHA 4P22A 3UOGA 4XZ3A 1WHTB 5B7PA 4JLVA 1MC1A 4Z51A 3NNNA 1J06A 1GAEO 1DOAA 2XOEA 3FOAA 1DEKA 2QM0A 4BNVA 1X92A 1QX4A 5IJAA 1EPUA 1IULA 3KWLA 3NHLA 5DLEA 3ZU2A 1XEXB 2EJWA 4R7GA 3W2TA 3BJEA 1XAJA 3MMPA 3VU9B 1ZR2A 2WG2A 5CT9A 1V0JA 2PD4A 5C8DA 1ZW1A 1MGOA 4OEHA 3DUWA 1A4UA 2CUNA 4UAVA 2EEPA 1FA9A 2DHEA 1BDMA 1RW4A 1M2JA 3DD1A 4O08A 1TQ6A 3NHMA 4KYVA 1EIZA 4B0OA 3CO0S 1N5KA 3O6VA 1XRSB 3CLVA 4MZDA 1Z6YA 4QYTA 2BMJA