4GOLD

Crystal structure of e. coli dna adenine methyltransferase in complex with methylated aza-sam
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
268
structure length
243
Chain Sequence
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDASVVYCDPPYAPLNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVDELLALYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Selective N-6 adenine methyltransferase Inhibition by Transition State Mimic
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords DNA adenine methylase
total genus 83
structure length 243
sequence length 268
chains with identical sequence E, F
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4golD02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4golD01
1INLA 3DH0A 1ZGJA 3FTDA 4HRAA 2K4MA 4BP1A 2ZIEA 5GINE 3I58A 5EEHA 4M7RA 3KPVA 4EK9A 1B42A 2P41A 4O29A 3LKZA 4AZTA 2PVCA 1M6YA 1VPTA 1VLMA 1JSXA 1ORHA 3T7TA 4F84A 4E2YA 5CM2Z 1QAOA 3UJDA 3UJAA 5E1OA 4DCGA 2PX4A 4GOLD 4HTFB 5E9QA 3PLAE 4LWPA 5F2KA 1QAQA 2PT9A 3OZTA 2OZVA 3FUUA 3GDHA 3MGGA 4KVZA 2JHCA 3MCTA 2C7RA 4RTNA 1FP2A 2BR4A 2GA9A 2P3OA 2ONZA 3EEYA 5DTMA 2NXJA 2G71A 3ELYA 3HVKA 4GEKA 4AX8A 1JSZA 3KKZA 1XDUA 4CKBA 4IV0A 5EHGA 3C0KA 3P9IA 1UIRA 3B3FA 3NTVA 3PS9A 4C04A 2PV0A 3VSEA 5GM1A 3HVJA 2EX4A 2ZSUA 1RI3A 3GRRA 1NV9A 1JQDA 3S68A 5FULA 2Y1WA 5DM0A 4CTJA 3KPUA 1NW3A 3OU7A 4ER7A 2Z6UA 5E9WA 3OFKA 3EMDA 5DM4A 3GNLA 3DUWA 2O06A 3QV2A 4R8RA 5T6BA 3SVZA 3X0DA 2IBSA 2Z6AA 4OBWA 4QQKA 4OQDA 1WXWA 4MTLA 2PJDA 3EVZA 5DXJA 3FUVA 4EQZA 1YUBA 2Y1XA 2PXXA 1EG2A 3JWGA 1NW8A 4GQBA 4P58A 4PYQA 4RWZA 1YFJA 3HA3A 3LCVB 5DPMA 3KQOA 4MHTA 2YXEA 2ZWAA 1G38A 5CUQA 3EVGA 2PSSA 4RTLA 2O0LA 4OA8A 1L3IA 3MQ2A 1BOOA 4GC5A 1JG2A 1X1CA 1KYWA 3IV6A 3O4FA 4K6MA 1ORIA 3GWZA 5DT2A 3KR2A 2E5WA 5FHQA 4QVGA 3LDFA 4FT2A 5KQRA 4R6WA 4RTQA 3FTFA 1NW5A 2ZLBA 5C0OE 2P1DA 3OFJA 3AWIA 1KPHA 3RODA 4YUYA 5IKMA 3DXYA 3KQVA 2AZTA 2OB1A 4GOMD 4X1OA 5E8JA 5K0CA 2AVNA 5CVEA 2GB4A 1Q0SA 1D2CA 4C05A 3SXJA 4E33A 4GC9A 2GS9A 4R6XA 2EG5A 1L1EA 3FUXA 3CGGA 3E8SA 3I9FA 1VBFA 1X19A 2BH2A 2NP7A 2EJUA 1SUSA 2PX2A 5EMMA 2IIPA 2ZBRA 3R0QA 5EZQA 3TPZA 4DCMA 1DCTA 5GWXA 1NT2A 2ZIGA 1R8XA 3ORHA 3P2KA 1EQAA 2JH9A 3KPJA 3T0IA 3GJYA 3IEIA 1JG1A 3KR1A 4X60A 5EEGA 4FZVA 2GH1A 4YMHA 3KQPA 2VDVE 2ZFUA 3EPPA 3IYLW 5F2NA 5GP1A 1M0EA 3PVCA 4QVKA 3PB3A 2PX5A 3G88A 3EGIA 1RI4A 2N47A 4RTOA 5LQAA 2ZVJA 3LX6A 3ME5A 4KDRA 4AZWA 3EVFA 1ZHFA 3G5LA 1XCJA 4EKGA 3P2EA 4DM3A 2AOUA 2FYTA 2F8LA 3H2BA 4UOEA 5K0EA 5KS2A 3MAGA 3PFGA 4YV1A 4EKIA 5CVVA 3KR9A 2BR5A 2EFJA 3GRZA 5EPEA 4C03A 2C7QA 1EJ0A 3CBGA 3LBYA 5DLYA 5E8RA 2XYVA 1X1DA 3I5UA 3SX0A 3DP7A 4U7PB 4X63A 2UYHA 2P3QA 3ELUA 3LCCA 3U81A 1SQFA 2PLWA 4HC4A 1O54A 3LECA 4PWYA 4ER3A 5JR3A 3FUTA 1BKYA 4YMGA 3BWCA 3V8VA 3OU2A 1G60A 1G55A 2AOTA 4G56A 2QM3A 4HG2A 3R24A 4CTKA 4OX9Y 1BC5A 1SKMA 4PINA 4YV2A 3M33A 5GM2A 2EJTA 3WSTA 1SQGA 2VDWA 3FTCA 1AQJA 3TLJA 5LQRA 4ZTBA 4KIFA 1KXZA 2V7EA 2O57A 2HNKA 2XYRA 4R05A 4PCLA 5CVUA 2DPMA 5LR6A 3THSA 5E1DA 1JTEA 3PTAA 5K05A 4C08A 4M37A 5K0NA 4BP3A 5FTWA 3LGAA 3P2IA 5EMKA 5EGSA 5U4XA 3M6WA 2AN4A 3JWIA 3BUSA 3HVIA 3G5TA 3DMGA 3UA3A 4GF5A 3LPMA 3G8BA 3P8ZA 2AVDA 4RVDA 7MHTA 1WXXA 3OZRA 2UZ4A 3TOSA 4KRGA 3LDGA 5DTQA 3KU1A 4WXHA 3UZUA 2IDJA 4CXMA 4IKPA 4BLUA 3KQSA 1P1CA 4Y30A 2I7CA 3PX2A 1AF7A 2YUIA 1KP9A 2OBFA 1I9GA 2FK7A 2PXAA 2YQZA 5HIMA 1TPYA 4KDCA 4Y2HA 5C1IA 2AOXA 1YB2A 3CJRA 4RVFA 1NKVA 2BR3A 2IH5A 2ZW9A 4CKCA 1KHHA 3KQWA 4V0QA 2FPOA 2UYCA 2IGTA 1ZG3A 2ZTHA 2ESRA 5B1SA 1F38A 5CVJA 3G2MA 1NBHA 4LWOA 5CCBA 2AOUB 2ONYA 3OZSA 3M6UA 3P9KA 2V74B 1X1BA 3VYWA 5HILA 2OO3A 4POOA 2YXDA 3EMBA 5BW5A 5GIOE 3LCUA 4ATNA 3DR5A 2CKDA 3RIEA 2GPYA 5ICCA 3DOUA 2CL5A 2NXNA 4QTTB 1JTFA 3BWYA 3CC8A 3B3GA 3B7PA 3I53A 4PCAA 2PGXA 1VL5A 3ELDA 3GO4A 3MTEA 1QZZA 1L3BA 3OPNA 3UWPA 2JH8A 1R00A 3I64A 4FT4A 4PYJA 4L7VA 2H00A 3HCFA 3TFWA 3UJBA 3OE5A 3CCFA 1VIDA 3KHKA 3NW9A 1DL5A 1WY7A 3R9XB 5DX0A 4ER0A 2OKCA 4OQEA 3M6VA 1JG3A 2AOWA 2P3LA 3KQQA 2NXCA 3GRYA 1FBNA 4HGZA 2I6GA 4M36A 4PONA 3B5IA 3LL7A 3BXOA 2QRVB 5EZSA 5EMLA 3GRVA 3PFHA 3CJQA 3HCDA 2VP3A 3HP7A 4YUVA 4PIMA 2B9EA 1JQ3A 2GLUA 2B25A 3BKXA 5ICFA 2R6ZA 3EVBA 2OB2A 5LQUA 3EVEA 2BM8A 3AY0A 3UFBA 5KVAA 1X1AA 3A7EA 4DF3A 3MHTA 1XJ5A 3UJ8A 5EMJA 2P7HA 4CWAA 2C7PA 3SR4A 4A6EA 4GBED 4YUXA 1M6EX 2B78A 3KQYA 2GAFA 3BKWA 3REOA 4MQ4A 2XBMA 3G8AA 3FPHA 3UJCA 1D2HA 4HH4A 1NW7A 1QANA 3SSNA 3VC1A 2HR1A 5DSTA 1RJEA 4RVHA 3CJTA 8MHTA 2G72A 2WK1A 1P91A 2HWKA 4AZVA 2ERCA 1YFLA 1TW3A 3E7PA 3EGEA 4GOND 5E2AA 5FWAA 2YVLA 3C3YA 4WVLA 3KQTA 3TM4A 3UA4A 3F4KA 3R6TA 4B17A 3AXTA 5EOVA 5BP7A 4XUDA 2VDUE 3T7SA 3A7DA 1NE2A 4PYLA 5P8WA 5CIYA 3UBTA 2IH4A 1JG4A 3K0BA 4OBXA 1FP1D 3HCCA 5DSXA 2PWPA 2H11A 3LBFA 3TR6A 5K0FA 5CD1A 3BGVA 5K01A 3EEOA 5KYGA 3GIWA 1R74A 3SMQA 3T7RA 1T43A 3EVAA 2KW5A 3OU6A 2ZZMA 3FUWA 3JWJA 4H0NA 4RTKA 1R6AA 4MWZA 4F86A 2JJQA 1RI2A 3NVKI 3ER9A 1WZNA 4HTFA 2BZGA 1FJXA 2I9KA 1VE3A 2BM9A 2QY6A 1O9GA 1SUIA 2ZZKA 3JWHA 4QPPA 4PYMA 4E32A 4QQNA 3SSOA 3NWBA 1KIAA 1YZHA 3PX3A 1JQEA 4P7FA 5E9JA 1NV8A 4DMGA 5K0JA 5M5BA 3G89A 3QOXA 2PXCA 3P71T 5H02A 1XDZA 2NNWB 3IHTA 4YUZA 2B2CA 4MIKA 3MB5A 3LDUA 5HIKA 2FK8A 5GIPE 5K03A 5D1NA 1I1NA 2C7OA 1TW2A 1YZ3A 3HCAA 5C9ZA 5FA8A 2IFTA 1P1BA 4RV9A 3SSMA 3BT7A 2I62A 3P97A 1F3LA 1KR5A 3DXXA 1N7JA 1G6Q1 4HGYA 4XUEA 3HA7A 4AUKA 2ORED 4RSRA 4PGGA 4Z2YA 2CWWA 1RJGA 4KIGA 4EMSA 1L3CA 4XUCA 4PYOA 5LSAA 5DWQA 4M38A 2XYQA 4E70A 5DRYA 3Q87B 1D2GA 1PJZA 3FYDA 3Q7EA 4EVIA 1XXLA 4ISCA 2NYUA 3EVCA 4GOOD 3E05A 4PYIA 3G7UA 1WS6A 2CMHA 4F85A 2P8JA 5E1BA 5FADA 1ZQ9A 3BWMA 4PNEA 4P7JA 4E2ZA 1HNNA 2VZ9A 4AZSA 3BZBA 5EIFA 3G2QA 1MHTA 1V39A 3DTNA 4BY9E 2PBFA 3FPFA 2OYRA 2JHAA 1SG9A 3DMHA 1R8YA 5HFJA 2O07A 1UFKA 2ZULA 3OCJA 5MHTA 3NMUF 4RTMA 4BLVA 4PYKA 3KPWA 1XDSA 1AQIA 1BHJA 3GGDA 3THRA 4X61A 3M4XA 2AR0A 1IM8A 4C06A 4E30A 5HIJA 5FHRA 1RI5A 4FP9A 3FZGA 3LKDA 3O31A 4IV8A 2NXEA 3FPEA 4YV0A 3MTIA 5JUWA 2FCAA 3EVDA 4NECA 5HEKA 1XTPA 2HV9A 2FHPA 5LQCA 2G1PA 1G8SA 3HNRA 2IBTA 3FTEA 4ER6A 3P9CA 3MCZA 3C6MA 1AV6A 3SM3A 4QTUB 3HTXA 4QPNA 2WA2A 5D1HA 1EJ6A 3K6RA 3EGVA 5EKXA 2JHPA 5K09A 5EKUA 1YF3A 1EIZA 5EG5A 4GUAA 4HSGA 1G8AA 2AN5A 1VQ1A 4LECA 1FPQA 3L8DA 5FQOA 2G8NA 3V97A 2H1RA 2UYQA 1MJFA 2JG3A 5G02A 5E2BA 3UJ7A 4FSDA 1QAMA 4QDJA 1IY9A 5CCXA 2ZWVA 3HVHA 5FUBA 1KPGA 4FR0A 5EC8A 4DKJA 2ZZNA 3B3JA 3HCEA 4RTRA 1XCLA 2ZBPA 1XVAA 3MERA 2B3TA 2VS1A 3B89A 2IDKA 4PYNA 5CVDA 4FGZA 3HCBA 4IWNA 2AOTB 4RYLA 3DXZA 1RJDA 4DQ0A 5K0GA 3FYCA 3TKYA 2AS0A 2PT6A 4P7GA 5DRTA 3LSTA 1U2ZA 3NDJA 5EVJA 3C3PA 4ER5A 2YXLA 3A26A 5DM2A 4E2XA 5FQNA 3O7WA 2PY6A 4X41A 3DMFA 3RW9A 2A14A 3A27A 3VC2A 3ID6C 1H1DA 3A25A 3HEMA 4OA5A 5T64A 2ZCJA 1L9KA 1ZKDA 3M70A 1N2XA 3TMAA 2ZIFA 4KWCA 2ADMA 5HZMA 1VP9A 3D2LA 1N7IA 2PKWA 3NJRA 4R8SA 4YUWA 3LHDA 4E31A 5ICGA 4KW7A 3KR0A 4XCXA 3ER8A 2XVMA 3GU3A 3ELWA 3E23A 2NP6A 2YR0A 4U7TB 1R18A 2P35A 4QDKA 1Z3CA 2PX8A 3TRKA 3G2PA 2OXTA 3FRHA 2IP2A 2OY0A 9MHTA 4RTJA 5DX8A 3CVOA 1KYZA 4BLWA 4A6DA 1Y8CA 1ZGAA 2ZBQA 2IH2A 2LD4A 3HA5A 5F2OA 3KPYA 5K0BA 3FPJA 4DA4A 1UWVA 10MHA 3GXOA 3M6XA 1SVUA 2IPXA 3AJDA 3ANXA 3TKAA 3FPGA 1I4WA 5EHIA 4CKEA 5KQSA 3GRUA 3GCZA 5K8VA 4JXJA 5DTRA 2AOVA 4FSXA 2YX1A 3TQSA 1VP3A 3C6KA 5DM1A 4C07A 3G2OA 4LG1A 2FRXA 2XVAA 3HM2A 2QYOA 5DX1A 3DLCA 5GOZA 4DZRA 3PT9A 1DUSA 3NVMB 4RVGA 3R3HA 3OE4A 3P9NA 2P40A 5LQNA 2AN3A 1P39A 3NDIA 3UJ6A 5LQJA 5HIIA 2QE6A 1O9HA 2HTEA 2OPBA 5FCDA 2CMGA 2YTZA 4V0RA 5DXAA 1KPIA 3NWEA 5ERGB 3FRIA 3UJ9A 4PIPA 5FWDA 3SGLA 1PRYA 2DULA 5BW4A 3ERCA 2G70A 3CKKA 5FA5A 2HMYB 2Q41A 5K0LA 1JR4A 5EIWA 4RTSA 1OR8A 3AXSA 4FS8A 5E1MA 2PWYA 5T67A 5ICEA 1QYRA 4P7KA 2O05A 4E2WA 4RTPA 3BGIA 2R3SA 2WA1A 1RJFA 4PGHA 2UYOA 5LQKA 3DLIA 3A4TA 1IXKA 5IH3A 3DULA 5HOQA 1EAMA 1WG8A 1NW6A 3BGDA 3KQMA 1HMYA 1NBIA 5EQJB 5BXYA 2P7IA 2QRVA 4C4AA 1RI1A 3TM5A 4RX1A 2Z6QA 3QOWA 1Q0TA 3BWBA
chains in the Genus database with same CATH superfamily
1INLA 1ZGJA 2IDMA 2K4MA 3I6QA 1MB4A 1EFPA 1G8MA 3UMMA 4OMFG 2HH9A 3WQRA 2W8BB 3LKZA 1TB4A 2G9ZA 2GD1O 3PI6A 2XB4A 4K86A 5EIHA 5AXCA 4ZAWA 2DT5A 1E6MA 1Y8QA 3HJUA 3HBMA 4ND5A 2R00A 1DPGA 4BB0A 1SEVA 1ZVKA 1QAQA 2Y2VA 4IO1A 4HPXB 3BD9A 3MGGA 4QAQA 2C7RA 1ZOPA 3R7DA 4QJBA 3KXKA 3SZGA 2GN8A 2YS7A 1ZD5A 1N1GA 3D0OA 3PD1A 1JYSA 4QBIA 1YS7A 3KHUA 2EGUA 1MJGA 1Q0UA 1GKIA 1ZITA 3TO5A 4YY3B 2JK0A 3NBXX 5J59A 1Q92A 1NV9A 2ZREA 3UUGA 3PFWO 4KACA 3ESXA 1IG0A 1ZY2A 5A04A 4CM9A 2B7CA 2VHUA 4G01B 4LMPA 2O06A 4FW9A 4EQ6A 3NTRA 4J6EA 3VJRA 3T41A 1K8QA 3OZIA 1IULA 1CDEA 4GYKA 2ZYIA 3L6RA 1XQYA 3H5OA 1GQSA 1EG2A 2O4CA 4JDPA 3A6JA 4R01A 5DPMA 3T61A 3KQOA 3GGOA 3NM6B 4UCXA 3WHKA 2ZWAA 5IS2A 1FRQA 3CH4B 1MO4A 3GLKA 4WNCA 2O0LA 4G8JA 3WNZA 5LP6B 2HA7A 1FLVA 3I9KA 3VPDA 2ZAIA 2WTMA 1XZLA 1X1CA 1GXSA 2OZKA 5JO9A 3VNQA 4ARZA 4BFYA 2NZJA 1U1CA 3G8YA 4U2EA 2MSLA 1PV2A 3M5WA 4HDKA 4EKNB 4RZ2A 4NFSA 4JI6B 4O0LA 2QN6A 1VJCA 4KIWA 1YDWA 3KQKA 5DCYA 4GOMD 4JYAB 1LC3A 2AVNA 1R9MA 4DDKA 1RXCA 4EYGA 1R6UA 3MFYA 4QDUA 3VJLA 1UKAA 1JNXX 2JBAA 3H2SA 1H8ED 2AJ8A 2WNIA 3EN0A 3DAHA 4GC9A 3N0VA 2XV1A 4TV8A 4MR7A 3NHFA 1EFPB 4AZ0A 4WNAB 2NP7A 3QVOA 2X9LA 1M1NA 4PRLA 4U0JA 5HFAA 2Q6OA 4R3NA 2JHGA 1DHRA 4BPBA 3WMFA 4BZXA 5I5EA 3NO4A 2LRHA 5IU6A 4CEJA 1ZNXA 2CE7A 2C2WA 1WSDA 4JYMA 2BFNA 2KM1A 4RDXA 5JCJA 5CEFA 3KYCB 1CQPA 4D3YA 2P1RA 3I30X 4IPTA 1P1IA 3B5EA 1QYWA 2PNJA 4IXNA 5M04A 3PVCA 1OXUA 3PNOA 5HW0A 3CA8A 1LNQA 1G21B 2WM9B 4MJXA 3Q3JB 4LWZA 2Y0DA 3ENVA 1QJ4A 2UAGA 4Q9IA 3QNUA 1U3WA 1RHUA 4OIMA 5DF1A 3VX3A 1R6XA 1Q1QA 3C4QA 3FF1A 4G0OA 3VR4H 3FJYA 3ZNPA 1JDPA 4DLKA 5IDWA 5JRJA 1Q20A 2XD9A 4JGGA 3H5NA 2FYTA 4LNAA 1E3JA 1QHGA 2GBGA 2Z2YA 1X7YB 3B1ZA 1JYFA 2F3TA 2VJKA 2J6HA 3EIXA 1D4ZA 3EZYA 3L02A 4L0MA 4L5YA 4NYIR 4E7PA 3TLXA 1XRRA 2Q99A 2PMDA 3LBYA 1P7WA 1Y9ZA 5J40A 2EX0A 2EKZA 3PHLA 5CW2A 5BW6B 1JLLA 2J8ZA 1OT3A 2BM0A 1RP7A 4WOCA 3GEBA 3SYLA 1LBHA 3J81A 3WRYA 1W2HA 3DUFA 4QEDA 5M7EA 4CLRA 1PS0A 4IHKA 2LE0A 1U4OA 1EK6A 2HK7A 4MUBA 4PX3A 1QNFA 5JS1A 3F3MA 3KKEA 2QL9A 1F2TB 3MWEB 3QWHA 3EXHC 5GM2A 4B6PA 3CQ9A 1AK2A 4RHEA 4INJA 1GFIA 4TSRA 4I14A 4P4TA 3URKA 1KXZA 1XMVA 1QIEA 2XHZA 4IFEA 1BXGB 1QWSA 1TUBA 2PR7A 1P0MA 3MK31 5G0WA 5EP2A 3W4KA 3LYUA 2FXIA 3M7IA 3HS3A 1YMQA 5U4XA 3ZVRA 4AZ0B 4V38A 2Y93A 4CV3A 3GGSA 5KCZA 1TZ2A 2HU5A 3CZCA 3QLEA 4GKVA 3N86A 5F78A 3MJSA 1JDUA 3L0PA 3NTUA 3JR7A 4HYEA 1P3Y1 3LDGA 3KU1A 3T06B 2ZQZA 3HBAA 3NM4A 2F43A 3GNQA 1ZGHA 3BHJA 5IJAA 3SYMA 3DHWC 3FPCA 4BLUA 1OTYA 2YVUA 4UVDA 1BS1A 2MOKA 4YJDA 1P0QA 4JJZA 2E4AA 5C31A 3ZWWA 4C88A 4ETNA 1JR3A 1FXUA 1X86B 2H5LA 2XUJA 4BV9A 5JNSA 3L6EA 3PL1A 5CIQA 5C1IA 1Z4KA 1EGAA 4KX5A 1Q0QA 4TS3A 3RVOA 2HL6A 4J7CA 3O84A 4UU8A 4M6WA 1JT2A 2FDXA 3D54D 2FX2A 4V0NA 3FNIA 1CBUA 1ZGBA 2AC4A 2QAGA 4YCNA 2IGTA 1DBPA 3HDGA 3OO0A 4IFTA 4QYSA 5B1SA 1V5GA 5C8ZA 1KQFA 2J4FA 4IZOA 3CIOA 2G28A 2IPLA 2JLSA 2Q4EA 5HZKA 4YDSA 5EE0A 3VPXA 4TQ9A 5COQA 4OVKA 4F11A 3K72B 4ATNA 1RRMA 1SHUX 3SWWA 3TEMA 1I1HA 2X0NA 1H42A 4F5DA 2XD4A 1RZ3A 4KEAA 2WOOA 1YIDA 1YCGA 2FPKA 2R7KA 3OFND 4URWR 1XZKA 4FOOA 1H3FA 3WK5A 4DIEA 5HTOA 2VSQA 4RE6A 4X85A 2BMJA 2X2FA 3MT0A 5CK4A 3I64A 4DNOA 1S9DA 3U16A 5AXDA 2GUGA 4Q03A 2PN1A 5EHNA 4EF5A 1L7QA 1NXTA 3R3SA 5HUHA 4JFRA 4NEQA 5KHOC 9ABPA 3RTEA 1C1DA 1EZ1A 4HV4A 4CLEA 3E2IA 3FCYA 3LNTA 5J4VA 1ZNZA 1QZUA 4MJ3A 3GRYA 4YPVA 4HP8A 4RF4A 3TZQA 4J9VA 1EA7A 3CGWA 2GARA 4AJOA 4P33A 3O8QA 1G8HA 4CGYA 4MKRA 4UHBA 3HP7A 2EIXA 4MHSA 3W2TA 3VSDA 4ACAA 5BSEA 1WM1A 1XYYA 3CTPA 1IZ7A 3L0YA 1NQXA 1U28A 2AFIB 2ZEJA 3FW1A 1G4HA 4UARA 4MEJA 4Y2RA 1SXJC 3NUGA 1W30A 5EMNA 5BNWA 4Y1GA 3JQFC 1K6JA 1U1GA 2A9RA 4YP7A 1O3YA 4AY3A 5CDFE 1AZTA 4M1EA 4P4UA 1TXGA 4MRNA 1QANA 1E5XA 2ET6A 3EVTA 3G85A 3EQ8A 4FPXA 2G9UA 4W8HA 2VYCA 5DK4A 1SU7A 2FPGB 4HDMB 4AO7A 2IHNA 1FU8A 5FWAA 5LU9A 1XCPA 3AWDA 3HJNA 1FMLA 3UCXA 3GEGA 3T7SA 2VBIA 4DRXA 2WHPB 1R5NA 3BQNB 2FN4A 3DNMA 2NSLA 2JKYA 4Y1EA 3RVRA 1JG4A 1VYHA 1E3DA 1YI0A 2ZTMA 3T3EA 2Y05A 3ADKA 3E4CA 1Z0UA 2C59A 5ALIA 5LD2C 1L8LA 2ZYSA 3QWAA 2YKGA 1EKXA 2VQ3A 3FPLA 3KKNA 3CUWA 3UOWA 3B70A 4S0XA 4JT8A 5KTMA 3RFFA 5KYWB 1PBNA 4QGHA 5FOUA 1RI2A 5JE8A 4BFCA 1WZNA 4F86A 5CXQA 2UYGA 4RLQA 1WV1A 2VP9A 5J4KA 2VDNB 2O0JA 3AIOA 1NQAO 2JDID 1T8TA 2P9FA 2QLNA 3AERA 1U0EA 4LOLA 1EGQA 2JL1A 3H6KA 4NVRA 4ZGGA 5MGNA 3GMSA 3AUYA 4G4IA 5TGZA 4AU1A 1H3EA 5E9JA 1TCUA 2PFSA 1PSZA 3HJBA 2LW7A 3K0AA 4FQ8A 1UK9A 3K4PA 3ONVA 4AX4A 1YRHA 4KSBA 2QJFA 2C92A 3O4IA 4HQRA 1KMIY 4F38A 5HX7A 3QU2A 3JD3A 2C20A 4ZI3A 3MLEA 2BRUC 4MGZR 5CFZA 1ZH8A 4N5MA 3CZQA 3HACA 5FA8A 2Y92A 3RNLA 3F7TA 4E51A 3QW2A 2HLDD 1HYGA 3PNPA 4OG2A 2PEZA 2D59A 3CLUD 3KIPA 4MHOA 1T9ZA 2NACA 4Q21A 1WMBA 4H3KB 3QF4B 3TX6A 4YMLA 3DLBA 3LUBA 1RJGA 4EMSA 2GEBA 4H1WA 3TWOA 2ZRIA 4H1TA 1I3KA 3S8EA 1F0PA 4UUBA 3THXA 1ZMXA 2XUOA 2FMXA 4NTZA 3UMFA 4JQZA 2J0UB 4ISCA 5C7OO 2O8DA 1T3LA 2Z2IA 1QBGA 3LF1A 2VAXA 4GOKA 4HXEB 1MZPA 5LPNA 4A2WA 2RC6A 1LGYA 1QO9A 2GRJA 1WQ1R 4ACBA 4S24A 1D1QA 5LMNB 2C77A 4RETA 4Y2QA 3T7IA 3EPLA 1TE2A 3G2QA 5DCWA 3C3MA 3FD8A 3WY9A 3NAZA 3KDAA 3R7AA 1FUYB 1NF2A 3DMHA 3BCSA 4BQNA 1F0YA 1RBZA 5EWLA 2XRFA 1ZFNA 1EWTA 3U31A 3W8EA 1KMHB 2QTRA 4AKEA 3T5PA 2YZ2A 2II6A 1Z0JA 3L7OA 4O8CA 3D8SA 4Q1BA 4BMDA 2AR0A 4KBYA 1C7RA 1E79A 1R0CA 4P4SA 4XYLA 2G3YA 4MVXA 4XJXA 5J5AA 3VH4A 4BAUA 3MB8A 5BVHA 3N58A 1P73A 1FFYA 1CFJA 1A71A 3UFXB 1T4CB 3TZCA 1WU7A 3OZXA 4Y0VA 3GN1A 1FFHA 1TC2A 2XNCA 1KZ7B 3D8NA 2VYQA 4C6TA 2WIKA 3GLVA 3UK1A 2WMOB 4UTVA 2JD2A 3RK1A 1X2EA 1XU4A 2I2FA 5EIEA 4Q9AA 1YQQA 3PA6A 2VK4A 1Z6QA 3IQHX 3NVAA 4N7BA 1IUKA 2EARA 3RYIA 2ODQA 3NOVA 4X84A 1EFLA 1OWNA 3BJEA 4JKOA 4V3BA 5F7OA 1ULTA 1M8KA 1IY9A 1IBSA 2OQIA 2D7CA 2CLMB 4BLSA 4OK5A 5FNVF 1H5NA 1C0KA 1B74A 1F5SA 2PT7A 4ARUA 1RKVA 2IELA 2ZBPA 1I30A 1L5FA 3B5JA 2QRMA 3OCXA 5E6RA 5CJ2A 5A0TA 2Q62A 3K20A 2AA3A 2XQKA 5PNTA 4IIVA 2HBQA 4EHIA 2ZSEA 1NMQA 3BFPA 4MS3A 2MJLA 1X92A 4EAQA 1EXVA 3JYPA 1T9BA 4DQVA 4TL9A 4C5AA 2YOGA 1TUIA 1GPMA 2WYWA 1XL0A 4KHZA 3G6WA 3WTCA 1NF9A 4TT3D 3PIIA 4TTTS 3VI4B 2YH2A 3EZGA 2VNIA 4IIYA 5C4MA 3UCEA 1UJ5A 2HEIA 3HDTA 4KODA 2VP2A 3JQAB 1S6YA 4OQXA 1PHPA 1EE9A 1VJGA 1NN3A 1QGOA 3ADCA 1WE2A 4QDKA 1T2EA 3T9CA 3G2PA 7YASA 1PP4A 3M49A 1SBTA 3RSHA 1TLTA 3IELA 2OY0A 3IMEA 2KHZA 3IVAA 2QDXA 4V1CA 3E15A 4BXOB 1RHQA 2OCGA 5G4KB 3WICA 2I3BA 1CR6A 5CNIA 3TNLA 1HEUA 2HXSA 1HXHA 4MKGA 4N6NA 3R7WB 3ZWNA 2IUYA 4ZGWA 1BDMA 1CF9A 1E2EA 2E2WA 4UVEA 3FFAA 3JAWA 1A8SA 3Q5EA 4JFAA 3E9ZA 4N8DA 3GRUA 1XZQA 2QXTA 3WIEA 3C8ZA 4MA4A 5KWJA 3L84A 2ISCA 4NZZA 3TMYA 3WZMA 4BYMA 3HHEA 3VR6H 3F4LA 3QELB 5JDCC 4YAKA 2C5LA 3N2KB 4R69A 4Y2YA 3TBHA 2P90A 4F2GA 5DX1A 5EFZA 3H75A 1JR6A 1W88B 2BTQB 1HZZA 1UBCA 4PE5B 3VTFA 1O4WA 2Y3IA 1GLNA 1P39A 2Y77A 1TF7A 4BJ1A 5LQJA 4JBIA 4NFYA 3GFOA 3CEJA 2DQZA 5DLEA 3WLNA 1NYLA 4MI3A 5FCDA 1L4BA 4QO8A 3H42B 3QPAA 2AMFA 4XFJA 4RHUA 2PQ6A 3I09A 4BZZA 5JCJD 4DUYB 5CLLA 1B4DA 3DZBA 4ZC1A 2GJ8A 3BMNA 4JP1A 2Y6UA 1QYVA 3CG0A 1O6BA 2HJVA 3CMMA 1PDVA 4FS8A 2PWYA 3G0DA 5I45A 4G0WA 1ZCZA 2O05A 2OHIA 4E6EA 4XVCA 4MVJE 4R2JA 1HMPA 3QTBA 2FSPA 3R9XA 3ILSA 1C14A 2HWXA 2J0VA 4Y2TA 3D7NA 3WMEA 1ZS9A 2RJ3A 4LYEA 5CT8A 3PVSA 1YT5A 4P32A 4YXWD 3OTOB 3SKXA 3SZMA 1WBDA 2OILA 2R5WA 1CHDA 2C8JA 1FFXB 1SKAA 2FR8C 4LJRA 2W83A 1EVQA 4DCOA 5CG2A 4MAFA 3V2IA 2Y27A 5JRDS 3BMCB 4FM9A 3BYZA 2ZIEA 3KEMA 3I58A 4I19A 4K6KA 1PLKA 2E89A 1G9TA 4G0YA 4ML3A 5D85A 1IOLA 1EFRA 4KIJA 3QLVA 3FLMA 3D2CA 3AEQA 3OMLA 3IP9A 2Q6VA 5DHFA 4ENRA 4GHWA 1UM9B 2I7XA 2PCLA 4LYYA 1R0YA 1YZNA 4LWPA 2CZCA 4CF3A 1II8A 1TKAA 3KD3A 4AL4A 3OWOA 3KSZO 3R75A 4FFVA 3M82A 1Z6GA 2ODNA 3NHRA 1Q6YA 1US8B 2DE0X 3CVXA 1OV6A 2WWTA 4MSUA 1NR7A 2IU4A 1GTSA 3AVXA 5GPBA 1FLAA 4YIHA 3D4PA 2Z5LA 1CJSA 1U1DA 3P9IA 3BFJA 3VSEA 3G59A 1N2SA 5LQSA 1X39A 1RI3A 5AI9A 4LSGA 1JQDA 5CX1A 5E4YA 3TR0A 3V33A 4D97A 3T8YA 2B83A 2QRPA 1M33A 4ER7A 3UBMA 2IZ7A 4X71A 2PNFA 3JQ9A 3NKLA 3CB4A 2Z95A 4A7PA 3ZCTA 2E5LB 1QH8B 4D0SA 1I4LD 1OIWA 4YMWA 4QQKA 1ZCFA 1ODTC 2MWMA 2BGNA 2R1VA 3OP4A 3OJXA 3KT8A 1G1AA 2AEFA 2B4RO 4LGMA 4NQZA 3OECA 2PXXA 3BC1A 5A3VA 4DXDA 1KHTA 1BGWA 1E2LA 2M6SA 4XSHA 3HA3A 3UVEA 4C7OB 1N57A 3RWMB 3KCQA 1IOVA 4Y1FA 1GGEA 3KO8A 4F3TA 2H08A 3WK7A 4JBWA 3A14A 3QA9A 4H1HA 1JG2A 3H0KA 4DL9A 3AHDA 4IIHA 5H80A 2QRUA 5B3KA 1I80A 4DV3B 2ZRAA 4FT2A 4YCBA 1BJRE 3T4XA 3DE3X 1IWOA 1O0SA 2I65A 3CNEA 4Q9KA 4CM7A 5IKXA 1GT6A 4WZ6A 1NRIA 4OXIA 3ZE7A 3CT6A 3I9LA 2VBFA 3MAJA 1NKSA 3JAKA 4BVHA 1PFKA 1PUJA 1VPDA 2EKLA 2JFHA 1U6IA 3OLXA 4QBFA 3R9WA 3T54A 3K6KA 2XOKD 4E33A 4MUEA 3GUUA 1AO0A 1MRSA 2ZB8A 3QE3A 4UDYX 1J20A 3FVRA 2IYQA 3GDFA 1ETHA 1IATA 3TPZA 3TLMA 1RCTE 3BTSA 6ADHA 2GBPA 2QN3A 1R8XA 4TLAA 1RACA 1I3CA 1U0SY 1ZRSA 2CNDA 4HKTA 4HF7A 5ARBA 1VGRA 2JAOA 4DYVA 1JG1A 1ID1A 2OV6A 1S2DA 1KL7A 1UODA 1Z5VA 1A7AA 1ZIOA 3MJCA 3KQPA 2QPAA 3EPPA 3MUEA 3AUUA 2QR5A 4RZXA 3BL5A 3C6QA 4AXXA 4IIJA 1H4VB 1NR5A 3GPBA 1GZ7A 3BDAA 3FJOA 4I1PA 3F3KA 1QPZA 4QEZA 3ZW8A 4X6LA 5C7YA 2G5CA 2BEWA 3P9ZA 4KMMA 2J30A 1KJJA 4X95A 5TT1A 4IJUA 1R5BA 1BQEA 3H1EA 1G41A 3TL3A 1H94A 3P20A 3U17A 1A98A 4C2UA 3PIDA 1OFTA 3N8KA 1JEDA 3CZ5A 1FE8A 3KKKA 2O1SA 1VL2A 5DLYA 3GLHA 1E4YA 1FP4B 2PKRA 4GSYA 2Q7DA 3V46A 2WSMA 2IE8A 5LOVB 3MM4A 1TIPA 1O54A 2RH5A 3GV0A 1USIA 1TUEA 3IBCA 1XD9A 1QPGA 5JH7B 3H1BA 1AS0A 2YZGA 3C5HA 5A02A 1E1YA 3H1TA 1GADO 1N3LA 3B6EA 1P9WA 2YFQA 3A31A 1B8PA 2FZEA 3D4NA 3M3PA 2XA2A 4F3NA 3GFPA 3MXOA 4L51A 4QT4A 2OFXA 3M2TA 3QEOA 3V4ZA 3HCRA 4GR4A 1AQJA 3RAGA 1ESNA 3QE9Y 1XRPA 3KAJA 2J7KA 2XYRA 1GILA 2UZAA 3F78A 2Y4OA 5DM60 2LWIA 1JTEA 3ZZ1A 4R71A 3LGAA 3P2IA 5AT1A 2AX3A 3UJPA 1MB0A 3WYCA 1RQ7A 4L73A 1RPZA 2J32A 4BMOB 1MG5A 4YACA 2NU8A 3ZLBA 4CR6A 2YY7A 3CCCA 2HQBA 3HGMA 4G0UA 1XPOA 4XB2A 1DV2A 1JQ5A 3BCHA 4BCCA 3NXSA 4PLFA 1LEHA 1BVRA 1NMSA 2V8OA 1P1CA 1U2PA 3PTZA 3ADPA 4PTLA 2I8AA 4RLSA 1ORTA 1TQDA 2OG2A 5EE1A 3I5YA 3WP0A 3ZZTA 1I5EA 1YSCA 2DPYA 1ZINA 5KNBA 3GFTA 1A4IA 5HK8A 2HCBA 1KAQA 3ZWAA 5M3BA 2LDXA 2O2CA 1NKVA 1SBQA 3PNMA 4FZ3A 1V3TA 1KMMA 1WO8A 2VQDA 2C2GA 4Z0NA 4I2NA 2V55B 4V0QA 1H2WA 3VPSA 3LOPA 3DF7A 4XD7A 3PEWA 5B36A 2UYCA 1DQNA 5L7WA 3W5BA 2G1KA 1CTQA 2NTEA 5JJCA 2G5TA 3IQFA 4RY2A 1QSGA 1UDAA 1QHIA 4W5HA 4CU2A 4IR7A 4HEJA 3DV2A 3HUTA 3FNBA 3CLHA 5I9LA 1XRLA 4POOA 1U0RA 3L7MA 3W9UA 4YP1A 3EMBA 3NCTA 2JFVA 4E14A 3SNHA 3DR5A 4RQBA 3RRJA 2X15A 4B71A 3JALA 3C3WA 2FFBA 2RH4A 2R7LA 4WLEA 4BMXA 5K6AA 3U44B 4W9NC 2CLOB 4PLWA 3LBAA 4D74A 4ZGBA 3ELDA 3A9SA 3CF4A 1RYHA 1LFAA 1R00A 1U1FA 5JNRA 5KIAA 1CD5A 2J5BA 4ITRC 5KHLB 1YVPA 3O2QB 3BILA 4B8ZA 4KREA 2VWPA 4HS9A 4DYHA 4BNKA 1SNYA 1SQ5A 4NCHA 1YIOA 1WA5A 2BUAA 4TWRA 4OQEA 1E32A 1RWXA 3A3KA 5F3RA 3PDIA 4UZSA 5T7BA 3CVYA 3JQ7B 3VC7A 2P9QA 3L7DA 3MMZA 3ONNA 1R4NB 3PCXA 3RLIA 4S2EA 4HAZA 4PLPA 2ZR7A 4OHFA 4F7WA 4WCFB 4FYKA 4PHFA 3MTBA 3NHYA 4PSVA 5A7HA 4MWCA 3L07A 1WCIB 1WUYA 1W96A 1YZKA 1OLXA 1QONA 1E3SA 1W4LA 2GR9A 4I1IA 2NMVA 3AHHA 4EY5A 3OIGA 2P9TA 4HZIA 1PD0A 2P7HA 3NFYA 3DZKA 2VH5R 4KNYA 3BMOB 4YUXA 5KB3A 4P9NA 1E2HA 1ZW6A 3KYIB 5AIBA 1LF5A 5ADUS 3LPNA 1EWQA 1ODJA 4EI9A 1JEOA 5JNWA 1YJ8A 1KDVA 3VNSA 3QITA 3BORA 2GMWA 1VE9A 1IY2A 1PYGA 2HMSA 2OVFA 2Q8QA 3CLTC 5JSZA 3U7GA 4KN6A 3TDMA 2XTZA 1ONPA 3TLEA 3OQVA 4MPTA 4XUDA 2V3VA 1EB9A 1O0BA 2C99A 2H07A 3D6AA 4BX8A 3SVTA 3P7MA 1BH6A 3OIVA 4PYLA 3O4GA 2IS4A 1PJ4A 3OICA 4OBXA 5EKTA 3AM3A 4DNQA 3TQCA 1S2LA 4D4IA 3LLMA 5DIFA 4DM4A 3SEFA 2JLAA 4FGUA 3INNA 1Q16A 2BGWA 3MJVA 4H0NA 3ANYB 3W8DA 4BRSA 4UHEA 5JMWA 1CEYA 4TKVB 5AM2A 1XE3A 3RHSA 3LLVA 4WVFA 1WEHA 4OGGA 2RBGA 2ZT7A 4UBMA 4UCFA 2IPOA 4OK3A 4RV5A 5DN9A 4K2HA 2I9KA 1TO6A 1VE3A 1JEQA 1LBTA 2R6HA 3HO8A 4PIVA 4QELA 1T4MA 4NICA 3KVVA 5IK2A 2VT6A 3K0EA 3U0BA 3WLPA 5K0JA 5HCUA 2E55A 5TEVA 4PR0A 5M5BA 1DUIA 4C7MA 2B92A 1RYEA 4GE3A 3U48A 4R2LA 4KO8A 3JQ7A 3F5FA 3OPMA 5ECGC 3OJOA 3H2HA 3AR2A 2C98A 1X80A 4UZEA 4IKOA 1YIAA 5CCDA 2XCIA 3ZDQA 3BT7A 2VZ0A 1SGWA 4RKFA 4YHBA 3HVUA 1P1KA 1QP0A 3DXXA 1EUDB 4JB2A 2ATVA 1L5KA 3IA7A 2WJPA 1Z9BA 2WUDA 3EDYA 4AYTA 3A70A 2Z58A 2O8VA 3LH5A 4R1TA 4REMA 2A0YA 2BZ1A 2VOJA 3JQQA 3KWFA 4UHCA 3UWOA 3QVJA 2VYVA 5LSAA 2ZI9A 3IJ5A 2XYQA 4LV8B 4QHTA 3H5AA 1D2GA 2PUAA 1XNJA 2L17A 1NLUA 1PD1A 1U3DA 2P9JA 2RB4A 4OHWA 3DNFA 4KQGA 3AKZA 3K1TA 1Z7GA 3K73O 4MRVA 4WFIA 4CM6A 1Z2DA 2OXRA 1QTIA 2BFBA 3FNRA 5FADA 5B1IA 5KWVA 2FB9A 2B6HA 1U2DC 2BFFA 1BWPA 3HJCA 2LKDA 4PXAA 1BWQA 2NUAA 4BMNA 4W6QA 4ZZ3A 2VQSA 1CG6A 3RADC 1YJ5A 5K51A 4YA6A 3QE0A 3T1OA 5ILQA 1TJPB 2WJZB 3EIFA 3EDCA 3UK7A 3IKTA 1M5RA 1YDHA 3OCJA 4AJLA 2XGSA 1TM2A 1PQUA 3HRKA 5GGYA 1KSJA 1D5WA 2FP3A 2WJHA 4R5MA 3VZBA 1DEAA 3KPWA 3E58A 3NTXA 5I6DA 5E2IA 5HOEA 4DB4A 3FPSA 1YZVA 5HNKA 1FLNA 3WB1A 2QQ0A 2F1OA 1ODIA 3QTTA 5CGQB 2GJ9A 3MGCA 2NXEA 4D6XA 3LV8A 5IABA 3I5MA 2QTZA 1TYEB 2O8FB 4I66A 5LQCA 4L9WA 3O9VA 4HLCA 4RFSA 5DGDA 1JEQB 2B7BA 1DARA 5TMDA 5FWXB 1M1YE 4ID9A 3D3EA 3PDHA 5DCUA 5BV7A 3DPIA 4A26A 2I7DA 2PUJA 4QC2A 4TKLA 2V6MA 5EKXA 2DECA 4EVSA 4GO1A 4QYIA 3TAHA 4LECA 1RE0A 4TWZA 1Z62A 4MVJG 4WSOA 5BUSA 3T1QA 4RL6A 3RKRA 2F59A 3EAFA 5G02A 4DEYA 3ZQ6A 3ZOZA 4C87A 5ALGA 1Y80A 3K16A 3EDMA 3VC3A 2MINA 4RMJA 5CCXA 3NXKA 2VJQA 1D7OA 3HVHA 1K98A 2VXCA 2X0RA 1D1SA 3TLCA 3TW0A 1HT2E 2H4ZA 2HO5A 1NXXA 4CMBA 1NM5C 2EKPA 2V0GA 4I9FA 1J33A 1XTBA 3EXHB 2X23A 4DR7B 1UH5A 5DO9A 4BIMA 1TCCA 2DYKA 3ROTA 2RARA 3DAOA 2XNKA 3IAEA 5FBVB 3TPCA 3VV3A 1QHFA 1IXRC 1O97C 3CEAA 5GV8A 3GEIA 3D1LA 1OFIA 2YOFA 2CDBA 4UU1A 2H4HA 1HO3A 3B36A 3MQ4A 3ZG6A 2FJUA 3PQ7A 3QVKA 3RU9A 5AKYA 2O54A 2GN2A 1JIQA 4EITA 1JPUA 2AKAB 2EP7A 3I2GA 4IO0A 2CSXA 1DQYA 3UV6A 1FQWA 5JI2E 4LF6B 1E4EB 1AKVA 1NX6A 1RHMA 1T6YA 4NRDA 3EQ7A 3TW8A 1UBMS 2NP6A 4UXIA 3WMXA 4JGIA 1E2BA 2PHZA 1X8LA 1GQQA 3S40A 2QTGA 2G77B 5CYOA 3UKJA 5LZ2A 4KXYA 1M73E 1FLDA 4HWKA 1JV2B 5IDVA 5J58A 4RZHA 2N0SA 2IYYA 3ILYA 2G88A 1K88A 4N8SA 5TS3A 3DBHA 1V8OA 3FB4A 3JVDA 3PUVA 2XPCA 1C3OB 3VR6D 1T0UA 6CHYA 1YJBA 5L40A 2IPXA 1DGQA 2XOEA 2P9GA 1LRKA 1XLVA 3DT9A 3F4BA 4LYGA 1II0A 3NBFA 2QX6A 2O20A 1NX9A 5E6SB 1JHOA 4XPZA 2FE1A 4HX2A 4JQCA 4JLUA 2AEJA 3VGPA 3COSA 2C2BA 5C3MA 4W9MC 1TPZA 4J43A 1NJ6A 1X14A 2BZSA 4IGKA 2I9PA 2P40A 3KTAA 3BK7A 1RHJA 4JIGA 2BFCA 1E1CB 4OHVA 4CM1A 3VMMA 2GFHA 4BAZA 2NTVA 3ENZA 4G1VA 1F14A 4HLUA 3H84A 5HIIA 4C0LA 4EG3A 1I0IA 1MF7A 3Q88A 1WZUA 1DJOA 1QV6A 5HGXA 5BRJA 3WNDA 2F64A 3K1AA 1K7EB 1GZ3A 2QRJA 4ZMBA 1L9XA 1BYUA 5BQOA 3UWDA 4K46A 3ZUGA 2JEZA 1D2RA 1KVQA 1JR4A 4EYKA 1Y4DE 1QGAA 3K30A 4HGRA 3AGPA 1J99A 3GMIA 1XKXA 1FNNA 4LF7B 2MSCB 4HQFA 4INAA 5A9TA 3I9MA 5JBNA 4CF7A 1NHWA 3F1LA 3FKSD 3FSGA 5DNDA 1R0WA 2C83A 1RWVA 4S04A 3PI7A 1NBIA 4HDNA 3F2IA 3GA7A 4HEA6 2QT9A 4JHLA 3R8XA 3RTGA 3STWA 3IKMB 1PR3A 4D99A 2QRVA 2QEQA 4DIBA 1R50A 2QTMA 2LCIA 1I4TD 4TKUB 2ZUEA 4TVOA 3ACBA 3TNDA 2GM9A 2NYVA 2R8EA 4CL0A 2XDQA 3ILHA 3IQGX 3ZZ0A 2WC1A 4GMKA 3OP1A 1VC2A 4EG5A 4WBNB 3E82A 1V3VA 4NMMA 1QP8A 1VL8A 4O29A 4V24A 1T5IA 1VPTA 3ZXSA 1AJEA 3G5MA 1K92A 1NU8A 1JSXA 1ORHA 3L82B 4MYRA 2ENUA 1N5MA 3HY6A 5G1NA 2PRSA 1KSFX 4ZVPA 3MINA 3R74A 4NARA 1EZ4A 5KNBH 1JALA 1KMQA 2FPIB 3E70C 5ITZA 1C3EA 4DLAA 4ZEVA 1BVYF 2OZVA 4K3VA 5JY1A 4W4TA 3JW8A 4F6RA 2Q07A 3PRKE 2QLBA 3CN7A 4PAGA 2FSIA 3DV0A 5JWOA 1RIIA 4Q4DA 1Z4QA 1ZL2A 2COKA 4G0PA 5EHGA 3RCBA 1PNVA 1UIRA 3M2PA 3WDLA 2HDHA 3GRRA 1OLSA 4CTJA 2PV7A 2PLAA 3L6DA 4GI5A 4I5DA 4ND6A 3VNUA 1JJVA 3F71A 4K7JA 2Q6KA 1Y63A 4KFTA 4CYMA 1THMA 3FCUB 4JH0A 3ZJYA 3HKBA 3A6DA 4BQOA 4U2GA 4UDNA 5DXJA 2EBFX 4KXWA 5E7MA 3O9MA 5JSFA 2ALJA 4Q47A 2HJGA 3OPXA 3WGHA 1G64A 2DCUA 3WNQA 3KTFA 3R3VA 2ENWA 4OA8A 4AKGA 3BJRA 1T3HA 3MWYW 1C2YA 4MJLA 1BOOA 4Y7CA 1TKCA 3KXDA 2JZCA 2I5PO 3O4FA 5HQJA 4REOA 1VPLA 3LDFA 1W87A 3AVOA 4R6WA 5FPHA 1J8MF 3AWIA 4EHKA 1NNEA 4DTCA 5C51B 1CLEA 1SXHA 2JGDA 4C4RA 2ZBDA 1G7RA 3P94A 4U63A 5HE9A 1YKSA 4BNNA 4E12A 3ESZA 5CFQA 2VXYA 1MORA 3SYRA 3TDKA 3GVPA 4NY1A 2OAEA 2J9FB 2HKIA 2QNIA 4Q4HB 4Y8VA 2ZRFA 2OC9A 5AVVA 5CPBA 1O0CA 1F60A 1V2HE 3MMXA 4K3UA 3E9CA 3DWIA 4MARA 1XTUA 4RA9A 4PQFA 1XP5A 4JQSA 5DYYA 4GDFA 3RG8A 1UBLS 2GEJA 4GNKA 1E3EA 2GAAA 2ZIGA 1FXWF 1R12A 2XJ4A 2QTFA 1UPUA 3TB4A 1V7ZA 3KPJA 4U7HA 5FR1A 1S02A 2V6IA 3DOJA 2ZUSA 1JJBA 2C0PA 2FZ4A 4RMGA 4X60A 5K8TA 5ITZB 2VDVE 2ZFUA 3I9V1 1L7AA 1R0SA 1PQYA 2X8BA 4D0GA 1KYYA 2JGFA 4RK7A 1T3TA 4F6RB 1KOJA 1K2VN 1BWSA 1WSBA 2AL7A 2OV3A 3PXEA 4JLVA 4X9XA 2D5CA 5C81A 2F1HA 2Q28A 4NPAA 2AHRA 1WQ3A 2OHGA 2EX1A 2QUHA 1U9CA 2JAWA 3OHSX 1S7GA 2QTWB 4RQTA 1KYTA 3P2EA 3GUHA 1ZJJA 4C14A 2V96A 4BLOA 1FJGB 1VJRA 3I3OA 2E6KA 3T52A 3VV2A 5JPDA 3OTWA 4N76A 2D1SA 4ZCLA 3OQJA 3SYNA 4KQKA 2GYVA 4KJZA 5SY6A 5KTOA 4I4CA 1PWEA 221PA 2IXGA 2WDZA 5E95A 2BF4A 1VIAA 5JR3A 4FDVA 2H4XA 3PUWA 1S8OA 4G23A 4NYIQ 4CMIB 5I9NA 1QORA 4F5YA 4AO6A 2JEYA 5EUMA 2FUG6 1TMOA 3EPRA 3SHTA 3LI2A 2IUUA 5T8KC 3NWOA 3VDMA 16PKA 1ZX1A 4OP3A 4UBKA 3DBVO 2CYAA 2YZ7A 5CDSA 1CW2B 1ODLA 4RAQA 2BBOA 2BKVA 1MQAA 1F7UA 1F2UA 2CL0X 2UVPB 2C94A 4WLFA 5G0SA 4EUKA 4D44A 3VAYA 1CPYA 1U9IA 1VLZA 4PHHA 4Q6WA 4QDOA 4QXRA 4BNIA 1G7CA 2QX7A 4I1YA 4M37A 5EYPB 4MQFB 2H1CA 4BP3A 1COWD 1ZMRA 4M9XA 4Q3LA 1TYZA 4GP6A 4WUTA 3CF4G 4FFRA 3VH2A 4Z3OA 2H59A 4GKKB 1X3SA 4MR7B 4C1NA 5I47A 1GA1A 3AF3A 1Q1ZA 3SICE 3ZVMA 5K8JB 4EG6A 1NDUA 1XZMA 3RYHB 1R27A 1VG8A 3DOEA 2UZ4A 4CT5A 4HB2A 2EJBA 2H7CA 2CN1A 2FZWA 4IIDA 1JLHA 2FQWA 4KQFA 2BMAA 3PRHA 4IDGA 1V8FA 3Q3HA 3NWJA 1ITZA 3CX4A 4M9UA 5ALLA 2A0XA 2B2XA 3B8EA 5KTKA 3TUZC 1JEYB 1IH8A 3W5IA 2FPSA 3U7FB 3TSAA 1E9BA 2WFZA 1G21A 3TG2A 2OYCA 4Y9SA 4H9GA 3TD9A 4FHGA 3UAVA 2OFOA 4PZCA 3DL0A 1XJQA 3E2MA 4OB8A 5I3CA 5K3BA 3T3OA 5BNTA 1YDFA 5DHQA 1P3DA 3HR8A 2ZWPA 3ZBTA 5K1ZA 5HILA 2J3IA 1QX3A 3GLFA 1ECLA 2YV4A 3NEPX 3IVCA 3LKBA 2CL5A 4QU9A 1R0LA 1V16A 3NHPA 4QTTB 1CJKC 1RLUA 1Z8DA 1O58A 1OWOA 2FSVA 3NBQA 4KDEA 1JKMA 4PRZA 2H2HA 3GO4A 3MCAA 4UDOA 5BW8A 2FN7A 1L3BA 2GJ4A 3P52A 1Z5OA 4RSGA 2XB2A 3RS7A 1P60A 1FDOA 2ABWA 3ENNA 4YYEA 1XVLA 5MN5A 2AIRA 4OMCA 1J5EB 4U2DA 2BF7A 3S1AB 2H52A 2DAPA 2JD1A 3DCJA 1I6WA 1E6LA 2QP3A 3U3RA 1J2TA 1I0LA 1WBJB 1LW6E 1Q1NA 2ILVA 3PHGA 3U7QA 1NJ2A 2JB9A 3BXOA 4ZKEA 1UPCA 2OBXA 1MGPA 2L18A 2XEXA 4PIMA 3CBQA 4NDAA 2PO7A 4NS1A 6GPBA 2B25A 2PL1A 2RJOA 1HFKA 1DAMA 1QOQB 2C3OA 4GZ6A 3BXXA 4PO8A 1SQSA 3A7EA 3CMCO 4FX2A 4OBEA 4C2AA 3ROXA 1QGYA 2Q0XA 3O26A 4V3CA 1RWKA 3TQIA 1JHAA 3I72A 2BTOA 3ZY4A 3KZ1E 5I7FA 5FUMA 2VQFB 2C5EA 2WG2A 3JQ8A 3PR2B 5GV7A 5F9FA 2GHQA 4HQNA 4WAUA 3WGJA 1R1DA 1KR2A 1M1ZA 4KPGA 4W82A 2EG9A 1IJEA 5HKKD 1JEYA 3PA8A 3A1SA 4TL6A 3BJMA 3ITDA 3PDJA 4RVHA 1H2XA 3SZOA 1GZSA 1N6KA 5CDTA 4EKYA 1P91A 1NE7A 4GPTA 4AZVA 2K5UA 2Z30A 1U5BA 2PUFA 1KJYA 1BJKA 1RAFA 4X8OA 1BMFD 2Z4SA 2D1QA 5AKKA 1BA3A 2ZE8A 2IKSA 3A36A 3OIFA 2FTKE 3GFFA 3PJFA 4R98A 1ISJA 4K03A 1E61A 1K97A 1XZDA 3IUJA 1MN6A 1KKLA 3Q7IA 4I4LA 5B30A 5KYTA 2WKQA 5DSXA 2UUBB 1C9EA 3H1AA 4L3WA 4W7SA 2E4VA 1IK4A 1YQDA 1CUVA 1I13A 4IMPA 1YJQA 1I2CA 3SJZA 1Z4OA 2VWQA 821PA 4LF9B 1SXGA 3HSYA 1VLLA 3MCVA 1UBTS 1OWLA 4KNWA 2Q50A 1HTTA 2XR1A 3FMIA 4LVOA 5EP4A 1L1RA 4W5RA 3U2QA 4B3MB 4R8KA 5TPWB 3W5AA 4RVUA 4M76B 4Q1FA 5EAIA 1YR3A 2BZGA 1EX6A 3STUA 4H17A 3QOFA 3BD7A 3VVMA 2DETA 1PE0A 2C3UA 5TT0A 4DV0B 1T6ZA 1EUYA 4BNVA 4XIYA 4PBTA 4ZI7B 1Z56C 2Q0HA 3RLFA 3VXKA 1K89A 3OOJA 2ZK7A 1HNWB 2FEPA 4MP8A 2WU0A 4RGVA 1K6XA 2Q3HA 3LDUA 1D9XA 4BZPA 4RA6B 2QXYA 5KOIA 5GIPE 3KWMA 4QG3A 2A1IA 3L40A 4YCDA 5L3SB 4M9QA 3PEYA 2CYCA 2YBEA 5DBIA 1OCEA 2VNAA 5FNVB 4UAUA 2IZOA 5CLQA 5CEJA 1YTUA 1SVKA 2YCLA 1J70A 1RM3A 4OREX 5GZ1A 1JX6A 2ZSIA 5IUKC 3GVIA 2PKYX 2ZS8A 3DXFA 2HLDA 4Q3KA 3AI7A 4FFBB 4EY7A 4CKWA 5DWQA 2Y2UA 4M38A 1GZ4A 2A5GA 5KWEA 2DGDA 1TU4A 4OGFA 3I0ZA 4HDCA 4Q4LA 4DTIA 5FX2A 2GEUA 1IQRA 3WADA 2RIPA 5H9WA 1WMSA 3V8EA 3AKEA 2O5CA 5E1BA 5ADWA 1SBYA 5JJ5A 3ZQKA 5ER6A 3LWNA 4E2ZA 1DKQA 1Z5GA 1HNNA 3G02A 1IN7A 2VZ9A 1XRJA 4NFHA 3MHPA 3QVSA 4JB0A 3NNNA 4BY9E 4UTNA 3QXHA 2V9CA 2IBMA 1OSNA 5BPFA 1FQOA 1Q1EA 1F8XA 1R8YA 3N7AA 3W3ZB 2O07A 1Y1SA 3S81A 2ZULA 4O1IA 2GLTA 4B3XA 1PVDA 1Z15A 2DWQA 1L5MA 1Y6RA 5IFKA 4BVFA 1KY5A 2XMGA 4ZPJA 2AR7A 4J0CA 1POWA 2QGFA 3MD9A 3IV7A 3EGCA 4B2LA 4E30A 1XTRA 4ARCA 3OC6A 1YAJA 3FZGA 1NAIA 3K09C 2XBLA 4XEUA 2VAPA 4JLAA 2Q5QA 1HYBA 1HPLA 1GU1A 4BNLA 1K63A 5DGIA 2R66A 2GETA 1ISSA 2J09A 1GCOA 3AERB 3IERA 3M89A 3ZU3A 2ETVA 4EJSC 4F46A 4WXYB 1DG3A 3SMVA 2HA5A 3FMOB 4NYMR 3BB3A 4Q1DA 2BMFA 1HI9A 1YZGA 2ZGVA 1YJAA 1GNVA 2QV7A 3AZOA 5EG5A 3P96A 4HSGA 5AKLA 4DPMA 4BFLA 1L7RA 4MVJD 3HBFA 1LCIA 3L7CA 4PX5A 3OSUA 2GNPA 3CNHA 2HY7A 5B2EA 1JPVA 3TJRA 5KSYA 5FNVA 4YRBA 4QDJA 4D9HA 1RM4A 4B2YA 4H7HA 3TGLA 1HLPA 1O7JA 2BGRA 4TN5A 4AS2A 4ZOQI 3D9QX 1N7GA 1Q17A 1H2RS 3QE2A 4AJNA 5KKAA 3HCEA 1XCLA 1M0SA 3KSUA 4M0UA 1DEXA 3MERA 4RKRA 4D43A 3BH6A 3QU5A 1P7VA 2O6LA 3GAMA 1QCZA 1QR6A 3MTAA 3SS8A 3KQUA 3GN2A 4QSHA 4CIYA 4IIBA 3HHPA 4HQLA 3LSTA 3ETCA 2KLBA 3Q6IA 4HQ6A 5EVJA 4INPA 4LQDA 3DEYX 3IQZA 2AMJA 2YXLA 4WKGA 5BN5B 1FF9A 3T0GA 4C76A 1KH3A 3PNKA 3GZNB 3IOCA 1WHTA 5JXHA 3KYJB 1LI4A 5KAMA 1V8BA 1A8QA 1XCOA 3IEPA 3NG1A 3PPVA 3RE1A 1OX4A 3B13B 3RAFC 1NVTA 3LQRA 2PR2A 5DXFA 4ZAZA 2RHHA 4KLNA 1GNTA 4L74A 4NIMA 3U5TA 1U2GA 2RI1A 2NG1A 3AC0A 4PAQA 2BMEA 2F9FA 3NOXA 3N0TA 3P19A 2CWDA 5BSMA 1PJ3A 4BEVA 2PM8A 1L5RA 4G5GA 5BWCA 2YR0A 3F6EX 1R18A 1L5ZA 1L7XA 1E2DA 1NUSA 2HSDA 4AY5A 3M4ZA 3MJEA 4XM1A 1P9RA 4DMFA 4Z9FA 3HV2A 4ZCRA 3X2FA 2PGLA 5ABPA 5A3RA 3DW3X 2AI1A 2R25B 1ZWKA 3ZWQA 2XUGA 4YJ2B 4ZQIA 2NPFA 1MPTA 5H16A 4EBBA 3GRPA 2TMGA 1HORA 4G0VA 2H4JA 1C3VA 1I4WA 2DHDA 3PQ6A 4OGLA 5CLIA 1U8EA 2XXAB 4CKBB 5K3OA 1RYDA 3JQGB 4C3ZA 1Z12A 3FKJA 1G2PA 1V5IA 2VJBA 5EVCA 3B6KA 4Y7DA 4C07A 2QX9A 1GQRA 3CV3A 1XDGA 4TLEA 1TVMA 5EJ2A 5IAAA 3MLBA 2OWEA 3OOHA 4K1LA 1HDXA 1JKJA 5H0IA 1EK2A 1WR8A 3LE8A 4RMIA 4HLNA 2Q5OA 1HH4A 1XK6A 2H9YA 3GG2A 4GRDA 4EI2A 5CYGA 4WRRA 4Y6QA 5TV2A 5CDYA 1P75A 2EKDA 2LXNA 3L4EA 1PKEA 3TLKA 1CZRA 1BCSB 3P5BA 5HUJA 2EIHA 3PTLA 1C30A 1G5HA 3L46A 4NESA 3TLYA 3KUXA 4KO3S 2ACKA 1UC8A 2HMWA 2IYTA 4NEHB 5DU2A 3WSVA 3R3UA 1OR8A 1TADA 4EA9A 4UTPA 2Q45A 3S1LA 4NJMB 2IJGX 2IF2A 3BE4A 1SUCA 3NEYA 4PANA 2DJ5A 1DUVG 4EH1A 1ECCA 2BDEA 2O6HA 4OIFA 5TMPA 4PGHA 3MVEA 4XA8A 5C1BA 2H2IA 1DC8A 3LKVA 3DKIA 2ZTUA 1W73A 3BMQB 2BH9A 1XLUA 4HUJA 1RR6A 2JJ1A 1SA0A 2A0WA 4H7DA 1NZJA 4RD4A 3TYXA 5CB4F 4A5OA 2FOXA 4QWMA 1C9YA 2P0EA 4QKQA 4EJ6A 5HG0A 3T7CA 2FLVA 5LLTA 2A1UB 5TQJA 1XHLA 1VLJA 4DRXB 1OROA 1A3CA 2I6QA 2CNBA 4G86A 4GAEA 1UT6A 1ZXXA 2PKXA 3SJBA 2GK4A 1ODCA 1VDMA 3BK2A 5THXA 3I2JA 3MTQA 4GWGA 3WQQA 5I4KA 1C4XA 4KZPA 4R83A 2XB6A 1UXGA 5C1DA 3I1FA 3PXGA 3UJAA 4CT4B 2PGJA 4N0QA 4A91A 5E9QA 2HSJA 2IK8A 1ATIA 4KR9A 4XSVA 1WNFA 2PPLA 3LK6A 4KR2A 1HRKA 3OIWA 4PPNA 1CQXA 1LA2A 4E2FA 4K26A 2QB5A 4P5PA 3MGAA 3VPHA 3F5DA 3GPDG 2CCJA 1Q57A 2JI6A 1WWKA 2I6XA 1KS2A 1RADA 1T9HA 4QU0A 4AYWA 3V55A 2A78A 2AWOA 1WHSB 3AFOA 1RWPA 1GZDA 1USWA 4LBWA 4JEMA 4UUAA 3UO8B 3I4CA 4JJKA 3FOWA 3G6KA 5GM1A 4EZIA 4O4HA 2P4QA 3LU1A 5FULA 3V7UA 3KPUA 3WDSA 1DO0A 1Y89A 2BE7A 3I83A 4Q7EA 4LSWA 4BV2A 3QU4A 3KL2A 1BFKA 1ZIDA 2P27A 3FIUA 3SVZA 5JCZA 2NGRA 5D87A 3X0DA 4DUGA 4W5OA 3AVYA 3FSJX 2WM3A 2Z56A 4EPWA 1CQIA 3C74A 3WA7A 2OHXA 1UADA 3FUVA 4MKIA 4NPCA 2I2AA 5HKLA 1OXSC 3QWIA 5TMBA 2QBYB 2DG2A 2YUTA 2IEBA 4P82A 1S0UA 1RRPA 1N5RA 1TRHA 4RIFA 4UHKA 3BMNB 1NDHA 2CHGA 5CUQA 2AI2A 1W4BA 4P93A 3RS9A 4JI2B 3DDWA 3E9EA 4O2BF 3VOSA 1BEUB 2GBFA 4P5EA 4UATA 3EQ2A 4WOPA 3RS0A 1D3AA 1W2WB 4WLUA 1KJZA 3ACCA 3U4DA 3LYHA 3TD2A 5BMVF 4QM7A 5AM1A 2VHWA 2ZBEA 3FTFA 1NW5A 1U7ZA 1YDGA 2HSZA 2O2HA 3BIXA 3FDZA 3E22B 1JGTA 1AKUA 4HNQA 4QDZA 1DX9A 1DLJA 2PSDA 1WPXA 3P32A 4IOKA 4JMPA 1Z25A 3ZGOA 2ZI5A 5DCLA 4YRMA 1QQBA 4PBSA 1OA0A 1P7ZA 3K9BA 5LZ7A 3WBBA 1Q77A 1P8JA 2HI0A 1T2AA 4NNJA 4R6XA 1AQLA 3TZEA 4I3FA 2AN1A 3VR4A 4B9AA 4DIDA 1NPYA 3DZHA 4PVCA 5INTA 2WM8A 3LQ1A 4WN3A 3TTSA 1LTHR 2XQIA 1SB8A 3T34A 5B12A 2GCOB 5ALSA 2R8YA 4B6FA 4GRAA 1YK1A 2DH6A 4L5CA 4M1QA 2FG5A 2OGSA 3O9ZA 3RBZA 1CB7A 1OC4A 2DKNA 4Z0HO 1OPRA 3GJYA 2RHTA 3CRRA 3RU2A 3JRXA 3VSCA 4RE5A 1W5FA 5KVCA 1W93A 4Q1AA 3BXEA 5ILGA 1K3UB 4B6RA 4HUQA 2IOYA 5D5QA 2NW6A 4ZHQF 4AMZA 1RI4A 5AM5A 4F7DA 1R8QA 1PJBA 1ZGZA 2OHOA 5CLHA 4YNBA 1F5NA 2IBSA 4GL4A 4EHHA 5JOQA 4JXKA 3HYLA 1WKVA 4ZEWA 2F2TA 5TB5A 4XASA 2XUIA 5IC4A 3JSXA 5AK0A 1E2JA 3O4VA 3WQBA 2CF6A 1P7CA 4O2AF 3TSYA 1R9GA 4OUKX 4LN1A 4F0JA 2WP8J 2P6OA 3U3DA 4I50A 3IIKA 3KVNA 1VTKA 1FVXA 3RSOA 3WIVA 1HQDA 2XYVA 2ZETA 2W7TA 2QD3A 4X63A 1NNLA 2RGYA 2B0CA 3HO6A 4INZA 4S1OA 3FZEA 3FSEA 1NBMD 3HSSA 2ORIA 5T8KA 1Z2PX 4G56A 1PS9A 3AIKA 5JTUA 4R81A 1T9GS 4CTKA 3R24A 1J2RA 4EPXA 3OLWA 2AFHB 4PZUA 1RVDA 1S8AA 3EGOA 4S1VA 5K3FA 4ZQEA 1YS2X 3C15C 3WLJA 4F4CA 4L2IB 2V4MA 3NBZC 1B93A 4O33A 1HEYA 3QSGA 5B6IA 1IVNA 2AUMA 1FNDA 1SELA 3P0JA 4HNVA 2NOAA 4G4GA 4X91A 3THSA 2SCUB 1RXEA 4FFLA 2GXUA 5C5CA 5KPJA 1ZZEA 1SC4A 4TLCA 3CS3A 4A2PA 4F3RA 1WUKS 3AFGA 1HZZC 1MC5A 4KN5A 4X6YA 3BUSA 5K6RA 3G5TA 4KGXA 2OD2A 3LPMA 3PJGA 4G4JA 2PT5A 3P8ZA 3ZBQA 4RVDA 4ZYZA 1WXXA 2HJRA 3JWPA 1ML3A 3S99A 3TOSA 3ZTTA 4HWPA 5E3IA 3DS8A 4LY3A 3GDWA 1PLLA 1AGRA 3T5DA 3TTXA 3U49A 4GT1A 2PSHA 3F8TA 3GJ6A 3KQSA 3LO8A 3LZCA 3L43A 3R4VA 2WHXA 1CUIA 2YIVX 3EXIB 3NBYC 3DLPX 1E3MA 2LNDA 1TPYA 4KDCA 2D2FA 1VJ5A 3HEAA 2XGGA 4HUQB 1JHPA 1TYAE 2IH5A 3BSYA 3OJWA 4ZZ2A 1LI5A 3L6OO 4J6FA 1YFKA 2Q3LA 4ZXFA 1KSGA 1J56A 2PS1A 3NJ4A 3HXKA 2X14A 1JILA 4P35A 1UXOA 2F90A 4EENA 1ZDMA 2KPOA 4N3GA 1DT3A 5JDIC 2DFLA 4FNAA 4WKCA 3OZSA 4DFDA 5AW4A 4B3CA 1Y7HA 2IVZA 1GPKA 1X1BA 3R3ZA 1ZP6A 3BH0A 1DMRA 1P0FA 1QLJA 3E35A 1GPWB 3P4YA 4II7A 3TIFA 3KAQA 3LCUA 5J3JA 1GHTA 3ES9A 2GPYA 1T0PA 2IW3A 4E13A 3SAJA 3TZHA 3ETDA 3MJFA 3OQBA 4YI3A 1U3GA 4R51A 3G2LA 1NR1A 4YRJA 1N1EA 2SKDA 5TGDA 3QVWA 2PH3A 4ENQA 4NXMB 4O0MA 4TYMA 5BR8B 3HNOA 4YJFB 4PLGA 1DX6A 1P45A 3EZLA 3O1HB 3RVKA 3TAUA 3VDXA 4CUKA 2JH8A 3FX2A 3NYIA 4WZAB 1E2FA 2JGNA 3CCFA 3KHKA 5AK4A 4N01A 4DLXA 1JL3A 2XE8A 1B8OA 1RLTA 2EZ4A 2F7SA 1VMAA 2OAP1 2GM4A 1DRWA 1VRVA 2YASA 4LOKA 3SIPA 5L45A 2AOWA 4LJYA 4OLBA 2A67A 3V1NA 5IEJA 3D81A 1OB5A 4Q7QA 5AOAA 3SYTA 5J1SB 3CJQA 4KLZA 1PJ2A 3QLUC 4E6PA 1PEKE 1XD8A 3FWHA 2JFXA 5A5GA 5CJJA 5ALEA 1DI0A 4NENB 2QLTA 4CMHA 1M75A 4UXHA 5KWIA 5KVAA 3QEMA 5ISMA 2V1XA 1GNSA 3FG9A 4XXHA 5KAPA 5KX5B 3W6OA 4J2TA 3IP3A 4IXWA 1WTAA 3UPUA 2P5UA 3DFIA 3PE3A 3AF6A 1C4WA 1D4AA 3G1TA 4P8RA 1GG8A 3V34A 1VHQA 1N4AA 1H9AA 3KAPA 2HQSA 2C54A 5AW9A 1Y1RA 2ONJA 1QB8A 1ZOLA 2X0IA 3C6ZA 2JFFA 1NJSA 3VC1A 2K87A 1IE3A 5TX7A 1QFYA 5AW3A 3U5ZB 2I1WA 3KB1A 3CJTA 1RXIA 2HFKA 3GXBA 1ZGCA 3AW8A 1X70A 4N4AA 3DOHA 1ICIA 1NLZA 5FJIA 5JS2A 2YWEA 1VKJA 1L8OA 1YE5A 3EUWA 4EPRA 1FP6A 1W75A 4ETWA 1FZQA 3JTEA 1UINA 4UOZA 1U3TA 1L8QA 3PGXA 4H1UA 4L3VA 4BMVA 1D07A 1D8TA 2B21A 4CUZA 3W06A 3DHEA 3U7EB 5EQFA 3WDKA 4L9RA 2A0UA 1BQ4A 2FY8A 1CF2O 1K06A 1SZJG 1CK4A 2IXFA 2V6BA 3NTLA 5EWMA 3K0BA 4O02B 5P8WA 3HCCA 4KRFA 2PWPA 2Z1DA 1SXQA 1GYPA 4WOKA 2IUSA 1E2IA 4IW3B 1G7TA 3M6AA 1KQOA 3DEJA 2R6DA 4ZOBA 1Z75A 3OU6A 3BFVA 4LZAA 2LIVA 1VHWA 1E2UA 3C85A 4JU8A 3E9DA 4TTRA 1OXTA 4B6SA 2VJDA 2C5GA 3GEEA 4GEGA 4MYDA 4IWXA 1T4DA 5EJ9A 1EINA 2ZWOA 1Z0KA 3TUIC 2JFBA 1PTKA 2QKYA 1XOIA 2QTNA 1O9GA 2QY6A 2ZZKA 3RGGA 5KINB 2IIBA 3IB6A 3O6VA 1KIAA 2R7NA 3QQ5A 4GE0A 1NC3A 3Q85A 5HJ7A 4YCAA 1UXKA 3MN1A 3NHLA 2QI9F 3RRYA 1IN4A 4RYDA 3V3TA 3N7UA 2B2CA 2YWBA 4FOLA 1QYIA 1CWUA 4OQQA 3NB0A 4XIJA 4WK4B 2EBWA 4I50F 4ZARA 1KOGA 4HDSB 2ARKA 2Z4RA 1O77A 2PIAA 3H2IA 4WCFA 4YRCA 4YAEA 5KNBD 3Q0IA 3SSMA 3WGOA 1GPH1 2DC1A 3D59A 1NGSA 2WIGA 2X58A 1NBME 2FWJA 2ZDQA 2QVXX 1WPRA 3DEZA 1VM6A 1Y8RB 3DF9A 3WGUA 4C4XA 5CBPA 2IY8A 4EJ2A 4DCUA 1GRVA 1TM1E 2ZIXA 5KQMA 3D3KA 3T1TA 4XUCA 1EP2B 3PENA 3E3NA 1I6LA 2WPNA 1K9SA 2Z3VA 3U13A 4IVQA 5KNDD 2YYSA 1W7AA 2VKQA 4P3XA 4B82A 1XDWA 4PAMA 5JADA 1T2FA 3FCOA 4OM7A 4ENWA 4KR6A 3K9HA 2DZDA 1RD4A 4O25A 4PYIA 5KKCA 1MG0A 4UJ5A 4F85A 4HVAA 4LZWA 2IWHA 1D6JA 1IEWA 1SBZA 1IYZA 1NBWB 3EZ9A 4JC8A 3ZWPA 1RXWA 4J90A 4KFSA 2EZ8A 2NO4A 4ZMRA 3TF5A 3WG9A 1V39A 2GAOA 3SOZA 2FW6A 4TTSA 1SUDA 3EG5A 3SIRA 4LRYA 1W48A 3CLUC 4IOJA 4V0ME 4FS3A 3WL5A 5TMEA 3QPWA 4R1MA 3F9IA 4IQGA 4D9BA 3ZEAA 4RJTA 5KMGA 4KN9S 4UBOA 4PYKA 3M1YA 4A6XA 1XDSA 3SS9X 3THRA 5FH9A 4WNAA 4FYWA 4IMJB 4N3AA 5TJHA 4C0WA 2NO6A 4ZIRB 3SI7A 2PYZA 5FRDA 2PANA 1GYRA 2H7VA 1GUDA 3OHPA 3PXDA 2ZATA 4CEJB 1UMCB 4HFNA 4K9QA 2DF8A 2C2KA 1ADBA 4NECA 1P6XA 1DC7A 3W4JA 2H4FA 4UPDA 1G5QA 4QOEA 1QGUA 1NF3A 4KC0A 3IIMA 3QENA 3UAOA 1QVAA 1FW6A 2RIRA 2HC9A 4YWHA 1WXGA 2G1UA 1EIZA 4J1QA 3AR5A 1VQ1A 5AP9A 3MWJA 1J8QA 3L8DA 5FQOA 1RKXA 2VHYA 2ZDHA 2H1RA 4FR2A 4ZYYA 3TQTA 1WETA 3BF7A 2JI7A 1JHZA 4PPFA 2AWNA 3H2JA 1Q14A 4UBJA 3OCWA 5I7UA 3EH1A 4RABA 2Y99A 2HXGA 1XF1A 4PAWA 4HVCA 4FUQA 4UNNA 5EJGA 2HIHA 5I7AA 5B57C 4BX3A 2XECA 1L7OA 3ZHTA 1XVAA 2QU8A 1J8FA 3DOCA 5AVUA 5CLFA 2M1ZA 5JQGA 3OEEA 5JZOA 2B20A 2OECA 2QM7A 2WHYA 5JSHA 3HCBA 3ZV4A 3LFHA 1SBCA 2FWNA 3DXZA 1CRLA 3BIWA 4KRYA 4QG7A 4A0GA 1N3BA 3K5WA 2FMFA 2AFVA 5AI5A 2Q1UA 5K2MA 4KO4S 1C80A 4ZQGA 3A26A 3FCCA 3QHPA 4NULA 2IXDA 2QN9A 5FQNA 5BNZA 2JVKA 5G41A 5KC8A 2QMZA 3KTOA 5CYPA 4P34A 1TUGA 2I54A 5I5GA 4EO7A 1GCIA 1J49A 2L69A 3G5UA 4LVNA 4XR9A 2ADFA 1XWWA 2ZU0C 3FNFA 4JIMA 4H0CA 5E9AA 4ZICA 2INGX 2ZIWB 5FD8A 5F64A 1UZMA 4BE4A 2EF1A 3ISJA 2PUGA 2JIZD 4R8SA 4DYDA 3OQMA 1B1AA 3SM9A 5ICGA 1CRZA 3ZWBA 1WNTA 5HJ2A 3UV7A 1GPLA 3RVSA 2M6LA 3GLIE 3BBPA 5FTMA 2R8ZA 2OXTA 2HU2A 2OA0A 4OHUA 4WESB 4BMYA 2JATA 4MV9A 2WWHA 4D0NA 4LOJA 3MRVA 2FUKA 1UMCA 4XH9B 1ZGAA 4GFDA 4A6DA 2O50A 3HA5A 1HKHA 3TPFA 1O97D 1UAGA 1F6BA 1GCAA 1E59A 3DMDA 2EJVA 2MYNA 4R2KA 4TWBA 2QUBA 3G9XA 4D42A 3ANXA 2REXB 4M6WB 2RSLA 5DP2A 5EHIA 1TFUA 3G0BA 4ILEA 3GCZA 3TZ6A 5K8VA 5JCXA 5KVVA 1TCBA 2XCUA 3V4SA 4G63A 4HGPA 1R0BA 5IJ0A 4NCBA 3F3YA 3SJCA 2FRXA 4IG9A 3E27A 4F9FA 1PR2A 1UZUA 5JLAA 3P9NA 4UCWA 2N3ZA 5KOJB 1EP3B 2AN3A 1TFRA 4HMPA 4RADA 2MSNA 4Q4JA 3UJ6A 2OOKA 1A72A 1OT5A 2XKAA 5BN1A 1V11A 2Q21A 1D6MA 4CCYA 1O9HA 3SQWA 1TMKA 3GZTB 3P2YA 2ZIVB 3U60B 1PQ4A 5D01A 2ZR9A 1LLUA 1PRYA 3EXHA 1ZM4A 5J4HA 2EP8A 2PJUA 3WV5A 4PZDA 3ZU2A 2ZRLA 1L5HB 3JD2A 2O3QA 2DXIA 2ES4A 1KEWA 3GQVA 2FEXA 4EYOA 4MV8A 1GG5A 4LSMA 1U0TA 5JALA 2DHRA 1ST3A 4U5XA 3NLLA 3A9CA 4XE5A 5LXTA 3PF8A 3IDAA 2GHRA 2D8MA 2VUSA 3KQMA 2YJ4A 4DLZA 1II9A 4EUEA 2PWBA 1AMNA 3DHNA 4BNZA 3O8BA 1SCAA 2BTEA 2R2AA 5BQXA 1ARZA 1HE3A 2BKEA 1ZEMA 2CHFA 1BGVA 4RQUA 1GFSA 4MI6A 3O8NA 1AT1A 3D2AA 2J3MA 4PN3A 1DRKA 4DMKA 3KPVA 4U7JA 3QQPA 4EK9A 1PV1A 3OPVA 2R9VA 2Y71A 2FQXA 1GN9A 1J7JA 3ITNA 4L3OA 4PQRA 3ZY3A 5JECA 1GNPA 1SXPA 1Z7BA 4NZNA 2V5VA 3BHNA 1PG5A 1XQXA 2Q27A 3FWNA 4TKVA 4LOAA 3PLAE 3OAAD 3DE0X 2VDKB 3OPQA 1WZ2A 1NVFA 2Q0SA 2RKWA 4HFRA 2J9RA 2X1MA 1C81A 5EXDA 4TSKA 4BU1A 4CV0A 2ZPAA 2ONZA 1F8GA 1V35A 2GA9A 3OE1A 4LDAA 2R1TB 4JI5B 3O4RA 1VMDA 4M98A 4EG4A 1JVSA 4EVQA 3DZFA 5JCOA 4NOMA 1AHHA 2VP4A 4F4FA 3EZ7A 3DG9A 1LFDB 3LHSA 4B48A 4E1AA 1WKCA 1UK8A 1DZ3A 5AJHA 2Z6UA 2EU8A 3ZDCA 3B2EA 4C7KA 3NHBA 3RABA 1EUDA 4EPTA 1GRRA 3W8RA 2OCKA 4ESHA 2SBTA 2ATXA 3DNPA 3U3OA 1WXWA 3COVA 3TOXA 3X43A 4IDDA 1W5BA 4AK9A 3E0XA 4EQZA 4FCCA 1DJPA 2A0FA 3GP5A 4OM8A 2HPZA 4RWZA 5EJIA 1PZEA 3AQ4A 3FMFA 2Q4OA 4RZUA 4IJMA 1YD7A 3SQXA 4Q3BA 3D1JA 4KAXA 4PNHA 2QN2A 1UWCA 4WZBA 5F3WB 1PJRA 3EC7A 2Z9BA 1OGJA 3OOSA 3RS4A 1VOTA 2ZT8A 3MNFA 4QXQA 3TRDA 1PVVA 2PZGA 1GL9B 1N1DA 2PRJA 3PQFA 1NF8A 2XA1A 4C22A 3I8XA 1O9BA 5CM9C 2IOFK 4TL8A 3LY7A 1FMTA 3V4FA 3O74A 3A1UA 2ZWIA 3LPDA 4GM4A 4OFZA 3VVCA 3GLRA 3SXJA 2QD2A 1CHNA 2GS9A 3ZWKA 2XDQB 3UW3A 1Z6AA 1X19A 3E6AA 3ZV3A 5JAMA 2C8LA 4D81A 2Y1OA 3QUSA 1WLYA 3LDAA 5FORA 1ZC3A 2YZNA 3OKPA 2H2GA 3F5MA 4KU4A 4F45A 2O8CA 1G4UR 3I76A 2V7WA 2OEPA 2JLBA 4J0EA 1ZHHA 4QNNA 1CNEA 1CJUC 5JISA 4YGXB 4ALLA 2NZ8A 1MJGM 3P0EA 4GBGA 3DCNA 2JIDA 5DVZA 2IODA 2JIBA 2JBHA 3FDFA 5GP1A 3ZV6A 4QODA 5EQTA 4QVKA 4KPYA 1C7QA 2OLKA 3G88A 2JFGA 2NV0A 4EB6A 4CKXA 1DBQA 1EFHA 1W59A 5ESRA 1KETA 4PHGA 3P5SA 3LQFA 4G85A 1WLSA 5ITWA 4GKBA 2QPTA 1FDWA 2XGMA 5C8VA 2ODEA 3Q7PA 2AG1A 1GTG1 4KQCA 4DM3A 2V7VA 4YAJA 4HYTA 2R48A 4XUGB 1G0NA 1VL1A 2FP4A 3MAGA 3T7KA 4D56A 3R8CA 1KYIA 1SB9A 1XZEA 4C03A 2C7QA 3Q8LA 1YE8A 1BCRB 1WY5A 4P3KA 3LUPA 1QHXA 2PZBA 1X1DA 4F92B 3M81A 2HF8A 3HJAA 5HE8A 4JVLA 4ONEA 1KAOA 1L5QA 4GP7A 3V00A 1ILWA 4CQMA 5LKRA 4B4WA 3BWCA 3PBKA 1DTEA 4JELA 4JLPA 5HDQA 4LFCB 2ZTSA 3RF6A 5J2UF 5IBQA 2IYRA 1IN5A 1OHHD 4J03A 1PJ8A 2GBCA 1UJ2A 1N0IA 2WP0A 5EFOA 3C3EA 4JITA 4LRTB 5J2TF 1B7GO 3DA8A 1NIPA 4X54A 4DQKA 1QFZA 3AB3A 1D2EA 1SQGA 1YVEI 1IDN1 2O14A 2VDWA 1O96A 3DGFC 3IP6A 3WX0A 4F5WA 5IH7A 1BYIA 1X0XA 2BHRA 2IYEA 4WH0A 1ZONA 2B4AA 2B1JA 4R05A 3PYLA 4DR2B 3RIXA 2EWVA 1V47A 4DM7A 1LDYA 2EYUA 3B53X 3IOMA 2E0IA 4N9WA 4PAOA 5AKZA 5GAJA 4DJTA 3S55A 1M5TA 4IH4A 2B5WA 3VAAA 4YJHA 1P2BA 4GF5A 3S7TA 4G2NA 1SN7A 2GZ2A 3PHHA 4XTRA 4PNZA 2GPNA 4P3NA 2QVGA 2P5YA 1MH9A 1UDBA 2YDXA 1NL3A 5ED0A 4DKXA 5JANA 2D13A 2L82A 2HOQA 4AJ1A 1IVYA 3DBHB 2I22A 3I92A 3SG0A 1PJQA 3UV3A 3WKAA 5ALWA 2Y1DA 3PXBA 4U3JA 3O83A 2BMWA 2VYFA 4CKEB 4MWOA 5FIUA 1RWQA 4RVNA 1PG0A 4ZALA 3JYOA 3EJ6A 3OJCA 4D8VA 3UG6A 1XFAA 4BX2A 3W9BA 2E21A 1Z4JA 3LX4A 2EAUA 4NHOA 3TRFA 5CDUA 3GT0A