4GOLD

Crystal structure of e. coli dna adenine methyltransferase in complex with methylated aza-sam
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
268
structure length
243
Chain Sequence
KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDASVVYCDPPYAPLNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVDELLALYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA adenine methylase
publication title Structural Basis of Selective N-6 adenine methyltransferase Inhibition by Transition State Mimic
rcsb
source organism Escherichia coli
total genus 83
structure length 243
sequence length 268
chains with identical sequence E, F
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4golD02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4golD01
2AR0A 2P7IA 1RJFA 2AS0A 3FTDA 1SQFA 2YX1A 3B89A 1EJ6A 1P91A 2ZIGA 2BM8A 5K09A 3GCZA 1JG4A 3FYCA 5D1NA 1WXXA 1QANA 1F3LA 1UIRA 3MTEA 2B2CA 3R24A 5FULA 1SKMA 3LHDA 3P2KA 1NV9A 4RVFA 5EKUA 2B78A 5FHQA 1D2CA 2PVCA 3C6MA 3S68A 1NBIA 2FK8A 2KW5A 3FPHA 3BGDA 4E2WA 3DP7A 5BW4A 3UBTA 3R3HA 3BT7A 4KDCA 3THSA 3NMUF 4HTFA 4QDKA 3THRA 3JWJA 2YXEA 1YB2A 4RYLA 4GQBA 4O29A 3P71T 3KR1A 3EGEA 1NE2A 3BWCA 1RJGA 5DTMA 4RTMA 1VQ1A 3SM3A 3UJ7A 2YUIA 3HCFA 2JG3A 2CMHA 2QRVA 3I58A 5F2KA 3UZUA 1V39A 3LDGA 3QV2A 5B1SA 5EOVA 4DA4A 2NNWB 2AOUA 2Y1WA 1JQEA 1DUSA 2Y1XA 2ZWVA 4OX9Y 4WVLA 2Z6UA 4RV9A 2ZFUA 3AXSA 3CBGA 4YUYA 4CTJA 1MHTA 3QOWA 2IBTA 3GU3A 3G2PA 1WZNA 4POOA 2ZZNA 3B3GA 1ORHA 2OB2A 5EZSA 4E31A 2XBMA 2E5WA 2PX8A 3GJYA 4OQEA 1QAOA 5FQOA 4EKGA 2G72A 3ME5A 4HTFB 3NWEA 3ELYA 2YTZA 3EVCA 4G56A 2ZSUA 3VC2A 1HNNA 3CC8A 3NJRA 3E7PA 4BY9E 2ZIFA 3MERA 4A6EA 4QQNA 3PT9A 4BP1A 2GH1A 1L3BA 1IM8A 5DTQA 3KU1A 5K0CA 2ESRA 5DRTA 4DMGA 3HVIA 5FADA 2PGXA 1Q0SA 2P35A 4RVHA 5BP7A 4K6MA 5EEGA 2BR3A 3KQOA 4PYNA 4DF3A 5E9QA 1WXWA 3MCZA 1AQJA 2V7EA 3GRUA 3GDHA 3PX2A 4QPPA 5T6BA 5GINE 1VE3A 3KR0A 1L1EA 3BKXA 5D1HA 3M6WA 4Z2YA 2R3SA 1IXKA 5DX0A 4DQ0A 9MHTA 3MHTA 1QYRA 4IWNA 4U7TB 5JR3A 5HIMA 3R6TA 2IBSA 5HIJA 2IFTA 5G02A 1XCLA 1NW7A 2QYOA 5FWDA 3TFWA 3M33A 3FPJA 3AY0A 3NVMB 5EIWA 4FZVA 5HIIA 1BKYA 5ICEA 1U2ZA 3KKZA 3GXOA 3OE4A 3GGDA 4M38A 5HILA 5EMLA 3BWYA 2LD4A 2FHPA 3KPUA 3P2IA 5DSXA 4OBXA 2ZTHA 5F2NA 4MHTA 4MQ4A 1ZG3A 5DM4A 1X1CA 5M5BA 2P7HA 5FWAA 5FUBA 1SVUA 2I7CA 2O06A 2ONYA 1XDUA 3LCCA 2CMGA 4DCMA 3JWGA 2NYUA 1EG2A 2BM9A 1X19A 4EVIA 3ER9A 2OXTA 1YZHA 3C3YA 2WA2A 5K03A 2CWWA 2PBFA 4YV2A 2HNKA 2YVLA 4UOEA 3HCBA 3ELDA 1FBNA 2EFJA 4RTNA 3EVGA 4ZTBA 3KPYA 2QY6A 3GWZA 4ER5A 3TR6A 5K01A 2P3LA 3A7DA 5E1OA 2YR0A 4HC4A 2ZBRA 4FGZA 5E8RA 4JXJA 5EQJB 5FA8A 2IH5A 1JG3A 2O0LA 3G8AA 2PLWA 2HR1A 4CKEA 2G8NA 2YXLA 3DOUA 3EMBA 3IEIA 3UFBA 2HWKA 4PIMA 4YMHA 4RTPA 3WSTA 4RTQA 1SQGA 3VSEA 3O31A 4F84A 4HSGA 1JTEA 3G2QA 2C7QA 2OBFA 5LR6A 2O57A 3KR2A 3P8ZA 4PGGA 5F2OA 4DZRA 5FHRA 3OU2A 1RI5A 2Q41A 3DULA 3IV6A 1AQIA 2BZGA 1R8YA 4HG2A 5HFJA 5LQJA 1L9KA 2OB1A 3LX6A 4OQDA 4PWYA 5EZQA 3PS9A 2NXEA 4GC5A 5CVJA 3T7SA 5MHTA 3MQ2A 5E9WA 1SG9A 3EVEA 5K0JA 5HEKA 4CXMA 1Q0TA 3EGIA 3LCUA 3JWHA 1YUBA 5LQKA 1BOOA 1RJEA 2PY6A 3OU7A 2Z6QA 2AOTA 3KQWA 4IKPA 5FA5A 3AWIA 4AX8A 4HRAA 1D2GA 2PT9A 1PRYA 4R8RA 4E30A 3A7EA 5T64A 2ZZMA 3KQMA 4C04A 4E2XA 2I6GA 1VBFA 4YUWA 2GA9A 1SUSA 1RI2A 2A14A 1KYWA 2I9KA 1B42A 3FYDA 4HGZA 3E8SA 5GM2A 3VC1A 3P9CA 3LPMA 4ER0A 1UFKA 5KQSA 1L3IA 2P8JA 1P1CA 4FP9A 4KIGA 1D2HA 5P8WA 2FPOA 2IPXA 2XYRA 5CVDA 5EKXA 3SVZA 3T7TA 4GOLD 1FP1D 4FS8A 1NW8A 4OA8A 5EMJA 5CVUA 3EEOA 1JQDA 2NXCA 5K0EA 2NP7A 3NVKI 1JQ3A 1KHHA 1FP2A 3C3PA 4IV8A 3RW9A 3BGVA 5ICCA 1VLMA 3IHTA 4OBWA 2JHPA 1I9GA 3TKYA 2OPBA 3FPEA 3QOXA 4M7RA 1NW6A 3TMAA 1AV6A 2DULA 3KQVA 5E1MA 5DX1A 3SMQA 2IH2A 1G55A 1VPTA 2IH4A 3GRYA 1EIZA 3EPPA 4P58A 1WG8A 3P9NA 4PINA 4ER7A 3DLIA 3SR4A 5JUWA 2PXCA 1HMYA 4H0NA 1Y8CA 1DCTA 2AOXA 3BWMA 3MCTA 4AZTA 2C7PA 4RTOA 3C0KA 1NW3A 4YUZA 3OZRA 4DCGA 3V97A 2P3OA 5LQRA 4PNEA 3FTFA 4X63A 3DMFA 1KR5A 4RTLA 1N2XA 1NKVA 3SX0A 4PYQA 1KPHA 1KXZA 3O4FA 1R00A 4R6XA 2BH2A 4M37A 4AZVA 4X1OA 2QRVB 3EVZA 2G70A 3HVJA 3PX3A 3UJ6A 1KYZA 2AN4A 1YF3A 3BKWA 2AOUB 2ZBQA 3EVFA 1R8XA 4FSDA 4U7PB 4E70A 5E9JA 3FPGA 2FYTA 4MTLA 5DM2A 1TPYA 4L7VA 2AZTA 3HA5A 1R18A 3DLCA 2V74B 3M4XA 3PFHA 3RODA 4XUCA 3UJBA 1VP3A 2PX5A 3CJQA 3G8BA 1VP9A 5BW5A 3G5TA 3M6XA 2HMYB 3ID6C 2ZZKA 2HV9A 3F4KA 2ZULA 3KHKA 3KQPA 4KRGA 5LQCA 2HTEA 2FCAA 3DXZA 5K8VA 2CKDA 3G89A 1ORIA 3L8DA 3CGGA 4RTKA 5DPMA 3I64A 2ZCJA 1XXLA 4NECA 2PWYA 5U4XA 2JHCA 1ZGJA 3TLJA 4AUKA 3EMDA 3DMGA 5KVAA 3UJAA 5LQNA 4PYJA 3CKKA 3KQTA 3EVAA 2XYQA 3BWBA 3BZBA 2PXAA 5ERGB 4IV0A 2B3TA 4WXHA 4CKBA 4E2YA 2ZBPA 1XTPA 3FRHA 2GAFA 3I9FA 1QZZA 3PFGA 4QTUB 2JHAA 5K0FA 3OZSA 5CUQA 1G8AA 1JG1A 3A25A 1EQAA 4XCXA 2FRXA 4P7FA 3KR9A 2C7RA 4AZWA 1XVAA 3TM4A 1MJFA 5HIKA 2EG5A 4PCAA 3CJTA 1AF7A 5ICFA 2I62A 2WA1A 3TPZA 4EMSA 2DPMA 1R6AA 3SXJA 5FCDA 1OR8A 1O9HA 3KQQA 1G6Q1 3MGGA 4FT2A 1Z3CA 4V0QA 4Y2HA 4HH4A 2JH8A 3T7RA 4CWAA 3R0QA 4LG1A 3PTAA 4DKJA 4KWCA 5DT2A 1NBHA 2IDJA 1F38A 2GPYA 3DH0A 3PVCA 3T0IA 4EKIA 3LECA 2Z6AA 2AN5A 1NV8A 5GIPE 2BR4A 2O07A 5GP1A 4KVZA 2VDUE 3LGAA 4RX1A 4FR0A 4QTTB 2ZVJA 3LDUA 3OPNA 1M6EX 3KPWA 4PYLA 1RI1A 4GUAA 5EIFA 3V8VA 2VP3A 3HCCA 4KW7A 3ELUA 4X61A 2CL5A 1RI4A 1T43A 3AJDA 4CTKA 3K0BA 2JH9A 5C1IA 4E2ZA 3REOA 2ADMA 4M36A 1YFJA 3E05A 5C0OE 3R9XB 3EGVA 3FUTA 5EPEA 2P3QA 1KIAA 1ZKDA 3HEMA 2OKCA 3G7UA 5E1BA 3BUSA 4E33A 3OU6A 5GWXA 3G5LA 4R05A 1N7JA 2B25A 3P2EA 3ELWA 3NTVA 3JWIA 3LKDA 1O9GA 4YV0A 2ZLBA 5DLYA 1KPGA 2PSSA 5CCXA 3A27A 2WK1A 3HVKA 3NDJA 2C7OA 2VDWA 3IYLW 5KQRA 2GB4A 5BXYA 5H02A 2PWPA 3KPVA 2IDKA 3FZGA 5EMKA 4A6DA 3HCEA 5DRYA 5DM0A 1WY7A 3LSTA 2B9EA 4RTJA 5DWQA 5DXAA 3OCJA 2YXDA 4PCLA 5DM1A 2PJDA 3LBYA 2UYQA 4F85A 4PIPA 5K0GA 2NP6A 3NW9A 1DL5A 4PYIA 5CD1A 2H00A 1G60A 5LQAA 1FJXA 2PV0A 1UWVA 2VS1A 2ERCA 3ORHA 4QQKA 3HVHA 3G88A 2AOTB 5DTRA 5C9ZA 4P7KA 1TW3A 1QAMA 3DMHA 4MWZA 5GM1A 3SSMA 1RI3A 3I53A 3SGLA 1M6YA 1JSZA 3D2LA 3UJCA 1EJ0A 3Q87B 4C4AA 2PKWA 3A26A 3ERCA 2XVAA 2OO3A 3FUUA 3A4TA 3EEYA 3C6KA 3DXYA 2PX2A 3GRZA 3M6UA 3KQYA 5EC8A 2OYRA 2OZVA 4QPNA 3M6VA 4QDJA 5EG5A 3AXTA 3Q7EA 5EEHA 2R6ZA 3X0DA 2G71A 1H1DA 2P1DA 1NT2A 5IH3A 3TQSA 1VIDA 4PONA 1TW2A 2IP2A 1EAMA 1QAQA 5K05A 1M0EA 2N47A 1X1BA 3P9IA 2VDVE 1FPQA 3B3FA 3TRKA 2EX4A 3LBFA 5IKMA 2O05A 3B5IA 4FSXA 4GBED 2VZ9A 3VYWA 1O54A 2AN3A 4R6WA 1KPIA 4GOND 1N7IA 3UA3A 3CJRA 1P39A 4P7GA 4BLUA 3P9KA 5LSAA 3KPJA 4YUVA 4BLWA 5E1DA 1RJDA 3GRRA 1INLA 4DM3A 2EJTA 5FTWA 3PB3A 4ISCA 3FTEA 3B7PA 1ZQ9A 3HP7A 3UJDA 1JSXA 5T67A 5EGSA 4YUXA 3PLAE 3KQSA 3MB5A 4GOMD 1I1NA 4KDRA 3RIEA 3FUXA 4PYOA 3EVDA 5LQUA 8MHTA 3E23A 4RVGA 5E2AA 3GIWA 3P97A 4C06A 3FRIA 2NXNA 3HTXA 1KP9A 3MAGA 4LWOA 3OFKA 4C07A 2IIPA 2UYOA 2F8LA 1XCJA 5E2BA 1YFLA 2YQZA 2JJQA 4CKCA 3NDIA 4ATNA 1XDZA 4RSRA 3DXXA 4FT4A 3BGIA 4BLVA 4ER3A 2XYVA 4GEKA 5EMMA 4R8SA 4QVGA 4LWPA 4Y30A 3SSOA 4GC9A 5DXJA 2UYCA 4V0RA 3HM2A 2ORED 3NWBA 5CM2Z 3K6RA 2H1RA 2G1PA 5ICGA 3UJ9A 1BHJA 4XUDA 3MTIA 5E8JA 5KYGA 3TM5A 2OY0A 4B17A 3CVOA 2AOWA 3FTCA 5K0BA 3HA7A 2NXJA 2ZIEA 3GRVA 3FPFA 3I5UA 5HOQA 2P40A 3GNLA 3B3JA 4PGHA 3GO4A 7MHTA 4ER6A 3UA4A 4GF5A 2QE6A 2GLUA 5DX8A 1JTFA 1XJ5A 4HGYA 1ZHFA 3H2BA 1PJZA 2PT6A 1L3CA 3DTNA 2EJUA 4LECA 4BP3A 4F86A 10MHA 2K4MA 5EHIA 5GIOE 3EVBA 4QVKA 5CVEA 3G2MA 4C05A 4XUEA 2IGTA 1G8SA 3LDFA 5FQNA 2AVDA 3OFJA 4EK9A 4KIFA 5CIYA 1X1DA 2GS9A 3HCAA 3OZTA 2BR5A 4C03A 1SUIA 2ZW9A 3TOSA 1JG2A 3CCFA 5CVVA 4OA5A 3M70A 4X41A 3G2OA 4P7JA 4PYKA 5K0LA 3BXOA 4RWZA 3LCVB 4X60A 4GOOD 4EQZA 2PX4A 1YZ3A 3HCDA 1G38A 5CCBA 2ONZA 5EVJA 1ZGAA 5K0NA 2H11A 3SSNA 3TKAA 4YV1A 2FK7A 4C08A 4RTSA 1X1AA 2XVMA 3DUWA 2UYHA 3HNRA 4AZSA 2ZWAA 3UWPA 4RTRA 2P41A 4PYMA 1JR4A 3ER8A 3O7WA 5EHGA 1WS6A 1XDSA 3HA3A 4MIKA 4E32A 1BC5A 1VL5A 3LL7A 5DSTA 4RVDA 4YMGA 3FUWA 5KS2A 1I4WA 1P1BA 3LKZA 2AOVA 3U81A 3DR5A 3UJ8A 2PXXA 3FUVA 3ANXA 1R74A 2AVNA 2UZ4A 1IY9A 3OE5A 5GOZA 2QM3A 5HZMA 1NW5A
chains in the Genus database with same CATH superfamily
2GEBA 2PUAA 4YRBA 5KOYA 1MO4A 1QTNA 2BM8A 5CH3A 3KJGA 1DBQA 1QQ6A 4Q9IA 4QXAA 1G5FA 1ONPA 2QN6A 4I5IA 5D01A 4C2UA 3S5UA 2WSSA 3E2IA 2D1TA 2O8EB 1CP3A 3E03A 2GZ2A 4KNVA 4NYJR 3SICE 2IXGA 1PJ4A 3ORFA 4CL2A 5BW4A 3K4PA 3E7XA 1JYFA 5ALGA 1VKZA 1JW9B 2F43B 1U0RA 4HLCA 2WVGA 4N5IX 4V0ME 3NWPA 2ZE7A 1JEYA 5DTMA 4XX1A 4DXDA 1XFAA 4LS3A 1V39A 5I3CA 1KEEA 1C7JA 5DHPA 4CVNA 4R2KA 1DUSA 2QLTA 1ZPDA 3PWSA 5JAHA 4Q3DA 3LXUX 2A0KA 4BYGA 1OXTA 2ZBVA 1E1QA 4UEWA 1Q5PA 3QXGA 3GLIB 2ARKA 1G21E 1YZNA 3GA0A 3KYDB 2ZWIA 2VYFA 3GGPA 5LBTA 2DPYA 1UXOA 4RKEA 4DDMA 3H6HA 2IBTA 5LM3A 3EFHA 4FKZA 3LC7O 2ZRQA 1VKJA 3LG2A 2OBBA 3O90A 1W9HA 2WYUA 4TQ9A 4UDOA 2AXQA 1J9EA 1QAOA 1TPZA 1U80A 2YXBA 1PJCA 4YASA 1N2EA 5DEIA 1KJ8A 2ZSUA 1ST2A 1OWPA 1I2MA 2WMYA 2XDWA 1WF6A 3GY0A 1NLYA 1RQ2A 4I5FA 2BGTA 3BMXA 4UTPA 4DDVA 1T9HA 1JHYA 1AHIA 4DMGA 4W8OA 4RM2A 3SXPA 4G1CA 2XUKA 4IIYA 1X1QA 1XCBA 2PFGA 3R3VA 2FXVA 1DIBA 4QJIA 2IYFA 1GPWB 1AQJA 3WDKA 4Y2QA 4HYTA 4D97A 1DOAA 3A9TA 1J97A 1USKA 1SCKA 1T10A 1UDWA 3BMCB 1WDWB 2EWMA 1U8UA 2ZRGA 3TCNA 2RHCA 1XLVA 1UANA 1Z7BA 2A5DA 4K6HA 2VQ3A 1XN4A 4M0KA 2P9HA 4YFYA 2AL7A 1TGVA 1MXHA 4QUBA 3CLUC 3OD5A 1Z2NX 2HPVA 2IYQA 2UVQA 1QYDA 2V6IA 1FB5A 3IT1A 4KSYA 4DUZB 3PUZA 4DLAA 4ABYA 4Q1CA 4DRZA 1AKUA 3P96A 4XDGA 4HYQA 4NMXB 1ZL0A 3AWDA 4UMFA 4EGAA 1JNXX 1UADA 4ETIA 4X66B 2HA4A 3JASB 5LP6C 5DMHA 4BNVA 1O6FA 4EFKA 3GGGA 3BXFA 3N07A 3TE6A 1B7GO 1WCIA 1Y6ZA 4BMSA 4HI0E 1UJ2A 3WIOA 1FSFA 3OE7D 4RDXA 4UNNA 5CDFE 3JU3A 4LIPD 2IOFK 5L3ZA 2VHWA 2EJBA 5KNCD 2ZRCA 4KQXA 4EZEA 1MX5A 4KKVA 1XRPA 3FNQA 2P9FA 2QTFA 4JLJA 4YXFA 4INZA 821PA 3TTYA 1GKIA 4PNPA 4YR7A 4N6OA 1GXSA 3T54A 1DKPA 2ATEA 3M1IA 4RE5A 5LD2C 5ALFA 1Q19A 3UH1A 3L4JA 2W8BB 1CJBA 2AFIA 2F8SA 3DFIA 3CZ4A 4XLZA 3WGOA 4EPVA 1VI2A 4QU5A 2OFPA 4FIZA 3EVGA 4J3JA 3K05A 4HYEA 4PSDA 2II6A 1RYEA 1G66A 1OBHA 1DKQA 1CDDA 1ZN7A 2PZAA 4R1TA 3E9MA 5DP1A 4YMLA 3O0DA 3BWEA 2CV1A 5DHRA 2CLFB 1J90A 4YXWA 4IYRA 1TQDA 1SD5A 3K6KA 3IQWA 2L17A 3TLEA 1ZIYA 1EHIA 1ZH4A 3TQIA 4RTPA 1KETA 3DZHA 3I9OA 3UO8B 5EN4A 3B20A 3F0TA 5FOXA 5IZCA 4D26A 4CFZA 1M2FA 3DB2A 4A8JA 1C9JA 1H1TA 3ZQ4A 2OBFA 3T5DA 3CISA 4DCNA 3MMSA 3IB3A 4PBRA 3WLNA 4GL2A 1KRXA 4ND8A 2GLXA 3OU2A 3TX6A 3VO2A 4TV8B 3CE9A 5FNVB 3EEIA 3KNZA 4Y6SA 3OZFA 3GFPA 3JQ7B 2J3EA 3PS9A 1ULTA 4J0CA 5EZQA 3URMA 2X7HA 5AW6A 3AV0B 1H0SA 1OX5A 3R0IA 5B2FA 2WSIA 5TX7A 2WT8A 1I80A 3MMPA 5D84A 3AUAA 3LFUA 3WMEA 2Z6QA 3EH1A 4HZGA 1DCMA 4E07A 5DHTA 1J0BA 1FUKA 1BD4A 2WJJA 2IYAA 1JEDA 2QTHA 3IX7A 4ZA2A 3NANA 3B2NA 4GMFA 2FWJA 3FCEA 3KQMA 1RXWA 3R76A 3OY2A 1I5EA 4KN9S 3L7BA 4X3PA 4ALKA 1TQ8A 3TNYA 1KMCA 2RKOA 1DMRA 2VPWA 3HH8A 4LY0A 4WBSA 3CF6R 2JLWA 4BMVA 1RAHA 1VFPA 1TIKA 3QIVA 4I50F 1RXYA 3V4LA 5BSKA 5EMJA 2QYSA 3O83A 4JAVC 4HRXA 1OI7A 4HPJB 4N6GA 3EEOA 5LC1A 3R23A 5JZVA 2X8JA 4KQ2A 4YAOA 3BPSA 3GMIA 2Y9PB 1QO9A 4P0PB 2ZU6A 5ICCA 5COAA 1W36C 4BO7A 2IYVA 3Q7RA 1P5RA 2QHXA 2E4UA 3Q3EA 2QMHA 5G4KB 4KI0A 4I5GA 5ILQA 3PXBA 4CIYA 2AH5A 1SBCA 3JQBA 3DD5A 1EI9A 3LOQA 5FPPA 1SZCA 3WGKA 1W25A 3WYEA 1JMKC 2H2DA 2XKBA 4HQRA 4JENA 1ONNA 4Z6KA 1IC6A 3E1SA 5DNEA 1O95D 1NW3A 2GX6A 1QU3A 4HWKA 1Y6GA 3F90A 1KY4A 4LHXA 2DZDA 1JEYB 3SX0A 4MRAA 1D1SA 4R1LA 1XIVA 4RUKA 1FRFS 4EYGA 1EFCA 2CV2A 1B0ZA 1QIMA 3QPWA 1JZSA 1IUKA 3OPVA 4TXJA 4U3JB 5A3SA 3CZPA 3PX3A 3HR8A 3IBGA 4TLLB 1KEEB 1MX3A 1YF3A 2R11A 3J7TA 1TVCA 1CJCA 4HGOA 4U7PB 1W35A 5JAIA 2HB6A 2HL6A 4PFQA 1AK2A 5E9JA 5DM2A 1TPYA 4M21A 4LZPA 3GH1A 3UJBA 1E1DA 1VBKA 2FPGA 3KTDA 4MI9A 2GFQA 1VP3A 2RAPA 1I7LA 4LJYA 3ZE6A 4F4IA 1Z12A 3T15A 3F8TA 1PSWA 4NQZA 1W29A 2PWBA 3M6XA 5HKLA 3QEJA 4GGPA 4R98A 4RENA 3ZZUA 4LDNA 2H9AA 5JD3A 1LF5A 2WUFA 4AICA 2VSNA 1XXLA 4HDMA 1WHTA 4AJPA 3TQTA 1X70A 3L7MA 4RPCA 1O57A 3O7MA 5FRDA 3TXAA 1T6BY 3KQTA 4GI5A 1PZXA 3HI4A 1XCOA 5J2UA 5ELXA 2H1HA 2P30A 3JD4A 5TE9A 1SH7A 2ANBA 3N6XA 1PSDA 1UF9A 5LMUB 5JADA 2XMZA 5TQVA 2VJCA 2I78A 3TLBA 1YVDA 1MVLA 1H69A 1TZCA 3ZNOA 5BSFA 3QWBA 2XNHA 1Y7LA 3NHUA 5K8IA 2OUIA 2O48X 4FD2A 2GD2A 2H1IA 3D0KA 4KFUA 4GE3A 1FMTA 2GUGA 2B8JA 2WJYA 4R83A 1MAVA 1PFUA 2QXUA 2BCJQ 4HB0A 4F4FA 3KD3A 3L8ZA 2PGJA 4IXNA 3OUTA 3NHBA 2J0VA 4M7PA 3A6LA 4RZHA 3W6OA 5JTUA 4MDEA 4OHMA 4UQOA 2R44A 5HCUA 3U7IA 5A6SA 1OR8A 4BPBA 3EUEA 2X3UA 5JANA 2QTWB 3OEYA 5DT2A 5ABPA 3L05A 2XXBA 3E9ZA 4GBGA 1T9GS 1WLSA 1TZMA 2CFCA 5D00A 4PG8A 2Y1CA 1LFAA 2Y0DA 2PTHA 1U8XX 3SHTA 1IZ0A 2FR8A 4NWIA 2PZJA 1S3GA 2RGAA 4GUAA 5FI1B 4CDNA 1MLDA 5AI0A 5BSGA 4KPUA 1ZHOA 4PW0A 1NC1A 4G1FA 4F8EA 5FYQA 1CRZA 2G0AA 2AFIB 3NV7A 2FSHA 1BCRB 1VYUA 4LQ4A 2HLHA 4NLLA 4RFSA 5EZ5A 4LYGA 1J2UA 1DEHA 1TCBA 1MZPA 5THQA 4KSBA 5EPEA 5L3VA 2P3QA 3AVWA 1IXZA 4F97A 2CDRA 1JQBA 1OF1A 2VDRB 1BRTA 1A9OA 1YBFA 3AB8A 2Q9AA 2IHJA 3ETJA 3ZJVA 1CJUC 3P4UA 1E1RD 4HEHA 4URVR 1VHDA 3SF0A 2PSSA 1OB5A 4GMDA 4EHHA 2J59A 4II3A 2C7OA 5FX2A 3GFBA 4G24A 4A8JB 5KQRA 4J0EA 2X22A 4LRYA 3WGHA 2GPAA 4L5AA 4MS3A 3ECCA 5H02A 4JJZA 4ND8B 2GRAA 2RDMA 3EUFA 3FRJA 4NAVA 5KWJA 4HJXA 3RM3A 2GF0A 3QFRA 3U1VA 4DV6B 1VIAA 5TQJA 4CMEA 2JBAB 2XB4A 1M67A 2R48A 1A98A 3I12A 4MJXA 1E77A 1AKYA 2OCBA 2QTCA 1DL5A 3DEZA 3QJ5A 4ENVA 4N47A 4DDTA 1DJNA 5LQAA 3MPUA 5CD1A 1X1SA 1N6HA 1C7EA 1UDXA 2VXYA 2WTBA 3RSLA 2C00A 2PMKA 4FTWA 4DADA 2MOKA 3L49A 4IEEA 2A5YB 2HWUA 4P83A 2QX7A 1WKCA 1J8VA 2NYVA 1JSZA 1SA0B 1UK7A 1ZD2P 3D2LA 2IELA 3GMSA 1Z6TA 4TN5A 5AR1A 3A26A 4LHSA 3ROTA 4DANA 1SCAA 3V2UA 1NI3A 3IVGA 3OUUA 2GA8A 3GRZA 3H5RA 4H7KA 4O63O 4DE5A 5AHWA 5CB0A 3KJQA 4UUBA 1XZBA 2GDZA 4GZ6A 3N2YA 2H1FA 4NU5A 2AFVA 2NAFA 2XMRA 1Y4AE 2A9FA 5BR1A 2Z1MA 2XCIA 1D6MA 2ZRBA 5JZ9A 3ZDRA 2J87A 2O0MA 2E6UX 4R1OA 4FHEA 3TGWA 3PFWO 4BFTA 1G8JA 1S4QA 4RXUA 3SCZA 3GFGA 1NVWQ 3L1JA 2P2ZA 1O54A 1ISRA 1QVVA 2R6JA 3FVTA 4Z4IA 1B0PA 4HFRA 3OLZA 5FOSA 3QI7A 4BFYA 1HUQA 4YUVA 4D0SA 2R8EA 4NH0A 1YE3A 1JDPA 1N2SA 1YDEA 1M0TA 4N76A 1G5PA 2NUAB 2PUJA 1CY1A 1EJ2A 4B6JA 3UPTA 1TU3A 3NTOA 2G5GX 3EFOB 1QJCA 2PIAA 3ILYA 1NSTA 3LQFA 4Y8VA 3ZWNA 4EWLA 1VJRA 1Z2PX 4L27A 4MUIA 3U6BA 4O2BA 3A06A 5EGSA 3Q4GA 1EDEA 5AVOA 3WLAA 4Z3OA 5DNYB 2BEUA 2WWVD 2Y67A 1OIWA 2G82A 1IPHA 4BJ3A 2J3DA 4QWMA 1JAIA 2DFVA 3C4VA 1Z25A 3PDIA 4K81B 1KXJA 4IFIA 4Q3NA 1GILA 1ZQ1A 4Q19A 1LQ2A 1GT91 2XMCA 4LWOA 5JXJA 2NIPA 1REQB 2H2FA 2QSJA 2UYOA 4ND2A 3I5AA 3DL2A 4OO3A 5LB4A 3KQKA 2FPGB 4JHLA 1L5QA 4CKCA 2H5EA 4A5SA 4XGRA 4UQLA 1P9RA 3ICQB 1XEWY 3BJZA 1QFMA 1MEJA 2VF5X 4C0QC 4D0RA 1Y3CE 3CONA 3HBJA 4K9DA 3RIXA 4QPCA 3ICEA 1WDMA 2H9IA 2BFNA 5GADl 3LUPA 2D3WA 5IEBA 2FLVA 1LNQA 1P0PA 3AESA 3FTNA 4INPA 4UHFA 2RGUA 3ITEA 3WHIA 1U7DA 3HU1A 4OUDB 3EIEA 4Y9SA 3HHEA 4TRMA 1J8DA 4JJ6A 1KP3A 1ODJA 2B83A 4QBGB 1GPMA 3K9HA 1Y3IA 4RXMA 3F4LA 3LVQE 3L1VA 4ZVLA 2YOFA 2XRZA 3AIKA 4JIGA 1NG1A 3I5XA 3BSFA 3UA4A 1JFFB 4GF5A 3D3KA 4KE6A 4L0DA 4O4IF 1RKXA 3OEED 4HGYA 4E88A 1L3CA 2CYCA 3OFVA 3Q88A 4BN5A 4DNFA 5J3JA 1Q3KA 1OROA 4J1NA 3ZVNA 3PJRA 2PX6A 4WE3A 3A9RA 4C7KA 2IGTA 3FLMA 5TC4A 5C1PA 3LDFA 3OFJA 2A88A 2FJUA 3VDMA 3D31A 1W0KD 3ZJ5A 3JZDA 2OESA 1B2RA 4URUR 2O8DA 1GKUB 2PQMA 3C3KA 3KSZO 1K5DA 3K94A 3M49A 4X41A 1GZ7A 3GP8A 1NMSA 3QUTA 4C20A 1VMDA 5A6SB 3R0XA 4GOOD 1EFKA 1QHHA 3EIFA 4KMOA 5CJ2A 3OC0A 3UVEA 4E46A 1LPBB 5J2TF 5JRZA 5EVJA 3GLQA 3HZHA 3PGA1 3K4HA 5INTA 3THWA 2BFFA 5JSYA 1T4GA 4RTSA 1NATA 3JRXA 1G21A 2F3PA 2OAQ1 2PU5A 5B4UA 1GUZA 3NBZC 1ZGBA 4MIYA 4Q05A 1YMQA 3WRXC 5CB6A 4B3MB 2EOAA 2FWNA 3O92A 1PJ3A 4YMVA 1R66A 1QUEA 5F9MA 1KYXA 2CNBA 1R5BA 3IEMA 2O7SA 3MWEA 5H3LA 5KI6A 4MIOA 4L4RA 3DLPX 4MLPA 5BWCA 2N42A 2ZYIA 3TW4A 1OZFA 1HNXB 4DQKA 3C7KA 2VSQA 4RFSB 3I3SR 5IDVA 1OXBB 1P74A 2GYWA 2WU0A 4QRIA 2HZ7A 4J1TC 4I36A 3IAAA 5CCXA 3HO1A 1NW5A 2AR0A 4BGIA 4C1BA 3H6KA 1JKXA 2Q2NA 1LTQA 1SXJE 2C97A 4G8JA 1UBEA 2WWTA 3C7AA 1KYTA 5K0ZA 1WOYA 2PUWA 5F73A 1WXXA 3O21A 5JPDA 3A2KA 3MTEA 2GYYA 3RR2A 3WIEA 4CF3A 2C20A 1A04A 3NTXA 4JBIA 5KJEA 1CUJA 4W1SA 2DLDA 3QF4A 1NBIA 4YPVA 1HDEA 4MKXA 3BGDA 4MS3B 3JD2A 3E84A 1OX4B 4LY3A 2XDQA 5EZ6B 4ND7A 3THRA 3USZA 2F1KA 2NT4A 1IBLB 4M0PA 3TLYA 2FMXA 2HLDA 5BSEA 4CI0B 2OD2A 3Q0TA 4GOKA 4YQYA 1ZGZA 4R3UC 4RTMA 5ALHA 1KYYA 2PV7A 2C7BA 2YUIA 3AH8A 4ZQGA 3SKVA 3WXBA 4PNHA 1GCAA 4BNKA 3GUZA 4ZCSA 5CDFA 2CK3A 4MRRA 2AOUA 4BDTA 4QKQA 5I7AA 3NJ8A 5EIBC 4XQ0A 1VHQA 5DNAA 4GICA 4R3WA 4HWGA 1ADBA 2B5VA 4IHJA 4TWBA 1HURA 4CTJA 4LHZA 5FV4A 1XJQA 5DLDA 1K7YA 4U5XA 5LQDA 1ORHA 3NEPX 4NZPA 1VDMA 1FFSA 4URFA 2JPDA 3NWEA 4MYHA 3W06A 4U7GA 3EGCA 1FK8A 2HFJA 1SEPA 4XE5A 5NLLA 3GFVA 1RNLA 2PKQP 4RV5A 2DKOA 4ARVA 4K8OA 3MHPA 1W88A 2HDWA 3KU1A 2ESRA 4MWOA 4PZ9A 1CUBA 2Q2QA 5AKXA 3TVTA 3ZLBA 3OQPA 1TJPB 2W2LA 4NV3A 4H77A 5EEGA 4Q3LA 2BUCA 3IMCA 3GRUA 2E1RA 4JC0A 2XCTB 5CX4A 2ZQYA 1TB4A 3BG5A 3TNDA 3SZMA 1V3UA 4BNMA 1NL3A 3DUFA 3O0TA 9MHTA 1YQWA 2OFOA 4Q4AB 1A88A 5HR5A 5JNUA 3PDWA 3VI3B 1E3JA 3KXKA 3UMYA 3L6BA 4TZKA 4P54A 1WW3A 3TLAA 2MU1A 3AY0A 3F3YA 3NIDB 1PR2A 2XGSA 3LQQA 1HG1A 3N1UA 4XEUA 5ER6A 1JAXA 2G8LA 1BKYA 2YXNA 2VFAA 1OXXK 4O2BB 4Q7JB 1X2BA 5L4SA 1H2YA 3GXOA 4YJ2A 2BEUB 3L6EA 2P1RA 3DL0A 5LU8A 2VSYA 2Y1EA 5ECDA 3HYLA 4HGRA 4Y7CA 1R8JA 3NBXX 5DF1A 3N59A 5F76A 3STHA 2PMCA 4RD6A 2KM1A 5AJTA 3SXUB 2I8LA 2BMJA 2FW8A 1XDUA 3ADBA 1JYEA 2H54A 5FOUA 4DCMA 4DR2B 4PZLA 4XWKA 3IPCA 4MUGA 1Q6ZA 3ZC3A 4CKCB 4FDVA 2V03A 3ITKA 1YS9A 1E99A 4J9UE 2AQHA 3AQ4A 1NVFA 2AI2A 2PBFA 3A3KA 3LP6A 5F77A 2CXNA 2YVLA 4JLBA 1HEIA 4L8VA 3SKYA 4UOEA 6Q21A 5JISA 3G7NA 4LRXA 4P1ZA 3AESB 2OP1A 5CJJA 4JK3A 2QY6A 3GWZA 2PZKA 2FY8A 3U1TA 3UAOA 2ZREA 3CUEF 4H1WA 4JXJA 1N7HA 1PGPA 1TYEB 3I6ZA 1NLZA 3KZ1E 4G8CA 3UG7A 1CY4A 3QLVC 1TC1A 3A6DA 3WYAA 4PTLA 2W0MA 3VU1A 4RTQA 3AJ8A 4P31A 5D86A 1U0LA 3DQPA 1Z39A 4WOBA 4BLOA 2CCKA 1U1IA 1XELA 1ZIOA 1Z8FA 2I7VA 4Z7QB 4LFCB 4J91A 2IYUA 2BOVA 2ZJZA 3C3BA 3FYHA 3OPQA 4MW2A 4NNOA 5A71A 2I4LA 1IK4A 1VL0A 3B6IA 4BTVA 1ZH0A 5ELMA 3QFHA 2NXEA 3LGSA 3EC1A 4R2HA 1NN5A 2R5FA 4NBUA 2WQ6A 1NJ1A 3O9VA 3D4OA 3U7JA 3V4RA 1Q74A 4AF6A 1Y42X 1L5RA 2GJKA 4TV8F 5IZ4A 1B00A 2FE1A 5FNVF 1QHHB 3J7AC 3BMNA 5JJ5A 1MV5A 4TRJA 1E4EA 6ABPA 3WLKX 4KK4A 3IKMB 5HUHA 3THWB 3DFZA 3TTUA 1G21B 3W3AA 2YWDA 4FUQA 4NATA 4TTTS 2DPLA 3T1VA 3QVMA 4NOKA 2IC5A 4PZDA 1U2GA 2G9QA 4C04A 4YCSA 1YC2A 1KOJA 3OQMA 1RI2A 3E3NA 4KUEA 3STWA 3AJ9A 3TRHA 1KBQA 3U48A 1ZN8A 2PUHA 1T6XA 4NH4A 4RY2A 1JXQA 2QA5A 3M2TA 3CNBA 1L6IA 3MWEB 3C7CB 3GJ8A 4WPGA 1D2HA 4YJHA 4I66A 1J1UA 4KGZA 1Q2XA 3VYSB 5IYZF 1KAGA 1SK9A 2VH5R 3Q9LA 2HJWA 3LZCA 1CZNA 2Z57A 4IHAA 1XWFA 3F74A 4QAQA 1NUAA 2I66A 4XWTA 1MQ8B 2A4KA 4ZC1A 2XCLA 1QQ5A 3O5AA 2O0HA 4J07A 3JQAA 3H9BA 1KHHA 3R7FA 4AJLA 3NATA 4KQMA 4OBWA 4PLPA 1JI3A 2CLLB 2IUSA 1JU4A 2PLFA 1RXIA 4OKNA 3ZIAD 5H8WA 1PE0A 3QTLA 2PS1A 2JVJA 1V9LA 4BV3A 4ZGWA 3P0EA 2XNDD 4UUOA 4LQDA 3L07A 4GAEA 4UULA 3ICVA 3GUVA 3JVIA 1E6CA 2ZDQA 3L43A 3QF4B 3CFYA 3VMFA 4G0WA 4CN8A 1TZJA 3W5BA 1JP7A 3PZRA 1BVHA 4YUZA 1OV6A 1AQLA 1I3NA 1UL1X 2N75A 3FSGD 3DMFA 1QFYA 3VOAA 3ZG6A 1CE8B 3G23A 5LMZA 1YAHA 1UJNA 3SK0A 2CGEA 1SK8A 5CFPA 1N9ZA 4F3YA 3HXKA 5G1OA 3W0LB 2R85A 2DSTA 4REMA 5GQSA 4CKZA 2AOUB 1U28C 4EJFA 2AIRA 2EBHX 3PSHA 2QGNA 5DNVA 3W8FA 4COKA 4IR7A 4JLDA 1W6RA 4IHJB 4V39A 3M4XA 1Y1LA 3RSZA 3KJEA 3SC2A 4GM0A 1GL7A 1FRVA 2FEWB 4I3GA 1Y5LA 4CW7A 4JU9A 1U8AA 3G5TA 3NBKA 3D1LA 3F4KA 3IOMA 4MPPA 3VTKA 1DAGA 1GCUA 4QLAA 4MGYR 2C82A 1N36B 1JU9A 4R0VA 4UVIA 1AC5A 1JPNA 3ETHA 2H2HA 3D5EA 4YP6A 2RKWA 4NPCA 2OAEA 2HC9A 4A5OA 1VPEA 2W6JD 1NN1A 4M88A 1KY3A 2P5YA 3ED5A 4I3FA 4Y6OA 1FYVA 3SZ3A 4KI7A 3CEHA 4X0EA 1KI8A 1RSZA 2V7GA 3O1HB 3O3NB 2QNIA 3A6FA 4CKBA 4EHJA 4PQEA 2JA1A 2R60A 1FYXA 3CRZA 5KAPA 4B33A 4ZRDA 1WBJB 4GECA 2JL1A 2WVJA 3IOCA 5FUYA 4X8MA 1KU6A 2XKKA 4IIHA 4B5LA 4B2LA 2AJTA 1EQAA 3DUFB 1FU4A 1XRLA 5CK5A 1KS2A 3O8DA 4X8LA 3V1KA 2CHVA 5J59A 5LU9A 2YWHA 3ZI7A 4D6PA 5KOJB 1XG5A 1KFJB 3S8YA 1N6RA 1W1UA 1Z4MA 2Y0CA 4L4XA 3VPDA 3EIXA 3G0GA 3DKVA 2F1JA 4E3ZA 2D6FA 5A4MS 3C87A 4I4NA 3C41J 3WYCA 4FT2A 3DBIA 1CJTC 1I2ZA 3OBIA 3CXUA 4LG1A 3BGWA 3W5VA 3KOMA 4MRVA 3DH0A 3IE1A 1T2EA 1UZUA 5ANRB 2CVOA 3OJLA 3MBKA 1F4PA 4OB8A 3ZNQA 2AW3A 5T5QA 1J21A 1V6CA 2I7DA 3WO1A 2AK2A 4GYYA 3ZCSA 3MWJA 2IXTA 2VYND 3UKJA 1YZTA 5EJIA 5CYOA 2B5WA 5LPNA 4FYWA 1D2NA 1SFRA 121PA 1JTVA 2LIVA 4NOLA 1RJWA 3DKPA 3V42A 3PC8C 4ZYXA 1ZX1A 5ADVA 2F9FA 3AJDA 2X15A 4LEIA 1C1XB 3ZWYA 1XMQB 3AFIA 5IHPA 5CJPA 2WE7A 3NBMA 3V48A 4E2ZA 4XSGA 1E2MA 3SWWA 3G82C 1ZSYA 3E05A 5C0OE 2ZQZA 5AJUA 3FUTA 4BP8A 1QQBA 2D5IA 2V9ZA 1CY7A 5AW8A 5C5CA 6CHYA 3ZIDA 1CULC 1IHXA 2RGWA 3DHWC 1TO1E 2V0NA 4QE3A 4L9WA 3RT7A 5KVCA 2XMBA 1WMSA 2Z8ZA 1DARA 2KX7A 4FMCB 4EG3A 1NDHA 3MNFA 5DTEA 4JZKA 3A4YA 4D5GA 3NALA 4CM6A 1H2WA 3VR5A 1A7UA 4D1YA 1BXGB 3EASA 3HKCA 1SELA 3JQPA 3FGNA 3H2HA 3ON5A 4LJSA 3S6JA 4CKXA 4YUAA 3L8EA 2NNLD 4QXQA 4LI3X 3V6MA 3X1JA 3KPVA 4HN4B 3Q0EA 3WLLA 3HJHA 2C07A 1QYIA 3PU6A 1T9CA 4NJMA 2CF6A 4MUAA 5DM0A 5TJ9A 3O8RA 9GPBA 3FCCA 3SE7A 2HKIA 2OHFA 1P75A 3RF7A 4DNOA 3OCJA 4BBJA 4DPLA 4XGNA 3NOXA 2ZITA 1B1CA 1X8LA 2AI3A 2CNDA 5C8DA 5K0GA 1XLTC 5AHXA 2J6CA 3BMNB 5FL7D 3WE7A 3G8YA 1YJAA 2WLSA 1BXKA 3FE2A 3HUUA 4LRTB 4W7IA 4G4IA 1KY5A 4W9NA 3TBFA 5C9ZA 1R3DA 1TW3A 3ECSA 1TRKA 3PFIA 3PUVA 4RA9A 3SSMA 5DGXA 3FOCA 1PWYE 2JI7A 2Q0XA 2CDNA 3BXZA 1EFDN 3AR7A 4NDNE 3V9AA 1G5RA 3VM6A 1BWPA 3VR4A 4A2CA 3ABZA 4NHEA 2EW8A 1THZA 1J07A 1JHUA 4HUTA 2J5BA 3EA4A 1ORDA 3EG9A 1QFJA 4B6FA 4YJHB 4B3HA 1IM5A 1NMXA 2XF8A 2FEXA 2CVZA 3NEYA 3M6VA 4D9NA 5B12A 2QD3A 3Q7EA 4JUBA 4NZ9A 4D5EA 3X0DA 4ZVMA 2NU8A 3N2EA 2ZUCA 5CTJA 4AROA 2ZRPA 3PTZA 2A92A 1DFGA 1NUUA 2VUTA 1DRWA 2HX1A 2VDVE 4YCCA 3WJ1A 5B7QA 4FFRA 4HNUA 2ZYUX 3I9V1 4A6PA 4M1KA 3AVTA 1JIQA 2O7RA 3ENVA 1CR4A 5KIAA 1HLPA 1R10A 5DTJA 4DLPA 3NGLA 3KLMX 4IJVA 4FEGA 5BY2A 4B6OA 2QAJA 3OBBA 1SBTA 3WL3A 2JIPA 2H2IA 5ALJA 3VPXA 4DV3B 3PJFA 3C8HA 3WGMA 3WB9A 5E2IA 5ARDA 4BMPB 1JFRA 1ZK3A 3HKBB 4M54A 4K86A 3IQIX 4ZOCA 3RTGA 5L8VA 4ZZIA 2PUDA 3HSYA 1WQ3A 3ONVA 2PGIA 4AYXA 4POAA 3W5SA 5E2AA 2M2IA 5HK8A 3P97A 2E37A 3ESXA 4YHBA 4OHCA 1ZR2A 1TF7A 4IIEA 3SI7A 1IG3A 3RADC 4HAZA 3EDCA 3GEPA 5HDBB 2BZSA 2R6DA 2Z43A 5B36A 2BGJA 4JB3A 4TKUA 2CD9A 1AJEA 3WWPA 4XD7A 5DH9A 3DD1A 5H1YA 2R65A 2FWIA 2YMMA 3SC2B 3SYTA 3BSSA 4IQ8A 1F51E 2L42A 2GKOA 3M6FA 4G1UC 1O8CA 3BGIA 3R0ZA 4I14A 3WA7A 1NLFA 2OV3A 4Z0HO 4FYHA 2PYZA 2AK3A 4JKIA 3KZVA 1AS2A 1GR1A 4K8RB 2Q5LA 4QUJA 1FC0A 3U9TA 3KSDO 2ORED 1LC3A 3ZXUB 2BRUC 2QJTA 1PGQA 1FYFA 2XT6A 3HB0A 1SXJA 3IKLA 4JI6B 1RM3A 3A1WA 1KOGA 4Y1FA 3EY4A 2V4UA 1GTZA 2JGNA 1ITZA 4D3ZA 2GLUA 3G6WA 5A3VA 4CKBB 1CFZA 4DT1B 1UXGA 4WJKB 4YT2A 1Q77A 4TLCA 4II2A 5AIAA 3SEAA 1GYRA 4GYJA 5EHIA 5J2UF 5GIOE 1LBQA 3LF2A 4X71A 3KE8A 2ZUFA 1PK7A 2CHGA 5JARA 3GEDA 1T2UA 3C5WP 4C4RA 2X1HA 3KBOA 1AO3A 4H1HA 4MS4B 1YO6A 2LCFA 3K53A 4G5OA 4H6XA 2V9PA 3G2OA 3RU7A 5GJBA 3W5DA 5DDIP 2HCFA 4R81A 4UTXA 5C8ZA 2UUBB 5JVDA 3JWPA 2J3KA 3GGSA 5A2GA 2PMDA 1UP4A 3L93A 4J0IA 1L5WA 2FK7A 1WXGA 4HDRA 4MA0A 3UXHA 4C08A 2C84A 5I7UA 4DEVA 1QGUA 2NXWA 4BC0A 1T2VA 4J4HA 3TO5A 1DO8A 5HW0A 1N1EA 3L8GA 3WQQA 4V0LA 1NASA 5JDCC 2AFRA 4MIKA 3MINA 3AX6A 3O1JC 3ADCA 2O6HA 1KFKB 1YOVB 4KH1A 4QLOA 4XASA 2L82A 2VDQB 1ZM4A 5ALTA 3EXG1 1SCIA 4EG0A 1RU3A 1E61A 1RFGE 3N7UA 1OLUA 2GKGA 3P2YA 1XEWX 2WINI 3GRPA 3QFSA 4HDNB 4QUKA 1MOSA 2OZLA 4YX9A 1YDFA 4MCHA 1NKTA 3DPSA 3OECA 1X80B 3MEQA 5EXEA 4NJEA 4GT1A 2YX1A 2DBZA 1DAEA 4NONA 1MC4A 2VDMB 1XRNA 4WCFA 1CERA 4CMIA 1UIRA 3PL1A 2JF0A 4QXPA 4B74A 4M4SA 3A1TA 3EJ6A 1E2IA 1EP2B 1IUPA 3MRTA 2HCJB 3V1YA 4R2LA 1OWLA 4DHWA 4US1R 3UUWA 1P5FA 1MB9A 1JJVA 1ENOA 1UM9A 3HDQA 1ORVA 3IIMA 3N7AA 3W2EA 5JYBA 4LF9B 1NSYA 2NN3C 2QJFA 2YXEA 4NJMB 5FBRB 3SQDA 4O29A 1VE6A 5AKGA 3TK1A 1W0JD 2FE4A 3WGJA 1V41E 3UY4A 3MPOA 5KSZA 5MF6A 1DXYA 1ELOA 3FGOA 2B35A 1U3CA 4DA4A 1N57A 4ZQFA 2AMVA 4MW9A 3F6CA 2Y1XA 1Z7WA 1SHUX 4RA9B 2B1GA 2DTDA 3AF3A 3REFA 4F91B 3Q1LA 2D74A 2ACEA 2QSZA 5KMGA 3QLUA 3G1WA 1H6AA 2YFHA 1ZH2A 3C4JA 5DGCA 4AY5A 1N0UA 3EG9B 1JPJA 4OK5A 2VRBA 1TC2A 3FHLA 2NZJA 1G63A 4MW4A 4G56A 5GONA 1ORRA 2C9ZA 3WLFA 1HNNA 1H9BA 4JZYA 5HCNA 1CJKC 1NJ8A 3B7GA 2QVXX 3PT9A 2IPMA 4TZTA 3COZA 4PPFA 4BNYA 2LBPA 3ANYB 1IOWA 5CYGA 3HVIA 4AJIA 5AVZA 3IODA 4R2XA 1G16A 2PN1A 4YDRA 1ZUNB 1XU7A 4K87A 1IJBA 1RHRA 1N1GA 1XDBA 4BDSA 1LK5A 3BWXA 4DW8A 5A4AA 4DB2A 5LZ4A 3WLJA 1TT5B 3AUUA 4ND6A 1WZ2A 4UU0A 3HXTA 4OMCA 2XKAA 2MIIA 3WICA 2WJAA 4EX7A 5DX0A 5JZBA 2QRPA 1ZMXA 4K1LA 4U7TB 5JR3A 1A8IA 3NIBA 3MHTA 4QOIA 4WLOA 3VR6H 4Y2XA 4IZOA 1L7AA 1GZ6A 1JWBB 1GN9A 3F96A 1QF7A 1C3EA 3NTRA 2NUTA 4R8VA 1FFEA 1XN1A 5HILA 2PO5A 3AEUA 3SQOA 1B6SA 2LD4A 5DISB 5FV7A 1RWWA 3QYFA 4PG7A 5F2NA 1WABA 1XQYA 1ISHA 3GG9A 3A6PC 4O2BF 1SGWA 1G3UA 4RXTA 2GVNA 2UDPA 4G6ZA 3Q10A 4Q7MB 1KMMA 5AM4A 4CU5A 1ECJA 1AUOA 1D09A 1Q20A 3FKJA 4WD3A 2GK4A 1EP1B 5LZ5A 3L4EA 2VJQA 2ZI9A 1DKLA 1NVKA 1A9XB 1G64A 4MGIR 2VDNB 1KK3A 2ZTSA 3LUFA 1JJIA 4RF4A 1AK1A 4URHA 3T34A 3FFXA 3VZCA 2UXBB 2XR1A 3MMZA 3P52A 4MICA 1TLLA 1FTNA 5J47A 2QNRA 4GH5A 2PKEA 4ER5A 1X7GA 5EJ9A 3AR3A 1S1MA 2WG2A 2FHSA 4FGZA 4X20B 5A5GA 2GZDA 4RLFA 1OA1A 1SXJB 1DC8A 2PLWA 2J7KA 1JI0A 4L85A 2PGAA 1U5AA 1GFZA 3AFNA 4HH1A 1HYQA 2VTKA 4NBRA 1P7CA 1ZS9A 5EUBA 3OPYI 5BQOA 3D6NB 5HGXA 4B3CA 4JLMA 1JN0A 3GCDA 4IIXA 3I9JA 3VR1A 1FLAA 2ONJA 1NF2A 1HQYE 3ASYA 3CLSD 4OREX 3TVYA 3D6FA 1RI5A 1I10A 1CP2A 2O0JA 3F97A 3G9QA 4L76A 3FWKA 2FPLA 3WKBA 1GCGA 3QFTA 1SVKA 2VNKA 4XR4A 5MHTA 2D0OB 1M2GA 2O8CA 2WJ6A 3A04A 2I6QA 5GMOA 1BMDA 4OHRA 3AK4A 1OD6A 4QUGA 3K8ZA 3FYTA 2NO7A 1BOOA 2VA9A 5E9AA 4CHTA 1Y6FA 2XWSA 3PNMA 3CZCA 4IGIA 5IJXA 5JVDB 3ROQA 2JLXA 4XYLA 1DXQA 2H4FA 4AX8A 5I4BA 3UMGA 1U0NA 2ZXEA 1VECA 3KJIA 4ZAFA 1JFTA 4LOKA 3PQFA 5LWQA 2ET6A 2A14A 2AJCA 4RFVA 3MINB 1FPMA 3AGQA 3BH6A 1WHSA 2JIZD 1SC1A 4C4OA 4ER0A 1E3MA 4Q0MA 1PR9A 3GBPA 2P8JA 3WQBA 2Q0HA 3KUKA 5IC4A 2FQWA 2Y2UA 3FY4A 5LZ8A 3T7TA 4FS8A 2VTBB 2V1UA 1VJDA 4OX9B 2RB4A 1RXUA 1UWCA 1OLUB 3OJWA 4J0HA 4KGVA 1Z17A 2VYCA 3G1TA 2OZLB 1QH0A 1TZ2A 2P2CA 4P3XA 3TAUA 3U4MA 1U6IA 1YU6A 1X8JA 2ZETA 4NJEB 3AEKA 2XX3A 3D7NA 1ISJA 1UWKA 3LUKA 1GWNA 3TKYA 1E3TA 1MEOA 2EZUA 3CLTC 3QOXA 2ETVA 2J5XA 4WCFB 4BO6A 4CMIB 5E1MA 1ETHA 4UXIA 1SZPA 3S8MA 2IH4A 3N05A 1T5HX 1J99A 1T8TA 2P77A 1UT6A 5C1OA 3X1YA 1E8NA 1JMVA 1YUMA 3N8IA 4IILA 3TN7A 2K2QB 3G0DA 4OFXA 3H1GA 1KI2A 1Z13A 4WKOA 3NX4A 5EE5B 2ZIUB 3ZCXA 4CQMD 1KJZA 5KB3A 3PYLA 2GT1A 2ZJ1A 5LQRA 3VYUB 4AN1A 4KXXA 3NRCA 4XVHA 1A9PA 1D2RA 1KR5A 2WF9A 2E48A 2YY7A 2VHQA 3H05A 4BL5A 5EWMA 1NP6A 3HEBA 1ZA1A 3KSUA 2MYUA 2NU7A 1XGKA 2VNJA 2C2ZA 3U0BA 3TECE 4GZMA 5SYMA 4MTLA 4AX4A 1X92A 2IKQA 1PL0A 2YS7A 4W5JA 1M33A 3W8DA 2GETA 3WIUA 5K6AA 1KZ9A 2NSJA 5KMGB 3I05A 3UMBA 1NT4A 3OQVA 2F62A 1JEQB 1KI7A 1SG0A 1SKAA 2ATXA 2QPOA 2AX4A 1BROA 1F2TB 3G8BA 3LP8A 3NZEA 4FQ7A 4REQB 1LUAA 2N46A 4CG3A 1ZCZA 4IHJF 1E0KA 3GEIA 1MTOA 5GONB 5BNZA 2OZKA 4P5DA 4MROA 5AJVB 1NVUQ 1DRUA 2WZBA 3RYFA 4FKMA 3AHEA 4W1QA 5DE3A 3D43A 3CKKA 3COWA 1RAFA 1M76A 4KGXA 1X2EA 1IZYA 1KWKA 4M0DA 4RHTA 5JS7A 3SVLA 1RZRD 3RLFA 3ROFA 5EA2A 2EKZA 1SMKA 2B3TA 1QKKA 1BU5A 2J41A 4JVNA 4N82A 5K0FA 1YS6A 3GLVA 2BY4A 1GNRA 1U8YA 3BA6A 3DVLA 4GOJA 4WFJA 3MRXA 1CB0A 4MQFA 2ZP1A 3KR9A 5DNDA 2IUYA 2I29A 1MJFA 3TM4A 2EG5A 5AW7A 4HX5A 1YDMA 2EZ9A 1Q83A 3EG5A 4G4SO 3ZGNA 4F6CA 5JATA 3R8FA 1U9JA 4GWKA 3ZD7A 1GZHB 3I30X 2H4HA 2Q0SA 4BQNA 1ZVVA 1YS1X 1Z6YA 3K70C 3FFBA 4Q9LA 1SIOA 3NETA 1QONA 2BT4A 3FOAA 4FZ3A 4IXMA 4XQCA 1M8GA 3LSYA 3P20A 3PQCA 2Q6OA 3OOJA 3W6ZA 1Y9ZA 2ZJOA 2Z6AA 2WWFA 1SXIA 3E61A 3QNUA 4YJ2F 1K3TA 3RARA 4YACA 3SVTA 1NRJB 2ZIWB 1EE9A 1T1EA 1S2LA 2AG8A 3GD5A 4C4SA 2JAQA 2O1WA 4QTZA 3KPWA 1YXMA 2HK6A 3OCVA 4P38A 2YS6A 3TWOA 4CCAA 3MS7A 3ENWA 1LD3A 4QRHA 4D79A 3EQ6A 1PV2A 2I1VB 1KSHA 3GDFA 1J9ZA 5A1TA 3LKBA 3VNBA 3LW8A 4L6CA 1MOPA 2G7MC 4XVUA 4D0NA 2ADMA 4GD3Q 4JI5B 3QLEA 1POXA 3H9JA 2O2XA 5EKSA 4KPYA 3PHHA 2PZ8A 4GWGA 4K46A 4M0LA 3V1LA 5E1BA 4J3NA 5J23A 5ECYA 3INNA 4HNQA 2DQSA 2WU4A 4MYTA 3S27A 2CLSA 2QSYA 2WAMA 4X45A 4ZTUB 5FL3A 2WD8A 2WQ7A 4DARA 3C6XA 3Q98A 2HGSA 2OXCA 3CPEA 2JI8A 3C6BA 1P4HA 2JFGA 1ODCA 1CF9A 1HDYA 3A27A 1FTSA 4HEJA 4RZUA 1FRZA 4MS1B 3JYNA 4MQUA 1QU2A 2C96A 3U4IA 3WZMA 5HNKA 5A03A 2PWPA 2PS9A 4FMCF 4IICA 1EFPB 3OZAA 1Y4DE 5JAOA 3H13A 1WY7A 1QE0A 2J9XB 1C7FA 3ILHA 3RFTA 5DXAA 4DYHA 5C8YB 2O8CB 2D1FA 2R2AA 1E18A 3OCYA 3LBYA 2HAEA 4FILA 4LOIA 3WOHA 1Z26A 4WW0A 1BHQ1 3ORHA 3OPMA 3VHXA 1JIKA 2PZGA 4DCPA 2XQGA 2J3IA 2EFDB 4KQFA 2D7DA 1UXJA 1M1ZA 3PV0A 5FOTA 3UHJA 4CIAA 1GIAA 3R41A 1JXMA 1T2AA 2AI1A 4MJ3A 5AMXA 4BZXA 4QG3A 2GOYA 1J06A 4EELA 3DZGA 4RDIA 3ORRA 4GEGA 5B6PA 1KEUA 3N58A 5IDQA 3ZGZA 1KI9A 2FOLA 4KRYA 2PNJA 4LF6B 2NADA 1DGQA 4UFNA 4JLSA 5KCZA 1I1OA 3OA0A 3OJ0A 5TGZA 1J2JA 2CDCA 3TE7A 5I7FA 2W8ZA 4EF5A 4BNNA 4JBXA 2VPQA 1EIWA 2HT6A 1NVVQ 4DLUA 2G71A 1H1DA 5IH3A 3QA3E 2OO5C 2J6BA 1CETA 1TW2A 1X8KA 3IAFA 5K05A 3IUPA 3DE5X 1N5MA 4K9RA 4MQLA 5JMPA 1IHUA 3AEKB 4AP5A 1TLFA 2B8NA 3HR7A 4L74A 3DAYA 4PYRA 4RGQA 1JB1A 1R8SA 3VYWA 4BLPA 4BV2A 1IEWA 3AF4A 1CY6A 3ONDA 4K1XA 2VHCA 2C59A 4NDZA 4Q6WA 5LYJA 3R7BA 3V7NA 4ZHQA 2JB9A 3OZDA 1Y34E 2HLPA 4U6NA 1BD3A 1H8EA 4IKEA 3M5DA 3JXEA 2LKDA 3MT8A 2Z2XA 2ZOSA 1EE1A 1P1KA 1PLKA 4I1OA 4LJAA 4ESVA 4LF8B 1OVGA 2X9LA 4JCCA 1X39A 1BMFA 1VBNA 1G7SA 1K3UB 2AF4C 5IT9A 2JGAA 2JHGA 4Z4FA 2FDXA 3EC7A 3H3FA 3EZ9A 1JV2B 4K88A 4E0BA 3RAEC 2WF6A 2YY5A 4AULA 4CLOA 1ZWKA 3OFNA 4X6XA 4FFMA 1UMDA 5TMPA 1X0XA 3HTXA 3AOGA 3MOSA 3E53A 2HCBA 5KHAA 5E2BA 1KFCB 3VKWA 1DCFA 1WLYA 3AVQA 1T9GR 4CF4A 1R4NB 2G0NA 4BLVA 4IIDA 1C2YA 2F64A 2Z83A 2RCNA 3EULA 4GEKA 1CQIB 1ZZGA 1SZJG 2RH4A 4R8SA 1OT5A 3LUGA 1M0WA 4RULA 4BUJA 3G8DA 5CM2Z 5ALRA 1MC8A 2OQVA 4D8TA 1S89A 4EHLA 2W42A 1CUYA 1SQ6A 3ZI0A 2R1UA 2W71A 3MWLA 3VFDA 1DC4A 3SBDA 2O3SA 1WCWA 3RYFB 1XZDA 4DRYA 2BFCB 1U7ZA 2FWRA 1KEZA 4GP9A 3UQYS 2CMDA 2JEOA 3C8UA 4R1SA 1J1IA 2HBYA 2Z0MA 3EY9A 5TPZA 3PNKA 4K03A 5HIAA 3KKOA 1PJZA 3RAJA 1B4DA 3NIWA 2XCOA 4AMUA 3WYFA 1HLFA 1SBZA 2WSBA 3E7FA 4MQFB 4DY4A 4XVCA 2IP4A 3SPXA 1AY0A 4H3SA 5K8JB 2HFKA 4FGLA 2X9GA 3TOSA 4DRXB 4DG5A 3ED1A 4N9QA 1B43A 5AVJA 5EESA 4ARZA 4B32A 5G3YA 3DTTA 4PYKA 2D0IA 4TS3A 2C4HA 2DKNA 3GUYA 2C03A 4K7JA 1Z8DA 3B1KA 4CR7A 1BMQA 1M72A 5IT0A 4F4DA 3VTAA 4YV1A 3H2YA 1NQTA 3TPCA 2MSCB 4HLQB 2UYHA 3RFXA 3RV4A 3UPDA 4EG8A 2EERA 3FBTA 4F3TA 1GKLA 3UWPA 4DIEA 2QG6A 4U1RA 3DT6A 2HOQA 3M6IA 3M83A 3M0EA 3V3KA 4TN1A 3VI4B 2FTKE 3GPBA 2IZ1A 4JQCA 1B74A 2FN3A 4MB6A 2HSWA 2ODEA 3C6YA 4M9RA 3IAXA 3GGOA 2FRDC 4MRNA 5KJFA 3U81A 3NH9A 2PH7A 4AXXA 3NHZA 5HFNA 2RH8A 2H0QA 1DUVG 4TV9A 1O96A 2BHTA 3ZDDA 4RK1A 3DMNA 4UCQA 4XD2A 2C61A 4U2GA 5GOZA 3OTHA 2OAGA 5HZMA 3NPMA 2EBUA 3BE4A 1KDRA 3PTLA 3RVNA 1CUUA 1SIUA 1VMKA 3RCBA 2X9VA 4DJTA 3MTDA 3D7SA 3W77A 3A6GA 5C18A 1OLXA 4FI3C 1XO1A 1FEZA 3A31A 3EVNA 3LHDA 4MULA 3RPEA 3H84A 5BV7A 5IXYA 1G19A 4Q1EA 1XAGA 2E0IA 1ZMRA 4DWOA 2AG6A 4WEOA 2H1CA 2KW5A 2R5NA 3R3WA 5IXJA 5FO1A 4FXPA 3I01M 5LZ2A 2B4TO 3ZDCA 1AZTA 1PVVA 1YB2A 4MUMA 4AG5A 4FOPA 2OORA 3Q41A 4WNCA 4IEFB 1T9BA 2F7SA 3LPDA 4G23A 5H4HA 4JT9A 3FCUB 1KMIY 4OD0A 1MABB 1UJCA 4OQLA 5T3YA 1LI7A 5CHEA 2Y1WA 3VHXB 4PC1A 1LZLA 2H59A 3BZUA 4WVLA 4FK8A 1AHNA 3RS3A 4BRWA 3OIDA 4RV9A 1O58A 5HBRA 3GELA 1I4DD 3H2GA 4OSPA 4PX3A 3IT3A 5AI4A 2PANA 3OD1A 1LSOA 3GU3A 2OBXA 2YNMA 3K73O 1L8QA 4MUKA 1MF7A 2XBMA 1IPFA 3UWSA 4JI2B 1ST3A 2JIMA 2PX8A 3ZWMA 1JYSA 4EKNB 4MDFA 1VGVA 3VTZA 1W1WA 2GPNA 4TKZA 3PWTA 2ATCA 4G5GA 4RHYA 1P3Y1 5DFAA 2J8ZA 4KQ1A 3R7SA 4P5PA 4B81A 3KYJB 1OT3A 3CU5A 1FFHA 2ZIFA 2JASA 3RVLA 2DEUA 4QOSA 3WK4A 1RQPA 5DTQA 5K0CA 2ZXFA 5DRTA 3IO5A 1OILA 1U2QA 3JZMA 4B6EA 1DOZA 2I1WA 4HGQA 2FPKA 1XDDA 1GKKA 1WEKA 1U2RA 2DT8A 2AYYA 4ZHQB 5LYJB 3BJMA 1W1IA 2NGRA 3WL4A 1JDVA 4TM7A 1L1EA 1E7YA 1G0NA 1L5LA 2VZEA 5DYYA 1M8KA 1JE1A 1ESMA 5IULC 4IWNA 5BYKA 3U17A 2QV7A 2AGVA 1RZVA 1C30A 2VPYA 4PHTA 1IXRC 4L6AA 4YCBA 1ESZA 1X1EA 4YN3A 3DMDA 5GTDA 3FCSB 3VSAA 1Z5WA 1VYVA 1U2ZA 1J8MF 2RH5A 1GAWA 3FBGA 3OE4A 5KDLA 3VPSA 5JMWA 5LVAA 1G59A 2AC7A 3QXJA 2J0QA 3VOTA 1WCYA 3LC1O 5DSXA 3F7NA 4CLOB 4QTXA 2A0XA 1UMDB 2A3RA 4MVJM 2QRMA 1NN0A 2AD1A 3R4CA 5HBGA 4Q3KA 3LCCA 2CMGA 4GLOA 3EODA 2BM9A 4QBTA 4FZJA 4DLRA 1ZBDA 3IXLA 3DONA 3GLKA 5TF4A 2IYLD 1OYYA 1V26A 2XNCA 3VSDA 4BO1A 2H16A 4P0TA 2E21A 3EXG2 5JBIA 4YV2A 2CK3D 3B1WA 5AYVA 5KTTA 4LZJA 4P9NA 2GAJA 1KGSA 2YZKA 3C48A 4R16A 5DBOA 1PFKA 5TXGA 3DHYA 4ED9A 1YNOA 2CLDX 2BM0A 2D2VA 2FFJA 2Q8PA 1U1FA 2BF7A 3C3DA 1J24A 4UCWA 5GOTA 4C5CA 3RC2A 4AURA 4CM7A 2QGFA 2C9YA 4NP6A 1II0A 1L8OA 4CQNA 2R5WA 3CRNA 3JY6A 5HRCA 3I4CA 4OQZA 1JJAA 4D9CA 4LMPA 3LBIA 1QV6A 1XMVA 2XZPA 2J4DA 3H3XA 4B9EA 4Z9YA 2H0RA 3VSEA 4RZSA 4UFPA 4R5MA 3ZVLA 1ZW1A 3LBHA 3JAKB 5EZYA 2G28A 3HO8A 1KVQA 1P9NA 1VYTA 4A0GA 1N9KA 5JCOC 4Y2GA 3I39X 1TVKA 4MWDA 5E0KB 2VP4A 4I08A 5B4VA 4HG2A 4EKYA 3LX6A 5A5EA 4YCMA 4I8IA 4F06A 1P81A 2FJPA 1HO3A 4OXKA 4ARZB 4QWWA 4S1PA 4DREA 5BW8A 3HJGA 1CUVA 1TUBA 3QVKA 1CYDA 4NCKA 3OX2A 1I4TD 1P0QA 3F8SA 3U3JA 2WYOA 4O0MA 4C6RA 5BQ3A 1PFGA 1Z33A 1Z2EA 3JTEA 1WKVA 1UDAA 4Y6RA 1XVVA 3SBOA 3GLHE 4TTRA 3RSFA 5KO2A 2BMAA 1H2ZA 3AL0C 4HRAA 1GGFA 3ORSA 1LBSA 4MVJH 2YN2A 5AKKA 1VBFA 4NI5A 1ZU5A 1QWSA 1KO5A 4G5YA 4IMJB 3P32A 3V00A 4EHNA 5JVDF 1N77A 4IUDS 3HDVA 2ZSJA 2VP2A 4OM8A 1A2QA 1VE1A 4FNGA 3ZGVA 3PHLA 1P1CA 2J46A 3PUKA 2POCA 4MWTA 5C46F 2M1ZA 2ZPTX 4CR6A 4R2MA 5BOSA 3SZUA 4L1KA 4MV5A 4AMZA 1K7CA 1AUXA 3VHLB 1OH5A 3I9LA 3T4XA 1GHTA 1O96B 2Z9DA 3NP9A 2LUOA 3CN9A 3VV2A 2VJLA 3D8RA 4JGIA 1RRFA 4MWEA 2NXCA 3HSSA 2FW1A 4ARUA 1JIXA 5JS2A 4AUMA 4X54A 5HXAA 1NQVA 3C3PA 3H99A 4EHFA 3SBXA 3N3BC 5T57A 3HE3A 4BRSA 1UQUA 4IVPA 1I9GA 2YBDA 2V96A 2OPBA 2PZBA 1O8BA 3HBLA 3LY5A 1R4ZA 4RLQA 1OLXB 1AV6A 3KQVA 1T8PA 1LPPA 4BKOA 1G55A 3MAJA 4A8HA 3S7TA 1UC4B 1HT3A 3BIJA 5FBZA 3QVGA 3WIDA 1SKYE 3VPFA 2VH2A 4XGKA 4QECA 1BCSA 1PGOA 5CB4B 1E6EA 3PKZA 4B7CA 1NMQA 1OBOA 1PKEA 4LFAB 4L8WB 3N75A 2ZJ4A 3HN7A 3IOYA 2XSZA 4MQ6A 2XAAA 4H7FA 4NZNA 2PH5A 2IU4A 4WXPA 1PZHA 4NS4A 5ENDA 4HWOA 3TUZC 1T8WA 4UHKA 2A1IA 3E7DA 3CV3A 4J1SA 1JA9A 4M37A 4OHVA 4EI7A 4EH1A 1NW4A 2MR5A 3NONA 4YJFA 2ZAYA 5DBEX 3TCXB 3OX4A 3Q2OA 4FONA 1F8GA 4MAAA 3ZV5A 4EHIA 1DTWA 1G6KA 4LBWA 1XJCA 1JALA 3EXEA 3IERA 3A9CA 5JO0A 4DLSA 1A7JA 5EHZA 1VPWA 2W43A 1DBWA 4R3NA 1RD4A 1CQXA 2Q8NA 2X8LA 3E3OA 3BK7A 3KHKA 3JR3A 3LX5A 2ZULA 3N39C 4NCNA 2IYYA 1A5TA 3H9CA 1KZYC 2CLMB 2DPXA 4L6IA 4Q12A 3W3AD 2XZTA 3GAAA 2P9JA 4LXGA 3TD9A 3WS7A 3WGZA 1PP4A 1P4RA 3RABA 5LZ9A 1QP8A 3IR5A 5GONF 2Q6LA 1VE9A 1V7PC 4YJ3A 1TYCA 3LP5A 2HV8A 2QVLA 3M2PA 3QWFA 4PSVA 5ERGB 3U9LA 2G1UA 3ELBA 3EPJA 4BEJA 3A2MA 1R6BX 1GUFA 1VIYA 3QY9A 2JW5A 4JBNA 4KE9A 3SC6A 1T6NA 1R0YA 1J8QA 3RU2A 2JZOA 1AD2A 3SJZA 4P3PA 4QU9A 1MT3A 3KZNA 2QY9A 1N4DA 2OHIA 1SOAA 3ND8A 5IS2A 1YC5A 3A6ZA 2XUIA 4MKHA 2AG5A 3MMNA 4QUAA 1G9SA 1I24A 1XVLA 1L8AA 2XD9A 4XDYA 1Z3CA 1J0XO 1MO5A 2H8GA 1NF9A 3RYHB 4E4RA 2IKSA 2FGKA 3OVMA 3TPFA 1W49A 3TJZA 1R4MA 3O1IC 1NVDA 2J4FA 1S9HA 3A8TA 4P22A 4Q6BA 1LVGA 1T8SA 5BW6B 2I67A 1V47A 4KO3S 2XKJE 1MMFB 1A9TA 3FMGA 4L78A 1PZFA 4K9LA 1V9CA 3REGA 4DUGA 5LA6A 2HA2A 4HKTA 4LXIA 4KHPB 3AUYA 3ELUA 4JELA 1OKKD 1IQ0A 1QPGA 2HRZA 2WTXA 3A3NA 2OM2A 3F2VA 3N6RA 3PUXA 4QHYA 3BRQA 4FHDA 4K3UA 1XOIA 4GBJA 1QCDA 3DV2A 5FEUA 4U9HS 8GPBA 3V33A 3OG9A 4FHFA 5CM8B 4AS2A 1ZOPA 3UCFA 5EIEA 1GFWA 3U3OA 2EG9A 4CM3A 4A8PA 3LHIA 2B25A 4ND1A 5J63A 3PGMA 2B7CA 4G5RA 3U5ZB 3NTVA 5FDFA 4ZAWA 4AK9A 3SLRA 5T41A 2J7PD 3LV8A 5A6VA 4MV6A 1THMA 3BC1A 5JNVA 1MJ5A 4HMQA 1E9AA 2CUKA 5EZYB 4IIUA 1GQFA 4UAGA 5TGDA 1TVKB 4MPJA 1N5RA 4P81A 5BUCA 4HQ6A 4Y9DA 2XE4A 2WD9A 2ZS8A 5E6SA 5C3MA 4F6RA 4J49A 2G63A 3Q5GA 2IHVA 4N3AA 2AC4A 1PR5A 2ODBA 3LI2A 1CUSA 2DTEA 4UBIA 2PRJA 3BCSA 1FNBA 1RADA 1UC9A 5ALEA 1M54A 3KOYA 2XGMA 3G59A 4CE6A 3CF0A 3FLEA 4ICIA 4EUFA 2P9QA 5AVYA 2GGSA 3NQ41 5FBKA 2C95A 1QAMA 1EA5A 4KQEA 3PA6A 1ZJ5A 4HLDA 4ZVKA 2BHLA 2ZYWX 2AXPA 3MS2A 2GPJA 1FF9A 4G97A 2X5NA 1RPAA 1YZLA 2O3TA 2Q5IA 5LP6A 2FSFA 3Q7PA 4EY8A 4DBLC 5HK9A 1ECLA 5B55A 2ZSHA 3T9FA 3AR6A 2H31A 2JFPA 2YINC 4MPRA 1LW6E 3AXTA 4FZ5A 3FAKA 1PL8A 2DYKA 2OZEA 1RC1A 5BN3A 3BK2A 2Q2OA 1XEXA 4WKBA 3F9RA 3KUUA 5LMNB 1K66A 4Y2SA 4M0CA 2N47A 3T7JA 3V2HA 4DZTA 4NCAA 1XD9A 2YUTA 3TZEA 3HADA 1YACA 3U13A 3U2QA 1N7IA 3UA3A 3CJRA 1JLHA 4G1MB 4R54A 3U3XA 4U0JA 3AJRA 2Z08A 3M9LA 5FUWA 3U39A 3WRYA 1KVRA 2WICA 3GRRA 2C04A 3KKPA 4F7DA 1WB5A 1Z0IA 1TI7A 3DCYA 3O91A 5I9LA 2IOQA 2R6R1 3QVGB 5C7OO 4Y6PA 1BCSB 1U0OC 1X86B 3OAAA 5K3CA 3B7PA 4K05A 3PLAE 3EUAA 4HX2A 3H2ZA 1BS1A 1XKQA 1GZ4A 2V5VA 4Q93A 3VR5D 3AM3A 1MB4A 3RKRA 5J4YA 4LSZA 4TMFA 4RVGA 5K20A 1U04A 3FRIA 4MLDA 1WXDA 3PXCX 4RETA 4Q03A 5K3SA 4HEQA 4XUGB 4Y6LA 4MHSA 5TF0A 5DGHA 1TMYA 3E4CA 2YQZA 4PGAA 4B6PA 2XXJA 3K0SA 3S2IA 3LQ2A 3ZN2A 3KETA 1WW2A 3SEQA 1VLVA 2YJNA 5TVKA 5DU2A 4F5YA 4ATNA 4JL5A 4UE3S 3VA7A 1SCUA 4YRCA 1A1VA 8AT1A 4LCEA 1GZDA 5IDYA 3WMWA 2DRIA 3H65A 3UWKA 4BNGA 4YVFA 5BNWA 3N74A 4Y30A 2ZJ8A 4GKAA 5B1DA 3RIGA 1HR0B 3G9XA 1QMGA 1RP7A 2BHNA 2UYCA 1I3LA 3PP8A 1NNSA 4MGZR 5B3JC 1CUFA 2F6RA 1TVMA 4Z0PA 1V9SA 3LAWA 3CUUA 3OWOA 2H4JA 4HZUA 4CLDA 3THOA 4B4DA 3GRVA 1SUAA 4O4JB 3M4YA 3GNLA 4OYLA 3TZKA 4RZ3A 1II8B 2VJMA 1UIMA 3FNHA 1F4LA 2BISA 3IBCA 3QBDA 4UM7A 3IELA 5IJ0A 3M34A 3W2HA 3ES9A 1ZHFA 4P5EA 4JD5A 2FX2A 5WRFA 2W98A 1CQZA 1G8HA 3LUAA 4KR2A 1YE5A 4M83A 4ZQHA 4Z0NA 1IOVA 3L7KA 1KR2A 4JHXA 1HV8A 3DMTC 5CU7A 5FQNA 5AXDA 1P31A 4EK9A 4YRZA 1H0KA 2X6RA 4N5HX 3AZPA 3T52A 3FF4A 4G63A 3C43A 2QLFA 3ZWVA 4LSMA 4ALMA 1RYBA 1Y5RA 4OA5A 5ALSA 1GJRA 3DEHA 1J0EA 1XCMA 4IO0A 4EQZA 1LBEA 1YZ3A 5AH0A 1RAIA 3Q1KA 3ABOB 2ONZA 4EA8A 1M2KA 1MVNA 1O5TA 2H11A 3BHNA 4QG7A 1T35A 2GN0A 1R4MB 2VP5A 1OLOA 3LYLA 1H94A 2EEZA 2W6OA 5BV0A 1P6UA 1Q1NA 1JR4A 2HREA 2O3QA 5E6UB 3RYCB 1SUPA 2P62A 5EHGA 3ASZA 1FNMA 4JC4A 2HRCA 1XYGA 3LVBA 2QTMA 2FWMX 3ABQB 3DDZX 5DSTA 3TIVA 2GF9A 4ARAA 4CQLA 4P4UA 2O8NA 2ZB3A 4GBMA 2QMOA 1UPBA 1DSSG 1XJWA 2MMCA 2WHRA 1RXEA 3LQKA 4M9QA 3CW9A 4QATA 1GADO 5JSZB 3FUVA 2HQ1A 5DGDA 3VZBA 3KFLA 2GEFA 1R74A 1CHNA 5JNWA 4QJBA 4NK5A 2BEVB 4OFZA 5CT5A 1HXHA 1XXHE 1Z4IA 4NFLA 4JL8A 1RLMA 1RJFA 3PR2B 3ROZA 5IT5A 3HCOA 1W5BA 2K7ZA 3U6KA 3WFZA 4ILKA 3CX4A 1DQPA 3FMVA 5DI9A 5COBA 5T8KA 2ATIA 4LA4A 1XMSA 3T1QA 2DVMA 3UTDA 1M2NA 3C16C 4M1MA 3DDWA 2X0FA 2GFHA 4H3HB 2X4GA 2HY7A 1JEOA 2IZ7A 3FDZA 4G37A 4KTVE 4Z2AA 2QBYA 4OQFA 5JJIA 1Q7CA 3R3HA 4ODIA 4HTFA 4KV9A 4MIEA 1A77A 1K86A 4KBYA 4PO9A 5E6SB 1C7RA 1BVUA 4GQBA 5I9MA 1WSBA 1GZ3A 3RT1A 4F6RB 4Q3CA 3X44A 4DHEA 4NBSA 2VAVA 4ND5A 2F3RA 1L7DA 2IEYA 4FYKA 5F2KA 3I58A 4IXWA 2G9UA 1P7YA 1M2VA 2Z6VA 2W22A 3FDFA 5L7YA 1M3SA 4BQQA 1QBGA 2O23A 1SOMA 2Y68A 4DLNA 2MYNA 2FPSA 1TEVA 2XTAA 2HU2A 4PZYA 5BT8A 2Y1FA 1NYQA 3HV2A 4GM4A 4IFBA 4M0UA 1WX1A 3FM9A 3K5HA 3O03A 4D3YA 2QENA 3DF9A 2Z30A 3RHZA 3CUVA 3G2PA 1N2JA 1RLOA 1WZNA 1XAHA 4KBFA 3TOCA 421PA 1XT6A 3IHKA 3O94A 3STTA 3IMFA 2R8XA 3ANLA 4DLZA 7ABPA 1JSCA 2DQ4A 3KWJA 3ELYA 4DQVA 2DB3A 3HDTA 3IUQA 3RSGA 4MXDA 2WUVA 3QGMA 4BFVA 3HYSA 3KLNA 1O6BA 1EUQA 2FETA 2AMJA 1SU6A 4MDYA 2XE7A 3EMVA 3H86A 5E95A 4LDPA 3K1JA 4RVHA 4F45A 1PV1A 2JCSA 4TT3A 1TECE 4U0KA 1RZ3A 3C45A 2I65A 2XZDA 2QP4A 1WXWA 2Q5EA 3N5CA 2V7EA 4KAAA 5E9QA 5EIBD 1Z2CA 3I2JA 2H1OA 4FLEA 3BXPA 2ZR7A 4LDAA 3RBXA 5JSQA 3BILA 1PNVA 3MW8A 2A8YA 4EEZA 4ESHA 3GDOA 4CLXA 3S28A 3VAZA 5AVRA 1YRQA 3IUYA 4ZHQF 2OGTA 5LYJF 3WYNA 2CBZA 4DQXA 4DLWA 5FTLA 5IT4A 3FPJA 2HD4A 4LC0A 3NVMB 1TMOA 3RE1A 3F3MA 5MFPA 1UOPA 3ESCA 1WVGA 5EIWA 2R00C 5U4QA 3UICA 4FQ5A 5ESWA 4NJOA 3WBFA 3DDCA 3KKZA 4D41A 4D4IA 4BMNA 1HYHA 5JV5A 2MINA 4ITUA 2FU5C 2F48A 1ZCJA 3GLHA 2Q2VA 4FFDA 4P36A 2JRLA 1YV9A 3ZGYA 2HMAA 5JFTA 2A0UA 2IE0A 4RS3A 3CLHA 2HQSA 2HF7A 3FNIA 3M4ZA 4RSMA 3WLSA 1Z5ZA 4Q39A 1EG2A 1FFDA 2QR3A 5ALQA 1KEVA 1P8JA 2VL7A 2WM9B 4US2R 1QP4A 3ER9A 5KINB 3KUXA 3VU3A 1LDEA 5H4GA 4ZQIA 3VNRA 3BB4A 1MPTA 1QRSA 1NM5A 1XHLA 3EPRA 3V4FA 2CBXA 4ENSA 5HOEA 4EJ0A 4KREA 2HI0A 3PBKA 1Z9BA 3RUFA 4K9KA 2D8AA 1OH7A 2BKLA 1YMUA 2B0JA 2Q1XA 3B1FA 1DJPA 2IDZA 2QTVA 4ZTBA 4BB5A 4QT4A 1GZUA 2JGEA 4G5FA 2OECA 2QI9F 1XTRA 4UPVA 3EGDA 1TJNA 4HZUB 5CX1B 3OEHA 2GZRA 3QNMA 4RADA 3RVQA 3E58A 3S70A 4AIRA 4LFBB 16PKA 2HWKA 4PQFA 2Q46A 2NO5A 3K1YA 1I7PA 2KMLA 5IJ0B 2EU8A 5F3WB 2JFBA 5KTMA 4FOLA 2Q5CA 4CMCA 2XWJI 1H1LA 1KYQA 1MDFA 4MA5A 1JWAB 2V6JA 2XW6A 4L7QA 2O57A 2B20A 3TKLA 4NOJA 4DCUA 2OCIA 3PQ2A 1GA4A 4FW9A 4QYMA 5CXUA 1JHOA 3I9MA 4CEHA 2ZZNA 3MCUA 4CM8A 3T7SA 4MP6A 4OAOA 1WUIS 4E94A 3T35A 5HVNA 1E3SA 2HDNB 2GCOA 2ZXUA 4KLCA 4GE0A 1UQTA 4KXYA 2BI4A 2R1VA 4TWIA 4E5MA 3ZVKA 1OY1A 3EA0A 1V96A 1YUBA 3JWHA 4UPDA 1IBSA 4Q21A 3VYRB 2J30A 3RS5A 5CFRA 3Q9NA 2O5VA 4EY6A 1W59A 3A7EA 4DNXA 3NOOA 1YTUA 1X9IA 2XZOA 1Q7EA 4MAMA 4H7IA 3T4UA 3WGQA 1SUSA 3L4BA 1JIJA 1EVKA 3DVRX 4G1EB 4MV8A 1PEKE 3E8SA 4JWTA 4WK0B 1AGPA 4E21A 3T3DA 3KKQA 3C74A 3QH4A 3G0BA 4RZQA 2N1MA 4IMRA 2A94A 2FPOA 1H6DA 5B2EA 3TW6A 4E09A 5NULA 2VWQA 1P7PA 4OA8A 4E51A 4P2BA 1YDHA 3K2EA 4ON9A 5ALUA 4HGPA 5F4ZA 3RASA 1Z35A 2FVYA 1VTKA 4C7XA 1UKZA 3TSZA 1VCOA 4J7AA 5L3QA 3RHTA 3EQ7A 1EX6A 2C9DA 2Q4OA 1YKSA 5ENZA 1USIA 4YONB 3S2EA 4EGJA 4TV9F 4YLYA 3JTMA 1KAOA 3UM9A 2JHPA 2C3OA 4J03A 1UMKA 4ALJA 2CL7X 1G8FA 5KNBD