4GOLD

Crystal structure of e. coli dna adenine methyltransferase in complex with methylated aza-sam
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
268
structure length
243
Chain Sequence
b'KNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDASVVYCDPPYAPLNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVDELLALYKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA adenine methylase
molecule tags Transferase
source organism Escherichia coli
publication title Structural Basis of Selective N-6 adenine methyltransferase Inhibition by Transition State Mimic
rcsb
total genus 83
structure length 243
sequence length 268
chains with identical sequence E, F
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02086 MethyltransfD12 D12 class N6 adenine-specific DNA methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1020.10 Mainly Alpha Orthogonal Bundle Adenine-specific Methyltransferase; domain 2 Adenine-specific Methyltransferase, Domain 2 4golD02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4golD01
2P35A 2Y1XA 3OCJA 4GOND 4KIGA 5LQUA 3LPMA 2PVCA 5U4XA 4XUEA 1KXZA 4R05A 1RI4A 8MHTA 5EMJA 1X1BA 2ZLBA 3CVOA 5E1DA 1I9GA 2P3QA 4GOMD 5K0LA 4X63A 4GC5A 3CCFA 5EC8A 1F38A 3DR5A 5EEGA 4PYKA 4RTQA 2PKWA 1JTFA 3QOWA 3IEIA 3KR0A 4BLWA 3HVJA 5E1BA 2IGTA 1XCJA 2H00A 2PXAA 2P8JA 1R8XA 4MQ4A 2V7EA 1BKYA 4LWOA 3EVBA 3GCZA 3RODA 2AOTA 1NW8A 1SUSA 2V74B 3O7WA 1RI1A 2YXDA 1RJEA 2GA9A 4OQDA 2Z6UA 4KIFA 1FBNA 4U7PB 1ZG3A 1IY9A 2GLUA 2IBTA 5EG5A 5LSAA 4FT4A 3V97A 1BOOA 3CGGA 3KQWA 2QRVA 3G2QA 3RW9A 4C06A 2PX4A 1EJ6A 4RTJA 5ICFA 4OX9Y 1QAMA 4WXHA 2AOUA 1D2HA 2ZBPA 3EMDA 2K4MA 1G55A 4ZTBA 5LQCA 3TMAA 2IH2A 1XDZA 2DULA 5FWAA 5M5BA 3G89A 1P1CA 2ERCA 2B2CA 3DULA 5C9ZA 2FCAA 3LX6A 1R6AA 2PLWA 4FZVA 1RJDA 3KQTA 3SXJA 2C7RA 5ICGA 3HTXA 3ER8A 2OB1A 2OZVA 2ZBRA 4RTPA 3FZGA 1B42A 4PIPA 5EMKA 3TLJA 3GWZA 5KYGA 2NXCA 1FPQA 3HCFA 2GB4A 4HTFB 4M36A 5IKMA 5E2AA 1INLA 3L8DA 3ELDA 3ERCA 4RV9A 1XDUA 3LHDA 2HR1A 5EZSA 4DKJA 4ATNA 1OR8A 3LKDA 3B89A 3F4KA 3HVHA 4RSRA 1JQEA 5FADA 3ELUA 1JG2A 3GRVA 3HA7A 1XVAA 2AOWA 2ZULA 3FYDA 2ZW9A 5EKXA 5FQNA 3DP7A 1KYZA 5EZQA 4PCAA 1QAQA 3C6KA 3LCCA 4DZRA 4E2ZA 5K09A 4DM3A 2ZFUA 3LECA 3P8ZA 2EJTA 1JQDA 1KYWA 5K0NA 5EGSA 5T67A 5LQNA 3KQSA 1YZHA 2PX5A 1VQ1A 2I7CA 3IYLW 5FQOA 4NECA 3KR9A 3SVZA 2XYRA 3MERA 3LCVB 4PIMA 5ERGB 3TKYA 2BM9A 2O06A 2E5WA 1UIRA 4XUDA 2AZTA 10MHA 1AQIA 3PB3A 1G38A 3KQVA 3TRKA 4RWZA 4PGHA 1SKMA 2A14A 3I5UA 1WY7A 4P7FA 3ANXA 4X41A 2FK7A 4HGZA 2GS9A 3OU6A 2PGXA 2NXJA 2PX2A 4R6XA 4DCMA 1JSZA 3DXXA 3EVZA 3KU1A 3TPZA 2JHCA 2H11A 5DWQA 5B1SA 1QAOA 2IP2A 3NMUF 3S68A 3UJDA 4DF3A 1N2XA 2P7HA 1NKVA 3HVIA 3KQOA 2CL5A 5C0OE 5FWDA 3P2EA 4C05A 2IBSA 4CWAA 3HNRA 2AOTB 5CD1A 1ZGAA 4QQNA 4YV2A 1TPYA 5BXYA 3LKZA 4PYQA 3PLAE 1WZNA 4F84A 5HILA 3TM4A 2FK8A 1D2CA 3K6RA 5DX0A 3UFBA 3UWPA 1P91A 5T6BA 4BY9E 5DM2A 4Y30A 3BGDA 2I62A 2O07A 2ZSUA 2AOUB 3EVAA 1RJGA 1AF7A 3C6MA 3FPFA 2OYRA 3G5LA 1JG1A 3AWIA 3MCTA 2B25A 3NJRA 5HZMA 3T7RA 2JHPA 4XUCA 2PWPA 4BLVA 5K05A 3HP7A 5E9QA 3A26A 5EHIA 4YUZA 3BT7A 5BP7A 1NT2A 2C7PA 2AR0A 1WG8A 5D1NA 3JWHA 4QTTB 2IPXA 4FGZA 4HC4A 4ER3A 1QANA 1Q0SA 2ZIGA 5LQKA 5DM1A 1VLMA 3P2IA 2CMHA 3FUVA 2CKDA 2HV9A 4K6MA 2Y1WA 3T7TA 4GQBA 3BWBA 5E1OA 2NP6A 3R24A 3SMQA 2ZZNA 5DTQA 2JH8A 4QTUB 1PJZA 5FHRA 4AZVA 4RVFA 1EIZA 3MCZA 3EVCA 2PX8A 3AJDA 5KQRA 2GPYA 5GOZA 3THRA 1ZGJA 3G2OA 2IIPA 5EPEA 2ONZA 5HIMA 3NWBA 4EKIA 1JG4A 5GM2A 4YUXA 3M6UA 3HA3A 2CMGA 2G70A 3GRUA 1Z3CA 1RJFA 1NW3A 3LSTA 5EIWA 4BP1A 3LDGA 1X1AA 4WVLA 4YV1A 5JR3A 1G60A 5FUBA 2UYCA 1ORIA 3BUSA 4UOEA 3KR2A 4EKGA 3G8AA 4YMGA 3OE5A 5KQSA 2QY6A 1KR5A 3GO4A 4H0NA 1XXLA 4ER0A 3PFGA 4KW7A 3SGLA 3JWJA 5KVAA 2FHPA 5CCBA 2P1DA 3DXYA 5IH3A 4JXJA 2P7IA 3OFKA 4Z2YA 3FTEA 4P58A 2B78A 3DMGA 2OPBA 2PT9A 4E2YA 3THSA 3KPYA 3UBTA 2NP7A 1XCLA 4C08A 4R8RA 2EX4A 2H1RA 3P9IA 4CTJA 4RTKA 1NV9A 5HIIA 1NW7A 1VP3A 2OBFA 3G8BA 3HCAA 1G8AA 1N7JA 1QYRA 4KDCA 1X1CA 2PXCA 5E1MA 2CWWA 2YQZA 2ZIEA 3BZBA 3OZSA 2PWYA 3BXOA 3LBYA 4RTSA 2B9EA 3HCCA 5CVUA 1I4WA 3A7EA 5DX8A 1VBFA 1ZKDA 3PT9A 5DSXA 5FTWA 5KS2A 4YUWA 3G2PA 2FYTA 4A6EA 1I1NA 2HMYB 3FTFA 4QVKA 3M6VA 3UZUA 2WA2A 1VIDA 3GRYA 3PVCA 4PINA 3PFHA 5DM4A 2LD4A 4R6WA 4DQ0A 4A6DA 1MJFA 4Y2HA 4BLUA 3ELWA 3BKWA 3FUTA 2YXLA 5DPMA 3DMHA 4PWYA 3EVEA 3G88A 2I6GA 2YVLA 3P97A 1P39A 5FULA 4E2WA 3ER9A 2ZVJA 4E70A 3VYWA 4OA8A 2IH5A 2NNWB 1X19A 3GU3A 3OZTA 4AZSA 2VDWA 2P40A 1O54A 3EVGA 4E2XA 1JTEA 2YUIA 2VZ9A 2AOVA 3E8SA 4IV0A 1DL5A 3UJAA 4X60A 1EAMA 5K0GA 5K03A 3AXSA 1HNNA 5DLYA 2EG5A 3FTCA 3HVKA 4R8SA 2NXEA 1SG9A 5CVJA 3M33A 1KP9A 2KW5A 5EOVA 3IHTA 1X1DA 4KDRA 5GWXA 3GRRA 4RTRA 2VS1A 3C3PA 4ER5A 2BH2A 1D2GA 1KIAA 3CJRA 3DLIA 3KKZA 4CTKA 4GF5A 1RI3A 2OKCA 1KPHA 4AZTA 2XVAA 2O0LA 3E05A 4QQKA 1ZQ9A 9MHTA 5K0CA 2ZZKA 2AOXA 4GUAA 5DXJA 2I9KA 2YTZA 3SX0A 1NV8A 2BM8A 2C7QA 3B3JA 2ZCJA 2FRXA 3NWEA 4QPPA 5E2BA 5MHTA 3WSTA 3UJBA 4HH4A 3EVFA 4OQEA 4ISCA 3HEMA 1O9HA 4HRAA 2Q41A 3UJ9A 3UJ8A 2XVMA 3HCBA 2GH1A 4YUYA 2YXEA 2IDJA 1YFLA 4O29A 3MTIA 3DOUA 5EHGA 3GGDA 1L3BA 3ELYA 3KPUA 5G02A 3OU7A 1UFKA 5LQAA 5DM0A 3TR6A 4F85A 4RVDA 5E9WA 4RTNA 3KQQA 4OBXA 3DMFA 1U2ZA 3CJQA 4AZWA 1Q0TA 3R9XB 4OBWA 3GNLA 1H1DA 4XCXA 2ESRA 1EQAA 1M0EA 2YR0A 3HCDA 3KPVA 4GEKA 3CKKA 4YMHA 5GINE 1G6Q1 3PX3A 5DTMA 4HGYA 2AVDA 4DA4A 4PYNA 5HFJA 1F3LA 4P7KA 5GIOE 1DUSA 1JSXA 1L1EA 1SQFA 2NXNA 3E7PA 2EJUA 3E23A 2ZTHA 3BWYA 3I53A 4IWNA 1JG3A 2O57A 3FYCA 5CM2Z 1BC5A 3T7SA 3FUXA 3TKAA 5LQJA 5DRYA 4HSGA 3KHKA 5LR6A 3MHTA 5EEHA 3R0QA 2PBFA 3VC1A 3V8VA 2YX1A 3G5TA 3SSNA 5E9JA 3H2BA 3P9KA 2QYOA 1SQGA 4LECA 1HMYA 4KWCA 3D2LA 3O31A 3NDJA 3OE4A 5K01A 1IM8A 5K0BA 3K0BA 2BR5A 1NE2A 3MGGA 3KPJA 2F8LA 4RVHA 1WXWA 1N7IA 3MQ2A 3MB5A 5E8JA 4F86A 4KVZA 3GXOA 3U81A 3BGIA 3NW9A 3Q7EA 3BKXA 3OU2A 4FR0A 3UJ7A 1WXXA 3FPJA 3A4TA 3A7DA 5EMLA 3VC2A 3VSEA 2XYQA 2WK1A 4E32A 2AN4A 3OPNA 3EGIA 5EMMA 2BR3A 3P9CA 5BW4A 3QOXA 3SSOA 4GOLD 3GJYA 3FPGA 3MAGA 5EIFA 5F2OA 3RIEA 3TOSA 2DPMA 1VP9A 2HNKA 2PT6A 4AX8A 4CKBA 3IV6A 3HA5A 5HEKA 1EJ0A 3EVDA 2G72A 3C0KA 1NW5A 3OFJA 3I58A 3SSMA 3AXTA 3UA4A 2FPOA 5LQRA 3LBFA 4M37A 3EMBA 3JWIA 5JUWA 1NW6A 4M38A 2GAFA 5CIYA 3AY0A 5C1IA 1R8YA 1VE3A 2QM3A 2ORED 5DX1A 4PYJA 4QPNA 2OXTA 2OY0A 3OZRA 3I64A 4QDKA 1PRYA 1R18A 3GIWA 3SR4A 4C4AA 2IH4A 4AUKA 2EFJA 4PGGA 1SVUA 4RYLA 1R74A 2JJQA 5BW5A 4CXMA 3DXZA 4EK9A 2P41A 1QZZA 4C07A 4DMGA 1YF3A 5CUQA 1G8SA 3GDHA 3ID6C 4LWPA 3M70A 5EKUA 1MHTA 5DTRA 1RI5A 5K8VA 1TW2A 3DH0A 4E30A 5ICCA 4RTLA 4PYMA 2PJDA 4GC9A 4ER7A 2P3LA 4BP3A 1M6EX 1XDSA 1JQ3A 1YUBA 4IKPA 2ADMA 3G2MA 3CC8A 4QDJA 3M6WA 3NVKI 4V0QA 2N47A 3LDUA 4LG1A 2BZGA 2O05A 3DLCA 5F2KA 1VPTA 2PY6A 5FHQA 1FJXA 4P7JA 4M7RA 1P1BA 1SUIA 2JHAA 2QE6A 1BHJA 3KQMA 3P71T 2QRVB 5ICEA 2B3TA 3T0IA 4YV0A 4MTLA 2VP3A 5K0JA 2UYHA 2R6ZA 3PS9A 3BGVA 5FA5A 3UJCA 2UZ4A 2IDKA 1ORHA 4RX1A 1FP1D 3BWCA 4P7GA 4GOOD 4X61A 3Q87B 1V39A 2G71A 3O4FA 2G8NA 2AVNA 1XJ5A 2UYOA 3M6XA 4QVGA 1AV6A 3M4XA 4CKEA 2Z6QA 2OB2A 1YZ3A 3C3YA 3FUUA 4ER6A 5F2NA 1VL5A 1EG2A 2PXXA 3LCUA 2OO3A 1AQJA 1R00A 3PTAA 3KPWA 2XYVA 5HIJA 4C04A 4MWZA 1L3CA 3GRZA 5K0FA 2WA1A 5EVJA 4L7VA 5EQJB 5CVDA 2ZWAA 3PX2A 3KQYA 5FA8A 4RTMA 3FPEA 3HM2A 5H02A 3FUWA 3R6TA 2AN3A 2VDVE 3MTEA 4PYOA 4FSXA 5GP1A 5HIKA 1WS6A 4G56A 1DCTA 3A25A 2XBMA 5FCDA 4GBED 3FPHA 1KHHA 5E8RA 4IV8A 3B3FA 4X1OA 4EVIA 3R3HA 2HTEA 3P2KA 4PONA 4EMSA 4RTOA 3UJ6A 3UA3A 1FP2A 3NVMB 5T64A 4E33A 2PV0A 3KQPA 1O9GA 2ONYA 1RI2A 1M6YA 2R3SA 3SM3A 3X0DA 5CCXA 2BR4A 3P9NA 4DCGA 5P8WA 3EGVA 3CBGA 1UWVA 1ZHFA 5DSTA 2P3OA 2VDUE 3B7PA 3LDFA 4C03A 1YFJA 1NBHA 3QV2A 3REOA 2IFTA 1NBIA 1IXKA 3DUWA 3HCEA 4PYLA 4POOA 4PNEA 4B17A 4OA5A 2NYUA 4HTFA 3G7UA 3I9FA 3ME5A 4KRGA 5CVVA 4E31A 4PYIA 2G1PA 3A27A 3JWGA 3TQSA 2Z6AA 2JG3A 2ZZMA 1KPGA 3TFWA 1YB2A 3EEOA 3CJTA 5DRTA 3ORHA 5DT2A 1L9KA 3EGEA 4HG2A 2AS0A 4RVGA 3FTDA 2ZIFA 3BWMA 2PSSA 3EPPA 4PCLA 1XTPA 3B5IA 3NTVA 3B3GA 5GIPE 4V0RA 4CKCA 1KPIA 2JH9A 3DTNA 4U7TB 4MHTA 4FSDA 5DXAA 4MIKA 2AN5A 5CVEA 5D1HA 4EQZA 3KR1A 3LGAA 4FT2A 1Y8CA 4YUVA 1TW3A 2UYQA 1T43A 5HOQA 3LL7A 4FS8A 4FP9A 7MHTA 2C7OA 5GM1A 3FRIA 3EEYA 1JR4A 2ZBQA 2HWKA 3NDIA 5K0EA 3FRHA 2ZWVA 1L3IA 3TM5A
chains in the Genus database with same CATH superfamily
4HB2A 3DKPA 3CF4G 4FCVA 3CZ5A 1SCUB 3E58A 3D7SA 1RCFA 2IT1A 3PI7A 4IJQA 4D42A 4C6TA 5LFAA 2OXRA 4WK2B 4DSZA 4DLZA 4CCSA 4DE5A 4CIYA 1YQXA 3RTBA 4F1WA 6REQB 4JLOA 3SQNA 1XXHA 1I9GA 3GRKA 3JQ7A 1XRRA 1KEEA 1N9ZA 4K2AA 2FQXA 3FVRA 1SZJG 1X94A 2X0JA 4CF5A 4RBNA 3MJSA 2MSCB 3IAS1 1QB7A 1IN4A 4FX5A 5AYVA 1A4RA 4MQ4A 4LWOA 5GQSA 1P6QA 1QM5A 1EGMB 4CW7A 3O7WA 1F48A 3M1YA 4HD8A 3V2HA 2H4ZA 1J0EA 2Z6UA 3DEKA 2OK8A 3FOAA 2P5SA 4IH4A 3X1YA 5LIRA 1Y98A 4BQSA 4TPKA 2H59A 4F1KA 4NNOA 3QPVA 3SN6A 2EZ8A 4IJWA 3E7WA 2FGKA 1O7JA 2I4TA 1OKKA 4LZZA 4TVKA 1B1CA 3FKJA 2PMDA 4NRDA 3SLKA 3TQQA 5HXAA 4PC6A 5LQCA 3HI4A 1ORDA 1E9EA 1DQNA 1PEKE 4D8YA 3BX1A 2H1WA 2AJLI 4X5OA 1AMOA 4GWKA 2XTZA 2B2CA 3Q7IA 5C1BA 5JXWA 3PEWA 1CBUA 5DZSA 1M1YB 2QGFA 3W2HA 3SXJA 2HYIC 5K3CA 4JV5B 1NMQA 1VM6A 2DWCA 3O4GA 1CK4A 4B6SA 3VQTA 4DSUA 4TTRA 3I3SR 5EHNA 2CBZA 5TQ2B 2ZT7A 2V7PA 3RBZA 3RVOA 1U7ZA 3L8DA 4F4JA 2Q6TA 1N2SA 1PG2A 4EG4A 3V5NA 3N75A 1KYQA 1EFPA 4L78A 2Q4OA 4HVTA 4DV5B 5KSOA 1HYBA 4IIHA 4RQAA 4H60A 2CE7A 4U63A 2PZ8A 4ARAA 4BB0A 4D3ZA 3F3MA 1XVAA 2GJ8A 1GVHA 2C78A 4JQYA 1TD9A 3BSWA 4E2ZA 4XD7A 5TSDA 4DM3A 5CFQA 4FQ5A 1RWNA 1J23A 3Q40A 2JFVA 2R00A 2V0CA 4RK5A 4BE9A 1K8RA 4GE0A 4J0QA 3EQ7A 4P08A 4D9NA 2Q9CA 4OXIA 3DQPA 1WPQA 5B64A 5BYAA 4KI7A 3GRCA 3R8XA 1RXYA 4GG1A 5CB6A 2AJDA 1MRSA 4N54A 5A4DA 5FB3A 1ZR4A 3DMRA 1QC5B 1FPMA 1Z12A 2JK1A 3AHIA 4GSYA 3U37A 2ZUUA 4ZEOA 1SCAA 2J9GA 1Y6FA 1RE1A 1Q11A 4P7FA 1W88A 2EJWA 1F5NA 3AVPA 4TQGA 5GONF 3A4YA 5B1YA 4KJZA 3K1AA 1E1DA 3IUBA 1IK6A 1GDDA 4HAXA 1FYFA 4KQWA 1F3OA 4WX2B 3WKAA 4BKUA 1GYQA 5CURA 5AI9A 2D5IA 2P0YA 3BDVA 2Z04A 1JIUA 2QMYA 1OX4B 2Q4BA 2Z2ZA 3KAQA 3QKIA 4G4SP 4BFZA 5KB3A 1D5WA 4HSEA 5JI2E 3UJDA 2QRPA 4MRPA 1C8BA 3PGA1 5G0TA 1ZIXA 3T4XA 5FWDA 4RU1A 4F3NA 3FI9A 1F6WA 2HBZA 3HGTA 3HABA 2ZU0C 3P2EA 5KTNA 4HWTA 3AVTA 1OUMA 4TV9B 5AKJA 3B3QA 3K2BA 2PRSA 1PI3A 4K9NA 4MYTA 3O95A 5MFPA 1JDPA 5AJHA 5HUJA 4JMLA 2OD7A 1WVMA 2YMLA 3GFRA 5F73A 4UARA 4PZCA 3W3ZB 3ZDYB 2AL7A 1HGXA 5EJ9A 3DDCA 5JZSA 4JVLA 2QTAA 4NLLA 3CNHA 1BE6A 2RHGB 2YNMD 1LSJA 2IY7A 1X7DA 1MIOA 1H3EA 3X1ZA 1ENZA 4D4IA 3FDZA 4KZKA 1FUKA 5AM4A 2GLXA 3I2IA 5F5XA 5K0ZA 4KXXA 4IVRA 3N2NA 1NQXA 3NHSA 4R1TA 421PA 1NVGA 3A6JA 1ISSA 2N42A 5A3JA 2MSKA 3NHBA 4INZA 4DA6A 4BVGA 5EHXA 1X80B 4C87A 2I4IA 5KQLA 1XA3A 3WQRA 3W7VA 3VAZA 1R6DA 2V6MA 1CY1A 3MIZA 2XIQA 4MRSA 4JWTA 4X1YA 1ABBA 1GGVA 3X44A 3D31A 3O9VA 5DYYA 3H4IA 4UDNA 3HYNA 5FTKA 3T41A 1SVIA 3CW2A 2ZZNA 1JYSA 3GQVA 2YINC 1D4AA 4K6GA 2BGLA 2XECA 4IQ8A 3KALA 5EMNA 4BX8A 2ZRIA 3Q6MA 3G2OA 8GPBA 1R6TA 3CN7A 1UMBA 2HDHA 4UPVA 4W9NA 5EIWA 4MDFA 2CMGA 3MPUA 2D3WA 1T9BA 3OUTA 1J1UA 3J7AC 2H4HA 3C3BA 4LYYA 1ONOA 4EP1A 1ADJA 1SG0A 4YCAA 3NFRA 5J2TB 5BVGB 2FVXA 4GVXA 4NV1A 1MTOA 5T3YA 2YFHA 5BMVB 4N3NA 4X8OA 5CLGA 5AW3A 4AUEA 1CR6A 2FR1A 2P7IA 3FPBA 4H1TA 4IGEA 1XBTA 3NETA 4JBYA 4Y3UA 2RHWA 3DMGA 4CFZA 1E8DA 2VHUA 1NNI1 5IJXA 4D1YA 1CZOA 2RARA 5TQJA 4R8RA 3V4ZA 3P9IA 3EYAA 4WZBE 1AO0A 4GKJB 1W4RA 4H1VA 4Z0PA 1FUEA 1B8PA 3GEGA 2WU0A 1WB5A 1II8A 3NRCA 3QVMA 3ZIAD 1KZYC 4HJRA 3U7GA 5DISB 2IU0A 5B5SA 1RYZA 3HFSA 5DSZA 2PBZA 3BMNB 6Q21A 4CU2A 2PD6A 1QH1A 2E5FA 3LHFA 3NTXA 3G68A 4MWCA 2EGGA 3A7EA 1T3GA 3PT9A 4KIUA 4JJ6A 3GV0A 1J1ZA 3BXEA 4W6ZA 4XIYA 4W5RA 2XKKA 3UZUA 2WA2A 3PVCA 1P29A 1NN5A 2DKNA 5K9ZA 4CETA 3SHQA 1J97A 4S1PA 4BLUA 5HF5A 4RK6A 2B61A 3H0CA 5HJ5A 6ABPA 1E89A 3OO0A 3ER9A 3U31A 1E3MA 1JR2A 2NTYC 4IOJA 3D7LA 3LUHA 1POXA 4Z7JA 4A0HA 1QGDA 4HX2A 1JTEA 4IIVA 4RZUA 1Z82A 5E6SB 1L8QA 2A7XA 4PGFA 4X60A 4GYYA 1TZ2A 3OPMA 1CUAA 1RBMA 4MEBA 5DOVA 1K5GA 2RDMA 3IEKA 4R8SA 5SZKB 3U62A 1REQA 1UBHS 1ONPA 2DFNA 2BTOA 3GLRA 1BJRE 4CT5A 2JGDA 2Y92A 3IHTA 4JB8A 2IV7A 4KXVA 8ATCA 4RTRA 4AS1A 4WACA 4I1SA 2DTXA 2BH2A 1CVIA 4YMVA 1DINA 3CLKA 2ZPTX 4HADA 4AZTA 5DIZA 1KPHA 2NZVG 2J8ZA 3DB1A 4R2LA 3W1EA 5DLQC 3QXXA 3O8RA 3EUEA 2ZB3A 4KO4S 5IJ0A 1T0UA 2I2WA 2RGYA 1C8VB 3OOYA 2BM8A 4N5NA 4V0ME 3I5MA 3F6YA 4I1YA 4AN4A 2ZDQA 3ZDFA 4KJXA 4ZO4A 4RJJA 3VR4A 1SU8A 3ND9A 3V1KA 1YH3A 5MF6A 2X7JA 4QFMA 4BQEA 1QF7A 1NQTA 2C83A 1CE8B 3D4LA 3L93A 3QY9A 4HYQA 4HZUB 4BEJA 2IV3A 4CL2A 4EGAA 1HC7A 1Z4KA 3PNLA 2C58A 1XZHA 3UICA 4RD0A 1E2GA 2XYGA 4B3DA 1WXEA 3GDGA 4F5EA 2AG6A 2ZI5A 2A67A 2GYWA 3B3AA 4F5DA 3EPJA 3G0DA 3NIFB 4M9CA 4OBWA 4XX1A 5IK2A 2ESRA 1YMUA 3D8HA 3E81A 3GPCA 1NVMB 4YRSA 2J9XB 1CUUA 1WBBA 3CXRA 1W85B 2WP8J 4H9GA 2H7VA 4B81A 4ZV7A 4HEQA 5DTMA 3SE0A 1BA3A 2H7YA 2J0SA 4ZQBA 3WA7A 2YOFA 4N41A 2QW1A 3E23A 5AK5A 2IPAB 4RPGA 1E63A 4XOUA 4F2DA 4DYVA 1E2EA 3ETCA 3UJPA 4LMPA 1XMJA 3VBEA 3PFNA 4EZEA 4C3UA 3V2IA 1I4LD 4EAQA 4DKXA 3FFXA 3I72A 3IDOA 3GMSA 3VVBA 2QLMA 3DMYA 4H1UA 4YDSA 1LWNA 5EIBD 3WLKX 5AVRA 2BEWB 2J9ZB 4LTDA 1CZUA 5KNCH 3HFRA 1X15A 1QKIA 1SQGA 3OT5A 2YZMA 5KO2A 1Z0UA 4EIWA 3KFXA 3NNDA 1F60A 4XSGA 2NVBA 1NF2A 3KPJA 4MXDA 2C2ZA 4TVSA 5J1SB 1VHJA 2OILA 2OCYC 3GXOA 3MT0A 2NT4A 4KVZA 2YS6A 2C84A 3Q7EA 2XSZD 3IGFA 2ILVA 3LYUA 3OECA 4D5EA 1P77A 4OGLA 1K3UB 1AKWA 4YH1A 2OO7A 3NZEA 4HAVA 3WISA 2JAXA 4FB4A 2H16A 4AB1A 3EXHB 4L15A 3CVUA 1YR1A 3CS3A 1OVMA 5JXHA 5AUPB 4RAQA 4PG8A 1PTJC 2IUUA 2CEAA 1SHJA 1HYHA 3FNIA 5KCZA 5F2OA 1ZH4A 1Y6GA 2DPMA 2TMYA 3H1PA 3PF9A 4IY1A 3K2QA 5JOQA 3FRJA 5HEKA 2BELA 2G72A 3EVDA 4WGFA 2IHNA 3CPHA 1G9SA 3G2LA 5JQGF 4NMMA 4KP7A 5B37A 2WIJA 5TMEA 5LDHA 1HZZC 4JI1B 1LRJA 4X6LA 5IM5A 4B80A 4J4HA 4E03A 3VO9A 1DGQA 1E98A 1YZVA 2OHFA 4DCSA 2O52A 2OXTA 2CZQA 5AI8A 3A58B 1YVUA 1QK4A 2VT2A 4LFBB 3IJRA 1MDFA 4AUKA 2EFYA 3K09A 3BF8A 1A5TA 4WKOA 1GZ7A 2O2SA 4A23A 1IIRA 1UDRA 4MGZR 4POAA 4Q1AA 3VH4A 2AMJA 1Z26A 1VPLA 2FPWA 3C3DA 4R3UC 4ARSA 4JXZA 1HZZA 5JAHA 3O91A 5DTRA 1OAKA 1Z56C 2AJBA 4P3OA 5FAXA 3DH0A 1YOVA 1M0SA 3KZCA 4X1KB 2J9YB 4MB0A 3KQKA 4DQKA 1QRRA 2IXDA 1WDMA 3R7SA 3Q3IA 2ADMA 4UD2A 5IVIA 3RVKA 3Q5DA 2CNWD 1KNXA 1CY2A 3L07A 4GYJA 1AZWA 2PY6A 3ILSA 2HHAA 3QF4A 4ZZ0A 3ZW9A 4JKOA 5CTAA 1OYWA 3FUCA 2PAFA 2YJ4A 4N39A 3FCSB 4JDUA 5F64A 3FPAA 5JAQA 3T0IA 5DI9A 3V8RA 4ENVA 4YV0A 4ZU3A 3PGJA 1L5GB 5EN4A 3BGVA 1FSZA 2QL6A 4PSCA 1XQ1A 4Q4AB 1GGEA 1Q0LA 2AF3C 1BYIA 2P9GA 4NBKA 2F3UA 4QE3A 2AX4A 2XDQA 3EAGA 3RANA 4JXXA 4QVGA 4UE2A 1UM9A 2PR2A 2BFOA 2I65A 3L1IA 1QHIA 3BTSA 4CKEA 3VVMA 2ZIZA 2XXJA 4L4RA 1V9SA 1VPWA 1YNOA 2XIJA 3Q3EA 3LXMA 4BKRA 3BULA 3MJ4A 4KFSA 3SAJA 5A9RA 1LTHR 1XRLA 1KK3A 2X8JA 3T4PA 1N0IA 1EVEA 4K9LA 3EA5A 3ER6A 1DE0A 1TZKA 1COZA 3WK5A 5DHUA 3SF8B 2CLHB 3TS1A 5I7VA 1Z7GA 4B85A 3TAXA 1QHFA 2V98A 4YP0A 2NADA 3WADA 1JJVA 2GZSA 4YQFA 1LC3A 3IIKA 3N39C 3T8YA 3BRWA 1VIYA 2WV7A 1COWD 3DMPA 1I3KA 2QN1A 5KYVA 2VF2A 4ILKA 2CJWB 4C9BA 4YMTA 1BWQA 1GZHB 4WY5A 1BTOA 1AF4A 4G5GA 4MPRA 2Q45A 4PEVA 4ZAYA 2I66A 4FFBB 4DQXA 3AL0C 2G67A 1L8AA 1XHEA 4PC1A 3GGPA 4WCFB 4WJZA 4PG7A 4XIJA 4TV8A 1RM4A 2O5RA 2PVSA 1QYVA 1IB6A 4DNPA 4EHDA 2R8EA 3FBWA 1GFZA 4FWBA 1XPRA 2OO5A 2C2XA 2OVBA 3LWZA 4BO6A 1U1DA 4GL4A 2WIBA 5COAA 1CQWA 2PHZA 3AB7A 3G02A 5BPFA 1EJBA 1O94A 3LQFA 2BTQA 2H5JA 2B8TA 2SHKA 2WG2A 3OC0A 3Q9UA 3ZHTA 1N2ZA 3PUZA 1Y3DE 4OA5A 3WDKA 1I5EA 3QM1A 1C7QA 3ONWA 4JGGA 1XNJA 5HWSA 1HQYE 3QYAA 1GDHA 2Q1TA 4BXOB 3DFZA 3VR2A 3EZLA 1TYAE 4AO8A 2OK7A 3F7NA 1BXKA 1RYHA 1G42A 2W6JD 4ZJYA 3RK1A 1PGPA 1JN0A 2FP4A 3VV3A 2ODPA 3E3LA 1FXSA 1JP7A 2HM7A 1KEKA 3MCAA 2RK4A 5DFAA 2Z56A 2OYSA 2JIMA 5IJ9A 1SIOA 1JHYA 1Z16A 3LGAA 1E3QA 1KH3A 1VG1A 1XROA 3IAAA 3GLHB 3U4IA 2Q99A 4LUCA 2E87A 1QP7A 1IEQA 3E9DA 2WJWA 1Q3KA 3HBJA 4CCYA 3PGLA 3QMWA 4E4TA 4LRYA 3BK2A 3FRIA 1S1CA 4TL6A 1MV8A 2WTEA 2H18A 2V5AA 3JS5A 5AM3A 1K7CA 3NV9A 4NS1A 1NP7A 3SX4A 1QDEA 4QLAA 4ED9A 4YHHB 3SNKA 4JU8A 3Q8WA 2L69A 4C0WA 5TGZA 2PVCA 4J9UE 1T6ZA 4P9NA 4OHMA 4R05A 3UW3A 4ILEA 2QG4A 3GH1A 1S9DA 1X1BA 3VZCA 3OVMA 3AI7A 4HFJA 5K0LA 3DL7A 4DA8A 1U7PA 5GOTA 3KNZA 1OLUB 2ZR8A 3ZG6A 3ADBA 1C30B 1FFGA 3HUEA 3I2KA 3U6BA 2PNFA 2GAJA 4X7BA 2UVQA 4LV8B 2E85A 1SB9A 2AZMA 3IT0A 3JRXA 5ICMA 2AXNA 5D6NA 4DR3B 1GKUB 4Q1FA 4TV9A 3DFKA 1JIIA 2Q4DA 3ESXA 2V74B 3HC7A 4HZIA 4EJ6A 4YRNA 1RI1A 4WZBB 2Q1WA 1E2FA 3ZHXA 1Q57A 5TJ9A 4RKQA 3ITDA 2IU6A 1TM5E 1RW4A 5CLHA 1YQ9A 1GNLA 2FMXA 3Q9NA 1NQOA 4U2FA 4IHJF 1AA6A 3KQWA 2XXAA 3AEUB 3JR7A 1Y80A 1NDHA 2BMVA 2CBXA 3JAKA 1KKMA 4IRMA 1GRQA 1K89A 4B3JA 1IM2A 1AS3A 1KFJB 2H4WA 4NK5A 1K6XA 2PYIA 1N4AA 2B82A 4ESHA 2DQKA 1JHZA 4WY2A 4ALNA 2AFVA 5JLJA 1N4DA 2JF0A 2ERCA 3LFUA 1T6BY 4L4UA 4HWKA 1SD1A 2CLDX 2YNMA 2G4LA 3CIOA 3ECCA 1RJDA 1OBHA 1Z7BA 4DJFC 1CP3A 3M6FA 5D7NA 1C1YA 3E53A 3S1AA 5A7FA 1YOBA 1SRRA 4IAOA 3ZWMA 5CX1A 5IAKA 2YJGA 1EK6A 1KJWA 3KB2A 4JB0A 3P9YA 5ALSA 2G5TA 2VVTA 3OJEA 4D74A 2P69A 3LUCA 3O0TA 7MDHA 2JFHA 4XB2A 2JGNA 2GCGA 2VUHB 1TRKA 3SJ7A 1N1EA 1MP0A 2FFQA 3AP2A 4JIMA 4RFSB 4TL8A 3VJMA 5I7RA 3OQOA 2O5CA 1ZY2A 1TU3A 3MWEB 8AT1A 4ZYXA 3NBYC 3HA7A 2AOWA 4ZC8A 3U4AA 1DJNA 5JS7A 1X14A 1MORA 1VOTA 3OM1A 4MJ7A 3ZZ0A 3DONA 4YMLA 2WMOB 4LOLA 2ZE8A 2GPTA 1JKFA 4HO1X 4R84A 1HY3A 1V2HE 4LF8B 3N74A 4XGIA 2Y0BA 4UAJA 4O4HF 1I8TA 3QFTA 4C76A 1VQ1A 3DQQA 1GUFA 2WJVA 4JL6A 4LCEA 4N18A 3TCKA 1XD8A 3NIWA 5DI3B 2VNHA 3X1MA 4LQ4A 3AFGA 4W5HA 2O06A 4YCNA 2WMYA 4GAEA 1SBHA 2F59A 4PV7A 4XUDA 4RS4A 5EE1A 3KKQA 4RD6A 2HA7A 2V7TA 5FORA 3KSAC 1W2WB 4J7CA 3TQHA 2R6CA 3IR7A 1AK9A 5JDCA 1R4AA 1FP7A 1WMBA 2V9PA 3N0XA 1U0FA 1UBFA 1PGJA 3TYXA 1KI4A 4ETIA 2OBLA 1HQDA 3DXXA 3INYA 5F2EA 4AY2A 1B2LA 1EZ1A 1IAVA 3TPZA 3S2ZA 3V4LA 1QAOA 1NKSA 3S68A 1C50A 2R6DA 3GZTB 2P7HA 1ZL2A 2IOHA 1IHYA 5G41A 5DGXA 3LC2O 3DZDA 2G83A 2PG3A 1G21E 3AEQB 2OD9A 4I46A 4PVDA 4A1FA 2GJSA 4J4BA 1X80A 1TPYA 2V7QA 1BMQA 3L7AA 1XVIA 1C0KA 4DRXA 4KI0A 4PYQA 1VHDA 4BKPA 1NXOA 3BREA 4KXUA 2XUOA 2H85A 5KYWA 1D2CA 2ZUEA 1J9ZA 4GLOA 1LQ2A 4NCAA 2NT3A 2ZJ4A 2P2GA 3MNFA 1PSWA 3VU9B 2P62A 2QORA 2G1UA 1ABFA 1MOSA 2KPOA 4OPMA 3EVAA 4K81B 4YONB 3WZLA 5JFGA 4I4NA 1JG1A 3G85A 4PFSA 4HTFA 4MJXA 2FEWB 3HB7A 1TTHA 4PANA 4MVXA 1FU8A 4Z4HA 3FX2A 1R1DA 4OSEA 2YXPX 4C3VA 2DUMA 1OT5A 1IK4A 2XZTA 4N01A 3VR3D 1FDRA 4QRDA 5DM60 1D09A 2IPXA 4A9AA 3EG9B 2HDNB 1WR8A 1UJ2A 4H08A 4G0UA 1AJEA 3RRMA 1FDUA 3ADDA 3JVIA 5HS4A 3JQBA 2RB5A 1PR1A 3A4MA 1D4OA 4CNBA 4OUKX 1WKCA 2D3TA 5DCYA 4YMSA 1B93A 1IUKA 1UOQA 2ZQYA 2NO0A 1FDSA 4AP9A 1R6BX 1AQNA 5HA5A 4BV9A 2FDCA 3U09A 1MR3F 3U40A 3HV2A 3IDZA 1XLTA 2PX8A 3D6FA 4XSHA 3CM0A 4Y2XA 2FRVA 2VTDA 1S2MA 2JZOA 4I36A 4YUXA 3NNSA 4UMVA 2OLJA 2BEWA 4RVUA 4J6FA 3AR3A 3NGXA 4QX6A 1E3SA 1F0PA 3AO0B 4XQGA 4HNVA 3K6SB 1N9GB 4WNAA 2RH5A 4V0LA 1LZLA 4QBTA 4MQEB 2CYCA 3RFFA 1S5PA 2E55A 4WDRA 4E09A 3QFRA 3KSUA 5H9VA 4M1SA 2YZ7A 5G4KA 3SGLA 4OHPA 3GLTA 4QRHA 4NESA 3OIDA 4ERXA 3K0KA 3MJVA 3TW4A 4DA9A 3U0VA 3ON5A 1E1YA 1RU3A 1J4AA 1VBMA 2IIQA 3ZJ4A 2XE8A 3RHTA 3EIFA 5DNEA 4V0SA 1P2SA 2X5OA 1UBMS 4QOGA 3STUA 1HSZA 4NYJR 3UHJA 4B6PA 4BX9A 1WZEA 2ZYWX 1R0WA 1PG0A 4F3YA 2R62A 3GEHA 2ZB2A 1WVIA 1H0RA 1Z39A 2R8BA 3ICPA 4XPIB 2O14A 1C7RA 1LPBB 2HRDA 3LBYA 3OBBA 4AKEA 3EMVA 5CVUA 5DX8A 5IDYA 4E12A 1VBFA 5DSXA 4M0DA 2QLBA 4J0HA 4DLBA 2B1RA 2K7ZA 3CBQA 3NXSA 5CB4A 2PA3A 2PS0A 2AG5A 1XMVA 3AYZB 3WB2A 5K3OA 3T54A 4L3VA 2C82A 2PX3A 4XWKA 1VIDA 5T6MA 5CFZA 4RLQA 5DTEA 5FPKA 4FZRA 4DNOA 4BAGA 4DDMA 3ZBUA 3MMXA 3O4JA 5FJJA 3GYBA 3EGXB 4LXXA 1Z6AA 2YVLA 3E9RA 4NBNA 2GJKA 2IKSA 4CR6A 3PQCA 4DPLA 2XQIA 1DP4A 4PQFA 1JQLB 4X92A 3T6KA 1JKXA 1QU3A 3FCUB 1JVBA 2L18A 3GIDA 4H0FA 4ZU1X 1DQRA 3LQ1A 4MEAA 4BTEA 2VDWA 5A5EA 2VHXA 1CNFA 2CNBA 1RHUA 2AKYA 4JI6B 3DE0X 1LBSA 1O6CA 3ANTA 2JD0A 3MFQA 1WXQA 4HI0E 2YWCA 1DTSA 4U6QA 3K16A 2RK6A 4TRMA 4UBNA 3SHOA 1KWKA 3H0KA 3KZOA 4OU5A 2Y1KA 3NTOA 1Q20A 3C3PA 3JV7A 3P52A 5ILGA 4MS3A 4EHAA 1ISHA 2SKCA 4Q00A 3K31A 4W9NC 1KQNA 4PXSA 1TMOA 1U1IA 2O8VA 5G0WA 2AOXA 4LXYA 3WGMA 2BTEA 1RS0A 1Y6RA 3U49A 1U4SA 2YW9A 3T7DA 1T0IA 3A2LA 3W4JA 3KKPA 1VZ3A 1PLKA 4ZJZA 4S1TA 4RA9B 4XCQA 1CJBA 1IHDA 1TVKB 1YNSA 4ISCA 3UUEA 5B12A 1W49A 2ZR7A 3AR8A 1AGRA 3H9BA 3UM9A 1YFLA 1Z34A 3HMQA 2CZGA 3HXQA 2A94A 2ZJAA 4N7JA 2WWGA 3ELYA 3OQJA 7AT1A 2ZDGA 4RFVA 4KRFA 1T0BA 1D7OA 3A1EA 3CKYA 4K6KA 4WZAA 2WJZB 2X0FA 3VOBA 4XWOA 3DMFA 3T3OA 1OLOA 2ZRGA 3ZYCA 4R54A 5CX4A 3F1LA 1H1DA 4BYMA 3H8VA 2KLBA 3GVCA 2C2BA 1PDVA 5J4HA 2FLVA 1L5OA 3KPVA 3CKKA 3D7MA 4IDPA 5GINE 1K06A 4BZWA 4CM9A 3MWJA 2WAXA 2II6A 1DUSA 5KYWB 3RARA 2XA2A 1UC5B 3OX3A 4CQJA 3WR5A 2ZTHA 1DWOA 3AHFA 3IT3A 1Y6QA 1QIMA 2WG1A 2CVPA 3OP4A 1VG9B 4HWPA 4EA9A 3C8DA 3TKAA 3FUXA 1SJ9A 5I01A 2UYGA 3EDYA 4MUMA 3RSOA 5JNUA 3EUWA 3I2GA 3E35A 3IBSA 1XCOA 1YZYA 4XWYA 4MICA 3WGYA 4MWGA 4A0RA 2WZBA 1GD1O 4EI8A 2Z58A 2I5PO 3ST7A 4C5AA 3I0NA 2G1AA 3Q6NA 2H7XA 5AW4A 4AS2A 2OWEA 4MV1A 5TF0A 2V3WA 1LVGA 1PR5A 1CUFA 4DDUA 1GTG1 3MQ2A 1OREA 4IOLA 1L4HA 4A82A 1Y7HA 5J3JA 1WLYA 1JRLA 2GILA 1ORVA 2JIZD 3A4TA 5JTTA 1B00A 5LBTA 2DKFA 2Q1UA 1X39A 4NS4A 4ZVPA 5HJ2A 4JNKA 1Y8ZA 2HK6A 4HX9A 2FDRA 3AERB 1PYDA 1QVVA 1FTWA 1ZUIA 3L8CA 5ALDA 2Q3MA 1C9KA 5BUCA 2BFBA 3FPKA 4XOIA 1E1LA 1PNTA 5HCIA 5I7AA 5LP1A 2XF8A 5E6UB 3ZX4A 3C0KA 3RR2A 3KOWA 3OFJA 1ITZA 5EWMA 1TYBE 4DHEA 1A98A 4PFJA 1F0YA 5JQGB 4FMPA 3V1LA 1SVOA 4LJ7A 1CEEA 1G2PA 1Q0HA 4GLLA 1E6UA 3AY0A 1R8YA 3AETA 2OFOA 2RB4A 1NM5C 2IWHA 3TQFA 3BJMA 3TLGA 1H2FA 2R8ZA 4BE7B 1TYDE 4MR9B 4PZUA 4RHEA 4X8LA 4PSUA 2JJQA 2JIBA 1RWMA 1U98A 3DXZA 3AEXA 4Q3NA 3TLYA 3CINA 1XCPA 1GNPA 1LPMA 3M9WA 1XQYA 4FOOA 2OCKA 4HAUA 1EDOA 4PU0A 2HRRA 4R1QA 1Q83A 3T1HB 3CUYA 2FMIA 2P2DA 1OI2A 1WUIS 3ITEA 4XVHA 3TG8A 3DJFA 4YN3A 3OIYA 4GL2A 3K32A 2FFAA 3PXCX 4RF5A 3I5YA 1YUBA 2H9YA 1GTJ1 5KJFA 3BMXA 2AI3A 3LC1O 4N0PA 4V0QA 1JLHA 3T9EA 3PLRA 5BR8B 4R8KA 3K5PA 4IGAA 3A6DA 1SQ5A 4IGIA 3JZIA 4ITUA 4MV0A 4Z49A 4ISBA 3C5HA 2XXAB 1OA1A 2B3TA 5AXCA 2RHCA 4ZO6A 1IN6A 2QRZA 3L79A 2XUJA 4JLAA 4QYSA 4ML3A 2Z1MA 4G1FA 4PRYA 4KWHA 4DUZB 1VRCA 3RGGA 3VAAA 3K5HA 4Q7JB 4Z4IA 2A1UA 2FOXA 5GJVC 1QZTA 1HYEA 5IBPA 3LGXA 3W1VA 3U16A 1P4AA 2PTGA 5D00A 3D5QA 3QVOA 4LY0A 4L8LA 2V4ZA 2CFCA 5C1OA 3BL8A 1CY0A 3NHRA 2QVYX 5IMSA 1AQJA 2QXTA 1WZIA 2YUTA 5L51A 1SC4A 1XELA 4ETMA 1EGAA 4WKPA 1N34B 3RYIB 1U65A 1ILEA 2A0UA 2ZGVA 1YWGO 3AR5A 5F3RA 4TWJA 4RTMA 2PUHA 2IYEA 2QD3A 4HVAA 1CIVA 2V7GA 3I9LA 3ND8A 4INPA 3TDKA 2Q46A 1EDZA 2R8RA 2VDVE 2G9QA 2V97A 2RH9B 2XQKA 3KYDA 3R2JA 4LJYA 4DCJA 2D6FA 3ODPA 4D8WA 3TSCA 3O74A 3KHTA 3F8WA 4TL9A 4GKKB 1IULA 2QLTA 1RXIA 3LXRA 4B3XA 3ETEA 2PK3A 2ZWMA 3PFBA 2IXFA 2CXUA 2VWQA 4IXTA 3GMTA 1X9IA 2WJ3A 1S3IA 5HFAA 1TA4A 3M81A 3VR3A 4NYIQ 1RI2A 2YJ3A 3FNFA 3GDWA 1QNLA 4DV4B 3B1WA 3EFBA 5JH7B 4ZQEA 5IUKC 4NVRA 2FPPA 2P9HA 5I9LA 3NOOA 2UXCB 4HDRB 5KINB 1UC8A 1GARA 2HC9A 1S96A 3N59A 3OUUA 1AS2A 1PHPA 1U0LA 2Y93A 4R2WA 3S81A 4O0LA 2XMPA 2PSDA 2QPOA 3GGGA 3GBVA 1CUXA 4GZ6A 2KSQA 3PD7A 4R9SA 5J5VA 3S1AB 1I1OA 5ALUA 1ODTC 2RGEA 4A8JC 4AKTA 1LEHA 3MBKA 3A06A 3O82A 5HGJA 1W1IA 3SS7X 2PH7A 4HG2A 4RVGA 5I48A 2WTBA 5CT6A 3NV7A 2X8JB 3OLVA 5GIPE 2PIDA 3KWJA 2EKLA 5IUNC 2ZRMA 2DU8A 4BMCA 3RJTA 4WAUA 4XJXA 4FMBB 4JR2A 3U44A 2ZJ5A 2CLSA 2ISQA 3VC3A 2NUAA 2VPYA 5BNFA 1JJ7A 3JAKB 1TW3A 1N2BA 2BFBB 5HOQA 3AVWA 1V7ZA 3K09C 4JUDX 1L4BA 1DUIA 1UFRA 4LJ5A 4R3NA 1LA2A 2V8OA 3ABIA 2R7LA 3CF6R 2QZ4A 3QG1A 2R84A 4A36A 2E4UA 3EDRA 3CX3A 4WZBA 5K0EA 4HDNB 3DFFA 2W6ID 1N8KA 1N3BA 1Q44A 3EC2A 5E38A 1J42A 3RUHA 3GLIE 2A57A 2I8LA 3O4RA 1GY8A 1XCBA 4BEVA 5F78A 2FAXA 4TKZA 1RHQA 4ZRNA 4ZZ1A 5FBHA 1TJ3A 2Z30A 4L0DA 3I8XA 4MGYR 1NXQA 1SHUX 3HB1A 3STHA 3AF2A 4HNAB 4HY3A 3EE6A 4CQLA 5JEEA 4PBSA 5A0TA 4WE3A 1N8NA 2P3QA 4P80A 3LNTA 5I5GA 4W9RA 1ISIA 5IC6A 1JIKA 3S8YA 1J9EA 3L6EA 2PKWA 3W3AH 3DZ8A 1ZD2P 2FFRA 4Q3BA 1M1NA 2W2VA 3CMCO 3LQYA 5DOZA 3L6OO 5FWYA 5AHRA 2V7EA 1SIBE 4D9MA 3LFTA 3PKIA 1F8XA 1QS0B 1VCHA 3GG9A 2G9NA 2YXDA 1J0BA 3WHPA 2ZIUB 4JC5A 2H4XA 4Q4AA 1DEHA 2X3UA 1CTQA 1R50A 2PDAA 2NUTA 2FOIA 1KMMA 1SXJD 3V4PB 1AKYA 4MQLA 3DOIA 2FQQA 2C0QA 1QO7A 1W2GA 1V45E 2WYOA 2QN9A 4DGQA 5J23A 1RWOA 4LVOA 2IH2A 3UT5A 3ZEAA 2WWXA 2ZUCA 1A2OA 1CULC 3YASA 4B7AA 3CIFA 4RS3A 4JBWA 5BV8A 5I45A 2HT6A 3T3HA 1NJ1A 1M83A 5CDYA 3U1VA 3BPSA 3K70B 2HPHA 4MR7B 5CDUA 2JLZA 1GUBA 1P81A 3JD3A 2DXIA 3HTXA 1IZ0A 1UK6A 3ZCPA 5KYTA 1FPQA 3W5JA 3I45A 3ZDDA 5C7IO 1VJ5A 3L0PA 1KU0A 2QMOA 4MW7A 1ZICA 1SXQA 1D9XA 1ECCA 2P5YA 4HQ6A 2RD2A 4ZIRB 1ISFA 1U6IA 1Z28A 3ERCA 5A02A 5LYYA 3OG9A 3OAAD 4S05A 3W4IA 1IY8A 1KDYA 1OI4A 3GXBA 5ADHA 2GESA 3KFVA 3BC1A 3OJ0A 4JSRA 5BN3B 3VTKA 1CRQA 1G1AA 3DP7A 4TV8B 3WYFA 4X65B 3C6KA 3FCAA 3IJPA 3O4VA 1UFQA 2Q49A 2ZFUA 5EXPA 3WAKA 1ML3A 4PRLA 4TWIA 4DQUA 5HKKA 3TN7A 2M6SA 1BS2A 3MUFA 1ZOOA 4L74A 2VPIA 3C2QA 1OWNA 1VJRA 1QRSA 1QU2A 1M0WA 1A9PA 1AUXA 4UUNA 4R1MA 4EEZA 1QH8A 5EPOA 1XZBA 2F9MA 2QE7D 3KJQA 4U9UA 5A4FS 5AW2A 4KR7A 3PB3A 1NG1A 2O7VA 4BRZA 4OXRA 2O2JA 4LF6B 1DIRA 3HU2A 1RLOA 5DV9A 4X41A 1ZISA 4WQMA 4YFVA 1SZCA 3KJHA 3IFSA 2CSUA 1O8BA 3D8BA 2YJ6A 1CY8A 1QIGA 2C9CA 1WQ3A 4MUKA 3UC5A 4X1IB 4AFNA 2WSSD 4YEDA 2VUSA 1ZU5A 4Q3CA 1RQGA 5E4YA 3DTVA 2VYFA 3PZRA 5AHWA 3WMRA 5DNDA 5F1OA 3WLRA 2A9OA 1K92A 5JQWA 3EXIA 3L3BA 3Q5EA 3FAZA 1FMFA 2EFCB 521PA 3RU2A 3ZX5A 1RFGE 4XM1A 3D7KA 2QLNA 4ZEWA 5BQ3A 4UBLA 2Q5JA 4R69A 5TVGA 3L1UA 3RK4A 2HUNA 3MG9A 2BKAA 4YP7A 3WMEA 3CUWA 2HCFA 2LCQA 4C4TA 3OM8A 1T2NA 4PLZA 4F84A 1OFVA 3UFXA 2CXOA 5EP2A 2JASA 4LK3A 4RNDB 4E7PA 4TYQA 5HHTA 5FUQA 3KZMA 4EHJA 3D81A 1NNEA 4GI5A 3TIIA 2IYNA 1WPRA 1WPGA 4KO1S 4OQQA 3ND7A 1KMNA 4DLUA 4X94A 3UMSA 2RE8A 2GDJA 2XQGA 4I14A 2GD1O 3KVRA 1O6FA 2ZWOA 1H0HA 1ZIYA 3NJRA 4J1TA 4B7UA 5EJ8A 1AGXA 1FNSA 5CTJA 4BLVA 5HZMA 3BE5A 1E2PA 3IQIX 3OJWA 3W9BA 4B48A 4BVEA 4EYGA 3LFHA 4EZBA 3P0RA 4EGJA 3IBFA 2M32A 4MAMA 2YDYA 1UKAA 1RRCA 4KMMA 2RGNA 5LQKA 3RIHA 4DC1A 3OOJA 1L5VA 4RADA 1A9SA 3ZDBA 3CLTC 4M8LA 1E58A 3RS3A 1PR4A 5HJEA 2GX6A 2VXBA 4GQBA 5IULC 2NP6A 2PFKA 3PNPA 3QVWA 2NYAA 3CZPA 1DXOA 3LP8A 2BDEA 3KAJA 4M9RA 1THTA 4PSAA 4QTUB 3JARA 3MCZA 1XO1A 3JQPA 1GG8A 2XUAA 2BFDB 5EP4A 2PMCA 3EOAI 1BW9A 4ZQGA 3AFHA 1Y1PA 1UP7A 3WQBA 2WKRA 2HFJA 2VF8A 3ZCXA 5BNWA 2WKQA 4HDSB 1H42A 1QMGA 1OZ0A 1JDBC 3DS8A 3U13A 3RU9A 1A7JA 3L7NA 5T5QA 1XXLA 2EDCA 4Q9IA 5T41A 2QM8A 3WK7A 3GD7A 4G0YA 2WJ6A 3CEHA 2QW0X 4GYKA 4WUVA 3IL2A 5M29A 3SQWA 1JILA 2GERA 5CDGA 3NM4A 1O95C 3SP1A 1OD6A 2QQ0A 3CLUD 4W4TA 5AD1A 2BM1A 4HYYA 1XX6A 4PGAA 3KPYA 3NBZC 2GNPA 4PCVA 3WHLA 4AQYB 4S0ZA 2IS1A 1KOFA 5GMOA 1M7HA 1PEAA 4O8CA 5JDIA 3SKXA 4HDQB 5EERA 4TMFA 3P0EA 5LL6P 3EG5A 2PXCA 4LKOA 2J0QA 2QHXA 2KS6A 1NF8A 4G0OA 1NU8A 2WQ7A 1J56A 4PLCA 4S1NA 4K03A 4S24A 4ZREA 1VE9A 1AMUA 3M9XA 1TUIA 1CYEA 1Q0RA 5FTWA 5B2EA 4B7XA 4YUWA 3KEFA 1KAOA 1N5MA 4H4CA 5JC8A 2ATCA 4REQA 1M54A 3I05A 4KNVA 2FZKA 2NU8A 1H1TA 1EWKA 3B5JA 1CQJB 1GT91 3C8MA 4LDQA 3LLCA 5EE3A 1TK3A 1XJQA 3EVTA 1OXBB 2XAAA 5C4IA 4S3MA 1ABEA 3QMMA 4Y2UA 1E2QA 1MGOA 2N0SA 5M7EA 2HB6A 1U8XX 3IEXA 2QVGA 5AKLA 3VYWA 3OPYI 2JKYA 3ACDA 4Y6LA 1O54A 1PT6A 3T7JA 2HA5A 5IDXA 1B6SA 4BMZA 1B6RA 1TEHA 3E3NA 4KYVA 1WD5A 1XZJA 3GWGA 2HRBA 3EZ6A 2BI8A 3I6MA 3NTUA 4O2AF 4OIFA 1FLDA 4QOEA 2BEUA 2EG5A 3K0EA 4ZARA 4WTOA 1RVV1 3U3MA 2B2NA 4KO8A 2PXHA 2PL5A 3ZWKA 1C7ZA 3BERA 1WA5A 1X86B 4YMWA 3GRRA 1H93A 4BMDA 4C7XA 4ER5A 5KQMA 1H4SA 3PCTA 4ZGBA 4RPKA 2G25A 3WYDA 2OKCA 3AR7A 4AJPA 4HN2A 1LLUA 1E94E 2QSYA 1AK2A 5JW6A 1K2WA 3NALA 3SIRA 2RAPA 4W5JA 3U39A 1YR2A 1NLMA 2NVWA 3COSA 4ENQA 5A1TA 3UG7A 1Z6TA 2VYVA 2UZ1B 4YIKA 3C7TA 3UJBA 3UMGA 3UJ9A 5D3QA 3W2TA 2J09A 3F3YA 2GXQA 3MS7A 1CZLA 2R1ZA 3HRIA 1X0VA 4WLOA 3DOUA 4V0NA 2H4JA 3BIJA 1T9HA 5BUZA 3F2IA 4EPXA 4IEFB 1RVDA 1JFRA 3MCUA 2WP0A 4P82A 3T34A 3AOEA 2QLFA 3LUBA 2QTFA 4M8NE 4EGQA 1RLMA 4PO8A 1VYVA 1CRWG 2Q3BA 3R9XB 3C1AA 1RRPA 2OENG 2W0SA 1PNVA 4XCXA 3VR0A 2Q1YA 5ARBA 3L49A 2SBTA 3A6ZA 3TSYA 4LQDA 3RS4A 2C4MA 1L7DA 2YR0A 1YIOA 3EA4A 3LX4A 2DUNA 2PJRA 1JNXX 4I7EA 4F8EA 3V42A 2OWDA 4RENA 5F7OA 2MMCA 3WIBA 1HYQA 1U7XA 2V45A 3C4JA 4HXGA 1GTL1 2W93A 1WBDA 4UFOA 2ZIXA 4GI3A 4TT3A 1VI5A 3BCUA 5EQDA 5BW6B 4M7PA 4DXHA 1MQAA 1PNRA 2BH9A 4HAZA 2I4RA 1R6VA 4HSGA 3U9TA 3VAYA 2LCIA 2NM0A 5JPCA 4FMDB 4H7FA 4FHEA 4HNUA 5EUQB 1XNQB 4L0MA 1SOWA 1WPXA 3RVPA 1OX4A 3DF7A 4AT1A 2AUMA 1A04A 1OX5A 2BFWA 3PWSA 1QJCA 4PAWA 1XZFA 4YWHA 2BR5A 4RVHA 1VKOA 5JYDA 4U0KA 3K1AB 4RZ3A 1PL7A 4M9SA 4JCCA 1A9YA 1U28C 4EMSA 2HCTA 1KO8A 1O58A 3ACBA 2WK1A 2GF9A 2C9ZA 4PF1A 5DYWA 4E2FA 4IXWA 5ICSA 4MPTA 2ZTLA 5LXTA 5ALOA 1CG6A 5ITZA 3C24A 3JALA 3WLTA 4QUEA 4EG0A 3K1YA 1CUWA 5FPYA 3OJLA 4AG3A 3QFSA 4Q18A 1BH6A 4MS4B 1U3FA 3G9TA 4R9UC 4YRDA 2PT6A 5BT9A 3SJUA 3DEYX 3R5TA 2M98A 5DN9A 2VHCA 5H3CA 4MV7A 5KU7A 4CGZA 4HLCA 2WWRA 4GMDA 4X93A 2XUPA 2I7TA 5IAGA 3ESQA 3WLOA 4RH3A 3LBFA 1GQQA 1PR9A 2ZIVB 4IEIA 2YY5A 4FDAA 2BONA 4DGSA 2ZRPA 4WFKA 3WIDA 2WUWE 4JEMA 2HRCA 1GKLA 1GFSA 2ZUVA 3GFTA 3SYRA 1PKXA 4PQEA 4QDKA 3NB0A 1KK0A 2B2XA 2E4ZA 1Z62A 5KNBA 4LHYA 1EHCA 4OATA 1R74A 4CXMA 1C0IA 2E89A 4JLKA 1U11A 3A3OA 3OQIA 4RDCA 1RDFA 7ADHA 4Y2QA 1OFUA 1WXIA 2Q5LA 1CUCA 3OI7A 4NG4A 3W1WA 4BBAA 4EG5A 1HMPA 5KOHA 5AR1A 2A9FA 4OLHA 1WP9A 3PJRA 3FDZB 3VTFA 5MN4A 1XDSA 4YB8A 1YV9A 3G2MA 1CT9A 1ECGA 4CEHB 3AL2A 2JCVA 3PJFA 5FHQA 4N47A 3DLCA 1SOVA 1NXPA 1P1BA 4BS9A 3AB8A 4RQBA 5C8VA 4AJEA 1HO3A 3ZWPA 5CXQA 3NOQA 1MTZA 1RXCA 1VPVA 5ALFA 4BN0A 2NX2A 3L0BA 3L5OA 4J1NA 2ZXUA 2G06A 5ARDA 1SVLA 1GPNA 5AUQA 1GAQA 4MRRA 3U6KA 1B0PA 3K70C 2QD2A 5D84A 3U3OA 4AX4A 2G9ZA 4P5EA 1BAPA 2W7TA 4D7AA 1NASA 4BPRA 5FUMA 3D6NB 1IPFA 2NAFA 1D1TA 5JAMA 1EUZA 3PC8A 4OHCA 3LCUA 2IZ5A 5E4JA 2OO3A 2X3FA 1G8KA 1T2UA 1ENPA 2YY7A 3PTAA 1QGUB 4XFJA 3U0BA 1UOOA 2A86A 4WV3A 4LQLA 5LM3A 1F4VA 1W35A 2IYRA 3CB4A 1KVTA 1EA7A 1DO8A 4X66B 2EERA 3B6IA 4KQCA 2VAVA 2VQEB 1O3YA 2GCOA 2W6ZA 3OT1B 1HDOA 3WO0A 5AW1A 2XDQB 1L9XA 4ZVVA 5REQB 1J0DA 2Q5IA 2Y1DA 2DPYA 1Q0ZA 3JWEA 1ULTA 3KJIA 2CBGA 4KN9S 1BU8A 3BK1A 1RYDA 1U2GC 2DHCA 2VP2A 2QXYA 1KHHA 4GVPA 2R60A 1ZUWA 4EO4A 4RKYA 4BNYA 1U0BB 3I28A 2HTEA 1O6BA 2QI9C 5CA1A 4LF9B 1HURA 2CMKA 2HSEA 4L0QA 3VH1A 1S6YA 1PGQA 1O9GA 3LYLA 3LJKA 3UB4A 1N0HA 2PV7A 1P7ZA 5FKJA 2B8JA 4RULA 2OC4A 3WFZA 2BSAA 3I6IA 3MBOA 5D51S 4I81A 3JPWA 5TPZD 5JZOA 1XDWA 2VDUE 3EEIA 4GICA 2IV2X 4GX1A 3RIYA 3WXBA 4EUSA 1FFXB 3QV2A 2ZM5A 1I2DA 1Y8QA 4PYLA 5DU2A 2FCRA 2C5EA 3TPCA 1C1HA 5CB4F 5HX7A 1L6RA 1D6MA 2FWBA 2QX9A 2YV5A 2Z43A 5FPQA 1ZVJA 4AKGA 2G1KA 1ZITA 1NC1A 2OV8A 1KPGA 3FA2A 3VU1A 3EEOA 1H8HA 3SYNA 3M83A 2HIAA 2Z2JA 1DG3A 5I9TA 4OMUA 5KVQA 1P1KA 3SHFA 3MD0A 3F1KA 2W58A 4V0RA 4CKCA 1TK9A 1W19A 2F1OA 3KXLA 1L5KA 2QMUA 2Z4RA 1WCIB 5FBWB 2R68A 3ZBPA 5D1HA 3S2SA 3U4CA 4EQZA 4ZVRA 3O0DA 4P54A 3UOWA 1GNTA 2B69A 3VSBA 4GZ5A 4WZAE 1NRJB 1BCSB 1JQJC 3CZQA 1VMDA 3FHOA 3GLUA 3P0FA 3Q3CA 1REQB 4UM5A 3W5IA 1B23P 7MHTA 3O75A 3RRXA 4OAOA 4PNPA 3ZV6A 2WE7A 3CXUA 4FW9A 4YK7A 3GGOA 4F2HA 2J0VA 1FXWA 2OCDA 4CM9D 4YAGA 1S4MA 3GLQA 2QI9F 5K5EA 4GP7A 3GPIA 2DE0X 2IPOA 2R1VB 3BRQA 1JIQA 4FGUA 2NUAB 3MTBA 2HLPA 4G63A 3ZPXA 2XCTB 4LZNA 1T5SA 5EMJA 2PBRA 1T91A 2HCRA 4FVTA 4OMFG 2WF9A 3OZEA 4W82A 4R2HA 4I19A 3QUAA 3S55A 3B9RA 1W4AA 5I5EA 4RD2A 2PUGA 1V26A 3DEFA 1EYZA 3EC7A 1XUOA 3R6GA 2G9UA 2FKNA 2OXEA 3E8XA 4R41A 3WWOA 4KX3A 2FI1A 4OYLA 2P8JA 5HZGA 3PC6A 5I7UA 3A2MA 2P6UA 1JR3D 1L1QA 1ULSA 1YD7A 1IBSA 3S70A 4DIKA 2Q3CA 1YDEA 2IGBA 3V1YA 5JDIC 1HNWB 4M1YA 2G0AA 3M6AA 1JHOA 5EG5A 2EBHX 1KL7A 5CDFA 5CT9A 5GZ3A 3CLTD 3IQXA 1II8B 3LKBA 1YSCA 5LC1A 5IXYA 3P19A 5JSQA 3PEFA 2AFIB 1G2IA 1FLNA 1DAGA 1VKNA 2F48A 2YWEA 3FM9A 4RZQA 4ZTBA 1BO6A 4F2WA 5L6LB 1IBLB 3JYQA 1E2NA 2PS9A 2FX2A 1PN3A 1U3WA 3QJGA 3SCZA 1GAEO 3I32A 1MOPA 2YMPA 3NM6B 1O89A 3W2FA 3RAPR 1H3FA 2OB1A 3O84A 2F8SA 1ZD8A 1Q7CA 3HKEA 2O2DA 2VHWA 3HCFA 1Z2CA 1Z6GA 1L7XA 1R0ZA 2DHRA 3GFFA 4F6RA 1JH9A 2HV8A 2FSSA 3OURA 4G5YA 4V03A 2OA0A 1EVYA 3S29A 4KOAA 3FCEA 3LHDA 5KWIA 1WB4A 5EZSA 2QBYB 4ATNA 5K8LA 3F4KA 2WWVD 3KXPA 4TKMA 4J8PA 1FYEA 3ZCRA 1GL7A 1QCDA 2V58A 5IUJC 1XE3A 1OCEA 5AVKA 4N12A 5F98A 4XVRA 1SOUA 5GAJA 1QAQA 1M1XB 3GA0A 4H17A 3DKKA 1ODSA 2VUIB 3HY6A 1DBPA 2JNWA 4OQ4A 3IYLW 1LK0A 2ILTA 3DM9B 1K4KA 1YS9A 3TLXA 5CT4A 5FI1B 3WICA 3CZ4A 3N76A 4U2GA 1PBTA 1HK7A 3KV3O 3B78A 2UYYA 5FL7D 2OUIA 1D07A 1Y1TA 1LX6A 1A69A 1OT3A 2I6XA 2AZTA 2EG9A 5REQA 3VPHA 4EF5A 5ITZB 1W5FA 5MFZA 2WYVA 3GT0A 5IT0A 1OYOA 3VUEA 5HRCA 1RP7A 4EFDA 2PSHA 3IE0A 2OXFA 1NMZA 3IXMA 1ODJA 1A8UA 1PJ3A 3Q2IA 1SULA 4CCAA 1Z68A 1P31A 4YRTA 2IBMA 2QP4A 4YRMA 4OK3A 4GOJA 2Q3EA 4G6ZA 1DQYA 1KQPA 2WUEA 4CV3A 1E8NA 3N53A 3T5CA 4DLAA 3DO5A 3M5CA 2ZIWB 1QPZA 2DR0A 1EM8A 2Q07A 2QUBA 3IP9A 1TFUA 3VTZA 1BSVA 3S2EA 2RGWA 1KDTA 1BE1A 2MSLA 2PUDA 1TCVA 5I9SA 5HP4A 4WL0A 1KMHB 4CM3A 1DRKA 2YQ5A 3HBNA 5HZKA 1NF9A 1YJ5A 3AY6A 1GCUA 5CX1B 3TIXB 1IPEA 5CBKA 5ES4B 2XNDD 3KLOA 1T0HB 1M33A 2WU1A 4HDRA 5AT1A 2G4VA 4O1MA 3HXTA 1ZOLA 1K6JA 2WUDA 4DHWA 1ANKA 5C81A 1GDTA 4NCXA 2PZBA 4DCOA 3I9V6 3UWPA 4HNHA 3BQ9A 2OFXA 4W5WA 4AROA 3D2BA 3EDOA 1D8TA 5G1OA 3CUEF 3KCNA 4LJRA 3UPUA 4KBGA 5IVKA 2RH8A 5AM0A 4D25A 1LKZA 5EZ6B 2ASVA 4ESVA 1Q2XA 2CFTA 4KCGA 3U7IA 2QZPA 5A7HA 1U3GA 3QNMA 4MO2A 4NATA 1ESNA 1POWA 2K2WA 1DC8A 4GZ3A 4NULA 4UREA 3T7RA 4CLEA 1G8FA 2GHIA 4XX0A 3HP7A 4ENPA 3I37X 5DN6A 1YK1A 3RTCA 3BT7A 1NT2A 3QU2A 1MB3A 2IC5A 2QPLA 5BYJA 3BXGA 3JASB 2ERXA 3JWHA 2JFZA 4ER3A 4KE9A 2UZAA 1BWSA 3KYDB 3SS9X 3NX4A 2LPMA 1XTRA 3P2IA 3MLEA 4R1UA 2CMHA 3I42A 3UOGA 4BZXA 4D9FA 1SHLA 3IULA 2FVYA 4OG2A 1RAHA 1TUBA 3FBGA 3MT7A 3B2NA 4HTAA 1YMQA 2QD4A 3K1TA 1K88A 4YRLA 3ZR4B 1WXHA 2PZLA 1B43A 4OJYA 2X23A 3T1TA 1UKZA 2WIGA 4FU0A 2NZ2A 4QKQA 4YJFA 1BN7A 5ARCA 5BV7A 3MJFA 1EDEA 3O38A 1CJMA 1AN9A 1R5OA 6YASA 2H9AA 2W37A 3ZY2A 5BWBA 3BRCA 5BN5A 5L4SA 1X1AA 3MWKA 2MSDB 3DLPX 1T35A 4B6QA 5K8UA 1YVPA 5JATA 4EKGA 4LYDA 2DPLA 4HWGA 5AVYA 1NYTA 3RTDA 4ER0A 3OEEA 3NYQA 1FA9A 1SBNE 3V80A 1Q12A 4B45A 4PZLA 3N6XA 4F92B 4AP5A 1BXGA 3CHYA 3IUPA 2AI1A 3QJ5A 3N0TA 4I0WB 5IJ9B 3FLEA 4Q3EA 4I9UA 1WUHS 3THSA 4JXKA 3VPFA 1ONBA 3E82A 1Z37A 3I6BA 1OLXB 2J6IA 4PG4A 4YI5A 1EFKA 2D0PB 1V4NA 2R7KA 1E2DA 2UVDA 3TZ6A 1G8AA 3HUUA 4P4LA 3VO8A 3ZNOA 3PJDA 4FDLA 3TRJA 2CFOA 4DZZA 5B58T 4HATA 2BKXA 2JARA 4CDMA 4QNNA 4JFAA 4EW1A 2C5HA 1KVQA 2H8GA 4HEJA 5K3DA 3ROFA 4D4HA 3A9UA 2D59A 5KS2A 4ZQHA 2HMYB 4JI5B 3FTFA 1YJ8A 1L5SA 5M04A 2Q8QA 2BUBA 3GRYA 3I52A 5IJAA 3L0CA 2WHPB 2QUHA 4R6WA 2FW7A 3AVVA 1SBTA 3LK7A 3JARB 1T2DA 2F17A 3BKWA 5H7XA 3EVEA 1Z75A 4PAMA 4Q02A 1CUVA 3DCJA 5MGNA 2FLWA 4YXWD 3P4YA 4RZ2A 3ICQB 1F20A 1ISGA 1RFLA 4TXHA 4O33A 1HLFA 5ER9A 4CN8A 5ADUS 3ESCA 2IRWA 4QAQA 1FYXA 1H2XA 1NVBA 3F6EX 1X74A 2R2GA 4UUOA 4AY5A 1XU4A 1PX0A 5JSUA 2DUUA 2C98A 4C5CA 2CNDA 2ETVA 2HJHA 2R4TA 3HZOA 4KQHA 1IJKA 1XKXA 2PO5A 4FHGA 4DLYA 2OEPA 3OTWA 5GZ1A 4HMOA 2OHVA 2R5FA 4G8BA 4TTJA 3B2EA 4K7JA 2WJHA 4N1AA 2YNMC 1TM2A 4QL3A 3KKZA 4LRWA 3OJOA 4N03A 4GF5A 5P21A 1KE2A 1K97A 4BFTA 3AR9A 4MULA 3E05A 4Q3AA 3SI7A 4DV3B 3PUKA 4BO2A 1AB5A 4ZYTA 3SQXA 3Q2OA 4N0DA 5I51A 4WLUA 5AKYA 5IMBA 3WQHA 1SOMA 1UK8A 3H1GA 2R8YA 3HCRA 1QIDA 4YJ3B 4BL5A 3V8PA 3DB2A 1G64A 2ZTVA 3A36A 4UZFA 1ZN8A 1JFVA 3LZ6A 4I2NA 3ZY4A 721PA 2QQFA 5FNVA 1W46A 4ZQCB 1PTKA 4PTLA 4Z5XA 2AMYA 3NT5A 4QWMA 2JGIA 1M8FA 1S2DA 4UHCA 5TV2A 4UVIA 1M6VA 2XNCA 3S44A 4URFA 4TKVA 3RREA 4OHXA 5CFRA 1DC5A 1XN1A 4M1ZA 2WVJA 3T12A 3V1TC 4AZWA 1BX1A 3B2QA 3Q8KA 2DLCX 1KS2A 3GNLA 3OFNA 3FSGA 3GF4A 2CL0X 1U3UA 4H35A 1W8DA 2OOSA 2QE7A 3BXPA 3QJYA 3I3OA 4Q24A 1SKQA 5DYTA 3R5HA 1XTTA 4TQAA 4HGYA 4FBLA 3SVLA 4DA4A 2GEVA 3U56A 2ID7A 1A5ZA 3GJXC 3ZDCA 2QN8A 3MRXA 3F2VA 2ODQA 3O8BA 1PZHA 2PVPA 3BZUA 3QX7A 5HQ3A 4TMYA 1WUJS 3OOHA 1F17A 2UV8A 5IC4A 1Y3IA 1XQ6A 5CM2Z 4N5HX 5I7SA 1M6HA 1Z5NA 2NUBA 1DBIA 1XEFA 3VGJA 4WNAB 5L7YA 3ZBQA 4GMHA 1C41A 2W2TA 3HQ4O 5CA1F 1UR5A 3V8VA 5KYNA 2JEYA 1DCMA 1Z0ZA 2MINB 3H8WA 1RYFA 1DRJA 4LECA 3AZQA 2I22A 3D2LA 1XZ8A 1E2IA 2Z8XA 3L7KA 2AC7A 4NZMA 4WBXC 2XB2A 3EOBI 4CMHA 1FSFA 1NE2A 3DTYA 3A6GA 3TBKA 5L53A 3G8CA 1B6TA 3AIKA 1CQPA 2E37A 1F2DA 3UJ7A 1XSEA 1Z36A 1HDYA 4RHTA 3EEBA 3T5AA 2GAIA 4MA4A 2IZ0A 3R0VA 4JR1A 4KQKA 5JT1A 2WWHA 1AO3A 4LYAA 4KB5A 2YYAA 3LTEA 3L4EA 2BR3A 3L7CA 3TLKA 1XYGA 2EJCA 2FPGA 2R85A 4G4IA 1FNDA 3D8NA 2JLVA 1LSOA 2D06A 2QA5A 4URHA 4MR7A 3GUYA 1WHTB 4IGFA 4HLNA 4OIMA 3KUDA 3UEOA 1UWKA 3H4TA 2YIDA 3WHKA 5G0VA 3ZOKA 3P0IA 3LUAA 4NH4A 1GAXA 2JFWA 1EQUA 4AP6A 3QTBA 1FDTA 3DMTC 4WZZA 3UA4A 4BNWA 3B20A 4R8LA 5IF3A 1F9AA 4II7A 4BP8A 4CTKA 4B43A 4EQ6B 2OHXA 1FK8A 1UMDA 3WNDA 3IT1A 4UEOA 1NW6A 1U0RA 4M38A 5JVDA 4N49A 3OX2A 1ZD9A 2WPDA 2M6KA 3UKDA 4LXQA 1FW8A 4OUDB 3AY7A 4OO3A 2WU8A 4Z1MD 2IYVA 2I99A 5DMXA 4C2AA 2EKPA 2FUG1 3FCYA 3K9QO 4FC7A 5DO9A 3K9CA 3P5BA 5BSVA 3FGOA 1TL7C 1HSOA 1S2NA 2HSZA 5D3MB 4EFMA 3OZVA 2BYTA 1TGYA 3K9LA 5L45A 1A5SB 2X1LA 5K8IA 2YHIA 4RMHA 2VNJA 1RSZA 1HTWA 2AEMA 1IVYA 1VHLA 2XCRB 1W5SA 5LP6F 1SFRA 3T3GA 4B47A 2HWYA 4OL9A 5ERXA 4M6WB 5D01A 2O05A 3PC7A 3D02A 2PH5A 4GLBA 4UDYX 6CHYA 1CIPA 3UF0A 1DHTA 5ALMA 2VWHA 4ZVLA 5JJBA 3I5XA 3P71T 3JQAB 5KDOA 1HNZB 4FGJA 4KFCA 1IONA 3G7NA 2R6ZA 3BFXA 1T0JB 3G1WA 4TT3D 1FP1D 3BWCA 4HRYA 4PX2A 2CDNA 4TYYA 4ARIA 3K6SA 2Q4TA 1ECBA 3II6X 4W8OA 2OCIA 1E2KA 1WXGA 2I87A 3FZQA 1FXWF 3I5AA 3AJRA 5D2CA 4NJMA 4O1IA 5ALKA 5FBZA 3ZGVA 4HH1A 4M0KA 3C3YA 1Q3TA 4QATA 2OUKA 1GSIA 1JA1A 1UOPA 4PLPA 4YJ2A 3H5RA 3M2PA 3CYFA 4B4DA 1NRIA 3D8RA 2QR2A 2PGNA 1CB7A 3FSJX 2R1VA 4LGYA 2DVMA 4MWZA 1XALA 2XHZA 1LBQA 3EHDA 3D0RA 5EJMA 2PZFA 3N8HA 1YZKA 4KLCA 4NCJA 4Q15A 2B6NA 2GFHA 5D7BA 4QUIA 4BO9A 3RRFA 3P0JA 3IPRA 5JAIA 5IAAA 2FW1A 2IK8A 4C0JA 3GAMA 5KMGB 1OIWA 1GPKA 1D0VA 3K73O 3UBMA 1Z6ZA 3BB3A 3FPHA 5TR9A 2IYSA 3GUUA 4FFLA 5I7OA 4CMKA 3OKAA 4M9UA 4R0VA 5PNTA 4PONA 1EA5A 4CM8A 1RWXA 4IDGA 4IX1A 5EJFA 3UT0A 4CEHA 5K3SA 4JQOA 2C04A 1U9ZA 1ZNWA 3K5WA 2BR4A 4N7RA 4QJ4A 2H08A 2F3SA 4HX5A 2FEPA 2NGRA 4TXJA 1DRWA 4X84A 1OBCA 4BQNA 4EI7A 4KSBA 4PE5B 1WD7A 2CVHA 2IE0A 3RVBA 3ZLTA 1JPUA 3FTNA 3QVGB 3RYFA 4ETNA 3K0AA 2IFTA 5KYXA 1IXKA 1MO6A 3BD8A 1L5HB 5COQA 5K3EA 2OM6A 3ODGA 2BE7A 1PZGA 1E6WA 4RKFA 3G9QA 1GTRA 3HBAA 3VMFA 3PUWA 3RT7A 1DEKA 2HQBA 3PHHA 4BVJA 2B3DA 4ZT5A 1YB2A 2GNOA 5KKNB 1IJEA 3DAHA 4MMYB 4WFJA 4WINA 5TT1A 4REMA 2NSYA 3IE2A 3K4PA 3STWA 4I55B 5FOVA 3Q10A 3X2EA 4ZEVA 3SSMA 2ZAMA 2PYDA 4ARCA 1Z0IA 4O4LA 3AB3A 1ZW6A 5CW1A 5JCXA 1SKYE 2UYQA 5EVCA 5KNBH 3WTBA 3WI7A 3BXXA 3IOMA 3AVUA 5JNVA 2XYHA 3I1YA 2X13A 3OZIA 2HWKA 4U2DA 1KA9H 3K3PA 4LSGA 1T3ZA 1QS0A 1Z4IA 1CF2O 4PHHA 1EK2A 4XTRA 2ZQZA 4FK8A 1I0IA 2QG6A 3AZPA 2VBIA 2C4WA 3QZUA 1H6CA 2QYTA 4KIGA 4MPPA 4PQRA 4BRSA 3GLHA 4M8KA 3AFMA 3QE9Y 2HK7A 1A4IA 4IIEA 5L8VA 3ZE2B 1KE1A 4F4UA 3RE1A 1GZSA 4UEWA 3P2OA 2VTVA 4FGKA 2ZS8A 3ADKA 2CMDA 2CE2X 2I9PA 1ZRSA 2VYCA 1ZHHA 3BD6A 1T24A 2I54A 4P93A 1PJCA 4QASA 2F9LA 4MRVA 2IGTA 1WW3A 5ED0A 4MUFA 1B76A 4D81A 3EG9A 4RPJA 3W2EA 3VR4D 1C8KA 3DV9A 1T2EA 3UAVA 3K9GA 3KP1A 1U0TA 2C3MA 5LJIA 1CF9A 3DMDA 2GAAA 2X4GA 5AKGA 3ZNNA 2BV3A 4QOHA 5INTA 3AETB 2A5JA 5C18A 1E0SA 3NT4A 3WL5A 1JHVA 4RTJA 1ZCZA 2GK4A 2X7XA 3B7WA 3QNWA 3KEGA 1XL0A 2EKDA 2GCPA 1O5OA 5F77A 2Q50A 3G17A 2M2IA 3TLAA 2H9IA 2HU7A 3F9IA 4TT8A 4CE6A 3UUWA 4JX9A 1FDWA 2VNSA 3L0ZA 1IY0A 1MB0A 2LDXA 1DKMA 3G89A 3SNHA 2J7PD 2WHPA 3AM3A 3DULA 4OXNA 4DBZA 4P0PB 5JADA 4IUCS 5JIBA 1XC7A 1O0BA 3OZDA 3Q98A 4OKNA 3OZAA 4DIDA 1S89A 5GVRA 2ZTSA 3AKYA 4C4YA 3AEQA 2PGIA 1E1QA 3IOBA 2AYYA 3LLUA 4Q03A 1NI4B 5HRAA 2BM0A 1GXSA 1ZXLA 1RRGA 2VPXA 1Y7TA 4O4IA 2BCGY 2OPHA 3EZ7A 1R12A 1JXMA 2C9YA 1CJUC 3HDGA 3L43A 3IMGA 2XKJE 4LQCA 4OGWA 3B89A 4EOGA 4EW6A 1B0ZA 2WJPA 2LBPA 5JISA 3RS0A 5EXSA 1TIPA 2ZRCA 3UGQA 4ZT7A 4L08A 1ODCA 3FYDA 4LHVA 2OBMA 1JHQA 1VPEA 4YGYA 3Q8MA 1Z0FA 5K09A 5BQOA 2IHTA 1Q0QA 1W4BA 2IUTA 4UEKA 3HJUA 5K2MA 4KPFC 3P8ZA 3R40A 4BKOA 5LXTF 1YS4A 3U4DA 4IMJB 4RVNA 3QA9A 1JEEA 2YICA 4UM7A 2GT1A 4CMEA 1U0HC 3WNZA 4X64B 3DKIA 9LDTA 5IBCA 5ERGB 1XRMA 1YJCA 1JB1A 4OQLA 2J48A 3M89A 3P9XA 2YRFA 2Z8YA 1X7XA 1X8LA 3L1KA 2AR7A 2MIIA 4Q3LA 2JIOA 4FOSA 5BR4A 3CZ9A 1M2KA 1BVYF 1ECPA 5EE0A 3RYIA 4WA7A 2QL7A 3VR6H 4GPIB 5JS8A 4FFOA 2ODWA 4C4PA 5HE9A 1RZRA 4RL4A 2Y8EA 1R7RA 4E07A 1QVZA 2AG1A 2AT1A 1T3HA 4DUGA 1YGPA 1G4AE 5DWQA 3R3XA 1U8UA 1Z2NX 5DBOA 4DF3A 3LPAA 2PGDA 5KTYA 3TX6A 5H83A 4DJ5X 5I8WA 1M1ZA 2QUZA 2VTBA 1CY6A 3FYSA 2I2FA 1GGJA 1P9OA 4U7HA 1OGJA 5BWNA 5KEIA 2Q5CA 3T1OA 2F7SA 2WF6A 1E3TA 5JE8A 2OFWA 1ADFA 4COKA 3LKZA 4K40A 4WH0A 4CF4A 3WNVA 3THWB 3HACA 2P9JA 2HY7A 1XPOA 4QGHA 5BOSA 4ID3A 2HK9A 3M5DA 5T6BA 1A9TA 3GG2A 1J8QA 3IP5A 4Y30A 1M75A 1DAEA 2REXB 4O6VA 2GXUA 1EXNA 2WRZA 5FI3A 2G28A 1AVTA 1PQPA 1TE2A 2IEBA 2P67A 4GKVA 4QYIA 1QQ7A 1XVTA 1FCJA 3ZV7A 4D8XA 4CTMA 4WJKB 4CM8B 3L82B 4KBFA 2QX8A 2COEA 1E1CA 1EX6A 3HYRA 1I33A 5DN6D 2CJWA 1GZDA 3RRJA 1Q7BA 1KARA 2P9QA 4CIAA 5D1NA 3EH2A 2C92A 2PZMA 5KVCA 1N7HA 4RXMA 1ULUA 5C37A 2P2LA 3EIXA 2QTHA 1SGWA 3LBAA 1W36D 1D8AA 2CKDA 3FUVA 4EY3A 4KR6A 2O2XA 1YZQA 3VO1A 4WBNA 1U1FA 5A9SB 4GI7A 1NC3A 3V6MA 2J9FA 5JWRA 1YDWA 1M1UA 1QE5A 1E79A 1ISJA 1EIZA 2CK3A 4OQFA 3UVEA 1E8MA 1U1EA 2ZJ2A 3HSKA 3AESB 5AIAA 4FILA 3ROKA 3ZY3A 4FW8A 1Z83A 1GILA 1Z7EA 3M6UA 3HA3A 1JDZA 4MK4A 1W0KA 2H2AA 3GZJA 3NT2A 2X0EA 3W5HA 5C5CA 4TYWA 3JD4A 2B4YA 4P0QB 2IEAA 1LGYA 1RABA 2KB0A 3KR2A 5KQSA 4E5UA 4ES6A 2N3ZA 4URWR 4BRWA 5K6TA 1PV4A 4KW7A 3S40A 5DEOA 3OQVA 2P1DA 2BP7B 3FTEA 4ZK6A 4P58A 4PCUA 4KTVE 4AKHA 2W2PA 4MYUA 4LDRA 2E9SA 4GH5A 1LNQA 4ZOAA 4K1XA 3UBTA 2FSPA