3LYUA

Crystal structure of the c-terminal domain (residues 83-215) of pf1911 hydrogenase from pyrococcus furiosus, northeast structural genomics consortium target pfr246a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
129
Chain Sequence
b'GPLGTPVPMEKFGKILAIGAYTGIVEVYPIAKAWQEIGNDVTTLHVTFEPMVILKEELEKAVTRHIVEPVPLNPNQDFLANMKNVSQRLKEKVRELLESEDWDLVFMVGPVGDQKQVFEVVKEYGVPML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hydrogenase
publication title Northeast Structural Genomics Consortium Target PfR246A
rcsb
source organism Pyrococcus furiosus
molecule tags Oxidoreductase
total genus 37
structure length 129
sequence length 129
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3lyuA01
3QFTA 2X3UA 2XNJA 4K1XA 2BSAA 1QFZA 1IB0A 1CNFA 1SM4A 5H5JA 1A8PA 1FNCA 2BPOA 1BQEA 3JQRA 1QGZA 1CQXA 1EP1B 1J9ZA 1E62A 3W5UA 1QG0A 1EWYA 2OK7A 4FK8A 1OGIA 1E63A 2VNKA 1QUFA 4YAUA 4WQMA 1GJRA 1I7PA 4U9UA 1FNBA 4G1BA 4DQKA 2BMWA 3QE2A 1OGJA 1DDGA 3JQPA 3CRZA 3JQQA 5FA6A 5KSWB 1H42A 2CNDA 4B4DA 3W2HA 1TVCA 4AF7A 2GPJA 1FDRA 4DQLA 2PIAA 3LYUA 2QDXA 1QFJA 1W35A 3LVBA 1GAWA 3VO2A 1GR1A 1NDHA 4F7DA 5TR9A 3FJOA 4YAFA 1BX1A 2EIXA 1QH0A 5THXA 2QTLA 3OZVA 3LRXA 4EH1A 1UMKA 4Y7CA 4G1VA 3W2FA 2OK8A 5H59A 3ES9A 1FRNA 3QFRA 3QFSA 1QUEA 2RC5A 1QX4A 1BJKA 3OJXA 1TLLA 3OJWA 3VO1A 1F20A 1W87A 4AF6A 4YAOA 1EP3B 2R6HA 3W2GA 4UAJA 2QTZA 2VNHA 1KRHA 1JA0A 3A1FA 3ZC3A 2BGJA 4YAWA 1FNDA 1JA1A 1FRQA 3W5VA 2VNIA 1BX0A 3ZBUA 1B2RA 1QGAA 3MHPA 5GV8A 3OZUA 2BGIA 1E64A 1GVHA 1GO2A 1JB9A 1W34A 2VNJA 2RC6A 4YALA 5GV7A 4Y9RA 4YHBA 1AMOA 3W5HA 2B5OA 3W2EA 4Y9UA 3ZBTA 4P6VF 1EP2B 3LO8A 3OZWA 2XNCA 1H85A 4BPRA 3W2IA 3FPKA 5EMNA 2BN4A 1QGYA 1DDIA 1GAQA 1CNEA 1QFYA 2VYQA 4C43A 3QFCA 2VZLA 2BF4A
chains in the Genus database with same CATH superfamily
1AF4A 1OXTA 3QFTA 4FFMA 3LP6A 1LDEA 4R0VA 3PNKA 5GVRA 3T7SA 3WMWA 4BMYA 5EHIA 3UA4A 5DNWA 3RWBA 5KMGA 2VSQA 2HBQA 4DC1A 5TMDA 2PUJA 2F8MA 4H60A 4HEA1 1A8PA 3R76A 3LC1O 3OPVA 2WD7B 4RSRA 1PUXA 4H3HB 1BQEA 3WQSB 4BFXA 2GM5A 5JYDA 4QSMA 3P52A 1MW8X 1EXNA 2VF2A 4TYQA 4EHFA 5FTWA 1N2SA 3LPDA 3H6HA 4ABYA 1RBQA 1D9ZA 5DV9A 4OX9Y 2YJZA 3OFVA 4UHDA 2OBBA 2PJZA 3MW8A 4L75A 4Y9SA 4F91B 4DLKA 5HTOA 4N5MA 4I4NA 1YQGA 3DD1A 1KJYA 1UQTA 2FFQA 3B36A 3FA2A 3NGLA 2X0DA 1NVAA 3LT2A 4IY1A 1TVCA 4FWBA 4ARIA 3U4IA 3HBAA 5EHNA 2OY0A 3R5XA 1L5GB 3TUZC 1LS6A 2C0PA 2VWHA 3K94A 1EYZA 1FYWA 1FDTA 2VQ6A 4I55B 1CUVA 4KNVA 1F5NA 5CUQA 3SNKA 5BUCA 1ZNQO 3T38A 4KNYA 4BQIA 1QFXA 3G6WA 3OJFA 2WMYA 4NENA 2HYIC 4EHIA 3QUAA 2OD9A 3MJCA 4B45A 1QG2A 4D9IA 6REQA 1YJ8A 3NP7A 4FBLA 3BBLA 4WEQA 1OLSB 3OT1A 4ZVMA 4D9KA 4HGYA 2EW1A 4U2DA 5EWJA 4Z7QB 5H80A 4GKKB 4CT4B 2XQFA 4GF5A 4M1QA 4MWTA 1ACLA 1V4VA 4MYSA 4MUGA 1DAKA 2VI5A 4RIFA 3X1MA 5FQOA 4XCVA 3CLUD 1H8ED 1M6HA 5SY6A 3D6AA 1JN0A 4NI5A 4OKNA 3H1AA 3IBCA 1WQ4A 2WJ3A 3TINA 2C1ZA 1LW6E 1YZGA 2SKEA 4MCIA 3DPSA 2QRMA 3NAZA 3ZK7A 1MJHA 1WXFA 3LC7O 2IYYA 1EBBA 2CV0A 5DTQA 3TTSA 4BAUA 4O2RA 2V54A 4B3RB 4BLQA 1WSDA 2AOUA 1SUCA 1UJMA 2QM7A 4ZQEA 2XWBF 4B3MB 2CXQA 2IS6A 1HUQA 4L57A 2W6ID 4FDMA 4E7PA 1F9AA 3BKWA 3HZOA 2JFOA 2PL5A 4L4ZA 4DLZA 1L4BA 1UBLS 2VQ3A 3B20A 2J0VA 3ECSA 3SSAA 3WFJA 5JAZA 1Q1GA 5FULA 1SEVA 1BVHA 3EWIA 3ZE0B 4G5SA 1A7AA 2HA4A 3K0FA 4YLYA 1JEQA 1GO2A 1N0VC 2GUWA 1EWRA 3JQBC 3I28A 1V1RA 3PXBA 1USKA 2Y1KA 4KO1S 3EW7A 4AMBA 3GRKA 3KZ1E 3IRVA 4CLOA 2Y0CA 1CB0A 4E5VA 3PIRA 4RU1A 1U8EA 5BWNA 3WNDA 4EATA 5IFLA 5TPWB 4GNRA 4CU2A 1J2UA 4WT7A 1A76A 5GY7A 3VTKA 2IYZA 1T2EA 4QD3A 1XQYA 3S2IA 2IPNA 2O3UA 3K70D 1R7RA 2ARKA 2QRKA 4H6XA 3FUCA 5DCWA 1PV2A 1ZVMA 3Q88A 4FEYA 3T4EA 1X13A 5LQCA 2DTDA 3OQMA 4CKCB 4MUAA 3TGLA 2VZLA 2IGBA 3VI4B 1DHTA 4EEXA 3MS4A 4EYQA 4BL5A 4RPJA 3WLSA 3V7FA 2R6CA 4QBFA 3HM9A 2CFIA 2W2LA 2FMKA 1ZGAA 1ZIYA 1M1YE 1PNOA 5CM9C 3DMPA 4M21A 3AG6A 3PNLA 1FTQA 3HKDB 2OMKA 1WU8A 4JLPA 1E61A 2BPOA 3ZTWA 3ZJTA 1E66A 2PSDA 1BA3A 2YWFA 3HCOA 1Z8NA 1Z2DA 3RH0A 1ISPA 3HO6A 1C8KA 2D2IA 3UQYS 1H69A 1L1QA 1L5HA 4QBIA 4YCSA 4C87A 3HCAA 3STHA 2BZ0A 2MT9A 2O6HA 1Y4DE 4WI1A 2GZ3A 5DM60 4CL2A 4TXJA 4PXYA 4N3NA 2FPXA 3LHFA 4NBWA 3H05A 1XEAA 1E2KA 1YB2A 3FVTA 3P9IA 4N8EA 4RHEA 4U7TB 1EIZA 4PSCA 5DN6D 1FSGA 3AR5A 5DBOA 2OYRA 3I0NA 4R84A 3I0MA 4UHFA 5FPYA 3WRVA 4D4MA 1G2QA 5AI4A 2FQWA 1OKKA 5LWHA 1RE0A 1ZICA 1SNYA 2JGIA 2R6DA 1YRWA 3QUCA 5E2BA 1IQPA 1ZK2A 3B1WA 1QRTA 4CMCA 1ENYA 3PT9A 1UBRS 4CEIB 1M6VB 1XMVA 3VU9B 4Z7NB 3OF2A 1Z5VA 4C7KA 2J0QA 1XAIA 2YHIA 1KXZA 3BTUA 4RE6A 2MMGA 1M7HA 5JAUA 4WOCA 2JAOA 1IB6A 4IQ4A 4PHFA 1H5NA 4QKQA 1B6RA 2YOHA 2RH4A 4L2IA 2QYHA 3SZOA 4Y7DA 4E32A 3QKRB 2C42A 5KYNA 3ZXYA 2A0WA 3B6EA 1CQJA 1NW7A 3AR4A 4KU4A 5TLSA 2XVXA 3P5BA 3EPLA 4MUMA 4NX2A 2BM1A 4Y6RA 2EKZA 4UNNA 1PR4A 3DCIA 1JDVA 4O4LA 2Z5LA 2ZRDA 4OGFA 5AQEA 1A4UA 4G0WA 3KTAA 1F20A 1ECBA 2QG6A 3ZIUA 2PSSA 1QXSA 3ABIA 3Q1LA 3GH3A 4UAJA 1GVNB 4CM5A 1UZUA 2EKQA 1KRHA 3I1FA 2AOXA 2ZRNA 3N28A 5B1IA 2WA1A 4MOWA 1I36A 1SHZA 4P3OA 3VSCA 5JISA 4N0MA 1FLDA 1FRVA 4EENA 1IBLB 3AXSA 2Z3VA 5JSUA 2YIVX 1PJCA 2GILA 4OXYA 5SYMA 2AC2A 2JIPA 2NXCA 3CZPA 4LYJA 5FPKA 1KXJA 4WOJA 3AQIA 3B1ZA 1SQSA 2HZ7A 3PHHA 5A4IS 2JGKA 2NNLD 4ZHQF 2QSJA 5CA0A 3U4MA 3ASYA 4YYZA 5I7UA 1YNSA 1XVAA 4L8YA 4QJBA 5CT9A 1G8MA 1CC1S 2NVWA 2C31A 4HZIA 2BR3A 2IY9A 3COYA 4JOQA 4MITA 2WF6A 4KPEC 1KZ1A 3AB8A 4FINA 4NTZA 2XB8A 3G2NA 2BFCA 2W7TA 5CEJA 10MHA 1P75A 1RCUA 2G1PA 3KKZA 3OEEA 4NF2A 5J4HA 3S28A 3MWJA 2WABA 2HPVA 1T2AA 3DE1X 3OEYA 3Q3JB 2I4OA 3A10A 2YXPX 2K87A 5E6SB 3V6MA 2QVGA 3EQ2A 1PDOA 4H6PA 4ZCTA 5HGXA 3DLBA 2HYDA 3A1WA 1U3FA 1YDEA 4JXKA 1XXHB 2XB9A 3U5ZB 1N7IA 1NU6A 2WJHA 4FKBA 2G1AA 3LZ6A 1IN8A 1LBTA 1KO7A 2JAQA 3T3HA 1WQ3A 2O20A 1WBDA 4EKIA 3GLFE 2W8BA 1U02A 2WKQA 2DHRA 1XTSA 3W05A 2C92A 3OJCA 1ZN7A 2R96A 1G21A 2JEZA 2IZ1A 2NU7A 3C5WP 5AK5A 4F12A 1LTQA 5HZGA 1J8VA 1EJ6A 4Z2YA 1ZD8A 1E1MA 3HS3A 5H70A 1WJGA 1TJ4A 2HY7A 3L4BA 4KYTA 4F5YA 3VC1A 4JI8B 2BMWA 4W7SA 1SUPA 5LVAA 2F4NA 4H7IA 4IFBA 2QR2A 2DFNA 2H52A 5HZMA 3ZOZA 4FMDB 1PW7A 1ZKMA 5HFAA 5DWVA 1C1DB 2DBZA 3SDBA 3WNVA 3X1DA 2VH5R 3V4VB 1TU3A 2OXEA 4IFTA 1I9GA 1NU8A 3QLTA 4UBKA 5TB5A 1OTYA 3T54A 4JWKA 1YB7A 1U0OC 4HTAA 1Z2OX 3TKAA 1KMCA 1FNMA 3OU2A 4RK5A 5CBPB 4JR0A 2PZLA 2VHQA 1YD7A 1UMDA 2HA2A 1BC5A 2O1WA 1YBFA 5FOTA 4YCLA 3ICWA 5PNTA 5SZHB 2WQ7A 2NO7A 3QPBA 1THZA 5DYWA 3RIGA 1G60A 3V4FA 3P2YA 3RV3A 3BILA 1AUXA 2VCYA 3FLMA 5CH8A 2WTEA 2YFYA 3R24A 4QEZA 2HHAA 4JK3A 5DT9A 4ZI7B 4ZGBA 5DNCA 2ZSDA 3O3CA 5J47A 2CGEA 5D5PA 3W7AA 3R8FA 2Z6UA 4YJ3B 3D4PA 3D6FA 2HU2A 1GV1A 2PSJA 4YRAA 1U2DC 2VF8A 4IG4A 1JSZA 4XVRA 2BDTA 2J32A 2AMYA 3MJEA 2WSYB 3T3DA 5E3JA 4HWPA 3QNUA 1GUBA 3NPAA 4ZCLA 1CYDA 2PK3A 4QOFA 1W5AA 1G8KA 2NX2A 3HDYA 4MULA 4PLGA 2VYVA 3Q5GA 2EIHA 3FLBA 1PQWA 4IJ6A 3RFTA 2VXOA 4EX6A 3F8SA 2BHTA 4NCIA 4TLMB 2ALJA 3UEOA 1BVUA 2NTYC 4Q9HA 3WDKA 2ZBRA 5LOVA 5ADUS 1Z88A 4ZO4A 3UC9A 5K0JA 1Z0DA 3A4TA 1OYYA 2BSXA 4MW4A 4FLMA 4JJAA 2I2FA 2JLRA 4L3WA 2R8ZA 2IU4A 4NNJA 1P0MA 1TW3A 2ZLBA 4XSGA 4BRZA 1HLFA 5C37A 1BSVA 1D4AA 2F8SA 1JVBA 3NG1A 2OB1A 1RKVA 4IIGA 5L8VA 1ZX1A 4NU8X 1I1HA 1JB9A 1VCOA 1CRWG 1JT9A 3H1BA 3K1JA 4QDJA 4DMLA 2UZ0A 2VQFB 2W2LD 4CT0A 1IWOA 2HREA 3D8TA 3AFOA 4XW2A 4AKHA 4DYHA 4OL9A 1K1EA 2Q3BA 5BWCA 2L0XA 1K6XA 3TLXA 5CDSA 4N6GA 4BFUA 3I76A 3GPBA 4FR0A 1K2WA 2H18A 3D4BA 5FEMA 1C3OB 2HJ9A 1K9VF 3FSGA 3FX2A 4BB5A 4RTPA 5T4BA 4OHRA 4HTFA 3LBHA 4HAOA 4OMDA 1CY4A 2ZIFA 1L5NA 2WFLA 1DJPA 1K8XB 2P35A 3AINA 3FSEA 3GJYA 1SU6A 3KXDA 4IKPA 3QRWA 1EDBA 3IDAA 3C87A 4PQRA 3MJTA 4PZ0A 1UZNA 1XTKA 4R1UA 3ZIAA 4IM7A 4CGZA 1DAFA 3DW3X 4O4IA 1RYZA 4UPVA 1CSEE 4NK4A 5FWXB 1TT7A 1CUGA 1LPSA 2G7ZA 2EGGA 4YCAA 5FLEX 2XYQA 2DFPA 4HDKB 4HPXB 2AG6A 2XKAA 4PQGA 1XRJA 4QDUA 3KLMX 2RHTA 5AVQA 3OVMA 1FU7A 3M4NA 3AZQA 3FMVA 3A4MA 4J07A 1Y8QB 2GHTA 2Z6VA 2J41A 4BJ6A 1VHJA 4Q3NA 1RWKA 3WBBA 2VOEA 2PKQO 3RNOA 1AQNA 3FUTA 1TQ8A 3F4KA 2SBTA 3IVGA 1VKRA 2ZYAA 4HXYA 1NNEA 2LP4Y 4Q02A 5JV5A 1FVXA 1TDJA 3ZDXB 4FFPA 3SR4A 1RMYA 2H31A 3WK4A 2VT3A 4KGVA 4Z9YA 3WK5A 4FGZA 5BV1A 1AU9A 2V03A 3L4SO 4I14A 3KYDA 4KWEA 4F2GA 5L3QB 2PKXA 1A82A 3ICVA 4KN9S 2GBGA 3BXXA 3GAMA 1P61B 4F4HA 3O2NA 3BAZA 4M1KA 4J0CA 1P1FA 3ICOA 2JBAA 1EK0A 4ZO6A 1P6UA 1Q19A 5E38A 5CA1B 3IQIX 2OV8A 4MUXA 2F8LA 2X8JB 4GOKA 3DV0A 2A9VA 1LK7A 3JR3A 4EG1A 3SQWA 1E9CA 1NG1A 1QOZA 2IYXA 3O0DA 1Y6JA 4E6EA 3VGPA 4E22A 3IQDB 3W0LB 2JJ1D 4ZU6X 3QSYA 1NI4A 1YJBA 3KEFA 3V1LA 5CYFA 3WIDA 5J4YA 4X62B 1AMNA 1FRNA 1BEZA 3O73A 5EXDA 3QOFA 4GR5A 4PPFA 2Z2KA 2GYVA 3KUDA 2O2CA 5JU6A 4TMYA 1X1EA 3OEHA 2ZETA 4ZEMA 1E99A 1GU7A 5J63A 2PVCA 1GIAA 3GA0A 1RJWA 1OI4A 1YR7A 1R0CA 4DKXA 1E8NA 1QCCA 2R6GA 3PWSA 4AX4A 3GPLA 3WLIA 4Q9NA 5AKJA 5JSZA 4RADA 3HUDA 2JI9A 3ZWXA 5I7SA 1Y7LA 1H1TA 2OM2A 3ET5A 3GEGA 1SG0A 3OEED 4NXMB 1II8B 2CLCX 4OHVA 4TWJA 2FZGA 3TEJA 4BATA 4UJ3A 3UK6A 1IK6A 2AL7A 3T5AA 4AKEA 1JPNA 3C3YA 3LWZA 3UH1A 4IDBA 1DEAA 4MQLA 3HVHA 2CC2A 3BULA 3I8XA 2EHJA 1ATIA 4Q3OA 3U3ZA 4B6SA 2OPBA 3DXYA 5AXBA 2YOGA 4FOTA 2G77B 1RRCA 1K7CA 1B8NA 1G64A 3MMXA 1O95D 3W6NA 3DB2A 2WWWA 1WY5A 2I2CA 5F1KA 4Q7MB 1PS0A 4B3CA 4HUTA 5HOQA 1S2IA 1ZG3A 1DADA 2QNBA 1QQTA 1ID8A 1JSLA 4IMPA 4MAAA 1BE6A 2X0FA 4IG9A 2IOYA 5DBHX 5KYWA 1L4KA 3QPDA 4LJ7A 4JLAA 3BF7A 4C06A 5KYGA 1MOZA 1RYFA 1T1GA 2MSNA 1A9SA 1O77A 4WKBA 4TTJA 3ZR4B 5F2EA 4O1HA 5JD3A 1U7WA 5AM4A 1FW6A 1W75A 2XMRA 1IEWA 3RK0A 2VJPA 3EZ2A 4IIDA 4D6PA 4FT2A 1H4TA 2V8BA 4MCAA 5KBYA 2FWMX 1KZ7B 2ZU0C 3LPNA 4M46A 5IJXA 1U6KA 1EUDA 1FFXB 3EGVA 3FPGA 1OF1A 3ZWAA 2J0SA 2EYQA 1F9EA 1B1AA 4BNIA 5IASA 4WXHA 1Q11A 1FZQA 2OAEA 1UH5A 3GIDA 4BLOA 3OTWA 2C83A 2G0AA 5FLYA 3QUTA 2XT6A 3GGOA 2ORWA 3KPVA 5REQB 4D3DA 3G49A 1C3VA 1OAAA 2G70A 1UBEA 3ZGVA 3SYLA 1TIBA 1LEHA 4AROA 3PS9A 1DKOA 1V11B 1ZOLA 3VDQA 3IMFA 3RUHA 5K3CA 4JBNA 1AD2A 4IOLA 1WB5A 1XZAA 3VR2D 1JZQA 2J3KA 4JFAA 3MMNA 3SN6A 2NSDA 3VJKA 4ZI2A 2COEA 3F5FA 2WNSA 5TVKA 4GOMD 1KEKA 1ODCA 2R68A 3K9HA 1DAPA 2I6TA 1EPUA 4BLSA 3PRYA 2BMVA 4DR5B 2VYVD 4L74A 5CDYA 3NT2A 4JA2A 4JZKA 5JT1A 1Y37A 2FR0A 2CFOA 2VTVA 3KAPA 4TKUB 5K1ZA 1Y7PA 3MB8A 4I9UA 1SZCA 4J4BA 1RC1A 2YHSA 4X7PA 5EA2A 1ADJA 3VR3A 4OG2A 4OHXA 1XL1A 3RVJA 3VX4A 1T3HA 2BBOA 4GI1A 1S0UA 1Q7EA 1Z28A 3IIEA 2XGMA 3N8DA 3QYAA 3IBGA 4FYKA 1X7YA 2FSGA 1YVEI 1TL7C 4Q05A 4AJKA 4KQ6A 1DL5A 1E58A 4N54A 4M49A 2CJXA 1BMFA 3EZYA 2LKDA 4O33A 1G0OA 1LV7A 4PHGA 4XAQA 1WHSA 1HSOA 1P29A 3OO1A 5LA6B 3RUEA 1EQUA 4C2TA 4IQ0A 3R3HA 2FYTA 4FNMA 1BQ3A 4CG3A 2V5VA 4GKAA 1XO1A 5JADA 1QANA 2P3OA 2Z8YA 4MRPA 5L4LA 1FRQA 1SFRA 2RMKA 4LYYA 1I10A 4F3RA 3ZGZA 2AXPA 2J4CA 4CLXA 1OGYA 2QKYA 3AR6A 2QM0A 3NFRA 1XU9A 4A6PA 5T8KA 2BYTA 1U9IA 5C31A 2ECFA 3V4LA 3LUFA 4BWYA 3H97A 4UDOA 3WL5A 2J6CA 1Q2XA 2G09A 3ZIAD 3P0HA 2H92A 1PVOA 5K3BA 5HF9A 4V0QA 1ZNZA 1MV8A 5BSFA 3OO0A 1I0LA 3E03A 2BDUA 3CNEA 5JNVA 3BDAA 3E5RA 1UZAA 2CLIB 4PG4A 5C5IA 1PJ2A 4RELA 2D00A 2XI4A 1K6JA 3LO8A 4AMYA 3IDSA 1ILWA 4P5PA 5T64A 3Q6IA 4OB7A 2HCTA 5LMUB 3T5TA 1XCJA 5IRCD 1VM6A 1NPTO 2ZAGA 3RNLA 2GN9A 5AJVB 3CZRA 1HX7A 2FPPB 1VMAA 4J7CA 3C3AA 4O8ZA 1BMDA 1PLJA 4O4JA 3STXA 4FFBA 2ZRQA 1VJRA 3OSZA 2CLDX 3VZDA 1KU6A 3D81A 2DUNA 3EQ9A 3G17A 1UL1X 1D2EA 3T1OA 4NV3A 1R12A 1P2GA 3DDZX 1UAGA 2XE7A 5BN5B 4ER0A 1GFIA 3URKA 4BVFA 4QODA 5KNCH 4L8GA 3W79A 3WE7A 4BV3A 5D5HA 3R6TA 4LMAA 4IIUA 3KOXA 1P5FA 1S3FA 4FD3A 3R6DA 1J33A 3DPUA 1ICIA 4UE6A 1DUVG 3DVQX 2HWKA 2VTDA 5LP6B 3JQ7B 3CF0A 2AKYA 4PBTA 5JUWA 2DY0A 3MS2A 4PLHA 2DWPA 1QUFA 4E70A 4RACA 2GNAA 4ND8B 5EINA 3ESQA 3VO9A 2B37A 3U62A 1WZCA 1L4UA 1SCKA 3F90A 1Z4PX 2YN2A 1C0PA 3FYDA 3DJYA 3IPCA 3QE2A 3QUBA 4AC9A 3D4IA 4G9GA 3IE2A 3W34A 3S7ZA 2PU5A 4NDAA 4L22A 2FAXA 1NL3A 3C6YA 1V48A 4AY4A 4HPJB 5AI5A 1ZGZA 2ZJ7A 3TIXB 3I9JA 1QNFA 3IKVA 3FMPB 2P8SA 3OFKA 4FYPA 4C0QC 3AVTA 3TSCA 5HZHA 3L04A 3QXHA 4MKIA 4Z3DA 1EFHA 4QZVA 3OPQA 2R7AA 2Y3IA 2ASEA 4R7TA 5F4BA 3ZHBA 1F8GA 3GRVA 4XGNA 3NNDA 2R25B 4ATNA 1EJ0A 2HSZA 5DTEA 2BEJA 3BTSA 3HEMA 5CB6A 1IIRA 3VZSA 3AF0A 1DWUA 2QJWA 3AEUA 4MLCA 3W1VA 3HI6A 1P18A 2AFVA 4P4NA 5I3ZA 5JJLA 3KQKA 1VE5A 5IKMA 5JAOA 3MILA 3GFSA 2FP4B 1TTQB 3SMVA 2RC5A 2B92A 3GH1A 2F90A 3NOVA 3CFYA 4XDHA 2FPOA 1QMGA 1R0RE 4U9HS 5D51S 1M73E 4J1NA 2G3YA 3W3ZB 5JH7F 3H6KA 3I9OA 4WMLA 3JAMA 2HMTA 5A3VA 1L4FA 3FNGA 2XEXA 2B8TA 3IBSA 1UBNA 3HABA 4LHXA 2X41A 4TTIA 1Q0SA 4LK3A 2ZVJA 1RHRA 3NGXA 3TLBA 4BMCA 3LUGA 1QYCA 3CE9A 4ND1A 4LOHA 1G5QA 2HM7A 1CIVA 2IYWA 3I1IA 3O9VA 3SVLA 1PFVA 3A9SA 4EGJA 2H2DA 2XVYA 2CUKA 3VHQA 3SSMA 4MR8A 4BNVA 4YEDA 4EY8A 3R7BA 1YR9A 3RU2A 2GF2A 3ZHVA 4YPVA 3AUTA 4G5YA 4RQBA 4PC2A 5LD2B 2ZRAA 1DAGA 1E1LA 4JFRA 4JLJA 2XYGA 4AJOA 3QYPA 1IUPA 4DJTA 5JXGA 1YZVA 2GCPA 2RI6A 5K8VA 3TGPA 1XDWA 4TTRA 2Y2VA 1KK1A 1X7XA 2DRIA 1QTIA 2XE6A 2XUHA 1XD8A 4J1QA 4C7MA 1RWVA 2ICAA 2VPTA 1YOBA 1UBTS 1T5LA 1VG0B 2XMSA 2TMDA 5E6UA 3DSRA 3QBVA 4KIWA 1Q92A 1JHRA 3KQWA 2C59A 4IO0A 5F7ZA 3I62A 3JAWB 1ZBQA 1EFRA 2LDXA 3EIOA 3D2AA 3P9XA 3QJGA 3EJWA 4Y2HA 4C88A 4M83A 2J0UB 1QK4A 1DBIA 4I4IA 1YRQA 4M9UA 3V00A 3GJ8A 4CM7A 4FONA 4K1LA 1CE8A 1V5GA 2FI1A 3NYIA 2R48A 1NR5A 2C4KA 1P0CA 2XB6A 3DMNA 1NJ6A 2QT9A 4IPTA 1G2IA 3VHLB 1IG3A 3UBTA 2PX3A 1AKEA 1NFFA 2A9QA 3HDQA 2O3JA 4JJEA 4WUTA 4FB5A 2IYUA 4C7OB 2NUAA 4M8KA 3WTBA 4D98A 1M6YA 2NT3A 1GAEO 1NBMD 4B5LA 1XNGA 1Z3IX 1EP1B 1U2ZA 1VL0A 3HDGA 3M6MD 1YACA 1KFEB 3O90A 3T95A 1TM2A 1D9XA 3D1VA 4LY6A 5H68A 3G5TA 4X7MA 3U7RA 3V3TA 4HX9A 5EJ9A 5HRUA 1CB7A 3GT7A 3ZE9A 4GI5A 2OFFA 5AVRA 3PENA 3WK8A 2H1LA 3BERA 5A5VA 1KMHB 3S0JA 3G68A 2J3JA 5LSAA 1QRUA 2P3LA 4A6XA 3LQ4A 1C9KA 4UUOA 2PS1A 5JSFA 1QOQB 4PPYA 3KPWA 1MAAA 3DTNA 4Q1CA 1XDGA 4OGLA 2YXDA 5JJCA 3GZ4A 1KR2A 1KOJA 1Q1BA 1SULA 1V71A 2C2ZA 2R7MA 2ZP1A 4NCXA 3EZ9A 3GXOA 4RZQA 4CJXA 2RHWA 4ZMBA 1BMFD 1C2YA 2B3TA 1Q1AA 4ESVA 3UUFA 1H2WA 4QFBA 3HCCA 2MCFA 2QRNA 8GPBA 1SXJB 1N2CA 1RI3A 2GK6A 3AVOA 4U6QA 3NP9A 1G3QA 2JD1A 1TYZA 1XTJA 1Y98A 2FLKA 3M89A 3ZHCA 4UUPA 3IKMB 1E3JA 4NOMA 4AQYB 2VPIA 3GDGA 4F9FA 4G5QA 2RDMA 3GLGB 5KYTA 5AM5A 2EZ4A 4JVOA 2LVBA 4NCJA 5HF6A 5CAEB 3RS2A 3C7DB 1GCIA 4HNTA 4QLOA 2WSSD 3C8MA 4R8LA 2D3WA 3E6AA 5FJIA 1CQZA 2HAEA 3ES9A 4HNAB 2IXFA 5K99A 2Z5GA 3BJIC 5M34A 4Z4EA 1JQEA 2XCLA 3IQZA 3BDIA 5EIHA 3MELA 4U7FA 4FYVA 3WYCA 2P4EA 4LWZA 2VDUE 1GEGA 4D45A 4U6SA 3PC8A 1F8FA 4F9EA 4NECA 3FLAA 1EX6A 1X74A 1R74A 2OE2A 4BWGA 4J76A 3QK7A 4KN6A 3KQSA 1I3NA 1VSQA 2DU8A 3KQVA 4P35A 2ZRMA 5CB8A 3EIWA 3A32A 4XCXA 2BLLA 5JHHB 2OO5A 4IJWA 4BXOA 1P1JA 5F1PA 4RANA 5GIOE 3A6HA 3N8NA 2AXNA 1KI8A 5CYOA 3CLRC 5EMHA 3G02A 3H2GA 1KK0A 4UAUA 3C14C 4MCJA 3GLSA 1HLPA 1KFCB 3DYIA 4JVSB 4LIPD 1JAYA 4MH0R 5E2IA 5EUBA 3L5OA 2EF1A 1ZSYA 3UK7A 1T6BY 1NBAA 4KC0A 4XIIA 4LNAA 3ETEA 2LBPA 4ND5A 1E64A 3KSUA 4DS3A 2QRLA 2HT6A 3X44A 3AM3A 3D7KA 3A9CA 1YZYA 4UBLA 5IZCA 5CW2A 4HH4A 1G1AA 1E1CB 3IALA 1WAMA 4L5CA 1JPVA 4PO1A 3V8EA 4OQDA 2ZUVA 2ATCA 2YC2C 3DDHA 4CMJA 2F1HA 2QMOA 2HR1A 3H99A 4ZZIA 1ZUNB 3HN2A 2Z30A 3CX3A 2KX7A 4BRUA 1ISHA 3MWDA 5LB4A 4BZZA 1EINA 3DFMA 4XXHA 5HE8A 1JIQA 2HV8A 4MEBA 5BUQA 3F4BA 4ZTUB 3U4AA 3WMEA 2JDID 1EG7A 2CL5A 1DLJA 3LQ1A 2OV4A 4FDUA 4P3PA 5CM8B 4UDNA 1FP4B 1FMTA 4JBGA 5KTNA 4B48A 5KQMA 2P30A 2EEPA 3QY9A 3C39A 4CTKA 1A2BA 1U1GA 1TTPB 3NH9A 3OTGA 2ZWVA 4EW2A 1M54A 3AO0B 3DONA 1PTKA 3JVDA 1A9ZA 1SOMA 1NONA 1U4OA 1Q14A 5DHSA 4X20B 1OX6A 4KFUA 4MV8A 4NBNA 5BO5A 2QNIA 3V2IA 1XTUA 4KXUA 4FDTA 5HK9A 4OI0A 2IDJA 1OW3B 3D7MA 4FTWA 4AIIA 3KUKA 4EEZA 2OXFA 3RVKA 3G8CA 2GPAA 1W7AA 1QHHA 1W47A 3D6MA 4KQJA 4OV6B 4DSAA 3L0SA 4ZN6A 1NY6A 2Q6OA 4YAKA 3GLIA 3PEYA 1TCUA 5TQJA 3S81A 1V25A 5LMCA 4AMZA 5AK3A 5TVGA 1JJ7A 4EQZA 1NQAO 2BKVA 5AOVA 1EUYA 4P7KA 4R1LA 2PKRA 4MWCA 3L6EA 4IWNA 2QMUA 4CKEA 1FC0A 4EB0A 4WGFA 5ESWA 2DHEA 3REQA 3CG4A 3FJOA 2XZLA 3ZKWB 2OC4A 2ZB8A 4PGAA 4AURA 3L5KA 2JIQA 3LSTA 3BWCA 5LU8A 1N32B 1OHHD 2A0UA 3AFMA 4E2FA 4OL0A 1VZ3A 2WK1A 3ET4A 3EB9A 4F1JA 4LJRA 1IFXA 3ICPA 3QX9A 1KNXA 2X15A 2OD2A 2XNDA 2QTWB 1WMEA 2I0FA 3GFFA 2BKAA 4N82A 1BJRE 1YGYA 1BO6A 3H1TA 3PWTA 4FHDA 4I50B 4PG7A 4US2R 5HS4A 2BI8A 7ABPA 1U2RA 2JEOA 1TECE 4KK3A 3TKLA 3H9EO 3FAZA 3GB9A 3A2NA 3AP2A 5EJ2A 3W2GA 5JY1A 2CUTA 7ADHA 4M9QA 2VL7A 3W6UA 4DUYB 2Q3FA 3TQCA 2YV5A 3W8DA 1K6EA 2OGWA 2ZI6A 5BSWA 3D4NA 2CXXA 3K0CC 5DGHA 5HILA 1HY3A 3UT6A 3CSSA 2RFLA 3JYHA 1CVIA 5G41A 3KZXA 5IAOA 3HXMA 2D54A 1NVTA 2C5BA 4XDZA 1B6SA 4XOUA 1YZ3A 3TMAA 3VV2A 5IJ9B 4ANFA 5CIWA 3E5MA 2VJAA 2HPZA 4XPIA 3DLHA 1OOEA 1UT5A 1MIOA 3PC8C 3VAAA 5JAQA 2PANA 1DZIA 5J5AA 1UPBA 1OI7A 1YQUA 3IX7A 4GOOD 4QUEA 3PQFA 4CG2A 4DMKA 3TZ6A 5IM4A 1RW4A 3TEMA 1NV9A 5HUQA 2J3IA 1F2VA 1SCIA 1WXDA 4O25A 4ZI3A 2OO5C 1GXSA 3UQZA 1N9GB 4HS9A 3KKNA 1X2EA 1EVKA 1XALA 4YV1A 1Q6YA 1KETA 2YVUA 2AOWA 4MKZA 3IS3A 5JQGB 2FZWA 2QG9A 1DAIA 3DO8A 3IUQA 2CL6X 2DM6A 4IYRA 4ND2A 4CKZA 1QLHA 2Y67A 3FWNA 4RTKA 2QTFA 5LYYA 4B6JA 2P77A 1J0XO 3Q9NA 3QJ5A 3TTWA 1NTOA 2AR0A 1IRXA 2AN5A 1G5TA 2IDKA 3TAHA 1EDDA 4UMDA 1CUWA 1BN7A 2XEDA 3EDQA 1X8LA 4HC4A 5GWXA 4DSNA 5C5CA 5HKAA 2GM4A 2OBLA 5I45A 3V34A 1T3SA 2DBVO 1LCIA 1R6BX 4FFSA 2I9KA 2HC9A 3PQ7A 1LBIA 3A8TA 1ZVJA 3TQSA 1IIBA 4RWEA 5FPSA 3ADCA 2YWGA 4J03A 2EBUA 3DKRA 1V3UA 4EG0A 1DQPA 3AU9A 4OMFG 4YJGA 4RA6A 3TR5A 4UBOA 1TC2A 4KLZA 4OQQA 3LJKA 3ZD9A 3GPIA 4JJ6A 1RLJA 3JXEA 2E0IA 4PY2A 5AJWA 3WL4A 3I61A 3HYRA 3AL3A 1N6LA 3F7TA 1TPYA 1DB3A 3PSAA 1W85A 2GESA 3QPWA 5TT1A 1WR8A 2EFCB 3FOBA 3U4CA 4R8KA 1T3LA 2AYYA 2W22A 3GT4A 3KYJB 2O5VA 1Z4JA 1L5MA 2EDAA 3A2LA 3C6QA 2TECE 3AFHA 5J58A 1Q7RA 1QORA 4BTVA 2MINA 1T6XA 4CR6A 4POOA 2QRPA 2Q4BA 3SIWA 3OF3A 4J1TC 2QPOA 2IXDA 3OP1A 4HNHA 3WSTA 1DPFA 1ZVVA 4PAQA 1KH1A 1TM7E 1X7DA 4L15A 3FOEC 4TXLA 2PVSA 5GZ6A 1PP4A 1VG8A 4L0CA 3ILSA 1UMCA 1ZGJA 3F4LA 5KNDD 3PUZA 3K6SA 3W7VA 5LKRA 1ECGA 1BJTA 1E9VA 4XIYA 5HG0A 1KOGA 3A1NA 1LDMA 3FTQA 3OFNA 4FDAA 4Z4HA 3O3OB 1E5VA 1WW3A 1JR3E 4PLTA 4EH1A 1HPLA 2YRWA 3WK7A 4JBXA 2REBA 4RF3A 4FN4A 1OV6A 3MUNA 4KYIB 5DP2A 5HIJA 4A8JB 5DI3A 2X40A 1DEKA 3I6YA 2WM3A 2FFBA 4BP1A 4BVJA 1NBME 3VDNB 4XEUA 2Q3JA 4X8OA 4B87A 4LF5B 4MEJA 4OYLA 5GINE 3UJAA 3KDAA 5AW1A 3KG2A 2QLMA 1CDEA 4C3UA 2Q4RA 1MNAA 4G5HA 5TQ0B 3N1UA 3VAYA 4BLWA 2ZUSA 3NIWA 3KKOA 4BO2A 1PL0A 1QF9A 1R0KA 2C1XA 3O8OB 3COWA 5GQSA 1N36B 1Y89A 4OHMA 4F0JA 1KEWA 2ONYA 2XMQA 3WR5A 3KFLA 2ZWMA 4YRTA 3FZNA 4A0FA 1QH1B 2YJTD 3BJMA 3JU3A 3T1NA 4JT9A 4K9QA 4R2JA 2XYRA 4JODA 3H18A 5ITWA 3HVRA 4QT0A 2HXGA 1UWVA 1AVTA 2TMGA 4PSUA 1JILA 1F7VA 2QQ0A 4BNXA 1LC3A 4H2DA 3RODA 2RGYA 2Q3CA 4K7JA 1PS9A 3ICQB 2OCGA 1QTQA 2GCOB 2YY6A 1OXSC 4UVDA 3GCWA 4EZIA 4F38A 3UXYA 5JEDA 3D2LA 2R2AA 3JV7A 3CLTD 1RI1A 4PVDA 3LDAA 4UUNA 2J3EA 1KVTA 2WWGA 3CRMA 3QW2A 3PICA 4UD2A 3SU8A 2VTBA 1YMUA 3KETA 5MGNA 2C2YA 4QJ4A 3TZEA 1KGDA 4MW5A 2UU9B 3UHPA 1FYXA 1NAIA 2HRDA 2IW3A 1Y8CA 4G37A 4PTZA 2CEKA 1LQUA 1A7KA 1YDHA 2WV7A 4N9WA 4KDFA 1RWNA 2QX9A 2BLNA 4HDMB 4XUDA 1JKIA 3LZCA 4I3GA 3AW8A 1DBPA 1RAIA 4EQ6B 1A8IA 1E59A 4W1RA 1QRSA 4D4KA 3FHTA 1M8GA 2OT3B 3MUOA 1E3LA 1M2FA 1TUBB 4TXHA 4UNQA 2DQKA 1NGSA 4WUVA 4MV9A 1M7GA 1WZNA 1XKQA 1SU8A 1EK1A 5AW8A 1RJDA 5DNUA 1IBKB 3SXJA 2RONA 4TMTA 1WCIB 1OPXA 1VHQA 5FBZA 4B40A 2CF5A 3OX1A 3D6UA 3ETGA 4TV9F 4EPTA 3QXGA 4EJ0A 3S7TA 2WJIA 3NDJA 5T3YA 3OLVA 3W5DA 3GI1A 1AOXA 4HXGA 3OMLA 1TD9A 2B7BA 4XD7D 3MAJA 1GAJA 4YMIA 5BSMA 1EFLA 4RNCA 4X54A 1QQBA 3KB6A 5ALVA 4LTNA 3I72A 4C6TB 4O4HF 3BGDA 1DLIA 1KJJA 2C8JA 3E1GA 3N0VA 4X71A 5JRJA 4OJMX 1TO2E 3TTTA 4I55A 1E6EA 3DA8A 1EK6A 4D82A 1CUXA 1VPVA 5C18A 3KZNA 5KX5B 4C05A 5HF5A 2R7NA 1UBKS 3JZDA 5BMVF 2O1EA 1EGVB 4FCWA 4D25A 1BKYA 3HJHA 3TWOA 1Y6ZA 2PLWA 2HNBA 4LZPA 4GI3A 4TN5A 2JB9A 3V9PA 1H9BA 2VDVE 3P19A 4PG5A 1OLSA 4LZNA 2AB0A 2FOXA 5DI9A 5JASA 3F78A 1NASA 2O54A 4MVJF 5CW1A 3VKWA 4FFRA 1YCHA 3TECE 2C4UA 1LK0A 1F2TA 1URPA 2XTJA 3PEWA 1Y8ZA 2DSTA 3CV3A 3LGAA 4RLQA 1W4RA 2W6MA 3SF8B 4HWTA 4DIBA 2WF5A 2OK8A 1J2YA 3GJ7A 2Z2ZA 3F5SA 4BE4A 3RABA 1W36C 3EGCA 3MTJA 1RYEA 2OGZA 3PNSA 1EBFA 4OSEA 5BUZA 1NXWA 2ZYVX 1PJAA 2GO7A 5GMOA 3WYBA 2V6BA 1ZGHA 2Q5LA 3MNFA 2PQ0A 3EXG2 4BS9A 3IXLA 1ZI9A 4KFTA 1MO4A 4OFWA 4DLXA 4FHZA 2Q49A 2GTHA 3L8ZA 4WKOA 2BBTA 2I33A 4PO3X 1E7MA 4CNQA 2AF4C 3M0EA 2OEPA 1ZW1A 2JPDA 4ACAA 5I5EA 4QLAA 3IQHX 3E70C 1ADFA 1G2PA 1Q74A 2QBYB 4HLUA 1UBSB 1B74A 1JIIA 4OGGA 4ZARA 2YINC 3IR6A 3KTOA 3V33A 4OXQA 4A9AA 3WYNA 4EGSA 1QV7A 4FE7A 2J9YB 3FCCA 3S8YA 1EB8A 4I55F 5HR5A 3SQXA 4ZT2A 2DBYA 3KJHA 4MYUA 2MSCB 5DHPA 2XB4A 4RSMA 2PZKA 5BWMA 4LF8B 1CEYA 4RM2A 4XTRA 4DJ5X 1AA6A 2L18A 4S2UA 1P4RA 3ISVA 5DF1A 1YK0A 4Y9UA 2ZTMA 3CLSC 5TPWA 3TG8A 3IQGX 2OTCA 3WO1A 2AA3A 2F7SA 4NKRA 3K4PA 1NM5C 4EJFA 1NNI1 2BWJA 2ZKLA 2FRDC 2QB5A 2YV4A 1NVXQ 4ZTZB 4NFYA 2W2KB 3OJOA 1R4MB 1NVWQ 4B8ZA 2UYYA 1E1NA 4ZVLA 2PGOA 4CKCA 2VJMB 2AR9A 4ZOLB 5AO9A 4F1WA 1ZD2P 3JQGB 3QBEA 4YO7A 2X3UA 4TXMA 1ESMA 5EPUA 4EA7A 3D3QA 3DBVO 2VRNA 1QVRA 1YVUA 3IL2A 3HKDA 3GBPA 3SOZA 4HCJA 5DJ5A 5FUQA 1HRDA 4OQNA 3LQKA 5AMXA 4B6QA 3D54D 1JNYA 1OTXA 3B2EA 4X61A 3PXUA 4C20A 4EVSA 2P5UA 5BW4A 3CWQA 3OOJA 4K9LA 4D41A 4X1IA 1MN6A 1J9ZA 1IM5A 4N7JA 2ZT8A 3CF4A 4N5IX 1WXWA 3U26A 3NLLA 4F92B 2QZ9A 3ABRB 1WSWA 2H1OA 3MN1A 5A04A 2VDKB 4MUBA 4QDTA 3WGOA 1K89A 1J20A 1LFAA 3FWYA 1TX4B 5A5EA 3NEPX 1EWQA 3ZHUA 1P1BA 4L85A 3W9YA 2ZUBA 4M76B 4A10A 2QRQA 3O95A 4HN4B 4MA5A 3U49A 3S4YA 4PZYA 4EFDA 1QZXA 2R97A 3RSFA 4AG6A 5FTMA 1HEUA 4RZ2A 4BO6A 4KQIA 5K05A 1UXKA 3F6CA 2I6SA 3G9UA 3CXRA 1M6VA 3G0IA 2GPTA 3VU9A 4DILA 3YASA 1GAWA 1KBOA 1WOYA 3FCAA 1YRLA 5HXAA 4RH1A 1L7RA 2XAUA 1OXBB 5DFAA 3ZCPA 3T1YB 1RYDA 4RKWA 3TFOA 3Q3EA 1M8PA 2QSYA 1HQKA 2CHGA 4IGKA 1XLTC 1KDVA 5IG2A 3TRHA 2B1QA 3OIGA 1MX1A 3NHFA 3OIVA 3R6WA 1T13A 4GEKA 5E6UB 5L4SA 3SS7X 2BHLA 3HCWA 2ISQA 4M8LA 4XWAA 5EIBC 4B4WA 2J31A 3SIPA 3KB1A 1JBQA 1W76A 2P6UA 1EBUA 3TOCA 2PWZA 2QUHA 1EFKA 2YRFA 3R0ZA 2G1JA 3OF5A 5DYIA 2WYOA 2G5GX 1NLZA 2AEMA 4N7BA 2IJGX 2M6SA 4R05A 2C3MA 3KHKA 1GQYA 2PL9A 2ZBEA 2RHRA 4ITVA 3TFWA 3FZEA 2HW8A 5A71A 3I12A 4HEA6 4B9AA 4AXXA 1CUAA 1JDBC 1P4SA 4ZO9A 13PKA 3O74A 2XKJE 3S44A 5C8YB 1X8JA 2NM0A 5FNVF 1GT6A 1W0CA 3KT0A 4MQMA 1PJSA 1L5OA 3H84A 5CFPA 1M9NA 3FOFC 2R5NA 2OGSA 3JWJA 3B5IA 4QU9A 3ZZMA 1CD5A 3PLNA 3QKUA 2HQBA 1R4AA 3KE8A 4DMGA 5D7BA 1C3XA 4Y2PA 3O7MA 2YVQA 3ACCA 1E2HA 1C81A 2HCRA 2JIOA 2G6BA 5KQRA 3DNFA 3RRJA 5J5CA 2QAGB 5L7YA 1R3DA 1JE1A 1T4CA 1VIYA 3LCCA 1PR6A 2VSXA 3HO8A 4K3VA 4MGYR 2QL5A 2YIMA 4OYHA 4DR6B 2WYVA 1JQ5A 1SCUA 4N3GA 2FMTA 1AKQA 1XP5A 1OUMA 2HX1A 4E1BA 2O7QA 3R77A 4WBNF 3RQIA 3DKPA 1C3EA 1J7JA 1NJFA 1W0JA 2VDJA 4M1MA 2BY4A 1RYMA 1U7UA 4JDUA 1KOFA 1O2DA 4PGMA 3PGA1 1XXHA 4V1CB 2JD2A 3F7MA 4JC0A 4M9ZA 1GRVA 5JSYA 2V7QA 4AO6A 1Z6GA 1IHUA 1K92A 2LTAA 3EQ8A 4MQBA 1JLMA 8LDHA 1NF3A 1UOQA 2AT1A 4YMUA 4C7VA 2PWPA 3KOMA 3DLCA 1K63A 5FFFA 5FYQA 1TT5B 2I3ZA 5LLSA 1XFAA 2AX4A 3DFKA 1RWBA 3LPAA 5A3QA 2GASA 4Y6LA 2PWBA 3TO5A 3OIDA 3B9QA 4DLSA 1H3NA 1WNTA 4CDNA 4R1NA 3KD2A 4YRQA 1DG3A 1Z29A 2CB9A 1DCTA 1TJ5A 1Y0BA 3NOXA 4GZ6A 5NLLA 2FPSA 5ARCA 3RREA 3A4LA 4WLNA 1IOVA 2YJNA 4RVOA 3TL6A 3GRRA 3ADOA 4DF3A 4BDSA 4JYCA 3LCUA 5TEVA 3UZUA 5JJIA 1SA0B 4QQFA 1J5PA 3GLHE 2H4XA 1STOA 2BH2A 3R40A 3NVAA 1IM2A 2ZYHA 3KXLA 4KV9A 4I66A 3VO2A 3VH1A 5CBPA 1U1EA 4GX1A 5TR9A 1WCWA 1A2QA 2NZ2A 2PUGA 3F8WA 1UADA 3U7QB 3ZWNA 1QGUA 5CLFA 5ICGA 4O1IA 5AVWA 2IZ5A 3CEHA 2A5LA 1ZOIA 1WPRA 4BMNA 3K6KA 4ZI7A 3E2IA 4KYVA 5JYBA 4NXNB 1GP2A 2WAYA 2D1QA 4HX2A 1S96A 4GU5A 4K5QA 5BV0A 3LKZA 5H59A 3WLLA 1BVYF 1EHYA 521PA 1ES9A 1X38A 2OD7A 2UYOA 3B53X 4XDGA 1T5DX 1V4NA 4TV8B 1TLLA 1RJFA 2J3MA 2WYWA 2GBLA 2ZI5A 2AZDA 3T9FA 3GVIA 4C5BA 1JUDA 2WSIA 1MF7A 1JWBB 4IIHA 4ZALA 2Z08A 5HUJA 1J23A 1Z12A 2Q46A 3OLZA 4TTAA 1B7GO 3NJ8A 3AI1A 2HIMA 4RMIA 4TRMA 1DXOA 1L7EA 1E77A 1LBSA 1SHTX 2AJCA 2FMFA 2NU6A 1QC5B 3HYTA 4RX1A 1JTFA 3ZNQA 3VU0A 1ZU5A 3WYEA 4CKBB 2FJ0A 2VC2B 3RSLA 4L5YA 1KYTA 4R3UC 1JHQA 5CCEA 3BD8A 3P0EA 2NACA 2VZEA 3G2JA 2PGJA 1IEXA 1RD4A 2PBZA 3G2QA 1OZHA 5K8JB 2NYUA 1RNLA 3H5LA 3AIKA 3M6XA 2RHOA 3CISA 1FQWA 2NG1A 3M81A 3PKJA 4J9VA 1NQXA 3AGPA 4PFJA 5IBRA 3QU5A 3S2SA 3SX2A 5LU9A 3GUZA 4URHA 1VE9A 3G59A 4LV8B 3DR3A 3ZWCA 4HY3A 3C70A 5HFJA 3AJAA 1LJ8A 4U5XA 1BD4A 1FLAA 1PFGA 3AHIA 2HF9A 4WXMA 4DMRA 4CDMA 5IBPA 2XCOA 4BQPA 4A1OA 4RL4A 2J5XA 1COZA 3OCCA 1A5ZA 4GE3A 1BYIA 3KUXA 2OUKA 2XADA 3OA0A 4Y2GA 3U9TA 4IJUA 1PD1A 2KJQA 3FPKA 2IHKA 3OT4A 1K0UA 3Q3VA 1KSJA 3DDSA 4H1VA 4AJJA 1W581 1NFRA 3U19A 1SKYE 1MGOA 4WZBE 1S5PA 2ZJFA 4Y1RB 4U2EA 4RGQA 1NF2A 4YJ3F 1V7QA 3FYSA 5I4IA 2ZYUX 1XKLA 5AKLA 1LWOA 2DKOA 3AP3A 4RK1A 3UAWA 1Z6PA 1T5SA 1W0KD 4ILKA 1JHPA 4JR2A 2VHVA 1KEZA 1P33A 2VA9A 4HDKA 1YRBA 4PC7A 3VTFA 4L5BA 3U1VA 2Z9DA 4QULA 5JXIA 1C9NA 1P31A 1PL6A 1SELA 2X14A 3DJFA 1Y8QA 3JALB 3MCTA 8AT1A 2JCXA 2YZGA 3LTEA 2NSHA 3V7UA 1QGZA 1HT0A 1JTVA 5HA5A 3DE2X 1XR3A 2EX0A 4MA0A 4F5WA 1UJ4A 2YZ2A 1G291 4MV7A 1JEEA 1BRMA 3CCBA 4K6FA 4Q39A 3CLHA 3V2HA 3EPHA 3D5TA 5LYJF 4RPCA 4YP1A 3DBIA 3FVRA 3V4RA 4BNGA 3FMOB 2CMFA 1VLJA 2QUBA 1CK4A 1OJLA 5L3QA 2FEMA 3B13B 4GO1A 5EFZA 4DOMA 4FNGA 2HBRA 4G9BA 1QP4A 4R40A 4OLBA 2G06A 2G8NA 1J1UA 2P2NA 1T8SA 4OUKX 2GPYA 5ALMA 3AHFA 3PJRA 5B1EA 1VYHA 5CA1A 2PT6A 4MVYA 3OKAA 3IP5A 2W98A 3AXTA 4JT8A 3DL0A 3QY0A 3O4RA 2P3SA 3R4CA 3ENZA 3L2OB 1ZVKA 1LPOA 1JDNA 4WINA 2FWPA 2OMEA 4M3NA 2FMHA 3OZVA 1N6PA 1WULS 3DYVA 1GG9A 3ONFA 5IDVA 2PUEA 5BNFA 1DTWB 4ZRDA 4LDAA 3QA3E 4JSYA 5K8CA 4QBGB 2X8BA 3A31A 1WO8A 4H0FA 3BB3A 3PGKA 1VPEA 1UJ6A 2YV1A 4QDOA 1ZH4A 4LHVA 3VPDA 5E3HA 1CT9A 4BFVA 1W4LA 1H1LB 4DB2A 4MV0A 1YZHA 2FW8A 2NLOA 1ZGBA 4R3NA 2P9JA 4QFCA 4MR9A 1SG6A 2IT1A 3HBNA 3MPUA 3OQBA 4EMUA 3Q3HA 2FEPA 2ODBA 4BUZA 1CUJA 3GU3A 1IUKA 3BXPA 5BNIA 3A1DA 4I2NA 4TROA 1A96A 1IY9A 1AQIA 1Y3AA 4Y1GA 1U8ZA 1JFRA 2BAGA 5EESA 4HV4A 5A9RA 1II8A 1YTUA 2QMYA 1UBUS 3HZZA 4WFIA 1H0HA 1PT7A 4K2AA 4ZHSA 4X6XA 3KKMA 4JCCA 1MMFB 2P9EA 1HSZA 2C5HA 4KO2S 3RSGA 3GLRA 1LF0A 1UXIA 1GQSA 3LQRA 4KFRA 1NJGA 3MD0A 4CQMB 3CKKA 1ZP6A 2KHZA 4NDZA 4GH5A 4R31A 3BHJA 3N70A 3PPIA 3A06A 2V7QD 2IEZA 3HN7A 3FN4A 4CHGA 3ZI7A 4DR2B 3FLEA 1XWIA 3G1WA 3I23A 4GKVA 4AZ0B 1XK7A 3DT6A 1M67A 4Q4CA 4ZDKA 3Q7SA 4N5DA 4GE0A 2IX9A 1JXOA 1GN8A 1LJLA 1QOPB 1X2BA 2Q9BA 2QMZA 2QQGA 2SHKA 5DK4A 4YMTA 3A1SA 3KALA 4OJKA 1H05A 1I4WA 1GKLA 1S6YA 2Z8ZA 3HZRA 1H9AA 2XJ9A 3FUXA 3UJ7A 3WZMA 3X2FA 3GZNB 2OCBA 6ABPA 1RM0A 5FL3A 3N07A 1KDYA 4JGIA 3QLJA 2P62A 3R5HA 1MGPA 1CJSA 4MJXA 4TM7A 1ZU4A 1PNTA 4NC9A 1N25A 2H48A 1HXHA 1IATA 1P5HA 4KPUA 4NQZA 1ZITA 4XYEA 3SR3A 3QVVA 3BB1A 1E4OA 1VKZA 2B1JA 3G9QA 4IIBA 4ON9A 2XUAA 3DOUA 4IIVA 4YAEA 3U7JA 4A0QA 4ALMA 3H3FA 2DR2A 4BBPA 1FFXA 1YKFA 1B42A 2V96A 4R0MA 4KXYA 3LAWA 3A1VA 1K68A 1PQUA 3GUVA 1A72A 3N53A 1D0IA 3BCSA 2CXOA 4AM8A 4MVJE 2DC1A 3HU1A 1INLA 2QVYX 5KKCA 1HL3A 2LE0A 4BDTA 1NP3A 2IYTA 3GFTA 1UXGA 2P11A 4US0R 5DBFA 1PZXA 2CSUA 3V8VA 1HYHA 1Y5RA 4ZFNA 1V11A 1HE8B 3WLPA 1LB1B 2R1VB 1TMYA 2Q1UA 5CITA 3P2EA 4DR4B 1AQ6A 4U6NA 3UK0A 1JW9B 3I1JA 2HRBA 3JQCA 1E9AA 2ATVA 4ENTA 4OATA 4L8FA 3ND5A 4DZZA 1Z5OA 1JR2A 2ODAA 4JUIA 4W5WA 1FPQA 4L0MA 3I2FA 2V6IA 1QE0A 1V5FA 2R11A 3EIQA 5E8JA 2FZLA 2IEYA 5IVPA 2Z2JA 2G4VA 4BNDA 4Z49A 2IYSA 1FFDA 1Q84A 1WV1A 2CW5A 1MZVA 3M6UA 3M83A 1M2JA 4M9XA 4XB1A 1HNZB 3MOGA 3JRWA 2FG5A 4WCVA 4AO8A 3QTTA 4IIYA 2C9DA 2ONZA 4HDAA 3AR7A 1O5OA 1DIRA 4ZJPA 1ZL0A 4HH1A 1FQKA 4M1SA 2PUWA 3DEJA 3ODPA 3R0XA 1ZNWA 1ARZA 1JDZA 1C9YA 5DVZA 1JQ3A 4DWJA 4YMWA 3GBSA 3IP3A 4P93A 1VCIA 2XNHA 2YWJA 3O2QB 2P6OA 2WVGA 2JA1A 3PF8A 4YDRA 2GHRA 2V1UA 5LA6A 2QN6A 4UXHA 3WB2A 1A7JA 1QHEA 4B85A 4HDSA 1QFMA 3JQ9A 4UHKA 4DSTA 2JJ8A 4XARA 2AFIE 4JJKA 3VDXA 3H11B 3JW8A 2VZ0A 1FUIA 1ZMBA 3ZWBA 1BX0A 3ZBUA 3IE1A 1UDRA 2PEZA 4PONA 2Q27A 5B6JA 5M5BA 1GQRA 2Y1LA 2R79A 3GDOA 3VPBA 3FZGA 1RE1A 2VTKA 1UIMA 3WRYA 4IVNA 4BLTA 4D56A 2NMVA 2CUZA 3NRBA 2AZXA 5GV8A 4QWMA 3H2JA 1CUDA 4BIMA 3QGMA 4BX9A 1TNDA 4CM9A 1YE5A 2VP5A 3WLRA 2JEYA 3OWXA 3TKYA 1SWWA 1GZVA 3WAKA 5BNZA 2C94A 1U8CB 3IJ5A 4QAQA 1PZGA 3DG9A 4BVHA 2X0JA 4W9NA 1S2LA 2XMCA 3VR6A 3H8WA 2MYNA 3PHIA 3FPSA 1VDMA 4R5MA 1CEEA 1D03A 4B84A 1FDIA 5KJFA 2ZI4A 3KOZA 5I7FA 1UDWA 1KRXA 3PTAA 4EI8A 4DV2B 1YE3A 1WOMA 2VYQA 5EWMB 4MWEA 1M0EA 3I8OA 4R8SA 2BFFB 1T5TA 2PWAA 2VP3A 1EA7A 2ODTX 4CTNA 1QYRA 2JFZA 2XTZA 3ZVNA 2XUOA 2ACKA 2OILA 3F47A 3N8HA 1D5CA 4V0LA 5BN5A 1DRWA 2VN8A 4G0YA 1RS0A 1YC2A 4I1RA 5KKAA 2F43B 3DHEA 3OOEA 4UAGA 2X0NA 2NPOA 1LSJA 2YN0A 3JQ8B 2WVHA 4ZEVA 1A7UA 4CIBA 1KNQA 2EJTA 3SY8A 4DM7A 3W5CA 3O8RA 4JN6B 5LP6A 2JGJA 1QDUA 3JQ7A 4IXTA 4C4YA 2OLJA 2ZSIA 1JAZA 3DE5X 1HDCA 1Z4KA 4FJ1A 4E6PA 3ADBA 1CVRA 4D2IA 3RT9A 4TRRA 1ZCAA 4KR6A 4ND8A 4K9MA 3LSYA 4BO8A 3KLOA 4A2CA 2P78A 3KQUA 4JYZA 3AOEA 5IAJA 5LLTA 1SBYA 2P6MA 3E3OA 2W0SA 4GSLA 4WV3A 1R4ZA 5CBKA 3IJRA 2CNDA 4DUZB 1C3LA 2YMPA 2IYLD 1UDBA 1YBVA 3UJPA 1KP3A 2DUJA 3DL4A 2WKRA 2FK8A 4GMGA 3W5SA 2VQSA 1VYUA 4DZTA 2VDOB 5AD1A 4MV4A 2VYNA 4M22A 1FMCA 4MGEA 2CV1A 5L40A 2OXCA 2BM9A 4PX3A 4EVIA 1BMTA 3TAXA 3GEHA 4I5DA 4WE3A 5K3EA 3ZI4A 4JI1B 1ZVQA 3WSVA 3H4MA 1VFPA 4YV7A 3OLQA 2YXEA 4WOPA 3UWOA 4TYWA 4JR1A 3PUHA 1T29A 2GDJA 1BMQA 2QW0X 1USUA 2Q5CA 1X39A 4L50A 1OXXK 1SVLA 1M34E 1T36B 5ENZA 1FFEA 5G40A 1UDCA 3IEMA 4DV5B 3WI7A 2FP4A 1P7CA 3DTTA 3S99A 4M7PA 5LBIA 3WHIA 1N6IA 1TUIA 3HDHA 3P4UA 1I4DD 4LDZA 3OJWA 3NBZC 1HLGA 3AQ4A 3EXFB 2KQUA 3P9RA 2TMKA 4M9RA 4DIUA 2PJRA 4IGFA 1M1YB 4B33A 3H2BA 1S8NA 3BD6A 3OM0A 4Y67A 1GTSA 1E79A 1Y1PA 2QXYA 3LE8A 1XZFA 3M5CA 3NBQA 3P2MA 4LK2A 4LSWA 1XVVA 1MB9A 3NTVA 4BBAA 3P0FA 2KSQA 1W49A 2DFTA 2BJHA 4BU0A 1J5EB 2BR5A 3OWOA 1TEXA 4OGKA 4TQAA 1U04A 3GNLA 2V59A 1HNNA 2Z4SA 1KS9A 3K8QA 3ZWPA 4RO0A 4D8XA 2WUWE 1BG6A 2GCNA 3TE7A 2JIRA 2WJAA 1ZCBA 1N1MA 3LL7A 2GLTA 4FR5A 4RTSA 1ZISA 3BWBA 4JUCA 1W19A 4PC1A 5FX2A 1PI3A 3B12A 1I24A 1GKYA 1BDJA 2INGX 3AB3A 2FOIA 4MVWA 3SBEA 5TY0A 2Y6VA 5JJ5A 2V74B 3HM2A 3A3PA 3CZAA 3OCUA 1YA8A 3W2EA 2ZRCA 1U99A 3N7TA 2IHJA 1CJMA 2X6TA 3B51X 3BAFA 4HYEA 4Z2AA 4YMHA 1UKVY 1CJTC 1WTCA 5FR2A 5T4FA 1MP0A 4GQIA 1ZZGA 2AW5A 4DMUB 3IESA 3JAWA 5TF4A 5G53C 1CDDA 3WRYC 1GKIA 4NJOA 3NM6B 1DV1A 4NCNA 3PJDA 4WLUA 2F3QA 3Q8KA 4LDJA 3UTCA 2J0UA 2A1UB 5IU6A 4EY5A 5E95A 1P1RA 2GRAA 4P4UA 5FT9A 2DE0X 2RGDA 1V45E 3BSWA 3HFSA 2R1TB 2Q50A 3C1UA 4D3YA 1K6MA 4P34A 3U4QA 1JFSA 1OTHA 1TJPB 4YFYA 4ZZ2A 4RVFA 2FWRA 4EFKA 1KFJB 1LTKA 4C7OA 1T8YA 2YVKA 3AIOA 2YFKA 4IGEA 2L2QA 4A6DA 2P0EA 3R3ZA 4QOHA 3TLCA 2GAJA 3ROFA 2IC5A 3QE4A 3D1LA 5EKTA 1FK8A 1VP3A 2PMDA 1A4XA 2WDPA 2WJZB 4F9GA 2N3ZA 2JK0A 2WIGA 3L0BA 1X7HA 4IAOA 4OFXA 4G0ZA 4X3OA 5E9QA 2I87A 4OKIA 1KEEB 3I30X 4GXQA 2VNKA 1KMHA 3DZKA 1SVSA 2V9CA 3GQBB 2ZZMA 1GGVA 1UKBA 2FQYA 1DS6A 4PPQA 3W4KA 4P86A 4OKSA 3RU7A 3LRPA 2QIOA 3JQPA 2F55A 4KSBA 4DG9A 4F5DA 2HK9A 3NHZA 4YT4A 5C81A 4LUCA 1ZBDA 4ZCPA 4R51A 1K8RA 1B73A 1U3TA 1CZHA 4L16A 1P0PA 2TYSB 3SZGA 3WC4A 4J0GA 1B26A 4M7WA 2UUAB 1CWUA 2Q3DA 4S1WA 5ALKA 4Q4AB 5B4TA 2OFWA 2O23A 4I1OA 4KTVE 2VR1A 4ITUA 2GN6A 4LOIA 1YGPA 1SXJA 2B98A 2FX2A 3H5OA 5AK6A 1LWNA 3NOQA 4G0QA 1JG3A 3CURA 4OJYA 2WE7A 5ALUA 4JHXA 5EJ4A 3WMRA 1SY7A 2V7EA 5LUBA 5IBCA 3AILA 2OKGA 2DHDA 2MOKA 4PYNA 1AKUA 1Z68A 5ELLA 3W6ZA 4F2WA 5CAEA 3G8BA 3ORYA 3OURA 1DQSA 1ENPA 1K4YA 4HNAA 3EISA 1RMQA 2Q5EA 1IC6A 1O9BA 2RCYA 3O4GA 1Z0IA 1JKFA 4YRFA 3S5UA 4W8OA 2ZBQA 4L7VA 3IB3A 4NBVA 4WAUA 1GPWB 1SKBA 3WIEA 4BO5A 4BZWA 4ZGWA 2VJYA 1JEYB 2A0FA 5CDGA 5HHTA 1OU4A 1TGVA 4YRMA 2BEUA 4F46A 4MIEA 3GLFB 3ND8A 4NEHB 3IT3A 1JS1X 4BNYA 5KU7A 3G2PA 2VWQA 3KZOA 4PCAA 4PRLA 3ZJYA 2XUZA 4REQB 4OHPA 4WY2A 3IOCA 3A1EA 5G0UA 4CNBA 4KCGA 3VJRA 2IDMA 3NWBA 3CW2A 4YI5A 3VR6D 3DEYX 1P0QA 2OSVA 3M8KA 2ENWA 3I42A 3M49A 1A71A 1AQUA 4QUBA 1M2NA 5FXMA 2FXVA 3ZV6A 1QVVA 1LNSA 5C32A 3E5NA 1JAHA 4JEHA 1RQ2A 2PXCA 2Q3LA 3UV7A 5KOHA 3TVDA 1XD9A 4UCFA 4ZDJA 2XRYA 5BOSA 3K0AB 3FOCA 1E1CA 1QIFA 4XE5A 1U8TA 1TEVA 1XXLA 1TW2A 1LRJA 4HGPA 4P53A 2V5AA 2O3RA 4D8UA 4F2PA 2IHBA 4A4DA 5FV4A 1L3IA 4KPGA 5ENDA 3QBTA 4NAVA 5CFLA 1EH5A 1VXRA 4G8DA 2DPXA 1ZUNA 1RMTA 5JW6A 3ENKA 4WXPA 1R9MA 3NMUF 1H65A 2Y93A 3FSRA 1LJUA 3S1AB 3ZBPA 2OZEA 1PNVA 2PRSA 4TKVA 4YR7A 3UPTA 2M6KA 5JCJA 2WIFA 4U63A 5EPEA 4MW6A 4EYKA 1LDNA 4CIYA 4YT2A 1GUYA 3EGDB 1V35A 4ARSA 3TE6A 1Y7TA 3HL4A 3NETA 1KO1A 3PXXA 1SC6A 2GZRA 5JAMA 3M4JA 3HB5X 1FP4A 1B0UA 4WY5A 4S24A 2XNJA 1DI0A 4ZU1X 1BXGB 3BMOB 4K0RA 3FFWA 3MF4A 3EQ7A 3JASB 1YR8A 1SM4A 1J1IA 2P1ZA 2XZTA 2BFAA 3DZCA 4PZZA 4D6YA 5EZYB 3AJ8A 1FS6A 2I6GA 3F5DA 4X20A 9LDTA 1NP7A 3ZQUA 2CEAA 2BMJA 3HVKA 4RQTA 3UM9A 3T35A 4PHTA 1BNCA 4KK4A 1IXYA 4GQAA 5CH3A 3U17A 2PYZA 1E1RA 4XQGA 2PE5A 2C4WA 4MDEA 1EFVB 4RJKA 2MR6A 5D84A 3QX3A 1U2PA 1KI3A 2G04A 3K05A 3ID6C 4P58A 4HS4A 3I5XA 3QKIA 1KP2A 5G0SA 4LZAA 2ADMA 1G7RA 5B7QA 4F85A 4BKQA 2WEKA 3E9EA 4K9RA 5H3LA 3MSCA 2JLWA 2CYAA 1J9GA 3GEDA 3OQNA 4JGGA 1NJ2A 2Y05A 2UVPB 2WJWA 5TC4A 1Z2NX 1A9XB 1ZAKA 1SIUA 1D5WA 2FPLA 3IAUA 1E79D 2E18A 5TJ9A 3W5IA 5KNBA 1C41A 3D3WB 4NMXB 2O0KA 3CEJA 5JLAA 4F04A 1CJUC 4FCVA 3IDFA 4DQXA 1QWOA 4K6MA 3T1VA 4UTVA 4KW7A 4E7OA 3TZQA 3K72B 1KZ9A 1R0ZA 2BP7A 3GN1A 3AH8A 1UEIA 1TRKA 4DEYA 3PWZA 3IDQA 1X1TA 3ILXA 4CEJB 4FFOA 4CODB 2ZR7A 1KI1A 3TR0A 4CLRB 4XJTA 1MX9A 4HATA 5CGQB 1NW4A 1NF8A 1OFTA 1CUYA 2WAXA 4I50A 2FHPA 3SEFA 3VYSB 2DEUA 3VNVA 1GWNA 5J2UB 4I4CA 4KN8A 4YTEA 3TSOA 1IVSA 5E8RA 3T3PB 1WVGA 3O4FA 4U2CA 4MPJA 2PO5A 1JQAA 2VXCA 3HPRA 3HY6A 2V7VA 3LP8A 4IMRA 3ESZA 5J1TB 5EPOA 5T6MA 1KJWA 4JELA 2EDCA 4B3TB 4Q4LA 3FPEA 3ZZTA 2IY8A 4V0MA 4ESOA 3OPNA 3OA2A 5IJ9A 3PI7A 1EUQA 3GJSA 1OC2A 1YZLA 3T9BA 2JFNA 1Z0KA 3IUNA 4M55A 3GGJA 4YPFA 2HI0A 1M83A 1QGAA 4OP3A 2DZDA 3IV9A 1O6ZA 3KQTA 3N6RA 4ROSA 3X1WA 4AJ2A 4D4GA 5IJZA 2WE8A 3WTCA 1GVHA 3QELA 4RVGA 4BQQA 2FUG6 1IN4A 5I7WA 5P21A 1LBQA 3FDZB 5ALTA 1N6KA 4L9RA 3ND9A 5EJMA 3MWLA 3SKVA 1QP8A 1KL7A 2J3LA 4EHBA 3OLXA 1FFHA 4F6RB 3DZIA 2VAVA 4COOA 3HP7A 2IS1A 4RK4A 2F9LA 4V0OA 2W70A 5JQGA 1WPXA 2C9YA 1G21E 3JATB 4BKOA 5ITZB 4DV4B 4CTOA 1FFCA 2XZDA 3TSZA 3UWSA 4P82A 2D7CA 3HGMA 1QMPA 3TDKA 1NDUA 2AQ8A 2H7XA 3NBKA 3TXYA 5FWAA 3U4HA 2AXEA 4G81A 4Z6KA 3LPCA 1ND6A 1J21A 1TK2A 2KI5A 1N2OA 2ID7A 2QTVB 3LS2A 1C4OA 4LXQA 5HS6A 1JAXA 4ZT3A 1TCBA 1QIKA 4NU6A 1I01A 3JY6A 1TI7A 4BZXA 1U3DA 1RQRA 2I2AA 2QAJA 4N0PA 2ZK7A 1BCRB 3NDBB 3IPXA 4W4TA 1L3BA 3IPLA 4Q1EA 4D9BA 3HA2A 1UK7A 1F51E 1E4VA 5A62A 2YC4C 1SXJD 2NSLA 1L7NA 2ZWOA 2X6RA 2ZB2A 4BU1A 4D8WA 3CVOA 4FDLA 4HKTA 3O4HA 4RVSA 1WBJB 4ITRC 4BVGA 4PX2A 4HB2A 3LHSA 1BDIA 3EIEA 3E9MA 4QQ8A 3W8NA 3RYHB 3ESYA 4MJ3A 3RWOA 4H6WA 1H3FA 4IWYA 2H1IA 1L8QA 1DWQA 1SBIA 5TNXA 2O8EA 3C7KA 2BV3A 5HMLA 4RYDA 3D64A 4O2BB 1I5OA 3EAQA 1PJ3A 2V4ZA 3C1OA 1QHNA 1DRKA 1ZUWA 1WRBA 3ESCA 3W04A 2H29A 1QFJA 4TLLB 4YJKA 1V95A 4Q15A 1JECA 3WGJA 3BMQB 3HK2A 1Z06A 1KQNA 2JJ2A 3ZY5A 2XWQA 3MWEA 3HXLA 4HR7A 4KXXA 4D97A 4JB3A 3D43A 3GGCA 5BVHA 1Z6YA 5HDQA 2WWYA 1EU1A 5JNLA 2B82A 2DLCX 5EJFA 1G4AE 3VZQA 3ZGXA 3E82A 4P0PB 2R6R1 4NCAA 1F12A 3FOZA 2VLIA 1UEJA 1V8ZA 3TBFA 3WBFA 2W6CX 1FU4A 4FZ5A 3Q7TA 5D00A 5FBVB 1TZ2A 1OI2A 4MP8A 5JHGB 4C0AC 1T8TA 1WMSA 1PF7E 1WLYA 3KSZO 4N49A 1T9ZA 1ZC3A 2LW7A 4L07A 4M36A 4IHJA 3A14A 2IS4A 4PVCA 5ETJA 4DA6A 4DRZA 3A6PC 2V7BA 1ZUHA 1TVEA 2WJ4A 4OBEA 2QZSA 1TYCA 3BVPA 1Y3BE 1L1FA 2EU8A 1YFKA 3PLAE 4RV5A 3QUQA 1KA9H 2I4RA 3O8OA 1MRSA 2ZSFA 3EDRA 4YIKA 1WP9A 1XTTA 4L8WB 1N7HA 4XI9A 3RYIB 2Q2QA 4CMIB 6ADHA 1R0LA 4DC9A 2XUKA 3P45A 4H77A 3VUFA 1E2LA 4AZ3B 1OB2A 3E9ZA 3LQFA 3OIYA 2O5CA 4K3UA 3ROPA 3UT5A 4D0NA 1GUFA 1QH1A 2O6LA 3G23A 1TAHA 3UJBA 5DGIA 2N75A 1WWKA 3G0BA 4AKSA 1VSVA 3T7JA 4BNZA 1PT6A 1PT5A 3CLRD 2O8NA 2E4WA 3S2EA 5GVSA 3IURA 4U0KA 5FA5A 3S29A 1GA4A 3U31A 1K06A 1JFTA 2QN8A 4NYJQ 4NMWA 4N0DA 4WCFA 2GCOA 4IINA 4KIGA 4DCOA 2G8LA 2ZS9A 3AVXA 4KMSA 4QYXA 2ZWAA 1VMDA 3D2BA 1RQPA 2HV9A 5EMNA 2OESA 4KGDA 5K45A 1A1SA 1LLQA 2AJBA 5E4TA 4MUJA 3ADDA 2C1EA 1SQFA 3K9NA 2GYUA 3NKFA 4MRMA 3W5BA 5IS2A 4R4JA 5AI9A 4C43A 5GOTA 1XJWA 2HQSA 4G1MB 4MWZA 4HDMA 1LXCA 1GTRA 4Z99A 2J09A 4QGFA 1YOVB 4WESB 4RPHA 5KQLA 1XQVA 1OWNA 2G76A 1V3QE 1VE7A 1Z0UA 2P41A 4PRYA 3DUWA 5H5JA 4M0MA 2Q1XA 4M88A 4RTOA 2QUAA 4JSTA 1IQ0A 3SF0A 4PLCA 3RVSA 4AU1A 4XFKA 1ULSA 4Q3DA 5CX4A 5FUXA 1A27A 2BTQB 2Y92A 1OY1A 4EEKA 2M9MA 3ZZUA 2CJWB 3U5TA 3MCUA 1WCIA 4GYWA 2GZMA 3U56A 5KNBD 1M8KA 1HDGO 4OX9B 1U9ZA 4M0EA 2JL1A 3Q3CA 1AGYA 2ACEA 5AIAA 3BWXA 4U7JA 5I9TA 5COBA 2GM9A 4IRXA 5AHXA 4G1BA 4UTRA 2AN3A 4HJRA 1NN5A 1PGQA 1Z26A 3BWVA 3JQQA 3H9GA 2HBYA 1Y9EA 2E89A 1LS1A 5EGNA 4HAZA 1Q6ZA 5FA6A 2I3AA 2QQEA 3NWOA 3RSHA 5KSWB 5LM3A 3IT2A 5E6RB 1N2EA 2DTXA 4EP1A 3MG9A 1SKUA 2YWDA 3GMIA 1C2TA 1NJ5A 1FJ2A 2PIAA 1MPXA 1K8ZB 3HEBA 3KFXA 3KLPX 3PBKA 4PAOA 4WJKB 4BWFB 3WFIA 5A06A 2AFHB 1NKTA 4KMOA 1E94E 3KQNA 1MFPA 2BCEA 1I2DA 3VMFA 1NQVA 1PLKA 1XLWA 2AMJA 5KNLA 2ZZNA 5JJKA 3NBUA 4URWR 2YBEA 4RA9A 5BSHA 1OC4A 4YFVA 4J49A 4TTPA 2GAOA 1OAKA 3PNOA 4YMSA 4DANA 4DNQA 1YQEA 2FKAA 1UDAA 4TL7A 3RYCA 4JI3B 1G4HA 1SIWA 3V4ZA 3SF8A 5JAPA 1TTTA 2EOAA 3OP4A 1J2TA 3GOHA 3EIXA 1XTQA 3OJEA 4HUQA 5JPCA 1N78A 2YMLA 2IQ5A 4C07A 4RIHA 3CUYA 4YP7A 4B0OA 2HSJA 3E0QA 2F3SA 4Y2XA 3ZDCA 1P3DA 1QIMA 4I8IA 3A7DA 1NUQA 1U0HC 4E5DA 1YR3A 5E9JA 2EEZA 3WB1A 5K8IA 3LA8A 4QX6A 4LQ4A 4BTEA 4BVLA 4C3VA 1XVTA 1GSAA 2HK8A 2JVKA 1DAOA 2X1LA 2IU6A 2UV8A 4CMHA 2RG1A 4D4JA 4NEQA 2FEWB 2YV2A 2WTMA 2NO6A 1G5PA 2JLUA 2A3NA 4RS3A 3K15A 1FNDA 4BQNA 4KMMA 4DTIA 4YUAA 4OLAA 4HHEA 3V8PA 3SFTA 1E5LA 4DUPA 3UOAB 2QI9C 3RG8A 1E0SA 4G65A 3F6PA 4WA7A 1VSBA 1JG7A 3RF6A 2C03A 1C30A 1Z4MA 1XLVA 3OQ6A 4JC8A 4NL4H 3LVQE 2XGGA 4FYMA 1GKUB 1IH8A 2H16A 4NYIR 4RLFA 2WYHA 3VKUA 3PKZA 5JO0A 1XMOB 3Q0EA 5KYKA 3EDCA 4QXRA 4X7RA 4D8VA 1XDZA 5HF8A 1QLWA 1ZIDA 3MTBA 4PYKA 1VJ0A 2G17A 4QNNA 3CB4A 5E7IA 5B53A 2NV0A 3DC7A 4QHSA 2W2KA 3WX0A 1L8AA 1ZW6A 1EGAA 4MICA 2E49A 3WNBA 3P97A 2VJMA 4ZOLA 5IC6A 1U4SA 4I9HA 1SVUA 4PS0A 3HDVA 1U0BB 1KDTA 4WIAA 4BKMA 3ULKA 2O3QA 1R16A 1KAOA 4BRWA 1XX6A 3QE9Y 2V3VA 4WCFC 2GAAA 1J70A 4DCGA 1WU7A 4NMMA 4ZCRA 3ZVMA 3C4VA 4ZVVA 2A0KA 2ZJAA 2AZMA 1E2PA 3IIJA 4QPCA 3VXKA 3T3OA 1J0DA 5JZ9A 4N3CA 2AOVA 1EM6A 4LYHA 4Z86A 2H85A 2ZYSA 5CX1B 4J6EA 3R5FA 4ZAWA 2JAWA 3BZWA 4G63A 1YDWA 4O0LA 2V3WA 4BMDA 2G88A 3CO0S 2M6RA 1CUZA 3R6GA 4UOQA 1ID1A 3ROKA 2IPXA 1RADA 3BQ9A 1O7JA 1SKAA 3FCOA 3IHWA 3FB1A 1ZRMA 4PU0A 2Z95A 3RYFB 4RJIA 1L9KA 3HTXA 1V5WA 3JR7A 4B44A 1KVSA 1A4RA 4UU8A 4DLAA 1M10A 1E98A 3ITNA 4TKMA 3T52A 1YULA 1U7OA 5AM1A 3OY7A 5A6SB 4DLRA 4I5GA 4QBHA 5LQNA 4XKJA 3L6UA 4UHCA 1R9GA 2QTRA 1U2GA 4AF7A 2O8DA 4JI0B 1GCGA 4WFQA 4NQRA 1XZCA 1J06A 2PX4A 3BTOA 4HNRA 4NU0A 4RQAA 3SZ3A 1TF5A 2QS9A 2UVDA 3TJMA 4B82A 3B1YA 3OIFA 3FKSA 2GD2A 1YWGO 4IDEA 1M8FA 3E8SA 3N3BC 4TYPA 4E5MA 1GU1A 4KYUA 1QO7A 1VECA 2GXSA 3TIGA 3KQMA 5FPQA 4R2IA 1PBTA 1XRPA 2NUTB 3L0ZA 3BWDD 3FYHA 5I9MA 5A6VA 4G0MA 1ENOA 2EG5A 3DE4X 3LHIA 1M1XB 1YVRA 1KSFX 2RHMA 3L7NA 1ACJA 3HBMA 3X2SA 4R9NA 4RH0A 3ROTA 3QE0A 3FNHA 3NXSA 1YE8A 2IU3A 3AESB 4NHEA 4MZDA 1JBEA 4ZC8A 5ICSA 5KYUB 1IBCA 4EF6A 4MW1A 4MVCA 2FFAA 3EEQA 5A0FA 3TI7A 2QGNA 4OQEA 2RSLA 1KBZA 2VNHA 2APJA 3Q6MA 4UUQA 2HA0A 2XXJA 3CH4B 4WX2B 2CVFA 2LCFA 4YRNA 3TRKA 3FOWA 1K08A 1N8TA 1NHWA 4G25A 4JMPA 4WSOA 2BEVA 5EKSA 3SHWA 5EXTA 1AUQA 4DY6A 3GLGE 1UKZA 2AMFA 2CKMA 2GEBA 3NEYA 3DBOB 2QM3A 3IQXA 1ZJYA 3IMGA 1T15A 2FN3A 2DR3A 3ETHA 1HEYA 4Q0MA 2WJYA 5TX7A 2RB4A 4NK5A 1FDWA 5AKXA 3ZWVA 2IBTA 2CXSA 2Q5JA 2WHRA 3G2IA 2CVZA 2QAGA 3DE3X 3NBAA 3QENA 4HDQB 4MIKA 5A7GA 3UAYA 4B2YA 4CQNA 4CQLB 1KK2A 1R37A 4R2WA 1B0PA 3R3VA 3WSWA 2I4NA 4OH1A 3EARA 4G0VA 5ALGA 2IUTA 2O2HA 1DOAA 4Z1OA 5C8XA 3DWGA 1NC1A 3RLFA 1FYEA 3COZA 4WHMA 1RRVA 4TRJA 3GFBA 2FDRA 4BFWA 2HSEA 4IX9A 4A7PA 3O0TA 5DM2A 1SOAA 2WINI 2AS0A 2GEVA 1JI0A 4HNSA 4KH0A 5J2TA 1Z7BA 5EYPB 1FUYB 3FGOA 3T99A 5K3SA 3AFNA 1UFOA 4B3IA 5P8WA 4CDRA 4DDWA 4GLJA 4EKDA 2OORA 3PDJA 2JF0A 3HKEA 1W46A 3OZ7A 3ZHOA 1PSZA 2HOQA 1MC1A 1LSOA 3IBTA 3IC5A 5DDIP 3LX8A 2C5SA 4NE2A 4DQDA 5C8YF 3RU3A 1ZLYA 5KX5A 3W9UA 1HNWB 4Y6OA 3CW8X 3TNJA 3G1TA 1BCSB 4BX3A 2ZCJA 1MO3A 2YL2A 1Y82A 4GLBA 1VIMA 2R6ZA 3WV4A 4JLNA 4ZK2A 4ARCA 2OHHA 1QS0B 2A3RA 3AUSA 4OSOA 1YASA 2GNPA 3HKCB 2WU3A 3UUWA 3DEFA 3Q5DA 2BE9A 3D6VA 3DDCA 4KQ1A 3WGMA 1L7BA 4LJ4A 1IAQA 2Q6IA 1SA0A 1OILA 2WT8A 2ZRLA 2PZ8A 3Q3IA 3L0YA 2J9GA 2EWVA 5K2OA 4HQNA 5FD8A 2CXUA 4K9DA 1W35A 3V1NA 2QM8A 3C41J 2AQIA 2CLFB 4RHCA 5I8ZA 4B4VA 4MUNA 1FYVA 5LJLA 4PZ9A 2XUJA 2PGXA 3U7QA 2V7TA 3UV6A 3AG5A 2P90A 2WC1A 3OCWA 4G3XA 4ID3A 1YAHA 3LT4A 1D07A 1VA5A 2Q9UA 1E20A 2GNOA 2ZRFA 3A9UA 3N6VA 2GHQA 2ZS7A 4O02B 2BDEA 4RZUA 4WERA 1HOTA 3QE3A 3ER9A 2G1UA 3P5SA 1QYIA 3MJSA 2GI4A 1O03A 4YONB 1UBOS 1BA2A 3TB6A 1ENZA 4TV8A 4Q9KA 5IKXA 2PRKA 3G7UA 1A98A 3MB5A 4JXJA 4F2HA 3T1QA 1RXIA 3QVGA 1Z0JA 1EESA 2VK2A 1M2KA 1S2MA 1R4NB 2XUQA 3MCZA 3PA8A 3SLKA 2JGDB 1OWPA 1XRNA 3K2QA 3THSA 2B3DA 2PTHA 4GSYA 4HUJA 5ALLA 1DV2A 1QC5A 3ZGLA 4CKWB 3U7GA 1WPGA 4PEVA 5A4DA 3HJRA 3B3JA 3HP4A 2FUKA 4OK6A 5EVJA 2PKEA 4UEOA 1EUZA 4AZWA 3WGVA 3D3KA 4JUAA 1S7GA 1XOIA 2QRVB 4XASA 2QW8A 5AXCA 3PXGA 4BO9A 4BUCA 5JPDA 1YZKA 4XM2A 1JEJA 5CFOA 2UYQA 1O8BA 1TE2A 4FNAA 1KE2A 3N39C 4DPKA 4PLZA 3REOA 1ZA1A 3E3MA 3LG2A 2C3YA 2PSFA 4I08A 5GZ3A 1GGMA 1NW8A 1XJQA 2W48A 3O8LA 2W2OA 1M6WA 1Z6QA 3A9VA 4Y6GB 1BE1A 5TGTA 3R23A 3TSAA 4B3FX 4Q6BA 3U81A 4MWDA