3LYUA

Crystal structure of the c-terminal domain (residues 83-215) of pf1911 hydrogenase from pyrococcus furiosus, northeast structural genomics consortium target pfr246a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
129
Chain Sequence
GPLGTPVPMEKFGKILAIGAYTGIVEVYPIAKAWQEIGNDVTTLHVTFEPMVILKEELEKAVTRHIVEPVPLNPNQDFLANMKNVSQRLKEKVRELLESEDWDLVFMVGPVGDQKQVFEVVKEYGVPML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative hydrogenase
publication title Northeast Structural Genomics Consortium Target PfR246A
rcsb
source organism Pyrococcus furiosus
total genus 37
structure length 129
sequence length 129
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3lyuA01
1GAWA 1TVCA 1EP1B 2RC5A 4F7DA 2BGIA 1QH0A 1E63A 3VO1A 5KSWB 1NDHA 2RC6A 2BMWA 2VNIA 4U9UA 1FNDA 1W35A 4YAWA 5H59A 1AMOA 2OK7A 1QFYA 1E64A 3ZC3A 1QG0A 1EP2B 1FDRA 3ES9A 1QGAA 4BPRA 1GAQA 1H85A 1OGIA 2OK8A 1I7PA 3OJXA 2CNDA 2VNHA 3QFSA 2R6HA 1FRNA 3JQQA 1GR1A 1QX4A 4EH1A 3LYUA 1J9ZA 3FPKA 1OGJA 1H42A 1CNEA 5GV7A 3LO8A 1JB9A 1EP3B 3W2GA 1FRQA 1JA1A 2PIAA 3FJOA 1CQXA 3W5VA 4K1XA 2X3UA 3W2HA 1W87A 3OZWA 5FA6A 3ZBUA 3OJWA 5GV8A 1A8PA 2BGJA 2BN4A 3W2IA 2QDXA 4FK8A 3QFTA 5H5JA 4Y9RA 1JA0A 1FNCA 2VNJA 2VNKA 2B5OA 4B4DA 3LVBA 4C43A 5EMNA 3MHPA 4AF6A 1FNBA 3QFRA 3VO2A 1DDIA 3W2FA 4AF7A 1QFZA 1W34A 3JQRA 2XNCA 5THXA 4WQMA 3W5HA 1UMKA 2EIXA 3QFCA 3OZVA 1KRHA 1QGYA 3W5UA 1BQEA 1E62A 3W2EA 2BPOA 1GO2A 1EWYA 2BSAA 1TLLA 2QTZA 2QTLA 4UAJA 4YAOA 4YALA 1B2RA 1QUFA 1IB0A 4YAFA 1GVHA 3JQPA 3CRZA 3ZBTA 1SM4A 2VZLA 1GJRA 2VYQA 3A1FA 3LRXA 5TR9A 4YAUA 1QUEA 1CNFA 4P6VF 4Y9UA 1BX1A 3OZUA 3QE2A 1BX0A 4DQKA 1F20A 2GPJA 1DDGA 4Y7CA 2XNJA 4G1BA 2BF4A 1QFJA 1QGZA 4G1VA 4DQLA 4YHBA 1BJKA
chains in the Genus database with same CATH superfamily
2YIVX 1NC3A 2QR2A 4B7UA 1EP1B 3EARA 4UUQA 2YN4A 3L18A 2AZDA 4S1VA 1NVMB 4W5OA 4P34A 3TTXA 5C5DA 3ZJVA 3TAUA 1C8KA 1DL5A 1K7XB 2IZZA 2GM3A 3TZCA 1SELA 5CNMA 3V1YA 1MPXA 1JHMA 3AHHA 3REGA 1PQWA 2QP9X 3USES 1O96B 4BPRA 3TSWA 4BVBA 4D6XA 2INGX 3A6HA 3ZLJA 2QD2A 2CKMA 1Q3HA 5DNEA 2ZS7A 5F35A 2PANA 5H80A 2DYKA 1PR6A 2HTFA 2X5JO 3EN0A 4S0XA 4WNCA 3UJDA 1C9YA 4DTIA 4NVRA 3W1VA 4R1NA 3WHIA 4FU0A 1X6VA 1HORA 4REOA 3PYMA 1KK1A 4EY6A 1KP2A 3D2CA 3VU9A 3ETDA 1FRQA 3NJ8A 2R87A 3FRJA 2PUJA 3ZVKA 1BTOA 3ZOKA 5A9TA 1Z5OA 2PQ0A 5B12A 5CVVA 5JCJA 5LL6P 4B7AA 4Q82A 1IBMB 1HQCA 2MOKA 1O58A 5LDHA 2WICA 2E1PA 1RBZA 5K3DA 1QYVA 1PUXA 5GPBA 4AWBA 3WP0A 4LDJA 1NYLA 4PRZA 1BN6A 2AF3C 5L7WA 1QQAA 1TADA 4TTPA 2GAOA 2Y0EA 5LYJB 4D8VA 3ZZTA 1OI7A 1Q0HA 2FSUA 2CXOA 3VC1A 3WTBA 4D9FA 3ZDQA 4J0CA 1P2VA 1E18A 4WOJA 5BT9A 3YASA 2NXEA 1FFSA 2O8NA 1PGNA 3FPGA 4RTLA 5BV0A 4KWHA 4ZAYA 4MQFB 2XTNA 4ENTA 4PANA 1JKIA 2Q3DA 3R9IA 4PLGA 5EA2A 3C3XA 4RSMA 1KO7A 3IESA 5DM2A 1PZXA 1LDGA 4ENUA 2I3AA 3H7AA 3AJDA 2EFDB 5K0LA 2RSLA 3MD9A 1N8KA 2R751 1YZYA 3EHEA 4R0MA 1NKTA 4GE3A 1U2RA 1UMKA 2Q5OA 5EOVA 4EIWA 4DCUA 1FUIA 3RUHA 1NM5A 3E2IA 4NENA 4S05A 4DIFA 3U9LA 2VEOA 1IOWA 5EGSA 2X6RA 3L7CA 2RGCA 1Y3CE 2XWJI 4GZ5A 5KNDH 3AWIA 5EWLA 1GCGA 2VDOB 4OMFG 5BNIA 2RH4A 1NJ1A 3PFHA 5IKMA 1I6WA 1C0PA 4AXBA 1M8JA 4NCBA 1HT0A 4A8JB 5AVZA 1CR2A 1EFHA 4WK0B 5CLJA 3BA1A 1S7GA 2Z6VA 5FWYB 1GGHA 1QIMA 2WU8A 2R6JA 4HY3A 5BSHA 1Z26A 4A8JC 2Z6UA 1G2PA 1M2JA 1L5SA 1OLUA 2P9FA 4TRJA 4IXTA 1D0IA 1WO8A 1H4SA 1PL7A 3L7DA 4CIVA 3G8DA 1JAYA 3LTNC 2N42A 2V98A 1TXGA 1JFFB 1E2IA 5IWCA 3H04A 2G06A 4AO7A 3QX3A 5JVDF 1Y8QA 1SKUA 2R85A 4UBOA 4YJGB 2V9CA 4MWZA 4EG1A 2R6AA 4ZGWA 1XAJA 4GM1A 4E07A 2P9CA 5F33A 4F96A 4TZKA 2Q50A 2OBXA 4KI0A 2DUNA 1PFWA 1WB5A 4PPYA 3TLEA 4W5QA 1KVSA 4O33A 3E5NA 1GG2A 2ZI7A 4CIDA 4OHRA 1L5OA 3KWLA 2G1PA 3TSAA 4Q05A 4OSEA 1DV1A 1IDN1 1KMNA 3O1LA 5CBKA 1UKAA 4LGMA 3U40A 2R11A 3MJHA 2BDUA 1VZ2A 3VUEA 4PYOA 1E9VA 2DQSA 5E2AA 2Y1OA 3G2OA 3RWMB 3L84A 4G25A 4UOQA 2H2DA 5D00A 3LYLA 4J0GA 2HJ9A 2X4GA 1K4YA 2Z83A 4ENRA 4F8JA 2YJ4A 3HABA 5KBYA 3DZDA 5CG2A 1JG4A 4G65A 2FRXA 4DDUA 1SKYE 5JDCA 3SYNA 1CR6A 5HKBA 3T6KA 1X1CA 1CJCA 4AO8A 5K0SA 5K4AA 4ZVLA 3GPBA 2Y93A 1DUIA 3GMDA 5MN6A 2HR1A 2NZXA 4ZI7A 1UZLA 2GUGA 2PY6A 2X0RA 2KBEA 4IV5A 4F9EA 5KVSA 1EMDA 4GZ6A 1BVHA 1RPNA 2H2AA 1MX5A 2O2GA 3MWFA 1IFXA 3KJXA 4FGZA 5H68A 2ZIUB 1JB9A 3HZHA 4H7HA 4BP8A 2ZR7A 3UCEA 4CETA 3IAAA 2A3RA 4M0DA 3U56A 2HSZA 2QTTA 4NR0A 3P9QA 4HZUA 1OILA 3P2KA 4Q0MA 4CL0A 3KT6A 3PNKA 2ZBGA 3KQNA 1GFSA 3L8ZA 3B3AA 1NTRA 3QYJA 4Q3CA 3OZWA 4JT8A 1XZHA 1R2QA 4JT9A 3OX1A 2HWKA 1XMIA 1AC5A 1GZVA 4M8SA 1XLVA 1R0LA 2ZYGA 2DT8A 3BAFA 1C81A 1PEKE 3P2OA 1NHWA 1ZW6A 3MELA 3Q2OA 3QU7A 3ZHOA 1TYAE 3U7EB 3SIXA 1IZ9A 3ZTYA 3Q5DA 1EQ2A 1T6XA 1W93A 5K2OA 1UBNA 4LDNA 3EEOA 1U8EA 4L75A 2C9CA 2ZB7A 4G8JA 4QD3A 4UDNA 2VHEA 5E7MA 1AUXA 2PSHA 4N8SA 5BVHA 3CR3C 2P69A 1PIWA 2BV3A 4I81A 3SM9A 4M22A 1FNBA 4X20B 1LI5A 4ZRNA 4CLHA 4EJFA 3HDJA 4MWCA 1CQIA 2FR0A 4CKEA 4JASB 4RLQA 5A4FS 2IYYA 2CE7A 5BN4B 1FXWF 1UOPA 3ZXXA 5M2QA 1MC4A 3BTVA 3DLIA 3GVHA 3MOGA 3PKZA 2CZGA 2Q8PA 2EIXA 4P7GA 4ZPJA 4N12A 4X6YA 2AQKA 1L5RA 3D3KA 2M6LA 3VHRA 4AROA 2H5IA 1V2HE 4RCYA 3R8XA 1ZSVA 5A04A 2QRGA 2OV3A 3BDIA 3HWX1 2HCFA 5A5FA 4NDAA 3T9EA 5HUQA 1CWUA 3JAKA 3L0CA 1W7AA 5EXSA 2JLWA 1QFXA 2C88A 3PR2B 5HCUA 3L77A 1M7BA 1SU4A 4IIUA 5C34B 4TMVA 1I1QB 3A6LA 1POWA 3VU0A 2W6CX 4PYRA 1H2FA 1S6YA 3Q0TA 5IX8A 1CKEA 3W3AH 2BKAA 1TK2A 4PN7A 3JD1A 4EKNB 1YCHA 3KD3A 3R0IA 5BR8B 4MIYA 2C1XA 3BL6A 3ELWA 3CKLA 4O4HB 1PDVA 3O9MA 1QU2A 3R6WA 1JKJA 3O3CA 5DKFA 4KQ9A 2ZI3A 5TVGA 3PE6A 2J32A 1E2JA 3NHMA 5LU8A 1O9HA 1ZCFA 3NHBA 4G5RA 1ZESA 5AK3A 2DLCX 3BORA 5M3BA 4FOOA 3ZU5A 4BO3A 4L8LA 2BUBA 4LYEA 4BNYA 3T3PB 4ERXA 3T5GA 1RS0A 3MWEA 2PMBA 2GFIA 2QENA 5JQWA 3MMNA 5DHRA 5CAEA 1OLSA 4DV6B 1YK0A 3R0QA 2BGTA 1T13A 2W8BA 5KS2A 2TSYB 2N47A 4OK3A 2LV8A 4QGAA 1N3LA 3N0TA 1KXJA 4E94A 3C85A 3QJYA 3UHOA 2Q2VA 3DCNA 4FKZA 1BXKA 1P5JA 1QG0A 2AG1A 4FILA 1RQNA 1CE8B 4MLPA 4KIGA 3U1BA 1M33A 3MYRA 4DVJA 1DOHA 1QWSA 4M0LA 2QGNA 4WFIA 1DPGA 1TLTA 5ALNA 4JLUA 3RRJA 2R1VA 2RG7A 5FULA 1C29B 3FWPA 3O2SB 1TO6A 2HNAA 3FYHA 3BZUA 1C1XB 3PDIB 4IH4A 4G2TA 2XZOA 2R9VA 1NC1A 2B83A 4IMIB 2TMGA 3LE8A 4C0KA 1AGNA 2F62A 3OPYB 1VPWA 2VQEB 3QW4B 3UJHA 4A8HA 4OQXA 5FOSA 2W2MA 2AOTA 2X3UA 2A1TS 3RVBA 1YQQA 2BGJA 3UT5B 3NT4A 1LTQA 1Z7GA 1UOOA 3EIFA 2GB4A 4EO7A 2WM9B 3NJRA 3SXPA 2V7VA 2XV1A 1OBHA 3WLQA 1H8HD 3HH8A 4QBGB 5GADl 1DX4A 2YUIA 1ZM7A 1T9GS 4IPTA 2BMFA 4M0FA 4G0NA 3F47A 1ZUWA 3ESDA 1PWEA 3RYHA 3ZDAA 1YDFA 3UYLA 2VSOA 2F1JA 3NM5A 4QBFA 2XA9A 3CEMA 4RO0A 4FEGA 4PY2A 1J0CA 5IW8A 2NZ8A 4LV6A 1BXGB 4OM7A 4ARVA 5BPHA 1A7KA 4A3SA 1AK2A 2AJLI 1JFRA 2F6RA 4KB5A 1XTVA 3D3WA 1Z4MA 2E7ZA 3K73O 3LY5A 4HYTA 2E1RA 3IP5A 3QPVA 1ZM3A 3RR2A 5CFOA 2ZANA 1UT6A 3EDOA 5B3LA 4I66A 3AF0A 3LT2A 3VX3A 1D8AA 4BO6A 1XTQA 2JARA 3BF8A 5I8WA 2VJBA 1S4QA 3VC2A 1Y3BE 3EPHA 2R6DA 3ZWVA 4JC5A 1LFDB 2PV7A 4DDVA 5AHXA 1ZCJA 7AT1A 1PT6A 1G8AA 3RV4A 1YACA 1PVVA 2XIJA 3KB8A 4FEAA 2F55A 3RC7A 1NT2A 1M7GA 1U9YA 4GQAA 1YOBA 1KWKA 4QX6A 3NBQA 3LK6A 3OLYA 5CJ2A 4XGNA 5GZ3A 1V9LA 3CCCA 4O4JA 3W1EA 4JI6B 3UAVA 3R3XA 5B1SA 2V65A 1E3WA 3PKIA 4L4SA 3DMFA 3QBDA 1AG9A 3HLTA 1LF0A 2EBHX 1GKLA 4YMLA 3HDVA 4HBGA 3GGDA 4RFVA 2J46A 1MV5A 1VL2A 2FEOA 4NCXA 4OO3A 4WWHA 1D6NA 3V1LA 1COZA 4TTRA 2BFFB 4AAYA 1V7ZA 3FAZA 2C9DA 5JT1A 5NULA 3UUGA 3UWSA 3OFJA 4XXHA 1SWWA 3LLUA 4ZCLA 2V59A 5EHIA 2Q3CA 3CZ5A 4XIYA 2X58A 2GEFA 3C6ZA 3T4XA 1MG0A 1SUAA 3V7FA 1N9GA 3IAFA 3PIDA 4MCAA 4ME6A 3EDCA 2A9JA 1WF6A 1Z18A 3TM5A 3OVMA 3HFRA 4BNXA 1WXHA 3HWWA 2YVKA 1JIVA 2BFBA 1E1MA 3AZPA 5T4FA 4YJ2F 2FJPA 3NPMA 2ZTSA 1E2DA 1RTTA 3FNFA 1ZOPA 2X86A 1SURA 1W4CA 1TFUA 3K2IA 4M4SA 1W59A 1EP2B 1UAYA 2XTAA 4Q19A 3QPDA 1GNQA 4V0QA 1UWKA 3FHJA 3TVYA 3QRWA 1GN8A 5K3FA 1DXQA 1MABB 3NUGA 4WN9B 2HDNB 1LZKA 5TJHA 3E0XA 4DJTA 1RP1A 4JJ8A 2AHRA 3ROPA 9LDTA 4NBNA 3EH1A 1MKYA 2H1FA 4MYHA 3EGWA 2FEWB 2AFVA 2JI4A 4D02A 3C48A 1F12A 1FP6A 1VECA 2LZ0A 2J6BA 5BMVF 5DTRA 1TTHA 1UBCA 4BOYA 5B2ZA 4YY3B 2YFQA 1U2DA 2AC7A 2BR3A 3MCUA 1U63A 4BDTA 2P78A 1AKUA 1F7UA 4UUNA 2QUHA 5LP1A 4C88A 1NW8A 3B1VA 2AFHB 1YJBA 4REQA 4D3FA 2JLVA 4RVOA 5KTNA 3GIWA 1JG3A 4KC0A 3OQBA 1U7UA 2WOJA 3K70B 4ZO6A 1UC9A 2YW9A 4FE4A 5T41A 2XAUA 4MR7B 1P8JA 2R7MA 4XCQA 1RW4A 3QE0A 3ZV4A 1CERA 1EG2A 3MJ4A 3K70C 1XHLA 5JWOA 4CMEA 5K05A 4K9PA 2PS0A 1FYWA 4L1KA 2BDEA 3ORHA 1QYDA 3U4GA 4J0EA 3R7WB 2FX5A 4CM6A 1Q19A 3R9XB 5EHZA 1MF7A 1EG7A 1P9RA 4DHWA 4RXUA 2V8BA 3GGPA 1NY5A 2F1IA 4TMXA 2VJNA 4HJRA 4DWWA 4URXR 4JP3A 2Q6LA 2VR1A 1Y6FA 4QBHA 1ZONA 1MO3A 5FH9A 2HSJA 1P9OA 4CKCA 2EQBA 2WJPA 3W8RA 3IJEB 3C16C 3LH5A 4CW7A 2QJOA 1CB0A 2KI5A 1JMKC 4O0LA 1JHOA 2I9KA 2PT6A 4OOEA 4DF3A 3ZJTA 2J3KA 5BNFA 3VBCA 2V5AA 3FYUB 2QLMA 1BG6A 3DM9B 2VEDA 2VPIA 3PA6A 4URZR 1JIUA 2VRWA 5JNWA 1GZSA 1MFZA 1NURA 2XUDA 3NT5A 1NV8A 2A9RA 3FYUC 4R40A 1OYWA 5L3QB 3BGVA 4DBVO 5BSEA 1E6KA 1T2UA 2IQIA 2JFNA 3CNEA 4O63O 5IC5A 4HNRA 3GN2A 4DAEA 1FSGA 1ST3A 1ZAYA 3ETNA 3N7AA 4P6VF 3D5EA 1IY9A 3NFRA 4PG4A 2QRKA 1OQAA 4KXMA 4Q3NA 5DCWA 4V1CA 2O2XA 2OXCA 1J5PA 2O0HA 1PEYA 4RE6A 2WFLB 3SI7A 4F3RA 4ZO4A 4Z1MD 5JASA 4PX2A 3BXXA 2FEKA 1CDOA 3PUKA 2JFZA 4QQFA 1P17A 1AM4D 4WEQA 4XWOA 2Q9AA 4M9ZA 1W5EA 2J4FA 5BOVA 3U1VA 1Z75A 2G08A 2TRSB 4GP7A 2VT6A 4HXFB 4L6IA 3SSNA 2J9YB 2GHQA 1AUQA 2BZSA 4JYMA 4I2NA 3TD6A 4X54A 5CCXA 4GMXA 1DLJA 2BT4A 1HLPA 2LTAA 1AKNA 3UMVA 2IU4A 3PRYA 2BEKA 3GLGB 4ZV7A 1VLVA 2Q1UA 3NCHA 3LF2A 1E2HA 2XQFA 3NDRA 1IY2A 2ST1A 2QTWB 3Q88A 3FTQA 4IZ6A 3HCCA 3OJOA 4H35A 2OPHA 5IAOA 3UXMA 3IOCA 1IQ0A 3KKLA 3REFA 2D7DA 2OAP1 1DZ3A 4EW3A 1XGKA 1BA3A 1ANKA 2AK2A 2CNLA 3EIWA 2PG3A 4RTSA 1A8UA 1G21A 5F5NA 2CVQA 2HZ7A 5DHPA 5KB3A 1OHHD 2NIPA 1YULA 5LNK6 4C03A 2C0PA 2V54A 1IULA 1R88A 1E1CA 4E32A 3G2IA 4PTZA 1U6KA 1ZM2A 2P5YA 3B3QA 4C5CA 4GEGA 4LPSA 5GIOE 1M2WA 1V5FA 1MENA 3NWEA 2FXVA 2VAPA 4G09A 3VR2A 1JIIA 5JBQA 2B3DA 4DXHA 5FWXB 1E4OA 3ZU3A 2JFFA 2P2YA 5CFZA 3OLCX 4WV3A 4IGFA 4ARIA 3SYTA 1A9XA 1T5HX 1FPQA 2CC2A 2O7VA 3LWZA 1N2IA 4KE6A 3T1VA 3TZBA 1LUAA 2C3YA 2CUNA 3H2HA 3RKUA 4BTLA 4PG7A 3WB0A 5K6AC 2ZTLA 1FEZA 1JW9B 4K0KB 2Z09A 1AH2A 3BDAA 1USWA 1XEXA 4I1OA 3SQOA 4RJTA 1NMQA 3H4IA 4XVCA 2QMYA 3HXMA 3FUCA 2MINB 4WCFA 4D26A 1M8GA 3P9YA 1OWOA 2C42A 2Q0HA 1Z4OA 4PLHA 3IBSA 3RTCA 3E15A 2RGXA 3QFRA 1W5BA 2NTVA 3FIJA 4PZAA 3LZ6A 3RABA 3ZCUA 4UHKA 2H85A 5AKGA 4NXMB 3X1YA 3DV2A 1E0AA 4YT5A 4JBXA 3LOQA 4XRGA 4PXYA 5GJCA 3EW7A 2XA1A 3VR6D 3AFIA 3H0CA 4PRYA 2DFKB 3R8CA 3UG7A 5KYWA 3NMUF 2EKBA 2GK6A 4HDKB 3W06A 1FX0A 1XJ0A 3LXUX 2HJHA 2OGZA 4Z4FA 4KUGA 2P9ZA 3ZY6A 4DE5A 1AGPA 2FPIB 3EXFB 1T91A 4N3NA 2PZEA 3ECSA 4HDNB 1QK3A 5ILQA 5H02A 3UMYA 1HNZB 4TWAA 1WWKA 3TJMA 4I08A 1JWLA 3DONA 4FVTA 2ZIAA 2WAXA 1WHSB 2DWOA 1RZ3A 4C7JA 2QWXA 3ESZA 1E3DA 4PHTA 4Z4CA 3JQPA 3HCAA 3F3MA 3QUTA 4EPTA 3IR6A 2PFGA 4C0WA 3TCNA 4JP5A 3GJ6A 3HM2A 2PUDA 1P9NA 4PYLA 5ALZA 1SA0B 3DYVA 1OXUA 1NW9B 3B7WA 4BNFA 1I14A 1YA8A 1NQOA 1V9SA 3EQ8A 1Q2UA 1ZO8A 4IWYA 4M8NE 3DTNA 4MYSA 3V2GA 2BBSA 4UVIA 3I0MA 2LKDA 3IP3A 1JQLB 3T3IA 1XU9A 2B61A 1R16A 3W05A 4F5WA 1Z4KA 6LDHA 4RKFA 4OK5A 3ZWNA 1HQKA 2DLNA 3TLGB 4A0HA 3OZBA 1M1YB 1TD1A 3O7WA 1A27A 1UBFA 2W93A 1ZJWA 3K8YA 1R3UA 4LDPA 4Q66C 1RTKA 4GMFA 5CX1A 2JDIA 2BHSA 5DCLA 3EZFA 3ZLVA 3B38A 4DMKA 3PJEA 3I09A 3M5DA 4DAOA 3VPAA 4EYEA 1QGED 2O7SA 4FP9A 1AHNA 2GCPA 3R3HA 1HO3A 4LOHA 2NVWA 4MO2A 4R5MA 3E70C 3WK9A 3AY3A 1IN6A 1G41A 1J56A 2IC5A 4G0QA 1D2AA 1Y82A 3AFGA 3NIDB 2NOAA 1PGJA 3O21A 3OJCA 1MAWA 1JG6A 3DJFA 3OOHA 4JVOA 4QNNA 1L7AA 1UK7A 3KWFA 4C20A 1WVIA 2ONZA 3EXEA 5J23A 2C94A 2IUYA 2ID8A 3TWOA 1FLDA 2PT5A 5L3SB 2ZS8A 4BZQA 3JVEA 1QTIA 4J0IA 1QG6A 2PE5A 2XGMA 2NSLA 4KR9A 1PYDA 4K6KA 4D5EA 5G4KB 1LNSA 1YDEA 2GEVA 2YQZA 1GQQA 1JH9A 2GVZC 3PQ6A 2CL0X 3T7DA 3T7TA 4A5SA 1PGPA 2CVHA 1K08A 3DAPA 3A4NA 3ZBUA 3AHFA 1UQUA 2A7XA 1EFRA 1Y1TA 3WP1B 5EJ6A 5EIXA 4OFXA 3G5TA 4MQEA 4Z49A 3PDJA 4RVHA 5IARA 3H5TA 4GP6A 2PMCA 5B1HA 3ESYA 4AYXA 2JEOA 4ALKA 4P3OA 4ARZB 2XCLA 2OWEA 4JWKA 5IXYA 4KPFC 5IT0A 2AN1A 3L05A 3OIUA 2ZIEA 4D9MA 1K66A 1M75A 3GFSA 2WWWA 1L6IA 5CT8A 5IKOA 4II3A 4IIGA 3PWTA 3ZW9A 3AX6A 2FKNA 1IOLA 3QVTA 1GQFA 1FF9A 1IC6A 4WZAB 4OJTA 1FW8A 2DE0X 5HP4A 2OVBA 4J7CA 4MW1A 4D9GA 1X92A 1WV0A 1AN0A 2C96A 2G1KA 3HU3A 4ZDJA 5KU7A 1I4EB 3QF4B 2G5PA 1L4KA 1QRAA 1U1CA 2G9RA 3IODA 3LF1A 2EYQA 2OXFA 4IVRA 3EFHA 4NEHB 1V45E 2Y66A 1H2BA 1CJSA 1NF3A 4R54A 3F5QA 2HRCA 1DFIA 5E95A 3FMVA 2GA8A 1OAAA 1T43A 4LEIA 3WLTA 2C5EA 2LIVA 4OHBA 4U3JA 4C7XA 1CUIA 1TA4A 3A6KA 3EULA 3QBTA 1XAHA 4QODA 4H1UA 4W1PA 5F78A 3ZTTA 3EA4A 1E1QA 3OECA 4C4PA 3RANA 2GX6A 3M3PA 3QKSA 3W8NA 3ZYZA 1T8UA 2E5FA 2AFIE 4U7TB 3H1AA 3DD5A 3KEOA 4EG0A 3QE9Y 1M6EX 2H92A 2WU1A 2QLJA 2QRHA 1SOWA 3R23A 4UULA 3KALA 4FHZA 3INTA 3OF5A 3WIVA 5KZMB 3AVYA 1YT5A 4DMMA 3PHIA 3QENA 2K6GA 3GMIA 1WDKA 1GSOA 5C18A 3BIJA 2ODEA 4A8TA 3LUBA 4JUBA 1J22A 1EYZA 4CEHB 5CM2Z 1L4GA 1A88A 1RJ9A 2O2EA 5I7SA 5KNBH 1F14A 4KLZA 2CCJA 3DR3A 1I13A 3IUMA 1YZUA 3IKMB 3C1TA 1JHVA 2ZFUA 3W4JA 4K7JA 4TLLB 2HDWA 3KKQA 4CKXA 3KQHA 1XTZA 2LCQA 2DERA 1D9ZA 7REQB 3ZVMA 4WFJA 2JRCA 3ICWA 3OCVA 2R0QC 1NXWA 2J48A 2PBRA 5GY7A 3T7EA 3OE7A 2H4XA 1C1YA 3D3JA 1A9SA 1NPDA 3OCYA 3R4CA 4O4IA 4UJ5A 2J0UB 4WLVA 3W4KA 4M1QA 3AR2A 4MHTA 2UYOA 3UATA 3LHSA 3QIAA 2JA1A 3BJEA 4OUKX 1EWTA 1R0WA 4EFDA 4YJHB 4OI1A 3ZYCA 2BFEA 3K7EA 3MUFA 4KMMA 1V47A 3JV7A 5E0KB 1MLDA 4JWTA 3EY9A 1F4VA 3AONB 3JVVA 4QU5A 1B43A 4JGGA 5FPYA 2F59A 4YCNA 3A3KA 1XEWX 1XMVA 3WIDA 4M54A 4HLCA 4GBGA 5A05A 5CH8A 3R76A 2YW2A 1DC4A 2H4JA 3IVXA 4M0UA 1A82A 2ZUCA 3JQ7A 4ZCQA 1E58A 3GFVA 1GGMA 1KJNA 2J67A 3IPAA 4YRCA 1UFVA 1E3TA 4QFCA 3KIPA 1XZGA 3H0KA 3RU7A 1MA0A 1WW3A 5KMGA 1EXDA 2CKDA 1TD9A 4IIJB 1CRPA 1D5WA 1NJSA 1GQSA 1SN7A 5ALRA 4KO8A 3VKVA 1P7CA 2QU8A 4FGKA 4RQUA 4E33A 5KQPA 2D0DA 4CU2A 1XXHB 1F38A 2VT2A 3CZAA 3L7NA 4KK3A 4X24A 2VPWA 3KFVA 3GQBA 4RF5A 4KQIA 2FF5A 3C41J 3AB7A 4PX5A 2IUTA 3QI7A 4N40A 2R5NA 1MOQA 2MYPA 1M66A 4O2BF 1JZTA 1B1CA 5AKEA 2HF8A 1W4AA 2VUTA 1ZD4A 4BFLA 5CB4A 3SC6A 1XKXA 3C8HA 1X80A 1KVTA 4ZGBA 3NHAA 4CM8B 4LRTB 4BQFA 2HIGA 1PZEA 2IW3A 4ZVUA 3U61B 1EUDA 1TT7A 1JN0A 1IMJA 2CK3A 2HYDA 1VKZA 1GZHB 1KQPA 2IZOA 5AKHA 4WNAA 4G9EA 2MSKA 3WBKA 3CPHA 2JGNA 3ZLBA 4OGLA 4HNGA 4TQGA 2ZRGA 4PNEA 4UXJA 2VATA 4CL2A 1UJMA 3OUZA 4X1KA 5EKXA 4PU0A 1PNOA 4RPCA 3UAYA 2B36A 5CLFA 1KYIA 3SU8A 4FMBB 4NXNB 4RVUA 1J5XA 4CKWA 1LI4A 4M1KA 4R71A 2IYLD 2FMFA 2IEDA 4PCLA 5CT6A 4ZI7F 3IDSA 4LDQA 2AK3A 2RAUA 3MQFA 4EPYA 1D2GA 2GESA 4OBWA 4EBBA 2R79A 1QSGA 5IFLA 1L3CA 3HLKA 1U1GA 1QLWA 2WJ6A 3I9V6 1NVUQ 1KI6B 1TW3A 2VI5A 3MN1A 4LRQA 4B3IA 3S6JA 3IAXA 1BX1A 3JASA 3W5SA 4BC1A 3SBDA 4M8IA 3GVXA 2JKVA 5C35A 3OICA 4C21A 4F2HA 5AI4A 2I66A 1XQWA 3CUSA 1I9GA 3RC1A 1XCPA 5GJBA 1R4MB 2Y0DA 3MB8A 3CLKA 1ORHA 5G0WA 5KOJB 3STXA 4P3KA 4JI1B 1ZXBA 2A5GA 2ODWA 5ITZA 5LLTA 1OFGA 3N2KB 1FYDA 4M86A 1C3OB 1X8KA 4RS3A 4LJKA 2GM5A 3AVPA 2RHBA 5H83A 4Z2YA 3WB9A 2H7CA 3OQ1A 3GRKA 1WCIB 3A31A 2SCUB 3EMBA 4DG8A 3RT1A 4NMXB 4HGZA 2IHJA 1N0VC 1KZGB 1NFRA 1BH6A 2VP9A 3DO6A 2KPOA 4B3TB 1ND6A 2PRSA 3EXG1 2ZDGA 1JEAA 3RC3A 2ZRAA 1WW8A 1WKVA 5KAMA 2PYIA 4EHBA 4Z4GA 3G0IA 3P2MA 4WFQA 1X2EA 4IDCA 4YAKA 1G60A 1CUXA 4LVUA 3VR4H 4GSKA 1M2GA 3P9KA 5EY5B 3PXGA 3RAEC 3PHBE 4LI0A 2P8SA 3D31A 3JRWA 4BQRA 1YB1A 2AN4A 3P2JA 1MJGM 2YHIA 1KH2A 4ZOLB 4XDYA 1T8SA 2QN1A 2VP0A 4EH1A 5HQTA 2YWFA 3KZ1E 4QPDA 1OGJA 3VNQA 1RYMA 4OUDA 1QPZA 1HC7A 1O89A 4PNHA 2NO4A 2HA5A 4ESOA 4H15A 3TUJC 3ACBA 2GTPA 2NXWA 3OX4A 1M0TA 4HDSA 4LGVA 4BBZA 1BZYA 1LPAB 4XR4A 3E4DA 2AXQA 5I7VA 4BP3A 2XUZA 1Y1PA 1PSDA 4QUEA 1J23A 2R47A 3M33A 4J2TA 2ZAMA 4BMZA 3W2IA 1F2VA 1EBBA 1GL7A 4FFLA 4O8ZA 4CF3A 1NATA 1V8DA 2CL6X 3FCCA 1WR8A 2VWQA 3PU6A 4RGBA 1DAPA 4KBYA 1OPRA 4D42A 3FPBA 2FA9A 1Q1ZA 1TEVA 1MUUA 1I0LA 5BYKA 4LFAB 3GRYA 2NO0A 1D8TA 4MUEA 1X7XB 3HUTA 4LZLA 1AZLA 4R2IA 1I51A 7MHTA 4PGGA 4YJDA 4UTRA 1P0CA 4RM3A 5HEKA 3VPGA 1GCOA 2HJVA 1S7CA 2O0KA 3AYZB 4RLFA 4X71A 3X1JA 2YMMA 2VDNB 4U7JA 2UVDA 4U2FA 1JI3A 4IJ6A 4FC7A 1MNAA 3USZA 1EFCA 4E11A 5BNTA 5EHXA 4JGBA 1QDUA 3M4NA 3NUZA 2NZJA 4G36A 3UG6A 3KXPA 2J0QA 1JEQA 1OX6A 2FUEA 3Q4GA 1MXFA 1GO2A 2XNKA 4ID3A 1H9CA 4M3NA 3JCZA 2FCAA 2GZSA 3W5VA 2XAAA 2J4DA 3MBIA 1SUFA 1T8RA 2PU7A 4I1SA 4MICA 2K2WA 3FWZA 1F5SA 4G1UC 5ERYA 1QHSA 3QITA 1US8B 3GB9A 2HMYB 4W4TA 1ODJA 1QZ3A 3BGWA 3ETLA 5BN3A 1D4AA 821PA 4DQXA 4JFRA 1KI1A 4ZP1A 2GEUA 3A1FA 1J42A 1P1KA 2P90A 3S1AA 1YZTA 4BFYA 3S2SA 4KL8S 1JKMA 3MWDA 1BKSB 2XD9A 4I1VA 5JNTA 2XUPA 1TJPB 1BX0A 1R6DA 1TZJA 2AE2A 3KHTA 1QVWA 2WA1A 2WYIA 5D3ZA 4Q02A 1Q7CA 2IXGA 2OFWA 1F60A 3IQGX 1V8BA 3NVAA 1K75A 1QBKC 4KTTE 4BX0A 5E8RA 2G77B 1P7WA 4PLCA 2Q49A 5HFAA 3DT9A 3T7CA 1XAGA 2C9ZA 3WB1A 1SXPA 5B58C 1G1MA 3PC8A 1D2NA 4MGZR 2XB8A 1U3VA 3JQBA 4PLYA 1X87A 3VKUA 3EZ7A 3KKEA 2C0QA 2AT1A 5KNDA 5ELLA 1L8LA 2OTCA 5LQJA 2H9IA 1E69A 3TIGA 4QG7A 3WK6A 1Z2NX 1LRLA 1SC6A 4YP0A 4BFCA 5KYUA 3ZHTA 1PEAA 1ZVKA 3A6GA 3IAS1 1ZDMA 4WI1A 4UQLA 4MDHA 1PW5A 3RTGA 5IRCD 1SQFA 4WK4B 3VSEA 3E61A 3GGCA 5E3HA 3KJEA 2A92A 4KQHA 1SXHA 1GEGA 1K86A 2BMDA 2ILVA 2MSLA 2ECFA 3PQCA 2A5DA 1R4NB 5IKEA 1L7DA 4Q9NA 1IVNA 4XWGA 3EZNA 3NGLA 4JQYA 1GVNB 2UYQA 2XCRB 1P2SA 2QSJA 1M2FA 5FA5A 3VVMA 2VZ8A 4YTEA 3T3NA 2WKPA 5JIBA 4DMCA 1S9DA 3HWRA 2R25B 5SYAA 3GJXC 1JG1A 3V34A 1UM8A 5A1TA 2DFVA 2LW7A 2NGRA 2XUJA 5EC8A 1EDEA 1HT2E 5KWIA 1FUUA 1M72A 2R66A 1QZUA 3A37A 3K94A 4O4JF 5DHAA 3PC3A 4IJQA 5BUQA 1Q0TA 3GDFA 4QUHA 2ATVA 3D8HA 2Y1GA 2VRCA 5AXBA 5BN5B 1NDUA 5KJ1A 1CLUA 1P29A 1DTWB 4S0ZA 1HM5A 4YRBA 3V2UA 3OTHA 5H5JA 5KDOA 4E4YA 1RT9A 4CKYA 4LY0A 1IK4A 4PPGA 1DQRA 3FHLA 2BFDA 4P2GA 4QUGA 2VJQA 1IQUA 3PT5A 1N3YA 2AXPA 2EQ5A 5LB2A 1XYYA 4GU5A 2O59A 3AESB 3X43A 2P9HA 3UJ9A 3FM9A 3Q3HA 4HNVA 2WUFA 3CUTA 4ALJA 3ZD7A 1PT5A 2XZPA 1KOLA 1IHOA 1SG6A 4NBTA 4WJKB 4WPGA 2FWJA 4JHXA 3QVJA 4YQYA 5EEGA 3T12A 2FJUA 3RUIA 3T5TA 3RAGA 3EAGA 4UNIA 5JNSA 2LBPA 4ZDWA 3CU5A 1XTTA 5LP6C 1NMSA 1NBMA 2WTMA 4AO6A 4HDMB 5KHAA 2IZ7A 2MSWA 3D8BA 4EDHA 3R1IA 1RYDA 3LHKA 1DRUA 2CXTA 4IGIA 2JVIA 2ZYAA 4HNAB 3WBBA 2QTLA 3AKCA 4YRLA 1CS0B 3FHCB 4ZZIA 2I4OA 1CYDA 2ZBFA 4UQPA 5U4XA 1A50B 4GWLA 1OYVA 1CHNA 1T5OA 1JMYA 4BJHB 2DFDA 1XBTA 4N03A 2UYHA 4KVGA 2FN7A 1YZ3A 5EJEA 3WHKA 5NLLA 5A4KA 1ETHA 3ENQA 3IOMA 2OCGA 1YRBA 2C4KA 3EPRA 4MQFA 5FA8A 3VZPA 4NG4A 2F17A 1SVOA 5DFAA 4UUPA 5DLQC 1OTXA 5IK2A 3RK0A 4L5BA 3RBVA 2OB2A 3SLRA 1P4HA 2ZG6A 3L0DA 2IIQA 3L49A 3BBLA 1Q1QA 4U5XA 1L7QA 4EITA 1U9IC 3UICA 5JRZA 1SXJA 3KUCA 1KI2A 4II2A 2JFUA 1KY3A 1IN5A 3V8RA 1WMBA 3GCDA 3IMKA 4RA9B 3HBNA 4OXYA 5G0VA 2J87A 3FZYA 7MDHA 3M2PA 1K68A 4NFLA 3NTOA 1EVYA 2VP2A 1ZOSA 3IYLW 1LBHA 5J2UB 4R9RA 1XFAA 5KYNA 3FTEA 1J97A 1YO6A 1CFJA 1HMPA 5KSYA 1UP6A 3GUZA 3WWOA 4D2IA 3L4KA 1BSVA 1TU0A 1N2XA 4MIKA 4MI9A 2GGSA 3URMA 1P6QA 3DGFC 4Y9TA 3DO5A 3W04A 3V33A 3MUEA 2B8EA 4A8JA 1P61B 2VPQA 2WF9A 5ECGC 1CUVA 3CLHA 3HUUA 2UAGA 1M76A 1J8MF 1V5WA 1W85B 1ZK0A 2XCSB 1I2BA 1QFYA 4F4JA 4JLKA 3J7TA 4HLNA 3L82B 1CT9A 1ONBA 3WYNA 4FMPA 1ZD1A 2IHYA 3RVOA 2CXQA 4NCKA 1NKSA 4BNKA 1BE1A 3A1SA 3W3AA 1MW8X 3QVSA 4YJGA 3WYEA 3EXAA 2B94A 1PNVA 3MTJA 4LNUB 1K97A 5JYBA 1RACA 1N6KA 1QANA 1V41E 2VBGA 4AJLA 5CA1B 3PT9A 3OTWA 1TCCA 2ECOA 4AL4A 3MJFA 3IUEA 3QEKA 2CUZA 5GV7A 3I9LA 3WL4A 2AB0A 2O52A 4HB4A 4YQZA 2VZ9A 2A35A 2ZB3A 5HVNA 4MUKA 2WP8J 4KDCA 4NESA 3T35A 1EWVA 1VC2A 1Z5VA 2ZVPX 1JS1X 1K5GA 5AIAA 2F1RA 1QQBA 1HDRA 4WK2B 5FQOA 3S1SA 4IINA 5ALIA 1XAIA 3RIXA 3LPNA 3PITA 3A06A 5LIPA 1W46A 1DAOA 3IS3A 5FXMA 2DWUA 3HUFA 4LZAA 4HPXB 3AVXA 4C0SA 5FWDA 3NC4A 5CDHA 3PQFA 1D0SA 3AOEA 2OHFA 3OZFA 4EI9A 1KJJA 3DL2A 4TT3A 3ZIAD 1MVLA 1GR0A 2FW8A 2MJLA 4ZKDA 2I3ZA 1U3DA 4IJ5A 4AJPA 4BQNA 1Y9EA 1YA4A 1ZCAA 3NXKA 3HTXA 4DILA 2J07A 2LKCA 3DH0A 4RSHA 4KFUA 1FP4B 5GONB 1H6BA 4QYWA 1RMQA 2ZBDA 1PNTA 3C3JA 2AW5A 1CZLA 4WUVA 4DLKA 2QE6A 4EM6A 1IVSA 3PUHA 2DHEA 5JU6A 3AR9A 1T9ZA 1V6SA 4X63A 4ZXFA 3KR9A 4RIEA 2Z6QA 5DHSA 3FHTA 4C4SA 2VDJA 3H6KA 2ZYHA 2G1AA 5EHGA 3STUA 5HXAA 2PSDA 1GPKA 3V1MA 4ZYUA 1NASA 3WISA 4WZAE 4CEJB 4I19A 1JLSA 5AP9A 4UAJA 1HLDA 2FNAA 2OCBA 4DMUB 1PX2A 3HBLA 4B35A 5LA6B 4J1SA 4GR9A 4R7TA 2BMJA 3KEFA 2IPLA 1VCMA 4QTUB 4NL4H 3FFTA 1KAGA 4BVJA 3LM8A 4HMPA 2WK1A 5AQEA 2PBLA 1M9NA 1W5AA 4D4KA 2A94A 1O8BA 1YKGA 3P94A 5L53A 3D2AA 2QDKA 1DT5A 2VT3A 3PTLA 5DE3A 4ZV9A 3QHQA 4X20A 1KMIY 2W90A 4RJKA 5TIIA 1ABEA 4PLVA 3P4YA 3N2IA 5BN4A 5EAIA 8ADHA 4JJFA 4O29A 5IJ9B 2E89A 1E79D 3HP4A 4JYPA 4RYLA 1W2HA 1Y89A 3QEOA 2PTHA 1YJ5A 1XK7A 2H5JA 3UAOA 3Q5EA 1UM9B 5A3VA 3N0VA 4IIDA 2Z9BA 4PSAA 3RSSA 4IS2A 2JFPA 4GKVA 4TTVA 5IC4A 1V1JA 1G18A 2R8ZA 3GNTA 4C08A 3AM3A 4EGAA 2HI0A 3ISVA 2ZVDA 3AR8A 4EY4A 2B98A 2GYVA 4X8OA 2ZBUA 2RJ3A 3PPYA 5I7WA 1DKQA 4HUTA 2GLTA 3IR7A 4XQEA 3ZI0A 4QSMA 2JHGA 5JZMA 2R48A 3C3YA 2OK7A 2R3SA 5GGXA 4RKYA 2GPYA 4R6XA 4H1TA 4IDOA 1TYBE 3FNGA 3A3NA 2GK7A 2WWHA 3JTEA 3PFKA 2VUSA 2CDCA 4LCBA 1WUJS 3RFVA 4L15A 1Q0UA 2YCBA 3GNLA 2QVGA 3OC6A 4YDHB 5K8JB 4Z0HO 2BTEA 1G7CA 2G67A 3LX6A 5SICE 2P41A 3VVBA 1G42A 3B53X 4FXOA 3NIWA 1A97A 3PLRA 2WU3A 2LCIA 2DCUA 2FPSA 4MUAA 4QWWA 3WRYC 3ZWYA 1I80A 4GRIA 1CEQA 1Z5NA 4FYMA 3SBOA 4Z3DA 2ZM5A 1GRVA 4IL5A 5HK9A 3QMPA 4BN4A 5EJIA 3FR7A 1I3LA 2GYWA 2FFBA 4KQ1A 3W6ZA 1OCEA 2DTEA 3PC4A 4DJFC 1I7DA 2E9SA 1MO6A 4P5PA 5DZSA 3WL5A 1TQ4A 3QVWA 4ENSA 3FMIA 3ONWA 2JCXA 4RPIA 3MTGA 1R50A 4UM9B 3HXLA 4C29A 1B4DA 2IKQA 1MX3A 2EVWX 2OENG 1R8JA 1RBQA 1CE8A 2X23A 1M34B 1JLKA 1PTJC 3VHQA 2XHZA 4LTNA 3EG5A 1GTG1 1WQ4A 1H2EA 1E2LA 3GRFA 2I3GA 4ZAGA 3L0ZA 3T7JA 4WOBA 1E7QA 5EIWA 4L6AA 4V2UA 4B3GA 1ENOA 1YFZA 3EXIB 3VHXB 2VXOA 2FMTA 1L5FA 1C1XA 1Z12A 3ASVA 4RANA 1GHTA 1Z0UA 2B5WA 1WHTB 1JP7A 2EV9A 1LSOA 3GFBA 4YCDA 3AUAA 2H7VA 3OPYA 1BS1A 4MAAA 5H9VA 1U1DA 1Y6GA 4OX9Y 4LJ6A 1EM8A 1Z5ZA 2WF8A 3H87A 1MA3A 4NNPA 4OHVA 4DYVA 5B7QA 3TQFA 3MYYA 3EIEA 3UK2A 2C59A 5EJ7A 3UT5A 1UEXC 3LCVB 1SO8A 1ZN9A 4YP9A 1XWIA 3OTGA 1NYQA 1ULSA 2JGFA 4YAFA 4BB0A 4XRRA 4CM3A 3BT7A 1XEWY 4KUEA 4NAVA 3PQDA 4UE2A 1BEEA 1GY8A 1VSVA 4QBTA 4FBLA 2C7VA 4HEJA 4UDYX 2H57A 4GM0A 4XJVA 5FUXA 3E9RA 1AQYA 3I2GA 3PLNA 3STYA 4IRUB 2DKNA 1MX1A 4MWOA 8LDHA 5JI2E 3KZXA 4EUSA 2GAIA 1FP7A 4H6WA 1BXGA 2HLPA 1CD5A 2PJUA 2YVAA 3E9EA 2YNMC 1IHUA 1T4MA 3OCUA 4J7XA 1GYPA 4N18A 3M6WA 1F6DA 5ARCA 2CHFA 4ARBA 4C7OA 2D0PB 3QVGA 1U0BB 4GM4A 3IO3A 2J1LA 5I7OA 5B64A 2VL7A 3SE7A 3CNOA 3SZRA 1FMCA 2DJ5A 2D54A 3GUVA 2RHGB 2JDID 1Q84A 5HM8A 5JAIA 4G8DA 4IIHA 1ACJA 3F1LA 4OSOA 3U4MA 5CXQA 4LXUA 1M83A 5DNAA 3FSJX 1PFKA 1G5RA 2W2KB 3CNNA 4US1R 2P40A 2FFHA 3AEZA 1ZK3A 1LSJA 1TEXA 1PV4A 2I6GA 5BO5A 1EQUA 1IBKB 1Q0ZA 4WA7A 1D1QA 4M98A 2NW6A 3IUYA 3K9NA 3NAZA 2NXJA 2PX8A 4KO1S 2PMEA 3MTBA 2FN4A 1JYFA 2NU7A 4D0GA 2PD6A 4EI8A 1DDOA 3LLMA 5TC4A 4CBVA 2E87A 5DTJA 4JIMA 1Z4NA 3QH4A 1DGQA 1VB5A 2XY4A 3W6NA 4DANA 2YJNA 3FNHA 2IBMA 1FMFA 5ALSA 4AZ3A 2PKQP 3RJ5A 1CY2A 1IDOA 4J9VA 5K0CA 4QECA 5TGTA 1QE3A 3IDAA 4WDRA 4BB6A 4LXTA 1SR8A 4US2R 2Q07A 4MW6A 2QN7A 3GDGA 2AQHA 3ABIA 1Y5LA 3EGOA 2P2DA 4FIZA 4MMXB 4B2IA 2COUA 1P7VA 1Z6TA 1ZOIA 1K7FB 2ZWVA 4MVCA 5FB3A 3HWSA 2C5AA 4H7PA 3RVPA 4BGEA 1GSAA 1VL6A 1IZ0A 4RJ2A 1K3FA 4C30A 1I9CA 2JI8A 5KVCA 1I01A 1MABA 3EEYA 1U65A 3LCCA 3O74A 4LRWA 5K0NA 1NBEA 1U4OA 2FDXA 4ITRC 4HTAA 2CMFA 3CCFA 4OQPA 4R6WA 5LMCA 3GZTB 1RAAA 4U9HS 1J8DA 3BIXA 2FLKA 1KR5A 4XGRA 5JAQA 3W5HA 3DMGA 1EM6A 4O4IF 5F5XA 1PQYA 3NDBB 3S7TA 3QOXA 5DF1A 2J3IA 1T1IA 3UC5A 2AJ8A 4O2AB 1CEYA 3SGLA 3TRKA 4GOOD 2HK7A 1KH3A 2YJZA 3DAOA 1IXSB 1Z36A 4L85A 2AFHA 4MGYR 4PF1A 4BU1A 4NNJA 4LQ4A 4ZI2A 2GFHA 3AL0C 4OFBA 2IZ5A 1H8EA 2COKA 3STTA 4KQWA 1K9VF 1MJFA 3DMYA 1GLNA 4L3VA 4O2RA 4AKTA 5CDGA 3AVQA 1B0UA 2NYUA 2WNSA 3UCXA 4DLBA 5IJ9A 3EIOA 3DEAA 4I1YA 4OD0A 4D4GA 1KTIA 4OFZA 1E1QD 3A11A 2NT4A 5GVSA 4MR7A 1CR1A 1Z4JA 3DSRA 2BMVA 3L1UA 4IDDA 2F8SA 1HYQA 4KRGA 3VSDA 3VPCA 1J8VA 5JCOA 3BWEA 2XVAA 4FT4A 4IP0A 5AH0A 1N0WA 5AW4A 3PGJA 5AW1A 1P0MA 4R3NA 2B34A 5CT5A 3AEKB 3R7WA 3Q8XB 3R9XA 3X3HA 3UAZA 2HK6A 2V03A 4UNSA 3OA0A 1FNMA 4JA2A 4HLUA 1IZZA 4MV0A 4NZPA 2CVZA 4RM2A 5C4MA 1OWMA 4Q16A 5B1IA 1XU4A 1ACMA 4FWBA 4KBGA 3HCEA 3OWHA 3VR0A 2IVFA 4K40A 1BJKA 2AC4A 4BO7A 1WU8A 1H1LB 2IEAA 1AOXA 4KQKA 4UU7A 5B30A 1W2GA 4MAFA 3D1JA 4XIJA 3LQ2A 3Q40A 5LQSA 4M8KA 2QLFA 3FYUA 4I5DA 4EHAA 1B41A 3OE7D 4HDOB 3WGJA 4A6PA 3NASA 1FA9A 3FPHA 5I9IA 4DV5B 4JV5B 3C6MA 4RK0A 2ZB2A 5L3QA 1Z6ZA 2NO6A 2QM0A 4LXQA 4TS4A 3AUTA 3S4YA 3VXKA 4KE9A 1OFUX 4JQZA 5AW6A 1CC1S 4MWTA 1YC5A 3RBZA 5L95A 3UC9A 1NW6A 5LOVA 5IH7A 1EVQA 4X95A 4YT2A 5AM2A 2XYGA 3ZGNA 1ODFA 2WD7B 1VCHA 1VXOA 2NUTB 1RRKA 5CNIA 1KSGA 4JMLA 2WFLA 4E6EA 5BNZA 5JSZA 5LQAA 2EBFX 3MM4A 2OV6A 3HR4A 4Y98A 1Y37A 2CNKA 2CFSA 2OOSA 1G5IA 1IEVA 4QOHA 4YC7A 2B78A 2V0CA 4XGIA 2I91A 3D4PA 1IN4A 1X15A 2YYZA 4EUKA 2AG8A 1AS2A 2W58A 1USIA 4UM5A 4RESA 4FMDB 1X38A 2B7CA 2P4EA 3QIVA 3REOA 5BSGA 1LDEA 1Q5PA 2QY9A 3GZ4A 4KU4A 1LBEA 3EVZA 3PUJA 3RRFA 4BWFB 3I52A 3S3TA 4BEJA 5JFOA 2R7NA 2X5OA 1E61A 2BFOA 2JA2A 4K88A 4Q34A 4U2DA 1M1NB 2OGSA 4ZAFA 3K9BA 1U9JA 3ZHQA 5KU1A 2FK8A 3RK4A 3NDIA 4UFPA 2FW7A 1EAYA 3O47A 4DZRA 1U0GA 3A28A 1JQKA 1ODLA 1RCUA 1J6UA 3MINB 4WKCA 2Y0CA 4XUEA 3V2IA 2RD2A 1L5WA 3KSMA 3UY4A 4OHMA 1YHYA 4G5SA 3AEUB 3PXDA 4MEAA 5EMLA 1L1EA 4KWTA 4ZJUA 4HJXA 1EAMA 2YUTA 3ASUA 4WXYB 3UGQA 1W34A 5D5HA 3UOWA 1I1NA 2E6KA 2JLYA 1X3LA 3I8OA 3OT1B 3RVRA 1N6PA 3WJ7A 4C4AA 5AW2A 2OE2A 1KRHA 3BQMB 1Y9JA 1KY5A 2JZOA 3NPAA 2WHEA 3JWEA 3OIYA 3PFBA 3PQ5A 4N5HX 3PDHA 4S2UA 3SMQA 4C6RA 2XKJE 3U4IA 3WXMA 3GEIA 5BVGB 3MMPA 4K8OA 5KJEA 4RHYA 1P0QA 3L6RA 2OB1A 5EE1A 2CN1A 5K6AA 1JHRA 4C3UA 1P3Y1 2RJNA 4MKZA 1HSZA 4QPNA 4PFJA 5B1DA 1KS9A 5TNXA 3DBHA 3ZUPA 1P73A 2ZWIA 5CLLA 1SG0A 5AJUA 4ZD6A 3PDWA 2XT6A 1LV7A 2MINA 4PPQA 4MJ7A 4F4UA 4DL9A 1NVKA 3L40A 4M37A 1JDTA 2HIHA 1QM5A 4Z4HA 4F92B 4FFDA 1DQPA 2SKEA 3UN1A 3ESAA 3NC0C 1QONA 3Q9SA 2ZJAA 3GF4A 1K3UB 3HJGA 4DV2B 3GR6A 3N59A 3SX4A 4YDQA 2EERA 5ADWA 3L6CA 4Y7CA 1UBJS 4G1BA 4N65A 1Z47A 5C7IO 4X65B 2EJUA 4HDKA 1QH1B 2B8JA 4RULA 2EKPA 2Q28A 1XJWA 2Y2UA 4YPOA 3EWNA 4KIWA 3RS0A 4B81A 4Y1RB 2FPIA 3EXFA 4LJAA 4UMVA 3K8QA 4HDNA 2SBTA 1TOAA 1AQJA 1BKDR 3I01A 2H3HA 4KPUB 1JHDA 4OV6B 3BKXA 4ZC1A 2QTMA 4U9UA 1Y1KE 4K9NA 4LMAA 3TN7A 4F12A 1TQ8A 3R20A 3MPUA 1KEPA 5F9MA 4EQZA 2IW1A 3JARB 4Q3LA 4HADA 4DJEC 1BHO1 1SULA 4PEVA 3ES9A 3MJSA 1DV2A 4I50F 2PUFA 1Q7RA 4B87A 1E9SA 3KR0A 3QKWA 4LQLA 3KLMX 4DIOA 4BCBA 1WB6A 1SA0A 1ZJZA 2GJKA 3A1DA 1MJNA 1QZTA 5CR9A 2WY2D 2UZ4A 1GSIA 1F6WA 2GJSA 1VG1A 3A7EA 2A7QA 3ND9A 1G8PA 3AINA 4UZEA 4V0MA 1UIRA 3M9LA 1ZHHA 1A1VA 2VCEA 4CL3A 2FZGA 3DS8A 3P97A 4V24A 3ZNOA 1JEDA 2C9YA 3BE6A 5LDGA 3A7DA 4JSTA 3RFXA 2WJWA 6Q21A 3TVTA 1HTWA 4EGSA 4F5EA 3OI7A 4JYAB 5G0TA 2O1SA 2DBRA 2YWRA 4LHVA 1M1YA 4DT1B 3GN1A 1Y7LA 5IT5A 1O54A 1X86B 1Z6GA 3CC8A 1Z4PX 4Q3DA 1U7PA 4U7FA 5D7NA 2IXTA 4INPA 5KNBA 2J8ZA 2YQ5A 4DQVA 1HTBA 1ZI9A 5T64A 4E4RA 1V35A 3QFTA 1L8AA 5JYCA 2FEMA 3ILYA 5FBVB 3GFQA 3ZY4A 3HPRA 4AJEA 2Z3WA 5I7EA 3TFOA 3I9FA 1JHPA 4F9GA 1EB9A 3OEEA 3NRCA 3W79A 3KPVA 3FVVA 1NN1A 2Y1WA 1XSEA 4B3HA 3KPUA 4Y2PA 4DR3B 1U2ZA 2UUPA 1ETUA 2Y71A 4KRXA 3S2EA 1ZY2A 3UXYA 2CDBA 3NU1A 1S01A 3QF7A 2H59A 5L40A 5J4KA 4E6PA 2O48X 2CCKA 1UMDB 3G0CA 3LYHA 4DM3A 2Q6OA 1RC0A 3EGDA 3BD6A 5L3SA 5TPZA 4EHIA 1CBUA 1BGXT 1D7OA 2JD2A 1KP3A 4HXYA 4IDHA 2IHVA 4NABA 4Q4JB 4YX9A 3DCYA 1UJBA 1M2VB 2ZJBA 1L6RA 3MTIA 4BLTA 1HDCA 4NZOA 5K8TA 4AKSA 4RY0A 5DB4A 3U1TA 2DPGA 4NTZA 1EJ0A 3BXPA 4I55A 2EHDA 3OP4A 1DTSA 1P4JA 4DLPA 1USUA 1YVEI 4Q03A 4AJOA 1SIWA 1NVAA 5ER6A 4KGVA 3OU6A 3Q12A 2C3UA 2J5RA 3E27A 4JLDA 3OG9A 3L4BA 1WABA 3P9PA 3D81A 2CBXA 4B83A 4QRHA 4MMZB 2V7XA 4GX5A 4TYNA 1OKKD 1Z8NA 3B3JA 1D6JA 1AUOA 4G0YA 3VJLA 3NAQA 3ZBTA 5KSOA 3AIKA 4LE1A 3ST7A 4JR2A 1FS6A 2ZRNA 3WGTA 4JP1A 2Y9MB 2YKGA 3MFQA 1FSFA 1D2MA 1IU9A 3UJ7A 4M7PA 2WQ7A 3OWOA 3IAHA 1Z22A 4UVGA 5A2QA 1JAIA 3MQ4A 1Q11A 2XXBA 3QX9A 2FUKA 2HXYA 1PE0A 1QKKA 1QK4A 1V8ZA 2PVSA 2YC2C 4B43A 2OG1A 2QY6A 3G89A 3V97A 2TMKA 4KGDA 4TWZA 3QF4A 1YQDA 2RBEA 3LUCA 3R7LA 1FJ2A 3HU2A 4ZOCA 1XD8A 3VGPA 3CLSC 2ZIWB 1YGPA 4Y1GA 3UV6A 1HFWA 3R74A 4A8PA 4ZV4A 1WSAA 4HTFA 4MRNA 1P1JA 4FBGA 4L02A 3DLCA 3LQRA 1S3GA 1IRXA 3V1NA 5KNDD 4RPHA 2AOXA 1I30A 1V3QE 4DABA 1O6BA 1B14A 1RMTA 2YHAA 4FFPA 3PL5A 4BKMA 1V16B 2WILA 4BRZA 4RIHA 1RQGA 2Z2YA 2FQ1A 3OBBA 4QOGA 5AVSA 1Z6AA 1XDWA 3A6FA 1ZHOA 3G0OA 1TT5B 1G1AA 1O87A 2XSZA 2X7HA 2VNHA 4LW8A 3TL6A 1CSEE 2X5KO 4OCZA 2OBFA 1XC7A 1WXWA 3ADOA 3RS9A 5JPCA 1WS6A 1NJ8A 3DNMA 5FADA 3VO8A 2ON6A 2XADA 1XWWA 3C5EA 1SQ6A 5CVCA 9GPBA 5IJWA 1HDGO 1Q7GA 4KN6A 4C22A 3WSWA 1AZWA 1G8HA 3BIOA 5LYJF 4I0WB 5TSDA 1CJTC 1Y3DE 1G20B 4DG9A 1Q0SA 3D5TA 1SUSA 3O95A 1LPPA 2FQWA 3GD7A 4UM8B 3WYFA 4D6PA 1RRMA 4L2IA 1TZMA 2PN1A 1CEEA 3NGMA 3FYTA 4U0JA 1ECBA 1V48A 2XE8A 3V4SA 1OT5A 4ATNA 3O5AA 4JS0A 2Q7XA 3FPLA 1CB7A 4JELA 3AF2A 3DZJA 3I9KA 3LKDA 1RU3A 4F3KA 4NZ9A 2Q3BA 1RADA 2XD4A 3DTTA 3B13B 7REQA 1RIFA 1KORA 3R9WA 2VRCD 4KLNA 4B80A 4J0JA 2G25A 1BNCA 4FYHA 2J0UA 1CP2A 1HEIA 4L0DA 3C6QA 3O91A 3WZLA 2H1WA 3WNVA 3EPJA 4UCQA 1SIOA 5JPDA 3CY6A 3H8VA 4A1FA 1KEEB 1OE0A 4RE5A 4HG2A 1I5OA 4OREX 5IBQA 2Z0MA 4ND3A 1ZGZA 3Q7QA 2G7MC 4QPZA 3GG2A 3VR4A 3NOQA 4LN1A 3B48A 3CN7A 4AQDA 1LFAA 2DB3A 4BO4A 1PX0A 3KYJB 2PUAA 2NUAA 3TW0A 4YI3A 2IPNA 4KR6A 4P3XA 1QHIA 1AV6A 3CVOA 1TO1E 3GRPA 3IKLA 3OESA 3PGMA 4CV2A 1A7JA 1NBMD 1ZWLA 2FZEA 1GLVA 1ZL0A 2QL6A 2Y4NA 1MHPA 3L8GA 2AUNA 3WLSA 2W5UA 4AS2A 1FLAA 3EPLA 1HOXA 2YTZA 3UB3A 1GM5A 2W0SA 1KA9H 1RRVA 1WEHA 1TVEA 2Q0QA 2ZAGA 1QMGA 1COWA 1W1WA 2IODA 3DDCA 2D8MA 3H1GA 2KB0A 4MAMA 1E7WA 1C30B 3LFHA 2D13A 2I2WA 3KR2A 1XXHA 3CYFA 1W47A 2IYQA 2YWDA 1X77A 2PKQO 5E9JA 1LPMA 2V6BA 1N25A 1QVRA 3TXYA 4PX9A 1R6XA 2GM9A 4EAAA 3PQEA 4RD4A 1WLSA 3AKDA 2IGTA 3PP8A 2B21A 2D2EA 4JC8A 5CW1A 3V8VA 4BFXA 1X0VA 1XZJA 3I73A 4QDJA 4G1MB 5K7SA 3RARA 4C78A 1NXOA 4G5QA 4X3CA 5E6RB 3V4ZA 2O8EA 1QKIA 2HA6A 5KYGA 5KHLB 2DUJA 2BYTA 3G49A 3EF0A 1ONNA 3C15C 5CMLA 4GI1A 2IHNA 3DTYA 1FDSA 4TS9A 2FGJA 1A2QA 3GLHB 1KJ8A 4R51A 2CFTA 1JSRA 3PD7A 3BRQA 5CVTA 4UBLA 1QYIA 5K8LA 1ID1A 4RH1A 5HWSA 1H22A 1Y8CA 3O8BA 1NJ6A 1GT91 2R96A 1ZGAA 4UATA 1ZNWA 3QVUA 5SY4A 3OZAA 1G5TA 1U9CA 3NAMA 1JU4A 1QIKA 5I4KA 3BMOB 1OZFA 4Y18A 2ODBA 1GDHA 4NBSA 3RODA 4ZYTA 4GR5A 2P4HX 1ENZA 1FFXB 5KKCA 2XOKA 4P84A 4YRQA 3HA3A 3TDKA 3DMRA 4G1CA 3R44A 5AW5A 3TQTA 1BDMA 2GS9A 2ZE8A 2YASA 3INNA 1FC0A 4OQ4A 2PMKA 1T3GA 5LCXA 1PR2A 3WIOA 3DEYX 4PLFA 5HDQA 3G8BA 1Q16A 3AFOA 1U3WA 4WESB 1YS9A 2P2ZA 3OHPA 4P4SA 2I80A 4ER0A 1A77A 4YBZA 1V71A 4NAHA 3TLBA 5ITWA 5AUOB 4ECAA 1EI9A 1I0IA 4JLSA 3WGZA 3IIKA 1R4MA 2QNIA 3GJ0A 1KSFX 3D6FA 3WV4A 2WABA 4B46A 1T6YA 4Q48A 4LUCA 3TLYA 4D6YA 2I8AA 5FIUA 3SHOA 1H6CA 4PV7A 2VKQA 4RVDA 3A1EA 2FP4B 3A6DA 3O26A 3L46A 3N2KA 2GWHA 1C3OA 3CLTC 1PVDA 2DGDA 3O4GA 4DV4B 2PZBA 4RU1A 2SCUA 2VUUA 1YNSA 2I7DA 4G0OA 4KUHA 3LCRA 1TM5E 3X1WA 4BNJA 1U8FO 2FPOA 2RGUA 3PX2A 4U8GA 1RZUA 2G9NA 3VZSA 4JJAA 2HMSA 1X3SA 4R5HA 5CTJA 2QYSA 1P2FA 3KDPA 4G1EB 4L8FA 1FTQA 3LVBA 3VPHA 4CTMA 2QRQA 3T1OA 4DSZA 2ATCA 4TT3D 3FVTA 4ASUA 1E1NA 2MSEB 3I2FA 2YRWA 1QVZA 1PJRA 1RI1A 2CJXA 1FVHA 1ZNXA 3M7IA 4LBWA 1ISJA 4S24A 3H05A 1HZZA 1DG3A 2K2QB 3X0DA 3HC7A 4PC3A 5A0VA 2O57A 3CG4A 1V11B 3RYIB 4MV9A 4EJMA 1OBOA 1T9DA 1IXYA 1EDOA 4MHOA 5DNDA 1U0JA 2J45A 1XF9A 3GJTA 3ZD6A 1E94E 4YO8A 4YGXB 2BPOA 3K3PA 2BM9A 1T4BA 3HNRA 4FW8A 1VPEA 2Q1TA 3IP8A 2X41A 5AHWA 1ZG3A 1XTUA 3D7LA 1M74A 3C0KA 3EJWA 4O4HF 2XT0A 4QICA 4EYGA 3ANNA 4X8HA 3GPCA 4HDRB 1RWPA 4GP9A 1S2NA 3D8RA 3P19A 1XVVA 3F3YA 1USGA 2BCJQ 4MV7A 3UJ6A 4YXWA 1ZD5A 1RZRA 2WKQA 2R6GA 2XGOA 1IB0A 5F7XA 5KQLA 1SXQA 5ICFA 1KY2A 3PD0A 4MTLA 1OH8A 4XLZA 1VMKA 1G8JA 2O0JA 3D54D 1EDDA 4RKQA 2VXBA 4Z8YA 5EHNA 1AS3A 3V32A 4YLEA 5TLSA 2JHAA 3CRZA 3A9SA 1HX7A 2ZJOA 5TR9A 1C50A 2QX8A 3X1XA 1J06A 4FUQA 5LZ8A 3RYCB 1GPNA 1SD1A 1YRHA 2CFIA 3BEDA 1VHJA 4RLSA 3FZGA 3S0JA 3TS1A 1TCVA 2Z2ZA 4E1AA 1C0LA 2I7CA 1P8AA 3M6VA 4QGBA 4UBNA 3DE0X 3LDGA 1GZ7A 2O8DB 4JX8A 5EWMB 1OIVA 3CSUA 3A6PC 4P4LA 4UNPA 3IP6A 4DA8A 1L0BA 3GO4A 5HKOA 5CJJA 3H13A 3DZKA 4ND8B 1QFMA 2NG1A 5K45A 4R84A 4UXIA 3RSOA 1APBA 1TJNA 2BFWA 1WLYA 5C31A 4QOSA 4IVQA 4AX4A 4Z7JA 4ZU6X 3A4MA 1XZPA 3MQ2A 2B2CA 4ZJYA 1SZDA 1W35A 5IYZF 2GNAA 4P4UA 4URYR 5B5SA 4AXXA 3COPA 3ZW8A 4TV8B 3JQFC 4M0MA 4RAOA 4Y6RA 2DEUA 1OV6A 3E3MA 3KQLA 4GMGA 5AI9A 2P6OA 2AUTA 4GAEA 1ZI6A 4CGYA 4NV1A 1TX4B 3L04A 3WIUA 3W9SA 4UMEA 3Q7IA 1XZLA 3OQNA 3DXXA 2XMGA 5CVUA 3N6VA 1JDBB 3D6VA 3KXIA 3OX3A 4GX0A 5AJTA 4M53A 2QRMA 1O97C 3RRYA 1VBMA 2RGNC 4Z0TA 1LA2A 1U2PA 2FG6C 1JPNA 2H0AA 1JDBC 3ORSA 4H60A 3T52A 4KH0A 1DEOA 5E3JA 4Q7LA 4ZVMA 1U81A 3B1KA 2WAOA 4HDQB 3WZMA 3ICPA 1X7HA 1K6IA 2O2HA 4DDHA 3PIRA 4IG4A 4RS4A 3QEJA 1EIWA 1MO4A 1VKRA 2XUHA 4X64B 1SU8A 4QC2A 3EY4A 4UEWA 1T6ZA 2GYUA 1XP8A 2K7ZA 3L2OB 1A4UA 2ZSJA 4HVLA 3C7AA 2OXEA 1EP9A 1H93A 4UCXA 4A2WA 4EGQA 1FNCA 3CVJA 3CBGA 4RETA 1ZLYA 1GAXA 1P6XA 3DYBA 4PAQA 4B32A 2JG3A 3T4PA 3UWOA 1RWVA 1SOVA 3HR7A 3JYHA 2ZUSA 3MMSA 1C1DB 5TPWB 3GOHA 3VKFA 2HJRA 4HAIA 1IZ8A 2G4LA 4IO1A 4RSGA 1NVVQ 4I4TB 1QBGA 1SBTA 2GSWA 1LTHR 5T5QA 4XVUA 4HCJA 2Q4OA 1R4NA 2GKSA 2IXDA 5GVRA 3TUZC 4DIDA 1BU8A 3L4EA 3THSA 3ZE6A 3SKXA 3LECA 3MWKA 2JIDA 3LBFA 3O2NA 4KQEA 3TB4A 4ZK2A 5I5GA 3HNOA 1YI0A 2VDKB 3EVGA 3TZQA 4GE0A 1E62A 1KYZA 3AUFA 4NYMQ 2EGUA 4UEJA 1U7OA 4F9TA 3KTDA 1NLMA 1T2AA 2H54A 5DGCA 1U0FA 2O07A 5EPOA 3DE3X 4I9FA 2O5RA 4K9OA 4P7KA 2GK4A 4MGHA 4BAUA 4YYZA 2ACWA 4Z7NB 4K6OA 4PO9A 3DYIA 3H99A 3EMVA 1B26A 3NOXA 3OIGA 5BN5A 1HLGA 2ORIA 3CX8A 3ZCXA 1GTRA 1UWLA 1DTWA 2X5NA 4MGEA 3DJYA 4MW5A 4LF6B 1E5DA 1I10A 4P54A 1QRUA 1B0ZA 4UU8A 2PS9A 2WU0A 2F8TA 2PX5A 1Z2CA 2CHUA 4RGQA 3PG5A 4KIJA 2SECE 1NWCA 3G17A 3K15A 3B6EA 3NWJA 3SC2B 3SJBA 4M88A 3JRNA 4ITVA 3ZV5A 5JV5A 1SWVA 4G3XA 1JIXA 2BCEA 3CMMA 2GSDA 3FSEA 3HJHA 4YH1A 2BGWA 3ZHBA 4KKVA 1T3LA 3RD5A 2PMWB 5K6RA 2YZGA 5JBIA 1E6WA 3PI7A 4PSCA 2AG0A 5E4FA 2EX4A 2XNJA 1ZMOA 1JWBB 4H1VA 1Z0AA 5FCDA 4OI2A 1EVIA 4HDMA 4RACA 1SHLA 4TSRA 4JI0B 1E96A 4OXNA 4CR7A 3F6PA 3LUGA 4AKGA 2R8YA 1DUSA 4B73A 4HNAA 4RHFA 1RAHA 1CS0A 3FCXA 1HA3A 1RQRA 1N5OX 4TMZA 3TTTA 1EHIA 1ZGCA 5EPUA 1L1QA 2JIQA 3RVNA 1S02A 1RKUA 2X8JB 2E85A 3A1CA 5FI1B 3F98A 1QO7A 4M46A 1W88B 3VTZA 2ERYA 4HWSA 1R8SA 4QQ8A 5HBRA 1E32A 1UXHA 3EUAA 3NBZC 4BKUA 2P3OA 1CUFA 4JJEA 1U9IA 4C0JA 4KTVE 4UDXX 2JKZA 5DJ5A 2XKBA 4LCEA 1XI2A 3TECE 3VV3A 3K0SA 4FHCA 4YMIA 1F1JA 2QT1A 2ORVA 4NJMB 3PQ4A 1Y3AA 3HBFA 3TEFA 1IAVA 4JVMA 4UAGA 2E18A 3BILA 4BFZA 2ZYDA 4UHHA 4RA9A 1VBNA 3SDZA 3GFFA 2WWYA 5E6UB 3L4SO 3KEQA 5J2UA 1EPUA 1ZWKA 2DR0A 1NSYA 1ULBA 4K6HA 4V3CA 3ZKAA 3TPZA 4N41A 1QOPB 4G97A 3W90A 2CV1A 2IU0A 3PBKA 2JAXA 1E1LA 4WFKA 2O8VA 5CHYA 1H2HA 3QX7A 5EUQB 1UZNA 3HE3A 4H9GA 1LLQA 2XDYA 1UP7A 4X00A 5JSZB 1LD3A 3EDQA 2P0YA 1OY1A 2HMUA 2J59A 1KK0A 3RG2A 3T0FA 4R31A 1QRDA 2Q8NA 5IXSA 2RKOA 4IKPA 3GZJA 3FWNA 4K9SA 4LNUA 3UH0A 1IJEA 2V4MA 3IBTA 4W8GA 5JAOA 1A7AA 1KJIA 5DWDA 5CA1A 1E2NA 1W25A 1KOGA 2DQ4A 2Q45A 4WERA 3ZWBA 1UH5A 3GLTA 1QGYA 3V8NA 2JGLA 4KLRA 4AB1A 2QR3A 2UXCB 5I7RA 4R1MA 3AR4A 3N7UA 1I2ZA 2JFOA 4KXNA 4BZWA 1PFQA 1P2BA 4J6FA 4D82A 3L9WA 4QTYA 1SQ5A 3R5KA 3ML1A 4AMVA 4TROA 4TRRA 2XI4A 1F4PA 4H2DA 5AKZA 1AHPA 2VJLA 1L5KA 1PZNA 1T10A 1VHQA 4JLOA 1DAFA 3ANSA 1UDCA 2IUEA 3TBFA 3FMGA 1D1SA 3F4BA 3JQDA 4IOMA 3I5AA 3EEQA 2NMVA 3K70D 4OL9A 4CQJA 2WIFA 4YRTA 4UPEA 3A9TA 3D4NA 3PWSA 1NXSA 3FBGA 1H0SA 4D99A 4XSVA 4ZQGA 4DLTA 3MAJA 1GA1A 1FP4A 1LV8A 2WIDA 2WWGA 2X0KA 4ODIA 5GONA 4CR6A 4QJIA 4DQKA 1I4DD 1SBZA 1ZXLA 2QS9A 4FNGA 5I01A 3THWB 3P0EA 4F3TA 1A8HA 4U6SA 1AF4A 1OXSC 1S2OA 3M8KA 3HKDA 5I9MA 3S2UA 1I4WA 2QU7A 2XCTB 2WSLA 4D0RA 2VH5R 3SWWA 1EEXB 2JJ1A 1XDDA 3Q5GA 4CEJA 4D1YA 2VPTA 3VYWA 4BNDB 1XRJA 1CEXA 2ZREA 4OAQA 3TLXA 5A1JA 1Q44A 2A78A 2V7QA 3G1UA 1G2IA 4FBMA 5LA6A 3GQVA 4Y2QA 3V80A 1SMKA 4AMGA 3PNSA 3QVKA 2LUOA 5C8YB 2I78A 3Q9UA 4MWDA 1K8XB 1WOMA 1GL6A 2X8WA 1C4KA 3BYZA 3DMHA 4LHYA 4FOSA 1YE5A 3AY6A 5JXGA 4A15A 2ZR8A 3O4JA 3UIEA 1ZH2A 4HV4A 2X1MA 3K5WA 1XZQA 4MWBA 3U3DA 2B9EA 1R66A 4PX3A 4CVNA 1MT3A 4ZVQA 1X8JA 1U2GC 3RK1A 5AOBA 2B25A 3IAUA 4JLMA 4F6LA 3TI7A 3FF1A 3WMEA 5AKXA 5AVVA 1PSZA 1TK3A 2J3JA 2VRNA 3L1VA 1KVUA 1KQFA 2G63A 1CY4A 1UM9A 4GHWA 2OHHA 4B6SA 4F3YA 1TDJA 1F2TB 1DBSA 2EGHA 3LHFA 1ZN2A 5CITA 2A1TR 4Q7EA 1DWQA 5COAA 2POQX 1WD5A 1E2GA 1PVOA 2HQ1A 4X1YA 5KO2A 2AG5A 3T5PA 1YNOA 3JWGA 4TLCA 1OT3A 5G0SA 4ZQHA 5ALEA 1UFQA 4KXYA 4HH1A 1C0KA 1T9GR 3LVFO 4LJ8A 1BQ3A 16PKA 5F5LA 5EXPA 4OHWA 3W8DA 1ESEA 3E3LA 1UKEA 3WWDA 4EQ6B 5KX5A 1CJVC 2QIOA 4PFKA 3EF1A 2R00C 3EQ2A 3DC2A 2C61A 4DCMA 5A9SB 2Z8YM 3HKEB 4INOA 2OAQ1 3NVMB 1QIDA 4L9SA 4Q9HA 3SK0A 5ES4B 1K8YB 5H82A 3I30X 3KXLA 1CZKA 1NW7A 2O1WA 1XNJA 4KI7A 3DEFA 1W48A 5LQRA 1OSNA 1DJMA 3LDAA 3MCZA 3WX0A 3N8HA 4P31A 1J8YF 4EARA 2ZITA 1TM1E 1N5IA 2CZQA 4CNBA 3HDYA 3AU8A 3R6TA 1O0CA 1ZH4A 2GJ8A 4DDTA 2B2XA 4DPMA 2W2LA 3RFFA 1DEXA 1AD2A 2CXUA 4NMMA 3T7KA 5LMNB 2FR8A 3AR5A 4HXEB 5FOXA 3ILXA 4WXEA 3RRNA 4YMVA 5AVRA 3ORFA 2QJWA 1H1TA 2PXAA 1DARA 1QF7A 3E7PA 5DHTA 3URKA 3ZD9A 5ETJA 4JLAA 4DSNA 2YRFA 3KEGA 1C9EA 1CIVA 1PTJA 1X9IA 1LVGA 1XRPA 4LX8A 4NOKA 2WSSD 3CF6R 5CCDA 5EIBC 3EYWA 4ISBA 5BSWA 1CNFA 1H1DA 2VF5X 4J6EA 4XH9B 3K05A 1J7JA 1ZZGA 1EK0A 2GPWA 5DT9A 3B85A 1K06A 4OMUA 5HJ5A 2NTJA 4YASA 1A95A 3F9RA 4FQ7A 1NN0A 3EXIA 2JFYA 3PXCX 1DQSA 4H31A 1UPUA 3VHXA 4DWVA 1DJOA 4CMIB 4FYKA 2AOVA 1T35A 4CT5A 2HSDA 3BEOA 4LECA 1SBCA 4A03A 1WHTA 1WXFA 4DCSA 2BJWA 4YUAA 3VM6A 1ULZA 2PJZA 5DI3B 4Z0NA 5IP5A 4KVFA 4E0BA 1G8MA 4R81A 2C54A 3SFZA 3NH6A 2B4RO 2O0LA 1EDBA 3EMDA 4ZEWA 3WGNA 1N4DA 2R2GA 3C3BA 4EWLA 3SZOA 5T7BA 1Z82A 2PGNA 5GWXA 1MO5A 5JPIA 3LNTA 2ZUWA 3WYAA 4EF6A 3BICA 1O95C 3ZWAA 3ZIDA 2XE6A 1GNSA 3PR1A 4EMSA 3GCGA 6AT1A 4GPIB 4RMHA 1M3SA 4NBRA 2VDPB 2C7BA 1RBMA 4I4CA 1ZUNB 4MDEA 4F3NA 1MC1A 3BHNA 3CUWA 4LJYA 5CDFA 1PL8A 3O9VA 2ADOA 4MYUA 1NW3A 3UA4A 3EUWA 4CCYA 2ODNA 4KN8A 2YNMA 3AR7A 3F46A 1PSWA 4UTPA 5HSGA 3G0HA 2V6GA 2MWMA 2RH5A 4X45A 1Z5GA 2NTYC 4OLBA 3C1AA 3ROMA 2FLWA 3SF0A 3WNDA 4D4MA 5CLGA 1ECPA 4GH5A 3RSQA 5IABA 1VSTA 1CDZA 4RLHA 4KJXA 2CDRA 1GTL1 3T1HB 2FRDC 2HSEA 1FXSA 4ZYYA 4TKVB 1T0HB 1N7IA 1X7ZB 3QEBZ 1SUCA 1W4RA 2AYXA 3NTRA 4ZOAA 5CA0F 1I6LA 1KZYC 4D25A 1JHXA 1N0HA 1WUTA 5DN6A 1JKXA 1DE0A 1ZD8A 2ZZKA 4K6FA 4O2BB 1Y6ZA 1Y6QA 3HYCA 1E92A 2VTVA 3H6HA 1KFCB 4I8XA 4MROA 4XB6B 2RGBA 1NBIA 5BV2P 5KNBD 3MD0A 1Z0JA 5AYVA 4CUJA 4CEIB 1T4GA 2G71A 3WV5A 3N8NA 5IZCA 2OQ2A 1L3IA 3IIMA 4KNWA 5CTAA 2FUG6 2WINI 3D6MA 1NNLA 3CWQA 3NOVA 1GU0A 3GFRA 1FTYA 3GA0A 2CLDX 3K72B 2W2KA 3LKVA 1JSXA 1YRYE 1PJ8A 2D1FA 2PWBA 3ETHA 4O6VA 5IHXA 4B2LA 5FOVA 5JSYA 1ESMA 2R5FA 2Q4BA 4GOKA 1G8YA 4H7EA 3K96A 3GFOA 4XA8A 2P77A 1RQXA 3JU3A 3Q11A 2VXYA 5TPZD 1B7GO 1MD9A 3H5AA 4UTOA 1IIRA 5JEDA 1U5CA 4LAFA 1QO0A 2B3TA 4G4GA 3C3WA 4HWKA 1N2ZA 1J33A 3BA6A 4HYYA 4UD6A 4KE8A 2BTOA 5J9FA 4CDGA 1R9MA 3PFFA 3JD3A 3CNQS 1EWRA 2G04A 5FJJA 3WHLA 1WBDA 3KUDA 1J0XO 2NSHA 1Z3IX 1G2OA 5FORA 4BKOA 4WXMA 2ADMA 2M9MA 4D4JA 3THRA 4CCAA 2ISQA 4W9MC 2CNOA 1HE5A 2X8BA 4OHKA 2I2BA 2WV7A 1F6BA 3NETA 3CINA 2P9EA 2QGFA 3I12A 5B3JA 4EFLA 1ZD3A 4ANFA 2IH5A 2XCOA 1I32A 3BK2A 4FXPA 2IP4A 1U11A 1P0FA 5EVCA 5HF5A 3TOZA 1OAOC 5A3QA 4EG7A 1LS6A 3D4LA 3HNPA 1HR0B 3T3DA 4QJ3A 1T5IA 2UUOA 2GQ0A 2FSIA 5J2TB 1PWHA 1ISHA 2XF2A 3JWPA 3K1ZA 5FNZA 5AO9A 2P11A 3BGOS 3UO8B 1WP4A 3NHRA 5AVYA 1JA9A 2H4ZA 3WLIA 1YTUA 4PLPA 5HJ7A 4L4UA 1RXUA 3R0ZA 1FFDA 5M5BA 3FJYA 2JBAB 5MFPA 2HA2A 4CG0A 5JBNA 5B3AA 1XKTA 1AMUA 1LQUA 4NPAA 2YBEA 2PSJA 2W2VA 1CUDA 4O2AA 3HVIA 4MW0A 4B6EA 2XLCA 2HDHA 5DBEX 5K0ZA 3AGQA 1KARA 2VNIA 2ABWA 4N6OA 1FNDA 1ZPDA 3IXMA 3G7UA 2O5VA 3NHSA 3ROFA 4C6TB 4FHFA 2GT1A 5DP1A 2C92A 3FKSD 5K0GA 4ZT7A 4R1SA 2HFJA 3VU3A 1WKBA 3ZWCA 3NALA 3PCRB 3ANLA 3C6BA 2PA0A 3QVLA 4QOFA 2JFHA 3DMPA 2XSZD 2UYYA 3RUEA 1U0LA 1RBYA 4G86A 1IXZA 3SZLA 4TVSA 4IOKA 1ST2A 2H17A 4IIJF 4KDFA 4LF9B 3KE9A 3UXEA 3HJUA 1UZUA 4EY5A 5FD8A 5IAGA 1YV9A 3ENZA 2MSCB 4BO8A 1BC5A 4CI0B 1IZYA 3EAFA 5BSMA 3SZGA 1U0EA 3KOZA 3ODGA 3TZLA 4HWGA 3UT6A 3GBPA 2H31A 2IYAA 4U7HA 4UZSA 4DWOA 4B45A 2Z5VA 1T1GA 4JI2B 3CR8A 1A2BA 4CG1A 2Q5HA 4QOJA 4YAIA 3VSCA 1IOVA 2E37A 1H1LA 3JQAB 3FDJA 2BFMA 3K4PA 1L4FA 1LNZA 4JXJA 1QC5B 3OLZA 3F7OA 2FYTA 4JJGA 3HB0A 3WWPA 3PGVA 3C7TA 4V3BA 2HCTA 3SSAA 2ZJ2A 3ASZA 4XQ0A 3B9QA 1TAGA 2P9GA 3CH7A 3E7FA 4DG5A 4GBMA 4QHYA 1G6OA 1DXHA 3V4VB 1VYHA 2CW5A 1NKVA 3I45A 3M6MD 4X41A 2ODQA 2P2SA 2GOYA 3FUTA 1OOEA 6YASA 3EQ7A 2J31A 1I2DA 4GXTA 2WD7A 5DM70 1BWQA 2VPYA 2VBFA 3ICCA 3VR4D 4RMNA 1HE1C 4Q9DA 4YMHA 1WPRA 2PU5A 1FFBA 3LV8A 3L7BA 3E5HA 1GUAA 4IMPA 1HKUA 3DOOA 3E3OA 1TAHA 1K6XA 4OYHA 5BSTA 5LR6A 3N2YA 4EAQA 3CVXA 1RVV1 5GJVC 3A2NA 3GMTA 2ILTA 4KFSA 4OH7A 3M5WA 2XRYA 2C5HA 3AJ8A 4YGYA 5ICSA 4ER3A 1CY6A 4EY3A 2BLLA 4PG8A 3DVQX 5KJFA 2P3SA 2ADFA 4GOLD 1SC4A 1COWD 5CLQA 1MH9A 3SFVA 3U4AA 2OL4A 4OP1A 2RHHA 1B8NA 1M1NA 1Y4AE 1NONA 3EEFA 4C01A 1KSHA 2EJCA 3N1UA 4CV0A 2I7TA 5J47A 3UJPA 2WM2A 3ABZA 4X6UA 5FR2A 2H18A 3K0FB 4B85A 3VTAA 3ULKA 1E99A 3BWCA 3I1JA 4PTYA 4YAUA 1HTTA 1IPHA 3EIHA 4M49A 4B79A 2C1ZA 1MOZA 4WOCA 1E0SA 1SJ9A 2H9YA 2HD4A 2XH8A 3AEUA