4RORA

Crystal structure of malate dehydrogenase from methylobacterium extorquens
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
319
structure length
319
Chain Sequence
ARSKIALIGAGQIGGTLAHLAGLKELGDVVLFDIVDGVPQGKALDIAESAPVDGFDAKYSGASDYSAIAGADVVIVTAGVPRKPGMSRDDLIGINLKVMEAVGAGIKEHAPDAFVICITNPLDAMVWALQKFSGLPTNKVVGMAGVLDSARFRHFLAEEFGVSVEDVTAFVLGGHGDDMVPLTRYSTVAGVPLTDLVKLGWTTQEKLDAMVERTRKGGGEIVNLLKTGSAFYAPAASAIAMAESYLRDKKRVLPCAAYLDGQYGIDGLYVGVPVVIGENGVERVLEVTFNDDEKAMFEKSVNSVKGLIEACKSVNDKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Malate Dehydrogenase from Methylobacterium extorquens
rcsb
source organism Methylobacterium extorquens
molecule tags Oxidoreductase
molecule keywords Malate dehydrogenase
total genus 114
structure length 319
sequence length 319
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2014-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rorA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4rorA02
4JK3A 4XRRA 2B4QA 4FSHA 1PJLA 2EW8A 3F9IA 3I9OA 4HNGA 5JO0A 2NM0A 1OOEA 3AJRA 4RO0A 3RUCA 3ASVA 3SC4A 3RUEA 4XYBA 3AU8A 4IDAA 5DN9A 2IYOA 4ZQEA 1EE2A 2Y99A 5GMOA 4WLEA 4PG8A 2IZ0A 1PJ2A 5JNLA 3L4BA 1W0CA 1DFIA 1R0KA 2Y68A 3GZNA 1CQIA 4IJWA 2PFGA 3GPIA 2QRJA 3S55A 4O59O 2VWQA 5DDIP 5T57A 3SEFA 1ENYA 2UUPA 3GFBA 1NQAO 1GD1O 3JSAA 3VH3A 3DZGA 4XQ9A 4MVJP 5JDIA 4Z0TA 3U4DA 1K6IA 4YR9A 5BSHA 2WE7A 2PZMA 3WFIA 3GDOA 3HDYA 1NHGA 5CPBA 4BIIA 4CQLA 4XWYA 3RJ9A 4ROSA 4RPKA 3L77A 4HXYA 3WOHA 3HWRA 1J4AA 2YZ7A 4GKVA 4IMRA 3ZWCA 5KJCA 4BNHA 2IEDA 1SBYA 1QYDA 2DC1A 1B8UA 3ZW9A 1PQUA 1ARZA 3LT4A 4A03A 1Q7BA 1NWCA 1BXGB 3GVIA 1RPNA 4NMHA 3WGHA 3ANNA 4E5PA 2H63A 1V9LA 1FDUA 1K3TA 5AXCA 1YOVB 3RWBA 2POQX 1NM5A 1P44A 5TT1A 1EDZA 4WEQA 1H94A 3FN4A 3RAJA 3RC9A 1JKIA 2EGGA 4XRGA 5G0TA 1ISFA 2J8ZA 9LDTA 5JCXA 3GVHA 4R69A 3GT0A 4RF2A 3C85A 5CDTA 4CM5A 4AJNA 2X8LA 3D5TA 5I8ZA 3OIDA 1R4MA 3UGKA 1SAYA 3RU9A 3W8EA 2GCGA 4TZTA 2J5QA 1OZAA 3U0BA 3OFSA 3HB5X 3S1LA 4JBHA 1O89A 5IN5A 3L4SO 1PQPA 3GA0A 2O2YA 3F4BA 5ITWA 3PK0A 3JYOA 4WLFA 1PJQA 1MP0A 2ZCUA 3CMMA 3WIDA 4GH5A 4GMGA 1ZMTA 2IXAA 3GN2A 3I1JA 3E9MA 1DAOA 3GG2A 4JX8A 5TIIA 2O4UX 1N2SA 1NQTA 2QIOA 3OMLA 2OORA 3FBGA 3F47A 4FGSA 1WPQA 3LLVA 4KUGA 2BFMA 4IMPA 3CUKA 4EBFA 2G5CA 3TF5A 5A02A 1XQ1A 1C0LA 5LDGA 2PV7A 3VC7A 1R16A 2Q49A 4A0SA 3GVPA 2GF2A 1WZEA 3CIFA 3K8ZA 5IF3A 4MINA 2JAPA 3PHLA 4MPDA 1RM3A 2BD0A 2GDZA 3Q3CA 1CRWG 3RFXA 2WSBA 5F1KA 3PHJA 5DULA 5A5FA 1GYRA 1O0SA 2GUGA 4CMBA 4J90A 3DONA 4YEDA 1Y7TA 4O5OA 1JA9A 3QVWA 1AXEA 3ZU4A 1P33A 1TT5A 1KOLA 5T5QA 1WW8A 2FZWA 3W1VA 3MZ0A 4ZICA 4BNUA 4XDYA 4II3A 1LDEA 3FNFA 4RGBA 1LA2A 1IPEA 4YXFA 2X86A 3ONDA 1ADBA 1B3BA 3GPDG 3RJ5A 5A06A 3DO5A 1BDMA 3L6EA 3ZU3A 4BV9A 3E18A 1PSDA 1GR0A 4XB1A 4B7XA 3TL3A 3HSKA 2Q4EA 5G2OA 1EBFA 1VSVA 2VUUA 2CF5A 4YA6A 1WMAA 4QSMA 4ONEA 1PS0A 2D5CA 3TOZA 1PGOA 3E9NA 4Z9FA 4RPHA 2GSDA 3FR8A 2P5UA 1PU2A 1V8BA 4MIEA 4DPLA 5JXWA 1C1DB 1RM4A 1W4ZA 4CV2A 1OFGA 3KLMX 4L9RA 1YDWA 4YTEA 1JW9B 4BNIA 4QQRA 2X22A 3ONEA 2DM6A 2GZ3A 1EVIA 1I3KA 1JAXA 1PS9A 2JJYA 3PFFA 4QECA 4QO7A 4WLUA 1E7QA 4HY3A 2B35A 3ZHBA 2J5KA 1HDYA 3NTOA 2DLDA 1S7CA 2CZCA 1T26A 2HO5A 3NRCA 4IXWA 3QVXA 4UVGA 3W4JA 8ADHA 3AY6A 4J1TA 1W6UA 4PN3A 4P4LA 1HETA 3UAGA 3RUIA 1MFPA 4KWIA 5C3MA 1AXGA 5A1TA 3WNQA 4AJ4A 3IJRA 1QYCA 1DC4A 4U0KA 1P45A 3FPCA 3DZJA 1LDNA 4GMFA 5A9RA 2I65A 3CKYA 3QLJA 4XQEA 2A9FA 4NR0A 4Y98A 2FR8A 3PJEA 4R3WA 5H82A 1K5HA 5TT0A 5HS4A 3ICCA 5HBRA 1Z7BA 4DLLA 3GDFA 1C3VA 3BXXA 2YW9A 2VRBA 5G4KB 1YL5A 1TXGA 3KM0A 2I9PA 2GN8A 1UAGA 3K73O 1HE4A 2G1UA 1ISMA 3WG9A 4EUFA 5KVSA 3IS3A 1Z7EA 4R68A 1KBZA 3ON5A 2YYYA 3DQPA 1NYTA 1Y9EA 4YT4A 2J3IA 2O50A 3PZRA 4YAKA 1SPXA 3T7EA 2LDXA 3U4HA 1KETA 1DHRA 1LRKA 1VJ0A 1YWGO 4I9HA 1Z6ZA 4YB8A 1ZO8A 2GNAA 1R0SA 3I4CA 4ND2A 4Q3DA 4GX5A 4DPKA 1NPYA 1NBOA 3IMFA 1VPDA 4PVCA 4RL6A 3FTNA 2O7SA 4AJKA 3CMCO 4J9VA 1MXFA 1GUYA 5G0VA 3WQRA 5B4UA 2O2SA 3ETGA 5B4VA 2B37A 4MKZA 4RJTA 1N5DA 2P9EA 1XDWA 1VC2A 1QYXA 1JVBA 3OIGA 2PLAA 1PL8A 3DR3A 4H16A 1AGNA 5AOVA 5CG1A 1VKNA 3PYXA 1NXQA 4CMHA 4RV9A 3PWZA 3RD5A 1CERA 1X14A 2C2XA 3QE3A 1T2AA 1UZMA 3KOUA 1M67A 4B4VA 4JGBA 1VLLA 3JYLA 1XSEA 2B5WA 1PR3A 1MG5A 2Q1SA 2XAAA 4I9NA 1T2DA 2C5EA 3EHEA 1PX0A 5A3JA 1GYQA 2J3HA 3F1LA 5JLAA 3TFOA 4Q3EA 3I23A 1H6BA 1MB4A 3K96A 3JD4A 4ZQFA 1PZFA 1HYEA 4DIFA 1WVGA 3BMOA 1HDXA 5CEFA 1ZXLA 2O4CA 4IIVA 3TZKA 3AWDA 1NAHA 1P1IA 1YBAA 4RVUA 5COQA 2FWMX 3ZWAA 3L4BC 4LVUA 3B20A 1HDZA 3ITDA 4CUZA 3WR5A 2O3RA 4FQ8A 1ZJYA 4CV3A 3X2FA 2EWMA 4RF3A 1EUCA 1ZFNA 2PH3A 3DBRB 4WCDA 5HM8A 3P19A 3GEGA 4S1VA 4AJOA 4E30A 3PPIA 2ZTVA 4FFMA 1RM5A 2NTNA 4OKNA 4WNIA 1QKIA 1NPTO 4OH1A 2FR1A 2GERA 1JWAB 2YUTA 3NJ8A 5TX7A 4E6PA 1YB4A 4KDFA 3RFTA 3AY3A 1U2DA 3K30A 3PDUA 5L53A 1I0ZA 5DBFA 3JQ9C 4LW8A 1DLJA 4UVHA 3SVTA 4BO4A 4MVJE 3K2EA 5EERA 1SOVA 1GEEA 2GRAA 4U0JA 1IHXA 1AHHA 2D0IA 1P1JA 1DJQA 1N7GA 2NQ8A 1Q0LA 2VQ3A 2V6FA 1R4MB 3NX4A 3PYLA 2CDCA 4N54A 2DTEA 4PG6A 5DCYA 3CTMA 2GPTA 4N5MA 2A94A 4OXYA 2ZB3A 4HFJA 3RROA 1NR1A 3C7DB 3S2FA 2OZPA 4UREA 4YJFB 4TROA 2W2LD 2VT3A 4BL5A 2XOXA 5KKCA 2VZ0A 3TZCA 1TVEA 5CAEA 1X0VA 3QWFA 1B14A 4N5LA 2JFGA 4IQ8A 2HRBA 1E3IA 1DC5A 3F1KA 2BH9A 1OBFO 5DBGA 1DC6A 4JXKA 1PGJA 3ZDFA 3G3EA 4L75A 1HDOA 1F8GA 1NAIA 2Y1DA 3ZWBA 3DZKA 3PYMA 4CQMB 1JWBB 5A5EA 1HTBA 5I7FA 1I2ZA 1L1FA 2WM3A 1XQ6A 1DDOA 4CUJA 3D3WA 3W4KA 3ENKA 2WYUA 2O3UA 4DIBA 1SO8A 3W8FA 5F21A 1A4UA 3Q9NA 4HP8A 3H5RA 4JJGA 1PZEA 3IC5A 4CM7A 5JAIA 2NVUB 1JTVA 5ES3A 4TSKA 1A72A 1SEPA 4YJGA 1HYGA 5KVVA 1E1KA 5KTKA 2VTDA 1HXHA 2BI7A 1QP8A 3AUSA 1I32A 4P4GA 1C1DA 2FHSA 2Q1TA 2PK3A 1PGNA 4D0SA 3HQ4O 2W90A 2VNSA 4IDGA 3AI1A 3PEFA 4CQMD 4DGSA 1I24A 3DOOA 3WMXA 5I9LA 3ZNOA 4DQVA 1LTHR 2Z1MA 2B0JA 3HADA 1QLHA 3VVCA 2Q1UA 3GC6A 2WD7B 1QV7A 4NK4A 5CDSA 4RVDA 5HWSA 2V7PA 1M76A 1SMKA 3NYWA 3PGJA 4Q3BA 2OFPA 5DCUA 5JDIC 2HSDA 2V65A 4NFYA 3V5NA 1GZ3A 3P2YA 1I3LA 3VH4A 3VKVA 2X9VA 2UDPA 2CDAA 1E1NA 4ZRMA 5AQ1A 3ZNQA 5BSFA 4Q3NA 5FI5A 2ZKLA 4ILKA 2ZTLA 4YJHB 1TT5B 1F12A 1H6AA 2CNBA 3JD1A 1PTJA 2H9IA 5ITVA 2E49A 4MIOA 3F3SA 3GRKA 3E1KA 1XCBA 1ZH8A 4B7CA 2EJVA 1IOLA 4WNCA 4MVJM 4NI5A 4OYRA 4W7IA 3UH1A 1ZK1A 1RJWA 1KC3A 4DMMA 3GF4A 3GHHA 3GGGA 3BTSA 4FW8A 4G5HA 1X7GA 4GLLA 4XJTA 5CDUA 4NJMA 1NQOA 5FF9A 3S8MA 2VZ8A 1ZZEA 5G0UA 1AUPA 2DU8A 4CMJA 2VHVA 2ZQYA 3ORFA 3KZVA 2GLXA 3AW9A 3B1JA 2EKPA 2HMUA 1MX3A 2GASA 2OXIA 1Z73A 3KB6A 1XU9A 5EINA 5JYEA 3D4PA 2FN7A 1LSUA 4BKOA 3NAQA 1BXZA 2NSDA 3LU1A 4B4OA 3DBHA 5GZ1A 3AUTA 5JS6A 2NLOA 2YV2A 3U4CA 2JD1A 3H6KA 1YQGA 1Y81A 4E33A 4XYLA 5EIOA 3JQEA 1U5CA 3GR6A 2BI8A 2J6IA 4K1LA 3V8BA 1PJ4A 4CLOA 3GEMA 1EQ2A 1E3WB 5DP2A 3PRJA 5A03A 1YS4A 5CHEA 2YJZA 3PQDA 4MKRA 3COSA 4FFOA 2VYND 4J6FA 3JQ8B 2NU7A 2BF7A 1KVRA 1HSZA 5THKA 3PQEA 4KUEA 1MGOA 3GEDA 3WX0A 3IUPA 1LEHA 1T2FA 1PZGA 4A7PA 1XGKA 1SOWA 3ROMA 4HBGA 5I8WA 3GH3A 4FJ2A 1PS8A 4EJ0A 1ZSYA 3I6IA 1IPFA 4R5MA 4YJGB 4HFMA 4TVBA 3AM4A 4JP3A 4BO8A 2FR0A 4OGWA 4B4UA 1Z75A 1U3UA 3KO8A 4PZEA 5TGDA 5KOIA 4CLRA 2BELA 1IZ0A 1B16A 3I9MA 4CM8A 3D3WB 4E12A 2A35A 4DL9A 1QG6A 1JKFA 1T1SA 4FDAA 2Z5LA 4TRJA 3ULKA 3OJOA 4B8WA 1BVRA 1Z82A 4WASA 2HRZA 3TZQA 3NKLA 5CEEA 3F6YA 2AQKA 1C0KA 1GV1A 4ALJA 4CPDA 2HDHA 2IE0A 4BO5A 1WWKA 4J7CA 7ADHA 1B8VA 1PJBA 2I6TA 2QZZA 3JQ6A 2HQ1A 3M2TA 1U1IA 4BNGA 3H9GA 4E5KA 4KMSA 2PTGA 2NU6A 4J43A 2VRCA 4N18A 5FWNA 5KCZA 5FEUA 2UVDA 1I3MA 3L6DA 1HRDA 4BMVA 2B4TO 3RC2A 3QWAA 4KZPA 3HDHA 4G81A 1E7SA 1CF2O 4R3NA 4ALIA 1GL3A 2AXQA 1U4SA 2GN9A 3EW7A 1IULA 1IY8A 3JQBC 1ISJA 3DL2A 3KSDO 3HHPA 4PCVA 4BQRA 2ZB4A 4RQUA 4G65A 3L9WA 4PLGA 2VOJA 3ITKA 3MCVA 1PWXA 3NTRA 3CZRA 3MTGA 3TQHA 2O7QA 4JJIA 3B1KA 1DIGA 4BMSA 3HNPA 3TZHA 3SLGA 3LQFA 4ND4A 3JCZA 4S3MA 1GQYA 1I01A 4BO1A 2C7VA 3HJAA 2J5RA 5JDCA 1QLJA 4E2ZA 4RVFA 1QXSA 5C37A 1T2EA 1U2GA 2PA3A 3U4IA 2Q99A 4M86A 5LDHA 3IUSA 4EGFA 3UN1A 5K0ZA 4FFLA 2HMTA 3GMSA 3VTZA 1RYEA 3U62A 4CMEC 4MIYA 4GL4A 4BNTA 2Q50A 4UULA 4GX1A 3O8QA 4CM4A 4NHEA 1KVSA 2JL1A 3IDSA 3STHA 1UXIA 4CR6A 4FB5A 4Y8VA 5FI3A 5DT9A 5EMHA 1LDMA 3O8QB 4CV0A 4CLHA 1IUKA 1LSSA 4M54A 3E5RA 3N58A 4HADA 3V2HA 2V6BA 2FMUA 3GUYA 5G4LA 4B3JA 3RVDA 1ZVMA 5JAMA 3I9NA 4LRSB 3KYCB 2E48A 4GI2A 3BA1A 4B3IA 5A9SB 3MJEA 4IXTA 5A9TA 5I7SA 1ZMOA 4NFHA 4BVAA 2C07A 4KWHA 2BGKA 2ILTA 1JLLA 3F5SA 2OBNA 3LC1O 2PWZA 3FBTA 4FOSA 1U5AA 3TL2A 1N7HA 3WGZA 4J1SA 5H81A 3VH1A 3GNTA 2Z1NA 3LC7O 4GVLA 4J4TA 4AJ1A 6LDHA 4YYZA 3DOCA 3E48A 5IDQA 4CLXA 1ZK3A 2ET6A 3JTMA 4FFPA 4CR8A 2FSVA 1ENPA 5CG2A 3U9LA 2QRKA 4FCCA 3WQSB 1UH5A 3BMCA 3I83A 3ZZNA 4GX2A 4E13A 2X7HA 1AE1A 3SC6A 1D7OA 3VTFA 4AJEA 3DC2A 3NDIA 3A28A 4NU6A 4EEZA 4CLEA 4RZHA 1ULSA 1XR3A 2UUOA 4QX6A 3LT1A 1I3NA 2PKRA 3RKUA 3GGOA 4IDFA 3MOIA 4YAIA 2ZTMA 4YRDA 2DUWA 3PDJA 1N92A 5JC1A 3EGOA 5EN4A 1N1GA 2HK9A 1SC6A 4B7UA 3ZU2A 1C0PA 4XGIA 2WMDA 2NACA 3G79A 4AJHA 4TRNA 5KWEA 4ZJUA 1E3SA 4M87A 3LK7A 4XYMA 5HTOA 1HT0A 5KVQA 4YCAA 4CM8B 1HEUA 2AQ8A 5ER9A 2X9GA 3DHNA 3ENNA 4E3ZA 3G17A 2A92A 3D5QA 1E3EA 1KS9A 2QRLA 4RPGA 3JQ7A 1ML3A 4HWKA 3VZRA 4NK5A 3FF4A 1WDLA 4DLBA 3A14A 2AG8A 3ADOA 3D7LA 5F5LA 4DVJA 3HFGA 3VKUA 4J4BA 4RORA 1UXGA 3O26A 3OICA 3H9UA 3Q2KA 3WSWA 1FJHA 2AEJA 2A4KA 2DBRA 2FRDA 4WUVA 2X6TA 1BMDA 3JQGB 4OHUA 3I52A 4TZKA 3O4RA 3OQBA 1EE9A 2P68A 4WCFC 1U8XX 3KHUA 5T8KA 3BMQA 1OMOA 3ZGYA 1I33A 3AOEA 4PGFA 4PFJA 4GSLA 4E21A 1DRUA 1ZJZA 2FOIA 2FP4A 3X2EA 2BKAA 3FR7A 3KEQA 4YAEA 3H5NA 1Y8QB 3HUDA 1LQUA 2HU2A 2ZTUA 3K31A 3O38A 3PHIA 4CMAA 1TT7A 4YBZA 1EK6A 3KBOA 1VL0A 1MFZA 4IJKA 1DO8A 3H7AA 3UCFA 1BHSA 3FI9A 3QWHA 3DBHB 1NTOA 1ZXBA 2B69A 3FCOA 1F17A 3OH8A 4R5HA 3OQ6A 4Z9YA 2D1YA 3DOJA 4Z0HO 1P3DA 4NH4A 5BQFA 2PGDA 3V1YA 3I4FA 3KSZO 3PWKA 3FTPA 1E7YA 1NFFA 1G0NA 2WEKA 3OETA 5JYDA 1U28A 5L7TA 2NNLD 3LSYA 1YONA 2DPHA 4D46A 3BHJA 4XYEA 3RQSA 3R3JA 1LLCA 4TKLA 4PVDA 1ZSVA 3K5PA 2Q2QA 4KUHA 4ID9A 1F14A 4RLHA 3R3SA 1Y5RA 3OEWA 1X7HA 3DMTC 3KSUA 1LRLA 1V6AA 2WWRA 5L7WA 1DB3A 3ROPA 3M6IA 3FWZA 4J2OA 1P77A 3KLPX 1JDJA 4DIOA 5KJFA 3WIEA 4E2WA 1Y8RB 4Z6KA 3PFWO 2VZ9A 4N7RA 5I7EA 4PZCA 5MGBA 4D7AA 1IYZA 2G17A 3A4VA 3ZW8A 2O3TA 1F06A 4KTVE 2EKLA 4YJHA 5CDYA 1WZIA 3TWOA 1GYPA 2C20A 4XD2A 4UEKA 1EQUA 4K26A 3JQAA 3EDMA 3EK2A 3L9XA 3T4EA 1LU9A 4FJ1A 3VH2A 3GQVA 1FDSA 3FHLA 5B37A 3B70A 3DAPA 5T8KC 2SCUA 3ZWVA 4E4YA 2WD7A 1B26A 2GD1O 1VKOA 2QG4A 1VSUA 4LSWA 4PLCA 2PD6A 4JROA 3JQ9A 4PG5A 4BS9A 1LXCA 3PP8A 1I10A 2DBZA 2Q2WA 3JQBA 2YHUA 2QQ5A 3WTCA 2EEZA 3WYCA 4F3YA 1LDBA 4OM8A 3W4IA 3GUCA 1WXDA 3I3OA 4GVXA 4JBGA 4A26A 4BO3A 3GGPA 1NX6A 3TSCA 4XR9A 4NU5A 4XR4A 2CDBA 1IHYA 4R01A 5IAAA 1YOVA 3QA9A 4Q3AA 1JU9A 3I9LA 4QO8A 1H6CA 2TMDA 2B36A 1BRMA 1GAEO 3FWNA 3H8VA 3V1TC 2RBEA 3RC1A 4U6SA 3C3XA 2JFHA 1KYQA 3WYBA 3PLRA 3JQAD 2BHLA 1O5IA 2XPCA 1DEHA 4CMEA 4PLTA 3EYWA 4Q39A 2YHIB 4WLOA 3I9KA 4A27A 4D41A 1WNTA 2AA3A 4OSOA 1NR7A 1YBVA 4DA9A 4PRKA 4PZDA 4CM1A 1Q7CA 2NVUA 3HFSA 1X1EA 2OGUA 3MEQA 2NVWA 2R00A 4OXKA 1DFGA 4MKXA 1NPDA 5I9NA 2E37A 1WLYA 4LCJA 3Q1LA 1NNUA 4RLSA 1EBUA 1NFQA 2GZ2A 2NTVA 2EP5A 4RCVA 5KVCA 5EL0A 1PGQA 5L4NA 2E4AA 2QW8A 3EUWA 3GLQA 4YACA 4WPGA 4DC1A 3GZNB 3IOYA 4DPMA 4AJLA 2J3JA 4J49A 1PJTA 1NP3A 3PQFA 4NZ9A 5DP1A 1GQ2A 2OMEA 1MA0A 3WGYA 2JD2A 2VYVA 4OKIA 3JD2A 1UXHA 5A04A 1WDMA 4IZHA 4L74A 5L45A 1PWZA 4UUNA 1H9BA 1OAAA 4AJIA 2F1KA 1A9ZA 1HZZA 5GY7A 1KVUA 1ZBQA 1ENZA 4BO2A 1ZIDA 4KOAA 8LDHA 2YV1A 1A7KA 1C0IA 1R4NA 1EEHA 1FDVA 1EDOA 1AHIA 4XJSA 5F5NA 3NEPX 1GV0A 3ZV6A 1C1XB 1NQ5A 5HS6A 1LX6A 5K6AA 1UXJA 4URFA 2Y0CA 4NBTA 1SNYA 1H9AA 3OJ0A 5KKAA 3DZFA 4M89A 5ADHA 5GZ3A 1YVEI 4LISA 1U8FO 1FDTA 4DTIA 2WJPA 3P7MA 3LZ6A 1S6YA 4FC6A 2PD4A 3QVTA 3AOEC 2C7GA 3GK3A 3NGXA 3S2GA 1ISGA 1GCOA 4WJZA 4F6LA 4W9NC 4ZD6A 1HZJA 4RPJA 1CDOA 3OA0A 2G82A 3CEAA 4XDZA 4ALMA 4F6CA 4HKTA 4I5FA 3K6JA 3VPFA 1WAMA 3H9QA 4W6ZA 2ZIZA 4YT2A 3C8MA 1X15A 5DNAA 1VL8A 2DTXA 3OJFA 1GFSA 4W82A 3MWEB 1VM6A 2OO5A 2Y05A 3BHIA 4ITUA 4AFNA 1P74A 5I7VA 1MC4A 1UDCA 1FDWA 3BTUA 4FD3A 2AG5A 2PY6A 2PKQO 2UYYA 3U5TA 1P31A 4R1SA 1J0XO 1NFRA 2H6EA 3C1TA 3JD3A 1HE2A 2NWQA 5A3VA 2PKQP 4MOWA 2ZJ1A 3H9EO 4LMRA 5K9ZA 3KYDB 3DB2A 1EK5A 4D3FA 2JCYA 4UVIA 3OIFA 4D42A 5KIAA 2VUSA 2ZYAA 3ANMA 1I5RA 4PLVA 5JPIA 5TRTA 2O3QA 1A4IA 3AFNA 4QFCA 3A9WA 1SB8A 4J16A 3VZQA 1JQBA 2CMDA 1Q1NA 3KETA 1BG6A 5COBA 2AQHA 3I5MA 1D4FA 3ZHYA 4U8GA 1KEPA 1QRRA 3C1OA 1H6DA 3E5MA 4J91A 5KJ6A 1DXYA 3PI7A 2OP1A 4NBUA 4QXMA 3Q9UA 3AI2A 4IGEA 5JMPA 1R12A 3WICA 4UVEA 5G4KA 1L7DA 1UXKA 3WGQA 1H2HA 3WLFA 4D79A 1EVYA 1P0FA 2I99A 2X23A 3E03A 3AI3A 4ALNA 4WCFB 2VTEA 1K89A 3ZWOA 4IGFA 5LC1A 4EUHA 3DZIA 5ENDA 3H9JA 2ZATA 1E6UA 5H83A 1TI7A 1R6DA 4BQPA 1YE3A 3ZWWA 1MV8A 3FD8A 3PZBA 4INAA 5TLSA 4CR7A 2D59A 3H2ZA 1E6EA 1L7EA 5IFLA 2JHFA 1ISIA 3RUAA 1B15A 4YWJA 3ZV3A 2X1HA 5I9MA 4OQZA 4M1QA 5EJ2A 3EC7A 1QMGA 1LLUA 1E1MA 2VYNA 3ADPA 5B4TA 1U7TA 4Y6PA 5AYVA 5JBIA 4D3SA 4BKRA 2VYVD 4IM7A 1ZK0A 1RM0A 4IJVA 4ND5A 5DOVA 4Q9NA 1ID1A 4BNMA 4BOYA 1UJMA 4DLAA 1UDBA 4CMKA 1GZ4A 5L4LA 2PH5A 3DEYX 3LC2O 4UEJA 1YL7A 2NVBA 4MVJH 1I2CA 1B3RA 2FSSA 4U5QA 3WJAA 4CL3A 4H15A 4EI2A 5TF4A 1O9BA 5DOZA 3NT2A 1I8TA 1Q7GA 2W4QA 4CM9A 2AE2A 1O94A 3UHAA 3DAFA 4W4TA 4JN6B 3MJTA 3QWBA 3RUHA 2PZLA 3UFXA 3IL2A 2YDYA 3JQFA 1E3WA 2B4RO 2CUKA 1NVMB 2C5AA 3GMDA 5IDYA 4ZGWA 2DTDA 3BMNA 1BGVA 3SJ7A 4BMNA 3L0DA 1PZHA 4J1QA 3HZZA 4X54A 4XEHA 2NTJA 2FPGA 2VCYA 1GTMA 4CUKA 1U4OA 4I5DA 1ZCJA 2CD9A 2I3AA 2VWGA 4P4NA 3QY9A 1CIVA 3AY7A 2Y67A 4BO0A 1VJ1A 1DIHA 4B3HA 1X7DA 2WDZA 1H93A 5ENVA 4Y6RA 4ESOA 1KEWA 1DC3A 5B12A 2IYPA 5IZCA 4LGVA 5T64A 4UUOA 2BMAA 5JCJD 2YQ5A 3D3EA 4FOOA 5U1PA 5FFFA 3TZ6A 4DRYA 4K6CA 3U3XA 5U9CA 3UW3A 3D4NA 3DFZA 3GVXA 4UAGA 3ZNPA 1E7MA 1EFLA 4GX0A 4MVJG 1XIVA 4AJ2A 1E1LA 3QV1A 2P9GA 4NPCA 3ZU5A 2HMVA 3B6ZA 5TNXA 3K2BA 4YAGA 3EAGA 1HLDA 1T24A 1NVTA 2WYWA 2ZB7A 1P9LA 3NT5A 5BNIA 1D1SA 2DQ4A 2GN4A 4BNFA 2OL4A 5C7LO 4ZQHA 1C1XA 1X13A 3U09A 3DAGA 5IDXA 4XX0A 3AUUA 3VPXA 2AEMA 2VHWA 2Y1CA 3JYNA 1R15A 2YQ4A 3O03A 5L95A 1TB4A 4A5OA 4TKMA 2HK7A 4EUEA 3T7CA 3ZWNA 2HLPA 5F1PA 2E6UX 2EJWA 2W2KB 1BVUA 4GKBA 1DIBA 4P8RA 2P2SA 3TN7A 3W6UA 5F1OA 4MVJD 3OECA 4CM9D 4ZVVA 1CETA 1PJ3A 1LLQA 3ABIA 4A73A 1HYHA 4WE3A 4JLWA 3OEYA 1GY8A 1V3TA 4MP3A 1EUZA 3BTVA 4TRMA 2P91A 1ORRA 1X0XA 2BGLA 3GFGA 1P1FA 1PR9A 4YQZA 1ADCA 3IKVA 1EUDA 4NNJA 3BYZA 3SBOA 1E7WA 2X0IA 2UAGA 4BUCA 4RDIA 5IDWA 4AJJA 3NDJA 3I9JA 1SEVA 3ZWPA 4XYGA 1GDHA 3IJPA 4NQZA 3LT0A 1CYDA 5JE8A 3LLSA 4A2CA 3H5AA 1E6WA 4E5NA 5L3ZA 5L9AA 2BRUA 5F3RA 3G49A 3WDSA 1I30A 5JW6A 3E8XA 4FS3A 3RUFA 2VNAA 1GZ6A 2GYYA 5IN4A 2FZEA 1P1RA 2DVMA 4I9UA 2Y0DA 3UUWA 5K6AC 3UXYA 1U3TA 2UV8A 4CQMA 3ANLA 1ADGA 2EHDA 3V2GA 4CQLB 2DUUA 4I5EA 1LBEA 4K6FA 1JVSA 1V3VA 2P4HX 1ADFA 3RBVA 5IXYA 3E9QA 2GR9A 4BKPA 1CWUA 4BNZA 4R51A 1ZKMA 3WJ7A 3KTDA 3CE6A 5JDCC 2AMFA 4DYDA 1A5ZA 1HSOA 1B2LA 1TEHA 1YO6A 2C2YA 4EZBA 5IZCC 4BNJA 5CDGA 4RF5A 4IINA 4TMFA 3NDRA 2X5KO 4YJFA 4QFDA 1F0YA 4CMIA 2VHYA 4FGWA 4NIMA 2EP7A 2O3JA 4I1IA 1OC4A 2YV3A 4HUJA 5EQFA 2JAHA 2ZYGA 3NUGA 3TOXA 4HV4A 2RH8A 2FPIA 2BFAA 1YQXA 3CXRA 1BWSA 4J2HA 4DC0A 1D3AA 1FK8A 4GGOA 1G6KA 2AEFA 3K92A 5IZ4A 2D2IA 3RBXA 3JV7A 4MDHA 4ZQGA 4PG4A 9LDBA 4NBWA 1NVGA 4YPOA 3OBBA 1FXSA 1P0CA 1RWBA 1NHWA 4R41A 3OJLA 4DMLA 1HE3A 1OC2A 2Y1GA 3SJUA 3WB9A 5TQVA 4C7KA 1Y9AA 1XU7A 3DMTA 1UP4A 2OOSA 4MVJF 1H5QA 2FY8A 4YVFA 5JAZA 1V35A 4UUMA 4E2XA 4NJOA 2C82A 2W98A 2WTBA 3WMWA 1ZEMA 5JCJA 1KVTA 2DBVO 4XKJA 5DZSA 4Z0PA 3WGOA 3RCBA 1YB5A 3DBRA 4NFSA 3H3JA 3LT2A 3PTZA 1UAYA 1LJ8A 3M1AA 4J1NA 1HF3A 2VUTA 4ZN6A 3MOGA 1KEUA 1PGPA 4ND1A 2RH4A 3RC7A 4MP6A 4I08A 2BLLA 3KYCA 5A9SA 2HKIA 4FN4A 4TWRA 2QYTA 1K6JA 3K9QO 1E77A 4FFNA 1QORA 1ONOA 3AM5A 1ZK4A 3D0OA 4FBGA 4LVCA 1XYGA 3GZ4A 1BTOA 2BFPA 4IIUA 4IDBA 1DAPA 4E32A 3WBFA 1E3JA 1JN0A 4U7WA 3CH6A 4L4XA 4M8SA 3UF0A 1E92A 3ZV5A 1T4DA 2I5PO 1DPGA 2W8ZA 1C14A 1P1HA 2PNFA 3QHAA 2WD8A 3AU9A 4JIGA 2G76A 4D0RA 4BNLA 1KIFA 2LDBA 3VDRA 3PIDA 4CM3A 4CJXA 4DBVO 1WDKA 2VN8A 5THQA 5ER6A 1B7GO 1BSVA 4L0QA 3PHGA 2CVQA 4PLYA 4JBIA 2C54A 4GPD1 3FNGA 3DBLB 4Z9XA 1LSJA 4OOEA 1LI4A 2O48X 2VWHA 3VVBA 4UVDA 4BNWA 4R9SA 3H65A 3L6OO 3UKOA 6ADHA 3BMQB 4NBRA 5BSEA 1XWFA 2D8AA 3FSRA 2HJSA 3TJRA 2PR2A 4YT5A 1ZEJA 1EVZA 2VHZA 3JD0A 1MC5A 3FNEA 3OHSX 4K9DA 4TQGA 4FC7A 3V1UA 3ETEA 2B83A 4DBZA 4DUPA 2X5OA 5L40A 1XA0A 3VPHA 1HLPA 4I5GA 1R4NB 4H7PA 2DFVA 3E82A 3ZN2A 1K0UA 1ONPA 3G1UA 3EVNA 4IDEA 1DHTA 4EJMA 5L51A 3SX2A 2GGSA 4ALKA 3N7UA 1R0LA 4LN1A 4QUKA 3DXFA 1UZNA 1UZLA 2IXBA 3BAZA 4HFNA 1QV6A 5C7OO 1VJTA 1M6HA 3ROKA 3VHRA 2R00C 2B5VA 5ILGA 1J49A 4Q3CA 2ZCVA 1DIAA 5DBIA 7MDHA 2ZB8A 1ONNA 2R2GA 5B1YA 2WE8A 4QTZA 4RVSA 2NADA 4IQ0A 2YDXA 3WQQA 3IP1A 3IAHA 4BV8A 2Z95A 4M55A 3IIEA 5AXBA 3OQ1A 3WXBA 1KY5A 3QP9A 2HUNA 1PQWA 4B8ZA 4HNHA 1EMDA 1LQTA 4D43A 1U3VA 3M2PA 4CLRB 1XLTA 3QWIA 4KDEA 3G1TA 1XKQA 2GZ1A 3TNLA 5HA5A 3WWZA 4EW6A 5MDHA 4IY1A 5BSGA 1LLDA 2AW5A 2E82A 3QRWA 5BNTA 2I3GA 5IG2A 1ENOA 5AXAA 2YHIA 2D5AA 4WLNA 4L76A 1Y1PA 1CQJA 1BXKA 2EF1A 4LK3A 4ZQBA 2IDZA 2IEBA 2XXBA 3WTBA 4FFRA 2HJRA 1J6UA 4J3FA 1HDRA 1DRVA 1ZW1A 3ICPA 5JAQA 3QW2A 5L4SA 1ISHA 3CINA 1O8CA 2X5JO 1YXMA 1HDCA 5BNFA 1VL6A 1A27A 1E0DA 4JCOA 2JFFA 2X9NA 1PJSA 2FPPA 3KUXA 2EERA 3OSUA 3ETDA 3Q0EA 1SCUA 4RVGA 4CMCA 3PLNA 5LCXA 1LRJA 2I76A 2RCYA 3VAZA 4E5MA 4PRLA 4XGNA 4BNYA 1T25A 4OXNA 5FYDA 2V6GA 3D64A 4EITA 2EW2A 1ZSNA 2NV6A 2Q4BA 3WGIA 1M75A 3H4VA 3GVCA 1DFHA 4ALLA 3O9ZA 4BO7A 3RI3A 2Q1WA 4XB2A 4CM6A 1KC1A 4JJFA 1JAYA 4WOKA 2IZ1A 2RHCA 4KP7A 2P4QA 1DSSG 2J3KA 2DBQA 4GWKA 3ZV4A 3OJEA 3ZNNA 2AQIA 4W99A 4OJNA 1CJCA 2CSUA 4WECA 1YB1A 2OHXA 3KV3O 1DJNA 2JHGA 4Z3KA 5CFZA 1Q2XA 3GDGA 1YL6A 2ZQZA 4B4WA 4EEXA 1BW9B 1UUFA 4ND3A 4ZA2A 4YJDA 1QR6A 5C7IO 1PEDA 1N8KA 1W8DA 3B1FA 3D4OA 1SB9A 4D44A 3ZWXA 1Q0QA 1H2BA 2NQTA 4MP8A 1V0JA 1Z74A 2HAEA 1T1RA 5A05A 3NTQA 4RPLA 4IBOA 3T4XA 4BNKA 3TPCA 1NASA 3S2IA 1ULUA 4CODB 3UCEA 4YQYA 1Y6JA 3LYLA 2Q46A 5JY1A 1TA4A 3GNQA 2EXXA 3N74A 2PZJA 2ZYDA 3RKRA 1YBMA 2WYVA 2RHRA 1N1EA 3JQFC 4J4HA 1HKUA 4J7XA 4BNVA 5CP8A 5IJZA 2VRCD 1BXGA 4RZIA 3VPGA 5ICSA 4CV1A 4BNXA 3PHHA 5DF1A 4GBJA 4WGGA 5CEJA 3QIVA 4P38A 5JY6A 4A10A 2Q3EA 2VT2A 4WK6A 2AHRA 3F4LA 4YRAA 2Y1EA 4KQWA 4EDFA 3L07A 2GO1A 3DTYA 3U49A 5EESA 4U6QA 4XGKA 4CMIB 4WOJA 4R1NA 1Y8QA 5L7YA 5TC4A 3D1LA 3RU7A 1K6XA 4BO6A 3ST7A 5JO9A 1DLIA 1MXHA 3H2SA 3NJ4A 3DHEA 4D45A 3OP4A 1UR5A 3S2EA 4IDCA 3GOHA 4FJ0A 4IDDA 3LF1A 4BHTA 3CPSA 4OAQA 4JP2A 4F46A 4Y6SA 3BTOA 2NU8A 2P9CA 1LUAA 3INTA 3PWSA 4J9UE 4N5NA 4NBVA 5A4DA 3M1LA 4IUYA 2C59A 1GUZA 4HX5A 3KXDA 3RFVA 4UEOA 3ZHXA 4BGUA 2I67A 3CZMA 3W6ZA 4OQYA 2Y1FA 5T6BA 2F00A 4QEDA 1R37A 4K28A 1K2WA 4GAEA 3KYBA 2H5LA 1A7AA 4CLOB 5JMWA 4L4RA 3OM9A 4IJUA 2HMSA 3PJFA 4MVJA 2JKVA 3MJSA 2QX7A 1LC0A 2DT5A 2NU9A 5G0SA 3VZPA 3MJ4A 3DWFA 1GCUA 3IKTA 1YQDA 4J0EA 4CL8A 4DREA 4TVOA 4XZ3A 1Z45A 1GEGA 3G0OA 3QVOA 4MO2A 3WNVA 4O1MA 2RIRA 4M49A 1F8FA 3TFQA 1I2BA 1KY4A 4PLZA 1YH3A 1N9GA 2JCXA 3EMKA 4LCEA 4BKQA 2Y66A 3QQPA 5COAA 4GWGA 3NV9A 4GGPA 1YRLA 2W2KA 5CPFA 2RAFA 3RSHA 2HCTA 1XELA 3JQAB 1BW9A 1GQQA 3HB4X 1O6ZA 4QT0A 1O95A 2IZZA 4ZU3A 3EVTA 3P5SA 4NJMB 3ZHZA 1X1TA 4BGEA 2QYSA 2VOEA 4RQTA 4YRBA 5C5IA 1TLTA 1QYVA 2OUIA 4OO3A 3SXPA 5TS3A 3VDQA 4MVJI 2CVOA 2BGMA 2Q2VA 1RKXA 1XHLA 2EGHA 4RVHA 4BKUA 3HDJA 4PLFA 4L8VA 2DFDA 3RBZA 2CVZA 1Y8RA 4G2NA 2NUAA 1PL6A 3BHMA 1WP4A 2EKQA 2PZKA 1G0OA 4FIZA 4BGIA 3DDNA 1Y5MA 2EIHA 4KQXA 1MUUA 3DTTA 3IQDB 3DMYA 3JYQA 4IQGA 1UP6A 2H1SA 4L4SA 4OMUA 3VOSA 3HDQA 4JNKA 4O63O 1HWYA 1B8PA 3JYPA 4C4OA 5TJ9A 2VHXA 4WLVA 5ILOA 1EFKA 2Q45A 3TRIA 1VE9A 1GPDG 1UDAA 3PGXA 1FF9A 3QSGA 3SLKA 4XCVA 3FNHA 4W7HA 5T67A 4DQXA 3UCXA 2W2LA 1QSGA 4BGVA 2IODA 2PD3A 4OSPA 3R6DA 1E5QA 4H3VA 1D8AA 1IZ9A 3C1AA 4BB6A 4EYEA 3FRJA 1U3WA 3UICA 1KEVA 4WKGA 3PXXA 3LVFO 1IE3A 5KNLA 2P5YA 5BT9A 2Y93A 3NT4A 3AUAA 4XIYA 2XXJA 1PL7A 3ZWMA 3LDHA 1QYWA 4J7UA 1T2CA 3BMNB 3F5QA 1MG0A 2I66A 2X58A 2YFQA 1H0KA 4B79A 4AL4A 2D3TA 3DBVO 3R0IA 4MJLA 3DZHA 2CF6A 3WYEA 1XG5A 1P1KA 1WMBA 4AJPA 4R1UA 4DXHA 3EY4A 1GU7A 2XF8A 3PJGA 2DKNA 3JQGA 1HL3A 2TMGA 1PJCA 4IPTA 4LSMA 2HK8A 3PIIA 1XEAA 3DHYA 3VPSA 5JSFA 1SZJG 5BR7A 3ASUA 3I6QA 1YGYA 3LF2A 4NG5A 3WWYA 3DZBA 2CFCA 2Y0EA 1U9JA 3Q11A 4I8XA 2IRWA 3AFMA 1FMCA 3JQ7B 3INRA 3BZUA 3H3FA 1RYDA 1EVJA 1M66A 1R66A 4IZIA 5HRUA 4WEOA 1YDEA 3QJ5A 1E7RA 4E31A 2X0JA 2YY7A 3GG9A 2O23A 4OL9A 3BIOA 4PLPA 1LSOA 4R1TA 3RIHA 5EQDA 3E6AA 3ZCXA 1LDYA 1LC3A 2HMWA 3ROQA 3MTJA 3CSDA 3ONFA 4R9RA 4ZRNA 3GAZA 5IXSA 3W8DA 4E0BA 4GQAA 3INGA 1DIRA 5KJEA 4Z3DA 3KVOA 3ZI0A 4IS3A 4WCFA 2DPGA 3DBLA 2OBYA 4F45A 1ZNQO 4EJ6A 3KEOA 4LRTB 3GRPA 1GUFA 4TRRA 4PLHA 2C0CA 4DQUA 3AOGA 3BMCB 3Q6IA 4FPXA 5TSDA 5AVOA 2C29D 2X4GA 1VRWA 5J23A 1G1AA 2EG9A 2BFOA 3RASA 3F46A 2O3SA 4AICA 3WFJA 1PIWA 3WBBA 4PG7A 4CLDA 4IS2A 5GZ6A 4Y67A 4Y9DA 3PJDA 4DYVA 2OP0A 2QHXA 1J5PA 3HG7A 2EV9A 3JQCA 1YJQA 4OOFA 4CMGA 3JQ8A 2X0NA 5KJ1A 1B0AA 4W9NA 2G0TA 2PGJA 5EPOA 1E5LA 4GSKA 3AK4A 3MJVA 1I36A 2GN6A 4R54A 1HE5A 5G0WA 4ZHSA 4JQCA 1KERA 3Q2IA 3FPLA 2ZJ0A 3KYDA 1DBVO 3EZLA 4XIJA 4BO9A 1D1TA 3C7CB 5AXDA 1LNQA 4YAJA 2VWPA 3ZH2A 1BDBA 4YDRA 3KRTA 3P2OA 4KTTE 3BMOB 1Q0HA 4GLOA 1M6WA 1VI2A 4R4JA 4RF4A 2R6JA 3TDKA 4XA8A 2DAPA 2QZ9A 1E3LA 3DFUA 3GY0A 4E2YA 3WGTA 2YFHA 2CY0A 3EZYA 1UP7A 4O6VA 1HDGO 3OA2A 2JD0A 4DWVA 3HE3A 1YKFA 1YJ8A 1DOHA 3GN1A 4CM4B 3WSVA 3WS7A 1A9YA 2ZK7A 4RDHA 1NWHA 4HFRA 2PGLA 4J0FA 3GHYA 1ZK2A 4L73A 1CEQA 3A1NA 3C7AA 5DCWA 4II2A 1JKJA 3JQDA 4P22A 3HN2A 1GPJA 4YT8A 1LDGA 1EZ4A 5JC8A 1V3UA 1ZUD1 5U4QA 4R16A 3PVZA 3RUDA 3A06A 3UVEA 4PIVA 4BNNA 4NDNE 4C7JA 3UOGA 3GNSA 3HN7A 1U7HA 1DRWA 3OF2A 1N9GB 1MLDA 5ICMA 2X0RA 4FR5A 3C24A 3WGGA 1GADO 4E5YA 5TJHA 2V6MA 4AG3A 3NGLA 3WLEA 4BB5A 4XQCA 4D3DA 3AM3A 4OIMA 4UUPA 3QVSA 5JFOA 1KVQA 1IB6A 2AE1A 3MWDB 1M2WA 1IL0A 2D4AA 4XQGA 4AVYA 3IP3A 3VZSA 4LMPA 1AN9A 3MJCA 3R1IA 4PLWA 1A71A 3ZWYA 3GAFA 3V2UA 1T4BA 2Y1OA 2JCVA 1W73A 1OI7A 4O0LA
chains in the Genus database with same CATH superfamily
3FNIA 3ADDA 1PJLA 1H5NA 3AR4A 1RC0A 4MUBA 3PCTA 4GOKA 3PT9A 4GEKA 4Z4GA 1FFBA 3MTQA 2IHVA 4EG3A 3E7DA 4DADA 3H8JA 3ASVA 3HVRA 1D2AA 2IW3A 4FWTA 2VUIB 3F98A 3RUEA 2IYOA 4ZQEA 2QD4A 3QLEA 4PG8A 1FU7A 3DGEC 3L4BA 1DFIA 1R0KA 1V5EA 4IJWA 3T3MB 5HF9A 3DPUA 2Y4OA 1V7PC 2ABWA 3GPIA 3L79A 5EKSA 1X74A 1C50A 3HP1A 2QRJA 3RYIA 1G5HA 4JL6A 1OSNA 5DDIP 5ECWA 1ENYA 1NQAO 2VPIA 5F33A 1DAMA 1USVA 2AS0A 1L4GA 4M88A 1VL5A 1KY2A 2X42A 5FBHA 3GRFA 3QE0A 1G42A 2W2OA 4UE2A 1Q2UA 5BSHA 4IIYA 5BSTA 4LNUB 4YCJA 5L3QB 3NKFA 2VHCA 5EXTA 1AQ6A 4ED9A 1E2QA 1Z5OA 1ZLXA 4DA4A 3R2JA 1C3XA 3A3YA 1TJ3A 1MMFB 5GAJA 2ZUSA 3ORSA 4BIIA 1UOEA 3K0EA 4CQLA 3RJ9A 3L92A 1R0WA 3IQFA 4RPKA 4HXYA 2G6BA 4AY3A 3HWRA 2LCFA 3LY7A 4GKVA 3CRRA 2WU1A 4LZOA 5B3JC 2H2FA 3D7MA 5EZ6B 3UMRA 5EJ5A 4MH0R 4O4IA 3IOEA 1QQBA 3VO8A 4BJ6A 1FDIA 4QVGA 2FF7A 5JQWA 3OPNA 4BEBA 2GCPA 1MH1A 2XWBF 3EAFA 3K8OE 2BYTA 1ETHA 1NM5A 1Z06A 2I4TA 3OWXA 4GI5A 4WEQA 1H94A 3FN4A 3RAJA 2QB5A 5CT4A 5JCXA 2J8ZA 1JDTA 4DWWA 2WBLC 1DCFA 1IQPA 1NE7A 1IN8A 1XVLA 3IKJA 3GJ7A 3OIDA 2XMSA 1SAYA 3RU9A 3W8EA 4EWLA 3OTIA 2BCEA 2K4MA 2OCIA 2J5QA 3CWQA 2RGYA 4C1NA 4EFDA 5DIFA 1K7YA 5IN5A 4JC0A 4CUKA 1QZTA 2XUGA 3L4SO 1PQPA 4G5GA 2O2YA 3F4BA 2O0HA 4I99A 3JYOA 2LGJA 3WNBA 3CVVA 1MP0A 1P80A 4BMZA 1TM1E 5BMVB 5IEJA 1M2VA 3L18A 2L18A 1MQ9A 2IXAA 3GN2A 4L4YA 1SQSA 2BISA 2JKZA 2WNSA 2MSCB 2Q1XA 1JAIA 3E9MA 3QMMA 5TIIA 1WHTB 2O2XA 3JY6A 2V9PA 1NQTA 1SVSA 4FE4A 2QIOA 3R74A 3GFTA 1XVTA 2PHZA 4IMPA 4RHUA 4CCWA 3CUKA 1GXSA 3HB1A 3KZ1E 2G5CA 4CZ2A 3GX1A 4EBFA 3TF5A 3ZVMA 2H52A 4Q1CA 1C0LA 1LPAB 4LY0A 3HJTA 5KYVA 4D74A 4Y7DA 2JKYA 2XNDD 3BFPA 1KEZA 4QLBA 3GLGB 1FTYA 1X7ZB 2JANA 2FMHA 2GF2A 1WHTA 3QI7A 3VOTA 5HX7A 2HHAA 3RAEC 2JAPA 5TXGA 5CGZA 2EDAA 3WL6A 1UJCA 2QGFA 1AGYA 3O31A 2HPZA 4H17A 4TT3A 4UMVA 2C3UA 3PHJA 2H85A 1GYRA 1O0SA 3M1YA 4G24A 2IWRA 3DT8A 1UJNA 4YEDA 1Y7TA 2OAGA 2J3LA 1N2XA 3R75A 1UOOA 5FUBA 4E5VA 1LH0A 2R85A 2Z2XA 1OLOA 1ZC4A 1T8YA 5IJAA 1YC5A 2PQ2A 2FMIA 5AW7A 4EB6B 2FZWA 3W1VA 4H1WA 2I2WA 4XDYA 2C7OA 4EM6A 3I53A 1H85A 3FNFA 3H2GA 1VLVA 4A6PA 5LD2C 1NZDA 2A5FA 1SCUB 3ONDA 5AI6A 5CW1A 1JIXA 1Y7HA 1WCIB 2XITA 3VU9B 3E18A 5I6DA 3T61A 3S6JA 1XEWX 1VKHA 4BMYA 5C46F 3QFTA 1Q21A 4B7XA 2IYAA 4UUBA 1OWLA 3UJHA 1JJIA 2QY9A 5ITZB 1SJ9A 2P30A 2VUUA 4RYLA 1ZI8A 2CV2A 2MR6A 4JL5A 2O0LA 5BN5A 2QE6A 4L8LA 4QSMA 2DQYA 5ALQA 1GILA 4NV3A 1PS0A 1NG1A 1PFKA 2WWIA 1XZGA 1M1UA 1RYMA 3AR3A 5EJ6A 3SF0A 1Y6RA 3FR8A 3IT2A 3T4UA 3MS2A 3ZCUA 4D80A 4CV2A 4L9RA 3A04A 5IMSA 4LDRA 2GM3A 3ET5A 1IZ8A 1VBMA 3BL8A 2RHTA 3RC3A 1WDTA 1Y1LA 2P62A 5ESRA 2GZ3A 3L84A 3ORHA 3QTTA 3AF6A 4ZOQI 1I3KA 4Q1AA 1PS9A 2QGNA 3PFFA 4PYLA 2ZKIA 4QECA 1F6DA 4WLUA 3DDUA 1YACA 2B35A 1C3OA 4DY6A 5HW0A 5AI0A 2DR0A 2BSXA 1FOEB 5A6SA 2XMBA 2J5KA 2F43B 2ONKA 3NTOA 4PIVA 2Z98A 6GPBA 2ISCA 2PXXA 4JA2A 4V0OA 1L4LA 4A3SA 1T9HA 8ADHA 4J1TA 3GP8A 3L7CA 1W6UA 4EQZA 4YPVA 4O25A 2XRYA 1HETA 3CVOA 3ABSB 4X7PA 3RUIA 1MFPA 4GS5A 3H99A 4EOGA 2FVYA 5J5VA 1KI7A 3WNQA 3O74A 2CKDA 4UAVA 1BDIA 1RHMA 4K6KA 3VI3B 3PPYA 3L5KA 4E70A 1DC4A 4OI0A 2WIKA 3CZ4A 3TNYA 1F51E 3R3VA 3FPCA 2G06A 4M9RA 2DF8A 3IEVA 3BWEA 1EIZA 2DG2A 4F4CA 1Z0DA 1LBTA 3DM9B 2RAUA 4MR7A 2CLHB 5H82A 3PJEA 4R3WA 3RGWS 4YRZA 5HS4A 3CLSC 4F4UA 5HBRA 1JB1A 2C0QA 2DPXA 3PFHA 4QARA 5J9FA 4MRMB 4Z7NB 1PQ4A 2VRBA 2FFAA 2IXDA 2YW9A 5DHRA 1O4WA 1W0KD 3MRSA 3OJXA 3TLJA 1JLMA 4NL4H 1SUBA 1G5PA 2WMYA 2GN8A 3K73O 3W6PA 4RTOA 1AKQA 1GL7A 1P9RA 4QAQA 1Z7EA 2P0AA 3GRVA 2LP4Y 5D85A 3HPQA 5EKDA 1NYTA 1Y9EA 1H1DA 5T41A 1ILEA 2J3IA 3BRQA 3MWDA 3TEFA 4JT2A 1PJZA 1HV8A 1J9EA 1MIHA 4DLWA 4YAKA 2XIJA 3FPFA 5B2FA 2OFXA 5DNCA 3X1WA 1JECA 4G9GA 1LRKA 1VJ0A 3Q8KA 2IL1A 4H3KB 1UKZA 4D26A 1R0SA 3I4CA 1NNEA 1E79D 1NBOA 3IMFA 1VPDA 4PVCA 5F2NA 1UL1X 3FTNA 4AJKA 4HJXA 4J9VA 2D1RA 5FT9A 2HMAA 5G0VA 1EFPA 5HMLA 5DTIA 4EHBA 7MHTA 2FVXA 2DWCA 1XRRA 1GZUA 3B6KA 3ESDA 4KMOA 5EJIA 5BWBA 1U8TA 2I9KA 1SELA 3CN7A 3G59A 1J00A 2GLUA 9MHTA 1LD3A 1RKUA 1JVBA 1T9GS 4P53A 1URPA 3DR3A 3HUEA 3ZV7A 3LHDA 2QIPA 2V4UA 5JIBA 1BKSB 1FSSA 5C31A 5LBUA 1C0EA 4CMHA 4RV9A 2BFBA 3IBSA 3R77A 1CERA 4I55B 1X14A 4PAMA 3SOZA 1JNYA 4D82A 1T2AA 1E3QA 3TR0A 4DAEA 3JYLA 1XSEA 4C29A 1MG5A 1OE0A 3E8SA 1GRVA 2Q1SA 4WXEA 4EFNA 3BRCA 1T2DA 2VF5X 1UPCA 2GJ8A 3S2UA 4A0FA 3FLBA 1JLLB 2XT9A 5A3JA 4J0CA 1DTWA 2F9LA 4GEGA 5EIBD 3Q3JB 4UHFA 2L42A 5BQ3A 3TFOA 1PLJA 5CA1A 3JD4A 3D8UA 4KVAA 2FSHA 1DTSA 3P9RA 2UZ1A 4ZZ3A 4ICIA 1U9CA 1ZXLA 5JALA 3RADC 1OPRA 5B58T 5LZ2A 1U11A 1UBOS 1DARA 2HGZA 3QPUA 2ORWA 1NAHA 2X15A 4GLJA 5COQA 1ZR2A 3G0HA 2FWMX 4QQFA 3VR3A 2MSNA 4F21A 4TXHA 1RWKA 1BOOA 1VDMA 2YIVX 2O3RA 2ZJBA 3E3MA 3CF4A 4LGYA 4ZP1A 4MQFA 4D9FA 3X2FA 3QPVA 4ZCMA 1F4VA 1ORWA 1QHNA 2Q7OE 4EKEA 3L1JA 2H1FA 4EENA 1F1JA 1NATA 4OXQA 5HM8A 1Z8HA 3NYIA 3P0RA 4QU8A 5JZSA 4S1VA 3GEGA 5FQNA 1M7HA 1X7ZA 2FRDC 1UWCA 1RM5A 2I2FA 2NTNA 3DS8A 4OKNA 4WNIA 2Z04A 2FETA 2GERA 1JWAB 2C5BA 1VKJA 2YUTA 4NULA 4QUHA 1J33A 3MMZA 4E6PA 3SE0A 3QOXA 4F5YA 2GCIA 1YB4A 2CJYA 1CEEA 5JBNA 2FN9A 4C7XA 2O6LA 4LEIA 1W30A 4RXUA 1O0BA 3SZ3A 3E15A 1ZJ4A 2FNAA 4V0LA 5EHQA 3GYGA 2AWNA 4OGKA 3TQRA 2NUPB 3UWDA 3MGAA 3JQ9C 3CJRA 1G3IA 3EXEA 1DLJA 5K3EA 2ANBA 4DM7A 3RODA 3T9AA 4XFJA 3TAHA 3SVTA 4BO4A 3NOQA 5MN6A 2B5OA 5JAPA 3RRMA 1SOVA 3E9EA 1QE5A 3HXMA 3HTXA 4NDZA 4RHFA 1ZH2A 3NDPA 2GVNA 3GUZA 4QJIA 5F9FA 2I33A 1P1JA 2HA5A 1P7YA 4NZNA 1DJQA 1N7GA 3EMVA 1Q0LA 1MVLA 3G5UA 1R4MB 1YC2A 3AVOA 1TDJA 1CXZA 2LW7A 2RHDA 1DV2A 1FXUA 1TKBA 3AFOA 5DCYA 1U6KA 4Q00A 4N5MA 3UPDA 2JFUA 2Z5VA 4IWNA 1T43A 3S2FA 1NR1A 3C7DB 1I7NA 2OZPA 4KN8A 3VGPA 5DXFA 1XROA 1VGRA 2UKDA 4O4HA 4BE4A 2AT1A 2VT3A 5EVJA 1PDWA 2PZBA 5KKCA 3LHIA 5GV7A 4FS8A 4MS1B 5CAEA 1MEEA 3FFAA 3DEJA 4NOKA 4TQUS 4N5LA 4IQ8A 1BDHA 2H2DA 1K5GA 5CX1B 5D1NA 1CIJA 3HYLA 3K70C 4E1AA 1V1MA 3CIOA 3S99A 1OBFO 2A5YB 2QSJA 2ZG6A 3WFZA 4CTJA 1BMQA 1V16B 3TE6A 1DC6A 2AJCA 2JZNA 2QXTA 2BFCA 2WVHA 4IGAA 4P58A 1PGJA 4Z1OA 4UTXA 2REQA 4L75A 3QK7A 1F8GA 4TLCA 4QPNA 1V8PA 1OPXA 3PC7A 1V96A 2H7YA 3ZU6A 2VSFA 1G5RA 3B2QA 3ZBPA 5LNK6 4RENA 4M9UA 3GIDA 4N3AA 1I2ZA 4S2UA 4A82A 1KOGA 4WD3A 4DWOA 4CUJA 2DH6A 4QELA 3TQSA 3Q2OA 1ZINA 2ZM5A 4DIBA 4HEA6 1F0KA 1GG2A 4ZMBA 2W6MA 3R5JA 2P67A 3DMDA 4BRZA 1EESA 1ITZA 3DF9A 2C2ZA 2QT1A 1JSLA 1EKXA 3FSGD 3W9SA 4CKYA 4LGCA 1HE1C 1P5FA 4Q9HA 3TD6A 4CM7A 5LLTA 3F9CA 4EB8A 1LK5A 2VAPA 4FONA 4H6XA 4JJ7A 1R8QA 3OU6A 5ALGA 4YJGA 1SEPA 1NMZA 1HYGA 5KVVA 4I9GA 4YGXB 2GCNA 1E1KA 1FSGA 2GZSA 1QGZA 3L02A 4A1FA 1KJ9A 4FFSA 5K0SA 2IXFA 4C0SA 4P4GA 1C1DA 4WTOA 1IEXA 3HQ4O 3DFKA 3LPNA 3NAMA 3OPQA 1C8KA 2BT4A 1T2VA 1XRPA 3NBFA 1NJ6A 1J1ZA 1E1RA 1S2MA 2ON6A 3DUWA 3QFHA 5I9LA 5KSWB 1AF4A 2A9KA 3FKSA 2A9RA 2B0JA 2YRXA 3I2GA 1QLHA 1VYHA 4LQDA 4N0PA 5SV2A 4BWYA 3MELA 2WD7B 3IUBA 4O2LA 2Y9MB 3O3NB 1UXOA 1EGHA 3QHQA 2FWNA 2VT6A 5JDIC 2WT8A 2OFPA 2QSYA 4KYVA 3PF8A 5KNBA 2QMZA 1QTNA 3ETNA 3N6VA 3MSCA 4RY8A 3A0UA 3WK9A 3VH4A 1I3LA 3D3QA 3GWGA 2X9VA 4TLMB 5DNYB 2UDPA 1A5TA 4UZFA 1RPAA 2D62A 4QUAA 4YRNA 2GA8A 1RQLA 3ZNQA 2J6BA 4Q3NA 5FI5A 1CEXA 5BSUA 1TT5B 2VFAA 2C1EA 1N2CA 1PTJA 3BRWA 1HO3A 1RXSA 1UCFA 3EISA 1JPNA 3GUHA 1GAQA 3QQ5A 4GYKA 4UHKA 2E49A 2NUAB 4MIOA 3ZY3A 1PW5A 3E1KA 2A0FA 2CL6X 3ECCA 4S1PA 1B6TA 4FD2A 1ZH8A 3ETCA 1X80A 4S04A 4I3HA 3EX7C 2X4LA 3O91A 1WMEA 2F1HA 1F4PA 3S4YA 2I2AA 2CHVA 3B1XA 4FU0A 4NYIR 4WXYB 2D1TA 4DMMA 1GTRA 1UPBA 4LF8B 3OZDA 4BN5A 4EPWA 2GN1A 3NPMA 4G5HA 1DAIA 3WA6A 4YBRA 3AKEA 2ZP1A 1SXPA 1PJAA 1KQ3A 4JC5A 2JK0A 3B3JA 4B74A 1AKNA 2W6ID 5EJ7A 5LZ7A 2VZ8A 4I14A 1H0HA 4LMBA 2VHVA 1QYIA 4NG4A 1N8NA 1G7CA 2GLXA 3B1JA 1Y33E 1FUEA 1MX3A 3PPWA 1HFKA 4MUEA 3ISTA 2OXIA 2ZS7A 3IP9A 3KB6A 1JEEA 4DCNA 2J7PD 3ND5A 2RGEA 2FR8C 5EINA 2QN2A 3AR6A 3D4PA 4KLRA 2QSUA 4XXHA 5KOHA 2PUBA 1SR8A 5LU9A 3NAQA 2EZTA 2NSDA 1K7SN 3D59A 4PICA 3CRNA 1YCFA 4XSVA 4YO7A 5JVDB 3AUTA 4WBNB 4W63A 5JS6A 4AJ9A 2NLOA 2YV2A 2I8CA 4QBHA 4ZAFA 2JD1A 3TEMA 1JQ3A 4MR9B 4ABYA 5FBWB 2YWGA 5DTMA 1D2EA 4QFMA 1U5CA 3S2YA 4M46A 1I5EA 1OB5A 1XA4A 4X6YA 5BR4A 1SXGA 3L1UA 2IUYA 3T0FA 3V8BA 1PJ4A 2J7PA 3MTBA 4N5IX 4EECA 5DP2A 4L08A 4DKXA 2FP4B 3SYTA 1YS4A 2HK6A 4IR7A 4RGVA 1CPYA 1WIWA 1JALA 2OEPA 2YJZA 4MKRA 1XL1A 3COSA 1SA0B 3ZUPA 3BKXA 2IPMA 3L41A 3JQ8B 2NU7A 3RS2A 2HWYA 5LN1A 2WAYA 1APBA 1J42A 2AD1A 1KVRA 1HSZA 4OHRA 3ICQB 3UG7A 2OBLA 5FOTA 3U9SA 1MGOA 1IJFA 2RKOA 2CNDA 2IYQA 2J07A 1HNWB 1XGKA 2IEZA 3B8EA 2X0EA 4TS4A 3F2IA 1J0CA 1T6YA 2B21A 1DOAA 1UK7A 2HM7A 3NRBA 4GT1A 3JZAA 4JT9A 4N3CA 4JKIA 4D9JA 1KARA 1MO6A 1ZSYA 2C8VA 1WRBA 2GPWA 2QP4A 4YJGB 5C52B 4LJYA 3EXFB 4FFBB 1ATZA 2R5FA 1QZ3A 3DLBA 2FR0A 4OGWA 4KIGA 3L43A 1Z75A 4QREA 3OCZA 5FNVF 2M1XA 2AX3A 3CH5A 1RQNA 2JDIA 4KPGA 1R64A 4ZT4A 4CLRA 1WBBA 4M0LA 4AY2A 5IYZA 3MMPA 5BPHA 4BQQA 1B16A 3I9MA 4FKMA 4O8ZA 3CYFA 1VXOA 3D3WB 4H08A 4I4TB 5G3YA 2EFHB 3TYXA 3ZIAD 1DG9A 4E12A 2DFKB 5IJWA 1XT6A 2YZMA 4UXIA 1JSZA 1R6VA 4TRJA 1DZIA 3SLRA 1KFBB 1N2EA 2FX5A 1CQIB 2C83A 1XDBA 2BMEA 4O33A 3OJOA 5DWDA 5J4HA 4P7FA 3NW9A 3WNCA 4QT4A 1Z82A 4IXMA 2IU3A 3FCYA 3JPYA 4W8HA 2F90A 4B83A 3AR8A 1TA0A 2RARA 1XN1A 5CEEA 2FFRA 2AQKA 2O8BA 4V0QA 4ALJA 4S05A 2HDHA 4C06A 1IVSA 5EG5A 2J48A 5E4TA 4WV3A 1WWKA 2P6RA 4FEEA 1JDNA 1B8VA 1N7IA 3JQ6A 1SQGA 2TS1A 1D6MA 3H9GA 4E5KA 4LE2A 4KMSA 4N18A 2NU6A 1AHPA 1F4LA 4OAOA 5KCZA 2OY0A 2UVDA 2IELA 4OI2A 4QPCA 5ANRB 3ZE8A 1G20E 3IEIA 1Q1AA 3LPLA 4GC5A 2GNPA 4G81A 4R3NA 1CF2O 5LWQA 1OQAA 2ILVA 4V3BA 3AXTA 3H5TA 3KSDO 5ALIA 1IULA 1IY8A 2CK3A 2FU5C 2HC9A 2JAQA 2JH8A 1PG5A 5IKOA 5PGMA 2ZB4A 4BQRA 4G65A 3L9WA 2GYUA 1NQWA 2GHIA 1EDDA 3TLBA 3MCVA 4L15A 4A2QA 4F4DA 5FXMA 2JLVA 3FHCB 2HRQA 2AWOA 5KYUB 3CLRC 5HQTA 4UDYX 5E9QA 3O21A 3B1KA 2CFSA 1IY0A 2GH1A 4BMSA 2HX1A 1DC7A 3HNPA 3SHVA 4KXVA 5DYYA 3SLGA 1SKMA 1IY1A 4QYIB 1R00A 1GQYA 4BO1A 2ZT7A 4DR2B 1QLJA 2ZXFA 1ZCAA 2FMTA 2I62A 2YXNA 5D5QA 2WILA 1T2EA 3WDMA 3U4IA 2PA3A 3NVMB 2XKKA 3M5WA 3GLFE 3MA0A 3I61A 2WMNB 3DD1A 3FOFC 2Q99A 3EIXA 4R98A 3NZEA 4DA8A 1BCSB 2CMHA 1B42A 4DT1A 3SVLA 3GMSA 2JIZA 3VTZA 1DXHA 4MIYA 4BNTA 4LV6A 4PFQA 1LY1A 4V0SA 2O20A 3SDBA 4MUFA 1NDUA 2R25B 3CNQS 3FFTA 2FW6A 4GX1A 4PPGA 1N3LA 1Y5LA 3IDSA 3JZDA 2IOHA 4JASB 1XTQA 1X1CA 4LJSA 2HA6A 5EMHA 3TPZA 4ZYUA 4AZ3B 2W4MA 2CN1A 2NNWB 1SCBA 3ZCTA 3RBAA 1AURA 4RJIA 3DDHA 5KAPA 4QU0A 3GUYA 1EJBA 1FFGA 1N4AA 1TUGA 1MEJA 4P7JA 4IXDA 1YZKA 1OLXB 4MKFA 421PA 2XBUA 3ET4A 1P17A 3I9NA 3H5WA 3AESB 1WY7A 3GA5A 4IXTA 5IAOA 5A0TA 4ZC8A 3EUFA 4N39A 3RTBA 3ESQA 4TLAA 2FQQA 1A95A 4QLOA 4DXAA 3THYB 4D3ZA 2ORYA 1K08A 3HJFA 1AMUA 4FGJA 1JLLA 4EJSC 3F5SA 4RIEA 3ZY4A 1OZGA 4UEQA 4F11A 3LXXA 2VKTA 3TXAA 3DMFA 4W7SA 1Q1QA 4E4TA 1AB5A 2XDAA 1E0SA 2WSSA 4J1SA 4Y0AA 3VH1A 5JHGB 3LC7O 5DBOA 3JALB 4J4TA 5JJ5A 1CRPA 1SKYE 3HRHA 5CNIA 4EYGA 1CQJB 3E48A 1Q0PA 4LUCA 1NXPA 4BVEA 2MYUA 2B3DA 3GCXA 4YRCA 4IIEA 5KOYA 1M6NA 4CR8A 1SM4A 3TZEA 2AC2A 4JYMA 2C2WA 4Q9LA 2ZQ5A 3TM4A 1DBRA 2ZEJA 3WQSB 2BHTA 4XWOA 3QEAZ 3BMCA 3I83A 3ZZNA 3QEJA 5BRAA 4QE3A 2VBFA 2OHIA 1AE1A 1BYUA 4GXRA 2WWFA 3O4VA 1RKQA 1T3ZA 4IOLA 1TEVA 1RZUA 4IIGA 3NDIA 3A28A 4ER6A 3V9PA 2NT4A 1BH6A 1DBSA 1ULSA 1YJBA 3I0ZA 3M4JA 4MEAA 4AY5A 3ZXYA 3E1GA 5BN3B 1FPMA 4UHDA 1R8JA 1LCIA 2DUWA 3GLHB 1J1UA 1JNXX 4A15A 5LWHA 4Q16A 3BIFA 1W2HA 4BEJA 1PUIA 1RHQA 2O7RA 2HK9A 3A9UA 4NNOA 5E95A 5I4BA 3ZU2A 4MV8A 4QQNA 3ZI4A 1SKQA 3MT8A 3UBTA 1MR3F 2ZRBA 2NACA 3QYPA 3VR5A 3ANTA 3MLEA 1NOKA 4C7MA 4BLRA 4ZJUA 3ENWA 1JE1A 3RSOA 2ZZNA 4ER3A 1N6KA 3UH0A 2ZYRA 4PAGA 4PZUA 3TINA 1HEUA 5ER9A 3V4RA 2X9GA 3DHNA 1GPNA 3HZHA 4G8CA 4PONA 5LDDC 2PSFA 3PXBA 3K0SA 2HJGA 4IJ6A 4MWTA 2P8SA 1ML3A 2OUKA 3JQ7A 3VZRA 2F3RA 4RHXA 5F1YA 5FLKA 3AKDA 1WDLA 3A14A 3ADOA 4ER5A 4QDZA 5HEKA 1R0RE 2WHPA 4NV0A 2AYXA 3Q40A 4BFVA 1UXGA 3Q2KA 3HFJA 1XBTA 3W8RA 1TZ2A 4DV1B 4F1KA 2A4KA 2BEVB 2FRDA 2QLBA 3ABRB 3KP1A 1YJCA 4GO1A 3R7WB 2X6TA 1PF7E 3QG5A 1A96A 3I52A 4KQCA 4TZKA 5AK6A 1EE9A 3CISA 4XGRA 1MO5A 4HXGA 5T8KA 3BICA 4F5DA 3DF7A 1OMOA 2PH7A 1HNZB 1RJ9A 3MUOA 4PGFA 3WLRA 3STUA 3TIIA 4WNYA 4EY8A 1OROA 4U2DA 2ZR7A 1IB0A 4TTJA 4E21A 4MGIR 1O57A 2FOIA 2FP4A 3O8LA 5E3IA 3KEQA 2A9VA 4YMHA 2LR0A 4MQ4A 4NEGA 3G9TA 1XMPA 1DE0A 2W71A 1RHUA 4OM7A 4X1KA 3SBDA 1OH6A 4Q66C 4QJ4A 5ERGB 4OB7A 4AZSA 3IBTA 3Q5GA 4MMXB 3FIJA 3G13A 4LXGA 3KBOA 5I9IA 3FTEA 1EHIA 3UCFA 1UBFA 2VH5R 1M8KA 4UDOA 1RJFA 3H6HA 1JG1A 3CLUC 4NYMQ 4QPJC 2GEBA 1RKVA 2VPZA 4RHCA 5CH3A 2MSLA 4PO3X 5JRJA 3FCOA 2RCNA 5TQ2B 4Q4AB 3V4LA 5IF9A 4EF6A 2R7KA 1ZUIA 2D1YA 2LXNA 4NH4A 4NECA 1G5QA 2ODAA 2VPYA 1TD1A 1Z0UA 1K7XB 1YS6A 2WPNA 3FTPA 1NUPA 4QGHA 1NFFA 1G0NA 2E1RA 2P9HA 3K5WA 3OETA 4OMDA 5JYDA 5KQRA 2AFHE 2RGNA 4ITRC 4KQEA 3BHJA 4KIUA 1Z4QA 5B57C 4MV6A 3GUUA 1Y82A 3THWB 4FZ3A 4TKLA 1PHPA 2PR7A 3NCHA 1W93A 4L4ZA 1RNLA 2HMYB 3K5PA 5GIOE 2R7NA 4AJIA 3FPAA 4RD6A 4DLKA 2NO0A 4HLUC 4ID9A 3TKLA 2C98A 1GTL1 4M7RA 4RLHA 4XEUA 3NR2A 1WV1A 1V2HE 1WX1A 3MS4A 4C89A 3HXKA 3DMTC 2OD7A 3RWMB 3VR2A 2NUTB 3L8MA 4TWAA 4Z4HA 5AESA 3R5XA 3EUAA 1C7JA 3WL4A 1XFAA 2XGOA 5IUKC 4IEIA 3M6IA 3FWZA 2IYWA 4IJMA 4WH0A 3IA7A 3ZGOA 5DYNA 1Q50A 3O4IA 2B2NA 5T4HA 1Y8RB 1UJ4A 4ANFA 3M6AA 5H59A 2UXBB 1I7LA 4BRWA 4D7AA 4H77A 1JYEA 1GL9B 1LJLA 2O2EA 1F06A 3UV7A 1AZWA 1NXSA 5LZ8A 3AKCA 3COVA 5T4FA 1AVTA 4A36A 2C20A 3C3YA 3K0BA 2VQSA 4MHOA 3GBSA 5AW5A 3VC1A 3SYMA 3MJDA 3TIXB 3JQAA 5E2BA 1JKMA 2P2CA 3ZHUA 1I1OA 1LU9A 4WZZA 3ROEA 2BR5A 1P72A 4G0UA 3SC2B 2RHOA 1Y6ZA 2YVAA 2ZJAA 3GQVA 1KQGA 4BQIA 4EW3A 2B7CA 2SCUA 2A9OA 4OBEA 2WD7A 1XDDA 3B7GA 4HATA 4MUHA 4E4YA 1EDEA 5DXJA 5JRDS 1TUIA 1SKAA 1VSUA 3DE2X 4JROA 3FNQA 2JEYA 2QN8A 3P20A 4ENWA 1KP9A 1NNLA 2PKEA 3AF1A 5ITSA 5L6LB 1LDBA 1P4GA 5EGSA 2RH9B 3B1ZA 3T3OA 3HY6A 3K0AA 3I3OA 4GVXA 4JBGA 2VJBA 3OQJA 5DNDA 4BCDA 3UGTA 4K9KA 3GGPA 2O59A 5DI9A 2ESRA 1U0LA 3Q15C 5AVZA 1PFQA 2YRFA 1IHYA 4NJEB 1NV9A 5KYNA 1PDVA 3OJWA 1XZMA 5JZBA 1XVAA 3LQYA 2Z3ZA 1MOZA 4QO8A 1VIDA 2YWRA 1OJLA 3UFXB 1L8XA 3ILSA 2XT6A 1ECLA 4F60A 2JIMA 3D8BA 2JLXA 2IZOA 3JARB 3A4NA 4U6SA 2ZRCA 1EGQA 2WAOA 2QNRA 4B87A 4JVLA 3AMVA 1KYQA 1F48A 1WOMA 3EFOA 2HV9A 3N6XA 3JQAD 2DXIA 1C3JA 4LZWA 1BNCA 1O5IA 3FCSB 3PQ6A 2PUCA 3K4PA 5H0IA 1DEHA 4WBXC 4PLTA 1VPWA 2DLNA 2YHIB 1GUAA 3WWCA 4WLOA 4PGHA 4F85A 4ON9A 1NR7A 2A1UB 3HL4A 3OEED 4CM1A 1Q7CA 5KEIA 3QFCA 1JG2A 5L3QA 2QQ0A 2NVUA 4O3FA 4D4JA 4MUIA 3L0PA 3HUFA 1Y34E 1SZCA 2NVWA 2NZVG 3A25A 2JBAA 3PNVA 4KQFA 3RSSA 5BURA 5I8PA 5CB8A 5I9NA 2KQUA 1WLYA 2WIDA 2Z2ZA 4IVQA 2BFDB 3ZTYA 1KQFA 3Q1LA 4RLSA 1VSQA 2BC9A 2GBLC 1EBUA 2CE2X 1MB3A 1ZOSA 2NTVA 2OPBA 3H4TA 4BB0A 3EEBA 1HM5A 5EL0A 2RGXA 5L4NA 5EE0A 1YAHA 4I1SA 2QW8A 3LZDA 2Q27A 4YACA 5JTTA 2C9YA 2SHKA 3T3PB 2OV1A 5DFAA 3WHLA 3EMBA 4FNOA 4ZO6A 5K8UA 3QI2A 1WUYA 2E5FA 1PJTA 2GLTA 4FDUA 3HKCA 3QPDA 4TSFA 4GXNA 4DDKA 4G0WA 1SOMA 3M9XA 1VHTA 2QZSA 2VYVA 1FLAA 1BN7A 2P90A 3AEXA 3JD2A 3ZHSA 5A04A 3PE3A 4TTSA 4PPNA 4HWRA 5TV2A 2C99A 3KJEA 2GT1A 2C8JA 2J3DA 3EXEB 5C80A 3UPTA 2FWPA 2EFEB 2OAQ1 1P4RA 4EKDA 4HS9A 2KM1A 1ZESA 1NMXA 8LDHA 2ZXEA 3F4KA 2YV1A 2EG5A 3LKVA 4Z8YA 4PBTA 4M1SA 2GCOA 1XJ0A 1EDOA 5G1NA 3DOUA 2Q7DA 1NBMD 4X90A 2GF9A 2C97A 2XUQA 1AGXA 2ONCA 1XJ5A 2XHZA 1GV0A 3RYCA 1R7RA 4H3HB 4M9SA 4MUGA 4TTVA 1LX6A 2WUGA 4NH0A 1M8JA 2ZUDA 3LHFA 1II9A 2J0QA 1Y9ZA 4UPDA 2BTOA 4N6OA 1U6IA 3NANA 4BVKA 5AUOB 1SNYA 2Z08A 3G8YA 3OJ0A 4KAJA 1MHPA 5KKAA 3FRIA 1YDMA 2XCOA 1FDTA 3HCAA 2ROQA 3KZOA 3P7MA 4DR7B 2PD4A 1ZH4A 4NOMA 5KNBH 1IN6A 1GPYA 3AB7A 3AOEC 5BUSA 4HB4A 3NGXA 4KMRA 5LYJF 2HHCA 4Q02A 3AHHA 1GCOA 1QAQA 4W9NC 4RPIA 3ZUGA 4H4EA 5AKJA 3HJHA 1MU0A 1HZJA 3IERA 3QX3A 1SIBE 3H0CA 3RTCA 5F73A 1G8YA 1QBGA 4RPJA 4HBZA 1CDOA 3DE6X 3UENA 1KZ9A 1XNRB 1UPTA 1YR8A 1CVLA 2OXFA 2Q4OA 2VTKA 2XCUA 1VA4A 2XRZA 3GB9A 1H2EA 3LKBA 4A23A 2AK3A 3CZAA 1GGEA 3F3KA 3H9QA 4W6ZA 1K6MA 2ZIZA 4B8YA 4B7ZA 2Y6VA 2ZITA 5KOJB 1X15A 2AXPA 1VL8A 3BSSA 1KEEB 2CLLB 1A2KC 4JC4A 4R0MA 1GFSA 4W82A 3OIUA 1FTNA 1S9HA 2Y05A 2XIQA 4ISCA 4ITUA 3VDMA 3PF9A 4AFNA 4HUQA 3JWEA 3Q7RA 2QTLA 3OZVA 1S2DA 5KQGA 1CS4C 1KMMA 2YJTD 2AG5A 2IF0A 2BHRA 5CRIA 1D4OA 3SY8A 2AKYA 1KDTA 2Q07A 2EYQA 5DRTA 1P31A 2GKSA 3CZQA 3WKEA 3K09C 4ZYWA 4TL6A 3WKBA 1NFRA 4W8GA 3C1TA 3S2ZA 3OTQA 3I2FA 2A5JA 4HOYA 5CH8A 3FZNA 4CIWA 4IILA 3DVAA 2GEDA 1AKUA 4X64B 1NOJA 1RDFA 5FUYA 4IWXA 1PK8A 1KJ8A 4JX9A 4D42A 5EJEA 2AI2A 3HV2A 5BNWA 5CBPB 2O0KA 5JPIA 5SYNA 3UTCA 2XNCA 1U94A 1Q6ZA 1US8B 3CS3A 5B6PA 4L3OA 3U3KA 2BI4A 1V41E 3AFNA 4R1OA 1OAOA 5JR3A 3A9WA 1P7ZA 4YYEA 1JQBA 1P5ZB 3DD5A 3CUVA 1F2VA 1Q1NA 4ZVRA 1CQPA 2A7XA 3PPVA 2AQHA 4PX3A 1ZYUA 2BOVA 3K9NA 2I6QA 1OH8A 1H2AS 2BEKA 5FBZA 2YUIA 3ND6A 3QZUA 4GZ3A 2NO4A 3HCCA 4J91A 4L6IA 3SBEA 1DXYA 4NBUA 2QU7A 4QXMA 3G6KA 4YRFA 1YBFA 4NYJQ 3GJYA 3AI2A 4IGEA 4BMXA 3D6FA 3WICA 4UVEA 4JOQA 3WGQA 4EEKA 3S7ZA 4HQFA 2OO3A 2O1XA 2X23A 1A2BA 3D8SA 3E03A 4LXYA 4PHCA 4F4JA 1IOWA 2GEKA 3HCOA 4MUYA 4PQEA 4WA7A 4IGFA 3IQEA 5LC1A 3WY9A 3SE7A 4EUHA 2H1IA 1RCTE 4ZDKA 2H16A 2YWDA 1PWEA 2WW8A 2ZATA 3BQ9A 1HT1E 3A05A 2W4IA 5H83A 3HKCB 4E46A 4PSVA 1G38A 2OQIA 4ARUA 1R6BX 2F3PA 4MULA 4GE3A 3U44A 4DLSA 4TWBA 4INAA 4UHHA 3WHKA 1FQJA 4PO1A 3WC4A 1A82A 2D59A 4A9AA 1L7EA 2R8RA 5IFLA 3TTSA 3RUAA 5B1EA 2C2OA 2BIFA 1P0IA 3ADPA 1E1MA 3FLEA 3F5MA 3ZHCA 3HL0A 2F43A 3HEAA 4BIMA 4FLMA 3KAJA 5ALRA 1GNQA 3DG9A 2I7CA 4RIFA 2JFQA 4Z7QB 4D3SA 5KC9A 4PHFA 1LNZA 4DY4A 3CUUA 2A3RA 1FRZA 4HAVA 4IM7A 1EP1B 1P0QA 4C05A 3C3MA 5CLJA 3U60B 1UJMA 1JZQA 2PGXA 1OFIA 3OC0A 1IMJA 1YL7A 4PFKA 2OSVA 2W6OA 1H4TA 1I2CA 1LW6E 3P9QA 1G6Q1 1OWOA 4NENA 1O9BA 3KHSA 2YMPA 4PRZA 2AXEA 3NIWA 5D7BA 1EPUA 2R7LA 2XEDA 2ZJ6A 5TEVA 4NWIA 2FW8A 3C3KA 5E7MA 4CM9A 1REQA 2AE2A 3UHAA 2HXSA 1SRRA 3DAFA 1EVEA 1GLVA 2OHJA 2RFLA 3DEFA 3QWBA 4OUDA 2AG0A 3A32A 3E05A 2CHEA 3PL1A 4UPEA 3GLIB 3JVEA 1QF7A 4BVJA 2I6SA 1MCZA 4JGGA 4KOEC 2R4UA 1TM4E 5DW3A 1GPH1 2DTDA 3BMNA 4F3TA 4OI1A 4HTFB 1FVOA 3A2LA 5IT5A 3SJ7A 2OLKA 3PHBE 1Z18A 2JCGA 2W2NA 2ZETA 2ONJA 4CRWB 3MJFA 2WNHA 3MTAA 3K0AB 4IHQA 4JGIA 1AV6A 4C6RA 4HZIA 4N7BA 5HF5A 1OXUA 3DYVA 3HZZA 4X85A 3ZW7A 4B34A 3WGVA 1N5IA 3VSDA 2D1FA 5A6VA 2P2NA 3OE1A 3AB3A 2BP7B 3LYAA 1YK1A 4J6EA 1KJNA 2NTJA 2VCYA 5K0ZA 3OOSA 2P6NA 2X3FA 4U00A 2VNKA 4PX2A 4I5DA 4Y7CA 3ZC3A 3PR2B 2CD9A 2VWGA 3HU2A 3DQQA 2JLBA 4P4NA 1CIVA 2F62A 4BO0A 1VLHA 1VJ1A 3GJQA 3ME5A 1SG6A 4IX9A 3UY4A 1ESEA 5ENVA 3W5BA 1D4ZA 3EVEA 4U63A 1CUBA 2IYPA 4A6DA 5K3OA 2XTAA 4DM3A 4BKMA 4PPQA 4BDSA 3OI7A 2R751 1CRQA 3QFFA 1MJ5A 4UUOA 4U2BA 4UTPA 4G0MA 1KO4A 3C6QA 5KPDA 1RXEA 1MQ8B 3T7RA 2H8GA 1W34A 3TZ6A 1RXCA 2B92A 4FGUA 1JG7A 2JBWA 5GGYA 5ADVA 1N5KA 2H1OA 3MK31 2AIRA 1RKBA 3DFZA 2XD4A 2BRUC 4ZARA 4RK5A 1JDVA 1GKUB 1GT91 1M74A 2GO7A 1EAYA 5HGXA 1E7MA 1Z7YA 4LPSA 3STXA 4G85A 1ZGGA 4M7WA 3QV1A 2P9GA 4NPCA 2HMVA 2GZMA 4YAGA 5EHNA 4E09A 1C30A 1GLNA 1JIUA 4B6QA 2WYWA 1JA1A 2ZB7A 4ZYTA 2VQEB 4RIIA 2DQ4A 3FPEA 2OL4A 2ZM6B 1ZJWA 1C1XA 1X13A 1CX9B 1E3TA 1Z2NX 3DAGA 3U09A 2GZDA 5FR2A 3JYNA 4UNQA 4KCGA 3C41J 1UBJS 3O03A 1YKGA 2ZVQX 1SK9A 2CLKB 2FW9A 3HBFA 4TKMA 1NN3A 4JFRA 2PSSA 3ZWNA 4A5OA 2XE4A 4C03A 5F1PA 2ZBQA 4OHXA 4AF8A 4G36A 3MUNA 1NF9A 3L1HA 3OX3A 1NXTA 4CU5A 4QD3A 4GI3A 1NQXA 1JEQA 3G9XA 4FZ5A 2JGRA 2C84A 3KKEA 1G60A 2R6GA 1PJ3A 4F7WA 3ABIA 4A73A 3KLOA 4QUIA 1VJGA 3OEYA 4MP3A 3PC8A 3BTVA 1YZFA 5B1HA 2QTRA 1PLLA 4MZXA 1P1FA 1PJ8A 3IKVA 3BYZA 4ZJZA 1BD4A 3HMQA 1KMNA 5K01A 2UAGA 1YR2A 3C5WP 3LFHA </