4RORA

Crystal structure of malate dehydrogenase from methylobacterium extorquens
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
319
structure length
319
Chain Sequence
ARSKIALIGAGQIGGTLAHLAGLKELGDVVLFDIVDGVPQGKALDIAESAPVDGFDAKYSGASDYSAIAGADVVIVTAGVPRKPGMSRDDLIGINLKVMEAVGAGIKEHAPDAFVICITNPLDAMVWALQKFSGLPTNKVVGMAGVLDSARFRHFLAEEFGVSVEDVTAFVLGGHGDDMVPLTRYSTVAGVPLTDLVKLGWTTQEKLDAMVERTRKGGGEIVNLLKTGSAFYAPAASAIAMAESYLRDKKRVLPCAAYLDGQYGIDGLYVGVPVVIGENGVERVLEVTFNDDEKAMFEKSVNSVKGLIEACKSVNDKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Malate dehydrogenase
publication title Crystal structure of Malate Dehydrogenase from Methylobacterium extorquens
rcsb
source organism Methylobacterium extorquens
total genus 114
structure length 319
sequence length 319
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 2014-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4rorA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 4rorA02
4CM1A 5AVOA 1KOLA 3AK4A 3KYDA 3NDIA 3O4RA 4RQTA 5AQ1A 4JN6B 4WCFA 2HLPA 5FYDA 4BO5A 5ICMA 3JYPA 3BMCB 1VJTA 3KEQA 3QJ5A 4HXYA 3WGOA 3HQ4O 4D44A 3INTA 1MB4A 5JMPA 2WSBA 4QFCA 4BGUA 1MC4A 4R69A 1ZK2A 1HYHA 1RKXA 2BH9A 1U3VA 2VOEA 3H2SA 4FC6A 2C20A 2VWGA 4FIZA 3RC2A 1EZ4A 2Y1DA 2Q50A 3WDSA 2EGHA 4TZKA 3GPIA 2O23A 5EIOA 3OA2A 3VTFA 5KJFA 3BA1A 5IG2A 2E48A 1P0CA 2CDBA 3PQFA 4HFNA 3QSGA 4I9NA 5DCWA 1P45A 1NQTA 2DPHA 2AEFA 3DBHB 1R4NA 3HNPA 1U2GA 3PWSA 4BO7A 1CERA 1HRDA 3JQCA 3A06A 5JXWA 4GX1A 5JCJD 1H6CA 1ZJZA 5BR7A 1R66A 3ZHYA 3TDKA 2QYTA 2RHRA 2CZCA 3ONEA 3ZWYA 4XA8A 1UAGA 1E1NA 2RCYA 2OO5A 1B14A 1PTJA 2JKVA 3AM4A 3LT4A 5GZ6A 1KS9A 1YS4A 4CMEC 4MJLA 3D4NA 2VHZA 5AXDA 2X9GA 5K6AC 4XYGA 3S2IA 1E5QA 4BNMA 1DIAA 1LLCA 1IZ9A 3K92A 2I65A 3JD2A 1QP8A 4BNHA 4PZCA 4IDBA 4BNTA 1HE4A 3DAFA 3X2FA 4JXKA 2C59A 5TJHA 4J1TA 4IIUA 1LSSA 5AXAA 1YL5A 5FI5A 4IZHA 3VZPA 2VNSA 1C1DA 5FFFA 1OMOA 5JY6A 1N7GA 4L73A 4UUNA 1P9LA 3G17A 3E5RA 1JKIA 3RU7A 1M6HA 1X15A 3E6AA 1HDCA 1H9AA 3I9KA 4FDAA 1X0VA 4YJGA 3RBXA 4BL5A 4CLHA 4NBVA 3V1TC 1R16A 4UVEA 4IDFA 4BNFA 4ZQFA 1I2CA 1KVTA 1QYXA 2C7GA 2QG4A 3G0OA 4CLDA 1ZSYA 1Q7BA 4UVIA 1R0KA 4RCVA 3GG9A 2AHRA 1UP6A 4CMHA 2ZQYA 1BDBA 3DFZA 1WP4A 2QW8A 3R3SA 3EW7A 2NU8A 4TRJA 1JVBA 4XD2A 4K6CA 4MP8A 2JD2A 3B1JA 1ENZA 1PGPA 1PL8A 1N1GA 4J2OA 4YPOA 1ZXBA 2A4KA 4HX5A 2JJYA 4J49A 5EESA 2O2SA 1QMGA 3C1AA 2QZ9A 3ROKA 3RUHA 3GF4A 3ON5A 5IXSA 2GR9A 1NFRA 3NTRA 5JDIC 4JBHA 3ITKA 5CDSA 1PZEA 4RQUA 2JFFA 2OL4A 1MG5A 1NVMB 4GX0A 1GUZA 3PJFA 4QXMA 1I3KA 4CMJA 3PGXA 4K6FA 1KVQA 3R0IA 1F0YA 5EERA 1K5HA 1DIRA 2YZ7A 5ICSA 5JDIA 1EBFA 1YJQA 3ZV6A 4FFOA 2WYWA 1P33A 1HDZA 3OIFA 5CG1A 3RUIA 1OC4A 3DBLB 1VRWA 4XB2A 3Q0EA 1K6JA 3SEFA 1P77A 2HRBA 3W4IA 1NXQA 4NIMA 3M6IA 1LLUA 1I2ZA 3WS7A 2YDYA 3LLVA 3DZFA 4XGIA 3HADA 2W2LD 3K30A 1ADFA 4LSMA 1T4BA 1FDUA 1YDEA 3OIGA 1JDJA 1A71A 4A0SA 2C2XA 3WJ7A 1IPFA 3AFNA 4FCCA 4W82A 5JMWA 1PZFA 1AXEA 1LXCA 4IM7A 4KZPA 1QV7A 4QEDA 1GFSA 4U5QA 5TNXA 1PJ3A 1ZBQA 3L6EA 2WYVA 3N7UA 1ZFNA 1I33A 3TOXA 2O3RA 5CPBA 1QORA 4GGPA 2Y67A 3AI1A 3GMDA 3IDSA 3SBOA 4R5HA 3TZ6A 1J0XO 1U8FO 4J16A 4KWHA 4MKZA 4BNYA 3ANLA 5TJ9A 2WEKA 1U4OA 1TT5A 5TT0A 4L8VA 4B4VA 2H9IA 4B79A 5K0ZA 4S1VA 3D0OA 1UP7A 4DC0A 2P4HX 2YUTA 4RVUA 5DDIP 3VPGA 2PWZA 4GX5A 2HUNA 3JYLA 2PY6A 3WQRA 5TLSA 3QV1A 5I7FA 1I30A 1MFZA 3FHLA 2EIHA 3H5AA 4JBGA 4JJFA 3GGGA 2ZIZA 1HDOA 3DZHA 2BRUA 3AY3A 2HMVA 2B4RO 3I6IA 4J7UA 4WNCA 4A5OA 4TKLA 1MC5A 1P3DA 5JS6A 2FP4A 3GDGA 1HE2A 3P19A 3ETDA 5F1OA 3D5TA 4MKXA 3G3EA 1KY5A 4OSPA 5LDHA 2BHLA 3I9OA 4UVGA 3S1LA 1PGJA 3RI3A 2QZZA 1GU7A 2VWQA 2ZTVA 5JDCC 5T8KC 4HUJA 3A28A 4YJFB 2R00C 1ISMA 2EEZA 3JD1A 3PP8A 2O3JA 3CTMA 2A35A 3ASUA 4Z0TA 2VYND 2CUKA 4U8GA 3ZW8A 2HDHA 3OMLA 4IMRA 4C4OA 4DYDA 1B8UA 2OUIA 4CM4B 5IN4A 2PZKA 1ZXLA 3COSA 1RPNA 3EC7A 4WLEA 4FGWA 2NTVA 3P2YA 1LLQA 3WQSB 1I36A 3C7CB 5GMOA 3RAJA 1GZ3A 2DTDA 3PZRA 3WNVA 4DGSA 4DYVA 4W7HA 3RC1A 4EGFA 3A1NA 3JQ7A 4CLRA 1PL7A 5L40A 2DBZA 3UOGA 2O3QA 1OC2A 3QP9A 4UEKA 4HP8A 3W6ZA 1KEVA 1DEHA 3KEOA 2WTBA 4DPKA 3ZWVA 4ZICA 3BMCA 2BLLA 3NTOA 2FN7A 3JQ9A 5HTOA 5IZCA 4CLOB 3BAZA 3L77A 1YWGO 2EF1A 5I9LA 3QIVA 1Q1NA 4ONEA 4JGBA 4Q3CA 4JJIA 3DZJA 1DC4A 3ONDA 1X14A 1R6DA 4GX2A 3MJEA 1IHXA 3E8XA 1WVGA 2Y05A 1DRUA 4P4LA 3CH6A 4MVJD 4R1NA 4ZQHA 3CKYA 2FHSA 2FMUA 3DBHA 1WXDA 4L0QA 4U6SA 4K9DA 3IS3A 3WFJA 4CJXA 4D3SA 4PG5A 4TQGA 3FPCA 3JD4A 3DMYA 4YQYA 1EE9A 3GVIA 1FDTA 3GNTA 4LCJA 1H6DA 5KOIA 2GERA 2EXXA 1G6KA 4QTZA 3DDNA 5JW6A 1T2FA 3L4SO 2DUWA 4CMGA 3AUTA 5JO0A 1UXKA 5TT1A 4Z9YA 5TGDA 5MDHA 3RKUA 3FTPA 3OEWA 5DCYA 1IL0A 3K96A 4E4YA 2D8AA 2Q45A 4E13A 5IF3A 2UVDA 3I52A 3QWBA 4FW8A 3D4PA 4IIVA 3QWAA 4PLVA 3UH1A 1KETA 3IQDB 3OECA 3UCEA 1EFLA 1DJNA 3EUWA 4BV8A 2FZEA 2P9GA 1LRJA 2BGKA 2IEBA 1GQYA 2Y66A 1H2HA 4GL4A 5H83A 5JYEA 4CV0A 2GCGA 1I3MA 4BGVA 5CG2A 3ETEA 1YBVA 1F8FA 1V3VA 2Y0DA 3L6DA 2DVMA 4OKNA 4RVHA 4YVFA 4FB5A 3JQAD 1U7HA 6ADHA 1E3WB 2AQKA 5A05A 2JCXA 2OMEA 4MP6A 3BMNB 2HKIA 2ZTMA 4E31A 4CL3A 3F47A 4XYBA 4R1UA 3KLMX 1N5DA 4CM9D 3PYMA 4LN1A 4D46A 4MVJG 4ZVVA 2AQHA 3ICPA 5CEEA 2I6TA 2YQ4A 3CEAA 2RAFA 1C0IA 2YJZA 1GEEA 1GYPA 1UXJA 1G0NA 5G0VA 4B7XA 2R6JA 4BNIA 3UCFA 1UZNA 1OOEA 1KVUA 1UZLA 3IMFA 4RVSA 4E3ZA 3AY6A 3ETGA 4XDYA 4MVJF 3I9LA 3H2ZA 1J4AA 3ZDFA 4NU6A 3PYLA 3KXDA 1UJMA 3I9NA 4DXHA 4UEOA 4FOOA 4XJSA 3E9MA 4JNKA 1PJ4A 3TQHA 4AJPA 2CY0A 2CVOA 4TWRA 1GL3A 3KM0A 4J9VA 4BMVA 3GZNB 4ZQGA 3GAFA 3ENKA 4PLTA 5B4TA 1T2EA 5KWEA 4D0SA 1QG6A 1V35A 3MJCA 2Z1NA 4TVBA 2WWRA 5TRTA 4Z3KA 1GDHA 4CMAA 3U3XA 4NHEA 5H81A 4B7UA 2PLAA 5KVVA 5I9MA 3GT0A 2OXIA 5JE8A 5C7IO 4M49A 4R01A 5BSHA 5FF9A 4WCDA 1LDEA 4XQ9A 1TI7A 1YQDA 5G0TA 4BNGA 3DHNA 4DREA 7MDHA 3LT2A 4WEQA 4AJOA 3JYQA 3IOYA 2IXAA 3CINA 3WSVA 4AJJA 1TB4A 3DBLA 1F06A 5A5EA 2XF8A 4YYZA 3VZRA 3EGOA 3F3SA 3LVFO 4P22A 4YRDA 1UUFA 1EVYA 4XYLA 1CQIA 2OBNA 1HE3A 2XPCA 2VZ0A 2Y0CA 1B8VA 1I24A 4OOFA 2I76A 3RFTA 5I9NA 2ZATA 3KSDO 1PGOA 1NPTO 1Y8RB 2BFPA 5DNAA 4ALNA 4ALLA 4CUKA 5EINA 3B1KA 4R5MA 3WB9A 4A03A 3VKUA 3V8BA 4M1QA 3LC7O 1MLDA 1HYGA 5A03A 2Z5LA 1HLPA 3K73O 1BW9B 1OZAA 4J1QA 3C8MA 4RL6A 4MVJA 1A7KA 4R41A 3PZBA 4FFRA 3HJAA 3NYWA 1UR5A 3CMCO 4DQUA 3BYZA 1V9LA 2XAAA 1DIBA 3D3EA 3V5NA 3E82A 1O0SA 3KYCB 1HSOA 4NFHA 4RPGA 1YOVB 3QWFA 5L53A 3FNEA 3AI2A 4F45A 4OHUA 5T57A 2O3UA 5DT9A 2VUSA 5ILOA 2AG5A 4TMFA 3OHSX 4G2NA 1NVTA 1JAYA 1GUFA 3E5MA 1PS0A 2C0CA 3BTOA 1GPJA 4HV4A 1RYDA 1VL8A 2B0JA 3WTCA 4D7AA 2HCTA 3WMXA 4YR9A 3RFXA 1ISJA 3IC5A 3GEGA 3P2OA 4BB6A 4NU5A 4EW6A 4E5YA 3H9EO 4TKMA 4R3NA 4XDZA 2AW5A 3TPCA 4AJ1A 3CUKA 3E9QA 3I3OA 3VPSA 4YCAA 2EJWA 1SAYA 2VUTA 4KDFA 3INRA 2HK8A 3MTJA 1O89A 5A06A 1J6UA 1WWKA 4KP7A 4EZBA 4X54A 3WXBA 1KBZA 2G1UA 3PI7A 4A27A 3QW2A 3PQEA 3RROA 4YJFA 1SOVA 4ZRNA 4J91A 1FK8A 1QKIA 1E77A 2DLDA 3AU8A 1EVIA 3SC6A 3TSCA 4CM4A 2P5YA 4YAGA 4NDNE 1E3IA 4XGNA 3DC2A 2ZB7A 4FOSA 2ZB3A 4L75A 4ZD6A 1IYZA 1JWAB 1AGNA 1YRLA 1LA2A 3GDFA 1B7GO 1X7DA 3HSKA 3RU9A 5ER6A 3WBFA 3DZKA 4YAKA 4D3DA 4OJNA 1VKOA 1HYEA 4GLOA 3I9JA 1P74A 4RJTA 3B70A 5JNLA 4NNJA 1OI7A 2PZLA 2VQ3A 3GEMA 1WMBA 3H6KA 1LQUA 1UXHA 4IQGA 3KUXA 4CMIA 1TXGA 4DVJA 4J3FA 2VTEA 4FBGA 2CMDA 5A3VA 1JTVA 3DBRB 2C29D 3LDHA 4RPJA 3CXRA 1LLDA 5I7EA 1FDVA 3DOOA 3TL3A 2I99A 4CLOA 1TA4A 3GH3A 3JQGB 2J3HA 4NBWA 3NV9A 1XELA 3PLNA 4WKGA 4ROSA 2IXBA 4FFLA 2IODA 3W4KA 1GQQA 3WFIA 4R54A 3DEYX 3DHYA 1EQUA 1JU9A 1MXFA 1PZHA 2ZK7A 4I9HA 4MINA 2EKLA 1W73A 3RC7A 2Y1EA 4DQVA 1Q7CA 4Y8VA 3VHRA 4U0JA 3V1UA 5LCXA 1E7RA 5G0SA 2HMUA 4OXYA 3DFUA 3OH8A 5L9AA 4IUYA 1BTOA 2NU9A 1D8AA 1XYGA 3LF1A 4PLFA 2B69A 5DBFA 2O7SA 3DXFA 1WZIA 3ZNPA 1E3JA 1XSEA 3RWBA 1TEHA 2TMDA 1PJTA 3VH3A 2EP5A 1EDZA 3T4EA 1DFGA 1P1RA 1YJ8A 2V6FA 2NU7A 3L07A 3BMOB 4OXKA 1O6ZA 1FF9A 1N1EA 3AOEC 3GZ4A 1XDWA 4BGEA 1EVJA 3RUAA 1DO8A 4R4JA 1M6WA 4DTIA 1M66A 3S55A 5U9CA 2IEDA 4J6FA 1MA0A 2NWQA 2O48X 4DA9A 1EDOA 5JAIA 4R1SA 4E6PA 3AOEA 3FBGA 2O50A 2Q4BA 3DMTA 3GVPA 1ISGA 3NT5A 3G1TA 1QV6A 4XQGA 2EHDA 2P2SA 4L76A 3NEPX 4XIYA 2VNAA 4ND3A 3AM3A 3L6OO 3ZHZA 4TRMA 5L7YA 4B4OA 4GH5A 4P4NA 2G5CA 2J6IA 4HKTA 3W8FA 5HM8A 2X5KO 3BMNA 1XA0A 1E0DA 3EVNA 1DBVO 3HG7A 3D3WB 4EEZA 3STHA 4IDCA 1GUYA 5AXBA 4PGFA 1DHTA 5U4QA 5JFOA 3ZWCA 5JLAA 1HWYA 3JQFC 4I8XA 4WLNA 5IDQA 3FI9A 3ZWAA 4KMSA 2C54A 3AU9A 4NBTA 4I9UA 4W7IA 5G4KB 2E37A 5DN9A 4A2CA 5C5IA 4CM8B 3OQ1A 2A9FA 2FR0A 2VT3A 3O38A 3GC6A 2CF5A 4XEHA 2JCYA 1H5QA 2P68A 1SNYA 5BT9A 1H6AA 3JQFA 1ZVMA 4GI2A 1SMKA 5U1PA 3ONFA 4GWKA 5G0UA 3I4CA 2C7VA 3M1LA 3V2UA 2FR8A 3F6YA 3NDRA 3CIFA 3GZNA 2PKQP 4N7RA 3NKLA 4KOAA 3ZWNA 2V6GA 4HFMA 3ZWPA 1RM4A 3HE3A 4BNLA 4BKQA 3EZLA 3MJTA 3WSWA 3RBVA 5L4LA 4PLYA 3MJ4A 4OKIA 1PEDA 1ZK4A 1SC6A 3FNFA 4II3A 2Q1TA 3PIDA 1C3VA 4YT4A 1U5AA 4E2YA 4AVYA 4CM6A 3GRKA 3U9LA 3DTTA 3W8EA 3V2HA 5HWSA 1KEUA 1WAMA 4AICA 5A5FA 4CMEA 2PH3A 1Z7BA 3Q6IA 4BNZA 1HTBA 3IIEA 3JQ8B 2ZQZA 2X0JA 5K6AA 4MIOA 5DZSA 1H0KA 2RHCA 2VWPA 2DBRA 1J49A 3U4HA 1I2BA 1F17A 1LX6A 1WMAA 4Z0HO 2BELA 1Z45A 1Y8RA 2DFDA 1B0AA 2OP1A 1ZUD1 2I9PA 4MPDA 4UVHA 4QQRA 4CQMD 5B1YA 4GKVA 4PVDA 1Y5RA 4AJLA 2EWMA 1EUDA 1BW9A 4Y6SA 4BKRA 4B8ZA 1CQJA 1PZGA 3ANNA 3IUPA 2X4GA 3F1KA 3GQVA 4ND1A 1LC0A 5HS6A 2X8LA 5DP2A 4IPTA 4EDFA 2P9CA 1YOVA 4IDAA 1LDNA 4AL4A 1U3WA 6LDHA 1A27A 3QRWA 5A9TA 2G0TA 2HK7A 1ZO8A 2YDXA 3BHMA 4FJ2A 4FN4A 1ZKMA 4J4HA 5LDGA 3DL2A 3RJ5A 3WOHA 3ZWXA 1AUPA 4M8SA 2BI8A 4L4XA 3RJ9A 3WMWA 1KC3A 3H9JA 3ZH2A 1EVZA 3H8VA 3EZYA 1EBUA 3KOUA 2GPTA 1I3NA 4E5KA 1VC2A 4BOYA 3ZCXA 2D5AA 1C0KA 3FF4A 3T4XA 4BO0A 3F5QA 5CPFA 4PFJA 2IE0A 3ZGYA 1T25A 2W8ZA 2GZ1A 3VZQA 3M2TA 3W8DA 2J8ZA 3HDHA 4J7CA 3ZU4A 4AJ4A 2DUUA 2ZTUA 4YAJA 2FPPA 1YBAA 4DMMA 3UXYA 2D4AA 4MVJH 4IDEA 4J4TA 1Q0QA 3OICA 5A4DA 2Y1OA 1M67A 1MGOA 2PA3A 3C7DB 4W99A 3RUEA 1KIFA 3K5PA 1PGQA 3PYXA 2VRCA 3GMSA 1HKUA 5AXCA 1D3AA 4XRGA 4YT5A 3F4LA 4CL8A 4AJIA 3I9MA 2JAPA 1E6UA 3SLGA 2ZJ0A 2ZYGA 1ISHA 3SVTA 1NWHA 1HZZA 3UFXA 3B1FA 3F46A 3DAPA 3KVOA 1ENOA 1PGNA 3VH2A 3O03A 1FMCA 1QRRA 2CD9A 2Y1FA 4OXNA 4RGBA 2A94A 3E9NA 1I8TA 2IRWA 2CFCA 3KTDA 4M55A 5DCUA 5B37A 1WZEA 4XB1A 3DB2A 3WJAA 1E1LA 3TFOA 4WOJA 1W4ZA 2XXBA 1AN9A 1CYDA 5J23A 1HDGO 4RVFA 2NV6A 1BHSA 3DZIA 5MGBA 2C82A 2F1KA 4ZJUA 4E2ZA 5BQFA 3IAHA 4U6QA 2HMSA 3TZCA 3WGIA 1W6UA 3DBRA 4J1NA 1JVSA 1PJCA 4MVJP 1V0JA 1NHWA 3K6JA 5FWNA 1TLTA 2V65A 3JQGA 3WIEA 4IQ0A 2BD0A 4YXFA 1PQWA 4CR7A 2QRLA 3GEDA 3U4DA 1XR3A 4O63O 1PQPA 3KLPX 4XRRA 3WQQA 4D79A 5IDWA 3IP1A 1YXMA 3GFGA 3OETA 1SEVA 3O9ZA 2HU2A 4BO1A 4KQWA 4WLOA 2POQX 1P1JA 2E4AA 3Q11A 1B8PA 1KC1A 2O7QA 3JV7A 1BG6A 1LEHA 2EJVA 4Q9NA 4WPGA 5GY7A 1ORRA 3LZ6A 2UYYA 3BTVA 1AHIA 2EV9A 3MWDB 4IGEA 3ICCA 2AQIA 3JD0A 1K0UA 3TZQA 1GCOA 2VOJA 1YO6A 2PNFA 3DR3A 4CR6A 1A4IA 2NVWA 3BMOA 4ALJA 4IBOA 1ZK3A 4CQMA 5T8KA 1R15A 5JDCA 3JD3A 1D7OA 1PS9A 1ZNQO 2D2IA 2XXJA 3E03A 1H94A 1Y7TA 2R00A 3ORFA 4R3WA 1P0FA 5CDGA 1H2BA 5L3ZA 3OF2A 1C0PA 1XWFA 8ADHA 2PZJA 4ILKA 1CEQA 4A10A 3PJDA 1DAPA 2HRZA 5A04A 4BNXA 4HFJA 4ITUA 2HSDA 1LDGA 2I66A 4BO3A 3Q2KA 4ND5A 5CHEA 3BHIA 1YB5A 4MOWA 4N5LA 4TZTA 4Y98A 2GN6A 4OYRA 4QECA 1KEPA 1MUUA 1PJLA 4R9SA 2GF2A 1DLJA 3H5RA 2V6MA 3F1LA 4N5MA 1XKQA 2YHIB 4Q39A 2J5RA 4YEDA 3D3WA 2NQ8A 3AI3A 4B4UA 2GRAA 3WLEA 4NBUA 1UXGA 2CVZA 3RD5A 1WNTA 4WOKA 1VL6A 3EK2A 5L45A 5ITWA 4YB8A 4JIGA 4CM8A 4EJMA 2W2KB 4PG4A 1I10A 3K8ZA 5C37A 3EDMA 4OIMA 3OJEA 3GDOA 1H6BA 1UDCA 2PGDA 2AEJA 1LU9A 4DLLA 3LF2A 2X5JO 2HQ1A 1YBMA 5COQA 1Q0LA 4GQAA 3I4FA 3NUGA 3QVOA 3MTGA 4DUPA 2AE2A 2BKAA 2B83A 4RPHA 5DP1A 2J3KA 3FBTA 4H3VA 2RH8A 5JC8A 4GSKA 1VSUA 2PR2A 5LC1A 1JAXA 3D64A 2NU6A 4LW8A 1X13A 2JL1A 2PGJA 5I7VA 3C3XA 4AFNA 2V7PA 3TRIA 2E6UX 4EBFA 4XX0A 4KQXA 4CMCA 2AA3A 3MJSA 1CJCA 1YH3A 1GD1O 1PX0A 2VYVA 3HHPA 5AYVA 2JCVA 2Z95A 1SCUA 2H63A 2F00A 5C7OO 3TWOA 4ESOA 1DIHA 1ULSA 3JQ8A 4BKUA 1L7DA 4JCOA 3S2GA 1DC6A 4UULA 4ZA2A 1KERA 1XLTA 1N7HA 4F46A 3VDRA 1IB6A 5L7TA 4I5EA 5IAAA 5L4SA 4IS2A 5A9SB 3RVDA 4F3YA 4DBZA 4Q3BA 1I0ZA 2QRJA 3EYWA 1NP3A 4QUKA 3ZU5A 3WTBA 5BSGA 3KZVA 4RV9A 1LDMA 3G49A 4FR5A 5JAQA 3FR7A 1CDOA 3AUAA 4GMFA 1NPDA 1V3TA 3GOHA 4QT0A 3RUFA 4OOEA 1NR7A 1P44A 1EEHA 3HWRA 4Y6PA 1ZMTA 3MWEB 2CSUA 2BI7A 2P4QA 1ZW1A 3OM9A 3F4BA 3NT2A 4PG6A 3UGKA 3V2GA 2HJRA 3Q1LA 3LU1A 2ZJ1A 4F6CA 3ULKA 3PHGA 3AW9A 3Q3CA 3K2EA 3MCVA 3BZUA 4OGWA 1XCBA 3PK0A 1IOLA 2CDCA 3GR6A 4D41A 3CE6A 4Y9DA 1NTOA 1K2WA 3ASVA 2NADA 3BTUA 3ZNQA 2QQ5A 4H7PA 3Q9NA 4MP3A 4RDHA 3NTQA 2NQTA 1R4MB 2VHYA 1QYDA 4XGKA 4PLWA 4L74A 4BO4A 4CLXA 2X7HA 2YV3A 1E1MA 5KCZA 3JQ6A 1Y9EA 2QHXA 2Q3EA 1T1SA 3ANMA 1I01A 4FQ8A 4H16A 3HZZA 1VE9A 2QYSA 3AWDA 2FSVA 4J7XA 3DQPA 4B3IA 4GSLA 2NVUB 3I5MA 1CWUA 4JX8A 1O95A 1BRMA 4XQEA 1HLDA 1UDBA 1LSOA 1XHLA 1CIVA 3R3JA 4RORA 1HDXA 5T67A 4NH4A 1DIGA 5C3MA 3D1LA 3AJRA 1E92A 4LMRA 4D0RA 1LQTA 1B3RA 3JQEA 1AHHA 4PVCA 1ZH8A 4JP3A 2CNBA 3KB6A 4B8WA 1DSSG 1A7AA 4HNGA 1NPYA 3EAGA 4L9RA 2ZCVA 3P7MA 5IFLA 4IGFA 3PTZA 5JPIA 4EI2A 4YT8A 1YL6A 1ONOA 3K9QO 5DULA 4NK4A 3VZSA 1FJHA 1H93A 1X1TA 4RO0A 4IMPA 1K6IA 3PGJA 3PPIA 2I3AA 4R1TA 1DC3A 3WGZA 3O8QB 4EJ0A 2B36A 3R1IA 4A26A 3FN4A 1NFQA 4LVUA 3U5TA 3LK7A 3EVTA 4XQCA 5CDTA 1KVRA 3W1VA 4EJ6A 2ZKLA 3LYLA 3LQFA 4G81A 2QX7A 2DBVO 3WX0A 5L4NA 4DLBA 3GFBA 5JSFA 3ZHXA 1Y6JA 5L95A 4BNJA 1ML3A 2PGLA 3V1YA 2P5UA 4ID9A 4Q3NA 3NAQA 3G1UA 4UUPA 1BDMA 4WNIA 2X86A 4YJDA 3PFFA 4W9NC 1MX3A 4FGSA 4UREA 2BFOA 4JLWA 2VZ8A 1NBOA 1PU2A 1DC5A 3R6DA 1PL6A 1MV8A 1ADCA 4JQCA 4NFSA 4R51A 1WPQA 3JQDA 3L4BC 3H5NA 2WMDA 2Q2WA 2X0RA 2O3TA 2WM3A 3MJVA 4NG5A 3ZZNA 5BNFA 5B4UA 4YJHB 3QY9A 5F1KA 4MDHA 4NK5A 2PZMA 2BGMA 2EKPA 3PEFA 4KWIA 1C0LA 4FFNA 1N9GB 4MVJI 2HMWA 1PWZA 5A02A 1SB9A 4E5PA 4S3MA 2X5OA 3VAZA 1U9JA 4XCVA 2I3GA 1T26A 3ZV5A 5EN4A 5BSEA 2X23A 1QR6A 3L0DA 5IDYA 3JQBC 4DIOA 2Y68A 1UXIA 3Q9UA 2GO1A 1GTMA 3VTZA 2EKQA 2C5AA 4C7JA 1DB3A 3E18A 3JSAA 3C7AA 2GSDA 3AOGA 4DPLA 4UUOA 1BMDA 1PSDA 1X7HA 3FD8A 5TIIA 2X9VA 4RZIA 1QSGA 5COAA 4ZRMA 2YFHA 5KNLA 4WK6A 4GBJA 4MKRA 4RVDA 2UV8A 4EUHA 3TZKA 5KVCA 2CDAA 2W2KA 5ENVA 8LDHA 4JJGA 4E5NA 2LDXA 2J3IA 2J3JA 4YDRA 3OJ0A 4BHTA 4DWVA 1E5LA 2Q49A 4XIJA 4BS9A 1HT0A 3OA0A 3M2PA 1LDBA 1P1FA 4XR9A 4CV2A 5FI3A 5KVQA 3W6UA 3A4VA 3E48A 3UW3A 2PH5A 3N58A 1E3LA 3H65A 2VZ9A 3GNQA 2GASA 2VHVA 1ZZEA 5IXYA 2DT5A 1DFIA 3GVCA 3AM5A 1G0OA 3PWKA 1CETA 4QO8A 4AJKA 2PKQO 4I5DA 3WGHA 2UUPA 1E7QA 3D5QA 1BXGB 1NFFA 3BHJA 5FEUA 1BSVA 3W4JA 3IL2A 3FTNA 3FPLA 3GN1A 3MOIA 4BKPA 5IZ4A 2EW8A 2DFVA 1VM6A 1ENPA 3H3FA 1HETA 4HY3A 5KJCA 4GWGA 2NM0A 4J0FA 3WIDA 1E3EA 1NX6A 3KO8A 4AG3A 3B20A 1HE5A 1LRLA 1VKNA 1O94A 1EK5A 2X22A 3RUDA 1JLLA 1GQ2A 1E3WA 1F8GA 1D4FA 3GUCA 4XYEA 2E82A 4BIIA 1RJWA 1SBYA 3BTSA 4GAEA 5A9SA 3HN2A 3TN7A 2PTGA 4GLLA 1YQXA 2VRCD 3LLSA 3WGGA 3FWNA 1MFPA 1U3TA 2OOSA 4G65A 1E7MA 1PJQA 4JK3A 2C5EA 2OFPA 4OO3A 9LDBA 3UAGA 1DXYA 1ID1A 2DC1A 3OQ6A 4LSWA 3IKVA 5T64A 3IUSA 3GY0A 1GYRA 4BO8A 3INGA 1T1RA 3MOGA 5JO9A 1DLIA 4WLFA 1B15A 1ZSNA 1Y9AA 3ZWMA 2BMAA 2FR1A 3VDQA 4FD3A 3M1AA 1ONPA 2Y99A 4RPLA 3IP3A 2PKRA 2Q1UA 2GD1O 4J1SA 3DBVO 1MXHA 3WWZA 3FCOA 1LSUA 1GV1A 1Y5MA 3HB5X 1LI4A 3VH4A 3FRJA 2VTDA 1WDKA 2WYUA 3NJ8A 4DLAA 1IZ0A 1BGVA 4CLEA 3QWIA 1ZSVA 2AE1A 3UCXA 2WE7A 1R4MA 3Q2IA 1XGKA 3DWFA 4H15A 4NJMB 3KSZO 4Z6KA 5EJ2A 1LDYA 5EPOA 4YACA 1VJ0A 4LRSB 4R16A 3ZV4A 3PFWO 3RCBA 1GZ4A 3U0BA 3FWZA 4OSOA 4UAGA 4Y6RA 3RKRA 3KV3O 4LMPA 2LDBA 2JAHA 3QE3A 1L7EA 3GK3A 4RVGA 5COBA 4ZQEA 4E0BA 4EUEA 1ZEJA 2IZ0A 3QVXA 1EUCA 2GGSA 1JWBB 2NVUA 1PJBA 3I6QA 2ZB8A 1NQ5A 3RSHA 2D59A 2B4TO 4J0EA 2ZYAA 3DOCA 4PLPA 2CVQA 5IN5A 2GN9A 2EERA 2NUAA 1M75A 4RF5A 1S6YA 4XYMA 5CEJA 4OH1A 3D4OA 2PD3A 1E6EA 1ADBA 1LTHR 5ADHA 3N74A 1ZJYA 1GADO 1GPDG 1TT7A 5CDUA 1WDMA 1GCUA 2WDZA 1RM3A 4RF2A 9LDTA 3FNGA 3ROMA 2Y93A 4NPCA 2NNLD 3IKTA 4MIEA 1NNUA 5ENDA 3KYCA 4KTVE 1CF2O 4IDDA 5TX7A 3QVSA 1A5ZA 4O59O 2FWMX 3PIIA 1GR0A 2G82A 2Y1CA 2B5VA 4Z9XA 3GGPA 2H5LA 3P5SA 3GHHA 3O8QA 4CUZA 3WG9A 4IQ8A 3H9UA 2G76A 3LSYA 3GG2A 5K9ZA 1C1XB 3L9WA 4OQYA 1IULA 4YWJA 2I67A 1U7TA 1C14A 1YE3A 1NASA 3F9IA 4IJVA 1XU9A 4GPD1 1EQ2A 2YV2A 5F21A 3DZGA 3KSUA 4CMKA 2O4CA 2OP0A 2GNAA 3ZU3A 1GV0A 5CAEA 1Z75A 1LUAA 3IJRA 4BO9A 2FPIA 4TROA 1PJSA 4CR8A 1QYCA 1U2DA 3A9WA 1NAHA 2YV1A 4IJKA 1YVEI 1JA9A 5G2OA 3KBOA 3S2FA 4JBIA 3F5SA 3MEQA 3WWYA 2ZB4A 2NACA 4J9UE 2HJSA 1VPDA 2YY7A 3OSUA 1YB1A 4QFDA 2Y0EA 2O2YA 3KHUA 2IDZA 4U7WA 2OBYA 3C1TA 1ZEMA 3T7EA 1B3BA 2PFGA 3TF5A 1OAAA 2JFGA 4NFYA 3VPHA 4CPDA 3PHIA 4BMSA 1PIWA 3SJUA 2WD8A 3PVZA 5CFZA 1Y8QB 3PLRA 4YJHA 1U28A 4BKOA 3RFVA 3SX2A 3K31A 3T7CA 3WLFA 1G1AA 1T24A 5A9RA 4NZ9A 2W4QA 4D42A 3GAZA 1N9GA 2NSDA 1NYTA 1UP4A 4UVDA 1F12A 3VPXA 4YT2A 7ADHA 2X1HA 3TOZA 3IJPA 4WUVA 1R37A 2IYPA 2D3TA 2VYVD 3FR8A 3ROQA 2V6BA 4YRAA 4FFPA 4II2A 3C1OA 3O26A 3WYCA 4NR0A 5JAZA 3X2EA 4MIYA 2EP7A 2NLOA 3QA9A 2DPGA 4GVLA 1B2LA 1HF3A 2GYYA 4M89A 1SZJG 1TVEA 4BGIA 5AOVA 2YQ5A 4BNNA 5KJ6A 1LBEA 1O5IA 5B12A 1U4SA 3FNHA 1DRWA 4WLVA 3EMKA 1NVGA 4BMNA 5EQDA 4AJ2A 1E1KA 1H9BA 1HDYA 1X1EA 3D7LA 3ZU2A 5JCXA 5DBGA 4XWYA 2Q4EA 1DJQA 1U8XX 3NT4A 3ZWBA 3DONA 4NBRA 4F6LA 1BVRA 3CZRA 1E3SA 1KEWA 1NQAO 4DIFA 4O6VA 3OFSA 5JCJA 3NGXA 2O3SA 1IPEA 2YHUA 2VHWA 4WLUA 1R0SA 3JYOA 2WD7B 3WGTA 3AUUA 1E6WA 4DQXA 1JKJA 5C7LO 4BUCA 2PD6A 4GGOA 4WASA 2DBQA 4TVOA 4Q3EA 1ADGA 3VC7A 3CPSA 3BMQB 3HFSA 3B6ZA 3WYEA 2VWHA 3OEYA 1ONNA 5F1PA 1J5PA 3PQDA 1SO8A 1ISFA 2HK9A 4EYEA 4FJ0A 3EY4A 3NDJA 1U1IA 2FY8A 3WBBA 3JYNA 1ARZA 2BGLA 3PHJA 4Q3DA 3RUCA 1YDWA 4GMGA 2H1SA 1BXGA 4XR4A 4HBGA 4XKJA 2W98A 3VH1A 2VHXA 4R68A 4HADA 3TFQA 4YA6A 3UICA 1GEGA 4CM3A 5CDYA 4J2HA 3VPFA 5HA5A 4UUMA 3TL2A 2P9EA 4E5MA 5A3JA 1ISIA 1YGYA 1KYQA 3JQAB 1EUZA 1IUKA 1L1FA 3GHYA 2AG8A 1GZ6A 1XG5A 2B35A 2PK3A 3NRCA 2SCUA 4E2XA 3GVXA 1A9ZA 4MO2A 1BVUA 4Z3DA 2ZCUA 1HZJA 3GVHA 5I7SA 4CQLB 1ZK1A 4D45A 3KYBA 4WE3A 1PR9A 4PLHA 2GZ2A 4TRRA 1ZMOA 5TC4A 5G4LA 3H3JA 4HNHA 3TZHA 3ZN2A 2B4QA 2J5QA 4A7PA 1CRWG 1W0CA 4LGVA 4PG8A 4TSKA 1LC3A 4CODB 1P1HA 4G5HA 3HDYA 4AJNA 1X0XA 1OFGA 2ZYDA 3JQ9C 4L4RA 3ITDA 5G4KA 4BNVA 3LC1O 1D1SA 4CMIB 4CMBA 5IZCC 3GA0A 5ITVA 2WE8A 4DPMA 3VOSA 1ZCJA 2GLXA 3JTMA 3PDUA 1A4UA 2QIOA 2VT2A 4XJTA 1UZMA 5T5QA 3GNSA 5G0WA 1NAIA 2YYYA 1M76A 4NMHA 1I32A 3U4CA 2Q99A 2GN8A 4CV1A 4IZIA 2H6EA 2Y1GA 2OORA 5EQFA 1VI2A 4ALIA 4I08A 1HL3A 5F3RA 4Q3AA 5TS3A 5KVSA 4YQZA 3I1JA 1K89A 4O5OA 2CF6A 5F5LA 2AEMA 1ZIDA 2AQ8A 5KTKA 1XU7A 2VRBA 3DAGA 3OQBA 3HUDA 2D1YA 4BO6A 1EE2A 2GDZA 2WJPA 4OL9A 4UEJA 3GPDG 4L4SA 5I8ZA 1NHGA 4PG7A 3AUSA 1N92A 4NJMA 1NM5A 2RH4A 4ND2A 4PZEA 3H9GA 2JFHA 4GVXA 5H82A 2W2LA 1X7GA 5L51A 3QHAA 2JHFA 2Q2QA 1N8KA 3RASA 4PIVA 2B5WA 4URFA 1SPXA 3HFGA 2YW9A 2OZPA 3UUWA 4KUGA 1E7YA 2HO5A 3WNQA 5F5NA 5JBIA 1UH5A 1EMDA 3SLKA 2D0IA 1I5RA 3PDJA 4IJWA 2X58A 1QLJA 3UHAA 4A73A 1R12A 1T2CA 4PLGA 5THKA 1EFKA 5ER9A 3ZNOA 3CMMA 1RM0A 3VVCA 4AJEA 5HRUA 4QX6A 4W6ZA 2NTNA 5TQVA 4QSMA 4Y67A 1K6XA 1W8DA 2E49A 3TJRA 1DPGA 3KYDB 1LNQA 2TMGA 4OQZA 2G17A 4P4GA 1IY8A 2C07A 2W90A 3ZW9A 4BNKA 1LJ8A 4JROA 1XQ1A 2UUOA 3A14A 1LRKA 3BIOA 1Z74A 3KRTA 2HAEA 4WCFB 5KJ1A 2HMTA 1KY4A 1T4DA 4RDIA 1S7CA 4YTEA 1AE1A 1UDAA 4EITA 5JYDA 4IS3A 2IZZA 3K2BA 1HXHA 4K26A 5KKAA 1NR1A 1D1TA 4E33A 1AXGA 1XIVA 3H7AA 3OJOA 1C1XA 1FDSA 4LK3A 3UF0A 1N2SA 5ILGA 4O0LA 2C2YA 2FOIA 4ZQBA 3H9QA 4PLCA 3PRJA 3U4IA 5HS4A 4ZGWA 4FS3A 4BQRA 4E2WA 1PJ2A 2I5PO 3WICA 1R4NB 4BV9A 4KUEA 5KIAA 3I83A 4N54A 5A1TA 5BSFA 1DAOA 4M86A 1A72A 3GUYA 2ZTLA 4C7KA 3L9XA 3NGLA 5IJZA 2RBEA 4FFMA 3PHHA 1PQUA 1NWCA 2VYNA 5TF4A 4YRBA 4B4WA 4J4BA 4TRNA 1BWSA 1V6AA 4I1IA 1DHRA 1YONA 4W4TA 3LT1A 4E32A 4EUFA 3HDJA 5DBIA 3NX4A 4BVAA 3VVBA 5I8WA 4RLHA 4PN3A 1BXZA 3ZHBA 3JCZA 3U49A 3QWHA 2JHGA 4OAQA 4IINA 4FC7A 1Y8QA 5HBRA 4E30A 4QO7A 4CUJA 4B7CA 4LISA 2FPGA 4ND4A 3GN2A 4BQPA 2ILTA 1VJ1A 2DU8A 3QQPA 1JW9B 4YAEA 4DMLA 2BFMA 4B3JA 2AXQA 4KTTE 5ES3A 1Z73A 4MVJM 1C1DB 1VLLA 3WGQA 1HDRA 1WW8A 4K28A 2X6TA 4EEXA 2X9NA 1B26A 4INAA 4YJGB 3C24A 1HSZA 4R9RA 5B4VA 4IXWA 3E1KA 1JN0A 3BXXA 4M87A 1PWXA 2XOXA 2GZ3A 3OP4A 2B37A 5THQA 3AY7A 1PS8A 3AFMA 4K1LA 2PV7A 2P91A 1RWBA 3DO5A 3WGYA 4PLZA 3PHLA 2NVBA 3CSDA 3ZV3A 2EGGA 1Q0HA 2BF7A 4IJUA 3SXPA 1YL7A 1T2AA 2IYOA 3ZNNA 2X0IA 1SEPA 3LC2O 4DRYA 2QRKA 4ALMA 1ENYA 2VCYA 4I5FA 3PXXA 2UAGA 3PJEA 5BNTA 1MG0A 1Q7GA 4WEOA 4FSHA 1I3LA 1GYQA 1GY8A 3UN1A 1VSVA 1UAYA 1NQOA 2WD7A 4IDGA 4BNUA 3KETA 2GN4A 3ZWWA 1QYWA 3G79A 1XEAA 1XQ6A 1DFHA 3BMQA 3WR5A 4Z0PA 5IDXA 5EL0A 1E7SA 4BNWA 3MZ0A 4OMUA 1ULUA 1IHYA 1E7WA 4IXTA 4DC1A 4HFRA 1RYEA 1YKFA 4M54A 3GRPA 4KUHA 3UKOA 1Z6ZA 4W9NA 1Z82A 1QXSA 5CEFA 1JKFA 4N18A 5EMHA 1K3TA 5L7WA 3SJ7A 1ZK0A 2OGUA 4WGGA 3U09A 3DZBA 4D3FA 1M2WA 1BXKA 5DOVA 3L4BA 1MP0A 2BFAA 4ZU3A 1SB8A 4ZHSA 4LCEA 3JQAA 2DTEA 4DBVO 3PWZA 4CM5A 3OJFA 3QVTA 4CM7A 3ZWOA 1VL0A 3RC9A 4CM9A 4LVCA 2ET6A 4NQZA 4OM8A 3RBZA 4AJHA 1T2DA 1WLYA 4J43A 5GZ3A 3OBBA 3GGOA 4CQLA 2DQ4A 1FDWA 1QLHA 1V8BA 2O4UX 2J5KA 4U0KA 1B16A 2DTXA 2YHIA 3ENNA 4BB5A 1FXSA 1IE3A 2VUUA 3HN7A 3JQBA 2FSSA 3U62A 3WYBA 3S2EA 2JD1A 3EHEA 4I5GA 1P1IA 4BO2A 1Q2XA 4E12A 1YB4A 4O1MA 2DAPA 3RIHA 2DKNA 3HDQA 5DOZA 1P1KA 3ROPA 1U5CA 1F14A 3QLJA 2Q1WA 1TT5B 1DOHA 3LT0A 4PRLA 4J90A 2PD4A 3DTYA 1O9BA 3ZI0A 3H4VA 4FPXA 4JP2A 2GUGA 4ZN6A 1GAEO 1JQBA 3ST7A 3C85A 1P31A 1R0LA 4PRKA 1SOWA 1Y81A 3QVWA 2YFQA 4PCVA 2Q46A 1DRVA 3UVEA 2Z1MA 2D5CA 4KDEA 1LSJA 2AMFA 1Z7EA 4CV3A 3DOJA 3GLQA 4MVJE 4E21A 3S8MA 1OBFO 4RZHA 3CZMA 2NTJA 2UDPA 4IY1A 2RIRA 4YBZA 2FZWA 4D43A 5JAMA 4P38A 4GKBA 3TNLA 1DDOA 5KKCA 4DL9A 2EG9A 5JY1A 1EK6A 3FSRA 4P8RA 4ALKA 5KJEA 5CP8A 3ADPA 1A9YA 4RLSA 4WECA 4LRTB 4XZ3A 5DF1A 3SC4A 1PR3A 4Z9FA 3RQSA 4PZDA 3I23A 4DIBA 1V3UA 5TSDA 1QYVA 1RM5A 4N5NA 1WDLA 2Q2VA 2R2GA 3DMTC 2X0NA 3DHEA 5T6BA 4CQMB 5JC1A 4HWKA 2JD0A 3NJ4A 5BNIA 2EW2A 4NJOA 2OHXA 2FRDA 3HB4X 4NI5A 5GZ1A 1Y1PA 2VN8A 4RF4A 1YQGA 4WJZA 4RF3A 4YAIA 1HEUA 3ADOA 3PJGA 4RPKA 3VKVA 2DM6A 3ABIA 3OIDA 4WCFC 1O8CA 2IZ1A 3JQ7B 2Q1SA 1KVSA 4B3HA 4CLRB 3OJLA 1U3UA 2A92A 4FJ1A
chains in the Genus database with same CATH superfamily
4OLAA 2C2ZA 5AVOA 3WADA 3OCCA 1BMQA 4MGZR 1JJFA 1Z4NA 3ZCPA 4RDXA 1LVGA 4RQTA 3HZRA 3IDQA 1W4CA 4JN6B 1YBFA 2CYBA 4N6OA 5GJWC 5BW5A 1DAFA 1YCDA 2WA2A 3K1YA 4XSHA 4MGEA 3IPYA 2RGNA 1JB1A 3BMCB 5DX1A 5EJIA 3KEQA 3QJ5A 3DNMA 3INTA 5IC4A 1MB4A 1N5MA 5JMPA 3B3GA 4D4GA 1Z8FA 1F4PA 3DDUA 1JHOA 4BGUA 1VYUA 5ALSA 5IM4A 4B71A 2BH9A 3RC2A 2VWGA 2XCRB 3PT9A 4ER3A 3OQMA 2Q50A 1U3GA 2IPOA 4YCJA 2EGHA 4OEHA 4Q4AA 5JCOC 4L5JA 4EABA 2ZJ5A 3HCBA 4YRSA 3BA1A 1KMMA 2E48A 4PX5A 1I2AA 4R2WA 1UBKS 3PQFA 1ULZA 4GMKA 1BJKA 4WJKB 5HQJA 4CU5A 2ISSD 2WF5A 1NQTA 5EJ7A 2DPHA 4OJYA 2AEFA 5HMLA 1CBUA 1KQPA 1U2GA 1Z4QA 3DE7X 1E59A 3T7RA 5B1EA 4I4TB 4LE2A 4D8XA 4H18A 2O0MA 4PAOA 1DAMA 3O8DA 4EY4A 2PSEA 3QUAA 1XN1A 5BR7A 2VP2A 4YMGA 3UOWA 3C4JA 1EWQA 5CJ2A 1YRAA 2QYTA 2QXTA 1XX6A 1KAHA 3ONEA 4R81A 1JXQA 3VQTA 1ACMA 2FPWA 1SWWA 1J2UA 1J7JA 4B2LA 1E5DA 1THTA 3GEHA 1Q15A 3OQHA 2JKVA 4I4CA 2P6OA 1R64A 5GZ6A 3E9DA 1YS4A 1KYIA 4GKJB 3MT8A 4KQFA 1P2BA 3L7JA 2GF0A 3IH5A 3ER6A 3PDHA 4AP6A 2O06A 2X9GA 3OP1A 3MWYW 1JG6A 1E5QA 1KRHA 3VMFA 2JFZA 1R8YA 1DIAA 1JLRA 2I0FA 2ZT6A 4MCHA 4RD2A 4BLQA 3RDPA 3JD2A 3CZAA 1QH1B 1DRKA 5FPYA 4BWVA 3SDSA 1CJVC 5C8VA 1OVGA 3QVGA 3LO5A 5SZKB 1YL5A 4UEWA 5FI5A 1H8HA 1ZD5A 4IZHA 2OHIA 1A2BA 3BB4A 2FEOA 1K3UB 1IWPB 1DELA 4KN5A 3WIVA 5ED4A 2W2NA 3AR9A 3IUQA 4L73A 3IBGA 3PD7A 2YIVX 2VNKA 3AFOA 2IYSA 4OREX 4EB3A 1HDCA 4X95A 4FDAA 4M88A 5F12A 5A6SB 1ONSA 1SU6A 4CLHA 1A9PA 2IHTA 2XD4A 1O6FA 2QB5A 3O2SB 1CEXA 4PWYA 1YUBA 2GCPA 3IMGA 4HLCA 1Z36A 3I09A 1B1CA 4LRWA 4ZQFA 1KVTA 4YRPA 3V4PB 3TLBA 5IKMA 1TZBA 3G0OA 3QF7A 2Y71A 1X8KA 5FOQA 1ZSYA 1EA7A 1Q7BA 2XMQA 1IEWA 1SU8A 2Q3LA 3GG9A 4KAFA 1GNRA 1U2RA 2C3MA 5I7WA 3GD7A 3UAZA 4C7OA 2QW8A 2FG5A 3EW7A 4N7MA 4NNOA 2B82A 3QYJA 1XZMA 2FDRA 1U2TA 1PT7A 3F0TA 3I2YX 4PQFA 4QHSA 3KG2A 5BN5A 1N1GA 2I1VB 1O77A 3NXKA 3HLTA 1BU8A 4I1OA 3Q8KA 2J9FB 3ZHTA 1ZXBA 2YHSA 3BK2A 3E22B 2P4EA 5DVZA 3PPVA 1XDBA 2A4KA 3DOHA 4S2EA 1I6LA 5FBRB 3I34X 2O2SA 2J5XA 5BQXA 1XWIA 3RUHA 4R6WA 2C2MA 2G9ZA 3HCCA 1Z2DA 4UCXA 2V59A 1VBFA 5E6RA 2HWWA 3N2EA 4Q03A 1NFRA 2IYVA 4BLWA 2UUAB 4JBHA 5CDSA 1PZEA 3CPHA 3QMPA 4X1KB 3PDIB 4HTAA 5K4AA 2QW0X 3FMVA 1FQOA 3SXUB 3U31A 2JH9A 1U0HC 4NZOA 1QM5A 2Z3WA 1G7SA 3R0IA 1N7JA 4UHDA 5TF0A 1KMHB 4O2RA 1FUKA 3S40A 1FS5A 4BV3A 4EYSA 1EBFA 4MUBA 4RA9A 1U31A 5DN6D 2IH5A 4GXRA 1L5FA 4FFOA 3LLCA 2OV6A 3NTVA 3OIFA 2IEAA 2JASA 4CG1A 1FFHA 5AVTA 1ILEA 3Q0EA 1K6JA 4LQCA 1P77A 2HRBA 4V0QA 4B83A 2AV6A 5C1DA 3IXLA 3KZCA 4NIMA 1U3DA 4AXBA 1I2ZA 1R0BA 1GILA 2YDYA 3WS7A 4JI0B 2W2LD 1WPXA 3OCJA 1BWPA 4JDPA 3HR8A 2MHCA 1OH7A 4MR7A 1YDEA 2YX1A 2DRIA 5IT5A 1OF1A 5I4BA 3U3KA 1A71A 2WQZA 1HTWA 1CU1A 3BGDA 4M7OA 4FCCA 4W82A 2P90A 4KZPA 4GOND 4OJTA 1GFSA 5A4MS 1KEZA 3IP9A 1YZYA 2CWDA 4YREA 1GUAA 2NZUG 1NZJA 3BN3A 2X76A 3IAEA 1F6BA 1FNMA 4YRJA 1HNNA 2O3RA 4GPEA 1EX1A 3TIXB 2Q8NA 4W9MC 1A9XA 3EZ7A 4GGPA 4V02A 2Y67A 3IDSA 5TEVA 1YD7A 3LBHA 2VXCA 2JDIA 4J16A 1U8FO 2WUEA 5IVPA 4HAYA 2YH2A 3RAPR 4P81A 3JALA 6PFKA 1TT5A 3JVVA 4L8VA 4TV9A 4UQOA 4UE2A 2VDUE 4O33A 2Y3IA 4DILA 3U5ZB 1JB9A 3SGLA 4JZKA 2YVQA 5CNJA 5BQOA 4DC0A 2P4HX 2YUTA 3O6VA 3FSJX 3RS0A 4GP7A 5BUQA 3GGJA 4GX5A 3HCNA 3N2IA 3NDPA 5AVVA 5IWCA 3HCDA 5T41A 3NHBA 1N8NA 1CZKA 4XPZA 5I7FA 5LJIA 3WC4A 5EZYB 2ZFUA 4UNPA 1G19A 4JBGA 3VOBA 4J03A 2EKZA 3FCYA 1GVHA 1I4TD 1XTUA 2V6IA 1CSEE 4IX9A 4YCDA 3OIWA 3DZHA 2HN9A 5DWQA 4LJYA 3SG0A 4J7UA 3TGWA 2B2CA 5G40A 1NN0A 2J0EA 4C88A 4TKLA 8ABPA 1DWQA 3O83A 3TZBA 5B2ZA 3MN1A 1ESDA 5FLYA 1G18A 1N6KA 2FMHA 4C01A 4MKXA 1G6Q1 4DJEC 1SULA 2V7XA 3HCWA 1GRVA 2FEMA 4UVGA 3S1LA 1PGJA 2QZZA 4UBMA 1EQAA 1DJOA 4G89A 2PX0A 3NANA 4FCVA 2GRJA 1JDBC 2EEZA 3GLHE 1NNEA 3CTMA 1XNGA 1PFWA 3LQ4A 3W9UA 4HOYA 4HH0A 4REOA 4RD0A 2CUKA 4U8GA 4V0MA 1CF4A 1ZD3A 3N8HA 1YDMA 3RFFA 2UZ0A 1YDGA 3WIOA 3PA6A 3DEZA 3COSA 2QGZA 3DKVA 1KI2A 2HIHA 3C48A 3ZY6A 1HPLA 1M8JA 4BBPA 1FNBA 3P2YA 2HSGA 5GP1A 1OY1A 2WK1A 1JF8A 1I36A 4OQMA 1LWNA 1XTSA 1HYBA 4BFXA 1G4UR 5LN1A 1KS2A 5FJJA 3GGDA 1GZ3A 2QTRA 3PZRA 3WNVA 1PNQA 4YGYA 4CTJA 4F5ZA 1XA4A 4NNPA 2WJAA 2QTMA 3I9V1 5CT9A 3IP6A 2HLHA 3FWHA 3KHSA 2B20A 2HC9A 1ZUNA 4IFBA 1XVUA 5J1SB 2MJLA 3O9MA 2Q8QA 2G9NA 1OC2A 2ZSIA 1FYWA 1K97A 2XCSB 3NBQA 4HP8A 4HQFA 1DEHA 4U8HA 3GDWA 5DEOA 2XT9A 3CW8X 3CF2A 3H5VA 2WTBA 3M3DA 2DFLA 1ODJA 4ANFA 1PLKA 1QG4A 4ZICA 5CA1F 1GA6A 2YRFA 2ZS9A 9ABPA 5L8VA 1N6LA 3LGSA 1RZRD 4IXDA 2FN7A 4DQDA 3ENVA 4ND7A 3KCNA 3TAUA 2NO6A 5HTOA 4CLOB 4JB2A 1XQVA 3BAZA 1YWGO 1CZNA 3OCXA 4AI6A 2JK0A 1JGTA 4P33A 4Q3CA 2BDEA 4AY2A 4JYAB 3BCRA 5CYGA 4MI1A 1I5OA 2GEKA 3LUAA 2PSJA 2RGWA 2VSOA 3I0NA 3JQPA 3LHIA 3O93A 1IHXA 3E8XA 3R7SA 5IVKA 4OHMA 2J33A 2D5BA 4LPSA 2FVYA 4P4LA 5T6MA 5J43A 3EZGA 3NPMA 4ZQHA 3CKYA 5CDHA 4FZ5A 2QZ4A 3U44A 4QUHA 2X8BA 3I2FA 4UPDA 4ZEMA 1U6KA 1YFJA 4QVGA 5KOHB 4DMUB 4AKTA 4PG5A 4Q7QA 3QKWA 3IR7A 3T7TA 1AUVA 2I71A 4MLCA 1UXOA 3BX1A 1TKBA 2ERCA 3JD4A 4OQFA 4OLBA 1UKBA 4O4JB 3PDWA 4YQYA 1FDTA 3AHIA 4LCJA 3RNOA 5KOIA 3PR1A 2A57A 4EGCB 2I33A 3MTDA 3DDNA 4MPRA 1G4HA 4D97A 3RU3A 1T2FA 1GZUA 3L4SO 2DUWA 4QFBA 3AUTA 5JW6A 1UXKA 3GI1A 4EMTA 5TGDA 4U7TB 1NN5A 2WSLA 3WLTA 4DC9A 2D8AA 2HGSA 4E13A 3KOYA 4JC4A 2YWRA 3I52A 1MJGA 2IC5A 4IIVA 3QKSB 2QVBA 3QWAA 1E4EA 1GGKA 1C29B 2HQOA 4HQNA 1TJNA 5IHXA 5HNKA 1XLTC 2O2CA 4FHGA 2CJWB 4TLLB 3V8RA 1ZX1A 3K0FB 2DY1A 2AXEA 1CZOA 1EFLA 1P9WA 2H65A 2VH1A 4S0ZA 3UCEA 3ELBA 1CUUA 3GPLA 3BAFA 4FXPA 4EHIA 5HE9A 3IMCA 1Z0KA 4R2MA 2Y66A 1H2HA 1Z2CA 3TI7A 5JYEA 4CV0A 2Z6AA 1I3MA 3OEHA 2MSKA 1FRVA 1WMDA 1YBVA 3O0DA 4Q1FA 3BH7A 3CUWA 4ZHQB 1SBQA 4P53A 3L6DA 5AOAA 4F6RA 4RVHA 1X7ZA 2FFJA 2QUAA 3VI3B 5JISA 3GLIE 2CFIA 6ADHA 1P91A 5CA1A 1ODTC 2JCXA 2OMEA 1AO3A 4MP6A 3ELWA 1XMXA 1SD5A 3NTXA 4Z3OA 1POXA 4IOMA 1E1QA 4JLNA 3KLMX 3GJTA 4FZVA 3NHYA 4CM9D 4LN1A 4B35A 3ITEA 1RI3A 2J08A 5CVDA 3R3HA 3HI4A 1XQ9A 3EPJA 4JAVC 5E3JA 1V1RB 3UPTA 2A9RA 2BJVA 2BONA 2RAFA 1TUBA 4I2NA 4JLSA 1XVLA 3IA2A 4L08A 4B7XA 5HKBA 2B4KA 1YS1X 3TGPA 4BVFA 4WOPA 4NJEA 4NCKA 1UZLA 1GSIA 3IMFA 3MVEA 4P2BA 5K45A 4XDYA 4D4HA 3HB7A 3KL4A 1MX1A 1N5LA 2ZBEA 2AF4C 2FZVA 1FTGA 3KXDA 1UJMA 3I9NA 3O8BA 4MQFB 3RHSA 1Z8DA 4F84A 1ZS9A 4AG5A 5SZHB 1PJ4A 3QTLA 3TQHA 1CUYA 1AGRA 1T4MA 2JRLA 2CY0A 2RGXA 5JHHB 4J9VA 4JYBA 1KI1A 2GBGA 2CL6X 1JEDA 4ZVKA 2PS0A 4F2PA 4AJ9A 1DG3A 3U19A 5GJBA 1V37A 1TJ3A 2R7LA 1QRSA 1QG6A 3DVAA 2Z1NA 5TRTA 4RPCA 3CHYA 3ZTWA 4GE0A 1GDHA 1C5KA 2Q3BA 3EIOA 3QG1A 3N8NA 4BCBA 1D6JA 4PZLA 5JJIA 1SCNE 2ZE5A 3T7SA 4L0CA 2PLAA 5I9MA 3PKZA 2VHQA 3GT0A 4X6LA 4MKHA 5JE8A 5BWNA 4R01A 5C7IO 5JASA 4Y6LA 4UJ5A 3BWXA 4D5EA 1RE1A 4G1EB 4MRNA 4UDXX 2QVYX 3KV1A 5SY4A 4DREA 2PO5A 1YTLA 7MDHA 2IYZA 4UAUA 3RVQA 4WEQA 3IFSA 4AJOA 4U7PB 3WWEA 1B74A 1TTHA 4AJJA 1VSBA 1OROA 4CEJA 1DV2A 1JSRA 2FCAA 1L7AA 5JC1A 3IILA 4JLKA 4BLPA 1X70A 4P22A 1PQ4A 4YRDA 1UUFA 1EVYA 2A30A 3OF3A 3QLTA 2ZYIA 5K20A 4PY2A 4ZZ1A 2ZWVA 1I24A 1Q1BA 2HPHA 3KQMA 4W63A 1GZ7A 2HI0A 3KSDO 1PGOA 4N5DA 2R5NA 1Y8RB 1A76A 4G9EA 1D04A 1JH8A 4CUKA 3WK4A 1L9XA 1RVDA 2NOAA 2WTMA 1YR7A 1S2MA 3NW9A 1CR6A 1FTNA 3OZUA 3WB9A 4GM4A 4A03A 4ZYYA 3DVLA 3COYA 2W7TA 5A03A 2Z5LA 4JR2A 4PYOA 1LJUA 1PBNA 4J1QA 4YRQA 4CKBB 2WWXA 3TLMA 1KJYA 3KX2A 1UWVA 3EISA 3V4FA 4DABA 1FFEA 1ZN2A 3N2KB 2V3VA 3HJGA 2H17A 4OHXA 4H1WA 3CMCO 4ZKDA 4R8MA 4FYJA 3D3EA 4DSZA 1U8AA 1TGVA 4HX2A 4X6UA 4RPGA 2OFOA 2OK8A 5L53A 5BVHA 1GUBA 1UJCA 2CNDA 1L8XA 2NUBA 2XA2A 2GK3A 4EARA 4RTJA 4TMFA 3FZGA 1NVTA 2Q5JA 2VDJA 4X60A 2BLNA 2R8OA 2WZCA 4KV9A 4NE2A 5E8RA 3R3ZA 4RGYA 4TUYF 4MUMA 1EX7A 3D6TB 3QEAZ 1RHQA 1XZFA 1Z28A 1U0JA 3BXPA 3FVQA 1Z35A 2B0JA 4U2FA 4WXMA 4X6YA 3WDMA 3WTCA 3IQHX 4W1QA 3F5DA 3O0TA 4E5YA 4LDPA 2ACKA 2J4FA 3UXMA 1IN7A 2NIPA 2XTAA 4OGLA 2RGYA 5AO9A 5HIMA 2C9DA 1D6SA 1QQ6A 3NH6A 3ZHRA 3TQTA 2C8VA 3E9QA 3L8ZA 3S2SA 5EIEA 3T1TA 4H7IA 3VPSA 4NRDA 4CTMA 2FPPB 2PH7A 2HQSA 4WXRA 3INRA 2HK8A 4WZ6A 3SQOA 1O89A 4DHWA 2I1QA 2B21A 2ZI9A 3OVMA 4DJFC 1QC5B 2P78A 2PT7A 2QN9A 2W6ZA 2XGOA 3LGXA 5EUQB 4EZBA 4JI7B 3M0EA 3EZFA 1FE8A 2ZAIA 1L4YA 4HUQA 4OFBA 4A27A 2PBZA 3PQEA 3RROA 1JEYB 2FRVA 7YASA 3NDBB 1BHQ1 3TIFA 2XNDA 1P5ZB 2WFLB 1OA1A 2AUTA 5LZ4A 1Z56C 5G1PA 3C39A 2DLDA 1V4VA 4QD3A 1DTWB 3SC6A 3N75A 2R7NA 2OPHA 4HCJA 4CM4A 3DT8A 3CA8A 3R8FA 1JR3E 1SKMA 1AU9A 1T1IA 1EP2B 3DC2A 4FOSA 1S3SA 2ZB3A 1VDMA 1IYZA 4QOGA 1AGNA 1XZCA 4IZOA 3RU9A 1B7GO 3PFIA 2RHWA 4U3JA 3K94A 4URXR 3DZKA 1VKOA 3MCWA 1P74A 2ORED 2XDAA 4XIGS 1Q14A 1XB2A 2OAP1 4I36A 4NNJA 3VXKA 5JNLA 1CX9B 1Z6AA 4GNKA 4JHLA 3UV3A 4QG7A 3GEMA 1G2QA 2C2OA 3VBEA 3N28A 4MWSA 2HY7A 1UXHA 4PS0A 3O1HB 4L8LA 1TXGA 4DVJA 1HC7A 3LUBA 2C4MA 1H8HD 4P4UA 1KMIY 1HFWA 5ISMA 4XUGB 3FYUC 4TUYA 4R8VA 3N5CA 1JTVA 2DUMA 3I8SA 3HL4A 1AGPA 3EIUA 5ALVA 4OJMX 3A6JA 2QP3A 2ODEA 5K7SA 2G4CA 1JHDA 3PFCA 3ODGA 1T8YA 3S28A 2R68A 1LW7A 3A6HA 8GPBA 1ZJWA 3M6UA 3GH3A 2XMDA 4WGFA 1E9CA 3EQ8A 1XELA 1RXYA 4ZAFA 1QVAA 3BL5A 3ZVRA 3PLNA 4ROSA 2IXBA 2YR0A 3W4KA 5LNK6 4CWAA 1XP8A 1PG5A 1PEAA 2ZK7A 4I9HA 4K9MA 4N3CA 5FUXA 3PEUA 1M34A 3G82C 3TD6A 1KAEA 4IHAA 3HRHA 4M0FA 2XDQA 2FPOA 3DEHA 1TL7C 1HG0A 5AJTA 1U0TA 1BS1A 1FYFA 2LCIA 2B25A 2CBXA 3DFUA 1J97A 2QVCA 1AF7A 1K8QA 4CDMA 5L9AA 1BTOA 2NU9A 1D8AA 4PLFA 5DYNA 2ZWMA 1RAIA 2O7SA 4AMVA 4YMVA 3GELA 3ZNPA 3TVTA 1AQNA 4G37A 1TEHA 2TMDA 2IBMA 3BL6A 4FFBB 1UK6A 1M73E 5JWOA 3USCS 1EDZA 1LBTA 3PCXA 1DFGA 3ID6C 1WZNA 1YJ8A 1F7VA 2NU7A 1FFAA 3G5LA 4OXKA 2GZDA 1G21A 3RQIA 1HNZB 3AOEC 3IHTA 3GZ4A 1XDWA 2YBDA 1EVJA 4ZVPA 3RUAA 1DO8A 4WKPA 2I2FA 4QODA 5KMGB 1XT6A 2PWPA 3N2GB 4YHHB 1YS6A 3G7SA 4DTIA 2F9MA 1JILA 4C5AA 3LIIA 3DHWC 1D4AA 1MA0A 2NPFA 1F2VA 2O48X 3GO4A 1EDOA 4ROTA 4TLMB 4DA9A 5FRDA 3WLJA 3NUZA 3ANSA 3AOEA 3FBGA 3P9IA 2Q4BA 4GZLA 5I9IA 1EPUA 3SS9X 5KYWA 4L02A 1IN8A 1QV6A 1WKCA 2WR8A 1P80A 4OY3A 3SHOA 2P2SA 3GEPA 4XIYA 1HA3A 1AY0A 3UHJA 1WOMA 3CJQA 3AM3A 3RIYA 4PHTA 3MLBA 2X2OA 4B4OA 4P4NA 3T3HA 2ZE6A 1RHKA 5EE5B 3TTXA 2QAGB 3WK5A 3S68A 2G5CA 2ZRDA 3RYCB 4ER6A 2JLWA 3HBAA 3W8FA 4YPVA 2IHZA 3HG7A 4RPIA 1CVLA 5IYZF 3L0CA 2XGSA 1NJGA 4Q9DA 4EEZA 3STHA 1E89A 1GUYA 4M1YA 4NP6A 5AXBA 1JEQB 1T8PA 1UJBA 5JFOA 3TOSA 3CVYA 1QGUA 2SECE 2H5JA 3ESYA 4KMSA 2C54A 1ODIA 4C6TA 1Y8AA 5KYXA 1E2JA 4I9UA 3TI9A 2E37A 5DN9A 4IHJB 4CM8B 3A3KA 2W37A 5ECDA 2WSMA 1HNXB 1TAQA 3DVQX 4IRXA 1Z4KA 2UXDB 2CL7X 1SNYA 2VPIA 3BOSA 3BSSA 4UXJA 4WXEA 3PGMA 1H6AA 5AHOA 5ALZA 1L4BA 3SS7X 4EF5A 1SMKA 4GM1A 4IYJA 1C1HA 4US0R 4GBED 4GWKA 3VX3A 4EIWA 5LMZA 3WV4A 3GQBA 4DG9A 3N3AC 1FNNA 4QASA 2B1RA 3AINA 2JDID 4KKXB 4TPKA 4UOQA 1QB7A 3V2UA 1J2RA 4B43A 2AMJA 4NDAA 4TTQA 1FJGB 3GZNA 1Y9DA 2VCEA 3AUJB 3WRVA 1VMDA 5K0FA 5MN6A 3RRNA 4EYKA 3AG5A 3NKLA 4KOAA 4MRAA 3ZY5A 2V6GA 4HAZA 4HFMA 2D7DA 1XMIA 1IRXA 2MYPA 4V39A 1SU4A 1XZPA 3EZLA 2GBLA 2VP4A 3MMSA 5JPDA 4FTWA 1SCJA 4PLYA 3DZCA 2NXCA 4NL4H 2ENWA 4TWZA 1UK7A 5L6LB 3Q5EA 3ZD9A 3PIDA 1C3VA 4NCHA 1XJCA 1U5AA 4JFRA 4R7TA 5CB4F 4AVYA 3U9LA 2RKWA 1SCUB 2I6QA 5HWSA 4JEUA 5ITZB 3G9XA 3PNSA 4CMEA 5C34B 4JQOA 5FWYB 2LVBA 2MYTA 1JSXA 5K6AA 2Q0XA 2AN4A 5DZSA 1H0KA 2RHCA 4G8DA 2QQ0A 2VWPA 3S7TA 2R0QC 3SEQA 4NDZA 3AXTA 3TLGB 1G8YA 3WGJA 2YXEA 2PO7A 5IYZA 1A7JA 4D6XA 2PZFA 4KKVA 4GLBA 4I4LA 1LX6A 4Z0HO 1W8IA 3GP8A 3EFHA 1JX6A 4TMYA 4NU8X 3JARB 3OMXA 2DFPA 1KWGA 4GRDA 1B0AA 1E6MA 1LKZA 2OP1A 4Q37A 5HKKA 2OZKA 5JRDS 2HA7A 2BBSA 3ETCA 1MGPA 1HV8A 1SCDA 2CHGA 4CQMD 3WRXC 3TSWA 1MX9A 4PVDA 4YR9A 1Y5RA 4LF5B 2OV4A 1MC8A 3O1IC 1G8AA 2Q29A 4PONA 3EGXB 4K86A 1VG0B 2JIDA 2I7XA 1OLUA 1BE1A 3U3RA 4LJ9A 1QVZA 4B8ZA 3GJYA 2VF4X 4KBGA 1B41A 1PEKE 1OIWA 4GKKB 5LQSA 1W25A 5HS6A 4DR2B 5KYUA 3CW9A 3EGCA 1MD9A 4I1SA 3WRXA 3ZQKA 1GL7A 2FUKA 4EATA 1JIXA 4EDFA 3NUQA 4C4ZA 2PPVA 2QTGA 2FLWA 4AL4A 1PK9A 5GV8A 5B57C 5GAJA 3W3AA 3PRYA 4KIUA 4NVRA 5A9TA 4HAXA 2G0TA 3BHMA 3BGVA 1YVDA 3FYHA 3RJ5A 3DL2A 1G1MA 2OK7A 2BI8A 1O4WA 3RJ9A 5ANRB 1EWKA 1DAEA 3AONB 2YVKA 4K40A 1SK8A 3CEPB 3PRKE 4Q34A 2OCDA 1I3NA 1LK0A 4WD3A 3ANXA 1QG0A 3ESRA 4QOFA 1C0KA 1U81A 2ETXA 3L8GA 4HDKB 4W1RA 5AP9A 1XTTA 3T4XA 1OI4A 3F5QA 4BO0A 2AOXA 4RXUA 4D4KA 5CB4A 1O2DA 2H4ZA 1C41A 2GZ1A 2OXEA 1KRWA 5G41A 2N42A 2BGIA 1NXTA 3LWDA 2DFKB 4ARBA 3AL3A 4HZUA 4RZSA 4YAJA 4TX1A 4UMDA 1ML4A 1OSNA 2Z2XA 4AAYA 3PNLA 2Q21A 2Q1YA 3NKVA 2MSEB 2Q6KA 4QYIB 1XQXA 2D4AA 3CLTC 1G5QA 3D2BA 2ZTSA 3OOHA 4JNCA 5J63A 2ZM6B 1Q0QA 2EFHB 5JQGF 4BIMA 2F3RA 3ENWA 3GFRA 3SZGA 1FMTA 2XBLA 1UKYA 1I9CA 4JH0A 4L9WA 1TQ2A 1VJCA 1O0BA 2PYDA 3LUHA 3PNYA 2I91A 1SJ9A 1HKUA 3SR4A 3TRFA 2QPTA 4PSCA 4CL8A 1N3LA 2IT1A 4AJIA 1JTFA 2NZXA 1IATA 2OCLA 4BLSA 2ZJ0A 2ZYGA 3SVTA 2FEKA 3KVOA 2W2PA 1ENOA 1SHZA 4QDOA 4IG4A 5EKDA 3UMBA 4GS5A 5HDBB 4RIIA 1MH1A 1QCCA 1QRRA 4N47A 3JTEA 3WLNA 4RAQA 4B31A 2W42A 3LTEA 1U9CA 5K0NA 1I8TA 2IRWA 1KIAA 2W00A 2YYZA 3KTDA 4WBNF 1NG9A 3AIKA 5EP1A 1CTQA 2FF5A 4M55A 5DCUA 5IJWA 1AV6A 4XB1A 4AS1A 1E1LA 4C7VA 2XXBA 1AN9A 1CYDA 5J23A 2QRZA 1ZL0A 1G4AE 4RZQA 2BTEA 2C82A 3OEHD 3Q10A 4EHHA 4ZJUA 5BQFA 3IAHA 3WGIA 2HMSA 3DLPX 4FOTA 1WA5A 4L5IA 1NQXA 2NYUA 3VSBA 4A0HA 1K27A 1B76A 1EK2A 2ATXA 3GCGA 2VNJA 4MVJP 1REQA 3K6JA 1DCTA 5FEMA 1TLTA 1HTTA 1X1BA 3MT0A 3JQGA 2BSQA 4KXFB 1E1QD 3V32A 1G9XA 1N2EA 3MGKA 3O3CA 4YXFA 2GJ9A 2IS2A 1C9NA 3SAJA 1SHJA 2QRLA 2BMFA 5IC5A 4E7OA 3U4DA 4Z7OB 4O63O 4HYYA 3G0IA 3WQQA 4BZZA 3A1FA 2ZZKA 5FWAA 3PTAA 1YXMA 3OETA 2OKCA 1FP4B 3L04A 1EZZA 1NVKA 2HU2A 5L3QA 3E9RA 1H05A 1O0CA 1J42A 1EDBA 4WN3A 1L3IA 2POQX 2V98A 4BMPB 2NQ2C 3HS3A 2P65A 1YIAA 2E4AA 2ZBVA 3JYHA 1B8PA 3Q11A 4U2CA 4WPGA 2EJVA 5JQGA 1G20E 3BWEA 3TVYA 1JLKA 1W9MA 1V7CA 1C9DB 3BTVA 1NQVA 4V24A 1KJIA 1X1CA 3OTIA 2AQIA 2HWYA 3JD0A 1BEZA 2QM0A 3K5IA 4UNSA 3UC9A 3WL3A 1S2DA 2LBPA 1KGDA 1JTEA 1ZI6A 4OGKA 5A5DA 5M2QA 1BNCA 4RSMA 3JX9A 4YRFA 4CR6A 5FH9A 1SVSA 3GCDA 3SMQA 5LQMA 9GPBA 2VHEA 4M7WA 4LTMA 1JEJA 4R40A 1R15A 2P1RA 1JYSA 1E0SA 4NF2A 1PS9A 1Q3KA 3E03A 4IILA 3STXA 4CHTA 1Y7TA 5H9WA 3ORFA 1QHSA 1P0FA 1MABA 2VDLB 4NZZA 1EP9A 4ENVA 1H2BA 2Y8EA 2I29A 3OF2A 4WBNA 3QFHA 4IWXA 2GPJA 3H2IA 5IHPA 2PZJA 1NMEA 1YMQA 1DAPA 1ORDA 2HRZA 3ONVA 1Y6RA 3PFHA 3ZTYA 4D99A 4HFJA 2C42A 2EDAA 1PDVA 2I2WA 3OO1A 4IUBS 4F04A 5I4KA 4DR3B 2CMKA 2QD4A 1E2QA 3UM9A 1SC1A 4N5LA 4TZTA 2A4MA 1GXSA 1PJLA 5DASA 2WWGA 4IP0A 1RFGE 2GF2A 1OFTA 1WJGA 2V6MA 3F1LA 4FFWA 1H2YA 3TLEA 4CF5A 2YHIB 4RHUA 1FZQA 2J5RA 3L3BA 5IABA 1A5BB 4MROA 3C4QA 4B4UA 2GRAA 3QF4A 3WLEA 5ALDA 2P9ZA 4NBUA 4LFBB 5FULA 3TQSA 3UJCA 4CN8A 1UXGA 1ZITA 2AGVA 2J85A 1Z62A 3AEQA 1K6MA 4MPPA 1A8PA 5GONF 3IIJA 3EMBA 4WOKA 1EJ0A 4LRYA 3WYGA 1I94B 5GINE 3D1JA 4NYJQ 1Z6PA 3BD8A 5FR2A 1GUDA 2Y6VA 3EK2A 4AU1A 3EA5A 3W5IA 4C7XA 3KQVA 4YRLA 4F5WA 2ZYHA 3IPAA 1R0XA 1SHUX 1Z4LA 2PT9A 2ZJ4A 1UC8A 3K8ZA 3OE1A 2J5BA 2L42A 3NKFA 4PG4A 5FOWA 5HUQA 2C3OA 1HOXA 4RU1A 5K0CA 4LNAA 5CNIA 2D2EA 4IR7A 3NWPA 1DX9A 1ZRNA 2R1TA 2QTAA 3Q3GE 5HIJA 4EPTA 3HL0A 4YUAA 2HSJA 3KJFA 2O2EA 3I4FA 3ND7A 3R09A 4GQAA 4RM3A 4AN4A 1DCMA 3HP4A 5KNCH 5BQ3A 2AE2A 3TIIA 3O47A 2QQGA 2J3KA 4H3VA 4L8FA 2RHBA 1V45E 2QLBA 4GSKA 2C0PA 5L6MB 1VL5A 1GOTA 2JL1A 2Z5VA 4MTCA 4CKEA 4BJHB 2PZBA 5I7RA 3P9KA 3M7IA 5I7VA 1RPAA 1XRNA 4EFLA 2V7PA 5CU7A 1KJJA 2BFEB 1XZGA 4A6DA 4P08A 2WKWA 4ARCA 4RCYA 1YH3A 1VPVA 5ETJA 2DR0A 4HVLA 1T43A 4OYLA 3LIPA 1IQRA 1RRGA 3S27A 5AYVA 2VEOA 3ZUGA 1VMIA 1CUDA 1JEOA 2EYUA 2IGBA 2IEIA 2NSYA 2A8YA 3IOCA 4JBNA 1Y3IA 4JP1A 4XVQA 3C3DA 1QH9A 2A67A 3Q4GA 2ZBGA 3TIGA 1XDGA 2XWJI 3V1KA 4PU0A 3I62A 3K3PA 3T5TA 3S2GA 1AZLA 1OAKA 2ZP1A 3AF1A 1AV7A 4N3AA 4AMBA 4ZA2A 1KERA 1SK9A 3WGUA 3EXEA 2ZVDA 4UDOA 5D3ZA 1JLLB 2JAWA 4HC4A 2A5DA 1JHQA 2R7AA 2YJ3A 1K9VF 5L7TA 4EW3A 4IVRA 1EWTA 1XMPA 4I5EA 1XI2A 4NH0A 3SIRA 5KTRA 3FDZA 2G7ZA 2XNDD 1PFYA 2WY2D 5GONA 4U2EA 3RVDA 3UUFA 4F3YA 3JATA 2FN8A 1DUVG 3NIWA 2QRJA 5DGIA 4F86A 1N2GA 5BSGA 3KZVA 1LDMA 4BP8A 4C87A 2YXPX 1UMDA 4NHOA 5KDLA 3PICA 3IMKA 2I2BA 3U13A 1NPDA 1Z2NX 5EWJB 3ZQ4A 3W5VA 3GOHA 1OXVA 2VP5A 2JGAA 3ASZA 1IUOA 3PXAA 1NR7A 1P44A 1UT6A 4O5AA 4PHCA 1AMUA 2CSUA 4L51A 2I2AA 1NA5A 2XKJE 1LTKA 2FA9A 4ENQA 3NT2A 4KMRA 2HGZA 3I04A 1ILWA 2X5NA 2YBEA 1FS6A 2CYAA 2HJRA 2WWTA 3GBSA 1S7GA 3SEAA 1WD7A 2H52A 3DVSX 2ZJ1A 3PEWA 3D6JA 3OPMA 4RGVA 2K4MA 3PC4A 3QU5A 3PHGA 4G26A 5J2UF 1AK2A 2PXCA 3M6AA 5DM0A 3M3PA 2IYFA 2J67A 3QTTA 4WXHA 1KOGA 5FI0B 1Z0AA 2E1PA 4Y9DA 3DV0B 4OI4A 4M21A 3SVZA 1UJ6A 4LY3A 4YCLA 5LQJA 4LBWA 3TX6A 1WPRA 2NADA 3H6GA 3PEVA 2XUZA 3BCUA 3G8BA 1X1QA 1X7WA 2QQ5A 4H7PA 1H1TA 2VJDA 4QUEA 5JEDA 2G8NA 2YNMA 1GAJA 2D0OB 3KFXA 2I7TA 4MP3A 3R9IA 2NQTA 1T6YA 2WM8A 3W3ZB 2V1UA 4G9GA 3RSSA 1F0NA 1QYDA 4XGKA 3PITA 3HKBA 4LYHA 4EX6A 4B3SB 2X7HA 5EZSA 2YV3A 1JFSA 1A1VA 3DT9A 1MIOB 1GARA 1MAHA 2AMYA 4KR7A 4FQ8A 4WUVA 1NUSA 4QFMA 4C07A 4Y2GA 3EARA 2GM3A 3CX8A 4HWGA 1VE9A 4JL6A 3QM1A 3F6SA 1WZUA 2VPWA 4WZBB 3TCXB 4J7XA 4B7ZA 1DO2A 1GVNB 3F7TA 4B3IA 2NVUB 1AGXA 1W1IA 3R6WA 4JASB 4JX8A 1O95A 3FOEC 4ZDWA 4HYTA 1CVIA 3ZGXA 4PN7A 1ODKA 1UQUA 1XHLA 1V96A 4AKEA 4X41A 1HDXA 4QUBA 1N6IA 2HCFA 3D1LA 5K51A 1A9QA 3W05A 3WLLA 5JZMA 1IMJA 3ZHOA 2P2ZA 1F5SA 4PVCA 5E95A 1RWOA 1SA0B 1ZH8A 5E38A 5HX7A 2CNBA 3EXFA 2A9JA 3PUJA 1NJSA 4JCCA 3P0JA 3VR4A 4GW3A 3MJHA 2ECOA 1DSSG 2OM6A 5EJ9A 3GZJA 1X7YA 5FX2A 3EAGA 3X1YA 3GJ7A 1PD1A 1Q21A 4NOJA 2CLLB 3O95A 1JJAA 2FE1A 3DE5X 3VHXA 4UW9A 1S1MA 1Z9BA 2QAIA 1NIPA 2RAPA 2JCBA 3IEXA 3KT6A 2BMWA 3QPWA 3R6TA 4G0YA 4ZJYA 4LXUA 4X3PA 5HQ3A 1SUDA 2FKAA 1H93A 1XMVA 3O4HA 3Q85A 4HTFB 3RUPA 4DOMA 4JEHA 4RO0A 3PPXA 3RYHB 3FUVA 3PPIA 1AG9A 4R1TA 5DYTA 2OLEA 1DC3A 5J2UA 1H8EA 1V4NA 1CRLA 4K7JA 4ML3A 1H69A 4LVUA 5FWDA 3LK7A 3TH5A 3EVTA 4XQCA 2E4YA 5LQNA 4DAOA 2OAQ1 4EJ6A 1UBUS 1W36B 3HBMA 2R2AA 1XRPA 1WF6A 2I7DA 4C0WA 1I1NA 3ESCA 1TX4B 4RTLA 4LHYA 4RH1A 3R9XB 5JSFA 2BGJA 4UDNA 1FCJA 1S89A 3VOTA 1AKYA 4CKCB 4QQKA 5JH7F 1RJDA 1EX6A 5ALGA 2SBTA 1FJXA 4NLLA 4ZOEA 5KWSA 2IY9A 4UUPA 3PFFA 3EUFA 4GO1A 2AXPA 4UREA 4JLWA 1Y5NA 4NSNA 4M0EA 1Z22A 1LZKA 3PNVA 2Y1WA 2OB2A 4BJ3A 5DNEA 1DC5A 2HIMA 4BDSA 5BR4A 3R6DA 4R84A 3SIPA 1ODCA 4D6PA 1HG1A 4JXJA 2A33A 4R51A 2KS6A 2YIMA 2QJWA 4M98A 3N9IA 1WPQA 1QZUA 1V8PA 3L4BC 1I3CA 3ML1A 3H5NA 1E64A 1D9XA 2IF0A 2VPQA 2VIIA 2WMDA 3OT4A 4IIXA 4K2AA 4LJ5A 2WM3A 2YOGA 3AYXB 1P6XA 3Q7EA 3ZZNA 4I3GA 3ZHSA 1X3SA 2Q3CA 2VPXA 1GLNA 3GGCA 4JD5A 3WHPA 4A8TA 1IMOA 1GWNA 2WTNA 4ECAA 3M5WA 1BRTA 4IV0A 2V3WA 1HMYA 3RADC 3AJEA 4BYGA 3VSCA 1I4OA 4IVPA 2BMVA 4E5PA 3EOBI 4S3MA 2QJTA 2X5OA 4FKMA 4PYLA 1FP1D 2OBLA 4OP3A 4CFZA 3FCAA 2GS9A 1RP1A 3ZV5A 3JRXA 1LPOA 5L3VA 4PXAA 3RT7A 5KQPA 3CPEA 2X23A 1QR6A 3IALA 4MRVA 3L0DA 1WCWA 4YN3A 4LMBA 4RIHA 1F9EA 2H06A 5A4IS 3WLRA 5CXQA 1UXIA 1YKGA 3EH1A 3JZFA 3TQIA 2ZR9A 4YV1A 2N9UA 1BXRA 1GTMA 5CT4A 1NMXA 3T3IA 4KN9S 4NV3A 4X0EA 3STWA 2VHCA 5IRCD 4TYWA 4P4SA 1IN5A 2O14A 2PX6A 3AOGA 3HV0A 3P9SA 2B61A 3PE3A 2RHHA 1VHWA 3FD8A 4RK5A 2FWJA 1KAMA 1WXFA 5IH7A 1C7QA 4L2IB 1KI6B 4QJ5A 4RZIA 4MYCA 2AOVA 2EGUA 3OMWA 4QPJC 4C30A 5EWLB 3VV2A 3W8RA 3W2IA 1WCXA 4JYCA 2GPNA 4MW9A 2YFHA 5DGDA 3UW1A 1LV8A 5EYPA 3LJKA 2J9ZB 4HR7A 5BYJA 4O4IF 5BR1A 4C6HA 3TZKA 1P75A 4LJ7A 2W2KA 3WISA 8LDHA 4Y2PA 3BE6A 2FWIA 1CUBA 5JH7A 5JZ9A 3ZJTA 1V8OA 4HYEA 2J3JA 2HHCA 4B3CA 3PPYA 4F71A 1UKZA 2ZI6A 4BS9A 4ZU6X 2WFAA 3B53X 1JQ5A 3V6MA 5B64A 1LDBA 2JI9A 2A1UB 3P9ZA 3TQFA 3OKPA 3E48A 4EUNA 1D7AA 4G0PA 3H1TA 5CW2A 3N58A 1JAZA 3H65A 3I4LA 1I4LD 1K7YA 4QPCA 2X1VA 5FL3A 4JT2A 3RARA 3TXAA 1R27A 4IKOA