2JPDA

Solution structure of the ercc1 central domain
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
124
Chain Sequence
b'AKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA excision repair protein ERCC-1
publication title Analysis of the XPA and ssDNA-binding surfaces on the central domain of human ERCC1 reveals evidence for subfunctionalization
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 36
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03834 Rad10 Binding domain of DNA repair protein Ercc1 (rad10/Swi10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jpdA00
1J23A 1J25A 2ZIVB 2BGWA 2BHNA 2A1IA 2M9MA 4BXOA 4M6WA 1J24A 4BXOB 4P0QB 1J22A 2JNWA 2JPDA 4M6WB 2ZIWB 2ZIUB 2ZIXA 4P0PB
chains in the Genus database with same CATH superfamily
4HG2A 3OIUA 1Y1RA 3NANA 4MUBA 2QXTA 4TRMA 2QD2A 3GN2A 2WWXA 4CLOB 4LDRA 4Q3NA 2ZIVB 2VPWA 2XGOA 2OKGA 3Q4GA 1A9XB 5BW8A 3I2GA 3L8ZA 1OFUA 3ZUGA 5JG7A 3D0OA 4OGGA 5A4AA 2D5AA 2GK4A 2AHRA 1ZCFA 3QVLA 4N7BA 3RCBA 1SXQA 2VJKA 3T5GA 4M0PA 5C5EA 1E89A 1CS0A 3RKUA 3RE1A 1YBAA 5BSHA 5KSZA 3B6ZA 3D4NA 2JGLA 1JJIA 1LBEA 1OLXA 1EXMA 1YB2A 4UDNA 3PR3A 4UBNA 1AXGA 4BNHA 4W8HA 3RHTA 3V8MA 3KB6A 4LN1A 4B4VA 4BEVA 4CIYA 5JV5A 3V8RA 5DI9A 3ZNQA 1RE1A 2RH8A 2E4YA 4GX1A 1HTTA 4IGKA 2G1UA 3HHPA 3SJUA 2NSYA 3ZR4B 2COKA 3E48A 1IMOA 1MAUA 1XZ8A 2H08A 2UXBB 2CXXA 5JCOA 2A1IA 4G5FA 4UNSA 3JQAA 2FF5A 4NATA 1EVKA 2PKCA 2V7TA 2YC2C 4H4CA 3IJRA 3R7WB 2ZB4A 2QM3A 3AFNA 4GE0A 1K3UB 4LFBB 1BX3A 2XLCA 3CBGA 2KLBA 4L50A 4JBYA 3RFCA 4ZVKA 2VQSA 1LK5A 3BMOA 4GU5A 3LBIA 4JBNA 2Z43A 2YOHA 1OZHA 3R3UA 3C74A 4K46A 1ICEA 4I55A 1Y3CE 3H2YA 4KQFA 1HNWB 1W2GA 2OCIA 3PKIA 1BEEA 1FP7A 4HQ0A 3NM6B 5HZGA 3GCXA 2H2IA 3ZTTA 4AKHA 3L6UA 1RABA 3ZXYA 1UWKA 2O8VA 2CL6X 3V8EA 2EJWA 4RF4A 4C0HA 4CQJA 5HKLA 4ACAA 5EC8A 3O8QB 4FVTA 5EIAA 4DIDA 2CV0A 3NM4A 1CERA 5K0GA 3U7EB 1BD3A 3OZDA 1I2ZA 2BEWA 1MGPA 2YWBA 3QEBZ 3AEYA 3FNRA 1ECCA 2O8EA 1W44A 1UCFA 5T4BA 4UDXX 3VM6A 2P3QA 2R9VA 2I87A 4M1KA 4BNDA 4XSVA 2HSJA 2JGNA 3CIFA 4YK7A 1QTQA 2VWHA 2Q46A 2HTFA 3WLEA 3OX4A 4ZOLF 4G1EB 3DE3X 3QX7A 1BA3A 1FU8A 2PD4A 4MWOA 1QWOA 4KFCA 1SU8A 2QG6A 2HEGA 4K5QA 4WN9B 3RVPA 5IT5A 3ADDA 3IRUA 1FVHA 3QLTA 4HWPA 6Q21A 1U1IA 3A3KA 1TCBA 2FZVA 3IEXA 4G9BA 2PMFA 3DVRX 1OH6A 1PNQA 1ADFA 2LBPA 1GUAA 4RDHA 3MGKA 1T3ZA 1FIUA 4Y30A 3TIGA 1TU3A 1TU0A 3G5AA 1UKAA 3L0SA 4M1ZA 5KJCA 4V0KA 3SFTA 1NI3A 4R68A 1PR0A 2IFTA 3BF7A 5EJMA 1JR4A 1LPBB 1VMIA 3QFTA 3JVVA 5EKUA 5KYVA 1E3SA 1L0BA 1QX3A 5AVJA 2H7VA 4D3SA 3DVQX 3FVWA 4F3RA 3VNUA 2FCAA 1Q0QA 1CF4A 2A3RA 2J4DA 3WGNA 5A03A 2ZJ3A 2N75A 1ZN2A 1ZKDA 3VKWA 4YO8A 1XVLA 2X0KA 4B48A 3DFMA 3IXLA 3ND6A 1JQLB 3QBTA 4QJ3A 2PZFA 4E14A 2FH5B 3ABSB 2YS6A 1AA9A 3H1EA 2O0LA 4LNAA 3R77A 1PTJC 1J4AA 3AYXB 3WJAA 2O19A 2OAEA 3CTMA 4PBRA 4G67A 4KN8A 3K1YA 1UBHS 3EVDA 3DL2A 4U9IS 3SFVA 1E9VA 2R7KA 2ONZA 2WWFA 3TM5A 2XOKA 1XO1A 1ZKMA 1QHXA 4QUEA 2A59A 2QT9A 1U3DA 3QVVA 2X4DA 4G4IA 5BYKA 3JQAD 3F47A 3G59A 4IDGA 4YECA 3MMXA 3RUCA 3LOPA 3SQOA 1GKYA 2BGUA 3NBUA 1WY5A 2JFXA 4RS4A 3WSWA 3ZGVA 4DQLA 1XPOA 4DDTA 3AUXA 4URZR 1DBWA 3RT1A 2ZTSA 4CMEC 4GEGA 1GCOA 1H66A 1IBSA 1FOEB 2BOVA 3A26A 2PUGA 2O8BB 4IFEA 5JS1A 1JR3A 1SJ9A 5C7OO 5AVUA 3TQSA 2CD9A 2INGX 1ZC3A 2X3UA 3VPBA 2EVWX 2IXAA 3HU3A 3OG9A 2BFFA 2E89A 3CRVA 5AJTA 4ZU1X 4YJGA 4BAGA 4ZVUA 2OC4A 1F2TB 5FQOA 2G36A 3KIPA 3PC8A 1CV2A 4WT7A 1UFVA 3GRFA 3OX3A 4UHHA 1KJYA 4K1LA 3TMKA 1V6SA 5KAPA 1YDHA 4E07A 1KSJA 4ZTUB 2W2XA 4H77A 3PEYA 3PPXA 3QEOA 5BNTA 3SJCA 3WWZA 4DJEC 5ELXA 1U7ZA 4ZYVA 4EB6A 2NUTA 3GRAA 4TTAA 4IG4A 3E9ZA 5LOVB 4ZVPA 1O6GA 2CJXA 2GAIA 5ERYA 4ZZ2A 1MQAA 3D4BA 2QB5A 4LNUB 1JLLB 1BGVA 5LR6A 2W6PA 2ODBA 3F3YA 2ZUDA 4MA0A 1BEZA 2W6IA 2O7VA 2HMTA 4X41A 2P27A 4TVOA 5G1NA 3I34X 3RB8A 2JGRA 4ALKA 4MAFA 2WSLA 3G1TA 1Y9DA 4BQQA 2ZG6A 3QWAA 3WLFA 3N7TA 2B4TO 4MS1B 2Q7DA 4CMIA 2P5YA 1W87A 1GGEA 1AUQA 1JZSA 1AQYA 4XGQA 2NV6A 5H82A 1T9CA 3JQ7B 4MKHA 1APBA 4PRZA 2O2JA 1GR0A 4J6FA 5ALPA 4CW7A 1OX4B 1NKTA 1N4DA 3W78A 4UJ5A 4B82A 3DDWA 1Z4LA 2O0HA 5C9ZA 4TPKA 1ULHA 1IVYA 2WBLC 2TRSB 1HLFA 2Q5LA 2XMZA 3CQ9A 2QVYX 3C1TA 4G65A 2X6QA 1Q6ZA 3VSCA 5DHFA 2FFJA 4JSRA 3MT8A 2R86A 3STXA 5KWIA 3C5WP 1S9HA 3S1AB 2CXRA 3FHOA 1BD4A 1V39A 2YASA 4KQKA 4LHSA 5K8TA 1C1XA 1N0VC 4QO8A 1LDBA 3WK7A 1XL0A 4WKBA 5HFNA 2XZPA 4LPSA 4L9RA 3LC7O 5F1OA 4BIIA 4O2AA 4BKPA 5FO1A 3KUKA 1HOTA 3OU7A 3H4VA 3QELB 5ENVA 1S8AA 5UKDA 3G13A 4QOIA 2OXEA 1NVFA 1O0SA 2NTVA 3RTGA 1KY2A 2DPXA 5BNIA 4O4JB 1U99A 4XVQA 4M0LA 4BWGA 3HJNA 2BZ0A 4CLDA 2OQVA 2H4FA 2VHQA 1G59A 2QUIA 1WZ2A 2R751 3X0DA 1ONNA 4RF2A 1QZTA 2KSQA 3DAFA 2QJRA 3U81A 4AMZA 2JHCA 1GGJA 4LJRA 1F20A 1JR3D 3IEKA 5E4TA 4D9GA 3HCOA 3TLJA 4RJLA 4ZZ1A 2C1EA 2YL2A 5L8VA 4G5QA 1G4AE 3SC6A 3W2HA 4F45A 1RE0A 4M2LA 3R9KA 4WGFA 4QUHA 1ACLA 4EB3A 3HY6A 4XASA 2D4HA 1V5IA 2FI1A 1SOVA 3GEMA 3I05A 4Z4IA 2SKCA 1ND5A 3GLTA 4HJXA 2FZKA 2ZROA 4ZANA 1A50B 2PQ2A 1JA0A 3Q10A 1NMYA 1Z0AA 2DPHA 2FPWA 3OZIA 1KWKA 5E3HA 3GZ4A 1T36B 5CYGA 3U1TA 4DILA 2HK8A 3MGAA 3T9DA 2MINA 4B73A 4DSOA 4NBWA 3LUHA 2CDCA 2HCTA 4FKBA 4IZHA 4RL6A 5F7JA 3MM4A 4A82A 3ZE8A 3ASVA 1E3QA 1F3OA 2D2VA 4LS3A 2HYIC 4QVGA 3JPWA 1JX6A 4BVAA 1IUPA 1L2TA 3O5AA 4TRRA 5D7NA 5BQPA 3WS7A 1NZFA 1VMDA 1M9NA 2GHQA 2W6ID 2PD6A 3MOSA 3MTJA 1KJZA 1OAOC 4DMMA 3QKIA 5MHTA 3D3WA 1M0EA 3FYCA 3IIMA 3T4EA 4R9VA 3V48A 3GR6A 1R8YA 3BB4A 2O5EA 3GNTA 4ZOEA 2J6CA 3K0CC 3NTLA 3WC4A 4NXMB 3SZUA 4E5DA 4I66A 4DE5A 1W9HA 5I8WA 4UE3S 3DCNA 4D3ZA 1V41E 4Q21A 4ZREA 1VKNA 3OUTA 3TQQA 4I50B 4QRHA 3UMMA 1RWPA 5LQNA 1SCIA 1CUYA 2CCKA 1MN6A 4Q6WA 5JPIA 4ZCLA 1J2UA 3AR9A 3LZ6A 3ZPXA 1C9JA 4C0JA 1KEUA 4RKEA 4WQMA 3MRVA 5FDFA 4N0PA 1HMPA 4X45A 4CQNA 3A14A 1RQXA 3IELA 1FSSA 4R40A 1G9TA 2JFYA 5HIJA 4ECAA 2YHUA 1D4AA 2ZRKA 5AHKA 2XR1A 4DWJA 3D6HA 3VBCA 1IPHA 4D4JA 4DIMA 2AN1A 3SKXA 3RIGA 1NOJA 4QPDA 5H3HA 4XTRA 3TW8A 2QZJA 4YWJA 5AVVA 4KXNA 1V1MB 3ZH2A 4CLRB 6ABPA 1GILA 1JAZA 4B3XA 4ASUA 3H97A 3DYBA 4CL2A 3BMCB 4YT8A 1S96A 4XRGA 2BFAA 3O74A 1FFAA 2Q6KA 2YW9A 5BSTA 3NVKI 4NCKA 1Y5LA 5AO9A 4EZEA 1A2QA 1NGSA 4EY4A 1VRWA 1VMEA 1Y80A 4DTIA 2RBEA 1SUEA 4R1QA 3W7VA 4DCMA 1XXLA 2AWOA 3P2EA 1WUTA 3PF8A 2F9LA 4I1VA 1C7RA 1MRSA 1U0LA 5EIOA 2F48A 5B4UA 5ADVA 3E0QA 4OSEA 1O0CA 4US1R 2ZIAA 5BRAA 5KNCD 1AKQA 3PDIB 4ZP1A 4XI9A 1WZUA 4YRFA 5DGCA 4HGOA 3ROZA 4NDNE 1SA0A 4BQNA 3D8HA 1ZI8A 4CG2A 4S2UA 4J2TA 3FYDA 8LDHA 1XPUA 3JYLA 4ZMRA 2OFOA 4CM9A 5DI3B 4OQYA 1AN9A 5K0CA 2ATVA 3P2IA 4TUYA 3KU4A 3L8CA 5C8VA 3THYB 2PYDA 1C9MA 1X2BA 1D8AA 2IYXA 2C7BA 2IY8A 3GIWA 3CW2A 1WWKA 4AK9A 4C7VA 3ZWCA 4J0CA 1K5PA 3RHZA 3B6IA 3RFUA 5HQTA 5K8UA 5IHPA 1PQWA 4UU1A 4B85A 3GFGA 1CRLA 4R2HA 3IR7A 3FPSA 3FUTA 2IE0A 1U8FO 2IEAA 1W1UA 2JW5A 4C2BA 2VJAA 1DDOA 2OGSA 4FGUA 2XXJA 2VA9A 2WPDA 3RRXA 4KDCA 4ZO4A 5EWMA 1K6JA 5IDVA 3PBKA 3UMJA 2MHCA 3F71A 2GRJA 3ZD7A 4ODIA 1K9SA 4NBRA 1AVTA 1U9CA 4PCUA 1NSFA 4MOWA 4HN4B 4AUEA 5DXJA 2EYQA 2WHEA 3CLRD 2C82A 3GUHA 3S70A 3T4UA 3UK6A 4C6TA 4Y9UA 2FSGA 5HA5A 3ROPA 3FHTA 1D1PA 3II6X 3VHLB 3ZD9A 3E9YA 1ZWKA 5CGQB 5JBIA 5BW5A 2OBXA 3X2SA 3LKDA 3I6ZA 1IRIA 3BRCA 121PA 4MKFA 3MG9A 4EHAA 1PSWA 2E4UA 2QXYA 3T5AA 2JH8A 3M89A 2EP7A 2BELA 2YQ4A 4BPRA 4DFDA 3K6SB 3KOWA 3QEMB 4GPEA 4LA4A 1J6UA 3FNIA 1E4OA 3H5RA 1OVGA 4CKBA 1WZNA 4E2WA 5J2UA 3T3MB 3R7BA 2TYSB 4B3FX 3BXOA 3N70A 4CM1A 1FRZA 1F6BA 1Y7IA 2QX6A 4H4DA 4Q66C 4KYVA 3GJ5A 2CLLB 1MLDA 4OL9A 5HM6A 1YVDA 4ASUD 2J45A 1NTOA 1QUEA 3IUSA 1YL6A 3MWJA 4R1TA 1E99A 1J09A 2WKWA 1UP7A 5BOVA 2A9KA 1BOFA 4GYYA 3VGPA 3R5FA 4ARAA 1RD4A 3TSWA 3SP1A 5K0LA 4R8MA 4UVIA 3AVVA 2CD7A 3L79A 5FUVA 1COWA 3LYAA 1DBPA 5AOCA 4MR7A 2C97A 4E4YA 1PYGA 1WEHA 3VH4A 1LDGA 2AYXA 2DFTA 3U61B 3QUTA 4JB0A 1NYLA 1LQUA 5D6NA 4GUAA 1QG0A 1YS1X 1D09A 3WLOA 1G41A 4NYMQ 2WWYA 3Q8MA 2RB4A 2W0SA 3RANA 4LC1A 3I0ZA 5CD9A 1Z08A 1VBFA 4P33A 1S7CA 2CEKA 3LG2A 4F4CA 2VNSA 3AVPA 4WMLA 2CLHB 3I23A 3ZI4A 2YVQA 5T64A 3C6ZA 4XJTA 4OB8A 2EJUA 1FDVA 3U7QB 3FH0A 4DUYB 3TFOA 3GVIA 1PFGA 1VCIA 1FZTA 1XNGA 2IW3A 4H6WA 1PR9A 5FBQB 4BE4A 3KAKA 3RHSA 2WUGA 3OZ7A 5EP1A 1YBFA 4DCPA 4DABA 2RIPA 2G25A 5FOVA 4E0BA 4O5AA 4S0ZA 1FUIA 1I13A 1ZBQA 4PIVA 3CZQA 5CFQA 4J8PA 2FMXA 2L18A 1ZD5A 2PH3A 4GBJA 2GM5A 2Z56A 2WYWA 3DONA 2GCEA 5F2KA 3H6HA 3TTWA 2C96A 1DGQA 3B20A 2FX2A 5KHLB 3LTNC 1CE8B 2DHDA 3ISTA 2JFZA 1VJRA 1RRGA 1XDUA 3MW8A 3D6JA 3OM0A 2O3QA 2IHVA 3LHSA 4JOCA 2D62A 3H0CA 4Y2PA 5BNFA 4D7AA 4RD1A 1BG6A 4R71A 4QM7A 3Q6NA 1N8TA 4MICA 2QT0A 1K8RA 1UBKS 1MP0A 3AW9A 4B7XA 4PIPA 2A3NA 4K6MA 3G9TA 4BRWA 3WAGA 1A2KC 3LQKA 2G6BA 1J49A 1DEXA 1KPIA 3TZEA 4BVGA 2DERA 1E1CA 2E48A 1FLNA 4XW2A 1TM7E 1JXQA 5KOHA 3CWQA 4RKWA 4Z9AA 1J8DA 3ASYA 1KVUA 3U2QA 2P2LA 3KOZA 3BEOA 4D4KA 2ZFUA 4HD8A 5BORA 1JJVA 5CH3A 1Q0HA 1BMQA 5LA6F 1JKFA 3BEDA 2FSSA 3AVQA 1G5TA 2CLEB 4NU5A 5TXGA 4UMFA 3GP8A 1OJ7A 1U04A 1P7YA 3C85A 3PJRA 4ZI7F 2QTLA 4Q3CA 1PUIA 2J9RA 1PTJA 2R6JA 1E6UA 4JSTA 1E4VA 4ZAZA 3UAGA 3ZWNA 4DJAA 2XVMA 4BU0A 3AWIA 3DZFA 3W1VA 4EJSB 3K0BA 2VKQA 1KXZA 1N2SA 1ND6A 2FYTA 1COWD 4Z1OA 5D00A 1GPLA 3HDTA 2Z6AA 1RLJA 1GDTA 2MSKA 1W5FA 4ZOAA 2HJVA 4NR0A 3K5PA 3W9UA 1QU2A 1ZJ5A 1WL8A 3M3HA 4BQPA 4IQGA 2JAPA 3RSFA 4F0JA 4ZCMA 3V1LA 1MAVA 3C2QA 3DSRA 3U44A 4D9BA 1E3WB 3PYMA 3UJAA 1O96A 3DKIA 4QL3A 1DKMA 2P3SA 1OTXA 5KOYA 3E7PA 1HFKA 5B30A 5HBRA 5HFAA 1UBNA 4B45A 4P3NA 2CB9A 2W48A 2H7CA 3K9CA 3OFNA 5FADA 4Z86A 1E94E 3OCVA 3ZOKA 4HKTA 4D8XA 3ES9A 1OLXB 2GN6A 2I9KA 3N8HA 2NUAA 1SC3A 4CNQA 3CWCA 1DBSA 1SXIA 2BD0A 4B32A 1D2NA 2EBHX 1X7HA 1YIAA 2PUDA 3ILVA 2QORA 4ZPXA 1Z6TA 2IEDA 3MWKA 2Y05A 1P1RA 1ONPA 4G85A 3T3IA 4PN3A 4KPEC 1SUWA 4DLRA 3UB3A 4P35A 4A8TA 2VNJA 1DKRA 3HCWA 4IDNA 3CN9A 3JQAB 4O63O 1HDRA 2P91A 1E59A 2B37A 3JQBC 3OLQA 1Y82A 2GZRA 5L3VA 1GZ4A 3PWKA 4HNAB 1I7DA 3WE7A 3BD8A 1XMQB 3BMOB 3GH3A 3LDGA 3N2LA 3SR4A 3MEQA 4EW6A 1M6HA 2ZB7A 3C4QA 3CNQS 4I55B 4HUTA 3UTCA 4UTVA 5AW1A 3CSUA 1IPFA 1NZDA 5AOAA 4BB5A 3I04M 3E9MA 5B2ZA 4NHOA 1TW2A 3OM9A 4PWZA 1HBJA 2XYVA 1QHHA 4HB4A 1E66A 3K1TA 1KMHA 3OWOA 4IVRA 2QTFA 3N05A 4LC9A 3LSYA 1P4HA 5C32A 2FWAA 3DMPA 3NHWA 5JH7A 5F7ZA 4H16A 4UCWA 2O8EB 3FOWA 3ORYA 2LR0A 2XD4A 3QOWA 4BNDB 2QY9A 1EVEA 4UM7A 5IZ4A 2GCGA 4E3ZA 1D1TA 3PHBE 4J7AA 3GH1A 5DLEA 2V6IA 4KPGA 3B2NA 1RWKA 4H9GA 1GVHA 3SIRA 4GOMD 1ADBA 2KYRA 4COKA 4DZRA 2HK9A 3F6PA 1ULZA 2PFKA 3KVYA 4Y98A 1DBQA 3CC8A 3TAUA 1B2RA 4GGOA 3A4MA 2OLJA 1G42A 1KH2A 5AW4A 5G3YA 5ADHA 1I1NA 4ARSA 4MRSA 5CEEA 2BE7A 3C8UA 2DR3A 2KE5A 1NAIA 4H6XA 4I08A 3X1KA 4CI9A 4NH4A 3AF3A 3F4BA 1GDHA 1PWHA 3BA1A 3QKRA 2JDIA 1TCUA 1ZDMA 1KFEB 4JJ6A 1NF8A 2WILA 3GZNB 3DLTA 3K2QA 1B00A 3LWZA 1ARZA 4WBSA 2QN8A 3L04A 4IOMA 5BYJA 5EPUA 2PL5A 3LLCA 3OFND 1HDCA 1MJGM 3IJPA 3ZV5A 4EJ0A 4BLRA 3C7CB 3IA7A 1SNYA 3DBLA 4NABA 4DLVA 3E6AA 3DCIA 2K5UA 3ZDCA 1BWSA 2HD4A 2WV7A 3O7MA 2V7GA 5C1OA 2Q50A 2PRJA 2NQ8A 2P6NA 3P71T 2PSHA 3H4TA 3DT8A 3HWWA 4E94A 2B30A 3NT2A 5CT5A 3AF4A 1W9MA 1MB2A 1U28C 2VDVE 3FTNA 3S40A 1KSGA 3PFCA 1Z34A 2VRCA 3DOCA 5TRTA 5CCEA 1IH8A 5HKAA 3OTQA 4ISBA 2XKKA 3HZRA 4HMQA 3QA9A 2CV2A 5A9SA 2PDAA 3FPAA 3OZEA 4WNAA 1LRJA 1ZCBA 4B2LA 1OAOA 2C8LA 2E3JA 4XDYA 3NOOA 3G68A 3QG5A 2J32A 3EVFA 4H3KB 1YKGA 2GRUA 5EPEA 3U80A 4PR3A 4MQ4A 1NUAA 4WXEA 4ZO9A 3TJZA 3AVWA 3WSVA 2LKDA 2HHJA 3CF2A 3KKLA 3K0CA 4IOLA 4FJ0A 4DGQA 1SFRA 2BFFB 3KSDO 4PGGA 4KHZA 4P53A 1Z8FA 2F1IA 3A31A 4YJGB 3VDNB 5A3JA 2WWWA 1OSNA 3NBXX 4P5DA 5F3DA 5TF0A 1UXKA 3KB2A 5CITA 1B1CA 3OA2A 3R6GA 3SSAA 1Z8NA 5JS7A 4ZCIA 4RCZA 5HDBB 3QFHA 3FRJA 4Q02A 1IZZA 4OHKA 5I7EA 4OOFA 3C3CA 5T4HA 1SWVA 2GPBA 2WTAA 4P5PA 4HYYA 4DQKA 3O8CA 5JJKA 2CSXA 2NZYA 3WMXA 4TKVA 4OX9Y 2AEJA 3NWJA 4JQSA 3EW7A 2B6NA 4B33A 4C7KA 4BAUA 2V54A 1E7WA 1Z33A 4NESA 1C0LA 2VHTA 4URHA 5P8WA 3GRUA 3LP5A 5JPCA 5AESA 2IPNA 1XHLA 4S1WA 1UR5A 1J0DA 3RRYA 4F21A 3AM4A 2UZ0A 1FXSA 1FNBA 4J1NA 2NT4A 2R79A 3O2NA 2XWQA 3W1EA 2QGZA 4L3OA 1I1QB 3VPCA 3ZCXA 3AYZB 1OLUA 2FFAA 3AB7A 3KHTA 3CJRA 3DTVB 3O4FA 1KI7A 2I4LA 4PLTA 4CMIB 2G7MC 1E2QA 2JEOA 1IQUA 2YC4C 2JDID 4BFUA 3QJYA 1EX1A 1LVHA 3RRJA 3WG9A 4CIWA 3RBVA 1UJ4A 2YV5A 5HS6A 1JJFA 1Y6GA 3AEXA 3GMTA 2C1XA 4TYMA 3MWGA 1DTWA 1HDYA 4UMEA 4OYRA 1U9IC 2ZK7A 3NOXA 4PQRA 4IMPA 2XVAA 1CIJA 4F4FA 3FCCA 1YBVA 1FVOA 2QW8A 2F7SA 2QU7A 2R7NA 1DINA 3VOBA 5IT4A 3A32A 5H9VA 1H65A 1I4EB 2IYFA 1JFFB 4X54A 5ENZA 2CC2A 2JK1A 5DTJA 5EP2A 5G1PA 3OQIB 1UBMS 1IUKA 1UK8A 2YWCA 1NE2A 1NONA 2FPMA 4OQLA 4B43A 2C5LA 1M10A 4WESA 5J2TA 2M6RA 3BS4A 3FB4A 3KJGA 3WJ2A 1GTMA 1R66A 3O21A 1B6RA 1FTWA 2VRCD 3QVTA 3R6WA 4OQNA 3WICA 2WG0A 1YCGA 3LBHA 2F59A 4KZPA 3UJ3X 3FFAA 3L7JA 5IHXA 2ZITA 3RSCA 2I4TA 3R8CA 1SG0A 3KQQA 4W9RA 2R11A 4YMLA 5LMUB 1NQTA 2ZZKA 3FPFA 3WIBA 2Z1MA 5HXAA 3PPWA 2OP0A 2YFQA 1XMVA 2G5PA 2NZUG 3NDJA 3KTAB 2GVZC 2PBZA 3K96A 5BVHA 1N1EA 3A0RB 1ZW1A 4GP7A 1TTPB 3FIUA 1N8NA 1JHVA 3BC1A 3N58A 3SY8A 4B5LA 4XXHA 1EBBA 4GQBA 3R0IA 2QOEA 1IATA 3U1BA 3JASB 4MW9A 3RK1A 2SNIE 5E6SB 1A88A 1OJLA 3I9MA 3T35A 1KFCB 2Q3JA 4D9IA 5GPBA 4X6YA 1V6AA 4JL6A 4WCDA 3H1FA 4CFYA 4Z7QB 5DHAA 1SBQA 2MINB 4NK4A 5KU7A 1ISRA 1ZH4A 1JQ3A 5TQ0A 4DLLA 1NULA 1XXHB 4IDOA 2W0MA 4LXUA 1DXYA 1GZHB 2QSYA 3RIXA 1NQUA 1EK1A 3FDXA 3MA0A 3V34A 5I7SA 1QIIA 2B9EA 1ECPA 1EEXB 3OE7A 3FVQA 1TUBB 4IGEA 5ER6A 3ZDQA 2I4OA 4F04A 3OI7A 4GXTA 4JLMA 1WUYA 1Z18A 4L28A 2C99A 5BWNA 2BGKA 1E0KA 1P18A 1ZHHA 2ENWA 3P9RA 1MVOA 4C04A 2HBZA 1H6CA 4QUJA 4ACBA 2FG5A 2N47A 1B4DA 1QMPA 1EIZA 2RG1A 2RI0A 3DO5A 3KYIB 1NP7A 2ZYVX 4IJ6A 2WWVD 1I2MA 1TAUA 2NU9A 1O8CA 3F6EX 1FQOA 1P3JA 1XAGA 3C0KA 3FOBA 3WWOA 2NTNA 4CCSA 3OBIA 2JKZA 4LJYA 3LI2A 4JP5A 3THSA 4RTSA 2JLCA 2GEBA 3WHIA 5CFLA 1R64A 5EHNA 5TQVA 1KR2A 2JLBA 1MHTA 1ZEJA 2ISCA 1LF0A 1C7ZA 2QLFA 4UM5A 4UXHA 2QTRA 5GWXA 2EZUA 3MBKA 5DPMA 1QUFA 1UEIA 2WRZA 1TVMA 3WLTA 4DMUB 3LLMA 2WNHA 3ME5A 4Z0HO 2QTHA 5LQRA 2QMEA 2XNDA 1J5PA 1LX7A 3REFA 4YDHB 1NL3A 4BBPA 4DR6B 3TW8B 2CY0A 4KV9A 4PO1A 3HDHA 3O2JA 3TIIA 3BB3A 3VVLA 1NASA 3LYUA 3I8XA 1DRWA 2PZ8A 3ZIAA 5JAMA 4JP3A 2C5HA 4G07A 2W43A 4DPKA 3SSMA 5HRCA 3ZD6A 2CWWA 3SYLA 5K0BA 3CKMA 4YR7A 3A04A 4QULA 4DTCA 2YV3A 5TARA 3B7GA 4YIKA 5I9SA 1RTTA 4CTNA 1E1MA 1HNNA 4QNNA 2OGUA 3WYFA 1H4SA 1IHYA 3W8RA 5TS2A 1NJ8A 2X0IA 1ATZA 1CFJA 1CUSA 3QHPA 2ZJAA 2NZWA 3E1KA 3U4QA 1CX9B 1F0PA 1POWA 2EX0A 4X1IA 4QDUA 5JXGA 4OX9B 4F3TA 3RSLA 2R1ZA 1E6LA 1JBQA 3O9VA 4JLVA 1HLDA 3TR0A 1L4UA 2P2DA 5DDIP 2PCLA 2Y8EA 4ZQEA 1W4AA 2ASEA 2RAUA 2MYPA 3GP3A 3VKGA 1WZIA 3JATB 5D1NA 4BZQA 4PGAA 4IW3B 3BGWA 3NBAA 3R5JA 2O9JA 4B74A 4JP2A 3SAJA 3K94A 3VR5H 4C4TA 4K3UA 4TUYB 1ZINA 4GM0A 1U0NA 1YK0A 4C06A 4H6VA 1KAQA 3P5BA 3U3RA 4ABTA 4D99A 5MF6A 2R8YA 1N2EA 3RTCA 1FPMA 1QPBA 4X92A 2A57A 3LTEA 4JODA 2HRQA 1JNXX 4ZEXA 1NJFA 5J5VA 4C0QC 1W48A 5EQTA 1NU8A 3BFVA 3DZKA 1NVEA 3D6VA 4K9RA 2VUUA 5EWMB 3PXDA 1NLZA 2XWBF 2XZLA 2OG2A 1USIA 2OV1A 2YJTD 5H80A 4AZTA 1HFJA 3BL6A 4IFBA 4ZI5A 2I1WA 1RAIA 2UVQA 2OGTA 1E6MA 1QIGA 3E8SA 4KN5A 3EUFA 2ZJ7A 2V3CC 2D7CA 2UYGA 1JG1A 4WPGA 3SEQA 2ECKA 1EAYA 4GUDA 2PLFA 1PGPA 2WKSA 5FR1A 2NO6A 2X22A 3OOJA 4BNKA 3H19A 1S89A 2B7BA 4E7PA 4MI3A 4TXLA 1QQ5A 2A5YB 4Q9LA 1GLVA 1TNDA 3QNUA 1F6WA 4OQFA 1G7CA 2HBRA 3U7RA 4DR3B 4BO1A 4AJIA 4LDQA 4I5FA 5KI6A 3CMCO 3TLYA 4B7ZA 2YW2A 4CG0A 4KWCA 2WFZA 3BWBA 3P1JA 2VT3A 5AKKA 3L1IA 1XD2B 2X8BA 4FBMA 4Y6PA 4CKBB 4D3FA 5AUPB 4NYIR 4CV2A 5HZKA 5LU8A 3P32A 2PLRA 3I9KA 2BRUC 1XR3A 1N78A 4MVJF 2XNDD 3Q5EA 1U02A 2X3FA 2PGAA 2EFCB 3PUKA 2WFLB 1BSVA 2O52A 3EZ6A 5GJVC 4MNTA 4DG9A 1HX7A 2C9OA 1T9GR 3LX5A 3PVCA 3R7NA 1U80A 1IK6A 1Y34E 2ZSDA 4CJXA 1R0RE 3FF4A 5CB6A 1F8XA 1MQ9A 3HXQA 3UPUA 4CF4A 1RXSA 3VH1A 1EP1B 3FNQA 1CUWA 4B6SA 4IWXA 3TE6A 3VR3D 1PP4A 2O5CA 5JBNA 4KX3A 5HSGA 2R8OA 1ZNXA 1CZRA 2EWVA 4OA8A 2G5GX 3FTPA 4OOEA 1LS6A 4QTZA 3UOGA 5IN4A 4EMSA 2J9GA 2V3VA 3QMPA 3WIOA 2BMFA 3BH6A 1EK0A 4MR7B 4CKYA 5LOVF 3LP8A 3E82A 3SG0A 3TLZA 1C4WA 2B4QA 1W19A 5BQOA 1DBVO 2HDOA 3JQBA 5A0FA 1G2IA 3E27A 3I53A 4TLBA 5ULLA 1EFCA 3KVOA 4FIZA 3VJRA 3EPJA 4A92A 3VA7A 2QN3A 1V0JA 3AJ9A 3M4XA 3M1LA 1U3VA 4JFAA 1XF9A 3ADOA 5DK6A 3N8KA 2VYCA 1F8GA 2XNCA 1S7GA 5FFNA 4HV4A 3PI7A 4ZO8A 2JK0A 4PHGA 5CD1A 1CUHA 2FP4A 3EIUA 5H16A 1N32B 4UUOA 3PTAA 2P9GA 4YAIA 4NJMA 2A33A 3L0OA 1KEEB 5L3QA 1G16A 1XDWA 3RG8A 1HT1E 3PG5A 5C35A 1UADA 3H9EO 2QP4A 1W4CA 4ND1A 3JYQA 3ESRA 2OE2A 5EFOA 2V5AA 1EAMA 2YHSA 3FD8A 3KC2A 3EPHA 3DOUA 2AN4A 3PFNA 4AMBA 4V24A 2D59A 4MLZA 1R8XA 3DH0A 4ZU3A 5FO0A 5A3VA 3S7ZA 1J70A 3W2IA 3W8DA 4QG3A 4RTLA 3IKLA 2A58A 2FEWB 3KPUA 1JBEA 2QIPA 2ZI7A 1VIVA 4J94A 4BV2A 3AR2A 4UTOA 4YRAA 3G2QA 1XELA 1WVGA 2IHBA 4IUBS 4O4JF 5T6BA 1XRJA 1C8BA 2H92A 4FNGA 1ZLXA 2ACVA 1DX6A 2PX3A 3O1LA 4ZCQA 4Z4HA 3FYUB 5ECGC 4D0LB 4MWBA 5JMPA 4QE3A 1MIOA 1N0IA 1QS0B 4L5YA 2VPZA 5JR3A 4KXYA 3RYHA 4GBED 4F46A 4XQ0A 4BC0A 5JY6A 3JTMA 3KV1A 4FN4A 1FS5A 2WWIA 3KQVA 3GJ4A 4F86A 1OBHA 4DDMA 3OEYA 4PZZA 5KDDA 4EPWA 4BX8A 4XVUA 3E61A 3F78A 4JELA 2GVNA 1GGNA 1T9GS 1GA6A 1II0A 1KEZA 1L8OA 2DBRA 2EW8A 3CLHA 3OZRA 1XZGA 4D79A 4DA4A 1A4RA 4RLQA 2H1HA 1XVUA 3SPXA 1O94C 3F6BX 4J0FA 4U7GA 5J2UB 5LC1A 1NLMA 2CHGA 2X8WA 4EW3A 2OILA 2QM8A 2RKWA 3FYSA 4NKRA 3EIWA 4UMDA 5A6SB 4LWZA 1HE1C 2BI8A 3ZQ6A 1U28A 1THTA 4EPXA 2FR1A 2XB4A 1WX1A 3UKOA 4FGKA 2F3UA 5EEHA 4F12A 1S8FA 1PLLA 1Q1QA 3RUAA 3H6KA 4Y0AA 4CM5A 4DCSA 2QTAA 1SKBA 3EDMA 4NEQA 3O2SB 1ZQ9A 4PYLA 1PT7A 3MWLA 3L77A 3L8FA 3U44B 5HJ2A 5EXSA 1R16A 3MHTA 1O96B 2D8MA 3UK1A 3ICPA 3GL9A 1ZH8A 1DWQA 5LCXA 1ORRA 4K87A 1U7UA 1TVKA 1WQ3A 4MEBA 4MV4A 3VPHA 3R3WA 1JIVA 1E58A 2GWHA 4A8JC 3LT5A 1KGDA 2IS4A 2EDAA 2AEMA 4MVJP 4A6PA 2VLIA 2UZAA 2L69A 3ORQA 3KFXA 4I50F 2ODQA 4IWYA 4DEYA 3PLNA 1OA1A 4KAXA 1Y4DE 4XWOA 3E9EA 2QUBA 1RYEA 4ESEA 2J46A 3DMTC 3L7MA 2Q4BA 4OHZA 2XMDA 4XYGA 4X85A 2B21A 4CG1A 2IUYA 2G88A 2E7ZA 2GARA 1RYFA 5JT1A 4BO3A 3BGIA 3HCPA 4QHTA 4FYJA 3RODA 5K45A 1Z5VA 3TVYA 5CFOA 5J4HA 4YQZA 5AWFC 3B1VA 1RAEA 4IEIA 3BJZA 4LYEA 2Q49A 3IHKA 2Q29A 2QMQA 3ECCA 1KYTA 1RBZA 4R9SA 3GEEA 4GVLA 2PWYA 1JLSA 4DV3B 3NB0A 1OA0A 1EE9A 3OOEA 9ABPA 4LFAB 4TTJA 4PG6A 2IUSA 5KINB 5KSWB 4BX3A 2IKQA 3HWSA 3JD0A 3NEAA 5J4YA 3TI9A 4BFVA 1R4NA 3LWNA 1UANA 4UCXA 4XWTA 4LAFA 5E1DA 2HLHA 1E9SA 5KNDD 3EEOA 2Z04A 3PUVA 1NBIA 3QG1A 1YC5A 2Z5LA 4FMPA 1XQXA 1GVNB 1QHHB 1MOSA 3GLIE 2C4VA 4EO7A 1KMHB 1YDGA 4DV1B 2D5BA 1DWOA 2BGRA 4HFNA 3O9MA 1NFFA 4DCCA 3BK7A 5D01A 2YCBA 1KK2A 2HMUA 2Q3BA 1B41A 3IUJA 2UKDA 5JH7B 4GQIA 4HX9A 4L4XA 2O6HA 2HO4A 2JARA 2VF7A 1U9IA 2B82A 3FLEA 3JVIA 3QUCA 3O6VA 1ISIA 4NK5A 3HHEA 2ZYHA 3AKDA 3OJWA 3MYYA 4WFJA 3UXEA 2OGWA 4M9QA 2JANA 5IAJA 1A9OA 1EIWA 5JDIA 1U65A 4MUNA 2YV1A 4OBEA 4LRWA 4Q7JB 2WF7A 5FWXA 2D2XA 1AT1A 1U81A 4FFDA 2RGRA 1PBTA 3UJDA 4NAUA 1M8GA 4DSTA 3PC2A 2ABWA 5A62A 2PGIA 5HDQA 2PWAA 4OM7A 3ADBA 5SYAA 4RL4A 5IT0A 4FFVA 4CMJA 3NCHA 3FZYA 2C2KA 5M2QA 1N6LA 3NEJA 4HK4A 1Y6JA 1EZZA 1EU1A 5CFPA 3G02A 1IJFA 3Q5DA 2ZCUA 2AMYA 3BRSA 4MWZA 2QTMA 3I2FA 1V7ZA 1WW2A 4QGFA 2VDKB 5AKYA 1MQSA 4K8RB 5AW5A 3CWZA 3VSDA 5BV2P 3QKRB 4AG6A 2H9AA 1DAMA 2WVJA 4IRXA 4ND5A 4P3KA 3I1JA 4H15A 2A8YA 3A25A 3WOHA 3EPLA 2AI3A 4OKSA 4R5HA 1U3TA 1P2SA 2YZNA 1YAHA 3EG9A 5CYPA 4J6EA 3QVGB 4HAUA 1J2YA 2C98A 4FI3F 1DRJA 3DBLB 2BEUB 3K1ZA 3D64A 5HF6A 2FWBA 1FDUA 1PL8A 3BF8A 3DJFA 2AZDA 1VDZA 3QXXA 2HNKA 4OGWA 1UMCA 1KHTA 1WZEA 4PLWA 4C4YA 2DH5A 3CT6A 4Z4CA 5BQ3A 4Z99A 2ST1A 5AUOB 3IRVA 1VA4A 1LY1A 2BMWA 4WFKA 4C88A 4JB2A 3QOYA 3GRPA 3I39X 1L5QA 4S24A 3ZBQA 4G4SO 2VXOA 2BBOA 4EF6A 1VSQA 5LMCA 1KDZA 3GJTA 2OBYA 5D51S 1C0KA 5DRYA 1EG2A 5GM1A 1UBLS 1Z35A 3A3NA 3QKUA 4DBLC 5FTWA 5B7NA 3OICA 3IVMA 3K0HA 4O25A 4EFMA 2XUZA 1DAPA 1Q1GA 2A9VA 3CS3A 3H1AA 4LYFA 3EXHA 2CLDX 2PRKA 4OP2A 1IJKA 1JHOA 2WJ4A 2QLLA 3ML1A 4UM9D 2QDKA 4WVFA 4WNAB 1A4IA 4WZAE 2H57A 2XA1A 1WU7A 5FB3A 3J81k 3NTVA 2UXDB 5JVDF 3RVNA 5F9FA 3TZLA 4CBVA 5BSMA 2VXYA 3A7EA 3PZBA 3T3NA 3AETA 3MJTA 4NEGA 1KIFA 1NI4A 1MBZA 1A4XA 1BQ4A 1Z39A 3CLUD 3KFLA 4RPCA 3VR1A 4KQIA 4AT1A 3L0YA 1VLHA 3TRDA 2Y77A 4DMFA 1XJ0A 2GTHA 4FFNA 2ZETA 2FP3A 3QKSA 3P9KA 4IXDA 4FQ5A 4LDJA 4RLHA 1Q0TA 2VPTA 7AT1A 4D44A 1O6FA 3L6BA 2JJ2A 2GA8A 3GJ6A 2BJVA 4IV5A 4YP1A 4C0KA 2HC9A 4NBNA 1QYCA 2V9ZA 2X6TA 3D8BA 2ZI3A 1N92A 2GRAA 2I78A 3G8CA 4FGWA 2I2DA 1SK8A 1Y3IA 2WG2A 3FPLA 5AM0A 3TOCA 721PA 4DV5B 1QLJA 2RAPA 2HKIA 2MT9A 1P3Y1 4NQRA 4AKGA 1PD0A 5LBTA 821PA 4XWYA 3EZ9A 2O1XA 4J43A 3FM9A 4ZVSA 3PJFA 1Q20A 4TMYA 3ENWA 4QIHA 3T3PB 4XQGA 1D9XA 3NBKA 4R7GA 3R9WA 2Q3HA 5E4FA 4TOIA 2NVBA 1OLUB 3M70A 3LECA 4HRAA 1UPCA 3C16C 4PLVA 5CNIA 3KQKA 1KNXA 4DWWA 5JZSA 2HSEA 1SC6A 1YJCA 3B1KA 3IFSA 3HE3A 2QN6A 2ACEA 2C3UA 6PFKA 1GG2A 4JROA 5KJFA 4JQZA 3R6TA 5HZHA 4Q5IA 1UZUA 3PQ2A 1ZOIA 1YR8A 1SVUA 3DGFC 3M81A 1ZP6A 2O8FA 5CA0F 1DTWB 2YWHA 4ETMA 1W36C 1J1UA 2PHZA 3DLCA 4XUGB 5LIRA 2BWJA 3DZ8A 1QYIA 5C5IA 2H1IA 4WA8A 2DAPA 5B4TA 1BU5A 4LF4B 3ZHOA 4JAVC 4YMSA 1XJCA 5GINE 2FOIA 3SEAA 1O5TA 3I2JA 2XCQA 4WESB 3OM1A 5AM2A 5J2TB 4EHLA 2B5WA 2I4NA 4OPMA 5D3QA 3RS0A 1L6RA 3PGKA 2PT6A 5IW8A 4BFCA 2C9DA 4MWDA 1QV9A 2DT5A 1P2BA 2OORC 5KVQA 2J0SA 1G6Q1 4URVR 2QVBA 2YHIA 3GC6A 2BGWA 1BVRA 4NNPA 3DWEX 3N0VA 3THOA 4IBOA 4EEKA 3O8RA 2ATXA 1R4AA 2TMDA 3DXZA 3N86A 3TD9A 3T7TA 4YAUA 3TMAA 1JHZA 3M6WA 4KKXB 1P9LA 5FWAA 4ZODA 1FLVA 1C1HA 2H5LA 4J7UA 4KQ6A 4AVYA 4PSDA 1Q1EA 2Y66A 1Q7RA 2IYRA 1YFKA 3S2UA 2GO1A 5IYZB 1E3MA 4FGJA 3N75A 5IK2A 5BVHB 1F60A 1UFRA 4EUEA 2ID9A 2ZU6A 1RYBA 2NQTA 2PO7A 4HRVA 1JIQA 2EZ4A 3QU5A 2FPGB 1JQKA 3ZWYA 2X14A 2F6RA 2GZ2A 3MXTA 3MLEA 1QCDA 3AEZA 3BDVA 3BSSA 3PE6A 4NJOA 5JCXA 1G8HA 3HS3A 1OWOA 2IC5A 4Y67A 1FTGA 4YT4A 3C3YA 1Q0UA 3WADA 3RC8A 2H1WA 2X58A 3CZ5A 4CM7A 2BF4A 4E5VA 1K6XA 4K9DA 1X7ZA 5ICEA 2XGJA 4C0WA 1M74A 4FHZA 1VG0B 3PGA1 5TQ0B 4REOA 5TV2A 3GJ8A 4JKYA 4EI7A 3KQMA 2EGHA 2BRUA 2BPOA 4ZAFA 5KDLA 2GKOA 3AKEA 2H4WA 2HRBA 2RHDA 3B8EA 3ZCVA 4H18A 1OH7A 4LGCA 2GKGA 1G291 1GSOA 3FVVA 3NXKA 3ZDFA 1JHQA 1P6UA 4HGRA 2RARA 1EUCA 1F0KA 4QSMA 1P2UA 2ALJA 2X19A 1I4WA 3VTFA 5FBVB 4MV8A 1EFRA 1OQAA 2CDAA 5FBHA 2P9CA 3U7JA 4JENA 3HA5A 1JVSA 4L08A 3VUEA 1QR6A 3LDUA 4ZVTA 3R3JA 2VQDA 4E12A 4CN9A 1M6NA 1T8PA 1KQGA 5CM8B 4F6RA 4ID3A 1O9BA 1P1KA 1K8XB 2QHXA 2QVCA 2HWUA 3FHCB 3MB8A 1RPJA 2P69A 1N6KA 1SQ0A 2PPVA 2XSZA 5TT1A 3KYDA 4GE3A 1U7DA 4K6KA 1PJAA 4PO8A 5BVGA 3A28A 3M4ZA 1KS2A 2JJ8A 1TQ8A 1U0JA 2EFHB 3DXXA 4S1VA 4NYIQ 1L5HB 1FP2A 2QI9F 3WIUA 4I55F 4MW2A 1P0MA 2P9YA 4HO1X 1YHYA 2R6HA 2XB2A 4E2ZA 1OAAA 1OX5A 4K86A 3WGUA 1S2MA 2ZUVA 4MS4A 2ZLBA 1YJXA 2AN3A 5EIBC 5KB3A 4URWR 4QLAA 4R1OA 2RHWA 1U2ZA 2FV8A 1T29A 3HJAA 3L05A 3DUWA 3K5HA 3I73A 5JMWA 1H05A 3MJEA 4YYEA 4BKUA 4I5EA 2RBKA 1KP2A 5CXXA 1B6GA 2NVOA 1USUA 5B64A 2PLNA 3P9SA 4H3SA 4W7IA 4LX8A 3T6KA 1GEGA 1LBSA 3LQ1A 1P8AA 2QG9A 4B83A 1FQWA 2DLCX 1ZI9A 4NZYA 1LV8A 1GLNA 2AR9A 1P62B 3O73A 4ITRC 2RHOA 2FVXA 3MVEA 5IK2D 3U4QB 4TYYA 1JDJA 1SCQA 3JALA 4MWCA 1MW9X 2B94A 1CDEA 2ENUA 3FJOA 3MNFA 4YRLA 3DMGA 3ILYA 4A15A 4J90A 4A0FA 4IRUB 1E8NA 1UPAA 1UOOA 2FQXA 4U7PB 2XECA 1FMCA 2PZEA 3X2EA 1DAGA 1PT8A 5BMVA 1Q7GA 2P2ZA 2WT4A 1GPH1 4I9GA 4AJEA 2HDNB 1ZISA 4QUBA 3U48A 5DM60 4QPJC 1E8DA 2EZ8A 2ARKA 3G8AA 4BQRA 5FUQA 4UNNA 2GETA 1RMYA 4GGMX 4U2GA 4UEOA 1MX1A 4UUBA 3G89A 4M4SA 3U40A 4A6DA 5C37A 1QZXA 1XTKA 1L7NA 2C0CA 3WGZA 2GXAA 2H0RA 3Q7QA 3NP7A 3BXXA 4N5HX 2NPIA 1Z2PX 4KR3A 2GD2A 1E1QA 1EYZA 3NTUA 3QW2A 4RVFA 1QTRA 1E2IA 2ZVPX 1DELA 1SKYB 1KFBB 4OIMA 4IKPA 2OD2A 2ONCA 3HCNA 2WHRA 2ZU0C 4PPNA 3SMVA 1PW7A 3GNQA 1EFRD 3A36A 3ID6C 4ER0A 3HCRA 2VK8A 3GT0A 4MPTA 5FFMA 5IMBA 4EI2A 1O94A 3COYA 2CUKA 4D5EA 1VYHA 4R8LA 3TTVA 3ZLJA 4ABYA 2IE8A 4EKIA 2HFKA 1XEXA 2XPCA 5CJ2A 5MGNA 1CR1A 2PMEA 1C3VA 2ZE5A 2OM2A 5AXDA 1TZCA 1ZIDA 1UXJA 1CU1A 3DT9A 1DAIA 4L95C 4PGFA 1XDSA 2JCGA 3PE3A 1RP7A 1L7BA 3LIPA 2PNJA 3JX9A 1SUPA 3LPNA 3ZDZB 3HEMA 1F38A 4G0NA 2IXEA 2QR5A 5T41A 4CMHA 4IYJA 1USGA 2VHWA 1CVIA 3G2LA 4LVCA 4PG4A 1GOTA 2PBFA 4R4JA 5F5LA 4ITVA 3T38A 2OK8A 4P98A 4DMCA 3THWB 1DJLA 4YDQA 1NX6A 3AIIA 3BJRA 1D6JA 1OTHA 4UUPA 2A7XA 2QTVA 4HTFB 4A8JA 1LZLA 4KO1S 4DC0A 1E2GA 2J6BA 4DJTA 2IYSA 3AVYA 3NIBA 1VOTA 1D4FA 2KM1A 4FJ2A 3RSSA 2RHMA 4I6JA 1XMJA 2ZRGA 3V46A 1MJFA 4UMVA 3N3AC 3SI7A 4F4UA 3S99A 2R5WA 1UWCA 4CLXA 1YR9A 1JHPA 5ITZB 2CMHA 1FFBA 3DMTA 1LJLA 2IYUA 4O1IA 4OFWA 3ZHCA 1M34E 1BAPA 1L8AA 1P81A 2B7LA 3EY4A 3EC7A 3NDIA 3V33A 1ZXBA 2VTKA 4B6PA 3FTFA 3N0XA 2WJGA 4UHKA 4OD0A 4UAVA 1BN7A 4IICA 4MUXA 3EA5A 1CRPA 5KNLA 4ZYUA 2EL9A 1YFJA 1RWQA 5F1PA 3S8EA 3QKWA 2K7ZA 3B13B 2JIPA 1SD2A 3QEKA 3LWBA 4YRBA 3UJHA 2GDZA 3OTWA 2IGBA 2C5BA 2RJOA 1JQBA 1RJEA 3W79A 1HEIA 4XIGS 1YGYA 4A4DA 3V3TA 5G3ZA 3CZPA 2ZXFA 4XOIA 2J59A 2JAUA 1KS9A 4ZT3A 4INAA 3SQNA 3RM3A 1A9SA 10MHA 1QRTA 4IF4A 4GKJB 2FP4B 4G0OA 4JZYA 1PNOA 1Z2CA 2J0EA 4M76B 1BA2A 2D1SA 2FQYA 2OZKA 5JDCC 1CKEA 3WOVA 3ZCQA 2FDCA 1NV8A 1FLAA 2FRDC 2YWGA 3JQCA 1DIHA 1NDQA 3F9IA 4NJMB 5B1IA 5HE9A 5L3QB 4OXQA 3PQDA 1R0CA 3PFKA 3ICCA 3IQDB 4XR4A 1TM1E 1G8JA 1I8TA 2LE0A 1F6DA 1IM8A 1AY0A 1U0OC 4GPTA 4XIFA 3RWMB 1E1QD 2H4ZA 4FYKA 1U8EA 1NHGA 1GZUA 1G7TA 2OHVA 2GEFA 4RHXA 4XIIA 3VRHA 4W6QA 5KVSA 1NVKA 3OO1A 1RZ3A 4KO2S 3LY8A 2RH4A 2A9JA 5JLJA 1FBTA 3TRKA 3LBFA 2YMLA 4KQCA 3FUUA 1DQRA 1Z0JA 5E1BA 4Q3OA 4G0VA 1SPBS 3ED1A 4O2AF 4TXMA 5L7YA 4D41A 3EZLA 3LNTA 4RPJA 4A0QA 3EQ9A 4BQEA 3GLFE 3D8RA 1Z74A 1WHSA 1NPTO 1NMXA 4D92A 3RSZA 2XCRB 1BFKA 1RYMA 2DKNA 2JLRA 3JY6A 4RWZA 1ITZA 3UWMA 3LUCA 2H06A 4QODA 2OZEA 3GQVA 2XQIA 4MVYA 3BX1A 3G8DA 2IWHA 4DCUA 5LDDC 1Z17A 1C3EA 2J5KA 3E84A 1B7GO 2X8JB 1M6EX 3LH5A 1H42A 3EG5A 5ALQA 3W5UA 5A5FA 5KYXA 3RYHB 5KTPA 2ZE7A 3ZZUA 3GDHA 1KKLA 3UN1A 2WYOA 4YUVA 4YJ3A 4MSUA 7MHTA 2V7WA 1L7PA 1I5OA 1ZSNA 1CEYA 5LPNA 1SBIA 1QGOA 2QE7A 3G2NA 4QZVA 3QVXA 1NQAO 5U1PA 3FJYA 3JQPA 5D86A 3UWPA 4BVLA 4AI6A 2VAXA 3OF5A 4ZDKA 1V7CA 5ERXA 2QPAA 2IUUA 1JEAA 3LNCA 3IQFA 3KUUA 1PI3A 3K05A 2OFFA 1Y3FE 1T3HA 4HEHA 4FMDB 3GO4A 3MUFA 3JD3A 3DDOA 4FC7A 4HB2A 4JR2A 4L2IB 4WAUA 4EX7A 1QO9A 1AMUA 3G85A 1TD9A 3S28A 3H3JA 2P1RA 4B6RA 3B2QA 1MX9A 1X1QA 1FFXB 1KI1A 2Q5FA 3B3QA 2GLUA 4RGVA 1M2FA 3PT9A 3AFHA 4RPIA 4NDAA 3VYRB 3LCMA 1K3TA 5JANA 2C83A 2GK6A 2GZMA 2Y9PB 3F5SA 3TKYA 1GTL1 5CB0A 1K97A 1Z07A 2H11A 1Y6QA 1QVWA 3QE3A 1YSCA 2QJWA 4M55A 4C5CA 4GWGA 4YCCA 1C5KA 3R7LA 1SCUB 4MKIA 4PQGA 3NT4A 2Y0DA 4DAOA 2GWRA 4IH1A 5JRJA 4N41A 2SBTA 1SCJA 3BXEA 2QMOA 1SQ5A 3EZGA 2AK3A 1KE2A 4K0KB 1ZD2P 5L6MB 1Z8DA 1X7XA 5FPQA 4BS9A 1HGXA 2VDWA 4CEHA 2EEZA 3COZA 1F2VA 4JIMA 2ZATA 5G0WA 4OHYA 1P7PA 3CZRA 3V8PA 1AF7A 2QLMA 1CLUA 2YXLA 2BLNA 3DV0B 1JAXA 4X71A 3VDQA 3L8DA 1NMEA 2VT7A 1NSTA 3CF6R 4INPA 5G1OA 3JR3A 2GZDA 3HABA 1NLUA 4CEIA 1E5TA 2BFMA 3IAS1 4EUKA 1H4QA 1ACMA 2HU8A 2XZDA 3D8SA 1MH9A 4QREA 2FLKA 4DLTA 2V4UA 3VAZA 4DWOA 1OYWA 2ID7A 2YWRA 3AY0A 2G0NA 1KYXA 3FTQA 5SV2A 3V7NA 1K9VF 2R96A 4E1BA 2L17A 3W2EA 2QYOA 4PS0A 4CCAA 5E1OA 1XZAA 3EODA 3G88A 1XG5A 4ZVMA 4J4TA 2I2WA 4BV8A 2D1QA 5E8JA 4ENTA 4OLFA 4TMWA 5B58C 3KKQA 4OFXA 4AICA 4HZUB 1M76A 3A10A 1QGED 4WK2B 3MN1A 4FOLA 1DMRA 4JXKA 4KXUA 1ULAA 5CGZA 4BNMA 1BRTA 3UT6A 4ZIRA 5TIIA 1NDHA 4QDZA 1SULA 1XZIA 1P2FA 3RUDA 1NW9B 3MCAA 4BWFB 5CCXA 3H18A 2JIZA 3AH8A 2OLEA 2QE7D 3GDOA 1IXYA 4KK4A 1DG1G 1E79A 3DWFA 3GVCA 3VZDA 3A4IA 1W35A 5JSFA 5HTOA 5BN4A 3V2GA 1DUVG 4LQLA 4S1TA 1FW6A 3LLUA 5FWXB 2BFDB 2X0JA 1FYWA 3TD6A 5B1DA 3DFUA 3Q7PA 1XEAA 1U0GA 4TUYF 4H2DA 1KJIA 3SN6A 4QYSA 2BCEA 1ESNA 5EY5B 4AUMA 1CRWG 2JS7A 2XDAA 1QYWA 2ZTVA 2OORA 4G8BA 1KDPA 3SMQA 1KYYA 1RHRA 1UC8A 1YL5A 3P9YA 4RTRA 1FDRA 2PH7A 3DE1X 3VTKA 2GXUA 3OPYA 3VPGA 1NXTA 4V3BA 3MYRA 1SRQA 2PTHA 3THWA 4ZYXA 3N6XA 5KC8A 2RGUA 2AFRA 4M6WA 1PNVA 1OIXA 3K0AA 2ADMA 3TTXA 2HPHA 1UDXA 1PJBA 2ZR9A 4ZICA 1GA1A 2FG7C 4FM9A 1QH1A 5SYMA 4JOBA 1SEPA 5EFZA 3LT2A 1I32A 1DAKA 2PN1A 1AS2A 2X9QA 3VZSA 4MAAA 1SMKA 4RHCA 4GWLA 3UPDA 4NAHA 3T52A 1U4NA 3CXUA 3N1UA 4JL8A 1S9DA 3PJGA 1VLLA 1UMCB 5EUQB 4FYXA 1S02A 4ZYZA 3NNSA 4JBIA 4IJ5A 2IZ1A 1ZSVA 4TQGA 4C3VA 1MO4A 1XRPA 2NWQA 3OQNA 3LPCA 4V0OA 4DLYA 4WDQA 3NTQA 4DV7B 2UUBB 4UFOA 3BHMA 2OCDA 4IJUA 4X24A 3BIXA 2PS3A 4Q05A 3KDPA 1GR1A 1E9AA 1P3DA 2ET6A 2V7PA 2VHZA 3U4DA 4ALIA 3WV5A 5FX2A 2LRHA 3CEHA 4K9MA 4D8WA 1Z5GA 4C14A 1Z6GA 1OCEA 1VLVA 3PK0A 3UW3A 1IHUA 1IZ0A 1WUJS 2FF7A 3IVXA 2TSYB 3EQZA 3H2ZA 3V1UA 3T1YB 4DB4A 2UUCB 1XKQA 2BI7A 1LDNA 1D4OA 1MFZA 1D0IA 2X5KO 5LKAA 1DAFA 2E9SA 5DNDA 1PVOA 3OKAA 1IYZA 5FEUA 3Q15C 3DMFA 2W2OA 9GPBA 3HFSA 2PPLA 4IIYA 4OMCA 1ZL2A 1GQRA 1GEEA 4J1TC 4XGNA 4YVFA 4DBZA 3OX2A 5IH7A 3HM2A 4YJ2A 5JWRA 1GU7A 5F64A 1C7IA 4NOMA 1T10A 3D5QA 2Y1CA 3OZWA 4RF5A 1ZK1A 3GBSA 3PEVA 1M83A 4RZSA 4AYXA 1JR2A 1HDXA 1GXSA 2XBLA 5LJLA 3DWIA 1W36D 1QANA 2H4JA 2JIZD 5C51B 4RJKA 2WINI 4IGIA 1E79D 4KU4A 3OJOA 4YDSA 4R54A 1U0SY 1XZPA 4G5XA 3KETA 1QHSA 2CXSA 4CQMA 3U7GA 1I33A 5LKRA 1HORA 3QUBA 2W6CX 3RC9A 3KHKA 2VLBA 5FUBA 3NO4A 3W05A 5H5JA 2PVCA 2ZTMA 3DJYA 3CCBA 1YOBA 3AVXA 4AYWA 2GCOA 5LZ9A 4HAOA 1OILA 3V7FA 3W6OA 5LL6P 3ZDDA 3BREA 5AK4A 5HK9A 1HXHA 4WD3A 3TOVA 2XY4A 5KWJA 1JAIA 5ALWA 4XX0A 4XGKA 4J3NA 2AMVA 1EVYA 4I1OA 3ZKAA 3UT0A 1IU9A 1GNVA 2W8ZA 1OV4A 1VLJA 3DW1X 3GRVA 4K9QA 1CXZA 4ZVLA 3HKBA 1Z26A 4S2EA 3K35A 2HF9A 4KO8A 1F5NA 2X0FA 3TDNA 3TQOA 4UPVA 1HK7A 1NAHA 3L1JA 4YA6A 3Q40A 1W85A 2SCUA 4DMKA 1JEJA 2ERCA 5FCDA 4IQ0A 4HR7A 4YMTA 1OWMA 1WB6A 1S8NA 2G0TA 3BGOS 4AG5A 1LDEA 2DR0A 2IPXA 4PONA 1IZ8A 3OZFA 5LQMA 2IIPA 2C00A 1C2YA 3IYLW 1NVMB 1QFZA 4FEAA 3RK4A 3TCXB 1B23P 3FETA 1ENYA 2TMGA 4KTTE 3TNJA 1UC9A 5CLGA 3L7CA 4OG2A 3OESA 3N6RA 1UFKA 4PC1A 4PFJA 4RD0A 4MHSA 1IG3A 2YHIB 3UHJA 4CIVA 3I4FA 3F9RA 1N0HA 2FZWA 2GN1A 4GLJA 4AWAA 2J85A 2XCOA 4HNQA 3SLGA 1RXWA 1UK9A 4HQLA 2FPRA 3PFGA 3LO8A 4HX2A 3QVMA 4NOLA 3VTZA 3TZ6A 5K8JB 3E2IA 4FHDA 3NHYA 4W82A 3BMQB 2UDPA 3I30X 3W6ZA 3KSUA 3FOCA 1O0BA 1V7PC 4HJRA 2QS9A 1ZJJA 2HIAA 2X2OA 5J2UF 3GZTB 2V58A 4C43A 1VL8A 4BU1A 5AHWA 3ZVNA 3ZGZA 4MZDA 3WHKA 4KAFA 5K6TA 3L7AA 5FTKA 3VFDA 1DPGA 2XEXA 2H5IA 2VJNA 3C8MA 3QE0A 4MJXA 3U3DA 1W6UA 1H69A 3MWDA 4C5AA 3ZWOA 4CM3A 3VR2A 1N3LA 4WN3A 1AHNA 4YR9A 3FBGA 1KSHA 3D4OA 3FUWA 2HK7A 3WZLA 4DADA 4LOAA 2NU7A 4L22A 1YS9A 3S81A 1NF2A 2W8BA 3F74A 4O2BB 1ETUA 1W4LA 3I92A 2XRYA 4QG7A 1VE1A 1X7ZB 4PNHA 4CR6A 3NRBA 5BMOA 2BTEA 2D1RA 3MLAA 4K1XA 4CQMD 1OLSA 1WV0A 2ZWAA 4F8JA 4AS3A 1GGVA 4FDUA 2FRXA 3PNKA 1N8KA 5EIBD 3U62A 4OI1A 3O47A 1P39A 1DEKA 2QRVB 1EUCB 2IHZA 3M33A 1P31A 2ETVA 3DLBA 4RETA 2ZPAA 3GLUA 2CXQA 4TZTA 4MCJA 4TMXA 1KJJA 2W5UA 3EWSA 5A9SB 5JAIA 5JYDA 5E6RA 2GAFA 1SVWA 5GADl 3PDJA 4XJVA 5CJJA 5B7PA 1K27A 2GYUA 3RW9A 1ZM3A 2FMHA 4F6RB 3C3BA 3NBMA 1Z7GA 2VP4A 4CTKA 3GLIA 1YBMA 1ODLA 1FUEA 3VKHA 3KYDB 4IIBA 4C22A 5BVGB 1WXHA 2ZIFA 1OGIA 1SXHA 2H9IA 5IJAA 5L6LB 3KQLA 4CKZA 2GA9A 3LYLA 1QQBA 2PL1A 4BN5A 1B73A 1ISHA 4WINA 3UMFA 1A7JA 2BLLA 3GD7A 4BLTA 2WWRA 4MINA 3ZCSA 1AQNA 1RHQA 4OMDA 1UT6A 2PRIA 3CLSD 1OD6A 2JD0A 1GZ6A 1Q16A 3LT1A 3NWOA 4MS4B 1SOMA 4B3CA 4DKXA 1Z2DA 5JDCA 2YXPX 2FRDA 1LPMA 3WTBA 4MW1A 3CCCA 1NW5A 3DL4A 4OXRA 3T1TA 1EKXA 2IXDA 5EIFA 3ZZNA 1OZGA 5JH7F 1K7CA 3E4DA 4FMBB 4UAUA 2VPYA 3BTOA 1W49A 1LFDB 2O48X 1BMFD 2ZRJA 1FBNA 3AJRA 4FT4A 1KC1A 3BK1A 1WKBA 4WY2A 1KJNA 1OXVA 4XB2A 4YQFA 1N77A 4Z4FA 3GARA 2WFMA 2IZ0A 5FAXA 1AA6A 3HN6A 3JALB 2QLNA 4LK3A 3UICA 3FTDA 4ZQGA 1SHZA 1PWEA 1UBEA 5KYGA 1U7HA 3CRW1 1L5RA 5CW1A 5COAA 1QOZA 5AXAA 3VR2D 4IJWA 1EWTA 4GW3A 4NHEA 3QE9Y 2YWJA 1DOZA 1QH8B 1GG5A 2BGNA 2O2XA 5BMVB 4OHVA 5G0VA 3T4PA 1TA4A 3NOQA 1V11A 2LCQA 3WA6A 1QR2A 4M53A 4YJFA 3GLGB 1KZ4A 1Z5WA 4PZAA 4R2IA 5K4AA 3SQWA 2XCUA 1GKLA 1IB6A 1CD5A 1NRJB 2REXB 3KZOA 4PPQA 5EIEA 2IXGA 5DE3A 1VPWA 2D06A 1P5ZB 2IL1A 3EEBA 2B83A 3AUJB 3M4JA 3GFPA 3MIIA 3VV2A 3SZ3A 4R69A 5LLSA 2JLVA 2J6HA 3CRQA 2I66A 4MR8B 2ZAYA 3TQHA 2VSFA 2G1KA 3DF9A 3MWFA 7REQA 1CY1A 1YJAA 1E7SA 4CGZA 3OOYA 1N5LA 3E0XA 1SU4A 5LYJA 3T8YA 3OTIA 1PR6A 1QIEA 2XGGA 4GPIB 3SYMA 1FDOA 3ETGA 3P9XA 4ZC8A 1DFGA 3KM0A 4EDFA 3ESZA 5J63A 3VXKA 4UTRA 2O0KA 1CR4A 2IZ6A 2ZYSA 3QVOA 5AKGA 1XEXB 1IDOA 2W90A 3F2IA 4O1HA 3U0VA 4CN8A 4H7JA 4MHOA 5ALZA 4Y18A 5GY7A 2O4UX 4R2LA 3GEPA 3H5LA 3KHUA 4L7VA 1GSAA 4HNTA 4OK5A 3DBVO 2XVYA 3NIDB 3Q9LA 1Z4QA 5I47A 3P9NA 1A8IA 3SK0A 4RE6A 3TZKA 1ZYUA 1XT6A 4X7BA 2OPBA 1A8PA 3HJCA 3AZPA 2FQ1A 4AIIA 1O1YA 2H63A 2H8KA 4GH5A 3LKBA 2WE8A 1GT91 5JECA 2OO7A 2JAXA 3ETNA 5EXTA 3HLTA 2ZGVA 2QTVB 4XUDA 2WM9B 1P4AA 1EFVA 4PZCA 1T6XA 3N8GA 3EN0A 1NRXA 3BAZA 3GJQA 1ZM2A 4JIGA 1Y8RA 2B25A 3N8DA 4IIGA 2OAQ1 1IWPB 5JD6A 5B1SA 1C1DB 1CC1S 3G0DA 3FTEA 3P2MA 3H1GA 2HW8A 4DGSA 1E5DA 4M99A 4I5GA 5D3MB 2DJ5A 3H17A 1HY3A 2E5LB 2VHYA 3MCZA 1M0TA 1VPEA 2ZBDA 4RBNA 1IBKB 1MB3A 2BGGA 1GDDA 2VG8A 1P29A 3MAGA 3QFFA 5A1JA 3MUOA 3KCNA 3STHA 3MS7A 1UAAA 2NU8B 3RQSA 1CJTC 1U0TA 5I8PA 3DDSA 1N2GA 3L1VA 5DHQA 4LQ4A 1N7IA 5EUCA 3THRA 2NNLD 1L6IA 4WCVA 2DWCA 3HZHA 4TROA 3B70A 2CHEA 2C8VA 3T1VA 4X93A 4RENA 1V4BA 3SZGA 4NCIA 1JPNA 1RQNA 3OM8A 5HILA 3N7AA 2XDQA 3ZKWA 2ZSKA 5LXTA 4WLNA 4A8PA 3ZHSA 1CUCA 2PKQO 3OSUA 4RYLA 4ZXPA 4DRZA 2FRVA 3EOAI 2AVNA 1DQPA 1PVDA 2DF8A 3NKVA 1PT6A 4QHSA 2DPYA 5DULA 4MUJA 4Q9AA 2XITA 3OQPA 4AC9A 4WVLA 2VF5X 3LXUX 2EYUA 4M1MA 2GOYA 1HTWA 3VKVA 3EVEA 3QPUA 4QDXA 4L6IA 3SCZA 3NWBA 3MAJA 1XTVA 3FDZA 3I6IA 1Z7YA 2M6SA 2Q99A 2WT9A 3FZEA 3OUUA 5C1PA 4IMJB 5K9ZA 1XZNA 5LNK6 4GEKA 2WYIA 5JFGA 4MWTA 4U2EA 2JCBA 2WIDA 4FBLA 5J2TF 3SC2A 3QPVA 2G9ZA 3TZHA 4Z3KA 5I6DA 1PS8A 1XJQA 1N7JA 2CXNA 2K2QB 1ODCA 4EUFA 2AA3A 2CJPA 2P65A 1U0HC 1X8LA 2YWDA 4GRDA 1WHSB 1HT0A 1RCTE 2FW0A 2HHAA 3EUWA 2FNAA 3R0ZA 2HCRA 5BUZA 1SIBE 3KALA 4HXGA 4BLUA 1NUPA 4O3FA 4Q4AB 3VZCA 1A98A 1KQOA 4LYYA 4N3GA 4B3HA 4XDZA 4BYGA 4W7SA 2OCXA 4MO9A 3GLHE 5FBZA 1KQNA 1YI8A 4KNYA 3A0UA 4YRKA 1CY6A 2PXXA 4H3VA 4F71A 3E8MA 1ZFNA 1VIMA 1XE3A 3AMVA 1JVNA 3ICOA 2K7FA 3KP1A 2FB9A 1QRUA 3LCCA 3B1YA 2BMAA 3DOOA 3AO0B 4N7RA 2P3OA 4BP8A 5EE5B 1J2EA 2XUGA 4NZ9A 2VP6A 4FR5A 4RVCA 3RVBA 2HF8A 1YR7A 5EL0A 3LW7A 3D3NA 3JZAA 4NFYA 4LMAA 4LQCA 2ZYAA 1U9ZA 3LUKA 4ND3A 5DNWA 1IN6A 3GWZA 4P82A 1VSUA 2IH4A 1NBME 3ROTA 4DUZB 1PG5A 1H4VB 1RLTA 1Y37A 3ROGA 1W581 2YZMA 3MF4A 1SM4A 3F97A 4XB6B 4LBWA 1VXOA 3DKPA 5BW6B 4MS3A 4RH0A 2QRJA 2VL7A 4EYSA 1HEYA 2PL9A 2GO7A 4EEZA 1C7QA 1J00A 4QA9A 3DDZX 4EKGA 1JEOA 1YFLA 2WD7A 4ENRA 4XSGA 4DM3A 1J8FA 3DULA 1R8QA 4WLEA 3F90A 1YR2A 3UQYS 2X1LA 4B8WA 5IU6A 3U5ZB 3L7DA 4J1TA 4CE6A 1XHFA 1PZFA 2OFWA 1VGRA 3SC4A 2ZJ6A 5LQCA 1Q95A 3ZXXA 5REQB 4GO1A 1WP9A 3HR7A 2HT1A 3IUEA 1UJ5A 4R1PA 3G2HA 1JH8A 1E2MA 3LFTA 5ED4A 2Z83A 4Z9XA 3B8HA 4QX6A 2IIVA 5THQA 4CEHB 3KKEA 3LY9A 4X97A 4KQMA 3UXYA 1FDIA 3ERCA 1IN7A 4B8YA 2IYNA 4MPPA 2FUKA 1C0EA 1AF4A 1DC7A 3HSSA 4MYCA 1EGAA 5LD2B 5JCJA 2AKEA 1KH3A 1ULUA 1R9JA 4W5WA 1TQDA 3GK3A 3Q87B 1AURA 2RI6A 4A5SA 2ODTX 3S44A 5JFOA 1NYQA 2ORVA 2VDUE 3AU9A 4B79A 1IM5A 1ZBDA 2QA5A 1KI8A 4FYHA 2O59A 2PG3A 1PK7A 1HM5A 2AWNA 4ILEA 3MOIA 2RI1A 1O58A 1R0WA 3GFQA 1CQPA 3B7PA 2AEEA 1RI2A 1R88A 2G63A 4R6XA 5EMKA 1VP3A 3GVHA 4PRYA 1OZAA 2MCFA 4EHKA 1B8UA 3AG6A 1P1HA 4R41A 4XRRA 1O2DA 3K70C 1BEUB 4FT2A 2Q5QA 4US0R 1H4TA 1U0RA 2JFNA 2JEZA 5ADUS 1VE7A 2BCGY 4B40A 5IXSA 1KO4A 4ZIRB 2WMOB 4H7EA 3WGHA 3ZTYA 3TG2A 1AZLA 1TVEA 1YIOA 2A92A 3V4FA 3M9WA 3NYWA 1O6ZA 4LV8B 4RW0A 5BN4B 4LISA 3E15A 3WKCA 1GRVA 4KQEA 4NDZA 5EESA 1JQ5A 1BZYA 1Z28A 2O2ZA 4J0EA 3WQSB 3CSSA 5K0FA 2VTBA 1SKMA 4WX2B 4P7KA 4HBGA 2NG1A 4WLFA 2WDPA 3UGQA 1Y5IA 2FR0A 2XYHA 2W7TA 3KUXA 4RY9A 5F78A 3IE1A 4OK3A 3WDSA 1MAAA 3JR7A 4GNKA 4WXYB 3ZHTA 4D6YA 3JS5A 3WLKX 2PSFA 3JWEA 2WT8A 1AD2A 4KUGA 3JARB 3T5MA 3OPYB 4P9NA 4ITUA 4CWAA 1N1MA 3CJTA 3ZWWA 1TIBA 4DDUA 3EMVA 3O0DA 1A1VA 5JWHA 4M6WB 3PB3A 5J4LA 3K0AB 2JA1A 4N0DA 2HLNA 1O97C 4CDRA 1HRDA 3C8DA 4JBXA 5E0OA 1JTVA 3LMKA 1QH1B 4G4SP 3KJNA 4S04A 1J23A 1KY5A 3P2JA 4XLTA 2PZKA 4RUKA 3TH5A 2RE8A 4EG4A 1XTTA 2XUJA 1P77A 1JEQA 3MRXA 4J9UE 1YMUA 4R2XA 1XZLA 3GCDA 2WM2A 1AE1A 1B0PA 1P0IA 3IUYA 4LHEA 4ADSG 2UYCA 2G40A 2VF4X 2HA6A 5JSHA 4TYPA 4OM8A 3QOXA 1A9TA 1CB0A 4G4GA 4OF4A 3CX4A 5AW3A 4BFXA 1FE8A 1RYHA 5H3LA 2PUAA 3JXEA 4P31A 5AD1A 2H2WA 1TI7A 2VOJA 3LRPA 4GICA 4RH1A 2AOUB 3HA7A 3COVA 3RI3A 5JCJD 2VWGA 2CDNA 2Q5EA 4GX0A 2C5GA 2CFSA 1YZ3A 3IEMA 3K15A 2BM8A 3GUVA 2XXAA 3STUA 1GRCA 3T9FA 3A3YA 5DT9A 4YFVA 3L4JA 3ETCA 2ZS7A 4UXIA 1T1GA 1BDMA 1C50A 2GJ9A 5HOEA 4LSMA 4Q9IA 1ECJA 3T0GA 4BVJA 4JLOA 3ABQB 2C78A 3KBOA 4EO9A 1J0EA 1L7MA 3KOXA 3MMSA 1JFTA 2P6RA 1JA9A 1N3IA 1UQUA 2YINC 1X42A 2F3QA 3RJMA 4BO8A 3JVDA 2OFPA 3LKZA 4TN5A 1U8CB 3STWA 1E4EA 1XTZA 1E92A 1QFXA 3WLLA 2OVFA 1T9BA 2DRIA 5EMHA 4PF1A 3DM9B 3M34A 3E7FA 1Q1ZA 1MOPA 2YN2A 3PFHA 4ARIA 1E96A 3O1JC 4P8RA 3MRSA 1FW8A 1KGSA 2K6GA 5ITVA 5JZ9A 5JRZA 3I6MA 3RNOA 4CQMB 1SVLA 3V32A 4H0CA 1UZLA 2QSZA 3QWIA 2QD4A 1E9CA 1GUDA 5FFFA 4OXIA 2CNDA 1V8OA 1ZN7A 3SKYA 4G2TA 2OD9A 4GNRA 1KTIA 4RYDA 2GCOB 1A9YA 5CLIA 1T9HA 4LXHA 3W5AA 2WU3A 3T5DA 1C80A 2IH5A 1IY2A 1IN4A 4PVDA 1DV1A 2FN7A 3GLKA 3KPYA 4IEFB 4QBFA 1G63A 1DC5A 4M22A 1U8TA 2ZVJA 2BVNA 3W9SA 2F4VB 4JJ7A 3REQB 3R5XA 4PU0A 4NYJR 3K1AB 4R8RA 1LTHR 1T6ZA 1EWRA 3CRZA 3DHEA 3RT9A 1L4HA 4LE0A 1ISMA 1KJWA 1XCLA 1XOIA 3U5TA 2GEUA 1ZGCA 2KJQA 3SQMA 4PX3A 5F9HA 3HKBB 3VSEA 2FX3A 3K53A 3OFKA 4IVNA 4P54A 4X5OA 3TUIC 3O3OB 3N74A 1W85B 4EGCB 1H2AS 1YQEA 2BBSA 1EDDA 5LDHA 4RNDB 2QMUA 4KR6A 1K0FA 3NXSA 3E1SA 1WRBA 4QU5A 3OCYA 2QNRA 4B47A 1NQXA 2XLBA 3QPBA 4A2QA 3PVSA 4QUAA 2QN1A 1Q50A 1R6TA 1PKEA 2FWNA 2WDZA 3BE4A 4FWIB 2DHRA 4TGLA 4DIKA 2C2HA 1JQAA 4Z0PA 4HNVA 4TWZA 4KO3S 3JQ8A 1KPGA 3DB1A 3WK6A 4EHFA 5CFZA 4PLPA 4W5TA 3PA8A 3EGXA 2W2LA 3MTAA 4N8SA 4WXPA 4D9CA 1D6NA 4TWIA 5AMXA 5MFPA 5JADA 2ZT5A 4I4TA 4ZQCB 5KQSA 1T1EA 2JFVA 3S2GA 4BC1A 3L82B 4QOEA 3LPDA 1OPXA 1G3QA 4JL5A 1EDZA 3SR3A 1N33B 3Q1KA 5CDTA 1HE2A 5IJZA 5B55A 3R1IA 4AO8A 2AJBA 3PDUA 1Q15A 3UJ8A 1XN1A 4Y2UA 3ETDA 3INRA 1ZH6A 2ECOA 4BO4A 1CUVA 3E5RA 3WWEA 3FVRA 3QV1A 4KYIB 4G23A 3EGIA 3GNLA 5IEJA 3FFTA 5K6RA 4A9AA 1DUSA 3LW8A 1WSDA 4KAJA 5ALDA 1DTSA 4U3JB 4RU1A 1XTSA 3L43A 2JL1A 2MSEB 1T8UA 4KX5A 3R2JA 4X8HA 1NTRA 3EAQA 5DOZA 1EZ4A 1YQWA 2ZULA 1U6JA 2EKPA 3SIXA 3RADC 1HDOA 2IYOA 3FMVA 3VDXA 2Q7OE 2NU7B 2GYYA 1BX0A 2YXBA 1CQXA 2BGTA 4KZKA 4R3WA 1REQA 4AL4A 5KMGB 4HB0A 4MQUA 1DQYA 1KU0A 3IAEA 3T3EA 1DVRA 1TCVA 4GHWA 1ZIPA 5CX1A 1CJKC 3D2CA 1OMOA 3OJXA 3HUUA 5E3IA 3VPXA 4LZNA 3I3OA 4JLJA 5H7XA 2BV3A 2O50A 3GJSA 3OKCA 3R5KA 4WBXC 5CA1A 1QFJA 1FRFS 3D7SA 1MRZA 4GL4A 5ES4B 1WJGA 2R8EA 2YFYA 3TB4A 1Y33E 1C1YA 1NW8A 3M1YA 2CBZA 2HZBA 1RRFA 2GYVA 2VDNB 5FI1B 4RHTA 4A2PA 2ACWA 3EZFA 5FLEX 5HF8A 3K9NA 2DVMA 2IU6A 3KAQA 3M6MD 2FWMX 5JE8A 3KR9A 3CUEF 3S1LA 1DKQA 3CEJA 4KODA 5JVDB 4YUWA 5BSFA 1QF9A 1S3IA 1VKOA 3UK7A 3KAJA 4AMGA 3V6LA 1G38A 4TM8A 4AUKA 3PJDA 1RWXA 2YX1A 4L0DA 1ZMTA 4RIGA 2DFDA 1KDVA 5BXQC 1TKBA 1WHTA 1XNRB 1XB2A 4YRTA 1BE0A 4PO3X 3W6NA 3ZYCA 5HQJA 3RU3A 3H0KA 3KSAC 2HM7A 1T0UA 2B9VA 1NIPA 3FCYA 1RXUA 5ECWA 3FMIA 4BUZA 2P79A 2YJ5A 4GX5A 5CW2A 1C3LA 4DN6A 2YYYA 1XQWA 1PJ2A 4TXJA 1N5JA 1PJQA 3PGMA 3H5AA 5AK6A 2W2LD 2OKCA 4JQYA 4L8LA 3KT3A 2YS7A 2W4QA 4YMUA 3LAWA 1OZFA 1VCHA 3DCYA 4Q7MB 1WD7A 3OOSA 1IQPA 3BFXA 3R5TA 3O8BA 5E9QA 3SDZA 5JSZB 5B37A 4BGDA 4O2LA 2OBFA 4W9NC 3JTEA 3VV3A 1ZAYA 2I8CA 1IIBA 4H7PA 3OLYA 5DM4A 2OM6A 2C31A 2BCJQ 3KZXA 5SYNA 2FHSA 4AY6A 1ODSA 4L8YA 2QDXA 2WF9A 4ZI2A 4ZAGA 5A7HA 1Z63A 2X8AA 1XTJA 2LWIA 2QGNA 4MVJH 1VBNA 4F72A 1HE3A 4BP1A 2X1MA 1Z4KA 4RDCA 3OURA 4HH4A 1P4RA 4OLJA 3GOHA 2QYHA 1ZM9A 2ANCA 1NR7A 4PLYA 4DR7B 2XH8A 4M9UA 4WGGA 1D4ZA 3ZWPA 4AWXA 4X3CA 4X94A 3PVZA 1AK2A 1VL6A 3TL2A 3W9BA 4TN1A 1NXVA 4WNIA 5EGSA 3KLOA 1VBKA 3OJLA 1TCAA 4FYPA 1YDWA 4NOJA 3ZGOA 4AS1A 2GTPA 4IDBA 5CCDA 3FROA 3WI7A 3NFRA 3TSZA 7REQB 1JDSA 2I8LA 2IOQA 4GF5A 1JPVA 2EDCA 2JFWA 3AHJA 2II6A 3QK7A 5DP2A 2SKDA 2ZQYA 1QGAA 5IC5A 3HV0A 4RHYA 4Z4GA 3FDFA 4IXNA 3W5JA 1Z62A 3G8YA 3MINA 8ABPA 3O26A 4PSUA 3AB3A 2YWXA 2B1JA 2ZYWX 1SHJA 2FE1A 2RGEA 5FKJA 4Z9YA 3HKDA 4KV7A 4D9MA 1I01A 1L5FA 4X90A 1G8PA 4TYQA 1HDIA 2LGJA 1M67A 5E4YA 1E9EA 5JXHA 4R8KA 2G28A 3LXRA 5FTNA 2GJ4A 2YNMC 3ESAA 2IPLA 3IQHX 1T0HB 4UHCA 5AIBA 2N1MA 1C9DB 4KSBA 5BSKA 5IBQA 1BVUA 3WMFA 5HUHA 4D6XA 3GLSA 2OLKA 5KVVA 4ZJZA 1EFVB 4X6XA 1JU9A 4LF8B 1KVSA 1JEEA 521PA 2DCMA 2Q5OA 3Q5GA 3RDPA 3UATA 1Y8RB 2FR8C 2ZIGA 1PHRA 1JT9A 3O8OA 2B98A 2V9CA 3O4JA 5HZMA 1SQ6A 2Q2VA 5LUAA 2JVIA 1A27A 5ALSA 3U3XA 4YCDA 2BMEA 3SF0A 3UHPA 4D46A 1VLQA 4RC9A 1NOIA 3HKEB 1JQDA 2E21A 3CURA 5GVSA 2BAGA 1EE1A 3UUGA 4C0AC 1U1CA 3EEYA 5KCZA 2VP9A 2BZSA 1K63A 3GFOA 3LXXA 5ILGA 2M6KA 621PA 3IP7A 3P26A 4PX2A 1OYYA 2F64A 5A4JA 4BFWA 2Q41A 4XQCA 1FNDA 4YLYA 4MQBA 2W6MA 1Y9JA 1AX9A 1JLHA 1V6CA 1J1IA 3V8QA 2GZHA 5LUBA 1Q11A 4I3GA 2JLSA 3DFFA 2HA5A 1N6OA 4ZGWA 4U5QA 4NZZA 1MA3A 2Z6QA 1WCYA 3VX3A 4QGGA 1X7WA 1P73A 1J9ZA 5LXTB 2FN4A 2XDQB 3B5EA 5BUCA 5EJ5A 2PUEA 3OMWA 2P68A 3DZIA 4OMUA 3T7SA 1WB4A 2Y6UA 5BUQA 1N9GB 3LC1O 4J03A 3IAM6 2CXOA 4WN9A 4AXXA 2EEPA 5CG1A 2GF2A 1Z06A 2F4NA 3KELA 1F1BA 3D3JA 3SZMA 2VQ3A 4WKNA 5CEFA 3GFFA 4A1OA 5KTRA 3HTXA 1L3BA 2PH1A 1LTQA 1ZO8A 1L5OA 1OHHA 4XM1A 1LPPA 1ORIA 3FDZB 2GASA 4G37A 4FKZA 5CK4A 2V98A