2FUCA

Human alpha-phosphomannomutase 1 with mg2+ cofactor bound
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
245
structure length
245
Chain Sequence
b'ERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphomannomutase 1
molecule tags Isomerase
source organism Homo sapiens
publication title The X-ray crystal structures of human alpha-phosphomannomutase 1 reveal the structural basis of congenital disorder of glycosylation type 1a.
pubmed doi rcsb
total genus 87
structure length 245
sequence length 245
ec nomenclature ec 5.4.2.8: Phosphomannomutase.
pdb deposition date 2006-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03332 PMM Eukaryotic phosphomannomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1240.20 Alpha Beta 2-Layer Sandwich Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 Hypothetical Protein, Haloacid Dehalogenase-like Hydrolase; Chain: A; domain 2 2fucA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2fucA01
2YMMA 4UM5A 2FUCA 4JB3A 4BEVA 1U2TA 2ODAA 3QU4A 3SKXA 3E84A 2D2VA 3FZQA 1RKUA 1YJ5A 3UMGA 1Z88A 3F9RA 2C8LA 1SWVA 4UARA 1YV9A 3DV9A 3MN1A 4BX3A 2HF7A 2WHEA 2YMQA 4UAVA 5IT4A 3UM9A 1Z4NA 3I1YA 4QQFA 3SF0A 3W5BA 3SD7A 3OCYA 3TLMA 1Z4QA 5ALGA 1ZJJA 5AIBA 3ZW7A 1ZRNA 2FUEA 3QU2A 3AR9A 4EELA 3A1EA 4IG4A 5A3SA 1ZD5A 3NASA 3WK5A 2ZBFA 3WK8A 4QJBA 2FPRA 3L5KA 4Y2PA 2Q4TA 3U7HB 3L0YA 4FFDA 3PDWA 2B82A 4EZEA 5AVUA 2HOQA 2P69A 2RB5A 1SWWA 3W5AA 2YY6A 4KX5A 4Y2XA 1LVHA 2AGVA 2FPUA 3IJ5A 4KX3A 5AW9A 1RLTA 1U2SA 2EARA 1J97A 2FI1A 2B8EA 3NAMA 2JARA 1L6RA 4FYPA 5AKLA 1Z4OA 4BYGA 4RETA 2WF6A 3KBBA 3ZUPA 5AICA 4YCLA 1TE2A 1Z4IA 2HCFA 1TJ5A 3S6JA 1TJ4A 1ZS9A 1T9ZA 2R8YA 5AI0A 4HGPA 1NF2A 1VJRA 2X4DA 2CFRA 3KC2A 2JAOA 2NYVA 2W4MA 2OA0A 3U26A 1Q91A 4XPZA 1SU4A 3L8HA 5AM5A 3UMBA 3WKEA 4KNVA 2I7DA 4FE3A 4Y2YA 2ZXEA 3OCWA 5E0OA 4UW9A 3U7EB 2Q4RA 3PGLA 2ZBDA 3W5DA 1Q92A 4HAIA 2JGAA 1L8LA 1QH9A 1RMTA 3ZU6A 3N07A 2HHLA 2FPSA 4YH1A 1TA0A 4OCZA 5ALPA 1YMQA 1WZCA 2AUTA 4J2TA 5AW8A 3B9RA 1U7OA 1WPGA 5ALFA 4UAUA 5ALOA 1F5SA 4Y2RA 3ZX4A 4UATA 1Z5UA 5ALVA 2AH5A 3PGVA 4L6CA 5AKIA 2EAUA 4XOUA 4G9BA 3ZWDA 2R8ZA 5AW3A 2BDUA 4BNDA 4IFTA 2O9JA 5AK4A 3ZVNA 2YMPA 4C4RA 1QQ7A 4BKMA 1S8OA 4Y3UA 5AM0A 2W11A 4BNDB 1EK1A 1O03A 1YS9A 3IB6A 3QU7A 5AKHA 2G1AA 3RF6A 3OPXA 4L57A 1RMYA 1U02A 3E8MA 2IOFK 5AKXA 4OFZA 1RLOA 3L1UA 3SHQA 3N5KA 3ZX5A 3ESQA 1K1EA 4E88A 2PR7A 4PNHA 4UASA 5AESA 1N9KA 4Y2TA 5AW6A 3U7GA 1XPJA 5FP0A 2YJ3A 3I76A 3L7YA 3MC1A 1Z4PX 4F71A 4DFDA 2CFSA 1T5TA 5IT0A 2RARA 2CFTA 3A1DA 4GIBA 2B1RA 4YCNA 4GXTA 3DDHA 5ALUA 4UU0A 5ALWA 4CF5A 3E58A 4Y2SA 3DNPA 2QYHA 4KN8A 2B8JA 2IYEA 4DW8A 1S2OA 4OD0A 4C4SA 3OCZA 2AMYA 1RLMA 3QU9A 5AVRA 3R9KA 1KYTA 4HYTA 1ZD3A 1RRCA 4NWIA 5AW2A 2HDOA 1QQ6A 5ALLA 1AQ6A 4F72A 1JUDA 3QLEA 4BX2A 1L7NA 4Y2UA 2HEGA 2Q5EA 4NFLA 3ED5A 1XP5A 1N8NA 1RMQA 4G63A 5AIAA 4J03A 1J8DA 3UMCA 4NAVA 5AVYA 3I28A 5AM1A 5T41A 1RKVA 3AR8A 2GFHA 2HI0A 5AK5A 3OCXA 2CN1A 2BY4A 3P96A 3ET5A 3NIWA 4YIHA 2G08A 2P27A 3ZTWA 2WF8A 2BDEA 3DAOA 1WR8A 4RESA 5ALRA 3BWVA 4O8CA 5AM3A 1Z4LA 5AW4A 1U7PA 3NANA 2C4NA 3L0CA 1RKQA 2ZOSA 5A3QA 1O08A 2OBBA 2IOHA 1MH9A 2I33A 2HSZA 2G07A 3ET4A 3J7TA 3QUQA 3U19A 4HGRA 1YDFA 5AKKA 3QYPA 2NO4A 4UM7A 4NV0A 2RAVA 3FPSA 4YGYA 3AR2A 3EPRA 3L1VA 1XVIA 2G0AA 3WKDA 3ZVLA 2IOFA 4UMDA 3K1ZA 2I34A 2GHTA 3RFUA 2MU1A 2C9MA 5AI9A 5AK3A 5AVXA 1Z5GA 2I55A 1WVIA 4OHFA 1QQ5A 3R09A 2GHQA 2OM6A 2YBDA 5AW0A 1VFPA 5ALDA 3OCVA 1T5SA 2YJ6A 4H1WA 2ZG6A 3NRJA 2B1QA 2YJ5A 3U13A 3SKYA 4YCMA 1EK2A 1TJ3A 5AW1A 1NNLA 3ONNA 2FPXA 1L7PA 4MUMA 5AM4A 1PW5A 3NUQA 2GO7A 3L8FA 4XQ0A 2ZBGA 5ALMA 3E81A 4UMEA 5ALKA 5ALYA 3QUCA 4YIKA 3CNHA 2JAUA 2R8XA 2C88A 3WK7A 3I6BA 4UU1A 3N1UA 3A1CA 4CE6A 5AW7A 1CQZA 3KZXA 4CNQA 1QYIA 1NRWA 3L8EA 1ZRMA 2C8KA 1X42A 2PQ0A 3FM9A 1Z4MA 4HGNA 3ZVMA 4C4TA 4ZEVA 3KDPA 2G06A 2YN4A 4BX0A 2B30A 2G09A 3AR6A 3OTQA 2O2XA 5AVQA 1VJ5A 2VKQA 3MMZA 1RQLA 2OYCA 3WKCA 1Z4JA 2FPWA 5AHXA 2P11A 4KNWA 4I9GA 3AR7A 5ALEA 1ZD4A 3GYGA 4MWOA 2RBKA 3B9BA 3N8GA 5ALIA 3SMVA 5AVSA 4HGOA 3WGVA 3N28A 4UMVA 5AW5A 3WK9A 5ALXA 3WGUA 3BA6A 3WK4A 5ALHA 3B8EA 4NABA 1L7MA 2HO4A 5JJBA 3KOOA 3ZI4A 2I6XA 5AVWA 2FEAA 2IA5A 3QGMA 2P9JA 1Y8AA 4ZEWA 5AVTA 3VAYA 3L0BA 3R4CA 1FEZA 4Y2QA 3QXGA 3WKAA 2R8EA 5AKGA 3EF0A 1RPZA 4Y2JA 1L8OA 4EX7A 5ALJA 2YFYA 5ALZA 5AM2A 2GMWA 3ESRA 2HF2A 3WK6A 2WM8A 4XE5A 1ZOLA 4CF3A 2NO5A 2YMLA 3D6JA 1LTQA 3NALA 4Y2VA 3QUBA 4EEKA 5AVZA 3WKBA 4B6JA 3EF1A 2WFAA 5ALTA 3M1YA 4ZEXA 4EENA 5ALQA 5AI5A 4UMFA 5AK6A 4DWOA 4AP9A 2W43A 2PKEA 5AI4A 3FVVA 4I9FA 5AI8A 3QU5A 2MSNA 3EWIA 1CR6A 1RDFA 2G80A 4EX6A 2HX1A 4AS3A 1ZD2P 5AKEA 2WF9A 5AKZA 2I54A 5ALNA 3W5CA 2YJ4A 3ZTYA 3HYCA 3CZ4A 1RQNA 3HLTA 3QUTA 3L8GA 2ZBEA 5IS2A 1RC8A 4BBJA 5AKYA 3U7FB 2B0CA 2QLTA 3MPOA 5AVVA 2DQSA 1IWOA 5ALSA 3KD3A 3M9LA 3A3YA 1L7OA 2WF7A 3FPBA 1YNSA 3QNMA 4KYTA 3IRUA 2EATA 4L6AA 2WF5A 3AR4A 3AR5A 4CF4A 2JAWA 5A3RA 3ZWKA 4DCCA 2FDRA 3QX7A 5AKJA 1Z4KA 3AR3A 4AS2A 4HGQA 3SLRA 3PCTA 5AI6A 3OCUA 4BEWA 3FGOA 4JDPA
chains in the Genus database with same CATH superfamily
4QBGB 4KBFA 4B3XA 1DUSA 1YQWA 3M33A 2GQ0A 4I6JA 1JTEA 2PEYA 2QVBA 1YQQA 1XL1A 4PC7A 4BRSA 5DHPA 3KRTA 4WLEA 4MPPA 4MP8A 4XYEA 5JSUA 2V0GA 1RI2A 3JATA 3ZXYA 2R79A 4GX1A 2R8BA 5AP9A 4YRSA 2CKMA 1AHHA 5KTKA 3JZDA 1FUEA 2C4KA 4ZCPA 2HF7A 3D1VA 3IEUA 2YMQA 3LZ6A 4PPFA 3FNHA 5F1KA 5A71A 5JAPA 3U61B 1OIVA 4Z1MA 3T9CA 4NJEB 1QWOA 1R6BX 2XXAB 2P35A 1QIHA 1BGVA 1ZEMA 4MEAA 1CIVA 3KXKA 3QOXA 4WXMA 4YN3A 1Z6XA 2F1HA 2RHMA 4UNRA 4X1YB 1E62A 1N6HA 2AA3A 4IDHA 3JAWB 3KZNA 5JCPA 1QHNA 3P26A 5CFZA 1SURA 3THWB 1R18A 4QVIA 5KYNA 5IJAA 3QTBA 5FTNA 4R54A 2R8RA 4LJRA 5TMDA 4O2AB 1WUKS 2V7WA 4TSFA 4US1R 5K8CA 1PR6A 1XDGA 2XTJA 5ELXA 2WV9A 1E2PA 1QKIA 2FI1A 2PFSA 3O95A 1ETUA 3NAMA 2IEBA 4UE2A 1KMMA 3M1IA 4Q9AA 5F76A 4BLPA 4UU8A 3SYRA 3KFLA 2EZTA 2YWJA 2VP5A 2ES4A 4OH1A 4AY6A 2Q6TA 3CZCA 3O03A 1NVUQ 4BFZA 3W9BA 1OW3B 1CUYA 2HW8A 4LRUA 3CUSA 1D03A 2HK8A 2O0KA 4G5SA 5FBWB 1MXFA 3GEBA 5EIHA 1JHQA 1WCYA 1Q7RA 4IHJB 2R6GA 4H6VA 2V1UA 4RFSA 3FB1A 2IEYA 4MTLA 5HBGA 2IYTA 2ZZKA 3FRHA 1FVXA 1V96A 1YOBA 1M6EX 3F9IA 4Y6LA 4CDNA 1BWRA 1K66A 2PU5A 2R3SA 2CFRA 3MWJA 2HXSA 4PCVA 3WLRA 4ZCTA 2PZKA 4B73A 3KUDA 5CM9C 5FI3A 5FLXA 2VYND 5BYJA 3LQRA 3V2UA 4BZWA 4KRFA 4TMXA 3PQCA 4MVJD 3QFFA 4HXYA 1UBRS 4PR0A 4G81A 1ZVMA 3P2EA 5U4QA 4ZYYA 4B3SB 2BISA 1CDZA 4D9CA 1S8AA 2I0FA 3PNYA 5FL7A 1E0SA 4WE3A 3FPFA 1W94A 3ABZA 4RZHA 2HADA 2OHIA 5JAOA 3PGLA 4ISCA 3I1IA 3W5DA 1ENPA 2PQ6A 3R3HA 2VBGA 2VSYA 4YRZA 4M46A 1ZN9A 3PTZA 2IP1A 2C2HA 2PKQO 1DIRA 2IRWA 4X61A 1TA0A 2PHZA 2Q2OA 1FRQA 1UM9A 2BZGA 4MUYA 3PKIA 1LJUA 3SFZA 4BO5A 1IY9A 4M0PA 4F93B 2HB6A 4HH0A 2H1OA 3TS1A 1X1EA 3TSCA 1UFRA 1Z7YA 1YQTA 3FFWA 1C1XA 1UJ4A 2V3VA 3HJCA 3M4XA 4DVJA 4KQJA 1UMCB 2ZIGA 5I8ZA 5JVDA 1YB6A 4B2IA 3B9RA 2PUDA 3KU4A 1LLUA 1SO8A 4GP7A 4IIXA 1EVYA 4D7AA 4Q4JA 3IUPA 2IYAA 1P0PA 3PJRA 4ZOLF 2B7CA 1AQNA 2VRCA 3V00A 2GD1O 1OT3A 3GJ8A 5J23A 2DLCX 5DTMA 1A5BB 4O2RA 3EA4A 2Z2YA 4XM1A 1RJWA 2XHZA 1YOVA 4LN1A 4BO8A 2QOEA 2Q8PA 3U4QB 4BWGA 1ZJWA 1FQKA 1WDTA 4HQKA 4HXGA 5DXAA 1TM4E 5JBIA 2PZAA 3AEQA 3PDUA 5HIIA 3UB2A 4WZAA 2C5SA 3KYCB 1MAUA 1VMKA 2F3SA 4ARBA 4R8LA 5EWMB 1OX5A 3NEYA 4MQFA 5AM0A 3EGEA 5I45A 5AXCA 1HLGA 3DCIA 1D1TA 3Q72A 4PYJA 4BTLA 4MLPA 5E4TA 5BMVB 1EHYA 3ZY3A 1Y8RA 4TN1A 1Q15A 4LWZA 3C6BA 1A9SA 2V54A 2ZP1A 1XJCA 1U02A 3E8MA 5IKMA 1REQB 2VPXA 3RQIA 4KFSA 2NU9B 2QE7A 1IK6A 1YB2A 3GJ6A 3KX2A 3ZDBA 3L0IB 2WRZA 4NBTA 5L9AA 3EVFA 3M2PA 4J1TC 3R3XA 4JT2A 4YJ2B 1A5SB 1N9KA 2YKGA 4DA8A 2VQ3A 3E3OA 5G0VA 1IAQA 1QAQA 1ZSYA 2C2MA 3NQ41 4GZMA 4R6XA 4F11A 4IZ6A 2XRMA 1QH8B 4WGGA 3DL4A 1XEXB 1VG0B 4JC8A 1JAIA 1ELOA 3UK0A 1V6AA 2Z9DA 2I4LA 4F1JA 4ZVOA 3T9EA 3NXSA 4HWKA 1L3IA 3QVKA 4I4TF 2JGKA 1ODSA 2OGSA 1BFDA 2VF4X 2ZROA 5GGYA 5HF8A 1T8YA 2NU8A 5IJ0A 2YWGA 3RB8A 1YBAA 2P2SA 2CFTA 5HTKA 4DV7B 1JP7A 5B5SA 3C48A 2EW2A 5KVQA 1ES9A 4DGSA 4MB6A 3MGBA 4H17A 1DT3A 1ZIOA 1DOZA 3L6BA 4J1SA 4W1SA 1PTJA 3NTXA 4HGYA 4HQOA 5EJIA 5FI5A 1AUQA 3VYRB 1G9SA 4OD0A 4OM7A 3DHEA 1DJMA 3AERA 2XXAA 1JN0A 3LYAA 1VZ3A 1AMUA 2QU7A 4D81A 2C4WA 3TOSA 3SC6A 3A9UA 1T0BA 2JFOA 2ZTMA 3R9KA 2WNIA 3O1JC 3TG2A 3THXB 2EJBA 1ANKA 3EVDA 1Z8NA 1Z9BA 3OZIA 3Q3CA 3C7TA 1IBRA 3KEGA 3L1HA 1UPBA 3FZNA 2Y6UA 3N8DA 1ECJA 1P0MA 3QKRA 2L82A 4FXPA 4K7JA 1MJ5A 5CITA 4W1QA 4ARIA 1RJ9B 4LF9B 5ALLA 4KV9A 1L4LA 2WG1A 4Y6PA 5JCOC 2FMTA 1USVA 5GZ6A 2QA5A 3DZCA 3CNBA 1Y48E 3IUNA 3SY8A 4Y2UA 4DT1B 4F4JA 2VHQA 4H4EA 4G63A 4URXR 4MPDA 4O2LA 2ISQA 1VL5A 4Z8YA 4Z9FA 5CW2A 3I28A 1CEEA 2PRIA 1JSXA 4IWXA 4W6ZA 2FP3A 2YHIB 3KJNA 3WRXA 3KEFA 2R62A 4H7KA 4JI8B 2BKXA 3Q41A 2D1SA 3A2LA 3D8NA 2JVKA 3ANXA 3HXPA 1GZVA 4YMSA 3WB1A 1X1SA 2BY4A 1OIXA 3R4VA 5DP1A 3E5MA 5JD3A 2B94A 3ET5A 4M9CA 5IARA 1N8KA 4LAFA 5JNTA 1BCRA 2G08A 4KXVA 3DDCA 1MCZA 4Z4FA 4IYRA 3Q5DA 2QDKA 5ALRA 3W4IA 4R1OA 2ZBQA 4YRQA 4ZVNA 2OO5A 5FEMA 5BOSB 4KO1S 2J3IA 1I2AA 1Y3HA 4JSYA 1T4BA 1Z73A 4QREA 1XC7A 3L7CA 3EFOA 3FOCA 3NO4A 3T38A 3V1UA 3VDNB 5AHWA 5HX7A 1HM5A 4ZODA 2Q99A 4BKPA 5CLJA 3DDZX 2OBXA 1DIGA 6REQA 1EWRA 2QTHA 4B3DA 4N8DA 1XMVA 3NBAA 1KFCB 3KJXA 1SZCA 2NYAA 1XTBA 5AKKA 3PU6A 3KT0A 3Q9UA 1BQEA 2C3MA 3QYPA 4P0TA 4PYNA 2QTVA 4BWVA 3DJYA 2QGZA 2CV2A 1DEAA 3EVTA 1XVIA 1W8IA 1ZH4A 3A4NA 4B47A 4WA8A 1VL2A 2H92A 4FHGA 4F3TA 1H2ZA 2WWVD 1DARA 1WU7A 2VZ9A 2X9LA 4OHVA 3ASVA 3IQEA 3N2EA 4CCAA 5AVXA 3QIAA 4UUBA 1OI4A 3RVRA 1VBNA 4F12A 4Z7NB 4UTZA 3V9AA 2R6JA 2GILA 4IGFA 3L06A 3NTRA 5HIMA 5CA0F 5JFTA 1SC1A 5AW0A 1OLOA 2O3RA 4YUYA 4Z4CA 4DUZB 2HY7A 4G5YA 3WWEA 2F9FA 3ZQKA 2D2XA 3IBCA 2O8DA 3F4LA 4JBYA 2C42A 1W5EA 3SKYA 4D3SA 1EK2A 4OFWA 4POAA 4PQYA 4N5MA 4RPJA 3UBTA 1ORDA 4H1HA 3JVDA 5K2OA 4C4XA 2VNJA 3ER6A 3SJ7A 1F0YA 3NUQA 3VKHA 4OQQA 5GONA 4E2XA 4F9FA 2HWUA 4Q3KA 1M10A 4AZ0A 1JG1A 2PLWA 4TM7A 5E4YA 1RQ7A 5ITZB 3CNHA 1ONBA 4JFAA 3EN0A 2W6PA 1RXYA 4BVAA 2P2ZA 1E4YA 1UWCA 2QM3A 3EEFA 3U3DA 2PS1A 4MWZA 2DC1A 3E4DA 4QELA 4D3FA 3OF5A 3IUBA 5D86A 1VJ0A 1KDOA 1AIPA 1M6WA 4MYTA 5JR3A 3PKZA 1FYWA 1GILA 2O14A 1PNVA 1Q3TA 4BOYA 5CFNA 3ASYA 3PNSA 4UFNA 3KJHA 1J8YF 2BGIA 3I37X 1U8ZA 5F3DA 4KOEC 3JAWA 1OFUX 2PXXA 3HEBA 5H5JA 3CWCA 3G9QA 4D8VA 3TR5A 2M2IA 1BG6A 1IYZA 1OJLA 2OCKA 2NT3A 2RK6A 2C00A 3D02A 1ENZA 4PSKA 3OE7A 3MTDA 3K9QO 3MRVA 1QFJA 3FPAA 4P83A 2BUBA 3L4SO 4BO9A 2RAUA 1N34B 4QRIA 3PPVA 1RAIA 2HMAA 3VFDA 2C77A 3HBFA 1DOHA 2AN5A 3MMZA 4KCGA 4EG7A 1PHRA 1RQLA 2EG5A 3ZHRA 1ZN2A 4KV7A 4GLJA 4JS0A 4NICA 5L3VA 4BL5A 3IAS6 3MGKA 2I6FA 2X0JA 1GPKA 1QOZA 2L19A 4P7BA 4KNWA 3EMDA 4I1YA 4BMCA 1FDWA 4JWKA 3MJRA 3W8FA 4R9NA 3KQUA 3OFND 3EBPA 1EM8B 3KEOA 4F5WA 1XCMA 3MELA 4D8TA 2DLDA 1MHTA 2D0IA 4KYIB 4GBMA 3O8QB 3BA6A 2JIMA 1NRJB 3HNPA 3JASB 5BN5B 1N4DA 5LWQA 3TF5A 1L5LA 3FSGD 2O2EA 3I32A 2F43A 4I50F 5FO0A 1ZUHA 3AC0A 2X5OA 1UC9A 3O5AA 4IO1A 3GEDA 1W44A 3RTBA 1MTZA 3QIVA 1DV2A 4WESA 4FD2A 1OC2A 1J2UA 3NUGA 1I6WA 1FB5A 3G2NA 4GQBA 3VAYA 2F1JA 1TC2A 2FRXA 2DFPA 3MTGA 3PDIA 4IF6A 2FEMA 5DTJA 1CQJA 3IALA 3IE1A 3IDZA 5A02A 4ZO6A 1PNOA 5ICGA 1U7HA 3AXSA 1US8A 3IBSA 4GM0A 3BTSA 4QTXA 2PR2A 4Y2JA 3K05A 4BBZA 4BVBA 5IANA 5FT9A 1TLLA 2JFBA 1JJIA 2NUPB 2YNMA 3VOBA 2X42A 4EO9A 1X9IA 2PX6A 1W1UA 3MTEA 1MVNA 4XQGA 2ZCJA 5GJCA 2Q0HA 3CX4A 3D6FA 3LCRA 4BB5A 1J39A 1J00A 1LD3A 1CU1A 3C4QA 3K9WA 3LDAA 4G0XA 2DRIA 1NJ2A 3TIFA 3LBHA 4G1CA 4MGEA 2ZWVA 2XWQA 3E15A 3CPSA 4S2UA 3RT7A 2H1FA 3Q85A 1IMOA 3GRKA 2HU5A 1Z5ZA 5EMNA 1KZHA 3FPHA 3GLQA 1U28C 1WETA 1BRTA 2H9IA 1LXCA 3OESA 1Z47A 4RCZA 1KXZA 4P34A 1OZFA 5FLKA 5C1IA 5AK6A 2KS6A 2I6GA 2GZSA 1FXWF 1N5KA 3WBJA 5DN9A 1JWLA 5FULA 9LDBA 4J90A 4EMTA 4C4AA 1V9CA 2HPHA 3WHPA 2EQ5A 2MSNA 3EWIA 4P92A 3V7YA 5I9LA 2ZSJA 3J81A 4PLTA 1OVMA 4B83A 2XVMA 3ND9A 4IPTA 1IHXA 1HYGA 1I01A 4UPEA 1FJGB 1GOTA 3H18A 4FZ5A 4R1SA 3KG2A 3TW0A 2PKWA 1CERA 1RAGA 1E6CA 1V11A 3N8KA 4QQ8A 4TMTA 1FTWA 3V3KA 3U4QA 4UNQA 5EQDA 3SFVA 4W7HA 1M5TA 3IBGA 3TRKA 1PFKA 5LQAA 4X6UA 4NI5A 4PZLA 1COZA 1S4QA 1E6WA 3O93A 2MR5A 1U2ZA 4V0KA 2QRLA 1LB1B 5KNBH 1N5IA 4HNTA 1KZ4A 1ZUNA 1PV4A 1XZGA 3KDSE 1KOJA 3SS8A 2EFGA 1LPOA 3G82C 2HHCA 3QWIA 1YRLA 1P8AA 2B21A 1FDRA 3E9EA 4GP9A 3HYCA 3AHGA 3QKTA 4NHOA 4OBEA 4WX2B 5E95A 1WBBA 2R00C 4HDNB 4NL4H 3AJAA 2RGBA 2YCLA 3QX9A 3RJ9A 3ILXA 1P0FA 3O2SB 1A8PA 1YAJA 2NZXA 3HLYA 5JROA 3IMGA 3HABA 1NI3A 1LWOA 2PBFA 3CX7A 3DXYA 1TM7E 2HSDA 2QNRA 3AF2A 3M2TA 2WA1A 3LVQE 5ADWA 1GLNA 3BE8A 3RBAA 2HF8A 1C0IA 4NEHB 1SKYB 2ZUVA 3CX6A 5B37A 4RPGA 5CFOA 1NC3A 3A4VA 3ZGLA 3VAZA 2BKVA 3QMVA 5GIPE 2P30A 3GRYA 4WZBB 2O1WA 4PYIA 4XJVA 1VSBA 4LPSA 2O6HA 3HFSA 4OOFA 1QTIA 3T34A 4CM3A 4XUGB 5IP5A 4FOPA 4PXYA 4DEVA 4AS2A 1G41A 3IIKA 4TLLB 2ACWA 4QJ4A 1CZOA 3GBPA 2F55A 1Z2PX 4HVTA 4C29A 4GRIA 2OM2A 1SU7A 2YNMC 2HIGA 1QYXA 1QJ4A 4C7XA 1YRBA 4LEIA 1UDXA 4J4BA 2ECFA 3DOHA 3WGMA 2OBFA 1O87A 1E3WB 1N7JA 2VNHA 2D0PB 3AILA 4JB3A 4TZTA 4BE9A 1LPNA 2QP4A 2QENA 2YX1A 4KPGA 4H0CA 4MMYB 3TG8A 3QELB 3FUXA 2PWYA 2QQ0A 3QLUA 4B2YA 1SUSA 1U3DA 3DL2A 4JYCA 1F60A 1ZP6A 1MT0A 3SVZA 3NBZC 3R0XA 1X7YA 4RFLA 2A35A 4RVSA 1CP3A 5EZ5A 4BIMA 5BVHA 4KFCA 1J22A 3N2GB 3EF3A 1NN1A 3DJFA 4DQUA 2W6OA 3MN1A 2X5NA 2D6FA 2WMNB 1IB6A 3FOBA 3B6EA 2W8ZA 4J0IA 4KGXA 1DX4A 4GOND 3DYBA 1A50B 1KSHA 4LXGA 4RZ2A 1H8HA 4MARA 4QU0A 4C04A 4F4IA 2QTTA 3RIYA 2FG7C 2CCJA 4MKRA 4OF4A 4HOYA 4F9GA 1Z45A 2HA3A 1ZKMA 4LXXA 4WOBA 4BNMA 3WL4A 2VTKA 1OBOA 5SY4A 3N8NA 4XUEA 4HCJA 2DEUA 4LI3X 1AQUA 2WYIA 1R64A 1JDSA 2VT3A 3A1EA 5DHUA 5TT1A 3TLBA 4EFMA 2Q4TA 4OAOA 1VYVA 1PD0A 3OPMA 1PJZA 1ZRSA 1E77A 4MUHA 3O8LA 2PZBA 3N2YA 2ARKA 5H59A 3LYLA 1W5TA 4FFWA 3LY7A 2ZRGA 4IIJA 4TS9A 4KWTA 4BLRA 3EZ6A 3I72A 4LDPA 4HDKA 1VFNA 1TTQB 1RLTA 4IXTA 1G59A 2AEFA 3SDZA 3GW8A 3LECA 1W0KA 2FHPA 2XW6A 4J16A 3ZNQA 3ZHSA 1OZAA 3T1VA 4A23A 4CU5A 4DOMA 1C8BA 3S29A 1Y1RA 1SMKA 2G83A 2I4NA 1IDN1 2JIQA 1SC6A 2GBGA 1XCLA 2CMFA 4NMWA 4NZNA 4LMBA 2QD5A 4ZHQF 2XUPA 1GKLA 4BNJA 4ER0A 4HX9A 4I6EA 3WZ2A 3PC7A 2Q4EA 3H6GA 5F2OA 3GEPA 1H2HA 1XQ1A 3VO9A 4B34A 5AI0A 4LOAA 2P9QA 3DBVO 3DBOB 3EVNA 3OM1A 2MSLA 4P3XA 1Q95A 2X5JO 3M4ZA 2Q2WA 3OF2A 4MK4A 3M1AA 2YZGA 4H7IA 1FVHA 2ZYAA 4TWAA 4URYR 5B4TA 2X1LA 3RH0A 2JFQA 2Q5QA 1KYVA 3C3JA 3GXBA 2HWWA 4PWZA 3QPUA 1NP7A 2A5FA 1TCVA 2J46A 1VIDA 3UJ9A 2IXEA 3QE3A 4C0HA 3U26A 2FQQA 1EDDA 2ZULA 5EJ2A 1ML3A 1XQYA 5IYZA 2CVPA 3PIIA 3IP1A 5EFZA 2C7QA 1U0SY 1LTKA 3NT5A 3OZBA 3Q88A 4FYVA 2FW6A 3BSSA 4IILA 4ND5A 3X1MA 5IABA 3P52A 2YN2A 2ZSKA 4PBRA 4WUTA 4Y2YA 2Q1SA 4X8MA 3IERA 3D6MA 3FSJX 4DQDA 4EZIA 3BBLA 1J0AA 4FONA 4HLUC 4IOJA 1LV8A 4F97A 2ZIUB 3HVKA 3GJTA 2A0FA 3QVVA 5FOXA 5GVRA 3GMTA 4EG3A 1K6JA 1JG3A 1KNXA 3RUCA 5AXBA 2B2CA 2FK7A 3N05A 4RE6A 2VJNA 4FCTA 1WZCA 2OZKA 3LDFA 1YONA 1MX3A 3RABA 2XMGA 3VTAA 3B6KA 2PNJA 3BK7A 5GONB 3QH4A 4N54A 4QUGA 2YW2A 3T61A 1T9BA 2ZIEA 3FNBA 4QU8A 1E63A 4E51A 4ZTBA 4DNPA 1JJAA 3ZQ4A 5JQGA 4HXEB 1KI8A 3ADOA 3GAMA 2WTEA 2BMFA 5JLAA 2R2GA 1BJRE 5EIXA 4CLOA 2LKCA 4F45A 4B75A 3H9QA 2ZSEA 3ZEAA 4Q3DA 3HCEA 3AINA 2I2CA 1G7CA 4Q93A 3OBBA 4FNOA 4HNAA 1MV8A 3UCEA 1BS1A 3TLXA 3GLRA 2ZRPA 1ZONA 3KBOA 3L0PA 4NZ9A 2GPTA 1U2DC 1NJSA 4EB8A 3AWIA 2X22A 4F6RB 1PR2A 4MV7A 2QR3A 1HURA 1TO1E 2H07A 2Q5IA 4A6XA 1IUNA 3G23A 3OEEA 1IN1A 3TRFA 4DR1B 4X7MA 4E7OA 1BHO1 3T52A 2QN1A 4LVOA 3F3MA 1G6OA 2MSEB 3P9XA 4M0DA 4P7FA 5CA1B 1II8B 1H3FA 3DOUA 4QJIA 3KTOA 2G7MC 4IZIA 1TAUA 3K2BA 4AY4A 4E88A 3BSYA 4JYAB 3WI7A 3E18A 3OOJA 1GFIA 1QQTA 3H99A 4XAQA 121PA 5JCOA 4AJOA 4FB5A 5K03A 4GXNA 3WNZA 5AW6A 1R3UA 3KJFA 3WFJA 2I99A 3C4VA 2WTXA 3OT4A 1RXEA 1E2LA 3IAXA 5ER9A 2GBCA 1XQWA 3NWJA 4X63A 3VR6H 3TAUA 4LRSB 1T5HX 4Q37A 1KDZA 2VPTA 3F6PA 3FMVA 3IJEB 5EKSA 1EBBA 3DCNA 2R5FA 4GIBA 4AMGA 1NBMA 4ZOQI 2MYUA 5NLLA 1R5NA 1JLMA 1A7AA 2OB2A 2ZJ5A 4UU0A 2ORED 5LBIA 2O59A 3FBWA 3E58A 5DI3A 1SRRA 3W6OA 2QYHA 4GU5A 1JEJA 4DA6A 1NN3A 3BB4A 3Q2OA 4K3VA 1RVDA 1B8PA 4P58A 4R5HA 3TTYA 13PKA 4M2LA 2KLBA 3L6RA 2N47A 4H59A 4MKZA 2CUKA 2UXDB 1GLGA 2P79A 1LNQA 1I1QB 4G5XA 1RLMA 2JJQA 2Y93A 4WECA 1J2TA 4G84A 4COKA 1V5GA 2DQ4A 1IQ0A 1IEVA 2GEVA 4KIWA 4QQKA 5D1NA 2O8BB 3GWZA 4HDQB 1QC5B 4LNHA 3T6KA 1LK0A 4CKWB 1H8HD 4YAEA 1K7CA 3PUHA 3N53A 4FC7A 1CLUA 2CDRA 4PVDA 3PXEA 1BXGB 2VK4A 3HJNA 1XQ9A 3CEHA 4DLUA 4LTNA 1ATIA 5JDCA 3QFSA 1D3AA 1LF5A 3LT0A 3TMKA 4JX8A 2GEJA 1UK8A 1XP5A 3RC2A 2RH9B 4OHMA 4MXDA 3HJRA 2QVLA 2PA3A 2N0SA 1TKRA 5CH8A 2BEKA 2BR4A 3AR8A 2L18A 1SK8A 1KEEA 4CMJA 1C9MA 2H0RA 1NW4A 3O1HB 2EX1A 2QXYA 2XCIA 3N2IA 2G5GX 1O96A 3IEVA 2ONZA 2X0NA 2D8MA 2I76A 3B70A 3I53A 5A6SB 1WDWB 4DIMA 1Z0AA 1NUAA 4LV5B 3REGA 4YR9A 1YA6A 1EXDA 3NLLA 2NTVA 1LBIA 2VDOB 4ZI5A 3OAAD 1F5NA 5AJTA 4EHIA 1MAAA 3GMIA 4CETA 3T99A 1ORHA 2PGDA 4DLZA 2O0JA 4UUQA 1N9ZA 1A9OA 3LYUA 1QFYA 3FCSB 1OSNA 1WXWA 1W85B 3HACA 2N42A 1A8HA 3QPVA 2E4XA 5J2TA 1KTIA 1P81A 3G13A 3FPSA 4BNLA 4I9UA 5E2IA 2QLNA 3CRMA 5IC5A 3R3SA 2DHCA 1V37A 3WFZA 1OKKD 2Z57A 2I34A 4WXPA 3PXAA 4BPRA 1WB9A 4PCAA 3FNEA 4O4IB 1U7XA 4EEZA 4S3MA 2NAFA 1C7FA 2H6EA 2MU1A 4DIFA 2JLXA 2DMRA 5FPSA 3NOXA 3UWOA 4B8YA 1BD3A 4YP7A 5CT8A 1E2HA 2JGMA 2W42A 4MI9A 3CKYA 3MJVA 2FPKA 1AVTA 1DHTA 4FX2A 5DU2A 3D8SA 2J9RA 2OM6A 4DRXB 5DNEA 5DYYA 3CBQA 1IJKA 3R7WA 4YJ3A 2PL3A 3QVGB 2MTBA 3LWDA 2YHBA 1DG9A 3PFFA 4C76A 1H6CA 2H1CA 4R7GA 2O05A 3IH5A 4NFSA 1PG0A 2PRZA 4JHLA 5KAPA 3U13A 1E9DA 5I4BA 1ZY2A 1LVGA 3VU8A 3FOEC 1GFWA 5BWCA 1J2YA 2FFJA 2FWJA 3EH2A 4DDVA 3BMNA 4XJXA 3H5RA 3LWZA 1CUUA 1QCZA 5C2JB 4D26A 2VG8A 2CMKA 2WFMA 1P9LA 2EWWA 2CHFA 3PA6A 4K03A 3OH8A 3KR0A 4JUDX 4C2UA 2LPMA 2JH3A 2GEBA 4E32A 2OP1A 5E1OA 1F0KA 1R50A 3CYFA 4NFYA 3WLNA 3X44A 4D25A 1T2CA 3HG7A 3OWHA 5IJWA 3OP4A 3I6BA 3IT3A 4BV9A 3A1CA 3HJGA 2F00A 5AOAA 3EZ9A 4F3YA 1UXOA 1TQDA 4EA9A 3KHTA 1QX3A 3GZNB 1MO3A 4ND1A 1CZKA 1A2OA 1G98A 2Q4DA 3DYVA 4F6RA 2NU6A 2X3FA 3TIGA 3C43A 2V3WA 3A32A 3THWA 2ORYA 2UZ0A 4OKNA 2P2LA 2QJRA 1DJLA 3STVA 4KN9S 5DYWA 4YPFA 1VLLA 1G5FA 2QXTA 5L3RA 4RLSA 3ZI0A 3WSVA 2GTPA 3CZRA 3L6EA 4J0JA 4WY5A 4OHBA 3PT5A 2IHYA 3RC7A 3V55A 2A9VA 1JIJA 1JA0A 1L4UA 2I03A 1ZVVA 4IDBA 3CU5A 1U3VA 1UBJS 1NN0A 1XXHE 1CUFA 2CCKA 3BHMA 3HO8A 4Z9XA 1SA0A 2GD2A 1XHLA 3MCAA 4DCJA 5FOSA 1Q1BA 2AZXA 4IEIA 1C3OA 1SCIA 2WYVA 2R85A 5E7IA 4K6CA 2ZVPX 4FD3A 1USUA 4H15A 4HEA1 5CDTA 1P31A 3FNRA 1Y9JA 2CL7X 2IU6A 4TVBA 4MV6A 5HILA 2OCAA 3L79A 4GMHA 1GGJA 2OXEA 4NCNA 4OI4A 1XRLA 4MUKA 3LRTA 2JLUA 1BHQ1 1GDDA 3OZVA 2M9MA 3NR2A 1OLSB 4JAVC 3MCVA 5JC8A 1U6IA 1E2IA 3M49A 3K32A 4C6HA 4BMXA 1R1DA 2VZ8A 2QPAA 4QIHA 4PANA 5AQEA 2QV0A 3P0EA 1P1KA 3A4YA 3TX2A 3W2FA 3ADKA 4XB2A 4YXFA 1XA3A 4W5RA 5F1YA 1NNI1 4P7JA 1FX0B 3LMKA 1F2TB 2XYQA 1L4HA 4MDYA 4QYIA 3TLGA 4DV2B 3E9QA 5LLSA 4HEJA 2ZYTX 3FOZA 2IHJA 3FWYA 1LBQA 1ST3A 2V6GA 2WA2A 5A9TA 1Z7BA 3D3NA 4NTZA 4WD3A 4DKXA 2P6OA 4LRWA 4M4SA 3M8KA 2H0QA 4G56A 2COEA 3FYDA 1XKTA 3G9TA 1YBFA 2HSEA 4ADSG 1MW8X 3VYSB 2BBTA 2PZJA 4K2AA 2FZKA 4RDCA 1YIDA 1RAEA 4U7TB 3E22A 2XQKA 1ESNA 2J3HA 4CG2A 1PV2A 2W0MA 4X1IA 2XR1A 4I2VA 3GLUA 1OA1A 2Q3FA 3BFPA 1MNAA 1JR3E 4TTJA 5ARDA 3NALA 3ICCA 5KPJA 3AIIA 2ENWA 3R41A 2O3QA 4JC0A 2Y0PA 1B76A 1ESEA 3A6JA 1QF7A 3DTYA 1ODLA 2YRFA 3TINA 2HHAA 3ETCA 4Q47A 1ZNWA 4ARCA 2EXXA 2PXHA 2XGGA 2A4KA 1WA5A 1FDIA 2H2HA 2ZSUA 3C14C 1W87A 4CJXA 3E3MA 4CN8A 4LXTA 4K9KA 3V4OA 5BSHA 1A96A 3BQNB 1YVDA 5AI4A 5CFPA 4YVFA 1FFXA 1N2JA 4KG7A 1DELA 5KCZA 4WKPA 2FSIA 4D8UA 4KDCA 1TJYA 4UUPA 1XVVA 5BPFA 2L69A 1N5LA 4FNMA 4FS3A 1RYMA 4ED9A 4II2A 2CK3D 4NEQA 1HY3A 5I9TA 2X86A 4EY6A 1OQAA 3TQHA 2ZW9A 7ADHA 3FPKA 3E35A 4FUQA 2Z4RA 3QELA 1QV7A 5GJWC 1KDYA 5IF9A 2ZTLA 2DY1A 3SXUA 1WZUA 2QZPA 3Q0EA 2WJZB 2I3GA 3OIFA 3QHPA 3DOEA 1VE9A 3Q10A 3PUKA 1N78A 2QX9A 2W70A 2IJGX 3HLKA 4C78A 3FMOB 4NE2A 2OZLA 1V7ZA 1GPAA 5JH7F 1QFXA 3F46A 2GYVA 2QAGC 3ETNA 4QX6A 4REOA 4RELA 4X00A 5J58A 2FWRA 2P6PA 1EZ4A 1CFJA 4L15A 5BN4A 1XRRA 4LYGA 4AZ3A 3L07A 1TVEA 1OUMA 3ZV4A 3BCSA 3OBIA 3A2NA 3WAGA 3N2NA 3EDOA 2GZAA 2TS1A 1JKFA 3II6X 3O9ZA 2ZKLA 1T1IA 4HADA 4ENSA 2IYVA 1Y1QA 1PNRA 2C5BA 4AJPA 4KR0A 1AGPA 2I4TA 2RMKA 2VRWA 3A9SA 1PO7A 2PBRA 2QF7A 3I92A 3LC7O 4OFBA 2C2ZA 4WK4B 2C31A 4Z4HA 4Z9BA 2GN4A 3MAGA 1UQTA 3AW9A 3KJQA 4UOZA 1RE0A 3QQ5A 2ORVA 1NBHA 4O2AF 1E1CB 2FLVA 2Y1KA 4GPEA 3O8DA 5FH9A 2O2YA 3HRIA 2VCHA 3JQGA 3SOZA 3S81A 2X4LA 4BQEA 3KZVA 4PLWA 4ZYLA 4B79A 3TWOA 1JH9A 2ODAA 3OLWA 3SKXA 5ILGA 4YJFB 2M6KA 2VQFB 1E6LA 3RKUA 2XB8A 1NR7A 4TMVA 4JKYA 3IXLA 4I4NA 3NYWA 4H3VA 3IQXA 5HP4A 4WFIA 2PZLA 1S6YA 1M54A 2NOAA 1QGZA 2EW8A 3QWAA 4KE9A 3PEFA 4L7VA 4P4TA 5LMUB 3DMFA 4YP6A 1O6FA 1YRAA 1GR0A 3F6BX 2VDKB 2XLBA 4HPXB 4IUBS 3WQBA 2VYFA 3FTDA 3PJDA 1L1FA 3TVYA 1T2UA 1KEKA 4DR5B 1E2UA 5LUBA 1M5UA 4BLQA 1F2VA 2H16A 5A04A 2DBZA 1I4WA 3I1YA 2C4UA 1H2AS 2R6HA 4DC1A 4QOGA 2Y2UA 1PLKA 2FW0A 1PF7E 1WSWA 1NP6A 2IIQA 4I4TB 4Q1DA 3EG9A 1ND5A 5G0WA 3G2LA 2IH5A 1FZTA 4ZV4A 1T8SA 3VNQA 3PICA 4B32A 1ZD5A 2A0XA 4Q3OA 4WASA 3NBQA 1JQLB 4EJ2A 3RROA 9ABPA 4ZCSA 2MIIA 3E4CA 1B0UA 5THQA 2Q3BA 5AVUA 2B3TA 1NT2A 2SICE 3DVAB 3HI6A 4TL7A 3WGQA 2BR5A 4C3ZA 1I14A 1T8WA 1HFJA 1UODA 2HNAA 2PMWB 1MABA 3BWBA 1ZX1A 1KMCA 1VSVA 2AF4C 1G6Q1 2E4ZA 1SCNE 1CEQA 3GNSA 3HUEA 4RD2A 1ZFNA 4U2GA 2CK3A 5B7QA 3WWZA 2A0UA 1K8XB 4BFYA 4J29A 1L6RA 3VNUA 3JU3A 1SHJA 1Z4OA 4R81A 1MN6A 3AJDA 4RTMA 4FP9A 2O8DB 5AYVA 5LJIA 4IGEA 3ZCSA 1NOIA 1V48A 4WJKB 4FHEA 1TE2A 1M2EA 3RSOA 2ISCA 3ONVA 4J9VA 4ROTA 1WU8A 3FNFA 1ORIA 2PWPA 3RRMA 2AQ8A 5I7OA 2Z1MA 2G6TA 5DBOA 1ZS9A 3ASUA 4Q00A 1K4KA 2RGNC 1U7DA 1ST2A 4PIVA 1CD5A 1H5QA 2QZZA 3KO8A 2CE2X 4JLJA 4LYFA 5G41A 5MHTA 5LQKA 3CF4A 1AKTA 2J6IA 3U9TA 2F8SA 5DK4A 1T25A 2XUQA 4XGNA 4HJXA 4EGFA 4G5OA 4G9EA 3COJA 4M0KA 1W2WB 1URPA 2P9CA 2WHRA 4LWPA 3TNJA 4CLEA 2H2GA 2JAOA 3PUXA 1W47A 3R75A 2JFPA 5K3OA 1EK5A 4XPZA 5LQDA 2PWZA 4WKOA 2IWRA 3WSWA 4BFCA 2ATCA 3BSFA 1K7SN 1H0RA 1K8YB 1WEKA 5EMJA 4TXLA 4TVSA 2H9YA 2PXAA 4AX8A 1N5MA 1F0NA 2OCBA 3BOSA 2C1XA 3L04A 1BW9A 4OHPA 3L7DA 3NBFA 4BGIA 1DKMA 5BXYA 3TW8A 4R2JA 1PX2A 2R44A 4M8NE 3F0TA 1SHUX 3CKKA 1QH9A 4V0MA 3M6LA 1R0RE 4DWJA 2ZUDA 4FVTA 4S05A 1IEQA 2Q8NA 2PGXA 2VXYA 1CJBA 4YRFA 3CLRC 4WDQA 2O19A 3GH1A 3GVXA 1JSLA 3BMNB 2Q3MA 4J2TA 1IHPA 3L4EA 2EFDB 1TK2A 3I9LA 1NPTO 1U5CA 3LUPA 3NAQA 4OIFA 1JFFA 1GYPA 2I3DA 1YCFA 3IOEA 2FPPA 4RVOA 4E15A 4K0KB 5JISA 1MFPA 2NXJA 2SKDA 1AV6A 5LZ4A 3QXXA 5CA1F 1SVWA 2BFBB 3BFJA 4OHUA 4XRGA 4TKUA 5DI3B 3TZEA 4NOLA 3PPWA 1RXVA 1UCFA 2R1VB 3L92A 2CHGA 1JKMA 3KV3O 5D3MB 3MJ4A 1V3QE 4MLDA 1RWNA 4RGVA 2P6RA 3CWQA 1L4FA 3T9FA 1C9JA 2BTQA 3FY4A 1GPMA 3BRQA 4CI0B 1QGAA 4PYKA 2O9JA 1L5WA 3LNTA 4Y1GA 3D59A 4HFRA 4M21A 4MVJA 1K75A 1DPGA 2D74A 2VBCA 4TRJA 1XPOA 1BYIA 5C4MA 2G3YA 2W2KB 3H5TA 3UMRA 2P2NA 4G1BA 4UNPA 5AKHA 4OBBA 1DTWA 2JI7A 4RSRA 3GGOA 3MPUA 3ZVRA 1QIJA 2IYUA 2NO6A 4R9UC 2HQ1A 4PX9A 1VA5A 3FDFA 3EXIA 5BVHB 2CV0A 5ERXA 4EG4A 3UIEA 1JU4A 2XYPA 1XD8A 1APBA 4KR3A 4W5HA 2P6UA 3HGMA 1XZCA 4RJLA 4YRTA 1XF1A 3ZX5A 1TYBE 1U9ZA 3B20A 3KLOA 1HDCA 3PUYA 2BPOA 1PWZA 5GONF 3ZQJA 3W2IA 1CZRA 1UMCA 3FWPA 4Z0PA 4FGWA 3T3PB 3KYDB 5KKNB 2HC9A 3VU9B 1J0XO 4WLVA 1Z7WA 2VT7A 1GV0A 4FZJA 3VZRA 4AUNA 4NNOA 5EJ7A 4J0QA 2G9ZA 5FPHA 4JQCA 3GZJA 1V8ZA 1YOVB 5HCUA 4D9MA 2FMXA 2G71A 6REQB 3KTAB 2JCSA 4RHUA 1VE6A 4IL5A 5DWQA 1J20A 5ALUA 3AX6A 4GUAA 1U7WA 4H3SA 4DDKA 3BDVA 3ESDA 2REOA 2D8AA 2REQA 4KI7A 1XDSA 4BQFA 1PX0A 3LUKA 4JU8A 2J9FA 2XRZA 4IBOA 4FQ7A 3HEAA 1OWMA 3O21A 5LDGA 3HCFA 5SZKB 2GSDA 2QK4A 2P4QA 1RFLA 2Z9BA 5F7ZA 1XYGA 2ZE6A 1OLXA 4BN4A 3I5MA 2HYDA 4X54A 2X4IA 4JYBA 4Q5IA 3EG9B 5EUBA 5TJ9A 4HDRA 4WKBA 1QG2A 1IU9A 1BQ4A 1II0A 3RHSA 1RZRA 2ZRDA 1ADGA 3C87A 4X71A 4YBZA 2A14A 2FWBA 2CD7A 4FLMA 3DAHA 5A1JA 3VU3A 4HT3B 4J0HA 3B5IA 1EXNA 3ZDEA 1D7AA 3ELYA 2OPHA 1N8NA 4CIXA 5EL0A 4RK1A 4DV6B 3PFHA 3C6KA 2PGOA 3V4SA 3VJKA 2XGOA 821PA 3BKWA 1QBGA 4GNKA 3LUDA 3LT4A 3VO2A 2C99A 1KMQA 3AUKA 2D06A 4R8KA 1SELA 1R8QA 3C85A 2GPYA 2GZ1A 2PJUA 4PLFA 3WA7A 4FS8A 3QEJA 4K9NA 3CJTA 2QE7D 2CNBA 2A1TS 1C41A 1NOKA 1RWQA 5JWOA 5H0IA 3N2ZB 3A1SA 4M7PA 1XGKA 4XQ9A 1NPYA 2HDNB 1EDEA 2COKA 5JYDA 1CHNA 4MQ6A 3ENZA 1HEYA 2QQFA 4AUKA 2IY8A 4NBWA 3ER8A 3G2MA 4DSNA 4PNEA 2HSZA 5TEVA 4LMAA 3ME5A 3ND6A 2A6PA 3OOYA 2IXGA 3ONWA 4GDMA 1UPCA 3RAJA 3ZJYA 3C8MA 3K0FA 1XMSA 3NBMA 3UUEA 3ZLBA 1P9NA 5JQGF 3P8ZA 1XDUA 1KH2A 2F48A 3L1VA 1UKZA 4G4IA 1FS6A 5HF6A 3RT9A 3UEOA 3CINA 3Q6NA 3V7UA 1VG8A 3AESB 4EPTA 2QORA 4Q9NA 1ZJYA 5AK3A 1JKXA 5FA5A 5U9CA 5DNVA 5CBPA 1I5EA 2NIPA 1JDBB 2TMYA 4KQCA 3K31A 3KUCA 4A91A 1M34E 4PNZA 1K7XB 1R4AA 3H16A 4WV3A 3RSCA 4HZUA 4JR2A 1QRUA 4QEZA 4PONA 3ZDCA 4DQKA 2Y0CA 1SD2A 2B1QA 1T15A 1KPGA 5FQNA 4TVOA 4EHBA 1XO1A 2GF2A 2ZLBA 5CPBA 4YAUA 3HXQA 1VB5A 2QTGA 4HJRA 3ONNA 4XVUA 4J49A 1EVQA 2EKPA 4B80A 3PR3A 3VDMA 1C1DA 1KMHA 1YR8A 3R0JA 1N2CB 5AM4A 3SF8B 4O2BA 3OPYA 2KSQA 3E61A 2AYZA 3UHJA 1XNRB 1A9QA 5DVZA 3TLYA 4RTLA 3PDIB 4WHMA 1U0GA 3AFOA 3UJNA 2VPIA 2C88A 2BMAA 1NLFA 3SJBA 2Q2VA 3LIPA 1CQZA 1XDDA 1AK1A 1J5EB 1OAOA 2VTEA 4CNQA 4HS9A 5BQOA 3T9BA 4CR8A 1QYIA 5SZJA 5K09A 1DMSA 4HRVA 3N0TA 3MTBA 2WWRA 1O5OA 5KNCH 5CCDA 1YBHA 1XPRA 3C24A 3EPLA 5DNUA 4NMXB 3OA0A 5IZCC 5FWAA 2OO3A 3RK0A 4RVHA 1NZDA 3LSTA 3L7OA 4ZVLA 5JT1A 4EYGA 3TL2A 5DGTA 3MMPA 1SUIA 3P20A 4O29A 4C4TA 1TPYA 4HTAA 3RKSA 5G0TA 2O57A 1VE7A 3KV1A 3EAGA 4BVLA 1A1SA 1G64A 2O2XA 2CSUA 3WNBA 3R3ZA 1DU4A 4NVRA 1FNBA 1EVKA 4KUEA 3WRWA 1TVCA 1MQ9A 1SXPA 4BNWA 3ND7A 3OX3A 1B23P 2DGDA 3PI6A 3TZLA 4MJ3A 4QYSA 3DPSA 2P11A 4IJ6A 1DC3A 1E4OA 2PY6A 1E9RA 1JXOA 1JHVA 4L07A 4OYRA 4PZCA 3IMKA 1NTRA 3SMVA 4BVKA 4DJAA 3S8EA 3B1VA 3FUVA 4ALLA 2WSSD 4Q4HB 1DAIA 2A92A 1C0LA 1DI0A 4QBKA 1ZIYA 1WY5A 4GX5A 4M60A 3WWYA 2OQ2A 1TIKA 1H22A 2HR1A 3DLBA 1MJGA 1UUFA 3GDWA 3R8XA 5CYOA 3IPRA 4IG9A 1VMAA 2PKXA 3D54D 1Z25A 1MTOA 3KL4A 4R4JA 5E3IA 3S55A 2A84A 3RFXA 5CFMA 4AS1A 1BVUA 3SZ3A 4EJSB 1F06A 5L51A 1KRXA 2HCBA 2WQZA 3D2AA 3O75A 4PY2A 4PHFA 1HE4A 4GE0A 1VCNA 2IEGA 2PH3A 2OT3B 5JVDF 1DIOB 2HCJB 2NVBA 4ZI2A 2A9FA 1DINA 1XRJA 4JJ6A 2W6ID 2BF4A 2OG1A 1F1BA 3O84A 1V1MA 3QPAA 1D6SA 2BIFA 1EIZA 4TV9B 1OXUA 5DFAA 5ALJA 3CH7A 4BASA 4M1MA 3ZWBA 5AM2A 5H3CA 2HF2A 1ULAA 2DETA 2QL5A 3RRZA 5EFOA 3KWJA 3IQWA 4OUKX 5D5HA 5EXDA 5L7TA 5JSFA 3DE2X 1MDBA 4YMVA 1G8FA 4NIMA 3TKYA 4WCFC 2P3LA 2JEYA 1BKSB 4G89A 3U1TA 4D41A 5BN1A 3INGA 3VR3A 1GZHB 4H1VA 1HE1C 3RS0A 4O3MA 3MMNA 1TGYA 4DLAA 3FTCA 1GTZA 1IPHA 1VBMA 2IU4A 3A05A 1N2IA 1G66A 1F7UA 1TAQA 3AOEC 1CY4A 3TEJA 1QIIA 4BIIA 4FBMA 4AULA 1PGOA 4W5OA 3TW8B 1Y9EA 1CG6A 2RH8A 4C05A 1X74A 1W36C 2AI2A 2CLLB 2X0RA 1TM2A 5B57C 4X94A 3DE1X 1PR5A 2H4ZA 3I30X 4WESB 3SDSA 1IULA 1MC8A 4D0GA 4KE6A 1ITZA 4C0QC 4PWYA 5LA6F 4TWIA 1Y37A 5UKDA 2IUFA 2CD9A 2QUZA 1RKXA 4OXQA 4X91A 4K46A 4ZC1A 3U7RA 3B7PA 1H6AA 1ZRHA 3L8YA 4LOJA 3DHVA 4G36A 2RG1A 4H7PA 3K5WA 4BO1A 2FPGB 3T3EA 2ANCA 2F62A 4AS3A 4LI0A 4ZZ0A 1ZD2P 5A4FS 1NX6A 3FSGA 2FSVA 3N8HA 1WSAA 3E03A 1OWNA 4MQEA 3HJTA 5CJPA 4ZU6X 5JO9A 1XP8A 2FXIA 3DGFC 2JFYA 4TLAA 1EUQA 4HDMA 3CUYA 4C7OA 2BC9A 3DZ8A 2VHTA 2Y3IA 4HQFA 3LLMA 1EE2A 3IAAA 1UDCA 3ECSA 4J0EA 4OA5A 4PSAA 3GRPA 4MVXA 1UOOA 1DCMA 1GZSA 1MENA 3MFYA 1RC8A 3UAOA 4G37A 3PNLA 2B0CA 3U7QA 4F4FA 3OQPA 4E5MA 1E3MA 1VM6A 5KJCA 1OXXK 1OFUA 1VP9A 1CEXA 1DQRA 5BSWA 3ZJUA 3RHZA 2DFNA 1IOWA 3ZBTA 3BE5A 1WSDA 4DDUA 2PK3A 3TD9A 5DLEA 1E4VA 3OE7D 2WJIA 1FYFA 3WBBA 1PS9A 2P8JA 5BR8B 1I6MA 4ALNA 4LYAA 4ETIA 1VYUA 2HDWA 4XB1A 1Y0BA 2FJ0A 4N9QA 5C9ZA 5B1HA 1G63A 4F96A 3T1QA 1JXQA 4FIZA 4J4TA 1BX0A 4O2BB 3RIXA 2PLAA 2UU9B 1E2EA 3DMPA 5HIJA 2ONYA 1KZGB 1XTZA 4L4ZA 4YRBA 5C8YB 3JZFA 1A72A 2QVCA 2SKCA 1QTNA 3TCXB 2GHIA 2YZKA 4LOHA 1BU5A 4LVCA 4QO7A 3T94A 3TLAA 3SEAA 3VHQA 2YDXA 3E8SA 5JZBA 1UBTS 1WQ3A 3FF1A 3OZSA 3C3EA 4CKWA 3TDMA 1KI3A 1KQOA 3UY4A 1IZ9A 1ZCFA 2FHSA 3QVSA 5EEHA 4WFKA 2QUKA 2Q2NA 1VGVA 2ATIA 3C16C 3GPLA 1AG9A 3AP3A 3JWPA 4UCWA 4W1RA 1XI2A 1Z88A 4JELA 1C2TA 5JNRA 3DWGA 1UINA 4B0PA 2XBUA 4LY0A 4YAJA 1WNFA 1MAWA 2VQSA 1FFEA 3C5EA 3L40A 2PVPA 4RTOA 3G8AA 2HK9A 3CS3A 3RIGA 4B4VA 3AJ9A 4Q0MA 2GJKA 3IIIA 3TJMA 1QZ3A 1Y1KE 4RTSA 4JMLA 2IXAA 1UOQA 2HV9A 2HMSA 3QBTA 5EXSA 4AUMA 3U80A 3TXXA 5A5EA 1N7HA 1HSOA 1R0YA 3L7AA 1YXMA 3KCQA 3PFGA 4J2OA 3W6ZA 1UPUA 1DO2A 2ZBRA 3OQNA 3P94A 3L5KA 3VMMA 3W3AD 1IVSA 1JAZA 3C3AA 3RJTA 2W2LA 5IH7A 3H83A 4QFBA 4DBZA 2A9RA 2UYOA 2FX3A 2FE1A 4G5GA 2QTNA 1VQ1A 3LGXA 3FGNA 3AF3A 2AGVA 2FRDC 2FPUA 3Q9SA 4G4JA 4UE6A 3V33A 5EJ6A 1DCTA 1NIPA 3CMMA 4PO9A 1NXTA 4NDZA 1Z3IX 1N0HA 3GJXC 3V8RA 2IKSA 2IUUA 2OXFA 1E99A 2OXRA 2W71A 5IK2D 4CM5A 3ZE9A 3K2QA 3F5SA 3FYHA 3HDTA 4S1PA 5CMLA 5AICA 3ZUPA 2ZJZA 4HB3A 3BT7A 1A77A 3H2HA 3ZHZA 3ZYZA 1V25A 3NHZA 1E1QA 1JSCA 1TQ2A 4BNIA 1TU3A 1TRHA 1X1DA 1QJCA 1LPPA 5TS3A 2BOVA 4XWWA 3ZPXA 2GBIA 3MWYW 4K9SA 3G88A 3L0SA 1NL3A 5FTJA 2SBTA 1YDEA 1ABFA 4OJKA 2NTNA 4NCHA 3D6NB 4X45A 1RRPA 3DOOA 3EQZA 3ZHCA 4FOTA 4PSDA 1BU8A 4H31A 5DYIA 1JV2B 4IVNA 2A5GA 4UNNA 1J2RA 1U8XX 1LPMA 1QDEA 5LQRA 2AMLA 3EUFA 4R31A 5P21A 3LVBA 4OMCA 4RKFA 3GLTA 2PUVA 2X8JA 1M8GA 3Q40A 2PS9A 4HQ0A 2ZR7A 2H5LA 4NPAA 4RULA 1LA2A 5IULC 2ZXEA 2J3MA 4JI5B 3JVIA 1DADA 4R1NA 2HCTA 4FYWA 2ZBDA 3O1IC 1NP3A 1HLFA 1Q92A 2DFKB 3EGVA 4RC9A 4Y0NA 1Q2UA 3DF9A 1E0JA 3HBLA 2QYTA 5DT2A 4ZVSA 2FPSA 1QM5A 1DKNA 1ENYA 3NGMA 2WZQA 2V7QA 3VPDA 1O8CA 2ZB2A 1SK9A 1EEXB 3EFHA 2WHYA 4UHCA 3BK2A 3RYHA 3LAWA 4RH1A 3UV3A 3PPIA 1G8HA 2PH1A 2V4ZA 1RWBA 4NAUA 3ZE6A 5EYPA 2E5LB 3EHDA 1ZH2A 1WPGA 5KC8A 1E32A 3MFQA 4ZVTA 3KNZA 2OCGA 4HUQB 1L7QA 2B4KA 2AFIA 2O7SA 2LRHA 3CKMA 1V6SA 2ZYHA 1I3LA 2FY8A 2I7TA 2VJYA 3P32A 1CEYA 5E9WA 5IAAA 3AGQA 2OAGA 2PFKA 2XUFA 3VZSA 1U63A 2CJYA 5ECWA 3HFGA 4HR7A 3ERCA 4J3JA 1ISRA 1FNCA 2QM0A 3EUAA 4M87A 4TV8B 2GJ9A 1IJFA 1ZI9A 2H7CA 2OSBA 2VDRB 1R4ZA 1AMNA 3PQFA 2X6TA 1KK1A 3PYLA 1QGOA 1EUZA 4LFBB 1S8OA 3I05A 4WFJA 4D46A 3R6TA 4QWMA 4R1TA 4RX1A 3OICA 3PRJA 2I2BA 4IZOA 2MHCA 3IB6A 5FPTA 2CLIB 2HM7A 4ZI7F 2IX3A 5FA6A 2QLMA 2WINI 3H3FA 1ECPA 3PQ3A 1RADA 3V48A 2JIDA 1WUJS 2W4QA 3FPCA 5E6SA 1IJEA 5DM1A 4UHJA 2IPAB 3OHMA 3IV6A 4RV9A 1JI0A 1KJNA 2OGUA 1VYTA 4ECAA 1BWPA 1Y1LA 4OJMX 3GD5A 3ZE8A 2BGNA 1GUYA 3WNDA 3HGTA 1LZLA 3M6VA 1I3CA 4FMCB 4U2CA 3T5TA 3VDRA 2EP5A 3K0BA 5KS2A 4N3GA 1ZESA 1MU0A 2RHCA 2ZVQX 1X1QA 4ER3A 2ZITA 2HMUA 3I76A 4OHXA 5DM4A 5TNXA 2VWPA 3MC1A 1Z4PX 3ZGYA 2M6RA 1G4UR 4BFVA 4ZXPA 4CMGA 4BHTA 1TD1A 3ZD6A 4ZPXA 3JD3A 4BU0A 1ZM2A 1EFVB 5IT0A 4MRMB 1X13A 2RGNA 2ERYA 1XLTA 1FTGA 1PJ4A 2VSFA 2J9YB 3KQWA 2YXBA 3A1DA 3JQQA 1VL8A 3O92A 221PA 3OFJA 4R41A 5DISB 3L41A 1I30A 1TM3E 4PYOA 2GCGA 2TMDA 3G5AA 4GOKA 1BEEA 4B8ZA 1T8PA 2XXBA 4DMKA 2W6JA 4ZQEA 4D9GA 1E2GA 4L8WB 1YF3A 5ED0A 4GX0A 3D6TB 5TQ0A 2DR3A 1VJCA 1CUJA 3N74A 3EQ7A 2I6QA 2GF9A 4IDEA 3G0OA 2R9VA 2X7XA 1RIIA 3CUTA 1IZ7A 4KIFA 4XWYA 1W1IA 2OCPA 5AVRA 2J87A 3DE6X 3VH4A 1Y3BE 3UMSA 2QX8A 4V3BA 1VIYA 1V4BA 4UM8B 1ZITA 4F5ZA 4MUIA 5ETJA 3AFNA 4HDNA 4N03A 1JB1A 2P9TA 3AKCA 3K1AB 4PLPA 4IHJF 2QWXA 4XDZA 3R7LA 1R2QA 3TTTA 3VGPA 1AQIA 3WADA 4DLRA 3PVZA 4EPWA 1KYZA 1T6NA 3MBIA 3D3JA 3LPAA 4FJ0A 2YZMA 4MJ7A 1Q6YA 4FFNA 3IB3A 2YJZA 5CVJA 1RMQA 2JIRA 4XRRA 3DEAA 4R8SA 3U3OA 2AMVA 2OV1A 3C8DA 3LQ2A 4JEHA 4UVHA 3KWLA 1EU1A 5CHEA 1UIRA 3STXA 2ZT5A 1S02A 4P3OA 3SR3A 2OWEA 2AR0A 2Q07A 3CNNA 3I9MA 3OZTA 1PFVA 4XDYA 1PN3A 4FGKA 1GSHA 3OCJA 1OX4A 2A88A 3BDAA 2TECE 4ND8A 4IDFA 3FFBA 4WBNA 5LKRA 3QWFA 2JJ8A 3P9CA 4IDNA 4JJFA 3DAPA 2C96A 1L1QA 3UAYA 4GGMX 3X2SA 1ADYA 3DAOA 5B58C 4GLLA 3CCBA 4I3GA 3I2IA 3DLIA 4I5GA 2HFJA 3AEUB 3RYFA 2BFEB 3U1BA 1HTTA 2ZDGA 1E6MA 3JTEA 2QTBA 4AJ4A 1JPJA 2Z83A 3CRZA 4LJAA 1D4OA 1X1AA 4GWKA 4RK6A 3GFQA 1RPTA 3JWHA 2Q3LA 1DC8A 2GVDC 2JCGA 2VHVA 5T57A 3KQLA 2WUDA 4TRNA 3V1YA 1UK9A 2ABWA 4PFQA 3VPBA 2YHAA 1KO8A 3H9EO 3PNOA 4DSUA 5BN3B 3KQTA 5GAJA 1WXGA 2B69A 3K8YA 3JQFA 1M3SA 3F7MA 4LBZA 1E3TA 2X8JB 3GBSA 3PC2A 4DPKA 3U48A 1DX9A 2ICAA 1JDTA 1PJQA 4QEDA 4V02A 4B9AA 4I4IA 1U0TA 4GW3A 5JPDA 4O08A 3KB1A 2CXRA 1M66A 2RHHA 3RSSA 1R0XA 3W4KA 4OHFA 3NOOA 4CIDA 1GFSA 3R09A 1WMDA 2VAWA 1GXSA 1EUDB 4PC6A 5EWJA 3RRJA 2HMWA 3BXZA 3JARB 1AKVA 1DBWA 4K9MA 2NM0A 3S44A 2N3ZA 3HBNA 2D3WA 4IXWA 2G0TA 2QZ9A 2M98A 1EJ2A 1Z8FA 2B4AA 2YJ5A 3DE4X 3H4IA 4MKHA 3WIUA 2R25B 3VPAA 3AL3A 2HYIC 2FGJA 2N9UA 1QRTA 3L9XA 1HT2E 5IHXA 2IEZA 3HXKA 1TT7A 3NDBB 2R1TB 5HF5A 3IOMA 1FY2A 3TAHA 2FF7A 5ESRA 3TPZA 3R7AA 2YHUA 3AY0A 3NHKA 2CXXA 3IUQA 1U8TA 3QNUA 4W8OA 2NAPA 3B3FA 3PNVA 5F2EA 3TFWA 2VDQB 2ODPA 5KO2A 4JLVA 4NBSA 3S2EA 1JMVA 2BGRA 1RRFA 1DEKA 5MFPA 1Y5LA 4RF4A 2B0JA 2WM2A 1WUTA 3DVLA 3COWA 4NONA 1YSCA 1JU3A 2PM8A 4MH0R 1B3RA 3ZCXA 4TS1A 5A03A 2PQ0A 3SYMA 1NYLA 3P2MA 1RSZA 3QI7A 3W04A 4ZHQA 2FWIA 4CM8B 1IPFA 1Q83A 1JLSA 2O1SA 5JZSA 3RBZA 3ELDA 4HGNA 4EL5A 4GBGA 3CJRA 1TO2E 4PZUA 2VL7A 4GBJA 3EX7C 3P9YA 1BHJA 5HYVA 1E7WA 2B30A 4RF5A 2GVZC 2REXB 4PU0A 4V0LA 1ZD9A 3TQRA 3K94A 1TZMA 4LXYA 1KE1A 3WJ7A 1O0CA 2QX6A 2J3QA 4WBNF 1DO0A 3ICOA 4GKJB 2XSZA 1CB0A 3OC0A 4WCVA 2UUOA 1Y5RA 1UP7A 1WMSA 3RS8A 3RVPA 5JNWA 4D0LB 4U7FA 1NRIA 5SYAA 5BNWA 2AOXA 2H57A 2FN4A 2JHCA 4TM8A 3QFTA 5ALEA 3VVMA 3AHHA 2MYTA 2Z30A 3N8GA 1HORA 4MLCA 4YJKA 1XCOA 4PGMA 5FHRA 2C04A 1P0QA 2RDMA 4F2GA 3WK9A 4ZT4A 1UWLA 3LW7A 3AVWA 3IT2A 3DEYX 4XEHA 1WHTB 2XTZA 1QP8A 1XTRA 4CGYA 4QOEA 2JRCA 3GEEA 1SVMA 3FD8A 4LFAB 2GEKA 2YRWA 1NBMD 3PHJA 1RHMA 3ZZ1A 1N1DA 1MPXA 1ZSNA 3ZI4A 4LRTB 1XN1A 1OIWA 3FWKA 3ASZA 3PGJA 4DM7A 3NHSA 1Q0PA 3A6GA 1DAHA 4KO8A 3WBKA 1JG6A 5CFRA 5JFOA 4URZR 3SC4A 4XH9B 3EVGA 4K5QA 3QEKA 4XUDA 2HJ9A 2V7UA 2V7GA 5TF0A 3S2GA 2CLCX 2PN1A 3PCRB 3C5VA 1PUXA 1FLDA 4DMCA 4K8OA 4YJDA 1E96A 3NHWA 1PGNA 4DKJA 4Q05A 2H1SA 3JCZA 4KDFA 2QD1A 2Q46A 3UENA 8MHTA 2J6BA 1UPAA 2WM8A 2Z8ZA 5EHQA 3I8XA 5H3LA 5KDLA 3HZHA 4J2HA 4BXOA 2DBRA 2WPDD 5DSZA 5EZYF 1JBQA 4N8SA 3AVQA 3G2IA 2H2AA 3HM2A 3W2EA 1JWBB 1HFEL 1Q0UA 1TYDE 4L3WA 2QN9A 5CVEA 5JWHA 1TECE 5B3JA 2PUWA 4AAYA 3ZIAA 4GZ6A 3AIMA 5G02A 5JY1A 4PG8A 1QUEA 2HXYA 4BVEA 5EOVA 4MVJF 1Q0QA 2QRGA 5BNZA 2Z04A 3PEEA 4ND4A 1N5OX 1GG5A 3M1YA 1AXEA 2GKGA 4L50A 5BV2P 1DTWB 1DEHA 3G85A 3HB4X 3IPCA 1TO6A 1XZFA 2HZBA 4YJHA 5EE5B 4XGIA 3ROKA 3RGGA 1E79D 4Z6KA 5KNDA 1YRHA 1ZW1A 2IHTA 3N7TA 1FA9A 3IEPA 2GLUA 2NZJA 1EVIA 2PQ2A 3SYTA 4ZCMA 5FAKA 4OAQA 2CBXA 1JE0A 3BQMB 3D8BA 4REMA 2FAXA 4IVRA 2VAVA 3WLMA 5BUZA 2PSHA 1QRAA 4MPJA 4D6XA 1PJSA 3ORSA 1I7PA 1PZNA 2RC6A 2YWCA 4N0DA 3BL8A 3X1XA 2CSXA 1R9JA 2C2XA 3IKVA 3AEXA 4NU6A 3RODA 2PA0A 2PUJA 3AUYA 3O7WA 4K6GA 3ZHOA 2HA0A 5KWVA 3B3JA 3RHTA 3L43A 4HDKB 4R2LA 5DOZA 5KMGB 1ZMXA 2UUAB 2HUPA 3EZGA 3BTVA 1TVKB 1UZUA 4L73A 1E5VA 1KMIY 4AWBA 1GL9B 1BMDA 4O0LA 4CUKA 4ZCRA 5IS2A 5C7LO 4PQGA 2MWMA 4CKBB 2GGSA 2NVUA 3MPOA 3OPNA 2EYUA 3ZY5A 4YUVA 5LNK6 2JI8A 4KI0A 2XNCA 3LHDA 2DQSA 4LYHA 4DRYA 2LDBA 4N82A 4P4NA 4Y9UA 3R9IA 4DV1B 3HO1A 4UCXA 2NGRA 3A3YA 3BVPA 1V2HE 1UZMA 3ZW8A 1L5ZA 3IAEA 3J81k 1EG7A 1UXJA 3P0HA 3GF4A 1WB6A 5CVCA 4FWBA 3UJ8A 3NKFA 4W1PA 3RC1A 4ZRDA 5AVJA 4DQXA 4ZRMA 2G1KA 2NPOA 4IJKA 3ZWKA 5L4LA 2FDRA 2P67A 6AT1A 3D5TA 3HB0A 5KHLB 1DJNA 3VC3A 1PG2A 4FKBA 1MQSA 4CTJA 4WY8A 4J3NA 2R6DA 5J40A 1CUCA 3BORA 3ULKA 1U6KA 3RS4A 3VYUB 2Y8EA 1NAIA 4XA8A 3BMCB 3GOHA 4TUYF 1Z0FA 1D8TA 1IG3A 2KLHA 1UEXC 4G0VA 4JJ8A 1JEQA 1NBAA 3CRRA 3DTNA 4Y7DA 3UMFA 4XLLA 2JHGA 1AN9A 4PHCA 2PJRA 1BXKA 1O2DA 2Y77A 3IVRA 1E7QA 3LT5A 5DCYA 1KIFA 3TYXA 3W2GA 3RAPR 1I2ZA 4GEGA 1AZTA 3CX3A 3OM8A 4KJXA 1ZL0A 3WS7A 4A8PA 5LWHA 3NXKA 2C8LA 3VV2A 3CNEA 2CV1A 1JW9B 1W85A 2H63A 2RB4A 2RKOA 3FHCB 4PS0A 2GN6A 2V7XA 4E2FA 5KOYA 2OCLA 5LOVF 2GCOA 4E09A 1DQYA 5ARCA 1IEWA 3GDOA 5AUNB 5C46F 1KEWA 3SF0A 3QWHA 4OA8A 3NTQA 1JQBA 2OQRA 4P1ZA 1BIFA 1Z4QA 2GJ4A 1J42A 5LM3A 1C14A 2H2FA 3DAYA 3K1AA 1VXRA 5FO1A 3ONDA 1NJ6A 4JJEA 2JGIA 4TGLA 5EIOA 4EHHA 5AIBA 2RONA 3ZJ4A 4DQLA 1V1JA 2Y68A 2NXWA 3DHWC 4IG4A 4HN2A 3VR2A 1B43A 4ZMBA 3AYXB 2I91A 2J41A 4GMFA 1N0WA 4S2EA 1FJXA 1GTG1 2BEWB 3VV3A 2WTAA 4LX8A 3T3OA 1JDNA 5C1OA 4LF4B 3OFKA 1LVHA 4L3VA 1RHUA 2O6LA 4US0R 4EMSA 1EFCA 5ERGB 3ZV6A 3UFXB 3EUWA 2XE6A 4EW1A 5BWOA 1L4YA 1NNEA 1C30A 4HLUA 4NJMB 4HAXA 4F3KA 2Y05A 1FTQA 2B7BA 2VDUE 1E2QA 1Z4IA 3LPLA 3ZEIA 3ROQA 1PW7A 3AUSA 2PUAA 5EQFA 4ER6A 5IDYA 1Z82A 5GP1A 3U9LA 2CNDA 3CW2A 1E64A 4AQ7A 2HWXA 1TF5A 1DC6A 1PT8A 3AFMA 1NJGA 3R7FA 1C9NA 5IYZF 1VHJA 1NF2A 4XWGA 2Q6OA 4FJ1A 2IZOA 3NBXX 3U3ZA 4HV4A 4XWKA 4TT8A 4QPCA 2W2KA 1XLVA 3M1LA 3BXFA 4HYQA 4F56A 4R3NA 4YY3B 2G9QA 3W7AA 1N3LA 2RGYA 3DDOA 5DKFA 3MS2A 1C9DB 3F71A 2FN3A 4B6PA 1P1FA 1U2EA 3VUFA 2LXNA 1YFZA 2HZ7A 2QPOA 4Y1RB 5CR9A 3R8CA 5HM8A 1LW6E 4KSCA 4H7EA 4KNVA 1XEWX 1A9PA 2AC2A 1WB5A 2BGUA 3A6HA 1A3CA 3WLTA 4Z7JA 1PZEA 5FUXA 4BLTA 7REQA 5JEEA 3HN6A 4HDOB 4Q39A 1AHPA 3A7EA 3HADA 1H1DA 2QGNA 2WJHA 3BWDD 3OCWA 4MZXA 1D9ZA 3GRVA 4P6VF 4Z9YA 3EQ9A 3WAKA 4W8HA 2WE7A 3TR0A 3OMLA 1YD7A 3ZU6A 2G28A 3LF1A 2ECQA 2IYFA 6ABPA 3GT0A 1RZVA 2F1RA 3P19A 4GEKA 4HGZA 4KKVA 4WN3A 4DWWA 2JASA 1U0BB 3UFBA 4BP1A 3OZ7A 5KIAA 4MIOA 1ODTC 2YFHA 2CGEA 3DD1A 3DZIA 3F2IA 1P45A 2LBPA 4ZAZA 4F4DA 2DTEA 3GLGB 4C21A 4TTTS 4D4IA 1IMJA 1PE0A 1DV1A 4FFPA 2J33A 4ZP1A 4LECA 1SY7A 3EAQA 4J7UA 1D2RA 1JHUA 2PTHA 4CLHA 4QLBA 4XCQA 3HBMA 2XVYA 3WLQA 3F5DA 2B1GA 4GC5A 1I2DA 1L5VA 1U8AA 3OU7A 1N77A 2OD7A 4CL8A 5FWYA 3KWFA 4LF6B 2ZPUA 3FLAA 4RWEA 5DBIA 4BDSA 5JHGB 2JFHA 1M8FA 3AGPA 3F1LA 4FU0A 3GUUA 4NBKA 2JEOA 1RBZA 1EK6A 3ZH2A 2EIXA 4NENA 2HQRA 3A70A 3P4XA 4QOSA 3PTAA 1FTNA 2UZ1B 4E94A 1QVZA 4G2TA 5CXQA 3V2HA 4OXIA 4EZBA 5B55A 1C9KA 2XUDA 5KJEA 4W7SA 3YASA 3N39C 4ARSA 1C3VA 2WJAA 4FR5A 2XT0A 3AEQB 3RSLA 3QK7A 2G77B 3BXEA 3TDNA 3DB1A 1UJCA 4CG3A 4OMDA 1WMFA 2C4VA 5HCNA 2ZRHA 3RS2A 1SC3A 3FVQA 3V8EA 5KX5B 1KJWA 1AB6A 2JHFA 1LSJA 4C1NA 1SUDA 3EZ7A 5K6TA 4YT4A 1W96A 3T41A 1E7MA 4EABA 3EISA 1FFBA 1TEXA 1JE1A 1D9XA 1ZGCA 4RY0A 2FPPB 4TPKA 3CCFA 3DEZA 2X23A 3FYCA 3N9IA 2J48A 4A2QA 4C9BA 3H9BA 2HNBA 1SRQA 1EFPA 1UPFA 2BMWA 2YJ3A 2JLAA 2QJTA 1EUCA 1QFZA 2QRVA 3H1AA 3INTA 4MS4A 1II8A 5HQTA 1X0VA 4X97A 3ZQ6A 1J23A 1XVTA 3HE3A 3NS7A 4LJ9A 4DNQA 1T4CA 2RHLA 3B53X 4P7GA 3WHLA 1GA1A 2W48A 3UAGA 4OSEA 5FD8A 4EKDA 3SVTA 3EVZA 1D1SA 3DGEC 2IYOA 4FOSA 4HG2A 4RY8A 4UTNA 4OHOA 3DDHA 5JMPA 1GNVA 4A92A 2HU2A 4EY3A 3QVLA 4CF5A 4OTZA 2C8VA 1H2YA 4KN8A 2RK3A 3HYNA 5JPCA 3EZXA 4QPJC 1OFVA 6YASA 1M2WA 1IXKA 2JAHA 2H7VA 4PG4A 4FILA 4C20A 3ENVA 3NBYC 3KQPA 3E48A 1OT5A 5K3FB 3BL6A 3DKKA 1U0JA 1DXQA 4QTUB 4A8JA 5H1YA 2V6FA 3WWOA 5JZMA 4PM4A 5F4ZA 1RWVA 5HS6A 3JQFC 3N2LA 4HATA 2H52A 4K9LA 4CXMA 2B83A 1FU4A 1FPQA 2EFHB 1QQ6A 2IE8A 5GV8A 4RZIA 3WSTA 3OE5A 4CUJA 5JTUA 4ESOA 3Q1KA 2VBFA 4PICA 4F4HA 3KYIB 3NRBA 4UD6A 5AIAA 5B3AA 1QSGA 2W4IA 3P9NA 1H93A 4UUMA 4DC0A 3NDIA 4DCOA 4HI0E 5F7OA 3G5MA 2IV3A 1A2QA 3OQ1A 2N1BA 1NV8A 4O4JF 2RD2A 5TX7A 2AOVA 1VOTA 1JDUA 5T8KC 5KNLA 4QBIA 3GEHA 4KPUA 3HJUA 2YH2A 3HGQA 4B4OA 1JS1X 3THYB 3UO8B 3D2CA 4P4SB 4LMRA 4FOOA 4RU1A 3KU1A 1RCFA 2HLDD 1QHSA 2XMRA 3P1JA 2OFOA 2BDEA 2YASA 3KUKA 1WR8A 3OHSX 1L7XA 4KEAA 2FNAA 2VP0A 2ZJ2A 4DM4A 3KQKA 1NBIA 4HWOA 4KU4A 4RPHA 3LK6A 5E7MA 4BMOB 8ATCA 3MD9A 1Z2OX 3VO8A 5F7XA 2YICA 5MN6A 1RKQA 3IQGX 4OREX 5DB4A 2PGLA 4CKBA 5JD5A 1X39A 4URVR 1E2DA 4GZLA 1SG9A 2W6QA 3EZ2A 3MYYA 1Y82A 5IKEA 3MF4A 1YVRA 1U0FA 3LUAA 3N3AC 1Y89A 3NVKI 2WTNA 2VI5A 2ZS9A 1GQYA 4IR7A 1E94E 1O94D 2IL1A 2JZCA 2PKRA 2Y0BA 1EVLA 4ZOLA 1KPIA 4RVCA 1CW2B 1DAGA 1HL7A 4IIGA 2G0AA 3KKPA 3NETA 1KYIA 4MW1A 4UMDA 2QTAA 2TMGA 4JEMA 1D2CA 1PFWA 2P5UA 3IE2A 3WICA 3ZZ0A 2NTJA 1EP9A 4BUZA 2WU0A 3GCWA 4IJ5A 3A6FA 2B2XA 4TTQA 5FPYA 1ISFA 3C1OA 1NC1A 1RPNA 2WJ4A 3TTSA 3I6YA 4DDHA 5A5VA 1UOPA 2BFOA 2HSJA 4WVFA 3AOGA 1VB3A 2QAIA 3QHAA 4E14A 1C9YA 5I8PA 4G09A 2D13A 2AG6A 2YWEA 2ZRNA 1O9GA 3GQVA 3LHIA 4FQ5A 2X1VA 1EWKA 2OOSA 4H1WA 3PUIA 4A2WA 5I3CA 4JIGA 1YVUA 4UDYX 3S3TA 1F4LA 1XOIA 4QUIA 3LA8A 4ZEMA 1M1NB 2VZEA 2B1IA 4DR7B 1ECLA 4TQ9A 4V0SA 5H7XA 1YJXA 3PFBA 1BE1A 4G25A 5CD1A 2PNFA 3AIOA 3M7IA 1E2BA 4JBXA 4MR8B 2WP0A 1FFDA 1CNFA 2LKDA 3E7FA 1SXGA 1LI5A 3PYXA 2JLSA 4OP1A 2WU4A 4UUOA 3QTTA 5LIPA 3JD0A 4O4HA 1WIWA 4OGLA 3V2GA 3C5HA 1BS2A 1P7VA 2XJ9A 1HI9A 4JI0B 5FBZA 3N7AA 1FFXB 2B8WA 1U2QA 3KZXA 3TIXB 4LW8A 1U9CA 5I4IA 5LXTB 1O94C 3H8SA 4UJ5A 4BZZA 1GPWB 1N2GA 1AKYA 3W1VA 1Z39A 1Y3DE 4K1XA 1G8PA 1RVV1 3ZI7A 1JGTA 4Z7QB 4TLEA 1KYWA 3ZOZA 1KYQA 1UJ6A 2OR3A 2ZYIA 5ED4A 2NG1A 4XXHA 1JVSA 2C58A 2YZ2A 1CJVC 4UXIA 2VRNA 4GPBA 5A9SA 4Y2GA 2FRDA 1Q0ZA 2XUGA 2AHOA 3W7VA 1B0PA 4ILKA 2UZIR 4ZIRB 1DRVA 2Q6VA 5HQJA 1SC4A 1SKBA 2ZB7A 5D6NA 1AXGA 4EB6B 1B0AA 1SU8A 4G4SP 5GINE 2XCTB 4PC1A 2HQBA 2Y1CA 2XX3A 3AFHA 2IBMA 4KAAA 5HK8A 4EMUA 1SXHA 1R5JA 3WGOA 1EFDN 3MMSA 1EM8A 1KMNA 2JEZA 3K7EA 3FPLA 4IHQA 2ZS7A 3CTMA 3WV4A 4ISBA 5CU7A 4C43A 3AFIA 4WZ6A 4KPEC 3LYHA 5LVAA 2KBFA 2HA7A 4U4AA 3TW4A 4BO0A 2I2WA 1FUUA 1YZTA 1F7VA 2V7EA 3DS8A 4GL4A 4ES6A 5A4AA 3HCDA 4NV3A 5FFNA 3H17A 4PVCA 2A1IA 4QPNA 4L5YA 1SQSA 3CE6A 5KSPA 1L8QA 3DFIA 4EJFA 4ESEA 2FEAA 5TMEA 2O3JA 3H2GA 1E5LA 5CIWA 4UQPA 3QZUA 5TQ2B 3NH6A 4IQ8A 3VSDA 1A5TA 1FDUA 1M1YE 2E2WA 2P0EA 3CM0A 3GV0A 3FGZA 1W0CA 3S7ZA 2W6JD 2DR2A 1NQAO 4QDUA 3H19A 4MS1B 2XCOA 3LTEA 5CYFA 2JPDA 5TQJA 1YQXA 2B4TO 3BXXA 1QIKA 2ZSAA 4U7PB 4N7RA 1UDRA 1P1RA 2Q9CA 1JWAB 3UOWA 2BGTA 5KYXA 2BGMA 1SZJG 1US8B 2W0SA 4F1KA 4IHAA 4PLZA 4NYMR 3J7AC 1G8SA 2JHAA 3D6JA 3IAFA 4RVNA 2VF2A 1M2OA 4QG7A 2IU0A 2XMCA 1QH0A 3MD0A 2WWGA 1YCHA 4EARA 4UDNA 4OB8A 1M34B 5LZ5A 4N5HX 1B74A 4B17A 2PSDA 5GWXA 1B41A 1U1DA 3CIFA 5IKOA 2JZOA 5TGTA 1OHHD 3BS4A 4WMLA 3G