1PDOA

Phosphoenolpyruvate-dependent phosphotransferase system
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
129
structure length
129
Chain Sequence
TIAIVIGTHGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETLIEKYNAQLAKLDTTKGVLFLVDTWGGSPFNAASRIVVDKEHYEVIAGVNIPMLVETLMARDDDPSFDELVALAVETGREGVKALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the IIA domain of the mannose transporter from Escherichia coli at 1.7 angstroms resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphotransferase
molecule keywords MANNOSE PERMEASE
total genus 45
structure length 129
sequence length 129
ec nomenclature ec 2.7.1.191: Protein-N(pi)-phosphohistidine--D-mannose phosphotransferase.
pdb deposition date 1996-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03610 EIIA-man PTS system fructose IIA component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.510 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphotransferase system, mannose-type IIA component 1pdoA00
3CT6A 4TKZA 1VSQA 3GX1A 2JZNA 3GDWA 3BEDA 1PDOA 2JZOA 3CR3C 3B48A 3LFHA 5T3UA 3IPRA 3MTQA 1VRCA 5IM4F
chains in the Genus database with same CATH superfamily
2R8EA 1V9CA 4Q6BA 2PLWA 4UPDA 4CMBA 1QTQA 2VHWA 1KRWA 4QNMA 4DG8A 1VKOA 4CBVA 1DO0A 1F17A 4BMDA 1CD5A 1CX9B 1N2IA 5FCDA 5A4FS 4V1CB 1ORHA 5ESDA 5TQ2A 1NLZA 3AEYA 3EUFA 2VHQA 3VA7A 3T3HA 1V1JA 5MF6A 1J4AA 1N7HA 3CEHA 4MP6A 1YR2A 2DMRA 4BV2A 1CVLA 4R2XA 4NBLA 3AK4A 4ZRDA 4ER3A 9MHTA 4YAKA 4RVUA 4OAOA 4TV8A 1E2JA 3T7SA 3IQHX 1NI5A 4D2IA 1J25A 3G49A 3RWOA 3ZCQA 4RH1A 4A2PA 2HUPA 5BY2A 4U5QA 4YDSA 4S0ZA 1DQSA 4DNFA 1REQA 1K4KA 2IYNA 2GFHA 1NIPA 1NMYA 2HT6A 4JA2A 3SAJA 4BV3A 4RVCA 3WLHA 1QS0B 2QVYX 4ND1A 2IIVA 4R8SA 2F43A 3GJ6A 3TSCA 3VTZA 2YXBA 3SIWA 3V8NA 2FWIA 1JA1A 3PNPA 4AT1A 3U40A 2QTVA 1OZAA 2UVDA 4AKGA 1XTZA 3MQ2A 1QS0A 2W58A 3D3QA 4W5NA 4EPXA 3VHXB 4A0GA 3AV3A 5EWLA 3T4PA 4EATA 5FAKA 4Z8YA 4NFYA 4QJBA 3AVQA 3K0FA 1KO5A 1V37A 1O96B 1UQRA 5JR3A 1S2GA 1HV8A 3LGAA 1UBEA 1WXXA 2PM8A 4Q3LA 1NUSA 3H86A 1ZHFA 1PNVA 5EHNA 1CZUA 1E2KA 4FEGA 4PIPA 3P2IA 1Y6QA 2FDXA 3L06A 3ML1A 4BJ1A 4R0NA 1VMAA 3LFTA 5K0BA 3PR3A 5DEIA 4EP1A 5EJ8A 4R8MA 2BHLA 2IL1A 5CFRA 3LJKA 5LM3A 1TMYA 2D0DA 3C1UA 4H59A 2X5OA 5AUOB 1EFDN 3FWPA 2I62A 5IM5A 3RS5A 4MV7A 721PA 3E3MA 3LP8A 3WFJA 4URXR 4V3BA 4YH1A 5JWRA 4YXWA 4D79A 1X7DA 4HF7A 2LCQA 1C7RA 1JVSA 2Q46A 2XTZA 3CIFA 2X0NA 2GM5A 1ZRSA 3KZ1E 1RABA 4H18A 5BWNA 3NEYA 1RPTA 2QP3A 3LTEA 3R9XB 1OX4A 5KNBH 5KJFA 4D9GA 2ZVQX 3I42A 2NVWA 3GZTB 4PX9A 2RHTA 3HXOA 2CMHA 4EJMA 4XDYA 2IIPA 3AKZA 1QDUA 3CE9A 5K4HA 6ABPA 1JLKA 5EUBA 3ZWAA 1DO2A 5EXSA 3LC1O 1J20A 1XALA 4PLTA 1YB5A 2FPXA 1HOTA 1ZHHA 1CC1S 3M4XA 2ZIGA 3OUUA 3DZFA 4OXYA 3B1FA 4LJ8A 2IDJA 1UMBA 4G4GA 3OX3A 2R6JA 3NRJA 4QXMA 4UM5A 2FE4A 4D0LB 3BWYA 1D6NA 4HAXA 4ZZ3A 3ANMA 5ES4B 3II6X 1J7JA 3KPWA 1VPWA 1QM5A 1KP2A 1TU3A 5DTMA 3KXLA 4E46A 5AYVA 3OQMA 1SA0A 1RXSA 1SHZA 3FNGA 4OP1A 3IP8A 3ZHXA 4NV0A 4N7MA 4DM7A 4GD3Q 4ARZB 4RHEA 4Z9FA 2G04A 2VCYA 3DWEX 2XV1A 4MVJG 5E1BA 4CR7A 1P1JA 3ZXYA 1SPXA 3STUA 1H3NA 1KZGB 4LK2A 1Z15A 3AETB 5AJYA 4P92A 2PKRA 3MELA 3NTQA 5FF9A 3SYKA 3ZWDA 2OAEA 3VTKA 3I1FA 4QBHA 2I6QA 2V0NA 4FC7A 4CL8A 3DS8A 1QYDA 4Q4AA 3PHGA 4BO6A 2V74B 4NKRA 1Y48E 3AWIA 5F35A 1L9XA 2VQFB 2R84A 1V4NA 4EB3A 4OO3A 2YBEA 1HK7A 1ONSA 2B8WA 2NG1A 3WIOA 2FWJA 1SRQA 3Q0EA 4WJKB 3WWOA 1FP7A 5A4IS 5A3RA 5C5IA 3GH3A 1OAKA 4NF2A 1RHMA 2BMAA 1ZGHA 1YSCA 3RVQA 5JS7A 1MZPA 3ORHA 2BD0A 1JS1X 1CFZA 4GX1A 3ZVMA 3EHDA 5JXWA 1EP3B 4TV9A 3BA1A 2SKDA 1FYXA 1TA4A 2IXDA 2WJYA 3BIJA 3TOVA 3V7WA 4RWZA 4MSUA 1QDEA 4M6WB 3TR6A 3DTVA 1H9AA 1L4FA 4Y6PA 3CX3A 4ZZ0A 3TMKA 1BS9A 3MBKA 5EE5B 4Z4HA 2WM8A 1A27A 4KYUA 3QLEA 4F3KA 2FW9A 4C21A 3T1YB 2PH3A 4O1MA 4DB4A 1ZD1A 1KJJA 4IRXA 1E58A 3FN4A 1IPHA 2BWJA 1NQTA 1NT4A 4W5WA 3B6MA 4M86A 5E8RA 2YZNA 3CJRA 4CLXA 2Q4TA 5C7LO 3RT1A 3I58A 5BMOA 4G86A 1O2DA 2A9RA 3WLPA 3ZR4B 2ALJA 4ECAA 1E96A 2P2DA 2JFVA 3AFGA 5JE8A 3ZTWA 2FPIA 1S89A 1DC8A 1BEUB 4NVRA 1FDVA 4L6AA 4LHEA 1TCBA 3WBBA 3ACDA 3L7KA 4DJDC 2E4ZA 2KPOA 4KE6A 4LKRA 3QP9A 1LU9A 3P8ZA 2IYVA 4FX5A 2WFAA 5LA6F 2NNLD 1JQ3A 1T5DX 3CLHA 3KLBA 2SNIE 4OFXA 3WNCA 2F3SA 1A4XA 2PLFA 2QTFA 3L4BC 1EXDA 5CCBA 5I5EA 2J9ZB 5HFNA 1ZG3A 4F4HA 4MLCA 5JZOA 3OC0A 5B53A 4DC0A 5IZCA 2GJ4A 1F20A 3N0VA 2A1UA 3EIXA 3NHYA 3ROFA 1JDSA 4AYTA 1NONA 4MITA 2FDCA 2YOFA 2HU2A 2QRKA 2WUFA 3ADKA 1ESNA 3K9CA 4RJLA 4X8HA 4R71A 4DRXA 3A1FA 2G08A 5DJ5A 1HYBA 5KYUA 5TQJA 1U80A 1JQDA 1K1EA 1X87A 2J5RA 2WU0A 3MM4A 4TLMB 5KQLA 2RD2A 3NC0C 4O0MA 2WQZA 1V7PC 3VKFA 3W9YA 3SBDA 4P3KA 1MPXA 2ZBGA 1PWYE 4YI5A 4EI7A 3DOHA 2BMWA 3L05A 2CNOA 4II3A 4E08A 1XROA 3EXEB 5KVCA 1Y1QA 5KVAA 3PGKA 4RHFA 4C03A 3F6EX 2AXEA 3AZPA 1LBHA 3WQQA 4FFPA 2QROA 2BDUA 2IUTA 2OD7A 2WUGA 4PS0A 4CFSA 2YMMA 5L3QB 1VE7A 3CR7A 3H6GA 2D2VA 1KKLA 4TS9A 1EX7A 4PVCA 4BY9E 4BKOA 1S3IA 3H75A 4ZJYA 1YI0A 4RLQA 3UB3A 1H93A 2ZUBA 1HYHA 1IFXA 3CGGA 3H6KA 1UPUA 4KX5A 4ONEA 3WYFA 3GLQA 3WOVA 4AX8A 4D96A 1KGSA 1RWWA 1XTIA 2FZWA 2R3SA 4J0KA 2X3UA 2PR7A 3CX4A 3I23A 1DXYA 3AM5A 3D2AA 5CLFA 1CYEA 2PXCA 2Q3CA 2VPIA 3I72A 1KK0A 3TZKA 3S1SA 5CNIA 1FLAA 1DKQA 1QXSA 3HZHA 1LX6A 3MWFA 4DCPA 4G56A 3H4VA 3AF5A 1H6DA 2O3SA 3C41J 1G6Q1 2J8ZA 5AJWA 3QU2A 1E5QA 3RSLA 3DLIA 1FBTA 1Q3TA 2WSMA 3BMOA 2F2TA 2ODWA 4H0NA 2OB2A 3G2OA 1GGFA 2BY4A 2CW5A 3HYRA 3IXQA 4ZYLA 3O8BA 1HY3A 3AY6A 4YRKA 2IUUA 2C4NA 3GBPA 2HO4A 2GVZC 2HHAA 3AU8A 4OXQA 5F1PA 4E5VA 2PUCA 1PFGA 2DPYA 2J6CA 4JB8A 5DOZA 2RI0A 1XD8A 3KVOA 3WRWA 1OU4A 2CD9A 3DFUA 3JQ8A 3FF1A 2H2HA 3C7CB 4R9RA 4CMHA 4EBFA 2I3GA 2HYDA 4PZDA 4MI9A 3TB4A 3E7XA 2MINA 4ZYXA 1DKUA 5EOVA 1XEWY 2NUAB 1FDTA 3TM4A 3EMBA 3GRKA 2VP6A 3PVZA 3P9NA 3OCYA 2AGVA 1Z47A 2GRUA 2JATA 2WF5A 4PHHA 4JDUA 2QX4A 4QOGA 2ZJBA 3UXEA 3OSZA 3ZEAA 4FDMA 1KL7A 4KNVA 3LP5A 4DLWA 2BE9A 1ZK4A 2RB4A 3PFIA 1J23A 4KWHA 2PMCA 4WFJA 5EJ9A 5A4DA 3QMVA 2ZIUB 4DEYA 1QGZA 5ALXA 5H9WA 1Q57A 2YUTA 4GKJB 4C04A 3CN7A 1GCGA 1V6CA 3QXGA 1OTYA 2VCHA 2J08A 3LDHA 4JR0A 4YHBA 2G83A 5E9WA 3OT1A 1SHKA 3LX6A 2ZITA 2FEAA 1YZFA 3ROGA 1ZNQO 3VHLB 2DPGA 4H2DA 2FRXA 3IQWA 3TTVA 3QE9Y 1M8KA 2CHQA 2ZEJA 4NYMQ 1SAYA 2JIBA 4D43A 2TMDA 3TFQA 1MTOA 5FWXB 2FOXA 5LDDC 3LTNC 3E9EA 5TQ0B 1H4VB 2GEDA 5LWQA 2JFWA 4NBRA 4XXHA 3QBDA 5CYPA 4HEQA 1SB9A 4BJ3A 4DSTA 1R4MB 1QDLB 3AF3A 3EWSA 3NTLA 4JMPA 4MMYB 6YASA 1XELA 2B21A 3A05A 1G98A 2HMYB 1EK0A 4JZKA 3B6EA 2VHJA 2ZYGA 4MJ7A 2XHEA 3TUJC 4BVAA 3AVVA 2IS4A 3ETHA 3ZTYA 4MHSA 4WOPA 3ZQUA 5DX8A 2B5WA 1F60A 4RCVA 1ZAYA 1N6RA 2XSZD 4FZ5A 4JYAB 2WHXA 3R0ZA 1XDGA 4IICA 3SXPA 2PD6A 2JGEA 2O7NA 2H3HA 3IUYA 4ITVA 1KEWA 4MIKA 5F33A 5A6SB 3M9LA 5C51B 2R6AA 3G2QA 3QKWA 3K6SA 2XXAB 3FCAA 5EAIA 1MFZA 3F3KA 4BMVA 4D8YA 1KI1A 1Y5LA 2G06A 5DGCA 4M53A 4H1TA 3FTFA 4B2IA 2R7KA 4HTAA 4FBMA 1YB4A 2WBLC 1KH1A 5BSTA 1XA0A 5C8YF 5LUAA 1UBMS 1ZOSA 3LPAA 4BX8A 4ND7A 2QRVA 2EWMA 4DSZA 1ZJWA 4EM6A 3EQ6A 4Q7JB 1U0RA 2WJZB 5SY9A 2GN8A 3O4FA 4IL5A 3C74A 4MUAA 2VRBA 4NEGA 1JT9A 3GGPA 1AHNA 3W9BA 5HIKA 1XPOA 1JBKA 3NAZA 1FA9A 1ZWKA 2P8SA 1XP8A 2ORVA 3MWDB 4I55A 3MFYA 4MAFA 2Q7OE 4OMFG 4MKXA 1KARA 5EJ2A 1ATIA 1JEEA 3BM5A 3FDJA 3L6DA 5FPQA 2W6PA 3KV3O 3D3WA 3LHKA 2C95A 4HDQB 3SQDA 1KTVA 3IAM6 4YWHA 3PNOA 1XOIA 3P52A 1TYEB 1A5BB 1IQUA 3QENA 5G3YA 1X8LA 4FW8A 5JSQA 3DTYA 2BTEA 2QT0A 5EIAA 1MV8A 1M2FA 5JZBA 1GUFA 4Q3BA 2FJ0A 1D9ZA 2QTCA 1PYDA 4IXTA 4YEDA 4ITRC 4E2WA 1KEKA 2CXRA 3P9YA 4FNGA 1QSGA 1A9XB 2GOYA 2QRHA 4DRXB 4EFDA 5KYWA 2ATVA 4N5NA 1E7MA 3ZXUB 3EF0A 1SXJC 2J9FB 2H3EA 4M60A 1YDHA 3ZXIA 3VC3A 4FT4A 2HHCA 3BMXA 3EGEA 5C1DA 1G1AA 2X1VA 3KQOA 3L3BA 4DC1A 1II8B 2JH8A 1I3NA 1XRSB 3ESZA 3H11B 3LT4A 2OC4A 1OIWA 4W1QA 3SYTA 4DLXA 1C80A 3LUKA 2VHVA 4NNJA 3MWDA 2QYOA 4H77A 1R12A 5JH7F 1BX1A 4U63A 1YIOA 2R68A 3E15A 2P9EA 1UT5A 1DAPA 2BM1A 1N57A 3EDRA 2Y2UA 4HMOA 2OHIA 1F4PA 1UJ2A 4GUDA 4J6FA 3RLFA 2R7LA 2VNIA 3AZQA 4TXJA 5HPYB 1D0VA 2NSDA 1JKJB 3FFXA 3ILXA 4PS1A 3RADC 1GPJA 3L79A 4RYLA 4CDMA 3OQIB 1LTKA 5A5FA 1H22A 4TKLA 3N28A 4CU5A 5CITA 1CUCA 4JP3A 1EDOA 2RGEA 3NTVA 5SV2A 3RSOA 3EDOA 2NUPA 1I80A 3KWLA 3RTBA 1QWSA 3CVVA 1H9CA 1RXIA 4MB2A 1JLHA 3UJPA 4B47A 1WZEA 3L6EA 4IV0A 4RD6A 2WVJA 1M1YA 4HFMA 4EQ6B 1G8MA 1ABEA 3F5FA 5GINE 3DE3X 5KOYA 2HWXA 4DPLA 1FL9A 2PGLA 1PWXA 3KKNA 1FSPA 1AGXA 5AOBA 3IR7A 4G85A 2V97A 4CMKA 3CLTD 3STVA 4DCCA 1JDJA 3QW2A 1U2QA 3KEFA 1VJ0A 2G9RA 1JPVA 4PZCA 3S28A 3W7BA 4AY6A 4Z1OA 4G5FA 1SCNE 4I08A 2AWNA 2Y0BA 3TGWA 4RM3A 1MQ8B 3EBLA 3ILYA 4HMPA 4OF4A 5TPWB 3OAAD 5IANA 4X62B 2HR1A 4BOYA 2A9OA 2F1OA 3QYPA 4TYWA 3CY6A 3EC7A 5JJIA 2AYXA 2GGSA 3G9UA 3KBOA 3AUYA 2GH1A 3SZMA 1IU9A 5B4UA 5IS2A 1A4UA 4JA0A 1FBNA 2IU4A 3JZDA 2D5BA 3F2VA 3G88A 1A95A 4RK5A 3PC7A 1U6JA 1XTPA 4NATA 4RTSA 1T8TA 2PXHA 3CTMA 1PQWA 2XD4A 3KXIA 1D2CA 1FFBA 5K6AC 5KCZA 1GA1A 4C0WA 3OD5A 1Q3KA 1YONA 2V59A 3ZE0B 4ZYUA 1NR1A 3QOYA 4CKYA 1NU8A 1Q2UA 4MKGA 2JAHA 2YTZA 2JFYA 5MFPA 2QHXA 3EW7A 5AK3A 3D5QA 1ZA2A 4TL9A 3RHTA 2PJUA 1A4RA 1N5RA 4IKPA 4MPPA 4KR0A 4CWAA 3P4UA 1PT9A 4DR2B 2B0CA 3I5MA 3UG6A 2G67A 3AHHA 2FP4A 4IZIA 1DINA 2YX1A 5M29A 3ZWBA 3EYAA 1S2DA 1ZQ1A 2RBGA 4JP1A 3TQFA 4BLTA 5BMVA 5KQPA 2CNDA 1XKTA 3EZ2A 4CCWA 1U04A 1UZMA 2FZLA 4F8EA 4WUVA 2E49A 2PVSA 2QD1A 3FVTA 3RW9A 4BBJA 4F4FA 1NJ8A 4L9RA 4TMKA 4DCOA 3QH4A 3BB3A 2QXUA 4IOKA 5DT9A 1W73A 5IDVA 3SJBA 3WA7A 1OX4B 3M2PA 3O8QA 3HDJA 3TZQA 4RANA 3NRBA 2O1EA 3JD4A 3PXXA 1WVIA 3HLKA 3D1LA 3EGIA 4GHWA 4LYEA 4BP8A 1MX1A 2D54A 2VDPB 4L75A 3LRTA 3B38A 1E1QD 1EFVA 3FPGA 1V4BA 4L5IA 3WQRA 1HQCA 1KI6A 2Z2YA 2E37A 4W9NA 2AOTA 4TL7A 4YT2A 1KSGA 1I24A 3C4VA 5I48A 4Z3KA 4B4KA 1Q1EA 2G17A 2JNWA 4DZTA 1KJ8A 2NSLA 4ZP1A 5H7XA 1UXHA 1INLA 3A58B 1CUHA 4MEBA 3AV0B 4DWOA 4RGQA 1W5BA 4LHZA 1K7FB 1MEEA 4HNVA 4R83A 4TKVA 2R2AA 4EMTA 3B70A 3KYJB 4HDCA 3ILHA 3GCDA 5AJXA 1FP4B 2X9NA 3B60A 3NTUA 1XL1A 1KYWA 2F1RA 1MTZA 1W4BA 1XF9A 5HILA 5K1ZA 2I5PO 3QWBA 4Z9YA 4BNGA 1ZUIA 4L8FA 2DHEA 3GJYA 3BE8A 4WNAA 3HL0A 2GUWA 3L4EA 2KLBA 4JBYA 4L4XA 3UJ8A 2DUMA 2H4WA 4AYWA 1OWMA 4LX0A 4PLCA 4BKMA 4MZXA 1FSSA 1R5JA 4B6QA 5JARA 4D46A 5FYQA 4X1KA 1SB8A 1M2HA 1W5FA 4OB8A 1QIIA 5IAKA 5M2QA 3HA2A 4D25A 3ETGA 2VT6A 1KJZA 3R7NA 4C01A 1B8NA 4TV8B 2ENUA 3AI2A 4ZN6A 4YO8A 5CEJA 2ZWAA 5C9ZA 3UXMA 4L8GA 4YXWD 5HF9A 5JJBA 1F51E 2FFRA 3FRHA 1KYXA 1OBOA 1RLOA 2R79A 2WWHA 3GAMA 2B8TA 4RTNA 3GFOA 5DM4A 3RUDA 4KWTA 4RY2A 4PN7A 3FROA 4A3SA 4ARBA 5B5SA 2RGYA 1M74A 3RAGA 2HU5A 3UQYS 1Q77A 4RW0A 3I61A 4ALNA 3AEZA 1JA0A 3PU6A 3PA8A 5BUCA 1FYWA 3DLHA 4I5DA 1SBTA 3SQLA 3WGIA 4NBKA 1Y6JA 3SHQA 5C32A 3DULA 3QLUA 2BGLA 3ICOA 5JXIA 3C0KA 3O73A 1IAVA 2AHOA 5LFAA 1XJ0A 3F97A 3ONFA 4JUIA 3D5EA 5HMMA 3DLPX 1JJAA 3AHCA 3P9RA 1QMPA 3IIKA 4PSKA 3OZFA 3RFCA 3VOSA 5BVHA 3ZX4A 1E2PA 3OKCA 1K9VF 1FJHA 3S4YA 5B1YA 2JGLA 1JH8A 1NUTA 3HM9A 2IX3A 1H69A 2CKDA 2MYNA 2NYUA 1E6WA 5F73A 3FUXA 5EMNA 2EG9A 4RY9A 3KQWA 1MC4A 2JIZA 1SU7A 2JRCA 2W2MA 5E2BA 5KPDA 3KM0A 2BMDA 3KAKA 3V8PA 1UMBB 1U2PA 4H27A 3M49A 1HDCA 3PJGA 1RC1A 3OURA 4M2LA 2Q8NA 4HSEA 3D7MA 5BSMA 4XGRA 1P75A 1KHHA 1JL3A 1Q7CA 1Z5GA 2E4XA 3AVOA 5H68A 4IDFA 1T3TA 3N70A 1MIOB 3SQXA 4JJZA 2O6LA 1SK8A 4KOEC 2JH3A 3F1KA 1ECCA 1HE1C 3SN6A 4FEAA 4IDEA 1OXUA 4FNMA 4GNRA 4KODA 2HN9A 4MKFA 1J33A 3ORSA 3RAJA 1F0YA 5LBIA 2YWDA 4G1EB 4CF4A 4MQ4A 5LZ9A 2O54A 2J09A 1NUHA 4J0DA 1EK2A 4RXMA 4DA0A 1ZJYA 3DAOA 3U7GA 1RPAA 3B52X 1WMDA 3GGDA 4UDYX 2AMJA 2X22A 1U3GA 3K5PA 3BWCA 2A1IA 3H9UA 3W5BA 5AVSA 4DG9A 4KN8A 4EUSA 5EZYF 2QTLA 4Y98A 3BWBA 1VZ3A 2IYYA 3EVCA 3PWSA 1NURA 3IYLW 4MUGA 4TRMA 3I92A 3BTVA 1OI7A 2Q5QA 1CY1A 2N46A 1GNQA 2VP4A 3EEIA 3IBTA 3DL0A 4GMKA 3VPAA 4BX2A 1SK9A 1UQUA 3IDFA 3OVMA 3F9RA 4FR0A 3A6FA 2YWHA 4MWTA 5BORA 1N7JA 5LD2C 2ZM5A 1P18A 2EQ5A 1CU1A 4UU7A 1L5KA 4M0LA 1W0KA 3PI6A 1NKSA 1MCZA 2O8FA 2ZSEA 2NPOA 3B5EA 3FPCA 2FLVA 3DM9B 3KT6A 4YBZA 4H1HA 4LVCA 2YKGA 2A9QA 5JSKA 2ZYTX 3UJAA 2IUSA 4LYDA 2PGIA 4UEWA 4KGVA 4UU0A 1DCMA 3QGMA 4NAHA 5JMWA 5MN4A 2BYTA 3O95A 4W9RA 1ULBA 2I8AA 2BVNA 4BFCA 1I0LA 4KXVA 5T4HA 5EIBD 2PANA 4NPCA 3SX0A 4YQFA 2QZPA 1YV9A 2WI8A 3FI0A 4Y6QA 4WIAA 1YJXA 1NQWA 1EYZA 1OBHA 1KEZA 2B7CA 5ECWA 4R6XA 1NY5A 4IDNA 1H1DA 3AI7A 3IQZA 4ALMA 3TLXA 1KS9A 1SXJA 4RKRA 1B8VA 2WDZA 3DCNA 3EIOA 4MUXA 2IJGX 3KZOA 3M5PA 3UEOA 4BNJA 1E5LA 2OHXA 1WKBA 2I2AA 2C2BA 1UM9A 4N76A 3RCBA 5F7OA 3ZWQA 2HNKA 2I4TA 2JK0A 5ICEA 1CDDA 4G0NA 3O1LA 3G2NA 4FI3F 4WL0A 3ID6C 3MIIA 1HDXA 4YCDA 6Q21A 3U4HA 2Q3JA 1GQ2A 1OGIA 4OU5A 5G40A 2DXIA 2Y1KA 4F38A 1MX5A 1T3ZA 5JQGA 5LDHA 1WMFA 2A9VA 1U6KA 1E18A 1V16A 1YZYA 3QTBA 2XNDD 5U1PA 5KYXB 1VCOA 4FLEA 2VJNA 3TL2A 2VA9A 1R4NA 2GMWA 3E9ZA 3ADOA 3IIJA 4WD3A 5T6MA 2ZRMA 3HE3A 5BW8A 1RKUA 1TUGA 2XECA 1V96A 3GLHE 5BT9A 5HNKA 1JHDA 1R0CA 2R60A 1XMOB 4J2OA 2FPSA 4AWAA 1FIUA 4CTMA 2A3NA 4JX8A 1ZD2P 1NJ5A 3RYTC 2ZRGA 1BMFA 3D8UA 4Q47A 4O1IA 1YRWA 4DARA 3E7DA 3K9LA 2LR0A 4DLSA 1EFAA 4DDWA 3ZVNA 3PD7A 5JNWA 1SXGA 3OLVA 2IDZA 4L4UA 4OYRA 3RAEC 1OH6A 2GD6A 3EVNA 5DCUA 2MCFA 1LNQA 5GAJA 4MA0A 2JJYA 1OOEA 1HLFA 2JAOA 3PP8A 4G8DA 4DQDA 5KWVA 1ORWA 2VTVA 4QVGA 5A4MS 5HKKA 2WWXA 2HIAA 4BIMA 1K7EB 2B3TA 3A4NA 3OLWA 2LGJA 5FWYB 3WMGA 4L4ZA 4JJFA 4ZGBA 4N03A 2XQJA 1SCDA 3UJ3X 1HUQA 3OU6A 3FHOA 5DWQA 2X0EA 3GDWA 4S2EA 4UEJA 2QTMA 4FIDA 1MIHA 1WIWA 3DTTA 4WW0A 4K81B 5DASA 1IPEA 2WMDA 2FG6C 2LKCA 1C9NA 3VNSA 4F6RA 2PLAA 1CUZA 2K4MA 3L0IB 1FMFA 1UPTA 1XXHE 3V97A 3QTLA 5H1YA 1CW2B 4GKVA 3KQNA 1LSOA 5JJKA 4MRAA 1EUDA 2UYHA 3DD1A 4W1SA 1TEHA 3HNRA 2GHQA 3QKTA 4MRRA 4CM4A 1GQRA 1ESDA 3Q15C 4HDMB 1WB9A 1XZQA 3PX3A 4W63A 1UFVA 1ZNZA 5IBCA 2NM0A 1B14A 2YV4A 1X0VA 5J2UA 3BMQB 3BKXA 1NNI1 1YBVA 1CZOA 1R6VA 3R6GA 3E0QA 3D6FA 5AM0A 4DBLC 1DJMA 2QX9A 2J48A 3CSDA 4YR9A 4YCNA 4KHPB 3JQAD 4OREX 1JP7A 1VPTA 3MUEA 4LPKA 1R50A 4KUHA 4ZIRA 5LQNA 3PUYA 2GJKA 2QGZA 3A6EA 3INNA 4YPFA 3SJCA 1Y5MA 1MQ9A 3M1IA 3HVKA 1C8VB 1UDXA 1GITA 1T1RA 2PGNA 3WBFA 3ZIDA 1P81A 4Q3OA 4FTWA 4RLHA 3N9IA 3SFVA 3VR5H 3KQYA 4HWSA 4UBKA 1OZ0A 3VQTA 2JS7A 1NVMB 4MUBA 2I4OA 4WBNA 1JR6A 1FNBA 2A88A 5EPUA 2R9VA 4CIXA 3PEYA 5H3CA 2IBMA 521PA 1CZHA 2XDWA 5THKA 5E7IA 3FMPB 2ZS9A 3WMEA 1KIMA 1RMYA 2JLUA 3WQBA 1SPBS 3PCRB 3KK0A 4K9NA 3VBCA 1II0A 1Y5NA 4NMWA 4PYRA 1EM8A 1MD9A 3QVKA 3DVRX 3SI7A 3WHPA 2RH4A 4MK4A 3GH1A 5KQSA 4LGYA 3IVAA 4W9NC 4ZCMA 5FEMA 3T5CA 3ZHCA 4OLJA 5HQTA 1VCIA 1ZK0A 2FVXA 1H2XA 1WU7A 1XVIA 1ZICA 2H1SA 1DKOA 2KB0A 1SUPA 4MEAA 4TTVA 2LWIA 3FVWA 3ZX5A 1VI6A 4YJDA 1R18A 4AO6A 1SHLA 3VH2A 3FLAA 1PLLA 4ICIA 1U0LA 2RGGA 1DLIA 2HSGA 2YVKA 4ZV9A 1KPGA 1SMKA 2XE6A 1BDIA 1G0NA 1F2UA 4TMYA 3EDCA 1XN4A 4QQRA 5JRZA 5IH7A 3T52A 1SC6A 3P32A 1UZLA 3ENKA 5CA0B 1C1DA 4WCDA 3INGA 5D7BA 3T0FA 3NBKA 1C8BA 5TB5A 2PPVA 1T9KA 4ZOBA 3LDFA 1ZGBA 3FCCA 4P0QB 2VDQB 3QBVA 4K6GA 5PNTA 2R5WA 1QKIA 3ESDA 4U7HA 4EJSB 3W2IA 2WAAA 4IPTA 1R0LA 4Q3KA 1KK2A 4MCAA 5FBZA 4G0ZA 3ZPXA 4B46A 1G0OA 2DT5A 3OECA 1FDUA 2E82A 4C7KA 2UZIR 2EFYA 5GJWC 2BI8A 4PICA 3AFOA 3DVSX 1Y8AA 2Q28A 3PDIA 4QASA 1CLEA 3CE6A 1Q22A 3MLAA 1SZDA 1SBYA 1TO2E 5CIWA 1K4MA 4MGEA 2A1TS 5FI0B 1ONBA 4DA7A 2XMRA 1OJLA 1QYVA 3KS9A 4QTXA 3IUMA 1H0HA 3BQMB 2FWNA 1K5HA 4P1ZA 3HO6A 4PWZA 3EIUA 4G8CA 2B35A 2BTQB 5HS6A 4E3ZA 1U8CB 4KMOA 1H4TA 4IKEA 4UM7A 3MD9A 2AZXA 1AKMA 2GHTA 2UZ0A 3EMVA 3EWAA 5DTEA 4EF5A 3DE7X 1E94E 4L3VA 1G6HA 3V9AA 3AU9A 2R86A 1Q0QA 1OV6A 1QC5B 1OAOA 4CN8A 3EARA 1M6HA 4JXKA 5B6JA 1T0UA 3NDJA 5A3SA 1VL5A 4HR7A 1WBDA 2NUTB 1JLLA 1GV0A 1S2OA 2Q3BA 2VPQA 2HCRA 4LSMA 4TWIA 1EAMA 4WBNF 2QRLA 1CRWG 1ESEA 5BWBA 1HLGA 2CDBA 2FSSA 3OZCA 4L5BA 4UBJA 4BMZA 5KYTA 2DB3A 3V8QA 4ZQIA 2AQIA 2H06A 4YRPA 3FTEA 1AKQA 3MD0A 1DEXA 2C78A 3RI3A 5ITWA 1N75A 3F4BA 2QPLA 1CLUA 5ER9A 4FOOA 3U4DA 3LK6A 4ZEXA 1OHHA 2VPZA 4YAEA 2HPHA 1LB1B 1NQVA 1A5ZA 4AG5A 1PZEA 1DKNA 4Q4HA 1CIVA 1RR6A 1QB8A 1W5SA 2G0TA 3JYNA 3FPKA 3LYUA 4HUQB 1D5WA 1Y1PA 2EKPA 5FUYA 3AP2A 1K5GA 4F5EA 3R7FA 3K9FC 5L4NA 4AY2A 3LBAA 4XPIA 5C8DA 2N1BA 3P94A 5C53B 4IWYA 2SKCA 4BBZA 4XB1A 2XZPA 3RS3A 5DIFA 1LV7A 2WM9B 4MQLA 4OFBA 1NXWA 3GLHB 4G89A 5BN1A 2XB2A 4BVJA 2JHAA 3BA6A 1F5SA 1X1QA 1YHYA 2NUPB 3G8AA 4WOJA 4DMCA 1NRXA 4DMGA 3BT7A 4MWEA 1DPFA 4Z99A 5DM0A 1I5RA 3FMGA 4XTCS 1EQAA 4F0JA 1YOBA 3CVWA 2Q9CA 2ZB4A 3CVOA 3H8SA 3MYRA 1P19A 1G2PA 4S1OA 3RV3A 1U3DA 5HWSA 2QMHA 1GTMA 1CIJA 1DFGA 3LQ1A 4G4JA 2DBVO 4DB2A 4WOCA 2CNBA 3N2KB 3ROTA 1J5XA 4BNKA 1LTQA 1YA8A 2JCVA 1IK6A 1M1YE 3U56A 1CE8B 3EQZA 1FFWA 1IBRA 2NTEA 3FHCB 1AC5A 1GCAA 4NK5A 2HJHA 1V41E 4ENRA 2VR1A 1BXKA 1ZN9A 4HGQA 2EKBA 2CEAA 4R54A 3V3TA 5JCJD 4EPVA 1D2RA 1J6UA 1YZVA 3S2UA 1IRIA 1L5QA 1PDVA 4GPBA 4ENVA 1DMRA 1ZJJA 4XIFA 2W2XA 5SY6A 3TEMA 2VHUA 2Y1XA 3KEQA 1E7SA 1JYEA 2DCMA 2R6DA 3GJ0A 3M5WA 3KHKA 2OAP1 1TFRA 1VC2A 2G1JA 4F3NA 3ZHQA 2NVBA 3SJUA 3G13A 3CG4A 2IT1A 2XCIA 3I34X 1RHQA 1U4NA 1HPLA 1E32A 1JLSA 1NXQA 3JVDA 3H9EO 4GLBA 5TEVA 3V5NA 1YJCA 2OXEA 4E03A 4B3TB 4JLMA 4A03A 2XX3A 3WHIA 1KERA 1D6MA 2H08A 1BQ3A 3TSZA 2J3IA 4RFSB 1RMQA 1YRAA 4HN2A 5DRYA 1T5OA 5ECYA 3P9CA 3IESA 1R8YA 2AN5A 2J7PA 4D98A 3CB2A 1M33A 5KDLA 1WMSA 2BFDB 3HYTA 3AI1A 4NMMA 3H3FA 1ISRA 3UK6A 3RANA 4PFJA 4PRYA 1TKRA 3PE6A 2J30A 2Y0EA 2WABA 4PHTA 3DVLA 4UUNA 3U7RA 1NNSA 3QG5A 1K7CA 2H4YA 4WOBA 3QZUA 1FDRA 1R9NA 1YCHA 4UREA 4JDPA 4KPUB 3VU3A 4RLFA 2WHRA 2OQVA 1Y0BA 3M8KA 2EFJA 3VAYA 4CM3A 4CQLB 4DT1B 4GKBA 3ZDYB 2JFUA 1MO4A 5JU6A 5F9MA 2W11A 4OH1A 4OOEA 5D2CA 2C77A 3LSTA 4KRGA 4L3OA 4A8JC 2XXAA 4YJ2F 4PSDA 5FI1B 1Q50A 3EXIA 1HRKA 2D2FA 4XSHA 1CUIA 1STOA 1U2SA 4BPBA 2YR0A 2CB0A 4QFCA 4L9AA 4CG2A 1ZUNA 3L5OA 1ZX1A 1EESA 3EUWA 3OJXA 1N5MA 1JFFB 1UBFA 1OZGA 2FP4B 1ZNWA 4YP0A 4F4JA 5TV2A 1VJ1A 1CB7A 4MUEA 4UMEA 3AO0B 4M9XA 2C20A 3HJRA 4IFIA 4N40A 3VDQA 1CVIA 2C8JA 2D1TA 3AKYA 4R69A 2BEJA 4JHLA 3AKCA 3MMPA 4OD0A 4Y2TA 4B6EA 4X1KB 1YQGA 3JYLA 4PSAA 3P2KA 4QGHA 1TM7E 1EE1A 3FYUA 3HA7A 1EP2B 1UJMA 3ZV4A 3X1XA 4F4IA 4FJ1A 4Y2XA 1IG0A 3GNLA 3PFFA 1PFKA 3NATA 3TSOA 1HBJA 3DLCA 3I52A 4P0TA 1VG8A 4J16C 2PZEA 2OPHA 1IBCA 4C2BA 2QRUA 4H3HB 1IY8A 2ODNA 4MTLA 3SM9A 2C3YA 5ENVA 2FPIB 4CL2A 2PZFA 1YDEA 3DMNA 3HLYA 1F6WA 1H85A 1RJWA 2AVNA 3LBNA 2AT1A 4LNHA 1CY8A 1SKYB 2CLOB 4XEHA 1NAHA 1N0UA 1XTKA 2BAGA 3ZWKA 4F92B 2PMWB 3UMMA 3EXHA 2PGAA 4DXDA 4QDTA 3BILA 3HCAA 4PZ9A 3IBCA 1T0HB 1R3DA 4N3AA 4MGHA 5CX4A 4KO3S 2RJNA 3L6UA 4J4HA 3A9VA 4XPZA 1NXTA 2QUHA 1QIFA 5E7QA 1G9XA 1HZZC 2ID9A 3TLGB 3R3JA 3Q8XB 2A0KA 1AK2A 5BNTA 2VIIA 3M33A 1U4OA 1VOTA 2A1TR 5DYGA 1WU8A 2F64A 1X1EA 4ZTBA 4OX9B 1N2JA 6NULA 1ZVJA 1HT2E 3TCKA 2PX0A 1GR0A 4EA9A 4EWLA 1SWWA 4FFRA 2C5SA 3U7FB 1HE2A 1SUEA 4DQKA 4MUKA 2I8CA 2IV7A 3G6WA 2PUWA 5F4ZA 3JQ7A 2AE2A 2NN3C 3KR0A 5KWSA 2CHGA 1BXZA 3DH0A 3H18A 1E66A 4MIOA 5THQA 4JNCA 3B13B 5IK2D 3J7AC 2BSXA 2NT4A 3KTDA 4DJEC 2ORYA 4OMDA 2QN1A 2ZRNA 3KSAC 4P3YA 5KSOA 1Z08A 4FDUA 2QPAA 2ZBDA 2D5LA 3CH7A 4I1YA 4J4TA 4LZWA 2Q6OA 4LY6A 1MMFB 1C7ZA 2GAJA 3CF2A 3Q6IA 4R01A 1GNPA 4O4JA 4UAVA 3TUIC 1Z4NA 1V1MB 4O2BA 1BHJA 2W37A 2HF8A 3V33A 3R3WA 4BRSA 2XPCA 5DXAA 3VSCA 4GPZA 3RPEA 3B3GA 4MV5A 2GK6A 2C2MA 1OYYA 1PYOA 3ESAA 3M83A 4FSHA 5CDHA 4DDKA 2FZKA 3EGWA 3MQ4A 3I4LA 1BYUA 4ZVMA 3S8EA 1IQ0A 4PGAA 1TQ6A 2NAPA 5BSUA 1MHTA 3TE7A 4AJPA 2YNMC 1M2JA 4M89A 4CE6A 4XWOA 5LQKA 1IUKA 2QL6A 1K6IA 4O2LA 4TTQA 4GKKB 1CDEA 1VFPA 1G5PA 1V3VA 1XZKA 3ME5A 4RIGA 3ZQJA 5AESA 3IS3A 2X41A 2AJDA 1R15A 2AOWA 4AK9A 1S7GA 1SVKA 4UDXX 4ZQBA 3JX9A 5BO5A 1AY0A 3MZ0A 2HF9A 3ITKA 5TPWA 4HG2A 1AUOA 3VYWA 3T7CA 1CKEA 2DWCA 5I9LA 1M6EX 5I01A 4X9XA 3E0XA 2XMSA 2P75A 2W71A 1ST2A 4OOFA 4HNAB 3VYRB 1GYRA 2W6OA 2AB0A 2AX3A 3N58A 3OFND 4XFKA 4BQRA 2ZVJA 2CLIB 4ND8B 3QI7A 1YRYE 4RXUA 2GD0A 1PQYA 1YBFA 2UKDA 4ZVRA 1KVTA 2XTAA 3FVQA 1O94D 1QIHA 4IMJB 3VJLA 1VLZA 2FGJA 4BP1A 1OMOA 2QMQA 4IGFA 4M7WA 3U3XA 3N7TA 3MS4A 3K9QO 3OICA 4HN4B 5JUWA 1FUIA 2ZW9A 4UCFA 2X5XA 3TQSA 1YQWA 4Q4DA 3ZIAA 5DLDA 3WJAA 2FZ5A 4O8ZA 3GMDA 5KOHB 3W4JA 2GEFA 1R8QA 4JLSA 2FOIA 4XUDA 4CGYA 4WJLA 1RNLA 2JZCA 1MZVA 1QBGA 4ZQEA 5GP1A 2I7VA 4B82A 2P0AA 2XT9A 3T1VA 4ML3A 4ZYZA 2CFTA 2N47A 1CY6A 1TQDA 1ISPA 2ZKLA 2IXAA 4GE0A 5K8UA 4RTJA 3FF4A 4K2AA 4FSXA 3T7KA 3ESYA 4ZVSA 4BXOB 3PXDA 3QXSA 2C4MA 2I34A 1Z12A 5I9IA 1CJMA 1FS4A 4KU4A 3E23A 5LZ8A 1EA5A 2PRZA 5P21A 2BH2A 1XZCA 1JDBB 1CQPA 2ZDGA 2IZ6A 4FXPA 2NP7A 2XB4A 4X45A 4CM8A 3CO0S 2ZE7A 3DD5A 3N74A 4RVDA 4Q1CA 1TUIA 1NOKA 2C98A 4XX0B 3IVRA 1FQOA 1XVAA 5EESA 1ULUA 2GO1A 2I87A 3KZCA 3QFSA 3T7DA 3V2UA 3W6UA 3RYCA 3A26A 3NJ8A 4KR7A 2FVYA 2RG7A 5ICFA 5TJHA 3RS4A 2UZ4A 2I78A 3VX3A 1DQZA 1SG0A 3CUWA 4UBLA 3W1WA 3NIGB 1WY7A 1J8VA 1E59A 2B6NA 2HDHA 4QGAA 4B6RA 3IOYA 5IVPA 2YY6A 2CDNA 1ISMA 4Y0AA 3RRZA 1Y1KE 3SNKA 4A15A 3FHTA 4C4RA 1W6RA 1AK1A 3H04A 3OHMA 4L6IA 4QLBA 3FYSA 1P5HA 3QX3A 1FVHA 1UFKA 4TM7A 4JLBA 1CP3A 4UTZA 4PLHA 4WQMA 4PSUA 1VP3A 4FE4A 1JGTA 1P1BA 3WIEA 3CUSA 4JOBA 4LCJA 3I62A 4Z7NB 1RP7A 3Q5EA 1SQFA 1DRJA 2ZE5A 1V16B 3GRVA 3I2YX 3MCTA 1LEHA 4MDEA 4O02B 3KSRA 2QTWB 4GR9A 4MP3A 1N4AA 4QOJA 5DH9A 2XRZA 3DL4A 1JEDA 1G7RA 1KY2A 1QYWA 2C4UA 3IEUA 4G5XA 5JYCA 4HQ0A 1O96A 2P4SA 4DQVA 4P7KA 4K6MA 2IYEA 5BMVF 4INAA 1L8QA 1SNYA 1AMNA 3O31A 1MO6A 4NWIA 4J29A 1NC3A 1XA3A 5GPBA 4BCDA 1W85A 1XZNA 2D2IA 1E64A 5AP9A 1FMTA 5CA1B 5LYJA 3Q3CA 1SUAA 4UHDA 2IP1A 4G9GA 4IMRA 3UWDA 2B6HA 4O4JB 3A2MA 1QUFA 3DJYA 3ZZTA 3UENA 2YC4C 3EISA 1C1HA 3JATB 4YROA 5CEFA 1IWPB 1FTSA 3ZKAA 2ZJ7A 4Y3UA 3DBLA 4OBEA 4Z54A 4C4PA 4BNHA 2JIOA 4AN4A 1XQYA 4R0VA 2I4NA 4BNLA 2G80A 3TQOA 3HJGA 1IJEA 2LE0A 1HG0A 2VUHB 3D8BA 1KNQA 2ERYA 2QW8A 3EXG1 1UDRA 5A05A 1TUEA 1PK8A 2AKYA 4HUJA 1GTZA 4RHUA 1BC5A 1E9EA 1UBKS 2MSWA 4QWMA 4TLAA 5FH9A 2GZ3A 4HB4A 2OILA 2X2FA 3ANLA 5D8DA 4EJ6A 3C7DB 4YREA 2I7DA 4JI6B 2VHZA 4NCAA 4C05A 3E7PA 4H6WA 2XNKA 5GGYA 3NMUF 2PT7A 2M6LA 3B3FA 1PAUA 3TKYA 4YYZA 2FMIA 3G82C 4WEQA 1H2YA 1E63A 2DU8A 1Z0SA 3GT7A 2O57A 2W98A 4MLPA 4U7JA 5DM70 3NJ4A 2Y27A 4R8VA 5FWDA 4EZIA 4D57A 4B6GA 2QPOA 1PU2A 3DF7A 2IHVA 4ESOA 3N6VA 4HAWA 1UWVA 4JLVA 4LF5B 3QMPA 5HGJA 1YQTA 4QX6A 3R3YA 4LHWA 4RESA 421PA 2AN9A 4F85A 4V38A 3EZLA 1JWAB 3WK8A 1QK3A 4FDLA 5LQDA 4I5FA 3OLQA 4ON9A 1JTEA 3DHVA 2CE2X 3NHSA 3QX8A 4Q3CA 5TR9A 3GMIA 4KBFA 4N5IX 5HYVA 4JGIA 1G291 1HNNA 1N2OA 3H3JA 4U9HS 3RK4A 3RASA 1VXRA 4YCAA 2E85A 5IVIA 5KWJA 4KCGA 4N0QA 1TM5E 4Z0NA 2A5FA 2AUTA 5HFAA 3U2QA 5A4KA 3EX7C 2XTJA 2X9GA 3DFZA 4LNAA 3OPVA 5BYAA 4RS4A 3IAFA 1R8SA 1PRYA 2H52A 4MV4A 1H3EA 4BECA 4UPEA 1XTUA 1QFSA 2KE5A 3EFHA 5ARDA 1GA6A 2O3RA 2ZWOA 3A0RB 3T9EA 1H0RA 5HK9A 3VNUA 5DM2A 2AYYA 3TQTA 2V6IA 4F3TA 3D3KA 1BRTA 3OT1B 1L1FA 1A9OA 4MUNA 2JKZA 1D2GA 5CAEA 1ZMTA 2AS0A 4L8WB 4UZEA 1N78A 3FIUA 4LQLA 4YX9A 2R66A 2L2QA 3O1JC 4JBXA 2DQSA 1EQUA 1F8YA 2EKLA 3A1NA 3L8EA 3TAXA 4QEKA 3Q5DA 4YHHB 3MC1A 4FKMA 1L4BA 3HB0A 1SUCA 5REQA 1H9BA 1WNFA 3B7GA 1C3JA 1ZVMA 4H3KB 4R98A 3QKUA 4L28A 5K4AA 2W2KA 4AUEA 1QZXA 2BI7A 4X65B 4OQQA 3OOHA 5I9TA 4JJ8A 2C2XA 2EBFX 1OKKA 2I0FA 4RV9A 2J46A 3IE0A 1U2EA 3H83A 3N2KA 1Q1BA 4M38A 3H0EA 1O95C 4PONA 4PXYA 4WASA 3BQ9A 1SCIA 3TOSA 2GPSA 4M0DA 4LYJA 5H3HA 2CJXA 3GB9A 2ZGVA 4H6XA 4YRNA 3C3DA 5CXXA 3RHZA 3HU1A 3R75A 4JXZA 3GR6A 5FTLA 2WF9A 2OZLB 1R9MA 3CFYA 4MZDA 4PN3A 1T4BA 2XUPA 1X7WB 3ZDZB 1B2LA 1DWUA 2YJZA 1FLVA 3KV1A 3RBAA 2E4WA 3MXTA 3EF3A 2C7BA 1VMIA 1PP4A 1G60A 3HWRA 2H1LA 2QORA 4DQUA 1PG5A 3KC2A 3IEKA 4LKOA 1G9SA 3A31A 3R9IA 1SVUA 4F8YA 3GFTA 4OXKA 4A92A 4RZ3A 2HRZA 5BNIA 4RM2A 3IE1A 2EDAA 4II7A 3NVKI 4QUHA 3ASVA 4EB6A 5BN5A 4OVKA 5D3MB 5J63A 5DGHA 5EY5B 2QN2A 4QBTA 1WF6A 3L8DA 1ISJA 2GVNA 3GAAA 2UUPA 5IJ9B 3S2YA 1DBSA 3ZHUA 3R74A 3I5AA 3ZBPA 4BNNA 4JI8B 2WWRA 3PF8A 1BS2A 2BUBA 4DV5B 1A88A 4OGLA 2C7PA 4LHSA 1E6MA 4V0LA 3SYMA 3ASZA 3FPBA 4EIWA 1EFUA 1U7ZA 2CK3D 3VGJA 4UOZA 5LMZA 3Q8KA 5K3BA 2CCGA 2HV9A 2WUVA 3M5DA 5K0SA 4BKQA 2DQ4A 1GUAA 4INZA 3CIOA 2AZTA 5J5CA 1Q0HA 3I9OA 1J0CA 2O2GA 5FLYA 3GEDA 4FW9A 3MHTA 3EZ9A 2RGBA 3VNVA 1YJ5A 1RPNA 4KLRA 4MGKR 4NS4A 2Q0QA 3JZFA 2R8BA 4BO9A 2QRVB 4BGIA 5DNAA 5GJVC 2H4FA 4FFWA 3WYEA 4ZQFA 1NI4A 4AJ4A 1V7ZA 1RXCA 1PW5A 4UKDA 3GRYA 3TECE 4RKQA 5A5EA 4IVNA 1GPWB 2V5VA 3A6LA 4ZO8A 1Y3BE 3NPAA 1AX9A 4RPJA 3M4ZA 3GVXA 1W9HA 4ALIA 4ZK2A 4U3JB 1A0OA 2WHYA 1MPTA 3JQQA 5LB4A 1L5RA 2QZ9A 2X8AA 4L5JA 4P93A 1D8AA 1DDGA 2AKEA 2RH5A 1VKZA 3L8CA 2FPLA 1IPFA 3Q1KA 2YOGA 3QBEA 4PC3A 2YWRA 1O97C 2V7WA 3A10A 3I2IA 2IOQA 2D2XA 3GIWA 1OH5A 1BKYA 3FBTA 1B6RA 2Z58A 3GN1A 4BN5A 1L4NA 3AOGA 2OZPA 2WAOA 3FNRA 3WKBA 3FGZA 4QO8A 4IQ0A 1U7DA 4WK4B 5COAA 5A3VA 3HYLA 1OU0A 2QTHA 1L8XA 2FK7A 1K89A 4UTXA 3OCUA 2IGTA 2M1XA 5A9RA 3RS9A 3LNTA 1P5ZB 3I04A 3C6ZA 1P31A 1CS0B 3EA4A 3QVOA 1NX6A 1C3OA 3NALA 2QBYA 1UK6A 3OX2A 3CPJB 2RKBA 2JLRA 4B7CA 2LXNA 3O90A 4EA6A 2WOOA 4HX5A 5BNZA 5GVSA 3GBSA 1HYEA 3EAGA 2X7XA 1KBOA 2ADMA 3M6MD 2RONA 3K70D 1QRTA 1T3HA 1NVDA 4KLCA 4KREA 1P4SA 4JLDA 5U4XA 2WTUA 2RHHA 1GADO 1WRBA 2XWQA 1TM1E 1F1BA 1SURA 1I4DD 3HUTA 4RGYA 5HM8A 2PEYA 1XZMA 1PN3A 1Y9AA 2HU7A 4I5GA 4MWBA 1UADA 2AG6A 2ZUSA 3I3OA 3UMGA 1XWIA 2YCLA 4K46A 4MYDA 5L95A 2MMCA 2P6MA 2XVYA 4KYVA 4XB6B 5YASA 3R1IA 4XIJA 2PUBA 4HAVA 3THOA 1S8OA 2HFKA 2B4AA 1V1MA 2AFIB 4O4HF 2IZZA 1Z22A 1D0IA 2PWYA 4MW1A 1SC3A 3L7OA 3QFCA 3RAFC 3H7AA 2QI9F 2XYHA 5HQJA 1GNLA 1JHAA 1OXMA 2P69A 3AYZB 4TXLA 2XDQB 2XOXA 1E2EA 1V47A 1EVQA 3C7KA 2PSFA 2GJ8A 1AKVA 4G0UA 1JSXA 2FE1A 3GZNA 3IVGA 1ODLA 1WMAA 3U19A 2QA5A 1N1GA 1X7GA 4JVNA 4LRWA 3EVDA 3NIBA 2NP6A 3W2FA 1UP4A 4R31A 4RPCA 2GHIA 4JNKA 1LW7A 1Q0ZA 1ZUD1 4U6SA 4BO4A 3TF5A 2VXBA 2ZSBA 1RJEA 3PT5A 4LV5B 5ALUA 2W2LD 2WAMA 2G63A 2CHUA 3CRMA 3ROQA 4D42A 3ND9A 3JQAA 5DTQA 2B99A 1XZHA 4QECA 4TTAA 1R0ZA 2XNHA 2YFYA 3KIPA 1ILEA 3PBKA 4I2NA 1E3SA 1RD4A 2YWEA 4K5QA 2CCKA 2XE8A 2RC6A 4YRDA 4P36A 1DMSA 4M87A 1JEQA 1LPOA 4HGPA 4H15A 2OYCA 1N6LA 3HWWA 1S4QA 1USKA 1JJ7A 2HXSA 4HLDA 3NTOA 2CXTA 4R9NA 4RV4A 4AS2A 1BFKA 3WK4A 3JVUA 3LO8A 5AVZA 2AFIA 2DERA 3HGQA 3VO1A 5BV0A 5G1NA 1GWNA 3WGHA 3HCDA 3RM3A 1GGNA 2MMGA 2QN7A 4URFA 3ZNNA 4ARUA 4BAGA 4RMNA 1QONA 1HTWA 1TC1A 3RE1A 3DT8A 3UH1A 3QNMA 4J0GA 1H8HA 4RBNA 1HE4A 3ZIUA 4FYXA 1ITZA 4I3GA 4CFYA 3ROXA 4UTVA 1B26A 5KB3A 3U4CA 1M2KA 1GZ6A 4YAUA 2JFFA 2AG0A 2SHKA 3WQHA 3JD2A 3OO0A 3AVUA 4LDQA 3LCJA 1VKNA 1WSAA 4IF6A 2IY8A 4M0EA 5IWCA 5LJLA 3MWGA 2C94A 3CUUA 5ALFA 4N41A 2B1IA 2P6RA 1QMGA 3G8DA 5BT8A 1S3GA 3VOAA 3TZLA 1T8YA 2FWPA 2ZROA 1MENA 5DU2A 1NASA 1R3UA 1W0KD 2OENG 3ENWA 3RVBA 3HJAA 6LDHA 3AUSA 3LKDA 4M8NE 2DM6A 4AMBA 5LLTA 2IZ1A 1H8ED 3KXDA 3LPLA 1T0PA 2HJRA 5M7EA 1QQAA 4G5GA 4X7PA 4D81A 2CBZA 3RSCA 4BRWA 2B34A 2AMFA 1HNWB 1CUEA 1YZHA 3VR0A 2JFHA 5JNVA 1ZM9A 1MHPA 2I55A 3AF4A 3TLGA 1HLPA 2HZBA 2Y71A 3A3NA 3AR3A 4DHWA 3G2MA 4B4UA 3BH0A 4DN6A 2DJIA 1M2EA 1XDBA 2V1XA 5GWXA 2QOEA 4UEQA 4BRZA 4O59O 4BGDA 1IZ8A 2L19A 4II2A 4UAUA 3FX2A 4MA5A 3CINA 1RMTA 1KTIA 5AKHA 1PFVA 2Z56A 4KK4A 1JXQA 2YHSA 4A36A 2BFCB 3BHNA 3I2HA 5LZ4A 5KX5B 1L7QA 1JPUA 2JGJA 2V6JA 1JKJA 4P22A 4QXRA 1PL8A 1O58A 1M8PA 3S1LA 2VQSA 5C80A 4AQ7A 3WIBA 4P7GA 2QG9A 1P7CA 1SZCA 4JI7B 2BEWB 2ZR0A 5K8CA 2LDXA 4JCCA 2FCRA 3TOXA 4ZHQF 5LXTA 3FI9A 1J21A 1FC0A 2GAIA 2PGOA 2O50A 4J2HA 1LJLA 4H7IA 4N9QA 4TUYA 5HXAA 2CJYA 3MINB 1L8AA 2X0DA 4MWSA 4MKIA 1Q17A 4MUHA 4URHA 2YC2C 3M6FA 4JKYA 5IHPA 1R6AA 2J5BA 3D3NA 4HP8A 3K7EA 5JAOA 3I9LA 1C3OB 2QBYB 2F00A 3D7SA 3KD3A 1SQ0A 1IIRA 1C9DB 4F5DA 1BW9A 4YCMA 3FYUC 5K51A 3RS7A 1CJVC 3THSA 3AL3A 4GL2A 4QTUB 4XKJA 3GRRA 4E4TA 4UXHA 4CF5A 1U0NA 2GDJA 3IAAA 5DYWA 4F3RA 1KJ9A 1OI4A 2P4EA 2CLDX 3OO1A 5H82A 5D01A 1Q2XA 1HMYA 2JEZA 2HK7A 2WFZA 2VPTA 2ZTLA 3DZGA 4I1SA 4RFVA 3Q2OA 4M1OA 3TE6A 4CEJB 2Q41A 3TTSA 1W75A 4L76A 3T41A 3P2EA 2JJ8A 4MCJA 3B2NA 5JMOA 3UJ9A 1J9ZA 4ZHSA 2VHEA 1SBIA 1DX6A 1M8JA 2KJQA 2P67A 1VKJA 1XU4A 2C03A 1IMOA 3BB1A 4GMXA 1MT0A 4ZEOA 3T54A 1WCIB 1YMQA 2RAVA 2XEXA 3KAJA 1J8DA 4KQ2A 3VNQA 1TAUA 1IN8A 4CTKA 2MYPA 4OXXA 4FXOA 1ZM2A 1A4IA 1JG4A 2JIDA 3EC2A 3I1YA 4WEOA 1ZU5A 2J3MA 5ELMA 4I46A 3C4JA 1M6WA 4BNVA 2DHQA 1OR8A 2GPWA 4TKUA 3VI4B 4UUBA 1XCMA 2REXB 3BXHA 3G9TA 3ZE2B 3LOQA 3NH6A 5GOTA 1AN9A 2ES4A 2W8BA 3TQHA 4NK4A 4GQAA 1X94A 3KJGA 4F9EA 3AHDA 2XR1A 4DADA 3IOEA 3PRJA 3SXUA 3AEXA 1ADJA 4FBGA 5ALJA 4YT8A 2R44A 1TRHA 4LVNA 4RU1A 1E2DA 4IS2A 2YY5A 2PMFA 3O2JA 1RVDA 3E8MA 3RGGA 3ST7A 2XWSA 2AJ8A 4KQFA 2ZIVB 2V7VA 1K6EA 4KGZA 2CLHB 1NR7A 1Q0LA 1RAAA 4HPXB 2QJRA 1QIEA 2EL9A 4GSLA 3BK2A 1P8JA 4EMBA 5JV5A 3UG7A 3WL6A 1SXQA 4N82A 4YJGB 3LQKA 1AB5A 4EHJA 1PWEA 2N75A 2ZK7A 3KALA 3L7AA 4YNBA 1WZIA 3NU1A 3RQSA 2BRUC 1JHVA 3ITEA 2R0QC 2FF7A 5ITVA 5A6VA 5KNDH 4WPGA 3UWKA 2WR8A 3NHLA 5EPOA 5L53A 1XK7A 1MRZA 2MSKA 1X1DA 1TJPB 3SDSA 1U81A 2GPYA 5K3FA 5BPHA 2OHHA 3AUAA 3ROKA 1AE1A 1H2WA 3LIPA 5J4LA 1GCIA 4XCVA 1C0LA 1E1NA 3ZV7A 4EAQA 2CJWB 4YV0A 4YMWA 4E3WA 2QLMA 5L40A 3HJNA 3EGOA 3JQ9C 5CVEA 1U7PA 4NCJA 3D2BA 1YVUA 3HVIA 3P4YA 4G81A 5CVDA 1SC9A 5E1MA 3RC2A 5DSZA 3W05A 3U44A 3QVUA 4GDMA 1PFUA 2AK2A 3NDPA 4EEXA 5K0CA 2J32A 3KQUA 5DKFA 4ZEMA 1V8DA 2C4KA 4Y2GA 1UF9A 1YK1A 4GYWA 4C4SA 1CQIB 4LJLA 4JB0A 3BH7A 1F2DA 4KAFA 5G0SA 4ZK6A 4ZDIA 5HE8A 1RI1A 2EWWA 1I2CA 4JELA 1DTWB 2C9OA 3T4UA 1LLQA 2I22A 3TGPA 3THYB 1TM2A 1UKCA 2R8RA 5EN4A 3G5LA 4WX2B 1XN1A 2C07A 4OHMA 4PYLA 1SC4A 3REQB 1HE5A 5FNVF 4CFZA 5BSRA 3U16A 4IM7A 5J40A 3PUWA 2UZAA 3CVXA 2J33A 2QRMA 5DNCA 1NNEA 2I54A 2ZTUA 5JJ5A 1USGA 1VIVA 2X4GA 3CU5A 3W8NA 3OQHA 3FJ1A 2OBNA 2RJOA 4YDRA 1L5VA 1OWNA 1JSZA 5ELLA 4BJHB 1YZQA 4BVLA 3EG9A 1KF0A 3EA5A 3O9VA 4A73A 2XUAA 1G5RA 3PK0A 3UYLA 4KRYA 3ECAA 3HR4A 3NHJA 3LZ6A 4NAUA 1UJNA 4CXMA 1NVFA 2H1WA 2P1RA 4NICA 1M66A 3C70A 3PGVA 4P82A 1KDVA 1Q0UA 2DT8A 3AIIA 3WWDA 1IVNA 4C0LA 2HSWA 4GVLA 2Z2ZA 5ES3A 1KDTA 2I91A 2VBFA 2QP9X 2G88A 1HSZA 4CKCB 5KYYA 3ZLTA 2V5AA 2LTAA 3NTRA 2ATCA 4XJXA 2I7CA 1S01A 4CV1A 1XXLA 1KZ4A 2UVQA 1P6XA 5CA1A 5FULA 4JLPA 4JJGA 2PQ0A 4JGBA 2YIMA 4JU9A 4LBVA 1WEKA 1D1QA 1FSGA 5K0LA 3CF4G 5BYJA 3OQ1A 3IOBA 3JD1A 4BVGA 2JL1A 3P0EA 3T35A 4Q4LA 1XDUA 2PVPA 2A59A 1YVRA 4DQ0A 4HPJB 5ISMA 5DLPA 2EU8A 3V32A 2QV7A 4PQGA 1QHHB 3IKLA 4RK6A 3NBFA 4WXHA 1L5LA 2B92A 4BEWA 3V48A 3U3MA 3U9SA 5ERXA 1N3BA 4K8OA 2KQUA 2NSHA 4R8KA 3KDSE 4OSOA 4UU1A 3X3HA 2PZLA 1TZCA 2BBTA 5EEHA 1ULZA 5B3AA 1UMKA 4RMHA 4XFDA 1VBNA 3KELA 2HMSA 3ZI4A 2PX2A 1AHPA 2WFLB 4HWPA 1T2AA 5HHTA 3NOQA 1MXHA 2OG1A 4GOJA 4Q0MA 3D4PA 3L18A 1RWNA 1N92A 1L5MA 4QULA 5F52A 3S27A 4B7XA 3W2EA 3WYNA 1RZUA 1Z0JA 2LV8A 3KT3A 2VRNA 1JG6A 1ZJZA 1QH0A 1JKXA 2P90A 3ICPA 2NQ2C 3O94A 4PNPA 3VR5A 1KQPA 1KY4A 3L6OO 4GR4A 3KSDO 2BGMA 3C7AA 2R7NA 3PNYA 4PYQA 4IJQA 1ZRNA 5I9MA 5U9CA 3NP7A 5BP7A 1CDZA 3CQ9A 1KNXA 3IP7A 3U26A 3L7CA 4OXRA 2I33A 4OL9A 2ODAA 2XXJA 5E3IA 2EKQA 1DUSA 5IK2A 5JAIA 1E79A 2AN1A 2EW8A 3RS8A 3GU3A 2ZRFA 3WDMA 3ZVLA 2QPTA 3BB4A 3Q0IA 5B7GA 2XUQA 1NQUA 4E2FA 5A03A 5GONF 3DHNA 5JHGB 1II9A 1FU8A 4BPRA 1UODA 4MYTA 2VSFA 3ELDA 2ZTMA 3W2GA 1ML4A 3KQHA 1L7BA 3D0RA 4BVKA 4CRWB 4EYOA 3P9QA 4DVGA 2J9YB 1TO1E 2G71A 3F96A 3JASA 4LWPA 5JS2A 2JDIA 4HTFB 5JCPA 3CTPA 1WJGA 3L7LA 4HDNA 2FR0A 2REOA 2G09A 1CETA 1X2BA 3LI2A 1ZP6A 4LBYA 5KOHA 4MULA 4EKIA 1RWKA 1TYDE 1UZAA 1Y3FE 1Q91A 4ZCTA 2EHDA 3JVIA 2X19A 3KO8A 3ZLVA 1ICIA 3SLKA 4YFVA 3E9NA 4ANFA 1LK7A 2V9ZA 4JQZA 4ARAA 1NI3A 2Q7XA 4IV5A 4W8HA 1IK4A 2B7LA 1WMBA 2R00A 3DOUA 5JEEA 5JSHA 4P3XA 2FOLA 2WJ4A 1JHRA 3EGCA 1WETA 4RFSA 4F4UA 3IT0A 1SHUX 2PKXA 4QU5A 5EZ5A 4ARCA 4CN9A 3COJA 1E61A 2X1LA 3T4XA 5KINB 5ILQA 1XCJA 2GWRA 3QBTA 4UFNA 3D81A 4Q5IA 3BFKA 3ZCXA 1WEHA 2R8PA 1VIDA 5C5DA 4U0JA 2O7QA 4J16A 4PAMA 3PQ8A 1M1YB 2I2XB 4XWTA 3ONNA 4L73A 4XX0A 4A10A 1PJ4A 5C34B 2CNNA 3K2IA 4L9WA 1H5NA 1WV1A 4ZVOA 4G0PA 3PXGA 3SR3A 3RRXA 5H83A 2B3DA 3FDXA 3QMMA 4S3MA 1RZ3A 4URYR 2J9XB 2V5UA 2VK1A 3D2CA 5EWJA 4EK9A 1IZ0A 4YQYA 4EO7A 1Y7HA 2RMKA 3K71B 4U2DA 1L4GA 2OESA 4XVQA 3O8LA 3CW2A 2PN1A 3TVTA 1W36D 4EKGA 4LXTA 2VP3A 1IOLA 1C8LA 1E62A 4R2HA 3LCRA 3SM3A 4JYBA 1JBEA 1VG9B 1R6UA 3A14A 5EE3A 1A9QA 4LW8A 4WKGA 5AVJA 5T3UA 3E84A 1S2MA 3HC7A 3H1PA 3REFA 3SLGA 3UTDA 3N2GA 1I4EB 4UC0A 1EUYA 2MDTA 3M3PA 3MAGA 1CY4A 1EHYA 1DO8A 2JHCA 4KO2S 3TW8B 3FMOB 5CYOA 2C99A 2RARA 2VXCA 3H5RA 4L5CA 1JI3A 3G6KA 3Q72A 5GOZA 1S8NA 3U7IA 2XUZA 2N42A 2BEVA 4N3NA 4GOKA 2FMFA 2NZVG 1CF9A 3EUAA 4GBJA 3VVLA 2QLBA 5KKCA 4ZI5A 1RRFA 1YIDA 1NX9A 2ONCA 1OVGA 1P0FA 4FMCF 4O5AA 3SR0A 3JQ9A 2OGSA 3QWAA 3VXKA 4AKTA 3SVLA 1ZN7A 2NU7B 2WHPA 2NO1A 3EFBA 4NH4A 4R41A 1YNOA 3LDGA 5ALQA 1GZ4A 1RAGA 4QYWA 1HETA 1ADFA 3HJTA 4PC2A 3U4AA 2E5WA 4IILA 3CPHA 3ZLBA 1AS3A 3PD1A 4RJKA 3ZOZA 3RYCB 1RIIA 3MTBA 3RF6A 4ZEVA 1NQ5A 3WNQA 4ERNA 2HJSA 2GM9A 3EGDB 4TT3D 3GJ3A 2SECE 2V0GA 5IVHA 1VB3A 1JQJC 1YKGA 2JFQA 4QQFA 2FPRA 3CZPA 1G41A 2VQ3A 3AONB 2ONZA 3A6KA 3ONDA 4LXGA 4UVHA 1YS9A 2KS6A 4LEIA 3A2NA 2A78A 2AR0A 1NBMA 3TLMA 3Q3VA 3KETA 3TPFA 4BAUA 3PIIA 1I1OA 1EZZA 4EKEA 4GPAA 4Y1EA 2P9HA 1P91A 4I4CA 4L8VA 2VSNA 3VPFA 1A8UA 4C0BA 3IV7A 4PIMA 1F14A 1ZXBA 4XUCA 1NYTA 1GM5A 2H4JA 4K03A 2CLMB 2R11A 4EHLA 3R44A 2HCBA 3TAHA 4FMDB 2YN0A 4Q1EA 1CRLA 1KI6B 5C4IA 4RZ2A 5JAHA 4OI0A 3FAKA 1HA3A 5HJEA 1NI4B 1BH2A 2WMYA 5EZYA 4NPHA 4M9RA 4I0WB 3SICE 1DHTA 4AXXA 4EI9A 2IQIA 5BWMA 2O19A 3BWXA 2VPWA 2WTEA 1GAJA 4MX8A 1K68A 2QDXA 1P1IA 3F71A 2P9FA 4QARA 4YWJA 5J4HA 2FZGA 3TDNA 3ZWYA 3IODA 4DUYB 1GGHA 1TVEA 4DLNA 3HBAA 1W88B 4UJ3A 1KY5A 4IDHA 4YDHB 1N1MA 1YFKA 4HVTA 3DLBA 4F91B 2A94A 2J3HA 1W52X 4I81A 1DTSA 4IJWA 2OY0A 3C8HA 2I8LA 5LP6A 1C7JA 4EVIA 2HWWA 3ER6A 4TZKA 4I50F 3T7TA 3LUGA 1H2BA 3ILSA 4FHCA 2HPVA 4NCXA 4Q9HA 5ETJA 3TJZA 4CL3A 4DY4A 2PYZA 3MUOA 1ADCA 1COZA 1OREA 2FQYA 2H07A 5LP6B 2DKNA 1X0XA 4M1KA 1B3RA 4PFSA 4YP7A 1K3UB 3A3YA 2J9GA 3IILA 5TT0A 3ZV5A 4KAAA 5HKBA 5IF3A 4K6CA 2WZDA 3AP1A 2X4DA 3IHLA 1PO7A 3LLSA 1UK7A 4JQCA 4QSMA 2IHKA 2ZI4A 2QYHA 3I3SR 3W34A 1X70A 4FD3A 4ZQGA 3LMKA 2WB2A 3KQLA 3QA9A 2G1PA 4JLWA 1FRZA 4WZBB 2PZBA 2VUTA 3B3AA 3B51X 3OPXA 2OKGA 3CM0A 3A9SA 3HDHA 1E92A 5GZ1A 2FUCA 3DCYA 5JDIC 2CVFA 3E9YA 2MJLA 1M0TA 1OPRA 3WI7A 4RD1A 2BC9A 2H31A 2VF2A 1DL5A 1ZOPA 3FTCA 3ISVA 3KR9A 4IIGA 4RL4A 5AXDA 3UMSA 2IYZA 5DXJA 5D86A 5CFZA 2A2ZA 3L8FA 4FONA 4OYYA 1G42A 1CHDA 1XRMA 3R23A 4JSTA 1BIFA 3ZH2A 3ZWMA 4E2YA 4BNTA 4CKWA 5K09A 3O38A 1R0KA 1DAEA 5AJHA 5B37A 2G4CA 3USCS 1HL3A 1QFZA 2MSCB 2EHJA 4DBVO 4MPDA 3E2IA 4Y8VA 1Z74A 1J09A 1CZLA 1KVQA 2AN4A 2D0OB 2ZJZA 3G8YA 1Z18A 1HEIA 1G8GA 3CNNA 3QEOA 2O06A 3L92A 4ZZIA 4Y6GB 3SEAA 5FD8A 3TDMA 3TX6A 3EZFA 1EFKA 4OHYA 2W6ZA 3HCPA 5FEUA 1LKZA 5IJ9A 1OTHA 3HO1A 3JPWA 4DKJA 5EL0A 1NULA 4DMLA 2RGWA 3C6KA 4GRIA 3U3ZA 4AD8A 3W04A 2OCBA 2PS9A 1A96A 2GEJA 5D1HA 5J3JA 4N01A 3BE6A 5CB0A 5CXUA 4DLRA 1G2OA 2W6NA 4W5QA 3OKFA 4D3XA 3DOEA 4Y7DA 4RPHA 1QQ7A 2LIPA 3VJRA 1J0AA 2WG1A 3H13A 3AEQB 3K0AA 3FSEA 2MYTA 5IT0A 2QLTA 4GOLD 3DMTA 3IDOA 1YZUA 5F2OA 1VBKA 3QIAA 4IFTA 3UHOA 1X7YB 3KDAA 2XLCA 3NM4A 4C2UA 2R5FA 1G8FA 5T8KC 1GL3A 5KTSA 1GZDA 1UK9A 2B2XA 4YRGA 2JRLA 5SZKB 5EHIA 2JK1A 4PWYA 2AOXA 2QD4A 3FCUB 4O63O 1F12A 4PVDA 3TZ6A 3W5IA 1JU3A 4GI1A 4L8YA 2OORA 3K09C 3RC1A 2PRKA 2QS9A 4L08A 2QB5A 4WVLA 1DGQA 1XZBA 4HEJA 3NWEA 4WLFA 1W29A 3AKDA 5F1YA 1LLFA 4B73A 3C3WA 3PFGA 5GJBA 5ILOA 2RHWA 1T4DA 4JIGA 4MS3B 5CT9A 2A9FA 3KYDB 3EOBI 1YQEA 3O2NA 4IIJA 4YS6A 1D3AA 3JTMA 3PQ4A 4CNBA 3PX7A 2Q4EA 4H1WA 4R2JA 5FRDA 2PAFA 4RLSA 4RDXA 1JWBB 1AS0A 1E6UA 3GT0A 4BCBA 2ZANA 4KAJA 3OFSA 5JW6A 4DA8A 2PJRA 4IDAA 2CV2A 1PTJC 5E9QA 4EI8A 1CRZA 4XPIB 4Q15A 4YAGA 5JNUA 3QELA 3WP1B 1TZBA 3OA2A 1FFEA 3GOQA 2WG2A 3PDCA 1LDNA 1B8PA 1GZSA 2A7XA 1HTTA 4RTOA 3MGCA 3G59A 4D8VA 3Q7QA 4POAA 2CDCA 2V8BA 1JSCA 2XBLA 4OM7A 4N0PA 2O4CA 1VLHA 2BFFA 4IUCS 1GGMA 4LWZA 4ZT7A 3LO5A 2DPMA 2GPAA 4ZC1A 3I6IA 3VOBA 3L77A 3X1JA 1NW6A 4E0BA 2ZIXA 5JZSA 4LYFA 4U7TB 2DR0A 3K92A 2NVUA 4PLWA 3KQTA 5B3LA 5IYZB 2GT1A 4UVEA 1QFYA 3WGOA 1ZI8A 4Z5XA 4EF6A 3TIFA 4UULA 1QB7A 2BKUA 5IAGA 5FP0A 1EVEA 5I7UA 2OYRA 1GGJA 4M1ZA 3WKDA 2WDPA 3B9RA 1EXVA 4O2BB 1SOMA 3UOGA 4BIIA 4PYJA 4DCUA 1NW7A 4QODA 2OQIA 2R47A 2P3QA 4K6KA 3IPXA 4QATA 2PS1A 4YLYA 1J70A 4IOLA 4D4HA 1K75A 3HB5X 4PR3A 1U65A 5A04A 5TX7A 1CUJA 1GFIA 2Y1LA 4COKA 3PVCA 1MBZA 4HEA6 1SQSA 3FYUB 2EFHB 1P0MA 1PEYA 1A8QA 2WUWE 1N8SA 2HMAA 1LA2A 1JIIA 1H23A 4EHAA 2OWEA 5TS2A 3CX7A 4IGIA 1Z45A 4U7GA 4PPYA 4ES6A 4ESEA 4V1CA 2GCPA 5JH7A 1W36C 2ERCA 2P1DA 3GDFA 4EG8A 5AM2A 4TVBA 2MIIA 4GWGA 1QANA 3ZHZA 3HJCA 1ADBA 2YBDA 1ZK2A 3M5CA 1P4AA 3TIXB 4ACBA 2XUFA 2R6CA 3H2HA 2WU1A 1JHOA 5HE9A 4YMTA 2XF8A 4NYMR 3UMJA 3ZCUA 1P2SA 3BL5A 4LFBB 3QITA 2X0IA 3VZRA 3EA0A 3QY0A 5E6RA 4DPKA 3DDUA 5HKKD 2QP4A 3LUDA 1IULA 4HI0E 4RNDB 2C5EA 2HA6A 1CQJB 2Y05A 4V0SA 3AVXA 1WF3A 5BQ3A 4LMAA 3NM6B 4UCXA 3ZS8A 1B3BA 4IF4A 4RELA 4A8JA 2G5CA 3W3ZB 4CIWA 1D4AA 5A1TA 2VDVE 3COZA 4BLRA 4AJ1A 2J4DA 1E69A 3FPHA 2XB6A 3GAFA 1OH7A 1ARZA 4ZCPA 1MNQA 3QVGA 4PPFA 1JECA 2D1QA 3GLIE 1QG6A 3EGXB 4HD8A 4HFJA 1U98A 2EOAA 3G7SA 4ZICA 4MKHA 3GG2A 4FYWA 1WUYA 3MJCA 1R9JA 2AL7A 1XTSA 4I1UA 4XSVA 2I1LA 1U8EA 4V1CI 5HZMA 4EYGA 3VZBA 2X6TA 3WS7A 1KPHA 2W6JA 3HCNA 3LUPA 5EYPB 1GUYA 2A67A 3EPJA 5DYTA 3SC4A 5AI5A 3PTAA 4GU5A 3FY4A 1QX3A 4ND8A 5LMNB 1TVKA 1B6GA 2UUCB 2DBQA 3UCFA 4DMFA 4AS3A 3V6LA 4YDQA 4WXYB 1PGNA 1Q21A 3E6AA 3CUTA 2ZJ0A 1XP5A 1NBWB 2P6UA 4TXMA 1I3OA 4F97A 4LOAA 1KEUA 1QVVA 3H9CA 4EECA 1HQDA 1Z25A 3MGBA 4Q4JB 3PUJA 3UN1A 2ZSJA 4FB5A 1QP8A 1C0KA 1TLLA 2CLFB 3CKYA 1WQ3A 1EWTA 2C59A 5HA5A 5HP4A 3VU9B 4CKEB 3VGPA 3R3HA 4I4LA 4Y1RA 1G4AE 1M75A 2AFRA 4YBRA 3ULKA 4A2WA 4CG3A 4U2KA 3VBEA 5IKXA 1UAGA 3O4HA 5JDCA 2BFBA 5NULA 2BFEA 2X15A 1GTL1 3RYIA 1SKBA 2VP0A 1FDIA 3JQGB 2PSDA 3GD7A 1JFSA 3I9FA 3B53X 3EOZA 4HT3B 5AD1A 1ZD5A 3FNQA 4WAUA 1HNZB 5LXTB 3RB8A 3B1WA 4N6OA 1VFNA 5AVOA 1AQIA 1NY6A 4IH4A 4JR1A 3CG0A 3JAWA 4RGBA 1LBEA 4DZRA 4E1AA 1K8QA 4CL0A 4YY3B 3DG9A 3TW0A 4CHTA 3OE7A 3P2MA 3R5FA 2ZUEA 1SVWA 5HCUA 2JLZA 2J3DA 3AXTA 2JARA 2BL4A 3TFWA 1T35A 1DOHA 5FO1A 5B1EA 3ABOB 2ZRQA 4IWXA 1QG4A 4XQ0A 3MK31 3R41A 3NYQA 4PF1A 1X2EA 4OQYA 1OH8A 4X3OA 1BHQ1 2GHRA 2EAUA 4HWRA 4FQ5A 2QLFA 2GARA 3FBGA 4JQYA 4PO3X 4RZIA 4C4YA 5DOVA 1NT2A 4BHTA 5HUJA 4FYHA 3ELWA 4WT7A 4GPD1 4ETWA 3BD9A 3SDZA 3ZWOA 3AT1A 3H2ZA 1PG2A 3DB1A 4F7DA 1SXJB 1FZQA 4LRYA 4BO8A 2VDWB 4YUXA 2QLLA 3WRXC 4ETMA 3H42B 1XCBA 3WJ7A 2WYIA 4BO3A 4GECA 3GLUA 3LW8A 4MUIA 4FCTA 4MAAA 4P3PA 5KVVA 2VP9A 3HU2A 4FHZA 4DM4A 3D0KA 3V4VB 5K8IA 4KV9A 4KQIA 5A0FA 5FWAA 1UMCB 3VYTB 3K8ZA 1AUQA 1DCKA 3BK7A 5DB4A 3WIVA 3HYSA 1PFQA 9LDBA 1ETHA 3EQ2A 1NUQA 5ENDA 3W0LB 4CM8B 4FYVA 1USIA 2QT9A 2VL7A 3CRZA 2UU9B 3L7NA 2XQGA 3RWBA 1OBFO 1EI9A 2PA3A 4CG0A 1OGYA 1KFJB 1U8ZA 5FTKA 1I5OA 3MPOA 3W90A 2XGSA 4IXNA 1PSWA 1WAMA 3FR8A 3MWLA 2B8JA 2NSJA 1NW4A 3AWDA 4OYLA 4PEVA 3R7WA 1GPNA 4IGAA 3UWSA 1LJ8A 1UFQA 1IYZA 2FN3A 4NYIQ 5I4IA 4TWBA 3LBFA 3PDIB 3FKQA 4GLOA 1PBNA 2BI4A 3D8HA 1RYYA 3GYGA 2PH7A 5JDIA 2JFOA 4PYMA 4RVSA 3UB4A 3EMKA 2WWFA 1CNEA 3L9XA 3IEIA 4KRXA 5FYDA 1RWOA 4V0MA 3JWPA 2P11A 4GQIA 4Q4HB 5FQNA 3AESA 4LZLA 5GONB 2VXYA 3LGSA 4NFSA 4UAJA 4EJSC 5K8LA 1E9FA 1ZMXA 3B1XA 2FFAA 2HM7A 2XUKA 3IJ5A 3MT0A 4JL5A 4NONA 3TTYA 5K01A 4CUKA 3LGXA 2J3QA 1GKIA 3OQJA 4Y9DA 4IZHA 2G6BA 3W79A 5K8VA 2YRXA 5BQXA 1T29A 5JAMA 4OKIA 3MTGA 4TVKA 5IJAA 3SBXA 5EIHA 3BF7A 4D3DA 3M6UA 1VKHA 5ADUS 3CEPB 4IWNA 1DZ3A 2ACEA 4O4IB 1BXRB 3HEMA 5ICSA 2OOKA 2V4UA 2IXBA 3BFJA 3NJRA 3G8BA 4UBIA 1ZSYA 1P39A 2R65A 2Z2JA 3UMCA 2ZBQA 2XB9A 3FMIA 1QZZA 1O9GA 1M1UA 1FQKA 5ANRB 5FDFA 3FWKA 5FTJA 2ZI3A 3ROEA 1VL6A 3GA5A 5IFKA 1JZSA 4KJXA 1TVKB 1K2WA 3MEQA 1B4DA 3QRWA 3MXOA 1MX9A 5JSFA 3AM4A 4YUAA 4X8OA 2W93A 2V55B 3A4VA 4FN4A 3BRWD 2QRGA 4PTYA 5J5AA 5HRCA 1X9HA 2C31A 4HXEB 5I7AA 3CLVA 3MRXA 3UMFA 5DRTA 3H0KA 2ORIA 2NV2B 1IDOA 2VBIA 2GK7A 3WLEA 4UAGA 2YWCA 1U63A 4ZOLB 1II8A 4DIUA 5D5QA 2E4YA 3WDKA 1OV4A 1P1FA 1Z82A 2ZREA 2H2WA 1W49A 3M82A 5AIAA 4WZBE 4DS3A 3M2TA 1J9GA 3GL9A 4GP7A 3INTA 4N5HX 1MH9A 1UBSB 2YYSA 3G3EA 1ZGZA 1P9WA 1WHTB 1WZUA 1G8PA 1ZA1A 2JIMA 2X2OA 5AI6A 2FEKA 4CKXA 3THWA 1IZ9A 1R74A 1YRLA 1ZWLA 1BHO1 2PUVA 3PEEA 2DTEA 1C14A 1MV5A 3IQGX 3NHKA 1KYYA 4EB0A 3OTOB 3T15A 2XGOA 2YMLA 3G2PA 4OUDB 4RPIA 2TMYA 5LOVF 3WLIA 3K6JA 4TYYA 3K30A 3ILVA 1SCUB 1I7NA 2TS1A 1GZ7A 1KAOA 1R2QA 1G8AA 2WJIA 3CLRD 4TZTA 4TWZA 5IBQA 1U8UA 4Z4FA 2HNAA 1WBBA 5K3AA 2GTIA 1X38A 1CTQA 1KSHA 2Z9CA 1ZIPA 3UK2A 4Y2YA 1BE1A 3UJ7A 2XGJA 5DWVA 1A98A 3PITA 4KDEA 3SR4A 3HH8A 5BNWA 3V8VA 4MPRA 1BZYA 3VI3B 2Q8QA 3CKMA 4XWYA 5CK5A 1WKCA 2F7SA 4RA6B 3CRRA 4MUFA 2VNKA 1Y7IA 5DYNA 4FFVA 3B36A 3JXEA 4D7AA 2IEYA 3AIKA 3H1TA 4PLGA 5IPFA 3C1TA 4FJ2A 3CX8A 2C9ZA 3WADA 2D8MA 4KB5A 4AG6A 2CFIA 3DV2A 1G3RA 3TD2A 4FCWA 3OKAA 2HK9A 4ZVTA 3AZOA 3HWX1 4D3FA 3R6LA 1QF6A 2VAXA 5KJ6A 3EG5A 2GFQA 4N6NA 3STHA 1CDOA 3QVWA 4PGMA 1SGWA 5BYBA 5GV8A 2JD0A 3ITNA 4ZYWA 3ANSA 1FS6A 2Z3ZA 3ECCA 3PHJA 4HPWA 3UBTA 5CLQA 5CT6A 4IIJF 4R2IA 4L1KA 4XX1A 4IXWA 4TWAA 4HWOA 1PVVA 3HVUA 2HI0A 2R1TA 4NSNA 5TVGA 4A91A 3TCXB 2BKLA 4ZMRA 2BGUA 4P5EA 4RF2A 1ZJ4A 5BUZA 1NJSA 1E1KA 4EDFA 4MGYR 1E3TA 2I6GA 3GFFA 1DARA 3KEOA 3LWZA 1Q92A 4OHRA 4QUBA 1T1GA 2XAAA 1RC0A 4X60A 1G21B 5TT1A 3SHTA 3WMRA 1SXHA 3F6SA 5KO2A 2WW8A 3DWFA 4BYMA 5C5EA 1M7GA 5ALSA 4F60A 4OKNA 1K6JA 1OYWA 1GXSB 1YUBA 3DVAB 4KBGA 1KC1A 3RIGA 2FRVA 4FFBA 1YC5A 3AF0A 3AGQA 1HMPA 3L6RA 5BN5B 3DV0B 3SS7X 3T8YA 3A25A 3U39A 3IE2A 5KC9A 5M34A 2O8EB 3U1TA 1JHUA 4EY5A 3B85A 4JLNA 1N8TA 1Z73A 2P1ZA 1ZUNB 2IBSA 2VJAA 2Q9AA 3S44A 1NF3A 1OI3A 1Y82A 2YFHA 5JMTA 1VJRA 2ZCUA 3OT4A 4Q9AA 1ZGJA 5ICCA 3EEBA 3BG5A 1XTVA 2BGTA 1D4ZA 2QUIA 1YI1A 3L7JA 2ST1A 3NBZC 4G24A 4KFSA 4WECA 3W5SA 3QUSA