1PDOA

Phosphoenolpyruvate-dependent phosphotransferase system
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
129
structure length
129
Chain Sequence
TIAIVIGTHGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETLIEKYNAQLAKLDTTKGVLFLVDTWGGSPFNAASRIVVDKEHYEVIAGVNIPMLVETLMARDDDPSFDELVALAVETGREGVKALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords MANNOSE PERMEASE
publication title Structure of the IIA domain of the mannose transporter from Escherichia coli at 1.7 angstroms resolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 45
structure length 129
sequence length 129
ec nomenclature ec 2.7.1.191: Protein-N(pi)-phosphohistidine--D-mannose phosphotransferase.
pdb deposition date 1996-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03610 EIIA-man PTS system fructose IIA component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.510 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphotransferase system, mannose-type IIA component 1pdoA00
1PDOA 2JZNA 3BEDA 3CR3C 5T3UA 5IM4F 3CT6A 1VSQA 3GX1A 3MTQA 3B48A 1VRCA 2JZOA 3IPRA 3GDWA 3LFHA 4TKZA
chains in the Genus database with same CATH superfamily
4QUBA 1XHLA 2ADFA 3DBLB 3S2ZA 3SHFA 1Y3FE 3C4JA 5JCOA 4D9KA 5B6IA 2QORA 1CKEA 1PDWA 1W4ZA 3DHEA 3SR4A 1XVIA 2RAVA 4LDZA 3TQQA 1KY3A 2AOWA 2VDWA 1JLRA 3L0IB 2O5CA 1TGYA 1II9A 4EJ6A 1W52X 5KHLB 4EDHA 5H80A 5KO2A 4AXXA 3E05A 3NH6A 4X3OA 5DSTA 4D4IA 2Z30A 4P5EA 1KYQA 2AG5A 2GEFA 3TECE 2PKQO 4P7GA 5CFQA 3IEMA 4F3KA 5IDWA 4PPQA 3UATA 3BIFA 4LQLA 3WXMA 4HEA1 3T5CA 4CIBA 1BXKA 1PQ4A 5FBHA 5EUBA 3AONB 3L6BA 1AIPA 3PD1A 4DDMA 3I1FA 1FJGB 4DSUA 1QG4A 5CYFA 3SR0A 1MD9A 1T5TA 4I1RA 5FF9A 5H9VA 4EYKA 1X80B 2R47A 2Z0MA 3D3KA 1DXHA 3G9UA 1VHJA 2C03A 3NYIA 3R44A 5AYVA 1SZCA 5FPHA 4DV0B 3DB1A 4U5QA 2GAOA 5A0TA 3NPMA 4DSNA 1NF9A 4OL0A 3BF7A 4ZI5A 3SZMA 2RGWA 3GHYA 4NNJA 4DZZA 1QIKA 2PUJA 3G0GA 3EVAA 4U7JA 3EZNA 4NL4H 3EGDB 2CMKA 1AOXA 3MJSA 2BKXA 1KDTA 5KMGA 2G9UA 4OJTA 4XUGB 3U56A 1II8B 4GX5A 5BSVA 1V8OA 1DOZA 4Y6RA 3IBFA 3VPCA 4BS9A 4E7PA 2CLFB 4MRMB 1NW3A 4G0QA 4ABTA 4N49A 4EF6A 5FDFA 1QRSA 5C8YB 1E1KA 1TAGA 4TMKA 2CJWA 3ASZA 2FPUA 4N6GA 3F8SA 4EUFA 3DXXA 9GPBA 3KJFA 1HPLA 2NVUA 2F3QA 3KSZO 1FP1D 1DQPA 2J9FA 3BWYA 3ZU2A 4YRBA 3A6DA 2PZFA 3J81k 1C3OA 3VR6H 2XVXA 2Q2VA 3GA5A 5E7JA 4QJ3A 2VPZA 2X0KA 3H5WA 1PV2A 5EXDA 1A88A 3LHFA 4IGKA 3RC1A 2G9ZA 1E98A 3EN0A 3WLEA 2DFPA 2CZQA 3PNVA 1G55A 1TIPA 4TKVB 2R3SA 1U81A 1I4OA 1QOZA 3NTOA 3R75A 4UFPA 4JLWA 1JS1X 2Z43A 2FG7C 3KLBA 3U4IA 4EZEA 1XFDA 2VKQA 2VPQA 3AEUB 3DMNA 2PKQP 4AS3A 2ZE8A 2HF8A 1AUQA 2HSEA 1GGHA 1WPQA 4XUDA 3HUFA 5FB3A 3WNQA 4DG8A 3ADBA 3G88A 5FTLA 2VAVA 4UEJA 4CGZA 2VRCA 3DOEA 1XZPA 3N2YA 3L8DA 3R3VA 1IRXA 1LX6A 1S02A 2GKSA 2VOEA 2OAP1 4TL9A 5F2NA 4O4LA 2J5XA 4HCJA 5IM5A 4HX9A 5AVSA 1X8XA 2BKLA 3LPAA 1V8FA 3K0SA 3T5PA 4H3VA 4M49A 3PDWA 4KFTA 4XYGA 2BVNA 5SZHB 2HREA 1XEXB 4W8HA 4IUDS 2UYQA 2JI8A 4JD5A 4GOJA 3T5AA 1PJRA 1K7EB 2P35A 1WVIA 2GXAA 2FSFA 3UANA 3AI3A 4C7MA 1JH9A 4RK6A 1BOFA 2CHGA 3MJ4A 1XPRA 2ODNA 2ZT6A 1NE7A 5EMMA 4J91A 1KFKB 3IEKA 5HIJA 5IVIA 1VHTA 3BKWA 4DV4B 3H7IA 3ZD6A 1OXSC 1MUUA 1Q0RA 2VN8A 3OOHA 1PTKA 4IXTA 2ISSD 3GMDA 4WE3A 3GPIA 2JLRA 2WIFA 4GI2A 3X2SA 5LBTA 1JZTA 1Z8FA 2VJAA 2J67A 4LHWA 1EZ1A 4PG5A 4YP5A 4LJ5A 1E9BA 3H42B 1UEIA 3L4BC 3ZC3A 1V96A 1Q20A 4OJMX 1L4GA 4C4ZA 2WWIA 4TZKA 5JDCA 4YHBA 1SURA 3MQ4A 2ZUDA 1QP0A 4WBXC 1DFHA 2O8EA 3L84A 4GP9A 2JGEA 4PAQA 2KQUA 1Y9DA 2UDPA 5IMSA 1S1MA 2R84A 4HB0A 1T29A 1E20A 2B78A 2R6CA 3KE8A 5JROA 1I80A 5F2KA 5AVXA 4JEUA 4M0LA 1JHYA 1PGPA 2ZSAA 5CLGA 1KOJA 2ZUUA 4JL8A 1ZW1A 4PG8A 2DPMA 1QYDA 3L7JA 4XA8A 5JSQA 1H8EA 1DEAA 3HU5A 2YW2A 1W85A 3F73A 4PCUA 3AK4A 4IUBS 2ZBEA 4OQLA 5IDYA 4EUNA 1SIBE 3C3MA 3REGA 3BH0A 4FFLA 2ZUCA 4JC4A 4RIGA 4QXQA 4WX2B 4Q3DA 4YCBA 2D7JA 2WAMA 1YS7A 2GEDA 1XTRA 2VQ3A 3CEMA 1R64A 4AP5A 2P0EA 4NZOA 4RQTA 4YASA 2NO1A 2UZ1B 4Z3OA 4FP9A 4EATA 1OAOA 3NVMB 5AD1A 3LBYA 4RTQA 3IQGX 3HCWA 4MK4A 2JHPA 3LHKA 4HZGA 1Z0FA 4J29A 4YAOA 5KKAA 4HN9A 3LTEA 2WYIA 3PYMA 3R3YA 4OHUA 4YO7A 4ZRMA 3OPYB 3MQ2A 2QN2A 3W7BA 5HRAA 4HRAA 3OC6A 1Z2OX 1XJWA 4POAA 4X1KB 1KO7A 1Z5UA 2G9NA 3UB3A 5B3KA 4MX8A 4CBVA 3A1FA 4YA6A 3F7MA 2JEOA 3B3JA 2NU6B 3DD1A 3AF3A 1SO8A 2I65A 4P3OA 3RVLA 5A3JA 1P33A 1DTSA 3KYBA 3SX4A 3VR5A 4F84A 4RVOA 1EUZA 5C52B 5A05A 3RT1A 2ZAGA 2RHMA 4B7XA 3J81A 4M1EA 1G1MA 3OY2A 5J3JA 2WFLA 1C7IA 1JHMA 2GZSA 3L8GA 4I9FA 4HAOA 4XVHA 1JA1A 5HIKA 3W5DA 3E9NA 1EMDA 3UYKA 3UG6A 3VTKA 3DLHA 2XDYA 1ULHA 3PGJA 3G82C 4NSNA 1B3RA 1QK3A 2B99A 1QIGA 2GJ8A 3FNRA 3IUYA 1MHPA 3L92A 3H1PA 4QASA 4Q1VA 3FTFA 4PS0A 1EUCB 2G40A 5U4XA 2Z8XA 3HJGA 2JLUA 1D7AA 2IVFA 5CCBA 1VIYA 1UMCB 4LOIA 1BXRA 4YNBA 1V25A 3CB2A 1Z62A 4HAIA 1BC5A 1T1RA 2CJPA 5K3CA 1AMNA 3CZCA 4B48A 4PSKA 4UM7A 2XCIA 1FL9A 5M5BA 2IP1A 3U7FB 4QECA 1K97A 4DSAA 4IH4A 4JP2A 3GDGA 4JXXA 2GM5A 2Q07A 4PYIA 4DLSA 1I7DA 2AG0A 4IKOA 2F1RA 1M9NA 1AXGA 1GDTA 4YCDA 3WAKA 1KE1A 3TLKA 2VAMA 3TI9A 5DNEA 2DT5A 1NI3A 5ADUS 3U7QA 1TPYA 2Z98A 1IVYA 2DPLA 4URXR 4GP6A 5BNTA 2HK9A 5EJ5A 2WUDA 2JIOA 1BHQ1 1RBMA 3GAFA 4RGYA 3EXFB 3ZZ1A 4PNZA 3SSNA 4BHTA 3AF6A 1G9XA 1VI5A 3P0EA 2PEZA 1UP6A 4UBNA 4V1CA 3UFBA 5LOVA 3L4SO 2DH6A 3SN6A 3HU3A 4L02A 3T1QA 3ZWVA 1QVAA 1RQ7A 4IWYA 5L8VA 2OBMA 1YT5A 4D80A 4M1SA 2ONJA 1SVMA 2KBFA 2FN8A 1AKYA 2JVKA 4KXXA 1OV6A 1L7RA 5I51A 2ENWA 3I01M 1VKHA 3F8WA 3D6NB 1W35A 4OHBA 5EPOA 5AOAA 1KI6B 2G6TA 5LNK1 1Q12A 4EGFA 3LECA 5EMJA 5BWNA 2C2KA 3KAQA 3NRCA 3W5JA 2G09A 4DPMA 5DBFA 2AFHA 3OKPA 4KAFA 5JAPA 4EOGA 2QMOA 2GTPA 3D0QA 5KU1A 3TZHA 3WBJA 1CT9A 1FTYA 3QWAA 3AVUA 1H0RA 4L50A 2H7XA 2I1WA 3I2FA 3O8QA 5K8TA 5AVKA 3ZY3A 2HEGA 1Y42X 2ZR9A 1RJ9B 3GZ4A 2G1KA 1CFZA 3TXYA 1NOIA 2BEUB 3OIUA 4M0DA 1G0NA 2PVPA 3CNHA 4R9UC 721PA 3WMXA 3N0XA 4C1BA 8AT1A 2W2KA 5B36A 1K4KA 2EJCA 3AIMA 4HPJB 4LJLA 4P7JA 3BDAA 3NNSA 4INAA 4JLNA 3K1ZA 3INYA 3OHSX 5H83A 3W4KA 3ZLVA 4D99A 1GDHA 4ZVVA 2RAUA 4QUKA 5LYJF 1I9GA 1PN3A 3A0UA 3RFXA 4GYKA 1Q0QA 2YJNA 1UBMS 4NU0A 4AZSA 2A5LA 2WJWA 3QFFA 2QJWA 5I9BA 5AM4A 1E3QA 4GHWA 1Q0LA 4BMVA 2KLHA 4OGFA 3O0TA 1FP6A 3DFFA 3C5VA 2FSVA 1OKKA 4M1KA 4MCHA 4IYJA 5ENZA 1JBQA 5EE1A 2UUOA 2W6PA 4BVJA 3D43A 2Q9CA 3LYHA 3GK3A 4UHFA 3T1TA 5FUXA 2VXCA 3MPOA 4UAJA 5L53A 3C41J 1PG0A 1H66A 1YFJA 1K1EA 1Z8DA 5BSKA 2I29A 1ZRSA 3EODA 2ZP1A 1HFEL 1NW7A 2DFDA 4GLFA 4YXWD 4ZXFA 2WRZA 3Q8XB 4MB6A 1X7WB 3KHSA 2E3JA 3NASA 3EULA 1NU6A 1QPZA 2NXJA 3ZYZA 5AVZA 4PO1A 2Q0XA 4DNQA 5DRYA 1HZZA 3CRW1 4PQGA 4HQNA 3ONEA 3S44A 3ZKWA 3DZFA 1VLLA 1MDBA 3R3UA 4XB1A 1PGJA 1XD2A 1YBMA 4J3FA 2M6KA 2Q3LA 1BOOA 2OXEA 3IPXA 3M0EA 1NN5A 1M7HA 3NJ4A 1T2UA 4N48A 4FYVA 3A05A 5E38A 2Z4TA 3HA7A 4FHGA 4LXTA 1WP9A 2VCHA 4DGQA 1NXWA 2JHGA 3UC5A 1TCVA 3B7PA 2FPIA 4XGNA 1IMJA 5JDCC 1QFJA 2BP7A 3EQZA 1GWNA 1T5IA 2EQ5A 2VS1A 4RKFA 1ORHA 1F8FA 2D2VA 2J3EA 1U7XA 3TFQA 3VC7A 5JZOA 2W6OA 3PF8A 4JJ8A 2MSNA 3V9PA 4G85A 2FU5C 1KIMA 1CDOA 4OQFA 3VO8A 4R71A 4AJHA 1JA0A 1EBUA 1FUYB 4DLRA 3EY9A 2QUBA 5IKEA 1IBSA 4KR3A 4RV5A 1GT91 4ENRA 3SR3A 3TSWA 4EI7A 2IIPA 2DQKA 3OM0A 4MUEA 3Q2OA 2OWDA 3JZIA 4JODA 3NGLA 3NP9A 1RQGA 1MABB 3QXGA 4L0MA 4XWOA 3P97A 5ALVA 1WPRA 2Q1XA 5T64A 1WG8A 3ZZMA 4CHTA 3DT6A 3SXUB 3N58A 3RKUA 3RTCA 3GLQA 5HS4A 3I3SR 4ZVPA 3RTEA 4D4HA 3PI6A 1XCJA 1IHUA 1LLDA 1U5BA 1OAOC 5F1KA 4BRWA 5A9SA 4OP1A 1KZGB 4UCQA 4OV6B 3VVLA 4ZEVA 3T6KA 4WT7A 4AQYB 1Z17A 2WIDA 2C5LA 4R8LA 5C8VA 2HMAA 4ZALA 1RRCA 4M1YA 3PD0A 1P91A 4AT1A 5JMOA 1N8KA 5C80A 1C30B 3IYLW 4RHFA 1EFDN 5ELLA 1UDCA 3TQCA 3V2HA 1RP1A 1ZN7A 1JJAA 3RYCB 1GPBA 1KRHA 1CB7A 2GBIA 5CDFA 3C3EA 4PZDA 3FGPA 3EWSA 2NZYA 5BQFA 2AE2A 1JX6A 1QCYA 3W4JA 1A96A 3FTDA 5C0OE 2ZFUA 4HGYA 4E2YA 3KO8A 2OGUA 4E88A 5HR5A 1F8YA 4CCSA 5H0IA 2PLRA 4X3CA 2GCNA 2ORYA 3PPWA 4E08A 3GD7A 4S1PA 1Z9BA 5H8WA 4JJ6A 1HFJA 4NPCA 4H15A 1DC4A 2N75A 3GJXC 3U1TA 2V1UA 4CYMA 5DOZA 4E14A 2CYAA 2F48A 1FUKA 1Q2UA 4FI3F 4L8YA 1QIDA 4LJYA 2WVJA 1Q1ZA 2XEXA 5ULLA 5KWIA 1MIOB 3BZUA 5EIXA 2ZDQA 1JZSA 1GPLA 3WKBA 3M3HA 3R3ZA 5DHFA 1ZM9A 1RLMA 2JCVA 3PNLA 4XRRA 3W9UA 4ENPA 1T3HA 1T8PA 1O97D 3HL4A 3UQZA 4JMLA 1B8UA 2QM3A 1SIUA 4MUJA 1U5AA 3GQBB 1OLXB 3PR1A 5FAXA 1BA2A 2ZREA 5AICA 2O7RA 1DWPA 3KSUA 3R7DA 1FA9A 1NXXA 5EE9A 1VGRA 4TM8A 3ZU4A 4J0QA 1T1JA 1T4BA 2VHVA 3IAUA 4IZOA 1Z4JA 3JVVA 3FMIA 5T6BA 4R1MA 1A9ZA 1BEEA 1QM5A 1YCHA 2VZEA 4GRDA 3U4HA 3WGZA 2BFOA 3K4PA 4INPA 5MN5A 1FZTA 3RJZA 4X5OA 3F6PA 4M22A 4DG5A 1E2DA 2WDZA 3DFZA 3K73O 4S24A 2PRZA 2V6GA 3GRFA 2OA0A 3VR6A 4IIYA 3EDOA 5JI3E 1SR8A 2C98A 2ES4A 3EQ9A 3IOBA 1N7HA 4M9CA 4TMTA 3F97A 3U37A 3OQOA 5CVDA 3LL7A 4JVOA 2BTQB 4G41A 2QZZA 3L79A 1W1IA 4ZI7F 1H2EA 1N0HA 2CDNA 2OHHA 2PMCA 3TL2A 3E5MA 5IXJA 2LWIA 1JLMA 5KB3A 4FFOA 3O8LA 3L0OA 2PL1A 4ES6A 1K6MA 4F5EA 1LXCA 1C3EA 1RAGA 2PX8A 3SS7X 2H6EA 3CLSD 2PZEA 4IIUA 3T9DA 5E8RA 3OQBA 621PA 3SQWA 1ULZA 4Q4AB 2FMIA 2ZSDA 2LXNA 3OIVA 4CT5A 2AWOA 1FRZA 2BGUA 4FWBA 4ARZA 4LNAA 1YZFA 3U3DA 4IX9A 2UYOA 3MN1A 4G1VA 5HKOA 3K32A 4D3SA 1XZDA 2PRIA 1LFAA 2WT9A 2YMQA 4PAGA 2JAXA 4RA6A 1XALA 3VPDA 4C4PA 2R7MA 2CL5A 5IT9A 2JFXA 1J20A 2Y71A 3JWGA 3WHKA 3ZWAA 3GMIA 2WHPA 3Q8WA 2X6RA 4PNHA 5EJ7A 2X9QA 4HC4A 2FMHA 1C4OA 1G8JA 3GLHA 1J49A 1ZIDA 1SEVA 3AO0B 3VH1A 4N8EA 3KKPA 3BN3A 4HDOB 1NVVQ 3SE0A 4LVNA 3EWAA 3OIWA 4EVQA 5KNBA 4IF4A 3GRUA 1XQ9A 3FOCA 1AXEA 1YR7A 4XYBA 2Z6AA 4GS5A 3NTVA 3V7UA 1RAAA 1QV9A 2YVAA 3BGOS 4YAFA 2XADA 3NC1C 2AOUA 4WNAB 3RVDA 3KB2A 4ZYWA 2F8MA 5FWYA 4RY0A 1IBRA 1EXDA 1PEKE 4EO9A 3LYLA 3IQHX 3TL3A 1VE9A 5K1ZA 1ZD8A 2ZQZA 2VJQA 3VHXA 4BLVA 1CXZA 2FSVC 4U7WA 3AI2A 3DE4X 3E0QA 2R6FA 3E0XA 2ZYAA 3KL2A 3F98A 2QP4A 1OIVA 3N05A 4REOA 1FSZA 4A36A 4K6OA 1YQ9A 1PJ4A 2OZKA 5BUZA 4H7PA 5EIWA 5C35A 2C0CA 2QYTA 1WW2A 4LOJA 5BNWA 4J8PA 2CVHA 3CR8A 4JFAA 2ZRQA 1XRQA 3WWPA 3ZQUA 2A2ZA 3LCVB 3OPNA 3ORSA 2P4EA 5BW4A 1KI4A 3DEHA 4HXFB 1HZZC 4IFBA 1N8NA 2YWHA 1TB4A 3AB7A 1U0EA 3C15C 3PJFA 1HBJA 4Y2TA 4B2IA 5KC8A 4YI5A 3AUSA 4MUYA 3N8IA 1FDTA 3AVOA 3TX6A 3ILVA 1NW8A 5JYDA 2COUA 2YWXA 1Y9EA 1EEXB 5AJWA 2JBAA 2W4QA 2EFEB 2FKNA 2G36A 2W71A 1Z12A 2BFEB 1M0TA 2Y1FA 4GM4A 3TIIA 3K94A 4JYZA 2Q8NA 1QCCA 5GJWC 221PA 1KQ3A 5KWSA 4JKOA 4KX3A 1WS6A 3ODPA 4HMOA 4QBIA 1Z15A 1OLSB 4IZHA 3AJRA 4O3FA 3ICPA 2P3OA 1TQ8A 4IP0A 2Q3MA 2Q7DA 4LI0A 1L4BA 2QD4A 3FDZA 2H0QA 1T26A 1J8YF 1P4SA 1VKRA 1DU4A 1ZJYA 1ZH8A 1DAEA 3HSYA 4AP9A 4B8YA 4BLSA 2Q4RA 4DB2A 3WA6A 3UPDA 3BD8A 1KRWA 1DB3A 1ZJZA 3ELBA 4TWBA 1FLDA 3AHEA 2PDAA 5KAMA 2JA2A 5LZ2A 4W5JA 5K20A 5G0SA 4I6EA 1Y6FA 2M32A 2RHOA 1GU0A 4YUVA 3QE4A 5CVEA 3CH6A 1PWZA 1Q1GA 3BIXA 4ABYA 2IOYA 3IEPA 2QX8A 2A0XA 3LCUA 3HZZA 4II3A 4LE0A 3CUTA 3KOOA 2P9ZA 4I6GA 3LQYA 2H1OA 4RYLA 4PYRA 5EIBC 3RFFA 2J0VA 3ZD9A 2VHXA 3MA0A 2B0CA 1RM0A 3QGMA 4PC2A 2XZOA 4WZAA 2VTEA 2C92A 2XA1A 4MUAA 2HXGA 2EKPA 2D8AA 4MW7A 4QUHA 4LSMA 1MOSA 4KLCA 3R8CA 1ZA1A 4ZAZA 1EE1A 2I2CA 3OCVA 4FMBB 1C3XA 3B85A 5FTJA 1SUBA 2P5UA 5BSFA 2X5KO 2C2WA 1T2FA 4XZ3A 1V7QA 3ANXA 3AEQB 5D8DA 2P4SA 2FPWA 2I4IA 2XMGA 4CMGA 4DS3A 3KJHA 4YMLA 3O4GA 3H83A 4AW9A 2IH4A 4X64B 4OAOA 1HE5A 2YFQA 1X3LA 3H5LA 3OCUA 5T67A 2VEOA 2XRFA 4UZEA 3GFGA 4PGGA 4OLHA 3BRWD 4L27A 5EINA 3A9UA 3FMVA 4GOMD 1QFZA 4MKZA 1A27A 3IAM1 1FDVA 3NOXA 2C31A 4DARA 5J47A 5BUQA 1XSEA 4UM8B 1B2RA 4DSOA 3S70A 5ADWA 2IXGA 1Q7RA 2P6MA 1U0SY 3V4LA 3K4QA 5BOSB 2W2MA 1L5LA 2VYCA 4BLOA 1ACMA 2XDQB 2ZAMA 3MJTA 4UPVA 4UXJA 2D1YA 4TL6A 4EG8A 3FWKA 6CHYA 2TSYB 1UR5A 3O74A 4KE8A 3OETA 3VU0A 4CIDA 1GPH1 2YV1A 1Z6TA 2FPMA 3UZUA 4BN5A 2ZTVA 2ZBRA 2NYRA 3HP4A 2C4NA 5JADA 3RABA 1E7RA 4FDMA 3M1IA 4QXMA 5JZMA 1ZG3A 3GLSA 2IWRA 1Y5RA 4PVCA 5IBRA 2PLNA 4IHAA 3ZBUA 1B6SA 3BHNA 4F04A 3F5QA 3SE7A 4JL5A 5BV0A 5ALOA 2JVJA 2NYUA 2X13A 5JCZA 3B3QA 4X7MA 9MHTA 2HJVA 1NJSA 3QEJA 4F7WA 1MZVA 1E3EA 3H3FA 3MB8A 1DTWA 4G81A 4J16A 1RM3A 4V3BA 5KKCA 2IJGX 4I50A 2Q49A 3GEGA 4GPBA 5I7SA 4GOXA 3W3ZB 2BZGA 2FZ4A 4F3CA 4F9GA 2C77A 1SXJC 2P62A 1GSOA 1XKLA 4LRSB 2IU6A 3ZCXA 1N6LA 4AFNA 4IZ6A 5DX0A 2IPAB 4PYOA 1J0CA 4RLSA 1E1RD 3FTEA 3NR2A 1O03A 3HDQA 4ZOBA 4YJ2F 5TPWB 4YGXB 5AIAA 1UJMA 5IUNC 5FR2A 5JATA 2FA9A 3WNZA 1J56A 1OWMA 3BMQB 3HGTA 2ZZKA 3KXKA 3NHJA 4ZAVA 1A9TA 3EB9A 1U2GA 3QE0A 1Y7PA 3KD2A 3DH0A 2UZAA 2HUPA 4QBHA 4NFYA 5HIIA 3W90A 4BMZA 3BGSA 1MU0A 3CH7A 3QVJA 3NCHA 3FDJA 2B1QA 1O6ZA 2M2IA 4KKXB 4WBSA 5D3MB 3U4AA 2I4NA 4MUNA 3OFKA 4QG7A 1XCPA 2ZJBA 3NHYA 3UHFA 4LXHA 4CEJB 1ENOA 1FFEA 1V9LA 2RGRA 3OFSA 1UXGA 4HP8A 4AD8A 3KQMA 4WWHA 3SC6A 1F14A 1X87A 1PQYA 1R6AA 1W73A 4TRRA 3T95A 1M33A 3QM1A 4FNMA 2AOVA 4HNHA 4OUKX 2IF0A 2WG1A 5JCJA 3HC7A 3F7TA 1AF7A 3SFTA 5AW2A 3QX8A 1DL5A 4B3DA 4CKBB 2I8CA 3M3PA 3RE1A 4AMBA 5CTJA 1TEHA 1JECA 4YRIA 4LOHA 5JNUA 3MTJA 2REBA 2V96A 3H6HA 4FNGA 1U9ZA 4IQ0A 4XWAA 1LPOA 3N6RA 5DSXA 2Y6VA 2A5YB 3DO8A 4JDPA 1OVGA 1XA3A 3CKYA 3FG9A 4GO1A 4IHJF 1JVNA 5KVAA 5EQFA 4UFNA 4HZUB 4LXIA 1AX9A 1L7EA 1VJ0A 3LZDA 5LMNB 3V2IA 2FV8A 1N5RA 1U3DA 2DGDA 3HJBA 5DN6A 4DQUA 2IX3A 1PW5A 4P4SA 3OLWA 3G23A 2E18A 4AY3A 3C1AA 3PUJA 2IIBA 4RTSA 3BXHA 2HWWA 1OAAA 1VBMA 4QKQA 3TR0A 3U7RA 2Y0PA 2O1WA 3CX8A 1QUFA 3B5EA 3B7GA 4HZIA 4OSEA 3D6VA 3SS9X 2P2YA 3EY4A 4I1UA 4EJMA 4H6PA 1W30A 1YKFA 1X1AA 1KZ6A 2Y4OA 1BRTA 2Y67A 3QVKA 3N2IA 1T8RA 2FFHA 2FWIA 1H3FA 3UGJA 3CRVA 1JEEA 5BSWA 1IYZA 4ZOLB 2O2CA 2PV7A 3TH5A 5DTJA 1EDEA 1JXOA 4BAUA 1UK9A 4RESA 3SAJA 5JMTA 4ND5A 4PZ0A 4S35A 1EGVB 1XWFA 1N7IA 3ZS9A 3CONA 1MENA 2GEKA 5BQPA 4B45A 1FFYA 5I9IA 4FHCA 3GG2A 4Q24A 2Q28A 3H2KA 3EG5A 5TS2A 1V45E 4LK2A 1CJBA 4EECA 3N3BC 2PFSA 1U8ZA 3OX1A 5FD8A 2V6JA 4XD2A 4R05A 2HBYA 4KVAA 2Z6VA 2DQSA 5FTWA 3BSYA 4JQOA 4Q6WA 1ZCBA 4E5UA 3JRNA 1D2NA 3AVVA 4DVJA 4KWTA 4OMDA 4B3XA 4IDAA 4UOQA 5C46F 1HT1E 5L7TA 3FGZA 3F6SA 4MKRA 4RVFA 5F9MA 3B78A 2ATIA 3A4LA 3BFPA 3GEEA 3L0CA 4NY1A 4LKRA 4O2RA 4R1SA 3ZX4A 1M75A 2SCUA 3LX4A 1B8OA 3P32A 2ZE7A 2O3SA 3QLVA 3TGWA 3G2QA 3LPDA 3RAPR 2JGLA 1G6KA 1I33A 1BE1A 4LPKA 2Y0DA 3FNQA 3VZQA 3QXHA 2P91A 4YMVA 3CPSA 1WUTA 4U3JA 1JQKA 2REQA 1YFZA 4YX9A 4IO1A 4MRAA 1I36A 2WTEA 4H7IA 1OREA 5CEEA 3ZBQA 5A4DA 1MX9A 3N0VA 1YZ3A 3GYGA 4B2PA 2O2DA 1KPGA 4MYHA 3RU7A 2VCYA 4DJTA 1QQBA 1ZQ1A 2EP8A 2AMFA 1CUGA 4XYMA 4FOPA 1POWA 1IBCA 1KMHB 3EVGA 1JQJC 2ERYA 4H59A 4L9WA 4QUEA 4UHHA 3HVJA 1LDEA 1JHPA 2FZWA 2OHGA 4HF7A 4KRGA 4WIAA 5AI9A 4DQVA 3QFHA 1GSHA 5IAKA 4MXDA 4NZ9A 1FS4A 1TECE 1JEYA 3QVMA 3M2PA 1F2UA 3LHIA 3PHBE 4RTOA 4BEWA 1HK7A 2FPGB 1EUDB 3GPDG 4GT1A 3TDKA 1RKXA 3H19A 3JSXA 3FE2A 4I5FA 3A6KA 4GVXA 3KXLA 4B79A 2B6NA 4ISBA 4UTNA 5TMEA 4ZT5A 2Q7XA 2AEFA 2WM2A 4F4JA 2RIPA 4FYKA 4YREA 1BZYA 3WQQA 2GCGA 1DAOA 4XIGS 5FLKA 2B37A 4C7VA 5AUNB 4QPNA 1Z6YA 2PG3A 4L08A 1BVUA 1ZO8A 1SC1A 2R6AA 4WOKA 5EGNA 1JE1A 3PPIA 3HJAA 4BUJA 3CH4B 3SYNA 4YMTA 5CA0F 5HUQA 3S99A 2GO7A 1WUJS 3BULA 5GV8A 3RNOA 1RS0A 3BD9A 3DHNA 4JKIA 3GJ7A 4KWIA 4JLUA 4CI0B 1R4ZA 1FP7A 4OB8A 4N0EA 2XCSB 2EF0A 4OOFA 5EIOA 2GD2A 2ZYTX 4Q48A 4WGGA 4LJ8A 3LX6A 4TRNA 1TX4B 3MWFA 2IHYA 3EXHB 4GNRA 1JDNA 3VX4A 5DXJA 1JTEA 1SOMA 2AJ8A 3QV1A 2N1MA 3EFHA 1YWGO 1H65A 4P53A 4QDOA 3MJEA 2NVWA 3L0BA 3KJZA 4PZPA 4TS9A 4TVKA 1QE5A 1CR6A 2ONCA 3AETB 4KR6A 1W0JA 3MG9A 3S1AB 1WHSA 4B75A 3I05A 5CCXA 3A6ZA 4H3KB 2VQ6A 3ANYB 4JT4A 1UODA 5CFZA 4A2QA 4R8MA 2AMLA 1M67A 2OBXA 3D8RA 4KFCA 1Y3HA 1ISJA 1YZHA 3KKOA 5AM2A 3V4RA 2IPXA 3D1JA 1P3DA 3EA0A 2XDAA 4Q01A 3K2EA 2WPDA 4WKBA 1RPTA 3DVLA 4ZWNA 5H16A 4WY2A 5A4JA 1RU3A 4IGIA 1H6BA 2DKNA 3IQDB 3O9VA 4GX1A 4RH1A 3U2QA 4C4RA 1PK8A 4AC9A 2JAQA 3ABZA 4ZU3A 5PGMA 2ZWMA 1XCOA 2XYPA 1FE8A 4NOKA 4RGQA 2FB9A 2IT1A 3IPRA 1DPGA 1U2GC 2E89A 1NPDA 4IDCA 3DDSA 3H9JA 4QPPA 4KOAA 1ZK4A 4ODIA 1AG9A 2DG2A 1AHNA 1IN7A 1S3SA 2FWMX 3ACCA 1TRKA 2JW5A 2VDLB 3CZQA 4IIJB 2R6HA 3SOZA 1PBTA 2AW5A 4QBFA 2VDUE 1VLHA 2X23A 2AZMA 2FSIA 4IJUA 1USKA 2O6LA 5J1TB 4DLAA 1CJCA 5CG2A 2P8JA 4CKEA 4NP6A 4ZTBA 4O2BB 3GLGA 4MPPA 4JNCA 5SZJA 1IY9A 2C2YA 4DSZA 2JGMA 1L8LA 2DR2A 1U8AA 3M8KA 1FFHA 3MERA 5FOXA 1C1YA 3GF4A 4C2AA 4LAFA 1VE5A 3IDSA 1IBMB 5ITWA 3SPXA 2VP5A 1SM4A 1PLJA 4Q9DA 3EC1A 2VYVA 3I45A 5BWBA 2UU9B 2BE9A 1ABBA 3BTSA 2ARKA 1E63A 3MRXA 1XEAA 4HXYA 4AICA 2OOKA 2CFRA 1XZEA 1KSHA 3PZBA 4Q82A 3B52X 3ZX5A 3GR6A 4Y1RA 1RCFA 1DC5A 5EZYA 4EA8A 2P1ZA 4EYQA 1ZM4A 2H5IA 3U0VA 2EBFX 4BN4A 3STXA 3SC2A 4UTXA 3E9EA 3T7IA 2ZRHA 3W6UA 1AZTA 4JLOA 3E7FA 2B0JA 3VR4D 5KHAA 3O03A 5IM4A 1VL6A 4JUFA 2XKKA 3D7MA 2JLCA 1W4AA 4GYJA 3WSVA 1VIMA 4E3ZA 4DXDA 3QIVA 1WTAA 1QYIA 1X2BA 3V00A 1NUTA 4V0ME 4UVHA 5HGJA 1X7ZB 3UMBA 4B35A 4RW0A 2JJ2A 2CE2X 4AZVA 4M83A 3PEFA 4OFZA 1QIHA 2XCQA 1IAVA 1JEAA 3IT0A 3PQ8A 3VDMA 1U0TA 4CG0A 1LPMA 1G9SA 5CAEA 1ICIA 1CZLA 2BGIA 4RFSA 3IP6A 5DPMA 2OFWA 3OQVA 4BWVA 6AT1A 2J09A 3KTAA 3LM8A 3HR8A 3COSA 4OTZA 3L5KA 2QW1A 2PVSA 1WCIB 1R0ZA 5JS8A 4HLUC 1PFYA 4C0WA 1GZHB 4DV7B 2E48A 3WRVA 4OHOA 1RWQA 1ZRNA 1X1RA 2C3PA 2ORVA 2XMCA 2ONZA 2A9PA 3H84A 4IGFA 4JLJA 2UUPA 3G6KA 4PHGA 4LHZA 4CU5A 3AHDA 4CKWA 3H8WA 4LGCA 2HO5A 2Z2XA 4FMPA 4UUAA 1WBJB 4DV2B 1YJ8A 4C14A 4RELA 1DAPA 2WJJA 4WLUA 4MV3A 4DA8A 3HFRA 1UAGA 1NF3A 4WV3A 3WSTA 2VYND 4AYWA 2TECE 1L7QA 2YUTA 1TJ4A 3FZYA 4RA9B 3GFSA 1C9NA 3TJRA 2WE7A 1ATZA 2P9EA 1ENZA 2ZIZA 3AUUA 1P9NA 1PR6A 3E9CA 3FSGD 2HF7A 3I58A 4FEGA 1M3SA 4EG1A 2ZR8A 4JJAA 1RHUA 4BMOB 1CZUA 1FS6A 2V7PA 3LL4A 4D5EA 3X3HA 3F6EX 4C4AA 2JHAA 1G6HA 4W5HA 4E5VA 1FDOA 4GUDA 4A2CA 4Y1EA 5AKYA 1CZHA 4FSHA 4UU7A 3V8BA 3HK2A 3GZNB 1YAJA 2AL7A 2GD6A 4R8SA 1HMPA 3I73A 3GW8A 4R0NA 1XD8A 2P2LA 1KYWA 3KQYA 1N6PA 3MGAA 1L4KA 1E3SA 3NGXA 5E1OA 1E18A 5EKDA 1EWRA 1Z28A 2PNFA 4KYUA 3TTSA 4E11A 3OCZA 4G1MB 3PS9A 4QOEA 1A5SB 2GA9A 3E48A 3MHTA 2VFAA 1N9GA 3L7CA 1R0WA 4IQ8A 3TLJA 3EGVA 5IJAA 1BCRA 3DZCA 1JILA 5TMBA 3B8EA 3C8MA 4Q34A 1KO5A 2AXNA 2RBEA 3P9ZA 1DBQA 5FNVF 4CVNA 3QW2A 2F00A 3NKLA 4J07A 4OHYA 4U0JA 1IHOA 1FVXA 2QAGC 2DR3A 2ZWPA 3TAUA 4BNJA 2BRUA 2GHIA 4DNXA 5D1HA 1FFDA 2B94A 3DBRA 3RUAA 2ZAYA 1Z2PX 4ZQGA 5TGDA 3EXIB 4RHEA 4BWGA 2AOTB 4B33A 4X66B 2VHCA 4X6YA 4JYBA 4UD6A 3PFNA 1JSCA 1W25A 1K75A 2Z95A 4BQOA 2WUVA 4BTLA 2IE0A 4NBLA 5FHQA 2JH8A 3IPYA 3NKFA 1CLEA 1R74A 3V4VB 1NLUA 4L75A 3WMFA 1PF7E 1S01A 3CMCO 3ZVLA 3DCNA 4NS1A 1EEHA 1ZSVA 2YVUA 1ZUNA 2FMFA 5KDOA 2EX0A 3TM5A 1AN9A 3FYUB 1O6GA 2VSQA 3RVOA 1P0QA 2A14A 5KYXB 4DV6B 4KDCA 2VZ9A 5JV5A 1QX3A 2J5RA 4DC1A 2DOKA 1HDOA 3HEAA 3LQ1A 4L5JA 3ZPXA 4OK6A 5ELXA 1D2RA 4QYTA 1B23P 4MQFB 3SJZA 5DLDA 1Z4LA 1NBOA 4D8UA 1E2PA 4MR8A 2KX7A 4X8MA 2H9AA 2J6BA 2PD4A 2CC2A 5T5QA 2V65A 5MGNA 4U2FA 1F4LA 3CVJA 3W78A 3PF9A 3GP8A 1PD0A 1P29A 5E1MA 3B2EA 1KAOA 4WVLA 4MVJE 4WHMA 5GZ3A 1AA6A 4ZYLA 2CEAA 1SHZA 2H18A 4LTMA 2DHCA 4Z2YA 3SYRA 2J48A 4DILA 1DT5A 2QVBA 1PKEA 3KM0A 3WO1A 1Y81A 3CYFA 4XLZA 5A7HA 1SXPA 4DEVA 1R6DA 2BBSA 3DFMA 4KXUA 1ENPA 2QE6A 4PNEA 5F7JA 3CE6A 3LHSA 3OCYA 2C97A 1JAXA 1RYDA 2R00C 3EZ9A 2QJRA 4QC2A 4C5AA 4MEBA 5IAGA 4BP8A 3KSRA 4BB5A 4EDFA 1WMFA 2J9ZB 2ZYUX 3QSGA 1G6Q1 4XM1A 3TKLA 3L4KA 3P5SA 4I5EA 2P6RA 2RJOA 1EFHA 3PJGA 1C7ZA 3L02A 2C8KA 3PP8A 1ISPA 2OEPA 2Z56A 1M54A 2OGZA 3C16C 3I83A 1O5TA 4FNAA 4GZLA 3DHYA 3ED5A 1A72A 1C1HA 3P1JA 3I9LA 3VPXA 4I9HA 4DV1B 4YT5A 2NUPA 3D02A 2I66A 3KDAA 4LMBA 2JAPA 5AHRA 4YCNA 1X1DA 4A7PA 4YRRA 2V6BA 2Z6UA 1LBTA 2EZUA 2M98A 1I13A 4RVCA 3WLLA 3ZE2B 1AGRA 3AM5A 4F6LA 1W88B 3EJWA 4B83A 1U8YA 1VBKA 2QM0A 3WLJA 3IODA 3Q8MA 5JJ5A 4IKEA 1FFSA 4HNQA 3TMAA 2RDMA 4KXWA 1DAMA 2QN9A 1C1XB 5CB0A 4KPGA 2R60A 3EFEA 2FG6C 5DGCA 3RREA 3ONVA 1O95A 4OHRA 4FW8A 1LFDB 1TO6A 1CULC 4HFMA 1ZAYA 3Q8KA 4H7KA 2QTBA 1XBTA 4Q9IA 2QQFA 1MDFA 4G97A 3DL0A 2X1MA 1KP2A 2W93A 5EOVA 4LRUA 3JV7A 3BE8A 3WZMA 1ABFA 1XGKA 4TS1A 2M6SA 5I7VA 1GNRA 3PVCA 4IUYA 1WV1A 3S7TA 4B3BA 5I9NA 3ZK8A 2F4NA 3KTFA 521PA 2IXFA 1Q19A 2HDNB 2ZJ3A 3Q3EA 2OFXA 4BKUA 3G7SA 3OO0A 4QVIA 4L8LA 1UINA 2B1RA 3IHLA 1OILA 1V8DA 1R8YA 2VJKA 3MTEA 4JBYA 3A9CA 1KMIY 1HRDA 1US8A 1ZOOA 1WY7A 2WMOB 1V3TA 3FYSA 1YDHA 2WIGA 3HCDA 4LXXA 3TCXB 3PR3A 4B47A 2Q41A 2A4MA 2XAAA 5BSUA 4C5CA 2GF0A 3O4FA 4US1R 1S9DA 2C29D 1ECGA 3N5CA 4RPLA 5ADHA 4RGVA 3VNUA 3HKCA 4YDSA 5IDQA 2P9TA 4JIGA 1XQ6A 2IZ6A 3U3KA 4ZARA 3SJBA 5JBQA 1NZFA 1LGYA 1WBBA 3F67A 1K5GA 5TIIA 1Q77A 3UC9A 3NALA 4G1BA 1K5PA 2IY9A 2WIKA 1NRXA 3C7KA 4TV8F 1WULS 3UIEA 1RM5A 1OB2A 2CUTA 1PUXA 2NYVA 3BCHA 3HNRA 4U9HS 5EWMA 2GDZA 1BD3A 1L4HA 2H5EA 2NM0A 2PKCA 3WQRA 2VH2A 3GWGA 3U48A 2YQ5A 4GRAA 1AU9A 3AR2A 4CMBA 2LW7A 5F23A 1O0BA 5B2FA 3HKBB 3EPHA 1YHNA 2D6FA 4DUYB 3QYAA 3EF1A 4GC5A 4JQCA 2TRSB 1UZAA 4PBRA 4RVNA 4OUDA 3K1AA 5TPZA 2B69A 1E6LA 3KOZA 4PLGA 2YOGA 2TYSB 5UKDA 3IB3A 3B12A 1YS6A 3O2JA 1NJGA 3KSDO 4QRIA 5DTRA 3N2KA 4FCTA 1E4OA 2G5PA 3JR3A 2GRAA 1YR3A 5JZBA 1Z4OA 2ZW9A 4NBTA 4PXSA 3TF5A 2FMKA 3LYAA 2FGKA 3IR6A 5HPYB 2AKEA 3EVZA 1UZUA 1LSJA 2OO7A 2O3TA 2BFBB 1EIWA 1CY2A 5I4BA 1G8AA 4U7PB 9LDTA 1D6JA 4HQOA 2CUZA 2PAAA 2MYUA 3A6EA 1EX1A 1G63A 2WP8J 3KDSE 4GG1A 5G4KB 3P2MA 4YIHA 1LBIA 3BK7A 3GFOA 3HO1A 3OX2A 4HWTA 4XOIA 2AXQA 4MARA 5DU2A 3JYNA 2IV7A 2G07A 2AXEA 2X19A 4RLQA 1CR0A 3ESBA 3CSUA 1YI0A 2BV3A 3OIDA 4TSFA 2JANA 3F9RA 5T4HA 3RQIA 1XCMA 2GN0A 3W06A 3I9V1 1ZIXA 2NUTB 3N2EA 4XD7D 3VZRA 1Z6QA 4C6TA 5EGSA 1C9DB 3TN7A 3T5TA 1RJFA 1AGXA 4LHVA 3K35A 1LDMA 2HIHA 1YJ5A 3SFVA 2BRUC 2JFNA 2YN4A 3K3PA 3O82A 3IXQA 1BMDA 3DG9A 3COYA 4FDUA 1MB2A 3KJGA 2O2EA 3B6KA 1WXQA 3PQ6A 1FMCA 1RC8A 1A9OA 4V2IA 5AH0A 2AZXA 4P83A 1FXWA 1EM8B 3A3KA 3K0AA 4MQ4A 1IBLB 1QOPB 4PYLA 1XKQA 1JPJA 1X1TA 2D1QA 3P9NA 2A6PA 2P9BA 1Z82A 4GYWA 4R4JA 4U2BA 4UBKA 5GOZA 4ZYYA 4N41A 4KIFA 4HNAB 1FXSA 1PT6A 1K3FA 2DFLA 3K72B 1JAZA 4OCZA 2Z4RA 2JDIA 1E2FA 1HA3A 2W6JA 4CM9D 4ZI3A 3DMRA 2V59A 2VXBA 3E9ZA 2X2FA 5BWMA 2H2WA 5IT4A 5HUHA 3CRRA 3M5PA 2YVKA 1UQRA 1LUAA 2P9YA 4MA5A 4ZO8A 3ZQKA 2ZI3A 4E22A 2VJCA 3JZAA 1FY2A 2H4ZA 1JQ5A 4GR5A 1R5NA 5ALXA 2G72A 2H57A 1PR9A 2EOAA 4HMQA 3SXPA 1SCUB 5GGXA 1PTJA 3VJRA 1YA6A 1XMJA 1SVNA 2CCKA 4OL9A 4B31A 4YJKA 1E77A 1ESEA 3B9QA 4RF3A 3DONA 3RW9A 4PW0A 4FS8A 2JJ1D 3E8SA 3ZE7A 2VJPA 1R6VA 3RAEC 3RHZA 5T8KC 3UAVA 1Q0ZA 3DDWA 2R7KA 2FEMA 1KIAA 1ZJWA 1E3JA 1TYDE 1HTBA 5K05A 4TYWA 3IDQA 4WZBA 1YL5A 4MVJH 3LKVA 1APBA 3HXTA 1UH5A 1M1YE 1ZNQO 3SJ7A 1KGSA 2GCIA 3EAGA 3H2GA 3K5IA 4OXNA 4ZAYA 2FN3A 3LDHA 3AFGA 4JR0A 1M6HA 4RJLA 4BYMA 1QNLA 1G4UR 5BUSA 4PPYA 1GAEO 4FJ0A 3RRBA 5EKXA 4U39A 2ZQYA 2EJBA 3S40A 4HAWA 2IE8A 4HN4B 2GNAA 2FLKA 1TUGA 4IWNA 4YV1A 4B87A 3HV0A 5AI6A 4BGIA 1DCKA 1N2CB 2NU7B 3OY7A 4BNIA 4C9BA 5DYWA 1RRGA 2AYYA 2Q8QA 3E61A 2R4TA 1RI2A 3ZCTA 1BE8A 4L4ZA 3R3HA 4UD2A 3NHZA 4O8ZA 1PGOA 1WF3A 5CDUA 3BOSA 4DDKA 1QIJA 4Q3AA 3NHWA 1NT4A 1VTKA 5IC4A 1JIXA 1AQYA 1R0SA 4AO8A 3QKTA 4D0LB 3WGMA 1W76A 3ELDA 2DHDA 4WEOA 2UYGA 3BCSA 2A8YA 3A28A 3CNEA 1Z5VA 2HSGA 2K2QB 2FEWB 4IOKA 2FNAA 3PIRA 4WFKA 3VA7A 4IICA 4ZQFA 2SBTA 1O95C 1N5DA 4UAUA 4FC6A 1B6GA 1QZZA 3P4XA 1V3QE 2AC7A 1J8MF 3MINA 3DNMA 2H52A 4QL3A 5KNCD 4FFMA 1JEJA 2C2OA 4ZKEA 1E92A 2JIZD 1JG6A 1LVGA 3AVPA 1EFAA 1PNOA 3RFCA 3N7TA 4CL0A 4GOOD 3DGEC 4IQ4A 1H94A 1YDMA 3V42A 1QB8A 3IAEA 1ECJA 3GUCA 2C8LA 1NVWQ 3OQ1A 4D26A 4UBJA 1XMQB 4N3GA 5HQ3B 5ED4A 3IH5A 4K03A 4RPKA 1C9KA 4WLNA 4C21A 1PV4A 4F2HA 3MLBA 1FLVA 4PAMA 1P1BA 1L1RA 2CLIB 3MCTA 2EGGA 2O4UX 3B38A 5DBOA 4BNFA 5JXHA 1XI2A 4QPCA 3W34A 3FCSB 4Q02A 3OF3A 2EKBA 3CMMA 3QEOA 2DJIA 4LRXA 1U28A 3TOSA 4EI2A 4ESEA 2X8BA 4Z0HO 1IXRC 2A0WA 3PWZA 4P6VF 3BUSA 3G9QA 3T8YA 1XIVA 4BGUA 1V1RB 1ZSYA 2FCRA 2OCXA 3CLKA 3HY4A 4D4LA 3SIWA 4FNOA 1KH3A 3A9SA 3DM5A 2PA0A 1YULA 4BV8A 1XTUA 1JEDA 3NG1A 1A5ZA 1AH2A 3CO5A 1ZK1A 4E13A 5I5EA 2VJLA 4HEHA 1E1CA 1Z7WA 1WRBA 7MDHA 2JIMA 5IAJA 5GJVC 4R9SA 5B4UA 1Y1LA 1YHZA 3KQSA 5DLPA 5AW9A 1ZCAA 1O8CA 4CN9A 1K63A 5IKOA 2NN3C 1VMAA 4W1PA 3V1LA 3BG5A 3DTNA 3WDMA 1CW2B 2XY4A 3K9HA 2ZBDA 3VOSA 1KFCB 5DV9A 1ZD3A 4J94A 1PWXA 1NMEA 4L3VA 4UUNA 1K7YA 3B6MA 3BMNB 4J7XA 1A7UA 1RDFA 5C1IA 2OHOA 3PSHA 1KQOA 4OXXA 1E7YA 4MKXA 4MS1A 4YMHA 1W49A 1Y82A 3F5MA 5LN1A 1U7WA 4LNUA 4KYIB 3U39A 1C1DA 4E1AA 2REOA 1BX0A 1UM9B 3GX1A 2F8LA 3KLNA 4PCLA 2QWXA 3NXKA 2HRQA 2PA3A 3TIXB 1SC4A 3PBKA 1BTOA 2EGHA 1NBMA 1J9EA 1YRWA 4JT2A 4KZPA 2B34A 4PG4A 3ZE9A 4P82A 1RLJA 4GAEA 5B7GA 3B1XA 1YZUA 5FV4A 1Y6ZA 3OTOB 4L9RA 2H11A 3DL4A 4C7BA 1ST3A 5KSPA 4Z4QA 4U8HA 1FYWA 1QKJA 5AW3A 1OBVA 1DKUA 1Y3DE 2CHVA 2Y1GA 1ZU5A 3FRIA 3ND8A 4JGBA 1LLQA 3H5NA 5HKAA 3CR7A 3O91A 4H35A 1GO2A 2XWJI 4CDMA 2UZ3A 3DZKA 2QVCA 4Z53A 2GLXA 4Z9FA 2QD5A 1T1EA 5HCNA 3ZWBA 1ML4A 1U0HC 3AHJA 1KS2A 1CQXA 1ECBA 1K6JA 2AQKA 1IJEA 1J4AA 1JWAB 1VB5A 5CFPA 5KPJA 3PNQA 4LDNA 2AKYA 1MPXA 3PE3A 4MA0A 5AK4A 1Q0TA 2PKEA 2FOIA 1QGYA 3L0SA 4XEUA 3K9BA 4J4BA 2AV6A 5C4GB 3NJRA 3N2GA 4BMPB 5KTOA 3KU4A 2FPPA 5DHSA 4D2IA 1GTG1 2MSKA 3VYWA 1FQKA 5A1TA 3BAFA 4TYNA 1GTSA 3LP8A 4XH9B 5DBGA 3B36A 4V0OA 1B15A 1G59A 4P8RA 2GX6A 1AQ6A 1MNQA 2E21A 1RSZA 1YE8A 4BNXA 5LZ4A 3JYQA 3EPRA 2Q4TA 3BXZA 3BD7A 3KOXA 4GW3A 1TMKA 4M0UA 1Y3IA 1RKUA 1BO6A 3HDYA 4RDIA 4G86A 4E5MA 5TQ0A 4XTCS 2AF3C 4CLOB 1B74A 1CRQA 2BJHA 1STOA 2QJOA 4IXDA 4A23A 2ON6A 4CLHA 1C2TA 1REQB 2ATEA 1IUKA 3KKZA 2BYTA 4MWOA 3QVUA 5JBIA 4PLWA 5L9AA 3SQOA 1A8UA 1MEJA 1QXSA 1I94B 4MR7A 4CV0A 1IE3A 2EZ9A 3WGIA 1ILEA 5ALPA 2F1HA 2I1VB 1M2WA 2OAEA 3ZZ0A 1U1DA 5CEFA 2LZ0A 2FW0A 4E51A 2OP1A 3L06A 4I14A 1PTJC 5JVDF 2FHPA 5CXSA 3ASYA 3IJ5A 2BUCA 2W2OA 5CIQA 5ED0A 4J1TA 3R23A 2WV7A 3T15A 2H7VA 4IVQA 4I5IA 4DRXB 6GPBA 1P7ZA 2ACEA 3DZHA 3AVXA 3QELA 3E2MA 4HK4A 1M2OA 1Y3AA 3FPKA 1HFWA 4JOSA 3UCEA 4I66A 2VRCD 1HL7A 5DTIA 1YNOA 3AINA 2VAWA 3DW1X 2PUTA 2C04A 3DOFA 1YOVA 3JWHA 2IHTA 1OBCA 2M6RA 3R5XA 4Y2XA 3VKGA 3AOEA 2YW9A 4QEZA 2AB0A 2Z6QA 3U4DA 1OI2A 3G0BA 3NVAA 4Z0NA 1Q7BA 1JNXX 1DQZA 1ONPA 2EBHX 4MGIR 3W7VA 4CV1A 3THWB 4WXEA 4RZUA 3PDUA 1UBSB 4BIMA 1IZ9A 2P41A 2GUWA 4YPVA 1DDOA 4NE2A 1IG3A 3CZ5A 1ODTC 4HYEA 2PUWA 5E8JA 2WG0A 4RIIA 3WHIA 2OSBA 3BYZA 1SUPA 4B6GA 1MIHA 2WUGA 3QVGA 4E2WA 2H07A 1VGQA 2CDBA 4BNGA 4CF4A 4P35A 5B57C 1QRTA 1DC6A 4EAAA 1R37A 3V1UA 3UGTA 4A6PA 5HA5A 4GMXA 4ZO9A 1M2GA 2FWNA 2R6JA 1KQGA 1T15A 1TF5A 2R8BA 4WUVA 3ZVMA 3W2GA 4E33A 2RIRA 4MGEA 1PEDA 3AUJB 2PWZA 4P2GA 1ETUA 1MNAA 3P2OA 3QH4A 4NMHA 4JITA 3V97A 1IM8A 2NP6A 4GGPA 4YRFA 2VBFA 1QJCA 4WNIA 5EP1A 4F97A 3FHCB 5EJ4A 5J43A 4XFJA 1NTRA 3IJPA 4MW2A 5CXXA 1RJDA 3V2GA 2C61A 2HD4A 4IBOA 1WB9A 3PTZA 1JR6A 5EUMA 4V0MA 3GZTB 2F3PA 4G5QA 4DA9A 3VQTA 1TVKB 3OOEA 3O38A 4ZIRB 2FEKA 2ZI9A 2A1UA 2J5KA 4ZHSA 1U3TA 5CB4A 5GIPE 3CH5A 1JHAA 1H8ED 2BMEA 3PXXA 1SK8A 4HNUA 4Q3LA 1RI1A 1A2OA 5ALIA 2BBTA 2ZBVA 5T4BA 1AHPA 4KYVA 1QTNA 4EEZA 4JI2B 1D6SA 3H65A 2VH5R 1K0UA 4M38A 4PZLA 3RRYA 5FUMA 4HYQA 4B76A 2KMLA 3MGBA 4MJLA 1U0GA 3F6YA 3CE9A 3GRCA 1Y0BA 2SKEA 5CVJA 1AKQA 4B4WA 1Z6XA 2YIDA 1ESMA 3KUDA 3QI2A 3HUUA 4II2A 1U28C 3INRA 4ZYVA 1KDYA 2PMEA 5KOYA 2PJRA 1JU4A 3NHFA 2A9JA 4I9NA 2NPIA 4FE4A 3T94A 4F11A 3LK7A 4ZP1A 3A4MA 3FCUB 3RUHA 3U4QA 2L42A 3E82A 4S04A 5AI4A 1B3BA 2GTIA 3Q3JB 1Q44A 2ZSBA 2VDVE 1CWUA 4MV8A 2YMMA 1KVQA 5PNTA 4OMFG 5H4GA 2NX2A 2ZVJA 4DWVA 3LO8A 3H04A 4ZK6A 4WKNA 3ZHXA 4WECA 2XQJA 4UTZA 3HKDA 5KJEA 2RGGA 2CF6A 1Y8ZA 1N2XA 4CMHA 4HFNA 2GZ3A 1K2VN 1M74A 3EAFA 5AXBA 2I4TA 3BCRA 3K1TA 3NHRA 4L51A 4UTVA 1SUEA 3VR5D 2AZDA 4FX2A 3CUWA 4LVCA 3KAJA 3S27A 2QMEA 3ZGVA 1Y8QB 1JWBB 4HDRA 4XYEA 3F8TA 3A2NA 1OBHA 3KFXA 4DG9A 2WVHA 5KZMB 3I3OA 1M1ZA 3JASB 2B5VA 2H4XA 4EWLA 2MU1A 3IA2A 3EEBA 2XWSA 3U4GA 1H4QA 3A1TA 3LX5A 1QVZA 1DGQA 2Y1WA 5CU7A 1UPTA 1V37A 4DLXA 2Y77A 1L7NA 2FFJA 4BNMA 4ZJPA 4G01B 1FYVA 2WJYA 3I8OA 4M7OA 5CK4A 2ZJ5A 2GK7A 3EPPA 4DQ0A 3TBKA 3C7TA 3CUSA 1QS0A 3UEOA 3LKDA 1FX0A 5J58A 2Q3CA 1T25A 2OLJA 1KQPA 3DBOB 1WCXA 2AHOA 1L3BA 2HTFA 1UFVA 3H3XA 1TUIA 5F35A 5ILGA 5EWLB 3U9LA 5AVUA 3JVIA 3NB0A 3IIEA 4PSAA 1VHQA 2WFZA 2VWHA 2OG1A 4X63A 1Z38A 3JAMA 4A92A 2J32A 3PX7A 1BMFA 1UJ4A 4DUGA 4KI7A 2XNKA 2WQ6A 1Y7IA 2VOJA 1LPAB 1YH3A 3FLEA 3G1UA 3U9SA 3CNBA 1QSGA 3MNFA 5BW6B 4BU1A 4YRGA 3OTHA 3F0TA 1KC1A 3SBEA 1AKMA 4RJJA 1D4ZA 4Q18A 3IOYA 1J2TA 5AJHA 5A71A 3TTYA 4CLXA 4ZGWA 2R5NA 4MINA 5GZ6A 3MIIA 3L1HA 1RMQA 2FQ1A 4CLDA 3C3CA 4FFPA 1KQFA 1RPJA 1VRVA 3AM3A 4A3SA 2HQBA 3AVYA 4UJ3A 2Y66A 2UYCA 2J41A 4LV5B 2PSJA 1KEEB 3T3EA 4ZI7B 1M2JA 3FF1A 3N76A 5EP3A 4KEAA 1IY1A 4RMIA 2XIJA 3LSTA 4Y6LA 3V8NA 1CDZA 2ATXA 4NEGA 1TIBA 1GL9B 2GN6A 1YJXA 5HVNA 3TYXA 5CITA 1NUHA 3NNNA 3JRWA 2PK3A 1NONA 3K4HA 5EI5A 3W2TA 3QU7A 1K8QA 4EHFA 3CLTC 4RC9A 1L8OA 4S12A 5LDDC 1ULBA 3L18A 2HMUA 5LVAA 3LBHA 4IPTA 1EH5A 4YP9A 3U9TA 1MEOA 3DYBA 3MT9A 1JAYA 4EJSB 2X58A 3WHLA 4RV4A 3VTFA 5FOTA 4MCIA 1FP2A 1T4CB 3BRQA 5BOVA 1NQWA 3ZHQA 1T13A 2I6SA 3RUDA 2G08A 1G4HA 1S8FA 5KYUB 3H5IA 5FA6A 4IG4A 2YWEA 3OBBA 3VKWA 1E2LA 1WHTA 1Y5MA 3G5UA 2ZI4A 4QGGA 4J1TC 3TW4A 2JLQA 3HYLA 1KEUA 3IAS6 3LDFA 3LNTA 2BFFB 1G291 2VUIB 3N70A 4Q47A 3QY9A 1QNFA 2X8WA 3LRXA 4K9PA 3UT6A 1BXGB 3F5SA 5FL3A 4ED9A 3MWLA 2B3TA 1ZI8A 1SRRA 1GAQA 1F2TB 3N0WA 3H4MA 4GDMA 3A32A 3VUFA 3HB7A 2C8VA 2ZIXB 5IYZA 4WLFA 1L8XA 3DB2A 4I3GA 5F3DA 3KJXA 4HDCA 1OKKD 5GQSA 3RPEA 4KIWA 3A06A 4Q9NA 2CFCA 2QZ4A 2XH8A 5ANRB 4XFKA 1QDEA 2ALJA 1LWOA 2AC4A 2CWDA 2P5SA 1T34A 3AOEC 3C7DB 1JN0A 4FYPA 4ZYZA 4FCWA 2QTZA 4AKSA 2ZYIA 4ZCPA 4ERNA 4E15A 1AURA 1E1LA 2ZUWA 3MAAC 4E5SA 4R1UA 3I04A 3IEIA 1EINA 3GAAA 4GSYA 1V0JA 3KYCB 1E2QA 3V7FA 2Q1TA 1OIWA 2XVAA 1DCMA 1C50A 1KMMA 4ZVUA 4A1OA 4HH4A 1E0KA 2I76A 4IIXA 4JP8A 1DOHA 3ZK9A 2GPAA 4WXMA 1MA3A 2II6A 5EKSA 3FCCA 4HG2A 5ALLA 1VCOA 3RO7A 2FVXA 3S5UA 1ES9A 1GZ7A 1X7YA 3EW9A 5DYTA 4ZXPA 5I7RA 1NX6A 1NKTA 4E3WA 3ANLA 3P0HA 3ZOZA 3MCWA 2VP4A 5FQNA 3L07A 3BPSA 4F6RA 4JDUA 4FMCF 4F2PA 5JWRA 2XXJA 2K87A 3BJZA 1YSCA 1F60A 2HQSA 2PXXA 3ENKA 5JISA 1E5LA 1LS1A 5IVHA 2XHZA 1Q22A 2V6MA 5KNDA 4RH0A 3GO4A 4IIDA 1N78A 2ABWA 5DHRA 3TSCA 3EGXA 2BEWB 3GJ6A 2O20A 4HQRA 2VF8A 3O8OB 4I1SA 3ND9A 1XTQA 1W36D 3NBAA 4JI6B 4PLCA 5J40A 5KEIA 3I1JA 4AK9A 3ISTA 4M9QA 1RHKA 4EO4A 1VPVA 1TMGE 4WLVA 1A76A 2GD1O 1XJCA 2W48A 3T7AA 4O2LA 2WSYB 4RE5A 1GV1A 1YS4A 1X92A 4Y1FA 3AHCA 2H1CA 2QP3A 2R7NA 4ZJZA 2GKOA 3MWEA 2BDUA 3CRMA 3FDXA 3D2CA 3HB9A 3KUXA 4DR6B 3G79A 5EIBD 1UXOA 4R8RA 1E5XA 1OASA 3I9NA 1W5EA 5AJZA 1L4LA 2GVNA 2OVFA 3SHVA 1I6MA 2IFTA 2VKTA 3ZY4A 2A5JA 3TLBA 4G2TA 1LJ8A 4GI5A 1PYOA 4IDOA 4RNCA 3QYPA 1G8MA 3NEAA 1UBLS 2R7LA 2XYHA 3FI9A 3O4VA 3NC0C 1Y9ZA 4RF4A 3NM6B 2AEMA 4FYJA 3R4VA 1A95A 5F1YA 4CR6A 4EG4A 4UNNA 4CUZA 1P60A 2CMDA 5HWSA 2G28A 2H1IA 4LE2A 5TLSA 2NZJA 2HMYB 1DRUA 4F8YA 2I7VA 4HHEA 1SJ9A 1KJ9A 1YK0A 4R8VA 4GIBA 4UAGA 2AUTA 2EF1A 3D4OA 4BZXA 1FLNA 4MGYR 4RY9A 4MR9B 2D2IA 4E4YA 1P72A 2Q5CA 2REXB 2F55A 3OOSA 1NJFA 4W9NA 1JYSA 2DX7A 3O6VA 3BIWA 2W2LA 4A5OA 5IJ0A 2E4YA 4IJWA 4YYEA 1AKUA 3GJYA 821PA 1H2AS 2BGJA 1OD6A 4EHDA 1W46A 1ADFA 2G04A 5KQRA 4Q9KA 3ORFA 2ZJYA 1AKEA 4U9UA 1TM3E 2QT9A 1R8XA 1YDGA 2G25A 4M9ZA 3KS9A 5ILQA 3VOBA 1SBZA 4ZAWA 4CM8A 3ZZNA 3GOHA 4YRQA 4RV9A 3WK5A 3WISA 4QQFA 3Q6NA 4M6WA 4BBJA 1EVQA 3RF7A 2YJ5A 2NP7A 3O8BA 1XB2A 3OJ0A 4QUDA 3H87A 1IC6A 2I3GA 4BMXA 3Q9SA 2C4WA 1J09A 1NZDA 1XRMA 2R87A 2XGGA 3OZTA 3PQ3A 4MDHA 4R9NA 4GZMA 3VPGA 4AN0A 1E4EB 2IYOA 1QRRA 3PGXA 3DKPA 5FBZA 1ZDMA 2QNBA 1XRRA 3CX6A 4X1YA 1HEYA 1RIFA 3AUKA 3QOWA 3ELYA 4RY2A 5DVZA 5E9AA 1SCJA 1PZHA 1VXOA 5C1BA 2IXBA 1BXZA 3E1KA 1QHYA 5BQOA 3VR6D 1NNEA 1KI3A 3E8XA 2RC6A 1AQJA 1G8KA 2G1AA 5KYYB 4AO7A 1YJAA 2G0NA 1X8JA 2GAJA 4KITB 5F9FA 1AVTA 1RVV1 3IP1A 3PHIA 2PX0A 3PICA 1XZMA 4B4UA 1OW3B 1OWNA 2FUNB 2IYUA 4RVGA 4YJ2B 2Q1WA 4FR5A 4NRDA 4R5MA 5BWLA 2Q29A 4X1IB 3I5UA 1JHDA 1CVRA 1VBNA 4XPZA 1IUOA 1CU1A 3DKRA 3EEFA 3DBVO 3RYIA 3TEFA 2FY8A 1X42A 1FFWA 2WFAA 3RVRA 4Z86A 3UA4A 5JEDA 2CV0A 5GP1A 3UG7A 3D0KA 1NSTA 3NDRA 4ZV4A 4NBUA 1JR2A 2B4AA 2VJNA 1CUYA 1N5LA 2ADMA 1H9AA 1YDFA 2YXNA 3C97A 4Y67A 3CGGA 5A5DA 5BP7A 1UJ2A 2B8TA 3WV5A 3DOOA 4MVJG 1UF9A 1QO9A 2RONA 4U2EA 3K6SA 2B82A 2D74A 1XKXA 1FBTA 3NPAA 4QAQA 2XYVA 3GJSA 1XDDA 3L6EA 1GV0A 4N18A 1KBZA 4X71A 2RH9B 3SZLA 4CDNA 5KNBD 1J8VA 3R7AA 3FRHA 3FPBA 4H2DA 2VDWB 2Q5IA 3IOCA 1K86A 1YRBA 2ZRBA 2ZXUA 5GADl 1LS6A 1BNCA 1T5HX 4FYWA 4LTDA 1SOVA 5HFNA 4MAMA 1GXSA 3LUKA 5KQLA 4H4DA 4AN1A 4H6XA 4ND3A 4K6HA 5L3QA 3GLFE 1X7HA 4YQFA 3ROKA 4AG6A 2OD7A 3D6TB 4EYEA 1MQAA 1DWQA 2IXEA 3RFUA 4HT3B 3H75A 2QLNA 3HR7A 5THQA 4C78A 4R81A 1U7ZA 4QULA 4E6EA 2HCRA 5EJ8A 3LUAA 4DKJA 2O19A 5HK8A 3ZLUA 2NNWB 2YWJA 1N2CE 3OJWA 1C9JA 4W1SA 3H2YA 3WGOA 1B6TA 4JJKA 5DISB 1J9GA 4GR4A 4PX2A 3SSOA 4J43A 4Q3BA 1C9EA 2BHSA 1E1MA 3DMPA 3GGPA 4YJHA 5F33A 3RC2A 1KJWA 3CVUA 3R3WA 1MAUA 1DXOA 4H31A 3UOWA 3V7NA 1UEJA 5KJFA 2BM8A 3ZXXA 5DI3A 3K9GA 4NJEA 2IGBA 5FADA 1TAQA 1QGDA 1FJXA 4P38A 3PG5A 3LLCA 4RWZA 1OX5A 2XJ9A 4G9GA 1H23A 3LPCA 3WKCA 3QPAA 1E2HA 2OLEA 2W8BA 4GP7A 5AHXA 1TLLA 4FDAA 4V38A 1FXWF 3D0OA 4X45A 2BN4A 4Y2GA 3KEMA 1LRJA 4AX4A 3TG8A 1YZNA 2X8JA 4OI4A 1TA4A 4RQAA 4YCAA 4LGMA 2IUYA 1Z2CA 4CT4B 1E3LA 4LZLA 1Z0KA 4C4SA 4QU0A 3H99A 3CR3C 2CJWB 2GN4A 3I8SA 3QXJA 5AJXA 1E0JA 3UAYA 2Z8YA 3ZBPA 4EKEA 3KPVA 2J9FB 1TC2A 2OPBA 4G1CA 2H7CA 4LSGA 4BX0A 1JPNA 4F3NA 1C3OB 5K2MA 1XEWX 3DE6X 2C7RA 2HYIC 3NAMA 2R5FA 3U62A 2E1RA 4L4SA 3JVDA 4BPBA 3F96A 3MLAA 1K7CA 2P8SA 2X14A 4HWOA 1GYRA 2Z2ZA 3KOMA 3PUWA 4XDYA 5L40A 4L7VA 3M34A 3ZWPA 2O59A 2EATA 1Z6ZA 3FOFC 1JH8A 4EZIA 4UHBA 2FWAA 4P4GA 3UXMA 3JPWA 5K0JA 5LU8A 1JLKA 3CW2A 4HGQA 3LT1A 5JS1A 2O0JA 4OMUA 4OVKA 2A84A 4JASB 4Z1MA 3WL7A 2FRXA 5CHYA 1DS6A 2ID9A 5EE3A 4HXGA 3VGPA 3RAFC 4WXRA 5DBHX 3THYA 2NYAA 3O4RA 1MGOA 4C06A 3V48A 4DV3B 2VQEB 1GG9A 1M6WA 4JBGA 2A1TS 5JY1A 1FPMA 1C0EA 1TO2E 1MJFA 2X2EA 3CEPB 3EVCA 3FD8A 3HYSA 3OUZA 4M8NE 2O8FA 4RPIA 4UUQA 1COZA 5TX7A 3DZBA 1R0RE 4HADA 4I08A 1Q1EA 2JFYA 3NCTA 2J9GA 3F6BX 4B71A 3D4LA 4WOBA 2ZTSA 3LAWA 2CFSA 2WF7A 2G9RA 1LNQA 2D1TA 3DUFA 3O1LA 3L8MA 5CR9A 3VFDA 2P9QA 2JKZA 3P20A 3R9XB 4O2AA 4ZQBA 4KACA 1KARA 3PT5A 1GNSA 1VP9A 5FJIA 7MHTA 4F56A 1G1AA 1Y9JA 1CUWA 5EE5B 3P0FA 4TXLA 1QLHA 3N2NA 4EQ6A 3F4KA 3BL8A 3PTLA 3MBIA 2Z1MA 4YT8A 3QFSA 5E6SB 3OZVA 4E70A 2GUGA 3ZWKA 2PRJA 4UMVA 5HE8A 4JI7B 3HJHA 2HB6A 2JFPA 2OR3A 4UDNA 4XIIA 2OL4A 1E6CA 1JKFA 4YP6A 3IP9A 2CVFA 1C0LA 5GINE 1ESCA 4WBNA 2B2NA 3GIDA 5HDBB 1RYEA 3FRJA 5EJ2A 4BCDA 4F8JA 1IQUA 2OZPA 5H3HA 3D2BA 3DF9A 4B6RA 4EFNA 1D1SA 2A9FA 3TEJA 1THMA 1Z5WA 4K88A 4ENUA 4OXQA 4ZA2A 4Z4CA 4OQQA 3EUEA 3VU3A 4NXNB 1KP3A 1QPBA 3N8KA 3TD6A 3LT5A 1UCFA 3NXSA 1M72A 4IFEA 1USWA 3RS4A 3BQMB 1DMSA 1UBGA 4E32A 1TK9A 5IUJC 1J2YA 3IMGA 4NYJR 1ULUA 3G7UA 3C85A 1OWOA 1RBZA 1ZFNA 1GPDG 1JIUA 4WCDA 3GB9A 2VYQA 3QNUA 4ZVNA 4EI8A 3SYKA 1AK2A 4MOWA 4G1FA 1ODFA 1RI5A 1L7DA 3GIWA 3VKUA 2FQWA 3B20A 3IEVA 3L8EA 5JO0A 1M8JA 3LUHA 1OYWA 1SVLA 2J4FA 2VTVA 2WJ3A 3E9QA 1LW6E 4LC0A 5HYVA 3H8SA 4M37A 2YQZA 5BURA 1M2KA 3A4VA 2ODAA 1RQLA 4G9BA 2M1XA 5TEWA 1OA0A 3KVRA 2V3CC 1HTWA 3D8BA 3VAYA 5TC4A 1XR3A 4G56A 5KINB 3G0HA 3DBHA 3IESA 2BKVA 3LF1A 4PAWA 2VLBA 4D3XA 1U0RA 3L9WA 2CXOA 3OAAA 4KXFB 2VDRB 5DCLA 3V1YA 3Q7EA 2I3DA 3SGLA 5JRZA 1GKIA 1ZNXA 4WLEA 2Q3BA 3JQ9C 2HJHA 4A16A 1OXUA 4BC0A 1TQHA 3TCNA 4YB8A 1J99A 3G2NA 3TLCA 5IC6A 2XE7A 1TF7A 4W5OA 1CVIA 3CX7A 4N47A 1RTTA 1A5AB 1BWRA 2AUMA 3DR3A 2I0FA 3VM6A 2AXPA 4KI0A 3ZEAA 3HCRA 4F6CA 5LQCA 4RAQA 3HBJA 1GQQA 1SZPA 2XUDA 4NQRA 5SZKB 2B2CA 4QWMA 4XM2A 1A71A 1KEWA 1Z2AA 3FZNA 2VDNB 3MTDA 3KYDA 1VQ1A 3BHIA 1PG5A 3W5HA 5IXSA 2IHUA 1SH7A 5ITZA 5JCJD 2ZXFA 4X9XA 5IH7A 3NRBA 1IM5A 2C5FA 4BMCA 3FFTA 4MIOA 3VMMA 4L5AA 3VHLB 5DE3A 4BB0A 4DV5B 4Z9YA 2ZWOA 1W5AA 4BVHA 1BXRB 1UXHA 3HN2A 2X15A 2FWRA 2WABA 2X5NA 3FIJA 1X3SA 1CZOA 3C8ZA 3M6XA 1NVGA 3OOJA 4JHLA 3TX2A 5KQGA 1OMOA 2GCPA 4HS9A 4TS4A 5FPPA 3TRDA 3WK6A 4KRYA 2ECQA 5DO9A 1GGVA 2QQGA 3IT1A 5FBRB 4MUFA 1C8BA 5DN6D 3IE2A 1L8QA 5KYWA 1AUOA 1RWKA 5C9ZA 4QEDA 3H0KA 1H2YA 2G1JA 4R0VA 3QE3A 2AFIA 4RM2A 2QZPA 4YJ3A 1W75A 4C2UA 1M2FA 4MROA 4MZXA 2JS7A 3D6JA 2YFHA 4M0KA 2X7HA 5CH5A 4U8GA 2K7ZA 1T9AA 5NLLA 2WA2A 4AMUA 2X4GA 3U7QB 4S0ZA 3V3KA 3CY6A 2I4LA 2L0XA 2YV3A 4I4TA 5F1PA 1GNLA 2QF7A 3SM3A 4AUNA 4C0BA 4WADA 2B6HA 2HRZA 3EQ6A 3Q3IA 4WI1A 5KKNB 2CXPA 2ZJOA 3HKEA 3WC4A 3GJ4A 5A6SA 3JATB 3P27A 4YHHB 3TTUA 4K9DA 3I4LA 1GILA 1DAKA 3TVYA 2XODA 1GITA 1RIIA 5FR1A 5BSRA 4TV9A 5CDGA 2E7ZA 1U7UA 2OXCA 2QLFA 3UAXA 4Z8YA 4L8WB 3MUFA 1JQAA 4IMRA 4PFQA 5ERYA 4WKGA 3PIDA 2GZ1A 1LI4A 2R4UA 1H2BA 1DX4A 2PFGA 5CEJA 2F2TA 5I45A 2VJYA 3AWDA 3RJ5A 1R1DA 3IRVA 4ZOCA 2DSNA 3LOQA 3GN2A 4LHSA 2Q4OA 1L2TA 1V7ZA 4FFWA 1M34E 2IYSA 1MW9X 2QSYA 4M86A 5I7EA 1JXAA 1SBHA 2AFHB 1QGAA 1MJGA 4OLFA 1VCIA 5AI0A 2ZZMA 1USGA 2YV5A 1W4BA 1JTFA 3KOWA 2HCFA 3ZWXA 1QHNA 4J7AA 3PKZA 4D82A 1MQ8B 1CEQA 5C3MA 3DDOA 2H1HA 1QX4A 3O8QB 1QMPA 2RARA 4BNDA 4EUHA 3GYBA 1KVTA 4EPRA 3ZN2A 2FZVA 5BMVA 1K88A 2JFFA 1F0PA 1ONOA 1H85A 1F38A 3KZOA 5TR9A 2W2KB 4M1WA 4BE9A 2XRZA 2WT4A 2WJHA 4TT8A 2R65A 3E5RA 4HSEA 4PLVA 1JDPA 2QDKA 1I2AA 1TCUA 1QBGA 3ZXYA 3WNVA 3KIPA 5AMXA 3M6AA 3KETA 1IB0A 5ES3A 5IBQA 1LLFA 3UFXA 2WWFA 4YAGA 3ZUPA 3MS7A 3VNAA 1ZR4A 1FNBA 4DR5B 3ZWDA 2X7XA 3X2EA 2VUUA 1PP4A 3Q7QA 1T9GS 3T35A 1DBWA 2ZSIA 1NDHA 1XZQA 3FDFA 2Q3HA 1JV2B 1MORA 2V5UA 4MRRA 3KJEA 5IWCA 4UMFA 1YGPA 5D00A 1O4VA 6REQA 3HN6A 1W5SA 3QVXA 3ZDBA 1UBHS 1VP3A 2B8JA 4L15A 1TVCA 2CD7A 2YNMA 4KQXA 2ZRIA 3M6WA 3GGOA 2ZB2A 4UDYX 3V55A 2HBZA 4OQMA 5CNIA 1H05A 4ROTA 5E7MA 3JARB 1JFFB 4P3XA 3WB1A 2XKJE 1X9HA 3KT8A 3LCJA 2VNSA 3OM8A 3TOCA 2FP4A 4C7KA 4URYR 3W0LB 4DNOA 1A82A 1XD2B 3C74A 5THXA 3G13A 2FQXA 1KEPA 4X92A 1JKIA 1HH4A 3PGVA 6LDHA 3TOXA 4CIVA 3RK0A 1R0BA 1CP2A 4D45A 4CTOA 3C5CA 3QMPA 3VOAA 3ZUGA 4S05A 2C4VA 4HBZA 1UBJS 3IUMA 4ZYUA 1NP7A 2FPIB 3NTUA 4TT3A 3HA2A 1HE8B 3KHKA 2BP7B 2DYKA 4KOEC 2JFUA 4WQMA 3OO1A 3T7SA 3AILA 4E4RA 4I81A 1IEVA 4L1KA 1I01A 4C0AC 2HO4A 4QTTB 5CB4F 2LV8A 3RHTA 4CQLA 1SXGA 4Q39A 2A5FA 1JPVA 2EG5A 2I3ZA 2NNLD 2PKXA 2QMQA 3VYRB 1ACJA 2J7KA 5ER6A 1W0JD 2LDXA 3OLXA 1TLFA 3OIGA 1ZD2P 3RHSA 3RTDA 3VR4H 1XLTA 3KK0A 4IFTA 3UOAB 4FDLA 2BFMA 2PS9A 3BL5A 1E6EA 2J0SA 3O5AA 1DQNA 4XE5A 3O3NB 2R2AA 1HYQA 3C6ZA 3NIGB 4YJGA 5ALSA 4DA7A 3IVCA 2WPDD 4ATNA 3IEUA 3FLMA 2G06A 3JWJA 4G0PA 3DBIA 3LC2O 5P8WA 1AGNA 4C29A 2R9VA 3Q4GA 3DD5A 4BNNA 1Q6YA 2NV2B 1V1JA 5A9SB 3U3RA 5FAKA 1R9MA 3SNKA 1BWQA 1NVBA 1NOJA 1Z34A 5ECDA 3RKRA 1B1CA 4DXAA 4EVSA 4R3NA 3NBUA 3ZDCA 1SWWA 3Q1KA 4QNRA 1BQEA 4AJJA 1XDBA 1I3OA 1DBSA 1RPNA 4NYIQ 5IFLA 2PUVA 4NTZA 4FPXA 4N76A 2FJPA 1WL8A 3OHPA 2J46A 1SVOA 4UNRA 3PXCX 4LZWA 3RIXA 4YACA 3D3WA 3AF1A 4YEDA 4MS4A 1R4NB 3T4PA 3EPJA 4HUTA 2NSJA 4XCQA 3OCWA 2PUEA 1KAGA 3LFHA 3HJTA 4ETMA 2HSWA 4PINA 4XVQA 4WW0A 3S2EA 4JOCA 1RI4A 3CCCA 3OSUA 2EHDA 4E30A 4CEHA 1H42A 3CV3A 5GJBA 3FPEA 4B1FA 2BCEA 4IJQA 1JJVA 3M6UA 5KVSA 4FIDA 2PUBA 1O0CA 2FCAA 1P9OA 2RAPA 2VYVD 1Q91A 1PLKA 3TPCA 3DO6A 1W581 2P69A 1LCIA 1MC4A 3C3YA 5IVPA 4BFZA 5KAPA 4JS0A 4UEKA 3IP5A 2XB4A 3P9CA 4MQBA 5LZ5A 4EHBA 8OHMA 5FLYA 1L5NA 1SU7A 4Q9AA 1CG6A 1OXBB 1J39A 3DE5X 4PZCA 1IVSA 1B16A 1Z7GA 4MUHA 3GJ8A 1GA6A 1KVRA 4ZDKA 5JPCA 2PPLA 3D3NA 4KU4A 5DCWA 4BO7A 3RSSA 1S4QA 1UBUS 3Q8LA 1EXMA 3MJRA 1R5JA 1KEZA 4O29A 4ETWA 3NDIA 4C4XA 2Q6KA 3DDHA 3EPLA 4H7DA 3UTDA 3H2ZA 3LFUA 3UKOA 3VSBA 2GFQA 2RJ3A 2W43A 1V5WA 3AKZA 2PUDA 4O1IA 3B53X 1N75A 1SN7A 4BX3A 4M0EA 1SXJB 4JB8A 1GUYA 1EFTA 4J0JA 4D9HA 2XQIA 1PVDA 1KE2A 2COEA 2JJ2D 2ODTX 3ZI7A 2EXXA 2J6HA 4QRDA 1RAIA 4Y6PA 3QXXA 5D86A 2GOYA 4G0ZA 1MO3A 1XZ8A 1O97C 4EFDA 5DYNA 2VBIA 1KYTA 2ZRDA 3RUIA 4I7EA 5GVRA 3WAJA 1YB2A 2YWFA 2ZB7A 4N3AA 1D1TA 2CLMB 3CCBA 2ZRMA 5DMHA 1FRVA 2WAAA 3NFRA 5CK5A 5LBIA 2W70A 3UHAA 1RWWA 4DM3A 1NWHA 3ZE8A 1MT0A 5ICCA 1E6MA 4TV8B 3K8YA 4MVJF 3G3EA 1VFNA 2W6QA 1IOLA 1WZEA 3AESA 4R68A 4LSWA 4A8HA 2WHYA 4KK4A 4ND4A 4NYJQ 1KPHA 4AKTA 1V8ZA 4ARZB 2E4XA 1UKAA 5I8WA 5F3WB 4AU1A 3UHOA 1T6XA 5AOBA 5F21A 3NTRA 3ZDFA 3MELA 3ZU6A 4DJFC 1P1JA 2KE5A 4K6CA 4RA6B 5JY6A 3IELA 2ZRLA 3KWFA 3ADPA 4L5BA 1HL3A 4YAUA 1B43A 2Y1XA 3GGJA 4K0RA 2GPBA 3RQSA 1N6IA 3U0BA 3IBGA 5ICMA 2WHPB 2RHRA 3HQ4O 2JGIA 3MC1A 3GLHB 3TW6A 2OK8A 2NVOA 4PHFA 4BMNA 4OQZA 1QHFA 5CT6A 3CLSC 3DQZA 2Z9CA 4LHYA 2DHEA 4US0R 4NPHA 5FTKA 3LS2A 5JH7A 1UDXA 4P86A 4CHGA 4ZZ1A 1RKQA 5ESXA 1MV8A 1W1UA 2NAFA 3ID6C 3VZBA 1AKWA 4B81A 1UPBA 2I3AA 4FIZA 2WY2D 4A8JC 1QRUA 1A69A 4MUMA 3NMUF 4G07A 4D0RA 1YRQA 5FWYB 3RG2A 3SYMA 4AF6A 5EWJA 3DOHA 3GT3A 5JZSA 4ND8A 13PKA 1X14A 1L5WA 3SP1A 2BEVA 3K09A 4KJZA 2G4CA 4MO9A 3VHXB 5KJCA 1UDWA 2W2PA 4URFA 1RYBA 1ZZEA 2XE8A 2QLBA 3T5DA 2NO7A 1FCJA 4K26A 4P4LA 3V8RA 1M6VA 1II0A 1JQEA 1RBQA 2R1UA 1G5FA 1YJQA 1S2IA 1EDBA 3H97A 3KQTA 2P3LA 4FKMA 1AMUA 3EVBA 1IWBB 1EVEA 1HV8A 2B3DA 2X7JA 2YNMC 2V7GA 1MB4A 2Z4SA 3FTCA 3PEUA 3OJOA 1BJKA 2JHFA 5G0TA 1CX9B 1HC7A 2CVPA 3FNHA 1FVHA 4GI7A 4PZAA 3QSYA 5DLQC 5G0VA 3NH9A 1V8PA 2J7PA 2DAPA 2QTGA 2JBAB 3GDHA 4EELA 2C4UA 3A9RA 5ENVA 2FFBA 4RQUA 3EK2A 1YQDA 1U02A 1PNQA 5ALRA 2AIRA 5E9JA 1DT3A 1UZLA 3TQFA 2JPDA 4W5WA 2HLNA 1JJFA 1FMJA 1PJCA 2OY0A 3FMPB 4ACAA 2CEKA 3W5SA 1QH8A 3LPMA 5ETJA 1JBKA 2OYSA 4DQXA 2QMZA 2AVDA 1Q2XA 2OM2A 3EF0A 1VG9B 4RDXA 4Y2QA 3FDZB 3L0ZA 2FDRA 2OFFA 1VL0A 1ETHA 4DF3A 3EMVA 3E4DA 2ICAA 1A04A 3SKVA 5LUBA 4ARBA 1P5FA 4GXNA 5C37A 1ZD9A 3KQVA 3V1KA 5KUTA 3QEAZ 5MF6A 1Q1BA 1JLLA 4HSGA 4M4SA 4QGHA 4LV8B 3RYTC 1X8KA 4KAJA 4ESOA 4UTPA 4AZ0A 2H4WA 3QW4B 2MYNA 5BR4A 1X1BA 4MW9A 2BBWA 4LRQA 4IDDA 1QG0A 3HLYA 3VI4B 4D8XA 1PWHA 1XTKA 3EUAA 1NLFA 5ALNA 4DANA 4WZAB 2IKSA 4RD4A 1NQVA 4NYMR 1Z2NX 3CZAA 1XLUA 3HJRA 5KX5F 4A15A 3DAHA 1IN4A 4QODA 2I2BA 1MH9A 1GZVA 4RBNA 1IPHA 2PCLA 3ETHA 1RAHA 1I4EB 4REMA 2IU0A 2D5BA 5FL7A 2GM9A 1QORA 2BH9A 3S0JA 3ZXUB 2FJ0A 3A6FA 4WN3A 2Q5FA 1O57A