1PDOA

Phosphoenolpyruvate-dependent phosphotransferase system
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
129
structure length
129
Chain Sequence
TIAIVIGTHGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETLIEKYNAQLAKLDTTKGVLFLVDTWGGSPFNAASRIVVDKEHYEVIAGVNIPMLVETLMARDDDPSFDELVALAVETGREGVKALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANNOSE PERMEASE
publication title Structure of the IIA domain of the mannose transporter from Escherichia coli at 1.7 angstroms resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphotransferase
total genus 45
structure length 129
sequence length 129
ec nomenclature ec 2.7.1.191: Protein-N(pi)-phosphohistidine--D-mannose phosphotransferase.
pdb deposition date 1996-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03610 EIIA-man PTS system fructose IIA component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.510 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphotransferase system, mannose-type IIA component 1pdoA00
3CT6A 2JZOA 2JZNA 3MTQA 1PDOA 3CR3C 1VRCA 1VSQA 3LFHA 3IPRA 5T3UA 5IM4F 3GDWA 4TKZA 3BEDA 3GX1A 3B48A
chains in the Genus database with same CATH superfamily
3I12A 1ORDA 3FNIA 3INRA 2GTIA 3DDHA 3GAAA 1KPHA 3DCJA 2BRUC 3EIQA 3F6SA 3WP0A 5IC6A 5BXQC 1OCEA 2BONA 1TMGE 4XD2A 1CU1A 4CV1A 5CCBA 3R3XA 2YFHA 5D5QA 1B2LA 2E5FA 4M0PA 2G5PA 1U2GC 1Z7EA 2GX6A 4KEAA 1K6IA 2E1PA 5DE3A 1ZIYA 1U0HC 1FSPA 2CF6A 2QIOA 3QXSA 4R8LA 4UVDA 1Q0TA 2P0AA 3WL3A 1TPYA 1U2DA 2QRZA 3ABRB 2SHKA 4YI3A 4EJMA 4M9QA 2E4VA 4WBXC 1DBIA 4NSNA 2C4KA 4DG5A 1O6BA 4W8HA 1X39A 1KGSA 2GF2A 4EYSA 1SKMA 4IIEA 1LPNA 1N92A 1X70A 1E3QA 4UNRA 2RK6A 4X44A 3FFXA 1R5NA 1D09A 2OXIA 4B2IA 3TX2A 4U7DA 3QJYA 1GRQA 2QNIA 4KBFA 3R5HA 2Z58A 4POAA 2F67A 1W6RA 4NEGA 4OIMA 2WF9A 3D6JA 4FC7A 4F7DA 1LTQA 2B4KA 3LUJA 1LDEA 1GUAA 2ZJBA 3UW1A 2H18A 4FMDF 3V9AA 5L3QA 1QR2A 2XDQA 3IFSA 3PFGA 3EIUA 4MQUA 2JH8A 3WC4A 5EUQB 1DFGA 3TTYA 1JEDA 1Y9AA 1HDCA 4BLOA 2J0SA 4PLGA 5D6OA 3R23A 1RXYA 1T4CB 1NMZA 2OFFA 5T41A 4LJ6A 1AKNA 2ORYA 4ND7A 1W88B 3L1VA 3PCRB 1NRXA 4LGCA 3UMJA 4EHJA 4JP5A 1E2IA 2WTUA 3QFSA 3F3KA 3O7MA 3P2KA 3GT3A 3EPRA 3UJAA 2CFSA 4GX1A 4WLFA 3HE3A 3PXDA 1YJ5A 1IRXA 1ECJA 4HAIA 4CT4B 4Z4CA 3H1PA 2ZUFA 1O0CA 4NENA 2A33A 3GWZA 2E9SA 2VHEA 1P7WA 4J7AA 1OT5A 2Q28A 1HEIA 2GZHA 3G5UA 5EIHA 1V8DA 5EL0A 1ACLA 1BDMA 3NEYA 5HRCA 4ISBA 3T15A 4H59A 2OOKA 5TS3A 2YRXA 1O1YA 2C58A 2D54A 2VHJA 4O2LA 1EHCA 1KA9H 1PL8A 1T5OA 1Z2CA 2W2XA 4GG1A 3SHVA 3ZQKA 5C7YA 3VNUA 3L0PA 5BY2A 5EN4A 2PH3A 1O97D 1JA9A 2PUHA 2I8LA 4HB3A 2GEBA 4MPTA 3S29A 1PL7A 2ZVDA 3RASA 4UFPA 3FJ1A 4XGQA 2NSHA 3PWKA 4CR7A 2X9QA 3WDMA 2P2LA 4W1QA 3ZWAA 1RZUA 4NQRA 1U6KA 4TRRA 4Y6SA 1VE6A 2W2OA 4L51A 4ZCLA 5AP9A 5DM4A 3ULKA 1W59A 5I3CA 1U7ZA 2RH4A 4C2BA 1OX6A 1GTG1 1P29A 2BKXA 1KC3A 4RV5A 1PVOA 4U7GA 4BLVA 2HRZA 1Q0RA 4ZKDA 3I2GA 3SJCA 4MIKA 1HNXB 4E3ZA 1VLLA 1SB8A 3OEED 1KKUA 1R15A 3P2EA 3GLGB 1F8UA 2OZEA 1OFGA 4NYIR 4PRLA 3H17A 4BEBA 3WADA 3RTBA 3GD7A 3EVNA 3AI2A 1XMXA 1DAOA 3D81A 2RH9B 2FFAA 4N6NA 4Q82A 1ZMTA 1QMPA 1XDBA 2Z57A 1AA9A 4QOHA 4Q6BA 4S0XA 4QPZA 2W93A 2V5VA 1DEKA 4LX0A 1UQUA 4GBGA 5JZMA 1VRWA 5BW4A 2J3KA 4EPTA 3JRNA 4WRRA 3IQEA 1RXEA 4QBHA 4N7RA 1ISJA 3PXGA 4LQ4A 4LF6B 4YP5A 2GN9A 4JIGA 2YWEA 2B9VA 3FUCA 4ZO9A 4EY3A 3KZNA 1IQPA 1JHYA 2W7TA 2PGOA 4HO1X 3UFXA 3Q7SA 2JGMA 4Q0MA 2RGXA 2AXQA 5TPWB 1NFFA 1RS0A 5BUSA 5IT5A 2QVCA 5KINB 4LE2A 3AVPA 3RTCA 1FVOA 1Y7IA 3DOHA 4EELA 4NMHA 1N57A 2BAGA 3T5BA 1C2YA 5FBVB 1TCUA 1JFFB 5IWCA 1RXIA 1X1AA 1JJFA 1Q1EA 4RLQA 2I2FA 4EKNB 3FIUA 3HR8A 5GADl 3U44B 3DXFA 5AQ1A 1KGDA 1LH0A 2O2SA 3F5FA 4GI3A 3EQ9A 4J29A 2Q0XA 2ILTA 2Q2VA 3VXKA 2VBCA 3CF6R 5FI1B 4PG4A 1UKAA 2DVMA 1IN7A 1U4OA 2RHBA 1N7JA 1JDNA 3DNMA 5BN5A 2VF2A 1KXZA 1BDJA 3RFUA 5KWSA 2RC6A 1QP7A 3HH8A 4AJIA 4AG5A 1NJ5A 3BFVA 3PA6A 2WM8A 2IWHA 4MGIR 4W99A 1YB7A 2WV9A 3D7KA 4G5SA 4O4HA 4H7PA 3BSFA 3H9QA 3IPCA 3VYRB 1XJWA 2ODAA 4PHCA 2YHIA 3PC2A 4IKOA 5B3KA 4LYGA 4TZKA 1UKYA 4TTQA 2QMOA 3IUQA 1VPDA 3O92A 4RTJA 2X2OA 2AFIE 1OAOA 1Q7TA 2PO5A 3JZMA 4DPLA 3LVRE 1KFKB 2CEAA 2ZRIA 4P3PA 4YVFA 4ZT6A 5IAAA 5KTYA 2CLLB 2DFLA 4DVGA 1GILA 1KFJB 2J9GA 1T0BA 5INTA 1IHOA 4DC9A 3LPMA 2PQ2A 3KQOA 4UXIA 5K6RA 2C7OA 3UJ7A 4WWHA 4LVNA 1J5EB 3L49A 2WHPB 3EW7A 4UXHA 5JZBA 2C07A 5KNCD 3TPFA 4DCTA 4D9JA 1X7XA 3GPCA 3LC2O 4LAFA 5LDDC 1XTIA 1V95A 3OPVA 4PLVA 1VJ0A 1PJLA 2F1OA 3E58A 3B1XA 4J03A 3RARA 1ISIA 3QEKA 2Q5EA 1JIUA 2G6TA 2MYNA 3IB6A 4LSZA 4MR7A 4B6SA 1F60A 3U3DA 4D3SA 1GHTA 2MU1A 3ZLJA 4L8GA 3OJCA 1AH2A 2FE4A 5E0KB 1CDEA 2AG0A 2WM9B 3CPJB 3OU7A 3RHSA 1WO8A 3L41A 4ZVOA 3U17A 5HR5A 3P9QA 1QQBA 4IHQA 4P4NA 1CJKC 4TT8A 2PA0A 3WMEA 1CIPA 1VL6A 4J0EA 4PLTA 3VOSA 3VZBA 3V9PA 3TSAA 4YXWD 2Q2WA 2XNDD 3O84A 1O7JA 3AHDA 3HUFA 4L9WA 4FSHA 4MS1B 4PONA 3UK1A 4D96A 4DIEA 1QG0A 4ENWA 2I1VB 1QIJA 2ORVA 5JBNA 2W2NA 3FBWA 3FFBA 4JUDX 1ZVVA 1LBTA 4MV0A 4BJ3A 1QCCA 3ESRA 4KSYA 1XTRA 2QVYX 2RI6A 4REMA 5H7XA 2O4CA 1GUZA 3H9BA 1E7QA 1X3LA 2F3TA 3AU9A 3GGDA 3RNOA 2C59A 4ENUA 5MN6A 3KRTA 1DXQA 3LW8A 4XWAA 3QPUA 2V7VA 5P21A 2R86A 2FFQA 4YFYA 2ZLBA 3O47A 3EQ6A 3MWFA 4QNRA 2EKZA 1HDGO 4TMWA 5FTWA 1L8LA 1R6DA 2YZ7A 3DE2X 4QG7A 2Z6QA 2CC2A 1F17A 1K88A 1WLSA 3B3GA 2ZI4A 4KRXA 1JHVA 3QYJA 3MS7A 1QDLB 1ZLYA 2YVLA 1APBA 4QYTA 5SYAA 1ZKDA 1YULA 2ZI9A 4GL4A 2XMCA 5BYAA 2VJKA 1SCJA 5A3SA 2XBMA 2XKAA 1YVDA 1D2HA 3VMMA 4ZV4A 6AT1A 4LYHA 3QE9Y 4JLMA 4N0DA 4O25A 4M86A 4U63A 2CNKA 4OSPA 3NFYA 1ZNQO 3N3AC 1KAMA 4GKVA 3QU7A 2VJBA 4UBNA 3RVJA 2AE1A 1QB7A 1J0XO 3JD2A 4RUKA 2Y4OA 4G4JA 3HY3A 4JB0A 4LXGA 1KU0A 3A1WA 4FJ0A 2VPIA 2Q7OE 1KI7A 1U3FA 3RROA 1BKDR 1TRHA 4CDRA 3EXIB 3HP4A 1JR3E 1Z5WA 1Z83A 1XXHA 3BHJA 1TIPA 4RZQA 4B43A 1RE1A 2C5AA 4LZJA 4P84A 2MYTA 1ZJJA 5K6AA 5KTPA 3O8RA 1TA9A 2GAOA 2WYUA 4OH7A 2KWIA 5AXDA 3RS4A 3OQHA 2YY7A 4WN3A 1U0LA 4JS0A 4LGMA 3UBMA 1ODLA 4B7UA 1TW2A 2Q99A 2QKYA 3UJ6A 1QKKA 2WF5A 5TF4A 3RAEC 1N5OX 1P72A 2WIJA 2QT1A 3RYHB 2E6KA 4ZO4A 1IG3A 4KYIB 3UHFA 3DXXA 3RRFA 4IIGA 4BX0A 4QJBA 1JLRA 1HDIA 1K6MA 2Y27A 5LOVF 1QVRA 2EU8A 3JQBC 1Z73A 3OO0A 4RWZA 5A9TA 1FMLA 3TOSA 1XMQB 2X76A 1H2ZA 1CKEA 2DTDA 4H7DA 4NDNE 4PCVA 5LU8A 1FNMA 2WSMA 3L7AA 4IDHA 2D8AA 4D9MA 4LRXA 4XYLA 3CBGA 4CLDA 3M4YA 4R1NA 1SURA 2G09A 1U2GA 2CGEA 4QU9A 5HTKA 4DZZA 1G41A 1H3FA 4MUHA 4TQUS 1ABBA 3VNBA 3E1SA 3I0ZA 4DUGD 3AVWA 1EDEA 2AN3A 1M2VA 2BISA 3DCNA 4PN7A 3K0CC 1MW8X 2VEOA 1LC3A 4W4TA 5DOVA 4EW1A 1MNAA 3RHZA 3JWGA 2D06A 1GN8A 1AGYA 1RM4A 1U8CB 2UZAA 4KPUB 1FVHA 2DH5A 3K0AB 5EIFA 4DBLC 1JKFA 1H6CA 4F2WA 3FF4A 3ICQB 4U6SA 3GBVA 4AULA 2QQEA 3F5QA 2VP9A 3DMYA 16PKA 1ZN9A 3MIIA 1NNSA 2HRDA 3SF8B 3DHEA 5IXYA 1WJGA 1W4RA 4H3VA 4H1TA 3FUWA 4RD3A 4X7PA 5EXPA 4EW2A 4WDQA 5B64A 4ODIA 1BC5A 4NK4A 3UTDA 3NVKI 5AKLA 2Q62A 1MNQA 1RBMA 2OZLA 1FUIA 4RA6A 2ZWOA 4WOJA 4HGOA 4MP6A 3U4HA 3B82A 1CY4A 4Z7JA 3OFVA 1V25A 3MOIA 4HDRB 5B53A 3VJMA 5TEWA 2CL0X 1RBYA 5KX5A 1NQXA 2OECA 4TV8A 1SBCA 4LRWA 1ZU5A 4GC9A 2F1JA 2QN7A 1LVHA 1LX7A 1ZUHA 2CXNA 2FF5A 3V1TC 4EI8A 1ICIA 2ORWA 5IVPA 4KIUA 4KXMA 1S3IA 3OX1A 3U16A 2F3RA 3LY7A 4LVOA 3QMPA 4NV1A 1EB9A 4INZA 4AB1A 4Z1MD 1KY3A 1D4AA 3TNFA 3MLAA 1PDVA 1AF4A 2WFLA 4X41A 2QYSA 2CEKA 1L5OA 2C9ZA 2VUUA 2UZ1A 2VSYA 4HGZA 1PT9A 1ZD2P 2GK3A 2IEAA 2ZIZA 3ACBA 3KOUA 4IZIA 2O2DA 3H5LA 3PXAA 4NATA 2F64A 3REQB 3OBIA 5HJ5A 3ZV6A 3PENA 1KEKA 4EHFA 2UUBB 3RCBA 3EW9A 3D0RA 4KFRA 4XTRA 1BOFA 5ALNA 1GTMA 2ES4A 5FIUA 1Q22A 3NJ4A 3C3YA 3SFVA 2R8ZA 3WE7A 3WJ2A 3DWEX 5DTEA 4I1RA 3FWHA 2BWJA 2NVOA 1STOA 3R5KA 3UAWA 4HUQA 5AHWA 2XBLA 4JSYA 2OBXA 3MXTA 5CGQB 3DBLB 3W1VA 2J6CA 2HK8A 3NDPA 2O8EA 4CIXA 2O2GA 4G89A 5DSZA 1QS0A 4R0MA 3PTZA 2D1TA 3GNLA 1ZYUA 5FI3A 5LMZA 3H86A 1SCNE 2QTMA 3OZTA 4PC3A 4XSHA 1ECGA 1J9EA 1LJUA 4PX5A 1CIJA 1KBZA 2W2QA 1FNCA 3HDTA 2HU5A 5JMOA 1PV4A 3IP8A 1ECFA 4KHZA 1PDWA 1HE2A 3L0YA 4LRSB 4NCNA 1GGEA 4I50B 4XPIA 2ESRA 2UKDA 4RAOA 4XFDA 3I01M 4DE5A 4W1RA 3ZVNA 4GPEA 4MGZR 1N77A 5HCIA 2BZ0A 2VYVD 3DV0B 3VQTA 4FHEA 4OJKA 3E22A 4Q3LA 1OX5A 3C3JA 1I5EA 3JASA 3TNDA 3ANLA 5JNSA 1YAHA 4UHKA 4HWOA 4YAJA 3ZHXA 1UFVA 4WXPA 1LU9A 4JJEA 5BOVA 2ERYA 2P9ZA 3SQMA 1TKCA 1T4DA 2QNBA 4YR7A 1PI3A 3T1HB 2V45A 4RGVA 1JDTA 4RMGA 2OQVA 1ICEA 1LDMA 1QGUB 3W2GA 5K3FB 3RFXA 2QI9C 3H18A 1NN0A 1JR2A 3AEUB 4MQLA 3T3HA 1MPTA 1LSSA 2CFIA 4O0MA 4RM3A 1F14A 4UUPA 5D7BA 5AKKA 4G85A 5JOQA 5JZVA 5JI2E 5EERA 3KSRA 1YZFA 2QR3A 2H9YA 3O74A 4BMCA 2FPOA 4YYEA 1SU4A 2QQ0A 1LJLA 2HMSA 4I55A 1HWYA 2YN2A 2D5LA 3N7AA 3ANSA 2AKYA 4AU1A 5B36A 1UMBA 2BFCA 4M7WA 1IMOA 2FRDC 5CNIA 5HZHA 2HF8A 1NTRA 2BKVA 1T9BA 1E0KA 3SM3A 3JYQA 3ZWOA 4A6EA 2NUTA 5KB3A 3IMEA 1QWOA 4KFUA 2ID9A 3BF7A 3OZVA 4FILA 1TM3E 1PQPA 4DB4A 3VU1A 4MDHA 1L4EA 3O90A 4KZKA 3M9LA 1P39A 3FUXA 4QGAA 3O4FA 3VU0A 3WISA 2BGIA 2EXXA 4CM9D 5JD5A 3N0WA 3D31A 1EZZA 1MTZA 3UG7A 4JYZA 1WDLA 1GFSA 4O2BA 4RTOA 5K3OA 2P6UA 1JG4A 2BE9A 2ZIWB 2OC4A 3IBGA 2YJ4A 2HBZA 2C3OA 2W6CX 1H1LB 3M6IA 1Y1KE 4DV5B 4ROTA 3WWYA 1EFRD 4DLNA 4DVJA 1DUIA 1E20A 1IM5A 2ECOA 1JBQA 3NGMA 421PA 1Q3KA 1JQAA 3NIBA 4EF5A 1ZSNA 1X38A 4ZT5A 1PFYA 3IAS6 2E18A 1U3UA 5LL6P 2VAPA 2GNAA 2PUVA 1ZHHA 1SQ5A 1O95D 4FFMA 5CYFA 4YIHA 2BGWA 1E9DA 4F9GA 3L02A 2XLCA 2GDZA 3BILA 3ZV7A 4NG4A 1LRJA 1QPBA 1Y9ZA 4ZGGA 1Y8QA 2B2CA 1YSCA 3OHMA 4I4IA 4BKQA 4TS1A 3PD1A 2BBOA 3IE2A 2XITA 3L8EA 3NHBA 3QV1A 3WV5A 4Y1FA 4B4VA 1P2VA 4BZXA 5LMUB 1B43A 4M7RA 2OV8A 5BSMA 4LDPA 4G1CA 1F9EA 4V0LA 3IEKA 1SZCA 2D2IA 5FJIA 1QFXA 4JX9A 1Q77A 4HJXA 1W94A 2ATXA 1I1HA 3TRHA 2C84A 1C41A 1F5NA 1MKYA 2WW8A 3I9NA 4FPXA 3IOMA 2RFLA 3JQQA 4FYYA 2YHSA 3SC4A 2P0YA 2O52A 1HORA 3UWKA 5A9RA 4HB4A 3WLEA 4X91A 1RC1A 4UEQA 1IWBB 1WZCA 2RGYA 1F0NA 4H9GA 1C9MA 1N2JA 2SICE 1TGYA 1PZHA 4R3NA 3D0QA 4CQMD 4UTVA 2WD8A 3T12A 3Q3CA 4BFXA 3E5HA 5FH9A 1KETA 1M72A 1YJXA 4JJKA 1N2CE 1U11A 5LZ4A 1JHQA 3VZPA 1NXTA 1Q83A 1E3IA 4CMJA 4BPBA 1AN0A 2FPIA 1K68A 2B34A 3C15C 3ESYA 4LY6A 4EL0A 4U2DA 4BZQA 1C29B 1W0JD 1THMA 4L28A 3QUSA 5HQ3A 2YIVX 2UU9B 4QA9A 3EG9B 3G7SA 4B6GA 2VH5R 2R65A 4I14A 1HFKA 2IFTA 4OAPA 4OBXA 4DMHA 4GX5A 1PJRA 3UJPA 3CISA 3F6CA 1ZH0A 4TSKA 5DF1A 1VB3A 5G1OA 1DKPA 5K0LA 1N78A 1D2RA 2PD3A 3C41J 5EQJB 2LW7A 4HN9A 3SCZA 2A92A 1JHXA 1IN4A 4K26A 4MB0A 3G2NA 3WX0A 4BMNA 2CF5A 3IO5A 5G40A 3ZJ5A 1R0XA 1T13A 3JQ7A 2DPGA 1UC4B 2GCEA 2FZ4A 3LPAA 4R2HA 3L6EA 5LN1A 3VAAA 2FLWA 4UNPA 3G89A 1KYWA 4N7JA 1QHHA 4JEMA 4K2HA 5I01A 4YLYA 1EFKA 4QOFA 4BTVA 1HYEA 3UY4A 1QRDA 2RI1A 4PINA 2EZ8A 5FBRB 5B7NA 1QIEA 1L7NA 3CLKA 4Z8XA 1HMYA 2GUWA 1UMCA 4OEHA 3JQDA 3KPUA 3DM9B 1YIOA 1UK7A 4MYHA 2PUFA 5HS4A 4F2DA 4R6WA 3KU4A 4WOPA 1FJ2A 4XCVA 4L74A 5KYXB 1L0BA 3K72B 1LDGA 1Z2AA 1HDZA 1TK2A 3ZEIA 1XQYA 3QI7A 1WMAA 4EM6A 3C48A 4WBSA 3WMFA 2AE2A 4NJOA 4E3WA 1TQ6A 3W5IA 2XZPA 5JU6A 2Q3CA 3K0CA 1TEVA 4KDRA 3ND6A 4YWJA 4ND5A 4IICA 2PMFA 3C1TA 4FDTA 5ES4B 4M60A 1HL3A 5EMHA 3N28A 4DCVA 1BU8A 1CZHA 5TJHA 2QEQA 1TCAA 2X8AA 3F8SA 3HU2A 2D74A 3E5NA 4U2CA 3V8NA 4AZ3B 4GRAA 1HYBA 3LY8A 3RIYA 5LQAA 3CMCO 1M8GA 2Z5VA 2C42A 1MEJA 4JLVA 3BGVA 4DHEA 4MQEA 5F4BA 2GPBA 4K3VA 3QSYA 3ICOA 1LPMA 1JG2A 3MCUA 2IHKA 4LOIA 5IABA 2AK2A 4DUZB 1N8NA 1JSZA 4D02A 1NXXA 4M7PA 3Q3JB 3NBUA 3VH2A 2QMZA 1IOLA 5AVJA 4PYOA 3N2YA 4HHEA 3IP6A 5CEEA 3B6JA 5FI5A 5JRZA 3PEYA 1ISFA 1FTSA 2BGKA 2DCUA 3W05A 4F04A 1P6QA 1IZ8A 2BMFA 1EP2B 3VX3A 1S8OA 3O21A 4ARBA 1Z82A 2BFEB 5H8WA 1G98A 3VO8A 1M0WA 2C1XA 2IP2A 2Q45A 3FCYA 3GLIE 2W2KA 2LIVA 2VDUE 4KE7A 3VH3A 2CLOB 4FWBA 1Q92A 4H60A 1R6TA 2GM3A 3BXGA 3KLOA 1X8KA 3WL5A 4DB2A 1P2FA 2ZIXB 4V3CA 4KAXA 5C51B 4S1NA 2L0XA 4HS4A 1NAIA 4U2FA 3N5KA 3ESCA 2J85A 4TV9A 3LGXA 4JOBA 4YDRA 1JR4A 3MJ4A 3F3YA 4L8WB 2OGWA 4ALJA 4AJNA 1OTYA 3DZGA 1NW5A 2II6A 2IHTA 3PYLA 2BTOA 4JOQA 5JXHA 4MMZB 1PNVA 4I3GA 1M5UA 3BTOA 4JXXA 2BIFA 3Q2IA 3ED5A 1Y4UA 4N5IX 2CJYA 1OFUA 2QG4A 5BV7A 3DTNA 2D1YA 3TBKA 5A0VA 4I4TA 1FFHA 1V2HE 3HVRA 1IYZA 5J4VA 4NV3A 4A8HA 1FSZA 2WYOA 2HR1A 2XJ9A 3G0BA 4MUXA 1OBCA 1Z6GA 4BO6A 2QTFA 2PCLA 5GIOE 1SIWA 5K8LA 2IUYA 2OUKA 5KTKA 1KAGA 1B8OA 1D03A 1CQPA 2VBIA 1N2OA 3CR3C 3PEEA 4P92A 3R7SA 4IQFA 4KAAA 4KXLA 4A15A 1P9NA 1GU7A 1GDTA 4O3MA 2WMOB 2D1QA 2GFQA 4A8JB 1FZQA 2H31A 4RY0A 2HA6A 3TAXA 1A76A 1K6EA 1SU8A 3U7RA 2ZSEA 1PP4A 3V34A 4L75A 5EMNA 4MVJH 1FRNA 3OZIA 5KVSA 2JFPA 2PN1A 3G9UA 5KOHB 4HQOA 1QGDA 1WXIA 3GELA 2ZBVA 2ZREA 3TUZC 1FK8A 3PIDA 1BX1A 4FKZA 4RJJA 1WB6A 4FWIB 4Z4GA 4QQFA 1F7VA 4TXHA 1Y3IA 2C9YA 5IN4A 1L3BA 2YICA 2H3HA 1YJ8A 2KHZA 3IAM6 3AETA 1I30A 2GBPA 1LY1A 1VJRA 3SC2A 1GV0A 4PIVA 4EEZA 2TMKA 2MHCA 3RS8A 4DW8A 2J9FA 5B1SA 4KR3A 4QUEA 3RK4A 2PKRA 3GFOA 4FFBB 5HXAA 4XASA 4R01A 5IC4A 2Z08A 5GMOA 4QELA 1PL0A 3JPYA 3N76A 3BMXA 4RQBA 1SG6A 4RS3A 5EHGA 2I7XA 1AN9A 4FD2A 5JIBA 2AZ4A 1S2OA 2C4MA 3AWIA 2Q1YA 4RTMA 2IXDA 1RFLA 5ALMA 1OJLA 5FOTA 5THKA 4X63A 4FEAA 3LFHA 4IXNA 4ARZA 3OX3A 4F12A 4MPDA 5KTSA 2FMFA 3NBQA 1ID8A 4V2IA 3M82A 3QLUC 4Q9AA 3LX5A 9LDBA 1XNRB 1SCKA 1YIDA 2QN9A 5DT2A 3GDFA 3K30A 3DKIA 2OFOA 2CXXA 3OCWA 3GAMA 4BO0A 4G0VA 1S3GA 4GI5A 4WMLA 3OQ1A 4H0CA 5C35A 1OB5A 3EDRA 4NU0A 4TYNA 2PUCA 1L9XA 3FNBA 4R81A 1YK0A 3OHPA 4TYPA 3AZOA 4EDHA 1G3QA 2YCLA 3C3MA 5D85A 4JN6B 1DBQA 1NZDA 1WB5A 4OO3A 5FBKA 5ESRA 4EEXA 1PJQA 1L5HA 1QIFA 1USKA 2DWOA 2V8BA 3HUEA 4CMCA 4BCCA 1SXIA 3ZI0A 5KC8A 2XMGA 4BO9A 4BY9E 2A5DA 4IJWA 2ZETA 2AOUB 4MVJE 2CSUA 3RVSA 3N8NA 4FIDA 4GH5A 2SKEA 1UADA 2X0NA 3T7AA 3EPJA 4YJKA 3I4FA 3NEJA 3QF4A 4NENB 4QNNA 3E9YA 4ZT7A 3VPBA 1QCDA 5ILOA 3TUJC 3OQNA 5KSYA 3SC3A 3CMMA 5AK6A 5EI5A 4DXAA 2GJ9A 4M1SA 1Y37A 4XUCA 3ZLBA 5TMPA 1U02A 1XRLA 4EJSC 1XP8A 1J9ZA 3LIIA 1RPJA 1MO5A 1TZ2A 1V3VA 2JFHA 2YOFA 3HHEA 4PY2A 3S44A 5G0TA 3WLIA 5AUNB 5BXYA 5CB6A 1N0WA 4KXWA 4NICA 1G19A 5GONB 4ZICA 3CNQS 3IOYA 4IOKA 2OV6A 2YJ5A 2O05A 1CHNA 4BAZA 1MTOA 4GKJB 3AFHA 4R84A 4M8LA 3I30X 4LK3A 1N8SA 1Y4AE 2WILA 4WZ6A 1A95A 1GSIA 4YROA 5JVDA 4PQFA 3I2FA 3RDPA 3K0FB 5K3CA 1J1ZA 5AHOA 2G4VA 2XH8A 2XWPA 1EE9A 1ZAKA 2D5IA 2JCXA 3DL4A 3TUIC 2JAWA 4D44A 5H9WA 3DMDA 1WL8A 2RAUA 3C6ZA 4UTNA 1RP7A 2JIPA 4AX8A 4YT4A 1WCIB 2A67A 3KYBA 3IE1A 1K8XB 1YRLA 2RJ3A 3SQOA 5AOBA 2RHHA 3LT1A 4NEHB 4CKCA 1BMFD 5KYKA 1VI6A 2ZQYA 1N3BA 2GPNA 5A3VA 1E4EB 5LR6A 3DMTC 5JJKA 3MCVA 1L3IA 3PE4A 4MVYA 4FYMA 3QX3A 5HA5A 1H9AA 2SECE 1V9SA 2P2NA 4LC0A 3HMKA 3K2IA 1GEEA 4DIKA 2FWBA 4LVUA 4LMBA 2Q9BA 2P9FA 1K4KA 1QTQA 4C0AC 2WY2D 3WYEA 3CXUA 4G86A 4G8CA 2GLXA 3IQIX 1WUJS 2HIAA 4G3XA 5K8UA 3VA7A 4DR2B 1EK5A 5HDBB 3EARA 2NZ8A 4Q9LA 3TRJA 5GJBA 2LGJA 3SBEA 4Y2TA 2WUGA 3GJTA 2PMDA 2PH7A 1NDHA 5M2QA 1GNPA 1KI4A 3DH0A 4Q12A 2HUNA 2WKRA 2WNSA 3AKDA 3D1LA 4JBWA 3B85A 4YPOA 4JK3A 1SXPA 3AESA 5L6LB 1RQ2A 2XB8A 1K4YA 3W6ZA 2JKZA 3PX7A 1N7IA 3Q7RA 2YZKA 3TWOA 5E0OA 5AKYA 5EVCA 5HZMA 3O73A 1HMPA 1WLYA 3JTEA 4PQEA 1GSAA 4Y0VA 1YB1A 1KP3A 4B81A 1E6EA 2ZRCA 3D3WB 1SUDA 3DYBA 4IXMA 3A6FA 3OKAA 4QPNA 4IG4A 5DMXA 3EZFA 4P3NA 2VAXA 3DO6A 1HV8A 2AXEA 4UCFA 4EUSA 1Y3BE 4MPJA 4Q4JA 1OH7A 2C2WA 5HRAA 4NU5A 1A9OA 1A50B 2VNHA 4XI9A 1IUPA 4ZYVA 3CLTC 4J2TA 3W5HA 3GLRA 3L18A 5CYGA 1SG9A 1M6HA 2J5RA 1WPXA 1CJUC 3P5SA 4PSDA 5AJVB 4DREA 4CXMA 2B21A 3BGDA 1J1IA 1U7OA 3W1EA 1UFQA 2ZTSA 2OGSA 2MMCA 3A3NA 9ATCA 1VIVA 2JHGA 3K70D 1RWQA 1MO3A 1U5CA 2WG1A 3R9XA 3RS0A 1GFZA 4A6PA 4CI9A 3KB1A 1CX9B 1JZTA 1XKLA 3CRQA 1RZRA 2WWHA 1T5DX 1EUCA 2W22A 2HFKA 3G2IA 3AF6A 1IOZA 2QDKA 3KLNA 2AEMA 1TJNA 3T1VA 5CBPA 1TW3A 3P27A 1W5TA 2C8LA 3P2YA 5D3MB 4DV1B 5I7UA 1G16A 3GR6A 4YJ2A 1EKXA 2VDMB 4PXAA 4G63A 1XU9A 2YWJA 4V38A 3S2UA 5IS2A 2Z4SA 1Z4KA 4QDJA 4ZT4A 1PR4A 3IT0A 5FP0A 2IK8A 1I13A 2PNFA 2EYUA 4O33A 1RAAA 2VDJA 2GXSA 2WJGA 3V2IA 4COOA 1OGJA 3STXA 4QDXA 1VL8A 2QSUA 1Z5ZA 3BWDD 2B61A 1Y3FE 4NLLA 2ODPA 1TGVA 3IIKA 1UK8A 2VHUA 4GOKA 4RIFA 4E4RA 2IDJA 4YC7A 4F4DA 1KYTA 2AT1A 1UQRA 2XVAA 4H3KB 3O6VA 1WW3A 3UJ3X 1QRRA 4YP0A 3IKMB 4MB6A 1JS1X 2A78A 2X40A 4WL0A 1FMCA 1OVMA 3JD0A 2CDBA 1FXWA 3FCUB 4JYCA 4IY1A 1TF2A 2IXGA 4MXDA 4BQFA 3QXCA 4X20B 4XQ9A 4QDZA 1JVNA 1W52X 2C1EA 4QUJA 3ZDRA 4ASUD 2QLLA 3KQHA 1C50A 2HIMA 3BGIA 2HJHA 4MRAA 4BLWA 5JS7A 2VHYA 2ZBRA 4C22A 1AXEA 1I2AA 1GNTA 4YJGA 3TZHA 2X15A 4GI2A 1VSBA 1XVLA 1IXKA 2F8LA 3GA5A 2J7PD 2O2EA 3RD5A 3ZD7A 1SULA 4JLPA 2HDOA 4PXSA 4UHJA 1MVLA 2OHXA 3AM3A 3MGCA 4LKOA 3NNDA 4BUCA 2Z8XA 1LWOA 3U09A 2ZAOA 1G20A 1ZGAA 4JUBA 2W6QA 4HQKA 1IBCA 3CPSA 4UEJA 2O2XA 1UPAA 3BRWA 3VKGA 2P2SA 1KKLA 3QBVA 3HTXA 2IEIA 1KPGA 1PBTA 3P1JA 5G1NA 2FLKA 2IQ5A 3OTOB 2JGRA 4TM7A 1T10A 2C31A 3N7TA 4KN9S 1KEVA 1TD1A 2AKAB 2Z95A 2ZB8A 3HYRA 2O3TA 1A98A 4ID9A 5D87A 3V8QA 1M7HA 2SCUA 4RPHA 2VF8A 2WU0A 4J4HA 3I2YX 4NZYA 2B1GA 3S2YA 2OT3B 4HS9A 4B5LA 5IBRA 4EBBA 4PZUA 3WGOA 2HF2A 1QTRA 2YFYA 3D6TB 5ALDA 3RUCA 3RSFA 5ALUA 1XUOA 1TFUA 3IQZA 2MINA 2ORED 3NPAA 2OHGA 1VTKA 1JLLB 4JHLA 2OD9A 1UBHS 1XXHB 4Q4HB 5TIIA 2VQ3A 3H83A 2YNMC 4R2LA 2W2MA 3RUFA 4JR2A 2NXWA 4LRYA 5F5LA 1GYQA 2C2YA 1X1DA 1LW6E 4DDUA 1FFAA 1ZCBA 2H4HA 2PM8A 3TSOA 5J23A 1ZCFA 1H2XA 2FUNB 2J0EA 1EX6A 2FMHA 2CLSA 4Q9IA 4DMKA 1TAUA 2RK4A 5IBCA 1BD3A 2FKAA 2W0SA 1CCWA 3KWMA 3A0UA 1AS3A 4LQLA 1SQSA 2J30A 1RJ9B 3PDIB 1ODTC 1J2EA 2ZJAA 3PF9A 4TTVA 4FGUA 1NY6A 1FUUA 1UM8A 1YK1A 2R1ZA 1M8FA 1S1CA 2AEJA 1F4PA 2NO1A 3DV2A 3MW8A 3QUAA 2HCTA 1VLHA 1MB3A 3EWNA 1XMSA 1EK2A 2OCIA 4HWSA 4ZVKA 3DWIA 4FYIA 3THSA 2IBMA 2PIDA 3KZXA 4CDGA 2FY8A 1Q3HA 1W93A 1WSBA 1ZICA 1SA0A 1JEQA 3EZ6A 1YOVA 2JDID 1AZWA 4YRPA 2C7QA 3REFA 1GN9A 1V48A 2QN2A 1JSXA 5D51S 3TEFA 5ALKA 4YJFB 4X95A 3QKSB 1A9TA 2FRXA 2I4OA 3OOYA 1O03A 3HBFA 4RHEA 2BPOA 1I14A 4Q3BA 3LQ4A 1R4MA 3P4YA 4R9VA 4W6QA 5JLAA 2CUZA 4XIFA 1HDYA 2L82A 3MMNA 3U0VA 3AVTA 3NGLA 2VSFA 3QLUA 2CMHA 2QP4A 4G0QA 4HMPA 4JVMA 3R9WA 2JD0A 1NLZA 1SU6A 1IIBA 1U6JA 4LY3A 4J0QA 2X3UA 3PFKA 1UPBA 1XCGB 4KWIA 4AX4A 5EA2A 4EQ6B 1MAHA 1UH5A 2RGBA 3HXLA 1HG1A 3UMCA 1QVVA 4F5YA 1B00A 3RTAA 5L45A 3AP1A 2VTBA 3UXYA 1G8PA 3FVTA 4GVXA 3P9PA 4TX1A 3H7IA 3NDBB 4CF6A 4ZU3A 1G3RA 1K8ZB 3A28A 3RS3A 1ZC3A 3DQQA 3PZBA 2QK4A 2HYIC 4LZLA 4RA9A 4QZVA 2J67A 1JN0A 3TPZA 1HTBA 2HD4A 2FJUA 1E5XA 1XEWY 4JP8A 5KX5B 2XUJA 1M2OA 3NUZA 2FCAA 3QFCA 4TV8B 4N5MA 4I3HA 3T4XA 5CFNA 1B93A 5KQGA 3ZLTA 4DR6B 4YRJA 4QOEA 2R6CA 3WGJA 2G9UA 2VTEA 3OZSA 4NKRA 3HCWA 2V9CA 1ACJA 3KFXA 4K9NA 2IYVA 4ROSA 4UUMA 4F97A 3PRJA 4FDLA 1I7QB 1VZ2A 1F3LA 1CY7A 1G21E 4J3FA 3ZWVA 4C5BA 2BGLA 4RMJA 2NT3A 2X22A 3KB6A 3LA8A 1Q11A 2MSWA 1EHYA 1OPRA 5TB5A 2QTBA 4DF3A 5DYGA 3ST7A 1R2QA 1LW7A 3MUNA 3P0RA 4EJSA 2PUAA 1UWCA 1UXGA 2V7QD 1QE0A 1GQRA 1ZNWA 5FUBA 2XR1A 1GNSA 3ABOB 3HRIA 3K09C 3JQ8A 2QPOA 4LXQA 5JBQA 5CM9C 1U0JA 3IVMA 4BMZA 2G83A 4OI0A 1ETUA 5ECYA 3OEYA 4B48A 7ABPA 2AF3C 3C5VA 4ES6A 3W3AD 1S3FA 2CNLA 2MSEB 3AR7A 4G0MA 4GOXA 4S24A 2IT1A 5IVDA 3W4IA 2XAUA 1QOZA 1EBUA 4NNPA 5KQRA 4QREA 2HF9A 3HNRA 4PBSA 4EY5A 2HPVA 1RC0A 2AFHE 3OCJA 4EHKA 4LJRA 2EKQA 1T9CA 4FOSA 3T61A 1SPBS 1M0EA 1AO0A 3C4JA 3W2TA 1Y4SA 221PA 2XT0A 3JRXA 1Y7LA 5GJCA 1E2DA 2HLDA 5C1OA 4EF6A 4EFNA 4KTVE 5L8VA 3GZ4A 3K0KA 4OXQA 1QDEA 1KI6A 3H8WA 2V4UA 4LWPA 5G1PA 3OPMA 2FDXA 3GP3A 3BX1A 3DMTA 4MQFA 4YCDA 2WVHA 3DS8A 2GYYA 2HZBA 4MVXA 2D3WA 1YACA 3RYTC 4R2WA 3ZGOA 3HXQA 3ZW7A 1NZFA 1K8YB 2PANA 4IEEA 4C7JA 3AM5A 3U31A 1UFRA 1W49A 4QAJA 4QGBA 5TPZA 1IIRA 5C18A 4B3GA 1CZUA 1XK7A 1UPCA 5LJLA 4Q02A 1WVIA 2B6HA 4B4KA 4C0XA 2RJOA 3EWIA 5ESDA 2JGKA 4OLBA 4ND8A 2XCQA 3EOZA 1ZCJA 2X1LA 1HEUA 3G6WA 4I1OA 5JAPA 2RH5A 4CM7A 4RFLA 3JZIA 4IIDA 2PGIA 4HF7A 3BTUA 4QQ8A 4WACA 3VR3D 1U28C 1NVVQ 1UJNA 2EX1A 3WWCA 5BQ5A 4OGKA 2ZQ5A 4Q05A 2XQFA 3HB7A 5D2CA 1RTKA 3WOHA 4EG1A 2L2QA 3HDVA 1J4AA 2OCGA 4F4JA 1KTVA 1AQYA 3B2EA 4BFCA 4I55B 4FUTA 3IQFA 2O6HA 4AY2A 1PU2A 2VK4A 2XYPA 4XLZA 3UB3A 2I6QA 4ZREA 5F9MA 1OXBB 5CURA 1V6SA 4RZSA 4XFJA 5FHQA 3UIEA 1TVMA 5B30A 3VDNB 4D92A 2YWFA 1L5LA 4V0KA 1ZN7A 2Q27A 3LW7A 1C2TA 3EUFA 1EJ2A 1K7SN 2BTEA 2G1KA 2YV4A 4ZXFA 2WAYA 3KS9A 1KVUA 1EVEA 3UT6A 1U9IC 4C4PA 3D7NA 4I36A 1ZXXA 1CJSA 1W4LA 2PH5A 2AMVA 3CKYA 3O82A 4K3UA 4N9WA 4DSTA 3KXKA 2Q4TA 5KNDA 3X1XA 4ZGWA 4KR0A 4NBVA 3ACDA 1JIIA 4PPYA 1FRVA 5E9AA 1UZAA 2GK6A 2NZ2A 2FOIA 2B30A 2VHTA 1H93A 2OORC 2POCA 4PSKA 4CCYB 2PA3A 3K9WA 4X45A 1DPFA 1G8GA 4A91A 3AHCA 1P5FA 5KHOC 5AW3A 2GWRA 3I8XA 3C5EA 5DYNA 3ICEA 1IUKA 2PZAA 3E6AA 4ETNA 2P79A 1JVBA 2Q3MA 2PD4A 4CTKA 5AYVA 4MQ5A 4WCFC 4YRTA 1A2KC 3OEHA 3WK4A 1GPMA 2FG6C 3CWCA 4Y98A 5TLSA 3FMOB 5GQSA 4CFSA 2JG3A 1MX9A 1G7SA 2HQBA 2W6ID 2XZOA 1Z29A 3KKMA 4TKVA 4W6ZA 3LWZA 3TW8B 2JI6A 2VZ0A 4GM1A 1H0KA 1YNOA 3FNGA 5EE1A 2C2BA 2FPPB 2VZEA 1K7YA 4KV7A 3SJZA 1JB1A 3D4OA 2ZCUA 4W5TA 2XDAA 4MW7A 5AVYA 1XTKA 2JK1A 3BJMA 5J5VA 1AXRA 2Q6TA 3ND9A 1GPAA 4XIIA 2JJ2A 5E1BA 1YVPA 1O95C 2ZWPA 1CUBA 3ABSB 4MHTA 4OQQA 3B6ZA 4WKNA 5HKLA 5C8YA 4ZOBA 1A4RA 3R7BA 4CT0A 5TQ0B 1NWCA 4DTCA 5HRUA 3ZDDA 3L5KA 2FK8A 5IDQA 2W4MA 4U0KA 1QFZA 1ISPA 3F5MA 5BP7A 1GM5A 5FFMA 3TQOA 3SC6A 1Z6XA 2REXB 4R9RA 1Z6ZA 5AVOA 4XA8A 3UAXA 1NA5A 4R83A 2RJNA 4PF1A 3MYRA 3JATA 1J7KA 4I8XA 1BXRA 2O5VA 3AERA 3BYZA 3F78A 5C0OE 3PJRA 5JD6A 4BFZA 1TU3A 4EPVA 4GX0A 5K0SA 3W0LB 1CYEA 4ZOLB 1N6LA 2V5UA 1CBUA 3H1AA 4LW8A 3IEVA 4TZ0A 4MKXA 4MYCA 4MW5A 2PQMA 4HQ6A 1DJOA 2M6KA 5BPHA 1IJKA 3KSZO 1V5GA 3E7WA 4HDSA 1FJHA 2AUNA 1BFDA 4FNGA 1MQAA 3OE7A 4JLKA 4RPCA 5ALYA 5LC1A 1T1RA 1WMEA 3GRCA 4WZBE 4IUBS 3ORRA 3K0HA 4CMEC 3UMYA 4MPRA 3PDCA 1TEZA 2W2LA 4W82A 2WVJA 3CO0S 3SKXA 4YN3A 4JJIA 2CXHA 1WQ1R 2GI4A 2LIPA 1VE9A 1YZUA 4HTAA 3OPQA 1RYBA 4RK6A 3CPEA 4Y0AA 1U2RA 4F5EA 4BB6A 2UVDA 3OF5A 1DG3A 1J2JA 1JSCA 1HGXA 3AF1A 1BN6A 3OOHA 4RAQA 4XQEA 1E77A 2YMMA 1UM9B 3JQ7B 3IOEA 4NG5A 4U5QA 3UJCA 4BGEA 1D2NA 1JDBC 1Q7CA 1QHGA 3KUCA 4RFSA 4WJKB 3R4CA 3FETA 2HX1A 2J0UB 5JQGB 4M53A 2YNMA 1EXNA 3H1TA 3BIOA 3Q12A 2IEBA 5E1OA 1K7FB 1LA2A 3NR2A 2ZI3A 4HWPA 1QYIA 2Q46A 4FE7A 1G6HA 4PG5A 2Y0BA 3BAFA 1G5QA 4BNNA 5F73A 2ERXA 1U5AA 2K6GA 3UAVA 4D56A 5C3MA 3QOFA 5CNKA 5IH3A 1UMCB 6PFKA 2C96A 1FZTA 4S35A 2VP0A 3IE0A 2FPRA 4OAOA 4QBKA 3O2SB 3HUTA 3L84A 3UXEA 5A5FA 3VNVA 3QVGB 1H8HA 3R8CA 1I3MA 4RL6A 2Y71A 2X23A 3PV0A 3VAYA 4G9BA 4Q7JB 5CT8A 4JI8B 3V8MA 5CHYA 2VPPA 2PG3A 5L3SA 3QEBZ 3DUFA 3EPHA 3FGNA 3SI7A 5FBZA 1VJGA 5E1DA 2HLNA 3O7WA 4HXYA 1IRIA 3VYVA 5LYJB 2HN9A 1KO4A 5ADHA 3GUZA 3PR1A 1UBNA 2YHUA 3FOBA 1HI9A 5BYJA 2GO7A 1ZJYA 2JLSA 1KK0A 5EWMB 1QHYA 1T8SA 1INLA 2IUEA 1W2WB 4WV3A 1KOLA 1Y7TA 1E96A 3M33A 3SFTA 3S2IA 1NQAO 2G5CA 3MUEA 5J5AA 1Z0UA 5EIWA 2O19A 1AB5A 2FGKA 2HWXA 1B8NA 2XMDA 3OOEA 3QX8A 4UAUA 1PWYE 3OU2A 1Z8FA 3B20A 4MQEB 5CT9A 1YHZA 4GUDA 1RYDA 3X1ZA 3GP8A 1DUSA 1FRFS 2H54A 1CY6A 3VU8A 2XX3A 3I32A 5HM8A 3EMVA 2FFJA 3HKCB 3ZDBA 4BGIA 1P7ZA 1YI1A 2F43A 3PFHA 4UCQA 1XDWA 3AHEA 1DKLA 3RNLA 1AV6A 3OTGA 4NYJR 4O1IA 2A5YB 1V1MB 2G0AA 4D4MA 3RU9A 1XZPA 1DUVG 2F1IA 3JWPA 4EVRA 3L0OA 4ENTA 3CCFA 1T36A 5DXAA 5CK5A 3G2PA 4Y6PA 3ICPA 5M29A 3FPBA 4K6OA 4L3WA 4JODA 5IT0A 1R16A 5ECDA 4GECA 3O38A 2H1VA 2OGTA 3IBSA 3NRBA 3NJRA 3TQCA 4X1YB 5HF6A 3GAFA 3TKAA 3IDSA 4MLCA 2YCBA 3GCWA 4E03A 1R3DA 1K97A 1LRLA 4G2TA 1R0ZA 3L7LA 1BNCA 2VDOB 1UMKA 3LO5A 5CA0F 2JFQA 3PL5A 4OXIA 4HN2A 4RJIA 1VP9A 2PGXA 1KARA 3LOUA 4OJYA 5FTNA 1NVBA 4GO1A 5TARA 3KBBA 3CVJA 3TF5A 3Q88A 1ST3A 4KWEA 3WGGA 3MERA 5DIZA 1VSVA 3UGTA 4ENRA 2FMKA 4GNRA 1H2EA 2DTXA 4DIMA 2CDRA 5DM0A 3NZEA 5F4ZA 2B7LA 2DY0A 2D1FA 4DANA 1WXHA 3OAAD 1X8XA 1HLDA 1IH8A 2XYGA 2LR0A 2GVNA 1ZGHA 1YL5A 4JASB 5EC8A 2GLUA 3CW8X 2NTVA 4IDBA 2X9VA 4Q1DA 3N2GA 4LXHA 2Q49A 4L5JA 3FG9A 3K1TA 5C34B 3V1YA 5HE9A 5FOQA 3I6MA 1NXWA 1TCCA 4US0R 4OBEA 3ITEA 1AQNA 1J22A 3JQGB 4XCXA 3ZZUA 1P7PA 2JLUA 1FYWA 2VSQA 3TS1A 1F48A 2FUKA 2B5VA 4JQOA 4ZTBA 4G9GA 3WWOA 1P1CA 4ZRDA 5HPYB 1ELOA 1QGYA 1RVV1 1S8AA 2Q6OA 4H1HA 2P9QA 1X1TA 2OBMA 3S2FA 1Z25A 3MBKA 2FN4A 4G1FA 5J2TA 2ZAYA 2OD2A 3A3PA 1VI5A 4DR5B 4BWYA 3BKXA 4R2MA 1M1NB 3VVMA 1JQLB 1FLAA 4I4CA 3RG2A 1OGYA 1TUBB 2WWTA 3AETB 3BL5A 1CNFA 2COKA 4NARA 1HNZB 1EWTA 3MWYW 8ADHA 2Z04A 1II9A 4MARA 2UDPA 4S3MA 5DNEA 3VKHA 2OHJA 4PGAA 4IEIA 2PGAA 4RVFA 2WYIA 1U28A 1L4MA 3P0JA 2NTNA 4MJLA 3V4ZA 4ZJYA 2XQVA 3TVTA 4UOEA 4ZAFA 1GQOA 5FOSA 3U19A 3GUUA 3PPWA 1QP0A 3DDCA 1HKHA 1N1DA 2E85A 3JD1A 5FWAA 4EO4A 1DIAA 1NJ2A 1EG7A 2RIPA 1ZONA 4GM4A 4DC0A 3MCTA 1NOIA 3QRWA 1D1SA 1DWQA 1O6GA 4WN9B 2O7NA 2R1TB 2O48X 5COAA 3JQAB 5FL7D 4DEVA 1PFUA 2WSIA 1F2TA 5JRDS 1ZH6A 4YRIA 4AECA 3KEMA 1T26A 5AIBA 3G68A 4M1MA 3DXYA 4ZXPA 4Z53A 3FR7A 2C2OA 1NSYA 4O1MA 5BVHA 3AOEC 1CP2A 5LP6C 4I5DA 4JFRA 5JR3A 5L6MB 1SKUA 3LBIA 3MYYA 1RHKA 2OZKA 2J5XA 2FG7C 3RSHA 2UXBB 3WSWA 4BNGA 2UVQA 4XD7A 3FYSA 1P18A 4ALNA 1YRHA 2EX4A 3KXDA 3PC7A 4LHXA 3UN1A 4D0NA 4WEQA 1SXJD 2HO4A 1DBVO 1ADCA 3T1YB 1BE1A 2ZANA 4CQLA 4GMKA 1GPBA 5EJGA 1IG0A 1U90A 4X1IB 4L8FA 2XSZD 3CR7A 5IZ4A 4KDFA 3JVIA 4E22A 2YUIA 1S8NA 3ZBPA 4ENPA 3L01A 3RADC 5K2MA 3ILVA 2Y0PA 3CSUA 3ZR4B 1XDSA 2C0PA 3GPIA 1AK9A 1EK1A 5FA8A 3WO1A 5KSWB 3RRBA 3KTFA 4GYKA 1UXJA 2COEA 1UR5A 5C7IO 4X60A 1VE7A 2QORA 1YE3A 5FHRA 3UMSA 4WFQA 4JVOA 2PDAA 2AN5A 1L9KA 3QPAA 2PS0A 3TOZA 3NHMA 3OP1A 1M6VA 1Y6ZA 4DQKA 3L07A 2C9MA 3DO5A 4WK0B 3TL2A 3TXAA 3TZLA 4MEJA 3VR6D 4HGRA 1E1NA 1DJLA 2PVPA 2H51A 5F76A 2AFRA 2P91A 1CZKA 3W9YA 1EP1B 3SJAA 4O2AA 5LUAA 1IHYA 3EXEA 4ZVMA 1IZ0A 1O89A 1A7AA 1T5TA 3G59A 4JL8A 4PZ0A 4IIUA 4HKTA 1BA3A 2EOAA 2QN8A 3TRKA 1E9AA 2BBSA 3JZAA 5LZ7A 3VR5A 5MGNA 3HFGA 5HZGA 4YUZA 2Z8YA 2PZFA 3HR4A 2GBFA 4KLAA 1T8RA 1T6YA 2RBKA 7ADHA 2R6FA 3UH1A 1NJGA 3IS3A 4D3YA 4AJHA 2AUTA 5KYWB 1ZR2A 3JQ9A 2DFVA 4MQ6A 3ROZA 2CXSA 1PV2A 1QLJA 3NAQA 1M76A 4LZWA 1E99A 3W2HA 1Y33E 3QXHA 4U2GA 5IKOA 3MWEB 3DMNA 1M5RA 3WNDA 4X3CA 2B6NA 1D2GA 3LPDA 3MN1A 5BSKA 1LI4A 2JI9A 3R3HA 1E2LA 1UEXC 1FRZA 3K53A 1ODIA 5HMLA 4OIFA 3KR0A 1ADGA 4FHCA 3VVCA 5A1JA 4LX8A 4OHRA 4RY8A 2R66A 5H80A 1BDHA 4I4TF 2P65A 1ORTA 4CMEA 1MW9X 1JKIA 1SNYA 4LNUB 3R3VA 1YKFA 3FSGA 3HL4A 3U7QA 3LIPA 5CYOA 2O8DA 1HZZA 1P77A 1LNZA 4X7BA 5G3ZA 1OMOA 2JEYA 3CZQA 2Y0CA 2YJZA 1UAAA 1B74A 3VDRA 4HNTA 3L1KA 1WHSB 4NPHA 1BU5A 2WG2A 2QM3A 2C5LA 2VA8A 3MINB 5FTMA 4E5UA 2GM4A 1W8IA 5K8CA 3T52A 2WOJA 3PJEA 1GZDA 5BV2P 5JNRA 5FFNA 2AJLI 3AOGA 4YAIA 4GE0A 3JARA 4TXJA 2WPDD 1VKJA 4OQFA 5DI9A 4Z0NA 5LQUA 5IDWA 4AP6A 2Q9CA 3M4JA 1QOPB 3WHKA 5BOSB 5J4KA 2OZVA 1FMFA 5LVAA 3B5JA 3W6PA 1JILA 3L46A 4K0RA 1XCMA 2XB4A 5EYPA 2B0JA 3SS8A 3TQQA 1T3SA 3GMTA 3FUUA 4CM5A 1KFEB 4EHDA 1GDHA 5E4FA 4DS3A 4EWLA 2ONYA 3BIJA 2VHCA 1BE8A 2G07A 2GF9A 4O4LB 2F8TA 1KPIA 1V4NA 5AI9A 2BEWA 2QE7A 3Q6MA 5DSTA 1C0LA 2C9DA 3C4VA 4QTXA 3VTAA 2O8BB 2G5GX 1G4AE 4B3CA 1GZHB 1X1CA 2QY6A 1JYSA 4JGBA 3TB6A 2FN8A 3CXRA 1TDJA 1MAWA 3F67A 1BW9B 1JIVA 3GLFB 2FMTA 1OXMA 3OZDA 3MUOA 2YWCA 1RHUA 4IVQA 4UE3S 3GL9A 4J90A 1N2EA 3K94A 1BIFA 3QKIA 4BFWA 1CRPA 3EOAI 5CBPB 5EKDA 4M0FA 4A6XA 2R4TA 4D4JA 4HDAA 4E70A 3II6X 1FP4A 3P19A 4C29A 1Z5UA 3ECCA 3U4AA 3QHQA 1XWFA 4QUDA 3D4NA 1IOWA 4UULA 2PJZA 4E7PA 1CUJA 3DKRA 1DJMA 2EF0A 2ISQA 2PIAA 5JJ5A 4HY3A 2A88A 1EWYA 3SYRA 4AT1A 2FR8A 2C2KA 4C7OB 3N58A 1X1RA 3BMOA 5JTUA 3W1WA 2QTVA 2CHUA 2JZNA 3AP2A 4OI4A 4TGLA 4BN5A 4D25A 1B16A 3S7TA 4YMTA 4FYHA 1D2CA 1XD9A 1HLGA 2JIZD 1O5TA 2MIIA 2QU7A 2CB9A 2RHMA 4EG7A 4NI5A 5FNZA 5F3WB 2AC2A 1OXKB 2VT7A 3I9JA 4D9NA 4FI3F 2JAHA 3FTQA 1QNFA 1Q2UA 1T43A 1XYYA 4M6WB 3QWAA 5IT4A 5L4NA 1Y4DE 1QG6A 3EF0A 4FGSA 1MG0A 2QU8A 4ZODA 1PZMA 3EAGA 1GAWA 4FQ5A 5E2BA 1ZA1A 3E9RA 2ETXA 4A1FA 4D7AA 1E2FA 3ELUA 3CVUA 2AFIA 3IP7A 4YJGB 5KQLA 1QF9A 3SIWA 5CVCA 2ZT5A 3AY7A 1EFHA 4IUYA 4TTIA 2FZ5A 3ZE2B 3NT4A 3SWWA 3FTDA 3PNVA 4RK4A 2B8TA 2YV5A 2PJRA 5YASA 2I55A 4YA6A 4H6PA 2V74B 1OI4A 2HQSA 4ITUA 3AY3A 1EWRA 3D7SA 4QASA 3ROFA 5IU6A 1OI3A 2VYNA 3VBEA 4BLTA 2PUGA 4BLRA 5E7MA 4OKNA 3I76A 1DRKA 3PTLA 3WQHA 5I45A 3GLSA 1TO2E 5JISA 2IPAB 4KH0A 1X7HA 3H04A 2OY0A 3HDJA 1SEPA 2O3SA 2OCAA 2J6BA 2JZCA 3D2LA 1JWBB 1DQYA 3HO8A 4IINA 4UVEA 2FMIA 2Q1XA 1EFVA 3HWRA 4BBJA 1WW2A 3URKA 3T0FA 1V8OA 1IY1A 5JVDF 2QD2A 4ZHQB 2F8SA 2GKGA 2R11A 2ZQZA 4GXTA 1H2WA 1JAHA 5J63A 1P9RA 2DHDA 4Y9DA 2FW6A 2Q9AA 2ZVQX 5ELMA 2D0OB 5CFOA 4J07A 2VR1A 3Q2OA 1YS7A 2GZAA 4JEUA 3SGLA 3BMNB 2PEYA 4AIRA 5BWMA 5B6JA 3JQRA 2G7ZA 1WCV1 2DT5A 2P6NA 3Q5GA 1V43A 1C9NA 3JR7A 2MINB 3STYA 2NZWA 2W83A 3OP4A 3TZ6A 3KYCA 1FUKA 1F0KA 4CCSA 3MWGA 3SXPA 2IC5A 3OIWA 4FYXA 4KN8A 1M8JA 1FNBA 1P1KA 1X13A 2H3EA 2EVWX 2IZ5A 1O4VA 1KH2A 2NIPA 2QV7A 4L3OA 1U1FA 3FYTA 1R4NA 3HYNA 3GRKA 2FZLA 2JF0A 1HF3A 1PBNA 5FNVB 1VCNA 2M6RA 2PZJA 3C7AA 1CR0A 1MJGM 2BMEA 3IIIA 4XZ3A 4EB0A 1E1RD 1XZKA 1Z47A 2YJNA 2GASA 3KQPA 3OSZA 4BMXA 1TLLA 1PT7A 4C4SA 4MMXB 4PBTA 4D4GA 1WBDA 2DLCX 4CFZA 5KC9A 1GUBA 3FPJA 2HOQA 2XEDA 1P2DA 1U2TA 4HEA6 1XTJA 3BDIA 1KMCA 4P3YA 3KC2A 3HVUA 3M6UA 4IOLA 2QL7A 3AEYA 4TMVA 4ZCPA 5AM4A 4ZEWA 4MUYA 1DIOB 2Q0HA 4XLLA 2FWRA 3JYOA 1J0EA 2ZUSA 4BVLA 3FHJA 2JD2A 1Q3TA 3CYFA 2QN3A 1I6KA 1O0SA 3O93A 4OSOA 3RVPA 2ZXUA 4BNJA 4Q7QA 1L5MA 1SKBA 2VPXA 4B6JA 3F97A 3QFFA 3R0XA 4G24A 4IPTA 4J0GA 5AKEA 4DNFA 1N1GA 3P0HA 2GZSA 3WWEA 1M6NA 3SR0A 4QARA 3RJZA 4A92A 1DAMA 2JFUA 2VA9A 2R62A 2QRQA 1Q0ZA 1W5AA 4KRGA 2I67A 5TGZA 4M89A 4ANFA 3CEMA 1Z0IA 1RR6A 3BH0A 4REQA 4UDXX 3O3OB 2HGSA 2F59A 4LOLA 2R7AA 1JR3A 1W4AA 1FNSA 2ZGVA 3AOEA 4JOSA 2P30A 4V0OA 4BNDA 4BC0A 5C5DA 5LP6A 2RD2A 3TK1A 2GO1A 2B92A 3A26A 1A1SA 3AHGA 3GRVA 1XGKA 5CLIA 4PFKA 1A82A 1VQ1A 1HSZA 5EP1A 3QF7A 1Q1BA 3NTVA 1ISMA 3FCCA 2OAEA 1VYUA 4LJLA 4WT7A 4EW3A 1VECA 4JLSA 4JXJA 3CU5A 2I6UA 4TMYA 5CXUA 4LY9A 2WYWA 4DQXA 5AFSA 1E6KA 3MRSA 2ZE7A 3CBQA 1LBEA 1T34A 1NW3A 4YJ2F 1SC9A 2UAGA 4OMUA 2ZIAA 3VM6A 3BN3A 4NIMA 4J94A 1YJCA 4AZ0A 4B46A 1SOMA 2ZG6A 3K6SB 1QU2A 4KO8A 4OGFA 1G291 2F3UA 4Z99A 3FN4A 4RBNA 3EGIA 2ISCA 1MIOA 4QUKA 1G3IA 3WRWA 5ENZA 3QH4A 4K8OA 4W9MC 1C5KA 1VGVA 4C30A 3F46A 2AXPA 5I7RA 2R7KA 2ZUCA 4NYIQ 2BDTA 3O4VA 3GJ3A 3OUZA 3X1MA 3EXFA 5K0CA 2FH5B 2QIPA 1QTNA 5EE5B 1NQTA 2X7XA 3JQ8B 2ZRAA 4CU2A 1K8QA 4Y7DA 5UKDA 3F5SA 3ZU3A 2H57A 2VAWA 1BSVA 1Z2NX 4WCDA 3L8ZA 3RSLA 3QHAA 3W3AH 1YE5A 2OO5C 3SQDA 4XWGA 1R5OA 1YDGA 1PRYA 2CLFB 1P1HA 3EDYA 1F8YA 1K08A 2OV2A 4I50F 4QUGA 4PXYA 1SCIA 2CMFA 4K03A 2CLMB 2HKIA 3TZQA 1JLSA 5FL3A 2VHVA 3UWMA 1BFUA 3IUNA 5FBLB 4BAGA 2WB4A 1KI6B 4YONB 2H52A 1KI8A 2I9KA 3OWOA 4UMDA 4FFNA 3GNSA 5B6IA 1MJGA 5DBEX 4P83A 1L7RA 4GDMA 1DSSG 1PEDA 4GQAA 3TTSA 1XRQA 5D3QA 1NVGA 2HRCA 4IH4A 4MZXA 3HCDA 2QOEA 1M33A 2R5WA 3OESA 5LUBA 1E6MA 3OOSA 2WFAA 5FORA 2WSBA 2Y2UA 4HQFA 1D4OA 3SK0A 5BSUA 3WR5A 4H7JA 3STHA 3NHPA 4G09A 3VR2D 5FOWA 3TCXB 3C43A 3G2JA 1AHNA 3O4IA 1MEOA 1XALA 3VYUB 4BKPA 1BMDA 1TUGA 1G8HA 1OWPA 2OLJA 4N7MA 3STTA 3B12A 2AW5A 3H0KA 5CFQA 1Q95A 1USVA 4XWKA 3R3JA 4GBMA 4JC5A 1H23A 3HDQA 3GLQA 2F3SA 4UXJA 4HZIA 4JBIA 5J2UA 4U3JA 1MV8A 5LLDA 4G5HA 2WJPA 1IZ9A 1QH8A 1I1QB 2P2ZA 4U0JA 5AIAA 1L8QA 1RDFA 1SXHA 4ME6A 5KNBD 1I94B 3HXMA 1PX0A 2NO9A 5CFRA 4J8PA 2KJQA 4EG8A 4YJ3B 5HIKA 5I8WA 5J40A 2Q8QA 3NALA 1YFZA 1J8YF 2AJ8A 2J3LA 3HA2A 6CHYA 3KELA 3A2LA 2WSSD 1HTTA 4GMFA 5THXA 3TAUA 1M1UA 3HB1A 2X2PA 3CRNA 2G7MC 2QG9A 4YV7A 1F0YA 4GXQA 1E2QA 5KYUA 4NR0A 3RT7A 1U8UA 2XOKA 4ZVQA 4C89A 2IYLD 3LQ2A 4AS3A 1XCJA 1OA0A 3R3SA 5B1YA 1KHTA 5KHLB 3KKPA 2BEUA 1V41E 3EDQA 1G4UR 4BNVA 3HKDB 3EY9A 5AJUA 5G4KB 2GYWA 2JGNA 2Z1DA 5HNKA 2PZMA 2VZ8A 2OFPA 4IFEA 4WHMA 3OO1A 3CLSD 5LQCA 3E15A 5JCOA 2IZ1A 1JEYB 2X8WA 3OPYI 4OD0A 1O6CA 2RGAA 1HDEA 2VI5A 4EUFA 2N47A 1RADA 3T3GA 1FPMA 3ANXA 1GGMA 1X74A 4JZYA 4MX8A 3NBYC 3WS7A 4AMYA 3TR5A 2GERA 3DHWC 4CL0A 1RLOA 1CD5A 1R0SA 1RAHA 1H66A 2E2WA 2PFKA 2QR2A 2XIQA 4UCXA 2EW1A 2GCNA 4UHDA 5CX1A 4I08A 2IZ0A 2BLLA 2QJFA 3TCNA 3INTA 4I3FA 4ZOCA 1W4CA 2B4AA 3DEZA 4B6OA 3AMVA 1G66A 1G6Q1 4DZRA 4NVRA 1PS9A 3IKLA 3VPDA 3PI6A 1Q84A 4RIGA 2JNWA 2YWHA 4RS4A 3KHSA 1YFKA 2J45A 4MW2A 3QU5A 1DTWA 1ZGJA 2B20A 2LV8A 4FX5A 4PRZA 4OHZA 1V16B 1HH4A 1HT1E 2F6RA 4LISA 3NH6A 4JA2A 2C4HA 4UTOA 1KHHA 5AI4A 3CZPA 4BVBA 4UTRA 1PVDA 4D8WA 5F35A 1XVAA 3O4RA 4Q1AA 4WW0A 2J48A 4P7GA 2AQ8A 2AV6A 5IUJC 1L5SA 4R5MA 3RTEA 4DQ0A 1GRNA 2HA5A 3HP1A 4WECA 1DXOA 2EKLA 4Y2PA 3IP5A 1M2WA 2E6UX 5E6SA 5LKAA 3UB2A 3OHSX 2WJHA 2HT6A 5LQSA 1JIJA 4G0OA 1PR2A 3RRXA 3EDMA 3AW9A 5ITZA 1CE8A 3WRYC 2XMPA 4ZI7A 1TYBE 3ETCA 2IYRA 2IYWA 3DE4X 3CVWA 3ZS9A 4DMMA 1GZUA 4POOA 1Z4IA 3D6MA 4H3SA 1K98A 2WKWA 3F4LA 1E9SA 2HAEA 2OEPA 2DSNA 3G2QA 1I3OA 3P52A 4BNMA 1PNTA 4F8JA 4P54A 1N0IA 3HI4A 3WGKA 4LF5B 1MZPA 4ZCMA 2W6JD 4UE2A 2XGGA 2AQKA 1I80A 1N5KA 2G1UA 2C1ZA 2DUJA 2WK1A 1PLJA 1H2AS 2JGAA 3SIXA 3JATB 4IDOA 1E58A 4CTNA 2XMBA 2XUGA 3OJFA 4KVFA 4AJJA 1JECA 2OV1A 1CQJA 3UYKA 1HM5A 2BFOA 5REQA 2QY9A 3AERB 4HBZA 4D80A 2B36A 3UXMA 1UPTA 2E4YA 3K6JA 3LLCA 3A37A 4D0LB 4QNMA 4GKAA 3PHJA 3RYFA 2ZS9A 3AF3A 3OFNA 2J1LA 3RSSA 2WTNA 2XRZA 2G3YA 1WNFA 5DWDA 4HDSB 1H8ED 2EQ5A 5DXFA 4CMBA 2IF2A 3IILA 3OUUA 4OHOA 3TLXA 4MULA 1USGA 2D2XA 5DN6A 3G5LA 3D3NA 3GUCA 2WQ7A 2Z5GA 2OK8A 1XZLA 4GMHA 2FXVA 7AT1A 2AYYA 2Q0SA 3QVVA 3FDZB 4DLXA 5LMCA 4ESHA 1N5JA 5LBTA 3K1AB 4YCCA 2UVPA 2HHCA 4YO8A 1T9AA 1VG1A 2AGVA 2PV7A 3DC2A 3E2IA 3MM4A 2Z9BA 5FUWA 3CEAA 2DETA 4J0HA 5I7EA 3U56A 4ILEA 3OCYA 3A4TA 3CG0A 2NADA 1WHTB 2EEZA 5TEVA 1NC3A 3ZJTA 2E0IA 3BRCA 3SLKA 2KSQA 3LOPA 1KYIA 2B83A 5B5SA 3S99A 3FHCB 3PDJA 2FGJA 3N05A 4MW9A 5ABPA 4O4JB 3A6HA 1H2FA 1XD8A 4JJFA 4FMPA 4MI1A 4W5RA 3PTAA 4I5GA 1XBTA 1W85A 4L6IA 1HNWB 4TOIA 3JXEA 1YA8A 4YRLA 1R9MA 3D8HA 1SXGA 3FTCA 3KDSE 1AF7A 4PFSA 4ZDWA 1JPVA 3SE7A 3ICCA 3ZKWB 1RABA 1SOWA 2H4JA 4Y6GB 1NPTO 3I9V1 3WIOA 4RD6A 1GAQA 5E4YA 1ZOSA 3WNQA 1KEUA 3KJNA 2CCJA 3DO8A 1GT6A 5CAEA 4P3XA 3WGHA 5L3SB 1HKUA 1TYEB 4ETWA 2W37A 2H0RA 4KREA 4E31A 1KYVA 1NN3A 3IPYA 1UBMS 1W1UA 4HLUC 3EX7C 4KNVA 2ONKA 2JGDB 3S5JA 1BDIA 4MS4B 1SK9A 5D86A 3EEYA 3ZE6A 2FX5A 3I2JA 4XJSA 1E62A 4HTFB 4LXTA 1TU0A 4WASA 4P8RA 3L93A 4QICA 3MAJA 1ZMRA 4BQOA 3SQXA 4AZSA 1HPLA 2QD5A 4MCJA 2ZRGA 2ZIUB 3D6FA 4R1SA 1P8AA 2WJAA 4R16A 3TRDA 4NBWA 4Q1VA 4EMSA 4ESVA 1ESCA 1YRAA 4P7BA 5F9FA 4NU6A 1KEEB 3M4ZA 2G82A 5COQA 4J1SA 2WHXA 2XD9A 3QENA 5A6SB 4AY6A 5JJCA 4O02B 5D5HA 1C4XA 1OC4A 3LLMA 3U3XA 5AJHA 1FMTA 3C3PA 3W5UA 2C9OA 2G9ZA 3AL3A 3MT7A 2AN4A 3VVLA 4B9EA 1W4ZA 2RHLA 4JBNA 4YRCA 4Y3UA 3V48A 1DRUA 1B3RA 2PYZA 1T5IA 4UMVA 1Z3IX 4MINA 1WA5A 1E6CA 1SHKA 1G5PA 1O9BA 3INYA 4GEGA 4LC9A 4RDXA 3EY4A 3ZGNA 3O8OA 1USWA 3EXHA 2ASVA 2Y1OA 2YXNA 3BWXA 5F2KA 1THGA 1ZINA 3SJBA 1EI9A 3R7AA 2XD4A 3TGWA 4X64B 4C0HA 1KI2A 4G8DA 3L7BA 4TTPA 1RI5A 4OU4A 2AH5A 2NLOA 2NQ8A 2XUOA 3I23A 1I1OA 1NBME 4AY3A 1JXAA 5FUQA 3MVEA 4A2QA 4RQUA 3ZIAA 3WDLA 4P22A 5JT1A 4GZ6A 2DR2A 4I9HA 1PUXA 2C8VA 1ZBDA 3C6MA 1R6UA 4ON9A 3COZA 4Y18A 5EMJA 5FPYA 2XNKA 4WD3A 4EL5A 3QVKA 4JNCA 5CXSA 5KJ6A 3ER9A 1XZCA 2H5IA 4YJHA 1RJWA 1LPBB 2XBUA 1XK6A 2C8KA 3A1TA 3CUTA 1H9CA 3ZPXA 4CM8B 3CVYA 1A8SA 1P5ZB 3GROA 4N3NA 4PZZA 3U4CA 3NIDB 2WSYB 4HAVA 1ZWKA 4PG6A 1ZUIA 4MR9A 1JAIA 1V5IA 4JI5B 4ADSG 1Y1SA 4LBYA 4RYDA 3DE6X 3LC0A 1DGQA 3DDOA 2H65A 5KQSA 4WSOA 1YQQA 3LZ6A 2QAGC 3H75A 3KTAB 3FOZA 2OO5A 3FLBA 3GXOA 3MWJA 1I33A 1AGRA 4OGLA 1NXSA 8AT1A 1NLMA 1JSRA 1P45A 2MTBA 3BUSA 3EWSA 1ULSA 3Q0TA 4DJEC 5JAIA 3RBAA 4BFYA 3N2IA 3G2HA 3TLKA 3TEMA 3OE5A 1RRMA 1KH1A 4K7JA 3V7YA 3EJ6A 1NKVA 4JROA 1RRPA 1E5QA 1M0TA 3GFGA 3H84A 3NP9A 4PGGA 3RODA 2ZT6A 3VR1A 1Z7WA 3N9IA 4DT1B 3CONA 4MWGA 1NM5C 1ZJ4A 1CR2A 3PCTA 2VJLA 3M1LA 2A1TS 2A5GA 4MA4A 1EYZA 2W4QA 4RVSA 3OCCA 4OYYA 2FP3A 2IZ6A 1DHRA 4JKYA 3IP1A 4V2UA 4EARA 5I7FA 1PFVA 2VPYA 3C3XA 1GR1A 4KX3A 3GIWA 3GLIA 5ALVA 2FI1A 4NOLA 3P45A 4WOBA 5A5EA 5C7LO 2VJMA 2IE8A 2O5EA 4MYSA 3ZY2A 2CNWA 3EH2A 4OQZA 4ZAYA 4KW7A 5BO5A 1J9GA 4ZAGA 2O8VA 4MQMA 1QQ7A 1TMYA 1DKNA 3S1SA 3IBCA 4PN3A 2G0TA 4UTXA 5HIMA 3D7MA 5K20A 1J23A 2J87A 1MPXA 3N07A 1LRKA 4FOOA 3QELA 2D1RA 2UXDB 1KTIA 1ORVA 4DIOA 5ED0A 4P31A 3G3EA 4RLFA 3R77A 3TNLA 3TQHA 3UOGA 4BJHB 2RAFA 2I2DA 3HDGA 1KVRA 2PYIA 4BL5A 3AUJB 3LM8A 1HX7A 2V7UA 2FWNA 4MIOA 1CXZA 3KHTA 5EZYA 1FQJA 3OVMA 4AMGA 4S1PA 3UVEA 4FC6A 3PCXA 4ZDKA 4OF4A 2XUQA 4MS3A 1VG9B 5ER6A 3BMCB 2AX3A 3NOXA 4B8ZA 4NJMB 1R9GA 2JASA 3NC0C 4Z0PA 5BN4A 2RGDA 3AXSA 3E18A 3OEWA 4GF5A 1FX0A 2IYZA 2P62A 1FFBA 2WJZB 4BKUA 2KB0A 4CWAA 4MV9A 2IUUA 1OIWA 2D5AA 4OA5A 1YQTA 1QZXA 3VTZA 3MMPA 1GCOA 2NG1A 1WTAA 1VLQA 4NAUA 4BLPA 3DPSA 3AY6A 3BGWA 2WLSA 4XDZA 4GBED 4FMCF 2H59A 4LYYA 4B2YA 3CZ5A 1KZ6A 1TM1E 3MJCA 3T1NA 1HOTA 3OQIA 4EUEA 2ACVA 2XQKA 4URWR 2H1SA 1MG5A 2X4GA 4C1BA 2Q9UA 2ZP1A 3V4OA 4CQLB 1D6SA 4JMLA 2OPHA 2NXEA 3H5NA 2BEKA 3WXBA 2PZEA 4E6PA 2AJDA 2HJWA 2R1VA 2AG5A 3E35A 3H6HA 3N86A 4O8CA 4EUHA 2ZXFA 2Z09A 2CY0A 1E32A 1RI3A 4IIJB 2GJSA 4OUKX 2VUHB 3SEFA 3W6UA 3EA0A 1T6BY 3DFIA 4C9BA 2Q4EA 1QO9A 2EJVA 4HLDA 4WCFB 3LDFA 4DRYA 3CLUC 4F56A 2ZTVA 3THYA 3IHLA 3HA7A 2MR6A 3H87A 1LZKA 4RF2A 4XUEA 5AVVA 4BE9A 3CSDA 2HY7A 1Z39A 2UXCB 3BK2A 2XNSA 1FU4A 1OD6A 2GD1O 2GEKA 1NDQA 4IIFA 3T54A 3GT4A 5IANA 3DEKA 1COWA 2P9EA 1TJYA 4M2LA 5EPUA 4KFCA 4HNQA 2IYYA 4QEKA 3H9EO 2NU7B 3HFRA 4YY3B 2ENWA 1TO6A 3ENQA 3GB9A 3GLHA 3ZV5A 4S0ZA 4DLLA 4CKZA 3EMKA 2XCSB 3IDAA 4M46A 1JLKA 3HBMA 3M7IA 3OPNA 4MI3A 3CM0A 5L3VA 3TGLA 3I52A 4FFPA 4L1KA 1KZGB 2I80A 4RLSA 1GSHA 3JVUA 3QIVA 4JBLA 4DM3A 3MS4A 4HATA 4K9SA 4KXXA 4F3CA 2CCKA 1CRZA 1M2JA 1MP0A 2P9JA 1ZD8A 2PWYA 4UU7A 3I83A 5JSYA 1X7WB 3QEMA 3RPEA 3RTGA 5A4FS 4QJ5A 5ED4A 3OT1B 3I34X 3NASA 1TQ4A 1NNEA 2B3TA 3SU8A 4LJ9A 3AZPA 4IHJB 2ZJ3A 5JWRA 1D07A 3HYTA 1BOOA 1CUGA 3FCAA 1IWPB 4ZHSA 4DGQA 3JX9A 1XMPA 5I4KA 1AS2A 3DZDA 3M0EA 4GGOA 4TL9A 3AW8A 4RMNA 1SBYA 3NTRA 4E11A 4K6CA 1J5XA 1LPAB 3L9XA 3VRHA 3OJEA 3TMYA 5BURA 1Q21A 4YYZA 5DU2A 4W5HA 4L57A 3WK8A 2FETA 1YOBA 4CQMB 4K9PA 4Y6QA 5GJWC 1GU0A 1F9AA 2BI4A 2GN2A 2EBHX 4TWZA 3T7JA 4DWJA 1YVRA 1XZBA 1M6YA 1CHDA 3H8SA 3U7QB 1GQYA 3NT2A 2DUUA 2FLVA 1EFPA 3PL1A 4LTMA 4XX1A 5ECWA 2O8DB 3RKSA 1A9SA 1C9KA 1GTRA 1WP9A 1WXGA 1Y3AA 4WY5A 3T3NA 4RYLA 3T06B 1CV2A 1YU9A 4XIJA 2CBXA 3UJNA 3A58B 3BE4A 5ALLA 3F9IA 3BXOA 4PTLA 4L7QA 1JDBB 4OJMX 2OA0A 2HSEA 2X5XA 4AN0A 3JARB 1VMKA 3ZQJA 1T9GR 1JPNA 4O29A 4EFLA 1KERA 4B35A 4DMGA 2WAMA 3WLAA 1VHQA 5ESXA 2PKXA 4YIKA 1FTWA 2XGJA 3T7RA 5DI3A 3B6IA 4YAGA 1DAPA 2FRVA 3I58A 5HK8A 3G5TA 2QJTA 3GLGE 1YH3A 4GXRA 2Y1FA 3KWLA 2DECA 1GG9A 1GLGA 1L4FA 2PX6A 3SBDA 4ZJZA 1E3WA 2R6ZA 3AWDA 2R7MA 1FUYB 1A1VA 5DIFA 5ESWA 3K2QA 3GJ0A 2ACWA 4ZOAA 4MDYA 5IJAA 5A4DA 4D3ZA 3Q41A 3HXTA 1B6GA 1J5PA 2O57A 1NV9A 4B6FA 3DLTA 4WX2B 1CRWG 2F48A 1I36A 4J4BA 5B58C 5DTQA 4K6FA 3AEQA 4NBKA 1L3CA 3KAJA 2HH9A 3SYKA 3UATA 1I1NA 3B6KA 5AJXA 1ZR4A 2WIKA 3OWXA 1KZ9A 3IIEA 1HBJA 2EW2A 2XUAA 4DLTA 4KIFA 3BICA 4DLYA 5CDSA 3UANA 5C81A 1IVNA 4GVLA 3JSAA 3IKJA 1RM0A 4C0WA 3QA3E 5CTJA 4XYMA 3SSNA 3H7AA 2IYSA 5EWLA 4Y2VA 1YZQA 1K75A 1Y5NA 2EZ4A 2H0AA 1GL3A 3Q40A 4L0QA 4L4YA 2UZ0A 5K1ZA 3OQPA 3X2FA 1LI7A 3M1AA 2B2XA 3LPCA 1N1EA 1J21A 2PZGA 2PCJA 2WKPA 3IQXA 3NIWA 5EOVA 2AF4C 3MCZA 1AOXA 1MAUA 2C5SA 2PUWA 1ZD5A 4IQ4A 3W2EA 1SVSA 4B6QA 4G1MB 5AVXA 2XCRB 1SUWA 5EUBA 2QTVB 3QNUA 4OXKA 3IJRA 5DM70 2E55A 2VLBA 4FR0A 2BFBB 4B3TB 3UQZA 4IGIA 2HWKA 3KHKA 4A2CA 5BMVF 5LDHA 3QQ5A 1ZM4A 5JATA 2ZSIA 3HGMA 2JAQA 2GJ4A 2VP3A 1H0SA 3GRPA 1PW7A 3K4PA 4JT2A 2J4CA 5CB0A 4RCVA 2HBYA 3K05A 5TVGA 1AUXA 2Q5IA 3ZH9B 1ZK1A 5BQOA 5E8JA 1DKOA 3MBOA 1AHHA 2X13A 3ZDCA 3DLAA 3E3LA 2GFIA 1Y34E 4JBGA 2IY7A 1EB8A 1EM6A 1WEHA 2EG5A 2EWMA 2FJPA 3CRVA 5SZKB 4BGDA 1V35A 3I1IA 2I5PO 3NHYA 1VBKA 4R2XA 1CETA 2GKSA 3C6YA 3PR3A 1A9PA 3C1AA 4YP1A 5IC5A 1B2RA 4B31A 5AMXA 4PC1A 2DWQA 3MOSA 3AU8A 3PNMA 4ZVSA 1W19A 3DONA 3OJLA 4QXOA 2WWVD 5EHQA 1F8GA 1T3LA 2ZRNA 1AKMA 4YDHB 1U1CA 3DZFA 3V1MA 2NV6A 1TCVA 4Z8YA 1OFHA 4N3GA 1KWKA 1X0VA 4Z3KA 3FRIA 3M4NA 1WDWB 3QVLA 4O2AF 1EFVB 4Q00A 2QAGA 3ZX4A 1R4AA 1WAMA 5H02A 2Y1WA 2AMYA 4Q15A 2I6GA 3FI0A 3GYGA 3VKFA 4C2AA 1JHOA 2R751 1T3HA 1SWVA 4NH0A 3CTMA 1N6HA 1VI2A 3ZD8A 4LF8B 2AJTA 1E6UA 2IW3A 3OWHA 4GSLA 4LIPD 1F4VA 1RPNA 2X0KA 3P2JA 1BQEA 1YC5A 2MOKA 3L6UA 3HNPA 2XEXA 3B1WA 3OOJA 4BFTA 3RS2A 4MJ3A 4LNAA 4L2IB 4XWYA 2JEOA 4RX1A 1A9XA 2NV2B 2QUKA 1NM5A 3KYCB 3WI7A 1AQLA 2P1DA 3NHRA 1JVSA 1YS9A 3HCPA 4LF9B 3UO8B 5F98A 1ZSVA 5K4HA 3K5WA 3GEIA 3TIGA 4C6HA 1FFDA 3K6RA 3PPXA 5LA6A 1IZZA 1TM4E 5AVRA 3E5MA 2ZM5A 4ZO6A 3SF0A 4ZI5A 3DVAB 4XM1A 3Q6IA 5KYYA 3HP7A 2ZRKA 2R60A 1I9GA 2BFWA 5A7FA 1T6ZA 1TVCA 1J8DA 1B1AA 2PXCA 1N9GA 2GD0A 3PK0A 5CUQA 2E49A 4LPSA 4A5SA 3WIEA 3EG5A 1SVNA 2DHCA 2VXBA 5IWAB 5CW1A 3DMFA 3U4QA 5DSXA 4B4WA 2EFCB 1SBNE 2WB2A 3EH1A 3S70A 1NN1A 3ZCUA 3ZHSA 2DFNA 2ZAIA 3U4IA 1X7DA 2GB4A 5FYQA 5BMOA 4EA9A 3USES 2FUCA 1E18A 1T5BA 2PS9A 2VNJA 2XQGA 2I91A 5DBHX 3HZZA 1QSGA 4AZTA 3EDOA 3H5RA 3N2LA 4QOJA 3BIFA 3BD9A 4G1EB 5TQ2B 4EVSA 5DW3A 3OI7A 4H77A 4NMWA 4DXDA 4F6RB 1ATZA 4N0EA 2FU5C 1WB4A 1ZL2A 2V6JA 4CCAA 1ZOOA 1DRJA 2ZR9A 1V7ZA 3ET5A 4RD1A 5F7JA 4DNQA 2EC5A 1YMVA 3ENNA 3UUWA 2CDAA 1H3EA 3GJSA 3M8KA 1E7MA 5AO9A 4L9RA 4D9EA 1E89A 1FPQA 4REQB 3QWHA 3NHKA 4RF3A 2JKVA 1V11B 1YKSA 5ITSA 3CUEF 1L4UA 1PYDA 1H4QA 5ALRA 5ETJA 4BNDB 2O8CA 5J3JA 1GADO 3M83A 2GSDA 4PSUA 2QTGA 3U5ZB 3ITKA 5TQVA 3UWSA 1IM8A 4KQIA 3NTXA 1A4UA 4XB2A 1N2SA 2JH3A 4BWVA 3U39A 4CVNA 4BLUA 1YF3A 3IKVA 1NQVA 2PHZA 1EVYA 3FCSB 3MTGA 4ZQFA 5ISMA 1NASA 5F2EA 4DM4A 4F4IA 2FMXA 1GXSA 1N2BA 4PZAA 5IP5A 1CC1S 3W5JA 4R0VA 4E15A 1QHSA 5TNXA 3EHEA 2W42A 4Q03A 2ZB2A 4FFDA 3TZCA 5JD4A 4J4TA 3NV7A 1GGVA 5CIQA 3KKLA 1A5BB 1IXZA 2IKQA 2PAAA 3Q8LA 4TLDA 1O94A 2GEJA 5DBFA 4EGSA 3RU3A 4CMIB 1JJIA 2POQX 2MSNA 2H4YA 2O8FB 2GAAA 1PGOA 2A0FA 4B76A 1MIOB 1S3SA 5EQTA 4DM7A 3FTEA 1VG8A 2O2HA 5KDDA 2DQYA 4Y1EA 3BWMA 1DE0A 2PUTA 3S81A 2W70A 2BFFA 4ARVA 5GM1A 1OLXA