3HYNA

Crystal structure of a putative signal transduction protein (eubrec_0645) from eubacterium rectale atcc 33656 at 1.20 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
186
structure length
186
Chain Sequence
b'YQNANYSAFYVSEPFSESNLGANSTHDFVYYNMLRMWKGEDNSFPFNDAHDKTYNVRDGSDWEKTLKPRLHTRLDNSKNIILFLSSITANSRALREEMNYGIGTKGLPVIVIYPDYDKKSDIVDSNGNFKKQIKDLWDKLPAFRDNMSSVATLHIPCTKSVIISALNNEDFMVNTMADAEKYYYKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative signal transduction protein
publication title Crystal structure of Putative signal transduction protein (YP_002936568.1) from Eubacterium rectale at 1.20 A resolution
rcsb
source organism Eubacterium rectale atcc 33656
molecule tags Signaling protein
total genus 60
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2009-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hynA00
3HYNA
chains in the Genus database with same CATH superfamily
3IUEA 5K8TA 2IGBA 1LI5A 2Q4TA 1NW7A 4WJKB 2QDXA 3ZDZB 4BNDA 4OH1A 2PZFA 4BQIA 1DP4A 4I5DA 1ODFA 2GK7A 4BFXA 1B1AA 1HQKA 2B2CA 3R6GA 2YS7A 4RPGA 4S2EA 1IOVA 3EAFA 1Z2AA 4ZXFA 3FPFA 3WNBA 4BAZA 2OFPA 3ESBA 1RE1A 5AM4A 4BMCA 4YCMA 1US8B 3RYIB 1BE1A 1J6UA 2XJ9A 3TM4A 4EQZA 5LQNA 1OBVA 4QDXA 4ZEWA 2R97A 1NQTA 4DXAA 4RIIA 1KQOA 3FPEA 2PVPA 3H3XA 3G02A 4UZFA 3TXXA 2NG1A 1G291 4OAOA 3VSAA 3DQPA 3KDAA 4I4NA 4REQB 3S5JA 4CG0A 2YL2A 5FPYA 3ETLA 2AYZA 2ZCUA 2ERCA 2ID4A 4NCKA 3VKUA 3WOVA 3FOFC 1Y6GA 3AF1A 5JCXA 4RY8A 5EUCA 3ZIDA 2HCRA 4FFNA 4LSWA 4D5EA 3IP8A 1F5SA 2KSQA 3E2MA 2ZWPA 4CIVA 4EHIA 3E3NA 4CFZA 2G1KA 2I62A 1JIUA 2N1BA 2J3EA 3G9XA 2VSYA 3K1YA 3RS7A 4MI1A 3Q3JB 2HA2A 5GIOE 4X92A 1IZ7A 5J1TB 3E1GA 4Q3OA 4D3XA 4URHA 3DL0A 3BSYA 2XBLA 4FJ2A 1E5DA 2KWIA 4H08A 4D56A 4OX9Y 3LOUA 2ZJBA 2P2YA 2XRFA 3GELA 3WXBA 2JFXA 1YZGA 5BN4A 1OFVA 3KSDO 4QOSA 4RPCA 4GPTA 1MF7A 2W83A 3GVIA 2OK7A 2L2QA 3HKCB 1THGA 1U4SA 1Y3IA 3K9LA 3KG2A 1WB5A 3KVVA 1SO8A 3OO0A 3IXLA 2P6MA 3DAFA 3MQ4A 4JP1A 3ZQUA 1LTKA 4B87A 3KSBC 5KHLB 2C0PA 3ZE0B 2PRIA 2F2TA 3LY9A 2JIPA 4YP9A 3ZVNA 1F0PA 1NUAA 2Q0QA 1NSTA 3H9GA 1KZ7B 1C14A 2FFBA 3FTEA 5H82A 4YV0A 1KRHA 1NBME 1FMTA 1YULA 2A14A 4WNAA 5D01A 3ZIUA 5MFPA 4DLZA 4FFVA 3CR7A 2V9ZA 2OCKA 2GTPA 1G20E 4PYRA 2WNSA 4AZ3B 3G0OA 2E6UX 2R4TA 5IF3A 3DNFA 1FMLA 2JCSA 3UOWA 3OJXA 3AF0A 4IJ5A 5I51A 4XSVA 2BSQA 1CFZA 2AA3A 3EEYA 4A3SA 5C8DA 1Z35A 1TMKA 4C14A 4M3NA 3EGEA 4C7JA 1SPBS 3O31A 4FILA 4KZKA 5EIEA 3KWMA 2D00A 4D9BA 1D6MA 4WL0A 3V32A 3SOPA 5ITZA 1C80A 1ID8A 3TIVA 1ULZA 4ZAFA 1UM9B 1VJ5A 2RHBA 4NDNE 1MEOA 1CQIA 2IUYA 4X20B 2FRDA 5KSYA 1F3LA 1I3CA 2C31A 4QUDA 3F6BX 3AESB 5TS2A 2ORIA 4TYMA 3V4SA 3DTVD 4YS6A 1I4WA 3IKVA 2VHXA 2FZWA 3UN1A 5CGZA 2BGGA 3HXTA 2VRWA 4OHMA 4B3DA 4XCQA 4JI2B 4IH9A 2WSSA 1MQ8B 5C5DA 2XQVA 3VR4D 1PVVA 1JEDA 1TCCA 4BVBA 1A5ZA 5DLPA 4CM9A 1WP4A 5AICA 2X4DA 5EHQA 5KPJA 3RARA 4PYOA 1ZOLA 1VMEA 4PO9A 1DCFA 3PFFA 1WDTA 3E0QA 1ILEA 4FYHA 1E94E 4AMUA 5CB4B 3IQZA 4I5EA 4P80A 1XTIA 4WGGA 5H83A 2WAYA 1EFPB 1V7QA 5I9IA 2EERA 4I8IA 3ZTTA 3JYOA 4R5HA 1IOWA 2ZVDA 5BT9A 4YUYA 5J43A 3HZZA 2FPLA 1PTKA 1V1MA 4PC1A 1BXGB 4XOUA 3TQQA 3VOSA 2XGOA 3KOMA 2PS1A 2AGVA 1ACJA 4BVJA 1RAGA 3R6LA 2GBCA 1NNI1 2D1QA 3KWLA 1TEVA 4DTIA 1EG2A 1M8KA 3N07A 2I67A 4E15A 1UBUS 2ZBGA 2PM8A 1N4AA 4ZD6A 4BJHB 4U00A 2PVCA 3COWA 5EE5B 5CX1A 5EPOA 4MVJM 5LA6F 5FOWA 4JGIA 2WIJA 1XZMA 3NUGA 4JJ7A 3IKLA 5CLHA 1NW6A 3DJFA 4E11A 1Z45A 2PT9A 1TZ2A 2ZIXB 3QUSA 3KM0A 4A1OA 1Y6ZA 2ARKA 4QNMA 2YIDA 1LC0A 4ZI7A 1KAEA 2EX4A 2OXTA 1D4ZA 2HLDD 2IJGX 5KJ6A 5K8LA 3OBBA 2P7HA 2GDJA 4JBIA 2R6GA 1C8VB 1T34A 3HV2A 3T94A 5HKAA 1GLGA 1JDZA 1U3FA 4LPKA 5K0EA 5FOXA 1DRKA 3UC9A 4Z49A 2D0DA 5FBQB 4A10A 5C80A 4V1CI 4L4UA 2I4MA 1LB1B 1NL3A 3BE6A 3LXMA 4NJOA 3EVGA 4QD3A 1WPQA 3SI7A 2CNDA 1OTYA 2XF2A 1E3IA 4MCHA 2XCLA 2Q5EA 3QUTA 4JBNA 4UBIA 1GNSA 3WYDA 4J49A 3QVGB 3U4QB 4HWOA 4RYLA 1XMVA 2KYRA 2Q4EA 3NEAA 4S1VA 2FMKA 5CTJA 2D3WA 4G8JA 3P9YA 4Z9XA 3ILYA 1PUXA 4DTCA 4ZAGA 5GAJA 2XYRA 5L3VA 1NVWQ 4ZIRA 5LC1A 2P6OA 3EVNA 5ITVA 2ANBA 1X7HA 2I4IA 3ZX4A 1N2HA 4EJ6A 2V45A 1HT2E 1E5XA 1RJDA 1H8HD 3E5NA 2HSJA 5DNEA 4X62B 2I6GA 1NVDA 2WVAA 1JNYA 2MOKA 3L9XA 3OBIA 2LKCA 3PFGA 3QLUA 1RYFA 1J00A 3EFBA 4IOKA 5ALRA 1YV9A 1SD1A 3C3DA 3ORQA 4MV8A 2CSUA 3FWKA 4BQSA 2CCJA 3O0DA 1B6TA 3P20A 2FOXA 4HDQB 1CUCA 5CEJA 3QBJA 5FBKA 5JFOA 2EKLA 3VVCA 4K3VA 4BGUA 2WWIA 4QOFA 2CK3A 1QE0A 4Q00A 3GP8A 1SVWA 3G3EA 5AJTA 1Q7TA 5LZ7A 1CQJA 3LLSA 3S2EA 2JAUA 2P77A 3MPOA 3QEJA 1HFWA 1DI0A 2F67A 2E85A 3NTVA 3QXHA 1EWVA 1KE1A 1DRWA 3GLKA 5B3AA 2XWBF 1YDFA 2FFQA 2VF8A 4Y6QA 2X14A 4IVQA 4JX9A 3RSLA 2IP4A 2YXBA 1GQ2A 2Y0PA 1W30A 2IZ0A 4QJ3A 3L0BA 2P9CA 3HYCA 2QD1A 3E5RA 4QDTA 2X9LA 1UBLS 2BAGA 3ROPA 1RXEA 4CT5A 2VHJA 3E4DA 4MTCA 1RJFA 1GV1A 1NBHA 3T3OA 4ZRMA 2Q5LA 2GUGA 3JCZA 3O91A 3W04A 4OD0A 5HCUA 5G1NA 1T0JB 1B00A 5LD2B 4N18A 1NJ1A 5CDFA 4AL4A 1HQYE 2E1PA 1P2SA 4E3WA 1UJ5A 2VKTA 4U2KA 4AUEA 4AJ1A 2W2PA 4UTRA 3K0CA 4M36A 3L2OB 4D4KA 4AD8A 1U1FA 2DULA 2FU5C 1YGPA 3BIWA 4WKCA 2QORA 2ZTSA 3D5TA 1U7WA 2EXXA 4LK3A 1RWBA 2JCVA 2ODPA 3QYAA 2QP9X 4LKOA 2IXEA 3QELB 3KTAB 3BMCB 1C7ZA 2RHGB 1LDEA 2DM6A 2F9MA 4NBLA 4DQLA 4RVOA 3OQBA 2ZRIA 3AY0A 3L4BC 4R2WA 3BTUA 1WU8A 4DWJA 1LSJA 2PRJA 2FSSA 1E89A 4EY4A 3DOJA 4E1BA 3A14A 4K8RB 1GSOA 1P1JA 4MYHA 1AKEA 4NI5A 4WCFC 1CG6A 3ZU2A 1Z0DA 4HHEA 4B76A 4C6TB 4EJSC 1W7AA 3CJQA 1FL9A 2W22A 5TGZA 4HF7A 1NIJA 1JJBA 3QKWA 5K3BA 3ZDRA 1C7JA 2KM1A 2JHAA 3QBTA 3KHKA 4P81A 5FOSA 3N2GB 4N01A 1LDGA 3VR3A 1J5XA 1A0OA 2IUUA 5IT4A 1MT3A 4OXXA 4YJHA 1RVV1 2DT8A 4H59A 4U7PB 3TUJC 4U7DA 3OP4A 2Z4SA 4LSGA 1GVNB 1Y3BE 4IMJB 2ZIGA 4N12A 3I2YX 2FPPB 3PNMA 1WV0A 1R00A 2ATEA 5DEIA 4Y9DA 1HZJA 4ZJPA 2YICA 2YYSA 1RKQA 1E4YA 2HV9A 3O47A 3WIOA 3NRJA 2H5EA 3B2EA 3ESRA 1K3UB 4TTTS 4MR7A 1YB7A 2FR8A 5G4LA 4HVLA 5K2OA 4MX8A 4W7HA 3PEUA 3WWCA 3N86A 4GKKB 4D8WA 1K89A 2BGIA 2IXFA 2QMEA 2QYTA 2YXEA 2FW8A 3AP1A 3BMQB 16PKA 3G0DA 3KD3A 2NT3A 4JCCA 3VH4A 1K4KA 4F6CA 5K01A 2GM4A 2FMIA 2IGTA 3ZCVA 3M6AA 2IYTA 4EAQA 1QGZA 2O6LA 3V2HA 2AMJA 4LSZA 1MG5A 4N0EA 5DYTA 4UTXA 3G1UA 3PTZA 3NETA 3PP8A 3PT9A 4JU9A 5B1HA 4LDQA 5A3VA 1VL6A 1V5IA 4G5QA 2MR6A 2C29D 3FPSA 4LNUB 1RPAA 2QK4A 2Q4DA 2AJ8A 3OPYB 4Z0PA 2J30A 3FLEA 3DEFA 2PWYA 3PGVA 2QN9A 2EJWA 4LWZA 3DWEX 3SMQA 4GOXA 2ATCA 1D8AA 1NOIA 4DIUA 4L3VA 5IT5A 1TF2A 3MS4A 1B76A 4UAUA 3WSWA 1L0BA 3AC0A 4J0KA 4NZMA 4KE6A 2AXEA 2QJTA 3OIGA 2DFKB 4Q66C 1Z73A 3SICE 4KYTA 1CKEA 5B7PA 4OM7A 2AQKA 1TQ2A 4ZI7F 4GX0A 3ZDXB 4PYLA 4BWFB 1HE4A 1AS3A 3HGQA 1E1CB 1H2BA 1PJ8A 2BGRA 5CIWA 5CURA 3VR2A 3ZBPA 4S0XA 2D2FA 1K5PA 3LPDA 2XYQA 4I1SA 5HHTA 3SOZA 4B6EA 4YR9A 2JGLA 2IUEA 6AT1A 2JVKA 1ZD2P 3OQIA 5AHKA 3GFQA 4M1YA 3MHPA 4UNSA 5FFFA 4M0FA 3VYWA 1SBIA 2WJ3A 2QZZA 4L5IA 3SQLA 1MC8A 2WOJA 2X3UA 4Z2YA 3OIWA 5GM2A 4LY6A 5BR4A 4TSKA 1P9WA 5C35A 2C2WA 5DGIA 3ZUGA 2WUVA 4RJKA 3NTUA 1RQPA 3A6FA 4ZYWA 2W8BA 5L40A 5JCJD 5EQJB 1K97A 2QB5A 3NTOA 2VP3A 5EGSA 2FE4A 4DIMA 1E2UA 1UUFA 3C7KA 5C3UA 1C1HA 3IDOA 4CEHB 1Q17A 4X97A 5KEIA 5BR8B 2AIRA 1H1TA 1PQPA 1R9MA 2FUG1 4XXHA 2HWXA 1P2FA 5D86A 5FI0B 3C6ZA 3R7NA 2QP4A 2GYUA 3DD1A 3KZCA 2Z3VA 4AZTA 3ZJVA 3H5LA 4AKGA 1TIBA 3PF9A 5DVZA 4WK4B 1PN3A 2Y1WA 4CG3A 3BMOB 1MAVA 5DLQC 3WB2A 2O0LA 1VPLA 2IVZA 1SH7A 2R96A 2RBGA 2WSMA 3NNNA 4ZMBA 1XXHE 5IBPA 1QU3A 3JYNA 4CODB 1KI3A 2WA2A 3KTDA 4L0CA 4PV7A 1PYOA 1XDGA 4TQGA 5JSZB 4WA7A 3EMVA 3N8NA 3L8DA 4FN4A 5AW5A 2J32A 3N7TA 1USWA 1U8CB 3K0AA 3SHQA 3WMGA 4ANFA 4DLNA 5DHPA 1CR2A 2OT3B 1UFOA 4TTQA 2BMDA 1P0MA 1CT9A 3FUWA 3L41A 3AEYA 5GOZA 2GZSA 3PUIA 2W93A 3VU9A 1EJBA 2O3JA 2X23A 3TCXB 4LSMA 4AURA 3QSYA 3LY5A 1Z5OA 2XQKA 4POOA 1ZWKA 3H99A 1N0HA 1HV8A 1YVPA 2P3OA 3KOUA 1G8HA 5CA0B 3KZ1E 1IWPB 4UHFA 1N2JA 2BBSA 3CW2A 3HCNA 4ENUA 1WPXA 1A9PA 1BFUA 1R6UA 4PBSA 3UGQA 2XPCA 3NJRA 2PXXA 4DLAA 2HA6A 4I9GA 5BSWA 2ZQ5A 1PEDA 3BBPA 4LEIA 4NVRA 1GN9A 2WTMA 3OZRA 4ZAWA 3T5BA 4G0VA 4DV7B 4EKDA 3HO1A 3AG6A 3F98A 3N8GA 1N2EA 1DDOA 1XXLA 2DPGA 1S2IA 4O29A 1H3FA 5ALLA 3BGOS 3UMGA 4EYKA 1OB5A 1XDBA 1T13A 5FL3A 3UKOA 4I55B 2ZXFA 3AVTA 1CIPA 4TQAA 5AXCA 4XFKA 2ZQZA 3I0ZA 1G6Q1 1MZPA 3DMTA 4RXTA 1SBHA 1F51E 2DFVA 4KQMA 4L22A 5BN1A 3M1LA 1W0KA 2PY6A 2HJVA 3FA2A 1NG9A 1Z82A 2CY0A 2C92A 2FLWA 2AHRA 2C84A 2QLMA 1K7EB 1J06A 2HLPA 3G2OA 3ABRB 4PZ9A 4MWZA 1TD1A 3UK1A 1EVJA 2C0CA 2ZRGA 1M6NA 2ZRHA 4PX5A 3PXAA 2XDQA 1E1QA 2VP5A 2ZYRA 5BWOA 2QBYB 1G9TA 2LD4A 2QVBA 1QHIA 1NM5C 1B1CA 2O3SA 2Y99A 3DBVO 3HZHA 2ZCVA 1A82A 2YIVX 3TEJA 2VJMB 3TR0A 3M3HA 4FSHA 3C6BA 4R1NA 5JSUA 1WXEA 4OHZA 3VOAA 3T1HB 2NPFA 2C5HA 4KK4A 5JHGB 1CW2B 5GONB 3LY7A 3EPLA 2BFBA 2FWJA 3HZOA 4OI1A 2UUCB 3S2YA 4EL0A 2IPNA 1ESEA 3KIPA 5CP8A 1S2OA 4P3YA 3RLIA 5LN1A 2K7FA 4J3JA 1UXJA 4LG1A 5BUCA 1T2AA 4G1EB 3S55A 6REQA 4JN6B 1F48A 4AXBA 3P96A 3IVRA 1Z8NA 1YBVA 1MX3A 2XT9A 1RACA 3U81A 4BMDA 2J9FB 5C46F 1FFEA 2A5GA 2VT2A 4K86A 4RZXA 1ISFA 4RK5A 3ROZA 4RTRA 3JD4A 3NIBA 5EWLB 4ZYXA 1TX4B 1YQGA 1QWSA 5JMPA 3RU2A 3GLUA 3NAQA 1I4EB 1L7MA 3DLIA 1MENA 4JKOA 2Y1DA 1DX6A 1NQUA 3FX2A 3R4CA 4RABA 5JDIC 3NH6A 3PUWA 5C0OE 4MVWA 2JD2A 4X3OA 4BPRA 4W8GA 1FX0A 3NCHA 1PL0A 5EMLA 2PEYA 4HPXB 1KDZA 4DJAA 5KMGA 3VR5A 2BN4A 3QOXA 2JD1A 3B3QA 4DEYA 3HL0A 2IBTA 2AE1A 2NUBA 1A4XA 2XBUA 5JQGA 1DC8A 1P18A 3DAYA 1MVOA 3RQIA 1O95C 4DWVA 3UQZA 3EDMA 4MLZA 2ZP1A 5CFNA 2JGNA 3CJRA 2QF7A 5KTYA 2D2EA 1VBKA 4PGGA 3QFCA 1TCVA 2P1ZA 3EASA 2PS0A 3K8OE 4QEDA 1DE0A 4W82A 3UBMA 2IW1A 3KVOA 2QUBA 4D9CA 4OQMA 5CLJA 1USVA 3WIVA 1H2RS 4QEZA 4KO4S 1WBDA 4KO3S 5EKSA 1JHQA 3O94A 1XVUA 4LMPA 3DA8A 5ETJA 1QSGA 1Z83A 7GPBA 5C52B 4HCJA 3J80A 1WUKS 4M53A 1W5FA 2CVPA 4HDCA 4AYXA 5AM2A 4TTSA 2W90A 4LOJA 1TYCA 2EJBA 4JC8A 4BGEA 3BIOA 3DTVB 4B7AA 1JWLA 3B13B 4AO8A 3C43A 4YCSA 4LJ9A 4FQ8A 3TXAA 4CF6A 1P6XA 5HF5A 3L1VA 5K8VA 2A9VA 4FIZA 3GP5A 2KBEA 5TR9A 1JYEA 2G4VA 1F2TB 5KJEA 1XZAA 3MSXA 1TU0A 3RAJA 1ZD8A 1VGQA 4O2LA 1QG4A 4HYQA 4D4IA 2C7GA 2RC6A 4CLDA 2OGWA 1V2GA 3LC0A 4HRVA 2XGGA 4H3HB 3ZDDA 5KSZA 3D6AA 3RIXA 4OXQA 3WDSA 2RHTA 1MFZA 1K7SN 2IYVA 4P58A 1EWTA 2EFHB 2ZW9A 3IQEA 4K9KA 4GNRA 1PDOA 4A2PA 1QFXA 2FPRA 2C4TA 2JK0A 2P9GA 2QIOA 1JWAB 2EFYA 4XGKA 4XDZA 1AHPA 4ZCMA 3PD1A 4MICA 1DKQA 3F6YA 5EAIA 1U9IC 4EEXA 1AUOA 2PPLA 1W25A 1ZJZA 4B45A 4X63A 2B20A 2C9DA 1RKBA 3RR2A 2WV7A 1QIKA 1O97D 4ZYTA 4BX3A 1A98A 1IU9A 1TJNA 1M6YA 5CG1A 3E7XA 2WKQA 3L4KA 3EIUA 1Z6AA 1TKRA 2H0AA 3FZQA 4JQSA 1PJZA 1ISRA 1JNXX 2I54A 3AETA 3NHYA 5LZ2A 1WW3A 3IOBA 1GADO 3P27A 2WD7A 1E69A 1K2VN 1WSAA 2ALJA 3HPQA 1TM5E 2B1QA 4KRXA 4TKMA 3RKUA 1J97A 4B3JA 3HJRA 4E4YA 2XB2A 5KQSA 5B4VA 1WX1A 5DP1A 3KOYA 1Z39A 2FZCA 1FDRA 3H7AA 2JVJA 5FFMA 2VXBA 3MWFA 1CRZA 4JT2A 2W2TA 3WX0A 4C0LA 6YASA 1QYVA 1YRBA 3HB0A 3TSAA 1HEIA 2OXIA 1C3EA 4BQOA 4Y9RA 3FRJA 3QMMA 5DGXA 2PFGA 3IV9A 3GFVA 3TPZA 4YMSA 1I24A 2J6CA 1JLMA 5F9FA 1AGPA 4P38A 3LF2A 4KRGA 5AR1A 4TSRA 4RKQA 1TPZA 4ARZB 1FK8A 3AVQA 4W1RA 4Z53A 1LX7A 1WZUA 5ALNA 1P9LA 3CN9A 2NUAB 1YKGA 2RHLA 4LWPA 1BHJA 3WGJA 4PG4A 3ZKWB 1AKNA 2RHMA 3OZUA 2B34A 4JS0A 4IIUA 2IYPA 1ZGJA 5IK2A 2Q5JA 3PRJA 5FXMA 4MDHA 4OJMX 2PZKA 2WP0A 3M5DA 3NM6B 5HKLA 9GPBA 1I1QB 1WF3A 2PH1A 2QM8A 5AJUA 4GU5A 3FCXA 2VBIA 3JU3A 4R2JA 4BJ3A 3AM3A 5TGDA 3CONA 1CEXA 3TNYA 4YIHA 1JXAA 4E22A 3LC7O 3A26A 3ULKA 1Y89A 5ITSA 2XX3A 1DZ3A 1J90A 1QIJA 2YIMA 3ICVA 3HVUA 4K88A 1L5SA 4MA0A 1NNLA 1XQXA 2H48A 1QRAA 2ZAOA 1PR5A 1RABA 2FR1A 2ASVA 3CCBA 2OECA 3OQHA 1SOMA 3N2ZB 4H7JA 5DO9A 5ER9A 5IABA 4MJLA 2V0GA 1MTZA 3FYUB 1A8PA 3CMMA 1P3JA 3N5KA 3ZGLA 3QQ5A 1NWCA 1IUKA 2AMLA 1M67A 4BX9A 1RWOA 1LXCA 1FSPA 3GK3A 1F0NA 4JLNA 3B85A 1E92A 2JF0A 4PWYA 4DA0A 1M6HA 1V3TA 2BH9A 4ON9A 1VL5A 4K9OA 1Y81A 1KK1A 3HJGA 1R4AA 4Z99A 3AL0C 3FYHA 3MRSA 3RUIA 3OTWA 1PG2A 2P9YA 2W4QA 4JP3A 4H0FA 2JZNA 1GQRA 3KJHA 1RFLA 1TT7A 1WCIB 4EA9A 4RGYA 1N3IA 5JNWA 2WK1A 4UMEA 1EH5A 3A2KA 3VDRA 8OHMA 1B6GA 1Y8RA 5ES3A 1AQNA 3RKRA 3GDHA 3IKMB 2XV1A 3MBKA 3BK2A 4KK3A 1C9MA 4F7DA 3MFQA 5GIPE 2I9KA 2IY7A 1D1PA 3H1GA 4AJHA 4EFDA 2LNDA 2NW6A 2V7WA 1R0CA 3A1FA 1KP3A 2JEOA 2FUKA 3P0HA 5JQGF 2WU3A 3KC2A 5JCOC 4R31A 3AR9A 1YRWA 3WIUA 1RLOA 1AH2A 4EARA 3CC8A 1Z08A 3CVOA 3RKSA 3EXIB 2COEA 3LWBA 1T1RA 4JU8A 1G0OA 1H69A 3GXOA 3STUA 1BOFA 2H8KA 3EYWA 5H9VA 4CTOA 4GC5A 3HUDA 2X4GA 5EE9A 3CSUA 3MRXA 4CKBB 3TS1A 2SECE 2IBSA 2AJBA 1MQAA 4GGMX 4ND7A 3L7LA 3SG0A 1HI9A 1JJFA 3GRUA 3QBDA 4N3NA 4DLLA 2GVNA 2QXUA 3IQWA 4Q3AA 3W2TA 1HE2A 2E2WA 4MEBA 4Q4HA 3VOTA 1PGNA 3QMPA 1L7QA 3AUYA 3EZFA 1DPFA 3MJEA 4KPUB 5CT4A 5HG0A 4DPLA 3I3SR 4ED9A 3DFIA 5AXBA 5F12A 5EJ5A 1X14A 4W5HA 4G09A 4I4CA 2IHYA 4RV4A 1W88B 1C0KA 4TZ0A 1I01A 2XW6A 2ZE8A 3NV9A 3QTLA 2HMSA 2P5YA 3HLTA 1TUBB 4F93B 2GFIA 2R3SA 1JA1A 4NK4A 1CUWA 4HOYA 1QMPA 4YRSA 4YUXA 3D2AA 1Y5MA 4KVGA 3INTA 4LQ4A 1MRSA 1FOEB 1T2EA 1DEOA 5FYQA 2XODA 4A2CA 3HHPA 1ECBA 2YASA 1EXVA 1AQ6A 1M2HA 3VPSA 4RV5A 3K6SA 3BDAA 5DM60 3OM0A 3DDWA 1DOAA 1A8QA 2B7BA 3BMNB 5EZ5A 2O4UX 3GRRA 1XA0A 2GN0A 3DLTA 3IBSA 3SKYA 3K35A 3JZIA 1VJRA 1UJ6A 2AD5A 1KE2A 1X1BA 4RF2A 3TZQA 3MRVA 4LFBB 2R11A 3CX4A 1X94A 5E7MA 2Q8QA 3MWYW 4M37A 4OQFA 4YAOA 2R8PA 3TBFA 4JI4B 3RVMA 3V8MA 4W5TA 5AIAA 2P78A 2GLUA 5DT9A 1YE5A 5AKEA 3QNMA 2A78A 2GXSA 3KXIA 2H18A 1DKLA 1CUEA 1KU0A 4IH1A 4EITA 4IYJA 3TZEA 5IVHA 1TAHA 2GTIA 5CJPA 3ROQA 2Y2UA 1NVEA 4QFMA 2P27A 1I30A 2XITA 2JFPA 2XOEA 4FFOA 7MDHA 4GDFA 3KVRA 2G1JA 1MT0A 3BSFA 3K1ZA 4PCUA 4FZRA 4WEQA 2JAPA 3GPIA 3VNQA 2VJBA 1R66A 3QVSA 3FKSA 4XR4A 2ZSJA 4UREA 4RTQA 2F1RA 1O1YA 3T9BA 3TOSA 2AX3A 2X8JA 3N0VA 1ZAKA 2TMKA 5IFKA 3REQA 1QH0A 2QT0A 1EJ0A 3HBLA 1E4EA 5L95A 4FYKA 2EFCB 3L40A 3QXGA 4YT5A 5H1YA 2XADA 5AHOA 4DR5B 3PDJA 2XMGA 3HYRA 2AEFA 3MXTA 1M7GA 4GOKA 1Y6FA 3A05A 4DR3B 2XDYA 2BEVB 2IYEA 1GVHA 4ZEMA 2XCRB 1JG6A 3OJLA 4LXYA 4C08A 1T25A 1U3CA 4M7WA 3VVBA 1E2BA 1DMRA 3DE6X 4FEAA 4IDQA 1PT9A 1TFRA 3GEPA 2WSBA 5CK5A 1HG1A 3RU7A 4E5SA 1WUTA 2N1MA 5JSKA 4KN8A 4CLOA 5HSGA 2W2XA 1J9EA 5FBHA 1HZZC 2NZ2A 5AESA 5CDSA 1T0PA 2JI6A 3BILA 3IJPA 3CZ5A 5DXFA 3FZGA 2F3QA 4FZJA 5L4NA 1DC5A 1QS0B 5EUBA 3M3PA 2ZBVA 1VE6A 1SBNE 5KHOC 5J5CA 2I4TA 4HDNB 3S68A 3H8JA 1EDOA 4KQ2A 1T0UA 1Z0SA 1TF7A 1QVVA 1YZ3A 3HDGA 4PXAA 2DC1A 3WNVA 4BNZA 2X1LA 1XRQA 1J0CA 1OJLA 1XCJA 3IOYA 1II9A 1AUXA 4C0QC 1KO4A 4XGNA 1A71A 1BEEA 3JQ7B 3KKPA 4EIWA 4YCCA 2BR4A 3R3VA 5IJWA 3EAQA 3V34A 2YX1A 3KT3A 2F3RA 2H1SA 2G4CA 4CQNA 2VF4X 1LCIA 2GZAA 3F9CA 3ENKA 2OM6A 1VZ3A 3CZCA 5C53B 1H4TA 1I6LA 3UKJA 1XROA 4IFEA 2NU7B 1ENOA 4PY2A 4L0QA 5B6PA 1KZ1A 2XCOA 4LZAA 1HT3A 5CFLA 5P21A 3Q3IA 4UM7A 1A5BB 2JGEA 1F8GA 4F56A 3PL1A 4PINA 5CNKA 1UFKA 2Z8YM 2KLBA 1RJEA 3CU5A 3I9OA 3H5OA 3E7DA 5B1EA 4MLPA 4YI5A 1XQ9A 1Y9ZA 1RI3A 2XDAA 3NI2A 3IULA 1GCIA 3IMEA 2J0UA 3IEIA 3OJFA 5J9FA 3C3PA 1HBJA 4JR0A 3VKHA 5JDCA 4D6YA 1IQRA 2C9ZA 5FO1A 1U2GA 4U9IS 1GGHA 3NC1C 4PLYA 3R9KA 3KUUA 4A03A 4BBAA 4E33A 4EO7A 3LRPA 5JVDA 4CTKA 1IOLA 1NNUA 2C4WA 3CZMA 4JEMA 4RA6A 1J2RA 4C01A 4EOGA 1O6CA 3ZE9A 4GIBA 3SNHA 3KAJA 5IVKA 1YQEA 4ETIA 1JPVA 1SBZA 1VKHA 2EFGA 3DGFC 3G5AA 4MVXA 5IM4A 1IVYA 1DAFA 3KLPX 4EY3A 1FFYA 1H22A 4G63A 1VGRA 1F9EA 3W3AD 4PZYA 2J6BA 3A31A 4M1EA 1V6SA 4FFBB 2UV8A 1P39A 1QWOA 4WNIA 1TAUA 3NGXA 2VDVE 3JS5A 3PHLA 4JAVC 4L9SA 3PXEA 2IX3A 1G60A 1NW8A 2FG5A 2ZE5A 2W6MA 1GAQA 1L7OA 4HUJA 5DYGA 1UODA 3KJNA 4N3GA 3U1BA 3A27A 3UYLA 2X22A 2G36A 5DIZA 2RCYA 1MOSA 1MQSA 1OT5A 5TSDA 4AY4A 2BFEB 1PVOA 2BIFA 3GFGA 3VSEA 1IG0A 1NI4A 4BNWA 1CEEA 4N7BA 4AF6A 1VMIA 2C96A 4TV8A 3GVHA 3VJMA 1T9AA 4NENA 4JVSB 4NHOA 1CLEA 1M74A 4TTIA 5KYVA 2ZPAA 1S9DA 2G5GX 4YRJA 1OR8A 3R3WA 2APJA 5G4KA 4N7RA 2C54A 2R68A 3JXEA 5EOVA 3O92A 2GYYA 5DDIP 1BS9A 1KBOA 2FPUA 4WKBA 2BTQA 3DHWC 5IN4A 4M0UA 1J2TA 1PLJA 2B1GA 4G0YA 3FOWA 4N3AA 4Y2RA 5EHXA 2O48X 1AKQA 1Z88A 3PQCA 3TTSA 4C76A 1DJMA 2XQJA 4JLBA 4G5GA 5HFAA 3ITNA 1FTGA 1K7XB 3ZD7A 1WBJB 2F3UA 3DMYA 4F92B 3NDBB 1QTQA 1EAYA 5C5IA 3R40A 4IGFA 4XPIB 3PK0A 4CM6A 3G59A 2CXTA 4MPDA 4C03A 4W1QA 5HM6A 1QC5B 4UKDA 2VPZA 3ILSA 3W0LB 5IH7A 2Z5VA 4HMOA 3ICQB 3QU7A 4NZNA 4CM5A 2ADFA 3W8DA 3T9DA 4DANA 1KMHA 3M4NA 3HGMA 4DT1B 1O8CA 2VDMB 3PSAA 5IAOA 3B70A 2SKEA 3IIKA 3GGSA 1ZI9A 4EG4A 5HUJA 1ONSA 1RMQA 5B12A 4OGKA 2B25A 3GPBA 4EL5A 5LU9A 1O4WA 1D6SA 1M1YA 1N75A 3CPSA 4U9HS 2ZYTX 2J3QA 3LQKA 4G2NA 1C30B 3QVTA 3CVUA 4MP8A 5FOQA 3UTDA 5IDVA 3SC6A 2Z9DA 4AYTA 3TTWA 1RQNA 2CLKB 2QPTA 4ZI5A 3N05A 2GEFA 5ADHA 4G56A 5I4BA 2DH6A 3DMNA 4QQFA 3U4MA 1FS5A 3QLJA 1LJ8A 1ZXBA 4W63A 4COOA 1HT1E 4E4TA 1M7BA 1TYZA 2Y9PB 4Q19A 1RNLA 1X8JA 2DSNA 3WAJA 3KDSE 1ZW6A 4A8HA 4XQ9A 5HDQA 2X9VA 3T9AA 4CQJA 1OWPA 3LZ6A 3TVTA 3V8VA 1A9TA 1IQ0A 4JI6B 4LQCA 5JALA 5BN3A 3DUFB 1NKTA 2HJRA 4J03A 5BR7A 3MT0A 3UWOA 4ZVTA 3MJRA 3NGLA 3RJ5A 1YH3A 3TTVA 2J07A 1R6TA 4G4GA 1MJGA 2ZFUA 4FYJA 2VDLB 2E87A 2HUPA 3AF5A 4TL6A 5AW8A 2Z5FA 4XLLA 4R69A 4W5OA 3B5JA 1RKVA 1PS0A 1YAHA 3VNRA 4NFYA 1U81A 5DK4A 4QTYA 1XJ5A 5HIIA 5JNSA 2BJWA 2FSHA 4CMEA 1QHHA 1V9CA 3BJRA 5A3SA 4ENRA 1KOFA 4NXMB 1P2VA 2OGUA 2HC9A 2IPXA 2VHVA 2WG0A 3T35A 3AU8A 2ZM6B 5IJ0A 9MHTA 3KWJA 5D3MA 4BQQA 2YC2C 1R88A 2O06A 4IRUB 5JYEA 3F7TA 4EP1A 4F4UA 1SHJA 1VPTA 2A0WA 1CZOA 2WYWA 2XCQA 5ALYA 4A91A 5HK9A 4GRDA 1IDN1 2CUZA 1JV2B 2ON6A 2ZJ1A 5THKA 1DHTA 4NYIQ 4QHYA 4AXXA 1XNJA 1HTWA 1XTTA 1CBUA 2IDJA 3EUEA 4DAOA 1JEAA 3V4VB 2YWBA 3RC9A 4AQ7A 1TL7C 3WKBA 4V1CA 2VQ3A 4CM4A 3V48A 1QG0A 2JIZD 5LXTB 2WJZB 5TDHA 3T5CA 3EX7C 4JHXA 3CSDA 2QI9F 1XZBA 3SKXA 4NBKA 1O89A 4IIJA 2I03A 2UYQA 3JQFC 4GKJB 3GU3A 3TK1A 3TN7A 1U7ZA 1T0BA 4I1OA 4MQ6A 5A4IS 5FNVB 1NUUA 3KQTA 4FSDA 1QYCA 3DBHB 4YCBA 1VQ1A 2ZPTX 1HEYA 3WGUA 2QT1A 1IDOA 2PZGA 2Q1XA 5BW5A 1W6UA 4QUEA 1POXA 4J43A 2WKSA 3EHDA 1CD5A 5CAEA 4ZOCA 3MTQA 1BS1A 4G1FA 5JNRA 1WY5A 4LXQA 4QPDA 2YR0A 3VMFA 4BRZA 3JQRA 3HKDA 5JVDF 2UUBB 3HI4A 4Z4IA 4JBLA 5AFSA 3QU5A 2MSEB 1MDBA 1GITA 1PWZA 4DYVA 5FEUA 2D3TA 3Q5DA 4EMSA 4TYWA 3D1LA 5IM4F 3I83A 5ESDA 4KDFA 5DTIA 4Z8XA 1Y48E 3WHPA 5HIAA 4ZOAA 3RC3A 3MTGA 1Y4DE 1JFFA 4JNKA 5DN9A 5DU2A 3VHXA 1QNLA 3BG5A 5K0BA 3LCUA 4G81A 1BW9B 1NLFA 1VSUA 2FKNA 4RKRA 1U02A 4HRAA 3BX1A 3KQUA 3KYBA 4WN9A 2EW2A 2H1VA 4B6PA 2RJNA 3H19A 3G5MA 4B7CA 2ZU0C 2JJYA 3QVOA 4O4JB 3TRHA 3PR1A 1QE5A 4ZT4A 5BV8A 1SXJE 1YJQA 3A10A 1GAWA 3KP1A 2OBBA 2O2ZA 1E2GA 4Q3LA 1HURA 2LTAA 2GKSA 3GT3A 4KVFA 4MQ4A 2QNRA 4S24A 5E9WA 4ILEA 4M60A 4WESB 4MV0A 1FP1D 4MVYA 4MIKA 3V9PA 2I2FA 3W4KA 5L3SA 1JZSA 3JQ9C 1CQZA 2G82A 4H3KB 4TV8F 3MCUA 4DE5A 3T54A 3QEMA 3TPFA 4DUGD 3VGJA 3MTBA 4F46A 1Z8DA 3GUCA 3MGBA 2Q6IA 1X7DA 1N2BA 3SSNA 2YNMC 3IBTA 1AO3A 3FFXA 1P4SA 4P7GA 3GVCA 3FOEC 1OH5A 5UKDA 4FXPA 3FTFA 2J46A 5DM0A 3JD3A 2AHOA 2BGKA 3DE7X 2TMDA 3AUXA 2V7EA 2PBFA 4FNMA 1GCOA 3HSSA 4QLAA 4EYEA 1K5DA 1TE2A 4PHFA 5AK5A 3ONWA 2AC2A 3IIMA 4O4IB 3DPUA 4OHPA 5ELLA 4HAXA 5T41A 2G8NA 3K3PA 4LYDA 2VSFA 3C3BA 1M1NB 3IDQA 3MGKA 4AJEA 5T4HA 1SULA 1Z34A 4J90A 5CDHA 1QKKA 3PNBA 4MIEA 4US1R 2P9FA 5FBVB 3SJZA 3BPSA 3TDKA 4KYIB 4EJFA 1J8VA 1UQUA 4HK4A 2JARA 4AI6A 1PBNA 3OZAA 4PIMA 4LF4B 3COSA 1FDOA 2H06A 2Y2VA 4BO8A 1CC1S 4DA6A 2P30A 4J76A 4DQUA 2KX7A 1GPDG 1NMSA 4NYMR 4XX0A 4HNRA 2ODEA 3UMCA 1MHTA 2Q4OA 4F84A 2ZRNA 1ZICA 1F0YA 1FFWA 1KRXA 2DBZA 3SJCA 1RHUA 1PCXA 2XVZA 4DR6B 3HA5A 4XB6B 4FFWA 4BNLA 2QX6A 3G2MA 5T57A 2JW5A 2ZJ6A 2OSVA 2J0QA 4ESHA 4FUQA 4B0PA 4W9NC 2P2NA 2QTGA 1FUUA 1EQAA 3ZYCA 2LGJA 2QS9A 2WUFA 5F4ZA 4YPFA 1XMQB 2QEQA 4Q9JA 3CBGA 1VCOA 3HB5X 5HDBB 5FWYA 5JXHA 2H3EA 2P40A 3KPVA 3Q6IA 3LPCA 3WHLA 3K0SA 5IG2A 4KPEC 5KNDD 2ZDGA 2ZUFA 4GT1A 3HMQA 1V5FA 1XEWY 3I09A 3MNFA 4BO3A 5K8UA 5KINB 3CWZA 2CLHB 1JVBA 2ILVA 3ZCQA 1RKXA 2L18A 1HEUA 5CVCA 2VA9A 5CBKA 4PICA 1DIRA 2Q6VA 2WJGA 2ZR0A 3EZGA 3R4VA 1Q0UA 2CBZA 3I9JA 5IJ9A 4YO8A 5FCDA 5ECWA 2A5LA 4L50A 4IO0A 4QOGA 2BE9A 5BNFA 2C2YA 3VVLA 3H2GA 4EG5A 1P4GA 1Y1LA 3UEOA 5BXYA 2AXQA 1C9EA 1SUIA 3SZUA 1YIDA 5FI3A 4OGWA 5EZSA 1A4IA 2FK8A 5BNTA 4E5KA 4MZXA 5EJ8A 3I9V1 3ETGA 3HYLA 5JD4A 4QDKA 1FQJA 3VKVA 1F1BA 2WIKA 3DF7A 3EC7A 4JVMA 3TQCA 1J70A 3AEKB 4UBLA 1PDWA 1PEAA 3OCWA 5CNIA 1OBHA 1FNBA 1QR2A 5TLSA 3JQGB 1H4SA 1JEQA 3FPBA 2VCHA 3GLIA 2AN5A 3BFXA 4JUBA 4GC9A 4PG5A 2E37A 2PUVA 3MAJA 3VNSA 1W36D 2ZYIA 3I2HA 4G5HA 1SU8A 2GJSA 4KXNA 1Q1ZA 2H4ZA 1L7DA 2GJ4A 4RKWA 1Q15A 1JBQA 1JDBC 3MWEB 4GSLA 1IXYA 4Q01A 1CR0A 1V95A 1D2GA 2FW0A 3TKYA 1P61B 5ULLA 4G4JA 2EIHA 2VCEA 5AVVA 2J4CA 3PHHA 1REQB 1L3CA 1IM5A 1SFRA 2IDMA 4NSNA 5LZ5A 4DV6B 1QRSA 1ZUD1 4IIJF 1VLJA 4OIMA 1WVMA 4LHEA 2LWIA 4P4SA 5BN5A 4NNPA 3LT1A 4O4LA 4J3NA 1NIPA 3WDKA 4M6WB 1BGXT 2R9VA 4Z3KA 1NKSA 3MWDB 2CXNA 4Y2SA 4CLRB 4EDHA 1H0RA 2HO4A 2PHZA 2P9HA 3AHGA 4TMTA 5C4MA 3DWGA 3W4IA 1GGMA 3D1VA 3LFHA 1JLHA 1G2IA 1J25A 1N0IA 2P11A 2XLCA 2ZSUA 4QU5A 3OLXA 4RENA 1OE0A 5JTUA 5CD1A 4RNCA 4D99A 4OHYA 1JSRA 3FUXA 4OUDB 2QRNA 5FKJA 1RHQA 2C4UA 3WLTA 3A6PC 4YASA 3ZNOA 1AQJA 1EDEA 3H5NA 1PFGA 2OD2A 2IF0A 5CLLA 5SZHB 1ZR4A 5D8DA 1N2CB 3GDOA 3LD9A 3A9SA 2HJ9A 1MVLA 2ACKA 1GCUA 2K5UA 4EA6A 4CHTA 1ECCA 2WHPA 3JPYA 4NF2A 4RULA 4RESA 4CYMA 3TG2A 1O2DA 1X39A 2JGDA 1QTNA 3TFQA 4HSGA 1U2TA 3PC2A 4CKYA 4ES6A 4AT1A 3M2PA 4YJ3A 3S70A 4GMGA 3F8SA 3LCCA 1SBYA 1X70A 4UOQA 3HJBA 3KLBA 3WIDA 3PHGA 3N2LA 2XE4A 1QLHA 2R6R1 3JX9A 3TSOA 4GL2A 2IKQA 3IUPA 2QRJA 3KS9A 3QFFA 4BFCA 1VLLA 1Z5ZA 2OHXA 1SUFA 1U04A 3O1IC 4X71A 5FH9A 2JLXA 4NJEB 3EA0A 3FFWA 1XYVA 2JEYA 4US0R 2CWDA 2FZ4A 3MRTA 5E1OA 3SJ7A 1AV7A 3RFFA 4F06A 2YRWA 4W9RA 3IEPA 2IE8A 2RH8A 3FSGD 3PWKA 3W6NA 1OLXB 3VU3A 1T8WA 1KAHA 4XDYA 1JB1A 1XMIA 2HHCA 3CKMA 2PMEA 4QXPA 2L69A 3OQ6A 3P4XA 2HD4A 3GQBA 4MB6A 4WCVA 5KQMA 2FFJA 3KE9A 1GL3A 1K66A 2W2OA 3GZNB 4R9UC 4EGSA 5KUTA 2OE2A 4IR7A 3QVWA 4PPNA 2ZRFA 3CF2A 4RH1A 4PFSA 3O9VA 4WK2B 3KD2A 2NTJA 4RVSA 1U90A 3DBLA 2XNKA 3TRFA 3A2MA 2FVXA 4KR7A 3R9WA 2AFHB 2P2GA 1GN8A 2Z58A 5JISA 2C2ZA 3BZUA 2W2KA 4KTVE 4XVRA 3THWA 4ZHQA 5TPZD 1EVLA 3OLCX 2CJWA 1TZCA 4L5YA 4OFZA 1RAAA 2WV9A 2GZ2A 2IEBA 3SXPA 5LMCA 3RS0A 4BGIA 5ALKA 3WL3A 4PW0A 3BF8A 3PWSA 4AUNA 2A7XA 5L8VA 2IU0A 1OXBB 2QW0X 5DHAA 2HKIA 1YS7A 2IUFA 2LE0A 4YREA 4BGDA 4W9MC 4JGBA 2PGJA 2DPLA 4RIFA 5EQDA 4A6EA 4EAAA 3TECE 4PO8A 2FW7A 2YV2A 4INZA 3LA6A 2Q5IA 1S2LA 2X58A 4N8SA 2NU8B 1XQYA 4Y1RA 2YWFA 1IPEA 3FDZA 3GNSA 2CNWA 1VXRA 2A59A 3RDPA 1ARZA 2C57A 4AVYA 1G5RA 3H8WA 3FVRA 1C4KA 1QORA 4KN5A 4XYBA 5GJBA 5IF9A 4URZR 2V8BA 2DJIA 2ZLBA 2B30A 3GEBA 1U0GA 3ZX5A 3TGLA 5K5EA 3GA0A 2YOFA 2OGTA 3AZPA 5AVOA 5K99A 2IS1A 2OB1A 4MRNA 4Y2VA 3TW8B 2XRYA 5C1DA 3TPCA 1UWCA 3GJ8A 4FHZA 2WUGA 3FF1A 1G18A 1RC0A 2PH3A 3RSGA 3EPPA 4EFLA 1VL1A 1WU7A 2UDPA 2GB4A 2QTHA 4U5QA 4RDHA 3ZE8A 4CJXA 2DQ4A 2GCGA 2YV4A 1X80A 4P53A 4K03A 1UBKS 2BEWB 1MXFA 5J2UA 1KFJB 5CFRA 5C7LO 1PZFA 1K08A 4N0DA 2QE7A 2BP7A 1A97A 2FKAA 1UCFA 3EISA 3GZ4A 3NHZA 4QGHA 1DRVA 1QZ3A 3IE1A 3HCOA 1T8SA 3KJIA 2RH4A 2QTMA 3EZ9A 1HLGA 3ORHA 2QLJA 4CUJA 3U3XA 3UMRA 2FUNB 3BIXA 2GVZC 2RC5A 3FNQA 2DUJA 3WGLA 2GRJA 2FF5A 3MJTA 3EVAA 1K7YA 4OMFG 4RD1A 1NX9A 3W9YA 4UEQA 3ZWPA 3E4CA 2ZR9A 3U3JA 3ZV4A 2EGUA 3SC2A 5T4EA 1G8GA 3U7QB 2XVAA 2F90A 4PAGA 1BN7A 1HLFA 4Z4GA 1ZBDA 1Z06A 4GSYA 1JTFA 3I6MA 1MC1A 2GZ3A 421PA 3HB9A 5CR9A 3CLKA 1NVTA 2WSLA 4WT7A 4TMVA 4JODA 3ANMA 3P9IA 4KFRA 1JQEA 4NOJA 3C0KA 1OWLA 4JLDA 2O20A 1IIBA 3EQ7A 4KPYA 4ERXA 2YJ6A 4O4LF 4OSOA 5H4HA 1PL6A 1QX3A 1H4VB 4RIGA 5DTMA 4CUKA 4DMUB 1PW5A 1EZZA 2V97A 3CUUA 1A96A 4OA5A 3FI0A 1QKIA 1RLTA 4O1MA 5D6OA 4PFKA 3BGDA 2OYCA 3TIXB 4H6WA 1PJ4A 2W98A 2YVLA 2XUQA 1YF3A 1XPRA 4WLNA 4YQEA 4L5JA 3B6MA 4RPHA 3TI7A 2I4NA 5G3YA 1IHOA 1W4CA 5JY6A 5DBEX 1FP6A 3JSAA 1OOEA 1S02A 4JJ4A 2CXQA 4MI6A 3GFFA 4FYXA 4E31A 3IBCA 2HAEA 1NMXA 5AKYA 2I6FA 1DC6A 3KFLA 1OB2A 3OZBA 4EB6A 1LJUA 3OLQA 1GKYA 4CLXA 5F23A 3U19A 3B60A 3RTEA 4O2RA 2P7IA 3ZZTA 3UOGA 5M5BA 1FMCA 4U7FA 2H29A 3Q2KA 4YJ3F 4BCDA 5FLEX 4MPRA 2COUA 4A9AA 4C43A 1X74A 1YQQA 3TLGA 1QDLB 4B17A 1GZ3A 1NWHA 3HJUA 4O2AA 1GPLA 3EGWA 4CL2A 2Q3MA 3A0RB 5L53A 3RYCA 2IZ7A 5BV2P 3MT7A 4EX6A 1NSYA 5AXAA 1BD3A 1IBRA 1R4MA 3QE2A 2C42A 5DWVA 3VX3A 3R5KA 4TZKA 5EESA 4F5WA 5U4QA 3K70D 1EWRA 4WDQA 1H1LA 2D7CA 1TQDA 3G13A 4QT4A 2BGMA 1R64A 3VC3A 2Y76A 4KTTE 2X7HA 4QU0A 2CMFA 4QBIA 2A1IA 3R76A 3UMSA 4WCFA 2LBPA 1VC2A 3MZ0A 2SICE 2WTNA 3T7KA 3WLKX 5IEJA 3OQNA 3E18A 1O54A 4OQDA 4QVIA 1YQXA 3H65A 2C4KA 2EL7A 2VA8A 2D54A 10MHA 3GUUA 5FLYA 4RACA 3NGMA 3CRQA 4PEVA 1J49A 2IXGA 3VV2A 4TVSA 1N9GB 4R1QA 4J3FA 5J63A 4HAVA 1KPGA 2I3GA 1W5AA 3PV0A 1VA5A 3SQNA 2NO1A 1I7PA 4FPXA 4BVLA 4MS4A 4N41A 3H0EA 3LUBA 3Q11A 2M2IA 4E14A 2YWXA 4MR8B 1V1RA 3CG0A 1NBEA 4F2DA 1S8FA 2OTCA 1N6PA 1PNQA 4OQEA 5JZOA 1BWPA 4ZHQF 5L6MB 6LDHA 5KYYB 3CISA 1KY5A 4OBBA 3ZV6A 2VTVA 3I9KA 2HCTA 1QHSA 1PJAA 3FUCA 4WUTA 4EG8A 1U8EA 2IRWA 1ZIXA 1NI5A 2O2JA 2I99A 2VP2A 5AI0A 3WFZA 1F17A 4X93A 1MO6A 1AS2A 1S4MA 2NZYA 3NR2A 4LHXA 1P8JA 1I33A 3N2IA 4C4YA 4YPOA 3ZQKA 1G2PA 5FA6A 2A6PA 3M9WA 4W4TA 2DMRA 4UAGA 4X60A 3GLFB 4MS1B 1HLDA 4FKBA 4AIRA 2DWUA 1PL7A 2Z1MA 4PC6A 3TBHA 5CDTA 3FFBA 2YWHA 4GLFA 3DQZA 1T6YA 2DQYA 3EXEA 2Q28A 4D43A 2BRUC 5LYJB 5G0UA 4DRXA 4JR1A 2G71A 1UBMS 1E1YA 4LDNA 4DMLA 1R2QA 3U31A 3ZBQA 3SVTA 1PZMA 3RTCA 1PHPA 2CKMA 2Q6OA 4N6NA 4WY8A 1NC3A 1Y0BA 1OXKB 1YUNA 4NCJA 5REQB 2BYTA 2OORA 3GFTA 1WLSA 4IOMA 4RZUA 5DV9A 2CF6A 1N5OX 2UYOA 3W8NA 4DR4B 2HBQA 5FADA 4L78A 5LPNA 5EXEA 2OG1A 3TDNA 2WG2A 2O7SA 3I62A 3PUXA 5JR3A 1N77A 3LUHA 1Z6YA 4X1OA 4JIGA 2GXQA 4OKNA 4N5MA 4ZAZA 1CUJA 2PAFA 4WV3A 2F00A 4UTPA 3WA7A 2V55B 3L8FA 2NV2B 3N0RA 4GKAA 5J2UF 2VNSA 4NPAA 4ZYVA 2EZUA 2P8SA 3AEQB 2JLRA 4LBVA 3V4FA 3WIBA 4CM9D 2QSUA 3OZEA 1A8HA 3BHNA 2A0KA 5KMGB 1JQKA 2L0XA 2Z09A 3HPRA 5CCDA 2VHCA 5DASA 3GFOA 1ORHA 2B7CA 4IFIA 4QXOA 4MB2A 2Q8NA 4TUYA 1H93A 1CY2A 3DVAA 1I4LD 4YMWA 1ZGCA 1J0XO 4QYMA 3VR1A 4TSFD 1E32A 4P54A 1BQ4A 2J3IA 4D9FA 5CCXA 3AI2A 3IA2A 3OQMA 4BMOB 2Q0SA 3DO5A 3P0RA 3BS4A 3QW4B 3BE5A 4KBYA 4Q9NA 1BCSA 1OI3A 5AW6A 3LFUA 3BXZA 3HCAA 2OOKA 2CDCA 1JXMA 2DH5A 2QJOA 4K9QA 4RD3A 1IULA 3LG2A 4CNBA 4ZVNA 1SUBA 3RC8A 3LQFA 3ZKAA 1OPRA 4M22A 4NDAA 3CEPB 1CR1A 4QTUB 3TFWA 5HCNA 3C8ZA 4OUKX 1WMBA 2AOTB 2ERXA 4NBSA 4OLFA 4V0NA 1F7VA 2WR8A 1NURA 1EX9A 4NQRA 2VWHA 3FRIA 2JJQA 3K4HA 5JS8A 1JA0A 1OZFA 3G49A 4MDEA 3BEDA 1EA7A 1CS4C 1CS0A 4O2BA 4FDLA 4DZZA 3UJ9A 1IN8A 3L8ZA 1O77A 3BWCA 4QYWA 4W5QA 1JAIA 2PX5A 4ZAXA 3M6IA 4YYEA 4A0GA 1JKIA 1AXGA 5BSMA 1FNSA 1EUQA 3NORA 3H04A 1DBIA 2FEMA 1XTPA 2Z9CA 3D5QA 3WMWA 3W5BA 5AHXA 3NHSA 1YU9A 4GLBA 4JBGA 1A72A 1TYBE 3X44A 1FMFA 1JLKA 1L1FA 1KVQA 4B7XA 4DBVO 3K73O 4TTAA 4KV9A 4RF4A 4DJJA 2CHUA 4Z4QA 2ZWOA 2V54A 2BFDA 1H6CA 4WK0B 1NASA 1MFPA 1JPUA 1YJAA 2LVBA 5HF9A 4EY7A 5BT8A 2F43B 4Q4JA 2O19A 3MYYA 3PD0A 3HADA 1CRPA 2OGSA 3A6EA 3VJKA 3I58A 1AZWA 1ESDA 1TGYA 2VJPA 3FF4A 4IHKA 5TE9A 3T7TA 1WXGA 1PQWA 3CIOA 3KEOA 1DFIA 3NHRA 2JIMA 3EUAA 1TMYA 3QYPA 2F1HA 3NRBA 3CUVA 2NXWA 4U5XA 4R1SA 3V1LA 3OWOA 4C3OB 1G9XA 3QKSB 4HAIA 4HAYA 1JKJA 2BFFA 5D1HA 3T5TA 4LRSB 2E4AA 2PKWA 4B82A 4WKGA 4A8JA 4YCJA 1WSBA 1W36B 3DFMA 1ZC3A 1T1JA 1V2HE 4QRHA 2C1ZA 3RWMB 2RGDA 1XMSA 3H18A 5A0VA 1GU0A 2BKVA 4DC9A 1QOZA 3B9BA 4YFVA 4B34A 1G21E 4O2AF 5AI6A 1G5IA 3B2QA 4I3HA 1QK5A 1Q20A 3BCHA 3DS8A 3FYSA 1KAGA 2V6JA 4XJXA 1AMOA 1B4DA 3MUNA 4MVJD 1MIHA 1M2FA 4M4SA 2O1XA 2I7CA 3L4EA 3UXHA 2V6FA 1CVIA 3IIJA 2OKCA 1A04A 2VAPA 3CO5A 3EFOB 3N53A 3NOOA 3QOFA 4YAJA 3THOA 1BU8A 3PRHA 4ROSA 4XIYA 1U2PA 3T3MB 4MDFA 1XZNA 1YUBA 3EBOA 1E2KA 4UD6A 1N2XA 4DR7B 3L7OA 3ODGA 4XQEA 1W2HA 6ABPA 4B3CA 3SS8A 2M9MA 3MPUA 5ANRB 1FRQA 1FBNA 2RDMA 2BBWA 1CUSA 2P91A 4DARA 2VYQA 4G0QA 8ATCA 4RA9B 1CJBA 1OFUX 3A70A 3AI7A 3OEHA 4K9SA 1CUDA 1UXGA 2J67A 5DW3A 5E6UB 5EVJA 2WY2D 1HETA 3SQDA 5KQRA 2HREA 3JWIA 3OZSA 3KAKA 4DILA 1IXSB 5AI4A 3FKJA 3UUGA 1HYGA 3D8TA 2HIAA 3R09A 1W1WA 2KS6A 3M4YA 4XYMA 3CNNA 3O2SB 1SCIA 3W2FA 1N7GA 3ER9A 1R18A 1BJTA 2WHYA 2NO6A 3R5HA 4LXGA 4M0MA 2R4QA 1RYDA 4X3CA 1V43A 3UOAB 4HEQA 4PRYA 5JDIA 2RAFA 3B36A 3H2KA 3VR6H 2WYHA 3M6MD 2MSWA 1BCRB 1SVUA 2VJYA 3ZU5A 1H9CA 3S7TA 2ODQA 4AJ2A 1YRYE 4MEJA 5HMLA 4QAQA 3FYTA 3G2HA 1Z0UA 4NJMA 3T1TA 2B4YA 2V8OA 3EGXA 2W58A 3KOWA 3HFSA 1EDZA 4KWHA 3ZDYB 2WZDA 1O95A 2HMUA 3D8BA 2IQIA 3TRDA 2CVHA 5IAGA 3CUWA 2HRZA 1DELA 3DQQA 4ND6A 2G0AA 3WJAA 4YK7A 5KS2A 3BM5A 4IIBA 4EO9A 2V0CA 3V4ZA 3MJHA 4KXUA 4LHVA 3BIJA 1VJTA 2HXYA 5J59A 5T6BA 2GHQA 2XMPA 4CKCB 4GF5A 5AKXA 3JV7A 5I9BA 3RYHB 3VZSA 1VHJA 3AFNA 2VRBA 4QGAA 1YB2A 1DXOA 5GY7A 4D0GA 3DAOA 1T8RA 2QMUA 4AJLA 2Z95A 5IC4A 4FGUA 3I2KA 1WABA 2J5RA 3VR3D 1U8YA 3ZC3A 4EZBA 1C4OA 2OUKA 2X5OA 4RJ2A 4TTRA 4UVDA 3ZZMA 1UM8A 5L6LB 4EMBA 2I3AA 3ILXA 3DCIA 3HYSA 3PVCA 1ZK0A 3N74A 1DUSA 2EKQA 3EWSA 1Y34E 3SLKA 1RQ7A 1G17A 4Z0TA 1NLYA 1A9XB 4NYMQ 4OYLA 4AJPA 5TXGA 2BISA 2DWCA 2C88A 1KJYA 3UFXA 4YR7A 3N2KA 3U16A 2D74A 1PGQA 1NRXA 4GW3A 4C88A 4Y6OA 4Y67A 3AKDA 5K3FB 3SYTA 4A36A 1JQAA 2E5WA 4L02A 1ZLYA 3PXXA 4DLWA 1OC2A 3O7WA 3SSMA 1ADJA 2IL1A 3LYUA 4TUYF 2O59A 4JI8B 4F9GA 2QTVB 1UFQA 2JZOA 3G8DA 4CNQA 3ZG6A 2FUEA 3UXYA 4RTNA 3NEPX 2AUNA 2V4UA 4LZLA 1J23A 1HLPA 2A30A 3BB4A 3ZE7A 3EIWA 4UPEA 3TJRA 1L7EA 1D9ZA 2CD7A 1P7YA 2OCGA 3QOWA 2D4AA 1PQUA 3R74A 1JRLA 1EDBA 2HUNA 2ZYAA 4JL8A 3Q6NA 3ZLUA 4CMAA 3UPTA 4HBZA 2GESA 1GEGA 4H4CA 3TB4A 4AW9A 3ZZ1A 3NHJA 4WK6A 5CCBA 1XQVA 3HSKA 5CVJA 2FW1A 3L79A 1O94C 4P0TA 3ILHA 1T8PA 3D6MA 1Y7IA 3NC0C 4XD7A 1IM2A 3OECA 4DG8A 3E2IA 4UHDA 2FZLA 2Z1DA 2QU8A 3A58B 2ZK7A 4II7A 4PLTA 4LZPA 5CXXA 5ER6A 1X8KA 4DOMA 2WWVD 1LPBB 4RHXA 3FCSB 1HOXA 4GSKA 1Z6QA 3BD9A 3JZMA 221PA 4I2VA 3UV6A 4FJ1A 5EYPB 1SOWA 4AJNA 4UCFA 4CQMA 1AQUA 4AMYA 4DW8A 1YZNA 2QN1A 1TFUA 3LDFA 3LGXA 3WP1B 3ZGZA 2VDPB 1LBIA 3CZ9A 3FLMA 2FMHA 3KXKA 3BCSA 1B23P 4MROA 1UADA 4W5NA 1KF0A 3A1VA 1HK7A 3ZEIA 2WVJA 2JAXA 1QZXA 1PE0A 3OTQA 4NBRA 2XUJA 3NM5A 3WYNA 2WZCA 4CF4A 2PN1A 4L4SA 3P2EA 2HPZA 3T9CA 1YACA 2IOFA 1G8AA 1SCAA 5DGHA 1QRUA 4JUIA 4DPMA 1ST2A 2QL9A 2VAWA 3A4MA 3BA1A 3QVMA 3RUEA 4FUTA 1BMFA 3W1WA 5F78A 4E2FA 4CUZA 5KNBD 3AR6A 3C4JA 1ZCJA 1TYDE 2R8YA 2J8ZA 3H11A 3LTEA 1W85A 3G7SA 4R84A 5ALSA 4B85A 2WW8A 3AIOA 5IMBA 4LY0A 4X90A 1QOQB 1RW4A 1OIVA 3TMKA 2ACVA 4CTNA 3R9XA 1LC3A 2LW7A 2VDJA 2ZB2A 3M70A 5IM5A 5LA6B 1XD2A 2POCA 5AMXA 2P3SA 1DG1G 4J75A 1LWNA 3I2JA 2C7VA 3V7WA 1WCV1 4FSXA 5LLTA 2ROQA 2AOUB 4YEDA 4LQLA 1U6IA 3TLJA 4RCVA 3T9EA 5BSVA 3HH8A 4PYKA 2OMEA 1RYEA 3DHNA 4J07A 1Y9DA 3DZFA 4J1TC 3RG2A 4A8TA 3U5TA 4F3TA 4BNDB 2D1SA 1TA0A 1W48A 2MINA 3CR8A 1SQ6A 1MTOA 2G9ZA 4Z4FA 4DBLE 2VS1A 2R00A 4JGGA 3O3CA 5G0SA 1I5OA 1T2FA 5AWFC 1V16A 1O5OA 4KAXA 1ZOOA 1EHYA 5CVUA 2V58A 1EZ4A 1Z4JA 5AK0A 1U8TA 3AHHA 5GVSA 2YY7A 2FW9A 4LVOA 1CE8A 1LUAA 2OLEA 3R5TA 5HP4A 3DOOA 3EDQA 4IG4A 2I78A 4JA0A 3L07A 2GF2A 3ESCA 2FJPA 4DXHA 2AB0A 4CMCA 2AH5A 3KCNA 3PDWA 2VK4A 3N87A 3O26A 5TVKA 1CUBA 1PP4A 1I14A 1QIHA 4GZ6A 4F97A 4I2NA 1N5IA 1KO5A 1GYQA 4HAWA 3AGQA 2CHFA 1TYAE 5G40A 1RXWA 4X8HA 4GQIA 1LS1A 2ZS9A 3GLGE 4HFJA 4MULA 1GTVA 4OJYA 2AW3A 2B4TO 5AH0A 4YRAA 5LR6A 2JIOA 4AM8A 3VR4H 2B21A 4JIMA 4LAFA 2AOWA 3OAAD 1YB6A 2GS9A 2V6MA 1JHDA 2Z43A 3LT5A 3H9BA 4BO7A 1Q1QA 5FI5A 3AFIA 1DQZA 4BFZA 4FB5A 3K70B 3UB2A 3CQ9A 4O33A 5AOAA 3C70A 3Q9UA 4QATA 4BB0A 2W5UA 4RU1A 4FMDF 2Q6TA 1YE3A 2A9QA 3ETNA 1LRLA 5EJ9A 1WOYA 4CT0A 1KO8A 4H3VA 4EG7A 1EWYA 4F1KA 2EWMA 1E2DA 3OKFA 1VMKA 1XFDA 3Q15C 3AHFA 5D51S 5BN4B 1D1QA 3A4IA 3BXHA 3QU9A 1GP2A 1R0RE 1M0TA 2XY4A 4HT3B 3HP4A 1KQGA 3T5PA 3KCQA 5LBIA 2YTZA 5CHYA 3E27A 4PR0A 3ZIAD 4KIFA 1T29A 3CYFA 4JROA 2XNSA 3GARA 1M2VA 3U3RA 2QQ0A 1C3XA 1OAAA 2PNJA 3L0SA 5MN6A 4FCWA 4N1AA 4M86A 4WNAB 1IZYA 1KJ8A 5BUQA 5JMWA 2I1WA 2P67A 4MJXA 2CLLB 3L0CA 5BYBA 2YOHA 3ON5A 2GHIA 1SQGA 3LH5A 4D80A 4Z7NB 4UU8A 1QM5A 1DSSG 5D2CA 2K87A 3H9EO 1CERA 1II0A 1N3BA 3L8CA 4GKBA 3VR5D 1UBOS 1N1EA 1DWQA 2XUHA 4F5DA 2VQFB 1IY8A 1NVXQ 1YFZA 1Q2UA 1EXNA 4AKTA 4Z7OB 1GOTA 3DJYA 5FBZA 3RQSA 1HE8B 1J5EB 3ICOA 2NLOA 3HA2A 2AWOA 5KU7A 3BH7A 3IUNA 4JQCA 2H4FA 3GJYA 3WLMA 4E03A 1OXSC 1DXYA 5ITZB 4U7HA 1JPJA 2FUCA 1CLUA 4OB8A 3KSZO 4H7PA 3DMDA 5C1BA 4F2GA 2EFJA 3DXFA 1RAIA 3TX6A 1DJOA 3OJCA 3WK4A 2DR2A 4HDAA 3GN1A 1CQIB 1GDDA 1USUA 2WMYA 3FPCA 1Z0KA 3C8DA 1QCYA 3R6WA 1SBCA 4QRDA 1HFKA 2YUIA 1ZA2A 2D5BA 5BV7A 4C4PA 2L82A 1M0SA 5ALDA 4FC7A 3UAVA 3ZHOA 1ZSVA 4Q1AA 1Q6ZA 2AI2A 4FXOA 1NOJA 1AS0A 1PW7A 1RQ2A 1RQRA 2ECQA 3GB9A 3JAWB 3PDHA 3UJ8A 4NABA 1HC7A 4AMZA 1YZKA 2YRXA 5C31A 1SC1A 1K27A 4KCGA 1KK2A 3QY0A 2D5CA 5I45A 4MLDA 4NR0A 4CM1A 4IDEA 1JR3A 5INTA 2BLLA 4DMMA 2YJGA 2SCUA 1GYRA 2ID7A 5JS2A 3WLJA 1F8YA 1WCXA 3BT7A 4XKJA 3UFBA 3VNBA 3VU8A 4AS3A 1T4GA 4QJ5A 4X1YA 1I0LA 4BZPA 1B8NA 2ILTA 2XXAA 1Y5RA 5DPMA 1LVGA 2GD0A 3K5WA 3ESXA 4Y0AA 1V1MB 4CU2A 1Z0IA 3THYA 1AKRA 1YRQA 3TLYA 1KEZA 1B42A 1L4MA 4NS1A 5I48A 5FORA 4CEIA 1ZZEA 3TUIC 5JADA 1HZZA 1XWFA 1DLIA 4IDCA 1Q0LA 1J33A 1W0JA 2F1IA 3TZKA 1OVMA 5JNLA 4G1MB 3ROMA 1OAOC 4MA5A 4F9TA 3UW3A 3KEMA 2IYLD 1LBSA 4BNGA 2JGKA 2DR3A 4M7OA 8GPBA 3CHYA 2G3YA 2XZTA 2YFKA 5BO5A 1GR1A 1LNSA 5B1YA 5CCEA 3GLHA 5CX1B 5EJ7A 4X44A 4AB1A 1H6BA 4XCXA 1XK6A 5HX7A 1NG1A 3H84A 4YH1A 1VOTA 1TAGA 1OLOA 2HU5A 2I5PO 2WLSA 2Q5CA 1KC1A 4MWDA 1P29A 4Q03A 3NHAA 1JDPA 4PC2A 1B8PA 4ZO7A 2FK7A 4B81A 1GGVA 5AKJA 2RKWA 3NBYC 3BRCA 3CZ4A 1GRVA 5IW8A 1RM3A 2Q3BA 5AO9A 4ZI7B 1BDHA 1MJFA 4LWOA 3UICA 4ZQGA 4LOLA 4PO3X 5IANA 3VZCA 3DTNA 4YO7A 2QMOA 3ZQ4A 1G98A 1EP1B 1XEFA 4NX2A 4W1PA 4DVGA 2RGCA 3RS2A 4QKQA 1I32A 2D0IA 4MITA 4JKYA 2ORYA 2ASEA 3F2VA 3V1KA 1WMEA 5JS7A 2NSJA 5JU6A 4BY9E 4D9EA 4YALA 1ETUA 2IS6A 1ZN2A 2D0PB 3DKVA 5CH8A 4W6ZA 4ZCSA 1QK4A 1U11A 5I4CA 2R6ZA 1ISMA 2A7QA 3VPAA 1MP0A 1EK6A 3BA6A 4IBOA 4FFMA 3SM9A 3LUFA 3C8HA 4LMBA 4LHZA 4LXIA 5IUNC 4DC0A 3HB4X 4S1TA 1T9BA 3PF8A 3U7GA 1GTL1 1SURA 1K0FA 1YS1X 3KO8A 4H35A 1T36A 5TT1A 4CIDA 1PR9A 1L7BA 1WUHS 3ROKA 4MW5A 5ECDA 4EKYA 2Z5GA 5HZMA 3VNAA 2Z8ZA 4IJUA 5B1DA 1OAKA 3HY6A 2ABWA 3QM1A 2OCAA 1IHYA 1BXZA 1ULSA 4P08A 4JWTA 1AMUA 4ID9A 3UVEA 4XYLA 1EK2A 1SHZA 5JZMA 3IR7A 4HV4A 4LX8A 2XNHA 1T6ZA 3CNLA 1F8FA 1FYVA 1RWKA 1JTEA 1ADFA 5HJEA 3HVRA 3L77A 4ACBA 2ZZKA 3QY9A 4D46A 1LSUA 3GLQA 2H9YA 1RAHA 1CQJB 2R84A 3ENVA 3FMPB 2V03A 4ASUA 3CEJA 1UANA 1WZNA 1D2NA 1KIFA 2JJ1A 1N5RA 3IQFA 1NLMA 3Q41A 3LS2A 4WY2A 5G02A 1N3LA 3BWDD 4NATA 4PYNA 3T4UA 2PJUA 4LOAA 3T6KA 4IF4A 1LFDB 2GSWA 4G1CA 2F9FA 3WLSA 5J4LA 4GX5A 3Q7PA 3ZK9A 1DBPA 1H2YA 2PRSA 4F72A 1QMGA 3QFRA 1UKVY 1Y98A 1ZK4A 3OEWA 1WL8A 4Q05A 4YRIA 5ICGA 1NDUA 4IIYA 4O02B 1YRLA 4O1IA 1ZH2A 1NFFA 1PJSA 1ZIOA 3WG9A 1DEXA 3TLAA 3DULA 1L5MA 2A9OA 3NVAA 4KN9S 4JDUA 5L9AA 2XMQA 1X1SA 3FGZA 2D6FA 2R6JA 3RH0A 4NE7A 3X1DA 2RGNA 1RRCA 3B6ZA 5E1BA 1QO0A 4FDAA 4U2GA 2AI1A 5CNJA 4LRQA 1XAGA 3C7CB 3E8SA 4BU0A 3AM5A 1VLHA 3AR5A 4MUEA 3R75A 2H1WA 1P3DA 4V3BA 3P9NA 1RXSA 3RT1A 4B3GA 3NTLA 4KU4A 4HJRA 4ZEXA 4N8EA 5GQSA 1BG6A 4DM7A 5LP6A 5IHPA 1AUPA 1ISPA 1TIKA 4N5IX 2UUOA 3ZHUA 1SU7A 4BFTA 1NY6A 1P5FA 5D6NA 3KZVA 2NO7A 2HQOA 3N2EA 4KGZA 2PSEA 4MYTA 3MXOA 2A33A 1Q84A 1O0BA 2YINC 4ZOEA 2GEJA 3S29A 3RBAA 3JVUA 4DEXA 8MHTA 2WAAA 4F4FA 5IP5A 4UPDA 2N0SA 4G9BA 4AF7A 3AFMA 1RYNA 2OZKA 3B3GA 5IAJA 1M54A 3K9HA 1KNQA 2CMGA 2E4VA 3GEEA 1THZA 2VF7A 3MK31 3LO5A 3OOWA 3ND9A 3GV0A 4TROA 5AKIA 4YJHB 4ZCRA 3RABA 2NP6A 1P8AA 4OK6A 2YW9A 3BD7A 2YKGA 3AX6A 4V0MA 2DQKA 3DC7A 3E81A 4UUQA 1ULTA 1O0CA 4MVJE 4ZQFA 3ZTWA 1QOPB 5AVSA 1N6HA 3UV3A 4BTLA 1ATIA 4MPJA 1FP4B 1ONNA 1F8XA 2DHCA 2FGJA 4IUDS 3D6UA 2Z2ZA 3UMYA 4IVRA 1VPEA 1KOJA 4MR7B 4NL4H 4JVNA 1JMYA 1XP8A 3N70A 4B4KA 4BPBA 5FWYB 1VE5A 4OI4A 1VE1A 3W05A 2EC5A 1RM5A 4X1KA 1JFLA 1YKFA 1X7YA 2NSLA 1GG2A 3OIVA 4C0XA 2HIMA 4RK0A 4UVIA 4BIIA 1OZGA 3AM4A 5CXSA 1Z4PX 3GR6A 5C8VA 1ODKA 2BY4A 2BGWA 3RVBA 4E6PA 2CGEA 5IH3A 2AF3C 4WRRA 3Q2OA 2VH5R 5KYXA 4B4OA 2YYAA 3H6GA 1HG0A 1LU9A 1SB8A 2WB4A 1EUZA 2DKNA 2PLFA 3QLVC 4EJ0A 4UMDA 1NMQA 4MW0A 3WLLA 1GPNA 1SKYE 3G2LA 5CFMA 5D7NA 3IV6A 3KEQA 3DVRX 1RLUA 3ND6A 3HB7A 1ONBA 3KOXA 3EFEA 2VNAA 3SAJA 3DTTA 4DUPA 2O2IA 4F4CA 4FYWA 2XGJA 4ERNA 1GZUA 3CIFA 5JEDA 1T2DA 4R5MA 4PYIA 5KSPA 2FCAA 1BYIA 1QH1A 3KKKA 3FNBA 2A9JA 4IWNA 4Y2JA 2IXBA 1WB9A 2YWJA 4R9VA 5KWVA 4I5GA 2NV6A 3EGDA 4QDZA 4CGZA 1D7AA 1Z6PA 2R8OA 3LWNA 5JD3A 1R4ZA 3OFND 3A4YA 4BOYA 1FLNA 4P36A 3OQIB 3OPVA 5DBIA 1Q0SA 4N0MA 1KXJA 5JATA 1WCWA 1Y3HA 2HA7A 5FWNA 2OCIA 1YR8A 1ZGHA 3JQ8A 3ZCXA 4D02A 3DOFA 1E6KA 5M34A 4HQ6A 3ZLJA 3HCDA 1WQ1R 5LWHA 1Y63A 4F85A 4EGFA 4PRKA 1WDLA 4B6FA 2P6PA 5B36A 3B1VA 7ABPA 4PSVA 5EERA 1NN3A 3ELBA 2W8BB 4RJIA 5KTMA 2HDHA 3HJTA 1VLVA 2NPIA 3E9ZA 4L1KA 3UB4A 2F8TA 4YP6A 4O4HA 4S35A 1RRGA 2B4AA 4EA7A 4GS5A 5IUKC 1VCHA 2V7BA 5ERXA 2OPHA 3WOHA 3NM4A 1VRWA 3LSTA 2LIPA 4OV6B 1YB1A 2UZ3A 3B7GA 3LDHA 4G89A 3E22A 4B3TB 1L5HA 2ZYUX 4D8VA 1GDHA 3P9SA 5KYNA 3PT5A 5A6SA 1S2GA 2P2SA 5AVRA 1UAAA 3G7NA 4IGKA 4D8YA 2C2GA 2IZ1A 3PR2B 4JVOA 4NZZA 3SWWA 3C3WA 4JBWA 1VHDA 1XEWX 2CF5A 2HHLA 3IELA 1LI4A 1D5CA 1UMKA 3Q3HA 3N7UA 4H0CA 2VHEA 2PO5A 2W4MA 2VCYA 4F9FA 3VU9B 3PEFA 3VX4A 2PZ8A 5F1KA 2FW6A 1OV6A 4CF3A 1YK0A 2QRVA 2ZJZA 3L92A 2ZPUA 5IARA 3JQ9A 1SXGA 2UU9B 1UK6A 1U0EA 3VO8A 3GH3A 2ECPA 3KV1A 4XM2A 2VYFA 4YLEA 5DT2A 5H16A 5EIXA 2C5SA 2WKPA 1A5AB 2C4MA 4R2HA 4XFJA 1SG0A 1Z68A 3CLTC 2DU8A 5COQA 1HKHA 1EEXB 2YNMA 1MHPA 3C7DB 4YRPA 3FOZA 1ORVA 1HE3A 2O23A 3QEBZ 4WX2B 3GGGA 4NOKA 3O7MA 4NBUA 2X0IA 3EIXA 3KETA 3IAEA 1ZUIA 2GA9A 3D8SA 1I1OA 3AJRA 2Q3LA 2Z98A 3BFVA 3ONEA 1VYUA 2J33A 4YCDA 3RV4A 2DFLA 2VZ8A 4EI9A 1YDGA 2F3TA 1D4FA 1QO7A 1T5HX 3BXPA 5TEWA 3JVDA 4CM8A 5LP6F 1Q2XA 3J7AC 2FOLA 2YRFA 3BKWA 4DMCA 1MCZA 2EQBA 2HRRA 1Z63A 3EVEA 1L3BA 5F51A 2OBNA 2HRQA 1EFLA 3SU8A 3UJBA 2IY8A 3VRHA 4BEWA 1QJCA 1TLFA 2BHRA 3GXBA 1QYXA 3FCEA 1ZI8A 3H97A 1DUVG 3GA7A 1J07A 3MCWA 1NUTA 4ITVA 4KO2S 4LI0A 3ZOKA 2JFOA 5JUWA 1M2KA 2GZ1A 1VIMA 1MOQA 2BFBB 2RONA 1KJQA 1XHFA 1ZZGA 4K2HA 4PXSA 1OJ7A 4N0QA 2AS0A 5JWHA 4YAKA 1OILA 1Z17A 3RFVA 3VPCA 2PE5A 4H1HA 1QGOA 3AF2A 2QRPA 4BMNA 6REQB 1BH2A 5DYWA 4QASA 1NQWA 3ZWYA 1EXMA 4Z1OA 1M7HA 1MJ5A 3C2QA 1W34A 1ZVKA 2H5JA 2UVQA 3DE1X 4FD2A 2BCGY 1AUQA 1L4YA 4KZPA 1U9ZA 2AN3A 2PRYA 4XR9A 5FPTA 6GPBA 1JDSA 2ISQA 3F97A 1GA4A 2FX3A 2QAJA 3HU2A 5I7SA 5AUPB 1IBCA 1LK0A 1T6BY 1RWQA 2UYGA 2G9VA 3D3NA 5K3CA 3P5SA 3EDRA 3K09C 2D1RA 1C3OA 4OF4A 3AERA 4WNYA 4YRBA 2IHTA 5DHUA 3U4AA 1PV1A 1W52X 5DBHX 4DR2B 2HT6A 2PSDA 1QXSA 4LJ4A 4LZOA 3IUJA 2ZTUA 3M6XA 2YH2A 3T95A 1YB4A 2G04A 3L6BA 5EWJA 1PK9A 4DQKA 3TUZC 4X54A 3LCRA 3FMVA 3B6KA 4CI9A 1E61A 3E9EA 3OUZA 5F2NA 5ALXA 2CZGA 4F11A 1MR3F 1QX4A 4RMIA 3L0IB 3CWQA 2YY5A 4TLAA 3CBQA 3VYRB 1CYEA 3HU3A 1OX4A 2Z4RA 1YOBA 1RMTA 1VYTA 2Y9MB 2BC9A 1E3TA 1SCJA 2XUFA 3BORA 5EMMA 3EG9A 2UUAB 1P0CA 3EFHA 4B0OA 5KTTA 1UPXA 1Z3IX 4TMZA 1J2JA 3HN6A 1KZGB 4GHWA 2GZDA 2E4WA 1E2LA 3BC1A 4J16A 1R0SA 1U5BB 3M4XA 4GR9A 5HBGA 2GN4A 4GZMA 4V03A 3IB3A 3OOYA 2I2DA 2IA5A 1R37A 2FMTA 3KYCB 3TSZA 1WCYA 1H2HA 2HEGA 4KQJA 1JFTA 4HH4A 4U8HA 3LXRA 4L2IA 1C0LA 2DWQA 4HDRA 3TEMA 1YHNA 5HTOA 1KO1A 4EEZA 1EFRA 3HEBA 2XZDA 1V5EA 5ENDA 4ZAVA 1M2JA 4B9EA 3AJAA 5GJWC 3UJNA 1Y9JA 1DT3A 3V46A 1U99A 5KTKA 4LBWA 4R41A 2OCPA 4FLFA 4O25A 1GYPA 4LDAA 5AJYA 4B3IA 1T1GA 1FFXA 4UDXX 1JA9A 2AL7A 2HJWA 3QV1A 3DP7A 1NJGA 3U26A 2JJ8A 4MV7A 4AIIA 2Q46A 3DCYA 5A3RA 2XMSA 4ZCIA 3KT0A 4EB8A 3I5XA 3E8MA 4ZARA 2O8FA 1OFHA 2QZPA 4CM3A 1ZHFA 3H75A 4O4HF 1R6BX 2W6JA 2A4MA 3QKUA 1AOXA 2UKDA 4QNNA 1IUPA 5EJGA 2QAGC 1DQSA 3NS7A 1GSIA 3ER8A 2VRCA 3EXG2 4TXMA 2PU7A 3WLQA 1PD0A 1TMGE 1PWHA 3V7YA 2JJ2D 1JP7A 1VBMA 4CV2A 3GCZA 2NACA 1ZGGA 4TVBA 4RGQA 2VPIA 4KLZA 3SYNA 1I5EA 1NFQA 1NF8A 1V48A 1L8QA 3N6RA 2AQ8A 3INGA 1F06A 4PIPA 4Y6RA 3LW7A 3ZGXA 4A0QA 5IKMA 1DNPA 4JUAA 1E4OA 2GVDC 2WD7B 1OLUB 3DKIA 1J22A 3R77A 4JQOA 3ENQA 4PG7A 3RAGA 1ADYA 2IOYA 1M34A 2PKRA 3GJTA 4JB2A 4LGCA 4PCVA 4RHTA 3ZY5A 2PL1A 5BSFA 4ZKEA 2B6NA 4ARSA 2FI1A 5F1OA 1E9RA 1YJXA 2VDOB 2P0YA 4AN4A 1LRJA 3OF5A 1L4EA 5EZYA 4UDOA 1L7PA 2FSIA 3A4VA 3DFZA 4Q9AA 2GM3A 3T3NA 1OYWA 1B8OA 1QQ7A 3KB1A 3N9IA 4KACA 3LNTA 1QRTA 3MMNA 4L3OA 2EBHX 3OZDA 1KHHA 2F17A 3HVJA 3LPMA 1Z4OA 3PVSA 2PVSA 4K6CA 3JYHA 3PUJA 3QU2A 3LIIA 1DBWA 3FPGA 2VATA 1DTEA 1ZJ5A 4FQ7A 4QQ8A 3HDTA 3UWDA 1N7IA 2XZPA 3DMPA 1XUOA 1T26A 2VJDA 2ZKLA 1SXJC 1FTYA 3AOEC 1G42A 4DDMA 2BGNA 4REOA 5H3HA 1QU2A 4UUBA 1EHCA 1YDMA 2UZ0A 1U6JA 2MR5A 3RK0A 5KOHA 4X65B 2YJ5A 3LO8A 1XRRA 3BB3A 2DFPA 2EL9A 4ZDWA 3GHHA 2WABA 2H4WA 1U7DA 2C2HA 3R44A 2H07A 4I5FA 2YFYA 4OL0A 4QO7A 1VHQA 1DWOA 1YQWA 2IYFA 3L0ZA 1GQFA 3T41A 2Y27A 3I5AA 4QDUA 3F7MA 3PX7A 4I81A 4R1MA 1QIFA 1DCKA 1JAHA 3CRMA 3OC0A 5LU8A 5ABPA 3EWIA 4G8CA 1DWUA 1EP2B 2IQ5A 1ZVQA 2PL3A 5IVDA 1INLA 4TVKA 1UP4A 4TS3A 5ES4B 3WK7A 5CDGA 4EFNA 4C1BA 1RDFA 1O03A 3I53A 4IJKA 4IXWA 3RRYA 4PZPA 4D42A 2HEIA 3AJ9A 3NJ4A 4UOZA 3SZMA 3NOXA 4PBRA 4H18A 1VI6A 4JLWA 4ND5A 1QV6A 4ZT3A 1N2IA 1VL8A 2VAVA 4UMVA 1G8JA 3TQOA 4XASA 3TW6A 5HJ5A 2PD4A 2WMDA 1X3SA 1KKMA 1XTBA 3M1IA 4EQ6A 4OKIA 1EX6A 1SAYA 4LHYA 4DWWA 4IMIB 1KHTA 4WJLA 4PQEA 4GMXA 1W2GA 5F2EA 4ZP1A 3B8EA 3PXGA 3PGA1 2Z6UA 2GXAA 3SS9X 3PIIA 2VP9A 2KJQA 3ABIA 4WZBA 4CR6A 3PUVA 4DCJA 2GA8A 2XKBA 2KQUA 3AIMA 5B6JA 1U1CA 1UEXC 5EJMA 4G9GA 4HVTA 3JASA 4LJYA 2CCGA 2OYSA 5FTNA 4YCLA 3RHFA 5IFLA 1QF6A 3AKZA 4LDRA 2FN3A 3FDIA 5AOBA 4GOND 5JECA 1UC5B 2C3UA 5LNK1 3U40A 3NHWA 1XZGA 3PGMA 1ZM2A 3AR8A 3BOSA 1E0JA 1GAXA 2PG3A 3KQSA 5F7JA 4UCXA 3Q9SA 1ZI6A 1L5WA 4L4XA 4ER3A 2CXXA 3VC2A 1UQRA 2HK6A 2H1CA 4XRRA 1Q0PA 2OQVA 3ZWWA 3TLKA 4X0EA 5CPFA 4D0RA 5SZIA 1MGOA 3AB3A 5KTSA 1GR0A