3HYNA

Crystal structure of a putative signal transduction protein (eubrec_0645) from eubacterium rectale atcc 33656 at 1.20 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
186
structure length
186
Chain Sequence
YQNANYSAFYVSEPFSESNLGANSTHDFVYYNMLRMWKGEDNSFPFNDAHDKTYNVRDGSDWEKTLKPRLHTRLDNSKNIILFLSSITANSRALREEMNYGIGTKGLPVIVIYPDYDKKSDIVDSNGNFKKQIKDLWDKLPAFRDNMSSVATLHIPCTKSVIISALNNEDFMVNTMADAEKYYYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative signal transduction protein
publication title Crystal structure of Putative signal transduction protein (YP_002936568.1) from Eubacterium rectale at 1.20 A resolution
rcsb
source organism Eubacterium rectale atcc 33656
molecule tags Signaling protein
total genus 60
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2009-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hynA00
3HYNA
chains in the Genus database with same CATH superfamily
4MUJA 4A9AA 4DR5B 1RVDA 7REQB 1GY8A 1OVMA 3GN1A 1UMBA 3UXHA 1V2GA 4BQNA 2WG1A 4ZYUA 4ZGGA 1REQA 3A05A 3KXIA 4N9QA 5J59A 1EIWA 2Y3IA 1SUCA 3P9SA 5AJHA 4HAZA 4CLOA 3KFXA 1KXJA 1P7CA 1G8JA 4RTOA 4CL2A 5CRIA 4DV1B 5AK3A 4KVZA 3IE2A 5E6SB 3H75A 5E2BA 4RZSA 3AB7A 2HJHA 3JAKA 2DHDA 3ORYA 2IIQA 2YHIA 1SIBE 3M6MD 5F9MA 3DFIA 2L18A 3U4QB 4KQJA 1V8ZA 4R8RA 3GQVA 3KLMX 4FE4A 4P5EA 2EL9A 5BO5A 5FUQA 4LHVA 3MW8A 4HGRA 1WNFA 3SJ7A 1CUWA 1J8QA 4A0FA 2N1MA 3A10A 1TIPA 5LP6C 1IVYA 1JBEA 2Z30A 3VDNB 1HBJA 4EHNA 5T3YA 4AICA 4YRGA 3DAOA 1MOZA 2Z4SA 1CE8B 2XNKA 1WOYA 2FF5A 2P4SA 3HPQA 5AVVA 5I48A 4BLTA 2ZZMA 5GZ6A 1EK0A 3RJTA 2PYZA 5I47A 4G65A 4OSOA 2Y9PB 3TD2A 2QP9X 3UJ6A 5KOIA 4O4HA 4A5OA 1UK9A 3RIYA 5BUQA 3WTCA 3ZW7A 1LTQA 4OUDB 4QBIA 2OHFA 3BRSA 5IBPA 3FCYA 3WDLA 1WEKA 4DQDA 5LQUA 3CSSA 4ZQBA 1NBIA 3TZLA 1MGPA 2D3TA 1UC5B 1YVRA 1FJ2A 2YINC 4FFMA 4MW7A 4MHSA 4OGWA 4UMEA 5JIBA 4FJ0A 2NO6A 3UBTA 1TZJA 3OPQA 5J1TB 4JBNA 3OG9A 2XOKA 4XYGA 4WXEA 4K1LA 5GM1A 1KHHA 1KYXA 3FF1A 4QOGA 1W5SA 2X5KO 4TRJA 3IHKA 5IWAB 3FMGA 3IAFA 1Y9JA 3O1HB 2RAVA 3Q3VA 4YRRA 1TA9A 3PXAA 1NVVQ 3H5OA 3M6LA 4YROA 3KEFA 5K0LA 3NUZA 3SZUA 3JR3A 1QCDA 4CIBA 3QK7A 5B3JC 1GLVA 3QUCA 3DFUA 3H42B 3WL5A 4IDQA 3DBRB 3E5MA 1G8KA 4Y1RB 1P1BA 1Q0PA 1SXJC 4JT8A 3PXGA 2H1IA 1FYDA 4HAWA 4BP3A 3DULA 2Z3ZA 3CG4A 3R9WA 2CE7A 4MR8B 5CVJA 1L4HA 3GLHA 1NTRA 2QGZA 1JX6A 5BNTA 3OX2A 1Z45A 3A7EA 1WUHS 2J7PD 4IOKA 2PRSA 2ZWIA 2BRUA 3OM0A 1N75A 4L8LA 4MRPA 3WMEA 2WTNA 4DE5A 3KR0A 2VJAA 4V3BA 1OX6A 3S81A 1OAOC 2CJWB 2FJUA 3VV3A 5LU8A 2GK3A 2BJHA 4AZ0B 4CIAA 1FJXA 2GA9A 4K9RA 5KMGB 4LZPA 2RIRA 4ZOBA 2EX1A 5IC6A 8OHMA 5J2TF 1UBCA 5LA6F 2ID7A 1NUQA 4I08A 5FKJA 2JGFA 2P5SA 5BMVF 3Q7TA 3QKRB 4TYNA 2IY8A 4X3PA 4KRGA 5K8LA 2B2NA 1VSTA 5H16A 4P80A 4Q39A 1P18A 5DM0A 1L7QA 1OBCA 2DRIA 2AJDA 1S7CA 3GBSA 2FYTA 2IELA 3BIFA 4IZ6A 4DTCA 1E8DA 3E9DA 2NYAA 1N92A 2OMKA 1VLZA 2QGFA 4JB0A 3CRVA 3TX2A 3WGMA 4DV3B 4HQLA 4CEIB 1H65A 4ENQA 1VMEA 4X95A 1IN7A 2Q1TA 3BDIA 3SEQA 5ALSA 5AKYA 3JWHA 1N8TA 3LRPA 4GOJA 2HPVA 5DNEA 5DHPA 1KSGA 3F47A 4N7BA 3RWMB 1CR4A 1V16B 3MC1A 1FDOA 2P6UA 2REXB 2XT0A 4G9GA 1FX0B 5EZYA 3WXBA 5GINE 2HBRA 1PYDA 3HB4X 1CUUA 2DSTA 4FFBA 1GQQA 1EZ4A 3RHSA 1E79A 2QRQA 3BCUA 3LDUA 4J1NA 3T5GA 4BP9A 2GERA 1XDBA 2FOLA 3A3NA 3NTRA 1H94A 4YACA 2F4NA 3H8SA 4B09A 3A06A 1BFKA 3VU9B 3HA3A 3S44A 1DO0A 2R5WA 1YASA 5CK4A 1V7CA 4X1KA 3RYHA 3BXOA 3UGTA 4C4AA 1SN7A 5AYVA 2EV9A 1KK3A 2DPYA 5JJLA 1PLKA 2JCYA 3AF1A 3AEYA 3O1JC 3R9IA 4D4MA 2OYSA 4UASA 3V8BA 3JAMA 2XA9A 1ADCA 2GYWA 1ZI8A 1JS1X 3PICA 1LZLA 2DWPA 3UB3A 1YB5A 3HCPA 4MVJA 3AESA 3VYVA 3WGTA 1FLDA 4EZIA 4O4IB 3N6XA 2W6MA 2QGNA 3BPSA 5KSWB 3N7TA 4GKJB 4YMHA 1F20A 2AEEA 3MIZA 2E5LB 2A86A 2NTVA 1WPQA 2XA2A 3I5XA 3H9UA 2AW5A 1R6XA 1QOPB 1UPTA 4D46A 1Y6GA 4PG6A 3JU3A 1CYDA 4W5OA 3FHCB 4A6PA 3EA5A 3LCRA 4R41A 3WQHA 3WMFA 5SYAA 3L79A 1DRUA 1FNDA 1N2OA 4LYYA 3TQCA 2QMZA 3GRUA 1Q6YA 1X7YB 3JSAA 3K9HA 3BORA 3HDTA 4FE3A 4TS9A 2O7QA 3P2YA 1Z62A 1ZMTA 1SC1A 2NSYA 2YFQA 1N57A 4BNTA 3OEYA 2GILA 3EX7C 4OLJA 1QKJA 1HKUA 2C7BA 5JNVA 1O96B 3HFJA 1UBKS 4KDEA 3ZI0A 5DE3A 3WC4A 5JRZA 2ZB8A 3WYFA 1M2WA 5FR2A 3GRFA 4JJIA 2H11A 3DEZA 1S8AA 4UZEA 1Y48E 1IPFA 2I2XB 1VHQA 1T43A 1X42A 3IOYA 1G8GA 4AMBA 1QGZA 3EF1A 3COYA 3FTNA 4GSKA 4UTOA 5HMMA 1F9AA 2OYCA 3B6MA 4MUKA 3WGYA 5J5VA 3RC8A 4EF6A 2F9MA 3SEAA 1FMLA 2AL7A 3MPOA 4J3JA 1W5FA 1EEXB 5IN5A 1E8MA 2YBDA 3IA2A 3L6UA 4RD0A 2P7HA 4PS1A 3ER8A 2WPNA 1WLSA 2VC2B 1AZSC 3VZRA 1U1DA 3AQIA 3ZX5A 2VA9A 3IHWA 3CIOA 1O77A 5GOZA 1T8UA 2NT4A 1JJIA 4MJLA 5FIUA 1ZRSA 4V0MA 5D6OA 4RL4A 1UZAA 2AC7A 2FWRA 2HQRA 4JB8A 3NYQA 3E27A 3JD3A 4C7JA 4IQ0A 4Q4AA 1A8HA 5J40A 1EHIA 1DOAA 2Q4RA 5BWNA 2H08A 1KSHA 4JU8A 5J4VA 3H4TA 5CHYA 1QHXA 5K45A 2PV0A 1Y4UA 5THKA 2IPLA 3KNZA 4Y2VA 2G6TA 4BGVA 1AMOA 2TMGA 1OH8A 1FFHA 1IC6A 2QW0X 3OWHA 1NA5A 2PS3A 2PXHA 3SSNA 3V8VA 1IL0A 3PEVA 1E2MA 1U0HC 1HYBA 1YZHA 2ZPTX 4LHZA 4XE5A 4YJ2A 4DR4B 1XHLA 3W9YA 1T4CA 2JIMA 4KN8A 4JI0B 3FRJA 4C87A 3QLVC 1HTWA 1K8ZB 4QHYA 4UEJA 1NJSA 2JHPA 4RH1A 4B4WA 3D8NA 4JT4A 3F96A 2ZGVA 3GL9A 3GZNA 3JQ9C 2O8BB 5CTAA 2OAEA 4FYHA 4B5LA 4R9SA 4MKZA 4WCFB 1NYQA 4RFSB 1L5HA 4AQ7A 3W5SA 1K3FA 3GG2A 1D8AA 2GCNA 2DQYA 2O7VA 3E0QA 1CUHA 3HNOA 1MC1A 1DP4A 4PNHA 2YWXA 1KE2A 4AJPA 1JG3A 2IPNA 4MGZR 4NJEA 1NVBA 2PGLA 1VBFA 3DE0X 4CDGA 4YRBA 1USGA 4EKDA 3MBKA 2V3CC 3N7UA 1XXLA 1W4ZA 2NO0A 3QMWA 5GONA 4Z0PA 2C04A 4I14A 5AWFC 1RI1A 1RYYA 3WLHA 3GP5A 5DGCA 3AOEA 4PPQA 1FTQA 1L8LA 3AETA 1XMVA 4OXNA 3K6SA 4QYIA 3BQ9A 1EWYA 2H54A 3I09A 4R5MA 4GLLA 3QOYA 4G67A 4O4LA 2VUIB 2JB9A 4RHYA 5E4TA 2Y1OA 4EMBA 2XDQB 3OFJA 1SKYE 1Z39A 2A1IA 2ETXA 2M6LA 3T7AA 3ZR4B 5ELMA 1AJEA 3CX4A 4KQCA 3RJMA 1GGJA 3FR7A 2YRWA 3IPLA 3KIPA 4KODA 4R2WA 1I14A 3NCTA 4MWDA 4BEVA 1GAXA 1A4UA 5ESRA 1SUFA 3UJ8A 2E0IA 4KNVA 4KHPB 1P62B 5SZJA 2FTKE 3AJRA 4XFDA 1T5OA 4FDAA 3FCCA 4OP1A 4QOHA 4S0XA 3N8DA 1T0PA 1SQ6A 1PAUA 1Z37A 2H1VA 2ONKA 3RFTA 1O57A 3G2KA 2YXBA 1RWQA 4KX3A 4PR3A 4D9IA 1SUAA 3INGA 2NU9A 3K0HA 1NUAA 2P6MA 1TUBB 3VHLB 1HUQA 2B69A 2FFBA 4QDJA 1TB4A 2O19A 4WUTA 3O1LA 2Q5CA 4RABA 1EMDA 2PQ6A 1S8FA 5HRUA 4K2HA 4KXXA 1X39A 3D3JA 2OCBA 1EB8A 1AOXA 1QH9A 3IOEA 4L4UA 1JHXA 3K71B 1KEVA 1W2WB 4XARA 5EXPA 5IKXA 1CUEA 3WO0A 5FUYA 5LKAA 4K40A 3PUVA 3UWSA 2Z2YA 4WL0A 5EP4A 2ZTLA 3DV0A 4Q9JA 3RFFA 2WWYA 2ZSBA 3WICA 1G98A 2C59A 2VJCA 2XUOA 2EYUA 2QQFA 1JI0A 2R6FA 3CVUA 1JTFA 3UV3A 3LPCA 5BWBA 5M29A 3CQ9A 5H7XA 4RIFA 4OFBA 4IVRA 4Z0HO 4Q12A 4YB8A 1RE0A 1P5ZB 1W581 2OP1A 5EMNA 2H7YA 4KR7A 1EXNA 1EUCA 5CP8A 1DBRA 5CA1A 4JYZA 2PZBA 4JXJA 4F3CA 1WXIA 1XUOA 4WJZA 4NC9A 4YUZA 1PW7A 2POCA 4G5OA 3AVWA 3NDRA 4D9CA 1JAXA 4J94A 3R4VA 2TMDA 1Q95A 3DQPA 5JTTA 1FUIA 3EFHA 4KXQA 3OC0A 4DQLA 1XRJA 5IN4A 2DQZA 2I3GA 2VBCA 3DOCA 4XW2A 1G7RA 2AOVA 2OT3B 5JS1A 4NPAA 1XKQA 3IT0A 1PJQA 3LTEA 3UT5B 3H2YA 2ZRIA 1A7JA 3IUJA 3DO6A 4MA0A 3NEYA 2JJQA 4R3UC 1X7ZA 1VE1A 2ZG6A 4CM8A 2CFRA 5E0OA 3EB9A 1NKTA 5TE9A 1GKLA 2IV7A 4CEHA 1VYUA 1GZ6A 3GPIA 4TOIA 3G7NA 4IIXA 3QVSA 3ECAA 3E3LA 1KU0A 5D84A 1JHRA 2L82A 5A9SB 2HV8A 5B4VA 5JEDA 2FEMA 4ZDJA 4BOYA 2NZJA 4DC9A 1B7GO 1YR8A 1ZC4A 3DD1A 3TGWA 1PEYA 3WR5A 4FB4A 2P2SA 4RELA 1C0PA 3FBGA 5AHKA 1LLFA 4B3CA 2LUOA 2NSJA 2YVKA 3SLGA 9MHTA 3VC3A 3WNVA 3VR4H 4JI8B 5DIZA 4BVFA 3S1SA 4PR0A 1R9GA 3AJAA 1WD5A 2YQ5A 2FZLA 4KXYA 1J8MF 2GF2A 4MKHA 5BSKA 1KP2A 2QRVA 1IWBB 5JAIA 4MS3B 1IATA 1P7VA 4RMHA 2IEZA 1QF9A 2O8FB 3LY9A 3KSZO 3TQIA 1NBHA 1E4EA 3QYFA 3LBAA 4QXOA 3SLKA 3UFXA 1U02A 1WHTB 3BXEA 2BFNA 2QSJA 4LDQA 3BSSA 3UXYA 1SIWA 4IXMA 1DTWB 5KI6A 4ASUD 5I5EA 1Y3BE 3HRHA 1SHUX 2MYNA 1L1FA 1VBKA 4DMLA 4DCUA 1A96A 3PUKA 1R8XA 3D8RA 3DVSX 4YASA 3EOAI 2WJGA 1W6UA 5IM5A 2JIQA 1MAAA 4OTZA 4O2BF 1N6KA 5BT9A 4TRNA 1FZTA 2WUWE 3PUYA 1B3BA 1DJPA 3C8DA 1EWKA 2BH9A 4PLCA 3ZXXA 4G0NA 3N74A 1PUJA 4XWOA 4N41A 4X6LA 1KJ8A 1OBOA 5JLAA 3G59A 4B7UA 1NM5A 2AN3A 1JHVA 5DHTA 1XMPA 1Z6YA 2BH2A 1XR3A 4TV8F 3EMKA 2JBAB 2PM8A 2VT2A 1C3JA 1DXOA 3H18A 3H11A 2IH4A 1WOMA 3B70A 1IE3A 3DZFA 3NJRA 1N9GB 4BMOB 4JN6B 1RRVA 1ZGAA 3P5SA 4ZTBA 2GBGA 3PQEA 3K6RA 4R1NA 2HJSA 3X2FA 4YMWA 1RMQA 5GY7A 1IQUA 1GG9A 1GDHA 3EDRA 3RTAA 2CL0X 2Z0MA 5C7LO 3RF7A 2PV7A 1S2DA 3QE4A 2SBTA 2IU6A 5MF6A 3EDQA 4PG5A 1E7YA 1KOLA 2YVUA 3K35A 4U3JB 2A6PA 2Y68A 4H6WA 4A3SA 3FMPB 1PFQA 1Z5OA 4CODB 4I2NA 1QHNA 1IUPA 2TMYA 2P2LA 5DGIA 3CMMA 5LDDC 2QOEA 4JXXA 1QLJA 4MLPA 1CVRA 5KTNA 1OD6A 1Z4QA 4MUHA 4NOKA 4NCIA 3V97A 4BQQA 2JGNA 1CQIB 1Z4NA 2I6SA 1D6JA 1IPEA 2CVHA 1P1HA 2Q3LA 2YJ3A 4URWR 1T4MA 5H59A 4I3HA 3WISA 5BWOA 1EP1B 4KTTE 4CLXA 2CLMB 3VPXA 2ADMA 2GB4A 4UM8B 3BSYA 2O06A 2CFOA 4XWTA 4QYSA 1U2DC 4TWIA 4UHBA 4URFA 3GBVA 1K4YA 2VZEA 1KH3A 1ULTA 3NYIA 1NOJA 4Q9NA 5EWMB 1CDOA 3DEFA 4BKRA 2FCAA 4DXHA 3C3CA 1ONSA 1MABB 1XU7A 1I5RA 3IV7A 4XEUA 3JRNA 3MD0A 4B6PA 5BSHA 1AKVA 5B1EA 1G2PA 2Q6KA 4XJXA 1QIEA 2WIAA 3GIWA 4UVIA 4R3WA 2AQHA 2XBMA 2H52A 1AGYA 1IN4A 1PSDA 1Y3CE 3L6EA 4F9TA 4BO4A 2I4NA 2QKYA 1CQPA 2GZ2A 5AW6A 5T3UA 3NBKA 3UMSA 4DEYA 1F8XA 4BBJA 4AI6A 2IE8A 1ODKA 5DSZA 1D2MA 3DMGA 1QG0A 3VJKA 2B5VA 4LA4A 1YFKA 4NEHB 4HJXA 4UHKA 1MEEA 3L1UA 3PRHA 4IJWA 1KAQA 1ZH6A 4RZQA 4YCLA 1K6XA 4G0WA 4P36A 4LVNA 2F1KA 1E9RA 3DWEX 1F2UA 3QIVA 4DBLC 3AR8A 5EQFA 4LXTA 3KE9A 1CJSA 4G4JA 3UFBA 3ZGVA 4AO6A 1SBTA 4DA6A 1QGUA 3TG8A 1GQYA 1IBLB 4QECA 3E48A 4B83A 3ITKA 1BFUA 1C4KA 3P0RA 4P93A 4WINA 5A7HA 3D0KA 1KARA 5DTMA 1E2DA 3IALA 2G04A 1XSEA 3LO8A 3DCNA 2XQGA 4E5KA 5AW7A 5IU6A 4R54A 4BVEA 3A9SA 3NHWA 3GWGA 1XXHB 4QTYA 5J2UF 1LWNA 2IIBA 4IMPA 4UKDA 4Y2YA 3K8YA 5K2OA 4BX9A 1O6BA 3PJRA 4P7KA 2IKSA 1WSDA 2JFXA 4WASA 4Y2QA 4EJFA 1F6BA 1YD7A 3IBTA 4QA9A 2ZRHA 3WHPA 1SU6A 4DR1B 1OTHA 4GBJA 2AC4A 4J0IA 2WV9A 5BWLA 4ZJPA 1J2TA 4GQAA 3GLFB 3I2KA 2C7RA 3PNMA 1U9IA 4DV4B 3AFIA 4LHSA 1JVSA 2WSSA 1GAJA 2HRCA 3C5CA 3DS8A 3FNEA 1KL7A 3K0EA 2C2OA 2RGNA 2V4UA 4KZPA 1E3LA 1E9BA 4CV1A 5IZCC 3AI7A 3C6KA 1QFYA 2CNDA 2W48A 3DKVA 3GK3A 4QUGA 1TYAE 1CUFA 4EMUA 2P9FA 1Z5ZA 3RDPA 5HP4A 4JT9A 1VL5A 5IVHA 1K68A 3BX1A 2MTBA 5CEEA 3IMCA 3AJ8A 2YV4A 4N0DA 4TT3A 5F64A 3SG0A 2CHVA 3UMCA 4FLEA 3R75A 2R6ZA 3WXMA 1V8PA 2ZBQA 4L02A 4AN4A 3VDQA 3REQB 2JHGA 1PNTA 4IKEA 4C7OB 4Q3LA 3BTUA 2WTUA 2ZSFA 4DHEA 3C1UA 2HA6A 3LSTA 2CL5A 2O8CA 4TKUA 2CXPA 3LKDA 1ZIPA 3CKMA 4PLWA 2XQIA 1BMFD 3DWGA 3O94A 5T4FA 1Y80A 3FOEC 3R74A 3UB4A 3F8WA 5ALPA 4HTAA 1Y37A 2EG5A 3O3NB 3GFPA 2BGTA 1ZM9A 2C5LA 3C6BA 4ESOA 2WF7A 5L95A 1Z12A 4XPZA 4FMBB 1UJBA 2YJNA 1KVUA 1LJ8A 1X1EA 3RRMA 3NTQA 3W3AD 2F8TA 1EVZA 1ISPA 3SD7A 5KTRA 3DTNA 4BVHA 4YP9A 2VP2A 4EZBA 1PVVA 2HB6A 1K89A 1P91A 2V3WA 4GS5A 2CZQA 4ZJZA 5K0GA 4PVDA 4XH9B 4MICA 5C32A 1ZH4A 2FETA 3Q3GE 3M5CA 1YQEA 1WQ3A 4GM4A 3FWPA 5JXJA 4CF3A 3OIWA 4TM8A 1GPMA 5AT1A 4R9NA 1H2BA 3PC4A 2XCRB 1IXYA 3DTTA 1EQAA 3NAMA 5EE5B 1BJRE 1OBVA 3JQ8B 1M67A 1KA9H 3QEMA 3AHEA 5A4KA 3G5TA 2ECQA 2IZ0A 3RFXA 3IEXA 1U0TA 3QXJA 2FGJA 4XGIA 2I6GA 2R44A 1QFXA 2OVFA 2RHHA 4AX4A 1J21A 1Z2OX 3AL2A 3PE3A 3QXSA 3R5HA 5JC1A 4WCFC 3HUUA 4LNUB 1TUGA 4N82A 2ZI9A 3INYA 1SEPA 3AUTA 3HBNA 3W8NA 1FRQA 1N8KA 4XTRA 2JVJA 4F3KA 4LJYA 2X3UA 1D5CA 4XD2A 4YJGA 2CWDA 3QF4B 2C98A 4C0SA 1QH8B 3CKYA 1T8TA 3JD2A 5FPSA 2ZWOA 1WAMA 1RAFA 3LQ2A 5TT1A 4YMLA 1L0BA 3L01A 2YRXA 2IXAA 4HB0A 3NO4A 3P9ZA 4NBVA 1L5LA 3W2EA 2GBLA 4KQGA 2B6NA 3N3BC 1D04A 4CLDA 4IJMA 4OSPA 4EY4A 2A4KA 4PIVA 3PCTA 3KYJB 4GMGA 5HSGA 1E94E 3HV0A 3CNHA 2H0AA 2WYHA 3ZXSA 4GNRA 2RGEA 4RCZA 1HLFA 2PX8A 2ZYUX 1FFDA 2O7RA 2WP0A 1U5BA 4MUYA 1Q7GA 2NQTA 3IVCA 5HILA 3ZY6A 4DSAA 3FPKA 4MKIA 1XPUA 4WESB 3D3WA 1XE3A 2NP6A 1H69A 4U2KA 4MKGA 1UBOS 2EJUA 2QVBA 4EO4A 3DFKA 3C3JA 4QBFA 1C7ZA 3TNJA 5IEBA 1VSBA 1QR6A 3VR1A 2I7CA 3U19A 1TCVA 3S6JA 2WHEA 4KQMA 1P5FA 3B52X 4RWZA 3OSZA 5ENZA 4AJNA 3ZWCA 2VJMB 2B0JA 3AB3A 5BN4A 2CFCA 4TKVB 1MHTA 1YVDA 2HDHA 3LECA 3UO8B 5GVSA 2ZB4A 1X9HA 4N1AA 4N3CA 1JEYA 3MWEA 4D9MA 1TLLA 1CT9A 1KQGA 5EVJA 3H5IA 3K94A 3BGIA 3LNCA 2EGUA 2QVYX 3KL4A 1T5HX 4OIFA 1B6GA 1TT5A 4XGKA 4XI9A 3RJZA 4EKNB 5K8VA 4XA8A 4FYVA 4MRMB 2FR8A 1ZCJA 3MJ4A 4DNFA 1XVVA 2G4VA 4D98A 4X45A 1TIKA 2R11A 2Y0BA 4BO3A 1XKLA 3O9MA 2H9YA 1I7PA 4X6UA 3PEUA 5C53B 3WAKA 4G4SO 4JBYA 5A2GA 5IH7A 1QLHA 4FYIA 4EATA 2XXJA 2QJRA 1TMYA 1UMCB 3MT0A 3NEPX 3OJ0A 2XIJA 2WZDA 4H0FA 4OQPA 1RXIA 3EMDA 2R8RA 4V0RA 4IIUA 2WM2A 4YYEA 5DHRA 4TSKA 2H00A 4GGMX 2X5XA 5BYBA 5HMLA 3UBMA 5JT1A 3WGHA 2CKDA 3M4JA 1RMTA 1SHJA 3MJSA 2GVZC 2JFHA 3A9CA 4HH1A 4R6WA 5CT8A 2OV8A 2QG4A 1RBZA 4O4JB 4QQRA 1DZ3A 2XEDA 1I1HA 1TZ2A 2Y93A 5F52A 5IDVA 1KEEA 1BHQ1 1SCKA 1R0CA 3AEXA 3S4YA 2P5TB 2YZGA 4KGXA 4TX1A 3ZQKA 1Y1KE 5DWDA 3SS7X 1C29B 4BFSA 2BFDB 1LSSA 2Q3MA 3WFIA 2M1XA 4FZ5A 3WYAA 1M1ZA 5EP3A 4YCDA 4ZREA 5JCJA 1T1IA 1Z8DA 3IUPA 4Y6QA 4O4IF 4XQ9A 2GRAA 3A28A 5EIWA 4NBTA 4QXAA 1GV0A 3OOYA 3VR3D 2DR2A 4MVWA 1PR6A 2BM0A 3LFUA 1J25A 3VPDA 5C46F 2XRMA 3TRDA 2FEKA 4E5SA 4ZJUA 5JFGA 2QTFA 5CB0A 3P32A 1M66A 4II3A 4LISA 3RS0A 2WIDA 4Y0AA 2WSIA 1NHWA 1TVCA 1VLJA 3COWA 4KU4A 4RYDA 1Y3FE 3JD0A 4ZVLA 5BSTA 2GAAA 2AFHA 3AW8A 3JWGA 2RGUA 4PRLA 2XB2A 4KJZA 3SLRA 3USZA 1GPJA 1LPOA 4D3ZA 3HYNA 3WWDA 5KOHA 4NBUA 4TYPA 1RJ9B 1WB9A 1KKUA 2QPLA 4IAOA 3QPUA 2Y0EA 2M32A 4J9VA 3LS2A 3PUXA 1FS5A 2ZSAA 1Q7TA 1E1CA 2VDLB 2WHPB 3PYLA 1JKXA 2H1FA 1Z4JA 2NUBA 4F9EA 1L3CA 4DV2B 2XZLA 2BI4A 4JLNA 5T4EA 1QOQB 3RSHA 3R2JA 1P8JA 3MCTA 2AGVA 2WHYA 3RK0A 2ZAYA 3SYKA 1K6JA 1CUSA 2BV3A 1T91A 4MRAA 5BVGB 2IYEA 3ICEA 4BEJA 1Y7TA 1RP1A 2AVNA 3VO9A 1ZY2A 5DSXA 1SUEA 1SURA 3A1UA 4M1KA 1GKKA 1RYBA 2K4MA 2X14A 4ZO8A 1SIUA 1ULUA 2F7SA 3CHYA 1AZLA 4ALLA 4KR6A 2NQ2C 1WV0A 2I0FA 2VA8A 3CWZA 4TM7A 5FUBA 3FVRA 4ZOEA 2OCYC 4GYJA 3V42A 2P9EA 1L1QA 1DFIA 4KRYA 4C07A 1WZCA 1PJRA 4KLCA 1K0FA 2NTEA 3OPVA 3KYDB 2PZ8A 1CZUA 2E4AA 1QIMA 2ZRPA 4KO8A 1JIIA 2JAWA 1JQLB 5D3KA 1P6QA 2J3QA 1UPUA 3E4DA 4D5GA 2NMVA 2G5CA 1IG3A 1J70A 1OC4A 2AFIB 4HAVA 4HNSA 3AIMA 4MI1A 3T4EA 4EHFA 3G1UA 3HWSA 1SELA 2FPRA 3ENZA 3EWAA 1PT5A 1UL1X 4NFSA 4WX2B 3WLMA 5J47A 5JSYA 4BMPB 3NWBA 1VI2A 2QLNA 4EY6A 5A06A 4JI7B 4D4JA 3O8CA 3L7JA 1ATIA 3WHKA 1ZVMA 2FW8A 1RXUA 4KQKA 4IDAA 4HZUB 4LE1A 3SC2A 3OQPA 2UUCB 4MWEA 4Z8XA 3KFVA 1HZZA 1MO6A 3L8DA 1NXSA 3NH6A 1BE0A 3KTAA 2WV7A 1EX7A 3M49A 3BMCA 3THXA 2BKVA 2GASA 4P3YA 1JYEA 4DSNA 4M6WB 3H1AA 2VJDA 3FCUB 1VCIA 3DLHA 4KSYA 1UAYA 2AG5A 2WIGA 5FOQA 3ZHSA 5CLFA 2WAOA 1KO5A 2WYWA 4CMKA 5GOTA 1SVMA 1ZQ1A 5E7QA 5FNVA 3T8YA 4P3KA 3PTZA 2HD4A 5AXCA 5GTDA 2HA5A 1M7HA 4QTTB 1TGVA 5B37A 1DEAA 4EHIA 4TYYA 1TAHA 2DH6A 2PKRA 4J90A 3G8BA 3NANA 3U37A 3JRXA 5I7RA 2QTZA 2WU4A 1JKJB 3JQBA 1XTUA 3T0FA 3B3GA 3A6DA 3FMVA 4TQUS 1CUZA 1OLSA 2FZVA 3N2KB 2ANCA 2GOYA 4IEIA 1LBIA 2XAAA 3KO8A 3OESA 5KJEA 2X4IA 3WWPA 1ESEA 2ZWMA 3LYAA 4K26A 4XOUA 4JLJA 3V3TA 5IMSA 4DNQA 2YJZA 4FYMA 3WB9A 3V8MA 1FXUA 1KYVA 3DTVB 1TW3A 3CX3A 3EGCA 4UEWA 2VBFA 1PZMA 3AI2A 4OFZA 2EEZA 4TXJA 5JI3E 1G19A 3MWYW 1RWKA 4I4NA 1VG8A 1TQ4A 1U6KA 1N6LA 2L69A 1S3SA 2XD4A 5E9QA 5GJVC 1YHZA 3U4CA 4C4OA 3C4JA 2K7ZA 4YV2A 2YFYA 2VHUA 3AGQA 3UPUA 2O48X 1R8SA 5BSGA 1VHJA 4RSHA 1RSZA 2J5BA 3FPJA 2RCYA 4FTWA 5FQNA 3TN7A 1PTJC 5M7EA 1Y8RA 1VTKA 4AUMA 4EMTA 4BQEA 3WK7A 2VQFB 1NN1A 3CZ9A 5E9AA 3W7VA 1GJRA 4F56A 2JH3A 1JZQA 2AEJA 1G7TA 4B79A 2ZRFA 3W3ZB 4BB0A 2I99A 2ZRGA 2EYQA 3SBEA 4AN1A 4NZOA 1DAKA 1Z29A 4JNKA 4MS1A 1BDBA 1GARA 4ZPXA 2UZ3A 4KN6A 2QTBA 1HOXA 1NMSA 3DHVA 2LNDA 2WSMA 4A2CA 3GEMA 4UBIA 3BXXA 2QI9C 4QM7A 1FP4A 2GGSA 5TV2A 1XZQA 5AVTA 4EF4A 1Q17A 2PL3A 2P1DA 2NSLA 2SICE 3DMFA 2P77A 3KK0A 4FS8A 4HYEA 2GM5A 3L5KA 2B7BA 3N0XA 4JLSA 4DARA 5BUCA 4FYXA 1CQXA 3L0SA 2BKXA 5HJEA 1BVYF 1E9CA 4TTRA 3CGGA 4I1VA 5HOQA 3EG9B 1TAQA 3W4KA 2RH8A 1UANA 2I34A 5AVUA 3PQCA 4DLZA 4HNHA 1DKOA 2DTDA 2LV8A 1YIDA 2ZLBA 3C14C 2Q9BA 3A8TA 1J0DA 4M49A 5LCXA 3UXEA 2UXCB 2Y66A 3DTVD 4EUEA 3PDWA 2W2QA 3IP3A 4DYDA 1OTYA 1M6WA 1YKGA 3SMVA 4YRMA 3B1WA 3LPNA 3TIGA 4HWGA 1QRRA 3ND6A 1QRTA 3OAAA 3HU3A 5FPYA 4JLMA 3O75A 3QXHA 2R1VB 1HO3A 1CJMA 1Y9AA 2EZ4A 4IIJA 1Z22A 3U6BA 1KI3A 2D1TA 4UBLA 4LOKA 3B89A 3KQNA 4ZAZA 2Q3DA 3KEMA 2RIPA 2ZYWX 1R6BX 3DD5A 4FP9A 3TDKA 4BE7B 2W9XA 4OI1A 3NKFA 5G1PA 1ZW6A 2AQ8A 2N0SA 3KEOA 5A5EA 4BQSA 4FI3C 2R3SA 3BRWA 2QU7A 2OXEA 3YASA 1Z35A 1H0SA 5HTKA 3ZCQA 2FSGA 3N53A 5HUQA 3TBHA 2XVMA 4WZAA 1AKUA 3JALA 1DQZA 4B0PA 1VHTA 1IY2A 2PS0A 1JIUA 3I58A 3IUMA 3Q5EA 3QVXA 2VT3A 1ZGGA 2ZK7A 2PYDA 3HDQA 4MO9A 5D3MA 3RV4A 3S2SA 1F9EA 1L9KA 1PDOA 3OKPA 2WILA 4QUIA 3T9EA 4S2UA 1XVTA 4HWPA 4DCOA 1T8PA 5A3QA 3HMKA 3HCRA 4ITVA 4Z9BA 2BF4A 3CCCA 2QN2A 3WK4A 2AN1A 4E22A 4HDRA 1W52X 1E3QA 1UXKA 4QVGA 3HO1A 4JD5A 1W59A 1EVYA 1GUYA 4ND8A 3AXSA 4KVGA 4RVOA 1G0NA 3H5LA 3IRVA 3KTFA 1UBFA 4QGHA 3URMA 5JDCA 1SZJG 2VJQA 3LBNA 1X92A 3VKUA 5B36A 2AC2A 4RSMA 2ZYSA 4LJSA 5KX5B 2EZ8A 1T1SA 3S1AB 1BN7A 1CUVA 2NACA 2HA0A 3PPVA 3ROQA 1JG6A 2QB5A 4CKWB 2FN7A 3LA8A 4TQ9A 1TCBA 2Y1KA 4KE9A 4KO3S 3GDOA 1JGTA 2FRDA 3A6ZA 4TXHA 4X97A 5B64A 1WQ1R 3F4LA 4B3IA 2F1JA 3OLVA 3GVHA 1EBUA 3CUTA 1P2TA 4IZHA 4CG0A 4F0JA 4RVCA 4NCHA 5JXHA 2VL7A 4H15A 1H8HD 3QU5A 3ZTWA 1U0GA 2WD7B 4IKPA 4JJGA 3ESCA 4E5PA 1V4VA 3DVAA 3KB2A 3JQRA 4EB6A 4M38A 2Y4NA 1TF7A 2V6GA 2ZIGA 4C0HA 1NATA 2GJKA 3PF9A 4HVCA 1JZSA 5HUHA 4JA2A 3QTLA 1GT6A 5HG0A 5JXWA 2ZB3A 4ARIA 5EXSA 1S8NA 5IW8A 3W1EA 5KQPA 3HDGA 5CIYA 4CWAA 3P9QA 1XNRB 1U8AA 4KI7A 2WKSA 5AJTA 5DU2A 1QE0A 3H83A 4X6XA 1KSFX 2RJNA 3LQ4A 2V55B 2FFAA 3P4XA 1S3IA 3M1YA 2IU4A 2JNWA 3TSYA 4B43A 4BMYA 3WGJA 1Z6PA 1IMOA 1RW4A 2IXFA 4RIIA 4DDHA 2WQ6A 4EKYA 5JC8A 4RK7A 3LT4A 5I5GA 1B73A 4I55B 3ITEA 4KAFA 5K4AA 1GP2A 3M6XA 2ZIAA 1UKZA 4R68A 4IJ6A 4JI1B 2YXEA 4YGXB 4UUMA 4F60A 1EP2B 1O9BA 3AEQA 3KUKA 4QQ8A 2HLHA 1NVGA 2YC4C 3HGTA 3MSXA 4FC6A 1NYLA 2EHJA 3VZQA 4LFBB 4W1RA 3HSYA 1Q3HA 1IEWA 3I92A 4A10A 5AI0A 3RRXA 4EWLA 1NN3A 3IQDB 4OQDA 1GNVA 2CZCA 2JEYA 3TYXA 2VCYA 2VO1A 1XZNA 4GT1A 5BXQC 3PJFA 1EWQA 4N4AA 4NPCA 4IQFA 3G9ZA 3G02A 3ZCRA 3OF5A 2QG6A 4PAWA 3I4FA 1UWLA 3LV8A 1WB4A 1UFQA 1KZ6A 3VQTA 4UTVA 1E18A 2XMZA 3HB1A 1YQUA 2ZXUA 2V58A 4F4DA 2J9FB 2R7LA 2WIKA 2X0RA 2B6HA 3RVRA 3RS7A 2HWUA 2ZIVB 5EGNA 2ZM6B 2IZ5A 3S2EA 3BB4A 3RYFB 5DRTA 3ZD6A 5IVDA 3IV6A 1ZICA 1FW8A 2LXNA 3R3UA 5B58T 3IS3A 5ECYA 1W94A 2GCIA 2VWPA 3MTDA 2HNBA 2KBFA 4A26A 3DGFC 4HPJB 2JRLA 3C6ZA 4BUZA 4DLBA 3PQ3A 5F98A 3ERCA 1Y1PA 2A9RA 3NJ4A 1KK1A 3U0VA 4IIBA 5JSHA 5CCBA 3SHVA 3GEGA 1ABEA 1EKXA 3RSCA 1AD2A 1HL7A 4AG6A 2JLUA 3SP1A 3CVVA 4DV0B 1BMQA 2Q07A 4UU1A 1THTA 4FHCA 4GNKA 2H18A 3S2ZA 1G20A 4MI6A 1C5KA 4GYKA 5GAJA 4CM1A 2P78A 3W8FA 2BCEA 1C0KA 1T34A 2BDTA 2J6BA 4UM9D 1CEQA 3NLLA 2W00A 3THYA 3IBYA 3KT3A 5IXYA 2HMAA 3L7AA 1UOQA 3QFHA 1SD2A 1O4WA 1YAJA 3GUCA 3L7CA 4IXTA 2X40A 4FHDA 2EAUA 4RNDB 1MC5A 3WIBA 1I3KA 1IQ0A 2FPGA 3EDCA 2Q5JA 3CUSA 4E4RA 2B30A 3NP7A 5A4JA 2W8BA 2W98A 1PG2A 1VE9A 4UCQA 5CDFE 3PA6A 5CXUA 4ZYZA 2FN9A 1E1NA 1NX9A 5KVCA 2WYOA 2Z5GA 5DBHX 5LDGA 1NNSA 4D6XA 3LRTA 5EKUA 1X7WB 2FG7C 1YOVB 3Q3HA 4JQZA 4FQ8A 5AJXA 3JD1A 4PQFA 5CNJA 3SJZA 3TJZA 1BS2A 5AVJA 2ISQA 3HA2A 3SBDA 2BHSA 4KR9A 1ZJ5A 4JENA 3IX7A 2FSPA 3CCBA 1JR3E 3O4FA 4YUVA 1PS8A 2QI9F 1TFUA 1XPRA 2G9RA 1YJQA 3NTUA 2HEGA 2VP5A 3I37X 2QAIA 4CCWA 1F2TA 4X91A 4GOXA 4GZLA 4JP5A 2MINB 2KI5A 4ME6A 1X86B 4UVGA 1Q6ZA 3Q6NA 4NBWA 5EJ4A 5ALWA 3MJFA 3KVVA 5AM3A 2VJBA 1II8B 3WSVA 4OI0A 3C16C 2COEA 1WXEA 4NQZA 4OQFA 3G2OA 1SHZA 3ZY4A 1HT2E 1JALA 1SO8A 3C3WA 3L4EA 3O31A 2ZRJA 1HV8A 4H16A 5DGXA 4G89A 4G1VA 5F33A 5TMBA 1WG8A 1YZFA 3F6BX 5JAHA 2XNJA 2LKCA 2H2GA 3I64A 1AZTA 2AX4A 2WF5A 2IV3A 4ZMSA 3PRJA 1NPDA 2MMGA 3ELYA 4NECA 1F60A 2NUPA 3L1HA 4XOIA 3P26A 2X2PA 3P9RA 3T9DA 1UQTA 1T5BA 1WXFA 2CVQA 2FNAA 4F2PA 3T1HB 1NLMA 4LJ5A 3HDVA 5JDIC 3HFGA 2ERYA 2OHXA 4ZU6X 5KJ6A 3FTPA 3JQCA 4NMWA 3WFZA 4U9HS 1O8CA 1Z38A 4FI3F 4IO1A 1M5RA 1XDUA 1XAIA 1PHPA 2JLCA 4H7IA 1UDXA 1Q83A 3Q3CA 2YVAA 3JAWB 4MV4A 2FQQA 2E48A 4YAGA 1W49A 3FNIA 1OBFO 1Y4AE 3AYXB 3H05A 4ABTA 1ZRMA 4YWJA 4DCMA 4HQ0A 4C5BA 4M9ZA 3OPNA 4A6DA 1PNVA 3DOUA 4Q7QA 4C88A 3TD9A 1IOLA 2VK1A 3DT6A 2FPPA 2GKGA 5JYBA 2X0IA 3IDFA 2OK8A 4PYMA 2PL5A 1WA5A 1AM4D 1SKYB 2QTHA 5DYTA 1XPJA 2FZWA 4JFAA 5HKOA 2EBUA 4B0OA 3VO1A 2WD9A 3B82A 1TMGE 1X80B 1YZ3A 2G4LA 2FF7A 3E81A 2Z9CA 4L9RA 1Q5PA 5ESWA 1EQ2A 5FPKA 1AQ6A 1K5PA 3OJLA 4EARA 2PNFA 4MQBA 1XAHA 4OYLA 2AJBA 2IZ1A 2GF9A 3TUJC 3WYNA 1LI7A 3C4VA 3PQFA 2J4DA 3OKAA 2FQ1A 4C22A 4PSDA 5DI3A 2YVLA 1G2OA 1E7WA 5LLSA 1F6DA 1QPGA 3OZUA 2JLZA 3R3VA 3LC0A 2QM3A 1U0OC 3DNFA 4RS3A 3RM3A 1A2QA 2X7JA 4TVOA 4RKYA 4PGMA 2MIIA 2WRZA 1MH9A 5CW1A 3GLHE 4EQ6B 2I2FA 5HQTA 1GVNB 3I1JA 2QAGA 1EGHA 3CR8A 4NVRA 5FEUA 3TUIC 4N0QA 5H3LA 5A03A 2FDCA 1N6IA 5JE8A 1JLRA 1Z47A 3PHHA 5BW5A 2CXOA 1QVVA 3DT9A 2C4NA 1G2QA 2PKQP 1MRZA 3OIVA 2FVXA 3G9UA 2JD0A 4BO6A 4G85A 1A4RA 3UJHA 2PH3A 3BRQA 3Q7EA 5B2ZA 4DN6A 5L40A 1QXSA 3FMIA 3ZWKA 3SI7A 4RV4A 3RYCB 2H2DA 3I1YA 4QL3A 4LJ4A 4U8HA 5AKJA 4CDRA 2G07A 3KTDA 2C20A 3WLSA 1T2DA 2PQ2A 1Z26A 4RMGA 4OXXA 4AYXA 5CFNA 3T1YB 2AA3A 1IN6A 1AK9A 1PR4A 2DR0A 4C4RA 3BA6A 3GCGA 4NK5A 1CJTC 3LXUX 3PEFA 1P29A 2PO5A 1H1LB 3AU9A 3MTIA 1H2WA 2B3TA 2YN0A 4OQNA 4ZU1X 1XA4A 1JDBB 1M6VA 5C9ZA 1YUBA 3L8ZA 4DS3A 4MP6A 3HDYA 4LJLA 1P4RA 3HB9A 3RNLA 1LQTA 5WRFA 5JCZA 2JLWA 3B8EA 2AMVA 3CXRA 1DBVO 5BR8B 2JHFA 3BXGA 5CG2A 5HVNA 2X8AA 1QO0D 4DZZA 2H51A 3CF2A 4G86A 3HB0A 2F67A 4FYKA 3AONB 3ZJVA 2NVUA 1OXTA 1ZINA 3IDSA 3K09A 4P3NA 4ZO6A 4PZDA 4FZJA 3FFAA 5FTMA 2ZZKA 1VCNA 4YR9A 1GYRA 1S1CA 3R20A 4HX2A 4RH3A 2RH5A 2FFRA 3A26A 2VPTA 5FWYA 1Y4DE 3PFIA 1BW9A 4B85A 2LE0A 1DBSA 1HMYA 2OO5C 3UGKA 3UUFA 1K06A 1OT5A 2WFLB 1ZI9A 3HADA 3OECA 3OMXA 4EFKA 1XZCA 2UVPB 1C9KA 3LY7A 4J3FA 2GHIA 4WW0A 4YDHB 4Q3CA 1ZNWA 2PPVA 2P7IA 3FTCA 4PN7A 3LUFA 1C9YA 3WKEA 1EI9A 5FQOA 1E59A 3OCCA 4RM2A 4Z4IA 2X9GA 3RSQA 5JO0A 4YCJA 3OTGA 2FZCA 4EEXA 1XNHA 3ABSB 4RTLA 4YFYA 2XHEA 3KXPA 4NAHA 1BEZA 2JCSA 3VH1A 3WHIA 2ZT6A 3FNQA 3NNSA 4MCJA 4O4JF 3LE8A 2WSYB 2BD0A 2IGBA 3H7IA 4G5HA 1P4HA 1N2SA 4RNCA 5EUCA 4BC0A 4OK5A 2XXAB 1A7AA 2P62A 3E7XA 3BWMA 2NU6A 1E9SA 2GBIA 5JRDS 1XKTA 1RPNA 2JIDA 3HL4A 4G5XA 4TKMA 1VKRA 1YJCA 5K20A 1EB9A 3TNLA 3NM6B 4D42A 1G1MA 4L2IA 4M55A 1WU7A 1G66A 3LUDA 1Y5MA 4R69A 1SWVA 1EDDA 5BV7A 3O4IA 4E4TA 2APJA 1L6RA 2DBRA 3NDJA 1TA4A 3O8BA 4YIKA 3OFVA 4DGQA 2J0QA 3TE7A 5CM2Z 2OFWA 3LFHA 3O21A 2J9GA 4H1HA 3K92A 3FE2A 3IXMA 4NYJQ 5LUBA 3VOSA 2JKZA 4MUGA 3ME5A 5DTQA 3UG6A 2ZSUA 1S2LA 1UP4A 5IKEA 1ZN9A 4PONA 2R1UA 1YHYA 4WHMA 2ISSD 1XJWA 4TLCA 4LOJA 1U2EA 5DNYB 3IEKA 1V5GA 1EVQA 1N2EA 1N2HA 3LCJA 4S12A 4CU5A 5L9AA 3MOIA 1ORHA 4IIFA 4K6MA 1UADA 3BGVA 4D81A 2NV6A 4C0QC 1QCCA 1KETA 3ZWWA 3U44B 2JD2A 5EHQA 4UTPA 3D4BA 3ZS8A 2WFAA 3BXHA 1CJUC 2Y1WA 2J9XB 3KKNA 4CMBA 2IZ6A 3VPSA 1CLUA 1JT2A 4M76B 5L3VA 3LYLA 1NMQA 1PDVA 3Q3IA 2CMHA 2QMUA 2Y6VA 3AFGA 3P4UA 4JELA 1EFAA 4QWMA 1ZISA 3KOZA 3OZ7A 5JAQA 3ESYA 4MDFA 3OZDA 3E7DA 3EAGA 4V0ME 3U4HA 3PEEA 4O2AB 4W5QA 1DCTA 4ZYVA 1JU9A 4NATA 2F62A 4R8KA 5FLKA 1ARZA 3GPCA 4QEDA 2DHCA 5F4BA 1M1XB 3JATB 3UAZA 4JJ6A 1E63A 4EAQA 3T06B 3TCKA 4AWAA 4DWVA 1MDFA 2P2ZA 2DOKA 2VHTA 3CLRC 3JASA 1SKAA 2C31A 1RLOA 2ARKA 4AJ9A 4E7PA 4QDKA 4HX9A 5ES3A 5L3QA 4ZQIA 4JYAB 1KC3A 1QHYA 2D5BA 2WBLC 3F5FA 3O4VA 4IDPA 3FSRA 1KFCB 3H2ZA 1ZGBA 2O4CA 5BN3A 1QC5A 5JJCA 3MFQA 1OGIA 4LK3A 4CXMA 1DV1A 5CURA 3FJYA 1N2XA 3VU3A 1FRNA 3JWPA 2XZTA 3PYXA 1VLMA 1JIXA 3KQOA 2ZIXB 3X1KA 5G0WA 1LX7A 3PUHA 1ULSA 2VOJA 2QTLA 1E5DA 5LVAA 1J0AA 2YW9A 2W6ID 1ZP6A 3A0UA 4ITUA 4D44A 2GESA 4F5YA 4BV3A 4IMJB 3AY3A 5I9SA 3ZD8A 2II6A 2ID4A 3V8RA 5JAUA 1FSPA 1XIVA 1T9CA 1PZFA 4BAUA 1U11A 3G0DA 4IWNA 4UJ3A 3WNCA 5A9RA 1NSFA 1F4LA 5DB4A 2YYAA 1GUBA 4AJ4A 5AK0A 4CM3A 5A1TA 2O50A 5KQGA 3AF4A 3ECCA 4DLXA 1TO6A 2P90A 3Q98A 3ZJ4A 1VM6A 2VPXA 2HOQA 1I51A 3OEED 4NAVA 3EEFA 4FDLA 2AW3A 1B6RA 3DDUA 3LF1A 2PBZA 4JLDA 1G3QA 2FQYA 4L0QA 1V3UA 2RSLA 3KQMA 4EI9A 2F1HA 3H1GA 2JZNA 1P73A 2OC9A 3I0MA 1YQ9A 4AO8A 3M2TA 2PUBA 1YB6A 5KHLB 1IJFA 1G21A 1LNSA 3R0XA 2JKVA 4MUXA 4B7XA 5KYYA 1XN4A 1ZGHA 1RYDA 2J0UA 4RE5A 3A1FA 1JSCA 1UCFA 1PJLA 2WWGA 1N2ZA 2PLNA 1XCGB 3DVLA 3OO0A 1JDVA 3KD2A 1BAPA 5AXBA 1B41A 3PB3A 1H5NA 3ZW8A 3PLRA 1EZZA 3GVCA 3NRCA 3VVBA 2GZ3A 3GBPA 1XN1A 3C85A 3QWBA 1BS9A 1W34A 2FSIA 4M0CA 1H0KA 3L0PA 5L51A 1O95D 2BE7A 3FY4A 5JPIA 1YJ8A 1RLUA 2DUMA 4FDTA 4JYCA 3CH4B 3HKBB 3DF7A 4BV2A 4NFLA 1SBQA 4F2DA 3DXYA 1QFMA 1E4OA 3F9RA 1GPUA 3UMRA 4DJFC 4D4HA 4E94A 1KYZA 5JXIA 1L5WA 1OWOA 1V39A 3JYQA 3JQGA 5GMOA 3ANSA 5IJAA 3GUZA 1TO1E 1ADBA 2KJQA 2MMCA 4B3FX 1IAVA 1JN0A 3DEYX 3FVWA 5EIBD 4YRKA 3I3SR 1ZONA 1NQTA 3FPCA 2P3QA 4DJEC 4QZVA 5JR3A 1GRCA 1CEEA 4Q3AA 2KPOA 2WOJA 3GUHA 1S02A 2GEKA 4Q7EA 5FL7D 4LBVA 3DO8A 1ZJ6A 4G41A 3O8QA 4Y18A 1D2EA 3N8KA 3DJFA 3ANMA 4ZRNA 3KQPA 3RU2A 3EUEA 2P4EA 1E9DA 1AKEA 1PFVA 3EIHA 2XQVA 4DC1A 2P8JA 4AF6A 3U09A 1T9GS 5EZSA 3PQDA 4DLAA 1KPGA 3ZK8A 3LC7O 1X2BA 1YZTA 3WB2A 3L43A 2ID9A 5CGZA 4K6OA 4G8DA 1P9NA 3X1JA 1B1AA 1C0EA 3U62A 3BKXA 1T35A 5CH8A 1AGXA 1MX3A 2VQDA 4JU9A 3IFSA 1ENPA 1Y7LA 4JYMA 1E1YA 4Z8YA 4C6TA 2O8VA 3BF7A 1R0XA 3KOMA 3MMXA 1CF9A 2XNCA 5K99A 3BGWA 2FP4A 1LRKA 1H3EA 2FN3A 2P11A 1UEIA 2VJLA 4HD8A 2FLKA 4W9NA 2KW5A 4CKCA 2Q9AA 3QX7A 3OO1A 4OYHA 4Q34A 4EA9A 2J4CA 2JA1A 3HNRA 1R27A 3AUFA 4YECA 4D97A 3QPAA 1Z2NX 1PQUA 3MGBA 2Q46A 2QN3A 3LHSA 5HBRA 3TBKA 2PVSA 1F0NA 2GJSA 3IKLA 1TUEA 5ALKA 1MIOB 3H17A 2G09A 1IIBA 1ZD9A 4MV5A 3TW8A 4B9EA 3ENVA 3OIGA 5SY6A 3BIXA 1VDZA 3K20A 2A2ZA 4EYOA 3D4LA 4D26A 2DX7A 4FCWA 3CNLA 1WL8A 1IIRA 3NHUA 3MK31 4L5JA 4UUBA 2O2IA 3LGAA 2DLCX 1QHFA 4RJLA 3PTLA 1XF1A 3CGWA 4C4YA 4LYJA 1GZ3A 4N76A 3IB6A 3EZLA 2H1RA 3QPCA 2BR4A 2PUVA 4Q05A 4XRGA 1KDOA 3TNDA 5A04A 1BE1A 4CHTA 2UZ1B 2A5YB 1J4AA 2HGSA 3MUEA 4FHGA 4Y7DA 3WBJA 2JFBA 5HHTA 3TNFA 5K9ZA 4US0R 3ZY2A 1QANA 3SJUA 3WWOA 1JEQA 4L85A 1B0ZA 5FOTA 5HIIA 3UUEA 5JATA 1BFDA 3LQKA 4N01A 3VZDA 1UMDB 4RPKA 2JLBA 5JS6A 4DLKA 6Q21A 4YX9A 3WGKA 2WAXA 1AKNA 3SZOA 1P9LA 2H85A 1YA8A 2AG6A 5E6UB 2QM0A 3QM1A 4PAQA 4IGIA 3ROGA 3TLJA 3L7MA 4YS6A 2VPZA 5KPJA 3OIUA 1XMIA 4H7JA 3TQRA 5KX5F 1PG0A 4AKIA 4IUDS 2QRUA 2DT8A 1M74A 2V6FA 3GRZA 3OM1A 3O47A 3RVPA 4KREA 4JROA 5DBOA 5AKLA 1H42A 4YP1A 3GFBA 4PE5B 5FWXB 1Y98A 4EYKA 4E6EA 5JD6A 3W77A 1XI2A 3NHBA 4GPIB 3QNWA 4WA8A 3HI4A 1SU7A 1KDTA 3ZNQA 3ZPXA 4TLDA 4C0JA 1KGDA 3AEZA 1OJ7A 1LXCA 1SBIA 2NADA 4PC3A 3Q8XB 3SC4A 3V4OA 3LM8A 1UOOA 2A0KA 2ZUUA 4QG3A 3ONEA 1KS9A 1AQUA 3WAJA 4GPAA 1I8TA 5CT6A 3MBIA 1UINA 1DAPA 2AXPA 1YOBA 4QJ5A 3GFSA 2B21A 4FOSA 1ML3A 2DGDA 4DAOA 3QX9A 2BM9A 3BCRA 3EFOA 3U2QA 1MO3A 3VR5D 4BLSA 5JNUA 1AU9A 4MP3A 5F23A 3N86A 5LZ9A 4DR3B 3GC6A 1QH1A 3Q3JB 3S40A 3GNQA 4BV9A 4E14A 4G63A 5FXMA 3HUDA 4TVBA 3OD1A 4IF6A 3ZG6A 5K2MA 2C9DA 2Z9DA 3ND7A 1Y7PA 2RI0A 1K27A 3PNQA 3U9SA 3RAPR 1EEHA 4HVTA 1AN9A 1YJBA 3ZBQA 1PJ3A 1Y7IA 2J09A 3V2IA 2R47A 3S7ZA 5EQDA 4OHWA 2F43B 4KIGA 4MR7B 5KDLA 3WL6A 3ZWVA 4KPEC 4DV6B 3R6DA 1MPTA 3O2JA 4CE6A 1VIMA 4PTYA 1WMBA 3GCDA 2ODEA 1ISJA 3GA7A 1JDBC 1NUTA 3HWWA 4J4TA 1J2EA 3GJQA 3K0CC 3U9LA 1OV4A 2PKEA 1E3WB 4GP7A 4XIIA 2BTOA 4F3YA 1FMFA 3T7IA 3OT1A 4IJQA 2DWOA 2XITA 5NLLA 2OG2A 1Z73A 1AF7A 1TW2A 1NASA 4JOBA 3DXFA 5AIBA 2BFEB 1YQXA 3A6LA 3FYUA 3KZ1E 4JKIA 3K0SA 3QHPA 1DIOB 4LF4B 2BHTA 1NNUA 4QJ3A 2Q1SA 1BWRA 5E4JA 2XBLA 4K7JA 3DE3X 4C76A 1FW6A 3V55A 4XVRA 5B7PA 3D2CA 1ZSYA 3GVXA 4QLBA 3IAXA 4BTLA 3GFFA 3EC7A 1WZ2A 2TECE 1M5TA 1M6HA 4MUNA 3RFVA 1I2MA 3ZCPA 1H0RA 2IT1A 2OD7A 3F74A 4UXHA 4C14A 4P0QB 1NVVR 1B8NA 3FSJX 4IY1A 3VKVA 3PCXA 3TSWA 5KAMA 1TTHA 2Q4OA 3K0FA 4X93A 4GICA 3U60B 4Q48A 2B35A 1NBOA 5AICA 1EFCA 1XA3A 3L7NA 5FEMA 4N5IX 1EFPA 2GEBA 4D4GA 3O83A 1JA1A 2R8ZA 4LG1A 1Y33E 2P67A 1IM5A 4FEAA 4P31A 1ONOA 1VMAA 3GFOA 1HG1A 3AI1A 3M1AA 2Z2KA 1R0KA 4A0SA 2VTBA 2IIPA 4XB2A 5ADUS 2PVCA 1FPQA 2PX3A 3NT4A 4X61A 3X43A 5JEEA 1O3YA 4MCAA 1NE7A 2A84A 4QXRA 2HWYA 2Z57A 3ZIAA 1FU8A 1XZJA 1GAEO 1W6RA 3CX6A 4Y9TA 5L7YA 3VBEA 3I4LA 5ICEA 1CIPA 2LTAA 3IJPA 4KGDA 5LBUA 4LXIA 2P3LA 5K3EA 1M2GA 1PR9A 4F7WA 4LMPA 3V4PB 2FR1A 5LP6B 1V6AA 1RE1A 1NMYA 5HQ3B 1SVWA 1SG0A 1VIDA 4Y9RA 2C8JA 2A5LA 2DP4E 1SCIA 2REOA 4HDAA 4OQEA 3GP8A 2XVXA 2W42A 3RAFC 3AV0B 1QX4A 1B2RA 2O7NA 3BE6A 1JQAA 5HA5A 1KAMA 3FUVA 4PLZA 1YI0A 4OAQA 1BXZA 1ZUNA 4PU0A 4F46A 2IDMA 4FCCA 2QTWB 3QX3A 1NULA 4U0JA 4X90A 4DNOA 3GJ7A 3A6FA 4NYIR 1JFVA 1L5OA 3QKSB 4ZOCA 1T2UA 2Z5FA 3VDMA 1OI7A 4MR9B 1ZK2A 4B47A 1CRZA 1NX6A 2WG2A 4MQEB 4HK4A 1YA4A 2C3YA 4CKEB 4C05A 4LRXA 1ULBA 3VHXA 5CT4A 2V59A 5BORA 5BSVA 3JQAB 4P53A 3SDBA 2C99A 3UXMA 4I9FA 3PKZA 4YT5A 4LRQA 1WXDA 4YK7A 5JD3A 3OZEA 2O0LA 2XGGA 3OA2A 4IEFB 3L6OO 3A1WA 4MRNA 1OQAA 3KWJA 5CW2A 3STWA 3WLTA 4TL7A 1DTEA 2EVWX 2NXNA 3UK7A 3JXEA 3SF0A 1TK3A 2O59A 4RZXA 4G36A 4MVJM 3UJCA 3ZVLA 3I9OA 4EB8A 2JGJA 4N48A 1UC9A 2RHGB 2VDNB 4QU5A 1XTBA 4P5PA 1NDHA 1V8FA 5CU7A 3WP1B 1EGVB 1PZEA 1EH5A 3AM5A 5K8IA 4F1WA 1ISRA 1ZK1A 3C8HA 1T26A 3KE8A 4GOND 3LO5A 2Y92A 5FFNA 2VTVA 4LGVA 1H5UA 1NZFA 2H2IA 4HXEB 4IS3A 3WYDA 2HMSA 3UJ9A 4M8SA 3DPSA 2VAWA 3FNGA 3KSBC 1TU0A 4W6ZA 3RIHA 5AMXA 4RTJA 2HRRA 2WHRA 4YJHB 2X15A 1SA0B 3W1WA 2FQXA 6GPBA 3VNBA 3HP4A 2JK1A 1SB9A 2YICA 4L8GA 5JZVA 2EDAA 1Z0FA 4IDOA 4K6KA 4XSVA 1D4FA 1EUDA 2QTAA 3DL4A 4FR2A 4Y30A 1UK7A 2GA8A 2YRFA 3CPSA 4ZCRA 4EW3A 3W78A 4CKZA 3S28A 3DWIA 1G16A 1C1XB 1FJHA 2CFSA 1RHMA 3RKUA 2F17A 3TW0A 3WQQA 5C8YB 4ODIA 5EIBC 4CG3A 2ADFA 2VKQA 2XNDA 4JZYA 5JH7B 1GA6A 2RGDA 1Q19A 2R7MA 1DG3A 3KQVA 3ZVMA 5KOJA 3SQXA 4H1VA 4JA0A 2P0YA 4B3DA 4ILKA 3ID6C 2QTVA 1JFSA 2QM7A 3HB7A 4OHRA 4UW9A 1W36B 4GF5A 1BGVA 3TEMA 4BP1A 1SOMA 3E3OA 2VZ0A 4I3GA 3IURA 1WTCA 2XJ4A 3EK2A 2BIFA 1JLLA 4W8OA 5ERGB 1P4GA 3NV9A 4NMMA 1G0OA 5L8VA 4IHQA 1V8OA 1FRZA 2FG6C 2YXNA 5CBKA 3DBLB 4H0CA 4AL4A 2HK7A 4ZVKA 4L72A 3TWOA 2XGMA 4IL5A 4HUJA 4LSZA 4OLFA 3C24A 1V45E 3C98A 2WINI 2ADOA 2C2HA 1QHEA 2AJLI 2PXXA 5D3QA 1ZR2A 2BEWA 3O1IC 1K4KA 1N78A 1LTHR 4ND7A 3BREA 3B3AA 3FWKA 5CTJA 4N3AA 1PL0A 2E5WA 5F5LA 2NNWB 2PGOA 3BMNA 3RC1A 1KEZA 2F00A 3ZQ4A 3I2YX 4J1TC 4ZCMA 2IPXA 1Z0SA 4B6QA 1R5BA 1DWQA 1ZAYA 2A5GA 1KRWA 5CVEA 3T3EA 4LQCA 3E8SA 1CIVA 4QSMA 3G6WA 4PX3A 3E35A 3HUTA 2A3RA 5C5EA 5BSEA 3FMFA 3WYGA 1ZG3A 2XA1A 1D2GA 3MUNA 2C88A 3M89A 5IT0A 3EQ8A 1NF9A 2EP5A 2C3OA 4KSCA 2ZS9A 2E1RA 3AG5A 4PLTA 3MPUA 4UVHA 1GPNA 1X1CA 1DXHA 1NXTA 2QL7A 3EXG2 2QT1A 4DLVA 2Z95A 1TGYA 2D59A 3AF0A 3SNHA 3N8GA 1TKCA 2NV2B 2GN0A 3DOHA 4N5MA 1PL7A 3H0EA 4NK4A 1WPRA 3EYAA 1DBWA 4TS1A 1V11B 4DMGA 4A8JB 1YGYA 4GO1A 2AQIA 4ISCA 4Q3NA 4F5WA 4I50A 4WAUA 4MVJP 3W8DA 4WOKA 1NLYA 3AEUA 1JMYA 4HQRA 2P79A 1W96A 1ODTC 2OENG 3S8EA 2AI2A 1IXZA 1C9MA 2GETA 4A03A 4BNWA 2CLFB 4NBRA 2P5YA 1RRKA 3UKOA 3QUAA 3UAGA 3UG7A 3AFOA 4HDKB 5IJ0B 1Q91A 4WERA 4ND6A 3B2EA 4DB4A 1PN3A 1RR6A 1WY5A 3DM5A 2CNWD 1RM3A 2RKWA 2CK3D 3G2JA 4Y8VA 5TQVA 5JD5A 1D0VA 4EQZA 1ONBA 1VZ3A 4B40A 4EX6A 1Z6TA 4DIDA 2VWHA 3EPKA 4B3RB 1F0YA 2PZAA 4FKBA 4YHBA 2H7VA 1C41A 1RFGE 1FS6A 1ORWA 2BEUB 3AY0A 4Q4HB 2WIBA 1UXGA 1QVRA 3EEOA 4OHYA 2JFPA 2IZOA 3QU2A 2QN6A 4V02A 1T6XA 3L8CA 5TPZD 1ENOA 1FNMA 1QORA 4XJTA 3RV3A 3VYTB 2OHGA 3C1AA 1GZDA 4P4LA 1ZGJA 1X2EA 3NYRA 5AW3A 1JRLA 2AT1A 3ML1A 5FOXA 3DH0A 1LFDB 2RC5A 4O59O 4QO7A 4YRJA 1OX4A 4C3UA 2I66A 2PMDA 3FGZA 4ID3A 3G1WA 3RK1A 4FNOA 3DOOA 3V9PA 5KVVA 4J43A 3OT4A 4G56A 4HNGA 3WI7A 2JIZA 2ZJ7A 2R6HA 3F2VA 3MVEA 1Z16A 3GLQA 4RV5A 4MV7A 2AFHE 3FCXA 5CIWA 2D0PB 1NXPA 4R4JA 3ODGA 3WGLA 2BC9A 4YAWA 3D59A 1T9GR 3RWOA 4RMNA 3T3DA 3R5TA 4MITA 1V9SA 1ZWLA 3E82A 4FC7A 3CRRA 1FFCA 1M9NA 1QFZA 3H9QA 4QDZA 5EERA 1GU0A 5K3DA 4PHHA 2WR8A 2NQ8A 4R31A 2DPMA 1OXSC 2BPOA 2X5OA 3TMAA 1RMYA 5ANRB 2K2QB 3QJGA 5CFMA 4QUHA 5C0OE 4UZFA 1KJZA 4AAYA 2PQ0A 2SKDA 2GCOA 3WLAA 3CBQA 2G9QA 3GGDA 4IF4A 3KVRA 5J43A 1PI3A 2NUTB 3EGOA 4D8YA 3I6IA 4M1TA 1MJ5A 5ALJA 1WZNA 1CY6A 3DUFB 2YFHA 4RESA 4L3OA 3EPPA 2EL7A 3EIQA 3Q6MA 4BXOB 1XO1A 3UCEA 5FAXA 1NLZA 5HKBA 1Z33A 5EQJB 4IZIA 5J2TA 3A27A 4G0QA 4ZVPA 3WYBA 3DPUA 1YDWA 3WRXC 4ACAA 4O2AF 2BI7A 2QV7A 4NBNA 5BMVA 2NN3C 3T7EA 3AR3A 3LA6A 4YP5A 1U0EA 1XELA 3L0CA 1CWUA 3FB1A 1F51E 3SQMA 1T8RA 3DE7X 2QT0A 2VUUA 3BDVA 2Z3VA 3G2IA 1XQWA 4IOMA 4PFJA 2QLMA 1ZD4A 2IVZA 3FTQA 4J6EA 4DC0A 6REQA 4WFQA 5BN5A 721PA 1WY7A 2QL6A 3EGIA 5BY2A 4G9EA 3C15C 4XYMA 4CIWA 1G291 4M4SA 2XUQA 3WMGA 3MTQA 3WFJA 1DVRA 4XGRA 3L77A 4BFVA 4KMSA 4X8LA 4AQDA 1FK8A 4PPNA 3E53A 1NP7A 5AQEA 4Z86A 5F1OA 4YRNA 4FQ7A 3QEAZ 3PKJA 3TCXB 5FYQA 1F3OA 3T7RA 3CLTD 2P2DA 4B3JA 4P8RA 5AM0A 4MKRA 2BGGA 3K1YA 3DYBA 4Q3DA 1BC5A 2XEXA 2WHXA 3ZNNA 5JI2E 4X71A 1OWLA 1T36B 3ON5A 4DRXA 4LCEA 3M3PA 3C7DB 4Y6GB 1UIMA 3S8MA 5H4GA 5JZBA 2IDKA 2QUJA 4MHTA 3HJFA 2EKLA 4GX1A 2ZAGA 1P60A 2OXFA 4WNIA 4D0RA 2PZLA 3CUVA 4MWZA 3R9XB 4YJ3B 3F3SA 1S1MA 5IMBA 1JYFA 1GDDA 3D2BA 3A4YA 4MLDA 1CB7A 3B6EA 3H4IA 4YRPA 2BHNA 3CRMA 3W6ZA 2PU7A 4NU5A 3NHMA 3USCS 4LXYA 5EE0A 3OUUA 1EFTA 2AOUA 2BLLA 3S99A 3MGGA 4BAGA 3B1YA 4RTNA 4FWIB 3J81A 1JDPA 3WDMA 3WQBA 2P9JA 1B26A 1T0HB 1NVFA 2QA5A 1A76A 4HB2A 4NZYA 4ZAWA 5BP7A 3HCWA 2XYVA 2X3YA 5AQ1A 4P4SA 3OPXA 4HTFB 4C6HA 5ELXA 1TCUA 2J48A 5ESDA 3I30X 4TS4A 1TCCA 1I30A 3EIFA 4XQCA 3KVNA 2GRUA 3D3QA 1FP6A 4JDPA 4M87A 3CEMA 1ZKMA 2ZBDA 3VBCA 4BO7A 2O8DB 3IP7A 2E37A 3HLTA 3ZW9A 2JIBA 3K0AA 1TI7A 4UATA 4PGGA 4MPDA 4DBZA 3C7CB 3QVGA 1K8QA 5KJ1A 3F1LA 3GRYA 3NHFA 4BNZA 2RGAA 2O3TA 1GXSA 4RC9A 7ABPA 2R7NA 2ZIWB 3QY0A 2PUAA 1NNI1 1FSFA 1DJQA 3UN1A 4ZAGA 4Y2PA 1UFRA 2ALJA 3K73O 4DREA 3C3YA 3TL2A 4CQMD 4TL6A 4MW0A 1POWA 4DCJA 5KNLA 3MJDA 1RWNA 1YZKA 1JH8A 4GPEA 4KQFA 4RVUA 1R3UA 3L06A 4ONEA 1XROA 5K3SA 2ZRKA 2EW2A 2Q21A 1Z6GA 1AB5A 5FTWA 4UPDA 4KFUA 4FWBA 4C2TA 3QWHA 2G83A 1R8YA 1ZIOA 5FBHA 1EUQA 1ORIA 3BH0A 3OUZA 4KYUA 5ECGC 4CLOB 5DXJA 3CUYA 1CZNA 2UVQA 4PLGA 4TWZA 5CHEA 3MTBA 1JXAA 1K0UA 5FA5A 5LL6P 4B2IA 2OFXA 2BFCB 2OV4A 4B80A 4ECEA 2R1TA 5MFPA 2D5IA 2ZYTX 4C7MA 3IL2A 1O94D 4LV5B 5CFQA 2B5WA 2WU1A 3DR3A 3LKZA 4F91B 2COUA 2ECPA 5IT4A 2ZITA 3HFRA 1LRJA 2YHIB 3P2KA 4IFBA 3ETGA 3FVTA 1C50A 4I8XA 4LYEA 5JSQA 3PNBA 4L73A 4OXRA 4QOFA 1YKFA 4Y2TA 4RK5A 2ZROA 2OXIA 3V2GA 4KN9S 2V0NA 4B33A 3GARA 1VL1A 5BNFA 3GCWA 5EMLA 1ZMRA 3DL2A 1W0KD 3WE7A 3ZTYA 3IVRA 3M4XA 2BVNA 2IS4A 3GDFA 2WJ4A 2P8SA 2HI0A 1ZD2P 3B1JA 3FMOB 3UK2A 1NVKA 1SC3A 3NETA 4WKBA 3UZUA 3BHIA 5JSZB 1JR3D 2QDXA 1Z6ZA 4R2JA 2Q6TA 5C37A 3H65A 3ZEIA 1CUAA 2ECKA 3HSSA 2JLVA 1ECFA 1R6AA 3SU8A 3CKKA 4AKSA 2REQA 2HK9A 3R0JA 4RTRA 1Y9DA 3DCYA 1A98A 2F59A 3M9WA 4NICA 3ZWQA 5JV5A 1V71A 3FOBA 1ENZA 2MSWA 4CTNA 2Q2VA 1J00A 2VDJA 1VI5A 1IDN1 4ZVMA 5A05A 4LKRA 3CRZA 4YCMA 2AN4A 2XE8A 2JFYA 3HWRA 2MHCA 1NG1A 1I0ZA 2AOTB 2W58A 2DBQA 3CF4G 3CNQS 1C3OB 2Y77A 4EECA 1YS4A 1KEPA 2I65A 3EIEA 4J1QA 2BFBA 3B38A 4NG5A 3TFOA 5DYYA 3O73A 4X00A 1HZJA 4J6FA 4N3NA 2JA2A 3KQUA 1YHNA 4KCGA 2XUIA 2BE9A 4V0KA 5IBQA 4EFMA 4OHVA 3GAMA 5E7MA 5CDUA 1R6TA 3E0XA 3H7AA 2NZXA 3HBMA 1I13A 4HDSA 4JK3A 4I5FA 1Y0BA 4XD7A 4Q5IA 4BN5A 2P5UA 1X7XA 1Z07A 5BURA 3GLHB 2I7DA 1VYTA 1HEYA 2AQKA 2G08A 1CY7A 1D9ZA 4G6ZA 2GN4A 1FCJA 1FYXA 4I19A 3RS9A 4FU0A 4NV1A 1I10A 3UHPA 3HJGA 3L07A 2AN5A 4F8JA 2BGRA 4KUGA 1J0EA 4RAQA 1ZSNA 3G5MA 1D4OA 1MOQA 2ZE5A 5DW0A 1U28C 1G42A 4DIMA 1Z7GA 3QEJA 4NYMQ 4RKRA 4AN0A 1CF4A 3VUFA 2JFWA 5KYGA 1DMSA 1W0JA 3D7LA 3HLYA 2QXYA 2RH4A 4ZEXA 1GTG1 4FR0A 5EKSA 4YQFA 2GZAA 2XHZA 4IRXA 4UXIA 4ALMA 5C8ZA 1W36C 3U26A 4S1PA 3IVGA 3UIEA 4Y1GA 4F72A 2V6IA 5EEHA 4FW8A 4C08A 1K3TA 3KR9A 4JS0A 2JAQA 2N9UA 3TINA 4CUKA 5JAMA 1F8FA 1UFOA 4I6JA 3CW8X 3D8BA 1P2UA 2QRPA 2W2KA 3OF2A 2C5GA 3S8YA 1K92A 4WXHA 5AK4A 4E2YA 4GMFA 4RENA 5EE3A 2QHXA 1H2XA 1N2GA 4DCGA 3ASUA 2F1RA 3BAFA 4EPXA 1SRRA 4EG1A 1JSRA 1AUVA 1C8VB 1G64A 3AUXA 3DLCA 1Z6QA 3TPFA 3A14A 1LTKA 1R50A 4DG8A 3RS3A 5AVXA 4JXZA 2ABWA 2XAUA 4DWWA 5KINB 4E1AA 2FMFA 4NULA 4FFBB 2RHRA 2YJ6A 5KS2A 1E20A 3JZMA 3EUAA 1PE0A 4LUCA 4F85A 5A6SB 3HJBA 2I29A 5AOBA 2YIJA 3TEFA 1NBMA 1WX1A 3K4PA 3MGCA 1F8GA 1KMIY 5T8KA 4WCDA 2GRJA 4BLUA 1K7CA 3IAAA 1JQJC 2BMVA 3B85A 2J08A 5EJ6A 2X7XA 4P38A 3W9UA 5B55A 4X1KB 3RYHB 3CS3A 1JW9B 5KTSA 1SC9A 1KJYA 1RQXA 3HCOA 2V7WA 4FDUA 3VX3A 3O8RA 2W2MA 4GZMA 4TTQA 1XRLA 1EFHA 2W6CX 1BX3A 4Q21A 4XVHA 5DLPA 1JL3A 1RWBA 5ARDA 4F2GA 4A6EA 1J7JA 2CT8A 1PR2A 2GTHA 2Q4BA 2VYVA 4BRZA 3L4SO 3ADOA 3OJOA 1FP1D 1UDWA 1GQRA 3PFKA 1Y1LA 1KYTA 1SZPA 3AESB 3ENKA 3NQ41 3QX8A 4LV8B 4BMDA 1A5TA 4A8JC 4BFXA 5IUNC 5JNTA 4ZT7A 2G6BA 4RBNA 4OAPA 4P7GA 2CHGA 5L3ZA 1A8SA 1W76A 4ECAA 1D4AA 4M22A 4YRZA 4GI5A 1N1EA 2H5IA 3F90A 2XCSB 2ZTHA 1QYRA 3L6CA 3T7JA 3C7TA 2FEPA 4GPTA 3ZDBA 2FWJA 3PDIA 1WCIA 1FNSA 2B34A 2EDCA 4BATA 1VL0A 3GLKA 3NOXA 1OXBB 1UBJS 1J39A 4FOLA 2IH2A 2G5GX 1UEXC 4J0EA 5JS7A 4KR2A 4Z1OA 1HQKA 3X1MA 4AS2A 5IPFA 2X2FA 2W2LD 1G20E 4PBRA 1WDKA 1CUGA 3D0OA 1GVHA 2G0NA 3R3JA 4LJKA 1CXZA 4JITA 3H8JA 3QG1A 4M0LA 4MO2A 1SUIA 3A1CA 1K63A 3AUAA 2QD2A 4Q66C 4F9GA 2DY1A 2WAMA 3GZ4A 3ISJA 5IM4A 4LOLA 4I5GA 1COWA 1CETA 2OHOA 3F7OA 1KZ1A 4L57A 3QLJA 3IQFA 1GHTA 1IZ9A 1HT0A 2C07A 3DEHA 3M6VA 4QYWA 3LLMA 3FSGA 4LRSB 2FW7A 1QNLA 3EJ6A 4P9NA 5SZHB 1TYEB 5BPHA 1TK9A 1TZMA 4ZP1A 3QUBA 1XD2A 4JL8A 1T3TA 3JV7A 2OOKA 3KC2A 3MJRA 2AKYA 4NH4A 5D7BA 4DANA 1ZESA 4E33A 3TKAA 1ISSA 5TGDA 4UVDA 3Q7SA 2BUAA 5CLIA 1U0RA 3P52A 2DUNA 3R7BA 3R76A 4N0EA 4OLBA 3T9FA 3P2JA 3R3SA 1ZHOA 2B8WA 1T2CA 4H7KA 3R77A 5CMLA 5IC5A 3SQWA 2HCRA 5LP6F 4YDSA 2ZYDA 4Q0MA 4U5XA 4WZ6A 3UT0A 121PA 4B3BA 3OKFA 4TXMA 3SBXA 3H9EO 2O0KA 1QTRA 4CTOA 5TQJA 2NAPA 2VNIA 4Q4AB 3A04A 5CDYA 1L5MA 3OF3A 4NAUA 3D4NA 4J0KA 3U1VA 2DTXA 4R0NA 2ZAMA 4FEYA 4A82A 3CLTC 4WEQA 2EFYA 1RAHA 1PX0A 2WKQA 3RUPA 3VPAA 3OKCA 1YR2A 3HWX1 1GRVA 4TKZA 3KYCA 1FVXA 4YJ2B 3ROZA 2AEFA 1NR1A 5KIAA 3A3PA 3IEIA 3KOXA 5B58C 4W5RA 2QM8A 1OHHA 5BR7A 5K6AC 1ESDA 1NY5A 4AMYA 4EUHA 1J22A 3BICA 4PANA 1NRXA 3RBVA 1TU3A 4L16A 3G68A 4Z7OB 2IP2A 1TEXA 2PA3A 1DLIA 1RCTE 3KELA 5AI8A 4OB7A 4HQOA 3NHAA 2A1TS 1L5HB 1QGOA 3ZBPA 3HY4A 2E55A 3JR7A 3LQYA 2AFRA 2LIPA 1HE4A 1L4EA 1MENA 4U6SA 2PRIA 4NJEB 4W7SA 4NCXA 5DZSA 2QZ9A 3B3JA 3TRIA 3PDUA 3FIUA 3QH4A 4JOCA 4PCUA 4YPVA 1FEZA 3STYA 4JBXA 5GONB 3FLAA 1ECJA 2AXQA 5AIAA 2AMFA 3K7EA 3EPJA 3AETB 3VM6A 2ODAA 4GAEA 4KAXA 4QYIB 4CV2A 4DDWA 4WBNF 4JP1A 1LBHA 3HHPA 2C5EA 3I2HA 4O4LB 5JWHA 1C30B 3ZHBA 3PPIA 4PHCA 3F6CA 1ZCFA 5AW5A 3FOAA 3GFGA 4Z7JA 3R44A 1CY0A 3SHWA 1SK8A 4OH7A 5AHWA 4LMAA 5DX0A 2OTCA 4N8DA 4AX8A 4BBAA 3WK9A 2Y8EA 3CH7A 3BFXA 4NJMA 3B20A 3ROKA 1FDSA 4LWQA 4OSEA 4ML3A 1R10A 1QIJA 3GRVA 1HE5A 4ZODA 4ZT4A 3QW4B 2VXBA 1ISMA 1RWWA 1SCJA 1PO7A 3KQYA 3LBHA 5C8YF 4HCJA 2NU9B 4BHTA 4YCAA 3U5TA 4PLPA 1RXEA 2A67A 2BUBA 3VO8A 4PAMA 4XUCA 2Q5EA 4RE6A 2HRBA 3NR2A 4CRWB 2HA2A 1H66A 4E11A 2F55A 2ZTMA 2VYFA 1AQIA 4YMSA 2B7LA 1PV1A 2BGMA 4IGAA 4L8FA 3T0GA 3U4MA 1A2OA 1BKSB 3C48A 1QLWA 2VLBA 2ZTSA 2FVYA 2VIIA 3HKDA 5ETJA 3GAZA 1DQRA 4PG4A 2R86A 1KO8A 3DV0B 2IV2X 3REFA 3FA2A 3WK6A 3MCUA 4ZVSA 5HZMA 4HBZA 3JX9A 1XAJA 2IOFA 3TZHA 1FXWF 1SHKA 1UH5A 1T2AA 2H3HA 3DA8A 4PX2A 5LQSA 1WBBA 3GJ0A 1W9MA 2BGNA 2G25A 1SHTX 4J29A 4WMLA 4A91A 5FDFA 2HF8A 4KXWA 3K9WA 1U8CB 3DMPA 1F8UA 4QX6A 1ZL0A 1MB4A 2FWNA 1IHDA 4Y2HA 2V7QD 1SCQA 3MJTA 4D4KA 1QBGA 1TE2A 1ZRHA 2A5JA 3R3ZA 4NDNE 5FPPA 5C3UA 5JMWA 5ALZA 1I0LA 1F5NA 1R3DA 3LVQE 4NCNA 2HADA 2PUWA 4AURA 1L4BA 1N6RA 2BGKA 3ADKA 4KFTA 2CNNA 1RDFA 2IEDA 1SG9A 4RTPA 3JWIA 2VQ6A 1XRMA 3IMFA 2V3VA 4L76A 5TEVA 3A36A 2DJ5A 1X7ZB 1ZLYA 4H7PA 2WY2D 1Q44A 1H05A 4CM8B 4Y2RA 4JIMA 4DR6B 1J90A 3EW9A 5HIKA 4LJ6A 3TAHA 4AD8A 2DWCA 5BOSA 3BTVA 2UZAA 1NW4A 4GXRA 3CT4A 1C9DB 1MXHA 2MSKA 4AULA 3MERA 1NL3A 1P17A 1G2IA 1VE5A 4D0GA 2F1IA 4URXR 3SQNA 1RWPA 4OXIA 1DADA 1GSAA 4AY2A 1KIMA 1DQPA 3PGKA 3AINA 1G5QA 4LZOA 4F6LA 1WD7A 4XIFA 1P39A 2ORVA 4DVGA 1ZVKA 2DERA 2DQKA 2R6R1 4XFJA 5J3JA 2YTZA 1H93A 1GPKA 4J9UE 1Z3CA 1E4EB 1YUMA 2IXBA 1TJ4A 3P0FA 4L74A 3MRTA 1JHDA 1Z6XA 3UFXB 1ACLA 2BL4A 1QIFA 4OGGA 3UH0A 1UQUA 5H80A 2EZ9A 2WB4A 4JI6B 4E15A 2PH7A 4EH1A 4DLYA 1E0SA 1G8SA 2DE0X 1L5GB 1B76A 3IP9A 5ALNA 5SY9A 3REGA 2J7PA 2OESA 4HKTA 3UYKA 4FD2A 1Q0QA 2GMWA 4IFEA 4X7BA 1DCFA 4AZ3B 4EVSA 1IAQA 1O03A 1OGYA 4C3OB 2WB2A 1Y8ZA 3B8HA 2WJPA 3SY8A 1RJGA 1VG1A 2WNIA 4FYYA 4KWHA 1UAAA 1E61A 1YNOA 4LV6A 3A6JA 3AKCA 3UKDA 2VRWA 3OVMA 4RPGA 1E2UA 2PU5A 3AOGA 4CHGA 5B57C 3U6KA 1Z34A 2GEJA 5ED4A 2QSUA 4BNIA 2ZBRA 4IMRA 4DSZA 1UM9A 5EPEA 4C0BA 1A71A 2C0PA 1W7AA 4H77A 4G0PA 1G60A 4YRDA 2DSNA 3H11B 1EDEA 1KYQA 2FG5A 3HJUA 4L22A 5DMXA 3JQEA 3K9LA 1DL5A 1RYEA 5LOVB 2EF1A 1IWPB 3ZGYA 4OD0A 4Y2UA 1S96A 3QOXA 4GXTA 1MC4A 1GTRA 5F1PA 2F8SA 3LD9A 3CG0A 1XT6A 2NYUA 1PL6A 1V43A 2VSOA 3AUSA 3DOIA 3L6RA 4OI4A 4K8OA 3CIFA 4PYRA 1GTMA 4JEUA 4XIGS 4BAZA 1XQYA 4R2LA 3GOQA 4KUEA 1Y6ZA 2RONA 2CLLB 4YUXA 3CJQA 2BRUC 4ANFA 1E3MA 1T6BY 1Q77A 1QIIA 3CSDA 1H2AS 3EBOA 4INOA 4NZNA 4QUKA 4V2IA 4AG3A 1JAHA 3QTTA 4Y1RA 2AOWA 4DMFA 2HU8A 3HRIA 1OSNA 2HX1A 2UZ0A 3KAKA 3OQVA 2JFGA 3AR5A 4JI3B 1EFKA 1IG0A 1QDLB 3VUEA 2GSWA 1G6Q1 4WOJA 1AUXA 2XOEA 2A8YA 1U2QA 1V7QA 4FOOA 2D5CA 4XYBA 3SJAA 3TR0A 2QD4A 3DHEA 3H4VA 3T9CA 2B8NA 4FOPA 3ZWNA 4AMUA 2CJWA 2DLDA 2H4WA 4H9GA 5J5CA 2QQ5A 4MARA 4E5YA 3EIWA 1IHYA 3LP6A 1ST3A 3S7TA 5KMGA 5L3RA 3UAOA 3JW8A 3VC7A 3QEBZ 4C2UA 1Q0SA 4CKBA 1A97A 3BWDD 1G3MA 3UWMA 4TYWA 2O5EA 2W2OA 2VPQA 3FDFA 1TYZA 3R8FA 4LXXA 3GAAA 1J2YA 1YRQA 4XUGB 1JXOA 3MS2A 2Z2IA 2I3BA 2GN1A 2BI8A 4K8RB 2C7QA 3ET5A 5EC8A 1A9ZA 3BFVA 3ORQA 1P0MA 1IU9A 3LDGA 3LNTA 1UP7A 4OGKA 3MWJA 5HS4A 4EG4A 3VPBA 2EJWA 4E3ZA 3K9CA 1RWXA 3U3DA 3IIIA <