3R7AA

Crystal structure of phosphoglycerate mutase from bacillus anthracis str. sterne
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
227
structure length
227
Chain Sequence
RETDSNVVTLYVTRHGKTILNTNHRAQGWADSPLVEKGVEVATNLGTGLKDIHFMNAYSSDSGRAIETANLVLKYSEQSKLKLEQRKKLRELNFGIFEGEKLDNMWDAVGKAAGVTSPEELLKFSIQEVIDLIRAADPTKQAEDWELFSTRIKAEIDKISEEAAKDGGGNVLVVVHGLLITTLIEMLDSSKTKLGVENASVTKIVYQDGIYTVESVGDMSYVAKGKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphoglycerate mutase, putative
publication title Crystal structure of phosphoglycerate mutase from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
total genus 81
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3r7aA00
2P75A 1QFXA 4ODIA 1ND5A 2QNIA 1H2EA 2ENWA 2RFLA 4GPIB 1DKQA 2H52A 2H4XA 1SKAA 3GP5A 3LNTA 3NFYA 2I1VB 4MA4A 2IKQA 4EO9A 2WNHA 2GFIA 2P9ZA 5PGMA 2EKZA 3R7AA 3D4IA 1UJCA 2P6OA 2BIFA 3OI7A 4FDTA 1QHFA 3D8HA 4AROA 1TIPA 2ENUA 3K4QA 3E9DA 3ZHCA 3QPUA 2AXNA 1V7QA 2P6MA 1H2FA 2OWDA 4PZ9A 4IJ6A 3MXOA 1C80A 1C81A 1SK9A 1DKPA 3EOZA 3F2IA 3GP3A 3E9EA 2YN2A 3DB1A 1BQ4A 1SKBA 2P78A 1DKMA 4ARUA 1K6MA 1QWOA 2YN0A 3C7TA 1V37A 1YJXA 2PA0A 1ND6A 2EKBA 1XQ9A 2P9YA 1BIFA 3GW8A 1SK8A 3NTLA 3DCYA 3FJYA 4D4JA 4TSRA 3IT3A 1CVIA 2A6PA 3QPWA 5CU7A 3KKKA 3F3KA 3O0TA 1IHPA 1RIIA 4JODA 4IJ5A 1T8PA 4GPZA 5CX4A 4ARSA 4D4MA 4JOCA 2P2YA 1RPTA 3IT0A 1EBBA 3LG2A 1FBTA 1YFKA 4D4LA 3IT2A 3D6AA 4HBZA 2P2ZA 2HPAA 4QIHA 1DKLA 3IT1A 2DWOA 5CDHA 2WNIA 4PGMA 3PGMA 5AJZA 4D4KA 1RPAA 4FDUA 2F90A 2P77A 2OWEA 3K4PA 5AJWA 1E59A 3EZNA 1E58A 2H4ZA 4E3WA 3MBKA 3FDZA 2EOAA 5HR5A 2H0QA 3HJGA 1NT4A 2A9JA 2HHJA 3LL4A 2P9FA 5AJXA 4EMBA 3QPVA 1DKNA 2P30A 1BQ3A 2WU0A 1DKOA 4ARVA 3BIFA 2P79A 1FZTA 1C7ZA 3FDZB 5AK0A 5AJVB 4PZAA 5HTKA 2HIAA 1UJBA 3E9CA 5AJYA 4JOBA 2DWPA
chains in the Genus database with same CATH superfamily
5JUWA 3JASA 4OH7A 5ALDA 5KAPA 3FWKA 1U0TA 3JD2A 1FXWF 2PD4A 3KKOA 5A02A 2FN7A 3G85A 4UUPA 4I5FA 4Z2YA 1GP2A 5FL7A 2OHGA 4MRMA 1WQ4A 4YRNA 2C1ZA 3KZOA 4GU5A 4KWEA 1X19A 1DWUA 3K8OE 3HM2A 1LFAA 3T5AA 1XL1A 1Y4AE 3L8HA 4HO1X 3EQ9A 2MHCA 5DN9A 2QLNA 4C43A 1I6KA 1NASA 3I6IA 2OHXA 2REOA 3GI1A 4OYLA 3UCEA 2JLQA 5J40A 3RBAA 4JJKA 2QTVB 4G8JA 3GLGB 2CDNA 1JIIA 1GSAA 4IDHA 3X1WA 3BMQB 4TTVA 5ABPA 1IN1A 5P21A 4BO4A 1AA9A 5J1SB 4GEGA 1DLIA 1L6RA 1Y8CA 3KSZO 2J3HA 3BMOB 5AVXA 4N6NA 1F20A 1QQTA 3W5DA 4K0KB 3CX4A 4X91A 3UJBA 3X1YA 5CD9A 3ZGYA 2B4TO 2Q28A 4MX8A 4WZBA 1XI2A 4CRWB 2HJGA 5JSHA 3L2OB 4U2KA 1S8NA 2R79A 5IK2A 1Y8AA 4ON9A 3A31A 1HX7A 3TTTA 3GCWA 4JJZA 3HDGA 3GVHA 2ZPTX 3DULA 3L3BA 3D0QA 4U63A 4E5MA 4K81B 2CF5A 4F21A 1U0JA 2HMAA 3MWEB 4ZMBA 2XUFA 1GNLA 1QZXA 2Q5JA 4ZAZA 3WYAA 4DM4A 4LCJA 1QGZA 3PENA 2D5IA 3UAYA 2ACKA 3LHFA 4JEIA 4X92A 1OWNA 4A2CA 3L7LA 2NYAA 3BMXA 1HTBA 4Q15A 1UBOS 1QHGA 2JJ1A 1GDHA 1OLUA 3QH4A 3VHQA 2GKSA 1EGQA 2QUAA 2AMLA 5I3CA 4CL3A 1NFQA 4G37A 1DFIA 1SU8A 1YZTA 2BF7A 1D6NA 3QG5A 1Z5VA 4AU1A 3TFWA 3P2IA 3TZKA 1BMFA 3KKNA 4NH4A 4O4JB 2JL1A 2WD7B 3GT3A 1JIKA 4OOEA 2BHNA 2ZATA 4P3PA 3TJRA 4IJMA 4I55A 4DT1B 1HDYA 1QZ3A 4P4UA 1EBBA 3CNNA 2A8YA 3M6VA 2ZW9A 4LHZA 3NHPA 3NIDB 1YZUA 2AEMA 2IBTA 1SUAA 4BUZA 3NYIA 5AM1A 3EZ9A 1KFCB 2ZS9A 3H19A 4HDRB 3UUGA 5ADVA 3JQ7B 3I2KA 4Y18A 2ZVDA 5IP5A 1XQYA 1EUZA 1T0HB 1SA0A 2C2HA 1JHAA 1ES9A 1XOIA 3RROA 3VKUA 1L4KA 4GD3Q 4L0DA 1EK2A 1N0WA 4CCSA 2MOKA 2BMJA 2IF2A 3FWYA 3SS8A 1W4ZA 3H8SA 5ALNA 1W88A 4BXOA 2JA2A 1DZIA 4ILKA 2IYZA 4UAVA 5I8WA 1XTPA 2WFLA 5LR6A 3ZCSA 1JKMA 1U99A 2BGMA 4PQRA 4R2WA 3LUHA 3G17A 5I8ZA 3DMTC 3RT1A 1XQ6A 3C24A 5K09A 5BMVF 3DCNA 1IY0A 2C92A 4OEHA 2CL5A 1A9QA 4QGAA 3ESZA 3B3QA 3K2EA 5ILGA 2ZCVA 1BWSA 3MIIA 2CJXA 3FYHA 3GGOA 4UBLA 4X6YA 1M34E 5JCOC 1MRZA 1W2WB 7MHTA 3GUHA 4BBJA 4WFJA 2JA1A 3SNHA 4GS5A 4AICA 3OEWA 3FYUA 1N6IA 4L9AA 2ACVA 2BEUA 2I4MA 1P1KA 5CVTA 1VJTA 1X2BA 1BGWA 4KDCA 4FI3F 2P9BA 3GCXA 4HEA1 2XEXA 5KVVA 1KH1A 5C5IA 2O1WA 4A5OA 3RT9A 1O7JA 1ZITA 2GN2A 4P80A 4EHDA 1JDSA 2R47A 4FFVA 4K6HA 1A8QA 2AOVA 2W4IA 1SHKA 4KXFB 3U17A 5TMEA 3W1VA 4FWTA 3FLBA 3MS2A 3NHFA 4AUMA 4KXUA 2XX3A 2K7ZA 3H9EO 2DBQA 1QF7A 3JWHA 4V1CA 2CGEA 4PFQA 3MTEA 4YLGA 1SKYB 3UK0A 4F3TA 1SU6A 2V7PA 2QD2A 1KEUA 4OQXA 4YAKA 5JW6A 3ZLJA 1J70A 3DE5X 2XZLA 5KOJA 3UJDA 2ZPAA 1CR0A 4NS1A 3PG5A 4KXNA 3PT5A 4MI1A 4MUHA 4Q7KA 2DR2A 3EGXB 4MQLA 3PCRB 4BB5A 5AR1A 2ZT6A 1VFNA 3KU1A 3OQBA 1IVNA 4GXQA 4OREX 4RUKA 5DNWA 2QAIA 4Z6KA 4NPAA 1FJGB 4PFSA 3OOWA 1R9MA 4U2DA 3JY6A 1N2JA 4TTJA 1CJTC 3I8OA 1NW5A 1IEWA 3P1JA 4OHMA 4EDFA 3M4YA 1YK0A 1ACJA 2X0NA 1L5LA 1MHTA 3HDQA 2Q49A 4LJ8A 3WL5A 3NR2A 3X1JA 1U8CB 4KU4A 2OOSA 1E1RA 1W19A 4TXHA 4RFSB 2ECFA 1EAMA 2O3UA 3JYLA 3CF4G 2QYOA 3I6YA 2Z8ZA 3BK2A 3EQ8A 4UEJA 4K9OA 1J8VA 5JMWA 1JAHA 1NF8A 2GTIA 4G0PA 1JKJA 1ZC4A 2FJPA 2OXIA 4CIXA 1X9HA 1II0A 1I4OA 4XEUA 5JECA 2A1IA 4B3TB 7REQB 1CZLA 3B7WA 3H5AA 4BE9A 4LDQA 4TUYA 3AR2A 1J2YA 4M1ZA 4D9EA 4QWWA 3DYBA 5BMOA 3EFOA 5H9WA 2HIGA 2GH1A 5BV8A 4PYQA 2WJHA 4RJ2A 1EFCA 4J07A 4Y9UA 3U16A 1ZIXA 1KBQA 3CEMA 1JU9A 3WRVA 5K0EA 4AY2A 3HRHA 4IKEA 2GEVA 3FVTA 4ZT3A 1REQA 1OYOA 2FFQA 4UOZA 1IZ7A 1YZQA 2PRJA 3P71T 4HLNA 2R6CA 4IFTA 3NWEA 4YXWA 1ABFA 5B3LA 4TTRA 5KTRA 2VHCA 4LYJA 1QUEA 2E1RA 1HDEA 4LMBA 4UHKA 3D02A 4W82A 4W99A 3N2KA 1B16A 1DAGA 2H07A 1QCYA 2P2GA 3P2OA 1BYUA 1JDNA 3KJEA 3UW1A 4TKZA 1E7QA 5BR8B 1OROA 2J4FA 5BPHA 3QA3E 3S27A 1UP6A 4KLNA 2D5AA 1B1CA 1MGPA 1RHMA 3ROGA 4WLVA 4YJGB 5JCXA 3DE0X 1ZMTA 3CNOA 5SY4A 4L8FA 4FGLA 4JMPA 2R68A 3PNBA 5H83A 2O0HA 2Z5GA 3BB4A 4OB8A 2VSOA 2GLXA 3WLFA 2AQ8A 1A9PA 1J39A 1B26A 4E1VA 1ZRNA 2EJBA 2C9MA 1KVTA 2AFVA 5AT1A 4TKVA 3QM1A 5ALXA 2F3RA 3QA9A 2PUBA 1DWOA 4OHKA 4UM7A 5PGMA 1RJ9B 4Z4FA 1TAUA 1M6HA 1IOWA 1HE4A 2W2QA 3WKEA 2C96A 3OY2A 3HYRA 3D6HA 3EYWA 3AM4A 4GQIA 3Q41A 4PCUA 1Y3BE 1BU5A 2P5SA 2FP3A 3S1AB 1NQTA 2D2FA 1NBMD 1KY3A 1THTA 4FDTA 4JN6B 3SAJA 4B4WA 5D01A 2Q5IA 4H1WA 3VUFA 1X14A 2ZRHA 1ULAA 1EM8B 3H2JA 3VC7A 3WMEA 4MKRA 2PVCA 1U0NA 4MS1B 5EUCA 4DILA 4KGXA 3JATB 3TNJA 1V4NA 3NNDA 3GEPA 1QCZA 4DY4A 1DTEA 3EGVA 5K99A 1POWA 4J90A 1RHKA 5JEDA 1HKUA 4CLOB 2PAFA 3BL5A 2NP7A 3DO6A 2J1LA 1QIJA 1YUNA 4CLRB 3UAVA 5H1YA 3A11A 4B75A 2XTNA 3D6TB 3EUWA 3IYLW 1ORTA 5EMHA 1SURA 5JNWA 1TGVA 2ZQYA 3TUIC 4ZI3A 1PR3A 3HP1A 1VSQA 1WY7A 4I50F 1GM5A 2Z3ZA 3GBVA 3WA7A 4MVWA 4DSNA 1KAHA 3C16C 4AXBA 3QEBZ 3GDHA 1RKVA 3FRHA 4HMPA 4Q82A 4A7PA 2VQFB 4Q19A 2B92A 3IEUA 2HSDA 4LFCB 1KQGA 5KYGA 2JLWA 2O8FA 2QB5A 1GDDA 3RRFA 5KYWA 1TZCA 4LF8B 4HDOB 5CIQA 4CHGA 2OCDA 3D8RA 2F8TA 2ATEA 5FBZA 3ZHRA 3OEHD 2RB5A 4P0QB 1WF3A 1PGOA 2H3EA 5CX4A 1BE8A 5FA6A 4J16A 1YQ9A 5BMVB 4KBFA 1NVKA 2R8YA 2YZNA 3L6BA 3RASA 2PYDA 1YIAA 3Q5DA 5JS8A 3F78A 1UCFA 4LDJA 5CEEA 5C52B 1OH7A 1JSXA 3WQQA 1QYVA 3L1KA 3T7CA 1DIAA 3UAWA 3HGTA 3HNRA 1QX3A 4MWEA 4YAWA 3LUJA 4XEHA 1UJNA 4GYJA 4UARA 4KFCA 1XJWA 1XALA 4N65A 3C7CB 4P92A 1Z29A 2W2KB 1V41E 4D9CA 1YQDA 2PZKA 5LOVF 2M98A 1SD5A 4A9AA 4TTQA 2C78A 3R6WA 2O20A 2ZSEA 1TQ6A 4AJIA 4DC0A 5JY6A 3T7TA 3C5VA 4QSHA 3AEXA 1FP7A 2AG6A 4OBWA 5ES4B 3EVTA 2ZT5A 1A7UA 2BFDA 3I2FA 7MDHA 1CIPA 2DUUA 1D0VA 4ECEA 1K06A 5ELMA 2HSGA 3TL2A 2Z2JA 4QYIB 1VHWA 2JEYA 1JLLB 3CIFA 1QG4A 4DSAA 1BGVA 1LNSA 1S0UA 3OPQA 1CUWA 2GEUA 1Z25A 2HWXA 1W5FA 3CMMA 2O0KA 4DV3B 4DRXA 5ILOA 3I28A 3ONNA 4S05A 2VT2A 1WCV1 1UINA 3BZUA 4PHHA 2KHZA 4WN9B 4F4IA 4X66B 1M0WA 3JSAA 2IP4A 4DCTA 3PLAE 4MJLA 1DRWA 4Z9AA 1ISMA 1LZKA 3A1SA 4RJTA 1EZ4A 3A4LA 4CMGA 1G3UA 1ZAYA 3AMVA 4CJXA 2QX6A 4LZLA 3B51X 5KC8A 3MWJA 2GCPA 5IKOA 2JBAB 2H11A 3N74A 1GG9A 2WWFA 5C8YF 3K6JA 1WDTA 1KAMA 2R5NA 1WL8A 5D1NA 5E7IA 2I4OA 5K3BA 2I0FA 2DULA 4YYEA 3ZHOA 4XYLA 3DKKA 3VPFA 1ZHHA 4J29A 3A2KA 4G8DA 3U56A 2GUWA 1CJMA 3OEHA 2C4NA 1Z16A 2FGKA 3KL4A 2BGGA 3A58B 3RODA 4Q9JA 4Z8XA 5BNFA 3ETCA 3RNOA 1Y8QB 3W06A 4CKWA 1Q84A 2BF4A 3LFTA 1RXWA 1DHRA 4QGGA 3G82C 5F33A 2L69A 2IYSA 2CVPA 2QJTA 3JQEA 5KC9A 2GQ0A 3K70D 4NY1A 4EM6A 1NJ8A 5KO2A 3KEGA 5K0NA 1ZC3A 5LYJF 3CPHA 3R9IA 3SPXA 1TCCA 3IOYA 4BQSA 2ZLBA 1P0QA 1ZMOA 1LV7A 2KJQA 2YN0A 3G2KA 2W8BB 3ZWXA 4EY5A 1EFPA 4DDHA 3J81A 1D6JA 2IY7A 1XQ9A 2BUCA 3B1WA 1SN7A 2VUSA 2W2LA 3V4RA 1R37A 3ETDA 4N5HX 5LMNB 4DKJA 4ESHA 1CUZA 1QFMA 2F4NA 2AFIE 3Q10A 3LQQA 4DFDA 3C1AA 3NWOA 3I12A 3UY4A 4PN3A 5AVUA 2DT5A 3OIFA 4AP9A 1QKKA 4V1CI 1KWGA 4OI0A 1DBRA 2ZJBA 2GBPA 4MZDA 4BNDA 3S6JA 1E2MA 8OHMA 4CETA 2QGZA 1GZ6A 3Q4GA 1GT6A 1PEAA 1J2EA 1PKXA 3U3KA 2VWHA 2VK1A 4HL6A 4OJTA 4RA6A 1VG9B 1WBJB 3HCCA 4UE3S 4AZ0B 1SBHA 2FEKA 4LV6A 2BKAA 2GRAA 4DR1B 2ACEA 1Z08A 1AQYA 1D2GA 4GBED 1MB3A 2KBEA 3JD3A 4R2HA 3BHIA 4TMTA 4IV5A 2Y1EA 4BKMA 4CU5A 1NXTA 2UYQA 3NEAA 4K3VA 1YIDA 3QMPA 1KQ3A 2B8TA 4PYOA 2VKQA 5A05A 4OFBA 3Q0IA 2IELA 2NPOA 4CEHB 2FCAA 1AZWA 1OGIA 2WM9B 4QYTA 4AJHA 5IZ4A 2HTFA 2VNHA 3K6SA 5JAZA 4R68A 2XWPA 4EMBA 3UK7A 2ZJYA 1DAOA 4WNYA 1YCGA 2F2TA 1YBVA 2VSNA 3SJBA 5K0SA 1IBLB 4FCWA 1D07A 1OX4B 1Q77A 3JTEA 4RZIA 2WBLC 1VGVA 1HDRA 3EYAA 3W5IA 3WL3A 4YAJA 3EF0A 5MN5A 2I4RA 3FSGD 3W6PA 1QTIA 3UQYS 2BFWA 4RSRA 1Q92A 1M0SA 1OX6A 2OV4A 2QI9F 2ZI7A 2JGRA 4MJ7A 4EJ2A 5KQLA 1J07A 1NL3A 4V24A 4YP7A 1VLQA 1WU7A 3QYPA 3R3VA 1IY9A 4QDKA 4Y2GA 2D06A 3O38A 1MLDA 3DZBA 1J49A 4R01A 5HJ5A 1C3OB 1CY0A 4PBRA 1I5OA 4X8OA 1E7SA 4YP9A 3PDJA 4TLMB 1OFUX 3GLGA 4MW4A 4DMMA 2ZTLA 3B3JA 1JI0A 1MO4A 1PZXA 3BMQA 4I50B 2W42A 1RXVA 4NOMA 4JXZA 2DBYA 4AS1A 2ODBA 3PUXA 3RU3A 2GJSA 2NQ2C 3BMOA 1BVYF 3MRTA 5D51S 1A1VA 5DLEA 3AB7A 4OATA 5DMHA 2JFVA 3CX7A 4B6JA 3IAFA 1U5AA 1YC5A 2NO5A 1NDQA 3BCRA 1RLUA 3DBRB 3DFZA 1XRPA 3JALB 4JKIA 3VX4A 3ZE9A 3NAGA 1WU8A 2JCVA 3R0JA 5ELLA 1JAIA 4WH0A 1E1CB 3BS4A 2W6JA 3UHAA 1C30B 2BRUC 5AKGA 5B4VA 2XA9A 1E9FA 2ZAGA 3MWEA 10MHA 5CH8A 4ZV9A 2WJ6A 1X8JA 5HUHA 5JCJD 2RGRA 4AMVA 2A9FA 2V9ZA 1MAAA 1R15A 1U2RA 1SVMA 2F00A 1GNSA 2HCBA 2ZJ7A 3DT8A 3MUFA 1FTWA 4JY7A 4LOHA 4Y2UA 1EB9A 1N6NA 3HJRA 4GHWA 2GVNA 1SCAA 1DX6A 3NVAA 2WICA 3PIDA 1RHJA 3G9UA 1Q5PA 5CLFA 1STOA 5JQGA 4EAAA 4ONEA 3HABA 3IOCA 1FUYB 4JCCA 4K6CA 4B35A 5IAJA 5GP1A 4M1YA 4PF1A 2E9SA 3IR6A 2NQ8A 5I6DA 2IYUA 4BO1A 2PUDA 3TPCA 2GCGA 3HI4A 4EKYA 1IEXA 5GJBA 1FRFS 4Q9DA 3ASVA 4R1NA 5CB6A 2PT9A 2WD7A 4M0DA 4KZKA 4KR3A 5EWMB 1QSGA 1WVGA 4PPQA 2CHUA 2FSHA 4NYJQ 4WXPA 3UV6A 2WMOB 1UOPA 4FUQA 2W70A 5G02A 3K15A 3SZLA 3D31A 3ZY4A 4M89A 1DBQA 1FLVA 4O4LF 3FSGA 5LFAA 4KPYA 1JPUA 1Q0UA 4M0PA 5GVRA 3GVXA 1GEGA 1KSFX 5GOTA 1BU8A 4FILA 1ZH0A 2BBWA 4EW6A 1O0SA 3C41J 4P33A 2PH5A 3WGZA 4BE4A 4RIHA 4LYYA 1XRMA 2AOTB 2RH5A 2ZWAA 1ETHA 1ZCJA 3ZWMA 1BWRA 1M8JA 4RL4A 5HE8A 2XNCA 3TLJA 1JZQA 2QRJA 4MAAA 1GG2A 1ZI9A 4K9KA 1I8TA 1JLHA 1NG1A 3CF6R 3DQQA 2YRFA 1C4XA 3D9QX 5F1PA 3CVXA 2QRNA 4ZK6A 5KUTA 1B3BA 4CKBA 2P7IA 1MGOA 2IVFA 4ZC8A 2O8DB 4C0JA 2LKCA 2ZRCA 4TLLB 1YL7A 1MCZA 2HT1A 3WK4A 2RI0A 4J0CA 4PZAA 1BFDA 1VCMA 2UZ1A 2ZVJA 4HPJB 1VJDA 1QE3A 5HTKA 3QEKA 4DKXA 4DQDA 4YMUA 5FV4A 2FPUA 1YACA 4GKJB 8MHTA 1Y3HA 3IAXA 5JCJA 3ZW8A 1KOJA 2P9CA 3FRIA 1IY2A 4H6WA 4KDEA 5C2JB 4B48A 3KPJA 1XMVA 3OPYB 2X5KO 4OQMA 1RPNA 2WTBA 4DXAA 5JNLA 3NHAA 4ZCSA 4XQ0A 3AVUA 5MHTA 3IB3A 3M5CA 3R5JA 1D1SA 2PKCA 1F2VA 1P9RA 2R5FA 2VK8A 3H1EA 1ZMBA 2EW1A 4M0KA 1U2ZA 3AR5A 4JKOA 3KBBA 4F04A 1VMIA 1J0CA 2K2QB 2IHUA 2OILA 4IUBS 2HFKA 3FMFA 3R5KA 4QOSA 4A8JA 3HADA 3UK6A 3U61B 4ZO7A 2ORED 3KLBA 2DPMA 2OBLA 1G3RA 2WWWA 4E15A 3HJAA 5DLQC 4IJQA 5G0WA 1QPBA 2CNNA 2DFLA 2E4ZA 2DPLA 4XD7A 5JSZB 3ZTYA 1IHDA 1PS9A 3E27A 2HU2A 2UYYA 3LPCA 2OBFA 2OVBA 1R50A 3BREA 4L5IA 4NZYA 1AXGA 3PFKA 4XRGA 3HLTA 2OUKA 5F2NA 3G13A 4G0MA 3PNYA 1VJRA 3VC3A 1VDZA 3PUVA 2HLNA 2VQDA 3D8TA 3BKWA 2OQIA 2I99A 4L4XA 3EGXA 3WDSA 3C1OA 5GIOE 3WY9A 2OCAA 1NQUA 3IMKA 3PWSA 1TAGA 4OHVA 3NBXX 3NYQA 3RYFA 4DXDA 3OZRA 1T2AA 3FMIA 3MXOA 1Z8DA 4EZBA 1UZAA 4I9GA 3JQ8B 4RTPA 2JIOA 1G7RA 4LE0A 1NLZA 1E6KA 1BW9B 1K08A 2I2XB 4KR2A 2X7JA 3KE8A 2YASA 4E33A 3OX3A 5BV1A 3L02A 4RM2A 3HKCB 4MV0A 2EDAA 4UM9D 3DZDA 2PBRA 4HAUA 5C31A 1PLJA 4DIEA 2RD2A 2N75A 1ODSA 4N0MA 3KAJA 4JNKA 1PVOA 5JD4A 3W1WA 4EL5A 4RFSA 2AE2A 2J5BA 3MMXA 1JHZA 2FJ0A 3CE9A 1NVUQ 3E23A 3OF5A 4UAUA 1MQAA 3EA5A 4K8OA 3V6MA 2QU8A 3KZXA 3QGMA 4BQOA 1AN0A 1NTOA 2FMUA 4MR9B 1U80A 1EWYA 1FXWA 1PJCA 1XZPA 4U0KA 4XIIA 2PYZA 4H0CA 5TDHA 3FNHA 1GGHA 1CUJA 2C7QA 3DTTA 4C4YA 4IRMA 5AK3A 1UIRA 1ZSVA 3V3TA 1ETUA 1JTEA 1DX4A 1V7PC 1ZM4A 3BA1A 3FYSA 3PC2A 3ZGLA 2IH5A 2SKEA 3UA3A 4MUGA 4QXOA 5IT0A 2B4AA 4M54A 5IF9A 3F8TA 4J0DA 4E7OA 4MYDA 3SEFA 3HJFA 2P2ZA 4JQCA 4ILEA 2ZZMA 2P6RA 1N9KA 4PO3X 5AM3A 1NTRA 1F48A 4WL0A 3QKTA 1V43A 1MA3A 5JHHB 1XA3A 2JCGA 5TR9A 1PZMA 2FDRA 2VP0A 4XVQA 4D9MA 2HYIC 1YULA 2R1VB 2CV0A 3FM9A 3U4HA 4A16A 2CDBA 2WG1A 3JWEA 4Q4LA 4RY8A 1MTOA 2YUIA 1HDOA 4G41A 4EUSA 3MELA 3PDIB 1QB8A 2OD7A 2ZWOA 2OCLA 4YAGA 4I7EA 2FEOA 2Z5VA 5KQPA 1N2CE 5KYVA 2GI4A 4C7BA 3QLEA 3FNGA 5GTDA 3MJFA 5G4LA 3NNNA 4YWHA 4UNRA 4YJGA 2B1RA 1CYDA 3C97A 1AZTA 3BDAA 1VIDA 4IVNA 4RABA 3BRWA 4TSFD 2E4VA 1BKDR 4D80A 1JKXA 1ORIA 1TF7A 1CCWA 1QB7A 4HWSA 2C82A 1E6WA 5IULC 4HGYA 2QX4A 3O84A 3RU2A 4RVDA 2A88A 3TZHA 3KB6A 3AFNA 3HLKA 2OHOA 4V2IA 4PAWA 1CUFA 3AP3A 3T7IA 2J85A 1RJ9A 4Q4HB 1Z9BA 4NIMA 1RXCA 3DDSA 1HG1A 1WXQA 2ANCA 2ZRGA 4FDMA 4G5HA 4CM5A 3S1AA 4AUKA 5FQOA 3QE2A 1ZR4A 4LCBA 4QTXA 5JU6A 3OA2A 5REQB 3RNLA 2XVYA 3GNTA 1A76A 3NUZA 4EPXA 3ELYA 4I5EA 4NE2A 1A8UA 2VUIB 3GUVA 5F9FA 5IUNC 2JZCA 4MS1A 4ENVA 2MR6A 4LVOA 3JATA 1Z75A 2VPTA 3BAZA 4ACBA 4N5NA 4YV1A 4YJ3F 4OQFA 3A1NA 1ENPA 1PR1A 2ORWA 3A6HA 3KTAB 4M8LA 4MWGA 1RYZA 4O6VA 4R0NA 3KEMA 4B71A 3HFSA 2PIAA 4O4LB 2R8BA 3E9DA 4CLOA 1WPQA 2JGKA 1GCUA 1SU7A 1W5SA 4CLRA 3IXQA 1E64A 1FFXB 2D59A 1DEAA 3LWBA 1AKRA 1L8QA 4UXIA 2A57A 5MFPA 4F8JA 1FUIA 2QUJA 1TEZA 3LUBA 3GL9A 1E0SA 2C57A 1ISPA 1SFRA 2IXGA 1CJSA 3AUSA 3DAGA 2XXJA 1ULTA 1MO2A 3M6LA 2I7CA 3MJ4A 4ER5A 4MQFB 3QPAA 4ARZB 4ZDIA 4Q7EA 2IP1A 3LXUX 5HIMA 3QXGA 5ILQA 4XSVA 5D2CA 1M2KA 1XCJA 2QMZA 2XMPA 3GNSA 4QJBA 1DAEA 4TWIA 1R5NA 4LZWA 1T6NA 5K45A 2IYRA 2V7VA 1BVRA 1A95A 4EHFA 3L43A 1S1MA 4XJTA 2DUNA 2WIJA 1FDUA 3IELA 2RGGA 5CVUA 3WL8A 2V59A 2QTCA 2VTKA 1UBSB 1HR0B 5BMVA 3EGDB 4IS2A 1CHDA 1J25A 2GAAA 1HE5A 3E3NA 4M53A 4NAVA 3TVDA 3NBYC 3C6MA 2GFQA 4IIFA 4MRRA 1TUIA 2HL6A 4MVXA 2ZI4A 3BE5A 4RZ3A 3TQCA 3U4AA 3ZUPA 4BNYA 2H18A 3HB9A 4P3OA 4Q4JA 3UOWA 2VP4A 3L0SA 1CX9B 1FUEA 2J9FB 2XJ4A 3BL6A 4S1TA 5JJBA 2PBFA 1IJBA 4PE5B 4REMA 3CLSC 1M6VB 3ZDXB 1PS8A 1Y5MA 2KLHA 3RK0A 4MO2A 1JBKA 4KR7A 2HBRA 2N47A 4ZJZA 1ZIDA 4MR7B 3ZJUA 1ZD4A 1CEYA 1Z33A 4G1CA 5DI3B 1M76A 1D3AA 2HJWA 3ETJA 1WE2A 4FT2A 2PSJA 2BSQA 2P77A 1DRVA 2GXUA 1Y4ZA 4P7GA 2CLMB 1BZYA 3TRJA 1G0NA 3AR4A 3N2EA 4RHEA 3QWFA 4D25A 5EQFA 4QYIA 4PRZA 5B1EA 2OGZA 1JLLA 1OGJA 3FLEA 3FPEA 1MDBA 4PZPA 3VQTA 2QWXA 3FJ1A 3ZZNA 5FBRB 3OMWA 3STWA 1QYWA 2FMFA 2RHHA 1JR3E 4F56A 1E3WA 2EHDA 3QNMA 3I83A 3FUCA 2HF7A 1X0VA 2IXDA 1NE2A 3R7LA 3SQLA 4WN9A 4NZNA 4EJ0A 2XUJA 2FOIA 4OMFG 1M0TA 4HK4A 4HXEB 2P4QA 2VNJA 5I3ZA 5CT9A 1I0IA 3UT6A 1SIUA 2C5BA 1XO1A 2GVZC 2D0OB 2Q45A 4TYNA 5FI1B 4K9RA 1FEZA 1ODFA 2AMFA 4QREA 4R51A 1XCMA 3ZG6A 1P2BA 5JNUA 2JBAA 2ZT7A 3CNLA 4B31A 3ZV6A 1ACMA 1II9A 4LMPA 1M2NA 2ZGVA 1J6UA 1WPRA 3VYTB 3UK2A 5EWLB 1WUKS 3RC1A 4MDFA 3QMVA 4ZU6X 5JMPA 1SUIA 2W4MA 1E2GA 4EB0A 2ZIVB 1CIJA 2YJZA 1XDUA 3T6KA 4EARA 1X7ZB 1Y9AA 2A0UA 3D0RA 2FRDA 3AUJB 3EQ6A 3GDGA 3NKVA 3RC2A 4PHFA 4CIWA 3FDXA 1OXSC 4MV5A 3U3RA 3UAZA 4E2WA 1LZLA 4DZZA 3ZDAA 1EESA 2WTXA 2X42A 2P6PA 3ABSB 2Q8PA 3HJBA 4FFWA 4TQGA 4J49A 3WV4A 1XZKA 4JENA 2O2JA 1EHIA 4EGJA 5A3JA 2IXEA 2PKQP 4KJZA 3TTXA 3WMWA 2VZEA 5JFTA 1B1AA 2D2EA 2HA6A 2PLRA 4YRZA 1CQIB 1ECFA 5C8DA 4ZGGA 1B73A 1ZEMA 3C7KA 2W8BA 2H1HA 3OIDA 1YS9A 2PV0A 2VT7A 1JEJA 3A6LA 1XV5A 2IUTA 4ZI5A 1CDOA 3RVRA 4FJ0A 3S2EA 2GAOA 1TPYA 1USUA 3OUZA 5CT8A 3FVWA 4QL3A 1BHO1 1YDFA 3BFVA 4U7PB 2WAMA 4P7JA 2IYVA 3UWOA 2NVUB 2QG9A 4DEXA 5JXJA 4G2TA 4MB2A 1NYTA 5I7VA 1IZYA 1C1YA 1G19A 2HSEA 4Y98A 3DTNA 1G5TA 1DT5A 1P1IA 3OM1A 2P1DA 4MITA 1HMYA 2C3MA 4DXHA 3B5JA 3EG9B 5JAMA 5EIOA 2YIVX 1N77A 1IBKB 2VHZA 4ZCQA 5LP6C 4C7OB 1KS2A 3I34X 4AZ0A 1I3MA 5HPYB 1C8KA 1V47A 3GZTB 1KJWA 4FU0A 1GL3A 3TD9A 3RYCB 4FHCA 3PGA1 4Q16A 5AD1A 1J24A 1V1MA 3B70A 3L7JA 5BW8A 3B48A 5KYUB 2HJSA 3ZWBA 2KS6A 2F1HA 2H2GA 1A8IA 5BPFA 3KOMA 3WE7A 5EE1A 4CEHA 1IMJA 2E4AA 5FNVF 1TE2A 3L1JA 1A7JA 3I6BA 2Z3WA 2H1VA 2NZ8A 1GY8A 2CMDA 2J33A 4J6EA 5EHZA 3TPFA 2OV8A 3D59A 1YB7A 2VNIA 1L5QA 4QECA 3VC2A 3D7NA 5EAIA 1LJ8A 1F0NA 1TKBA 1MABB 2VOJA 5ICMA 3TLMA 3MGCA 4RSHA 3B82A 3DWFA 3LY8A 3DHVA 3I2JA 4RV5A 3EXG2 2PUJA 3HN2A 4GLJA 3B52X 3FB1A 2J46A 3RFFA 2F7SA 4HEQA 4EJSB 4PVDA 2OC9A 1BS2A 2VYVD 4BNFA 4BMXA 4LXQA 4YJ3B 2KQUA 1MH9A 2HD4A 1J8QA 1DEOA 2ERXA 2XW6A 5HM6A 2GYUA 1L4FA 2IDZA 4MRPA 3JVVA 2FI1A 2ZVPX 2IZ7A 1A27A 1DMRA 3H42B 3HMKA 4YT4A 3O83A 4G9BA 1E5QA 3HL0A 4NC9A 4BZZA 5BV2P 3HB5X 4FGKA 1UBCA 4WTOA 1T5IA 4I50A 1DBVO 3MF4A 4PLGA 4DJDC 2LRHA 1O6FA 2AC2A 2Y8EA 4CVNA 2XHEA 2I8CA 2Y66A 5CFPA 5EJEA 5JNSA 1VYVA 3DHEA 1VBNA 3TZLA 1FMJA 4IYJA 4WK0B 2O8VA 3BDIA 4JJEA 1U2DC 4KQMA 4OU5A 4P3XA 4QUBA 4ZVPA 3S2UA 4BKQA 1ENZA 1EHCA 4CKEB 3R9KA 4Q3AA 3DBRA 1Z2NX 3JALA 3V4OA 2X22A 3RIEA 4F84A 2PSEA 3M1AA 4IV0A 4TLCA 3L49A 3KOZA 3TFQA 4R1MA 1KU0A 1E1CA 4FJ1A 4Q3DA 3QEMA 1BXZA 2NO1A 2PT5A 1QZTA 4S35A 3COWA 2ZJOA 3F5DA 3PTAA 1JDBC 4DCGA 2QIOA 2PMBA 4HXYA 4OUDB 4AY5A 5KBYA 1EK1A 3OZTA 2CVFA 1E5XA 4QUAA 1ZU4A 1CY8A 3Q3EA 4NXMB 2AKEA 1U65A 2Z8YA 1FFCA 2PWBA 3ZLBA 3OPMA 1GFZA 4B47A 1E3JA 3OHMA 4IJVA 3VMMA 3CZ4A 1Q0SA 2ZI3A 1L7BA 3O1HB 4FUTA 2OHVA 1SXJD 1U9IA 2FW0A 4PZYA 3HMQA 5AI8A 3GJ3A 3EDQA 4EG6A 1F14A 4QQKA 3MRSA 1VG1A 4JA0A 4LZPA 1UJMA 2C84A 1T4CB 2QTLA 3JWPA 4M1KA 4OB6A 3VMFA 3KR0A 4KHZA 5FIUA 5DIFA 1HT3A 2ACWA 5ADWA 3IHLA 2XYPA 4MQ5A 4YCCA 1WP4A 1MT3A 2PH1A 2G6BA 2W7TA 1M2HA 5AO9A 5EXEA 3U62A 3U4QB 5EJ6A 3NBFA 721PA 3PEWA 3K9WA 3A4MA 1J99A 2C3OA 2AXPA 2EFEB 2X7HA 3ASZA 4D41A 4HVCA 1GTL1 5ALKA 3LO8A 3DT6A 2V7QD 3LWDA 3R6LA 4FZRA 4GBMA 4JS0A 5HGJA 4BVLA 1D6SA 3B3AA 1ZGCA 1UXKA 1ZISA 3GHYA 3KKKA 2R4QA 4H1HA 1HLDA 1N1MA 3LL7A 3TZ6A 3LPAA 3O8OB 1ZK2A 4GPZA 2IEZA 2JLCA 2UUOA 5IVDA 3IUSA 2DJIA 2AOTA 3MUNA 2ZJ2A 4JL6A 4MVJG 5ERYA 5JYCA 4Z4IA 1KAOA 3LGAA 2EF1A 3CEAA 4DLBA 4PRKA 3RRBA 2KB0A 5BOVA 1JFTA 3CONA 3COSA 4MV7A 4BRWA 1S7CA 2GZHA 3CSUA 1NKVA 1G7CA 3D3WB 4R81A 3IDOA 1LCIA 3NNSA 4Q39A 3RLIA 4BV9A 5JFOA 2UZIR 3KSUA 1N6RA 3FVRA 5INTA 2R2GA 4KIWA 4NCKA 4FQ8A 5C8YA 4ETMA 1CG6A 3GY0A 4FNAA 4HLQB 1B8PA 3RYTC 1L1EA 1PFGA 1ZCFA 4J3JA 3ZY6A 3KZ1E 3A3KA 2O8DA 2C4WA 2JGLA 4G1BA 1UBTS 2FHSA 2XUIA 3FBTA 4EUEA 4L95C 4EY7A 3DLBA 4V0QA 3DZKA 4R7GA 1SPXA 2YV2A 5LLSA 3FWNA 1X70A 1WJGA 2C5AA 3QTBA 5CVCA 2Q9CA 4G2NA 3RUFA 1WDKA 2BEWB 2C5EA 2PV7A 1DIGA 2VZ9A 2UZ0A 3AF5A 3K2QA 3OTIA 1LPBB 4NMLA 1B41A 5B12A 1EDDA 3M83A 3UMRA 5C8XA 2Q29A 1T3HA 3UANA 1ZK1A 1I0ZA 3OPYA 4A5SA 2FU5C 5KDOA 3DVLA 2R11A 2ZUEA 3WL4A 1VSVA 1KI2A 1SC4A 1ZOIA 3BB1A 3E9QA 4HEA6 1ABBA 2ZB4A 5JC8A 4R9SA 1PR2A 2NACA 3PS9A 1RWQA 1SXJA 3DJYA 1IN6A 3I30X 1WTCA 3V7YA 4DRZA 1SIWA 3NETA 4JI5B 1Q74A 1I2AA 4H60A 2VQEB 4I8DA 1QQBA 1PT7A 5F23A 3HSSA 2XYVA 2AUNA 3JPWA 3L9XA 2R6AA 1ISRA 4AJ4A 1QJCA 2EZUA 5DNCA 4QYXA 3G9TA 5JRJA 2ZOSA 1KZ1A 1MDFA 1DXHA 3HR8A 2BBOA 4YRFA 5E7MA 1FS5A 4A8TA 4GZ5A 5KU1A 2TMDA 1NLMA 1H2WA 4WVLA 3R7AA 3T9FA 3ZGXA 2GN6A 1X87A 1G3IA 2V7QA 4P8RA 3I01M 2G70A 3N6XA 1RSZA 4YONB 3BH6A 2FQWA 2FSGA 2X4LA 3VU9B 1CZUA 4X1IA 2CB0A 2PWYA 3O73A 3T0IA 3MS7A 2JF0A 1PBNA 2R2AA 1BW9A 3U3ZA 1RJWA 3L8DA 1YS6A 2JS7A 3GLSA 5K4GA 3K1YA 2QTTA 5A06A 1FRNA 1H2FA 1OBOA 2IU3A 3HKCA 3M6FA 5JVDF 1ZSYA 6REQB 2FTKE 4WZ6A 3N2YA 3DH0A 3VX3A 2FK8A 1PGNA 3OLVA 2YDXA 4EUFA 3M7IA 5LLDA 5IS2A 1H6BA 2DFTA 3G8DA 5FNVB 1C0PA 5DEIA 3ADBA 1YHYA 1JQAA 2F48A 3KWJA 4KQCA 1T6XA 2DRIA 2CLHB 4TYPA 1TRKA 4WD3A 5EXDA 4ARUA 4IPTA 3ASUA 4P9NA 1N6KA 3TL6A 3RFXA 4MR9A 1N2SA 3MB5A 3KFXA 2DBZA 2VC2B 3BHMA 1LRJA 521PA 4WXYB 2GEJA 4HNRA 4OKIA 4IDGA 3D2CA 4RZUA 3NCTA 4EYSA 5KZMB 3WRXA 3QPWA 1CUYA 2HEGA 2IY8A 2BI8A 4IQ0A 2FXVA 3L06A 3LVFO 4F8YA 3K0AB 2FXIA 4WCFC 1QAOA 5IAGA 3RANA 1JQKA 1RAEA 1B0AA 5M04A 3C6KA 3GFPA 1G38A 3HYSA 2FNAA 3HFGA 2NUAB 3BWEA 4Y1GA 2O6HA 2R1VA 3MCVA 3NDRA 2A9RA 3IR5A 2H65A 3NRBA 5EKDA 1RYFA 1U6IA 1XHFA 3UJCA 3MMSA 5CAEA 5KWEA 2ECKA 3MIZA 4JX8A 4QX6A 3V1KA 4R4JA 5HOEA 3UGJA 5DULA 2J6BA 3A4VA 3N2NA 1BS9A 3HXLA 4Q9AA 5IEBA 3FCYA 3GZ4A 1TMGE 5LU8A 5KPJA 2WF7A 1HT1E 5KWJA 3T7EA 5BURA 4RYDA 1YI8A 2Z4SA 2I6SA 3F6BX 3LL4A 2JAHA 4A0HA 1W1UA 3WGLA 1VIVA 1NY6A 3U81A 3T5BA 4F4UA 2XB9A 2Y1CA 1I2BA 4UHEA 4BO6A 2CNBA 4D2IA 1XMSA 2IH2A 1TX4B 2ZWPA 2DKFA 5E1OA 1G64A 1PWYE 1WKCA 3CUUA 1EX1A 5CDYA 2NO0A 3K9LA 8LDHA 2WFAA 2OAEA 1ND5A 3KR1A 4Q4HA 3AHGA 3IQHX 1Y1QA 1N6HA 4H7IA 2VRNA 3EVNA 2G25A 4OM7A 3T4EA 3BTSA 3KJGA 4XR4A 3GRUA 5COQA 3URMA 1KI9A 4DJJA 2XSZD 4LCEA 3Q7IA 3NTOA 4C07A 5L45A 3G0HA 1T4BA 1A4IA 4PWYA 3GJ7A 4M46A 4B79A 4CBVA 4B3CA 3UV7A 5GJWC 3ESXA 1QKJA 3R09A 3JQGB 2BDEA 2BGUA 1NC3A 4EH1A 3JQBC 1QC5B 1FYXA 1C8BA 2FX5A 4RY0A 4YQFA 3ZTWA 5A3RA 3KTAA 1W9HA 3D6JA 3F71A 1DDOA 2JGMA 2QU7A 4O4LA 3MRXA 3W77A 1DX9A 1HF3A 1J0AA 1JDVA 2WKRA 3MCZA 3N7TA 4O4HF 4BMCA 3BJMA 5FBQB 1UBLS 1USVA 4K26A 5F7OA 2QSUA 3MUEA 4FFBA 1W76A 2G82A 5ECYA 3K0SA 2A0YA 1BH2A 1Q1AA 2G06A 3G9QA 1T0UA 5KB3A 4CUKA 1YMUA 3QVTA 3IUNA 4MQFA 1UM8A 2E5WA 4J1SA 4NJMB 3G0CA 2ZB7A 2B1JA 3KPWA 4P83A 4UCXA 4CQMD 2OO5A 2P2DA 5ELXA 2G1PA 2O8CB 2FN3A 3QEJA 1AQLA 1I3CA 1ZNWA 4UE6A 1ZH4A 4XH9B 5TARA 3LM8A 2NNWB 1ZG3A 1PKEA 1Z0IA 2PGXA 3UMJA 2EBFX 3RAJA 1A69A 2JHCA 5AXCA 2O2HA 4DLWA 3T4XA 2LKDA 3CWZA 1SIOA 2REBA 5B2EA 3EGDA 1K3FA 3U2QA 1PDOA 4DQUA 3CCCA 4ED9A 3BCHA 2HDOA 2Q6KA 1NHWA 3CZQA 3RAFC 3ESQA 4ND7A 1A9XA 1YDEA 1SXGA 3LYAA 3KYJB 4EFDA 2I3GA 3EEIA 3ZI7A 3LBAA 1XGKA 3C3XA 1YTUA 1M6VA 2OZPA 4S24A 3TD6A 3TCNA 3N0WA 4F4DA 1HQCA 3AYXB 3A10A 4I1VA 2LE0A 3QVWA 3M6WA 1LTKA 2VAVA 2ZQ5A 3I58A 3L8CA 4GT1A 1JAXA 4MR7A 4C0LA 5IT9A 1IN7A 3IULA 1RQLA 1CV2A 2A5FA 5DI3A 1P7CA 1AKMA 4M0EA 1R0RE 2E21A 2XUKA 4GF5A 2C83A 1VKRA 4OY3A 3GMSA 1B15A 1HWYA 1P4SA 1T5HX 3ETGA 3FNIA 3UUEA 1HO3A 4CEJB 3AVVA 4BQRA 5DHPA 3HDTA 3WIVA 1H5UA 5A5FA 4NH0A 1W8IA 1WDLA 4ZRDA 3F73A 2BGTA 3N3BC 4DV2B 5CITA 5ERGB 2QYSA 5JXWA 1IBMB 4UU0A 5CVEA 1GAQA 2CLEB 3OY7A 5LQMA 4S0XA 2GO1A 2SKDA 4HTAA 4UMVA 4OD0A 3VNQA 4AYXA 5JZOA 4JI4B 3ZWPA 3UPTA 4DHEA 1U0SY 3H4IA 4TVBA 2Y27A 4M1MA 1IEQA 3MJCA 3OIVA 3WZ2A 3ANYB 1GZHB 4TV9B 3S7TA 1LW7A 4E2FA 2AW3A 1OYWA 2WIGA 4G5GA 4OSEA 3F5FA 1PT6A 3MGKA 4CQMA 5E2AA 4DA7A 2WJPA 4BLVA 3GD5A 5TSDA 5JVDB 3B2QA 4MH0R 2KBFA 3BIOA 4CDMA 2JGFA 5EWLA 2C4MA 3NX4A 4FGWA 2W6CX 3OTHA 2IU0A 3IIKA 1KEEB 2IS1A 2EFYA 1K8QA 4AQYB 4X62B 5DBGA 4ND8B 4MYHA 3W5VA 5M34A 1YQQA 2ZI9A 1NUPA 2IEGA 1P33A 4FDAA 4IIUA 5JWOA 3LQRA 3ED1A 1BDMA 2I4IA 4IHAA 3B8EA 3WIOA 1JR6A 1VLZA 2PSDA 5F12A 5H9VA 1FZQA 3DDHA 3VJMA 1YVUA 3UKJA 2YJGA 4I9NA 3OZFA 2KWIA 1TTPB 1RD4A 3UJAA 4AS2A 2JFUA 2IK8A 4QXRA 3CBGA 4DB2A 2VQ3A 3KOWA 3LT0A 3K9QO 2C99A 4NEQA 4KSBA 4AIIA 1G2IA 4OAPA 3MJEA 5DDIP 4DNFA 3OPYI 3W2HA 1CQIA 1MO6A 1UK9A 3FBGA 3FMPB 4YT5A 5T8KC 4JGGA 1N32B 1PDVA 5CB4F 1YB2A 2JGEA 3JVEA 4B3FX 2XQGA 2R0QC 2IW1A 4I1SA 1I4LD 1N6PA 1VYHA 1W48A 4JC0A 4LA4A 4XSHA 4UHJA 4C08A 1PUIA 3OURA 4CKZA 1EUCB 2IPOA 2QPTA 3IVAA 3PRKE 1OXUA 2O0LA 3AIKA 4N8SA 5ESWA 3T34A 4DA0A 4EYGA 2C1EA 2IYLD 1Z45A 2Q3HA 5AW2A 4QBIA 4URZR 4Q12A 4BATA 3NASA 2A14A 2JIBA 3CH4B 3EN0A 5AWFC 4DMGA 3KEFA 4HUQB 1L5FA 1N8SA 2G67A 3TAXA 4BMPB 2VG8A 4MW5A 5AVWA 2P3SA 4QELA 4FN4A 2D6FA 3R3SA 1JWLA 4ALLA 3VU8A 4OQNA 3EG9A 4WOPA 2X13A 2C20A 1YJXA 4OB7A 4G81A 2H7YA 1UZUA 3S4YA 2ONKA 2A1TR 5KJEA 4Y2HA 4D46A 2OE2A 3M33A 5EL0A 4URHA 4C7OA 4UHHA 4XI9A 2GT1A 3IS3A 3G59A 2AMYA 3GLQA 3KAKA 3UNXA 1YOBA 3E1KA 3OKAA 3L4KA 2JKVA 3RYCA 1JJBA 2BLNA 1R4AA 2CXTA 1FSZA 2ICAA 2IZ5A 1EVKA 3C7DB 3CPJB 3H11B 4OYYA 5KYUA 2PT6A 1SVSA 3W5AA 4KG7A 2G7MC 4C0WA 2HIHA 4KZPA 2RGBA 5TVGA 3X2SA 5HJ2A 1ZFNA 5BNZA 1P81A 2P2YA 1V9SA 2UYHA 3M49A 4ZDJA 1M5RA 5LBUA 3S1LA 8ABPA 1GJRA 4LNUA 1DKLA 1U2EA 1OI4A 5JNTA 1D04A 4WGGA 4XTRA 2ADMA 4EPRA 4KUEA 4B3RB 4QDXA 1UBKS 4N40A 5HXAA 1MABA 2ZSDA 1S3SA 3EXFA 3O94A 4XDZA 4RFLA 3E3AA 4NPCA 4ZEVA 1XAIA 1NZJA 2HA3A 2FUCA 4BKOA 2UYGA 4JSRA 3EC1A 3WP1B 1C3EA 4CNQA 1EFKA 3CUVA 5FPKA 2VFAA 1ESNA 1U28C 4JI8B 3ESDA 4YJ3A 5TC4A 5CR9A 4OX9Y 3KTDA 3VSDA 1MEJA 2DFPA 1EWRA 3C6XA 1LF0A 1HLFA 4NYJR 3A4TA 4XRRA 4FM9A 3U1TA 3BIFA 1W47A 3AI2A 1C7ZA 2WUEA 5KREA 4JP2A 3GJQA 2WM8A 5IH3A 4ZOEA 3GDWA 2HIAA 4TMZA 1ST3A 2QDKA 3G5LA 5AJYA 1DQYA 4TXLA 2QTMA 2PCJA 3COYA 4I9HA 1SY7A 3K5PA 3WLLA 1NUSA 2AWOA 2PJZA 4CKEA 1MMFB 4U7WA 4FYHA 4UJ5A 1Y6QA 2VF5X 2C5GA 3EA0A 3NC4A 5J5VA 2Y9PB 4FYPA 2WF5A 4S1WA 2WIDA 4INPA 4AWAA 4ZODA 4B17A 5CDGA 1W4LA 1M1ZA 1XAHA 2FB9A 3FDIA 3IDFA 1YMQA 2J5QA 5EEHA 1QRDA 1MJHA 1RJGA 4OUDA 3SX0A 4ER6A 2IHNA 4EG0A 4I1YA 1YRAA 2CE2X 2RBEA 3PHIA 1PGQA 3ZD7A 2PY6A 3NV7A 2FH5B 2WHPB 3M5PA 1QRAA 3ZCTA 3EARA 1Y1PA 4H1VA 4OQLA 3U1VA 1BWPA 3AP1A 5BR1A 1C4OA 1S2GA 4YBZA 2AFHE 4ND3A 3VYSB 1C1DB 3FIUA 2HYDA 2WPNA 5B55A 1A8HA 2Q4EA 5FTJA 3UBMA 1U7DA 4WNAB 1GOTA 1U3CA 4E6EA 3H2BA 2RHMA 4KAFA 1I7PA 1TJPB 1A77A 2DKOA 3ZVRA 2ZR0A 4IHJF 1AM4D 1Z83A 2BVNA 3KKZA 4F7DA 2IYTA 3ODGA 3VPCA 1U7PA 1RLMA 2C4HA 1H6AA 2NU6A 2C5FA 3DOFA 3H9BA 3IIIA 1KGDA 2XA2A 1M72A 1E0KA 1NJGA 1WMAA 3DPIA 1G8JA 5HQJA 1NI5A 3B89A 4Q7JB 4OYHA 2GXSA 1V1JA 2H59A 1XTRA 4JUIA 1KYZA 4B5LA 3FHLA 2Z30A 4MV9A 4G1VA 2X5JO 3TN7A 1NVWQ 4Z0TA 1ZU5A 3O8OA 3DO5A 2P9EA 2ZI5A 3Q7PA 2A92A 1Q0ZA 5HNKA 3MFYA 1VM6A 3BDVA 3AP2A 1RWBA 3A3YA 3QI2A 3NU1A 1X8XA 4KWHA 1X1DA 1BCSB 1W59A 2DE0X 1P5JA 2AA3A 3D3WA 3IVRA 3MD0A 4YN3A 3E81A 3TTSA 1LBSA 2QL7A 2P35A 3KJQA 3H5LA 3Q5EA 1BDBA 4KQWA 2GPSA 2HCFA 1VFPA 3H5VA 4Q1CA 3O82A 4EKGA 4FW9A 5ICEA 4D79A 1E1DA 2Y4NA 3O31A 3KO8A 4RXTA 2D13A 4MCJA 3KVOA 5A03A 4B8ZA 3RHZA 3PUZA 3U9TA 4YIHA 3RVDA 3PE6A 1DQSA 2E5LB 5A9RA 1GFSA 2XB2A 2GJ8A 4LJRA 2YJTD 4ENRA 5JFGA 1A9OA 1AV7A 3AUTA 2OR3A 2JAWA 3P9KA 4L73A 2H1OA 1XTSA 4HNQA 1L5HA 2YIMA 4PPFA 3RKUA 4EEXA 1VP9A 4Z9XA 5JS7A 2F17A 3H75A 2Y76A 4KLRA 5T6MA 3GGJA 4RF4A 3HEBA 4RY2A 2Q8NA 3WGHA 1HRDA 1HYGA 4U7FA 1SMKA 3S2SA 4BIIA 4HB0A 2GASA 3D3EA 3JSXA 1SCUB 1LEHA 2H0QA 1D7AA 5FBKA 2JD0A 3QSGA 2FSFA 2IRWA 4E5VA 3LA8A 1T0IA 5EIBC 4EITA 3RVBA 3V1TC 4IS3A 4ARVA 1T5DX 4DQ0A 3E9NA 1CJCA 2JVKA 3AJ9A 1IIBA 2N46A 1YQEA 2P1ZA 3EZGA 4WZBE 3WXBA 4DMCA 3HJCA 3AHHA 4G09A 3ZU5A 1HNNA 3VZPA 1JYFA 4MJ3A 3OQ1A 5K0BA 1CF4A 5HZKA 2C4KA 2Y2VA 1XJ0A 2COKA 3KT6A 2KSQA 4L8GA 3OJCA 1UBMS 1BD3A 2A0WA 4RHUA 1MIOB 2PEZA 5FHRA 3FSJX 2PS1A 4WERA 4FLFA 3NVDA 1CEXA 5K8JB 2B8NA 1LNZA 1TIBA 3QWBA 4XLTA 1HETA 5BSUA 4CW7A 5BSGA 3ZGOA 1YU9A 1F8YA 3HNPA 1UKYA 1W0CA 3ZDCA 4ENWA 1P60A 2RIPA 3KJHA 1IJKA 3FSRA 3UJPA 1LI5A 4C78A 1JHOA 1OFIA 3ZK7A 4D9KA 2FG5A 3VO1A 1KK2A 5IX8A 5J58A 3VU9A 4TMKA 1G63A 1UJCA 1CF2O 2GN4A 4HKTA 4JQYA 1XA0A 1KDPA 5DGIA 1D03A 5JS1A 2IYEA 3UICA 4B7XA 1KEVA 1VOTA 2O19A 2CLFB 1JG3A 1D4OA 3OM9A 4XLLA 2VO1A 3IQEA 4MQUA 1GU7A 3B85A 6REQA 4K6OA 4FFMA 3STVA 4JWKA 1HFWA 4MKHA 4YO7A 4BZXA 1MC5A 2IOFK 2ORYA 4G86A 1Y0BA 4KR0A 1J7JA 1O3YA 5FNVA 1K3UB 5K8VA 1N34B 1XEXB 1J23A 3ZGVA 4RPJA 2FWMX 4LHEA 1RYYA 2EWMA 3FIJA 1GNTA 2GEBA 3KSBC 1H3NA 4TTSA 3TLBA 3ZOKA 2W6ID 4PYMA 4HDAA 2GXAA 4RAQA 5DLPA 1N5LA 2GOYA 1KMHA 1MO5A 4YCSA 1W0KD 3I09A 1SKBA 4ETWA 1Q14A 2DUMA 3QU4A 2ADOA 3DLCA 4A26A 3FUTA 3NHWA 3PC3A 4NMHA 1ZIYA 1V5EA 5EGSA 2UZ4A 4RO0A 3OA0A 1C4KA 2DUJA 4XVCA 5IEJA 1QK3A 4IZIA 1LX6A 1X1AA 2G9ZA 2ZJ6A 1JR2A 2GS9A 4MJXA 3K0AA 3ORFA 3WLPA 5E9AA 1K3TA 5DP1A 3OZUA 1WHTB 2H4JA 2BTQB 2NUAA 1XN4A 2WKPA 3ESBA 4F97A 3FHTA 4NNPA 1MXFA 2VHXA 4B4DA 3GRCA 4L15A 4MXDA 4RK1A 4Y1FA 3GPBA 1E2HA 2R5WA 4BNNA 4D0GA 4OSPA 4P93A 4F1KA 5KSZA 3RRNA 4Y9DA 3GLVA 4IH1A 4QPCA 1PN3A 1I9CA 3W9UA 4KI0A 2MSKA 3WL6A 2IOQA 1Z15A 1DIOB 4GUAA 2WYOA 2PRIA 2NXNA 3CCFA 3EVGA 2REXB 1YQGA 3IT1A 3RS0A 4AZSA 3LA6A 4W7IA 4NBLA 4II2A 4X93A 1IPFA 3DMRA 1KJYA 5AJZA 3BHNA 1N7JA 4Q3NA 4C0HA 4Z7NB 1MIHA 421PA 4OGWA 1E9VA 1DTWB 1AKUA 5IZCC 1A9SA 2J32A 3BH0A 5JBQA 3EXEB 2GD6A 1JFSA 2ZSHA 2VTVA 1PT8A 4RTKA 2WJJA 5G53C 5THQA 5JALA 3QX8A 5HRUA 1VIAA 3WDLA 2OM2A 2AN1A 4HN4B 3UWPA 1M2FA 2CF6A 3K71B 1U4OA 2QRZA 3EZFA 1SGWA 3NG1A 4JZKA 4Z0PA 4RIEA 4E4YA 3AO0B 3FOBA 1NJFA 1QVVA 1T5BA 3THRA 1BDJA 1U2GA 1QKIA 3HV2A 2PLWA 1NHGA 2I67A 3A6ZA 2J6HA 4FMCF 4Q1AA 2G5PA 3A27A 4WIAA 3RU7A 3T3NA 5ISMA 5DE3A 4EG3A 4XXHA 2P9HA 1GPJA 1YRHA 4E11A 3D1LA 5IXYA 2HXSA 3P94A 1Z0DA 4KK3A 3OU2A 1B6TA 1TUGA 4O1MA 4W5QA 3N6RA 4D8WA 3H9JA 3NUGA 4QC2A 1YASA 4IHJB 5TV2A 1VSTA 2H4XA 4HS9A 2H2IA 5I4IA 3FNRA 3DZCA 5AMXA 2V4UA 3JQGA 4HZUA 5EE0A 4B2IA 5IXJA 2RGCA 3AOEC 4XARA 1QC5A 4I4TF 4Y1EA 3P9YA 5G4KA 3D8BA 4W5JA 1UZNA 4B2LA 2V7UA 1GPMA 2O52A 4LV8B 2JZNA 3BXOA 3R6GA 4PG4A 4XQ9A 1ILWA 2ZCJA 5DGCA 2SNIE 3WHLA 4W8OA 1P2DA 4LJLA 4AJJA 1UBUS 4R8RA 2R9VA 4JR1A 2OENG 4F0JA 3D4IA 2H9YA 2Z2YA 5F1KA 4GVPA 1PFKA 1SZPA 1O95D 5HCNA 5TS3A 2D3TA 2O2EA 3OT1B 1DIRA 1KSHA 2O8CA 1BXKA 1L7RA 1HE2A 4EKNB 2HQOA 4QAQA 4R05A 3HP4A 2FSVA 5FBVB 3VDQA 3WP0A 1V7ZA 3R9XB 1R8QA 3PEVA 4A2QA 4ZHSA 1Q0HA 3GGCA 2I6TA 2H9AA 2X0DA 1JJAA 3U49A 3P2KA 2H00A 4A82A 5EJ4A 1Z4LA 4BGUA 4NFLA 1NATA 1GGKA 2I34A 5DCYA 4O2RA 3V8VA 4FZ3A 1Q95A 2PR2A 4F2GA 4A10A 4F4CA 2ZXFA 4RZHA 5JZSA 4LZNA 4B3JA 2ZRMA 5ALHA 2IUFA 3K35A 4PXSA 1DQZA 1MB4A 3M8KA 4NKRA 1QP7A 1CFZA 2Z2XA 2PL1A 5EZ6B 4I4CA 1XZEA 4QZVA 4QVKA 1CDDA 4IWYA 2P2NA 4IVPA 1SCDA 2AHRA 5IT4A 2I2FA 3ZXXA 4YR9A 2ZRAA 4LJAA 2HCTA 1GSOA 3DMFA 1PJ2A 2IXBA 3FCXA 3GRKA 3EDCA 4KMMA 1NV8A 1TKAA 5DGDA 1TZJA 2B2XA 3A1UA 3PGVA 2Q3MA 4DMLA 1DJMA 4H17A 4XM1A 3O0TA 1SHTX 4RVHA 1RBQA 1WXXA 1X1SA 2X9LA 2I2DA 1K98A 2IBMA 2XEDA 2PWAA 4LBWA 1KMIY 5ALIA 2C03A 1TJ4A 2BLLA 3DAOA 1ONBA 4UHCA 1U0FA 3PVZA 4CEJA 2V6FA 3RYHA 1IQPA 3RLFA 3RS3A 2YIJA 3H5IA 1ZJWA 3CF0A 1GU1A 1X80A 2PL5A 4RAOA 2RJNA 5K03A 2EJUA 1XD2B 2OHJA 1XQ1A 4ZVMA 4EEZA 3TOXA 2R62A 4WKBA 4YRAA 3NDBB 1W4RA 2HQBA 4MLCA 4DMHA 1WVMA 1E3TA 1EMDA 3WL7A 2OFFA 5J4YA 4FD2A 3TGPA 4TLEA 3PXGA 2D4HA 3TLXA 1V96A 2BHLA 2HRBA 2ZU6A 1U7UA 5JARA 1F6WA 3NGXA 1O95A 1HDIA 2R751 2Z43A 2J3LA 5ALTA 3VRHA 2QVYX 2RGUA 2WPDA 4RH0A 1NP6A 4GNRA 1QHIA 4EBFA 621PA 3FWZA 1EK0A 4A73A 1Z7BA 3RQSA 3MOGA 1LXCA 1KEEA 3HWX1 4HBGA 4YK7A 4YI3A 4YAIA 4K46A 1QR6A 1X0XA 1KR5A 3KQVA 3NC1C 4ND8A 5TPZD 2Q50A 3ZIUA 4G0YA 4S1PA 4BY9E 4EMUA 1X9IA 1B00A 1I2ZA 2DT8A 4Q1EA 1W35A 2DR0A 1GPUA 2VP3A 1EK5A 3GN1A 3QVKA 3WO0A 4DADA 4YUWA 1DXQA 2W0SA 1XCGB 3NHKA 2H0AA 4YUYA 2WK1A 1GADO 1IFXA 3IPCA 5FWYB 4RTQA 3PQDA 5HBGA 1F7UA 4XGQA 1VPWA 2FR1A 4M7WA 4OXNA 4R1SA 2WJAA 2WOOA 3KT0A 4POAA 2PPLA 3Q11A 3W2FA 1RP1A 2WC1A 1RVV1 4TRJA 4CG0A 1MAHA 5EP3A 4ZANA 4WI1A 4QSMA 4E0BA 4I14A 1TVMA 1PL8A 5FFNA 1PQPA 3CEPB 2CNWD 3AI7A 4OXQA 2WUVA 2FOLA 3NH9A 3EIXA 5EP4A 3FY4A 3RUEA 1AHNA 5K4HA 3RJTA 5KNCA 2JBHA 1EEHA 4RLQA 2NQTA 1EUCA 2X3YA 4CKCB 4L6IA 5CFRA 2WAOA 3KYBA 3P20A 4JVMA 2G4LA 2LPMA 121PA 1OYYA 4XVRA 3E03A 5F52A 2PMDA 4MW9A 3TR0A 2VYCA 4JA2A 1BDIA 3KQOA 2BHRA 2YV5A 3OWOA 5LU9A 3DOOA 3HDVA 4NENB 1Z6PA 3Q40A 3IQXA 2P65A 1IBRA 3IRVA 3DE1X 5C35A 2OKGA 3EOZA 1WV1A 3GELA 3ES9A 3UJ3X 1N5OX 4JI3B 1S9HA 2EV9A 5ECDA 4HLUA 4R8MA 1Z07A 2FMIA 3H7IA 3KXIA 1XVVA 3T3PB 2ETVA 2WRZA 2YFQA 1M74A 1YAHA 2NSYA 3ABOB 3M82A 3NOVA 5AOBA 4BO3A 3S8MA 5COAA 5AP9A 3C8MA 1U3GA 3U3DA 4DCOA 3GLFB 3HPRA 2PX4A 1KP9A 3ICCA 3K72B 4H3SA 2HADA 5AM0A 3ZCPA 2GO7A 4PLPA 4XOUA 2OEPA 3GAAA 3LUFA 3VNRA 2W2MA 1IN5A 3SFZA 4EG8A 1NNSA 1Y8RB 2VUUA 2NUPB 4MUKA 2QE6A 2RONA 1LLUA 3KYDB 4RK0A 4QGFA 4U5XA 4GL4A 4JI1B 4DLTA 3LUDA 1QFZA 4EVSA 5EIXA 3R3HA 3H8VA 2VRCD 4U2CA 3DW3X 4FHGA 4FMCB 4OXYA 1CWUA 4Z54A 2ZSIA 1RW4A 3KT3A 4LZJA 3ZWYA 3BC1A 1FNMA 3K9GA 3ZU6A 5CYGA 1ZM2A 4BX8A 5IANA 1B8NA 1G9TA 2V9CA 4FLEA 3R24A 2IVZA 5TPZA 4LTDA 4OHZA 3ZHBA 4A15A 3IL2A 3TGWA 1VCOA 3PHLA 1USWA 4KITB 4JELA 4BLSA 1NSYA 2H8KA 3EODA 3S7ZA 4MI6A 2X2OA 2Y99A 4U4AA 1SHZA 4QEDA 3E4CA 4GR5A 3Q9UA 3FPFA 3DW1X 1NVFA 4QUEA 4YRTA 5CNJA 4RKQA 4PZZA 5LKAA 4XFKA 2WG2A 4O4HA 1E59A 1FU7A 4H7PA 3MTDA 4MKZA 1ISHA 4A8PA 1RZRD 1BHJA 1EQUA 2O7SA 4R9UC 4KCGA 2CJPA 2BKUA 2CNWA 2DJ5A 2YQ5A 4RORA 4PO9A 4Y2PA 2PHZA 2WYIA 5CK4A 2ZUWA 3N8GA 3QPVA 5AM4A 3TB4A 3UAXA 2NTJA 1SUEA 2R6DA 3DKPA 1YZVA 1TIKA 5A6SB 1PD1A 2OFOA 3Q98A 4XB2A 2SCUB 2Z95A 2ZUDA 3G89A 4YWJA 1QPZA 4P4TA 3OSZA 4IDCA 2PJUA 2BDUA 4D4HA 3P0JA 2VEOA 3ZN2A 4BGDA 2J3EA 2X6RA 4B3SB 3GG9A 2QW1A 3U31A 4XW2A 2FMTA 3NDPA 4KVFA 3H0CA 2XQKA 3GRPA 2GNAA 1NW7A 5ARBA 1FDSA 3QBTA 2Z6QA 1QH0A 2I6GA 5F98A 3Q3HA 3B7PA 1EVYA 4WKPA 3VPAA 4D5GA 1OH6A 3PXCX 3LC1O 3DNPA 5EIFA 1B23P 3T7DA 1R4NB 3I6QA 3SYRA 4C7MA 2F67A 4WKGA 1QZUA 3WK5A 2XDQB 4B81A 3RTBA 1CDZA 1K5HA 3ORHA 4MMZB 1F0YA 3VSCA 4L7VA 4B46A 1O8BA 2X9NA 2NU9B 1UDBA 4WRRA 5C1OA 4U2BA 2OBXA 1RS0A 3N75A 3EC7A 3F4LA 4FKZA 4EI2A 1E3MA 2XMBA 1C1DA 1U9ZA 2VRCA 3CVJA 5FUQA 5CHEA 3RUIA 2A3RA 4JGBA 4EYEA 1E7WA 2XXBA 1P72A 3WRYC 1KMMA 1M1YB 1NW3A 2K6GA 2X5OA 3TDKA 4KTTE 3JS5A 3SIXA 2ASEA 3U3JA 2VSQA 3QV1A 3SBEA 1G5FA 4AM8A 4WY8A 5C3UA 5AHXA 4XYGA 4PZ9A 3EUEA 1YI0A 1A8SA 1PWEA 1R4MA 3B6KA 3GYBA 1DG3A 1V5GA 1QF9A 2AF3C 2V65A 5KU7A 3FCEA 2VWGA 1R7RA 4E08A 2SKCA 2IQIA 4M55A 5JBNA 3P4UA 4DA4A 1G8MA 1N3LA 1ESCA 4IF4A 4EI7A 5DXJA 2GKGA 2QAJA 1AXEA 3TMYA 2A9VA 1J00A 5JZBA 1U2SA 2UYCA 1Z88A 1SCIA 2C2GA 2XNKA 3EZ6A 2X15A 4X44A 3UWKA 2X86A 3PUKA 3I0ZA 1DO2A 1RAGA 2VH1A 2OMKA 1KYIA 3A6JA 3FJYA 5F21A 1IY8A 4FMPA 3K5IA 5IYZF 5I7FA 1AKTA 4TQ9A 1CFJA 1A7KA 3GFGA 5EVCA 5C3MA 1IHPA 2V3CC 4L28A 2BMDA 4KIFA 2IIQA 2VBCA 4ICIA 4CIBA 3T38A 4POOA 4KV9A 4G5YA 4RD0A 2NX2A 1T9BA 3D6MA 4EABA 1Y9JA 1YXMA 2PRKA 1XU4A 2VXOA 2Y1LA 2JASA 1RP7A 2HPAA 2MT9A 4D0LB 4QUGA 4P7FA 3AX6A 5IBQA 4DN6A 3GLGE 1YB5A 3AY6A 4HQKA 5DVZA 3TMAA 2QRPA 2CEAA 4N82A 3VJLA 3RHFA 5B30A 4PHTA 5DRYA 1F0PA 2XBUA 5FEUA 2JGIA 1LS1A 2DFKB 2EBHX 3FD8A 5DIZA 1JJFA 1H2BA 3BRQA 3H18A 1IRIA 2IHJA 4DWJA 2UDPA 5FJJA 5TY0A 4L57A 1XBTA 4Q3KA 4WLFA 4G0UA 2Z04A 2QRLA 4IOLA 2LDXA 1GCGA 1AZLA 1L7DA 3PUWA 5CB4A 1Q3TA 2ZUVA 2TMYA 2PX8A 1EIWA 1Q21A 4HRVA 5E4JA 1PJ8A 3FNEA 3TQIA 1JDBB 1P17A 5DXFA 2GK3A 3PLRA 2PQ2A 4X63A 3EIOA 1MIOA 2VWPA 1UUFA 1SRQA 5FA8A 4DPMA 4YMLA 5DTRA 5DHFA 3PICA 4JJFA 4M6WB 1E77A 3LPDA 1CT9A 1ZGJA 1F3OA 2Q41A 2PT7A 1NSTA 1YJ8A 2HM7A 3C3JA 1D4AA 2ZP1A 5AESA 1X6VA 1K86A 1E2KA 5H4HA 1RC0A 3QNUA 1M2EA 3RFUA 2VSXA 1UBGA 1C7JA 1P18A 3SJCA 3MT7A 3DHNA 1K6XA 3ONWA 4PGGA 4MV6A 1TKCA 2BFOA 2DCMA 1G5QA 1ELOA 1OC4A 1KMQA 1RZ3A 3UKOA 4BMVA 5JAHA 2GZAA 3MCUA 5KHAA 3HUDA 4HQ6A 3NIGB 4KQHA 2F6RA 4OI1A 1WUYA 2DSTA 3FLAA 3DV0B 2HB6A 2FWIA 2HFJA 4KO4S 4NJEB 2XCLA 5EXPA 5J2UF 4URYR 4D3DA 1XEXA 3AB8A 5EMKA 2HRDA 3PLNA 4EP1A 1XMQB 1FNBA 1IQRA 1IH8A 4Z2AA 2DWCA 1S8FA 1KZGB 5EJ9A 4CM6A 2A4MA 2Q0XA 3LT2A 4ZALA 4ARBA 5KTMA 4D45A 3GLTA 4TXJA 5IAKA 5DT9A 2C97A 3D43A 1WG8A 1LK7A 3DQPA 1G59A 1BJKA 2YZGA 3Q2KA 4RS4A 4EK9A 4OSOA 5KNDD 3QSYA 5CB0A 2P91A 4FPXA 1Q1ZA 5LDHA 2FPGA 2VHTA 4AMUA 2BTQA 3IBSA 1Y37A 3CZ5A 1P2TA 4ZV4A 1V1RB 4PIMA 1K7EB 1XKXA 5E95A 1KI3A 1YHZA 1JL3A 2AEEA 3QLVA 5CLQA 1L7AA 5FORA 1V3TA 4GPBA 3TQQA 3AKZA 1E6LA 5FPQA 3EX7C 1WVIA 1T43A 2AJDA 4GOND 2AG5A 4JLDA 4KQXA 3V7FA 1CYEA 1UT6A 5LD2B 4A2WA 1QTNA 3CINA 4XWGA 1P4AA 3MTQA 1ZICA 2KLBA 3H5WA 2WA2A 2V74B 4XUEA 3IJ5A 2P0AA 3HCAA 3W3AD 1V8BA 1Q16A 3K09A 3CH6A 1U1FA 3DR3A 3IT0A 3L40A 2F8SA 3OPXA 5HZHA 3HBAA 1BEUB 1JEYB 3REQB 3EXEA 3KOYA 3IURA 3JU3A 5KKCA 4FQ7A 1Z63A 4YJKA 3AEZA 5LOVA 3CNBA 1UPAA 3S28A 3ORYA 4JVNA 1N6LA 2F90A 1ONNA 2JIMA 4LYGA 1M1NA 4ZAFA 1GZSA 2OWEA 3IXLA 2XMGA 4HADA 1NXXA 1TMKA 1UFRA 3K4PA 4Q9LA 5DSTA 3F8SA 3VZCA 2YWXA 3G0IA 1PF7E 1U0EA 1IUOA 4MLPA 4AJ9A 1SKYE 1FFGA 4F60A 2ZUCA 4PYRA 2VDRB 2EBUA 2WKWA 2YC4C 4RPHA 4UVIA 1DDGA 1KY2A 1YNOA 2B21A 1L5NA 1XUOA 1IG3A 5DSXA 4EMTA 4GPD1 3LQ4A 1S8OA 3OSUA 1E3IA 3ANNA 1LLDA 1GPYA 3ADOA 1EVZA 4JVOA 4G1UC 4IHJA 4BC1A 5KSOA 4L27A 4TMFA 5TQ0B 3KFLA 4REOA 1OH8A 2HRZA 1XHEA 3LLCA 2FY8A 4JEHA 2ABWA 1C9YA 2XCUA 3KZKA 2QNIA 3IP8A 4QD3A 1OLXB 2ZJ1A 3ZS8A 2GB4A 4C0AC 2R7LA 1CUUA 3RIMA 1FTNA 1X3SA 3ILSA 4NMMA 4OYRA 5IDVA 1LX7A 4HDNA 3R0ZA 3WZMA 1R5OA 4FKBA 1DXOA 3HXTA 5KNDA 1ECJA 4FB4A 3EZXA 2QN8A 1WV0A 4O0MA 4QXPA 3TQRA 3DEHA 4BGVA 2HLDD 3TBHA 3OX1A 3OT1A 1NIJA 1JU4A 3C70A 3M5WA 1GUFA 4ZOCA 3TSWA 1Q19A 4V0KA 1KDRA 2CLKB 1KEKA 4HQ0A 4XE5A 4CT5A 5DWQA 3LDFA 4JLMA 1MQSA 3WMRA 4BWYA 1PW7A 4C87A 2VP2A 4XJXA 4Q01A 1SUCA 2XE7A 3NJ4A 1QMPA 1KO7A 3PTLA 4YACA 3GZJA 3REOA 4AD8A 4WCFB 3F96A 3B8HA 3Q8MA 1CP2A 3W3AA 3DBHB 3HR7A 4P32A 3U5TA 4IJUA 4IICA 4IW3B 4D9IA 2G71A 3BWXA 2EC5A 2OZEA 4W63A 3GJ6A 4YRGA 4KW7A 2R84A 4N9WA 3ND9A 4LRYA 4XUCA 3GRYA 3I9V1 4WOCA 3W6OA 3UJ8A 1E0JA 4ISCA 2FF7A 3BWYA 3WISA 5DLYA 3MW8A 1THZA 3BGOS 2B3DA 2VTDA 3GEBA 5K4AA 5LQAA 1PI3A 4HNGA 4G24A 5EPEA 1UDWA 2G1AA 2Z83A 3UK1A 5ALZA 1QAQA 1H66A 4JU8A 5KNBA 1VJ0A 1Z4NA 5HFNA 2FLKA 2PKQO 4JLBA 3V32A 2BJHA 2IZOA 4IQFA 2N1MA 2O59A 4YMGA 3K5WA 3VR4A 2A3NA 5D7NA 1NY5A 2JJQA 2QTRA 5JEEA 1CVIA 3MWFA 2HF9A 3Q8WA 3WADA 2RI6A 2NSHA 1FX0A 3FDJA 4G0XA 3F7TA 5L3RA 2ZAYA 4ZTZB 1H0HA 1SD2A 3I5UA 5DOVA 3CLUD 2BPOA 1Z0UA 4GI5A 4HQRA 6YASA 3R74A 4MIEA 2C94A 4AK9A 1JT9A 1P73A 1UBEA 2OVFA 5K6TA 1HORA 1JE0A 2A33A 5HQTA 1FTSA 3V7NA 2NO4A 5EP1A 3V8NA 4EGSA 3DTYA 5A1JA 2K87A 5BVGB 1K8RA 3Q6NA 3VXKA 1BRTA 1OUMA 2JJMA 2YZ2A 2HLDA 1OWOA 3MGGA 4XR9A 5FLKA 3VR5D 4BVFA 4ZXPA 4JC4A 1G6KA 1K27A 2XITA 3GC6A 4FBMA 4RIIA 1HEIA 2W2OA 3LBYA 3OFJA 3R8XA 3NAZA 1PFQA 3PKIA 2XIJA 1KQNA 1D1QA 3CN9A 3GH1A 1SHJA 4KNYA 3DR5A 3HYCA 5GMOA 4FMDF 4I66A 3OO0A 5J2UB 2QZZA 1RHRA 1LY1A 4YCMA 5SZJA 4AO6A 3E8XA 3O4RA 5KVAA 2QX7A 3OFND 2A7XA 3MMZA 4X85A 3AXTA 2A5GA 2DHEA 4BDSA 2J0EA 2MMGA 1K68A 3P9RA 4FHZA 4JZYA 3UJ6A 4ENUA 5FWYA 1UPFA 5J4HA 1P8AA 1UXHA 3THSA 4B76A 3ZHXA 4RNDB 3C6YA 1ZJ5A 1JKFA 2OZKA 3R0QA 4YRCA 2OSBA 3FPLA 3M1LA 4GZLA 4LE1A 2BHTA 4P22A 4D43A 4MQMA 4JAVC 3M3PA 1OXKB 1VE6A 3IBFA 1UFVA 3B20A 1X7WB 1ZYUA 3ESAA 3MCAA 4MI3A 5K3CA 4F3CA 2Q27A 2WVAA 3AOGA 1XFDA 4L9SA 5EE9A 1G8PA 1ZK0A 4CKCA 5DNVA 2VDOB 4YCAA 4B7AA 1KETA 1SNYA 1PQUA 4DLXA 5J59A 4DJAA 1P0IA 1OJ7A 4L4UA 2F1IA 1RCTE 2GD1O 5TRTA 1WUTA 1QO0D 3ER8A 2XE4A 3O2JA 2B7LA 3SVLA 5A0TA 4I46A 4MQ4A 1YGPA 3I2IA 2J0QA 3Q9SA 3VO8A 4ZIRB 1YWGO 3HY4A 3PHCA 2XUQA 3EOBI 4YAFA 4AZ3B 2EFJA 2Q1UA 2F55A 1NXVA 3C3AA 3DZJA 2XADA 4GYYA 1U0HC 2DGDA 3VGJA 3VOTA 1U1DA 4I08A 4YHHB 4G4IA 1SUPA 2WJ4A 3GLFA 5DTEA 1YVEI 1R6VA 4R98A 4FBGA 3HJUA 4QLOA 1GHTA 1PEKE 1CUGA 1S9DA 1XLWA 4FR5A 2YJ3A 2RHDA 4QBHA 5G0VA 1Y8RA 4A2PA 4QJ3A 2NUPA 1EGAA 2YC2C 3N8DA 1W7AA 1KI8A 3VOSA 3KYDA 3VR5A 4FBLA 4FYXA 3D1JA 3W2IA 5A04A 2CLLB 3TEJA 5DGTA 1NPYA 3PR1A 4BLRA 3DQZA 3B60A 2Q1SA 1PGPA 2V7BA 3CEHA 3KBOA 4HLCA 3W04A 4DUPA 3KHTA 3F1KA 3ZQ6A 4HC4A 3D7LA 5J2TB 2AJBA 1NXWA 1RRPA 2J9ZB 1NN5A 5BQOA 1LDNA 1NW6A 4MUNA 4KLCA 3ASYA 5IJ9A 2Q9UA 1HRKA 2C7GA 2EVWX 4RKRA 5A4KA 5JNVA 1QIEA 1P77A 3OFNA 3T8YA 5IDXA 1KU6A 4LV5B 3CZAA 3SHVA 3DMHA 3G5MA 3C1TA 3SHFA 4YDQA 5C1DA 5JG7A 4RMNA 5LJIA 4I4TA 1RPTA 1BN7A 2IP2A 1YGYA 2B78A 3ELDA 5DMXA 1R6BX 1T3SA 3COZA 3R6DA 1E8NA 3GJZA 1EH5A 1MXHA 1SB8A 1YL6A 3FE2A 5AVOA 3HVKA 2P27A 4JYMA 2AFRA 5LWQA 2PUCA 1DIBA 2OO3A 2NM0A 2RKBA 1EK6A 2Z1DA 3NPMA 4ITUA 3HUFA 4DG8A 5TJ9A 1TMOA 5BYKA 3I9OA 4LRSB 4RMJA 2R6ZA 5AJUA 3QF4A 1DXYA 2VPQA 3RSQA 2O5CA 4CIAA 5FPSA 4LKOA 2VLBA 1YBHA 2CL7X 3ANTA 4HWKA 4WXMA 2SCUA 1ESMA 1IULA 1A96A 1FYEA 1JDZA 2IEYA 5CJPA 5BT9A 4EELA 4BNGA 4C2TA 1OIVA 2FGJA 1XJ5A 2HLPA 3Q3GE 4MARA 4H4CA 1BOOA 4XFDA 2JI9A 4M86A 4YAOA 1RMTA 5LZ9A 3VU1A 5B6PA 2VPPA 4F12A 3H5NA 2PN1A 2POCA 2QD1A 3OFSA 1F7VA 2R4UA 4UNIA 4FE4A 2P9GA 4MKIA 2FKNA 4Y2QA 1DRKA 1F4VA 1YZYA 4KACA 3TRDA 1W49A 1R0WA 4JL5A 2ZVQX 3CY6A 4A6DA 2YKGA 4D9HA 5BQXA 1H6DA 2JFZA 5ALGA 1RRFA 1TCBA 2QM8A 3WKDA 4KR9A 2Z5FA 4KJXA 4W5RA 2H7VA 2CNDA 4NCAA 1XJQA 3A3PA 2IC5A 1M6NA 2JH3A 2I4NA 1F8UA 2NU9A 2PL3A 5EJGA 1KI7A 4TV8F 4F86A 1IXYA 4RVUA 1JALA 1SBCA 1H65A 5JLAA 2F4VB 1U7HA 5FWXB 3MD9A 2Y1KA 4OIFA 3SYTA 3G8BA 1V9LA 3A26A 2LDBA 4MVJM 5IKMA 1DAFA 1M1YA 2GESA 4AZTA 1S2LA 1R6TA 2Y1FA 4M98A 3R5FA 3PK0A 5ER6A 5B6IA 2FX3A 3JQAB 4O5AA 3KYCA 5EI5A 1HT0A 2PRYA 1MAVA 1YBAA 3OI7A 5FOXA 4JVLA 4CL8A 1VI6A 3K9BA 2PMCA 5DWVA 4IYRA 2IV2X 1ICIA 2IUSA 4F5DA 3CA8A 3GMIA 1BKYA 4KQEA 2QX9A 4W1SA 5I9BA 1KZHA 4AF7A 4B6RA 1PJZA 3CH5A 4QGSA 4BJ6A 3O47A 3BD8A 3I8XA 1PLKA 4IP0A 4KXMA 5KYNA 1LBIA 4TKMA 1EXNA 1TJ3A 1OTYA 4N48A 2AQIA 3SE0A 3SBDA 2XRZA 5KEIA 4MUAA 5JI2E 4H7FA 3RR2A 3ZVNA 1RIFA 4LMAA 3KJFA 5EESA 2Q7OE 2FR8C 4I81A 2PU7A 2XMQA 4H6XA 3EVAA 1WAMA 3ZCRA 1P5RA 2ZBVA 1XZNA 3O75A 4ME6A 3TR6A 2M6LA 5LUBA 4BNZA 3DYIA 3NP7A 1V3VA 2GR9A 2W43A 2CXSA 1C5KA 2B9VA 3NTLA 4BN5A 3WYEA 5AKYA 3VZSA 3HU5A 2C8VA 1X7YB 3KQLA 4S3MA 2QP9X 1JMKC 2P4EA 4FMDB 4H7EA 1MEEA 2RJ3A 4GH5A 4C0QC 5BSVA 5CGQB 1MFZA 4J0GA 4KEAA 4KAAA 2IA5A 4HX2A 4ETIA 3LSYA 4Q9HA 3ILHA 4XM2A 3FCSB 2YYAA 3AL0C 2PSFA 3FWPA 1WCIB 1D2AA 2N9UA 4L6AA 3ZHYA 3A0UA 5D86A 1EJ6A 2LIPA 3OCUA 2A5LA 4EB6A 1UXIA 1JN0A 3F4KA 4CTJA 2GPJA 3FRJA 3SLGA 4AP5A 3T61A 2JH8A 3DNFA 1J42A 3ELBA 4AJNA 4KDRA 4ABTA 1LBTA 5K3SA 4BMZA 1ZKDA 2ODAA 1KI1A 3N0VA 2RBGA 3E9YA 3G2IA 5T4HA 1KYYA 3ZWQA 1QYXA 4HR7A 1AG9A 5CDSA 3PB3A 3L07A 2VJOA 5AJWA 5C1BA