3R7AA

Crystal structure of phosphoglycerate mutase from bacillus anthracis str. sterne
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
227
structure length
227
Chain Sequence
RETDSNVVTLYVTRHGKTILNTNHRAQGWADSPLVEKGVEVATNLGTGLKDIHFMNAYSSDSGRAIETANLVLKYSEQSKLKLEQRKKLRELNFGIFEGEKLDNMWDAVGKAAGVTSPEELLKFSIQEVIDLIRAADPTKQAEDWELFSTRIKAEIDKISEEAAKDGGGNVLVVVHGLLITTLIEMLDSSKTKLGVENASVTKIVYQDGIYTVESVGDMSYVAKGKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoglycerate mutase, putative
publication title Crystal structure of phosphoglycerate mutase from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 81
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3r7aA00
5PGMA 2H4ZA 2OWDA 3FDZB 4D4KA 1DKMA 3KKKA 2EKZA 4D4JA 1CVIA 3LL4A 3E9DA 1T8PA 1E58A 2BIFA 2P9ZA 3EOZA 1C81A 4JOCA 3MXOA 1DKPA 1SK9A 2YN0A 4IJ5A 1TIPA 3HJGA 4ARSA 5AJWA 4AROA 3DB1A 1H2EA 3IT3A 4FDUA 2P77A 1BIFA 2P9FA 2P75A 1YFKA 3PGMA 4EO9A 5CU7A 2P2ZA 2QNIA 4ODIA 4D4MA 1NT4A 2P6OA 2F90A 4IJ6A 3K4PA 3F2IA 3IT0A 5HR5A 3DCYA 3OI7A 2P79A 4D4LA 3D4IA 2P6MA 4E3WA 2EOAA 1UJCA 2I1VB 2P2YA 2YN2A 1SKAA 2WNHA 1SK8A 2A6PA 3NTLA 3FDZA 3QPUA 4ARUA 2H4XA 3QPWA 5HTKA 1DKOA 1H2FA 3ZHCA 1DKLA 2HIAA 2GFIA 2OWEA 1ND5A 5AJZA 2ENUA 3R7AA 5CDHA 2WNIA 4PZAA 1RPAA 4MA4A 2ENWA 2H52A 1ND6A 3E9CA 4GPIB 1V37A 5CX4A 1E59A 2DWPA 1XQ9A 1IHPA 2RFLA 2HHJA 4TSRA 1QFXA 4JOBA 1SKBA 2P78A 4GPZA 2DWOA 4PGMA 2AXNA 3E9EA 3MBKA 2HPAA 2PA0A 1FBTA 3F3KA 3O0TA 4FDTA 3D8HA 5AJVB 4EMBA 3NFYA 2WU0A 1FZTA 1DKNA 3GP5A 3QPVA 1DKQA 1C7ZA 1EBBA 2A9JA 2P9YA 2P30A 5AJYA 1V7QA 3IT1A 4HBZA 1RIIA 3K4QA 5AJXA 3D6AA 3GW8A 1BQ3A 2EKBA 3IT2A 3FJYA 5AK0A 3LG2A 1BQ4A 4ARVA 4JODA 3GP3A 2IKQA 1QWOA 1QHFA 1K6MA 1C80A 3BIFA 3C7TA 1RPTA 2H0QA 3LNTA 3EZNA 1YJXA 1UJBA 4QIHA 4PZ9A
chains in the Genus database with same CATH superfamily
2IKSA 5DP2A 3ETNA 4JC4A 1AQJA 5BW5A 3N9IA 1KAHA 3X0DA 2Q46A 3W4IA 5BORA 2Q2NA 1Z15A 5BVHA 5BNWA 4L07A 4LKRA 4CU2A 2PSHA 1R0BA 3T3DA 1T3GA 3O4GA 3RF6A 3M3HA 1W46A 4F3NA 2X5JO 4EUHA 3WWDA 3AGQA 2A8YA 3GT4A 4GR9A 1UMBB 5I45A 2J0QA 3GVIA 2ZRBA 1KI3A 2C96A 3D5QA 3VVLA 3P0JA 4J0JA 3ELUA 1OTYA 4BN4A 5JH7A 1M0SA 4BNVA 1SXJA 1Y4AE 1N3YA 2FMUA 2QRGA 4WA7A 4LJLA 1XQVA 1VKJA 1FMLA 3CUKA 1NUSA 2EVWX 3KYDA 4K88A 4KQ6A 1J06A 3UWSA 1YFZA 2P8JA 2QDXA 3QVGA 4KGXA 3STTA 1CNFA 1Y80A 1YVPA 1FX0B 2QMZA 1YNOA 1TAHA 3KQSA 3PKJA 4I55A 1QG2A 3JSAA 4N0DA 3IJPA 3W7BA 2R4QA 4LDQA 5LLTA 4UDXX 2I67A 1OLSB 3FKSA 2NTJA 1B00A 1OU0A 4YC7A 3IP1A 1YR3A 1Z73A 2H0RA 4DRXB 1E1RD 2PE5A 1KZ7B 3DW1X 4RXTA 1U04A 5DTEA 2WFLB 3R5TA 4RY0A 5LB4A 5KEIA 1H2FA 3WOHA 1S8NA 1T36A 2FETA 2PYIA 4QUGA 1CQXA 2XWQA 3IQWA 4I4TB 4EW2A 3C2QA 2TYSB 3FVRA 4EL0A 4Y2YA 4M0MA 5AESA 2AOWA 3RS9A 3KKMA 2GEUA 1DGQA 5CX1A 3KTOA 1EB8A 3O0DA 3IESA 3H1BA 5ALYA 2FZCA 5L3ZA 5FTNA 1CUCA 3UW3A 3IOBA 4WVLA 1WNFA 3IPXA 3SHOA 3IUEA 4UAVA 1TTHA 1GUFA 1VHJA 3PGVA 4JOBA 1DRJA 5D1NA 3HBLA 2P78A 2QN7A 3NBQA 3V8NA 3HKBA 5CYPA 1VIYA 2H4FA 3HB0A 1P7CA 2E55A 4MGZR 3SE7A 1UADA 4TTSA 3NNDA 4MV4A 4LI0A 5KU1A 3QJGA 3D3QA 3OZFA 4JLOA 2CLMB 1ZY2A 5KKAA 3JQ8A 2B1RA 1A5SB 1MB3A 3L8FA 5IJWA 4Q4HA 2LV8A 4MWOA 2LPMA 1L1QA 3VZBA 3R3XA 1FJXA 2J41A 4BBAA 3KHUA 1I80A 3DA8A 2LDBA 3I5UA 4Y98A 1LLUA 4I9FA 4LJYA 4FLEA 4MK4A 3UT5B 4L57A 3SDSA 5MF6A 1SKMA 1BCRB 3WYEA 3GVXA 3LX6A 3OMLA 5ADHA 3C3BA 2UYYA 4WASA 4L75A 4G01B 1J70A 3BJIC 4LRQA 4Q9HA 4ZMSA 1J5PA 3ZQJA 1JXQA 3G2IA 1YQQA 3SBEA 5FADA 4B1FA 2GO7A 2ZANA 2NO9A 4KZPA 4OU5A 1CB0A 4B7XA 1GUZA 1TECE 2B4YA 2CZGA 1Y5NA 4WJZA 3Q9UA 4FHEA 1FFEA 4HQ6A 1G20A 4OQLA 3RYIB 1Q77A 4UPDA 3EZNA 1LPSA 3CUTA 1USUA 3GLGE 3JYPA 1QGAA 3BL6A 5JYCA 1GNTA 5GONB 4OSOA 3HXKA 2OPHA 3S1AB 3TWOA 2BBOA 2AQKA 1M1NA 1EDDA 1HG1A 4FOLA 4BUCA 1DDIA 1H3NA 4WFKA 3GA5A 1NR5A 2DG2A 3C70A 4C08A 2QJFA 1GAEO 1WWKA 2FAXA 3W0LB 5B5SA 3ZV4A 3F9CA 5CDFA 1EESA 1U1FA 3MAGA 3JQPA 3MWKA 3IODA 4GICA 5IWAB 1T24A 1BOFA 1WO8A 5ISMA 5FPSA 4R83A 2G67A 2AMLA 1D7OA 3MT8A 3A6LA 4NJMB 4RSRA 3HABA 5DTRA 2G9UA 1YZTA 3G85A 3TZEA 3N2GA 4B6FA 3ZK8A 3FTCA 3ASVA 3I32A 3JZMA 2MMCA 1DRUA 4W5QA 2WM9B 3F78A 2GN6A 3O3CA 4ZO6A 1VECA 2GK7A 1L3CA 2V6BA 3K0CC 1JQLB 3HZHA 1PDOA 2YXBA 2IYVA 2OYSA 1E3SA 5K2MA 4PFSA 2VDKB 3O1LA 4UBNA 3GLIA 4MS3A 1W47A 2IZ5A 2VUHB 4YMUA 5IJ9A 2XMDA 3R74A 3E2MA 3WK6A 2IP2A 3A9VA 3R8XA 5IT4A 3HSYA 1O96A 5K7SA 1EH5A 4RXUA 2JVIA 4KITB 1KQFA 4RSGA 3V7WA 2WV7A 4YONB 3KZVA 3HXLA 3BGSA 4ZARA 2REOA 1GUDA 2C4MA 3REFA 1BJRE 2XADA 4F3CA 5CLQA 1WDKA 2G40A 4AN4A 2IH4A 1A97A 3FM9A 1YBVA 1O6ZA 2HRQA 2BFDB 1BXGB 3EWIA 3U26A 2W7TA 4CCYB 2Q27A 2IEGA 2PFGA 1RM4A 4DABA 2HUNA 2EW2A 5DYYA 3QKWA 2ZS7A 1PVVA 4GAEA 4OP3A 2CYBA 4QTXA 5F33A 4UBOA 1XKLA 4BB5A 3IB3A 1PR5A 2FFJA 4KGDA 4M1TA 3U2QA 4JKOA 3WIBA 3LHKA 3HEMA 4Q21A 3RRBA 1FRNA 2I2DA 3PV0A 4D92A 5JARA 3HJFA 5EYPA 5IRCD 3FY4A 3T35A 5EEGA 4HX5A 1G3MA 5HZKA 2XLBA 4I81A 3WGVA 2IYFA 4F6RB 1A4XA 3FNRA 4KNYA 3F49S 1RZVA 2Z9DA 3OPQA 3GFVA 3O90A 3SBOA 2ZBDA 2B6HA 4RPGA 5A9TA 1QMGA 3ANXA 1HORA 3H84A 3CUEF 4FILA 2A0UA 3UN1A 1DKNA 3SC3A 1NUQA 2EGHA 2J9YB 1B8UA 1O97C 1T2AA 3BOSA 3P0HA 1C7ZA 3T1QA 5CCEA 3NWEA 4LXTA 5FHRA 4GKVA 2H06A 4P2GA 1NMYA 2ZIAA 4HV4A 3DDCA 1N6PA 5AIAA 1L7RA 3BULA 4KXWA 1U0GA 4U6NA 4YCBA 4ROTA 4ZRDA 2JHFA 4W7SA 5EI5A 1PSDA 4PONA 4WEQA 3ZVRA 4V24A 1Z5ZA 3T5PA 3VPXA 4MLDA 3PLRA 2PZJA 1MAVA 2ZW9A 5B6IA 5JYEA 2XNDD 4HWPA 4WXPA 3R9IA 2POCA 4M7RA 1E1LA 2FTKE 3FZEA 5EINA 5KNCD 1NNSA 3IDSA 4XIGS 4C3ZA 3NHPA 1X6VA 1RT9A 4ALMA 4LYGA 2VWPA 2AI3A 4FBLA 4YDSA 4DWJA 2FU5C 1Z0UA 1J2EA 3OAAA 2H2AA 3RO7A 2QE6A 5DIFA 4JOQA 2A5LA 4M7OA 4NNJA 5KUTA 3CRZA 4KO8A 1HTTA 1G21A 2W6JA 3EXFA 4R98A 5DK6A 3WWOA 4QC2A 5DXFA 2FQXA 2VHQA 1MFZA 4EH1A 5DP1A 1T2UA 3DBOB 4MIOA 4RA9A 5HCIA 3RVSA 4GLOA 3WB1A 5FPKA 4YRLA 4A27A 2RB4A 2BZSA 1QTQA 2H7YA 5FQNA 1HYEA 1SIUA 1E58A 4ZOLB 2OILA 1KEZA 2RGXA 2ZB8A 1C3OB 3T3GA 1VIAA 1U1EA 4JROA 5DLPA 2FW8A 2WF5A 3BE8A 3OCUA 2JGEA 2YX1A 2LE0A 4XWTA 3A1VA 1LDMA 4HR7A 1X42A 3HJGA 1DIRA 2YWRA 2L17A 1NA5A 1BE1A 1F9AA 4Q00A 2LKDA 3ZG6A 1PJBA 1Q7BA 3HC7A 5BN1A 2IYOA 2O14A 2VHTA 2OCDA 2AMYA 2G7ZA 2GN9A 2RHTA 2ZRHA 5AIBA 5JI3E 2MSCB 3MTEA 2N3ZA 1KORA 3E2PA 4O4IA 4UARA 3UQYS 3QE9Y 5BSWA 4JT8A 3U7GA 3DFKA 3K71B 1WXWA 2ZIXA 3DCYA 1ZVJA 1ZOOA 4L0DA 4BX3A 4F9FA 2IVZA 3GLUA 3RBXA 2IOQA 4BV9A 3GGJA 3PS9A 4NIMA 3AHHA 1XPJA 1AH2A 4Z3KA 2W8BB 1FY2A 5K4HA 3IAXA 4PIMA 1VDZA 1DWPA 3TFWA 3RYFB 5C5DA 1H0KA 2QROA 1RRKA 1UDWA 2AN3A 2CLEB 1I4TD 3GA7A 3G0GA 4FGZA 4PLTA 4XQEA 3WJ7A 1OYYA 2AC4A 3AL3A 5ESRA 1A96A 1SN7A 3D4NA 3NAQA 4Y2HA 4JUFA 4E70A 3UWMA 2BKUA 4OREX 3A1NA 3COVA 1ZUD1 1IUOA 2PQ2A 4IX1A 3U7HB 1NUHA 5D2CA 2RGNC 5KWIA 3QI7A 4GLJA 2VKQA 3GDFA 5D7NA 1C2TA 2H1FA 2W6OA 2ECPA 3OLQA 2VHEA 3Q8WA 2HV9A 4PSAA 1IHPA 3RRZA 1I30A 4FMBB 3O9MA 1P31A 3PKZA 4O8ZA 3C74A 4B4DA 1B8NA 1KQPA 1SBZA 1T0PA 5JWHA 3E9EA 5KSOA 2QTGA 2Q7XA 4RLHA 5KDOA 4ONEA 2E4UA 3HE3A 2GJ9A 1E1DA 1RVV1 3EY4A 1KOFA 3DHVA 3GFQA 3PHJA 3PHHA 4XUCA 4Y2VA 2IUFA 1CW2B 3EAGA 1KA9H 3LC7O 4B2PA 4KXYA 5DX8A 4HJRA 1R0SA 4HAXA 3S2FA 1IXKA 3TR0A 2FFBA 3O93A 3VR1A 4MWBA 1M1YA 1FPMA 3RAGA 1T3TA 3RVBA 3D7MA 1KBZA 2ZYVX 5AHRA 5H1YA 3CR8A 4M0FA 3VJKA 3N7TA 3UMBA 3V3KA 3D59A 3FWZA 3AP1A 5IFLA 5AKXA 3WRXA 3EVNA 3TLEA 3STVA 1S5PA 2O1XA 3BWDD 3PDHA 4BQNA 1DIAA 3FTDA 4D6PA 5EWJB 3R9XB 1IEXA 1H6BA 1N2CE 5H02A 1KQGA 4CIDA 1R3DA 3SC6A 3N2KB 4X7PA 2GO1A 4GYYA 1BW9B 4S0ZA 2W90A 4Y67A 1IN7A 3T7KA 1ZL2A 2FF5A 4TSKA 4EQ6B 1P44A 3N7AA 2G4CA 2OG1A 1SUFA 3EAFA 4IIJB 3F6PA 4KWHA 3O7WA 4P92A 4IEIA 4B8ZA 2VSYA 1D0IA 2ZU0C 3BK2A 5DRYA 1G6OA 1FF9A 2IY8A 3FFAA 3EA0A 1GN9A 1H0RA 1X39A 4G23A 1HDEA 2GSWA 5TT1A 5HJEA 5L7WA 1Z47A 3ZU3A 1CQJB 2KMLA 4TPKA 1N2JA 3I9JA 4RA6A 1TQ2A 4BNLA 1YB4A 4QOGA 3JS5A 3I3OA 3OJLA 1BEUB 4R3UC 1YFJA 3ICQB 5H68A 3VAAA 1RQNA 3OM1A 4RV5A 4HLCA 2WTXA 1P60A 2XVZA 2PUDA 1XZBA 4FK8A 5HFJA 4S1VA 5EHIA 1MC5A 1FQOA 2Y9PB 2WD7A 4XVQA 6ABPA 3GGDA 5A0TA 4GRDA 1YTUA 2AFIB 1AF4A 2AHOA 4J49A 1M73E 1VJRA 4PYKA 5JBNA 3GH3A 5BSGA 1J56A 1TM3E 5FHQA 4IRXA 3JXEA 5U4XA 3FWKA 3PX2A 5ER6A 5D7BA 3L9WA 4LI3X 5AK5A 2PS3A 3NT2A 1J0EA 2A0KA 1RJFA 2EHJA 2XTNA 3C3KA 4TSFA 3QUTA 5BSKA 4B3SB 3IKVA 2ZUBA 1GT91 2Q2OA 2RH8A 5E8JA 2B36A 1Q17A 2ZRNA 3EODA 4N01A 2C8LA 2O2JA 1F4VA 2PZKA 3CLTD 3MWYW 5JDIC 3UQZA 3VX4A 4D82A 1PVOA 3RAEC 2OV4A 2RGDA 1OX6A 2WM8A 2JAOA 3FLMA 1DAOA 1JAYA 4H15A 4LCJA 1L8QA 3GEGA 2WBLC 4RVDA 4XLZA 3W2TA 2PUEA 2E89A 1YA4A 2O3RA 1T10A 3NWJA 2AXPA 4MW9A 4O6VA 4BGVA 1K7XB 3W2EA 2AFHE 2X8JA 3WMGA 4C22A 1HYQA 3CYFA 1X7GA 3DWGA 3ILYA 3KL2A 3UAGA 1ZM2A 1BFDA 2BM8A 1PEKE 2H29A 4I9UA 4LC9A 3UXMA 4XASA 3KALA 5FUBA 4NJOA 1GKLA 3M82A 3G79A 2KE5A 3PC8A 3VR2D 1M6HA 2CCGA 3RC7A 3HCFA 1Q44A 2C59A 3BE6A 2OBFA 3JD0A 1UK9A 1DG1G 1I01A 1V39A 3DKIA 4GPZA 4JU8A 4MRPA 1KFCB 1MBZA 5CPFA 3WGKA 4BNGA 4F6CA 2XGGA 1U6IA 1OFTA 2PHZA 2XVMA 4KFTA 1SFRA 3KU4A 1YBFA 1AF7A 3OFJA 4XB1A 13PKA 4CFZA 5FAKA 1UWLA 2OO5C 3V8BA 3KWMA 2OYCA 1DEOA 3GDHA 2OHHA 3P26A 1LF5A 3TGPA 2PUWA 5AW2A 5JY6A 2BZ1A 3OWXA 1JJIA 2WW8A 3QW4B 2FWBA 2GM5A 4P5PA 3PC2A 4D4HA 2GD0A 2O2IA 3PT5A 1T2NA 4HB2A 1QO0A 3LOUA 4RETA 5CK4A 5LQAA 3UBTA 2R60A 1JWLA 4HAIA 4KE6A 1TKRA 1UAGA 5DTJA 1BQ4A 2IGBA 4I1SA 1AQYA 1P8JA 2MSLA 3E7XA 5CDUA 5FKJA 1H4QA 4HN2A 4ZYVA 2R7MA 2OQ2A 3BG5A 5EE5B 4YRPA 1UC9A 3WI7A 5HZMA 1U7XA 4TTTS 4C14A 4ARIA 4RUKA 4RY8A 3P9ZA 1AA9A 1U5BB 2VQSA 3QEAZ 1UDAA 2JJMA 1YJXA 1ZN7A 2OLJA 4BOYA 4C9BA 4KR0A 1G16A 1V3UA 4E51A 2IHYA 4WTOA 4UJ5A 4WGFA 3S2EA 3ZHSA 1ECGA 4YMVA 4M83A 1KIMA 2ISSD 5CHEA 1XSEA 1KDYA 4ALIA 3C3AA 1EVQA 1JTVA 2QM7A 2ONYA 3T9BA 2QUJA 3K1TA 3LL4A 3TGWA 4J0QA 5IG2A 1WUIS 5KVVA 1VG0B 5BVGA 2NZ2A 2XJ9A 3DC2A 4K9OA 1QUFA 1SPBS 2I22A 3A3YA 4XZ3A 5DLYA 3RU7A 1Z8HA 3ABSB 2VJDA 3CH5A 2L0XA 5TT0A 4WXHA 3WMXA 2HJHA 3DD1A 2YDXA 4JI1B 4DMHA 1ZGHA 1CR4A 1VHDA 3PQ6A 2BHSA 3NWOA 5DO9A 3HNRA 4M8KA 1YJCA 1TM2A 3CRW1 4AWAA 1SXJC 4M60A 2Q5EA 5CAEB 2VSXA 1CQWA 3JPYA 2IXEA 4Z7JA 3CLSD 4LZWA 3SSOA 1NVGA 4RABA 5CD9A 1H6AA 3OMXA 4RZSA 1UIRA 2IS2A 1W5BA 5GGXA 5C53B 5C2JB 4FZRA 4F72A 3GVCA 1FFAA 4CLRA 2NUBA 2A35A 1DJQA 4PCLA 2VNHA 1JKJB 3GRRA 4K9MA 4Q7MB 5GINE 4DR7B 4TT3A 4AP5A 4BLQA 5B1IA 1G3UA 4EA8A 2YZ7A 3OX4A 4JI7B 3IPAA 2C77A 3VFDA 1SCBA 3CF4G 3OEED 4YAWA 3WWYA 3WYBA 3K35A 3TIFA 1FSZA 3KKPA 1RFGE 3ZU6A 1GKUB 1XDDA 3IERA 4NE2A 3EGEA 5DLDA 4GSKA 3U4MA 3D2LA 5AJZA 3T3OA 3HFJA 4QTYA 2LKCA 3HFSA 3OQPA 3COZA 1Z2PX 3H1AA 4UCWA 5TY0A 2XUPA 1BXZA 1FSSA 2VJBA 3KQTA 3OCZA 4IXMA 4N8DA 4QYMA 3WX0A 3I9OA 3DH0A 1TOAA 3F5SA 1CE8B 2I5PO 3NIGB 3FWPA 1LB1B 4MRMB 4XCQA 1T3SA 3GZNA 4GI1A 2VZ8A 4L28A 4PG5A 1J1UA 3CLHA 3P9YA 1GCGA 4CF5A 1XCOA 1I5EA 3IA2A 1NBMD 3KBBA 3AEKA 4Y1GA 4ND7A 5CA0A 4PXAA 1HC7A 2FA9A 2RBEA 2JLRA 3ZWDA 1EFAA 4X44A 2QX6A 3ZI4A 5HS4A 2OP0A 5BYBA 1FP4B 4KIUA 2PMDA 1I24A 1UOEA 2ZIUB 3EF3A 3F8TA 3NOVA 2D4AA 1BHSA 2WU0A 4XB2A 5G4KA 3X1KA 3GLFB 2D13A 3OFKA 4JQSA 1KZYC 5H7XA 3VX3A 1U1IA 2GJSA 3GRAA 4HMOA 2YZGA 2EW8A 1OI2A 3ZWQA 1BDHA 1H5QA 1LVGA 3A4TA 1ZK2A 1CP3A 1ZM4A 3I6ZA 4FNGA 5DTIA 4I1UA 2VO1A 1ZXXA 3UWOA 4ZHQA 1ZJYA 2JGNA 4P3XA 1KI2A 4JB3A 2J6HA 2VP2A 4Q1CA 5AQEA 4FW9A 1RTKA 1SB9A 4KHZA 4KQFA 1Y9ZA 4OV6B 4DMGA 5A9SB 5K0CA 4RULA 4V0KA 4KE7A 4FW8A 2F43B 4IVNA 3TX2A 2H1HA 1OW3B 4FOTA 5JSZB 4NZYA 1D6NA 5KNCH 3OPYB 4BS9A 3CKMA 3D7SA 4NXNB 4M87A 3KD2A 2O6LA 2NZVG 3THYA 1IB0A 3FHCB 5JNSA 4EHKA 2YV4A 5EXPA 4BNFA 5EWMA 3JVUA 5CGQB 3K1YA 3U40A 2OBNA 4FYYA 4FLFA 2P67A 4TM7A 4TTQA 4F9GA 4WBXC 3AUJB 4G0PA 2WHPA 2ZOSA 3LWNA 1XJ0A 4L7VA 3ZE2B 4CIYA 2Q0QA 4DJTA 4RTSA 3GZ4A 1KJNA 2ORVA 3G2OA 3AJ8A 4BMSA 3WSWA 3AETB 2BGKA 4CG1A 4RTJA 4RKEA 3V32A 5DTQA 2C8KA 3HCPA 3GLHB 4L9WA 2P91A 4OX9B 4IM7A 1BWSA 4JYAB 2HO4A 4N5MA 2GM9A 4YT4A 5DT2A 4NG5A 1QH8A 5CMLA 5DYWA 5I8WA 2AW5A 4PGFA 1IVSA 4U7HA 5LZ7A 5JJIA 2PPVA 1ILWA 1AHNA 4PYQA 4PNEA 1S0UA 2DU8A 3JD3A 1C8VB 5HKAA 1XB2A 1IC6A 2B2XA 2C5FA 4JLUA 1Q0LA 1QV9A 2REXB 1B0PA 2X23A 2RKBA 2NT4A 1EGMB 3K9NA 3LX8A 1W19A 4LOHA 5EJ8A 2CL6X 5AI8A 4JXZA 2WNSA 2CFCA 5CVJA 1YBAA 4G0VA 1DELA 3DBIA 1V1RB 3AFHA 4GF5A 4PRLA 2CDRA 1N8TA 4AL4A 1WHTA 2BMAA 2O2GA 2WAOA 3VTZA 4F2PA 5BY2A 2J1LA 4NVRA 1Y4ZA 3EXAA 4I9NA 3B1KA 2DQ4A 1U7ZA 3V42A 4YT8A 3P0IA 3Q9LA 1O8BA 2G07A 3K9GA 4I1IA 3E6AA 1NW3A 3EZ6A 3NS7A 2WNHA 3H2KA 3CNOA 3REOA 4CBVA 5CVEA 3LHDA 3R5JA 2IY7A 3WLSA 5K05A 1A4RA 1N0VC 3ZDEA 1YJ5A 3AEYA 2CXNA 3QFTA 1RJDA 1FTYA 3ND9A 4OK3A 4RQUA 4AN0A 4G67A 2PZ8A 4O2LA 3UAYA 3FZYA 2J6CA 3FPLA 5HRUA 1E0DA 4M0DA 4CKEA 3C8UA 4IIBA 4RJTA 1NBME 1DQZA 1NSFA 2B37A 1SBCA 4MUEA 2EL7A 4NZNA 1TUBB 1PYDA 1Y1SA 1H2HA 2W48A 3AR6A 4CODB 2ZE7A 4TYMA 2PZMA 4N5IX 3OF2A 1EDZA 3KT8A 5CLLA 2HJRA 1GPUA 3AFNA 5H0IA 3C87A 3RYTC 2DRIA 2WF8A 3U4GA 2YVLA 4A8HA 1RBZA 2IDMA 4WQMA 2AD5A 1MABB 2C2MA 4KDCA 2V7XA 3WWEA 2HPAA 3WZLA 2XOEA 2JKZA 4MJ3A 4HSGA 1EDBA 3AI1A 4ZO7A 4FDTA 2IEBA 3WLKX 1JR3A 4MULA 5JS1A 4LK3A 3WB2A 1JP7A 2WHYA 4D6YA 1AZLA 2FPLA 1NYRA 2J09A 2LRHA 1O6GA 4G1BA 3F6SA 1Y9EA 3N70A 3SZOA 4E2YA 1H2XA 1FVOA 2XQKA 2LTAA 4QEDA 1H9BA 1RNLA 4NBKA 4XLLA 1D2HA 2GHTA 3O84A 1KYWA 3PCRB 3QENA 3SYLA 6YASA 5J4LA 5L7TA 3NR2A 3PFCA 5KS2A 2XGJA 1OWOA 2E6UX 1W2GA 3B53X 3GRYA 4AJLA 1Z26A 4WOPA 3O4RA 3OF5A 3WNVA 4A5SA 5AVVA 2O8CA 1CHDA 1YHYA 2KSQA 1KQOA 3Q8XB 4P3OA 5M5BA 3HM9A 1K89A 3DULA 1O57A 2A59A 5TS3A 4BNZA 4PX9A 3V3TA 2XYQA 4HDCA 3COPA 2WAAA 2P9JA 3JAKB 3H5IA 3IHWA 4TZ0A 1DJLA 5E9JA 1B6RA 2B5WA 1XRMA 1OFGA 3BGOS 1HLDA 2PT9A 3KIPA 4DJAA 1GCOA 1SO8A 3UJPA 1RYDA 2YWHA 4Q12A 5HILA 4Q1FA 2PWPA 1IZ0A 1KQ3A 3BHIA 3L1UA 4XPZA 3WLQA 3GROA 3F0TA 4UBIA 3OTWA 1UXHA 4CQMB 2XRFA 2NTEA 3P5SA 4RLSA 1P91A 3G5MA 4H27A 2D0DA 1I3CA 3TNYA 2IBTA 3VQTA 1TUEA 1WY7A 3WY9A 1N78A 5AVYA 1M2WA 4EJSB 5B64A 3QVMA 3WGUA 4TGLA 3E35A 2P8SA 2IS1A 1E1KA 3OZEA 3QMMA 4L76A 3WBKA 2G8NA 1NW4A 1V16A 1U8EA 2ATVA 2H8GA 4R2KA 2AK2A 3RROA 1LDEA 2BFWA 4OJKA 1EBFA 1XMSA 1NC3A 2B35A 1P7PA 2WOJA 2F48A 1FRFS 5KYTA 4IZ6A 4WW0A 3WWCA 1JNXX 1YDFA 1YMVA 2UZ1A 4ENQA 1C30B 1SGWA 3MVEA 2WKQA 1RQLA 1NVEA 1P80A 2OTCA 2FB9A 2P6OA 1YBMA 3D1JA 3DT9A 2I3ZA 3QOFA 4G9BA 1VZ3A 3RS8A 2GAJA 3KQOA 3OHSX 4QU5A 3P4YA 2BFEB 5J2UB 3RG2A 3AUKA 5C1IA 3L7IA 5ELMA 3AQIA 3DVLA 4BO2A 4F2HA 5F5LA 4CTKA 5KYKA 2HQ1A 2PZEA 2JFZA 4L5IA 4BNIA 1LFAA 8MHTA 4FSXA 3ZYZA 3T1HB 2AS0A 3GAZA 5GONF 4IV5A 4I6JA 3U80A 2PVSA 3EVFA 1ZEMA 10MHA 5PNTA 2PKRA 4YPFA 3TTSA 3EH2A 4NZOA 4B35A 4WVFA 5GIPE 4M1OA 3VU3A 2O8FA 1ZAKA 5H80A 1VSTA 2J7PA 1WRBA 1N7GA 2UAGA 2R11A 3NUZA 1DQRA 3ZDFA 2OD2A 4KV9A 2JDIA 2XQJA 1G3QA 2IDJA 1NT2A 3U4AA 3FGPA 1M2OB 2ZSUA 4FFRA 2OM2A 3W3ZB 4TSRA 2WJIA 1XZDA 5AKIA 3MS2A 2WKWA 2CFOA 1KWGA 1S3GA 3WTCA 1JAZA 4DJDC 3FW1A 1M6EX 2CUNA 2NUTB 1B6SA 2DAPA 3P7MA 1V2GA 1Z83A 2V0CA 5K0BA 1TGYA 2OXEA 1RCFA 3TJZA 3RAJA 1PFKA 2GN2A 1R64A 1KSGA 4PFJA 2E7ZA 1U2SA 2EAUA 4D9IA 1J8DA 5L7YA 3RSSA 3PB3A 4N39A 1B41A 2QW0X 4WY2A 2H3HA 1SVNA 4TYYA 3HRKA 1P1FA 3CLKA 2B25A 3NVAA 4UOZA 4ROSA 3DZFA 1E3EA 1PYOA 1Z18A 1KH2A 3KSUA 1JDUA 4H16A 3T5TA 3UJ8A 1WQ3A 3FWYA 2G5CA 4ZI7A 2O2SA 1LCIA 5CNIA 3UK2A 2PFKA 5HX7A 2IPAB 1MQ9A 4F7DA 5J2TB 3N8NA 1U8YA 5IKOA 2OC4A 4NCKA 3WRXC 5IBPA 4OL0A 3SDZA 1YCFA 2V5AA 4LJAA 2XJ4A 4YWHA 1DJNA 3U5ZB 3DCNA 5JLAA 1KMHB 3P0FA 3VSDA 5LN1A 1E60A 1JHZA 3BMOB 1AGRA 4L5AA 4U0JA 3JAMA 1TB4A 2VCHA 3ED1A 1GTSA 1RAIA 2Q4OA 3ESDA 4MR8A 3RFUA 1CZHA 5EUMA 5CCBA 1JU3A 3R77A 4KI7A 2XDQA 2P2NA 2Q5FA 4XQGA 1MG0A 4BO8A 1FU4A 2O05A 4Q05A 2O9JA 3PPVA 1G8HA 3JQ7B 3Q10A 1QDLB 4NZZA 1PHRA 1KMCA 2DH6A 4AYWA 2PAAA 1JIKA 2FN8A 4CF3A 4KX3A 1AA6A 2XZOA 3SJUA 2EKQA 1BN7A 3EGWA 2C9BA 1OF1A 4YCDA 4QGSA 3N2YA 5C8ZA 3H3FA 5I7VA 5IUNC 4DSOA 2MYTA 2Q4BA 1WB5A 4B45A 5KWJA 3ESQA 1HMYA 2ZRLA 5EGNA 1KEKA 4K0RA 5EQFA 4HLUA 4B6PA 4AUEA 4OHXA 1P7WA 4KB5A 1C8LA 1A98A 2I2WA 4GC9A 4KIFA 4NZPA 4NECA 3S68A 1XXHB 2ZLBA 1Z33A 3K4PA 2WG0A 3QG5A 4MHOA 4CR8A 4OGGA 2OV1A 5BN3A 5BQPA 3LKVA 3HA7A 4XDYA 4F56A 2UYHA 4ARBA 3KLOA 4MRSA 3ZD7A 3K3PA 1E77A 2BR3A 4NDAA 4R9UC 4HSEA 2NQ2C 3NTLA 1BH6A 1XTBA 2O7QA 4YREA 2PNJA 5IS2A 1ZNXA 2C4KA 3DFZA 4M0KA 3KPUA 5JYDA 1H3FA 3EPKA 3PD0A 4R3WA 2VT2A 4PYMA 2WD9A 2A5GA 4RGQA 2JLZA 4Z49A 1NNEA 4GGMX 2R62A 4IXNA 2PN1A 5ALIA 1EQ2A 1FOEB 3LLVA 2V58A 3SQXA 5EA2A 4KPYA 3AEXA 3HV2A 1SU6A 4QZVA 2FGJA 1NPYA 1H8HD 1LY1A 1Q1AA 1UFRA 4KXLA 1MB0A 2EKPA 4UE6A 2LDXA 5FBZA 2PUFA 3SCZA 3AVXA 2AZTA 4DCTA 3LTEA 1IULA 2D8MA 2BISA 2YOHA 5I7UA 4V0QA 4LFAB 2NZUG 1SKBA 1Y3IA 3CJTA 3OIFA 2Y1DA 4N40A 1BO6A 5AMXA 4BQRA 3PXGA 4EPYA 3U60B 4G84A 3AEZA 3HRIA 1W4LA 1VB5A 2YJ6A 3PC8C 3SZMA 2AQIA 1UPAA 3FX2A 1CK4A 1S4MA 4OXIA 1CNMA 1YO6A 3Q9SA 3H6GA 4DNFA 4RPHA 4JBIA 4V0MA 2FJ0A 4OQMA 3TNFA 4BAGA 1NG9A 2OXCA 4GW3A 2HQOA 1UQTA 1HBJA 2GWHA 4I7EA 3GFGA 5ALTA 4AWXA 2HLHA 2F9MA 2VNAA 5FEUA 1P0IA 3UK7A 4GX2A 5T4FA 2YC4C 4N6NA 4U2FA 5JALA 2HLDD 3ULKA 3HDTA 4Q4JA 4Z4IA 2CD9A 2ZYGA 3PJGA 1T9BA 1NRWA 2WIDA 3HLKA 2V4MA 2IWRA 1HRDA 1NBHA 1T25A 3GDOA 1K0FA 1RHQA 1SXIA 5FNVF 4GBED 3DONA 4XOIA 4BTVA 3CVYA 2ZSJA 2IHZA 2AG5A 4GGPA 4GR4A 4MRVA 1DU4A 4OD0A 1QHFA 2GZ2A 4P32A 4WAUA 4TQ9A 1KZ1A 2V0GA 4UHHA 4XEHA 1GA4A 1SCAA 4RS4A 5ALZA 1RQPA 2NADA 3PIRA 2WR8A 3UF0A 1JQ3A 3ZWCA 4OEHA 5DNAA 1VMKA 4L95C 4IJKA 4G2NA 2J7KA 3EBLA 5JXHA 5AJUA 3M5DA 4L0CA 4AU1A 3N8IA 2WQ7A 3KJEA 1H4SA 1KY5A 2BKAA 2XWJI 3LDFA 2PV0A 3LXUX 4Z3OA 1ZRSA 3IC5A 1RZRA 2BP7B 3VKWA 1QIIA 1E2BA 1ISFA 3JQQA 4F06A 3U49A 4B0PA 1OJLA 2AD1A 3LBFA 4FT2A 1PK7A 3D2BA 4NYJQ 3RGWS 2J9ZB 3RUIA 1ZD3A 3MT9A 4YXWD 3KPVA 1N0WA 2B4KA 1E8NA 3TW8A 1Y3FE 2XGSA 1RRFA 1ZIYA 5LWQA 4AKGA 1XKTA 3K0EA 4J3NA 3V1NA 1HOXA 3D2CA 4K81B 4WZZA 1KJQA 3ILHA 3W5HA 1J1IA 1NQUA 2NYAA 3AKYA 4CTNA 1G8YA 4RVCA 1XL1A 1RHJA 1Y3BE 1LLQA 5T7BA 1CZLA 1D4FA 3OD1A 1P4JA 3AONB 1HLGA 1WMBA 4M53A 4OU4A 2JAHA 4F91B 3GRCA 1ZOLA 1IOLA 5JNLA 2ZCVA 1MG5A 1BNCA 4LBWA 3UYLA 3ESYA 2X5XA 1RC8A 1YV9A 1AD2A 2NGRA 2GCNA 3IP8A 4UDOA 4QULA 1JKIA 1EXNA 1UKZA 3V5NA 1N1DA 4FD3A 4MUIA 1E4EA 1SVIA 3H8VA 5AKKA 3DUFB 4K5QA 2F67A 4IG4A 4E3WA 1E4OA 1MC4A 2BC9A 1E0JA 3FCEA 3FFXA 4EX7A 4AQYB 2UZAA 5A3JA 4AQDA 4V0LA 4EHDA 4HGNA 1OLOA 1T8RA 4Q7KA 2ET6A 3CM0A 4QOHA 5TVGA 2JKVA 4US1R 2CD7A 3DV2A 4MI1A 1V7PC 3GH1A 2SECE 4X8OA 3WE7A 2OFXA 3NHAA 4D45A 1ZD2P 3LCUA 1E1CA 3RQSA 4LX0A 1YRAA 3TDMA 4QTUB 3J7AC 3L04A 4W4TA 3G02A 4HQKA 5IBRA 4AMUA 2VPTA 2G0AA 1ILEA 2I1WA 3ZD9A 1EWQA 3L7CA 4WEOA 1UINA 2A67A 4L02A 1UBJS 2VSQA 1V37A 2WWRA 3UATA 1N9GB 2PEYA 2WFMA 2QVBA 3AF3A 2Q4TA 2Q3BA 2ZJFA 2RFLA 3C5HA 3K9WA 1QFXA 1I10A 4X1YB 2P0YA 4EUNA 2D2VA 3ROXA 3N7UA 5EE9A 1F8XA 1RYEA 2FZGA 1V4VA 3NBUA 3HBFA 3QBDA 4AX4A 5IM4A 5EJ4A 2C7PA 5A6SB 3ONVA 5CH3A 1DO0A 2CE7A 1PWEA 3CV3A 2WP8J 3IAEA 1TDJA 2IYYA 3CB4A 3M5WA 4TLDA 1X7ZA 1L5WA 2A4MA 3VDNB 4B7ZA 1DTWB 2IYZA 1FSFA 3QWHA 3GEPA 5GJVC 1J25A 3ZOZA 2D2IA 2BRUA 3LY8A 2OESA 3DW3X 3NNSA 4JEHA 3H5NA 5L3SB 4JJ7A 1K86A 3R6WA 5AI4A 3VO9A 2HCFA 1ZDMA 5CFOA 1P2BA 1PD0A 2VPYA 5IC4A 2B61A 3KZCA 4BUJA 4GNRA 3MERA 4QNRA 4HNSA 1GA1A 5CLJA 2AG0A 2J8ZA 4DJEC 2F59A 3JATA 3K1ZA 3K15A 2E4WA 4R1SA 4ZVKA 5KI6A 1GQRA 4G4JA 3BS4A 4EPVA 3VH3A 5BVHB 5AW1A 2H1CA 3UJ7A 3UAZA 5CXQA 2KYRA 5CNMA 4F5EA 2B21A 4ZYZA 3OOWA 2PGAA 4ZAXA 3ZBTA 4ZC8A 3W7AA 1LSUA 1ORRA 3L92A 2ROQA 3MJ4A 3MXTA 4Y0NA 4EG8A 2JIZD 2H4ZA 1P1BA 3DOOA 4D46A 2C31A 3BRSA 4XYBA 3LC2O 4DJ5X 3DMHA 1XU4A 4LNUA 3GMSA 2EKZA 1CB7A 2BKLA 1SXJB 3VNBA 4QHTA 3N0VA 5BWOA 4OHVA 1Z75A 4TYQA 3P27A 4AJ1A 1KKUA 1H4TA 1K3FA 3C5EA 4RORA 1I0ZA 3UGKA 1MJ5A 2FWMX 2PA3A 3QVGB 2GHIA 2GLXA 3O91A 1R3UA 1NM5A 3NDPA 3PF8A 1ZVKA 3VSBA 1ICIA 1J42A 2D54A 3NBFA 1B1CA 3ORQA 4L9SA 5K2OA 3CNBA 3OZRA 5G0VA 1EM6A 1AOXA 2GFHA 1J21A 2I3GA 3DB1A 2A7QA 3I5AA 4PAMA 2HBYA 3LC0A 4V0SA 1JW9B 3RIEA 4YUWA 3CB2A 1PWXA 4HDRA 4EO9A 4H4CA 1S8AA 2QVCA 2WFZA 1NBWB 1L5VA 1JE0A 3OZXA 4RQAA 2PGDA 3OZWA 4QU9A 1G2PA 1YH3A 4IIDA 5K0SA 2QAGA 4LJKA 1M6YA 1FTQA 1IMOA 1RKVA 2VXYA 2WE7A 1Y8QA 2HT1A 5A1JA 2P69A 3KE8A 2I1VB 3R6DA 4ZOEA 1KS9A 3WP0A 4ZN6A 4LHEA 3ORHA 2FRDA 1KOGA 1C9EA 3NP9A 4Q6WA 1YMUA 3IKMB 3HXTA 3G9XA 5K0FA 5CTJA 3E0QA 3NTVA 2OGSA 3QPWA 4IHAA 3JD2A 1QFSA 2R6DA 3DAOA 3G9QA 2YWEA 1VMEA 2C9YA 3B1YA 4GE3A 4OHOA 3KR2A 3T7TA 5HUJA 2GN0A 4P31A 2YCLA 3OOEA 3P2EA 4KH0A 3LC1O 3HKBB 2QRMA 2WSBA 1QOQB 3UB2A 1Y3CE 5LL6P 4YACA 2BBTA 1VCOA 1ND6A 3EGCA 4COKA 2FHPA 5BR4A 5KJCA 1EWYA 1U81A 5IJ0A 4BMPB 5JLJA 4GPEA 4YAFA 4PU0A 1E79D 5F3WB 2GLUA 5DYGA 4UUAA 3VV2A 3LBIA 2FHSA 2HHAA 2SBTA 1BMFA 2OT3B 3WQQA 4A0HA 3M4YA 1K8XB 3KZ1E 1PNQA 2BHTA 2BELA 5I8ZA 2O06A 4Q3DA 3I9LA 1A5TA 2X7HA 5CH8A 1BE0A 3E7WA 5I8PA 3DKKA 4B32A 4X65B 4IX9A 3TQHA 3TQSA 1T6NA 3EVAA 4DB4A 1KR5A 3E1SA 5ERYA 5A4IS 3CNQS 1NN0A 4MUXA 2PL9A 4UVDA 2W5UA 3CG0A 1D0SA 4NOLA 3EXHB 1OBVA 3VU9A 2ZXEA 4G63A 4M98A 1WXXA 2JGDB 2IU6A 1EB9A 2OENG 3HUEA 3BREA 3QE0A 1N57A 3GY0A 3QVTA 4EKIA 4M1SA 2TMDA 1TXGA 2JIOA 3DVRX 4HFNA 4HLQB 5E1BA 2IPMA 5K3FB 1GITA 3U4CA 4NEGA 1OAKA 4EEXA 1OT3A 4BAZA 1XROA 1UBHS 4EWLA 1DO8A 4D97A 2GTPA 1X3SA 2JJYA 1IXSB 2LVBA 3OPMA 1KE1A 4IDCA 3SJBA 1JBQA 1VJCA 3QLUA 2FFHA 2QZJA 2J4CA 5FI5A 1NVDA 3QU4A 4MZDA 2JLYA 5BR7A 1NX6A 1FQKA 3BRCA 3S2UA 2RHHA 3ZXXA 2PR2A 4GI5A 1ZS9A 1L4LA 2ECQA 3KB8A 4OBBA 4C6TA 3QEOA 1WCWA 4YQYA 4XA8A 4DCMA 4RCYA 5KTRA 1B76A 2BMWA 2WJWA 4DDMA 4L08A 5IKXA 3LS2A 1NXXA 1YVEI 5LQDA 1YZQA 4KO4S 1JXAA 2ZVDA 1D09A 2H18A 1L7BA 3RBVA 5JVDA 1FIUA 4BHTA 1XTKA 5BWBA 3OJEA 1XWFA 3GRPA 1Y5RA 2HSDA 2ICAA 2CVZA 4DIFA 3E5NA 5CNJA 3HMQA 1WUKS 3U9SA 4MS3B 4FR0A 4DYDA 1M2KA 1XAIA 3DE2X 2O7NA 4HGOA 4LCEA 2JLBA 2Q9BA 3QLVA 5DMXA 1OYOA 3SYMA 4EPTA 2BGGA 2P11A 4URXR 5JUWA 4KQHA 3LUJA 2V7QA 5KO2A 3I3SR 4RNDB 3UC5A 2UUBB 1Y8RA 2CDCA 3ZS8A 3FPGA 4OQQA 2F1IA 2IXGA 1FUYB 2OOSA 2X9NA 3BH6A 4NL4H 5B7GA 1WHSA 1BG6A 4V38A 5HF8A 3D6HA 3IBFA 3X1JA 4HDSA 1O5IA 1F2TA 3LVBA 3U5TA 4MRAA 1W44A 2V1UA 3T41A 4P0PB 1B93A 1KAQA 2R97A 3A7EA 3URMA 2BGRA 3H8WA 3E23A 3E7FA 4QNNA 1HZJA 1XTUA 2PM8A 2JPDA 1CIVA 1XTIA 3C85A 3SFVA 1WP9A 2PGLA 2C8VA 4PBTA 4J29A 2ZATA 3STYA 3VU1A 4PZPA 3SNHA 4CQLB 1N2SA 4H1WA 1PUIA 1NURA 2JZOA 3HR7A 3Q5GA 5J63A 1RCUA 1QGYA 5K3CA 2OA0A 3PQ2A 2Q6LA 3GJ0A 4EDFA 2WZBA 3DNFA 1AURA 4OLBA 3NWPA 2VDWA 4ZVMA 3CVJA 3C3JA 1QHEA 3AF6A 1A77A 1BHO1 1N2EA 4DNPA 3ZEAA 1A9YA 4GH5A 2VDOB 2DLDA 5A7HA 3ZNNA 4Q7QA 1WXDA 3LQFA 3WK5A 3QK7A 3D54D 4OHRA 3O4FA 4WUTA 4M6WA 4ZT3A 2ZG6A 5I7WA 1H94A 3OFND 1SCDA 1AG9A 2IHKA 2UVQA 1IL0A 4KR3A 3Q85A 4N3NA 1E9FA 1VXOA 4Q1AA 1T9GR 1WLYA 4V1CA 1W1UA 2HF8A 2IOFK 5M3BA 4LOJA 1CP2A 1O5TA 8GPBA 2VQEB 5DTMA 4YPVA 2VF5X 1EUDA 1DIHA 4C0HA 5A3SA 4PN3A 1NMZA 1NWHA 1NLZA 1Y1LA 4Q4AA 4QXPA 1I36A 5JCJA 1N2OA 2IYEA 2OUIA 2OXFA 1CR0A 5ICSA 1V7QA 3IT1A 1OT5A 1FTWA 4KIGA 1DIBA 3FZQA 1VPLA 2ZI3A 1JFFA 1KJYA 3OLCX 3R5FA 4KN5A 5AM2A 2ZPUA 2R1VA 1RXIA 3P45A 3TQQA 1DZIA 5DDIP 3DAHA 3K92A 3FHOA 1JSRA 1STOA 1HY3A 1W75A 3H11A 4R0VA 3VAZA 4ARVA 2Y76A 4D74A 1Y42X 4A0GA 5A5FA 4A03A 4NEQA 3U4QA 2D74A 2JI7A 5F9FA 1NJ8A 1W5EA 2HSEA 3CC8A 2FH5B 2YHIB 3NUGA 4K40A 2R6R1 1MOSA 3LYHA 2C97A 4M89A 1US8B 3RI3A 3IHLA 4LTMA 1SKYB 2IUTA 3COYA 3L82B 1TAUA 3OU7A 4OPMA 1AKVA 2Q28A 3IQGX 2JGKA 4K1XA 2XKKA 1W9HA 4OMUA 9MHTA 5TPZD 1GSHA 2IODA 4A2WA 4XUDA 2HYIC 4BUZA 4E07A 2XMBA 5JQGA 3TR5A 4DIDA 4YRRA 4GOLD 3QUCA 1MUUA 4YO8A 1T9KA 4EG0A 4YJHA 4AN1A 3IGFA 4EOGA 3K0HA 2C9DA 3FYUC 5IHPA 1GSAA 1T8YA 5HE9A 1PZXA 1K8ZB 2A9RA 3LNCA 4BKQA 3AUTA 2JGLA 2YWBA 4HGPA 2O50A 5B58T 4EAAA 1JDNA 1XCBA 5LP6B 3DAGA 1Q84A 4LY9A 4MUAA 3JWPA 4WFIA 5CPBA 3RRJA 2B2CA 3KL4A 4REOA 1J7JA 1T26A 1VMIA 2JVKA 1GG2A 1V9SA 3JALB 3PSHA 4Y9DA 4BMCA 5IK2A 4MNTA 1S6YA 3C1AA 3O21A 2P1RA 3PF9A 4R69A 4H6XA 3TNJA 2GD1O 4NATA 4ETIA 4KV7A 1VOTA 2FEWB 1XF1A 4FWIB 4GZ5A 2C92A 3S2IA 3TMKA 1F06A 2X3YA 1RD4A 1V7CA 1PJQA 1BXRB 2H8KA 3KRTA 1L5GB 1HDYA 3ZX4A 2MYUA 4F4HA 1F60A 1SRQA 3TNDA 4FE7A 4CCWA 1UP6A 1IXYA 2WPNA 1EWTA 3N3AC 1QLJA 1FLNA 3SJ7A 1UKEA 3QNMA 1KEEB 4BWVA 1WB9A 5FO1A 3QJ5A 1ZBDA 1L9XA 2NZYA 3ZNQA 1CUXA 5J58A 1Q0ZA 5FL7A 5JMWA 5DHAA 4FSDA 3U09A 2YN2A 1IOWA 3LPMA 3UIEA 4CL3A 1SQ5A 4W5NA 1UBLS 3ETJA 1QO7A 2QR2A 4YUAA 1SG0A 3P5BA 4FCWA 3SYNA 5BW4A 3DL7A 3V8RA 2EWVA 4H77A 1QFJA 3FPCA 3LU1A 3V4SA 4FYVA 4Q3NA 1DX6A 3BA6A 1AKWA 4OKSA 4UPVA 3VPGA 1UDRA 2VWHA 2PH3A 4LC1A 1VGQA 4URYR 4GSLA 1UWVA 1YVDA 4K28A 2WAMA 1LI7A 1M5TA 4NOMA 2C98A 4CZ2A 1W88A 5TC4A 3A9SA 2E4YA 1B15A 1M72A 5B1EA 1OTHA 5J40A 1SHJA 1Q11A 1UAYA 4XSHA 5ALKA 1X9GA 3ONWA 3OTQA 1NI3A 4X24A 4RTMA 4PG4A 4Q3BA 3RR2A 4UEQA 3HNPA 1JHVA 4DY4A 1TX4B 3M0EA 1XAGA 2AJBA 1N5RA 2I78A 4DLAA 3KXPA 3G0BA 3CVUA 3S5UA 2XDWA 4IJWA 3CNEA 2J9GA 4EG7A 2ZJ4A 1T34A 2DSNA 3L8MA 3QPDA 4JK3A 1R6TA 4UU1A 2HZBA 1GTL1 4HNAB 1YB2A 2JIRA 2NX2A 1ENOA 3KAKA 1JHRA 1Q0QA 2NU8B 1E69A 3IIIA 3OICA 3B3JA 3IEKA 3O8LA 1QIKA 1G3IA 1Z0SA 3BORA 3BWMA 4DAOA 5AYVA 5C32A 4ZVVA 3GLSA 2JK0A 2OFOA 1DAEA 3RHZA 3SSMA 4DA7A 4JVNA 5FUWA 2FPXA 3B12A 3KXIA 4U1RA 3W9YA 3OA0A 4BZQA 1U1DA 4FCTA 1LBTA 1F4LA 2MSNA 3LX4A 3ELDA 2ZYAA 2B8EA 2FRXA 1PEAA 1VB3A 2BHRA 2IYXA 3OIUA 4DIEA 1KSHA 3LQKA 2NSYA 1SEVA 3N59A 1RPTA 4ZAYA 1VJTA 3I2IA 4FZ5A 5CBPB 2OGWA 1RHKA 2WICA 4M7WA 4J94A 2ZT8A 2ZUSA 2CYAA 4BO6A 3U37A 4E12A 4TYWA 4QM6A 1F2VA 1Q91A 5LBUA 3WBJA 1BEZA 1P0MA 2JAWA 2QRHA 3FE2A 1KOJA 2GBIA 2CLKB 4CKWB 1DHRA 4PPGA 3KOWA 3ZWPA 4TZTA 1MIOA 3R20A 1V3TA 3W77A 4I6EA 3N87A 2FWIA 1KMMA 1DXQA 4WRRA 1P19A 1K3UB 1RLUA 3PC6A 1CUHA 2E4VA 2YS6A 4RF5A 3HEBA 5KMGB 2EF0A 3DAFA 1EVJA 1QB8A 3MRTA 3N2LA 1A69A 4UJ3A 1ULAA 5A04A 4C6HA 5G4LA 2R2AA 5B1HA 2H65A 5E38A 2A9VA 2NQ8A 1EU1A 2VDJA 5AJWA 1U3VA 2D3WA 3AUSA 2R5WA 1S8FA 2B98A 1B8PA 1I32A 1KZGB 3KYJB 2QTCA 3LUGA 1I7NA 3R0ZA 1KKLA 2QRNA 4D8XA 2P4HX 2ZUFA 4Q1VA 1ES9A 1L7QA 3FLAA 4CIWA 1ZFNA 1ZMBA 3HDQA 1BFKA 4MIEA 2CXQA 1OYVA 2VNJA 3ME5A 1PJRA 5B12A 4NBWA 2PO7A 4FKBA 4O4LF 3WNBA 1UK7A 3SWWA 2VSOA 2FUEA 1F0KA 2JD2A 2OK8A 4DSZA 1PT6A 5HGXA 1PUJA 1W59A 3L0YA 3Q2OA 4RU1A 4RSMA 3U4IA 2H0AA 2EZ4A 5IAKA 4ZGWA 1IQPA 4HVTA 3A27A 3G9TA 4XJXA 3KDPA 1PTKA 3BHMA 1XVUA 5CD1A 4DTCA 1N2CB 3P0EA 3SZUA 3H5LA 3PQ4A 3ADBA 4JBXA 5G3ZA 5C1OA 4L9AA 4L8WB 4U3JA 5G53C 2YH2A 3MELA 2NVUB 2ZJOA 4C4PA 4CKXA 1Z5OA 3T4XA 1O7JA 2FK7A 4P86A 2QU7A 1HFEL 1IDOA 3DTVA 3L0PA 3IVMA 5L3QA 1TAQA 5U9CA 1Y6ZA 1BCSA 1I1NA 2HU8A 4LUCA 4O29A 4X8LA 2ZUTA 4L4UA 3UC9A 2AJCA 1RLMA 2OPBA 3C6QA 1RI2A 4LA4A 3V48A 5FV4A 4OA8A 4IV0A 4TXMA 3FMPB 1XD2A 2I4TA 1FFBA 4D3XA 1QX3A 5C4IA 2WRZA 3CF6R 3DT6A 4IGKA 2DCMA 4POAA 2ZYHA 3NEYA 4AUKA 2AXEA 3GXOA 5AVKA 2XUIA 2DBQA 3I4FA 4WOKA 3U1TA 4B4OA 2PWBA 1ZW6A 4QX6A 4Y2UA 3U7QB 2DH5A 1HFWA 1SCQA 3GDGA 4N76A 1MC1A 3KPJA 4U9UA 3K96A 3K0AA 1YZGA 3D8HA 1E3WA 2QZSA 4E4RA 5JAUA 3U4HA 4FN4A 1NI4A 3GP5A 3OG9A 1DDOA 2QAJA 2R1ZA 1JG7A 3R23A 4XGRA 4BFZA 5CHYA 3NNNA 3C14C 2NQTA 1SCNE 2OSVA 2YIMA 3FPKA 1TPZA 1SQ6A 1ZW1A 2G70A 2BFFB 2H2GA 2NSDA 3Q0IA 2YMQA 3QA9A 4I8IA 3T5GA 2Y1LA 4D2IA 4DLVA 5KNBD 4X90A 5FXMA 1FYWA 3MOGA 4WZAE 4EZIA 2YMPA 4DC9A 4XYLA 4JJ8A 2YNMA 2XKAA 3G0HA 2I65A 3WYAA 4LDNA 4O2BB 1MO2A 2BRUC 4OUDA 4Z54A 5JQWA 3ISVA 5KYGA 1QCCA 5CT4A 1NTOA 2PZBA 3RIMA 4Z53A 3B8EA 2Y92A 5DRTA 1DZ3A 1Q19A 5BP7A 5JJBA 1E6MA 1TTTA 3T5BA 1GILA 2PQMA 1WPRA 3DB2A 2PUVA 4HWTA 2ODEA 3HG7A 1R4MB 4G5OA 5DZSA 3BGWA 3UO8B 3ZDZB 1C7QA 3EQ6A 4WLUA 1Y3HA 2DFPA 1MGPA 1WKVA 3ICEA 5J43A 1XNHA 4L2IB 1VMAA 3A3NA 2AFHB 2GZ1A 2HUPA 1VSBA 3IQZA 3QW2A 3TZCA 2G63A 5DW3A 3TLGB 2XV1A 5H16A 3THOA 4CV3A 3E3MA 1IU9A 1DIOB 1YKSA 3MB5A 4XH9B 1LXCA 3EW7A 4XE5A 1D4OA 4IIFA 1UJ6A 4PFQA 3QYPA 4RIHA 2J07A 5KYNA 1SRRA 2P68A 1PZEA 4G81A 3SZRA 5AW0A 3TGLA 1WDMA 2C42A 4YLGA 6GPBA 3R3WA 4CLHA 3A4NA 1CLUA 5AVRA 4FFMA 1DEKA 2VKTA 4NH0A 2R8PA 3EZFA 4IQ0A 4IMPA 1N1MA 2BM0A 3OP4A 1CJMA 3C4JA 3FSEA 1NM5C 3OECA 2V8OA 4Q6BA 3MHPA 4UNNA 2G06A 4K9NA 1UJMA 1V8PA 3LDUA 2BMJA 4OJNA 4ZYUA 4U7DA 1N2HA 2B83A 2RCNA 1B6GA 2ZS9A 1OX4B 3GGOA 1ZL0A 2RGUA 1AHHA 3CO5A 3IOYA 2B4TO 4PHFA 4Y2PA 5F73A 1IPEA 1WZEA 4KQCA 3UHOA 1C3LA 1M0WA 3GRVA 2WTAA 4JLBA 4ZJUA 1RRVA 1EHYA 2F3UA 1YJ8A 2W58A 2YMLA 4A1FA 4EI9A 4NICA 3FPAA 1W73A 4MO9A 4D9KA 2IPNA 1ZG3A 1ZNWA 4URWR 2C88A 1Y34E 2Q1UA 4OM7A 3HVKA 4YALA 3VYSB 5KB3A 3Q8LA 4I3GA 1CZUA 1XLTA 2X6RA 1XRNA 2QAGC 2ZAGA 3BBLA 3OEWA 5JD5A 4UUBA 4TV9A 4DCPA 4H59A 4DSUA 5I51A 2DUNA 3ZWVA 4W9MC 4H08A 2JHCA 1OR8A 3BFKA 4WGGA 3TKYA 2FRDC 3GZNB 3UK1A 4YRFA 3SEQA 4CGZA 4EMSA 1P17A 4O25A 3MJTA 4Y2JA 2VH5R 2D1YA 1RJGA 3AKDA 3WDKA 1VHTA 4IGIA 2PGNA 1X8KA 4ER6A 2GPSA 3TLKA 3HTXA 4JJKA 4NG4A 5L9AA 4QXOA 4WZ6A 1JEYA 4AJIA 2FG6C 1JEJA 1AGYA 1T1RA 4FYJA 4PNZA 3PVSA 2A30A 2AKEA 5DGTA 3B6EA 4ND1A 5FO0A 3ZWAA 4KQJA 2CNLA 5FTKA 4DZTA 5KJ1A 4OM8A 4ZHQB 5IM4F 5BV0A 3BF7A 4N0PA 1I9CA 1FS4A 1OZHA 1GLVA 2FN4A 3NTQA 5FUYA 1L8OA 3R6GA 5EQJB 5THXA 2CZQA 3HJTA 3PPWA 4LAFA 2WMYA 3JRNA 4PGHA 4EG4A 3TL6A 3OIWA 5EJ6A 1QFZA 1RM5A 3BWEA 4YP1A 4EYKA 2Q0XA 5C5IA 1D2NA 2P7IA 4C6SA 4ASUA 3IE0A 1JZSA 3KUXA 5EMKA 4IH1A 4XX1A 2QENA 1O3YA 4U7FA 4G6ZA 4UVEA 4V39A 4EABA 4IHJA 1D1PA 3X1DA 5F1YA 1P4RA 3BFJA 2HDWA 4P22A 5D51S 4WJLA 1W5SA 2WHPB 1GFIA 1VG9B 1X87A 5DM2A 4JC0A 4UM5A 2BR4A 1OMOA 3AERB 4NBNA 2IH5A 1C9KA 3FZNA 3SEZA 1AK2A 4QARA 2HNBA 3S2SA 4HQRA 1Y6FA 2HR1A 1M6VA 4EECA 1E94E 3NG1A 3G6WA 4L1KA 2NSHA 5ALQA 3UPUA 1QQAA 2PUTA 1JSXA 1G8SA 1U7PA 3BX1A 3QLUC 3TKAA 3WLOA 4BX0A 4BFXA 1TADA 1JMKC 2N75A 3P9XA 1K63A 3DBHB 4L5YA 5IVKA 2DB3A 4O4HA 1ECPA 2FSVA 4JV5B 3CEHA 3R6LA 3MPOA 1SK9A 1EM8A 3CX7A 2O3JA 5FWAA 4ESOA 1ZISA 2Q6OA 2FXVA 2VN8A 5CLIA 4R2WA 1HM5A 1K0UA 4JS0A 4MW7A 1THZA 3ESXA 1UZAA 3RU2A 1P18A 4OJMX 4BVAA 4IKEA 5DSXA 3X1XA 3O82A 3QA3E 3EA5A 3BTSA 2YOGA 4BWFB 3ELWA 3C5CA 5ESXA 4CHTA 1Q57A 1ML3A 1V95A 2LUOA 3PFIA 3QLVC 4X1IA 5AUOB 3F7NA 5ALEA 5JATA 4GL4A 3UJBA 3OQIB 2HSZA 4KQ2A 2AV6A 1H2ZA 5BMVA 5IFKA 5EIWA 2IYNA 4Y9UA 3ACDA 4LDPA 4EKDA 5CA1B 3NB0A 2HDHA 5EJAA 1FQJA 3CGWA 3I01A 1NFRA 3B5JA 1Z4KA 1DQNA 2ZR8A 3GUZA 3JQBA 4NFHA 1BMDA 1MFPA 3TDKA 3EG9A 4DV6B 4GG1A 1PVDA 1ORHA 3ENVA 1JHDA 5AW7A 3LBHA 3F4BA 3HLTA 3C5VA 2OBLA 2VTKA 4NPAA 4DV0B 2Z4SA 4ZYWA 2XNKA 3V8EA 4NNOA 4K6KA 4RD0A 1EE2A 5A7FA 1G59A 3PNPA 2C5AA 4FEAA 4M21A 4X6XA 1YDEA 4B9AA 4G0UA 2GA8A 2IF2A 3HCCA 5JH7F 1ZQ9A 1S2IA 2AH5A 2ZB3A 3TTXA 3EFOA 2YBDA 2ZYTX 3QXXA 2OGTA 4MV6A 2FRVA 4PBSA 9ATCA 4HS9A 4YJFB 3JRWA 4HPJB 3IKLA 1BJTA 3FZGA 3HUFA 3WO1A 2HHJA 4EVIA 5DN6D 2XB6A 4WLVA 2CVOA 4AZ0B 5CBKA 2IE0A 2FSGA 3MBKA 4IBOA 2H16A 4I55F 3E5HA 1ZJ5A 4DY6A 2I3BA 2ILTA 1TD1A 3A7DA 2NLOA 4QE3A 2GRUA 4TKZA 1T5SA 3S44A 4HB0A 3IEMA 3BT7A 2HWUA 1IJKA 3BE5A 5MN6A 3HCWA 1X19A 2O5RA 3KYIB 3PHCA 1MV5A 3A3OA 1X7YB 4RK1A 2ERYA 3DZBA 4NQRA 4IRUB 4WZBE 4GDFA 3VBEA 3K5PA 4UBMA 1WQ1R 1C8KA 3BMCB 3K1JA 3K8YA 4UUNA 3LBAA 3TX6A 2HW8A 2FLWA 1U7WA 3VZQA 3SMVA 2F2TA 5SY6A 1IZ8A 1ULBA 2ZSKA 3ESCA 3LG2A 4JUDX 4QBGB 5JD6A 4AS1A 2C3OA 2Q50A 4I5DA 2MIIA 3AHJA 5BRNA 4RQBA 4WBNA 1V0JA 1SURA 2RGYA 2OP1A 2QYSA 4KVZA 3WFIA 5G41A 2H1IA 2Q1SA 1VGRA 2BBWA 4LQDA 4Q66C 3UT0A 3VKFA 1NAHA 2WKRA 1H3EA 2H0QA 3VYUB 3SVTA 3DDUA 2CEAA 1WJGA 3P2JA 2QX9A 4BFUA 4CM7A 2FE4A 3AZQA 4YQEA 4DWVA 4BQPA 3HYTA 3RSGA 5JISA 3T34A 3SE0A 2QKYA 4G1VA 5IH3A 2C04A 1D2EA 2VHUA 1HTWA 4JT2A 4UFNA 2IT1A 2QL5A 4ND8B 4Y2GA 4ARAA 4W5RA 1CRZA 3LCCA 4IWYA 5C35A 1VLZA 1ZITA 5I4KA 4OMDA 3PXCX 3HHPA 5D5HA 5REQB 4UUQA 3SQWA 1F7UA 2YY6A 1EJ2A 3PGA1 2NUPB 4K3VA 5JCOA 2FPIB 3VISA 1JF8A 1UH5A 1QH1A 2JK1A 3ZJ4A 3F67A 5T3UA 4M9XA 1MH9A 5BQFA 1I1HA 4M49A 3VH4A 3MW8A 3U44B 5IVHA 1KRWA 1O9BA 4HP8A 2WJVA 1RLTA 2ZBGA 3X3HA 3IB6A 3B7WA 4UBKA 4TYNA 5CVVA 3PLAE 2AFVA 4K9SA 1P1HA 3K09A 2VPPA 3NHSA 4H9GA 4P0TA 1ZJWA 2IDZA 1OA0A 1TEVA 2Z5FA 2FLKA 1G8AA 3RVPA 2M1ZA 1SOAA 3GCXA 1GTJ1 1KI7A 3B5EA 1TAGA 4I66A 2Y3IA 4KPUB 5DKFA 3W2HA 4Z5XA 2VHVA 5JNUA 5HK9A 2C4HA 3B9RA 3OZUA 2RG1A 1FL9A 2XUOA 3RF7A 3LVFO 5K0EA 3C3YA 2UUAB 3HA5A 5LMZA 1QWSA 2DWCA 2HPHA 3K8ZA 4BE4A 2XZPA 4W8GA 2L19A 2APJA 2O8FB 4FCCA 1XFDA 4MJXA 3TCKA 3LO5A 4YJDA 4BYMA 4ZYTA 2D5CA 2Q5OA 2W11A 1IM2A 3PXDA 5DN9A 3RYHB 5A2GA 3KFLA 1F8UA 1BRTA 1UFVA 2H85A 2X77A 2CCJA 4ZICA 1E6CA 2W6NA 1ISMA 5ICCA 3TZKA 2ZUEA 2WJHA 1JEDA 4S1WA 5CEEA 5JNTA 1J1ZA 2Y1CA 3GEBA 4RVOA 4XFKA 2Q41A 1CLEA 3LAWA 4ZFNA 3A3KA 4IFEA 4MWSA 2IWHA 1WBJB 1XYYA 1EFLA 4HYQA 1X1QA 4J7AA 4TQAA 4DGSA 3VR2A 3WL4A 1LUAA 4MZXA 1ZGBA 4Y7DA 3FTEA 3F4KA 3NH9A 1NQWA 5C7YA 5KOJA 1WU8A 1HE4A 3M8KA 1MPTA 2XTJA 3ZKAA 1U7OA 5BV8A 4UPEA 1ODTC 4QO8A 2XMPA 3FMOB 1PEDA 5K3OA 3PDIA 1W35A 2F17A 2R5NA 3RKRA 3NPAA 4CJXA 3Q2IA 3ODGA 2QLMA 3QVVA 3JYNA 3WDLA 2WHEA 4RMNA 9LDTA 1UBCA 1UJNA 3GEDA 5AHKA 1ISSA 1JLLA 1L5FA 1OJ7A 2ZWIA 3PBKA 4RNCA 4ZI7B 2IS4A 1YB7A 3ND7A 1AQLA 4DUGD 3M49A 5KNBH 1IG0A 3PNQA 1BROA 4PLWA 1ONBA 3REQB 2R47A 4AMYA 5M34A 3O2SB 2C5GA 2VZEA 4MJLA 1OH8A 3PDUA 1BGWA 3AZOA 1FNSA 3IP5A 4FINA 3JQGA 3TQRA 4B8WA 4E5NA 2GETA 3EVZA 5K9ZA 4CR7A 1FTGA 1Z6XA 3A0RB 3KLPX 4I2NA 3FYUB 4TMVA 5CFLA 3CZRA 1XZAA 1QWOA 2JIQA 3OP1A 1QV6A 3WKCA 4FFOA 2EJUA 2QYTA 3CNHA 5GP1A 3U19A 5I9TA 2REBA 1M2NA 2AWNA 2X1MA 4J4TA 2PJZA 3HR4A 2XDQB 3TZHA 3BL8A 2ZJYA 5JWOA 2ZIWB 4CIVA 1IVYA 1JN0A 3GD5A 4MROA 2XAAA 3M9WA 4OXYA 5K8IA 1GDDA 1CQIA 2QUAA 3COSA 4JLVA 4ZAZA 1A8QA 2MJLA 3H4VA 3OUUA 1JX6A 1HQYE 3R75A 4BTLA 1H6DA 2HCRA 3W5CA 4GMDA 1O2DA 1SCUA 3M7IA 1YDMA 2VJNA 1XYGA 2FSHA 2O3QA 3E0XA 1XWIA 5KQGA 1NRXA 1ZM7A 1I3MA 4R05A 1THTA 1K1EA 1II9A 1NXQA 2FMTA 1UAAA 4RTPA 4TM8A 4W5HA 1RYBA 1IM5A 1Q14A 1GGVA 1Q83A 2OHGA 4NZ9A 5ITZA 1N3LA 1NXSA 2F1KA 4FYWA 3KE9A 2UKDA 1EZ4A 2JCXA 5D3QA 4CF6A 4MGKR 4RY2A 2X4GA 2X1LA 1UK8A 5C18A 1RLIA 1B23P 3KJZA 3HO1A 3V4FA 1X80A 2YHBA 4C1BA 2FWPA 1A8HA 3DVAA 5HUQA 4WXYB 4EZEA 3HCOA 3JPWA 1NJ1A 5FOWA 5GY7A 3TFQA 2D2XA 2F1JA 2HMUA 1JYFA 2RHMA 5FOSA 2GCIA 4NAUA 4EYQA 5ES4B 1JJFA 1U2DA 2H11A 3DLAA 4J6FA 3RRNA 1HYGA 3UAXA 3WK4A 1WMDA 4E2FA 3E22A 5DCYA 4UOEA 5H9WA 3TQCA 4D4LA 3LTNC 3I9KA 1A2BA 4RW0A 5HMMA 1OB2A 4Z0NA 4ZZ3A 4K1LA 1U28A 1TJPB 3STUA 1RWXA 3VTKA 3VNVA 1XEWY 2CHVA 2P9TA 4PYIA 2AX3A 3LFUA 4OHYA 2JHPA 1MC8A 1GDHA 3KVRA 3HBNA 4OKNA 1OH5A 3IVCA 5I9IA 5ITSA 4EVSA 1XCJA 1JEOA 5FTWA 5J59A 4BLWA 4CV2A 1AU9A 2EFHB 3A4YA 2IYAA 3IHKA 4H7FA 1YE3A 3TI7A 1MVNA 3F6EX 2X4IA 3S40A 1Q95A 2JHGA 4DCGA 2HRCA 5HIMA 2XF2A 3ETCA 3BQNB 2UV8A 3TO5A 3ZLUA 1BVUA 3GCDA 1KJ9A 1NBMA 4PGMA 1CS4C 2F3TA 2P4SA 4PG7A 4UC0A 4PS0A 1Z62A 2QL7A 3AI2A 1EG2A 2Y9MB 4O4IF 1W49A 1DFHA 1UMDB 4GI2A 4S35A 5F77A 1QGDA 5JO9A 1Y3DE 5KZMB 1A5BB 1S01A 2E49A 3JWJA 4YB8A 3E8MA 3VAYA 3KTAA 4EHAA 2OM6A 5BN5A 1ZVQA 3E5RA 4RK5A 3MTQA 2AC7A 1FW8A 2GWRA 4JHLA 1QS0A 4GOMD 5FRDA 4AJ4A 4EJMA 4Y6PA 1XIVA 3S6JA 3V6MA 4L8GA 3WGQA 3CCFA 3WTBA 2H1RA 3ANYB 2DPGA 2OV2A 2X76A 2XNHA 3KKNA 1FVFA 4MQBA 4WECA 4YP7A 5B6PA 2J5QA 3IPLA 4YIHA 1JQKA 4DDUA 3KJGA 4REQB 4DR5B 1UDBA 3G7UA 3PKIA 1EFVB 3V1UA 4PX2A 3DLCA 4E13A 3TINA 4OQEA 4BFCA 1GPMA 3PQ3A 4M9UA 3RT7A 2B4RO 4YCCA 3EF0A 3I2JA 4J0IA 5ILOA 4EPWA 3I62A 2YNMC 1PNTA 1ULZA 3VHRA 1GGJA 5KX5A 2ZRGA 1ESCA 4FVTA 3WHPA 4WWHA 2NNLD 3HJCA 4L5BA 4PZ9A 4ZV4A 4C7OB 3Q3CA 4CEHA 2VJKA 5TB5A 4LN1A 2QT1A 1N6HA 3TW8B 3V4RA 2X0IA 4C7MA 3SZ3A 3EEQA 4R51A 2YRWA 1V11B 2CFRA 3DG9A 5CCDA 1WG8A 4WL0A 4ZDWA 1KSFX 4Q39A 2FEOA 1KU0A 2FUG1 2H57A 1IRXA 1II8A 1GQOA 2NYUA 5AJHA 3WKBA 5FX2A 4YROA 3RDPA 1A1VA 1GPH1 2ZXUA 3PI6A 1RXYA 3C3MA 2LWIA 1V8OA 5ECGC 1N7HA 1QHHB 4ZAFA 1JDTA 1FJHA 4F4DA 3TW4A 3UWDA 4N7BA 3VVMA 5LP1A 2ILVA 1M2JA 5F76A 1JNYA 3CINA 2B69A 5E1OA 5HNKA 1U0OC 2G9ZA 3EMDA 5AI5A 4I5IA 4OAQA 2HU2A 4CM6A 5K8UA 1U3UA 4JR1A 1CJVC 1DC5A 1RM0A 3NH6A 3UMGA 3NZEA 4GQAA 5JSKA 1J8YF 5SYAA 3VDXA 4DPKA 3FBGA 1E4EB 1EP3B 2ZZKA 3GEEA 5D87A 2BFNA 1PJZA 2IA5A 4RK7A 1P2DA 1Q1BA 3SXUA 1A1SA 1Z4JA 3OPVA 3QFSA 4NI5A 5IPFA 3FPSA 2CXHA 2G83A 1DX4A 1GM5A 2L42A 3KSDO 5CYGA 3UWKA 3A9RA 3FNQA 4MUNA 3ZDQA 1FYDA 1E1CB 4WFJA 1JKXA 5BWMA 2J08A 4KVFA 2B7CA 3WGHA 3NHWA 4QODA 4QO7A 3S3TA 2MOKA 3BZUA 3H9EO 4MWGA 4MEBA 4PLFA 5L8VA 2BF7A 2OHXA 4ID3A 4X6UA 4EYOA 5IJ9B 3HKCB 1QIMA 3RTCA 4NBLA 1CIJA 2ZB2A 4EFLA 1LQUA 1XLTC 2H5IA 2HIMA 3L0OA 3OLXA 4FDAA 5CB4A 2C4VA 3FYDA 2DJ5A 3B2NA 4WESB 621PA 4JFRA 1KJ8A 3T7SA 5JPCA 4IF4A 4QEZA 3RVRA 2IXTA 5LXTA 1L4FA 4MV0A 1DL5A 2CMGA 3LZDA 4I9GA 4I5GA 3SLGA 3E9CA 3MD9A 4YJ3B 5CX4A 2P6PA 3AB3A 3INNA 4TS1A 4KOAA 3KQKA 1Q0RA 4BMOB 5TIIA 1XP8A 4D42A 1X7ZB 2WZQA 3F7MA 1E1QD 4HGRA 4XGIA 3UENA 2XT0A 4D9CA 1AQIA 3D8NA 1RYZA 1FMTA 4QLBA 4HQFA 2HNKA 5LBIA 1Q0TA 3OBIA 4EM6A 2Q6TA 2HFJA 2IIVA 1ZCBA 2ACKA 3GMIA 3SZGA 4HX9A 1PJAA 1YI8A 4CKZA 2XCTB 1SBQA 3QEMB 3RNOA 1G7TA 2MR5A 2G5PA 3PENA 1GR1A 4NS4A 4QT0A 4M37A 1SXQA 1KI6A 1G5QA 3PEVA 5JJCA 4LC0A 3K2IA 3TSZA 1FBNA 3CRVA 5P21A 3VNSA 4Z4EA 3UMSA 1IN5A 5LQCA 4O4JA 1N6IA 2PVCA 3OFSA 4TMWA 4EB6A 3QF4A 4HDNA 4Y18A 1GAXA 4GZMA 2PWZA 1QC5B 1YRBA 4X66B 2YINC 2ZBUA 3F1KA 1OX5A 1FTNA 3WGMA 2C2WA 1A71A 5DHPA 1CY1A 5TS2A 1NDUA 1AV6A 2R87A 2FMXA 1ADYA 5EJGA 5FYDA 3U31A 5IHXA 4B33A 3BXOA 5EXTA 1JFTA 3PEFA 1NGSA 4D9NA 4CPDA 2BGUA 1GQYA 1QYXA 2VPIA 3VR3D 4C0JA 1TFRA 3SKVA 5DNVA 5DM70 2Q1WA 3OX3A 5KKCA 3ZPXA 2JJ1D 2JH9A 3M1AA 3E9QA 3MN1A 5AJTA 4TRMA 3HVHA 2CNBA 4RD3A 2O23A 4RM3A 5KTMA 1JSLA 1QUEA 1YE5A 1JKMA 2OVFA 2OWDA 3DNMA 4F60A 4YUYA 1J7KA 1BDIA 3PJEA 3B6IA 1NV8A 1R0LA 3OEHD 4ND5A 5LB2A 1P8AA 2TMGA 1TEXA 4Q47A 1J8FA 1RRCA 1VE3A 3CX6A 2H6EA 3IP6A 3LIPA 3QFFA 4HLNA 3W4JA 1PW5A 3LLCA 4LJ5A 2AMJA 3ONEA 1MLDA 3ZWBA 5GQSA 4Q3CA 4WA8A 4YTEA 2PNFA 4YNBA 4XD7A 2TMKA 4OLFA 4GMKA 3AVPA 1Q5PA 2A88A 4G4GA 3D2AA 3IUNA 3DKVA 3R6TA 4OGLA 5JW6A 4E5MA 1VKRA 1WVMA 2P5YA 5BN4A 2ZTSA 3CMCO 3AXSA 4E94A 1ZA2A 2GESA 4PXYA 1EKXA 4YVFA 4DWWA 1WP4A 3MFYA 3EEBA 2Q5CA 4MP8A 4DBZA 2YWFA 3AHFA 1QK3A 1I1QB 3QHPA 4YP5A 2PD4A 1X7WA 2PH1A 3DEJA 3KC2A 3G9ZA 2EHDA 1YQEA 1TQHA 4ZC1A 4HN4B 4BZXA 2CHGA 4TTJA 2V9ZA 1VG8A 2FEXA 3C39A 2I03A 1IWOA 1GPBA 3RT1A 1G5PA 4N47A 1FB5A 4HJXA 2FOXA 4B6EA 3K1AA 2XCLA 3TE6A 3VR5D 4CLEA 4RVUA 3EJWA 3MCTA 3I12A 3BEOA 5AW9A 4D57A 3IQFA 4E33A 2X8WA 3WQRA 2ZPTX 1G2IA 1EQUA 1OBFO 1YZFA 3NC0C 4K26A 4TL9A 1U8FO 5I7AA 1BA2A 3ZW9A 4FI3C 2NXJA 2B92A 4QQNA 4B2LA 3JQBC 5IJ0B 3R7AA 2ZREA 3MTGA 4R1TA 2OG2A 1XHLA 2NMVA 2P62A 1XWWA 2QMHA 2QN3A 1A72A 3FSGD 4KO2S 4RHUA 5J4YA 5HPYB 2QBYA 3KJXA 4EO4A 1HDGO 5EZQA 3PHLA 4EO7A 2XMCA 4PAGA 4US0R 1EAYA 2ZBEA 4G4SO 4ZI3A 4R7GA 5E6RA 3UPTA 5GOTA 4UTNA 1F51E 4ZO9A 4PLZA 4PPNA 5FA8A 2G88A 4DANA 1ESEA 2WUEA 1JT2A 2WG1A 2GZAA 1M2HA 3LRTA 2ECFA 3NT4A 4YHHB 2CFSA 2V03A 3CWCA 4W8OA 1SCKA 2Y66A 4WNAB 3TUIC 4EI2A 2X9VA 3Q5DA 2HA2A 2W2KA 3FWHA 4UULA 1PBTA 1LRJA 4UUPA 1TU4A 4ZOCA 4BNTA 1TU0A 3NDBB 2GT1A 1WCXA 4YR9A 1IM8A 4E14A 1B2RA 1T5OA 1PR9A 2ZYUX 3B38A 3ILVA 5DT9A 2QQEA 3W2FA 3C1OA 1SBHA 2XA1A 5L45A 1Y7IA 2FPPB 1BX0A 1YZYA 3TOXA 1E7SA 1XD9A 1N34B 2CXTA 2YQ4A 2ZJ2A 3OH8A 1EP1B 1VGVA 2B4AA 2PCLA 3H1EA 4YAEA 4YV1A 3T0GA 1BS1A 3FOCA 1K9VF 3I1JA 4F04A 1GSOA 4P9NA 4F9TA 1IBLB 3H0KA 4PSDA 3T7JA 5BOVA 2HHCA 3LY7A 2CJWB 4LCBA 1PZHA 3VVBA 3EGXA 2F3RA 4CW7A 1QU2A 3FB1A 4MWCA 3OEYA 1MXFA 1QVWA 3OZIA 5AK6A 1RI5A 1KAOA 1UC5B 2ZWOA 3TEFA 4HVCA 3K32A 5CA0F 4QJBA 4FFBB 1D2CA 4RY9A 3U56A 3L7MA 1NE7A 2ZE6A 3EH1A 1ECCA 1YKFA 3IURA 2OAP1 3ABOB 4IL5A 3B52X 3WIUA 3P71T 3PGXA 3AWDA 2XCQA 4X97A 2CMDA 2B20A 4I46A 3PK0A 1LDGA 5AVZA 1X70A 1Z8DA 4D9EA 1U98A 2LIVA 1JPJA 1UBTS 2NZXA 2Y6UA 4IDEA 4N1AA 1GNSA 3K6JA 4L5JA 3V34A 4ZHQF 2WU3A 3V8VA 5JCOC 3FCCA 1XMJA 4HAZA 4UMDA 1B0UA 3GBSA 4PHGA 5LUAA 1ONSA 4V1CI 1BTOA 3RS0A 3R7WA 3SIRA 4BP1A 3EYAA 3VDRA 4H7JA 4JLAA 1ZUNB 2JD0A 4QBFA 5JS6A 1FNNA 2BKVA 2WDZA 3NHKA 1WM1A 3TIVA 1USVA 4PPQA 3LPAA 4X92A 1Z2NX 3K09C 3TJRA 1G8KA 1Q12A 1LDBA 1TQ4A 1Z7WA 4GIBA 4PO9A 4LYAA 1HL3A 4YRJA 1G38A 5FWNA 5ANRB 1ZD4A 4N3AA 3E58A 1GUYA 2YDYA 4ND3A 3KOUA 4FNAA 1PQUA 3U3XA 2V96A 2H4YA 1DAGA 4NE7A 3ZK9A 1H9AA 2Y1XA 1C8BA 2G36A 2R8EA 2AOUA 2X5KO 3EYWA 4P7BA 4PAWA 1IN4A 5EIAA 5GMOA 3ZY6A 1PG5A 2HMYB 4CI9A 3N8KA 2O8DA 2IVFA 1TRHA 4H4EA 3NO4A 3CLTC 4QGFA 4HLDA 4EHBA 1UXJA 2E37A 3M6VA 2BH2A 5BSMA 3W2GA 1K7YA 4IIUA 5JJLA 1GZSA 3PEUA 4KQ9A 3B89A 3HM2A 5B4VA 4A73A 4V1CB 5KTOA 3UH0A 4HZUA 4F85A 3TI9A 2RONA 3C0KA 3X2SA 2VYVD 3JTEA 1R4AA 1W94A 4BECA 1EUDB 3IO3A 3B3AA 2ZIGA 3QITA 4Y8VA 3WLRA 4Q4AB 2QEQA 3L4EA 1PZNA 2IHVA 4L5CA 5J5VA 3QQPA 3JQ6A 1PWHA 4ENRA 5JHGB 3NIFB 5KQSA 3QU2A 4DEVA 3KYCB 3KP1A 4GO1A 1JFFB 1U0SY 4IDHA 1YL6A 1ZZGA 4D0GA 2J31A 1DVRA 4YGYA 4OLJA 4D7AA 3GB9A 4DLBA 4PG8A 3VNUA 2NZJA 3NHBA 2CWWA 3L7DA 2OV6A 1JDBC 5AWFC 2AA3A 3ZLTA 2O2HA 3U4QB 1JG4A 2J0EA 3FMVA 3D6AA 3GCGA 4X8MA 2NVOA 3G2JA 2ZRKA 4FB4A 2GM3A 1YD7A 3W90A 1JG2A 1TYZA 2J3MA 3NYRA 1P6QA 5F4BA 3UJHA 4R8LA 4DILA 2QORA 2X58A 1CY7A 3SGLA 4ZV9A 3V2UA 4N65A 5BUZA 5JI2E 5JQGB 5BUCA 5BYKA 3GRUA 4QYIA 4AJ2A 1LV7A 4ENWA 1E2IA 2B5VA 4K0KB 4WKOA 4YJHB 3P2IA 4H35A 3CN7A 3B51X 3AT1A 5CURA 4LXYA 2OMEA 2HIHA 3GFFA 4QIHA 3ASUA 2I91A 2DR2A 3AX6A 5FUMA 4EKEA 2F64A 1WPQA 3UB4A 1XEAA 2VDRB 3E82A 3T7EA 1Z35A 1TLFA 1WZCA 1YAJA 2X0NA 4EHFA 5BT8A 1QZ3A 3URKA 4M8SA 1CFJA 3BIXA 2GYVA 2DBRA 3RUHA 5IZCA 1LFDB 1DBIA 1F2DA 3EOZA 4YRZA 3UPDA 1PT7A 1C3XA 2O5VA 1GSIA 1XZEA 1RHRA 2FVYA 2XY4A 1HNNA 4UTOA 4TN5A 3WNCA 2PSSA 1EDOA 1E3DA 1GPJA 2JHAA 2ZUCA 3V8PA 4MW5A 3LL7A 4NJEA 1RWKA 1A9QA 3CO0S 3DQZA 2JFBA 4D9FA 3HL4A 1D2MA 3H86A 3BJEA 2X13A 3TTTA 2Z2IA 4CTOA 4HWRA 1LC3A 3L7BA 3STXA 3MWJA 1XMQB 1N2GA 4TYPA 4TUYB 3RSFA 4AJEA 1ODSA 4QSHA 3PGMA 4B9EA 3ETGA 3WSTA <