1T0UA

Crystal structure of e.coli uridine phosphorylase at 2.2 a resolution (type-a native)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
251
structure length
223
Chain Sequence
KSDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTTMKQTESHAVKIVVEAARRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uridine phosphorylase
publication title Crystal structures of escherichia coli uridine phosphorylase in two native and three complexed forms reveal basis of substrate specificity, induced conformational changes and influence of potassium
pubmed doi rcsb
source organism Escherichia coli
total genus 78
structure length 223
sequence length 251
chains with identical sequence B
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2004-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1t0uA00
4MARA 5K1ZA 4DA7A 1OV6A 4TXHA 1WTAA 1K3FA 3OZDA 4U2KA 3OOHA 3UAYA 1PR5A 4BMYA 4LNAA 3KHSA 1V4NA 2AI1A 4QARA 1PK9A 1ODKA 4FFSA 3K8OE 3DP9A 4QEZA 2P4SA 1JDTA 3QPBA 3OZCA 4DA0A 1A69A 2GUWA 1U1CA 3IOMA 4BMZA 4KN5A 4WKCA 1CG6A 5B7NA 1RT9A 1ODJA 3F8WA 3O4VA 1V48A 1RXUA 5CXQA 4JWTA 1V45E 3MB8A 4TYMA 3PNSA 3GB9A 1JDUA 4JP5A 4QAQA 2Q7OE 3UAZA 4R2WA 4I2VA 1K9SA 1U1DA 2HRDA 1VMKA 4M7WA 1Z38A 4F3KA 4G89A 3KU4A 1VHWA 1FXUA 2A0WA 2ON6A 3NM5A 1OU4A 4DANA 5F76A 1JP7A 1YQQA 1TGVA 2I4TA 1A9SA 5F73A 1Z5NA 3OZBA 4D9HA 2A8YA 4GMHA 4NSNA 4D8VA 5C80A 2PGAA 5CXSA 5F78A 5B7PA 1T8SA 2OECA 3OOEA 5EUBA 4OJTA 4OF4A 4IP0A 4X24A 1Z36A 1RXSA 4RJ2A 4L5AA 1RCTE 3SCZA 1Z33A 2A0YA 3OCCA 1Y6RA 4WKBA 5FAKA 4R2XA 4YO8A 2BSXA 3TL6A 3KVVA 1PW7A 5KB3A 1V2HE 1A9PA 1PF7E 1RYZA 3P0FA 4H1TA 1JDZA 4QATA 4D98A 3OF3A 1JDSA 1OTYA 4TS9A 4BMXA 4TXNA 1RFGE 1RXCA 1SD1A 1Y1TA 3DJFA 2HN9A 1RR6A 1ZL2A 1U1EA 1ULBA 3DPSA 4P54A 4LNHA 3O6VA 4PNPA 4WKOA 3ODGA 1OTXA 4OGLA 3E0QA 3FWPA 1U1FA 3BSFA 1LV8A 1RXYA 3LA8A 4F1WA 3EUFA 1TGYA 1ODLA 1PR6A 1ECPA 1JPVA 1PWYE 1Y6QA 4YJKA 3BJEA 1T0UA 3T94A 4D8YA 4M3NA 4GKAA 5CCDA 1NC1A 4EARA 5ETJA 4DA8A 1PKEA 1Y1SA 1A9OA 4GLFA 1JYSA 4G8JA 4YNBA 3C74A 4QFBA 2QSUA 1YRYE 4D8XA 1Y1RA 1YR3A 5B7GA 2H8GA 3EEIA 1PR0A 3UAXA 5JPCA 3EMVA 3PNPA 5IU6A 5EFOA 1V3QE 1SQ6A 3E9ZA 2QPLA 4TTIA 4TTAA 2QTTA 2AI2A 3KUKA 1CB0A 4UC0A 2OC9A 4TXMA 1YBFA 4PR3A 3ONVA 1VHJA 3FOWA 2QDKA 4F3CA 3KVYA 2AI3A 1VFNA 3DDOA 2OXFA 3LBAA 4OGKA 4DABA 5F7JA 4DARA 1XE3A 1TCUA 2XRFA 4LZWA 1I80A 1RSZA 1PK7A 4E1VA 1A9RA 4R31A 3NM6B 4M1EA 1PR2A 5EPUA 4MCHA 4TXLA 1PR1A 3BL6A 4OEHA 4WKNA 4YMLA 5CYFA 1ODIA 3DF9A 3K8QA 3IEXA 2B94A 4K6OA 1TD1A 1K27A 4L0MA 5F7OA 1NC3A 4L5CA 1B8OA 2HWUA 4LKRA 4TTJA 3BGSA 2IQ5A 5I3CA 4OY3A 2ISCA 1ZOSA 1PBNA 5F7XA 4TS3A 3FAZA 1Z5OA 2I8AA 1T8YA 4MCIA 5F7ZA 1Z37A 1B8NA 4JOSA 3D1VA 2A0XA 3FB1A 1Z5PA 4TXJA 3INYA 5CYGA 5DK6A 1M73E 3U40A 4F2WA 4ECEA 3GGSA 4F2PA 3ENZA 3FUCA 4BN0A 1Q1GA 1ULAA 1JE0A 4EB8A 1Z39A 3OZEA 1JDVA 1T8WA 1T8RA 3P0EA 1JE1A 3UT6A 1OUMA 1LVUA 1LX7A 4DAEA 1G2OA 1C3XA 1N3IA 4NS1A 1NW4A 4GLJA 2AC7A 1YQUA 3NM4A 1A9QA 3UAVA 1QE5A 4DA6A 5B7QA 5F77A 4DAOA 1OVGA 3PHCA 3NBQA 3LGSA 1Z34A 1Z35A 5CCEA 3FNQA 3KVRA 4L5YA 3UAWA 3OPVA 3PHBE 1V41E 1Y1QA 4L6IA 1SD2A 4WKPA 3EUEA 5IFKA 2OC4A 1PR4A 4QASA 3MMSA 2RJ3A 1SJ9A 2HSWA 1A9TA 2QTGA 1TCVA 3E9RA 4LDNA 4G41A 4NY1A 1U1GA
chains in the Genus database with same CATH superfamily
3OAAA 3AHFA 5F33A 4DB2A 2ZPAA 2IZZA 2XJ9A 4JGBA 4L3VA 4MW6A 2YZ2A 3HYRA 1FEZA 2Q49A 1P7YA 2XHZA 1T2FA 3KXIA 1LPMA 4K86A 1GR1A 3K1AA 2GCNA 3RS9A 2AF4C 1PO7A 1HXHA 4RS3A 5F5LA 1QFYA 2WDZA 5GTDA 3T1TA 2HHCA 5KYUB 2WP0A 1WDTA 4BZQA 1YHNA 3DEJA 1G21E 5ADHA 5J23A 1LDEA 2ECKA 1GPDG 4X7RA 5AVJA 4EL5A 4R0MA 5KWJA 2ZUBA 3DC7A 2QY9A 3MTEA 5JQGB 2XW6A 4IF6A 1Y7PA 5IUJC 4FZJA 4KXFB 4B2IA 1BRTA 1H8HD 2K7ZA 1JWAB 3LAWA 5KYUA 5CNJA 3PWTA 2C00A 4LBZA 2L19A 4JUAA 1LK5A 4Z2YA 3SYRA 1HL7A 1R5BA 1T3HA 3HNOA 1YRQA 2XJ4A 4U0JA 3ROZA 5JBIA 2O8DB 3PTZA 4O4HB 5IULC 5JQGA 4BNGA 3E5NA 1FDVA 5ALVA 3WRYC 5HRAA 1SCQA 5ENVA 2JHPA 3DA8A 1J4AA 1QAQA 2PZFA 5EA2A 1IC6A 1SURA 3GJ4A 4G56A 3FB4A 4IZIA 1IXYA 1NHGA 1O9GA 2ECQA 4O4HA 4OOFA 1QU2A 5CVJA 2CF5A 3DNPA 1O2DA 4NBTA 4NS4A 4HQFA 2GBCA 1I7PA 2QX6A 3AR6A 4MRSA 4LOKA 4Y6RA 4BOYA 4C3ZA 5GWXA 5J2UA 3STVA 1JALA 5BUZA 1FS4A 4L76A 4R2WA 1YS6A 1SXJB 3ZK8A 4J16C 5LQAA 5AUPB 1PEDA 1UR5A 3BTSA 4GI7A 1O8CA 4WZAB 3RUPA 1C1XB 4YFVA 2ZREA 1G5TA 2N75A 1WSBA 1Q1QA 2VK8A 4DM4A 4EJSB 2O0HA 2WV7A 1YJQA 4KFRA 5TXGA 2VLIA 1Z38A 3X1JA 4S2EA 2RBKA 4NH0A 1SXJA 2M9MA 5C7LO 1OI2A 2HPVA 1CULC 3FXAA 3IQHX 2FFJA 3K8ZA 4O8CA 4WY5A 4RK0A 1XYVA 3OIWA 4I2NA 1II8B 1ORHA 1X7ZB 1XTJA 4QFCA 4MRPA 3SD7A 4BRSA 4EJSA 4LJKA 5SY6A 5GMOA 2ZSFA 3OQJA 1RYYA 3BA1A 4YWHA 1U8ZA 1PUJA 1XZ8A 4II3A 3T35A 3V55A 3VO8A 3WIDA 4IJQA 1I2DA 2HPZA 3BFPA 5JLAA 3A04A 3IAUA 1R6XA 1II8A 1HOXA 1X7ZA 1CPYA 1G3QA 5K5EA 2VQFB 4PSUA 3IAAA 1KQ3A 3EOZA 3M49A 5HIJA 3JTMA 1P31A 4YROA 3A0RB 3C14C 4Y2JA 4H7DA 3O26A 4LAFA 3GJXC 4HEJA 2C5LA 4FSDA 3DTTA 2NU6B 1KZ6A 5SY4A 3GEHA 1NX6A 2FW0A 3E05A 3OWHA 5HF5A 3KT0A 5FQOA 3AZQA 1YQEA 1UP6A 2P91A 3NG1A 4JLSA 4LYGA 2HAEA 4K8OA 1GM5A 3Q9UA 3DFMA 5JAQA 2ORYA 1JAHA 4Y0AA 4C6RA 4EHIA 1A2BA 3NT4A 1A76A 4XCXA 4AJ2A 1LB1B 2NU6A 5FPSA 4AMGA 2H5LA 4WNYA 1N2HA 2NO7A 3NIDB 3P9NA 4JKIA 2VAMA 1XEWX 3LV8A 5F2EA 3RFXA 3PLAE 3F90A 1PG0A 4C4ZA 4JSYA 4ESVA 2BGIA 1D6JA 3V4ZA 3ER8A 4URWR 1JV2B 5IG2A 4EG1A 1RPAA 3G8BA 4C4AA 3HZRA 4W6QA 2V6BA 4XASA 4EPWA 4CKWA 3BAFA 2WJAA 4E5MA 1Z7BA 4J0HA 3FWHA 4CTMA 2E5LB 4W8OA 3F96A 3EY9A 1L8OA 2CFSA 3BHIA 4IGFA 2HRQA 2WUDA 3H9CA 4QUEA 3WB9A 5JT1A 1SHJA 3TL6A 4GZMA 4LY6A 2C2HA 1WXFA 3FR8A 3VISA 1Y8ZA 3IAEA 2ZRKA 3AP3A 2AT1A 4H7HA 4IEIA 2PSJA 2PUDA 3AVXA 1NVWQ 3ZJVA 4ETWA 1WW8A 1N0UA 2CBZA 3G2KA 4YCJA 4RD2A 1KYQA 2D5BA 3ORQA 3RBVA 2HJGA 1WVGA 4P4UA 3KQVA 1CS0A 4AFNA 4NBKA 5IAJA 2PA0A 1AUXA 1IJKA 3M4JA 2R6DA 5EJMA 4X3PA 4L4YA 2PUTA 3PXDA 4S35A 4BMXA 4YJ2F 9LDBA 4G1BA 1UBKS 1W19A 4HFMA 1OFUA 4OP1A 3BIJA 1QTIA 1WULS 2R2GA 1OIXA 3TAHA 1XLWA 3M5WA 4PZAA 1PJQA 1Y1TA 4RH0A 3WK8A 4BMDA 4A7PA 4FYHA 4FWTA 1U1EA 2C04A 2IY9A 3I1YA 1ULBA 5MDHA 3DPSA 2JVIA 4XCVA 3WLHA 2XWPA 3H5IA 4EBBA 2JFVA 1DFGA 4GIBA 4PQEA 1N3BA 2HDOA 1FXSA 4UD6A 1KMQA 1PUXA 3A8TA 3H8WA 4NENA 4Y1EA 2I7XA 1JTEA 3O8BA 4D92A 1CHNA 2WZCA 3I37X 3PYMA 4RLSA 1M6YA 3N2EA 2PUBA 1WXIA 2ZKIA 1NY5A 3E3AA 1UJMA 4RADA 3C87A 2A9VA 2IKQA 3EVBA 3PFFA 5BN5B 3SF0A 1ISHA 1GU1A 4LHEA 4QU0A 1M74A 1U3CA 4P32A 4YQFA 1YAJA 4R3NA 3CKMA 4IH4A 3JAKA 1KHHA 1JMVA 4A91A 1K5DA 3AUTA 2WHEA 2NM0A 4ISCA 4N0MA 2O52A 2GN2A 4IX1A 1T0IA 2QM0A 3SBOA 2FPXA 1JH9A 5BN5A 4CDGA 4ND4A 5BV8A 1XJ0A 1AKVA 4XPZA 1ZESA 3KJZA 6REQB 3HK2A 1USGA 2BFMA 4P0QB 1Y6QA 1J00A 2NYRA 3IVRA 3D4NA 1DUIA 1EEHA 3II6X 1J2JA 4US2R 3UBMA 5EY5B 2ZSDA 1BFUA 4GOXA 1A9YA 3P97A 4NE2A 4NV1A 5KKCA 5KNCH 2KM1A 1EDEA 3J7TA 4IZOA 4N6NA 3EHEA 3WWEA 6REQA 1ID8A 1QHSA 4NZNA 1NAIA 1Y5NA 4HB4A 2WSSA 4Z3KA 1M5RA 2CJPA 1CX9B 4XB1A 1PJAA 2OORC 3L7OA 1J1IA 3ZBPA 4FHDA 2EWMA 3IAS1 1YJXA 3GP8A 3B1JA 1XZLA 3ZQ4A 4YRTA 4AF6A 2F1RA 1A9OA 2YYSA 1B3BA 4QO8A 3ZOZA 5AW1A 3TUZC 1O0BA 2Y1EA 4LVUA 4J1QA 1IMOA 1KMCA 1NXWA 5AM4A 2B34A 2WM9B 3EWSA 3SDBA 1S01A 3W1EA 4IDCA 1PYDA 5L4LA 1Q91A 4HQ0A 1EFTA 4YNBA 2DF8A 2W0MA 1VMAA 2IBTA 3IR5A 3LPLA 1TZKA 2QP3A 2VDMB 3D3WB 2X2OA 2I6TA 3B13B 3DUFB 4M9UA 4X45A 3VR3D 2ZI9A 4D96A 5M2QA 3EA4A 5FA8A 3ZKWB 3NONA 3L93A 4QXMA 3T1NA 2I7VA 4FCCA 4FKBA 1M1YE 1E6UA 1US8B 4UOQA 4PSVA 1E7RA 3R6LA 2Q5QA 1UCFA 5I9SA 2CHEA 4LV5B 1GYRA 2FQXA 1LSSA 3DUFA 4DWJA 4X41A 1XPOA 1CS4C 4BVJA 1Q2UA 3ZKWA 5TGTA 3LS2A 1ZD4A 5K3FB 1US8A 1XVLA 9LDTA 1KA9H 5SZJA 4IUBS 3R8CA 5JJKA 2IUTA 3NUZA 3QI7A 1GIAA 4ALNA 1R27A 3O1IC 1G55A 2FR8C 2IYWA 2ZYIA 4I9NA 4L9WA 2QV0A 3BF7A 4TTIA 4BBPA 3GFBA 3KUKA 2ZUSA 1LF0A 1AGYA 4JKOA 2GD6A 5K3FA 3F7NA 1DG1G 5A0FA 3NFYA 1MOSA 1W87A 4FOSA 1SXHA 4GL4A 2JGMA 2FWPA 2IGTA 1OWPA 3AR7A 3DO5A 2H8KA 3K5HA 4L4RA 2XCSB 3GUHA 2DQSA 1J8VA 1VHJA 4CNBA 3SP1A 2YN4A 3GJQA 3C15C 1GKLA 4LFCB 1NNEA 3A25A 3K1JA 4YP0A 5LXTF 3AU9A 5CXUA 1A0OA 4OHYA 2DM6A 3TIGA 1VIYA 3RG8A 2YFQA 1QIKA 1GEGA 1FZQA 2KWIA 3EDYA 4HDSB 4TL9A 2IYVA 1E2UA 1B6RA 3QX8A 1Z5GA 2JIBA 1DO0A 2F3QA 1U4SA 2ZKLA 3AMVA 4Q7KA 4R7TA 4KRGA 2C0QA 4GT1A 4DABA 1NKSA 3C6YA 4NJMB 3ZDRA 3ZNQA 1F8GA 1YJBA 3M1LA 4IIYA 1U11A 1P60A 3RKUA 2XQJA 2X1VA 3T3MB 3I9LA 1NW7A 1DADA 2HV8A 2DEUA 2XIQA 4KE7A 1AUPA 1GOTA 1RMQA 3WBBA 2VQ3A 4NJMA 5HS4A 2SNIE 3M3DA 4UHFA 3JYQA 2FN7A 1ZVQA 2XRMA 5F1YA 2BCJQ 1MEEA 4D9GA 4F2GA 3OQNA 1TJNA 1MX5A 2ZYTX 3B82A 3HFRA 1J0DA 3KQOA 3TSCA 3C24A 4B87A 1OB5A 1H2HA 4Q1VA 1P2BA 1DRUA 2A4MA 5ALZA 2RK3A 5IDVA 4FYXA 3BVPA 4TXLA 2FOIA 3L01A 1WB6A 2AG0A 3OOJA 4NFYA 4TT8A 3TM5A 5CIYA 2GWRA 1I7LA 3EZ6A 3FPGA 5HBGA 4LI3X 2HSDA 2JGDB 4AY3A 4HEA6 4BFVA 4KKXB 1VLZA 1SHZA 5EIFA 2VQDA 3V1YA 1VMEA 1UQTA 2WWXA 4HB2A 1D2NA 1SZPA 3ODPA 3L2OB 2PBFA 1DBQA 2WNHA 2I99A 3GEPA 1Z0JA 1PRYA 2PKXA 4K6GA 4Q1AA 5A7HA 4EGFA 2WC1A 3CRVA 4GP9A 4WSOA 3TNDA 2OPBA 5HSGA 1MHTA 4W5HA 3W6OA 5F3RA 4DPMA 6GPBA 2OZVA 3VI4B 4RESA 2JGDA 4L5CA 2C9YA 3U4IA 1M1UA 3DMHA 2VF2A 3BDIA 5EWJB 3I1JA 1GNTA 2D2IA 3JAWB 4DTIA 2Q0SA 3IB6A 1ORIA 3L8HA 5EIAA 2XOEA 4YP1A 1IQPA 3CNNA 3FPEA 5I6DA 3SWWA 4HNVA 3S99A 1M1NA 4IIEA 5IAAA 4HH1A 3AHIA 3QOFA 2VRCD 4FW9A 4QXPA 2HLHA 2FZLA 5LN1A 1IYZA 3H2JA 1U8CB 1O96B 1ATZA 1D03A 1AZTA 3JAWA 5B4VA 4AWAA 4RKEA 1FY2A 3KR1A 4BB0A 3ABRB 3LYAA 1P9WA 2QR3A 3AONB 1TZMA 2HMVA 3CRQA 1BHSA 2AA3A 3OY7A 2DH6A 1BWQA 1L7OA 2LCIA 3UB2A 1Z0IA 1M6EX 2AR7A 3WMWA 1PTKA 2B83A 1PX2A 1B8NA 1U7WA 1IUOA 3I9KA 2C99A 2PXXA 1UC8A 3ELDA 1FNSA 1ESDA 1SU4A 1E2FA 2XBMA 3OEYA 5AKLA 3C3WA 3E48A 3KZVA 2OGUA 4Q3DA 3MS4A 4QYWA 3PA8A 3JQEA 1XLVA 1QK4A 4MUJA 2HUNA 4E2YA 4X00A 4F2WA 2Z5LA 1SBQA 2IYEA 4PCAA 4URYR 3VR2D 4S2UA 4RA9A 3FAKA 4KDEA 3H6KA 4WEOA 2BKUA 1IIBA 1A71A 1PZMA 2P5UA 3MMPA 3ZYCA 2NXNA 4DIEA 3D64A 4D9EA 3AHHA 1DC4A 1LI7A 1RHUA 3H16A 4YAJA 4DCGA 2AZMA 3R75A 5AJZA 3OOYA 4HAWA 1GGHA 4LRXA 4UXIA 4B8WA 5D2CA 2ATIA 3EG9B 3ELYA 1U2QA 3OECA 3JASB 5DM4A 3LLVA 5L51A 3UJ6A 1XHEA 2BMJA 3WHLA 4MMZB 1ZINA 3PCXA 3DYBA 1DZ3A 3BE4A 3DMYA 1YF3A 1M9NA 1V8FA 1XFDA 3RADC 3EA5A 821PA 1IG0A 3DVQX 3SK0A 2W5UA 1M7BA 3EXHC 3EG9A 1XQVA 4LDPA 4RPJA 3JASA 1I32A 5EKSA 2QT9A 5HJ7A 4B45A 4EUFA 1A04A 5K20A 1JHOA 5EHQA 3HB9A 3DT8A 1XKTA 5EE3A 1N6IA 3VR4A 4I1OA 4URVR 3OE7D 1HMPA 2J3EA 3FSEA 3G85A 1K1EA 1ZN7A 4PC2A 4EWLA 2YZGA 3ELWA 1UOEA 1UDXA 1VE6A 3QVVA 4GLJA 1DDOA 5I47A 2ZAOA 1L7BA 1A9QA 1NL3A 1VI6A 4LHZA 1NNSA 2JIOA 3BH7A 4XQ0A 4JI7B 4F1JA 1I51A 3OZAA 2ZRCA 2OWEA 4OB8A 3A3PA 1JL3A 1OVGA 3P5SA 2OHIA 5J40A 4BJ1A 4D3SA 2BSQA 3C3CA 5JATA 1A82A 1Z6ZA 1N2XA 4RIGA 4R7GA 1FMJA 2P0EA 3UG7A 5IVPA 3N39C 3RGWS 4U7PB 2WVAA 2LTAA 3LF1A 5LKAA 1DPFA 1U2DA 1O0SA 1XEXB 2Q6VA 4RCZA 1CEQA 2J3KA 3AHEA 5BSTA 3RKSA 2GPBA 3P7MA 3SGLA 3PEUA 4ZCMA 1CETA 4LJRA 1WXHA 2RGNA 1QGOA 4RD4A 3AL0C 3GBPA 3R5XA 5DN6A 1POXA 4YRLA 3LLMA 1U80A 1Y1QA 3HPRA 3NS7A 4IJ6A 4L6IA 4AKEA 4DCSA 3I52A 3GBVA 1JAIA 3T0IA 3ZV7A 1XEXA 2PV0A 3KLOA 4WXYB 5K0GA 1MPXA 1Z0DA 2BM9A 4GLOA 5DYGA 2N47A 3TK1A 4MUFA 3U16A 3A36A 4IF4A 3LO5A 3ZIDA 1T6ZA 5BQXA 1RWOA 2VHXA 2HPHA 2BIFA 2FP3A 4I0WB 2YXDA 4B85A 2P65A 4RGBA 2AXPA 3WVNA 3TECE 1N7JA 3ISVA 4MJXA 5A4AA 1M2VB 3E9RA 3UJ8A 1C1DB 1ZW6A 5CR9A 4TM7A 3ZJ5A 1V25A 3C2QA 2PL5A 4WK0B 4UXHA 1KIFA 4YP5A 1KO8A 4Y2RA 4D41A 4MHTA 3DAGA 3AVQA 1M2VA 5FPYA 4UFOA 3DZJA 3NBZC 3LUJA 4Z4CA 3DMDA 1MO5A 5EZYB 5BQ5A 3E2MA 2Z8YM 4M9XA 4XM1A 2FQWA 5BWCA 4HXGA 1CT9A 1HZZC 3DKVA 3G6WA 3PUXA 1KEPA 4EHDA 2XRZA 1TFUA 2YVUA 3D0QA 1ZD5A 2IVZA 1KEUA 3N2NA 4EUHA 4R2KA 3CBGA 2VWHA 2EQ5A 2WEKA 3W1VA 3HUFA 3CSDA 2WYIA 2IF0A 5EZYA 5AICA 3T3DA 5C51B 3VPBA 3EMBA 1JHUA 2NO4A 3QKTA 3V33A 2TS1A 4QRIA 3LC2O 4ENTA 5FWNA 2DPMA 2GUWA 5KNDD 4PV7A 1HRDA 1I2AA 4P4SB 3QJGA 1IXZA 3PRJA 4GMFA 2VOJA 3HZZA 3PI6A 2IDZA 4JP1A 5CD9A 4RFSB 5JD5A 2IH2A 1O9BA 2BWJA 3VR5D 2ZAGA 1DLJA 1J6UA 1THZA 1TZ2A 2EBHX 4BAGA 3DMPA 4QYIB 3F8WA 2O2EA 1TAHA 1VRWA 3PDJA 4P4SA 5LQJA 4Z4GA 4QO7A 1VIVA 4PGHA 4JWTA 3QE0A 4KMRA 1D5CA 1H8HA 1XLUA 2Z8YA 4RFSA 3RFFA 5BNTA 3A6GA 5GIOE 1S8AA 1PV2A 2C58A 2ZYAA 2M98A 1C7ZA 2FG6C 1TM3E 4QYIA 3DW1X 4IIBA 2H4JA 1M2OB 3IALA 3QX9A 4OI2A 4WDQA 1LSOA 2WSMA 2Z83A 3PKZA 3WL7A 5JNUA 4IVNA 3HJTA 1H2BA 1DU4A 3NW9A 5CFZA 5GV8A 1NMQA 1I01A 1AQYA 5MF6A 2R79A 7YASA 1EVKA 1Y6ZA 2GN8A 4M0CA 3ZXYA 3F6YA 3A7EA 3RIEA 1M2OA 3VOSA 2XYRA 3A9TA 1JA0A 1ECJA 4ZKEA 4AY5A 1BJTA 5FHQA 1P0PA 4C4PA 5C1DA 1U4OA 1YQDA 4G9BA 1NVVQ 4BNNA 1IUNA 1L7QA 3NC1C 2AFVA 4DPLA 3WKEA 3Q40A 1H5NA 1IK4A 5B57C 1U98A 4IKEA 3U5ZB 4MICA 4E33A 3KHKA 3EFHA 4LJYA 1A2OA 4WNIA 4PZPA 3ND5A 1DGQA 1TGVA 3T5AA 1ZQ1A 2GLXA 5HOEA 1I2MA 2RC6A 1LI4A 3ROKA 2WINI 1OIWA 4AZVA 5K4HA 5A3RA 1L2TA 5K4GA 4MVJM 3G89A 1JIUA 2WJIA 5LJIA 3M4ZA 5IJ0B 5HZGA 4K26A 4DMRA 2JGRA 1P4SA 4J1NA 4E5NA 3C3EA 5HHTA 3G2OA 1LBSA 4L5JA 1CY2A 3HKEA 3OJCA 4U4AA 1VECA 3FCYA 2AKAB 4FHGA 4RY2A 2ZXFA 2YWXA 4ZHQB 3DEZA 1CF9A 2V4MA 4MITA 1JQDA 3QU4A 5JQGF 2NMVA 1UZAA 1RYBA 2F9MA 4I1YA 3GJRA 3HZHA 2CWDA 2QDXA 4KYUA 2WIBA 3B36A 2IGBA 4C6HA 2B2NA 1K7CA 2HLPA 5DGTA 4ZHQA 1XMXA 1YJ8A 1KARA 3SBXA 1TRKA 2MT9A 2RSLA 2AXNA 3D2BA 3WGJA 4O4HF 1PL6A 4R1TA 3NOXA 4RNDB 2J3HA 1RCTE 1MX1A 2QRPA 2RHTA 3DNMA 3NVMB 1XRLA 1Q1BA 1QHFA 4BKUA 2FK8A 4F4IA 4HQLA 5J2UF 5HIMA 3U7RA 4CLHA 3W3AD 3V8VA 1TLFA 3B3QA 3GI1A 4F5WA 3KVVA 1K5HA 3ZLJA 4DLUA 1FLVA 2JIMA 4OQXA 1BO6A 3EIXA 5E0KB 1E2JA 4KSBA 4R0NA 2Y76A 3UXEA 2YVKA 3B1WA 2H08A 2HKIA 1UAAA 3G2NA 4HRXA 5L45A 1ZXLA 3K09A 1QP8A 4OYHA 3AEKA 1RYZA 3KVOA 1VA5A 2PAFA 5CFOA 3FPCA 1X1BA 5AVQA 4A26A 5ALPA 1C41A 1TAQA 3CX6A 4PQGA 4YCAA 2Y6VA 4RE5A 1V5GA 1T8UA 4HEHA 4M36A 3SQXA 1NDQA 2O3UA 3GRVA 5FUXA 4KGXA 4ENSA 4EA6A 1GZUA 1Z56C 1AXRA 2ZYVX 1KVRA 3UTDA 3ZIAD 4C76A 3PVSA 4XRGA 4BGDA 1A1SA 1NU8A 3IT0A 2IYQA 2LUOA 3NP7A 3ZE2B 3WQHA 4MR9B 1QZUA 4QYSA 5LWQA 3E8MA 4EM6A 2FRVA 3WY9A 2K6GA 2W11A 4JIMA 1EDOA 1NQOA 3ETDA 5H16A 4EG5A 5BVGB 2WNSA 2UYCA 3WHKA 3EZ9A 4YV1A 1UBNA 1ZNQO 4CG0A 3GCGA 1VA4A 4P58A 2G4VA 4B82A 3BDVA 3WRWA 2GRJA 5JSZA 4K7JA 1NNLA 3TVTA 2BH2A 3M3HA 4FN4A 5FO0A 2BHRA 4AIIA 3RT9A 5BVGA 4JI8B 4EX6A 4TTSA 1V6AA 3C5HA 3O3MB 3DWFA 3HO8A 5FWDA 3LA8A 3V2IA 1PTJA 2WF9A 4ROSA 1AMOA 4HH0A 1UINA 4XFJA 2AG6A 4LECA 5FEMA 5JZMA 3KDPA 2LPMA 5JBQA 2UDPA 3GRYA 1GZSA 1XCPA 4OH1A 1JR3E 1EVYA 4B73A 1K4KA 2O7NA 4MKZA 1XP8A 2LP4Y 4PPGA 4UPVA 2OHGA 3GELA 1W4CA 4BB9A 4XRRA 3JU3A 3NCTA 4D9IA 2GXUA 1GD1O 2QTFA 3EGDB 5FUVA 2CNKA 2M6RA 5G1OA 3LRXA 3IAS6 3DVSX 3S28A 3R7WB 3WIEA 4ND1A 5FOXA 4AB1A 2WT8A 4HO1X 1DWPA 1KYIA 3LPNA 4R2MA 5F5NA 1P18A 3AFNA 2XDQB 1PV4A 3EGDA 4D25A 1U7TA 3LCMA 3N7UA 2J0EA 1CFJA 3KB2A 4CNQA 3R7WA 3UT5B 1HEIA 2YWFA 4EKIA 3DBLB 4DSUA 5AIBA 2XDQA 1FX1A 3R09A 4EENA 3HWRA 2VF4X 3HR7A 5KQLA 2PX6A 2NP6A 1RRCA 1W0JD 3G7NA 3BG5A 3UT5A 2IPNA 3D7NA 2QZ9A 1C3JA 3LUCA 1P1HA 3OH8A 2WJVA 2Z95A 4GWGA 4N0PA 8AT1A 2Z1DA 2WYWA 3H2GA 3DV9A 3KSZO 3NDPA 4AUKA 3D3KA 4RTLA 1G9SA 1OX5A 2J4DA 5KNBD 2JD2A 4HXEB 5D01A 4C78A 4CM6A 3H2SA 3GLSA 3DVAA 2SKEA 1X1AA 5CIQA 3OSUA 5EJ6A 4YT5A 3GRAA 4FW8A 3UKOA 2WVJA 1HYBA 2QNRA 2IOHA 1E7MA 2V7UA 5EFOA 2QVCA 3BFVA 2C0PA 3GYGA 1R8XA 1L5GB 2QPLA 2X0EA 4RULA 4P82A 5H7XA 2IX3A 3M4NA 3IILA 5BPFA 1MQAA 2UVDA 4FJ2A 3PF8A 1IRXA 3RW9A 2H31A 1Q0PA 1RWNA 5GV7A 4IJ5A 1TIKA 2NN3C 2HJVA 1U0LA 1F0KA 3KWJA 3LY9A 3ZCTA 3ID6C 4TXMA 1QPBA 4R8MA 2AN4A 3VUFA 5MN5A 1WP9A 5DLQC 3LT0A 5K3OA 2BV3A 2J3LA 2WWIA 4Q19A 4BS9A 4WCFB 1L7NA 1CZNA 1E9SA 4GVXA 2IYYA 4X1OA 1ELOA 3COYA 2YN2A 4NEGA 2DP4E 2ZGVA 3FUTA 4KLNA 2IHZA 3DDOA 4I1IA 4Q1DA 1WBBA 2FH5B 4Y7DA 1M6VB 3EN0A 2WU0A 5A4DA 3UJPA 4IWNA 4CMAA 2JIDA 2FJUA 2WIGA 4RNCA 4OQDA 2CYBA 1PDWA 4WCFA 3ENQA 4Q4JB 5GOZA 2N42A 3L6BA 1AV7A 3SXJA 4IMIB 3RYIA 1SC6A 1TL7C 3L06A 1ST2A 2JCBA 3A4TA 4ACBA 2VQSA 2J59A 2IIPA 1M6VA 1TYEB 3ZY2A 3LF2A 4A1OA 2VSOA 2WIFA 3NDRA 5EEHA 3FOCA 3OCZA 5G1PA 4W5RA 3TLXA 1RSZA 4Q4JA 1U2SA 3IRUA 3BBPA 4N3BA 1SQ0A 1JQ3A 2RAFA 3LH5A 5EKDA 4ZANA 4XDZA 5KUTA 3F98A 3PXCX 1PX0A 4QGBA 2BTEA 2IU4A 4HBGA 3COJA 3SHVA 4FLEA 5ENZA 3LWDA 4M9RA 2OV4A 2PGLA 4NYMQ 4KXLA 2IOYA 1QV9A 2P79A 2YZ7A 4M1EA 3TLBA 4IDAA 4DDVA 3AFMA 1W5TA 2PXHA 3T7JA 1X80B 1LBQA 3EH2A 1O0CA 1JG1A 2AJ8A 3ENWA 3VM6A 4RIFA 1JHPA 1QYXA 3JR7A 3D5EA 3IQZA 5AVSA 2ODWA 1HG0A 3O2NA 3P20A 3P9RA 4AU1A 2A1TS 4EHFA 2B94A 5L7TA 4JVMA 1I94B 1BJRE 3S70A 5I9LA 1XTRA 1K27A 1IPHA 1P3DA 1X19A 4Q7EA 3KZOA 1T4CB 3WGGA 4B09A 1BHJA 3AYXB 3G1WA 5F7OA 2C7QA 1KH3A 1WTCA 5ALFA 4B7XA 2PZLA 2GVDC 1YZVA 1STOA 4YN3A 3TRJA 4ABYA 1MAAA 1P7CA 1ZCJA 4HQNA 1YKGA 1PQUA 2OQVA 2FWIA 1GN8A 4JT2A 4JMPA 5JXHA 5B6JA 2R0QC 2AN1A 4CLDA 4DHEA 4C87A 1D1TA 4EB6B 3IT3A 1QUEA 3DZGA 1B26A 2NG1A 5LZ2A 2PWAA 5IVHA 1CKEA 3CNOA 1WHSA 2O0JA 1XYYA 4RZHA 3DYVA 3IESA 2AR9A 4JSTA 4F12A 1ECFA 2APJA 1GV0A 1TQ2A 4G09A 4NK5A 4Y2TA 5C4GB 3KAKA 5LNK1 2OGSA 1ZPDA 1PQPA 3CQ9A 1EM8A 3CEJA 1KO1A 2PR7A 3MW8A 4H9GA 4JLUA 4EB6A 1H0KA 3HLYA 5F7ZA 2C2BA 2OAQ1 2C3UA 1CTQA 1FE8A 3HBAA 2JEYA 5ALIA 5TVGA 2H16A 2VRCA 4HJXA 1ZIXA 3CFYA 2OFXA 1NJGA 1OB2A 3RJ9A 1XXHE 3HYLA 1WUHS 3TG8A 5H02A 4EGAA 1WOMA 3WG9A 1JBQA 1NBOA 1XDDA 2PL3A 4QPNA 3O9MA 5AT1A 5IAKA 3RVMA 5BR8B 4LYYA 5JBNA 1SUSA 4ZFNA 4L3OA 3U0VA 1E20A 2I1VB 3D6AA 3GGSA 3QUQA 4M0KA 5KZMB 3E3LA 5FRDA 4ENUA 3GP5A 1USIA 1Q44A 6ABPA 2Z5GA 1AV6A 4N48A 1CFZA 2BKEA 4XX0B 2P4EA 3ONFA 4QRDA 3W5BA 1KPHA 3ZXXA 2B4YA 2XNDD 4P7JA 5AH0A 2VDNB 4BO8A 1YRLA 1QZTA 1X8KA 1O94D 4KO3S 4JX8A 1ZRNA 1YULA 5KWVA 1UP4A 2AJLI 3KPWA 5A9RA 1ZK1A 3DBOB 4XX0A 1EXVA 2ZRLA 4Z8YA 1X2BA 2LKCA 3ESAA 1Y81A 3B1VA 3Q3GE 5FOTA 2ZIVB 3T12A 3CJTA 3VR2A 3H2KA 5KQMA 4ZYLA 3CWZA 4XJTA 3WAJA 1E0SA 1XD8A 3WKAA 4AG6A 4E22A 3O8CA 4BN5A 1EK6A 2AFHA 3B6MA 3C3DA 4KQ9A 3T1YB 3GJZA 5B2ZA 4F8YA 2QV7A 1DKUA 5DHUA 1RWBA 2W9XA 4PWYA 2VYQA 5K6RA 1F60A 5KJ6A 4E5YA 1EB9A 2CD7A 2I4MA 3MF4A 4M1TA 4MO9A 5DN9A 5AUNB 3JYOA 1GNSA 3FSGA 3VPDA 5JLJA 2Q8NA 1ANKA 4F06A 1YRHA 5IS2A 1W4BA 3CLUD 4B46A 3UK2A 3VBCA 3GLQA 3PE4A 5KOHB 1E5XA 3JQQA 4F56A 4HDKB 3NIFB 1M2JA 1RAAA 1WZNA 5MN4A 3RUEA 4PG6A 3CE6A 4IDQA 5IASA 1DIOB 5IWCA 1QNFA 5UKDA 1K5PA 3SXUA 3ZWOA 3QVOA 2X0JA 5KOHA 1QLHA 1SUWA 5HZHA 4HDKA 2D74A 3GLUA 4EUEA 4UHCA 3LX5A 4WZZA 4BCDA 2VJYA 1IEQA 2A92A 2DECA 4GZLA 4IW3B 2JG3A 1L8LA 1N2ZA 4GPTA 3UT0A 2PUFA 1SD2A 3NTVA 2PUAA 3SJ7A 3R0QA 3SLGA 3W2GA 1WABA 3T9AA 4A6EA 4AG3A 3T7KA 4ZI2A 3CR7A 1PR4A 1X7WB 3KLPX 3VKVA 3GEGA 1NOKA 3HA7A 1HBJA 3MMSA 3P52A 1FOEB 3V48A 2GR9A 5ECDA 1IZYA 4OM8A 4TGLA 1JLLB 3CZMA 4CCYB 1BHQ1 2O50A 5AVUA 1BVHA 5LLDA 2F3TA 2P0AA 3AF5A 2ZRPA 1S0UA 4NU8X 4QSMA 1X7WA 2JHFA 1E18A 1SG0A 4PLVA 4NOMA 1L5KA 1ZL0A 1KZ1A 1PKXA 3QNMA 2E5WA 4E13A 4B1FA 3D6TB 3GOQA 4XQCA 4GOMD 1ZH0A 4DA7A 3RU9A 1JLLA 2HU2A 4CCYA 1YMVA 1NVVR 2F1JA 1ZP6A 2Z9DA 1Z4IA 2HF9A 3PSHA 3IR7A 4G1UC 4GYKA 4PIMA 2R6R1 5BMVB 4DCPA 4NNPA 3U4GA 4KXWA 5IDWA 4F5YA 3IAM1 4WNAB 2XE6A 3MQ4A 3QXCA 4MUEA 4IVQA 1Z5UA 1I5RA 1RE1A 3O3NB 2OBBA 5KREA 2Q4RA 2QN8A 4ZKDA 5KDOA 3CNEA 2KLBA 1Q0RA 1JKFA 2X19A 2J32A 3IDOA 5E2BA 5EIHA 1T36A 4I8DA 4A0RA 4CL2A 5KHLB 1LNZA 3EOBI 3TQRA 3B38A 4LMBA 4MWGA 4OQEA 5KVQA 1K86A 1T26A 2OGWA 3CF0A 3QITA 4M9QA 3AUUA 2ZM5A 4W8GA 2H18A 2W4QA 4U7HA 3H11A 4XAQA 5E7JA 4V0SA 2RONA 1NMXA 2Y0CA 5LC1A 3RT7A 1Z6YA 1GQYA 3EBPA 3KQYA 4DBLE 3VR6D 2XMSA 1VG8A 1GFIA 1IZ9A 1UM9A 4HWGA 3IT2A 3SQDA 4D9JA 4OLBA 4H6VA 3NIGB 4BQSA 2A9KA 5I4CA 1ZH2A 3DBHB 4BGIA 1HNXB 1J8QA 1P5ZB 1VBFA 2B5WA 2OVFA 3CSSA 1NURA 3L40A 4R6XA 1FU8A 1V48A 2O8VA 5E95A 2DMRA 1NVDA 1JFLA 1RXUA 4JLJA 5KOJA 4K0KB 2CXPA 1TJ3A 3HKBB 3PNSA 3SVTA 3GB9A 2P2SA 1OZHA 3SEQA 5KNDA 3TZ6A 3KYDB 1GPBA 2D2EA 5GQSA 4AYWA 3QENA 1K98A 3REOA 3T34A 3R5TA 5CLQA 2D13A 4EOGA 1NA5A 4BCCA 2G1KA 1N6KA 1GG8A 1LPPA 4PRLA 4EVIA 2LKDA 2WKWA 3T41A 4Q05A 3L3BA 3V7NA 1ZHOA 5AJTA 1UIRA 2QZZA 1RC0A 3ET5A 3GDHA 4RIEA 1NWCA 2C4WA 4L27A 1L8AA 4Z7OB 1BC5A 4HI0E 4HZGA 4OHVA 2FU5C 4X6UA 2RFLA 3Q3JB 2ON6A 1GU0A 1TEXA 2FZWA 5CTAA 4JMLA 3DC2A 1YQQA 3GUUA 3R9WA 1HQYE 1QFMA 4G8BA 2WF5A 2OD2A 4LV6A 1QPGA 3LZCA 5JCXA 1CF2O 3B7PA 3CPJB 1HI9A 1YGPA 5EVJA 2V7PA 1LJUA 1NY6A 2GO7A 4R2JA 5F73A 4EMTA 4EVQA 3FNIA 4UTXA 3ZU4A 1CRQA 1XAIA 2WJJA 1O97C 4PXYA 2YS7A 1BDBA 1G5QA 4L02A 2JGEA 4BBAA 4FUTA 1PJCA 1ZJ6A 2VUIB 3LCCA 4PHCA 5AM1A 4CQMA 2FP4A 2X8BA 1TEHA 4MCAA 3IIMA 4GO1A 4K2HA 4O0LA 1VYHA 5EZYF 5A4KA 3LP6A 3G13A 4MEBA 4WPGA 2VDKB 3UC5A 1Z2OX 1E64A 4UCXA 4ZICA 1PLJA 3ZD8A 2B98A 4CR6A 1M72A 3L8FA 4P3OA 1KBOA 2B0CA 2OECA 3GDWA 4U2GA 2Y1CA 4YGXB 1ABBA 5J2TA 1G66A 2HK7A 5LWHA 1A4RA 1T5DX 3TIXB 1XL1A 2JFFA 3TKAA 1PU2A 3ZCRA 3BWEA 2ZJYA 4YXWA 3ZQJA 4JP8A 1LLFA 3JQAD 4PSCA 1HRKA 3VO2A 2N3ZA 3WIUA 3DXZA 1ZI6A 4IP0A 4LOHA 4OSEA 1MDFA 4X24A 1YZNA 2IHJA 2UUPA 2Y1FA 3IJPA 3R2JA 4DJFC 1JFSA 1FYXA 4YRJA 3TZHA 4A2PA 1SUPA 1GKUB 1I3LA 1G7SA 1KP2A 2VZEA 1HE4A 1YR6A 4GKKB 1FDSA 3JVVA 3QHPA 5EXTA 5J9FA 4EMSA 1G8YA 1U2GA 4DY6A 1G21B 1Y42X 3H4TA 2PH1A 2RHMA 4FC6A 4QNNA 3IBGA 4PGFA 1XZNA 1HDRA 1SG6A 3MJRA 1NF9A 2HUPA 3FW1A 4XGIA 3UCFA 1UWVA 3B8EA 1CP2A 1E66A 3ND7A 4J29A 2X13A 5DEIA 2W58A 3PXGA 1XVTA 4ZCSA 4F85A 5C1IA 2Y1OA 3W79A 3CIFA 3LOQA 1II9A 3I30X 4C1BA 4Z1MD 4Q1BA 5MFPA 3W5AA 3D1JA 4DJAA 1AGRA 4H18A 3U37A 1JG7A 1NT2A 4S1NA 3MHPA 1SBTA 3K5WA 1VPLA 2VYVD 1PJ8A 1DKQA 1L1QA 1XOIA 3BWDD 5E1MA 3W3AA 1CIJA 4XWAA 4HZIA 2IV3A 4EYSA 1TUIA 4GHWA 5IBCA 2WVGA 1CJUC 3L18A 4C0WA 4HWKA 4IH1A 1XLTC 3FYCA 3WWZA 2VWGA 5DYTA 2Y71A 2GPSA 16PKA 3EZYA 3B6EA 1B73A 2CHVA 4R9RA 4L7QA 3SC3A 2CEAA 3NXKA 1EGVB 1ZGGA 2QRVB 1TAGA 3M89A 5BN4B 5K3CA 3SYTA 4YRBA 4Z4FA 3AIIA 5LOVF 1QH8B 1SOVA 1E6EA 4KPFC 4XDGA 3ITDA 4KQ1A 2QB5A 4OA5A 3CLVA 2C3OA 3GJTA 1J42A 1DWUA 2E55A 2EZUA 4REQA 3W9YA 5BN4A 3VNRA 2PANA 2W2OA 3MCTA 2DBZA 3GMDA 2AWOA 4FR0A 2GPNA 3BWVA 3C4QA 1QH8A 4I1SA 4EDHA 4PQRA 1CDDA 5A4FS 3EGWA 1E5LA 2YRFA 3MCWA 5FL7D 3QXSA 4NG5A 3RS5A 1O58A 3V4LA 1E7SA 2OBMA 3CO5A 1AK1A 3N2LA 5JU6A 1ABEA 3IELA 1XZHA 2P9TA 2XMBA 3FMOB 3CUTA 1YRWA 2BFBB 4NBVA 3EIWA 4HDRB 5T6MA 1JAXA 1KL7A 2H85A 4G26A 3K0CA 3TD2A 2XT6A 2YNMD 2CMDA 2RGYA 4OQYA 1T6NA 4HLDA 1J9ZA 3NB0A 5DVZA 2D6FA 1CP3A 3E4CA 1S3GA 1I0IA 3Q5EA 2WJ3A 4D8TA 4EG3A 4AK9A 1IH8A 3P9QA 4MZXA 1XAJA 2BFBA 1LW6E 3MUEA 3LI2A 4HDRA 4DJTA 5IZ4A 1SUFA 3RS7A 1Y37A 3T5PA 4MVJF 2AUTA 4I9UA 2LW7A 1XDSA 1W48A 1ZSNA 5L95A 1HE3A 1E6MA 4GM0A 4R1MA 1T8PA 2E4ZA 3WLJA 2Q5OA 4MDHA 1PKEA 2X8LA 3PEYA 4I3HA 2QL7A 3TBKA 3O9VA 4IVPA 1TYZA 2PLWA 3H18A 1Y1SA 1CNMA 4CF4A 3HO1A 3R1IA 4IR7A 1EK5A 1JJBA 1KIMA 1DI0A 1MPTA 4IIJA 4J7XA 3HLTA 4OQLA 4CMJA 4ZTZB 3HR8A 5ALOA 5EJFA 2ZIZA 1I3MA 1M3SA 4MTCA 3AO0B 2GPWA 4FJ0A 4OSOA 4OQ4A 2EHJA 1IZ8A 3O8DA 5H4HA 2ZUUA 4C0AC 2BHNA 1LK7A 3TW6A 4FWBA 3GHHA 2G0TA 4RVDA 3GGGA 1EKXA 1K3TA 1P72A 3H1AA 5AI6A 1WMAA 2VQEB 2GVZC 2WWFA 4S05A 1MW8X 1EBBA 2VJBA 4CIWA 1GLGA 4KDCA 3EIOA 1CY4A 2E49A 2XUZA 5SZHB 1FDUA 2XQKA 3WGOA 3KFXA 4HH4A 3BXHA 4UHBA 3DVRX 2UKDA 2WU8A 1K7EB 3E9EA 1DJNA 3OY2A 3PC4A 1U65A 4HPWA 5FAXA 1JNYA 1ZGZA 2PKWA 1W0JA 1YZKA 4L85A 5CGQB 4I36A 1WDLA 1KKUA 5T4HA 4EUNA 1EXDA 1RBZA 3KOUA 3QG5A 4TTAA 2AI2A 3R3XA 1YONA 3ASVA 4RZXA 3AUKA 1LBEA 2BDEA 3L84A 2P8SA 4C4XA 4D97A 2EHDA 2BR3A 4ZAWA 2YDYA 3IUJA 5KNBA 5JRDS 4MDYA 2AN3A 5IC6A 3T8YA 4HXYA 4LW8A 1X15A 5JIBA 2QDKA 3PJEA 5DKFA 5IN4A 1H2XA 3GARA 2WTUA 1C7QA 2JDID 1Y3IA 1YASA 3N58A 3NHMA 3S2FA 1JR2A 1XKXA 2R8OA 4IRMA 1MB0A 1Y6JA 1WHTB 1ZZEA 1XP5A 5CITA 1JG6A 3TLJA 3F47A 4RPGA 4ZDIA 3CXRA 3IQGX 4KC0A 4F4CA 3AEXA 2HA5A 1RXWA 2DSNA 3WJ2A 3HXMA 4P08A 4WESB 3W6UA 2A9RA 1UMDB 3I6ZA 5F7JA 1QKKA 1PD1A 1UP7A 1GZVA 2PGIA 1JR3D 2XTZA 4P0TA 4U3JB 3ZE8A 5GZ3A 2LRHA 4CEIA 1XHLA 2FN3A 1FRQA 4BP9A 1GHTA 4RKRA 3W5DA 1NF2A 1XVIA 2X86A 3UHAA 3EODA 2L42A 2ZI5A 4WESA 3AC0A 4PRYA 3AUYA 4X1IB 2YWGA 3UM9A 2K7FA 4LRQA 4NV3A 2OHFA 2B4TO 4TT3A 4MS4B 4WACA 2QMOA 5CNKA 1I5OA 4N41A 3NYRA 3ADDA 4Y6LA 2FRDA 2BPOA 1A7JA 3FTPA 4H6PA 1D6NA 1PR1A 3QNWA 4YB8A 1C0KA 5CB6A 5CTJA 4JJIA 3A4IA 1KPIA 3EYAA 1NV8A 2RI1A 1MT0A 3DOJA 2HA4A 3DR5A 3NHFA 4EO4A 1QV7A 3PJDA 4MS4A 5HPYB 1LQTA 3K9FC 4TKZA 5DW3A 4P3PA 4BVAA 5B6PA 4FSXA 3UHFA 4R69A 1RXEA 3SJCA 3I3OA 2FQYA 5SYAA 1UKZA 3NBAA 4BPBA 2PAAA 3C16C 3KHUA 5IWAB 4EHLA 3L0PA 3PEWA 3ELBA 3GPBA 1AVTA 1PT5A 4G65A 3A7DA 1BEEA 3C7DB 4NI5A 3AW9A 1IBCA 3T9BA 1V9LA 1ID1A 4P34A 5D3KA 3IH5A 4IV0A 2V6FA 1MMFB 3L0ZA 1I24A 4HX9A 4KO8A 2NZVG 1E5DA 1N36B 4JCCA 1V35A 5CDTA 2ZWMA 5LNK6 1AS3A 3B6IA 4BKPA 3JQDA 2FPGB 1M1YB 4I3GA 3DLAA 3EXFB 4RQTA 4B3DA 5TNXA 5EE0A 2Z4TA 2VDWB 1UDWA 3PJGA 2NU8B 5A6VA 8OHMA 1DQSA 5IW8A 2Q3CA 2HXYA 3MD0A 3KQMA 5TPZD 7ADHA 4G8DA 3FUVA 2DGDA 4JBGA 1Z37A 4RX1A 1LZLA 3I73A 4W9MC 1SA0A 1BH2A 1U2PA 2HA3A 3FB1A 3IHWA 1CIPA 4ROTA 1ACJA 3TTWA 3VAAA 3VHRA 3ZZTA 2VDWA 5D5HA 2J85A 2MSEB 4P7BA 2NU8A 4BZPA 4DMMA 1DPGA 3ICOA 3KWMA 4QU8A 1SVNA 1EGAA 3JD2A 3LCRA 5DGHA 5IDQA 4YJ3B 2P9ZA 2YOFA 3A3NA 2D3TA 4OK3A 3SN6A 2EEZA 4FKZA 2RMKA 2O2DA 1PJSA 5JMTA 1RWMA 4H4CA 1LFDB 4KE8A 3IVXA 1PNQA 3RS8A 1Z62A 1Z0UA 1G9XA 2WZQA 4PN7A 2CKMA 5KKNB 1SHTX 3REQB 4YJ3A 4WZBA 4Q1EA 1COWD 1G8PA 3N86A 4OI4A 4LTNA 4RY0A 4XLLA 3W90A 4BU1A 2HY7A 3RGGA 2PX0A 1QIGA 1T2EA 1EJ0A 1KMIY 2CK3D 3CO0S 3G8DA 4KODA 3AEUB 4TLLB 3S6JA 4RENA 1T8RA 2V54A 3REQA 1G3UA 2XBUA 5IZCC 1LPSA 1AS0A 4AJ4A 4EW2A 1H1LB 5KJCA 1CJKC 4QQNA 2FXIA 1ZMXA 2P78A 4G63A 4D5EA 1VG0B 1ADBA 1SNYA 2D5AA 2O0KA 2FSUA 2VA9A 3D54D 2G40A 4ZALA 2W6JD 3FJ1A 1AO0A 1R0KA 3T0GA 1VOTA 3RV3A 2XNDA 1Q1EA 2KHZA 1KE2A 4ER3A 1DX6A 2C1EA 4IJVA 2A5DA 2G8LA 1H1LA 3DE4X 2XLCA 4FYPA 1LLCA 1H4QA 1D2GA 2ZUCA 3RM3A 3ER9A 1ISGA 1T91A 2QAJA 5EE5B 3Q2KA 1GRRA 1RI4A 3EARA 1TA0A 1MO4A 4UZEA 5CJJA 1L5NA 2I80A 2PUEA 1ST3A 1JSLA 2QD4A 4C0SA 3T5TA 3QA9A 4ZT4A 2SKCA 3I9MA 3T7TA 4PNZA 2AUNA 2FW6A 1KJQA 2OGZA 1ESMA 2OBFA 4NJOA 1IHDA 1ZNXA 3KVRA 4L5YA 4KUGA 4HUTA 5EMHA 2XCTB 4WKGA 1JTVA 3FGOA 5D6OA 4R8RA 3HCRA 1RIFA 1CQZA 4RTMA 4ZA2A 1GCOA 2JLQA 1GCUA 4GW3A 4RVHA 2Y66A 5TT1A 3GFTA 1ZVMA 5CA1B 4PLZA 2C31A 4F4UA 4DL9A 2OK8A 5DLPA 3LDHA 3QKRA 4NAUA 3E3MA 3CN7A 2CXRA 5HF8A 1E9CA 3MM4A 1G3MA 4AO7A 3C98A 2PSSA 2ONJA 1W2HA 2O20A 3Q4GA 4MKFA 3VHQA 5CA1A 3P9SA 1CUCA 1DKNA 2FKAA 2GF0A 5LDDC 3LHIA 2B4RO 3G7SA 4J4HA 1HE2A 2PT5A 3DPUA 3KNZA 2FZVA 1XTVA 1W96A 2WDPA 3DE2X 3LBNA 1AKWA 4G1EB 3LFTA 4R1SA 4ZVMA 3WK7A 1I6MA 2QLBA 2KBEA 3ZU3A 1UBMS 4M55A 1KGDA 3HU3A 5DGIA 1U8TA 2A67A 2VDLB 5KCMA 3GJ3A 3ONDA 4D0RA 2DBYA 5CDFE 4ZK2A 2HV9A 3I83A 4LUCA 1WXXA 5DI3B 5JZSA 4YK7A 3KETA 2R4QA 4KRYA 5G4LA 2G63A 2JLBA 3BL8A 4TWRA 1TM2A 2PS9A 2DUWA 1DAIA 2DCUA 2IBMA 2DR0A 2PPLA 4MQLA 1TK2A 2FLVA 4RV5A 4N5NA 5CB4F 3LXRA 3HA5A 1XQWA 5DI3A 1VCMA 3RAFC 4P6VF 3SYMA 4AZTA 2KJQA 4QDOA 5ICEA 3AI1A 4DEXA 3K9QO 3MJTA 5K03A 3UYKA 1EX7A 1DEAA 2UZIR 3A1TA 4V02A 1HSOA 1V37A 3GCXA 4MOWA 5TLSA 4A1FA 1C1YA 1A69A 4LYFA 1T3LA 4M0PA 4I55A 4TM8A 4QVGA 5DFAA 2GF9A 1RLMA 1I1QB 2CFCA 2PRIA 2FHPA 4UZSA 5BUSA 1U1CA 1RAHA 4JLNA 2FLKA 3HHEA 3IJRA 2QRJA 4JB8A 4LZPA 2Y0DA 1KGSA 4UE2A 5DMHA 4KDFA 4BDSA 2PO5A 5EL0A 1OXSC 3IXQA 3KP1A 4TVKA 1KZGB 1JJVA 4AURA 3PWKA 3LOPA 4LJ8A 2Z5VA 3RIXA 3QU7A 4RYLA 1B74A 3ROEA 3AETB 1Y9JA 1RRKA 3M1IA 1QHNA 1T6XA 3MGKA 4MVJH 3FPAA 4JJ6A 3H04A 2VAPA 2FR1A 2XZTA 3O38A 5HQTA 2FX5A 3C45A 2HGSA 3QF7A 2OKGA 2EBFX 1DLIA 4GQBA 4P2GA 4A2WA 3KPJA 3LYHA 1NE2A 5HA5A 4FGJA 4J49A 3VR6A 5AW2A 3AETA 1ILEA 2CZQA 1VJDA 1JH8A 4DNPA 3OCJA 3D43A 5JECA 1QORA 3OEED 1U1DA 1OASA 1UMBB 1L3IA 1KFBB 3DOCA 2ZUWA 3OA2A 4ZARA 4C03A 5HWSA 1Z6PA 2FMUA 1JQBA 5IFLA 4I08A 2E6KA 2QUBA 4F3KA 4XUGB 1RI3A 1ZKMA 2WMNB 5FLKA 4YUZA 3PPYA 4CT5A 4S0ZA 1D2CA 3BE8A 4PTZA 4TS1A 4LFAB 4QECA 4BEVA 1NFRA 4FC7A 2DXIA 1J0CA 5GAJA 4I5EA 2VSFA 1U0FA 1UBJS 2BI8A 4P7GA 2XBLA 4ZRNA 4CM9D 2JLWA 1C3LA 4ACAA 5LZ5A 5F76A 2CB9A 4C9BA 1YRAA 3CLRD 1EXWA 3N74A 4TSRA 1SCJA 2J8ZA 2BFAA 4TMTA 4JENA 1M8JA 3O8OA 2XMRA 1R37A 2B9EA 4DLKA 2R00A 3HRKA 3I2KA 1HSZA 1X1QA 4Q4CA 3R40A 3HBJA 1E2PA 4MAAA 3INGA 4KQGA 5DTRA 3WLPA 4GL2A 3PNYA 1O95C 1PFYA 4INPA 3TIIA 2JIRA 1C4WA 3BXXA 4EF4A 1G1AA 1H9CA 1QX3A 2A8YA 2L17A 3OVMA 2PKYX 2VHWA 3RBAA 3YASA 2JJ8A 5FA6A 4QPJC 4QTUB 3ZPXA 1MB9A 1I6WA 3OICA 1UAYA 4IOKA 1WETA 1GZDA 1BJKA 3GHYA 2XKKA 4QYMA 1L8XA 2UYGA 4QELA 2XITA 1NUAA 2GEDA 3OOEA 4KL8S 3JPYA 3B3GA 1RRFA 5AK5A 2Y0BA 1K8RA 4GD3Q 4G07A 1WR8A 4TWJA 1N0WA 4FGZA 3K05A 3V7YA 2ZBRA 2QTNA 3GOHA 3O4IA 4BV8A 1L4HA 3OX3A 3U80A 1PWEA 3UXHA 3T5GA 2V7TA 3NTOA 1RWVA 2A57A 2NO1A 3GWGA 3ZWWA 3JQAB 1P5HA 3CVJA 1XG5A 4XQ9A 3A0UA 4PPYA 2QR2A 3BXZA 5FIUA 2K5UA 3IMFA 1OI3A 1Y6RA 3ER6A 3I76A 2EERA 3CURA 3A9RA 3O8QB 1JEAA 5B36A 1UJ5A 2XADA 5EQTA 3FRHA 4W5NA 2R6AA 3ESYA 4JY7A 3HJGA 4F5EA 1L9KA 5GONA 3TTVA 4BQOA 4I7EA 3U5TA 4L50A 5E2IA 1K97A 4XD2A 4JUFA 3WB1A 4D3YA 2C4NA 3EEOA 4NQRA 2F8SA 3O8QA 3QHQA 5AKYA 2Q4TA 4DADA 5D3ZA 3PFCA 2B3DA 1QVRA 1S2OA 1R6BX 2V59A 4GECA 1L1EA 4M9ZA 1RQPA 5L53A 2WSYB 3JY6A 2UVPB 4G4GA 2Z6AA 3HKCB 5DTJA 4K9LA 4YRKA 4R1UA 4UMDA 1JIJA 1A7KA 4JSRA 2PZEA 2W22A 4B9EA 5H80A 1VPVA 5T5QA 4TXNA 1RXCA 2CSUA 1SD1A 2H2WA 3ZHQA 2Q8PA 5AW8A 1F7VA 1HF3A 2IEGA 4PYNA 2ZB4A 1KOFA 5JSYA 4DCJA 3UFBA 2YV3A 4OMUA 3QH4A 2IHBA 3F5SA 1M0TA 2G0AA 4ZPXA 1IN6A 1KVTA 1F8FA 1Z3CA 3K9WA 3P9ZA 3D3QA 1QCDA 4L72A 4N82A 4Y67A 4EITA 4QODA 3TOVA 3MYYA 4O25A 3RIGA 1GXSB 1QIMA 4U7JA 4AZ0A 3PHGA 2X5XA 5F3DA 4R9VA 5NLLA 3BFXA 4V3BA 1PS8A 1JSZA 2OXRA 4LBVA 3R3YA 1Z08A 3GD5A 2XECA 2ZSKA 2EW1A 2V6MA 1V43A 2JW5A 1ZD8A 1GXSA 4COOA 1NF8A 2DT5A 4ZIRB 4CMIB 1QK5A 5CBPA 1WPRA 4HWPA 4Q00A 4FKMA 5JTTA 2WY2D 4UULA 3BMQB 4E14A 1F0PA 1TM4E 3CNHA 4FSHA 4ITVA 2BGLA 1OX4B 1ODLA 4O4IB 4U63A 4RSHA 1MIHA 4XD7D 4M1ZA 1NVBA 2YVLA 1OWMA 1LWOA 3F5QA 3WFZA 2IZ0A 2OTCA 3JW8A 4KACA 4BMPB 2QTCA 4PWZA 1SUEA 4CMIA 3GJ5A 2A5FA 3BMQA 1GUDA 1RLJA 2X8AA 4BX8A 5KU1A 1LS1A 2XCUA 4MH0R 1QIFA 1MEOA 4JC5A 1OX4A 4O4IA 4EBFA 5FL7A 1KR5A 4FFMA 4Q21A 3FJYA 3S7ZA 1DKMA 3H17A 2PD6A 5G0SA 4K3UA 4YP9A 1PT7A 1PT9A 3MK31 3TVDA 2WFAA 2ZTUA 2IUEA 4EARA 2V5VA 2HSZA 2WV9A 1NUQA 2H0AA 2PT9A 2NUPB 2YNMA 2J67A 1A72A 4KRXA 2F90A 3AK4A 3QYJA 4YXFA 3G5MA 5BUCA 1KSJA 5LYYA 3WK5A 1EP9A 1Y8RB 5D87A 4TVOA 1P2SA 2XMPA 3GPIA 2TSYB 3KE9A 4WLEA 4CV1A 5AK0A 4KAAA 2AOXA 2FW7A 1ZD9A 2HEIA 2ZWAA 9MHTA 3LCJA 2NUPA 3F0TA 3F3MA 3D4OA 4LZNA 4CTNA 2GASA 3TRIA 3C74A 2BZGA 4GI5A 2WHPB 3EWIA 1ZNZA 3FRJA 4WCDA 2JAWA 2IUUA 1ZD3A 5IXSA 4AQ7A 2AG8A 5C4MA 4UUPA 2IKSA 3EUAA 3RYCA 1JDBC 4IV8A 4P4TA 2VVTA 4PYRA 3TOSA 4LRSB 5BR1A 5C3MA 2C5FA 5B7GA 4XGRA 1QP7A 3WNCA 1CNFA 1PK8A 4ETNA 2AEEA 4DTCA 4Z49A 3EEIA 3HYNA 2UZ3A 3F78A 2DHCA 3T3IA 1ETUA 3B89A 3AESA 1JJ7A 2ZPTX 4R1NA 1YL6A 2GNPA 2C4TA 3NNSA 2XUHA 2ZVQX 3NRJA 4HAUA 2HLNA 4UEWA 4J76A 3RB8A 1SVMA 3K31A 5AW0A 4C2AA 5I7SA 1N1DA 2J3JA 2ZB3A 4LPKA 5JZVA 2BR4A 1DCMA 4AXXA 5A0VA 4DV3B 3NWBA 4ZCPA 2ZR7A 4L15A 3SFVA 4DXDA 2WF6A 5BORA 1ZMRA 1YTLA 3KJQA 5I5EA 1C9KA 5GM2A 3H0KA 3L7YA 2NO9A 3FMPB 3SS9X 5M04A 1YBFA 1E4EB 1P19A 3RWBA 3G0HA 3MWJA 2JAQA 2ZBVA 4A23A 2YTZA 5LQDA 2RIRA 3D8NA 2GFIA 1S8FA 1ZMBA 2Q99A 5FI5A 3G1TA 1PR3A 2AIRA 1YB5A 4RJLA 4TVSA 1ZUIA 4R71A 1LW7A 1WZIA 2Z56A 3HUTA 1N57A 1R6TA 1YB4A 2OXFA 1I3CA 2YV4A 1GUAA 2ATXA 4X92A 1COZA 1ZSYA 4EVSA 5B30A 2BELA 3DDCA 4E5UA 1LRJA 2VLBA 4LKOA 4CG3A 3C3PA 4S0XA 5B4TA 2H5JA 4YRAA 5AVZA 4DYVA 5CM8B 3D6JA 4FYYA 4V2IA 1U28C 2XB8A 3ONEA 4IIJF 4AJOA 3TLGB 3WLIA 2JDIA 2UUCB 3OLZA 2XKJE 2JCGA 4F4HA 5AOCA 1X70A 4PC1A 2F17A 5EP4A 3RFUA 4BXOB 4NMHA 2YINC 2R48A 1PW5A 4DREA 3ES9A 5JSFA 1E1CB 4J0GA 1JKIA 2ZYHA 3F9CA 3JQ7B 4HAXA 5AWFC 4CUZA 1GSHA 4YI5A 4JDUA 5G0VA 5L3VA 4KU4A 5B1IA 4OXXA 3SFZA 3W9UA 4U9HS 2ZPUA 3SY8A 4EW1A 4HPXB 4DB4A 4BXOA 3ISJA 3BL6A 1E1CA 3I8OA 3I72A 3JQ7A 2YOHA 1A8UA 2A9FA 3F5FA 4MV8A 4ZVNA 2FI1A 4KR9A 1JR3A 2G08A 5DHSA 2IU0A 1RBQA 4D42A 1NUUA 1WMFA 2VDJA 3DF9A 3K8QA 4WFIA 4XX1A 3QFSA 5K8TA 2I6XA 5G4KB 3RRJA 1OXBB 5LZ9A 1JSCA 1V4VA 3L77A 3FOFC 1ENOA 2PLNA 5BT8A 1S4QA 2OXTA 4EFNA 4JELA 1CQWA 1RW4A 2D4HA 3PYXA 4JLAA 1XJWA 4RLQA 2XE7A 2FEMA 1XMSA 4PIPA 3LQKA 2DBQA 3VZRA 4K9MA 3FG9A 1NR7A 3IE2A 3K1ZA 2WJPA 3AP2A 3HDGA 4R1OA 4Z9YA 5TEVA 3WYAA 4UTZA 3SHQA 4DVJA 3A1VA 1WMEA 2I65A 3N7TA 5GIPE 2YN0A 4YV2A 3GG9A 3HU2A 4KWTA 3RVBA 4J3NA 1L4MA 5AI4A 5CCBA 5B1EA 2NTYC 4D4JA 5TE9A 3PZBA 5CIWA 1PBNA 2VWPA 3CUSA 3S5JA 2E1PA 2P5TB 5FHRA 4IRXA 2ZRJA 3IJEB 4W9NC 2ASEA 1LDYA 2VJOA 3BMOA 3PL1A 3HB5X 3PQ7A 4TZKA 3KB1A 3ZI7A 1MEJA 1QJ4A 1T8YA 2PRKA 3KWFA 1R1DA 2DFKB 1AGPA 1FJGB 5TMEA 3HFSA 1G60A 1FTWA 1N5LA 2XZDA 2QUAA 4ZEWA 4LJ5A 4H7KA 4MXDA 4GH5A 4GXTA 4WAUA 1DT5A 2A58A 1JHYA 1U5CA 3M6WA 4I5DA 4TXJA 1WAMA 5AXCA 4C3OB 2JA1A 5HFJA 3QBDA 2Z2YA 5TF4A 3DMNA 1BMFD 1TZCA 3O7MA 4I6EA 4ZGGA 2J3MA 4TKMA 4PM4A 4CDNA 2IA5A 1S2GA 2Y4OA 4HNQA 4L28A 3O2JA 4MGIR 4ECEA 1DCKA 3L1VA 4EY7A 1UC5B 1YVDA 2O5EA 2BEUA 4MIOA 3F6CA 4CF6A 1OH5A 1H6CA 5L6MB 1BW9B 2HT6A 1P4JA 2EWWA 3MS7A 1XMJA 1RE0A 2HTEA 1XHFA 1DVRA 4XIIA 1NMZA 4UXJA 2B7LA 1OLUB 3MT7A 2Y6UA 1AF4A 1YUBA 3AR2A 1OIVA 3DD1A 2IYNA 3L6EA 4MB2A 5TPWB 2P9EA 1E2NA 4RMHA 1QHXA 13PKA 3UWPA 3ZV5A 4F0JA 1E63A 1CQJB 1BW9A 1QFZA 4MV1A 5C8ZA 5K0LA 5CDSA 4BTVA 2JLVA 1YHZA 4F4JA 1HA3A 2IX9A 1T29A 2OAEA 4LS3A 3GT0A 4DQVA 1OLUA 3BFKA 1AC5A 1QGUB 1FP2A 1XYGA 4GQAA 2YH2A 1DV2A 2B92A 1X77A 3K1YA 4N0DA 4XWTA 1N75A 2BZSA 4RHCA 4QBGB 5ALGA 3RC1A 5CDGA 1AH2A 2V7QD 5COAA 3ZU6A 1U5AA 4KH0A 1HQCA 3QBJA 4PO8A 5CA0A 4BGUA 3Q8LA 4LJLA 3UC9A 1COWA 1X8LA 3ZD9A 4JA2A 4BB5A 1T9GS 1NW4A 3GA0A 3NIWA 4WLFA 1QGUA 5JMPA 3MAGA 1ONBA 1SVSA 4KMOA 3EAGA 4OIMA 4U5QA 2EJWA 2FW1A 2VDUE 1P0IA 1SXJC 2CK3A 2WOOA 3KOMA 3QMPA 4G0QA 5LP6A 1YQUA 1ZR2A 1YE5A 3VVBA 4UBIA 2WTNA 4YPFA 3QKWA 2HHAA 2TMKA 2V3VA 4O5AA 4BLRA 2VT6A 4EJSC 5JWOA 1FNCA 3ZVKA 1X13A 1Q12A 2BHLA 2W6JA 2ZJOA 2OYRA 1MVLA 1E1KA 4KI0A 1H4SA 3IHKA 1II0A 4K28A 3SJUA 4D57A 1LBIA 2LV8A 3N8NA 4HLUC 4ZOAA 1M10A 1CUSA 1UPFA 3UA3A 1Z74A 1FDRA 2IV7A 1YACA 3NC0C 4BFCA 1XNGA 1JA9A 4H0FA 3I34X 3IO5A 3LXMA 4V0OA 4JI0B 5EPEA 3NVKI 1KJZA 2GBPA 4JC4A 4HNHA 3LM8A 3S5UA 1IBSA 3DD5A 5ALJA 4PYIA 2JGAA 2OP0A 3ABZA 2VDRB 4OATA 4AWXA 4QLAA 3I53A 4GWKA 3IP9A 4EYOA 4ZV4A 1U3VA 2Z08A 1HT2E 4MVJG 1X87A 4J1TC 1QJCA 2AZTA 3T99A 5D00A 1BHO1 4FX2A 1HURA 1SJ9A 2GKOA 4DV7B 1UH5A 2ZEJA 4UMVA 3ND6A 1A9TA 4AJNA 2ALJA 1YKFA 4KVZA 3PHLA 2G9RA 2I62A 5D85A 2RHLA 3UJBA 1MH9A 4MKRA 3F1LA 2EWVA 4MARA 1OD6A 1HLGA 5C0OE 1MA0A 1P5RA 3LBIA 4LDQA 3X2FA 1QQ5A 2C29D 2FF7A 3I4LA 1N6OA 3DM5A 2PKRA 3OOHA 2GM3A 3P2JA 1XXHB 4BFXA 4RTPA 1MR3F 4YUXA 5EVCA 3BBLA 1OE0A 3OT1B 2VNKA 2WICA 3SQNA 3SZRA 4BX9A 1V4NA 1NP6A 3EXG1 5FV4A 3FMGA 1T1IA 4CEHB 3W2EA 4JX9A 3G9UA 4ND7A 4UNPA 3SHOA 4G0WA 5DM2A 3IMGA 4Z53A 5L8VA 1XXHA 3QPBA 4B8ZA 4C22A 4Q4LA 3FFXA 2NXCA 4DZRA 3OT1A 4NYIR 3SQWA 2Q21A 3TR5A 1EXMA 1CJCA 2BN4A 4MW2A 4PYJA 4CEHA 2F4VB 3EJWA 4AC9A 5HQ3B 1D5WA 2AOTB 2WHXA 1JKMA 2G1PA 2GERA 1PWXA 1IVSA 2XB2A 3SMVA 2DG2A 3RRYA 2CL0X 3W5SA 4DWWA 3WLOA 2EIHA 2WUVA 3QVTA 3KZXA 2HIHA 3PEFA 5GP1A 5I9NA 4I3FA 3L5OA 5HQ3A 2AMJA 1CVRA 1QLWA 1GZ6A 2AOTA 1AUQA 3CLTD 3ZCVA 4Z7NB 2QBYB 4M8IA 4Y2XA 3U4DA 4G2NA 4C4SA 1J2YA 5TQ0A 4X85A 1I4TD 3I2FA 2QBYA 1O4VA 3N0WA 4JB0A 4OHPA 1K6XA 4M7OA 5CW2A 1PWZA 4A6DA 4A73A 1NJ6A 4GPD1 1D8AA 2JAHA 2C42A 2ZBGA 1EX9A 4QU9A 3L49A 1LGYA 2P77A 4DEVA 4ZHSA 3AU8A 4FB4A 5CA1F 5JDIA 1HM5A 1XCGB 1XTZA 2ONZA 1Z5WA 1VMKA 2Z8XA 4DWOA 4EL0A 4JQYA 5CT5A 2BBWA 3Q8KA 5B3JC 2CV0A 3R5SA 2JJYA 1RXIA 2GSWA 1R5NA 3MJCA 3IIJA 3F6PA 4FFWA 1W8IA 2BDUA 2FUG6 5COBA 3VJRA 1EQUA 3ADPA 3BILA 4M86A 4XGKA 3RS4A 1M0EA 4UCFA 1N6LA 4MK4A 1LTHR 3GLHE 2Q6KA 3OEHD 3KELA 1OFGA 4NMXB 1HFJA 3DQQA 1LBTA 2R96A 1T1SA 4OHXA 3OEEA 4TOIA 1TYBE 2EJVA 5LB4A 3UV6A 1V1MB 4DUGD 2CDBA 4C0XA 2HA6A 4ZU3A 1N5JA 1P91A 1Q1ZA 2FX2A 2OCIA 2PWPA 1PGNA 3I6MA 3MRTA 4PO1A 4WBXC 1WO8A 2FXVA 4FINA 4PICA 4O8ZA 3RC2A 3OZFA 1GGJA 1D4FA 5DP2A 3V34A 2IHYA 1P2VA 2JHGA 3ICQB 2G36A 3H13A 2H7YA 3F46A 1V1MA 3FF1A 5DBEX 5E4FA 1SU7A 4E32A 4RK6A 2PMWB 2E18A 4RIHA 3KOWA 3CCBA 4IYJA 3LTNC 4YRGA 1KI3A 4I55F 1HDGO 2OFOA 2P2NA 2QJRA 3A4VA 4DQXA 4Q3BA 4TKLA 1UBLS 1KXJA 1A98A 5FTMA 5KYTA 4KBFA 2J6BA 2J9RA 2O1WA 2WE8A 4I8IA 3MT8A 3ZCXA 2BR5A 2CLIB 4F9GA 3TGLA 5DIZA 1KAHA 3DCIA 1CDOA 2FZ5A 4WA7A 4GVLA 1RI1A 4UDOA 5LQRA 3WAGA 1TC1A 5KNCD 5KTYA 1GTZA 4PCUA 2BEVB 3LWZA 2P4UA 4J9VA 1JNXX 1NW6A 1VSVA 5ILGA 3U13A 2A9QA 3EGXB 4WKBA 2ZUFA 3VJMA 3VNSA 1F9AA 4YO8A 1DUSA 1R9JA 3TPFA 4M6WA 2ZDQA 2C7OA 2R7LA 1L7EA 4GX5A 4DR1B 2PUVA 2BEVA 2YFYA 3NT2A 4IX9A 4XSVA 4NC9A 2F64A 3FBTA 4H77A 3LPDA 3JZMA 4QEDA 4ZYTA 1NNUA 3EGXA 4RZ3A 4J90A 5JJLA 1VXRA 3V8MA 4WD3A 1PVOA 1A77A 3FUWA 2D2XA 5C8XA 4RFVA 2A0FA 4KQIA 2NXWA 3TNFA 3WFIA 5BR4A 4DUZB 4DV5B 3VFDA 1W7AA 5LMCA 3VVCA 1T2AA 2CCGA 2SKDA 3H1EA 4HY3A 4YAEA 1Q16A 4LZJA 5B5SA 5LD2B 3AR9A 2ECPA 3W8FA 4IIGA 3HMKA 2VHUA 4GC5A 3Q7EA 2RAPA 4B6SA 4B84A 2VJKA 2AQ8A 4FIZA 2FFAA 3DJFA 5BWLA 1BKDR 1ADGA 1WXDA 3H8VA 1B42A 1QNLA 4CFSA 3E9NA 5JNTA 1EWVA 1T6YA 1FFAA 2QQFA 2XDWA 1W1IA 5AHKA 1P73A 1MRNA 3C8DA 1P9NA 1SG9A 3E4DA 3M4XA 2QG4A 4CCWA 3AFOA 1G6HA 3OT5A 1RYMA 3KKEA 2ZYWX 4IZ6A 1OTXA 3GNTA 2XUPA 4MR7A 4RACA 3GT7A 1LPOA 3UCEA 4PQFA 1XWWA 3V3TA 1M5UA 4DA9A 1TD9A 4FNMA 1RZVA 1N1GA 1NVMB 3AOEA 5HF9A 2BRUA 3SSAA 1EZZA 1CRZA 3U4HA 2BMWA 3VH2A 2FSGA 1UBSB 4BO4A 4MGYR 4XTRA 3WB2A 3KYCB 1FDTA 1XZFA 2PDAA 4J07A 4YT8A 3EUFA 1EH5A 2M6KA 1B1AA 4H0CA 1IQUA 2B1IA 2X6QA 3CH4B 3W8EA 1NDUA 2DHEA 5KOIA 3LD9A 3MJEA 1FLAA 4K0RA 3WSVA 1VJ0A 2P67A 2DH5A 1G20E 2QI9C 3T9FA 3DP7A 3RUFA 1C7FA 2JGKA 4JJ7A 3VPSA 3AINA 3KYCA 2DJIA 4C43A 4K9DA 1E3TA 3FLAA 3ORRA 4LJ7A 5SZKB 3CZPA 1OAOA 4F46A 2R8ZA 2C95A 2CNBA 3FETA 3IKVA 4QBIA 2OV3A 2IHUA 1IXSB 3Q7SA 4GKAA 1OGJA 4EHNA 4XWOA 5GONF 3N7AA 2OP1A 4DCVA 3K0KA 5HW0A 1C9YA 1HYQA 4G4JA 2FV8A 4XD7A 4DLTA 2W42A 5DBOA 4ZMSA 2V0GA 3VVMA 1FPQA 2DKNA 2GMWA 1XX6A 1U2EA 2X15A 5KQGA 4CM5A 3HWSA 2AVNA 1C7EA 4ASUD 2BFCA 3HDQA 4DLVA 1R0WA 2WAOA 3NHSA 2H2IA 1USKA 1N5RA 1EG7A 1JYSA 4D0LB 5JARA 4OXRA 2MDTA 1VE1A 2BGRA 1X0XA 3OLCX 2C9ZA 3T3PB 3ZUGA 3PSAA 4CGYA 3UMGA 2FWNA 1EK0A 2IU3A 1GFSA 1QRAA 3GAAA 1VJ5A 2KBFA 3LRPA 3CT6A 3QVMA 3ZXIA 1FSPA 1DX9A 1AKQA 4GF5A 5JVDB 4H3KB 4HUJA 4HRAA 2ZZKA 2OVBA 4R98A 4DLXA 2EYQA 1L7DA 1DBPA 1PE0A 1QQAA 5A4IS 2PMDA 5G40A 5I8PA 1NQAO 4EG0A 3I5XA 2I7DA 2WF7A 4EG8A 2XVYA 3HB0A 4H7JA 4YUVA 1U9YA 1ODSA 2XY4A 4NCKA 5E4TA 5JVDA 1IZ0A 4TX1A 4ZOLB 2W0SA 1AGXA 5IABA 4H35A 3DOEA 1O6FA 5AIAA 3L7NA 4DUYB 4F3RA 3DKRA 2BZ0A 1YR7A 2BSAA 3JWPA 4OK6A 4R9SA 3B20A 4YFYA 5EERA 4FS3A 3S2YA 3TTSA 3CZCA 3I2YX 4X8OA 3SIXA 4PCLA 1GDTA 4R2IA 3LL4A 1Y4ZA 4DJDC 5CYOA 1RKVA 2IQIA 4OHZA 2HU8A 4MGZR 1BX1A 1ZH8A 3PRKE 4OQPA 5JMWA 5AMXA 4M8NE 4LF6B 4CMCA 3O91A 5AKZA 3R77A 4ID9A 1GV1A 3S2GA 4FFVA 4Q47A 5AJWA 5L7YA 3GFOA 4HYYA 4OX9Y 3WMXA 3E9QA 1J0BA 3D31A 4O4IF 3HRIA 2WQ7A 4H1VA 1GU7A 4ZO7A 5KDDA 4X71A 3DTYA 3ZHSA 4BVEA 2QX9A 4OHUA 1OAAA 4C4OA 1IBLB 4UFNA 1J0EA 4EA9A 5E3HA 5I7UA 1DV1A 3NJ8A 4OPMA 4YQYA 1KDVA 1NW8A 1IXKA 1GTJ1 3W6PA 1KF0A 3HXLA 1I36A 1SBZA 3KYIB 5H9VA 4KGDA 4DARA 4C2UA 3WLAA 4V0ME 3MJVA 2ZI4A 2BJVA 4HWOA 3FNBA 3DWEX 5HK8A 2GRUA 2IWHA 3PUWA 2HW8A 4MMXB 3RU2A 3LLSA 1IBMB 1PNTA 4IXDA 2GHRA 4JQZA 2GB4A 1LDBA 5ES3A 1QAMA 5IJ9A 1FUUA 1E3MA 2DPXA 2KB0A 2R5NA 2WE7A 3GJ7A 1ZUNA 2ZS9A 3COWA 4N7RA 3RARA 4M8LA 5DLYA 4KG7A 4N1AA 1NUPA 3WICA 4KR0A 4YYZA 1YZQA 3AFGA 1O1YA 1NFQA 3AY3A 4MW1A 5G02A 2FFBA 4G0ZA 2WM8A 1PSZA 3PITA 3GDGA 1J20A 3TSYA 4A10A 3IEXA 3E81A 2QPOA 3N3BC 5LP1A 1QUFA 1HLDA 2H2HA 1BG6A 1NTOA 4EG7A 5ED4A 2R44A 4L95C 4E5SA 4B3TB 5DOVA 2WJ4A 1PNOA 3N6RA 4KIUA 1DC6A 2D5CA 2OWDA 2XSZD 4GLBA 4L51A 4Y2UA 1S5PA 4LKRA 1ZLXA 1K0UA 2XNSA 5JWRA 3IUNA 3G59A 4KE9A 3TZQA 1QV6A 4KIGA 2GETA 1WD7A 2B20A 2PSFA 2V4UA 2XMZA 3NTQA 5GGYA 4YV7A 1PJ2A 3O1LA 3P9PA 1RKQA 2C98A 3QMVA 4IFEA 2GA8A 2C97A 3PFHA 2ZAIA 2ZOSA 4LK3A 4NBRA 4O2BB 5K3SA 3W3ZB 3RABA 1CUWA 1VLVA 1TTPB 1E0JA 2OA0A 1X9IA 4MYDA 4HDCA 4I46A 2A0UA 3Q9NA 2HMTA 4MX8A 1N8NA 2YYYA 1V8BA 5A1JA 5EJ8A 1NOJA 1FRFS 3AJ9A 4R0VA 2PMBA 3I9V1 4LWPA 1OMOA 1VMIA 2VFAA 4NZOA 1WVIA 2FMFA 4X8LA 2NQTA 2GUGA 5AKIA 2Q29A 4RZ2A 1GTSA 4A6PA 3BE5A 4H7EA 3CH5A 4KQ2A 3H4IA 3TZCA 2XTMA 4X1YB 4WN3A 4WZAA 1R0LA 2NNWB 3HA2A 4UUQA 3U61B 3JD4A 4ML3A 4KFUA 4B7ZA 2DB3A 3QNUA 4S3MA 1ECCA 1OXMA 4B6JA 3ERCA 3MILA 4GNRA 2O0LA 4FD3A 2ZE5A 3IUMA 4Y98A 3NBXX 2WG1A 2R4UA 3C3YA 4GICA 5JS2A 2YRWA 4WFKA 1BN7A 2VPPA 2H1HA 5HTKA 4B2LA 4UHHA 2I6UA 3REGA 3STYA 5BRAA 2ZWPA 1KY5A 3P4XA 3PT9A 2C9MA 2V55B 3KEFA 4JV5B 2ID7A 1FMTA 4BN0A 4LHSA 2Q3DA 5BQPA 5KTNA 1MJFA 4TLDA 5J1TB 5D1HA 4PYLA 3T1HB 2IH5A 4MR8B 1ML3A 2VL7A 2AN9A 2WPNA 3IUQA 4FJ1A 5AKKA 2C2OA 1BMFA 2Q9BA 1YQGA 3R9KA 1KEZA 1E2GA 4EB8A 2GT1A 1LJ8A 1FFGA 4INZA 1SOAA 4K8RB 5BSEA 2QIPA 4Z99A 1E6KA 1XTKA 1OA1A 2QGZA 4MR8A 3SX4A 1G2OA 4WY8A 2R7KA 4KJXA 1N2CE 3QWBA 3C3MA 4P53A 1GNVA 3DL2A 4LXQA 3CPSA 1YTUA 3DBIA 4E46A 5EMNA 2MSDB 1OJLA 3TKLA 1KC3A 1QVAA 3W5VA 1V8OA 1K4MA 3ZY4A 5FNVB 2FSPA 3HDVA 1K8ZB 2CFOA 2VEOA 1TF5A 3PC6A 1AS2A 5SICE 1NYQA 2BKLA 2D7JA 1NXSA 2NTEA 3LNTA 4JH0A 3FZQA 5EWLA 3T7CA 3CMCO 3NYQA 4BP3A 2VHQA 1XD2B 1D4ZA 4EKYA 5KX5B 1LUAA 1L0BA 5LU9A 5FNVA 1Z34A 4KK3A 1UBEA 3LT1A 4DXHA 3DZKA 2W00A 3DKKA 2OSBA 1H66A 3PXAA 3WV5A 4HL6A 4EFLA 3RAEC 2QZJA 3V46A 5JAPA 2VH2A 2H0RA 4EW3A 5C1OA 4MVXA 2G82A 1XD2A 3VR6H 5KX5A 3DAPA 2QA5A 2R66A 4NCIA 1TDJA 3ICWA 4NL4H 4RAOA 5KSPA 4M76B 3VPHA 2VF8A 1T9AA 3QVGB 3S2SA 4BUCA 3WL4A 1CQXA 3ASUA 5MGBA 4JXXA 1FX0B 2AQHA 3OPYB 1I7QB 2Q0HA 1MAHA