1P91A

Crystal structure of rlma(i) enzyme: 23s rrna n1-g745 methyltransferase (northeast structural genomics consortium target er19)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
268
structure length
268
Chain Sequence
SFSCPLCHQPLSREKNSYICPQRHQFDMAKEGYVNLLPVQHKRSRDPGDSAEMMQARRAFLDAGHYQPLRDAIVAQLRERLDDKATAVLDIGCGEGYYTHAFADALPEITTFGLDVSKVAIKAAAKRYPQVTFCVASSHRLPFSDTSMDAIIRIYAPCKAEELARVVKPGGWVITATPGPRHLMELKGLIYNEVHLHAPHAEQLEGFTLQQSAELCYPMRLRGDEAVALLQMTPFAWRAKPEVWQTLAAKEVFDCQTDFNIHLWQRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal RNA large subunit methyltransferase A
publication title Crystal structure of RlmAI: implications for understanding the 23S rRNA G745/G748-methylation at the macrolide antibiotic-binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 64
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 2.1.1.187: 23S rRNA (guanine(745)-N(1))-methyltransferase.
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1p91A00
3DTNA 4ER0A 2ZIGA 2P35A 1NE2A 2ADMA 2YXDA 3I5UA 3HCDA 3KR2A 5CVEA 3TR6A 2AOVA 2EJTA 3LKDA 4RVDA 1JTFA 4PONA 1L1EA 5BP7A 3FZGA 3HVIA 3IEIA 5ICFA 4PINA 3A27A 5FQNA 4GC5A 5FA8A 1D2GA 1YB2A 1RI1A 3GNLA 5CVJA 5HZMA 3KQYA 3HA3A 5HIIA 5P8WA 2IGTA 3FPEA 3FUUA 4P7KA 4QPPA 1KR5A 4DZRA 2OXTA 3P8ZA 1Z3CA 2IP2A 2PX8A 4GF5A 5CVUA 5DSXA 2YX1A 3EVEA 5EPEA 1NW5A 5E1BA 1YFJA 3B3GA 3VC1A 4Y2HA 3RW9A 3K6RA 3UA3A 4HSGA 3I58A 3TQSA 1QAMA 4F84A 4CTJA 3EVBA 4R05A 4PGGA 2JJQA 2PV0A 1YZHA 1M6EX 3FTDA 4AZWA 4PYNA 3KU1A 2XVAA 4MTLA 4FT2A 2XYQA 1XVAA 3G7UA 1RI5A 5K09A 1JQEA 4QTUB 1AV6A 5ICCA 4GOLD 5G02A 5LQRA 4OQEA 1NKVA 1JTEA 2I9KA 5CUQA 3FUWA 2FK7A 3P9IA 2C7OA 5GM1A 3ELYA 3SSOA 2XYVA 5CM2Z 3K0BA 3M6WA 3UJCA 3BWMA 5CCXA 4P7JA 4DMGA 1G38A 3ELUA 3LCVB 4V0RA 4C04A 5C1IA 2ZULA 3LPMA 5E9QA 3EGIA 2FRXA 2P3QA 2FHPA 5DRTA 2Y1WA 2HTEA 3JWHA 4XUDA 5F2OA 5HILA 4LG1A 5DX8A 4GOOD 3EVAA 2O57A 3R0QA 5ICEA 3BGIA 1NT2A 3FUTA 1X19A 3LHDA 3UBTA 4KDRA 3CGGA 3ERCA 3LDGA 1QAQA 3M6XA 4EQZA 3FUVA 3HP7A 3HTXA 4HGZA 4WVLA 4PYJA 1YUBA 4PWYA 2QRVA 4X63A 5KVAA 1G60A 1KP9A 2CWWA 5EGSA 1MHTA 2G8NA 4PNEA 3ER9A 3M6UA 3L8DA 3DULA 4KW7A 4EMSA 3TPZA 4CXMA 2V7EA 1R6AA 3P9KA 2ZBRA 1VP9A 3GDHA 4FS8A 4IV0A 1I9GA 1NBIA 2C7QA 2NNWB 2ZTHA 4F85A 5LQKA 4FGZA 3NMUF 3SM3A 2I6GA 3LKZA 3P9NA 1X1AA 3HCEA 3TKAA 4RTNA 1VP3A 2AN4A 2ONYA 2PX2A 3EMBA 3RODA 1VE3A 5K8VA 2JG3A 2K4MA 3CCFA 3LCCA 4Y30A 2JH9A 1VQ1A 3DLCA 4QQKA 4E2YA 3DOUA 1QYRA 3KPYA 5KQRA 5GINE 3KPJA 4FSDA 5EMKA 2EG5A 5F2NA 5JUWA 1JG4A 3GJYA 3EVFA 4YV1A 3A7EA 1IM8A 4KDCA 4U7TB 5DXJA 2ZWAA 4M7RA 4HG2A 8MHTA 4RVFA 5HFJA 3C3YA 1XCJA 4LECA 4PCAA 4OA8A 2UYHA 5CVVA 5E8RA 3OU7A 5EEGA 2AVDA 5DTRA 2YR0A 2ESRA 3KQVA 1ZGAA 3LL7A 1O9HA 3PLAE 3QOXA 4OA5A 3LCUA 4IWNA 3FTEA 2OY0A 2PXXA 4FZVA 3ELDA 3THSA 1Y8CA 1O54A 3HCAA 3IHTA 1V39A 2P3OA 3B5IA 2VP3A 1SVUA 1ZGJA 3BWBA 3CBGA 3JWJA 4H0NA 4QPNA 2G72A 1EJ0A 3X0DA 1VBFA 3GWZA 5ICGA 3ER8A 4AZTA 2GA9A 3KPVA 3TMAA 4YV0A 1IY9A 1ZHFA 1I4WA 3TM4A 5EHIA 1T43A 5LSAA 4X41A 2WA2A 4MWZA 5EIWA 5IH3A 3UWPA 3O4FA 3P2EA 4KIGA 4PIPA 3MAGA 3T7RA 1JR4A 1QANA 2HNKA 1VL5A 1QAOA 2JH8A 1ORIA 3SMQA 2QY6A 1O9GA 1RI4A 3B7PA 2FK8A 4YMHA 2OO3A 3T0IA 4C05A 2ONZA 5FTWA 3QOWA 5T64A 3E7PA 4RVHA 5FWAA 2OKCA 1L3CA 3FYCA 3SSMA 4X1OA 3D2LA 1AQIA 3HM2A 4A6EA 2OZVA 1NV8A 3A4TA 3FPJA 4GC9A 3DXXA 4KVZA 3PX3A 2N47A 3OE5A 4ER7A 3CVOA 4PIMA 1AF7A 2NYUA 1N2XA 3GU3A 1XTPA 3WSTA 4OBXA 2EFJA 5K0CA 3AXTA 1JG3A 2VDWA 3LGAA 5EVJA 2XBMA 4E33A 4KRGA 3E8SA 1P1BA 4YUZA 5KQSA 3G8BA 3DH0A 2PY6A 2IDJA 4P58A 5D1NA 3TM5A 1DUSA 5EG5A 5DM2A 4GQBA 4XCXA 2AOUA 3BWYA 1YZ3A 2VDVE 5LQUA 1KPHA 3MB5A 3BXOA 2H11A 3FUXA 3KQSA 7MHTA 2O06A 3G2MA 2C7RA 5FA5A 3HVHA 2E5WA 2C7PA 1PJZA 1FJXA 4AUKA 2ZBQA 4LWOA 3GXOA 5CIYA 1SUSA 2OPBA 3GO4A 1KYZA 3CJRA 2PGXA 3TLJA 4CTKA 3LBYA 2P3LA 1INLA 3FPGA 3VYWA 5K0FA 4BP3A 3DXYA 4ISCA 5EMMA 4HH4A 3MTEA 5E9JA 2PT9A 5U4XA 3UFBA 3HVJA 3O7WA 4PYMA 3UJAA 5EHGA 2AR0A 3KR0A 3VC2A 3F4KA 1R8YA 3KQOA 2IH5A 2UYCA 4XUEA 2I7CA 2WA1A 5LQJA 2YQZA 1QZZA 3I9FA 3FTCA 1G55A 3P97A 3LDUA 4GEKA 3QV2A 2PWPA 1ZKDA 3U81A 1D2CA 3C3PA 2R6ZA 4PCLA 4RYLA 2GS9A 3EEYA 1I1NA 1XDZA 4GOMD 3BUSA 3HA7A 3OFKA 1X1DA 1WG8A 2DPMA 2FPOA 2XVMA 4HTFA 4L7VA 3B89A 4R6XA 5EQJB 4E2WA 5E1OA 3SSNA 4GBED 5K0JA 5CVDA 3KHKA 1G8AA 3TRKA 2YUIA 4AX8A 2Q41A 4PYOA 4CKBA 1X1BA 5C0OE 4ER3A 1AQJA 5E9WA 3PT9A 3TKYA 2WK1A 3PFGA 4PYKA 2Y1XA 3KR9A 2ZFUA 4C03A 4RTMA 3KQPA 3BKXA 2ZW9A 3LX6A 3UJBA 3B3JA 3BT7A 3PTAA 1NW3A 1D2HA 1KHHA 2P41A 4E32A 3EVCA 3M70A 3DMHA 2IH4A 2P7HA 2O05A 4QDKA 3PS9A 1MJFA 3FYDA 3ELWA 3OZTA 3AY0A 5FUBA 3GRYA 2UZ4A 5E8JA 1M6YA 3BGVA 1NBHA 2O0LA 3OPNA 1B42A 1G6Q1 2B3TA 2PBFA 1VIDA 3R6TA 1JG1A 3NJRA 4GOND 2R3SA 5E1DA 4FT4A 2HWKA 5LQCA 1NW8A 5GIPE 2QRVB 4R8RA 1U2ZA 1BC5A 1RJEA 2BR4A 4RX1A 2AOTB 2G70A 3NW9A 3A7DA 1EIZA 1JQDA 3KPWA 1N7JA 3P9CA 4BLUA 4EKIA 3NVKI 3HA5A 4G56A 5B1SA 2OB2A 3G88A 5HIMA 4RTRA 3H2BA 4OQDA 5DTQA 4E70A 2ZLBA 3REOA 1TW2A 3Q7EA 5GM2A 3A25A 3V8VA 4LWPA 2HV9A 5EKXA 3G5LA 3TFWA 3HCFA 1Q0SA 2YTZA 1NW6A 2OBFA 4EKGA 5LQNA 4FR0A 2PSSA 4ATNA 2OB1A 1RI3A 2AS0A 3R24A 4EVIA 1SKMA 1R74A 3EMDA 5LR6A 4HGYA 3OU2A 1R18A 4JXJA 2ZWVA 4FSXA 1TPYA 5T67A 1X1CA 3E05A 4RTOA 2Z6AA 3C0KA 2PXCA 1KPIA 4EK9A 4HC4A 2PLWA 3HNRA 5FHRA 3JWIA 5EC8A 5K05A 3ORHA 5DRYA 4YUWA 2AOXA 3LDFA 3OFJA 4O29A 1JQ3A 3FRIA 5CCBA 4R6WA 4RTSA 2Z6UA 3E23A 2AZTA 2P40A 1ZG3A 2PX4A 4U7PB 3M4XA 4OBWA 5DM1A 1P91A 4YUYA 5BW5A 2NP6A 2CMGA 2JHAA 1SUIA 5K0EA 3C6KA 4AZSA 5K01A 1YFLA 3UJ7A 1EJ6A 3EVGA 4V0QA 5EMLA 5EEHA 3I64A 2AOWA 3B3FA 3MTIA 4YV2A 2ZVJA 4F86A 5DTMA 5DX1A 2IBSA 4WXHA 1XXLA 5GP1A 5ERGB 3DLIA 3UJDA 3LECA 1N7IA 2ZBPA 2ZIEA 1L9KA 5DT2A 4DCMA 4YMGA 1XDSA 3PVCA 4DKJA 2DULA 3G89A 1IXKA 3HVKA 4C07A 5BXYA 4RV9A 5HIJA 5H02A 4RTPA 1FBNA 5CD1A 1G8SA 5HEKA 2LD4A 1FPQA 4QDJA 3VSEA 4DM3A 2BR3A 2NXEA 3G2QA 3GRZA 5EOVA 3DR5A 3RIEA 2ZZMA 5FCDA 3EVZA 2PVCA 5DX0A 2H00A 3SR4A 2PWYA 5K0GA 3FRHA 2I62A 5DWQA 3GRUA 4C4AA 1JSZA 5M5BA 3OCJA 1NV9A 5FHQA 3C6MA 3CC8A 4RSRA 4C08A 3UJ6A 4ZTBA 4BLVA 9MHTA 5DLYA 4KIFA 2GPYA 3S68A 2H1RA 4UOEA 3G5TA 3KR1A 4XUCA 3MQ2A 4RVGA 4QVKA 3MCTA 4QTTB 5IKMA 1OR8A 2AVNA 5K0NA 1F38A 4MHTA 2P1DA 10MHA 5D1HA 3KQTA 1M0EA 3M6VA 2Z6QA 2OYRA 1KIAA 3EGVA 1WXWA 4PYQA 5EZSA 5LQAA 1DCTA 3GCZA 2G1PA 3CJQA 2UYOA 2VS1A 3LBFA 5C9ZA 3G2OA 1WY7A 1YF3A 2AOUB 1SQGA 1UFKA 4K6MA 4PYIA 4C06A 2QE6A 3MGGA 4X61A 5EIFA 2NXCA 2UYQA 4P7GA 4RTJA 4HRAA 4NECA 1HNNA 4DCGA 5HOQA 3UJ8A 2ZIFA 2ORED 3ANXA 3P71T 5HIKA 2CMHA 4PYLA 5FQOA 3GRRA 3DMFA 2IIPA 1WZNA 3KQWA 4P7FA 1WXXA 2ZZNA 1PRYA 2F8LA 5FWDA 2YXLA 3V97A 2P8JA 3UA4A 1RJFA 3BKWA 1JSXA 4RTKA 5F2KA 3DP7A 3UJ9A 1L3BA 1FP2A 5FADA 5T6BA 2VDUE 3DXZA 5GIOE 3HEMA 3ME5A 1XJ5A 2B25A 3ID6C 3PX2A 3IYLW 3MERA 5DM4A 4BY9E 3TOSA 3DMGA 3G8AA 3A26A 4HTFB 3EVDA 3SVZA 3KQQA 1ORHA 4YUXA 2B2CA 3NWEA 4BLWA 2CL5A 4QVGA 2HMYB 5DPMA 2FYTA 3I53A 5BW4A 1VLMA 2V74B 4E31A 1XCLA 1P1CA 2EX4A 2G71A 2AOTA 3OU6A 4RTQA 2GB4A 2GLUA 4GUAA 4IV8A 2PXAA 1KXZA 1L3IA 5DSTA 4B17A 5JR3A 5K03A 1KPGA 3CJTA 1TW3A 3GGDA 3KQMA 3R3HA 2KW5A 4CKCA 3MHTA 1HMYA 2B9EA 5KS2A 4CKEA 4IKPA 4DA4A 2AN3A 3OZRA 3BWCA 3CKKA 2B78A 1BHJA 3Q87B 3OE4A 4QQNA 3DUWA 4FP9A 3UZUA 1R00A 2FCAA 2EJUA 1RJDA 4E2ZA 3NDJA 3FTFA 2AN5A 3P2KA 3KPUA 2IDKA 3AWIA 1EG2A 1UIRA 3NDIA 3NTVA 2PKWA 2QM3A 4M37A 2O07A 1BKYA 4R8SA 1H1DA 5E1MA 5DXAA 4Z2YA 5KYGA 1R8XA 1VPTA 4MIKA 5DM0A 3R9XB 2JHPA 3HCBA 3BZBA 1FP1D 3IV6A 3PB3A 2BR5A 2QYOA 2BZGA 3NVMB 2PX5A 2IPXA 3JWGA 2BM9A 2IH2A 1RJGA 3GRVA 2PT6A 3LSTA 5E2BA 4OX9Y 3FPHA 2P7IA 5EZQA 2IFTA 5E2AA 2BH2A 4CWAA 1EQAA 2ZSUA 2BM8A 5K0LA 2PJDA 4M38A 3SXJA 4ER5A 3GIWA 1P39A 2A14A 4RTLA 2ERCA 3O31A 5FULA 4DF3A 2ZCJA 3OZSA 3M33A 5EKUA 3AXSA 2JHCA 1Q0TA 2VZ9A 4ER6A 1RI2A 2GH1A 1DL5A 3KKZA 3PFHA 3AJDA 4AZVA 4POOA 4M36A 5MHTA 3HCCA 5GWXA 4RWZA 1WS6A 1SG9A 2CKDA 2YVLA 3T7SA 1F3LA 1ZQ9A 3FPFA 5GOZA 1NW7A 5EMJA 1KYWA 3BGDA 5K0BA 4MQ4A 1BOOA 4YUVA 3THRA 1UWVA 3EGEA 4E2XA 4A6DA 2GAFA 3G2PA 4PGHA 3SGLA 2IBTA 4E30A 2NXJA 4X60A 4DQ0A 2HR1A 3EPPA 4BP1A 2NP7A 2YXEA 3NWBA 3P2IA 3T7TA 3EEOA 1JG2A 2NXNA 1EAMA 3MCZA 1SQFA 3SX0A 1XDUA 2XYRA 4KWCA 2ZZKA
chains in the Genus database with same CATH superfamily
3QU7A 3L0YA 3VMFA 2J1LA 3KR2A 5BXQC 1YRQA 1MX9A 1QKJA 1NIJA 4C0HA 2BFCB 2C9BA 2EJTA 2YYZA 2CV1A 1TJ5A 2GFIA 1H69A 3G9UA 2HSGA 3CN7A 3IRUA 4EPWA 2ZYVX 3TD6A 4OI0A 2VBIA 4W9NC 3KOOA 3CWCA 3PEEA 1EJBA 1KR5A 2H2AA 1KAGA 3E3OA 5B2FA 3N8GA 1IEXA 6ABPA 2E4YA 2G0NA 3MJRA 4BO4A 4IZOA 4DSUA 3TOCA 3C6ZA 3S2EA 4A03A 3TF5A 2R1TA 2ZUDA 5I9LA 2Q99A 2AJBA 1W35A 3PPXA 3W2TA 1Z68A 4MHSA 2OFWA 3HB4X 4FUQA 4MV6A 1XVAA 5EVCA 3SHWA 3V6MA 1Z13A 2ODNA 3DFFA 3N6RA 1MEEA 1TVKB 2WJVA 4HDNB 4Y2UA 4IUYA 4EO9A 3KKKA 3CPSA 4OJKA 1LPBB 3R75A 2FMUA 3SSOA 2G6BA 2FPPA 3F0TA 1CUVA 4RK6A 3UIEA 2F3QA 4GZMA 5HPYB 4N3AA 1YO6A 1EMDA 2WAYA 3N2KB 5I9IA 2VTEA 1UKZA 1ODTC 2IIBA 2OHXA 2QV7A 4FFLA 2WUFA 2VK4A 3O1LA 4U2FA 3KZCA 5KTNA 5TY0A 3JQQA 1ZN8A 1ODCA 2EP8A 3N3BC 3SEZA 3PR3A 3N2EA 4QFMA 1D2RA 1RSZA 3CCBA 4L76A 3NWOA 2PZBA 1Z5NA 5CFOA 5K8LA 1X19A 2F8SA 3ECSA 2D0OB 3OWXA 1W85B 4BNLA 1XOIA 4JJIA 4NS4A 4D0NA 3EVNA 4XLTA 3G13A 5HE9A 5K8UA 4EBBA 1AHHA 4TV9B 2GBLA 4KTTE 3PGKA 4H7JA 3VV2A 3A3KA 3IUPA 2HZ7A 3RVMA 2WM8A 4IDPA 4NJMA 4HLUA 2IF2A 4R1QA 4US0R 2EWWA 5KYWB 3I2FA 2JGFA 1ZH8A 2Q3MA 3B8HA 5GMOA 2ZUTA 4FFWA 1K97A 3A32A 3Q85A 2VFAA 2BFEA 5EHQA 1LJ8A 2CNLA 1R6AA 4HMOA 2RBEA 3O90A 2IY8A 3OX2A 1YB1A 1ZVMA 2NNWB 2D7CA 3NMUF 3IEPA 1XTBA 2JEZA 1LNSA 3P9NA 4XLLA 5BOSB 3E9EA 3K15A 4B2YA 3DNMA 4DC1A 3AM1A 1JI3A 3RV4A 2XF2A 4ESOA 1TVMA 3VC3A 1L0BA 2ZI7A 4LV8B 4AECA 1WOYA 2GXSA 4BKRA 3GT7A 4AP9A 1T3ZA 3DLCA 5AK6A 4HKTA 2XCSB 4JV5B 4Z3KA 1M10A 4KYIB 2QXTA 1TZKA 3GHHA 4Q03A 4MWSA 1M2VA 3GOHA 4H18A 5KTYA 2W4MA 2V54A 3HBJA 1BDJA 4BB9A 1DWQA 1QGUB 2VKTA 5C3MA 2RCNA 1F2TA 4EP1A 3BTSA 3NETA 4BBAA 3OIFA 4BO7A 2GDJA 5CVVA 2GM4A 2QSYA 4PQYA 5DTRA 4BLOA 2ENUA 3QYJA 2WHXA 1UFRA 4FKZA 4YJ3A 3MMNA 1T8YA 3L07A 4CETA 5MN6A 3QLVC 4FZVA 5A6SB 1EEXB 2VH1A 4KPYA 1KFKB 2LR0A 4ND1A 2A3NA 3H42B 4HN4B 1V3VA 4NYIR 4Y7DA 1PNVA 2PFKA 4OEHA 4RE5A 3BJIC 1EJ0A 1T9HA 3TZCA 4ZPJA 1K8ZB 2N42A 1TFRA 1WCIB 1C4XA 1SVSA 2PFSA 1XZHA 2QN9A 1DB3A 3ANLA 2WWVD 5MDHA 1DRJA 1G2OA 1TLFA 3L9XA 1DEOA 5EHIA 2BM0A 2XMBA 4Y6LA 1V37A 4UJ3A 4RD2A 3H65A 1DKNA 1PHRA 2ZAOA 4X20A 4S24A 4M1SA 3V48A 3L2OB 1QX4A 3T7RA 5A1JA 1JR4A 3NEYA 2NZJA 3WGKA 3NORA 4CV3A 2GQ0A 3AEXA 1RTKA 4H6PA 1EWVA 1MDFA 4KR0A 3GUHA 3KT6A 5CX1A 3TK1A 4YMHA 4XPZA 1CDEA 1VMEA 2BHRA 4JWKA 3HYTA 2GJ8A 4DUYB 1NLMA 4X1KB 2H7XA 1UM8A 4HQLA 4FC6A 1H6BA 3OZCA 4QOJA 3IO3A 4WMLA 4CLRA 5C51B 3H5OA 4PBRA 5FOVA 5HX7A 3VJRA 2N47A 1SXJD 4I6EA 5FR1A 1ONBA 2Z8YM 2VF2A 4HJRA 2F1JA 4ZTZB 3DTTA 1WULS 1ILEA 4IUDS 4CU2A 2DFTA 1ABBA 2NZWA 3PUVA 3V8NA 1HC7A 1BYUA 1MT0A 3EDOA 4H1HA 3P2MA 3QUBA 3EXEA 3FNQA 2IYEA 1V5WA 4I4LA 5JXIA 1DAOA 2IELA 4ZTUB 4AF7A 2YHAA 3MAJA 4NK5A 3FDJA 3JAKA 4G81A 3LQYA 3IULA 1K4KA 2WMDA 3Q98A 2Y6VA 4JBYA 5DM2A 1C0EA 4B48A 3BWYA 3K9GA 3AIOA 5JCZA 2PH3A 5LQUA 3F2VA 1VL1A 3LRXA 1U7OA 4QPZA 4KI7A 4G0UA 3VFDA 4X44A 1PZXA 3GLQA 3ADOA 4AUKA 2CL6X 4QBGB 4TMFA 3QNUA 7ABPA 4MS1B 3SPXA 3NGLA 4JJ7A 3TLJA 4CTKA 3L0PA 4WKCA 1UBFA 3WLKX 2QX4A 1ST3A 5B1HA 1IVYA 3SKXA 5K0FA 2P2ZA 3O1IC 2PKQO 1VHQA 3NYQA 3P0RA 3M4ZA 3ORSA 1NNEA 2PT9A 4R7ZA 4MYSA 3IPLA 4Q4AB 3FAZA 4D4LA 5E4FA 1RLTA 2PYZA 1GPNA 2IGBA 1U3FA 2XIQA 3AZPA 3EW9A 3IQWA 3MW8A 4KLNA 3E35A 1XLTC 1Z5OA 2WSSD 4MKFA 1HTWA 4UTOA 4BTEA 2YV4A 3ETJA 4YXWA 3DONA 3OMXA 4OMFG 1YRBA 4QU0A 3CVXA 2VZEA 4HQKA 2UXBB 1HZZC 2ON6A 3HA7A 1QMGA 4O5AA 4OQYA 4R6XA 2HMAA 4B3HA 4GZ3A 4XIJA 1NXTA 2MIIA 2JFYA 3UVEA 1Y5IA 5J2UA 4L4UA 4ZRDA 2QI9F 3AWDA 5KB3A 2C58A 1E2PA 1PDVA 3AJEA 4IXMA 2OXIA 3QITA 4X93A 1T3LA 3A05A 3KTAA 4AO7A 5JSZA 4IAOA 4TS3A 2H1LA 4NFSA 2W2KB 4DDMA 4JJ6A 4U7GA 1GU1A 3OZGA 3RGWS 3T1QA 4DEXA 2VJOA 3T4PA 1D2HA 4E32A 4IIGA 3CLTD 1Y3AA 5TE9A 1OB5A 2QTLA 2PA3A 4P54A 1G3QA 4JDUA 4B3BA 3F6PA 4BFCA 2O48X 4OVKA 3QSYA 1E99A 1ISIA 1JB9A 4M88A 5BV7A 1VCMA 2V8BA 2ZIUB 1E2FA 2VL7A 4DBVO 1RBZA 2WHRA 4OQ4A 3S2ZA 5KOHB 4GL2A 2Q2QA 4I9FA 3DC2A 2JLYA 2JANA 4QBIA 3I5YA 1E1CA 4DANA 2Y67A 3P4XA 5JDCA 4ZGWA 1EIZA 4S1WA 3FZYA 1QO7A 4FU0A 3W9UA 5FEUA 3CZ5A 4BP8A 3E9CA 2VBCA 1E9CA 1H9BA 3WS7A 3U7EB 1DT3A 1V1MB 3CSSA 4H59A 5F1PA 1GTVA 5DYNA 2I7TA 4RA6B 4H1TA 5HA5A 4MDFA 4B2PA 4B6SA 5ARBA 2DECA 4Q37A 3HLYA 4TKVB 5CHEA 4IQ4A 5AKZA 3LQ1A 3R24A 4EVIA 3QUSA 2HBRA 2MR6A 1R74A 1BMFD 4PG6A 3T12A 3UT5A 2R0QC 2PUJA 4IDEA 1NUSA 2ZKIA 3EQ7A 4Q1FA 1GAWA 1PDWA 4JXJA 4KZPA 1JIIA 2PRSA 4U0JA 5CT8A 5D7BA 1CZOA 2CVZA 2XZTA 1ESZA 1ZU5A 4P38A 4TQ9A 2EJWA 5CFQA 1PSDA 1QFSA 3H83A 1WL8A 2XR1A 3HKEA 4BFUA 3H2GA 3B7WA 3C7TA 1PLJA 3BOSA 5LD2B 3U48A 3D3KA 3VM6A 2D7JA 4AKTA 3DEHA 1GPH1 1WDKA 3NP9A 4L74A 4TXHA 3E1KA 3EGWA 3TRHA 2H9YA 4C4ZA 4HUTA 1WDTA 4J75A 1U6IA 2PKXA 3BDAA 3QIAA 4RTSA 1K4MA 1W5EA 1LJLA 1NNSA 2VH2A 4IGIA 2OBBA 4AG6A 2LV8A 4YONB 2J67A 4LXXA 1XRJA 4M1OA 1CB0A 1M1ZA 3B3QA 4G9EA 4XSVA 1F1BA 3GRCA 1DTSA 2OFFA 4LA4A 2DJIA 3ENKA 1BXKA 3EOZA 1XXLA 4A8HA 4GU5A 5F52A 2O0HA 3LX5A 1AA6A 3NWPA 2B0CA 1ZRNA 1L9KA 2VPPA 2ZB2A 4BNTA 1P1HA 2O8FB 2UDPA 1QFZA 2W6CX 1N2OA 1W88A 3DO6A 3WQRA 5HUJA 1DTWB 2VA8A 1B6SA 2P3SA 3GEBA 5CD1A 2LD4A 5FFMA 3VVLA 3W6PA 1W2GA 1PWHA 1E7SA 3G2QA 1R6VA 1UWCA 3EMVA 1OJLA 1WVMA 1E2GA 2C97A 2RI0A 1OLUB 2ZUWA 1E8DA 3E8MA 2PWYA 3N0TA 3HUDA 3QV1A 5B3JC 1WSDA 3RS0A 3JAWB 4FQ7A 4W8GA 1VE9A 4NTZA 2A35A 1EFPB 4FCTA 2WAXA 4QGHA 5IM4A 1Z33A 2PUVA 3DTYA 3TD2A 4BLVA 2AIRA 3H6HA 3SHQA 2AKYA 3S1LA 4X66B 4LGVA 1P7ZA 1WHSA 2A5FA 4YGXB 5GY7A 4EPTA 5A06A 1Q6ZA 1SQSA 3B13B 4UFOA 4AMVA 2CUKA 5EJ4A 1GGJA 5CB8A 1MX1A 1MORA 1NU8A 2FXVA 2VDWB 2GK6A 4ACBA 4M86A 5J2TB 4RPKA 1XZNA 4BC1A 3CR7A 2X5KO 1OXTA 4OP1A 4ZI3A 1ZIXA 1F8GA 2HU8A 4JUBA 3AVVA 4IILA 1R4MB 1CVLA 4FOTA 1I6WA 1FMCA 2PMCA 5AJYA 3AL0C 1JDNA 2R25B 3H8WA 3DWEX 2KWIA 4YMUA 1C30B 2QE6A 1OLSB 4P7GA 4O4IA 3K0CA 3L1UA 4E4RA 1K66A 4EJMA 4LJYA 4E13A 4F3YA 4DCGA 1TRHA 3UJ8A 2ORED 2W83A 3F9IA 3D6UA 2CMHA 6NULA 1Y5NA 2GEFA 1B43A 4O2BB 4UMVA 2WICA 4A26A 1ZNYA 4NEQA 5DWVA 4YLYA 4DJFC 4G26A 1G7SA 1WZNA 3H5TA 1IPFA 3DKPA 3GFPA 3TFQA 4B4DA 5JC8A 4RL6A 2WEKA 3R3UA 3G0IA 4V02A 4KAJA 1LK0A 1U8ZA 4W6QA 2PT5A 1IAQA 4UUPA 4JJZA 3CO5A 4HS4A 4X7MA 4F4HA 2Y0BA 4RIFA 2O0MA 2ZRNA 3QMVA 2QORA 4I66A 3LBIA 4OI4A 3LBHA 4FC7A 1N3BA 2JFBA 1DAGA 2QLTA 3L5KA 4I1IA 4WESA 4NOKA 5G1PA 4CQLB 2FSPA 4N3GA 5JS6A 3EPJA 2E6KA 1WV1A 1TM3E 1COZA 3EULA 4UTPA 4R41A 4MXDA 1H4TA 4DJEC 1QHIA 1J1UA 3UKDA 4FI3F 1ID1A 3A1NA 1XL0A 3I42A 3OZEA 4GUAA 4MEJA 2GLTA 3ZD6A 5KYXA 2XZDA 4B34A 2IOFK 4M8NE 5FNVA 3UUGA 3VAZA 5CH5A 2VAXA 4C78A 2J6BA 4CKCA 2BBTA 3VKGA 3AR6A 2VSNA 2ADOA 2O8DB 3KTDA 1SIWA 3HY4A 2AH5A 3QFFA 4FKBA 2P6UA 2GILA 3N9IA 3WZLA 5C1PA 1LDGA 4G0YA 4EG8A 2BGTA 1NN1A 2FGKA 1OFGA 4R83A 4GI2A 4UUAA 3RJ5A 4DQDA 4UTRA 5I7HA 2GJKA 4C3VA 5B4TA 4MCJA 3TCKA 2GI4A 4EFNA 1CG6A 4ND8A 4HDRA 3AVYA 5DGXA 2CUZA 1KK0A 2GA8A 3JYPA 4LV5B 2H3EA 3OZ7A 3UV3A 4CR8A 1QZUA 4S0XA 1N2JA 2FCRA 1SVKA 3CZ4A 4MRMA 3GH1A 4W9RA 4MA5A 1R8XA 3L0CA 2ADFA 2D1FA 1USKA 4C3UA 5FR2A 3ES9A 4LF7B 4DMRA 1Z7WA 3B60A 3V1YA 3LDHA 1W0KA 3WK8A 5J59A 1T2EA 5A3JA 3HDGA 4YCJA 1PQWA 3AILA 2NQ2C 2JDID 2YV5A 2AEEA 2BH2A 4UAVA 5G53C 4CWAA 3RK4A 3R3VA 4FEAA 3MUNA 3VZRA 3LF2A 4DUGD 4BBPA 3SJBA 4HXYA 1VE1A 1E79A 4IMJB 4DADA 1AA9A 4L50A 2Q5IA 4PZAA 4HB3A 3MTAA 5F5NA 2X6RA 4YA6A 1IXYA 3AXSA 1DV2A 2VZ9A 1GCIA 1WVIA 3M83A 2WF8A 2TMYA 3BICA 3H2ZA 2IE8A 3RJTA 4RWZA 1GTSA 4H7IA 3LXXA 3CHYA 4W5JA 1R6XA 4DFDA 4NX2A 4MAMA 1SHUX 1UM9B 2NPFA 1JE0A 2GHQA 1JFVA 1NFQA 2RDMA 3KLBA 1W1WA 5CMLA 3T5CA 3U7RA 4CIAA 2V8OA 1LY1A 5BSGA 4IEEA 1U5BB 1IHDA 1XFAA 1V5FA 1OTYA 2X40A 1AIPA 1M5TA 1TRKA 1UANA 3HN7A 3NT2A 3R5SA 2FSVC 4ENQA 3MCZA 1OC2A 5KNDA 5F1YA 5KTSA 4AT1A 5CA1F 4DIKA 2AHRA 5AVUA 4LRQA 2CNDA 1ENYA 2GN2A 1Z82A 2YOHA 3NDPA 1BX0A 4JOSA 4RVDA 2WQ6A 4ZVNA 3G5UA 4HPJB 2GBIA 4U6QA 5YASA 5ICFA 5BP7A 5CD9A 3I52A 3TLGA 1PNRA 1TKCA 3SKYA 1YB2A 4HJXA 1Q74A 1E3WA 1GUBA 2R7MA 4KDEA 4YAIA 1AG9A 4XCQA 4HEQA 1YC5A 3DD5A 3PFBA 1D04A 2CDRA 2IHBA 1KJQA 3FUUA 4KX5A 2NYRA 4RJLA 4Y9RA 1YVEI 4EYGA 4EY7A 1GQQA 4GF5A 1ZD1A 2IP2A 3VVCA 3WMWA 2HSEA 4K7JA 1ZVKA 5JFOA 1ISGA 4PX5A 5LQSA 1YFJA 3RW9A 5I7AA 1MJHA 1ZGZA 2QMUA 2C3UA 3RU9A 3DL0A 3T0FA 4DM7A 2IZ0A 5KSWB 1O9BA 1PNTA 4XWOA 2Q4BA 1XYGA 4G5FA 3OKPA 4GECA 2Z0MA 4NDAA 4PYNA 3VVMA 1CR4A 3WG9A 5KJEA 4ZT7A 1DRWA 1DOAA 1PNQA 3G7UA 1RI5A 1XXHA 1JQEA 1UPAA 2RBGA 1SKQA 3HWRA 4R1TA 3ZWOA 5CPFA 2VN8A 1GKKA 3OUZA 1W4LA 2FK7A 2GEKA 2NOAA 3R74A 5FO0A 2CJWA 1JFSA 4CIBA 3QG1A 1A9TA 4ZVPA 5IAGA 2O50A 2DHEA 4KACA 1ADGA 3QG5A 3ENVA 3LLSA 4IDOA 2E48A 4PX3A 3L7JA 3IUJA 4YAJA 1MJGM 3DWFA 3JD0A 5DE3A 5CAEA 5H9WA 4PBSA 2ZJ3A 1Z37A 3ZE8A 2O57A 2YHIB 4XD7D 3WLMA 3GEIA 5ICEA 3D9QX 2OM2A 3LX8A 4GD3Q 4IKOA 4R2LA 2KLBA 2JPDA 2OXCA 3CZ9A 4DLXA 1C4KA 4EMBA 5K8IA 2I7VA 4ZCRA 4FTWA 2D74A 3BJMA 4DWVA 4EQZA 5IWCA 2ZQZA 2I6FA 2AK3A 1F8XA 4LZNA 3O8RA 4HGZA 4R1SA 2XUAA 1KAHA 4UARA 4WXMA 1SUWA 4X63A 3FXAA 1XP5A 3KAKA 1E2DA 3DMDA 5DW3A 3TG8A 4FHDA 5D6OA 3FNEA 2YC4C 3C5VA 3MJVA 3OCCA 1LZLA 3WLRA 4KR6A 2DHDA 4LSZA 5AO9A 1OSNA 3UQYS 1R4NA 4PNZA 5PNTA 1ACJA 5JAQA 1PLKA 3ZH9B 3HNPA 4FS8A 1P2GA 3GDHA 3TI7A 6PFKA 1FDVA 3D3QA 4WFQA 2YWDA 5E95A 3HCEA 4WFKA 3IP7A 4TKUB 1OFUA 3T34A 3SF8A 1GU0A 5KX5B 4ZAVA 1CY0A 2ALJA 3JQ7A 4M8IA 4TT3A 3INYA 1VQ1A 3E7XA 1DJMA 1W4CA 1GFIA 5GV7A 4IJVA 5GINE 5AKJA 1E9RA 4HO1X 2AFVA 2Y93A 5CFMA 1L7AA 1S2NA 2G88A 4QU8A 3TLCA 2ZWAA 2WYVA 5WRFA 3SR0A 4EKNB 3GUZA 4RVFA 1JGTA 4H3VA 3KRTA 1VPLA 2GTPA 1V25A 2QJFA 2LTAA 2Y99A 1EH5A 2Z5LA 3PNSA 3QVGA 4MQ6A 3LVBA 3U80A 4L3VA 5ER6A 4A5OA 4IHJB 1T4GA 3IUSA 1PZGA 3VNRA 2VQ3A 3CLSD 5CT9A 3LUKA 5J4YA 3S6JA 3U1TA 3BIXA 1Q14A 5B6IA 1IZ0A 4EW1A 1LNQA 1GN8A 3QX3A 2R8BA 1XDBA 3D0QA 3DTVD 2J32A 4CKYA 3B5IA 4TQAA 1XMXA 1V16A 1QYWA 4IX1A 3H7AA 1IRIA 1HT1E 2XW6A 3IGFA 2B4RO 1Q84A 4MGIR 4MQFB 4NNJA 1X8LA 3AF2A 2WA2A 3L9WA 5AI5A 2H1HA 1YH3A 4X8MA 4OHYA 4WVFA 3RD5A 5B55A 5J1TB 1ORIA 2Q50A 4RQTA 4N5MA 4V0LA 5D84A 5BR7A 4CKWA 1YE3A 4GX1A 3UM9A 2Q29A 2JVJA 1U1GA 1T5TA 2WMNB 1D4AA 3BTUA 2YYYA 4B83A 4MRRA 4FKMA 3ETLA 4EX7A 3HM2A 4AF8A 1Z6QA 2G07A 3FPJA 4PZ0A 4ZOLF 1LU9A 2QRGA 5CLFA 2YIDA 1NN0A 3D6AA 4CLOA 1Z8FA 4RMGA 3OE7D 1AF7A 2NYUA 5AW0A 3R7DA 2VQEB 1E6CA 1QVZA 2WFLB 4RKFA 4RORA 3VUFA 1ESDA 1Y8AA 4F12A 2VNIA 4PC3A 3T7EA 2P1ZA 4M9RA 2NTVA 2QRKA 4ZZ0A 5KQSA 3B9BA 3QYPA 4Q66C 4KXNA 1OZHA 1HEIA 1ZSVA 1OGYA 2IDJA 2M6KA 3ONNA 4X85A 1OFIA 5HCUA 3E2IA 4PRZA 1IWPB 2P77A 4YRRA 1EX9A 3W6UA 3HSKA 3JQBA 3N2NA 2X1MA 4RHFA 4W5WA 5HW0A 1NVEA 3I9LA 3OLVA 1V2HE 3QWFA 4ARCA 1JAXA 2PWZA 3BERA 3QVJA 1E6EA 1XAIA 2FQYA 4LWOA 1K75A 2NWQA 4XSHA 3RF6A 5FWXA 3I2GA 1KYZA 1PJSA 1ZK0A 3BE4A 4HFMA 4E5VA 1Y48E 1JQBA 1ZP6A 1K89A 2I2AA 1TJYA 2W6QA 3VNSA 2GK4A 1GAXA 4LVNA 1R5OA 2WUWE 3ZWXA 4RH1A 4KQMA 4PLWA 3AF3A 3C3AA 3UJAA 2VDRB 2BTQB 3EXHA 4BCCA 4FPXA 2B69A 1LBQA 1U0TA 4QYIA 6Q21A 2QRNA 3ODGA 1X94A 1AX9A 4IIDA 4E5MA 2YQZA 3G7NA 4MMZB 2R44A 4B33A 4L4RA 3U3XA 1LPAB 3JAMA 4P1ZA 1FX1A 5AK5A 1UODA 3LLMA 1C8KA 3NOVA 4YP0A 5K8CA 2W2LA 1YHNA 3BUSA 2QYTA 2XVMA 1G8PA 3H16A 3FPBA 1PR9A 2IYWA 3NB0A 3IE2A 3NO4A 4BVEA 3OPYA 4Z7QB 4TZKA 3V7NA 3OEHD 5BQ5A 3RSOA 5F51A 5F9MA 1A8UA 4F6LA 1GZDA 4ITVA 1S96A 2BLLA 3QHAA 1XJ0A 2LP4Y 2Q21A 5LB2A 5H70A 3ZJ5A 4KK4A 1T3HA 2Q2OA 2QTRA 4MQBA 2HADA 3BT7A 5DTIA 2C7BA 5FH9A 3QMWA 3RSFA 3QX8A 5L7TA 5LU9A 5JNLA 1YD7A 3O2QB 4L1KA 1SIBE 2JJ1D 3GJSA 1NBME 4OXQA 4X95A 3K0SA 3TJMA 5L7WA 2Q6OA 4P0QB 1KJZA 4YR9A 5CNJA 1WTCA 2QAGC 1UZLA 2BFMA 3KTOA 1F17A 2CJXA 3HEBA 3ZJTA 2Z5GA 3L49A 1D7OA 1H6CA 2PZFA 3R6TA 1NNI1 2ZT7A 1C81A 4GOND 4M46A 4OB8A 3F5DA 5EKSA 5EXTA 2HQBA 2AOTB 3RYHA 2G70A 4AUMA 1TJ3A 2GAOA 1L6RA 3A7DA 3BH7A 1IN8A 3IDSA 3L0OA 4A2PA 8LDHA 5HF6A 4ITRC 3AIIA 4YJFA 4M1ZA 1XU9A 5TVGA 1JJBA 1SFRA 1A5TA 4QIHA 2J41A 2V55B 1C7ZA 1G5TA 1P1KA 2OPHA 3A25A 5DBEX 2G0TA 3HBFA 3C3WA 4MDHA 5FBKA 3LC7O 4R9RA 1VXOA 1E7YA 1CVRA 1X87A 4FR0A 1PI3A 2ZWMA 3G2LA 4TQUS 2AS0A 4ZC8A 3GEPA 3BMOA 3O8QA 2JAXA 2Q1SA 4KQWA 3HU5A 2C5GA 3RHTA 4Y2XA 2WG2A 5IK2A 4FSXA 4CF5A 4ZYUA 5KVCA 1M0WA 4UNQA 3O3MB 5ABPA 1CUJA 3NM5A 1NG1A 4O1HA 5A5VA 4PR0A 3ZCVA 3INRA 1BAPA 3D4BA 3FIJA 2DQSA 4F9FA 3S27A 3EODA 3B52X 1OT5A 1HDIA 1Y5MA 4EW2A 1YDMA 3IS3A 1QH8A 4YRJA 1DV1A 2B4YA 4FR2A 2GJSA 2HT6A 3C8UA 2AZTA 1LWNA 5IJ0A 4XQEA 3F5QA 2PS0A 1V7CA 4TLEA 4U7PB 3ZZMA 4COKA 1RZRD 3UCXA 2D1SA 1KQ3A 1MJNA 2RG7A 4KWTA 1EJ6A 1L2TA 2Z43A 5ESRA 4BFYA 1KJWA 3U60B 2EZ4A 1JZTA 1H1TA 2NTJA 2NO1A 3ITKA 1E2MA 3MQ4A 4AK9A 3IELA 4YDRA 1RYNA 1BXRA 2PSFA 4ZOAA 5HKLA 4Z3DA 3TZHA 1Q1QA 2R6GA 1SU4A 1HSZA 1IM5A 3PIRA 4JQSA 2WYOA 4IIVA 3JZDA 4LXGA 1IBMB 2HW8A 3F8TA 3WY9A 2XIJA 2ACVA 2V4UA 3LVRE 4QO7A 2ECPA 2CNOA 4WZAE 1GQSA 5T4EA 5J47A 2ZZMA 1M6VA 2FLVA 2WWXA 2ZRBA 5FCDA 4R81A 4Z9YA 3ECAA 2ZJYA 2RAFA 4EGSA 2H4ZA 3M1YA 2FE1A 4NG5A 1IWBB 3VNAA 1M73E 3OCJA 4B8ZA 2HEIA 4PLTA 2PJZA 2VNSA 3C3EA 2E1RA 5TRTA 1FU7A 1V3TA 1U7ZA 4ARVA 3KT0A 2GPYA 2NGRA 4E21A 3U9SA 3BHMA 3MYYA 3WC4A 4AJPA 4MWEA 2H1RA 4QTXA 1ZJJA 2GBLC 4EAAA 4POAA 1OVGA 3G5TA 5TGZA 2I1LA 3VU9B 4QVKA 3JQAD 1C0PA 2COKA 4MULA 4DCPA 3MCTA 4YREA 3G68A 4EHJA 4A91A 1PT8A 1KMCA 1P72A 2AVNA 2WVGA 5TJHA 3ZNNA 1QB8A 2PK3A 4HLUC 5AMXA 1RQ7A 2AN9A 3QHQA 3BFJA 2G1PA 1U7HA 3B1VA 3LC2O 1BGVA 4MYTA 4NH4A 2IOHA 4I8XA 4BIIA 5IT5A 5KYUB 5JAPA 1AZLA 4JXKA 1T4CA 4O2AA 4GLLA 3WLIA 1SCKA 1M0TA 2H5LA 2QVLA 3LA8A 4Q3BA 3NYWA 1P7YA 4YBZA 4LVUA 4NZ9A 1FJGB 5DMXA 3I0MA 4FJ0A 4M9SA 1IG0A 4LYAA 2X77A 2OL4A 4NESA 1V8DA 4OGWA 5E6RA 1AC5A 4MVJD 2FMTA 2M9MA 3FW1A 4OYRA 1VMIA 4B0PA 4CR7A 5JMTA 2ZSFA 3K0FA 3GRRA 1U7XA 3FWNA 2EAUA 2ZOSA 3Q8MA 3GMDA 4HY3A 2ZZNA 2BFFB 3GZNB 3Q6MA 1RXCA 2GCIA 3A6JA 2LDBA 3UA4A 1RJFA 2UUBB 4OK3A 4RTKA 2VBFA 3QI2A 2R8YA 2ID4A 3TW8A 1RJWA 1P81A 1YUNA 4PHHA 1JR3A 1FYXA 1T0PA 3ME5A 3GN2A 4XLZA 4LY0A 4LOLA 2CFOA 3RYTC 2R6HA 5HHTA 3IDOA 2HD4A 3DMGA 2BSQA 3RTEA 4TQGA 3LCJA 4WZZA 4ENUA 3VX4A 5BSVA 1E3IA 5IC6A 4HPXB 1QBKC 3ONVA 4RPGA 1DQYA 1AS3A 3I9V1 4QRIA 2IV2X 3O82A 3DEZA 3JATB 1BEUB 1QP4A 1FDWA 2I91A 2VDOB 3UAOA 2GKOA 3ORRA 3P9QA 3L7IA 4MV9A 4P0PB 3USCS 3RVRA 3VPDA 4TPKA 2WKSA 1UBLS 1QDEA 2CFCA 2MYPA 1X7HA 3BEDA 3O94A 1F2UA 2O6HA 3OE4A 4Q0MA 4ZYVA 5C52B 4B73A 2H16A 4QSMA 4TXMA 4DVJA 1QRUA 4URVR 2B82A 3RWOA 3ZZNA 5JRZA 1IUPA 2AQKA 3FVQA 1RJDA 3MT7A 2YV2A 3GC6A 1A5ZA 4DIDA 4ILKA 5TNXA 4AJ4A 1KFBB 4V0MA 4UNRA 1FNSA 1CUXA 3WJ1A 5AUOB 1FQWA 1AZSC 2QM3A 3KZ1E 4NJEA 4BJ3A 2QRMA 3AHEA 4C21A 3AW8A 2NAFA 2BMDA 2OHIA 1XRPA 2R9VA 1ZOLA 2ODQA 2AMYA 3L05A 4O59O 3OPXA 4ID3A 2N3ZA 3GRVA 1SXPA 3KJQA 2PT6A 1IBSA 2PQ0A 2Y0CA 3EBOA 4B6QA 3WMXA 4E7OA 4JOCA 4ZO4A 5B1EA 4JOQA 5HWSA 1ONNA 2W0SA 5HDBB 3OJ0A 5CB0A 3KUUA 4V0OA 2FF5A 2R66A 1Q95A 1FDSA 4BAZA 4XRGA 3KVYA 3W4KA 3A1FA 1F5NA 2FJUA 1WHTA 3HGTA 2KB0A 3AHIA 1DL5A 3RYIA 3FHCB 4OKNA 4A15A 1BMDA 4HAUA 3EIHA 1XAJA 2MMCA 3GF4A 3ZI0A 4ABTA 2W71A 1KAOA 1DP4A 2DG2A 4ON9A 1LLUA 1HNZB 1EK6A 3IMFA 4TYMA 3ZWAA 3O3CA 1L7PA 2XSZD 2G82A 1D0VA 1XZQA 2ZS8A 1SH7A 3EGEA 3NONA 4NBLA 3SEQA 4E2XA 3U4QB 2GWRA 1CIPA 2H6EA 3PP8A 1ZY2A 1RWXA 1I8TA 4UCQA 1H1LB 3SLRA 4ALIA 5JSUA 3GVHA 2VYNA 4S1PA 1JU3A 1GCGA 1WRBA 2XYRA 1BHQ1 4OHKA 1FVXA 4PAGA 2WB4A 1NE2A 4NMHA 3LPLA 2JD0A 2R84A 1QBGA 1JTVA 4LQ4A 3JALB 3S5UA 5KVVA 3BXGA 1E4VA 2VEOA 3DHEA 4OK6A 3LIPA 4B81A 3NBMA 2YH2A 4EZIA 5FQNA 3AL2A 4GC5A 3ZX5A 3FPLA 1VLHA 2WHYA 4DARA 3CKYA 1SA0B 3A1UA 3KOXA 3RT9A 1N5OX 1BOFA 3FJOA 4G0PA 5ALRA 3P32A 5HIIA 1FMJA 1QGZA 4HDMB 1LTQA 2X0FA 5CPBA 4CGYA 3HDHA 1DAMA 2QIOA 3D81A 4BQOA 4ZI2A 1JWAB 3EGCA 1ML3A 3IR5A 3JS5A 4NLLA 2FQWA 5DNDA 3TNLA 4EHBA 4OLAA 3A58B 2QX9A 4UVHA 3O92A 4GXQA 4JFRA 5CK4A 2Z6VA 3CG4A 3Q7RA 3G0GA 2ISCA 3LCMA 2AFHE 2FJ0A 1WQ1R 4JHLA 1LF0A 1VFPA 3LY5A 4MS4A 4CTJA 1RHJA 3ZWNA 5A1TA 3SZOA 3OD5A 3ICQB 4N47A 1KGDA 4MJ3A 4D3DA 1I10A 1GPUA 4KXMA 4L2IA 3QKTA 4G6ZA 4QTUB 1PGQA 4A8PA 2G1AA 4GOLD 5SYNA 2IHUA 3AERB 5JWRA 2HMWA 2XT0A 1POWA 2C77A 5IVIA 4W5NA 2D54A 4NAHA 2HL6A 4JLSA 1DXHA 3LUBA 2QMYA 5TX7A 1MG5A 1XE3A 3O47A 1AKTA 1JAHA 2H9IA 3UY4A 1M7HA 2OCPA 4MKXA 3KQNA 2Q6LA 2N46A 2RK6A 4IIXA 2NSJA 3HABA 2WHEA 2BEKA 4C7VA 1PD1A 4OJTA 5JJIA 1V6AA 2AG5A 4DLBA 3BXEA 1KVUA 1I0IA 1U3DA 4QASA 5JDCC 3QX9A 1LBTA 3V1UA 4NWIA 4LG1A 3VR2A 1QE5A 2VLBA 3RKSA 3VTKA 3HDVA 1E2IA 2KQUA 2E4WA 2HK8A 3MCUA 3PEYA 3MJSA 1PR5A 3ZGLA 5F35A 2C8JA 4WN9A 4D0LB 4EDHA 4WXPA 3ZDXB 3P0HA 1P7WA 4MKZA 1KI9A 1OKKA 4F9GA 5CT6A 2I4IA 5DF1A 3M6XA 5FBQB 1W8IA 1ZCJA 4ZEVA 1NMQA 3OX3A 2JFOA 1Z4NA 2Q3JA 5D87A 1HORA 3QVWA 3HGMA 4IQ8A 4KMOA 4XAQA 3S2YA 3VISA 5BV0A 4C7MA 1B6TA 5JS1A 2H2DA 1UJ6A 2XNDD 3E3AA 4IO1A 4RVUA 1JG6A 1FLNA 2ET6A 2P0EA 5G40A 3G79A 4UM8B 1X8JA 1SC1A 1GGNA 1V5EA 3ZIAD 2G9RA 1ORVA 4URXR 1KY2A 1J9GA 1Z4MA 3D8TA 1C7FA 1MUUA 5AI4A 1EWQA 2YCBA 5EUBA 1MLDA 3FBGA 4HN2A 2ZETA 2RGRA 2K2QB 2OAGA 3MJFA 1TD9A 2JGIA 3LC1O 4K6CA 2PX3A 4WHMA 4JLBA 2G5CA 4LPSA 4Q34A 4F06A 5HJ7A 2FW7A 1DIGA 2J9FA 1N34B 2XMZA 3B82A 3R6LA 2OZLB 2BONA 1JRLA 2ZYDA 2ZXEA 2OP1A 3RODA 4FGKA 3TEMA 1MOPA 1NONA 3CCFA 2QP3A 3NHYA 1SBNE 5DI9A 3ZCTA 1CZUA 1M54A 2JH9A 1HM5A 1LV8A 1X42A 3A2MA 4JR0A 4XGIA 3EFBA 3SZRA 4TTRA 4XPIB 4C4TA 2BI8A 1XJQA 5HBGA 4U7TB 3OJWA 5DNAA 4PSUA 2FI1A 4R2XA 4M7RA 4D57A 1L7OA 3Q3GE 3JD2A 1T91A 2HY7A 3DE5X 4BFSA 4ZHQA 3PFWO 4M9QA 4TTAA 3UQZA 1E1QD 5TSDA 3TB6A 1M8GA 1OFVA 2JKVA 3MJEA 8ADHA 1LRKA 4LRUA 2ESRA 4G0VA 4IHAA 3ITEA 3KVRA 3RLFA 1ZU4A 4WNAB 1PJTA 1LRJA 1WMSA 1ZOPA 2BHSA 4QULA 5FLEX 2BTEA 4KQ2A 1M2OA 1QWSA 4GMGA 1IBRA 3THSA 2ZJ2A 2BI4A 3H2JA 4J3FA 4QL3A 2GN9A 4DQXA 2CC2A 3V6LA 3VNQA 3GUVA 1K6MA 2JLZA 4H3SA 5KINB 3RIMA 1RFLA 1VBFA 1I2ZA 1NLZA 1DWUA 1T5BA 1VYVA 1KGSA 1M9NA 2P75A 3CR8A 2NMVA 2L42A 3E5HA 1P2BA 4PCVA 3UW1A 4LWZA 8GPBA 5FV4A 4KO2S 1FMLA 3P2EA 5JAZA 1SKUA 4QVIA 5DP2A 1RCUA 521PA 1T2UA 1ZSNA 2ZTVA 1MIOB 5D01A 1EI9A 1E9AA 1V6SA 4D98A 2DQZA 1WSWA 5IDYA 1K2WA 1NPTO 5B7QA 1Y3BE 4WIAA 3TRFA 3A4IA 1U2DA 4FWBA 4LSMA 1ZOIA 3RC2A 2A30A 1PJLA 3LY8A 4FYWA 4JC0A 1ZK3A 3K0CC 4LS3A 3BBLA 1XV5A 2IKQA 1SNYA 2ATVA 3MJ4A 5CYOA 3RREA 4DHEA 3TR0A 2EFJA 3VDRA 1GNVA 5K0CA 1EM8B 2C83A 4DIUA 1QH1B 3PBKA 1JHMA 1GZ5A 4WZAB 2OHJA 3U2QA 2X2OA 2RKWA 3G02A 3F5SA 4MP6A 1HYEA 2L2QA 3QPDA 1DDIA 5DXFA 3IV7A 3GD7A 3E4DA 4CLXA 4JLPA 1NX6A 1Y7IA 5I4IA 2DCMA 2VDVE 4CM9D 2BN4A 4DRZA 5FL7D 2QL7A 1YE5A 3KQSA 2O06A 3G2MA 1G5FA 4JR1A 4Y0VA 5ERXA 3ZU6A 4BZQA 4WBNB 3Q11A 2E5WA 2C7RA 1HDOA 2YASA 4AM8A 1AKUA 4LXQA 3OSUA 1G8YA 1SUFA 2UXDB 3LBYA 4DA7A 3WYCA 2QD5A 4W8OA 5F21A 2CNWD 2QUJA 2A94A 1W46A 1X2EA 1SIUA 2V9ZA 1EE9A 2QN7A 1E0KA 1YHYA 3DDSA 3KSZO 4S35A 2WFZA 5E9JA 4ZIRB 2AFRA 4FYMA 5JAMA 2WZCA 2VHXA 4IO0A 3A04A 3VC2A 5JPIA 3P45A 2NZXA 1JLLA 1K5PA 1KYQA 4IGKA 3TSAA 4G09A 3V2HA 1KH2A 2I7CA 3FSEA 3W2HA 1G21A 2J31A 3ABRB 4KIUA 1O5TA 4O8CA 4A6PA 5TLSA 2FJPA 4PSKA 2Z2KA 4GEKA 4KGVA 4LGYA 1JBQA 4E08A 4NBKA 2PWPA 3R7LA 5JQWA 1I2BA 1SO8A 4PCLA 1T3SA 2UYGA 3EUFA 5L6MB 3CIFA 2J0EA 1A2KC 1T2DA 1VOTA 1X1DA 5EQJB 1YIOA 1PGOA 4EI9A 3RAFC 5H82A 2VK1A 1VIMA 1MGOA 3N8IA 4RPIA 3TCNA 2W42A 1I4LD 1E4OA 5TPWA 1ZH2A 4CF4A 4CKBA 5I3ZA 5IYZA 4FHGA 1UR5A 4FDLA 1GPJA 3ZGYA 1QLJA 4G07A 5T67A 4N40A 3EN0A 2MYTA 2EIHA 1AHNA 3FB1A 4C7OA 3G0CA 4AJOA 1JLKA 3F6BX 2I0FA 1I36A 3AI7A 1R0CA 1QVRA 3F6SA 2J09A 3M5WA 2FW9A 4TL6A 3LNTA 3RG8A 3WXMA 1ELOA 1NW3A 2VP6A 3ANTA 1KHHA 3L6OO 2FWAA 3EVCA 4MQLA 4N5LA 1JQAA 3DXFA 3KV1A 5BV2P 3VXKA 3GEDA 4NENB 3ZWPA 4B75A 3A9WA 5CXQA 4I81A 4QDKA 5LUAA 2ZJ4A 3WL4A 5AHKA 2Y0DA 4LCEA 1LDNA 2KYRA 3NBQA 1JB1A 2X5JO 4JKYA 5E8JA 1JQKA 2PUDA 4MB0A 3CUVA 2DTXA 1E3MA 1AK9A 2X0DA 4D4JA 1ZCAA 2IEDA 2VJQA 1SELA 1NW8A 3D7RA 3GH3A 3F67A 1J39A 1L4NA 5FUXA 4HQRA 2BR4A 1OH7A 3T3OA 2G1KA 4NBTA 3F6RA 4ZMRA 2YHUA 1C0KA 4XDZA 4YHBA 2XMQA 1L4YA 4RD0A 3NYIA 3U7HB 1TQ2A 2H3HA 3AFHA 5DT9A 4KOEC 1FW6A 1E1LA 1P2VA 2C03A 5JHGB 3ZH2A 1YJCA 4ZCTA 1R8SA 4Z8XA 4M54A 3V8VA 3VHXB 2AG6A 1V1RB 3ABIA 3AUKA 3KUCA 1YDHA 3KZMA 5JANA 1E3DA 1Z6XA 5AT1A 3A9CA 3F1LA 5FB3A 1BA3A 2QGNA 3OETA 5LQNA 2OG1A 2CE2X 4Q3CA 2V6FA 2I6UA 2K7ZA 2V98A 5J43A 3PQ3A 1VHJA 1SKMA 1C3EA 1PW7A 1U8YA 2V7PA 5TR9A 4F96A 3BCSA 1KO5A 2Q28A 1CRZA 3OQ6A 2IU4A 5ALXA 5AK4A 3BDVA 4BQPA 2JIZA 1L4GA 1OA1A 4MV5A 1HUQA 3UT0A 3HZOA 5AKKA 1I01A 2XQJA 4UREA 2FUCA 4MVJE 1ZBDA 5EC8A 4EYKA 5AKXA 5T41A 3KKLA 4JLOA 2BEJA 3TX2A 4TGLA 3AHHA 1M1NA 4LMRA 2QV0A 2FFBA 1I14A 1CERA 3FRIA 1XU7A 3IALA 4W63A 4EYEA 5TMPA 1W30A 1AMUA 3TAXA 2BFCA 3WYDA 4OYHA 3ZWMA 4MV0A 3KZVA 4ZYLA 2L18A 1TUIA 1YFLA 1ZCZA 2AOWA 4RK7A 4AKEA 3LTEA 1UINA 2IEAA 4IIYA 4F86A 1EP9A 1OGJA 4WXHA 4LVOA 1V96A 5TGTA 3BFXA 3LT0A 4K03A 3PQ8A 3NZEA 4MWCA 1LQ2A 1Q3TA 4CL3A 3EZ9A 1TE2A 3QEKA 3GBVA 4C2UA 4TSKA 4F8YA 2OD9A 1PL6A 2DSTA 4M0LA 2WYWA 2P62A 4MW1A 5C8YF 3FYUB 4JJ4A 4JNCA 1OIXA 1KRHA 1DX4A 2HF7A 3PT5A 4CM7A 4PS1A 3UMRA 4G8CA 3W3AD 1OAAA 5ADUS 2ORIA 4WKPA 5TMDA 3ZPXA 5B2EA 1TFUA 5FD8A 2GUGA 4YQEA 1TVKA 2JFQA 2XWPA 3GRUA 4HDNA 4K6HA 3AVWA 1VBNA 1E2UA 5EFZA 4EHKA 1B7GO 3JYHA 1YDWA 4OG2A 2E4VA 5B7GA 1TU0A 1FXWF 5DP1A 4LYFA 4F5ZA 4G2TA 4B7AA 4IRXA 4HAWA 1C1HA 3M2PA 4GGOA 4QUAA 1MTZA 3N2KA 1IJFA 4HQNA 3DDHA 2B0JA 3DMRA 4RVGA 5JWHA 2IYTA 5LBTA 2AFHB 1P1JA 3DW3X 3B6EA 4IS2A 4PNPA 5EIHA 1L5HB 2WIDA 3PJGA 5AICA 3RWMB 3K71B 4RK0A 4OLJA 3K73O 2A9OA 3K16A 1XTVA 3VKUA 2QTWB 4FX5A 1DIRA 4YRDA 3RASA 3LBFA 4RIIA 3D6HA 5C9ZA 3JYQA 2AOUB 2E4XA 1YF3A 1UFKA 5C5IA 1P80A 3D4LA 1U8XX 3TTVA 1RTTA 1TA0A 3MGGA 4DABA 1ZD8A 4TV9A 2O8CB 4RJKA 2X0RA 1XD2B 4OGLA 4QQRA 3OX4A 3RVQA 1X7XA 2J9XB 3LU1A 1PR2A 2EJBA 2ZIFA 1I3OA 3AFMA 3W77A 3E7FA 2W2OA 4OP2A 2AC7A 7GPBA 4QAQA 1YZLA 4Q9JA 1EFUA 2ECKA 2W93A 4UULA 5KYWA 2ZCUA 3P0EA 2Z95A 4BQRA 3TIFA 3I04A 4TXLA 1D7AA 1QUEA 4LDZA 1H3EA 3NHBA 4EY3A 1U2RA 4WEQA 3COPA 5ALZA 1RVDA 2X9LA 1AKEA 1JIXA 2J7PD 3VZBA 4AG5A 1CZKA 1FP2A 1A9YA 2PMEA 2GEBA 4KSCA 3TNJA 1OFUX 1IEWA 1PBNA 2QVBA 1JFRA 1D9ZA 1YB5A 5GIOE 4FINA 3MERA 1SB9A 5BOSA 1KAMA 4KWEA 3I3SR 4JCOA 4KN9S 1K4YA 1LWOA 4P35A 3JVDA 2PYIA 4JC4A 1GARA 1J1IA 3KQQA 4ALMA 3OD1A 3M1LA 1L1FA 5SZKB 2O0KA 5LB4A 4EUEA 4YT8A 5FDFA 5LFAA 3KAJA 1ZUNB 4J49A 5EXXA 5ALDA 1XCLA 1P1CA 3S70A 4E1BA 4QGAA 5ENZA 3BB4A 1N5IA 1D4ZA 3CW2A 3IAM1 3G2KA 3I1YA 1LBEA 1YRLA 3K4QA 3IX7A 1IATA 1EWRA 1V8OA 1XMJA 4UPVA 1CYDA 2VHUA 4IHKA 1QVWA 4Y7CA 3VYSB 1BHJA 3CLHA 3T9BA 4O4LF 1N0IA 1DAHA 1MNAA 4YC7A 1EINA 4DUZB 1VKRA 4YNBA 3I2JA 4X1IB 2ZUUA 5EYPB 2FF7A 1CQIB 1SCAA 2FVXA 3ABSB 1XDGA 2WTMA 3BCUA 3H87A 3VPCA 2HLHA 5A6SA 5CBKA 3FRJA 3EEFA 4RANA 1NQVA 2WZDA 3KOZA 2GZRA 3DT9A 3M1AA 3Q4GA 3T3IA 1E3QA 1GNRA 4YJDA 1WCIA 1C1YA 1SWVA 1T36A 3ANMA 4JFAA 2WTUA 2HOQA 3ML1A 3PQEA 4PSCA 1TEZA 2AMFA 4GP9A 2QMQA 3ZUPA 2G0AA 4BTLA 5LZ7A 4AP5A 2V7XA 3CE9A 1K88A 1Z0AA 2V5UA 4X6XA 1OXVA 2NUBA 3FROA 4MP3A 2VSFA 2PJDA 2TSYB 1J21A 1CULC 1FXWA 3CF2A 3O95A 4LZWA 1LLQA 1YS6A 2CLKB 1I7NA 2ZBEA 4DPKA 3QU2A 1TOAA 1GUYA 3BSYA 1R0YA 4G5HA 5B1DA 3T9AA 4FN4A 3ZHOA 2Q3HA 4EEXA 3PFNA 4AZVA 2OHGA 1CP3A 2WF9A 3GGGA 3JQBC 5TVKA 3WBKA 3H4TA 4I9NA 1DXQA 3N28A 5GOZA 1RQ2A 3PEVA 1W5FA 4KIWA 4UOZA 4X64B 1UK7A 3U09A 1F2DA 1QO0A 2B6NA 2HIHA 4LYHA 2Y1CA 1V26A 4DLVA 1IEQA 3WAKA 3PJDA 5CCEA 4FDVA 1YZNA 2FPUA 2NAPA 4Q1DA 3R3YA 1QB7A 3ZOKA 4GYJA 3JSAA 4Z0PA 2OSVA 4U8GA 4QUDA 1XEFA 3EFEA 1BS9A 4IJKA 1QYXA 5JQGF 4FYIA 3GVXA 5CR9A 3EXHC 3VR3D 1VL8A 5CDFE 3WRWA 3H9GA 1QK4A 1W73A 2SBTA 4I2NA 3QSGA 2QHXA 1OASA 2PKRA 5E4JA 3VUEA 2JBAB 2VO1A 1YE8A 1E61A 2HSZA 2WTEA 2CZCA 2JLSA 3AR7A 4Q4HB 4ROSA 4IXNA 3F7MA 5CVJA 3T1OA 1QONA 2QOEA 1J2TA 4XQ0A 3UUFA 1DBIA 4M8KA 4XDHA 2Q7OE 4UM9B 1Q3HA 4BE9A 1LPOA 4QOSA 3W8FA 3ER8A 1XKLA 1V4BA 2FZEA 3EZ2A 2WJIA 4HB4A 4Q4AA 3VC1A 3S40A 1N6IA 4I4NA 3AIMA 4N1AA 4ND3A 4F84A 5B7NA 1NWHA 3PSHA 4ISBA 4R05A 4J7XA 5TC4A 1BRMA 2NN3C 4M9CA 1RIIA 3IAAA 1DUIA 4UBMA 1GRNA 1Z4QA 3KP1A 2QN1A 1KO7A 1XBTA 3I61A 1IY2A 4LNAA 2AEFA 1M75A 5JD5A 1AV6A 5CT4A 3HZHA 4RY9A 3JD1A 2EBFX 4ZVTA 3V8BA 3R7NA 3P9IA 1EP1B 3LKVA 5FNZA 4WEOA 4P4LA 1G19A 1UKCA 2WU0A 1IHXA 2JGLA 1VLJA 3FHJA 2VWGA 3ZXXA 4DJAA 3NRBA 4DS3A 2W2NA 3WQHA 1TVEA 1CCWA 3IOMA 3IP3A 1ONPA 1ZUD1 4I4CA 3ELUA 5DCLA 5IBPA 5LA6F 4NDNE 2E21A 1TM4E 4BCDA 1PKEA 4C6SA 5LIRA 4FFDA 2W2KA 3QBVA 5DRTA 1JU9A 2QNIA 4KE8A 3DOEA 4FBMA 5HILA 3H18A 3UAVA 3VHRA 1IG3A 2WZBA 3IKMB 4UVEA 4MRPA 1DRVA 3SIXA 4HI0E 2Y05A 3SIRA 2H08A 1ISRA 2DFVA 2FRDA 2X5OA 3KYIB 1KKLA 4L08A 2JLXA 3RSHA 3S44A 2YV3A 3AEZA 1NUPA 1BYIA 1FNBA 5CIQA 5EJAA 4PANA 1Q1ZA 3CB2A 4X8HA 2WC1A 3OBIA 2EFEB 5IG2A 2XPCA 2I4NA 3MTJA 3CT6A 3MD9A 3TLYA 1IHYA 1ZAKA 2OMKA 2HAEA 3FMFA 1JV2B 5IF9A 4G5YA 2CWWA 3WWYA 1Z4KA 4CV1A 2R1VB 3ADKA 2X58A 1S6YA 3M6AA 5LWHA 4BB6A 5KU7A 2IDZA 3SXPA 3ED1A 1DAEA 4DCOA 3OZIA 1XD8A 5EJ9A 1E5QA 5TT0A 2XUOA 3OA2A 4CR6A 4O4JF 2WDZA 1NVDA 1V1MA 1NP7A 2WWGA 4W1PA 4GZ5A 4MWTA 4XH9B 4QXRA 4RA6A 4BNDB 1MVOA 5JH7B 5LQKA 5DTJA 3HO6A 3T7JA 4C1BA 1BHSA 5LYYA 4B3TB 4TKVA 2ONYA 1Q77A 1IWOA 1RKQA 4WNCA 3DKVA 5K8VA 1R66A 2VJNA 2Y2VA 1YMVA 4LNUB 1V0JA 4E2YA 5KQRA 4M21A 4CMGA 5TGDA 1NPYA 3SFTA 1DC4A 2XCTB 4TRNA 2F1RA 2JI6A 2XHEA 4PPGA 3EVFA 4WE3A 4X24A 1BDIA 1N1EA 2UZ1B 4ZJPA 4E7PA 3ABOB 4PZPA 1X7GA 4RF3A 3H04A 5JCPA 3ZBUA 5A9RA 1OAKA 1N1DA 2VCHA 4XVCA 1YL7A 3OTWA 2QTMA 1X9IA 4QUHA 2ZVDA 2QAJA 4XVQA 1ETHA 3R2JA 3RTAA 5I4KA 1VM6A 1ZGBA 3QI7A 4FMBB 1ZGAA 3UJPA 1MENA 1YVRA 2PUGA 1YQGA 4JBHA 1J22A 1LVHA 3H4MA 3IT0A 4D6YA 4U8HA 1WP4A 2G1JA 3O93A 4EF4A 1UMBB 2ZR9A 2XKAA 1SVUA 3CBGA 5I7RA 4UU1A 3KX2A 4MLZA 3CH7A 1GNLA 3S28A 4FEGA 1SGWA 3UV7A 1EBUA 4RHEA 1B6GA 2GA9A 2GZAA 2P2NA 2Z6UA 4C0JA 1AXEA 3RRXA 2O8FA 3TM4A 2C2XA 1V47A 5BWCA 5LWQA 3LPDA 1XVLA 1DTWA 1Z5ZA 2IW3A 5BUCA 1GPBA 3FG9A 3MIIA 3OLQA 3UENA 2PSHA 4GKBA 4KIGA 2QTGA 4JB0A 4MV8A 4DAOA 1NTRA 1O0CA 2O52A 2PXHA 5EPUA 2JD1A 3J81A 4GNKA 3L7KA 4DZZA 3EC1A 4WK2B 2D0PB 2OGSA 2FK8A 2Z9DA 3LUCA 3AOGA 4DG5A 1QGAA 4J0IA 3JAWA 3CVYA 3ZUGA 1U7PA 5KQPA 3GFTA 3ZYZA 10MHA 2TMDA 2OKCA 4I55B 3FYCA 2MCFA 1EFPA 3KNZA 4YP9A 4IV5A 4QYTA 2ZRIA 2IEYA 2DHQA 4WQMA 3QQPA 5B3KA 3CX3A 3DXXA 1TUGA 2C98A 3U16A 3IILA 3LRPA 1T29A 4DTIA 2I76A 3CVOA 1UT6A 4K05A 1NQAO 2DQYA 2JHGA 5AW5A 2GTHA 1OOEA 3DCYA 4GLBA 1UZUA 2VDWA 3EPHA 2BUAA 5J2TA 2EOAA 1WJGA 1P1BA 3IVRA 5DNCA 1UBCA 5H3HA 1QG0A 3JQFA 5EXSA 4EMTA 5CEEA 4DQVA 3U7FB 3ADDA 5DN9A 1RYEA 2X4IA 3QEOA 1UZMA 2VBGA 3SG0A 1I3LA 2BKEA 2Z2XA 2IOYA 3OUTA 2JFWA 5HXAA 5JCJD 4KHPB 3O2JA 4XA8A 1ULUA 4IP0A 1LLCA 1ZESA 3ASVA 4G01B 1R27A 3FUXA 4UNNA 1C30A 4BJHB 4DRYA 2RGXA 4HUJA 1OLSA 1ORRA 5E3HA 4ZK6A 2XZOA 1E32A 1CWUA 2HWXA 3DUFB 3TW4A 4CGZA 4D4MA 1WUHS 1FJXA 2CF5A 2ZBQA 3QKWA 1C3OB 2YJZA 4IIJF 4O4JA 2WSMA 3TQTA 3K05A 3WL3A 2PGXA 1C1DB 4O2BA 3ZWVA 4Q47A 4URUR 3OLWA 2CDCA 1IBCA 2NUPB 3FR8A 4G1FA 4GZLA 1IEVA 3IUYA 5AJVB 5C4GB 3RUCA 1ZMRA 2IYLD 3ESQA 1VBMA 1HFKA 1OBCA 2P68A 3VSDA 4B5KA 4CL8A 3TNFA 2I7DA 5CCDA 1S2IA 3F8WA 3KD2A 3T9FA 3VJLA 3F4KA 3KQOA 1VHLA 1XNGA 3N6VA 3O03A 1XKTA 3OHSX 4FOPA 5FUWA 4TMYA 5LQJA 1W0CA 4ZEWA 3K72B 1YQ9A 4P3YA 3QU9A 1KMMA 3F7TA 3V55A 3ND7A 1LDMA 3EWAA 1JHZA 3F1KA 3AI1A 3IVMA 2BMVA 1RMQA 2PS3A 4OOEA 4CQLA 1XNHA 3WISA 2H1OA 3DJYA 2YQ4A 1Z63A 4L7VA 3ZHCA 2P2YA 1B8VA 1NF3A 5DHTA 1RYZA 4BUCA 1Z12A 2A86A 5BNIA 5JS8A 1LV7A 1SZPA 4Q4JB 3FLAA 3V4LA 3RH0A 4RF2A 4XX0A 1DI0A 3JU3A 3IPYA 3MJTA 4ER3A 2PZGA 2WE8A 1JIQA 5CEJA 4KQ1A 4I1VA 4L0QA 1U0LA 1P74A 2FGJA 3OQHA 4GRAA 2I1QA 3NHJA 3U7JA 3LX6A 1N8KA 3CRMA 2W70A 4WI1A 1DTEA 1DMRA 3FGPA 1DC6A 3IXQA 1XVIA 1KZ7B 5ALWA 3EDCA 2HF8A 2F00A 3J80A 2JJ8A 2KBEA 1N0HA 2P9BA 4WOCA 3TZ6A 3ZQJA 3FYDA 3OSZA 1T8PA 2BZ1A 3OZTA 1OHHD 5INTA 3PGJA 4NZPA 1M6YA 1ZUIA 3GK3A 4PSAA 2RKBA 4ZVKA 3BXZA 4DE5A 2H29A 1VIDA 4U2BA 1Y1TA 5BYKA 1ENZA 1GLGA 3EBPA 3JVVA 2OYSA 4R0MA 5KTOA 2CLCX 4KPUB 4CFSA 2O4UX 2ZR8A 3OCWA 5ADHA 5C18A 2PLNA 1HSOA 3C85A 3JY6A 1EFHA 2IF0A 5IN5A 1E2JA 1XZJA 5DEOA 421PA 1QOPB 3KEMA 2GYWA 2Z9CA 2JCBA 1RRCA 3LHKA 5LYJF 2HBZA 5KYVA 4YAUA 4YH1A 3REOA 1RAIA 1OX6A 3W5HA 5HJ2A 5CU7A 4CUKA 3EBLA 1NGSA 1P44A 4H6XA 4OLFA 4JZKA 3WK6A 4ZT3A 5DH9A 4KXLA 2SICE 3IOCA 1UDRA 4REQB 2JIPA 4I5IA 4JKOA 5AHWA 5JG7A 4ATNA 1N8TA 3I8OA 3EPKA 1RP7A 1F8YA 4BNVA 3L01A 3IJPA 1LRLA 3LRTA 3UKJA 4EI2A 1CNMA 3SQXA 1CJVC 1CRQA 4RELA 3VR5H 2IKSA 1DEAA 1TPYA 1QGED 1UM9A 3KTFA 4N5IX 5J4HA 2V9PA 2JFGA 4DNQA 3WWDA 3L7NA 4NE2A 1WCWA 2Z2JA 3AG5A 4JEIA 2V45A 2V7QD 1QHFA 1U5BA 1R9GA 2PVPA 5BQPA 4P7BA 2FPIB 2L0XA 3ORHA 4Q9HA 5DRYA 2C9CA 1DHTA 4S1TA 1MN6A 1B8OA 4DYDA 4G5GA 1YAJA 4DXDA 4RA9B 1ODFA 2B30A 2YY5A 1YMQA 4UVGA 4BRSA 4M1TA 5L9AA 7REQB 1XLWA 4I9UA 3GG9A 4KX3A 1WQ3A 5BRJA 5DM1A 4IF6A 3KEFA 3M9XA 4BOYA 3F6CA 4WXRA 4L5JA 2ORVA 3MOGA 1WF3A 3EVGA 1X7YB 2BCEA 1OU0A 3MTIA 3B3FA 9LDTA 2AEMA 1C9EA 2OWDA 3G3EA 2A5DA 3DO8A 5FWNA 1J49A 3SVTA 4N0DA 3NBAA 3KQUA 3BIWA 2O8EA 2IK8A 4JBIA 2MMGA 3ND8A 2CBXA 4GOXA 4ZCPA 1KK3A 3DGEC 1FXSA 1HURA 5ITVA 2M6RA 3THXB 3F90A 2ZTMA 4RHXA 2F3SA 3DV9A 2FPRA 4ZVUA 2BGWA 5IP5A 3QUTA 5EOVA 3GRZA 4CG2A 2GGSA 1QPBA 3CH4B 3LLUA 2WWYA 1XP8A 2ZSDA 1AZTA 2R6CA 2H00A 3DF9A 3GGOA 1OWMA 4Y2RA 1OX4B 3MWDA 4LRSB 3C5WP 4JP5A 3WLTA 3O38A 1UPBA 3JR3A 3U4GA 3CRW1 1SR8A 3SZ3A 1DIAA 1GQYA 1O95A 4Z7NB 3NS7A 4AJHA 2VF8A 2VF7A 3GT3A 1FVOA 1WABA 4G97A 1U0EA 1YI8A 3DZBA 5GVRA 2J3DA 4NBVA 1N3LA 2RE8A 5F4ZA 3QF7A 1S02A 4XM2A 3EVTA 2B8NA 4K9KA 4NV0A 3L82B 1VKOA 4JLWA 1I3CA 5D1HA 3HI6A 3MBIA 4TTTS 1XU4A 1WMAA 1MH9A 3UUWA 3D1LA 3W05A 5A2GA 1RC0A 3V33A 1VI2A 4L4YA 5HM8A 2YHIA 2K7FA 2VP0A 3TBHA 2G08A 3M2TA 4PS0A 3TQFA 2LKCA 3C3CA 3GJ8A 3KBOA 1SQGA 4PQRA 3WLHA 3EA5A 5ESWA 2JARA 2FN8A 5JBNA 3RSSA 2NXCA 6GPBA 2R751 5EJ6A 1X3LA 5ANRB 4RTJA 4L8VA 4NECA 3T6KA 3HGQA 5E3IA 4XYEA 1Z7GA 3EEIA 1V48A 3JD3A 4PAMA 4LY3A 5LXTB 2PGDA 4HLDA 1XZKA 1S2GA 4JEMA 4OXKA 1Y7PA 5J40A 2F8LA 1JH8A 4Y2VA 2YWXA 3HN6A 3R9KA 1TTTA 3H5NA 5K3SA 3TSYA 5A04A 5AKYA 4CIDA 4ESEA 5JVDB 3WRYA 1HRKA 3FZEA 3TTXA 1ZOSA 1SKYE 3NNSA 1S7GA 3AJ8A 3NV9A 4BO2A 3X1DA 3EXIB 4ZCQA 1UMCB 1YR6A 1UT8A 3AFIA 4M7WA 3NGXA 4R2HA 4TKUA 3TOSA 3ZR4B 4D0RA 1RXWA 4DB2A 4XTCS 2ZEJA 3L77A 1C8BA 4YUXA 5KHLB 4EZBA 1N25A 3PUJA 2CL5A 1HE5A 4OXRA 5I7SA 1LFDB 1CJBA 1VI6A 1FK8A 2ZRKA 3D8NA 4JH0A 2QKYA 3U44A 2VDLB 2XMRA 3MK31 4UHDA 2I2XB 2V7BA 1ZRHA 1DXYA 2OGTA 4DA4A 4ARIA 2GX6A 1U7DA 1C9NA 4E5NA 2QBYB 4C2AA 4IOKA 3TL2A 3U3DA 1XAHA 3AQIA 4IHJA 1FS5A 9GPBA 2BYTA 1WB4A 1A27A 2BGKA 1R00A 5E38A 2IPNA 2V7TA 5JNVA 1Y3IA 4RCZA 4E2ZA 3IAS1 3Q41A 2OEPA 3P2KA 5A4AA 1DPFA 2BAGA 5HKBA 1EG2A 2ZR7A 3NTVA 2QX8A 3FFTA 3P5SA 4XDGA 4Z51A 1KRXA 1ZJWA 3ZHQA 4YAKA 2A0UA 3RS4A 1FRNA 4KCGA 2ZIVB 4DCSA 2QE7A 1UK6A 2J5XA 3HCBA 3IV6A 2HPHA 1GG2A 2ZUVA 3KT8A 3TIVA 1U2DC 1IRXA 2BZGA 1TQ8A 2O3SA 2UZ0A 3HUEA 4P3XA 4QX6A 2Q7XA 4A36A 3M82A 4MQFA 4YRFA 3FPHA 4L75A 1IULA 2WJ6A 1O6BA 1P18A 1PUXA 1XMVA 2FEAA 2C95A 4M38A 2PKYX 1TQDA 3HPRA 4L6CA 4CQMB 3IJRA 1CRLA 4XVUA 1DARA 3AO0B 5FPHA 2ZAIA 1E5TA 3CINA 4P4SB 4CN9A 2CK3A 3C3XA 3K8OE 4Z1OA 1C3LA 1C29B 1U3CA 2A84A 1GUDA 2ZB4A 3FI0A 3BRCA 2WYIA 2H7YA 4BMYA 1P29A 2C7GA 4HXGA 5ILOA 1SG9A 2W2MA 2GHRA 1Z18A 2OFXA 2X0KA 1JJ7A 1TJNA 2YVLA 3CEPB 1KYWA 1UC9A 3M9WA 2FN9A 4GM0A 4XIYA 5F1OA 3GLRA 3P2OA 4D92A 3NDRA 2O1WA 3SJCA 3VHQA 4BIMA 3HKBB 3PICA 4QFDA 2X8JB 2IBTA 2O3UA 2J3LA 2MT9A 3GLKA 3O21A 4P3OA 1NF2A 5LOVF 2CFSA 2FFHA 5IJ9B 1EQUA 1XK7A 4ND5A 1H65A 4JLJA 1HK7A 4BZWA 1AGNA 1UAGA 1E18A 1G8JA 3AHGA 2QLLA 1WSBA 4RFSB 3PTLA 1JR6A 3TR6A 3U0VA 4DGQA 3DWGA 4DBLC 3CO0S 2DETA 4MUJA 3O8LA 3WGNA 2CCJA 2XNKA 4JVSB 4ENSA 4G0QA 2PZKA 4DLPA 2DLCX 3AKCA 3M4YA 1TC2A 1L7RA 3HA3A 4Z0NA 3VNVA 3TWOA 4CMJA 4P7KA 3COVA 5GADl 3A31A 4DDTA 1SKBA 1OB2A 2HLDA 3KB1A 5E1BA 3STXA 1W8DA 3BGSA 1E1RA 2BTQA 3FETA 4F04A 2RFLA 1PN3A 3S4YA 3SJ7A 3P9PA 3O9VA 3DOOA 4A82A 4AIIA 2WT9A 3B70A 2IHNA 1PEDA 2R2AA 4IDAA 4YROA 1YFKA 1AGRA 2VQSA 3GNTA 3LT4A 3B1XA 5DNUA 5LPNA 2JGDB 3CW8X 3HYSA 1CP2A 4HNAB 1C3VA 4J43A 5CA0F 4XB6B 4INZA 4HUQB 2X8AA 3IAFA 3NEPX 3G2NA 1OV6A 3D1JA 3GZJA 3KT3A 3LCVB 5LBUA 3ZWKA 1THMA 2IXFA 3LPMA 3NAGA 4NCXA 4WRRA 1KE1A 4K9MA 2YVQA 5EHNA 2JH3A 3HXMA 3RUIA 5DYGA 2QAIA 5GGYA 1FFCA 2HTEA 3F2IA 3MLBA 3PNYA 4MIYA 4BP9A 1Z5UA 3U4DA 4GOOD 3LOQA 1EVZA 4HLNA 1ICIA 4Z0TA 3SX2A 2A0YA 4Y9DA 4YAFA 2XWJI 3K5PA 4KO8A 4IDNA 5BNWA 4F97A 4ZPXA 5LBIA 2H18A 4DHWA 5CYGA 2EGUA 3U7IA 4C0AC 2PUBA 1QZTA 2I65A 3UK2A 3CGGA 3KYBA 1FYDA 4JS0A 4RK5A 4DNOA 1O7JA 4CKZA 2YKGA 1PO7A 3ADBA 1RPAA 3MTGA 3PQDA 2ETVA 5AXAA 3SHFA 3U39A 2QPOA 4II2A 1B1AA 4DG8A 4MYHA 2EHDA 5K99A 1M3SA 4M98A 1JJVA 2VTKA 4GR9A 4PYJA 3ZDCA 2P69A 3LL4A 3L6BA 4RXTA 3PC3A 1Z7BA 4A5SA 1EFDN 2C8VA 1AUQA 1XUOA 2PMKA 3AY6A 3AVPA 4Y6QA 5KHAA 4KGZA 5SY6A 1UXJA 4KDFA 1H0KA 2ZGVA 3PDWA 4N54A 5IMBA 2XUPA 3AEUB 1PTKA 4YQZA 1T1SA 2PYDA 3ADPA 3B6IA 4WINA 1M33A 3O26A 4U7WA 2JJ2A 3V8PA 1FXUA 3W4JA 1J0XO 1Z88A 4WGFA 3OKAA 5A9SB 3KUDA 2AZDA 2IITA 1O94A 2WW8A 4MS3A 4JVOA 1UOOA 3RVBA 1OXXK 1MAUA 2ATCA 5LOVA 2JG3A 3PDHA 3EDMA 4QQKA 3F5MA 3WQSB 3H7IA 4PX2A 1T0HB 2O8NA 4BDTA 4EFDA 4RVSA 4YVFA 4A16A 4BTVA 5JMWA 2YW2A 3HB9A 4KQJA 3HWWA 4IZ6A 5ENVA 3NUZA 4HGNA 2LIPA 3ZQ4A 5EMHA 2F3TA 1SXQA 1OJ7A 2YICA 5HFJA 4NV1A 2CEAA 3DA8A 1XZ8A 2E82A 3ESBA 2CB9A 3FTPA 4OHZA 5DBOA 2HM7A 1ZA2A 2K87A 2XVXA 3K8YA 4I5FA 3KQVA 4KRXA 4W7SA 3ORQA 2B36A 2OZKA 2J6IA 4M9XA 4GQAA 2OXEA 2PRJA 3CZQA 3FYHA 4HZIA 3GRPA 4MHOA 1YRAA 3ZC3A 2Q5FA 2G67A 3OJXA 4H0NA 3Q10A 2HWYA 1J97A 3KXPA 2BFAA 5DOVA 4D82A 2PTGA 3VPGA 4B31A 5JNUA