1P91A

Crystal structure of rlma(i) enzyme: 23s rrna n1-g745 methyltransferase (northeast structural genomics consortium target er19)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
268
structure length
268
Chain Sequence
b'SFSCPLCHQPLSREKNSYICPQRHQFDMAKEGYVNLLPVQHKRSRDPGDSAEMMQARRAFLDAGHYQPLRDAIVAQLRERLDDKATAVLDIGCGEGYYTHAFADALPEITTFGLDVSKVAIKAAAKRYPQVTFCVASSHRLPFSDTSMDAIIRIYAPCKAEELARVVKPGGWVITATPGPRHLMELKGLIYNEVHLHAPHAEQLEGFTLQQSAELCYPMRLRGDEAVALLQMTPFAWRAKPEVWQTLAAKEVFDCQTDFNIHLWQRSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal RNA large subunit methyltransferase A
publication title Crystal structure of RlmAI: implications for understanding the 23S rRNA G745/G748-methylation at the macrolide antibiotic-binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 64
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 2.1.1.187: 23S rRNA (guanine(745)-N(1))-methyltransferase.
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1p91A00
3REOA 1ORHA 3JWGA 1RI4A 2AOTB 2FYTA 2ESRA 4RWZA 1RI1A 4AZVA 5K01A 3G2QA 3E05A 5LQJA 3LDUA 2QRVA 1UFKA 3IHTA 3S68A 3VYWA 2AR0A 5LQUA 2Z6AA 3FPJA 2ZSUA 1VLMA 5FWAA 4RTSA 1KPGA 2PT6A 5DX8A 1VE3A 3SMQA 5K8VA 1UWVA 3PT9A 1BC5A 4P7FA 2VDVE 2OPBA 4G56A 2IIPA 5DM4A 3VC2A 3GIWA 3BXOA 2PWYA 5EC8A 5EEHA 2P8JA 2WK1A 3G88A 2G70A 3GCZA 4RVDA 1JSXA 2PV0A 2PBFA 1WG8A 5EQJB 3DR5A 1I4WA 4BLVA 3ER9A 3HP7A 5EGSA 4DCMA 3HCFA 2O0LA 3IEIA 3LX6A 3OZTA 2E5WA 2HWKA 3PS9A 4X63A 3SM3A 4CKEA 4ER3A 3EVFA 4U7PB 5E9WA 4POOA 5K0GA 4DA4A 3MHTA 5EZSA 4C4AA 2PJDA 3TFWA 4HTFB 5EHGA 4YUYA 4RTLA 4V0QA 3M70A 3R6TA 1AQIA 4F86A 4O29A 4DMGA 3MTEA 3HM2A 1SG9A 2YR0A 4PIPA 3PTAA 2VDWA 4GEKA 5CCBA 2HMYB 2XVAA 2GS9A 5CVDA 4EK9A 1HNNA 3UWPA 5K0NA 3KPJA 3FPFA 4K6MA 5GINE 5DSTA 2FPOA 3C3PA 4FR0A 4FSDA 1NW7A 2UYHA 4GOND 4EMSA 3R0QA 1VQ1A 5HIJA 4YV0A 3GWZA 3DLIA 5HOQA 1X1BA 4FT4A 4PCAA 5BW5A 2VP3A 5EG5A 2JHCA 4E32A 2PGXA 3OE4A 4QVKA 2F8LA 3AWIA 3BGDA 4V0RA 2ZIGA 5H02A 1YFLA 4OX9Y 4OA8A 1EJ0A 2IDKA 3T7RA 4EQZA 3B3GA 2ZZMA 4LWPA 1HMYA 3M6VA 5M5BA 2B78A 4RVFA 3THRA 3MCTA 2AOTA 2B9EA 1XDZA 4OBWA 3M4XA 3UJBA 4LWOA 4Z2YA 3QV2A 1JQEA 3P2IA 4E2WA 3B5IA 5DWQA 2P3OA 3M6UA 1N2XA 2YXLA 3GRRA 3KQPA 2GPYA 5DTRA 3HEMA 4OA5A 1Q0SA 3R3HA 1R00A 1NV9A 3DMFA 4QTUB 1NT2A 5DXJA 4RTKA 3I64A 1WY7A 5B1SA 1G8SA 2O07A 5P8WA 5E2AA 1KR5A 4M7RA 3DXZA 4RTPA 1U2ZA 3JWIA 4ER0A 5LQRA 3MB5A 2G1PA 2OXTA 4C04A 5FWDA 3NMUF 3G5LA 1JG1A 2XYRA 4E30A 4PNEA 3C6MA 3ID6C 4GC9A 2ZBPA 4YUVA 1B42A 3LPMA 2GH1A 1KHHA 2PXCA 3C6KA 2IH2A 4HTFA 4GUAA 4PYIA 3SSNA 3ER8A 5DX1A 4X60A 4YV2A 3FRHA 1SQGA 3DUWA 3Q87B 1RJFA 3LCUA 1P39A 5CM2Z 2G71A 3EVZA 3FZGA 3BWMA 3HCDA 3FUTA 4Y2HA 5LQNA 1SUSA 5KQSA 2AN4A 3LGAA 1KYZA 4MHTA 3GU3A 3GRUA 2BM9A 3FYCA 3HA3A 4PIMA 5K05A 4X61A 5DM2A 3G2PA 4QTTB 1DL5A 3L8DA 4M36A 2GLUA 2NXEA 4QPPA 2XYQA 3P9KA 3FTCA 3A27A 3HCAA 1YZHA 4GOLD 3UJCA 5FTWA 4ATNA 3EVEA 5CVJA 3UJ6A 2OB1A 3TPZA 2Z6QA 2P1DA 2O57A 5E1OA 3EGEA 3E8SA 3KR2A 4QQKA 3SX0A 5ICEA 3FTEA 1Y8CA 3EEOA 1EQAA 5CUQA 1O54A 4X1OA 2PY6A 1L9KA 2AVDA 5F2NA 1NKVA 4R8RA 2NXNA 4BP1A 4C07A 5EMKA 2I7CA 3WSTA 3D2LA 4FS8A 1INLA 1VL5A 2PX4A 4M37A 3CKKA 3BUSA 4RTQA 1JTEA 1JSZA 1JG4A 5C9ZA 5HZMA 1P91A 4AZWA 3P2KA 3HVIA 2ZCJA 5K0FA 2HV9A 5E2BA 4QQNA 3G5TA 4RTOA 1EJ6A 2OKCA 3CJRA 2YX1A 3NTVA 3HVJA 3EVGA 3KPWA 3BGIA 3UJ7A 1M6YA 1XCLA 2VZ9A 5GM1A 3UFBA 2O05A 3QOXA 1QYRA 4HRAA 4KIGA 1M0EA 1YZ3A 3HNRA 1NE2A 4C05A 3KU1A 2ZIFA 5FA8A 5FHQA 1O9GA 5EEGA 4DM3A 4RTNA 3EGVA 3EMDA 5FQOA 2UZ4A 4P58A 1G60A 5GM2A 2FCAA 2IFTA 3TOSA 3THSA 1P1BA 4U7TB 3KQYA 4YMHA 3CJTA 4CKCA 3AY0A 3OU7A 5E8JA 5CIYA 4P7JA 1NW5A 2PSSA 2BZGA 2XYVA 5EMJA 2JG3A 3NVKI 3CC8A 4XUCA 2I9KA 5CVVA 3MGGA 5LQKA 5EIFA 3DOUA 3T7SA 3JWJA 4E33A 3LKDA 3NDJA 1M6EX 1G55A 4RSRA 1KYWA 4ZTBA 3I53A 3VSEA 4GBED 4PYLA 2PXAA 2P7IA 3I9FA 3MERA 5HIKA 1JG3A 4MIKA 4CXMA 2FHPA 1RI3A 3TLJA 2ZVJA 3TKYA 1QANA 4EKIA 5LQAA 3NDIA 3DULA 5ERGB 3GDHA 2ZBRA 8MHTA 3DMGA 4PGGA 10MHA 1TW3A 4CTKA 3O31A 2H00A 4P7KA 1SKMA 1KIAA 3KQSA 2EX4A 3RW9A 3TMAA 1D2HA 2IP2A 4BLWA 1V39A 4AZTA 3P2EA 1Q0TA 3TR6A 1KPIA 3K0BA 1BHJA 4PWYA 5CCXA 4E31A 1ZHFA 3DTNA 4MQ4A 3X0DA 4E2ZA 5DX0A 1XDSA 3T7TA 2QM3A 3CBGA 3EGIA 1XXLA 3HVHA 3PX2A 3UZUA 3C3YA 3FRIA 5U4XA 3SXJA 3LKZA 3EEYA 5HIMA 1RI5A 4RTMA 2ZWVA 3GNLA 3KHKA 3LCVB 2ZTHA 3MCZA 2R3SA 2ZW9A 1L1EA 2QYOA 3DP7A 3PVCA 4HGYA 5DM1A 3UJ8A 3V97A 4PONA 3FTFA 4E2YA 4FSXA 1OR8A 2P35A 3NW9A 3KPVA 2OB2A 3DLCA 3P71T 1EG2A 1JR4A 1QAQA 4XUDA 3TKAA 4CWAA 3ELDA 4YUWA 2EFJA 5BW4A 1RI2A 2FK8A 2AVNA 3I58A 3LCCA 3ORHA 2PX5A 3M6XA 3EMBA 3OZSA 4RYLA 3GO4A 4PYOA 4ER5A 4IV8A 3MQ2A 4DF3A 4R05A 1BOOA 4NECA 5KYGA 2JJQA 2QRVB 3SSMA 4R6XA 1IXKA 3B3FA 4FP9A 4PYJA 3UA3A 4FT2A 1FPQA 2B2CA 2DULA 2K4MA 2XVMA 4ER7A 5G02A 2IGTA 2PXXA 4GF5A 5HEKA 5K0EA 2HNKA 3FUVA 3G8AA 5EOVA 1XTPA 3CCFA 3ELUA 5DLYA 1O9HA 2H11A 3PFGA 2NP6A 4HSGA 3KR0A 3KR9A 1NW6A 4KW7A 4R6WA 3EVCA 4OQEA 2HTEA 4PYQA 3OU6A 3U81A 1JQDA 2GB4A 2VDUE 5DSXA 2ONZA 3SSOA 3TQSA 5HILA 4RVGA 1NBIA 2P41A 3AXSA 3V8VA 3LECA 1KXZA 1Z3CA 2YXEA 3BKWA 1RJGA 5E1DA 2ONYA 1FP2A 5T6BA 4BLUA 4C06A 5FA5A 4UOEA 4MTLA 3G7UA 2PT9A 3EVDA 3KQMA 1X19A 1WZNA 4WXHA 5ICCA 2Y1XA 4H0NA 1X1CA 4RTJA 2FK7A 5K0JA 4LECA 1QZZA 3EVBA 2V7EA 3BKXA 3OZRA 1F3LA 3MAGA 4KRGA 4RV9A 2BH2A 3KR1A 4CTJA 2IH4A 5C1IA 5DT2A 7MHTA 1KP9A 3T0IA 2NXCA 5BP7A 2B3TA 5ICFA 5LSAA 2NP7A 1XCJA 3BWYA 3ME5A 3KPYA 4KWCA 4PYKA 3DH0A 1ORIA 1XDUA 1BKYA 3BZBA 1VIDA 3BWCA 2P3QA 4GC5A 3PB3A 1G8AA 3LBFA 1X1AA 3OPNA 4BP3A 2C7PA 4FGZA 3CVOA 4ER6A 2KW5A 1UIRA 3BWBA 3QOWA 3TM4A 5LQCA 5CD1A 2UYCA 5HFJA 2PWPA 4L7VA 3KPUA 1EAMA 4HC4A 4KVZA 1R6AA 5EMMA 2BR3A 3KQVA 2ORED 3FUXA 2JHAA 2QY6A 5DXAA 1KPHA 4R8SA 5E9JA 3BGVA 2PLWA 4OBXA 2P7HA 2CMGA 5KS2A 4PCLA 2ZIEA 3HCCA 4HGZA 5FUBA 3RIEA 3A7DA 3IYLW 3OU2A 4HG2A 4EKGA 4DCGA 2Q41A 3FPHA 4XCXA 1X1DA 1PRYA 1I1NA 5DTQA 3FYDA 1I9GA 4OQDA 3FPEA 4PGHA 2ZFUA 1JTFA 3CGGA 3I5UA 1R74A 3UJDA 1DCTA 3TRKA 2PX2A 3GRYA 3NWEA 2ERCA 5KVAA 3HVKA 5EIWA 5GP1A 1N7IA 1XVAA 3TM5A 3CJQA 1ZKDA 5GIOE 2NXJA 2O06A 1EIZA 2PKWA 1SQFA 2YXDA 3FTDA 4HH4A 3SVZA 3FUUA 2AOXA 2OY0A 1TW2A 1G6Q1 3M6WA 4JXJA 5EKUA 3BT7A 3HA7A 2JH9A 2GAFA 3NVMB 1WS6A 3P9CA 4IWNA 4PYMA 4QDJA 5F2KA 5KQRA 5T64A 4PYNA 3A7EA 4MWZA 2H1RA 4LG1A 2ZZKA 3E23A 3E7PA 5CVEA 3UBTA 5T67A 1ZGJA 1AV6A 2I6GA 3EPPA 4DQ0A 2I62A 4PINA 2BM8A 5DTMA 2OYRA 5D1HA 4IV0A 4A6DA 3H2BA 2R6ZA 3ERCA 3Q7EA 2BR5A 4KDRA 4X41A 4GOMD 4IKPA 4RVHA 1IY9A 4P7GA 2OZVA 5DM0A 3PLAE 2PVCA 4CKBA 3A25A 1YUBA 4RX1A 5GOZA 1YF3A 3ANXA 3C0KA 5JR3A 3GRZA 2PX8A 5FHRA 2Y1WA 5EMLA 2YTZA 3HTXA 5HIIA 2AOWA 4YUZA 1WXXA 3M33A 5BXYA 2ZBQA 1L3IA 3G2MA 1AF7A 2AOUB 2BR4A 1VP9A 2G72A 4WVLA 1TPYA 1R8XA 2OO3A 2CMHA 2FRXA 3GGDA 1VP3A 3GJYA 5CVUA 2NYUA 2G8NA 5EHIA 5C0OE 3VC1A 4E70A 4M38A 2CL5A 5DRTA 5ICGA 3OFJA 3F4KA 5EPEA 2CWWA 5K0BA 3DMHA 5E1BA 1AQJA 5DRYA 2CKDA 3KQOA 1NBHA 2UYQA 3LDGA 2AN5A 5F2OA 5K0CA 4AUKA 1ZGAA 3IV6A 4A6EA 5EVJA 1SVUA 3P8ZA 2WA1A 5JUWA 3B3JA 2A14A 1ZG3A 2WA2A 5IH3A 3SGLA 4B17A 3OE5A 3FPGA 1F38A 4QDKA 3R24A 2YVLA 1H1DA 1RJDA 1VBFA 3G89A 1T43A 2V74B 3P9IA 4RTRA 2JHPA 1P1CA 1MHTA 1D2GA 3ELWA 2P3LA 3P9NA 9MHTA 1YB2A 2VS1A 3A4TA 5EKXA 5D1NA 5LR6A 3KQTA 4AZSA 4KDCA 3PFHA 2Z6UA 2QE6A 1L3BA 3DXYA 2C7QA 1N7JA 4GQBA 1D2CA 3LHDA 2JH8A 2C7OA 4C03A 3KKZA 1FBNA 2AZTA 3NWBA 5E8RA 2IDJA 2AN3A 2LD4A 3AJDA 4YUXA 1JG2A 4YMGA 3KQWA 5K03A 4Y30A 2UYOA 3KQQA 3OCJA 3LL7A 5FADA 4C08A 3AXTA 5E1MA 3OFKA 4EVIA 5GIPE 4YV1A 3GRVA 2YQZA 3GXOA 1VPTA 1R18A 2ZWAA 5K09A 3NJRA 2IBSA 2AS0A 4F85A 1ZQ9A 1QAOA 1JQ3A 1IM8A 4BY9E 4ISCA 5EZQA 5IKMA 1XJ5A 5MHTA 4E2XA 3R9XB 1NV8A 2ZLBA 2HR1A 1YFJA 2ADMA 3P97A 2EG5A 5FULA 2IH5A 3G8BA 3RODA 1R8YA 3B89A 1PJZA 2OBFA 3DXXA 2ZZNA 3ELYA 5GWXA 3G2OA 2NNWB 2IPXA 2EJUA 4F84A 2IBTA 5E9QA 2AOUA 4XUEA 2DPMA 1NW8A 1FJXA 3EVAA 3LBYA 3LSTA 3O4FA 2B25A 2EJTA 1SUIA 3B7PA 4QPNA 2GA9A 3JWHA 1L3CA 3O7WA 4KIFA 1NW3A 2XBMA 1RJEA 3PX3A 4DZRA 5FCDA 1DUSA 4AX8A 2AOVA 3UA4A 1QAMA 4QVGA 2C7RA 1G38A 4GOOD 3HA5A 2P40A 3UJ9A 3UJAA 4DKJA 1FP1D 1MJFA 3HCEA 3HCBA 3MTIA 1WXWA 4FZVA 3SR4A 5DPMA 2ZULA 3K6RA 2YUIA 3FUWA 3A26A 2N47A 3LDFA 5K0LA 5FQNA
chains in the Genus database with same CATH superfamily
4HS4A 5BVGB 3IUYA 1SOUA 3M5WA 4ZI2A 3DBIA 3EA4A 1FMLA 4Q37A 2J31A 2QRVA 4JOQA 3KUCA 3W5AA 3IUMA 1B4DA 4LV6A 4ZYTA 2WMYA 3R0VA 1G21B 1TIKA 2Q3LA 2VIIA 3FSGD 2Y9PB 4M1SA 3LVFO 5JRJA 4FBMA 2XTZA 4XW2A 1VE3A 2I34A 4LNAA 3AEZA 2FN9A 4X24A 5J3JA 2Y93A 2ZWOA 3D0OA 3PDIB 4LUCA 5BO5A 5GPBA 5BUQA 4TT3A 3RASA 3GRCA 3PI6A 3PSHA 2CFOA 2PWYA 2QBYA 1DVRA 3GD5A 3I6MA 1T0BA 4IDQA 3USZA 1M8FA 3OOJA 3T7IA 5FR1A 1DGQA 4HTAA 1XA0A 3GCZA 1NR5A 4NZPA 3FMIA 4I4TF 4PFJA 2XMQA 1ZD1A 4TTAA 5CFRA 3FE2A 5DI3B 3DOJA 5KNLA 3OI7A 4A9AA 4X63A 3L7BA 4DDWA 4TTPA 1OB2A 1RYZA 3L93A 1KERA 5IZ4A 3AB8A 3GLHB 4M9UA 3WLOA 4EYQA 4MI6A 1NOKA 4G5GA 5KSYA 1JXMA 4PZAA 4YUYA 1KK2A 2FUG1 1Y9ZA 2IUYA 4Z8XA 4F86A 3RYFA 3EYWA 5BUZA 4RZ3A 2PGNA 1MOZA 4PIPA 4RK4A 4UTVA 1C1DB 2ODWA 3RS8A 4BMYA 4JI0B 2AYXA 1D2NA 3PUWA 4WEOA 1XAHA 4I14A 4YCNA 3QX3A 5GINE 2OM2A 3CKYA 2FPOA 4L4SA 2Y1OA 4DQLA 1PFGA 3A10A 2AFIB 3IR5A 1X1BA 5AR1A 4YQFA 1O6GA 4NARA 3WVNA 2J3LA 3OQOA 5CXXA 1O0BA 2RAVA 3N7TA 4IYRA 5IBRA 1ZRNA 3C87A 2HO5A 2HQSA 2ADOA 4Q0MA 1KKMA 2WB2A 1MR3F 2HAEA 1YI8A 2OHXA 5AT1A 1TCCA 1RM5A 3MYRA 1N2SA 4UU7A 4AJ1A 1SZJG 2WINI 3FH0A 1ILEA 5JCOC 3COSA 2FF5A 3WDSA 1E1NA 3QE0A 3QWIA 4NPAA 5K99A 1JDBB 3EYAA 3CLHA 4PWZA 2ACKA 3PJFA 4DLAA 3NNNA 4LRQA 2UYYA 1AKRA 2O1WA 3RLFA 4BAUA 4EJ2A 4RHFA 1AOXA 2CDNA 3M0EA 3NONA 3P4XA 1DFIA 1HOTA 1P19A 3WSWA 1P2VA 1OAKA 1GQQA 5DGCA 1IH8A 4BTEA 2VA9A 4B33A 3QHQA 3U6KA 4WY5A 1KIMA 4FQ5A 5CVCA 3IP6A 1QG0A 2BFBA 3K05A 3F8WA 3B1KA 1WB5A 5A05A 5K4AA 1SMKA 2YDXA 2LCFA 1K9VF 2W6OA 3MPUA 1WCXA 1BX0A 1YE5A 5FJJA 2NO7A 3RK0A 1ONBA 4G0NA 5REQB 4JC0A 3LGSA 3A9WA 1U9CA 1CY2A 5HTKA 4WH0A 4I1YA 3AH8A 4Q7JB 1JMKC 1UBKS 2JGJA 2G1AA 2OV2A 2QG4A 1PK7A 1TT5A 4DLUA 1RZ3A 2A9PA 1VL6A 4NBVA 3V1KA 3VTZA 1T4CA 4F6RA 4Q05A 1E1RD 2C3MA 2VR1A 1P9OA 1BXKA 3PQFA 2J45A 3KL2A 1B42A 5D84A 2B8WA 3TIGA 5A06A 1XVLA 4KO2S 3WTBA 1MUUA 2EARA 4DDHA 3OT4A 1SHKA 4XPZA 3EFBA 3ZDCA 3WFZA 1IDN1 4LV8B 4PCVA 4P3XA 1G64A 1P8AA 1ML4A 1XA3A 1SOMA 5DJ5A 1JDPA 1ONNA 1WDMA 3KSDO 4FD2A 5C8ZA 3CZMA 2XSZD 4IGIA 1JLHA 5KB3A 1JE0A 1XVTA 1SIWA 2D1SA 2HW8A 3T7KA 3ESZA 1UP6A 5EXPA 3UXYA 1KZGB 1ZJJA 3V2UA 1E1CB 1W0JA 3OZXA 2L0XA 4PIMA 4WLEA 1VTKA 3FWPA 4QUGA 3T3MB 3X1YA 1SC1A 1S02A 4M1TA 5ETJA 5HF5A 1B7GO 3HDTA 3ZCQA 1PL0A 4IIXA 2DQSA 2VWGA 5ICMA 4GT1A 1DAMA 4GOLD 1JZTA 2XHZA 5FTWA 4DNOA 1R0XA 3VYVA 1BD4A 1TKCA 1ZJYA 3L7KA 5TMEA 2HOQA 4PFQA 5LZ7A 3RUEA 4DRZA 1D9ZA 3LYAA 1X7ZB 1RXCA 4NFSA 3I09A 3ZI0A 2O8CA 4JUBA 2G7MC 4TSFA 1OXKB 1TIPA 2D5IA 2PY6A 2AEFA 5JQGF 1HV8A 1TTQB 2NZ2A 5IF9A 1NY5A 1P62B 1DOAA 1M6VB 1W52X 3QPWA 1LBHA 2VNJA 2HSEA 4DV0B 3C1AA 1LH0A 2PS9A 4ALNA 2XT6A 4ZANA 3QMVA 1XHLA 4J07A 4CCYA 2O5EA 3TCXB 4BRUA 5TV2A 5CW2A 2CNWA 1GZVA 2CSXA 1X9HA 3E18A 1NBAA 3V8EA 1NLZA 2CDAA 3ECAA 1AHNA 1ZHHA 2RHDA 4QRHA 2HN9A 1NXXA 1F3OA 2Q9CA 4B5KA 4JP5A 3HK2A 4GZ3A 1NXTA 1JR6A 4KIGA 5JCPA 3DDCA 3TR0A 2HRDA 4YO8A 2AN9A 3CLSC 3OUZA 4C05A 4DC0A 1BN6A 1EZ4A 4RZXA 2FVXA 1O9GA 4XA8A 5FKJA 3EGVA 3THWB 5AWFC 1UAAA 4FSHA 3C3BA 5AJZA 1JDUA 3CJTA 1UJ4A 3CLUC 2DF8A 2P5UA 2UZIR 4OJNA 1P6XA 1R6VA 1ZUHA 3GROA 2BM1A 3FI9A 3OFVA 3STYA 2A5JA 4NJMA 1ICIA 2X19A 3B13B 5BPHA 4AO6A 1BWSA 1KVRA 5KZMB 3I9MA 1F9EA 3HSYA 3ZWNA 4MPRA 2EX1A 5DEOA 3B6EA 1EFAA 1EVEA 4FCCA 1T35A 5CTAA 3U7IA 1JKIA 3FNHA 2Z5GA 1CVIA 4WNAB 3I53A 4G0PA 5DNEA 3RVKA 4MQEB 3TSWA 4PYLA 4CNBA 5JY6A 1PVOA 1KR2A 4P53A 2WJ6A 1AUOA 4GU5A 5HK8A 4DYDA 1UC4B 3TUJC 2VOJA 4HQLA 2FSIA 3ER6A 4HVTA 2NSYA 5F3WB 4MGZR 3OCXA 1LPBB 4O1MA 1NVKA 2FMHA 1QTQA 2O8EA 2WT9A 8OHMA 1N25A 2HHCA 5ERGB 1D8AA 3SS9X 8MHTA 1Y1KE 3B1JA 3OOSA 5IVPA 1YDHA 3GEIA 1FVOA 4H60A 3MSXA 4Q01A 3OJEA 3MC1A 2Q4DA 4JENA 3RW9A 4URUR 1FDWA 4NCHA 4M1MA 3OCZA 2IEIA 1GSIA 3DS8A 1WZCA 4BLWA 4ZFNA 4F7WA 5IHPA 5A04A 4BVBA 5JEDA 4PWYA 5EKTA 3SY8A 4DVJA 2WFZA 4E2ZA 3U9TA 5A9RA 1T2VA 4FBGA 2Q4BA 4F5WA 4RW0A 4YRRA 1U80A 1XXLA 2O2ZA 1A71A 1NBOA 2Z8YA 4OHRA 4AN0A 4C0XA 4YO7A 2GN6A 3AF2A 4NI5A 1K08A 1YQDA 3A37A 3EEYA 1Y6RA 3H13A 3OT5A 2CD9A 2XUKA 3OC6A 4NG4A 4URZR 5EZYF 1KBZA 3ASYA 1ZOLA 3VQTA 3JTMA 1ATZA 3LYLA 1NKTA 2P2NA 2G4VA 3VKVA 3OT1A 2J6HA 3MTDA 1ZC4A 4C0WA 3NW9A 1SKYB 2A1TS 2PU7A 4NZYA 2A9FA 5I3CA 5L53A 2NZJA 4JMLA 3TSAA 5L8VA 3ZGXA 2IBMA 3PGXA 3EW7A 1R8QA 1YVUA 1K6JA 5IARA 2GKSA 2OZLA 1C1XB 1NYQA 4I6EA 1U8YA 4KQ6A 1ZMRA 4D25A 3FDZB 1X74A 4D9CA 1ZH4A 2R6JA 3SSMA 4R69A 4BMXA 4BLRA 3CNOA 2PSDA 3Q0EA 1JYEA 4HLNA 2CVHA 2P4UA 1DKLA 3LLUA 3DOOA 3B2EA 3RU9A 4FT2A 1FPQA 1GG5A 1AN0A 1Z4MA 2EG9A 4CN9A 4QBIA 1BEZA 1EMDA 2NU6A 4KQJA 2QENA 3ZWQA 4KCGA 1DINA 1XQ1A 3CLTD 4URFA 2QGNA 3WBFA 2Y6UA 2V55B 3EVCA 1O3YA 3IOMA 3K5HA 4RS3A 3ZI4A 1JQDA 2FRDC 1F0KA 1TM5E 3KSMA 3TQSA 4MI9A 1HT3A 3S2IA 3VTKA 5ULLA 1SBHA 1EFKA 1QC5A 3HKCB 4B3HA 5JNRA 2OGUA 2XODA 2XE4A 4FXOA 4K2HA 5K3FB 4C2AA 2J6CA 3N3BC 2W43A 2XA1A 4UAVA 4QM7A 3TGPA 1R4ZA 3BIWA 4LECA 5FL3A 1JA9A 5E6UB 4HCJA 3FCUB 4HB4A 1KDVA 5IF3A 5CA1B 4KRGA 4D4LA 3KYCA 3QXCA 5BQPA 3U39A 3OEHA 1IMOA 2ZG6A 1AKQA 3OM8A 3EWIA 3SIRA 5TT0A 1XEAA 5KX5F 4CETA 1AB6A 3EQ6A 4UTZA 5BMOA 1VGQA 2PYDA 1D2MA 2HCRA 3K8QA 1EH5A 5LSAA 2BMEA 3FB1A 2K7FA 4KDEA 3FGZA 4WK4B 1C1YA 2BLLA 4RUKA 4Q9LA 3ZWYA 2HO4A 1W30A 2WFLB 3ZWDA 2G36A 3IUQA 4RHYA 3CEJA 4O4IB 1PIWA 3ZWKA 3TDMA 1G41A 2O2HA 1BXRA 1OI7A 2E37A 2HHAA 3CH6A 5DHUA 1A9SA 1F8FA 1JSLA 1T9KA 3QTBA 2HMVA 1J2UA 2BIFA 3BMXA 3FSRA 1B1CA 1NBMD 3TAUA 1UZNA 3ZBTA 4HC4A 4HRVA 4R51A 3D6HA 4QOSA 2GD1O 1OREA 4QSMA 3T1TA 4ZT7A 1GUFA 2Q28A 1IHUA 3DVAA 2H31A 4HR7A 3K4HA 2IY9A 5EKSA 4NS4A 3AVPA 3HCCA 2FSUA 4FJ0A 3WSVA 4DADA 1CS0A 2NU8B 2C97A 4L5YA 4XCXA 2WJIA 3A1NA 1GLNA 1H2AS 3GGSA 3PG5A 4BS9A 1NAHA 3C5WP 3AG6A 1ACMA 1ZJ4A 3H1EA 2LCQA 5H82A 3CINA 1QB7A 5EIWA 3A4MA 5CXQA 3INYA 4BFTA 4HSEA 1E59A 5K3SA 3V5NA 1Q0PA 2Y9MB 2GT1A 3BRSA 4MGEA 1Z39A 4YYEA 2YWRA 3UHAA 5EWMB 1YNOA 3LCRA 1DKNA 4L4YA 1LLDA 3DHNA 2A67A 4NONA 5JTUA 1YL7A 4BPBA 5EPUA 2C07A 1Y4SA 1FRFS 1Z06A 2BN4A 4BAZA 3WA6A 3OURA 4CM4A 4ESEA 1AV6A 1L4NA 3MOSA 4F2HA 4ETMA 1ZMOA 4RH3A 1M5TA 4PN3A 1OXXK 4K7JA 1CDDA 3VKHA 3BYZA 3BK1A 3AFOA 4UFNA 2BR5A 2OV8A 4X41A 2WU1A 3V2IA 1T5HX 5I8ZA 1LTKA 4Z4GA 3ETJA 5FH9A 1XNGA 4GR5A 3U5TA 2I1QA 3W6OA 1PTJC 4R4JA 3QE3A 3EIEA 2YTZA 4C4XA 1X1RA 2EX0A 4PNPA 4YROA 3WP1B 1SR8A 3SLKA 2FPUA 5CNMA 5HKLA 3TTUA 1PZGA 2G72A 2MSDB 1SGWA 4ENVA 3HDQA 3AHHA 3N9IA 1DKOA 2G8NA 2HD4A 3UMCA 4EHAA 5K8UA 4XD7D 3TK1A 5B1YA 5DRTA 1Y6GA 4U0JA 1MB9A 1NW9B 1EFRA 1JLLA 2D2IA 2ZRQA 2ZB2A 3AIOA 3P7MA 4O1HA 5AI6A 2RE8A 3S99A 1U0EA 3L0ZA 4ZK2A 2WG2A 4X1IB 3VR4A 3HFSA 3E2IA 4NMXB 1QGDA 5CXSA 4GX5A 3I12A 5TPZD 2A14A 1EQUA 3I3SR 4KI7A 1RRFA 5KYYA 3OE5A 3IUBA 1SXHA 4U00A 2O8NA 2P67A 5AVKA 4PAQA 5CG2A 5A71A 3WHLA 4UPEA 3H1BA 1RJDA 2HL6A 4YAFA 3TLYA 3L6BA 3V4LA 3ZKWA 4YMLA 3DVLA 2VTBA 3N8DA 4OXNA 1XCMA 3JAWA 2I9PA 1RZUA 2WAYA 4O0LA 4O4HB 4KBYA 3YASA 2LCIA 4ZJYA 3KQTA 4BNHA 3RQSA 5I9TA 2ZSFA 1NRIA 1XAIA 2GR9A 5TSDA 2IYSA 1X86B 1GJRA 5F5LA 2PA0A 3HKDB 1F8YA 4PPGA 4ZCRA 1JZQA 2MJLA 5F51A 3LWNA 4CQMD 1WXGA 2O0HA 1J07A 4M3NA 1ST3A 1SVSA 2Y1CA 3B78A 4LYAA 4X7RA 4HAZA 2DSTA 4ZHSA 5IU6A 2W48A 3KWFA 3QEOA 1BS2A 2JI7A 4R1UA 1QMPA 3AXTA 5DIZA 4XTRA 1VYHA 4MOWA 4N54A 4YQZA 3F9CA 5AI4A 2OLEA 2RKBA 3GXOA 4DLRA 2VG8A 3DWEX 5K09A 2W2VA 1L5RA 3ZHOA 2AS0A 1V5WA 4X8LA 2YYSA 4JYZA 1NV8A 2BWJA 5P21A 1QLJA 4OUDB 5FPPA 1FXWF 2BM0A 4F2GA 4MYCA 3WICA 1CB7A 1PR4A 3DGEC 1HE5A 1V7QA 5GWXA 1D6SA 4AROA 3DBHB 3R20A 2AKEA 3CH5A 3CYFA 2CLSA 3WK8A 4ES6A 3DUFB 1QXSA 2XKBA 3ETGA 2RGAA 2LIPA 2X0RA 4A15A 1W25A 4UNRA 3ANTA 3IXLA 2F90A 5H0IA 1L3CA 2JAOA 1HL7A 4DYVA 4EY5A 2FPKA 5C32A 2IZOA 3F6SA 4PEVA 3UV7A 1A9YA 1B73A 2R8RA 4DV2B 3QPBA 5FORA 4DMLA 4I4TB 3LC7O 5TMBA 2F4VB 1OFTA 1Y7TA 1V16A 3PRJA 4N49A 3VRHA 2VK8A 4D43A 3DMNA 1MH9A 1RFGE 2DFKB 3L18A 4F60A 1E1YA 2QSZA 2DHEA 1KJNA 2HRBA 5J4VA 4FOPA 4M9QA 1EIWA 1TJYA 4LGCA 3U44B 4RWZA 2XGGA 1DP4A 1NT4A 1VE6A 4M98A 3A31A 1U9IC 3LUFA 4C1BA 2X41A 1UXOA 3KOXA 3C6BA 3O94A 2IOFA 4V39A 1CE8A 3BE5A 4E09A 1MGPA 1BS9A 4MVJI 3VDXA 5KNDA 2Q99A 4IJUA 3PDUA 4U1RA 3MS7A 2LVBA 4RZHA 3L3BA 3KYIB 4DSOA 5B4TA 2IOYA 1P5HA 1IG3A 1NN0A 1T2AA 2BGRA 2F1RA 2A58A 1X70A 3G8YA 4MUFA 2WK1A 4LYGA 4O33A 3LXRA 3UJ3X 1NIJA 1PZMA 3SM9A 3WHKA 2G70A 1NI4B 1QPGA 1SCKA 2O2EA 2ZPAA 5K3EA 4HNQA 1DC3A 3GZNB 3MJRA 2YH2A 5JDCA 3T3DA 3HR4A 1CUBA 4CLRB 4Q4JA 1VE5A 4MJ3A 3E7WA 3NLLA 4WMLA 2FG5A 2C54A 2P1ZA 1G9TA 3A0RB 2VT6A 1UT8A 3P5BA 4K9NA 5CFQA 5FUMA 1A9XB 1OHHD 4LDQA 5BV8A 3I01M 3N0VA 3P2YA 3DLHA 2X4GA 4BNIA 1WCV1 3HC7A 3M70A 3KOZA 2WWIA 3MF4A 5EYPA 3RRZA 4ENUA 4S35A 1Z8HA 5SYAA 4DMGA 3HM2A 2EFHB 1FYDA 4QYMA 3B7GA 2X23A 4E4RA 1QYCA 1XCPA 3H75A 3KB8A 3D3WB 4E21A 2DFNA 4CLEA 3LDHA 2FOXA 5TMDA 1A8SA 1BXGB 1E3IA 1Q74A 5DSTA 4S0ZA 3RYCA 3DOHA 3H8JA 4FN4A 3V8NA 5AM4A 4DBLC 1Y7LA 2C2BA 3KZXA 5J58A 4TMYA 1JDJA 3IA7A 4CKWA 2XT0A 1KSGA 4M0FA 1RZRD 3WLHA 1WPQA 1KAQA 4NDNE 1LK0A 2VYNA 3K8YA 3C3CA 3OE4A 4QVKA 3CZRA 5HFAA 4YACA 3D5EA 1FNCA 3TNJA 5CPBA 1I0LA 3RT1A 1EJ0A 1SOWA 4EQZA 4W5OA 2GEDA 3V1YA 3RSZA 1WOYA 3JQFC 2VKTA 1WEKA 4BJ6A 4CTNA 3DZCA 2VHVA 2B9EA 1EA5A 5CP8A 5JCZA 4XM2A 2CJWA 3IJPA 4NCBA 3EAFA 1W2HA 4J3FA 2PGDA 3PPVA 3U40A 1A9TA 1G2OA 3CX4A 1OFVA 4QGSA 4CDRA 3J7AC 5JNWA 5HDBB 1S1MA 1Q91A 1NVUQ 3LP5A 3U4QA 4L57A 2Q9BA 2QUIA 3GVXA 1GFZA 4K03A 2E3JA 2C2XA 5IN4A 3HKBB 1NT2A 4R1MA 4RGBA 3O9VA 2UKDA 1O0SA 4AJKA 2WUVA 1XRJA 5L9AA 1U8CB 2C29D 1SC6A 4PN7A 5LDDC 3TVTA 4ZGGA 1QG4A 2QJRA 5DE3A 4GX0A 3DBLA 3UKOA 4LZOA 1EVIA 4IDNA 1Z0IA 3D5QA 3LPMA 4B7CA 3RABA 2FEMA 4MIYA 2JJMA 1XWFA 2WQ7A 4PYIA 5JQGB 5K3DA 4WKBA 4D3XA 4WXRA 3HFJA 1ISSA 5FYQA 2H3EA 4RCZA 4KH1A 1R5JA 3CNQS 3NWJA 3EZ9A 3DEYX 4QODA 2RI0A 4Q1AA 4TMTA 5JSUA 1ZNWA 3ABZA 3DCYA 1P5ZB 3QLVA 3VAZA 1ENZA 1ZD3A 4FHGA 3M82A 2XGJA 2JIZA 3CW2A 4Q3BA 2Q21A 4DJAA 2O2DA 2J67A 4RXMA 2Q5HA 3FTCA 4QHYA 4J6EA 1FB5A 4DY4A 1D09A 2G0NA 4ATNA 1K6EA 1LGYA 2VSQA 3QLEA 4GX2A 4ZVPA 2OCKA 4M7WA 4Q82A 3V32A 1RRKA 1MX5A 4IUCS 1AMUA 1JPJA 3ZHBA 3ORRA 2QVXX 1D9XA 1EE1A 4QJ4A 5IM4A 1X0XA 4MUNA 1QGED 3C6YA 3H1GA 2ACEA 1ISJA 5JFOA 2GK7A 4I36A 3RRYA 4RTQA 1WUTA 2Y66A 1VCOA 1KO7A 4GOJA 3WQSB 5I4KA 3U17A 2XADA 4EO7A 5TT1A 2IDMA 3ENKA 1POWA 3HVIA 2DT5A 2CDRA 3PZRA 5DNYB 2ZCJA 1T8RA 2D0PB 2VTVA 3KJHA 1U7OA 2E9SA 3N5KA 1MDFA 1P60A 5GZ1A 2QV0A 4QUEA 4TLBA 2JAHA 4K87A 4J9UE 3HVUA 4O59O 2MWMA 5BYKA 1IONA 2Q1UA 3CA8A 4AY3A 4EGCB 3OKFA 3R5HA 2QQ0A 4AW9A 4AF8A 3E4CA 2WKSA 1IUOA 1ONOA 2IT1A 1IRXA 2E21A 3GFGA 4X44A 121PA 5DBIA 1NE2A 1FZTA 2XUOA 4WLFA 1PR5A 4JELA 5CX1A 1OGYA 3LKVA 3ZCUA 2CL7X 4DM3A 2AUMA 3RSFA 4P58A 3O21A 3TVDA 1CUHA 1J56A 4W5HA 1W85A 1XF1A 5ITSA 1SUAA 1I2BA 4R0MA 4QNMA 3PUZA 2IUUA 4QKQA 3ADDA 3PZBA 1HKHA 1ODFA 4P7JA 1RCUA 4JJIA 1T1IA 3IH5A 5FV4A 2VJOA 3U7FB 2FVYA 3DDOA 3NHRA 1O1YA 2VBFA 3CC8A 3OD5A 5JAIA 4Q9HA 1NZJA 4FHFA 3NUZA 1JKMA 1L4BA 4MR7A 5EIFA 5EJ6A 1Q57A 2Q9UA 2SNIE 3JWJA 3V7FA 4E33A 1GITA 1QWSA 1C0LA 3KBOA 3K73O 2B98A 2JIBA 1KYWA 3I2HA 4MVJG 4QNNA 5EZYB 1NXQA 5LDGA 2GAIA 1UFRA 1DC6A 1JG3A 2Z5FA 4X1YA 1DARA 2XX3A 3QTTA 2R4UA 4HYEA 3W04A 2DG2A 1ZVKA 2I7DA 2GJ4A 1J2RA 3ZJUA 1W0KA 2GRUA 3F8SA 4UNPA 2NVUB 1L5QA 1LEHA 4UBNA 3ZDQA 4OQNA 2NUTB 4ALKA 3QJGA 4FNAA 2ZRCA 2QOEA 3CSDA 3O31A 4CTKA 1UC9A 1V6AA 3PUHA 2BBSA 1OFUA 4LRUA 5DF1A 1GNVA 3N58A 5JZBA 1Q0TA 2AMJA 3A70A 1CF2O 2IKSA 1CB0A 5CH3A 1NTOA 4MQ4A 5FPHA 2P9CA 4CIDA 3P19A 2RHBA 2CSUA 1JHUA 4ZYLA 4GM0A 2BFPA 1I01A 2HK8A 1T5OA 4LSMA 4L07A 5KTKA 2GI4A 3K6JA 3B60A 1SB8A 2BFAA 4HDRB 4RV5A 3L06A 4FPXA 2VATA 3W78A 4QDXA 1ZOIA 5E4TA 3N74A 3AESB 4ND5A 1MB0A 4RTMA 4FW8A 1Y1QA 3AR4A 4AT1A 2QYOA 2COKA 3OWHA 3EEIA 2CHQA 3FR8A 4Q12A 1RKVA 3ZH9B 3EDOA 3GPDG 3WY9A 1MLDA 4K6FA 2JA1A 3FF1A 3TKAA 2QUHA 4TXNA 4B6EA 1O5TA 5ILOA 4BB5A 1W6RA 1EKXA 2AW3A 3A6ZA 4YP0A 3AX6A 1W94A 4KFRA 1THGA 4RYLA 3WAGA 1ZNXA 4BFLA 2EGHA 2VWHA 4LVUA 1DJQA 4JNKA 1G5TA 4G4IA 3KJEA 2FPSA 3RS3A 3ZU5A 2B1RA 3LQ1A 3MYYA 1HG0A 4MUAA 4R8LA 4J03A 3T7DA 5KX5B 4J1QA 2C9DA 2JGEA 3B1WA 4NDAA 3W79A 4ARVA 3UK7A 2RMKA 1QKJA 3WMEA 4R84A 1ZVMA 3M2TA 2B8JA 3F98A 4GF5A 1JIQA 2Y77A 1Z08A 1N2EA 1UKZA 4Z7JA 1OILA 1EYZA 5IAOA 2FW9A 4U3JA 1H8HA 4PXAA 4N7MA 2G7ZA 2WJJA 1LQ2A 4AKEA 2F7SA 5CYGA 3F6BX 4HO1X 4KIJA 5FXMA 5DASA 3C8DA 2ZK7A 2XUIA 1YBVA 3WR5A 4BLUA 5A5GA 2DFTA 1KI8A 2H5JA 3NUQA 4ASUA 3O5AA 4IAOA 1KY4A 1QO7A 2PT9A 2QRQA 3HJHA 4Y6QA 4BWGA 3MD0A 4RTJA 1MB3A 1HWYA 2WF5A 4PSCA 4EDFA 2I0FA 3FNGA 5A6SB 2IE0A 2X58A 4RV9A 3EFEA 4ZYVA 3PGVA 5BWNA 3RRFA 2VQFB 4YDQA 5LU9A 3RHSA 4ALLA 1GUYA 2FN7A 1U02A 3F7TA 3TOXA 4I5EA 3JZMA 1M1XB 1V3QE 4F6CA 3ZWVA 5AKEA 3IMGA 1HYBA 1A76A 2HGSA 4XPIB 4GC5A 2J3MA 3C8HA 3LUPA 3TZ6A 3LBFA 5DB4A 3AUKA 2C7PA 2C9YA 1TAGA 3CVOA 2KW5A 1UIRA 1ULZA 5KWVA 2GILA 4OXKA 5LQCA 4HNHA 4EMTA 2WUDA 1Z6XA 2PWPA 3LCJA 3LA8A 1YS4A 4KVZA 4RC9A 3FYUA 2JD2A 4X45A 1KTIA 2C0QA 2UU9B 3D9QX 4GFDA 2PQMA 1F7UA 1MB2A 3B5JA 4DM7A 5FUBA 4PYRA 3ZNQA 2XE6A 5A4IS 5ITVA 3ZDBA 3C3DA 3Q8KA 3NOQA 4B3SB 3Q6NA 1GRQA 3HXQA 1E9DA 1R37A 3PRKE 3C4QA 1HH4A 1ZGHA 4OQDA 1GCAA 4GP9A 4LTMA 1PBTA 3LH5A 2FW7A 4OB7A 2FGJA 4EAAA 2PT5A 5LD2B 2D8MA 2YWBA 2NN3C 4XR4A 1QPZA 3NC0C 2Q4TA 4KXMA 1RXYA 3BICA 3EXFB 2ZSEA 1GPAA 2CNBA 3MRSA 2YMPA 4HH4A 1NR7A 2VYVA 5CURA 2C2WA 2DY1A 2GX6A 2YCBA 2ZANA 5I7SA 1KZ9A 4V1CA 4LJSA 3AVOA 1G20B 1Q1QA 3TS1A 1A4RA 2SHKA 5G41A 4DSUA 1TJ4A 4WAUA 4S3MA 3AY6A 4O4LB 4MWZA 1ADCA 1CR4A 1W6UA 2R8ZA 2ZRDA 3GFSA 3ROTA 5T67A 4HT3B 3OQ6A 2W71A 2BEUA 2VF4X 3AZQA 2FLWA 3HB5X 4J4HA 4PINA 1X7GA 2FP3A 2QRLA 2WV7A 1N2IA 1E2LA 2NZYA 1SKBA 1O9BA 2VP5A 2QTZA 3N1UA 4UEQA 1D1QA 1A97A 4KN8A 4Q9IA 2QN6A 4POAA 4Z9YA 3MHPA 3D3EA 3ZUGA 5EIEA 1Y1TA 3J7TA 3OTQA 1KWKA 2PZAA 3G6KA 1EUDB 1I5OA 1C2TA 1JFLA 1J8DA 3N70A 1WTCA 3OWXA 3NOXA 2PX8A 4YUZA 1P9LA 8AT1A 1PWYE 2GUWA 2PFKA 3MJCA 5JJIA 1WKCA 1ZM7A 1V8DA 4WEQA 4ZTUB 1N5RA 1OYYA 5DOZA 1TPYA 3GOQA 2CJFA 2CMHA 3K20A 3WBKA 4DTIA 2ZSIA 4TVKA 4M38A 1MX9A 2REOA 2ZIUB 3FNEA 4LXQA 2GZMA 3PEWA 2RK3A 1AQJA 4GR9A 3I4CA 2VT7A 3O1IC 3ODGA 5IASA 4IH4A 1M2FA 1IL0A 1SVLA 1W19A 5C7IO 1U9YA 4K6CA 4KIUA 3TX6A 2JFHA 1JHYA 2JLQA 5C2JB 1CJMA 5JJLA 3EZ7A 4L8VA 4NAUA 4V2UA 3B3JA 4J0FA 1R66A 1P0PA 1ZG3A 2L18A 3D6VA 3HRHA 4FBLA 3KYDA 4YCAA 4BGVA 5B3LA 2PS1A 3IX7A 4FXPA 3QUBA 4LRTB 4ZAZA 1Z0ZA 4B6GA 1BW9B 2GBIA 1ABBA 2NMVA 4XTCS 4R8VA 2VJBA 2PMFA 1MIOA 2FMFA 3U13A 3UK6A 5C81A 2W58A 1R15A 2AQHA 1G2PA 6LDHA 2WD9A 3QY0A 5LDHA 1KGDA 4REMA 3RAEC 1UWCA 3LO8A 3NBXX 1Y8AA 4QUBA 3EE6A 2COEA 5FUWA 1IOLA 3VBEA 1IUPA 1WMDA 3AEXA 1LDMA 3P20A 4I5IA 1UR5A 4QDTA 2IYTA 4QXMA 3F9IA 5CG1A 5JZOA 5K5EA 5MFZA 2JIQA 1Z3IX 1SCIA 3TE7A 3ISVA 3PHLA 1G98A 3KSBC 2RHWA 3AJAA 4NMHA 4R01A 3AOEA 5THQA 1J1IA 2BTQB 3CE9A 3NTRA 4N5IX 3V4OA 4AWXA 4ZDJA 4RHCA 3VR1A 1E5LA 2AFHB 2G0AA 1IZ7A 3QVWA 4B3FX 1ESMA 1HXHA 3OBIA 3V2HA 1KZHA 4CM1A 3AERA 1IM8A 1BQ3A 1QUFA 4DCJA 2HPHA 3WK5A 5HE8A 4KMSA 1PHPA 4B81A 3FN4A 1VB5A 4NC9A 5CB8A 2IY8A 3HB7A 3PTZA 4HDSB 4JLOA 1DRJA 2OGWA 4OOEA 4P0QB 2NUAA 4MUHA 1SCQA 1O6ZA 5KJ6A 4QOFA 4R8MA 3CB4A 1S96A 4GVXA 4H7HA 1RRGA 4DLXA 1ZIYA 1WKVA 1K6MA 3QENA 3LUKA 2I4RA 3QEMB 1QV7A 3K0AA 4KJXA 4LK3A 4BVEA 2AOUA 2VUHB 3RVPA 1QIGA 4EHHA 2WHXA 5KNBD 4ERXA 5IABA 4MRNA 4Z86A 4KQXA 4BNLA 3OJFA 3TGWA 3JY6A 2NSDA 3UKJA 3E4DA 3VPSA 1NW3A 3ZV6A 1RJEA 1Y3AA 2VSYA 2Z3WA 6ABPA 2OCBA 4X1KB 4WD3A 1L4MA 2JFWA 1G38A 4LZAA 4CEIA 1US8B 3EIQA 1KYVA 3N28A 4U2EA 4KYTA 4OQXA 2Q27A 3RPEA 1IUKA 4JJ8A 2L82A 5BN4A 1OFUX 2YIVX 3MUFA 1YDFA 2KLHA 4KOEC 4MA0A 3TZQA 1NMXA 3JW8A 3V8RA 3OE1A 3H8SA 3ZDXB 5AFSA 2Q0HA 4Q9AA 1Y4AE 2DH5A 5F2EA 2BGIA 1RI1A 1EUCA 3MWFA 5CK5A 2OQVA 4CIXA 5LKAA 1GZHB 1IB0A 4ZEOA 3VYSB 2ACVA 1CK4A 3FPJA 3VPBA 5E2IA 3AVUA 1AHIA 2XUAA 1R3UA 4KFTA 1G1AA 3BL5A 1ZSVA 4UEWA 3RC8A 1I3NA 2FH5B 2KB0A 3SMQA 5K7SA 1SURA 1Q0ZA 2ZYSA 3OSZA 4MNTA 2P11A 2IIPA 3DKIA 4G2TA 2WUEA 4EQ6A 4OQZA 3JQGB 2VJMA 4H15A 4ND6A 4UU0A 4PTYA 3STUA 4ZD6A 4Q1FA 3DQQA 2QNIA 3I28A 4AKSA 3IJRA 4DG5A 4TLAA 4DW8A 1I7QB 4MQUA 4DCOA 1JP7A 1MRSA 2FFQA 3EQ7A 3GP5A 5A4KA 5AD1A 2GSWA 1VG9B 4JP8A 5K0FA 1F4VA 2OC4A 2CMFA 2WZBA 1A2KC 4RA6B 3SBDA 1RVV1 4XI9A 1Z5OA 3PVZA 4J0DA 3SDBA 4F4CA 3A6PC 2X7JA 3SHVA 3WKEA 2XE7A 1TVKB 1GLGA 1XRPA 4XGKA 1V45E 2R8BA 3U2QA 1APBA 1VLHA 3CVXA 3D59A 4CM9D 16PKA 2KMLA 2WKQA 4O29A 4JSRA 1OAOA 2YJ3A 3OHPA 4OY3A 2GS9A 3RR2A 5ITWA 4QPZA 5K0NA 2B37A 3A3OA 3NHBA 3MMXA 3OEEA 4P9NA 3OQVA 2VK2A 3A1FA 2PL9A 4BJ5A 4D92A 1W93A 3LWBA 2GF0A 5AVQA 1U0BB 2CY0A 4IKOA 2ECKA 2ZYHA 4TKUB 4EY6A 4LBYA 1WQ4A 3KZ1E 3REQA 4J0QA 3CR8A 3DWGA 1QZTA 1WA5A 2PK3A 3Q9NA 3STWA 2VN8A 3ZGYA 4TS1A 3RAFC 1GCUA 3ZZ0A 4Y6OA 1CF9A 3LLMA 4U2DA 1UMBB 4EA6A 1ZEMA 1ZC3A 2QW0X 1RQXA 3OA2A 3PFNA 5M5BA 2I1LA 3IV7A 3SKYA 3WLTA 3K3PA 4E0BA 3GJQA 1QU3A 1EP9A 1TPZA 1JMYA 1XDZA 3PQ2A 1Y81A 4J43A 2YOGA 5K8TA 1Q14A 4MCHA 1S2IA 2QTAA 3TUIC 2EW2A 2GN4A 4Z2YA 1VLLA 3D1LA 3DB2A 4HNRA 3PGLA 2FPIB 1N0HA 2FQWA 1YACA 4G0YA 1YC2A 4JZYA 2GPYA 5E38A 1OWPA 1M75A 2CYCA 2DGDA 2JFFA 3DV9A 2IEGA 3SIPA 4XIIA 5J40A 4MS1A 1M67A 2VCHA 3NT5A 1ODIA 4RM2A 4RVUA 3WYDA 4KSYA 5FBVB 4C7OA 3FJYA 3MBIA 3OZBA 5ELLA 1VHLA 2PZJA 4DG8A 4OMCA 4UCQA 2OCDA 3TGLA 3V7WA 4A6XA 4BJHB 4YRMA 2W6MA 3U60B 3G0OA 1KGSA 1E99A 3AW9A 4BE9A 5BXYA 1HRDA 3VXKA 3HMQA 2FJ0A 4CMHA 4FGSA 3EY9A 4UM9D 4A6PA 5AXCA 4MRAA 1JJIA 1DJPA 3G5LA 2C7VA 3SHQA 2HH9A 2OHVA 1DV2A 1YZTA 2J5QA 1UJCA 1Z9BA 4B8WA 5A7GA 1ARZA 1KO8A 2GH1A 4MJLA 4Q5IA 4QBKA 3SC2A 4ZEXA 1MORA 2ZUUA 1YDMA 3B1YA 3IBGA 1AE1A 3UTDA 3VNVA 2IVZA 4J0CA 4M0DA 5DX1A 3IEXA 3FRHA 1CF4A 3JD1A 2AJBA 5JMOA 3SC6A 4YRTA 4AUNA 3E7DA 5BRAA 1H0KA 5ALFA 4BGIA 2RSLA 2XD9A 3GPBA 3ORQA 4N7RA 1DBIA 4Y2HA 2WICA 2ACWA 4KXNA 3I2GA 5IBPA 3C6ZA 4LS3A 2BM9A 1ZUD1 3EZFA 1ST2A 1MW8X 2B7BA 3PHGA 3NC4A 4R9NA 3SS7X 2GLUA 4FOTA 4R3WA 4MO9A 3RWOA 3S2FA 3ANSA 3ZHSA 2Z2JA 3N6VA 1TVMA 1RKQA 2V3VA 1SA0B 3DNPA 1L6RA 5IXSA 3UWMA 2PD3A 4WW0A 5DK6A 2Z6QA 2AD1A 2DWOA 2JVJA 3UO8B 3D7NA 3ZVRA 3ZD9A 1U7PA 1V96A 4OK3A 5C18A 3NDRA 4GE0A 1EQAA 5CUQA 4CWAA 2P9EA 1FUIA 5CFOA 4UHEA 1XEXA 2ORYA 2HYDA 3HDVA 4XZ3A 4FS8A 3RYTC 4JIMA 3WSTA 1K5GA 1T10A 2LXNA 1CERA 2ZB3A 3OZGA 4RAOA 5EJMA 2OZKA 3IAXA 1JG4A 1GYRA 1G5HA 3I9V1 4PGFA 4XH9B 3LO5A 1EFVB 1DFGA 1V9CA 1IPEA 2OHOA 1I4EB 2HV9A 3URMA 1VBKA 2XY4A 1QU2A 2CBXA 4AYXA 1F1BA 1XQYA 2GRJA 2PYIA 4JH0A 1E5QA 2PIAA 4W1QA 1DUVG 5BN3B 4WY8A 2JKYA 3NI2A 1HMPA 2FPWA 3A32A 2IS4A 2BP7A 2FETA 3PD1A 4HRAA 4CQJA 1J06A 4KMMA 2R1UA 1P2DA 2GN1A 3OY2A 5E7IA 3PK0A 2P2ZA 4YRJA 5CB4F 4L95C 2ZRPA 1Y33E 3EXIB 1PG0A 4RHXA 5F21A 2XCLA 5BORA 1Y6QA 2JLZA 4MP6A 4XQEA 1P1BA 4Y6SA 1DC7A 2LIVA 2W83A 1Y8RB 3AR5A 1PV1A 3LZDA 4DLTA 1XZLA 1AGPA 4KNVA 3OQHA 2QL7A 4KHPB 4DNPA 2UYGA 2P6UA 3OFSA 3ZXIA 3ACCA 2X1MA 4RDCA 1WUHS 2WWXA 3V80A 3MRVA 3TLMA 2D2FA 1IVYA 1VMIA 2FN8A 3ET5A 5C34B 2I2BA 2XTJA 4G8JA 4S2EA 1P9WA 2PKEA 5CFNA 3W8NA 4CLRA 4BMDA 3ZK7A 4UW9A 3DEHA 3UAGA 4HPJB 2W22A 1UBTS 1FVFA 1NNSA 1NYTA 4MKFA 2DKFA 1ZOSA 1IQUA 1COWA 1N6HA 2VDLB 4LNUB 5HE9A 3ZYZA 4TXHA 1C4WA 1PJ8A 3GA7A 1V8OA 3Q72A 1YJAA 2FN3A 3ORYA 4JC5A 4PAOA 4MS3B 5EWLB 5TY0A 1AKNA 1OPRA 3IRUA 2FPLA 3GDHA 3T5GA 4M22A 2XUJA 3EWSA 1TW3A 3HJCA 2HQBA 5HHTA 4BQSA 3EG9A 1P31A 1N92A 1EDBA 4CN8A 4BASA 2EX4A 4FYXA 4BQQA 5GADl 1JEYA 4XE5A 3OF3A 4AZTA 1TUBB 1HKUA 5AHOA 1KEVA 2DUWA 3JVEA 4BYGA 5CLIA 3TLGA 3DCJA 3BF7A 1I24A 4HADA 2YYYA 3BCHA 2VHCA 3P0RA 3R7WA 3RREA 4N3BA 1MT0A 1GTJ1 2XB4A 5U4XA 3EMVA 3WWZA 1Q6ZA 3SXUB 1KYTA 2XAAA 2XUPA 3NORA 3BC1A 1DTWB 2PH5A 4ZI7A 1V48A 1H2HA 1P3JA 3FTFA 3I73A 1DELA 4QPCA 1RXWA 2P35A 3JALA 4TS9A 4WERA 2WYOA 2Z2KA 4HPWA 2OB2A 3DLCA 3WL6A 4R1NA 1G8MA 4XUDA 3H1FA 4LGYA 4FCTA 5EFOA 1X8LA 3O8OB 1I1QB 2AVNA 3OZSA 4MYUA 4REQB 1L7QA 1K75A 5PGMA 4IV8A 1REQB 1Q20A 3AP2A 3JVIA 4OHZA 2JJQA 3IMEA 3U56A 2YQ5A 1GG9A 2QTVB 3LX5A 1TU0A 1XLTC 1Q7CA 2NLOA 4M7PA 1T8UA 3OCVA 4QYIB 3WJAA 1M33A 5EJFA 3MWEA 1FSPA 2DULA 1TGYA 2VDQB 1UK9A 3AY7A 2EBHX 2M6KA 1EWRA 4W7SA 3QIAA 1DAKA 1VE9A 3FUVA 2XMDA 3G8AA 3KCNA 3CCFA 4PCUA 3WGMA 3GEEA 2CC2A 5DLYA 3SU8A 4F4FA 4FNOA 5CLLA 1OZAA 2HTEA 3H1AA 4G65A 4PYQA 3T3PB 4E13A 1UXJA 3FPSA 5BSHA 1Z0SA 1VXRA 4WVFA 1WABA 5BY2A 3MW8A 1UQUA 3NU1A 1QLHA 4L5AA 5DP2A 1E3TA 4H4CA 2JIOA 2HLNA 4K6HA 1RJGA 3A4IA 3H8WA 1JQBA 3R3XA 3T1QA 4DEXA 3OP4A 4HBGA 4P83A 4F4HA 1TUIA 5CLQA 3R0IA 4N0MA 5DYYA 1KKUA 4B32A 4F4UA 4MVYA 4CKEB 1X19A 3WYAA 2ZETA 5LNK6 1JXAA 1IEXA 2K2QB 3VZDA 2BSQA 1ABFA 3EXAA 3AI3A 2OMEA 3BN3A 3SJAA 5C1DA 2Q4OA 3DLTA 3LNTA 1C80A 3LC0A 3MAGA 3KEQA 3PUKA 5E7JA 1PJCA 5KVVA 5C1IA 3R76A 1XQVA 4PHCA 4IIGA 4ME6A 4BEVA 1OX5A 4R9RA 4HWGA 3FZNA 1XCJA 2ATEA 2PMEA 4DIEA 4MYDA 3DFUA 2XCRB 2Q07A 5D3MA 2E6KA 3FAZA 3D6UA 5C5EA 4QULA 5KYVA 4OKSA 3HB4X 3Q7PA 1GXSB 4M1YA 3BSSA 4AULA 4K6OA 4XFKA 2XCUA 1UANA 2MYPA 3ZOKA 2NV0A 1FX1A 1K9SA 5LYJA 5T4FA 1KSHA 4UTOA 1R6AA 3EASA 4DIBA 2C88A 1NRXA 3QX8A 2JHAA 2GPJA 3CN7A 3FGNA 5HVNA 3BGVA 5JZSA 1Z37A 2O2XA 1P77A 3T6KA 3CRMA 4P82A 3IUNA 2EYQA 1UM9B 2VJNA 3IVXA 3KM0A 3N2GA 4IJ5A 4Z0HO 4DSNA 3OU2A 5D87A 3KX2A 4C7XA 2NO4A 4DG9A 1ATIA 1X1DA 4LDJA 2Y8EA 2ZFUA 2BD0A 4I9HA 3D6JA 3R3WA 4C1NA 4P3KA 3GRYA 1OJ7A 1QGUB 1ZONA 4V0OA 5ALRA 2WD7B 4V38A 5GP1A 3W3AH 2B8EA 2NXJA 2OBYA 3KJIA 1YGPA 3KVYA 1AK1A 1Q17A 1N1DA 5J63A 2I6QA 4AZ0B 2P9HA 4IO1A 1M2VB 5ALVA 1RRPA 2HU8A 3EULA 4ILKA 4NAHA 2JBAA 4OGKA 1NG9A 5KMGB 3G2KA 1GPUA 2DJIA 4C4SA 2XNDD 4PFSA 3SFTA 3E23A 4O2RA 4BBZA 2MSKA 3LFHA 3GLIE 1X7WB 1YVPA 3EPPA 4AWAA 2BW0A 3S55A 2VPIA 2RGCA 4PC6A 4U7JA 2OHJA 5CH5A 5EQDA 4ZODA 1DC5A 4PRZA 5AW5A 4B44A 5MGNA 4IM7A 4MX8A 3ST7A 2OXFA 1XF9A 3ZQKA 1XNJA 5B58C 4PZCA 3KTOA 1NULA 1BU8A 3DE3X 2VYCA 3L8EA 2G9NA 4CKBA 4D8XA 4YR9A 2FDCA 1TOAA 1GCOA 1FTQA 1W34A 3GRZA 1AM4D 4LISA 3MMNA 5JR3A 1U7UA 4JP1A 1IOWA 3NPMA 1USWA 3NPAA 3HN6A 4GS5A 1R0LA 4BMZA 2PPVA 2CDBA 3G2MA 4WVLA 1XSEA 1TB4A 1H05A 4PF1A 2YZMA 2OO3A 4KTVE 4UOZA 1IAVA 3PRYA 2BZ0A 2ZSBA 4UM8B 4QECA 1L1FA 1XZNA 3R7AA 5E1BA 5COBA 3ICEA 5F2OA 2FOLA 3H18A 3KKNA 4OQQA 4AUKA 3K09A 1CEQA 1WUKS 4EGSA 2JFXA 1PFWA 2Z58A 3BJMA 3H2SA 5IH3A 4WLOA 3FOEC 3GG9A 5DGDA 4FE4A 4FW9A 5JY1A 1MJGA 4EMUA 1QQBA 1H1DA 2VZ0A 3SKVA 1N32B 3BTOA 1JIKA 3PPXA 4HZGA 4ND1A 4GGPA 4IQ8A 3ZWPA 4JT8A 5IJXA 1UBSB 4B8YA 9MHTA 3DLPX 5BV2P 2A35A 2BGGA 5EKXA 3IAUA 4HQKA 2YFKA 5C5IA 2H63A 1DXYA 1JKJA 4LSWA 1GRNA 2N46A 5CJPA 4CZ2A 4P36A 3R7NA 4C03A 4F9TA 2VRCD 5HKKA 1TEZA 1E77A 2AN3A 1LY1A 4F04A 3NYIA 2IUSA 3HBFA 3KQWA 3D3NA 3ZZMA 2GZ2A 1R0KA 2GUGA 3EGDA 1P4SA 3K92A 4GLFA 4U6SA 1MGOA 2ATVA 5B7QA 4LWQA 4YV1A 1TMYA 3NDPA 4XX1A 4BIIA 1FQOA 4ZAVA 1NI5A 4C9BA 2PBZA 1CVRA 4WK6A 4IMJB 2GAJA 3DZBA 1ORTA 4EGFA 4U02A 4MDEA 2I80A 2HQ1A 4MDHA 4EP1A 4UVGA 5IKMA 4XGNA 1R4AA 3R6WA 5MHTA 1M8GA 3QVUA 3D4LA 4RK5A 1U7HA 3IT0A 2IU6A 4EB6A 1DBSA 1DCKA 1KJ8A 2EG5A 2RHTA 1PT7A 4BGUA 1JEQA 2PZKA 3DP9A 4NHOA 4CIBA 1TKAA 3RYFB 3BSFA 3TE6A 3LKBA 4G0WA 3ELYA 4WINA 2C5AA 2J4CA 3FVQA 1Q2UA 3L7LA 3Q11A 3EIUA 4FGLA 1RWMA 1ENPA 2DWPA 1S2MA 4ZDWA 2FI1A 2G25A 4KH0A 1XCOA 2Y05A 3ZVLA 5C53B 2R1ZA 3P9QA 4RF5A 3ZIAA 3GLIA 1PR1A 1KL7A 3QUQA 1ZAKA 1ISGA 3OESA 1OXUA 1H66A 1CJVC 1ZEJA 2H7VA 2OGSA 2JLSA 2Q3CA 2WU0A 5AO9A 4RESA 1XBTA 1KVTA 2H5EA 3F2IA 4K05A 3WNQA 2F1IA 2YHIB 1DUSA 2GAAA 4WFQA 1XXHB 4B0OA 1NZFA 1J97A 3OMXA 3UJAA 3MNFA 3L49A 4FNGA 3MA0A 1JS1X 4N5NA 4RELA 3TLEA 4FI3F 3BMNA 9ABPA 1SUFA 3E6AA 5JC8A 1PL6A 3OETA 4RKEA 1B3BA 1XVUA 4MSUA 1U2PA 5JD3A 3HB9A 5K3OA 2CV1A 1OLUA 4CQMB 3IUEA 1Z0FA 4MKIA 3IQHX 1ELOA 3IP1A 3WGTA 4F97A 3GMDA 2JVKA 2IZ5A 3LYUA 1RTTA 1P29A 1Z25A 1A5AB 2XVYA 4MW6A 3WAKA 1N75A 1JB9A 3S68A 1YTUA 3SYMA 3A9RA 4YPFA 2EKBA 1NATA 4BN4A 2CZCA 1G291 1LDBA 1X14A 3DEKA 2PT6A 1VB3A 1T0PA 2KX7A 3LL4A 4GBJA 4NKRA 4AN4A 4QZVA 1MABA 1UDCA 2YJ5A 3AF0A 3K1AB 4UHKA 1R6UA 2JATA 2WHPB 4JX8A 3WLPA 1JVNA 1VYVA 5JDIC 5DM4A 1M1UA 2Q6KA 1EA7A 5E3HA 1I13A 4N4AA 1OROA 2H85A 3D54D 1XTRA 4HXEB 1ZXXA 2KYRA 3G88A 2EWWA 3IBTA 1T24A 2QLNA 3EC1A 3JASA 1WG8A 1IXRC 3CR7A 3RSSA 4CG0A 4DUYB 4RACA 2ZBUA 4CHGA 5AKIA 1GSHA 3IE2A 5HCIA 3UV3A 5AVVA 5IT5A 4PBSA 4NF2A 4RNCA 5KDDA 3OHSX 2OHHA 3HCFA 4U6QA 5AMXA 1OY1A 1VL8A 2BBTA 2NG1A 2Z09A 5AW9A 3V7UA 4POOA 1M9NA 4DA4A 2RH9B 2A1IA 4BP8A 5FLKA 4C7VA 1PGNA 4GMKA 4ZI5A 1C3VA 2CLEB 3T38A 3BSWA 5JI2E 1W73A 3WNZA 2EFGA 2OD2A 3BE6A 5EXSA 3W1VA 1JFVA 4U2GA 3ULKA 2I3GA 4PLHA 3PEFA 3RBZA 3STXA 4AJLA 2EQ5A 1UFVA 4INZA 5IUNC 1B15A 2XVAA 5BWOA 1G59A 2JC3A 4D6XA 3O82A 5AICA 2AMYA 4QARA 4HB3A 4YJ2F 5DHRA 2AZDA 3QYJA 1TZBA 3FSJX 4EELA 4FILA 5TEWA 1J99A 4GKBA 3WRWA 3DLIA 3F3SA 4KYVA 4CL0A 2XV1A 1P6QA 4LPKA 3QV1A 2D7DA 1VPVA 3NANA 3SQDA 3T15A 2DR2A 2ECFA 5F23A 3ZW8A 1VA5A 4IF6A 3F1KA 3W3AD 4Z4HA 3H9QA 4NOJA 4RQAA 3NWOA 3DKKA 1P5RA 3NXSA 4ZYYA 4MR8A 3UMVA 4OA8A 3IIJA 2R8PA 3RGGA 2WVAA 3WJ1A 2ZZMA 3BQMB 3H0KA 3Q10A 2O8CB 4LMPA 1L9XA 3S44A 1YOBA 3NATA 1PQPA 3CWQA 2QAJA 2WHYA 3LIIA 5FF9A 4MICA 2Z9BA 2JGKA 3RSGA 3M4XA 1U3VA 3MSCA 4INAA 4IVRA 2VNSA 1QZXA 5CT8A 5JSHA 1I2MA 1N2XA 2YY5A 2R8EA 2GPWA 3IQZA 4Z9BA 3T3NA 1XMIA 2CJXA 3K30A 2LRHA 2RC6A 4ZU3A 1ZCJA 3I6YA 1Q95A 1T15A 2C4TA 2QLTA 4JU8A 4DRXA 1TF2A 3FMGA 3PRHA 1GPBA 2Q2NA 1A27A 5FO0A 3NM5A 1K7YA 1WY7A 4E5PA 5P8WA 1ACJA 2CXNA 3SYRA 2JAXA 4RLQA 4CF3A 1KR5A 4XDZA 5AVWA 1NVAA 1GU0A 2JRLA 3GGCA 4IF4A 5KTTA 2C4NA 5GVSA 4KPGA 3K32A 4FYVA 3AF5A 4AMZA 2YN0A 1E2DA 3ANLA 3W2EA 2R1TA 4JITA 3LUJA 4JKYA 4EB3A 2FPMA 3VPXA 4KO3S 1A88A 1PGJA 3TX2A 2ZBGA 1M6WA 2ZBPA 5EHXA 2BJWA 3OJXA 4KK3A 1IBRA 1CR1A 2CNOA 3AC0A 3MT8A 3W9UA 4X60A 4HDKA 3SN6A 2VBCA 3K2IA 2WQ6A 1XPRA 1BVRA 2VUSA 1UPCA 4AS2A 5KC9A 3U61B 1P39A 1Z5NA 2I87A 1JL3A 3GGJA 4KGXA 1Z4OA 4KR0A 4Q24A 4ZCMA 4MGYR 1DX6A 4RKQA 4K81B 3C1TA 4TPKA 3HCDA 4BQIA 2EKDA 1AXGA 4IZOA 3V4PB 1LNZA 5DU2A 4B4OA 3NHKA 1YI0A 3MWJA 2Q1XA 2CHGA 1FXSA 3EC2A 2Q6IA 3M3DA 2P2CA 4HBZA 5DCWA 2A88A 4M1QA 3ZWCA 1HQYE 1FK8A 3ADPA 3HCAA 1N5LA 1B8UA 1EHCA 2OV6A 3IP8A 1UBNA 1WXHA 3PI7A 2OFPA 3DLBA 2P1DA 2WSMA 1F5SA 1DAIA 4JQOA 5CB4B 3QYAA 4QQKA 4DXHA 5AVRA 4IXDA 3LY7A 4OSOA 3EEOA 4ETWA 3P9PA 5ECWA 1E6KA 2HXYA 2PMCA 3TO5A 1H2YA 3E7XA 1J9ZA 4W82A 3JZIA 2I7CA 4HS9A 3PJRA 1TQ2A 4HWSA 3FYHA 4QO8A 2PX4A 2ZAIA 1M6HA 2O7QA 4M6WB 2FY8A 2H1SA 2ZYVX 1E4OA 2EQBA 4FDLA 3O47A 5IANA 3O1HB 1XR3A 1FP6A 4JJ6A 3VR3A 1PQWA 5H7XA 1UCFA 3ZNPA 4FDMA 2JFBA 2R9VA 1KMHA 1TK9A 2YV5A 5DYGA 4OJTA 2KBEA 1TM3E 4WN3A 1J6UA 1QV6A 2FFJA 3CUYA 2Q8QA 4J6FA 4X64B 2O05A 3VO9A 4JLPA 3GVIA 1YZ3A 1XUOA 1XDWA 4KQKA 7MDHA 2ZTLA 3GJTA 1JWLA 4A2QA 2D3TA 1ZIOA 5DEIA 2OZLB 4V0ME 1RZVA 3ZVMA 1IBKB 2BEVA 1WV0A 1UBEA 1B23P 1WP9A 3E9YA 1JBQA 4GYKA 4H6XA 3STVA 3SX2A 1AUVA 2AZ4A 3REGA 5E8JA 5BSVA 1X9GA 4QASA 1A8HA 3FA2A 4BZWA 4MUMA 3GA5A 4EHKA 4U0KA 2NU6B 4H7IA 1R27A 3T8YA 4JN6B 4XUCA 2JG3A 2QTNA 3GNSA 3MLAA 3FXAA 1RJ9A 4KE6A 5C8YA 5A6SA 2ZYAA 4P84A 2GZAA 2G76A 2R4QA 2Y76A 3E7FA 3KEFA 1TUEA 1UXKA 1VHDA 1VI5A 3IIIA 1OE0A 2VTEA 3FROA 3KWMA 3NDJA 1O89A 3UW3A 3OO1A 4HXFB 2UUAB 3OH8A 4RD0A 1KMCA 1XE3A 1A7KA 3KOUA 4GIBA 2V8BA 1BHSA 1NHWA 2ZVQX 1IEQA 1H5QA 1QC5B 1RAIA 2H1HA 3QVGB 4XVQA 2GYUA 4YP6A 4BRSA 2IHKA 1YGYA 1PFQA 4LJKA 2D5AA 1JAHA 3G79A 3ZHYA 1NP7A 4G25A 1PT9A 1QYWA 3NDIA 4FFLA 2YFYA 4DCSA 1CUZA 4OOFA 5KQGA 4E15A 1RRMA 1KIAA 2E82A 4PAGA 2WMDA 1TAUA 2IYXA 2G6TA 1G7CA 1NLFA 4F3YA 2ID4A 1USGA 3K0BA 3D6TB 1A2OA 1YB1A 4A8JA 4E7PA 5M7EA 2DPYA 3NBFA 3K5IA 3RFUA 5H4HA 5J43A 5J23A 3C3YA 2IV7A 1WULS 4US1R 4E5SA 2A5LA 3LBHA 2FX5A 2ODPA 1QVRA 1BXRB 5HIMA 2ZJ3A 2E4YA 3OPMA 5A0VA 4W6ZA 3KHKA 4AJOA 5EJ7A 3DP7A 4W5QA 3UQYS 2AX3A 1F2UB 2B61A 4UXHA 1XOIA 3WGJA 1V37A 1N8TA 4BFVA 1FZQA 1R0YA 1QVWA 2HF9A 3ZY2A 3OJ0A 1AB5A 1M6NA 5KBYA 3QEAZ 2C0PA 3DVAB 3A1TA 1UDXA 3L7IA 3ZS9A 1X8XA 2EEZA 4EUEA 1WXFA 2XMZA 5BW4A 3UV6A 1H85A 2GBFA 1YS6A 3VKFA 2PX5A 5FL7D 1CS0B 4FFNA 2QA5A 3GO4A 1II8A 1KAOA 1YQ9A 2J9FB 2WT4A 3K2BA 4GNKA 3ZHUA 2OGTA 2PANA 3OLWA 2WJZB 3KKKA 4IQFA 4AMUA 2QUKA 1W29A 3QYFA 1Q7RA 2O23A 2Q5IA 3B6ZA 2WLSA 3CTPA 1U8AA 3L7DA 4IG4A 2P2LA 2GNAA 3QE2A 4D82A 3OZDA 2OSBA 3PLNA 1ZUWA 4MVJM 3W0LB 2B20A 4AS3A 4U2FA 4UUMA 2BCGY 2BFFB 1KAHA 2WAXA 3JQ8A 1FTSA 1ZW6A 2HREA 1PNOA 3KV1A 3SE7A 3OG9A 5LMZA 2C7RA 4R6WA 3QEKA 4MW1A 3PITA 1GAWA 2NU9A 3DMPA 5FA6A 3L77A 4RE5A 2O1XA 2I65A 3A6GA 4BO8A 5CB0A 1NBIA 2LPMA 3JRXA 3LT0A 4V0MA 3MCUA 4M89A 3QF4A 4AZ3B 2YXEA 1O57A 2ONYA 1FP2A 1KU6A 3STHA 5TPWA 4MW0A 5FA5A 3X1WA 1A72A 4AMVA 4CM4B 2Y2VA 3Q12A 3FUCA 4YRPA 3R5JA 1OB5A 1Z6ZA 5KPJA 1WZNA 3S7ZA 1M1YE 4FGWA 3O4JA 3OA0A 3ITDA 2I2XB 1QX4A 2HDOA 2YL2A 1AUPA 3LWZA 2JIRA 3QG1A 2PR2A 2QORA 2XHEA 4N0QA 5AW1A 3BK7A 1BZYA 3T06B 2AMFA 3NNSA 3RAGA 4EUHA 3QKRB 5DHPA 3L4SO 1Z33A 3P2OA 1XTSA 5AXDA 4PR3A 3I61A 4I0WB 4KXWA 4AB1A 1Y1RA 3F5SA 4PYKA 5I7OA 4IH9A 1BKYA 1E9CA 1GGJA 1H9AA 3EWAA 3KJZA 3W1WA 1EUQA 1G8AA 5JH7F 4N7JA 4F71A 4I08A 1RJWA 1SO8A 1ZM9A 4R7TA 4D9MA 2QT1A 3BWBA 2PUAA 1X38A 2PEZA 2XTNA 2IPMA 2QB5A 3M4ZA 4P34A 4E5VA 2PSJA 3MIZA 2IPNA 1JLLB 5JVDA 1NWCA 1JDSA 1JR2A 1WNTA 2B0CA 4JVNA 1LZKA 2BHTA 4BNDA 1ID8A 1TVEA 2QPOA 4FN5A 4KLCA 3AFGA 1GA1A 4M1OA 3V34A 3VSAA 4MTCA 4F56A 3O2NA 1W1WA 2O5VA 5K3CA 5TARA 2AJDA 1Z6PA 2A1UB 3AUTA 1OU0A 3CUKA 3CRVA 3HUUA 4FGKA 4MS4B 1Y4UA 2XGSA 3R1IA 5I8WA 5K8IA 2RBGA 2GF2A 3PXCX 1T1GA 3WK4A 2VTBB 3FF4A 2GAOA 4Q3NA 3VU3A 1QP4A 3QPUA 4LQDA 2ANCA 1LBTA 3CGGA 3JAWB 3UW1A 3ZJTA 2YJGA 1I36A 2EZUA 2PX2A 4D2IA 2J7PA 1TA4A 3DMDA 3QQ5A 5DCYA 3SQOA 2XEXA 3CLTC 2JLXA 1F14A 1GN8A 4TMWA 2O06A 3VPFA 2QTCA 4F3RA 2OVBA 3F1LA 3S4YA 5KTPA 2CK3A 4GX1A 3C5VA 1GCGA 1N8SA 3W8FA 2OO5A 1UC5B 3MG9A 3KB2A 5MFPA 3HA7A 4C3UA 2PUBA 1MV5A 2WSYB 5IKOA 2QTGA 1ZD4A 2WABA 1QH8A 1QHEA 3A7EA 2HJHA 5LA6B 4AMYA 3CLRD 3E7PA 4D56A 2NTNA 2I33A 1WW3A 3GDWA 1CUUA 4RK1A 4EW1A 1J5EB 1NUSA 3A6HA 4DQKA 2BM8A 4UTPA 2V65A 2PVSA 1GGKA 3IQGX 2WNIA 3EA0A 4ZIRB 1C4OA 2JH3A 1MTOA 3AP1A 1QS0A 4CV0A 4Q4HA 5DNDA 3T0FA 2HJ9A 2HRCA 3AI1A 5E9AA 3QVVA 3F90A 3S1AA 5DM0A 3CHYA 4PBRA 2P30A 3DOIA 1CIJA 1Y63A 2DRIA 4PLZA 3TNDA 4D26A 1E63A 2I99A 2EKQA 4GQIA 3ICCA 3P26A 3S2UA 3UB2A 1WXXA 2OESA 3OECA 3NHUA 1C9EA 1C7ZA 1H2WA 2Y71A 1FP7A 1KDZA 3OAAA 2JRCA 4EGJA 4OX9Y 4RD6A 1VP3A 3C97A 4JT9A 1XCGB 1U0GA 2VAPA 1M1YA 1PKEA 1U0HC 2JW5A 4QOIA 3B8HA 3LE8A 5BVHA 4R40A 5KQMA 1JT2A 3DV0B 5HSGA 5KTYA 4GE3A 1QHIA 4M2LA 1GA4A 4J0KA 4KB5A 4ZHQF 4LSZA 4C5AA 7GPBA 4GSYA 1CYEA 2Z98A 4B7XA 3C74A 2ARKA 1PSZA 2ZI4A 5AJHA 4BXOA 2PSEA 2Q2VA 1E1DA 3EIHA 1KH1A 1T2CA 4EVSA 2OQRA 2RGNC 1PTKA 2FQXA 3Q3GE 2JFOA 4Q1VA 1Z4LA 2WIDA 4W5NA 1RHQA 3H7IA 3WLIA 2YJZA 1Z5VA 4G63A 2RB5A 3MAAC 3C7DB 1FFSA 2XLCA 3PEEA 4UMFA 3SSAA 3DBRA 3B85A 1BQEA 4I50A 3KUDA 3L8ZA 4G8DA 1DHRA 2UVPA 4ZO9A 1DXOA 4LE1A 2Z6UA 2WLTA 3ROZA 4GQBA 1GV0A 4NIMA 2PH7A 1AJEA 4G1MB 3O4VA 2BFEA 2XWQA 3F7MA 4DJ5X 1B8NA 2IDJA 4L08A 4CL2A 2O8VA 5ARDA 1RQ2A 2BMAA 5M2QA 4H7EA 3H8VA 1FP4A 1ISRA 1HE8B 2ZJ2A 1Y7IA 1PJ3A 2FKNA 1V11A 5H83A 3M49A 1M74A 1WOMA 2OENG 4KUGA 1FC0A 1MG5A 1XFAA 2FZ5A 3P45A 2G80A 4TXJA 1PYOA 3N2EA 2NT4A 1RCFA 2NXWA 2FQ1A 2W90A 5AOBA 2SCUB 2H07A 2K6GA 1JQ3A 4PRYA 3OFND 1M2OA 3SI7A 1M2JA 3SX4A 4DOMA 4FR2A 1DDIA 4D3YA 4YUAA 1C3OA 1MHPA 1Z13A 2X3UA 3HUFA 5CR9A 3A4NA 1SXIA 4Q4AA 1RFLA 5KYWA 4NE7A 4U7FA 2XZDA 5T3UA 3S3TA 4C0LA 2CYAA 1JKFA 3UGQA 3EPJA 2W4IA 2Q2QA 2F64A 4Q16A 1NNI1 4ZGBA 4PQYA 4D8VA 1IN8A 4M88A 4X3PA 5IJ0A 4H1TA 1XVIA 2VHZA 1OH8A 1D03A 4WE3A 1G6HA 4ZVKA 3UT0A 2AXEA 4I8IA 1E4YA 4BMCA 3RD5A 3RYCB 3N59A 1N3YA 1TADA 1NVDA 1J2YA 2BFNA 2JKVA 2QT0A 2TMDA 2YV2A 4OHBA 1SY7A 1TQ4A 4X6XA 3T5PA 3HWWA 5FAKA 4OKNA 3DAOA 2OK8A 1Z12A 1XZMA 1IU9A 3Q2KA 5TQ2A 4ZQGA 3KHUA 4X8HA 1KETA 5KDLA 2P5SA 4LHVA 3DVQX 3QMWA 1FJ2A 4P4TA 2IELA 2ZULA 3OTHA 1NX9A 2XMCA 1C81A 5FQNA 1P45A 1QYIA 3ECCA 4S0XA 4AZVA 5A4FS 5L7TA 2FJPA 2CJWB 2WWRA 1WHTA 2VF7A 5BNZA 2JL1A 3FWZA 4EPYA 5BSWA 4YQEA 1SBTA 4EO4A 2YXBA 2FB9A 4EYOA 4H1HA 1CT9A 4BAGA 2XB2A 1ZCZA 1E9AA 3TW0A 1SPBS 3FKQA 3ZTTA 3U4IA 3R7FA 4R3UC 2RB4A 5JO0A 3U4QB 2W42A 1YRQA 4JLBA 5JQWA 3K5WA 3AQ4A 4QLAA 4CE6A 4P6VF 3ANYB 4YJ2B 1IY8A 3AHIA 3G1UA 4I1IA 4LBWA 3R7BA 4L4UA 2HK9A 3OQBA 5ALNA 3U3OA 1C9KA 1HYGA 3LP8A 5EC8A 1XKXA 5FPYA 4NCAA 1HNZB 3ZI7A 1Z7BA 2ZBFA 3TZBA 3KLMX 1Q1GA 5KDOA 1VSBA 5JIBA 1NNUA 3QKTA 5ALUA 4ZK6A 4C0HA 4LZZA 5BT8A 2G40A 4RULA 3BCRA 3T7AA 5U9CA 4L15A 3E3LA 4MI3A 4Y2PA 4L9RA 2IPOA 4XOUA 4CL8A 2WU4A 3RYHA 4N48A 3FOCA 4LMAA 3BL6A 4NU6A 2SBTA 3V8MA 4CTOA 1Z0JA 1U1EA 3K09C 3PD7A 4MAMA 3SF8A 4PG4A 3TQRA 3MJTA 4HUQA 1T91A 4AC9A 4ESOA 3SBXA 3NX4A 4KOAA 1T6XA 5KINB 2HQRA 4IDPA 2GD6A 3R6TA 1MQ8B 1Z8DA 1NDHA 3QE4A 3ZJVA 3GPIA 2YR0A 2FMKA 2NNLD 3NBUA 4DLSA 1Q15A 2CZQA 1XD9A 4NX2A 5CVDA 5A5FA 4X6UA 2IXFA 4H3HB 3VR2D 2JS7A 3NGXA 1ZU5A 2ONKA 2X0EA 4D6YA 5JNTA 2IOQA 2Y0CA 1XL0A 4FR0A 4FSDA 5A9TA 2UYHA 1XZIA 2VHUA 1IJFA 3L6RA 2PJRA 2E48A 1J0CA 1ES9A 1HEIA 3SF0A 5JDIA 3QU2A 4WECA 3ABSB 1MF7A 3RF7A 3RTGA 2WIJA 1W4AA 4O3MA 1QK5A 1POXA 4J76A 1YFLA 3PICA 2VPTA 3FFWA 2GM5A 1PSWA 3EXEB 4Q3LA 3T7RA 2ZB8A 3K2QA 5I3ZA 4ODIA 3IA2A 2WPDA 4KQHA 1GILA 4OEHA 3WKDA 4ZO8A 2Z3ZA 3MCTA 4MUKA 5TGTA 3NWPA 4HY3A 3ROPA 3SEAA 1GZ3A 1T5SA 1J1UA 3AKDA 4E5NA 3USCS 5DWQA 2DR3A 4OJMX 2IS2A 3VSCA 4P33A 4RMHA 3TQQA 3RM3A 3O8BA 1A96A 4RL6A 3IAS1 4G36A 4XRGA 2OV4A 4PU0A 5JYDA 4PSAA 4BUCA 4MMYB 1I6MA 2FR0A 4GLBA 1NMZA 1OWNA 1A9QA 2CVPA 2GN8A 2QN3A 2GYYA 3H4VA 4ZOAA 4A8TA 4B2YA