1P91A

Crystal structure of rlma(i) enzyme: 23s rrna n1-g745 methyltransferase (northeast structural genomics consortium target er19)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
268
structure length
268
Chain Sequence
SFSCPLCHQPLSREKNSYICPQRHQFDMAKEGYVNLLPVQHKRSRDPGDSAEMMQARRAFLDAGHYQPLRDAIVAQLRERLDDKATAVLDIGCGEGYYTHAFADALPEITTFGLDVSKVAIKAAAKRYPQVTFCVASSHRLPFSDTSMDAIIRIYAPCKAEELARVVKPGGWVITATPGPRHLMELKGLIYNEVHLHAPHAEQLEGFTLQQSAELCYPMRLRGDEAVALLQMTPFAWRAKPEVWQTLAAKEVFDCQTDFNIHLWQRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ribosomal RNA large subunit methyltransferase A
publication title Crystal structure of RlmAI: implications for understanding the 23S rRNA G745/G748-methylation at the macrolide antibiotic-binding site.
pubmed doi rcsb
source organism Escherichia coli
total genus 64
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 2.1.1.187: 23S rRNA (guanine(745)-N(1))-methyltransferase.
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1p91A00
5F2KA 2UYCA 3BUSA 2IIPA 3IYLW 4DF3A 1I9GA 2AOTA 2IH4A 3GRYA 3OU2A 3RW9A 2ZULA 3MAGA 3NTVA 2ZFUA 3BZBA 2YXEA 3PFHA 1L9KA 2Y1XA 3HA5A 4PYIA 1YB2A 3P2IA 2BM9A 1YFJA 4X61A 3SMQA 2YTZA 4M7RA 4A6DA 4EMSA 4F86A 5KYGA 3HP7A 3M4XA 5EMMA 1G8SA 4RVHA 4E31A 3HNRA 3O4FA 2P40A 2O07A 3HEMA 4GOOD 5BP7A 1IY9A 3FPFA 4ER5A 5K0EA 2I7CA 5ICFA 2PX2A 4PYQA 3G8BA 1JSXA 3Q7EA 4OA5A 1XJ5A 3M6WA 3GGDA 4E2XA 5E1BA 1JG4A 3DMGA 5FHQA 2QE6A 3UA3A 3FUXA 3DXZA 3R6TA 5FADA 3LKZA 4RTPA 2CL5A 2P8JA 3GWZA 1WXWA 2NYUA 5DPMA 5GM2A 4UOEA 5KQRA 2XYRA 3THSA 1PJZA 1ORHA 2FK7A 2VZ9A 5EC8A 2HWKA 3LDGA 3NDIA 1EQAA 4CWAA 4YUZA 5BXYA 3R24A 4E30A 4HRAA 2H1RA 3KPWA 4DCMA 4RTMA 1RI2A 3A7EA 4FSDA 4MTLA 2EX4A 4RWZA 5K0GA 5K0JA 4X41A 1X1DA 3DMHA 3UJ7A 1VL5A 1P1BA 3OZTA 1RI4A 2VDUE 1EJ0A 4PGHA 1NW5A 3REOA 3UJCA 2OY0A 2GLUA 4E32A 3MHTA 3JWHA 3ELDA 4V0QA 2VS1A 2PWYA 3HCBA 4PYMA 3M70A 4H0NA 4R8SA 1TPYA 3CJRA 5E2BA 4ZTBA 3LPMA 5FA5A 3UFBA 4E70A 2N47A 3FTFA 5DTRA 5LQKA 3SXJA 1TW2A 3ELYA 3ORHA 4CTKA 3MB5A 3HVJA 4FT4A 5BW5A 2HV9A 2ZCJA 5HOQA 4Z2YA 1WY7A 4RTJA 3HCFA 1MJFA 5M5BA 1WXXA 2FYTA 2WA1A 3V8VA 4DKJA 3CVOA 2R6ZA 3UJAA 1M6EX 3I53A 4LWOA 5DRYA 2V74B 3DOUA 5EMKA 4GEKA 5GOZA 1KR5A 2BR5A 5EIFA 3GO4A 4RVGA 5DLYA 5K0FA 1QZZA 1WG8A 1VPTA 1YZ3A 3B89A 3G88A 4OBWA 1JSZA 1XVAA 2ESRA 2ZBRA 4K6MA 3FYDA 3NDJA 5HIJA 4ER7A 1VBFA 3FPGA 4R6WA 3G5LA 3NW9A 1N7IA 1IXKA 2XYQA 2XYVA 2AOTB 3G89A 3T0IA 1B42A 4EVIA 5CVJA 2NXJA 4OQDA 4GBED 1RJEA 5CVDA 5F2NA 4GQBA 3KQSA 3R9XB 2OB2A 1KHHA 1ZKDA 5FTWA 1F3LA 3G7UA 4AZTA 4C4AA 5BW4A 3GNLA 3PVCA 5HEKA 3SM3A 4RTNA 2KW5A 5HZMA 4RSRA 4YMHA 2OBFA 3ERCA 1FJXA 3K6RA 1ZGAA 3OFJA 3OFKA 3TPZA 3TR6A 4GF5A 4PONA 3CCFA 4U7PB 2AZTA 5DSXA 4FSXA 2G71A 4FP9A 2BR3A 3TKAA 4RTKA 1TW3A 3G8AA 4DA4A 2QRVA 3UJ8A 1JQ3A 1QAOA 5K05A 3C6MA 4QPNA 3KQWA 2G72A 2Z6UA 1AV6A 2O57A 1KPIA 5T64A 3KHKA 4HGYA 1QAMA 3KQVA 1JG1A 3DULA 3KPJA 4QQKA 3TQSA 4GC5A 1SG9A 2VDVE 4AX8A 3SGLA 2ZLBA 2JG3A 2AVDA 3DXXA 4ER0A 2WK1A 1EAMA 2DPMA 2V7EA 4EQZA 5FQOA 3HCCA 1YUBA 3NVKI 1L3BA 3O7WA 1N7JA 3BGDA 4PNEA 2ZVJA 1PRYA 2ZSUA 3HVHA 4O29A 4BLWA 1MHTA 5EOVA 4GOLD 2YX1A 2NP6A 3OE5A 1SQFA 3TRKA 2BZGA 2PXAA 1R18A 2NXEA 4JXJA 5D1NA 3OU7A 4IWNA 5DM4A 5FUBA 2LD4A 3EVGA 4PYKA 1RJDA 2PJDA 1WS6A 1ORIA 1XXLA 2FPOA 5K03A 2B3TA 5EEHA 4BP3A 3GJYA 1BKYA 2B78A 4PGGA 5B1SA 4PYOA 3EEOA 2HNKA 2R3SA 2C7OA 2ZTHA 3ELUA 3FUUA 5FWAA 3VC2A 2BR4A 2P35A 3M33A 5EPEA 4PYNA 5C0OE 3P9NA 4X63A 5EZSA 4OBXA 1ZQ9A 4A6EA 4RYLA 2ZIGA 3AJDA 2OYRA 2PT6A 1G6Q1 1ZGJA 2JHCA 3DLIA 3HA3A 2P1DA 2I62A 4KVZA 5C9ZA 4M37A 4BLVA 3K0BA 3ER8A 3BXOA 3DTNA 4MIKA 3SVZA 2ZWAA 4C05A 3FUTA 5CCBA 1X1CA 4KDCA 4PYLA 3PFGA 5CVUA 3KQQA 3X0DA 2OKCA 2HMYB 4IV8A 3CJQA 1ZHFA 1XDZA 3F4KA 3I9FA 5ICGA 3GRZA 3NWBA 4OA8A 5CIYA 5FULA 1AQIA 1UIRA 2ERCA 3IEIA 5GINE 2XVAA 1FPQA 4XUCA 4YV1A 2ZIFA 3QV2A 4GUAA 5JUWA 1G8AA 4C03A 5DWQA 4EKIA 3P2EA 3B3FA 2QM3A 1NT2A 3FRIA 5EMLA 3FPJA 2Y1WA 2GA9A 3RIEA 3TLJA 3CC8A 3FTCA 2JHAA 3SSMA 3SX0A 3TMAA 4PYJA 4YV0A 7MHTA 3FYCA 5DM0A 2UYQA 3GRRA 1JQEA 2B9EA 3KR2A 3P2KA 3SSNA 4IKPA 3A7DA 1KXZA 2ZZKA 3EGVA 3VYWA 1P91A 2C7PA 4EKGA 4BP1A 4F85A 3P97A 4QVGA 3CBGA 1I4WA 4GOMD 5DSTA 2CWWA 3LDFA 2ZZMA 1IM8A 3EMDA 3LSTA 1D2HA 5E9JA 2JJQA 3UBTA 1YF3A 4XUEA 3GDHA 2PVCA 2A14A 4QTUB 3KQTA 4R8RA 3FUVA 2GAFA 5G02A 5HIIA 4RTQA 3B3JA 2EFJA 2YUIA 1FP1D 1VP3A 1FBNA 3EGEA 4U7TB 2QRVB 2PWPA 1L3IA 4KDRA 1Y8CA 1R00A 4RTSA 1N2XA 2YR0A 3HCAA 3LBFA 3PTAA 3MGGA 2I6GA 4LG1A 5C1IA 5GIOE 2PKWA 1RI5A 1F38A 4ER3A 3KQMA 2FCAA 4PIPA 3M6VA 1AQJA 3EVFA 3IV6A 3JWGA 3DP7A 5DX0A 3VSEA 2C7RA 3I5UA 1KPGA 3MERA 3SSOA 4BY9E 4RVDA 1NE2A 2AOVA 4KIGA 4EK9A 1JG3A 2G70A 3DXYA 3C6KA 2GS9A 2P3OA 3I64A 3JWJA 3LGAA 3NJRA 5EMJA 3UJ9A 3BGIA 1DL5A 3PB3A 5KVAA 1NBHA 3BWBA 4PWYA 4V0RA 3SR4A 3EVCA 2CKDA 3KR9A 4OQEA 1QAQA 5ICCA 3KQYA 1INLA 2PLWA 3P9CA 2Q41A 1SKMA 1ZG3A 3LECA 4YMGA 3TOSA 4DZRA 5EHIA 2JHPA 1M6YA 2IDJA 3KPUA 5H02A 3FRHA 3A25A 4P58A 3UZUA 4C08A 2CMGA 1R8YA 4E2WA 3TFWA 2WA2A 3KKZA 3B5IA 3PS9A 3BWCA 5E1OA 5HIMA 3UA4A 3UJ6A 1AF7A 3HA7A 1EG2A 3TM4A 3G2MA 5K0NA 1P39A 5T67A 3UJDA 2Z6AA 2XBMA 2O05A 3LCUA 2OB1A 1Z3CA 3ANXA 3B3GA 1RJFA 3AXTA 1NV9A 3CGGA 4X1OA 3HM2A 5DX1A 5E2AA 1Q0TA 1KYZA 4HGZA 1D2CA 2EG5A 1XDSA 2AN5A 2DULA 4KWCA 1NBIA 2NXNA 5GM1A 3TKYA 4P7GA 2HTEA 4P7JA 4YV2A 4RTLA 3E7PA 1QANA 1O9HA 2NXCA 3BGVA 3P71T 4RVFA 5EVJA 5FCDA 3OU6A 3R3HA 3UJBA 2IH5A 3I58A 3P9KA 2UYOA 2FHPA 4Y2HA 5E9QA 5LQRA 2OZVA 3CJTA 4HC4A 3HVIA 2NNWB 3IHTA 3LHDA 2UZ4A 5EGSA 4KW7A 5K09A 4IV0A 2AN4A 4M36A 2GB4A 1SUIA 4GC9A 1X1BA 2YVLA 4CKBA 5T6BA 2UYHA 4PIMA 3LL7A 5JR3A 3LKDA 2VP3A 4BLUA 5LQCA 2PBFA 1T43A 5LQAA 2ZIEA 1JG2A 1I1NA 1KPHA 2YXLA 3FPEA 1R74A 3AWIA 4CKCA 5LQUA 5EKXA 4RTRA 4RTOA 3ER9A 3C0KA 4WXHA 3Q87B 4HG2A 3FTEA 2GPYA 2ZBPA 2P3QA 5DXJA 4CTJA 4POOA 5LR6A 3DR5A 4LECA 3RODA 2ORED 4R6XA 3EMBA 3PX3A 5DM1A 2XVMA 3A26A 1BHJA 2FK8A 5K0BA 2ONYA 3A4TA 3DLCA 3HCDA 1NKVA 2ZWVA 2VDWA 5DTMA 5LQJA 3EVBA 2ADMA 3HTXA 1NW7A 4HTFA 4XCXA 1VP9A 1XDUA 2PX8A 1YFLA 5EG5A 2G8NA 3KR1A 5EQJB 8MHTA 1U2ZA 1VQ1A 3P9IA 3S68A 3TM5A 2AOWA 1NV8A 2FRXA 3DUWA 3JWIA 4PCAA 5EZQA 4E2YA 1O9GA 5ERGB 3MCTA 5E9WA 4HSGA 1L3CA 2OPBA 4QDJA 1R8XA 1SVUA 3GIWA 3BKXA 4MWZA 4R05A 4M38A 5FWDA 2F8LA 3UWPA 5GIPE 1G38A 5K0LA 3EGIA 4QDKA 3NMUF 5DRTA 3NWEA 2C7QA 2ZZNA 1HNNA 5DXAA 1O54A 2HR1A 2PGXA 1UWVA 2PX4A 3MTIA 2ZBQA 4CKEA 4C06A 3MTEA 2E5WA 3KU1A 1YZHA 3LCVB 4AZWA 5LSAA 4CXMA 2YXDA 3FPHA 4X60A 5CUQA 5IKMA 3BT7A 3EVAA 4RX1A 1G60A 2PY6A 3T7RA 4DQ0A 1BOOA 2NP7A 3P8ZA 1V39A 5FQNA 4E2ZA 4MQ4A 5U4XA 3CKKA 4FGZA 2P41A 3FTDA 3FUWA 5CD1A 4YUXA 1L1EA 2B2CA 1EJ6A 2P7HA 3BKWA 4B17A 3GCZA 1OR8A 3E8SA 1KP9A 10MHA 4OX9Y 4YUVA 3OCJA 3KR0A 4WVLA 1VE3A 5E1DA 2G1PA 1WZNA 2JH9A 3G2QA 4AZSA 3LDUA 4YUYA 4YUWA 3GRVA 2Z6QA 2AS0A 1KYWA 3E23A 3O31A 1QYRA 5D1HA 2BM8A 5GP1A 5KS2A 3EEYA 3OPNA 1DUSA 4L7VA 2IBTA 4XUDA 3L8DA 3EVEA 1JR4A 1VIDA 3OZRA 5K01A 1VLMA 3LBYA 3AY0A 4P7FA 4C04A 2AVNA 4DMGA 5FHRA 4QPPA 1JTFA 1RI3A 1XTPA 5E8JA 2PT9A 5EEGA 2JH8A 3LX6A 5K0CA 2AR0A 4Y30A 2IBSA 1SQGA 3H2BA 2AOXA 2CMHA 1Q0SA 4FS8A 5DT2A 5P8WA 3U81A 5HILA 2OXTA 1DCTA 3QOXA 1NW8A 1JQDA 2QY6A 1NW6A 3B7PA 3ID6C 2IGTA 1P1CA 3D2LA 4NECA 5E8RA 5ICEA 5MHTA 1H1DA 2B25A 5HIKA 3NVMB 5FA8A 4E33A 2EJTA 2ONZA 4LWPA 5DX8A 5E1MA 5HFJA 5KQSA 2IFTA 2PV0A 4GOND 4FR0A 2IDKA 4P7KA 3T7SA 2PSSA 2AOUB 5CVVA 5IH3A 5CCXA 2ZW9A 5CVEA 3MCZA 1HMYA 3PLAE 2GH1A 3M6UA 3PT9A 3A27A 3G5TA 4QTTB 2P3LA 1RJGA 3GRUA 4DCGA 3VC1A 4PCLA 3GXOA 4KRGA 3EVDA 1R6AA 1M0EA 5LQNA 4F84A 1D2GA 3E05A 1EIZA 1X1AA 4MHTA 2PXXA 2PXCA 1G55A 1SUSA 3OE4A 2IPXA 3KPVA 1RI1A 3T7TA 3G2OA 5CM2Z 2OO3A 2QYOA 4DM3A 4HTFB 3KQPA 3HCEA 3MQ2A 2P7IA 3EPPA 3G2PA 2H11A 3M6XA 2AN3A 2BH2A 3HVKA 3BWMA 9MHTA 3C3PA 3AXSA 3R0QA 4G56A 1FP2A 2PX5A 3LCCA 4C07A 2I9KA 5EKUA 2EJUA 4PINA 5DTQA 1NW3A 1UFKA 2O0LA 4ISCA 3KQOA 2YQZA 3GU3A 2K4MA 1XCJA 1BC5A 5GWXA 4ATNA 4QQNA 2IP2A 4KIFA 5F2OA 3THRA 3OZSA 5K8VA 5EIWA 3DH0A 5EHGA 3FZGA 4ER6A 4HH4A 1KIAA 4AZVA 2IH2A 1JTEA 3V97A 2AOUA 3BWYA 3ELWA 3ME5A 3KPYA 5DM2A 3WSTA 1X19A 2H00A 4FT2A 4FZVA 2O06A 1XCLA 3PX2A 4RV9A 4QVKA 3C3YA 4AUKA 3EVZA 3QOWA 3DMFA
chains in the Genus database with same CATH superfamily
2WI8A 4L57A 6Q21A 1NYRA 2IIPA 2PUTA 3INGA 4AFNA 3V1UA 3A70A 1V8OA 3G2IA 4RNCA 3HDHA 2ZFUA 3BFJA 3HI6A 3OQIB 4Q66C 2W2KB 2NVBA 2Y1XA 3NKFA 3PFHA 4GM1A 1ODFA 4IHJA 1P9WA 4M22A 821PA 1GZ7A 2C4MA 3H3XA 3DZDA 5CGZA 2FZVA 2RFLA 4DSUA 2V1UA 1YA8A 4LY0A 1HI9A 2X40A 4MRMB 4A6DA 1JEYA 2I55A 1S4MA 3MWFA 7REQB 1Z08A 1P3Y1 2J5QA 3AF2A 2NUBA 1XZAA 4B2LA 4C4XA 5JY6A 3IQWA 5IXJA 4TZTA 1WAMA 2LXNA 4CEHA 2GAOA 3ZX4A 4KXNA 1NNUA 1JI3A 3GDGA 4GOOD 3BMNB 1SOWA 4MV6A 4KLNA 4IICA 1TIKA 2PUVA 4DCJA 2CNWD 3GFPA 3WOHA 3FSEA 1WCV1 2RBGA 1KOFA 3Q72A 3Q3HA 4BKQA 2R00A 1WPQA 2I9PA 2ORIA 1D5WA 1YBAA 4BC1A 1M2EA 3DMGA 2WJYA 1TYBE 2CZQA 3FUXA 3KEOA 3PQCA 1QIEA 1DRKA 5TE9A 3P4YA 4HB3A 1C4XA 3UK7A 4EZBA 5A4KA 2GZ3A 4KMSA 1CNEA 1XRQA 1OWNA 3D4BA 3KX2A 4QWMA 3ZJ5A 5CJ2A 1EZZA 1NSFA 3QA9A 5EC8A 2X0RA 3G5AA 2KBEA 1K9SA 3PR1A 3WP0A 3ZY4A 1PYGA 4YUZA 3TGPA 3GJ4A 1YJ5A 4WZBE 3SLRA 5HKOA 3NV9A 3B1JA 3W3ZB 1PR5A 1MW9X 2KQUA 1NWCA 1GRQA 1XZHA 2FZ5A 2ZUVA 3KWMA 4MTLA 3B38A 4TYQA 2Q5EA 2Q8QA 3UMSA 8ATCA 3DB1A 3JPYA 1X1DA 4JLBA 3C4JA 1D7AA 4NV1A 2I6XA 1O8CA 1HZZC 3H2YA 1RCFA 4R41A 3Q0EA 2AFRA 3UVEA 4WBNB 1ADBA 4B09A 3SIXA 1Y7TA 3HMQA 2NGRA 3CVWA 5D7NA 3W9SA 3RAGA 4D46A 4GR5A 4ZPXA 4JL5A 4Q9KA 5JAIA 4Z0PA 2P8SA 3GA5A 3SEAA 4EO9A 4QELA 2PTHA 2Q1TA 4FX2A 1TCCA 3LPMA 4OHZA 2FAXA 1A5SB 5REQB 4FYYA 4CTKA 4FT4A 1ACLA 1VIMA 5BW5A 2HV9A 4Q1DA 2H5LA 2WSIA 4P3NA 5EWMA 1E1CA 5J5CA 4E1VA 1J4AA 2DFVA 3I12A 1NBMA 4Y2VA 3HCWA 3L4EA 4MGHA 2FU5C 4IMRA 1YR2A 4GZLA 4X1YB 3R9IA 2ZYVX 3C41J 5EMKA 4PPQA 2D0PB 3RB8A 4TM8A 3KELA 2ATEA 1QTNA 3ZHQA 2MSLA 4QYSA 2N75A 5AJVB 5I51A 1E8DA 3VDXA 4GZ3A 3OHPA 4UW9A 4JAVC 2FGJA 1GFIA 2QV0A 6PFKA 3IDQA 4KTTE 2Y0EA 5LMZA 4JLPA 4M1SA 3SC6A 3EQ6A 1PYDA 4M0LA 1OKKD 3GUVA 1B6SA 2SECE 4PXSA 2QUKA 2J07A 2ZI3A 3BF7A 3EAFA 3G89A 1CS0B 3I6IA 1X80B 2DHEA 3K5IA 1VCNA 4L9SA 4FFPA 4RVOA 5JXGA 1ISPA 3Q11A 3SR0A 4CLXA 3IO5A 4WIAA 4NDAA 5FTWA 4AZTA 4YCSA 5JSZA 1QU2A 5HEKA 3KSRA 2GPJA 4R4JA 5K9ZA 1HT1E 1ZK0A 1Z7BA 1QHEA 4EYSA 3COYA 2BEVA 4RQAA 3IHLA 5INTA 4NATA 3NV7A 2G9UA 1PDVA 4IXDA 2W4MA 5KSWB 1N8SA 3MWLA 1KK2A 2GPAA 3EXFA 1C4WA 3F49S 4BP8A 4PRLA 5G0WA 2D3TA 3RT9A 1BQEA 2QRVA 2GEDA 3V42A 4AUMA 1QAOA 2DMRA 5E4YA 1PJ4A 4KIJA 2VHEA 1XCGB 2I3GA 1GRRA 2RJOA 3WG9A 2BFBA 4RK0A 5JW6A 4CEIB 3N87A 1H2YA 3E7DA 1HEYA 2FSGA 2LR0A 1BJRE 2BF7A 2QD1A 1V16B 3VI4B 4FUQA 3C3WA 5KYKA 1ZIOA 4TKLA 3BWVA 1KNQA 2WTEA 1VMEA 2NADA 5KZMB 2PGOA 3H7AA 1UPCA 1U8CB 4LDNA 1MVNA 3I4CA 3KLNA 3WLRA 4WZ6A 1NLYA 3BEDA 1BX3A 1LBTA 3Q7PA 1U0LA 3WP1B 1SKBA 4BV2A 1DJOA 1F3OA 3BGDA 2W93A 4LAFA 2EYUA 5JRJA 1QFYA 3HVHA 2VJYA 3NC0C 3BDVA 1FTYA 4GECA 2DE0X 4CG0A 2GK6A 3I42A 5EKSA 1GLGA 3ZE8A 4PZCA 3QLJA 3KKEA 4EVQA 3QF7A 2NXEA 4L72A 1P2UA 2VAPA 5P21A 4YRAA 7ABPA 2W48A 2LD4A 3AG5A 3WLNA 3NHUA 4PYKA 4RO0A 2IVZA 4GIBA 1T4BA 2P79A 2QZ9A 3HJGA 1KZHA 3KAQA 4URZR 2I2WA 4WXMA 4B74A 1GLNA 1I7DA 3EEOA 1SO8A 4DABA 1SFRA 1DQSA 1BMFA 1UXGA 3IQZA 4ZVRA 4EVRA 1IOVA 3WL6A 2C29D 2D5LA 4MPTA 3ZBPA 2G0TA 3QI2A 3AERB 4L74A 3TPCA 3HB9A 2OQIA 1QCZA 1YRHA 2NSLA 1W2WB 2D0OB 5LZ8A 5ECDA 1TYAE 4CL3A 4EKDA 5I6DA 2EZ9A 2CXUA 3H3FA 3HJHA 2ZIGA 4YHBA 4WA7A 3JR3A 4CIAA 5CDSA 4QXPA 3H5TA 2WF9A 4R1TA 3V7WA 5HQTA 4F93B 4KP7A 3ICEA 3K2QA 2Y8EA 3I9V6 3E9RA 3R40A 5KNCH 4URYR 1N9KA 4EYKA 1PX0A 2A9KA 2V59A 1L5HB 2O0HA 3X0DA 5ITVA 1AGXA 4Z99A 2Q5QA 2P1RA 5AHOA 2VTBB 3MJDA 1ZX1A 2FSUA 2ZI4A 2R96A 2VP6A 2YINC 2O5RA 1H85A 2YV4A 3R4VA 4MWGA 5KVCA 2Y9PB 4D74A 1FU8A 1MB2A 4DIEA 1FPQA 3I23A 3CPJB 4GUAA 3OTQA 5JUWA 4C03A 1HDGO 1JFVA 3MRXA 3P2EA 3DL2A 1C3OA 3WDKA 2J3EA 2JL1A 1TO6A 4DCVA 2ZJ6A 4YV0A 4J29A 4AAYA 5AVWA 2UXCB 4DJ5X 4JOCA 1Z2EA 5BQXA 3GJ8A 4Z0HO 3H16A 3U31A 4GE3A 1PL8A 5KTKA 4YRZA 1U3FA 3DVSX 3OEEA 2X2EA 4COKA 5A4DA 1KRXA 3LY8A 2QYHA 1OY1A 2A0KA 3FUCA 5F52A 4WASA 5JJBA 1ZN8A 4N3AA 4X1KB 3OT4A 5ANRB 5K3EA 1TVCA 3ZK8A 1IUNA 2A14A 2ZSKA 4R8RA 2Q2OA 1UANA 4FHCA 1FBNA 3PI6A 5B4TA 3DC7A 4H1UA 1PU2A 2BCJQ 2WP8J 4EITA 3BE6A 3KYCB 1Z16A 1FUIA 3EYWA 3Q8XB 1E8NA 4PLVA 721PA 3MGKA 2PUJA 1RI5A 3BMOB 4FI3F 4ER3A 3VZDA 1JAYA 2DKFA 4F1JA 4TROA 3DCNA 3GLFE 4DTIA 1KPGA 3T61A 2FSVC 4DR6B 3ZCTA 5AJYA 4G9BA 3FVRA 3I09A 2CBXA 2ID8A 1TLTA 3NTXA 2L2QA 2G70A 3N8NA 4H77A 4K88A 4YO8A 1AMUA 1I8TA 4FOTA 4BO7A 2Q2QA 2Q6IA 4GWKA 4Q6BA 3FSGA 3IBGA 1MT3A 1DL5A 1CDEA 5ILGA 2VNAA 2NUPA 4PWYA 4P98A 1I0LA 3QVSA 1DG3A 4X7MA 4R1MA 1YBHA 2VDKB 1KBQA 4OXQA 1DEHA 1E0JA 4G0QA 1U6JA 3TUIC 3HXOA 2DR2A 3K30A 4US0R 3O94A 4RVSA 4EQ6B 5H02A 5TS2A 3EPLA 1NAIA 5DEIA 1WSWA 4B34A 1F8FA 3CR7A 4G37A 4MV3A 5ITWA 2RGGA 2NYAA 4PLYA 1GU0A 5ESWA 4WINA 2PZJA 2HRRA 2DQSA 3DMDA 3OUTA 1P5JA 3FG9A 3CG4A 1K7YA 3PFFA 1B00A 2VC2B 2WHEA 1RQXA 4AUNA 4AYXA 1QORA 1HE4A 2AR7A 2CDRA 1JR3D 3FTQA 3K09A 2EW8A 1GV0A 2IYWA 1TM7E 1JJVA 3UNXA 5EQFA 4RD2A 3WGMA 3CN7A 1E79A 3ESDA 2EP5A 4P7GA 4EHNA 3F6SA 1IN6A 3FD8A 2P9CA 3ZK7A 3WYBA 1FDRA 4D4JA 3PU6A 5EVJA 3DOOA 2XUPA 1CLUA 4UPVA 1VZ3A 2KBFA 1BKDR 1PUIA 1X3LA 5AQ1A 2OZVA 3CJTA 4HC4A 3HN7A 2X0FA 1V5FA 5EAIA 1KO5A 3AUFA 2ZJAA 2A4KA 3PF9A 5JAZA 3U60B 1IAVA 4I5GA 4RHTA 4Q82A 5H5JA 3JVVA 1WLSA 3FDXA 5J2UB 3WQHA 1UJBA 5A9TA 1ISIA 3H0KA 5CB4A 5CDYA 1T8SA 1NM5A 3KSDO 3W77A 3Q7RA 3L4BC 1PF7E 5EUQB 2AH5A 1F4LA 1N0UA 2GNOA 3IA2A 5C8XA 1U2RA 3GROA 4WBSA 3PCTA 3Q3VA 3KUUA 4TPKA 5DXJA 3TSOA 4LECA 2WNSA 1SB8A 1BAPA 2GZ1A 2AMYA 3ECCA 3HKDA 4FYHA 1DBWA 1U7ZA 3JWPA 3SYRA 4MWTA 3QUSA 4IGFA 2ONYA 3OOSA 1JX6A 1KJJA 4N5LA 3RUAA 3C6XA 3WHPA 3HTXA 1G8KA 1DELA 1I7LA 3OZBA 3QEBZ 4OP1A 3GN2A 2L19A 5KX5B 1M5UA 1I7QB 1T9AA 2B1GA 1L1QA 3CLSC 3FSJX 1VB3A 1FFSA 2R62A 1VQ1A 2ID9A 2R8BA 3M81A 4MS3B 4UPEA 1GTSA 3PQEA 3KKQA 5JC1A 2FRXA 4ZREA 4GW3A 3L01A 3QWFA 4LRTB 2E4YA 2XZDA 2PMKA 1LDBA 1J2UA 4WXYB 1X8JA 3T1NA 2F8LA 2QM0A 2NOAA 1KI8A 2OWEA 1ZGBA 1N7HA 2HEIA 3FJYA 3Q2IA 4AW9A 1I6WA 5C7LO 3T3NA 1YZVA 4IOKA 4ZQFA 1EFVB 4FGKA 1KBOA 2QJOA 1WW3A 2VF5X 3C98A 4HQRA 4OOEA 3RSSA 3ZQUA 2UZAA 4UUPA 5FPHA 1T2VA 1OX4B 1NVVQ 2ZI5A 3PPYA 3NAQA 1QKJA 3DLPX 3L8YA 2PY6A 4ZC1A 3ST7A 4CUZA 4QDTA 4COOA 3P8ZA 2GUWA 4LJ9A 5BRNA 3UJPA 1XA3A 3CKKA 1LX7A 3RTEA 1TT7A 1N1DA 2CK3A 3QP9A 2JZNA 4YUXA 1ODLA 2WR8A 1GYPA 3A6KA 2VJLA 3B51X 3G13A 4TMVA 4JNCA 4BNJA 3QKIA 2ODQA 2PFGA 1EGVB 3OCJA 3WGHA 1E32A 4MAAA 1DTSA 2IOQA 4F04A 1BMFD 2GHQA 4HMOA 1B41A 4MPPA 4PPFA 4Q47A 4ZT7A 5G4KA 1OMOA 1U9CA 3TLAA 1G8MA 4DCTA 4KPUB 5CDFE 4LZLA 3JSAA 1GKYA 3L4KA 4LUCA 4YJFB 4WV3A 3KKOA 2VRWA 4J94A 4BGEA 4DMGA 1JR3E 3FMOB 5FHRA 4JASB 2HQ1A 3WBJA 4MTCA 4I66A 1FMCA 1H2WA 2IEIA 1XTPA 2H4FA 5FPPA 2PT9A 2ZI9A 1PT9A 5JBQA 3K72B 4RSMA 3CT4A 4CV3A 3WLJA 4URXR 3TXYA 1FNBA 1BKSB 1GA6A 3E27A 4S0ZA 2EJWA 3WNDA 3NS7A 4EHHA 3MT8A 1QE5A 4AU1A 1JB1A 4IWYA 4A82A 3WYFA 2B25A 4BMOB 1E1RA 4RF5A 5F1YA 4JT9A 4PG5A 3UMMA 1CJTC 3BEOA 2GK7A 3A3PA 4AZ0A 2CD9A 1PE0A 2QAGA 3VNSA 2JZCA 1YRYE 4DA7A 5AVUA 3N5CA 4LDQA 4RM3A 4MVJH 3S6JA 2YVAA 3EYAA 1K0FA 2XNDD 4W7HA 4L4SA 2HA7A 5AM3A 4LRSB 1R5NA 1Q7EA 1PTJA 3GMSA 2IHJA 4YP0A 1BWPA 5GONA 3CPHA 1UBOS 3U4HA 1XVTA 3EDMA 2LCQA 3SZ3A 3WR5A 1SGWA 2FUNB 3BFVA 2VUUA 3JYPA 2A86A 3QF4A 1G55A 3P4XA 1SG0A 2VXYA 3R6DA 3X1YA 3DJFA 1EE9A 4UNNA 4WOCA 1U0TA 3T7TA 3EA0A 4ZDKA 2JGJA 4AC9A 2QQ5A 2C31A 3G0BA 3UXHA 3N2GB 2AN3A 4PPNA 3S2ZA 1IZYA 3IE1A 1DXOA 4RGYA 1P6XA 5D87A 4TWRA 2E18A 3AIMA 5UKDA 4MXDA 1BEZA 1FP2A 2WOOA 3V6MA 2XMQA 1VJRA 1Y8AA 4Q1AA 4XDGA 4ODIA 1QIMA 2P4QA 1QIDA 4RVCA 3ZNPA 1Y37A 1BVUA 1R3DA 2K4MA 1PG0A 4ARAA 4XWWA 2QQFA 1LGYA 2O2GA 4DUGD 1D1SA 1JWAB 5CURA 5F3DA 1UUFA 3C8ZA 5HRUA 4CKEB 3D3KA 1XTBA 4JFRA 3HXLA 4JJZA 3T6KA 2GEKA 2JGAA 4FZVA 1RXCA 1NMXA 4DCUA 5CAEA 2Q5JA 4PIPA 1CNMA 1P2DA 1WU8A 3QOWA 4DLAA 2C7RA 3OA0A 3SKYA 1QRAA 1E0DA 3IPYA 1I9GA 3JQPA 3LUKA 5J4KA 2ZRHA 3MWEA 4W6QA 2OG2A 2GEUA 3KV1A 3U4QA 4RFSB 5IBCA 3KAKA 1ZOSA 2WAOA 4QG7A 1E4VA 1OIVA 2D5BA 4XLLA 5J3JA 4OMFG 1CVRA 1OVGA 1TO2E 3I4FA 5A0TA 2WPNA 4NWIA 4HFNA 4R2LA 3HGQA 4WL0A 2HSGA 5FFFA 5FORA 1GVNB 2HIHA 2P9ZA 3O2JA 4E31A 1S8AA 1VDZA 2VJPA 3K53A 2P78A 5NULA 2X23A 1UJ4A 3CNHA 2FWIA 3USCS 4E07A 1RE0A 3V2IA 4O4HA 1WXFA 5K0EA 4MW1A 4PW0A 2J0QA 2WYOA 1AN0A 1CWUA 4DCOA 3CS3A 2ATCA 3WK6A 1JXMA 1NE7A 2HIAA 2XWBF 1X14A 4ON9A 2OCIA 2YZKA 5KNBA 1DBIA 3RD5A 4JI4B 2XQJA 2I9KA 3DL4A 2H06A 2RGNA 2W90A 1X9GA 2P2GA 1CF2O 1UBGA 2Z2KA 2VZ9A 3F3SA 2CMFA 4J4HA 5MN5A 1Z0ZA 5DTIA 4Z4QA 1Z62A 1S9HA 3S81A 4GSKA 3NHFA 2QAJA 4HD8A 2FPKA 3BQNB 4WK4B 4L4UA 5EE5B 5LC1A 4RTMA 1JDBC 1TM1E 4OHPA 1U99A 5IK2A 3UCXA 4FDAA 1DQZA 2EX4A 2XEXA 1F12A 2Z9BA 2YXPX 2Z8XA 3KHTA 1W35A 3Q2OA 4KYVA 4UTRA 3BRCA 2CJXA 5HKAA 2OCLA 1C4OA 4M1ZA 5HBGA 1W36C 4FFVA 3SDSA 1HQYE 3LUHA 3UATA 2IP4A 3T3DA 4NAUA 3S7ZA 3VYVA 4NJOA 1SUFA 2IYAA 4B79A 5DP1A 3N7UA 3KWJA 3CSUA 5DTRA 3SXJA 3FZYA 1FUYB 1KAEA 4RWEA 5TQ2A 1WY7A 1E59A 4KUHA 5LMCA 1JECA 2AT1A 1FJ2A 2AQHA 4X84A 4ADSG 3D0OA 2GJ4A 3NHLA 5GVRA 1KQ3A 3CRMA 1W0JD 2NPOA 5JAPA 5DRYA 3CUWA 3RUEA 3VR2D 4FN5A 1KH3A 1SOAA 1YHNA 2NU9B 4CMIB 1EA5A 2WU0A 5EIFA 1H6DA 3GO4A 3WRXC 1U0FA 2O8NA 2XT6A 4JJ7A 1U8AA 1Z7WA 3PHHA 3WWDA 4DEXA 4ZYLA 5K0FA 3Q8MA 1IPFA 1NSYA 4N8SA 2XE6A 1TA4A 3DBHB 3KSMA 4R31A 1PS9A 1HG1A 4Y9DA 4A5OA 4B75A 2PUDA 4RZUA 1D4OA 1SNYA 1BFDA 2RGCA 1P77A 1GAXA 3L0PA 4ZARA 2C7BA 1EQUA 1T2FA 3JQ8A 2PBZA 2PZLA 4I6GA 2D1QA 1C5KA 4TRJA 1EVYA 1TF5A 4AJHA 1B42A 1O57A 1UT8A 2MINB 5F2NA 2R751 2ZYTX 2CGEA 3KQSA 4JBWA 1HYGA 4LYDA 4IXTA 3AMVA 3G7UA 1I6KA 3MM4A 3Q6IA 4RXMA 3WFZA 2CV0A 1EWYA 2WQZA 3WA6A 3SQMA 4UDXX 1LI5A 2WIDA 1JFLA 1TJ5A 5IX8A 3UV6A 1Y1SA 3AF0A 3E3OA 4LXXA 2EIHA 3OFKA 4XCVA 5CT6A 1UH5A 2B98A 1RRMA 5GGXA 4DLNA 4TYPA 4BZXA 5HRAA 3PUHA 1NDUA 1SK9A 2BR3A 2PIDA 5TEVA 4GGPA 4UEOA 5C1DA 3GHHA 2JI8A 3CEAA 3M6MD 1PJAA 2VUSA 2P6MA 3G0HA 4UHJA 4JLWA 2VRNA 2ZI7A 2FUG6 3KB8A 1BX0A 4B8WA 2J30A 5F5XA 1MX9A 3KFXA 2O54A 4J4TA 3CZPA 5DW0A 5BUQA 4C3OB 2KS6A 4F9TA 2I67A 2ZLBA 2QTFA 2RDMA 3PVZA 3NATA 4LI3X 1T34A 3QEMB 4D0LB 1H5UA 3GFRA 2DC1A 1Y7PA 4FSHA 3K1YA 2YBDA 3TO5A 5KMGA 3PHBE 1YUBA 1N2CA 1VMDA 4XEUA 4QUEA 1FP6A 1ETUA 4G4SP 4BPRA 4CPDA 2R0QC 1FL9A 2ZSUA 1Z18A 3IV7A 3TZEA 5H8WA 1NC1A 2FMUA 1XZGA 2OZLB 2YX1A 5EOVA 4JVSB 1L0BA 1FNSA 1PSDA 1EWKA 5KSPA 2YWDA 3OQHA 4K3VA 4FYVA 5KUTA 3FCOA 3HJAA 3ZXUB 1QOPB 4WHMA 4NMHA 4CDGA 4BNKA 1QQTA 1XXLA 3FWPA 1PNTA 5EEHA 5IJ0B 4L15A 3JWEA 5B1SA 4YCDA 5FF9A 3WOVA 1VHDA 4TL8A 1DAGA 1CZKA 1Z5WA 2HJRA 1GPBA 2FWMX 3ELUA 4HYEA 4NF2A 5IVPA 1CY4A 1OVMA 1PG2A 1V5GA 4G0NA 4R68A 5EYPA 1EEHA 1HFEL 2FSIA 4X54A 5JTTA 2C97A 1NAHA 5JXHA 4KXMA 4D6PA 2VRBA 1ZQ9A 3L0BA 2IODA 3AHEA 3DPUA 3FDIA 2OYRA 4HDKA 4KDEA 4B43A 4AO8A 1PLJA 2G4VA 1YVDA 4A7PA 3RLFA 1J49A 3P1JA 4NMMA 4ZI3A 1K98A 2ONCA 1PJ2A 1BDBA 1SXJB 2QR5A 4RSHA 3RUDA 1LPPA 4ECAA 5CCBA 2VDRB 1JPVA 4CMGA 1K6EA 2YCBA 4MUNA 5KSZA 5D6NA 2JFVA 1P9LA 1FDWA 1VL6A 1Z8FA 1JJIA 2EHDA 2CSUA 3CTMA 3PC3A 4DMCA 2ST1A 3QU7A 4KMRA 1D1PA 3M7IA 4LV8B 1E9RA 4G3XA 4BCBA 4GRDA 1IBKB 3ICWA 1G4HA 4N5NA 2WD8A 4B3JA 3VPBA 3ZC3A 2RKWA 3GFFA 2KWIA 3QV1A 4ZP1A 4TUYB 3K2EA 4DIOA 2JHAA 1SBYA 2XQFA 4EEKA 7MHTA 5AKLA 2QT9A 2V0GA 1NIPA 3BJRA 4YCBA 5E2IA 5EHNA 1T5BA 3SPXA 5C2JB 2C7PA 4TLAA 4KX3A 4B6EA 3NYIA 4RMIA 4LKOA 3NHSA 1E2UA 3EC7A 2DUNA 3WSWA 1B0PA 5DBIA 4DB2A 2GD0A 1TCBA 1MAAA 1HDYA 2FA9A 5BV2P 2HJ9A 3LQQA 4FQ7A 1ZGGA 1QO7A 3GAAA 3HSKA 2GAFA 3KQTA 5HIIA 4UHDA 1MO4A 2EKBA 1BHSA 4FOLA 4PLCA 4B8ZA 3U09A 3VYUB 3BFPA 2C5BA 5JSKA 3V7NA 1KZGB 1OI2A 1TZJA 3BL8A 3UY4A 1MRNA 2QD2A 1G9XA 2FP4A 1BD4A 5MGBA 4MVJF 4DJTA 2CHVA 1VYUA 5TQ0A 2PT5A 3EXHB 5AK4A 3TQHA 2PVPA 4BRSA 1P1RA 1P2FA 1U1GA 2CFOA 2CXRA 2JFZA 3C45A 3RVOA 4KRFA 2BTQA 1P6QA 4QM6A 1IWOA 2OD9A 1C50A 3W7BA 5BSUA 4YXFA 3CBQA 3E58A 1AQLA 3AL2A 3NJRA 4HGOA 3ZLBA 5EMJA 3BGIA 4ZQIA 4B6RA 4BRWA 5C81A 1QM5A 2J3LA 2QRGA 4ZHQB 1E64A 4K1LA 4R8LA 4X6XA 1KDRA 3EFBA 1U5BB 3RRBA 4ID9A 4YV7A 4JEMA 1OYWA 3BHIA 2D8MA 1DAIA 1N6HA 1V6CA 2VT7A 1C9KA 4NNOA 3FRHA 4GLLA 4YGXB 4FWTA 1P3DA 3PFNA 1J2YA 3IP7A 3UA4A 1LV8A 3W90A 1FTGA 6AT1A 3R3UA 1E3MA 5F4BA 1BVRA 2Q2WA 2FGKA 3ENWA 3AEQB 5T67A 3BSYA 4ERNA 3THOA 3R7NA 1LXCA 5HMLA 4YCJA 1WMEA 2C59A 3RWOA 3IMKA 2IPLA 4G0OA 4PCUA 3PC6A 5D3MA 5JCPA 3UYKA 3O4IA 4RV4A 5AJZA 1PWXA 3GRKA 2I7VA 1TMYA 4HPWA 3EJ6A 4ZAZA 4IIYA 4CR6A 3WMGA 4Z53A 4AURA 2QORA 5FCDA 4UCXA 2ZRMA 4UC0A 3SEFA 4DM7A 2IH5A 1QGYA 5CTJA 1HNWB 1XL0A 4EGSA 2AE1A 5TXGA 5LQRA 4KXXA 1K6JA 3LP6A 2C3OA 4NV3A 4OYHA 2E4VA 1ZBQA 1MEEA 1NJ5A 1Y33E 2XD9A 4L95C 3WMXA 1AA9A 5JAHA 3T9DA 5H59A 4E5MA 1KU6A 2HI0A 1E3DA 5KEIA 5COAA 1BZYA 4YUAA 2UYHA 4A2QA 2Z8YA 3LL7A 3IJ5A 2C94A 5DYWA 3TQTA 4WFQA 3S2YA 5BV7A 5LQAA 2IYSA 5AM4A 1AQNA 3V80A 1U1CA 2V4MA 3AEKA 3F2IA 4YJDA 1XMSA 5KJFA 5LQUA 2WWTA 3ONVA 4RTOA 1C3VA 3NJ4A 3Q1LA 3AB7A 2Q0XA 3AB8A 1Z5GA 5ICMA 4JL6A 5CLJA 1VJ5A 3PRHA 4A0QA 2HK9A 1FBTA 1WMSA 5IVDA 1C7ZA 5ED4A 3T5MA 4FYPA 3CNQS 1WHTA 5A3VA 2A7QA 5KYVA 3NHBA 2GPTA 1W36B 2V5UA 3DTTA 2MT9A 1RVV1 4ZCPA 1S7CA 3LXRA 2V7WA 4YCCA 1XZLA 1YE5A 2FEAA 2WPDD 4MWEA 4XB2A 2HA3A 5BQ5A 2O7QA 1U2ZA 5LB2A 4E3ZA 5CBKA 3CLVA 5JE8A 1UMKA 5LZ4A 4LHSA 4RS4A 2YHUA 2NX2A 3U3OA 2CE2X 4KQXA 5I7EA 4EB8A 3PPXA 3P0JA 2FR1A 4K86A 3RYHA 2LPMA 3NX4A 4MI9A 1CR4A 1VJDA 1KZ7B 3MWYW 3LQYA 4RKYA 1NPTO 2R8XA 3R7DA 4MWSA 1EDBA 3D6JA 5JXJA 3FNQA 3MTIA 2ZUEA 3HQ4O 4R3WA 3UIEA 1I3LA 3PEVA 4KBFA 4HNAB 3VHQA 4L8FA 3GEMA 3VKVA 3WRYC 4LZAA 2XV1A 2B8WA 1E96A 3HU3A 5IEBA 2DKNA 5FP0A 4CMEA 1U63A 4MW0A 3SZOA 4RX1A 4AN4A 4Z9BA 2NP7A 4G5OA 3QX3A 4FMCB 1W6RA 2WHRA 2IEDA 1GTVA 1TKBA 3SJUA 1NQOA 3HCRA 2B2CA 1MXFA 1XAGA 2GZSA 4DV6B 1G7SA 1HDIA 1WSAA 2A5LA 2CHUA 2Q21A 2QS9A 1HOXA 1C9MA 1W87A 4G2NA 4P93A 3BF8A 1CEXA 2FN7A 4G1BA 4UQPA 3WYGA 5GQSA 2FWNA 2WYVA 3AEXA 4YRTA 1U3VA 3LDUA 3V9PA 3C39A 3WLLA 2HNAA 1LEHA 5CT9A 3UV7A 5J9FA 1GJRA 2PRKA 3RVSA 1T9BA 2GF0A 5LIRA 4L5JA 1A50B 1IVYA 1ZY2A 4G4JA 4PZDA 3RJTA 3DAHA 3P9RA 4RC9A 4CV0A 1UBEA 3AY0A 4B48A 3HBLA 3T12A 4D8TA 1MFZA 4C0AC 1PDOA 2L82A 3QHAA 3LX6A 5EEGA 2NIPA 5HDQA 3NHYA 4BKMA 2ZXEA 5K0CA 3NR2A 2O8EA 1VLHA 4XOUA 1TC2A 4F8JA 1QFMA 3HWRA 2BMEA 2CMDA 2C99A 2R1VA 2VUIB 1QVRA 2M32A 4UM8B 3F7TA 1OBFO 3G2KA 4C7KA 3ABOB 1Q0QA 2H1SA 3SJCA 3VPCA 1GP2A 2V7GA 4RHFA 1QH9A 1U7DA 2P0YA 3D3WB 3KRTA 2EJTA 4UPDA 2LZ0A 3RANA 3L82B 3EE6A 2NZ2A 3PGJA 5AVSA 5E1MA 1UMBA 2IFTA 4DVGA 1OBHA 4IDDA 5FUQA 3OOEA 3LWBA 1N36B 3B1YA 4WERA 1RQLA 2DH5A 2PRJA 3AUXA 4INZA 3W34A 4W5JA 4P35A 4PYJA 3KVNA 4BPBA 4EO4A 3G5TA 3Q7QA 4OQMA 3ILYA 5D8DA 3IMEA 3L7YA 3VDRA 1WULS 1S2MA 1ZUD1 5SZJA 3ZHZA 4TKVA 5IFLA 1AHPA 4GLJA 3TAXA 3BCRA 5FTMA 4QATA 3RV4A 2HBYA 2IYRA 1HKUA 3BC1A 4XB1A 3F5QA 4DC9A 4KLZA 2WQ6A 5EWJA 3PX7A 4N0QA 4QX6A 1XF1A 1YIOA 1U0OC 4QGGA 2ZRBA 3LFHA 3IOYA 3UM9A 4JI1B 1YL5A 2FP3A 4WNAA 1WZIA 2Q7OE 1ZONA 4AD8A 1T0UA 1OLSA 1YJBA 2EW1A 3ZGZA 2B4KA 4AO6A 4MWCA 1T4CA 4CDRA 2YWHA 3MJSA 3OKCA 3VU9A 3FCEA 4GPZA 5KJ6A 5SZHB 2ZRNA 3A3KA 4AK9A 2JCXA 1SVOA 5AM5A 5FOVA 4EEXA 5JAOA 2RBEA 5AKZA 5GWXA 1NVDA 5IKOA 1MVLA 3VSAA 1OAOA 3BWXA 3LQKA 4MS4A 5HCIA 1HWYA 4IV5A 1SBIA 4F4DA 1KIAA 3FI0A 4WKBA 5AKIA 5GV8A 4HZGA 4D7AA 1N2CE 2J41A 3JQEA 2GTHA 2QXUA 3F3MA 4WXPA 1I6MA 1ILWA 2VDNB 3ANTA 4E09A 4XPIA 2ZYAA 4K6FA 3RTGA 3BOSA 1M8GA 3KE8A 5K1ZA 4OHFA 3IYLW 3MCAA 4KWHA 4X7BA 3UW3A 1QGUA 3MAGA 2NZJA 4ZPJA 2O7RA 1CQJA 4DKXA 3K8YA 1HFJA 4HO1X 1H0RA 2JGLA 3U7QA 4RIFA 4WOKA 4EO7A 2FXVA 1CQZA 2JAXA 1VLQA 2EF0A 3AW9A 1CB7A 3E48A 4UE6A 5J1SB 3TZCA 5FUYA 5AKJA 5B3JA 5DISB 2XTNA 3FOEC 1COZA 1F20A 1K1EA 1XEXB 4G09A 1SC3A 3T0FA 3VPAA 3WHKA 4YRQA 4CGYA 1XTUA 2OILA 4I6EA 1A1SA 2AYZA 1QGAA 1AQUA 5A9SB 4GUDA 2F2TA 2Q6VA 4GWGA 2BLLA 2YFYA 1FK8A 3PCXA 4WXRA 5HKKA 3WGZA 4P0PB 3IXQA 1K97A 2W2VA 1H2BA 1HSZA 2ZDGA 5BR7A 4N3GA 2C78A 2H52A 2Y1EA 3K71B 3T3OA 4MUXA 3L7KA 2YUTA 3K1AB 2OCBA 4OHMA 3W9YA 4DJEC 1DGQA 1VG0B 2QROA 4WD3A 1JKMA 3R6TA 1Y3DE 3WWPA 3H9GA 3IP1A 3FWYA 3UJHA 1UPBA 3LRPA 3O4HA 2IYNA 4KGZA 3VDNB 3AYZB 1MHTA 4UULA 1P75A 5KNDH 2QGNA 3QENA 1VIAA 4OMCA 3UXYA 3ZEIA 1KH1A 2A84A 2WUVA 4K26A 3EBOA 1ML3A 4FFMA 1MC8A 3LO5A 4BMVA 1I7NA 2OYSA 3OQIA 5I8PA 2EDAA 4UBKA 4WOJA 4EGJA 1G2PA 2D3WA 2VQ3A 4ED9A 4Q1EA 5IS2A 5IT0A 2AC4A 5K0JA 1MJGA 1O94A 1CG6A 1FXUA 3KALA 4QRIA 1GU7A 4AXXA 3DZBA 3I92A 1EJ0A 2WLTA 3R6LA 3TF5A 3SWWA 1MZPA 4BCCA 1KZYC 3ND8A 5DYNA 4V0QA 4LV5B 4Q9AA 4KQ1A 4MULA 3UFBA 5E2BA 3BMNA 3VSCA 2WJGA 2DPLA 3I2IA 2E4XA 3PG5A 1OZFA 1YXMA 5AUNB 2O8BB 4NZYA 1YC5A 4HQ0A 4BDTA 2NUAB 5DP2A 4Q19A 4XWOA 1COWD 1ML4A 4JJ8A 4UD6A 4KV9A 4M9CA 1L7DA 3BXGA 3K9BA 2ZCJA 3F3KA 1WXXA 4NCXA 2JFOA 3QVJA 4I3GA 2C07A 4OGLA 1FJGB 3HRIA 1Z47A 2DEUA 2CHGA 4EAAA 4LY6A 2OVBA 3ZNQA 4UATA 2QUHA 2CF5A 2BJWA 3LBAA 4ZRDA 4V1CI 4AG6A 1E5TA 1DEXA 2ILVA 2H57A 5DLYA 5F64A 4YRNA 4ZEVA 3IEPA 4JKOA 1QQ7A 3TE7A 3J7TA 5EIBD 2DFLA 1GSIA 1RBMA 1Z88A 3DYVA 4IZIA 3T4XA 3NTUA 1SHUX 4MINA 1Z6TA 4AKGA 5DI3A 2PX0A 4ER7A 2OESA 5FRDA 5FJJA 4FDUA 4QQRA 1ANKA 3MRTA 3QE3A 1OIWA 1H2EA 1L5OA 1US8A 2FQYA 8LDHA 4XKJA 2G17A 2QRMA 4O1MA 1H5QA 5EE1A 3DE7X 4WBNA 1CR1A 3NBZC 1EHIA 1R50A 1ZNQO 1D04A 2HN9A 3IRVA 4W5RA 3MIZA 3A6JA 2FEWB 3AL0C 2X2OA 3MMNA 3AFMA 3OIUA 4GLOA 4Q15A 3PVCA 4B3RB 2GT1A 2ZAOA 4QBGB 4PLFA 3NOQA 4G6ZA 5REQA 2XT9A 4LDAA 1M34E 3ZVLA 3JAKA 1G66A 2FLWA 2PMDA 3WGIA 4GD3Q 1V8PA 1MAUA 2AZMA 4LX8A 2ZIXB 1AKEA 2FWPA 2OHXA 3QBJA 4OIMA 1JA9A 1KVRA 2ZYHA 2FQXA 4GXQA 2PSDA 2FKAA 3F5SA 3F4LA 5TGZA 3T4PA 4CQMA 3HV0A 1AGYA 3G8AA 4OXKA 3IAHA 4DA4A 4LK3A 5K05A 5G3ZA 2B37A 3KJXA 1ZDMA 2YWEA 4HOYA 1AV6A 1CETA 2B4YA 2I65A 3KHKA 4G9GA 3JQFC 1X7HA 1YONA 2O8DA 3MZ0A 2UKDA 4M0CA 3LT0A 1SG9A 2DBYA 1UBRS 3DT8A 3DTVD 1XKXA 3RRXA 2Q4DA 2PAFA 3QUTA 1D4AA 4Z9AA 5A1TA 1IY0A 2YJ6A 4G41A 4NFSA 4F71A 4EQZA 2FX2A 3DBRB 2DUMA 1BD3A 5ETJA 3T7JA 4YJ2B 2GERA 3IIKA 3O7WA 2A0FA 1RMYA 4OFZA 4RK7A 3UXEA 1Y89A 4J90A 1F8UA 3FGOA 4BNLA 2NQ8A 2IXFA 3E84A 4ASUA 4BNHA 4DLUA 4X65B 1RHJA 4OKNA 4Y9TA 4YXWA 3ADBA 3VAYA 2H48A 2IOYA 1GKLA 3MELA 4JXJA 4EGCB 5KNCA 2NV2B 3AM3A 3G23A 5CG2A 1Y1LA 3C24A 3FYSA 1IK4A 2X9QA 1Y6JA 4NOKA 1UC5B 3TRIA 3CSDA 1O4VA 2ZJOA 1U80A 1RACA 1U7OA 3DP9A 1JIUA 3TSWA 5CDTA 1JDUA 1SUBA 3QPBA 4TTPA 1BKYA 1NXVA 2D00A 1K2VN 2VYVD 3ZS8A 1QYIA 2OQRA 4CLEA 2PN1A 5JCOC 2C7OA 3DHVA 2GRUA 4UHKA 4X0EA 1DTEA 1ULBA 3FFBA 2C8JA 4QBHA 4OLAA 3CXUA 3G2JA 1FY2A 4BBPA 4CKXA 4OI4A 3P96A 4X63A 2P91A 5TMEA 4D4MA 2XB2A 3NZEA 2C2KA 1DC7A 4FFBB 4MLPA 2O8FA 3TSZA 5B4UA 1J33A 2JHCA 3QHQA 4CM3A 1X7YB 2QV7A 2XBUA 2EKPA 3LV8A 5C9ZA 1DEKA 3I6QA 2JK0A 4KXLA 3K70C 5JSFA 5DHRA 4YLEA 5CH3A 2FFHA 3PJRA 1D4ZA 2OKCA 3I5AA 1MD9A 3FJ1A 4JLMA 1K7SN 1Z2DA 5JZMA 4CV2A 2NZ8A 2PKQO 3FLMA 4W9NA 5BOSB 1H8HD 5CIYA 2R6R1 4LXTA 4TMFA 3LNTA 2Z4TA 3QVLA 3UAVA 5GINE 1HURA 1DJLA 3AHIA 2E2WA 3DWFA 2VYCA 4BFVA 2X19A 4ONEA 3JTEA 3NTOA 4Z51A 1NXOA 1Z0FA 3DGEC 2XB6A 3CW9A 5KYTA 4NXMB 2HEGA 4OM8A 2UYQA 3GRRA 4BDSA 3SSNA 3A7DA 3SZLA 3UH0A 3MB8A 4M0MA 1JLHA 3GG2A 5BWMA 5LMUB 1HK7A 3TL3A 2F7SA 3DZJA 3EIQA 4IDHA 4AMVA 2J09A 3LSTA 4O08A 4S1TA 3L7IA 1HDEA 1YZTA 2OBNA 1O2DA 5KCMA 1GCUA 1R37A 3UG6A 5F3RA 3F5FA 5JDIA 4XIFA 2YWJA 3K9LA 1VP3A 2WT8A 1MF7A 4PFQA 3SU8A 3W79A 4P8RA 3IT2A 3U2QA 4EARA 4KDRA 1W5FA 4V39A 4Y2TA 2J7KA 3SQLA 1QC5B 4GWLA 5DKFA 5K51A 1P9RA 2I6GA 4HK4A 2A5GA 4Q01A 4RZSA 1LFDB 1IPEA 2XA9A 2ZUCA 1RWKA 2ZYUX 3CISA 4I4NA 4NBKA 4V0ME 5BQOA 4EHJA 4UEJA 1AOXA 3JWGA 4CU5A 1GCAA 5HNKA 1CUDA 4NEGA 2C9YA 4Z54A 2OORA 3RUHA 1AA6A 2A7XA 3GMIA 1O7JA 3JQDA 1YBVA 4M7OA 4YJ3B 4OQFA 3CG0A 4OFWA 1VJGA 4EI2A 2BCEA 3FH0A 1AGNA 1Q0ZA 3JWJA 4RL6A 1TUBB 2PNFA 2DFNA 4QYTA 1NBHA 1ZD3A 4V0RA 1EXWA 1OXMA 3SR4A 4XOIA 4ENUA 1S96A 4OQEA 4O4IF 1JGTA 3H04A 5KHLB 4RUKA 4FMCF 4NJMB 4RF3A 1GZ4A 2X5JO 4BB5A 1ZG3A 1Z6ZA 2SKCA 4YMGA 2EGGA 1MT0A 4XLTA 5ARCA 3ROKA 4ZVQA 3S1AB 3GLGB 1L5QA 1OLUB 2YVKA 3WGTA 3VNQA 4X1KA 3ZWVA 4F12A 5E1OA 1SC1A 2V8OA 3BM5A 5E0KB 4C2TA 2J32A 1ELOA 3CQ9A 4XTCS 4NZOA 1JDNA 1XRPA 1MIOB 1SELA 1XK6A 1TM5E 1FUUA 2JBAA 3KYCA 2GYVA 4UVGA 4FB5A 5LP6B 3KSAC 5G53C 3E22A 4C0JA 4DJDC 3WDSA 4DR1B 4A2WA 4DT1B 4EATA 2ZRIA 3JALA 5B53A 3OPQA 1PL7A 2I87A 3DZKA 2YJ4A 1NBWB 2ZR9A 5L40A 4OHYA 4YWJA 5IF3A 2FI1A 3LS2A 4Y2HA 2CXHA 4DS3A 2GJSA 3U3JA 7AT1A 1UM8A 1CY2A 2ZR8A 4IAOA 1MC1A 1CQPA 4KVAA 1JEEA 5I4IA 5AP9A 2LV8A 2W6JA 3ZDXB 2GNPA 4TLCA 5T8KA 5JR3A 2YC2C 1W96A 4MA0A 3H4TA 1XVIA 4GMDA 3W5AA 4HBGA 4UOQA 4EQ6A 4HVLA 1ZN7A 2RH4A 3ROMA 3V6LA 1VLVA 4B3GA 3C0KA 5L4SA 2Q5OA 2ZBPA 3AM4A 3C7DB 4EZEA 4POOA 1PNRA 3DR5A 5ALFA 1IBCA 3ZIAD 1HT0A 2UUPA 2XVMA 2NNLD 3H1AA 3H0CA 3PGA1 1U0GA 1ULAA 3F8WA 2VBFA 1MV8A 1UK7A 2H2GA 3G6WA 5TPZD 3RFXA 4MUEA 3PGKA 4DG8A 1PJQA 1IWBB 1JUDA 3ZDEA 2HJWA 4BMNA 5I48A 3KR1A 4DPLA 1IN4A 3RVKA 3CKYA 2FN9A 1Q7BA 3DUWA 3GGOA 3LBNA 4PCAA 2FG5A 3TLGB 1GUAA 4EPXA 3C3JA 1RLJA 2VPIA 5ERGB 1I80A 4HDSA 2VQFB 3H86A 4I1IA 1DV2A 2GBPA 5DOVA 4F5EA 5KDOA 2C2WA 1DIBA 1XCMA 2CZCA 4QDKA 4URFA 1DIGA 4HZIA 5K4AA 4A9AA 4EPVA 2CL7X 3PUKA 4ZVLA 5G02A 1JLSA 1JZTA 1WKCA 2AF3C 2WU4A 5A6SA 2CVFA 2C4VA 4I81A 1ODJA 1SBTA 4YRKA 2CNDA 3QXXA 1PZEA 2WIFA 5IKMA 1OCEA 3OJEA 2HCJB 4MJ3A 1S0UA 4Y0VA 5IMSA 2SICE 3DVLA 1MTZA 4G1MB 4X7RA 5EP1A 4MQ4A 1HDZA 4YRJA 3SQOA 4Y0NA 4BLPA 1HDRA 3ZXIA 3OKPA 3TKLA 2QUAA 4M6WA 1SCUB 1HZZA 1DCMA 4IDOA 2C42A 2RBKA 2PNJA 3R6WA 3S0JA 5JVDF 3IIMA 4MW2A 4N9WA 3D4OA 5IJXA 5AVZA 2VF4X 3HYTA 4KN8A 2JH9A 1E2EA 1NG1A 4INJA 3RUCA 1JLKA 2AS0A 2OGUA 2QTZA 4MROA 5D1HA 5DSTA 1T1GA 3G6KA 1C14A 1PR3A 3NKLA 4DTCA 4L7VA 4X3PA 1I2BA 3GEIA 2XB8A 2X86A 3RSHA 5JD4A 4MVJA 5KYWA 2OHJA 3DQPA 4P7FA 5CXXA 5B2ZA 4QYMA 1QG2A 1Q6YA 2GZRA 5FUVA 4C04A 3MGCA 3EQ8A 1HETA 3KB2A 1NURA 2F3SA 5KQGA 1E1NA 4RJTA 5JLJA 2POCA 4AJOA 4BQRA 2ASVA 5DT2A 5LYJB 1VFPA 2ZB3A 4MGKR 4KAXA 3AEYA 5LLSA 4Y6QA 2V7QD 2C8VA 1Q74A 2JKZA 3DMRA 5BNZA 4JELA 3KL2A 4IUBS 4J4BA 2BH9A 4XYBA 3ESYA 3SHTA 2VYNA 2FFQA 1CB0A 1ZITA 5FA8A 2EP7A 2OCAA 2XD4A 1L4UA 1VB5A 2FDCA 4U4AA 1X8LA 2BJHA 1RMTA 2WICA 3HY4A 1DDOA 1PO7A 2YOHA 2H4HA 1WPGA 2AOUB 4RKQA 5JH7B 4IDAA 1HE8B 5I9LA 2WJ3A 1Z6QA 4MCAA 1IPHA 4GVLA 2JFPA 1N0VC 1VCIA 2C3UA 3HN2A 1NUHA 3HYNA 2HA0A 3QK7A 3S7TA 3VRHA 4QYIA 3LYUA 1KI7A 2JFYA 5FBKA 2BTEA 1QG6A 1BN6A 3Q5DA 3I5XA 1VL0A 3HLTA 3H9CA 3KM0A 4RACA 5F5NA 2FW0A 4OAPA 4J75A 2C8LA 4YJFA 2VHUA 1DWPA 4QTZA 2HMWA 1RI1A 4AL4A 1LTQA 2QRJA 3RUFA 3VDQA 3KQPA 1RWNA 4CEJB 1Y3CE 5JCJA 4IFIA 1LTKA 2P4SA 3K6JA 3ESCA 4FKZA 3AUSA 4K1XA 4R2KA 4DUZB 3V48A 2V8BA 4C7JA 1PNVA 4PINA 5JS6A 3VU1A 3Q8WA 3H99A 3V55A 3R75A 3V7YA 1R8SA 2NAFA 4CYMA 5M7EA 2O2DA 3GJZA 3RVNA 1QOZA 3UFXB 4E4YA 4WPGA 3ABSB 2YDXA 1AXRA 1PVVA 2VNSA 3DH0A 3OJ0A 4NCHA 4GPAA 4WEQA 3V00A 3K70B 5A1JA 3CX6A 2WHYA 4U2GA 4QJBA 1T2EA 2RHLA 4D56A 2ODNA 1CD5A 2CLOB 4KNYA 4AUKA 3QELB 4U0KA 1S8FA 2O0JA 1KVUA 4KOEC 2Z08A 1PL6A 1JJ7A 4G8DA 1FP4A 2IYFA 1Z25A 2PSFA 1BE1A 3NNNA 3CO0S 3H2SA 3LY7A 2F9FA 3PNQA 2PUEA 3S1LA 5JZ9A 5JG7A 2C95A 3VV3A 4EY3A 3F8SA 1FLAA 1L7OA 1G3MA 2FXIA 4D82A 1E2LA 2ZITA 3DBLB 1U1EA 1LLUA 1DWUA 3RYIB 4BQQA 5A04A 2JARA 2WF8A 2YTZA 1IHXA 5FT9A 4B73A 3N2GA 4W5WA 4ZT4A 2ORVA 3GCGA 3V2UA 2JIZA 4TRRA 4X6UA 4H7FA 1GZVA 2VNJA 3GFQA 3L6OO 5CTAA 3FPFA 4ABYA 1AKQA 3T4EA 4RHEA 2W00A 3G9TA 2XIQA 4PYQA 5FBVB 1CUEA 3M6WA 3VYSB 3JXEA 2KM1A 1NIJA 3EF0A 4CHGA 3I2HA 1NBAA 4HDRB 2ZIWB 5I7SA 1KY3A 4L85A 4ND8B 3D31A 3U17A 2BV3A 4RULA 1NP6A 2ZR7A 1RXIA 1Y48E 1ORWA 2NSDA 1LDMA 2W6JD 1NVKA 1KXJA 3ANNA 2C4HA 3I2YX 1EH5A 2X22A 5J5AA 4UTVA 4AKEA 4YJ2F 4ZMBA 4M99A 3RRNA 1NQWA 3IP5A 1KOLA 4H1HA 4OI0A 3QU2A 1E4YA 2IU4A 5GZ1A 1L4KA 4GE0A 3SHFA 1N3IA 2NUTB 4PG4A 2AEFA 4OHOA 1QRUA 1IDOA 1FLNA 1U8YA 1WY5A 1UK9A 4RZ2A 3UJ7A 4HWOA 3TEMA 1X15A 5ADVA 1P5FA 2PL9A 1NLZA 1WZ2A 3GLUA 3B3QA 4P3PA 1XZIA 4OL0A 2DOKA 3HNOA 1PS8A 1BH6A 1ISSA 1OXBB 3QPDA 4C6SA 3KWFA 4P81A 2UVQA 3LPLA 4DQUA 1PWZA 4L5IA 4H0NA 3TNLA 4PNEA 5JHGB 5FA5A 2A1UA 4ZGWA 4XVCA 3ZE1B 1G7RA 1AK2A 4K9LA 3CLUC 3D43A 4UVHA 5SZKB 3IHKA 1YBFA 4TMWA 1K68A 1S2GA 1VE6A 4IKOA 1DKRA 1E7MA 3H5OA 2J9FB 3AKYA 1ECGA 3GF4A 3ITEA 1B0ZA 4TWJA 4B47A 2YJTD 3GLHB 5DN6A 5ES3A 4GEKA 2IL1A 4Y1GA 2AC2A 2D54A 2Y67A 3DGFC 3E7FA 4AKIA 1NOIA 2X3YA 2UXBB 3ZDCA 4MYUA 2GCNA 5AJXA 5E3HA 1OT5A 2FSVA 2J3JA 1B1CA 3JQBC 1NF2A 4QXRA 4WK2B 3H9EO 1GAQA 1MG0A 2GYWA 3WAJA 3FNIA 1JKJA 4MUJA 4AJJA 4O8CA 4UMDA 1PVDA 4W4TA 1XNHA 5MDHA 3JATB 4LF8B 4B3MB 4RMJA 4X66B 2RC6A 2I29A 2FPPB 1XTZA 1WEHA 1B2LA 4DW8A 2OB2A 5DK4A 2IU0A 4B7ZA 5KTOA 2GZMA 2QX4A 4FEYA 1XD2B 3FVQA 1ZW1A 1R0XA 1JLRA 3ORRA 1BSVA 1RXVA 2H6EA 4DMMA 3MBOA 1QTQA 1CR0A 4ZDIA 5H3HA 5JEDA 4C88A 2AXNA 5G41A 5H3LA 2D2XA 2Q0QA 1DTWA 3JSXA 4HDOB 3AZQA 5L6LB 5DYYA 4CRWB 3FA2A 5IVHA 4KQHA 3TKAA 3ZE6A 3GAZA 4L3WA 1TW3A 2GMWA 4Y6SA 1J21A 1M6NA 1OXUA 5AI6A 5FWYB 3UJ8A 2PE5A 3MBIA 1RYZA 3S5JA 3EVTA 5AOVA 4AKTA 2H9AA 3DQQA 1OLXA 1Q1ZA 1AHIA 4DXHA 1Q92A 1EINA 1U3UA 1YB7A 5DCYA 2RGDA 3OFNA 4JR0A 4IHQA 4GL4A 2VYND 3FXAA 4IJVA 1LPOA 2Q4TA 2WK1A 3GB9A 3KT3A 4KVFA 5AW5A 4BMPB 4K2AA 3MJEA 3U48A 3JU3A 4YJ3F 1RD4A 2LKCA 2VZ8A 3P0IA 2DUUA 2ZYRA 3S3TA 4IPTA 5C1OA 3FAZA 2VXCA 4P4UA 1MAHA 5BUSA 3BWEA 2B1JA 4YROA 1KSFX 1GN9A 2JH3A 5H1YA 3S28A 5KB3A 2GXAA 2NP6A 4WCFC 5L53A 3M6LA 4NPAA 5KKNB 1XQ6A 4DUYB 4XRGA 1GAWA 3L4BA 4RPJA 3DCIA 3FBGA 3CSSA 3U19A 2IHBA 3SC3A 4BX8A 4N8EA 2R48A 5AW9A 4Q1CA 4HNHA 4RCYA 3PDJA 1D9ZA 4PN7A 1Z7EA 3MLAA 3ZIDA 4XYGA 4BFXA 5B55A 1N3LA 1JLLA 2C96A 5HCUA 3VU3A 1N6LA 1J0AA 3D3JA 5JCJD 1Z0IA 5AXDA 2JLWA 1ZNYA 1R0ZA 1ESDA 1H42A 1O1YA 3STWA 4Q4CA 2O8VA 4J7UA 1T6NA 5EJEA 1ZU4A 4L9WA 4JI0B 3ADOA 5MN6A 1BCSB 1O08A 1QMGA 1R2QA 1YQWA 2Q1WA 2Q6OA 5AO9A 4AI6A 3RAFC 4JBIA 2FZKA 4HAUA 2P1DA 2SBTA 1LPSA 3D8NA 4GS5A 3UUGA 1WO8A 2ZRGA 3LA6A 621PA 5JQWA 2A5JA 5TMDA 5CVUA 4NJEB 4ZQGA 1KJNA 3AKEA 2HMYB 5BSGA 1YGPA 3M6IA 4IYJA 3E5MA 3GRZA 2C03A 2CCJA 3COVA 4YQFA 3KYBA 1EG7A 4L0DA 3C14C 4PX2A 2X8BA 4FEEA 3TTYA 4M8NE 3PTLA 2XOXA 3I8SA 4HXFB 3AI7A 4CG1A 4O2RA 2AI3A 4HZUB 3VH1A 4PO9A 4Z4IA 1MO2A 3LHKA 3FAKA 3BRWA 3S5UA 4BU0A 3G02A 2VAXA 1AKNA 1C3EA 1DHRA 1ONNA 3GMTA 3SX0A 1JYSA 3ZWDA 3SFVA 5EJIA 5IABA 3IEMA 3SK0A 4TVSA 1V1MB 2VJBA 4E15A 4JUCA 3A11A 2SKEA 1HH4A 3NPAA 3NBXX 4ZOCA 3LQRA 3HDVA 3LUDA 3IJRA 5GJCA 3FHOA 4BNXA 4L0MA 4ERXA 2WWYA 2HU2A 2J67A 1NUUA 1YI0A 4F3NA 3DG9A 2GCPA 1NN3A 1T1EA 1A71A 2FWJA 4E6PA 5I3CA 3INNA 2GEBA 1M2HA 4PLWA 3CNOA 4RAQA 3ZI7A 3F6CA 4NULA 1J2RA 1YK0A 3NUQA 4V0SA 3TTUA 3BORA 4A36A 5C1IA 4JLJA 3AFOA 4DWOA 1EFCA 3N05A 2I54A 2G5PA 4NYIR 1MKYA 5B58C 4XQGA 2IEBA 2IK8A 5JSUA 1J25A 2V45A 4OQPA 2XCRB 1WU7A 3GGJA 2C83A 1LVUA 2E6UX 4LBYA 1SHLA 4LJSA 4LOAA 3BIFA 3C5EA 3DD1A 3O4JA 4J0EA 4ZO4A 1NUQA 2Q4RA 2HREA 2V1XA 2J3HA 4JEHA 3CWCA 1P8AA 4DCCA 2CKDA 1QIKA 1GPDG 3EFHA 2NXWA 2VK8A 1Y81A 3D0QA 1WZCA 1Y5MA 2XIJA 3KYDB 2VN8A 3HMKA 2AJ8A 3DM5A 4B8YA 4KR0A 1P5HA 3X1KA 2GF9A 3CVVA 3KZVA 2CFIA 5HIMA 4BE7B 1OF1A 2HMAA 1JEQB 3V8MA 2R66A 2Q4BA 3UJDA 1G21B 4AJEA 1RLTA 3OQ6A 2VZEA 3PQ2A 1NV9A 4PZLA 1KRWA 3L04A 1W59A 4GYJA 4O0MA 1CY7A 2JIOA 4YJKA 4DNPA 1NBIA 1XDWA 1XAHA 3IJEB 4N5MA 5DN6D 3ANLA 2A1IA 3R8FA 1KI6B 3DHYA 2P5TB 4YMHA 3ZCVA 3NMUF 4P38A 1I01A 2HB6A 4B6OA 1RTTA 3T5AA 2UYOA 1I2MA 4OK6A 1DCFA 2QJTA 3VFDA 1ADYA 4AZ3B 4DV3B 1WDKA 2ZS7A 1UC9A 4FZRA 3C15C 1ZGZA 2VCYA 4J0IA 4IV0A 4JQYA 3T06B 2DTXA 2WUEA 2IY9A 1UXIA 1TFRA 2AFHA 3W6NA 1U5BA 3D6AA 3TN7A 4BP9A 2XMBA 5KOIA 4WEOA 5JH7F 2R8PA 5IT9A 4TTJA 4YREA 4YMTA 5I4CA 4US2R 2I0FA 1GUBA 1KPHA 4PU0A 4PO3X 3ROQA 3TNDA 4ZVKA 4AROA 1Y6FA 4ICIA 1IH8A 4OYRA 3TVYA 5ALWA 2VEDA 4AMGA 3Q87B 1WBJB 2IXDA 5IAEA 1UBCA 3S99A 3H7IA 4V38A 1Q19A 4G2TA 2HMTA 3TQCA 3V9AA 1BMQA 1G3IA 1DC6A 5DCWA 1J0DA 4IH4A 4XW2A 4MV1A 3KSBC 3WS7A 4LZJA 2Q49A 5JS7A 5EP2A 3PJGA 3AR2A 3JQQA 3O3NB 4HTFA 1A9SA 4IJWA 4JDPA 1ZI8A 1QYWA 1Z12A 3KT6A 3PHIA 5LVAA 4CIDA 4CM4B 1GCGA 2F3QA 2QLNA 2QM8A 1SJ9A 4O33A 3EGXA 3VZSA 2OVFA 2J3DA 3NT5A 4GBJA 4TT3A 3RBZA 1X1QA 3IPXA 1XMOB 2OFWA 5KU1A 2C5AA 4HH0A 1KEEB 1XNRB 1ODCA 4U7FA 5DRTA 5AW1A 5LLDA 1Q0UA 1R4NA 3PQ8A 2PGXA 5AJWA 2NYVA 4FOPA 3CR3C 3L5OA 5DI9A 2WAXA 2EQ5A 4JBHA 4TMKA 2GA8A 1TAHA 4R8MA 3VTKA 4AZWA 5CT5A 4AQYB 1X87A 4JI2B 1XUOA 3ZCPA 3CEJA 2NO0A 4KBGA 3PNBA 1MH1A 1G60A 1TT5B 4G5FA 3VZCA 1J2JA 3GUUA 1UJ5A 1SXIA 3Q85A 1OIXA 5ALRA 2AFIB 3L1IA 4MYCA 2VK1A 2HGZA 1WUKS 3I5MA 4ZOLB 3M82A 3SQXA 1H4VB 1M0WA 3OO1A 4I1RA 2CSXA 1MX1A 4GNRA 1ZM3A 4LZOA 4CW7A 3WGYA 3AM1A 5EP4A 4WVLA 2BP7B 4JLSA 5B3AA 4CQNA 1JV2B 4OUDB 2X1LA 5JWRA 4N39A 3S8YA 4BJ3A 1T3LA 3IFSA 2H85A 3EEYA 1DUSA 1LBHA 4IDCA 2BELA 1SY7A 2EFHB 2QU7A 2GJ8A 4KGDA 4MYHA 4NE7A 2OK8A 4LGMA 1PR9A 3A1DA 2IS2A 4YRSA 1SUDA 2AVNA 4XI9A 5BY2A 2G88A 2R6HA 4YH1A 3R9WA 4KODA 3H83A 1JWLA 3SBXA 4RFLA 3RG8A 3WJ7A 2JLYA 4XZ3A 3CUKA 2IYZA 4QPDA 4EG6A 4XVUA 4H35A 3KL4A 4I36A 3KUCA 3JQGA 4M83A 2R84A 2Q2VA 3WRXA 4K3UA 3QQPA 5ICEA 2O2XA 3N2KB 3OEYA 2XVXA 2ZJ0A 3ZJYA 3A6DA 3WNBA 5AW6A 4JDUA 2O2IA 5LJIA 3BFKA 4O4IA 4OY3A 4YACA 1H0SA 1YKSA 1WXIA 2NM0A 1KZ6A 4ZODA 1I3NA 1H22A 1KI1A 3DV9A 3R7FA 4QARA 3V32A 1MC5A 1YDGA 3ZUPA 1QP4A 4OB7A 5L7YA 2P2LA 4IX1A 1KDVA 3T5DA 4DDHA 2XRYA 1SU8A 3BRWD 3TD2A 4YA6A 3CUEF 1GEEA 2ZYWX 4MAFA 2P3LA 2ZE8A 4M9RA 1EP9A 5DB4A 1EJBA 2OHGA 2F43B 1CF4A 1BQ3A 5C4IA 4KRGA 4KPYA 4WCFB 3CPSA 1NJ1A 4PFKA 4IH9A 1CVIA 3E05A 3Q3GE 3IKMB 3O2NA 1E5VA 3OTIA 2D0DA 3DYIA 4HH1A 3COJA 1M1UA 3AJEA 4MITA 1U2GC 421PA 4TS4A 1FEZA 4BAGA 2RGRA 3JQAB 2YV5A 1OI4A 1RRVA 2P7IA 5KAMA 3ABQB 1YA4A 1SXJD 5D2CA 1R4ZA 3NHZA 2GD1O 3S2UA 1GLVA 1XRRA 2QG4A 3STUA 3ZOKA 4A1OA 3EQZA 1CUFA 1ZC3A 4LFAB 1LDEA 1M7GA 3QPVA 5CLIA 4X1IB 2WAAA 2V7BA 1EEXB 2XGMA 2HFJA 4OBBA 1XROA 4KYTA 1Z83A 1FMTA 4BMZA 4W9MC 1YDHA 3EZ2A 4ATNA 3D3WA 3E9EA 2BEKA 2TECE 4J0GA 4KIFA 4KWEA 1OPXA 2IGBA 2VF2A 3BCSA 1JALA 1S2LA 3DV2A 3OZSA 3M3HA 3RT7A 2XSZA 1J7KA 2W98A 4Z0TA 1OH6A 5JZBA 2ECKA 4TYNA 1UL1X 4PX5A 5DM2A 3MGAA 1SCJA 5KC8A 3VOTA 2CFTA 5DULA 3NBMA 5EXPA 3GJ5A 5ER9A 4FGWA 4PVDA 3I01M 4Q3OA 4QJ5A 4MUIA 3NYQA 5HGJA 1G18A 3U40A 4JCOA 4DREA 3NRJA 5NLLA 2FETA 1ARZA 3D6HA 4L50A 3OJCA 3RVPA 3AT1A 1CUJA 2PZ8A 3UAXA 2FWBA 4PPGA 2JGEA 2J9YB 1O0SA 2O3RA 2XA2A 2HF7A 4D4GA 4DEVA 4AQ7A 2DXIA 4M7RA 5KNDA 2XZLA 3RI3A 4L2IB 1ZR2A 3L8EA 3NYWA 1EP3B 1UXKA 5JS8A 2QVZX 2Q6KA 1JHPA 4XGKA 1NATA 3RS4A 3LZ6A 3V8NA 4DFDA 4EPYA 2H1WA 1CUXA 1IEXA 1R12A 1UJMA 2CNKA 4PPYA 1TYCA 2EU8A 5M04A 1XBTA 5C8VA 1OJ7A 1WQ3A 2A9JA 3FIUA 3V4FA 1KRHA 1A9RA 3LT4A 4B7CA 1P17A 2V6MA 4JT2A 1EXDA 1E98A 2FFJA 3ACDA 4E2XA 2F64A 2JFGA 2VWPA 3B12A 3GNTA 3H5LA 4JN6B 3BPSA 1KQFA 3JQ9C 4B2PA 1CW2B 8GPBA 1IN7A 3IEKA 4QU0A 1Q12A 2OV4A 4QGFA 1R66A 1HG0A 1ZC4A 1ZS9A 1IE3A 2HKIA 1H2ZA 2R25B 4PEVA 2NSJA 2GK4A 2FK7A 3A9CA 3BSSA 3HFRA 3L7AA 3VR1A 3WLPA 2FOLA 1GKUB 3GEPA 3EAQA 1XD9A 1EQAA 2CJWA 3FSRA 4QASA 5BXYA 2CJFA 3W78A 4G4IA 4TL6A 3UKDA 4HNTA 4TTRA 4IIEA 2KSQA 1NBOA 3WLMA 5KPJA 4QSMA 3HCNA 5EMNA 4B4OA 2EEPA 4K0KB 1QJCA 4KI0A 3M5PA 4XM0A 3AVVA 1KH2A 2ZPUA 3ZEAA 1RI4A 2HXSA 5CDHA 2W2PA 5HUJA 3B6KA 4QM7A 2PGNA 1N8KA 3CUYA 1O5IA 1V2GA 2GN9A 3OLQA 5ESRA 5KVQA 5JAQA 4Q3CA 2PUCA 2G07A 2DM6A 4NYMQ 4QLBA 5BSFA 1VPEA 2CB0A 2QSJA 3D2CA 2W70A 2B2XA 2C88A 5A9SA 2WWVD 1ESMA 1UXOA 2EWWA 5DBEX 3ZVKA 3LHFA 1YB1A 3GOHA 4RKWA 2SKDA 5KTPA 3AHDA 3RBXA 3VZPA 1GRVA 4FW9A 1JXOA 1SXJE 3GR6A 3HYSA 3K1AA 2WM8A 1K89A 4LYAA 2IEAA 2X4LA 2NU8B 3TX2A 1SPXA 2A35A 3AR6A 1F0YA 4DQLA 1KJWA 2JLXA 1NXQA 2YWGA 2ZYDA 4C7BA 4L78A 4LQCA 4S1PA 3VR5D 3FNHA 3JQRA 2I22A 3TMKA 2OAP1 2XKBA 1C0KA 3KSZO 4UKDA 5CFOA 3EHDA 1IHOA 4D97A 3TUZC 1T9HA 3WIOA 1B3BA 5FL7D 1TJPB 3WB1A 3GEGA 1JSZA 4C2BA 4TZ0A 4FFLA 1Z8HA 3DT6A 4NI5A 2D7CA 3HSYA 2FOXA 3E9ZA 3N6XA 3PFCA 1XTKA 5ITZB 3G5LA 5K8CA 3DFKA 1QB8A 3URKA 1NG9A 4X92A 1H3FA 1PZXA 1QE3A 3IBTA 5JYBA 2NXJA 1XJQA 3ZXYA 1JFTA 2ZIUB 3JD3A 3AR5A 4ZYTA 5DW3A 2QL7A 1YASA 2K2WA 4NAVA 2O8BA 4OSOA 1X1SA 6ABPA 1EIWA 4GZ6A 2C5SA 1JJBA 1CFJA 3H0EA 5BQ3A 3Q40A 3OFJA 1GZHB 3BB3A 4M0DA 1EB9A 3WWCA 4DIDA 4NBSA 1PFWA 1E5XA 1P19A 2XQIA 2O0KA 3L8HA 4DC1A 1QPGA 4BYGA 3RU3A 2CHFA 1NX9A 4LSZA 4YYZA 3ZV3A 4FP9A 4JL8A 4B31A 3VH3A 4OSPA 1XHEA 2O2ZA 4CU2A 3EQ2A 4ACAA 3AETB 3ETJA 2PG3A 3T35A 2RHTA 6REQA 3DULA 3NEJA 1SHJA 2YQ4A 4F6LA 2WWHA 4J0QA 4AO7A 4DV0B 1LSUA 3I05A 2AVDA 2RKBA 3A1TA 1EAMA 1XF9A 4UNRA 5KTSA 3QW2A 4QJIA 5EZYF 3TXAA 2B5OA 3FYTA 1ZCBA 2XKJE 1ZD1A 4RW0A 1V11A 3HA2A 1V37A 3SG0A 1XEFA 3R0JA 5BN4B 3OKFA 1SA0B 4MB6A 4ZN6A 5KU7A 4F4CA 1KYXA 3QKRB 1G5RA 1RLMA 1I32A 1FTQA 3N07A 3ND9A 4P80A 2BFFB 1TD1A 4ZVPA 5B7QA 3HXTA 1XZEA 2ES4A 2QMUA 3UPUA 4NHOA 3T8YA 2C04A 4RZXA 5EPOA 5I9BA 5TEWA 1GAEO 2GNAA 4X94A 2QE7A 5CYGA 3BMQB 4BP3A 3GJYA 3I37X 5E7MA 4PGGA 2H92A 4NS1A 4D9JA 4C22A 1N1GA 5ARDA 2DQKA 3ZWPA 3HB4X 3UWSA 1VKJA 3MJVA 3P19A 1YZFA 5KREA 1XAIA 5AOBA 1WV0A 4PAMA 1DXHA 3NTQA 5CYFA 1ZINA 3MQFA 3CH4B 2CXXA 3GARA 5DH9A 3F73A 2G1AA 1ORTA 3EZYA 3HDQA 4R0VA 1ZAKA 2HCBA 4OO3A 5I9MA 1LCIA 3ZCRA 4KVZA 5JJ5A 1O8BA 3RYTC 3VC3A 1V6SA 1R4MB 3SVZA 4BUZA 3IHWA 4FGLA 4NEQA 5CHEA 1BU5A 5BSVA 5JECA 3O4VA 3DBRA 2XQVA 3D2AA 4I50B 1M9NA 3QBVA 4YJ2A 5EXXA 2HJGA 5JD5A 3IUQA 2VJAA 4HXGA 4LI0A 1QH0A 3P0EA 1MX5A 4MDHA 4CMHA 1CJMA 3BJZA 4E12A 3MWDA 1M2OB 1SD5A 1ZH0A 2R7MA 3F7MA 3WRYA 3B70A 4B2YA 4DLRA 4V1CB 3PEFA 4YV1A 3O8RA 4R1LA 1F6WA 4G0UA 3AEUB 1WMBA 3U3ZA 1NN5A 1G5TA 2VNIA 3F2VA 2O5EA 2E37A 3E5RA 4CNQA 4MLZA 3UOAB 4PZEA 4D4LA 2ANCA 1DHTA 2B36A 2VPTA 2ZU6A 1AZSC 1VL8A 1EDZA 4HQNA 2FHSA 4LJAA 4IKPA 1KXZA 3AOGA 1M2JA