1P91A

Crystal structure of rlma(i) enzyme: 23s rrna n1-g745 methyltransferase (northeast structural genomics consortium target er19)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
268
structure length
268
Chain Sequence
SFSCPLCHQPLSREKNSYICPQRHQFDMAKEGYVNLLPVQHKRSRDPGDSAEMMQARRAFLDAGHYQPLRDAIVAQLRERLDDKATAVLDIGCGEGYYTHAFADALPEITTFGLDVSKVAIKAAAKRYPQVTFCVASSHRLPFSDTSMDAIIRIYAPCKAEELARVVKPGGWVITATPGPRHLMELKGLIYNEVHLHAPHAEQLEGFTLQQSAELCYPMRLRGDEAVALLQMTPFAWRAKPEVWQTLAAKEVFDCQTDFNIHLWQRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal RNA large subunit methyltransferase A
publication title Crystal structure of RlmAI: implications for understanding the 23S rRNA G745/G748-methylation at the macrolide antibiotic-binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 64
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 2.1.1.187: 23S rRNA (guanine(745)-N(1))-methyltransferase.
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1p91A00
2OB1A 4RVDA 3KPJA 2BM8A 2BH2A 5T64A 4OBWA 1JQ3A 3FYDA 2AOUA 3LBFA 3MQ2A 4RTNA 2FYTA 3JWGA 2KW5A 1RI4A 1G8AA 2FK7A 3GRRA 4C06A 3G8AA 5EVJA 4C4AA 1KHHA 3DLIA 3LSTA 5CVVA 1NBIA 1I1NA 2O0LA 3T7TA 4F86A 1DCTA 4RSRA 2P7HA 3FZGA 2ZIGA 1NBHA 2CMGA 3A26A 2O57A 4PCLA 4PNEA 1Y8CA 1ZG3A 3P9NA 2NXNA 4R6WA 2IH4A 2WA1A 2NNWB 3B3FA 5BXYA 2ZZKA 1JG1A 1XDZA 3LDUA 1VPTA 1X1AA 4GOMD 2ONZA 3HEMA 3OU7A 3HA7A 1AF7A 3P9KA 4PYNA 1I4WA 4V0RA 3ELYA 5BP7A 3NWEA 4YMHA 3FPFA 4PONA 3B3JA 4ISCA 5EIWA 3UJDA 5DLYA 2PWPA 2PX2A 1EG2A 1O54A 2PKWA 3GRUA 1DL5A 4ER6A 1I9GA 1JTEA 4GOND 2AVNA 4QDKA 1M6EX 1XXLA 3KPYA 4XUCA 5DTMA 4FSDA 2P35A 1EJ0A 2BM9A 2QYOA 3RW9A 3GCZA 1BOOA 4HRAA 4EMSA 1XCLA 1UIRA 1RI1A 3THRA 4BLWA 4E2YA 3JWHA 1NKVA 4P7GA 4PIPA 4EKIA 2UZ4A 1KXZA 3LL7A 4GQBA 2VS1A 1B42A 4E33A 1XDUA 5EZSA 3NDJA 4YMGA 5GOZA 1JQEA 1VQ1A 2AN4A 2VDWA 3AJDA 5HFJA 4RTLA 2ZBRA 2I9KA 1P91A 2PXXA 2YUIA 4POOA 3VC2A 3A27A 1G55A 3R6TA 4RWZA 5CIYA 1RI2A 2EX4A 3G89A 2HTEA 5C0OE 1NW8A 1EAMA 1ZGAA 3DXYA 1UWVA 3EVFA 3GRVA 3GRYA 2FRXA 5CM2Z 5K0LA 3NJRA 3EGIA 3G8BA 5G02A 5HZMA 1AQJA 2EFJA 3ORHA 2ZULA 3P9IA 3QOXA 3P9CA 5KS2A 3NVMB 3FUXA 4QQNA 4DA4A 5K0BA 1R00A 2XBMA 2EG5A 1VP9A 5ICEA 3UJ8A 5E2BA 2OZVA 3HTXA 4CKEA 1NW3A 3C0KA 3MGGA 4FT2A 2V7EA 5DWQA 5K01A 10MHA 3R9XB 9MHTA 4IWNA 4MIKA 2AN3A 4PIMA 4OQEA 3UJAA 4M36A 2NYUA 4IKPA 5U4XA 5B1SA 3KPVA 5C1IA 4AX8A 3BWYA 1FP2A 4RVHA 5BW5A 1P1BA 2G1PA 2P3OA 1TPYA 5CVJA 2BR4A 5EC8A 1IXKA 3HVKA 5EMJA 3UJ6A 2XYRA 2YXDA 3QOWA 1INLA 3LECA 2VP3A 3PX3A 3ER9A 5CUQA 3EVGA 3DMGA 3LCUA 4PYMA 2GAFA 1HNNA 3EVCA 4E2XA 1YFLA 2JG3A 3CC8A 4KDCA 2HWKA 3ID6C 2ORED 2WK1A 2PBFA 3AXSA 2PGXA 2IDJA 1NW7A 3OE5A 1AV6A 1F38A 3MTEA 5EG5A 4RTSA 4CKCA 5LQJA 4A6DA 2B2CA 3CVOA 5HEKA 1ZHFA 2YQZA 3EMBA 3I5UA 4P7FA 4UOEA 5E1BA 4Y2HA 2V74B 3REOA 4R8SA 2BZGA 2ZIEA 1X1CA 1ZKDA 2PWYA 4EQZA 3MB5A 1SG9A 2ZVJA 3FPEA 1X1DA 5FHQA 3M33A 3OPNA 3KR1A 2Z6UA 5HIIA 2PJDA 2H1RA 2YVLA 3EGEA 2PY6A 3BXOA 3G5TA 2B78A 2ZTHA 3PB3A 4QPNA 4PYKA 5E1DA 1KIAA 5GP1A 5FA8A 3UZUA 1V39A 3KQMA 5LQCA 3HCAA 5EMMA 4QPPA 3FTFA 4YUYA 3PFHA 4R8RA 3IEIA 2AOVA 1UFKA 3HCCA 4LG1A 1WXWA 4E2WA 4K6MA 2P1DA 2IBSA 2P41A 3OU2A 4YV0A 3B89A 4X63A 2PX5A 1MHTA 2Y1XA 3L8DA 4X61A 1YB2A 2YTZA 3UJ7A 1G60A 3LKZA 3FTCA 3M4XA 1NW6A 3PVCA 3X0DA 3NMUF 4OA8A 4ER3A 3OFKA 4XUDA 2R6ZA 3FPJA 2PX4A 4PYQA 5EEGA 3T7RA 5FWAA 4CTKA 4PINA 1Z3CA 2IH5A 2Q41A 1X19A 1XVAA 2JH9A 5DM4A 1JR4A 3FRHA 3KQVA 1N7JA 2ZZNA 1N2XA 1SUIA 4RX1A 1QYRA 3P2EA 1KPHA 4M7RA 3BGIA 4BLVA 3VYWA 3KQQA 5E9JA 4PGHA 2UYCA 2AZTA 3Q87B 5K03A 3BWCA 3TLJA 4E2ZA 4E70A 5CD1A 3TQSA 4XCXA 3UA3A 5LQNA 4IV8A 5BW4A 3KPUA 3DLCA 3KPWA 5F2NA 1IM8A 2XVAA 4NECA 1WXXA 4GBED 2DPMA 2ZWAA 4HH4A 2C7OA 5LR6A 4P7KA 2B9EA 3EVDA 3ELUA 1ZGJA 2A14A 4E32A 4DZRA 1D2HA 3UBTA 2FK8A 2OKCA 1BKYA 5E8RA 4DCGA 1MJFA 5HIJA 3E23A 1KYWA 3B7PA 1VP3A 2GA9A 4FT4A 1NE2A 5D1NA 3G2OA 3HCEA 2PXCA 2EJUA 2QM3A 3GO4A 4FZVA 4M37A 2VZ9A 4P58A 3UJBA 1Q0SA 3KQYA 3KKZA 4QVKA 3LPMA 4CKBA 2IIPA 1NT2A 2PT9A 4GOLD 3FUVA 2P3QA 2G71A 5K0GA 4LECA 3I58A 1YZ3A 2PT6A 4HSGA 4OBXA 4C04A 2CWWA 5IH3A 4R6XA 1BC5A 3M6UA 4Y30A 2B3TA 3EVZA 4F85A 3ANXA 3C3PA 5F2KA 5EGSA 4RTMA 2Z6QA 3LCCA 5H02A 3M70A 4YV1A 2LD4A 2FHPA 3SMQA 3SR4A 4KIGA 1ZQ9A 1F3LA 2DULA 4M38A 4RTKA 3PT9A 5DXAA 4GC5A 5CVDA 4AZWA 2PLWA 2HNKA 3A7DA 5GM2A 3IYLW 5GIPE 2YXEA 3ELDA 3ME5A 4RV9A 2CL5A 3R24A 4CXMA 1NV9A 4P7JA 5ICFA 5FQOA 3CJQA 3DXZA 1DUSA 4C08A 2ZLBA 3FYCA 5K05A 1FP1D 5KQRA 2O06A 3A25A 1XTPA 3BGDA 3E7PA 4V0QA 4YV2A 3KQTA 1Q0TA 1SVUA 3NDIA 2Y1WA 2XYVA 1JSZA 3P8ZA 2JHPA 5K0JA 3DUWA 3I64A 1R74A 1RJGA 3AY0A 3DR5A 3CBGA 3HVHA 3IV6A 5DX0A 3EVEA 3PFGA 2FCAA 3CKKA 4X1OA 4AUKA 1VL5A 5JR3A 5HILA 1JG3A 4HG2A 3FRIA 3G7UA 3LGAA 3RODA 3BUSA 4QTUB 3DOUA 5IKMA 3TR6A 2H11A 3UFBA 5DPMA 3K6RA 4U7TB 3GWZA 1WS6A 4OA5A 3HCBA 1P1CA 1R8YA 1XDSA 3K0BA 1PJZA 1L3BA 3C3YA 3OU6A 3R0QA 4IV0A 4O29A 2ZCJA 5FUBA 3SM3A 5KVAA 5EMKA 4FP9A 4GF5A 4RTQA 4KWCA 2ERCA 3M6WA 4HTFB 3GGDA 5GM1A 3OFJA 1RJDA 3PS9A 4H0NA 4QVGA 3RIEA 2ZZMA 4C05A 5MHTA 1ORIA 5LQRA 1IY9A 4AZSA 7MHTA 4DCMA 2AR0A 2PV0A 5EHGA 1YFJA 1KR5A 4RVFA 3NWBA 4U7PB 1ORHA 4KVZA 3GXOA 3P2IA 4DMGA 5EKUA 4E31A 3NVKI 2NP6A 3SSNA 2CKDA 3IHTA 4FGZA 3SVZA 1SQFA 2ONYA 3KHKA 3LDFA 3TPZA 3JWJA 2O05A 4HGYA 5FHRA 3TRKA 2AOTB 2NXEA 5FWDA 3FUUA 2OY0A 2AS0A 3VC1A 1JG2A 5GWXA 3LCVB 3FPHA 3DMFA 2AVDA 4GOOD 2QE6A 2WA2A 2NP7A 3ELWA 1WG8A 2OB2A 1SKMA 1EIZA 4B17A 5EMLA 3D2LA 3BKWA 1OR8A 5CCBA 3HM2A 2Z6AA 3SX0A 3JWIA 3TMAA 3MTIA 2CMHA 3M6XA 3LX6A 1JG4A 1QAOA 1KPIA 3MHTA 1EQAA 4PWYA 1N7IA 1FPQA 3GDHA 5HOQA 5EZQA 1NV8A 3OZSA 5HIMA 5DX1A 3FPGA 1FBNA 4YUWA 1TW3A 4LWOA 5DTQA 3GRZA 3GJYA 4CWAA 5K8VA 2GPYA 4BP1A 4OX9Y 4LWPA 3KR9A 3V8VA 3PLAE 2UYHA 2GS9A 2UYQA 2ZIFA 3UA4A 5ICGA 5GIOE 3FUTA 4BY9E 1VIDA 2P7IA 4R05A 4KW7A 4MTLA 4KIFA 4PCAA 2OXTA 2R3SA 1L1EA 2QRVB 1D2GA 3AWIA 3C6MA 5JUWA 3SSOA 3U81A 4F84A 3EMDA 4ZTBA 4JXJA 3ERCA 5DXJA 2OBFA 1R18A 3LBYA 4HC4A 1RI5A 1KPGA 2ZSUA 2ZWVA 4Z2YA 1SUSA 3A7EA 3EPPA 3Q7EA 4PGGA 4QDJA 3WSTA 4BP3A 3G2PA 4FSXA 5K0CA 2BR3A 1BHJA 2JHCA 5F2OA 2ZBPA 5CVUA 3HCDA 4C03A 3UWPA 3TKYA 2HV9A 1G8SA 2G70A 3FTEA 3TM4A 4AZVA 2ZFUA 5LSAA 1G6Q1 1O9GA 2AOUB 4ER5A 3KQPA 2PXAA 3TFWA 3KR2A 3A4TA 3KQWA 3S68A 1H1DA 5ICCA 3SXJA 2G8NA 4RYLA 5EHIA 5LQKA 5FQNA 5DM0A 3KR0A 4X41A 1QZZA 3OCJA 2C7QA 2IDKA 2PX8A 2HR1A 1U2ZA 2P40A 3HCFA 5HIKA 1AQIA 1RJEA 5EPEA 1HMYA 3P97A 4C07A 4RTRA 5C9ZA 3EEOA 3V97A 2P8JA 5DSXA 2OYRA 4EKGA 4PYJA 3G2QA 3CGGA 2EJTA 2N47A 3DXXA 3NW9A 4KRGA 5FADA 4MWZA 3LHDA 3LDGA 3DMHA 2NXCA 3M6VA 1YZHA 3KU1A 5CVEA 1RJFA 3DULA 5CCXA 2E5WA 4DQ0A 1P39A 3EVBA 2AN5A 4WXHA 3B3GA 3HA5A 2JJQA 3LKDA 2YXLA 5E8JA 4BLUA 1KYZA 2AOXA 4ER0A 2JH8A 2GLUA 2BR5A 5E9WA 3UJ9A 3T7SA 2HMYB 2ZW9A 4YUZA 5KYGA 5LQAA 3E8SA 1NW5A 3TM5A 2I62A 4HGZA 5K0FA 2XVMA 4GC9A 3GU3A 4RTPA 3HVIA 1PRYA 3P71T 2PSSA 3B5IA 5EQJB 2IPXA 3E05A 2PVCA 4GEKA 5EIFA 1M0EA 3F4KA 3G88A 4A6EA 3G2MA 1XJ5A 5K09A 2IFTA 2VDVE 3HA3A 1R6AA 4MQ4A 5DT2A 1XCJA 2G72A 3PX2A 4HTFA 3DTNA 2YX1A 4RTJA 2F8LA 3HNRA 3ER8A 1TW2A 3G5LA 5EKXA 3GIWA 1X1BA 3HVJA 4WVLA 3TOSA 3NTVA 1JQDA 3CCFA 3I9FA 2QY6A 3MAGA 1D2CA 4GUAA 1FJXA 1QANA 4MHTA 3THSA 5GINE 5E2AA 4CTJA 4RVGA 3VSEA 1KP9A 2H00A 3SSMA 5P8WA 3MCZA 4DKJA 2C7PA 3EGVA 3FTDA 3KQSA 2AOTA 2AOWA 2ESRA 3DP7A 4YUVA 5LQUA 1JSXA 5E1OA 4DM3A 4DF3A 5KQSA 5K0EA 5DX8A 3SGLA 4QQKA 3C6KA 3BWMA 5E1MA 5T67A 2K4MA 2IBTA 5FTWA 2UYOA 4AZTA 2NXJA 5DRYA 4EK9A 3HP7A 2ZBQA 3CJTA 1YF3A 8MHTA 2IP2A 3OE4A 2P3LA 1VE3A 3BKXA 2ADMA 3P2KA 3EVAA 4X60A 4QTTB 3DH0A 3MERA 4PYOA 4ER7A 3AXTA 2C7RA 4XUEA 3BT7A 2O07A 3I53A 2YR0A 4PYIA 2B25A 1SQGA 3BZBA 2OPBA 2VDUE 3O31A 3R3HA 1VLMA 1T43A 2IGTA 3OZRA 3QV2A 2IH2A 1L3IA 5FCDA 5ERGB 5DSTA 1EJ6A 2I6GA 3GNLA 4PYLA 5FULA 3OZTA 3O7WA 4FR0A 3UJCA 4EVIA 2GB4A 4RTOA 1M6YA 5EOVA 2GH1A 4L7VA 5DTRA 4OQDA 2FPOA 4YUXA 5EEHA 2OO3A 4ATNA 2XYQA 5DM2A 1G38A 3BWBA 3T0IA 1L3CA 2QRVA 1R8XA 1L9KA 3TKAA 4G56A 5DM1A 3BGVA 5FA5A 3H2BA 4KDRA 5D1HA 5E9QA 3EEYA 5K0NA 1O9HA 1QAQA 2JHAA 1WZNA 3KQOA 5T6BA 4E30A 1WY7A 3MCTA 3FUWA 1VBFA 1YUBA 5M5BA 3O4FA 4FS8A 1JTFA 3PTAA 5DRTA 3CJRA 1RI3A 2I7CA 1QAMA
chains in the Genus database with same CATH superfamily
3PUIA 4MDEA 4QWMA 4F2PA 1Y9ZA 3LCRA 2DGDA 3OCYA 3E9YA 4C4RA 3JWGA 2F1IA 3LIIA 4LOHA 3U60B 1U0HC 4TTRA 5SICE 4GD3Q 4KLCA 5HCNA 1LNZA 4BAGA 2J6CA 3LT1A 1KHHA 1ZSVA 2C0CA 2VPTA 3NI2A 4R2LA 4TTTS 5AKXA 4CQJA 2WKQA 5IT0A 1KGDA 3ITDA 4JOQA 4F86A 4RSRA 2RGAA 3WYDA 2DUNA 3A26A 1H6DA 2CLCX 3FI0A 3PDHA 4XI9A 2ZI5A 3K9NA 4I5DA 4X3OA 2XQJA 3OQ6A 5KPDA 1EBUA 2MSWA 5KO2A 2Z09A 3NHRA 3JATA 1H2YA 4YJ3F 3HZZA 2NV2B 4MUEA 2ZE5A 1OFUA 3HEMA 4MUIA 3QM1A 5BMVB 3DVQX 4Z1MD 2D1FA 3WQRA 4KI0A 4MVJF 5KMGA 1CLUA 1VDMA 5FT9A 4CCYA 2ZP1A 3ELYA 5BXQC 4Q3OA 3DOCA 2D3TA 2HHJA 1DBRA 4DIDA 3LIPA 3ZVNA 4MSUA 1QORA 4LY6A 3UJDA 4QTZA 1EJ2A 1RM3A 1KI8A 4YBRA 1J99A 1JJAA 3JQ8A 1FDUA 4YDHB 5AI8A 3IE0A 5IK2D 3U49A 5A6SB 2I2CA 4RFLA 1PGJA 2EV9A 1GNQA 1QK3A 3UFXA 4V2UA 3LA8A 2OM6A 3WWDA 2V7BA 1G2PA 3G23A 2HXSA 4PBSA 1JHPA 5L7YA 4CEHB 2A84A 1PJRA 1R4NA 2WD9A 3CB4A 1KXZA 3C1AA 1G1MA 3LKVA 4MQLA 4JQSA 3TEMA 1GGJA 1OLXA 1PW5A 2VHQA 1H0SA 1K7FB 2CN1A 3QTTA 4G4SO 5EA2A 3SKVA 2KQUA 3SICE 4RENA 1MQAA 1QMGA 3WYGA 1M5UA 1T5IA 2YNMD 4CM3A 4EIWA 1ZH4A 2VDWA 4GSYA 3JVUA 2PZBA 2IIBA 3WKEA 3PKIA 4EHAA 1CF9A 1QZ3A 1Y3DE 3ELBA 2Z1NA 2VUSA 3T3IA 2XUKA 1SA0A 2JIRA 1ZOLA 2NT3A 3KAKA 1ZQ1A 2WJYA 4N7MA 1PJCA 3UN1A 5KNLA 1LLFA 1R9NA 3PVSA 2PKXA 5J3JA 3ORSA 4UVDA 2WU4A 4ZHQF 1V1RB 3O74A 3RC1A 3WJAA 3MJSA 1G8GA 3P9IA 3Q9LA 5L7TA 1U31A 1EI9A 1RLUA 2NV6A 2AFHE 2QTBA 3IHKA 4J0DA 5LFAA 4Q0MA 2Q1UA 1R00A 1WXFA 4X7RA 2I2FA 1F2UA 3GQBB 2PO5A 4XWTA 5K9ZA 4EKYA 2XWPA 4G4JA 2OAQ1 3AQIA 1J20A 3TSYA 4FT2A 3SIRA 1PWXA 3FCYA 1GJRA 1A7JA 1KKMA 3QF4B 1VTKA 5DN9A 1YJ5A 1JDZA 3WYEA 4KAXA 2DHRA 4N9WA 4LGYA 4Q1BA 2XNJA 3RK1A 3PCXA 1Q44A 4O8CA 2BGUA 2IYWA 2VHEA 4YA6A 2XCLA 4TXMA 1MPXA 4IIBA 3RS4A 3T7EA 3I9V6 3WSWA 4BNHA 3KS9A 3L7IA 1J22A 1Z6TA 2DKOA 5SYAA 5CGQB 4HUQA 4EY7A 4Z4GA 4A8HA 3VNVA 4BEVA 1BQ4A 3GRPA 3HFSA 3UQYS 1W73A 3NNDA 2W2LD 5CXUA 1WZEA 2IS1A 1ZD3A 3T1QA 5HS6A 2BBSA 3AEQA 3T3HA 1RWBA 3OIFA 5EJ5A 1FFDA 1XJCA 2CJWB 3IRUA 2PSJA 2WJZB 3DTTA 4IH4A 3T4UA 3QE9Y 2XCRB 3QEBZ 3ETGA 3I4CA 5EG5A 4NH0A 2PZAA 3ZKWB 4GKJB 3MWDA 4R51A 1OBOA 2ACWA 3B7WA 2YQZA 1P3DA 4QUHA 1VBKA 1R0KA 2JF0A 3ML1A 1NXQA 2CCGA 3HBAA 4LBWA 1IL0A 3ZU5A 4Q00A 2RAFA 2ZRGA 1QTQA 1U8UA 4HX2A 3G7NA 3DZGA 4LJ6A 2G5GX 3UANA 1ZKDA 1WW2A 1TCAA 3FPEA 5KQLA 3HUTA 2DBYA 5ALJA 2JEOA 4NC9A 3W05A 2BTQB 3S7ZA 1JU4A 5SZHB 4LXQA 5E1DA 1GITA 4NK5A 3EIOA 1M2FA 3TYXA 2AKYA 1Y5IA 2ZIAA 4POAA 3HCAA 3VPGA 1YBVA 2QXUA 3VOBA 1DEAA 3EPKA 2B0CA 2A35A 4QZVA 1UDWA 2H8KA 3QTBA 4V3CA 2VHCA 2WKPA 4YQYA 5NLLA 4YXFA 2V7VA 2YJ6A 4C4ZA 1UEXC 2QN9A 4C29A 3TSZA 4LG1A 5BSUA 521PA 4E2WA 1B93A 1LVUA 2WU3A 1DU4A 3LUJA 3GQVA 2CMFA 3H9GA 3C8UA 1GZ4A 2N0SA 3IIJA 4MTCA 3CN7A 4D9EA 3PGXA 2R96A 2RGXA 3GEGA 2YYSA 4H31A 3M4XA 1HSZA 4TSFD 3IO3A 4MDFA 4YJ3A 3TOCA 3O95A 5JD5A 3NEJA 1WUHS 4KOEC 1JWBB 4PYQA 4BJ1A 4J0KA 3T7RA 4MVJA 4CLRB 5CU7A 1JZQA 4O63O 5DGDA 4LAFA 1SXJD 5AW1A 1AKYA 3AF2A 4FR2A 1GG5A 2CXPA 2R7NA 1LC0A 3Q85A 2ZIXA 2W98A 3QBEA 4MVJH 1DC5A 3PJRA 1AKRA 1R3UA 3RI3A 2Q3LA 3GW8A 1XRNA 1GQ2A 4UM5A 5KYWA 1H6AA 3TECE 2VZ0A 4QRDA 5BUCA 1P2GA 2JFYA 2EOAA 4N6OA 1QF7A 5CD1A 3IPYA 1QK4A 4FOOA 2HU2A 4KP7A 3FYUB 1UQUA 1Q91A 1E3IA 2WHRA 4BNZA 4C14A 1IC6A 3G9UA 4M6WB 2OGSA 3K72B 1X39A 4YS6A 5KPJA 3L4BC 5FI1B 4DC9A 1H1TA 1SZJG 5T5QA 4DB4A 4DZRA 2YMLA 2H9IA 2E18A 1R9JA 3AM5A 2AW5A 2CXNA 2ORVA 2R8XA 4CNQA 5BO5A 5T4FA 1PTJC 1GM5A 1SAYA 4EHNA 5G0WA 4H2DA 5KU7A 4AN4A 1OAOA 1RRMA 5LKAA 4P58A 4ACAA 4NMHA 1TYDE 3C3JA 4UU7A 3DV0B 5AXBA 3IAAA 1W36D 2A88A 3UAVA 1II9A 2XW6A 4DQVA 1E1QD 2VK2A 3EZNA 2G71A 2GQ0A 3FCAA 4F5EA 3LQKA 4MWGA 5JS6A 1ZR2A 1KI6B 2PT6A 3MBKA 2WHYA 3I9KA 5IH3A 1CEYA 4AMYA 2V5AA 2B4RO 2CNKA 4OQPA 2Q7DA 3LCCA 3NUGA 1KMIY 3IB6A 3IVMA 2Q50A 2IODA 3ONVA 3GPLA 1NXPA 3DL0A 5JNRA 3DVSX 4BMVA 2AXEA 1EYZA 1AB6A 1NM5C 4YECA 2AYYA 2PGNA 4ZGWA 4C7OB 1QGAA 3KDSE 4QU9A 2JFUA 1R4AA 2HNKA 4BJ3A 2WJAA 3QU2A 1JRLA 1T0PA 5K4AA 4GECA 4ECAA 3QBVA 5EGNA 2ZR7A 3IMEA 4GMFA 1QG6A 2ZDHA 4JP1A 4OXKA 3ROFA 4D9JA 2QBYA 3ZDAA 1ISFA 1I2DA 4JZKA 5DXFA 3GRAA 2IXDA 4BO2A 1NT4A 1KVTA 5TEWA 3GUUA 3CF4A 3PGA1 2GBCA 4DLLA 3QXHA 3DUWA 5JXJA 3BHMA 1NX9A 3FW1A 3IV6A 2ONCA 3CR7A 4L78A 5AXCA 1TL7C 2C54A 2ZR9A 4AUKA 4J6EA 3FOZA 1T2UA 4WJZA 1N7HA 1H2RS 1SK9A 2J33A 1NYLA 2G36A 4RANA 4MR8B 1E9BA 1HV8A 1T5BA 1F0KA 2V96A 3PNVA 2XYPA 4G24A 1D6JA 4IHKA 4WKBA 4LF9B 3HPQA 3K6RA 3VYRB 5KUTA 3AVXA 4Q1DA 2BGNA 4MCIA 3WLRA 2X6RA 1T4CB 1E2EA 1PJZA 4NJEB 5E6UB 2I4OA 3FJYA 1NI3A 4R1NA 3HDHA 4RTQA 2JVKA 2X9GA 3R9KA 1RMYA 2IZ5A 1OYYA 4PBTA 2PQMA 1SUEA 1VRCA 5HFAA 2K2QB 2C5GA 3KUDA 3WLHA 4QXPA 3ENNA 4LYAA 4P1ZA 2AR0A 2PV0A 4AZSA 4FN5A 4AD8A 4A2WA 2DHQA 2FGKA 2XNSA 4BQQA 4L57A 1N8TA 1OH6A 1ORHA 4JJKA 4E31A 2QUHA 1OC4A 3QG1A 1GOTA 4OOEA 4P5EA 3COZA 1G8KA 3N6XA 3RC2A 2JFNA 3F7TA 1NRXA 3WI7A 1J0AA 4MR9B 1PWYE 2VT3A 3FMIA 3FPHA 3LCVB 1OI7A 3MD9A 3L4KA 3DZFA 4RA9A 5F7ZA 1CY6A 2XUFA 1PR9A 1SH7A 3HG7A 5LKRA 3OQOA 4B6OA 5HIAA 1QVWA 2FZCA 4FUQA 5L3QA 5HM8A 1EWVA 3O4JA 4V39A 5AI5A 1GLVA 1XZNA 3NC1C 4V24A 3OSZA 3MTIA 4LZWA 3IAXA 1NF9A 4TV8B 3CE9A 4FW9A 3RBAA 1XHLA 2R66A 3F4BA 3FCOA 1YDWA 3WQHA 5IC4A 4NCBA 1NGSA 5DIZA 1KZHA 4KO3S 3A1CA 1WMSA 2HA2A 3B20A 5FNVF 5C8DA 1ZVMA 2I67A 2EW2A 3G0BA 4RK7A 1T26A 2ZWPA 2YRXA 5ED0A 5LP6C 1GZ3A 4HPJB 3TMKA 1J07A 2M6RA 1UDRA 3J7TA 1G5PA 2ZSIA 3W5BA 3JV7A 3O9MA 1L5GB 1PDVA 3G0IA 3GRZA 4Q39A 4GOKA 1NWCA 4D0LB 4WN9B 1KJJA 2YFHA 4GX0A 1KI3A 1MAWA 4QG3A 1CR6A 4I4TF 1KC3A 3LV8A 2AJBA 2Y1FA 3QIVA 4RD2A 3FLEA 4MTLA 5KOHB 1Q84A 3BS4A 4YX9A 1T3ZA 1V16B 3REQB 1EPUA 2JI7A 1AC5A 3SZGA 4FFVA 2YXNA 3KXKA 3C6MA 3RH0A 3FSGD 3MTDA 3U81A 3F6EX 3WL5A 1ZUD1 3CNLA 4DRYA 1E89A 2XTJA 3IEUA 5IYZB 3H1GA 4HFJA 5A0VA 3EIQA 3UKDA 1S8FA 4G36A 2GYYA 1W47A 1G8FA 1THGA 4FUTA 3G2PA 1WOYA 3PQEA 1RRCA 3ZVLA 1ZC4A 3L41A 1LK7A 2C8LA 3NKLA 3ZY4A 2B69A 2XCIA 1PHPA 1G8SA 2G70A 3Q5DA 1EWYA 4PO8A 5JE8A 3DPSA 5IBPA 3HN7A 1TGYA 1ZIYA 1YQDA 4CM4A 1BJTA 4KO4S 4DIBA 5GJWC 3S5UA 2XSZA 1HDCA 3PDIB 1MRSA 3SQMA 4EB6A 3A36A 4S1TA 5KCMA 3WP1B 4B3MB 4TL6A 1H42A 3PZBA 5JC8A 3OEHD 5DK4A 1IWPB 4JSTA 4FYXA 1R6DA 4X65B 2FTKE 1EUZA 4A2PA 4BMOB 4O0LA 2JI6A 2PYDA 4P4SA 5BQ3A 4JBNA 1JZSA 1LB1B 1UZAA 2P2LA 3F2VA 1DB3A 4OYHA 4RNDB 4AF7A 1T3HA 1P7YA 2NXCA 2F59A 3KU1A 2BSQA 3DULA 4M46A 5CCXA 1OIXA 3EFBA 3AVOA 2C9YA 3OCZA 2BEWB 3MINB 1RXCA 2YXLA 3QW4B 1QYCA 1FNCA 1KQ3A 3RUAA 3U4DA 5KYXB 3BK1A 1KQGA 1OXXK 1UC8A 5EI5A 1IRIA 4FFLA 4WN3A 5E6SB 3TNDA 2B83A 1EFVA 1KKUA 3CNOA 3EXHB 3SYNA 1Y1SA 3JVDA 2HJ9A 2C5AA 4XB2A 4XVRA 4D7AA 3L6EA 2XB2A 1U1FA 3ICEA 3PP8A 3ILHA 3NWOA 4ZN6A 2HRBA 1N6NA 4BWVA 3T1TA 2HHHB 1CR4A 4BV2A 5C8YB 1Z62A 5I3CA 2IYRA 2JFQA 1F5NA 3AILA 1ML3A 2C4KA 5KI6A 3KOMA 5D84A 2JJ1D 1NUAA 3DFIA 3FHLA 4H0CA 2WU0A 4OKIA 4WW0A 4BB6A 2ORYA 4R41A 3V1NA 3UM9A 1J0XO 3ZHYA 3IP8A 3JQCA 2UXCB 1EP9A 4F3YA 4Q34A 4MVXA 1E79D 3WIBA 2QAGB 4EYSA 1J5PA 3UB3A 2GKSA 4FYYA 2BYTA 2PBRA 1XN4A 2IUYA 4N3CA 1G20B 3SJUA 1KAEA 2ZRMA 1XZEA 2RBKA 4JJ8A 4RKQA 4EHDA 5HQ3B 3H84A 2W2OA 1R27A 2QI9F 2QTRA 2ZBDA 4NXMB 5F1KA 1GSHA 3NOXA 4DPKA 2UYOA 3NGLA 4EK9A 3UF0A 1G21B 3CJTA 4DARA 2GHIA 4Q9LA 3A6ZA 1I3CA 3WBJA 1VE3A 1EGHA 3BRQA 4OF4A 3AP1A 2JIBA 2K7FA 4OSPA 2I2AA 3ZV7A 3F9IA 1Z83A 1E96A 4X8MA 2ZYHA 4ZU6X 4OL0A 5EINA 2C92A 4WESA 4Q7EA 4XPZA 2FH5B 3BT7A 4GI3A 3BORA 3AEUA 5JVDB 5KEIA 2OPBA 3PF8A 2O8VA 3GOQA 4J0HA 4N01A 4QUKA 5B1DA 6PFKA 4JQYA 2JEYA 4Z0TA 2IH2A 3D7RA 2MSEB 4G9GA 1J25A 4LJ9A 4BL5A 4YWJA 3BULA 5HUHA 4EPYA 2HYIC 5FNVA 4DWWA 2HCFA 3IKTA 1G7SA 1G21E 2X5JO 4LVNA 4JIMA 4PLVA 1KO7A 1UCFA 2KMLA 4EZIA 1DOAA 4YO8A 3VDRA 3TK1A 3UAYA 3BWBA 1YJ8A 2WSLA 3V6LA 2X22A 4PLYA 2FMKA 2QRVA 3BCRA 3ZCVA 2HA5A 4EA7A 5BN3B 4INAA 1S8AA 2BP7A 1EK5A 1YS2X 4I4TA 2GEVA 2NTEA 4KO8A 5G1PA 4ZDJA 4D9IA 1IUNA 6CHYA 3ZH9B 4XIJA 4DFDA 1QOPB 3H4TA 1RWQA 2PT5A 2CHQA 3B6KA 1EFPA 2NG1A 3DZDA 3KU4A 3M81A 3OIWA 4INPA 1VBFA 3SBOA 1JB9A 5IZCC 1Z6ZA 4RL4A 5TMDA 1JTFA 3PTAA 1OLSB 3AZQA 4K6GA 4B4UA 2I7CA 1J8VA 2QVLA 2JDIA 4F97A 4S1PA 4NK4A 3C43A 1CZHA 5F5LA 5HS4A 2NSJA 3IT0A 1RYHA 1T5HX 2H1LA 4U4AA 2NQ8A 3DAGA 4A2QA 1N2OA 2WMOB 2X0IA 3QPCA 3R4VA 3MFQA 2J07A 1YJCA 2WWWA 4JOCA 3CHYA 1ZGZA 3WSVA 1NQUA 1PR4A 2P7HA 3JWPA 4MLDA 2X0FA 3OIDA 2G04A 1W4RA 3NT5A 3ZWWA 3HSYA 2Q3FA 3DE1X 1DZIA 3JYOA 2RKOA 4Q1VA 4TMVA 4UUQA 1NDQA 2E48A 5IBCA 2B99A 1M5TA 4ZICA 2JRCA 1NHWA 2J9YB 1VCMA 3LI2A 1R0XA 2ZQZA 2CF6A 4JX8A 1WSBA 4M88A 2PD3A 3PD0A 5TLSA 2HKIA 3KQNA 2XE7A 1AK9A 4PYNA 4Y9RA 5AOCA 1PL0A 3P5SA 3QYFA 3RO7A 1JDJA 1WB5A 3TLCA 3TTVA 3FPFA 2HF2A 2HQRA 5HGXA 2DQYA 2G6BA 2PSEA 1J7JA 1LLCA 3L8FA 1LI4A 1QQAA 1JKMA 3HCOA 1JG6A 2XBLA 3EHEA 1M6EX 2CYBA 3RW9A 1U0RA 2EFYA 4Y67A 3QEJA 2ARKA 1TT5B 4L8GA 4MICA 4LE1A 2BFEA 1M74A 2ZVDA 2E7ZA 4EJFA 4HEA6 2OGZA 4ARZB 3K8OE 3WYAA 5I01A 1CW2B 2B3DA 2PZGA 1N1MA 2QD4A 1QG2A 2GR9A 3M4NA 2VJLA 3PDJA 1KZGB 3M0EA 4EP1A 3HJAA 1AA6A 4DL9A 4H3HB 4D81A 4MPTA 8AT1A 4Q9IA 5AKYA 1SXJC 3WQSB 4Q9AA 1F5SA 3OQMA 3RS3A 3AFGA 3EQ9A 2EZTA 1JIQA 2YDYA 1NVGA 3MTBA 1PUXA 2X2PA 1DOHA 1KO1A 2HSJA 4UE2A 3ST7A 1UBUS 2IQIA 3J81A 2Z3VA 3PYMA 2O8BA 1ZMXA 2WMDA 2M1XA 1KRHA 2EFJA 2ZJ3A 3Q8WA 4MYTA 5TEVA 3P9CA 4K3UA 1QCYA 1BMDA 4ND7A 5J40A 4DBZA 5LD2C 3FZQA 2XBMA 4I3HA 1EA5A 2FX2A 1YQWA 2D5LA 2X6QA 2J0EA 3DCIA 2VHVA 2E21A 3G2LA 2FG7C 3ZI7A 3EZ2A 4M1QA 1ST2A 2OHFA 4W6QA 1CETA 4BX9A 1HF3A 2DCUA 2V7EA 1NWHA 4FC7A 3N9IA 2AN9A 2C4MA 4ZO9A 4XM0A 2AJTA 3ABRB 4LRQA 4M0UA 5ANRB 4EQ6A 1AKVA 1W2GA 1HO3A 1QYWA 1IY2A 4LJSA 4N3BA 1EFHA 3T7CA 4AF6A 1QB8A 4FW8A 1W2WB 5AM1A 3WMRA 4OHYA 1TPYA 1U3CA 1Y8QB 2BR4A 5CVJA 2O8CA 2HBQA 5A9SA 2V6JA 3OPXA 1CS0A 2VP3A 1V48A 5H3CA 3I1YA 2FUNB 3EVGA 3Q0TA 3K94A 3LCUA 4QVIA 1YL5A 4GMHA 5IJ0B 5HJ7A 3GEDA 4F3RA 2P9BA 1DXQA 2IE0A 2QTFA 1ECGA 4B43A 3RAFC 4KN9S 2PRIA 1Q21A 1W85B 3KT0A 5DW3A 4MW1A 1H8HD 1QB7A 4Y6QA 5THXA 3TOXA 3L4EA 5AVOA 2OBBA 4QAJA 5JTTA 1X8KA 1FLVA 3IAHA 4GGMX 4NYIQ 4P5DA 2GAAA 1K7SN 3RF7A 4K5QA 4M21A 2A7QA 3MWFA 1E6MA 4YAFA 1C7QA 3NORA 1FYXA 3IE2A 4JLDA 3DWGA 4RIEA 5T4BA 5JRDS 1TZBA 2NZUG 3ZOKA 2HSDA 1B6RA 1H6CA 5A3SA 3HB9A 2GCOB 4QU0A 5DOZA 3MMNA 3UK1A 3VVCA 4JYBA 1CEQA 1I32A 4EW1A 3O1IC 4Y9TA 4NKRA 4OFWA 2CHVA 2FE4A 2OV1A 3IOMA 2VTEA 4UC0A 2EEZA 3QX3A 4KGDA 1ML4A 3NASA 3NJ4A 1OYWA 1JKFA 1XZFA 1P45A 4JIGA 1JXAA 3HCCA 3WGYA 4YYZA 5CFPA 4D98A 1BMFA 2V7QA 1QYXA 4KR6A 3QFRA 4DMFA 3B89A 4EH1A 3F2IA 4BN5A 5AUOB 3D1JA 5EYPB 3R9WA 3LGXA 3GDGA 4U5XA 1JEYB 2F4NA 4RJLA 1I5EA 5T3YA 1NMXA 5HFNA 4C6TB 3AHDA 2PKRA 2R6ZA 5EEGA 5HKKA 1R9GA 5LU9A 5MN4A 3AKZA 3SYMA 5K8CA 1EVYA 4WADA 2DBQA 2L82A 4NRDA 3B7GA 5F7XA 3BDAA 4MMYB 3DOJA 2QV0A 1B0UA 2E4YA 1PEDA 1QGYA 3C41J 1IOVA 1XE3A 4HQRA 4R1SA 1U3VA 3SDBA 5JCXA 5M7EA 4MK4A 3THWA 4OXRA 4PAMA 4WK4B 1UBSB 2WD8A 2G5TA 5K03A 1RXWA 3FYTA 1JGTA 4B46A 2E49A 2F6RA 2P90A 1S4QA 4LYHA 4YCSA 4IIEA 3OETA 4LZAA 4IX1A 1JECA 4YAJA 4ZVSA 1S2DA 1XC7A 1XD2B 3RV3A 1Y6ZA 4B75A 2EC5A 3PEFA 4OJQA 2BKAA 1U3GA 4KPYA 4IPTA 1ZXXA 2EQ5A 4DCNA 4N3NA 4O08A 4P7KA 5JOQA 4AMZA 3FWPA 1QIEA 1ABBA 3QMPA 2OG2A 4AP6A 4HF7A 3TQOA 4IKEA 3EG9B 1H2BA 2CMDA 4QE3A 1MC8A 1XDGA 2ODQA 3MHPA 3JQRA 1SC9A 1DXOA 2GA9A 4O4JF 1S96A 2PXCA 3GLSA 2J5QA 3UJBA 3AQ4A 3OT1A 5A71A 3VO2A 3EX7C 3AIMA 3FROA 1Z0SA 1FCJA 1UMBB 3E0QA 1T6XA 1WHTA 3K4QA 4DMHA 4FNAA 4RSHA 1LW6E 4GE0A 4PRZA 1I7PA 3ZE6A 1P5RA 2XF8A 1V5FA 1NP3A 3ANXA 1ARZA 2W8ZA 3F90A 5EGSA 5JROA 4MVYA 3ZCRA 1A50B 5B1HA 3JAKA 1KTVA 2ZJ2A 2AWOA 4J3NA 1ECBA 5FPSA 4WV3A 1XROA 2YH2A 5CVDA 2PLWA 4Q9DA 4CVNA 3KJHA 5B1EA 5L40A 2DPGA 1XJWA 4PO1A 2QENA 4EYEA 3OD5A 2UKDA 1H2HA 1I4EB 2BCEA 2Q07A 1CE8A 3KE9A 3P96A 4X5OA 4N47A 3V3KA 5K05A 5KJFA 4NPAA 1QQ5A 4QUEA 4QU8A 2XDQB 3CX4A 3H05A 4V0QA 2AFRA 2G1AA 2WLTA 1EUCB 3ISVA 2FWMX 1FFXB 3W2HA 1D8AA 2CUTA 1QMPA 4F6RA 4JI0B 2O9JA 2XTAA 3Q0IA 4KYVA 3DR5A 2HT1A 4WCFB 5AOAA 3QUBA 4IFEA 1A76A 1SBCA 4UUMA 2BZ0A 3AC0A 1E9RA 2FP4A 1GTJ1 3QKWA 1SN7A 1U7OA 3ROXA 1Y4AE 3W9YA 5HHTA 2ALJA 3QVVA 2M6LA 3LGAA 3FAKA 2IRWA 5KVQA 3LGSA 5F5NA 2B8TA 4H7JA 1ONOA 4JVSB 2JH3A 1P1KA 2QGNA 2XWSA 1OSNA 3P19A 1HTBA 4OA5A 5D3QA 2MR6A 1RYEA 2X5XA 4PLTA 4YJGB 3HCBA 5ITZA 2G9UA 1XTJA 1DVRA 2VZ8A 4GSKA 4NX2A 3C3YA 1QQ6A 5BSVA 3ZNPA 5LQDA 1LLUA 4PR0A 3AJAA 3KE8A 1PLKA 3HI4A 3ZLTA 1POWA 1K6EA 1B8VA 1PCXA 1VXOA 1MJNA 2Z1MA 1JQBA 3C16C 3C2QA 1IEQA 3BGWA 3HXKA 1GPJA 3FIUA 3GLRA 1CY0A 1A88A 1DBVO 1D0SA 1KR5A 1ECFA 4Q05A 4Q24A 3ETCA 4D80A 2H1OA 2GEFA 1DCKA 1DC4A 2XUIA 3K30A 1WSWA 1LPSA 4XVHA 3TOVA 5FOQA 3GX1A 3NVKI 1CF2O 1UPAA 3EY9A 3AHGA 1AUOA 3TRJA 1OH7A 4DWJA 5JJIA 1NBMA 1WU8A 3TPZA 4JGIA 2WYOA 3OCCA 4V2IA 3WGIA 3VO9A 5FHRA 1BXGA 1F17A 2X8AA 1J9ZA 3R23A 3MOGA 3JQ6A 3N0RA 3FYSA 4G2TA 4K7JA 5FRDA 1HFEL 1XHFA 3QLUA 4JL8A 5GWXA 1BMQA 1XDBA 2P2YA 3CF6R 5EE9A 3VR5A 3RYIA 5LC1A 5CDYA 2OB2A 3D8NA 3LT5A 2FCRA 1X9GA 4LK2A 4BO8A 5CCBA 3ET4A 1VKZA 2RC5A 1F6WA 4D4MA 2GHTA 4YRGA 1L6IA 4B74A 2ZI9A 2BGKA 3B6JA 3DDSA 4HWSA 3CBQA 1KPIA 1X7GA 3CKMA 1IEVA 1W93A 3JVIA 3Q5EA 4D8TA 5HOQA 1N5LA 2J67A 1L5QA 2YMPA 4JEHA 4RQUA 3IIKA 4GXNA 1QH1B 4ZDKA 4K0KB 3GIDA 4C5BA 3EH2A 2J41A 4NOJA 1DAFA 2FUG1 2X13A 4IXMA 2GM4A 1USWA 3KKPA 3DNMA 4MGKR 1K75A 4CUZA 1EP3B 3KAQA 5TE9A 2HUNA 1RXVA 3BQ9A 2XSZD 4GOXA 1JB1A 5G3ZA 4I4CA 1FL9A 2JGIA 1SUAA 1HKUA 1X7YA 3QHQA 3CPJB 2REOA 5CIQA 2W70A 2BLLA 2A9VA 3PVZA 4L0CA 3AR4A 3I39X 2BFBA 4XZ3A 4LRWA 4O4JA 2VNAA 2HADA 4ZV4A 2UVPB 3QIAA 3RVQA 3BDIA 4PGGA 5JARA 1CP2A 2GZDA 3HYSA 4Z53A 3BFXA 3DC2A 1FMFA 5DCWA 1A7KA 3UY4A 4NESA 2RGUA 5HPYB 4QYWA 1BFUA 4O4HB 4GMKA 3SNKA 2PZLA 3G2HA 4PQGA 3COYA 1OTYA 2DKNA 1G6Q1 2BFMA 5CG2A 3FMFA 4K6KA 3WICA 3SF8A 4MA0A 1YOBA 1C8VB 3ETNA 2B9VA 4AFNA 4TQUS 1G9SA 5IM4F 1C8BA 4G41A 3T7AA 2R11A 1R5NA 2VHJA 3CXRA 3IEKA 1TPZA 2XEXA 3GA0A 4C07A 5IZ4A 3STWA 3V97A 4M9XA 4BFCA 1JLLA 2GARA 5LYJB 4R2IA 3O8QA 1I13A 3UHFA 4C43A 1YZHA 4IEIA 1P39A 3E84A 3PUVA 1Y8RB 3A2MA 3B3GA 3HA5A 4HDCA 2PCLA 5FLEX 3UAZA 3PTLA 2VDNB 3NX4A 4OPMA 2G07A 2GLUA 2P11A 1T3GA 3NDRA 3T7KA 5LQAA 1PVOA 3NUQA 3OM0A 3I6ZA 1DG3A 2ZT8A 4NZNA 5D86A 4BRSA 2Q2WA 3H86A 1H66A 3JY6A 4NU8X 1XZ8A 1U1CA 2PVCA 4OFBA 2O1WA 4RORA 2ZPAA 4OM8A 5BURA 3G2MA 2CV1A 4OXQA 3KSUA 4O6VA 2IFTA 1GWNA 4ZQCB 4QYMA 3NC0C 4WDQA 3RLFA 4UASA 4Q4HA 3FCEA 4FEGA 4QYSA 5B3KA 5KX5F 1K6JA 2OOSA 3HVJA 3GFGA 2OBYA 4CFSA 1NZJA 2OD2A 2DX7A 3I9FA 4GZ6A 2QY6A 2XOXA 1X42A 1ZJYA 2B37A 4RHYA 1F2TB 5T4HA 4RVGA 2YCBA 1JFRA 2HDHA 3AHEA 3ZCPA 2ODTX 2AOTA 2BCGY 5IXYA 4F8EA 2XD9A 3KUCA 5A3QA 2F8SA 3ZY2A 4BOYA 4B6SA 3ZTYA 1GL7A 2VZEA 3KAPA 4WKCA 2VTDA 1NFFA 2VSOA 2ODEA 1T0UA 1LVHA 1XRLA 2P6PA 3E48A 1DX9A 1HPLA 1IZ8A 1I2MA 1S5PA 3TLAA 3M2TA 4A5OA 1A27A 4DR7B 1K9SA 2K4MA 2WDZA 3IA7A 2UUAB 4EDHA 5E9AA 2Z9CA 1L5RA 4B3FX 1NG9A 4KO2S 3VZDA 4CKEB 2XA2A 1MOZA 2IU4A 3VVLA 3A1SA 3AXTA 1SKQA 4XUEA 4EAQA 2WJPA 4FGJA 2C2GA 1LLQA 1JIVA 1VL2A 1T2CA 5KREA 2GBPA 3SAJA 2JDID 5EZYB 3WWEA 3HR7A 1M6YA 4I2NA 4U63A 2QWXA 2IF0A 5CNMA 1X8LA 2YV5A 1L6RA 2H7YA 3MYRA 4RK5A 1D04A 5EEHA 4BQIA 2V1UA 4ATNA 4NAHA 3EC7A 1W34A 1SK8A 1CIVA 1OFHA 3LUGA 2RGWA 1M2GA 3RHZA 1L9KA 4YWHA 2QU8A 1X2EA 3F7MA 4NZZA 4RLQA 4AMBA 3TF5A 4EI7A 3U6BA 2I3GA 4LNUB 3JQDA 3HV2A 1WZNA 4L72A 2QMEA 2BEKA 3KO8A 4W7SA 4B6GA 1J06A 1RZRA 2C31A 1VSQA 1IVNA 3HKCA 2ZQYA 2CB9A 1GHTA 2NX2A 3DMPA 1SVSA 2BI4A 4L02A 5HF5A 3EAQA 3UHOA 4PE5B 2ZWMA 1QAMA 2L0XA 4LGVA 4PC6A 3KPJA 5JANA 5K20A 3A1VA 2GBGA 2GFHA 1MRZA 3IDSA 4ID3A 2E3JA 3HU5A 3SXUB 3R8CA 1I10A 4S1OA 3NT2A 4E09A 1FUYB 1CUJA 2I4RA 3NAGA 1JXQA 1HNWB 1ZJZA 1OXKB 1AQYA 5U1PA 4TLBA 1FB5A 2C2KA 3SDZA 1BKSB 4KR2A 5DULA 1B41A 3CLKA 3NHKA 3DDCA 2CLSA 1KDOA 1T5LA 2DWUA 1S1MA 2I2BA 3KFXA 4LKRA 3RVPA 2VJYA 1CUDA 5IM4A 4P35A 1PGNA 1KH1A 4FMDB 3ZXIA 1Q2UA 1XTKA 1AF7A 3O84A 2X9QA 3O8OA 3CZRA 4GVXA 4J0EA 2A5JA 2YOHA 1VFPA 3NOOA 4V0RA 3I04M 2BHTA 5JV5A 5K0TA 5EKTA 3FDZA 2P69A 3KFLA 3D43A 4QQ8A 1RSZA 4PG5A 4WX2B 4BNFA 3ZZUA 4DG8A 4ZCMA 4ABTA 1UP6A 3I5MA 4ER6A 5BUZA 4GOND 2IHYA 3W6UA 1D7OA 1Q92A 1ZPDA 2HZBA 3WLKX 2DT5A 5I9NA 3WP0A 1BOOA 1SVIA 4HNRA 2DCMA 3IX7A 2BMEA 1ZCAA 2H4JA 3IBGA 3SQDA 3AVWA 1JMKC 2CW5A 5THQA 3OKAA 3KXIA 4KRYA 3LL7A 1YSCA 5HBGA 2VS1A 1XYGA 4HH3C 5EZSA 2FFHA 1D9ZA 1ZK3A 1CUVA 4BWYA 5KX5A 2XNHA 5HFJA 1IJBA 1QJCA 3FZEA 3V1YA 2ZT7A 4HWTA 4TS3A 5HGJA 5SY6A 2WRZA 3DB1A 4Q02A 3TRIA 2I2WA 2AIRA 4RULA 3I61A 1JSRA 2NYAA 5GZ6A 3U4QA 3PEWA 3C3KA 1N3BA 3TNFA 5AUQA 5HZGA 3GLIB 1E4VA 2I87A 3OC0A 2BMAA 3L0PA 3ORHA 3H2YA 3VTAA 3X2FA 2P9JA 4RF3A 4MRPA 4QQNA 3ZOZA 1U8XX 1MMFB 1T15A 3SLRA 1SCQA 1SB9A 3ZDDA 1C9JA 5CDUA 4H77A 1N8NA 1FU7A 3LW7A 3K6SB 1LI5A 3NIFB 9LDTA 4JLOA 3AV0B 3D4BA 4CL2A 2H9AA 3ZWMA 4F12A 2AEMA 2WKWA 2FOLA 4DW8A 5KJ1A 3QWAA 3A6EA 1ZNQO 1K4KA 2A3NA 5FH9A 4L16A 5ENVA 5IULC 3UGTA 3GLIE 2JFBA 1S8OA 3L8YA 4MUBA 1RU3A 4KFSA 1OWPA 4OBEA 2CE2X 2BHLA 2JJYA 1YXMA 4JVOA 2FW1A 2CLLB 1YGYA 1C30A 1QYVA 1TTQB 1JE1A 1S1CA 2BGRA 3ANSA 3PI7A 4NNPA 1KYXA 3K7EA 1F6BA 3EB9A 1A8SA 2VRCA 5HJ5A 1O0BA 1E2PA 4PZAA 4GLBA 2IL1A 3WMFA 4B8ZA 4MO2A 1LPBB 3EWAA 3NBYC 3VOSA 4K0RA 2JG3A 2GBLA 3HRHA 4LOIA 2PZKA 1WB6A 4X8HA 3VZCA 1PWHA 2LZ0A 2VZLA 3OY7A 4LX8A 1ZRHA 1THZA 3TTYA 3W79A 2IUEA 1B8NA 2GJ4A 2PSHA 2SKDA 1BMFD 1MB9A 1SUBA 1Z82A 2JGDB 2V7QD 4CKCA 2B8EA 4FLEA 4ESOA 5JBIA 3W7BA 3H5NA 4P22A 4K9DA 5CA0B 3CW2A 1YQEA 1T36B 1K5DA 3GBSA 4DR5B 4RETA 3N1UA 1ZRNA 1VHLA 1BNCA 1C0IA 2ZIEA 2CNDA 3PQ6A 1WABA 4HMPA 2IXBA 2ZTVA 4I9GA 2EZ8A 4JR1A 4QXAA 3U7QA 5HKKD 5FI5A 2P6RA 5HK9A 3CUTA 1QX4A 1S2MA 1JT9A 1XPRA 1TJ3A 1FW8A 2WSMA 5BYJA 1U65A 2PY6A 1DKQA 5BT8A 1E69A 3UW1A 4B83A 1E3LA 3FNHA 3V2IA 1LQ2A 4G5RA 3UVEA 2XQKA 3A4LA 2F8MA 1S2NA 3N2GB 4V0ME 1LPMA 3EDOA 5KWSA 3BIFA 3RYHB 1U1EA 3Q7PA 3A14A 3EZGA 3K73O 3OP1A 5JMTA 1KMHB 2H5JA 4FFBB 5A7HA 4YV0A 4QXMA 4GM1A 5EFZA 4C7VA 2O14A 2Q4OA 1Y80A 2A7XA 1IXRC 3I76A 5CW2A 1ILWA 4MULA 5EXTA 2JCYA 4RF5A 2Z1DA 1I7DA 5J4HA 1QK5A 4FIDA 5DBIA 4F9GA 3K3PA 4LS3A 3TNLA 3OE7A 2IH5A 5CAEA 1K2VN 2XGGA 3I8OA 4HFRA 1V7ZA 5JJ5A 1H4QA 1SY7A 4AY3A 1V4BA 1RQXA 4K40A 1CZKA 1LNQA 1M33A 3LG2A 4TZ0A 1TB4A 3AF4A 1E1LA 2F1OA 2HK6A 4ZHQB 4FGWA 4QOFA 2QTMA 5AHXA 3SEFA 4P9NA 3VYWA 3OWHA 5E9JA 3EXG2 4J1SA 2C94A 2C97A 4JY7A 2FV8A 3LXUX 3PXEA 2QD5A 4JP5A 4KRFA 2DBVO 3PI6A 4Y8VA 1ODJA 4B6EA 3AUAA 1NLZA 3PXXA 1OZHA 5IMBA 5TJ9A 1M1YB 3BE6A 4CIAA 1WDLA 4U2DA 3L7MA 5BUQA 1EP1B 3C87A 1TLFA 2WG2A 1OXBB 2DUJA 1HE2A 4Q7MB 1U7HA 1D2HA 2V4UA 3OZIA 2R4UA 4DBLE 2Z5GA 1FYWA 3E23A 3IUEA 4LDZA 4HBZA 3CKLA 3CEJA 4XIIA 1CFZA 3FB1A 2UUPA 1VA4A 4MI3A 5HXAA 1QRAA 1TQ2A 2YQ5A 1ODLA 3GO4A 2EJUA 3N74A 2GHRA 3Q9NA 4XEUA 3UB2A 1M1YE 4LF4B 1H8ED 2NU8A 4AKSA 1KHTA 3FUVA 1FUUA 1GGEA 1Q1NA 1VG0B 3UMBA 5AQ1A 3DAPA 3KV1A 4HSGA 2QQFA 5ALWA 2CWWA 3U4GA 1R8JA 3V2GA 3VH2A 4LYJA 4FOLA 3Q2OA 4AKHA 3E9QA 1W5AA 3OQHA 3OJLA 4ZYYA 2XXAB 3MILA 1AGYA 4TZKA 4C87A 2HF9A 4BFTA 1F3LA 1GUYA 3D54D 3CB2A 1ATIA 1UAYA 2JIZA 2ANCA 2C29D 3C97A 3FHCB 4MUKA 5HCUA 4BVBA 1AKEA 1MTZA 1U9JA 4V1CB 2QROA 1ID1A 1XTUA 2CL5A 3KDPA 3NNNA 3OZGA 3BA6A 4LV8B 4P81A 5BN5B 3QE0A 3KB6A 4AC9A 1DUSA 1V37A 4K6HA 1ZRSA 1DBSA 3LDHA 2WPDA 3ITNA 4D2IA 1RWNA 2GEBA 2HMWA 1Q95A 4HKTA 1K6XA 1L8OA 1VE7A 2GVZC 2Y1WA 2NVUB 3R09A 621PA 3A58B 3TTTA 3ANMA 4B3BA 2OO7A 1MA0A 2OO5A 4UHCA 4OLJA 1T0JB 4JN6B 5LLSA 3DKVA 5DX0A 1EFDN 5KOYA 2IYPA 4DT1B 1W5SA 5EL0A 1GAJA 1Y1RA 1U7TA 1UK7A 3PNMA 4GGPA 3L9WA 4UVEA 1NBMD 1Q57A 2R1TA 4J91A 1YK0A 2DLNA 2X0RA 1VPDA 2YWJA 3ICVA 4RAQA 3H5TA 1VG1A 5J1TB 1RPTA 4JODA 2EYQA 3FWKA 1R7RA 4CQMA 3ZUPA 4BTVA 3PENA 3VR5D 3WK6A 3K0BA 3MGKA 3ER8A 1JKJB 1XMPA 4FP9A 5BMOA 3U13A 3OF2A 1FDIA 1XVVA 1R10A 3GT7A 1L5KA 2X41A 2Q8PA 4QICA 3RIEA 2ZZMA 1WKVA 3A2NA 1QFXA 1MT3A 3HWSA 3KBOA 4P84A 3M4JA 5EHGA 1MAHA 3PRYA 1DXHA 1WBJB 4O4LB 5HZHA 5ALSA 2VNIA 1AX9A 1W1WA 4ML3A 1CERA 1OU0A 4Z6KA 2VBIA 1Y6JA 4MVJM 1L7BA 3TNJA 4ZVLA 3X1ZA 3BE5A 1QGDA 3FUUA 3EIFA 3MMSA 5FOXA 4BO3A 4EY5A 4I1PA 1YJQA 1ZU5A 4TWBA 4L08A 1YZLA 1MX1A 4LVOA 4UHEA 4BTLA 2PVPA 3F6CA 3OX4A 4PN3A 3GT4A 3RTDA 2CSXA 2VSQA 1NVKA 2Y9MB 4TLCA 4TROA 3ZLVA 2JANA 5CMLA 1NNEA 3CO0S 3T38A 4CMJA 5KTYA 1RQLA 1WTCA 1CU1A 2J6IA 1TC2A 2WJ3A 4LISA 2WM2A 3ZBPA 1GP2A 1A7UA 2MINA 3LX6A 4DEVA 2ZUEA 3A3NA 2VCEA 2P2CA 2QSJA 2ZYWX 1W0KA 1T9KA 3WXBA 3QSYA 1KFJB 5AO9A 4DZZA 1VZ2A 3RREA 1S3IA 3WFZA 1Y9EA 5I51A 2UAGA 5C80A 2BEVB 4QODA 2P1ZA 2RHHA 2Z8YA 3MK31 2WUFA 1J39A 4JI2B 2JAQA 2P27A 5MFPA 3U80A 3TLGA 4YI3A 2RAPA 1RAFA 4KTVE 4RXMA 3TSWA 3H0KA 3U19A 4KIFA 5H68A 1DDGA 4RY2A 1Z0UA 2NM0A 7YASA 1U2QA 2NT4A 1M2EA 3HY4A 2OCKA 4DM4A 5JASA 5JRJA 1UK9A 2HA7A 5JCJA 1G2OA 3ERCA 3OG9A 5J4VA 1R18A 5IWCA 1FBTA 2IU3A 4O8ZA 4HC4A 1W46A 4KUEA 6REQB 1X7HA 2QTNA 1R6BX 4U7WA 1F06A 2J9FB 5CXQA 4OXIA 3ZJ4A 4Z7QB 4FINA 2G1JA 2MHCA 2WWFA 2XWQA 2XJ4A 2VTBB 2B94A 5CFZA 2H51A 2OK8A 3GOHA 5BV7A 1MB2A 2W6JA 4QPJC 4AZVA 4XIFA 1P7PA 3RSCA 4LE2A 1RHRA 1NIPA 3PJGA 2IHKA 3U44A 5DHPA 5IXJA 4EPVA 1CVRA 2ENUA 4RYLA 4W5NA 4GHWA 3KR0A 2I8LA 2KE5A 1R5JA 2N46A 3C15C 3O4RA 3GLHA 1CHNA 3KLPX 4FDTA 1QDUA 2OCDA 3MSCA 1Z0AA 5CYFA 2AA3A 4WFIA 3TZCA 1KZYC 4IDCA 4G8BA 3Q98A 5C9ZA 5E3JA 2I5PO 1GA6A 2FI1A 4H16A 1NN0A 1OW3B 1GFIA 1V95A 3RUFA 4KRGA 5CNJA 1NVDA 3GMIA 5A2QA 3RYCB 4UBJA 1B0PA 4R54A 4HRXA 5AXDA 3VU8A 5K4GA 4WNYA 5I8PA 3FCUB 5ALOA 4MWSA 2BMDA 5BVGA 1PEYA 4JI3B 4LJYA 3AVPA 1ADYA 1W0CA 1Z15A 4HP8A 2BCJQ 3FFBA 1YB4A 1NUSA 2UZ1B 4HDNB 4LWQA 1I3LA 5CT8A 2RGDA 4WZBA 4I9FA 1XCMA 2PYIA 2NMVA 4JSYA 3HVIA 2B92A 2X8JA 1N8SA 1F60A 1U2GA 1NJ2A 1U5BB 1I4DD 4EJSA 5ADHA 1ZM3A 1IK6A 4H1WA 3L18A 2WT4A 5KAMA 3T4XA 2CMKA 1ORWA 2P2SA 1BCRA 4NJMA 4D8VA 3EA5A 5KYTA 4MGZR 4P5PA 5AVYA 5L95A 2VYNA 1FDVA 1EKXA 1IBKB 4EW2A 4A36A 2WUGA 4LTDA 4QO8A 3FM9A 5ESDA 3M3HA 3HP4A 5EXDA 5LQMA 5AKIA 4D9KA 5CFLA 1NJ5A 1KDYA 2GZSA 3TXXA 3KZMA 3THSA 4ARIA 5HQJA 1KZ6A 3CUUA 3TLEA 1G6OA 1KP9A 3VSEA 5BR7A 3BB3A 2YOFA 5JYCA 1IOLA 3L0DA 1BW9B 3N6VA 4XIYA 5ALGA 5JXHA 2OCAA 3Q2IA 1JSXA 3TG2A 4BLPA 4HX9A 4WRRA 5JVDF 5JBQA 1AKUA 4PLGA 1XZPA 4I1UA 2AFIB 3ASUA 4LDAA 2QNIA 5DX8A 3PSHA 2P5TB 4LRYA 4BMNA 5ESWA 3RS8A 3OEWA 2PX0A 3SYLA 2IEGA 1F8FA 1NOIA 4TYPA 2BJHA 3WYNA 2O8DA 4DJAA 3P2KA 3EVAA 3IQGX 1XMOB 2FSHA 1ZH6A 1GRVA 2CZCA 4DLTA 2OUKA 4TKLA 5CH5A 1ODSA 2VJMA 2MYTA 5EP3A 3T95A 1RZRD 1NLUA 1TMOA 5AHRA 2AFIE 1M3SA 3BJRA 3RT1A 3DA8A 3DTVD 4B80A 3QV2A 4LJ4A 3B70A 5FCDA 1XEFA 3E5NA 5DSTA 4CQMD 2JIDA 4EUHA 3CQ9A 1TUBA 3KOYA 2GH1A 1CJMA 5EOVA 3IHWA 4X71A 4RDHA 1C3OB 2PUJA 3QBTA 4LDNA 5JS7A 4CMIA 4ZT5A 1IDOA 4JYZA 1E6EA 5JZSA 3D1LA 1MXFA 2HTFA 3T0IA 4L4UA 3KQHA 3C3AA 3CUKA 1J49A 3UG6A 5K2OA 2W6PA 5EJFA 3RSFA 3UENA 1W0JA 2ECFA 1S9DA 1XCBA 2C5BA 3TRHA 1O9HA 5COAA 3VR6A 1QAQA 3QUTA 4IOKA 3GAMA 4AO8A 3AH8A 1AVTA 3CRQA 4E30A 2WHXA 5JIBA 1E3MA 3VR6H 4WTOA 2HLDA 1TX4B 2FWNA 5FUQA 3DDZX 4MKIA 2OV2A 1PSWA 1ZAYA 1AHIA 2I0FA 3CW9A 3MC1A 2NZWA 4J9UE 1G2QA 4DRZA 3W3AA 4IEFB 3HADA 1A1VA 3KL2A 2BH2A 1LH0A 3WZ2A 3MIZA 4MCAA 1X1EA 4LBZA 4YRJA 2FFAA 1E2JA 4YRSA 1F20A 1VKOA 2E4UA 3W3AH 4BP8A 5C81A 1RKUA 2FPPA 3V00A 1MAVA 3L7JA 4I50B 2WQ6A 1AXRA 4ITRC 3D8SA 4RH0A 3QNWA 4FYWA 1E2LA 3PE6A 1Y8CA 2JBWA 2WIKA 2EP5A 3NEYA 2IH4A 3MJ4A 1XZCA 2ZZKA 1ZO8A 3KJFA 2DOKA 3MWGA 4KX5A 5IARA 1PYOA 4LCEA 3FOEC 3KJGA 1I4WA 1WOMA 3O3CA 4OQXA 5F9MA 1E1YA 1UBTS 4FYKA 3NWEA 2QR5A 1FXWF 3BVPA 3V7WA 4PN7A 2F64A 4WY8A 3O2SB 5AK4A 3BWDD 2CLFB 3SJAA 1E3QA 4L76A 1VJRA 2C9ZA 3BMQB 4PXSA 1I9GA 3DBHA 4GH5A 4QDKA 3ZXUB 3ZHOA 1QIGA 2BH9A 3GCZA 3HE3A 3MXOA 3QOYA 5GJCA 5FEMA 1LS1A 5IPFA 1JNXX 4ZVVA 2IHBA 1PQWA 3THRA 4I4LA 4A0SA 2VHYA 4TV9B 3I8XA 2ZSHA 1NKVA 3PC7A 1WF3A 2YKGA 1FZTA 1OYOA 4GO1A 1JR3D 3GV0A 4QGBA 4DGSA 4EFNA 3JAMA 2Y92A 1Z25A 3DYBA 2AN4A 2HJRA 1SVLA 2BDEA 3TLBA 1UBOS 3H8VA 4G1EB 2RHJA 1FDSA 4LNHA 1U0EA 1J8QA 1RLJA 4S04A 1K89A 1B16A 1GU7A 1M2OB 4AY5A 4RWEA 3TW6A 2X40A 1VOTA 4A26A 4Z7OB 1P4GA 2VRCD 1TYAE 1JQJC 5HZMA 1W19A 5DNDA 2QTVB 4JVNA 4UE6A 3MA0A 5INTA 2CBXA 3FUXA 2W2TA 1F0PA 2QZ4A 4BTEA 2EG5A 1ZNXA 1GIAA 2FPGB 2LNDA 4KH0A 2NOAA 4LN1A 1KYVA 4AJKA 3VISA 4PHFA 4WLEA 2H1CA 5IANA 2G76A 1VE1A 1W48A 2WJHA 4K86A 2AF4C 3R3ZA 4PF1A 3AUJB 4I99A 3R9XB 5LOVF 5JAUA 2QGFA 3EIUA 3GK3A 2P0AA 4RIIA 4E5PA 3HGTA 1W88A 2FWBA 4IKPA 4R01A 5DBGA 3KPVA 1Q7RA 4U2CA 2M32A 4W82A 2AWNA 4RVHA 4DLSA 5C1BA 4AJEA 2DPHA 4TRMA 2PGIA 3ADCA 1X14A 4PHGA 2IT1A 1E98A 5F3DA 5C53B 3BBPA 3L0BA 1PS0A 2OVFA 3EYAA 2YVQA 3MT0A 1M0WA 4F8JA 4TN5A 1HL7A 4KDCA 2PXHA 1TTHA 1OI4A 1WRBA 3FVWA 4JB2A 4LXTA 4JYAB 3PWKA 4XA8A 2YBDA 2MT9A 1DIGA 1FUIA 1PLLA 2VDOB 2Y4OA 3G8CA 4K81B 4PM4A 3FWZA 1VLVA 4QBHA 3H6GA 3RR2A 3ZWYA 2O3JA 1D0VA 1NLMA 2BFOA 1IOWA 2GLTA 1IY1A 1IHUA 2GCNA 1RS0A 2DUMA 2GRUA 3REFA 4UMDA 3UC9A 1SOVA 1T2AA 2JJ2A 4B7CA 4BGUA 3VBEA 2JFFA 2WSSD 3L7OA 4EQZA 1CRQA 2AF3C 4QUDA 2FEWB 1NI4A 3M33A 3OE7D 3ON5A 1XF9A 2GN9A 1U3TA 2HMAA 1WUIS 2FMUA 1U8TA 2PJDA 2XWJI 3L1JA 3QE4A 4JDPA 4PLCA 1DJMA 4ENRA 121PA 2O5RA 3ZJYA 4BKRA 1NN3A 1J5EB 1A0OA 1I33A 1QSGA 4RV5A 1JFVA 4MQFB 5AW4A 4I46A 3SOPA 2DHDA 4GICA 2C2MA 4RM3A 4EGJA 3K5HA 1SHLA 3FKSA 1YDEA 3NVAA 3SHQA 2ZTMA 3QLUC 3KEOA 4ME6A 1BDIA 5A0FA 3JQEA 5EJGA 2P1DA 1E1CA 5KQPA 4MP3A 4EAAA 5HRUA 3W1VA 3RROA 1KSHA 3AEKB 2LIVA 4HQ0A 2W11A 2Y8EA 2R6JA 4PZCA 2MSNA 1ZAKA 2IY8A 4GOJA 4F11A 3KVNA 4B6PA 4YI5A 4BBPA 1GGMA 1LBSA 5A06A 1XNGA 4IIJB 3R3VA 5ES3A 2VP4A 1PAUA 4ARBA 4B3GA 2VDJA 1HZZA 2HK8A 2IJGX 2O2GA 4DV6B 2D74A 3R2JA 3AERA 3WDSA 5FFMA 1N2XA 5G2OA 1RW4A 2CXRA 2XMDA 3ROKA 4DNQA 4RMHA 3EWIA 3HDGA 3W7VA 3F9CA 4LJ8A 4G5XA 4HLDA 3TTUA 3C7CB 1ZWLA 3IQXA 3JD2A 4CMCA 3WIDA 4DJFC 3BH7A 4DEYA 3GHYA 2VATA 3TQSA 3K70B 5F35A 4CMKA 2IOQA 2VRBA 2EF0A 5BW4A 5AM5A 3KPWA 4IUBS 5JH7F 1NIJA 1TIPA 3A2LA 1WXXA 4FMCF 1XZQA 4DDMA 5EMHA 3EXEA 1BKDR 3VJMA 4B7AA 2J0SA 4B3XA 5L4SA 2A14A 2BM0A 3C1OA 2JIZD 2ZSFA 4AKIA 1L7XA 1HYHA 3DO6A 4PFJA 5EXEA 1IBMB 3RU7A 1EXDA 1YS1X 5HF9A 3VNQA 3O8BA 3ZE1B 3UTCA 4CHTA 9ATCA 5LB4A 3OKFA 1EK0A 4S0XA 2WPDD 4G5SA 1JKIA 1EDBA 1OX4A 2QX9A 3I37X 3N05A 4IVRA 4PPGA 4BEJA 2Y3IA 1WMBA 1KK3A 2CVHA 4GLLA 1L5YA 4HTAA 4AJJA 4E4YA 2QW1A 2IIPA 3AW9A 2FN3A 4JL5A 5C5DA 1U0LA 2OYCA 3FB4A 5AKZA 5E95A 1KI4A 4TZTA 3BTUA 2YY7A 3AYXB 5IUJC 4YCLA 1YZ3A 5LPNA 1E66A 2GZ1A 3ABIA 3DE2X 4JKYA 1RNLA 5EIAA 5F2KA 3JQ7A 3H3XA 1RKBA 4ESVA 1UZLA 4FJ1A 1DAGA 2ROQA 3DBRB 1Q16A 1CDZA 1DS6A 3QGMA 4FFDA 3U6KA 4RPLA 1FNBA 4U8HA 3SY8A 5CITA 4U0JA 4B5KA 5LOVA 5DHAA 1AGRA 4IIYA 3X44A 4AZWA 1M6VB 4ZJUA 2E1PA 1Z0JA 1QE3A 2XVYA 2PYZA 4Z8XA 3A3OA 4G9EA 4W7IA 5CPFA 4XSGA 4UZFA 3SYKA 1Q0TA 1TT7A 3KQTA 2IUSA 1VLHA 4P2GA 2XYVA 4CV3A 1Z4LA 3C3BA 1ZM2A 5D7BA 1B2RA 1NR5A 4W9NA 1ESCA 1ZSNA 5ETJA 1LC3A 3I64A 5CVCA 4Q6BA 1E99A 3E7XA 1KMNA 3W77A 3PFGA 2QZ9A 3WHIA 1PFWA 4IIDA 2Q2VA 4QXOA 2E1RA 4HG2A 5E6RB 1QVVA 1A1SA 1P1FA 2H4YA 3DNPA 3LPLA 2ZANA 4IILA 4OY3A 2CHUA 2YYAA 2C4TA 3D2AA 2VEOA 3QLVA 3RRJA 2XY4A 1NATA 3DOHA 4TTPA 3AB7A 1D5CA 1G8MA 4HI0E 4BZZA 3IL2A 3KSBC 1XDSA 3EMVA 4YLEA 3WLFA 2B82A 3OZXA 3QWHA 1C1XA 3V4RA 2K6GA 4QQRA 3KL4A 4YJHA 3AESA 5EXPA 5H4HA 2H0AA 4BNYA 1M34B 4HTFB 4L5BA 3GGDA 1YB5A 1TO1E 4A8PA 3RTAA 2JLVA 1WHSB 1UIMA 3SMVA 3F71A 3N7TA 4J0GA 1IY9A 4OSEA 4AJNA 3WB9A 2J0QA 2A9QA 2QYHA 3UK0A 2G0NA 3WL4A 3R7WA 4G0VA 1L5NA 1W0KD 4L07A 3SZLA 1OWNA 2AI2A 3TX2A 4CDMA 1A71A 1IATA 4KR9A 1CUXA 3REGA 2QT0A 2QQ0A 4M8SA 5TQ0B 1SRQA 1ZLYA 5DLPA 1GQSA 4N8SA 3AGPA 4OXYA 3LOQA 5AW0A 2GXQA 4XJTA 3AR5A 5DO9A 1P4RA 3MTQA 1T6NA 5REQA 3CPEA 3DEKA 4D79A 2G0AA 4OHOA 4TL8A 3OOEA 1SXPA 2WA2A 3P4XA 3UIEA 3M5PA 1YZYA 4LZNA 2JZCA 2H18A 3BXHA 3U4HA 4UFPA 4DSTA 2C96A 2FUG6 2Y77A 4KPUA 4GBMA 1AUVA 1QCCA 2DFVA 2O3RA 4QX6A 2P2NA 4UBIA 4FBGA 4G25A 1RYBA 4ZMRA 5K45A 1DWQA 2XE8A 1JVBA 1DQNA 2W71A 2R1VA 5JCJD 1CUZA 3COVA 1E3SA 5KJEA 1EIWA 1NY6A 2FFRA 4JHXA 4UU1A 3E4CA 4D9GA 1WY5A 1P3Y1 3P0HA 4YRKA 5T7BA 4I5EA 3CEMA 2HNBA 2OP1A 3ZVRA 4UAUA 2IHUA 2X8LA 4RH3A 1IMOA 2A1UB 3AM4A 3RUPA 2IYQA 7AT1A 2R7KA 2W6JD 2YZ2A 3C7TA 2PTHA 3HN6A 1YBHA 4OUDA 3O94A 1ACJA 1U7DA 3RS0A 1BWPA 4N9QA 4OX9B 4CQLB 4BY9E 2P7IA 2OUIA 1Z5NA 5JH7A 3ESCA 2NUPB 5HNKA 5FYDA 2QRGA 3EGXB 4FEEA 1LNSA 2P4QA 1ONPA 3PYXA 1SZDA 3OTHA 3S40A 4XWKA 4NFSA 5IJ9B 5DHUA 5TMEA 5JUWA 1XHEA 1Y3BE 2AJ8A 1HM5A 1KGSA 1SD5A 2VXYA 2QRKA 3E9EA 3FGZA 2R00A 3LPAA 3R6LA 3WWYA 2EYUA 5C8VA 3U4MA 4BX2A 3PXBA 2M6SA 2WAOA 3AY7A 2XQVA 4JU8A 1PS8A 2IYEA 3UH0A 3WMWA 5K0CA 3OZBA 5L9AA 4UDYX 3BE8A 3K2IA 5ESXA 3HCDA 4MPPA 3BEOA 1L5HA 2Q9UA 3H97A 4H4DA 1R4ZA 2YW9A 2VJKA 3ZQKA 5LSAA 1O9GA 5IAJA 3FCCA 4AS3A 1UODA 3KKNA 5JATA 2C84A 2VDKB 4JKOA 4WBNF 4AULA 1DJOA 3AETA 4PG7A 4ENQA 1CIPA 4N5LA 2C2XA 2X4DA 3W9UA 3W2TA 2BGGA 3CPSA 5ADWA 2A92A 2P0EA 2BIFA 3K9QO 1HMYA 1NKSA 2VYND 3OOSA 2GWHA 3EEOA 2BF4A 4XTRA 2PZ8A 3MT8A 1Y42X 5B1YA 1RFLA 1I0LA 2CDBA 3EC1A 1I94B 2B30A 2BJWA 2P9FA 2PEZA 3M6VA 2LDXA 4MJ7A 2CYAA 5JMWA 1RJFA 2BEJA 1GNSA 4ZEOA 4RSGA 1KEZA 1RLTA 4M1SA 2BBTA 4CDGA 3MRVA 3ND7A 4G23A 3ZJ5A 2A0XA 5U4QA 1XCOA 3ODPA 2IVFA 2IOYA 3EZ7A 3EISA 4LDJA 4S3MA 4IOLA 5B7NA 4BVKA 3TM5A 3F3YA 2E5LB 2I62A 4QUGA 4W99A 2DPXA 2WHQA 2NU7B 4YJDA 1KQNA 4YJFA 3V7NA 3DHNA 5B58C 8ABPA 2PSSA 1R37A 3ESRA 2IPXA 3N2LA 3VAAA 3OOWA 1KE2A 1MVLA 5EFOA 4Z51A 5A5VA 3WQBA 3FGNA 5BQPA 2DFLA 3D7NA 3ASVA 4LWZA 3HNRA 3N6RA 4N39A 2HGZA 4KR0A 5AI9A 1JSCA 1RADA 3M4YA 1WNTA 4HB2A 4QNMA 4LVUA 3P0IA 4ZI5A 5FLYA 2JK1A 2IYSA 2SKCA 5CH8A 5ADVA 4P6VF 4UXJA 2AQHA 1JEAA 1FJXA 2Y0EA 5KB3A 4OXNA 3RHSA 1TZMA 4HO1X 2Q62A 1TYEB 1BA2A 5ELMA 2H00A 2ZQ5A 2ECOA 4CG2A 5JLJA 4DKJA 1ZH8A 5IJ0A 4DUZB 1JWLA 1DFGA 1ECPA 4G07A 5DCUA 1OD6A 2ESRA 5AW3A 4MR7A 3RSSA 1P7WA 4XJSA 4PHCA 4PX5A 1P7VA 4FB5A 4DJJA 3V8NA 4JUBA 3AFMA 1P74A 1PJSA 1D2EA 5AKHA 4QJ3A 4UXHA 4RD3A 4NMLA 1NFRA 4TS1A 4Q03A 1WA5A 3MZ0A 3W78A 3NETA 4KZPA 1M10A 2X1VA 1W0JD 1JDPA 2OAGA 4B3HA 4Z4HA 2IP2A 3URKA 3VR6D 3G8DA 4HHEA 2ZK7A 4YALA 3WV5A 2FEKA 3ASYA 1GARA 2OWEA 4FJ0A 2LPMA 4LSZA 4N76A 2BMVA 2H63A 4M9UA 2X19A 4ND3A 5LBIA 5CLQA 2Y2VA 1CRPA 1JMYA 3GZ4A 3I53A 1W2HA 2AK3A 2HLDD 2ACKA 2DWPA 1R0WA 2DQKA 4X66B 1QM5A 4DCCA 4S05A 1X7ZB 2GBLC 5CXSA 1BVYF 3C6XA 4GX2A 3IOBA 4MEJA 3L2OB 3MTJA 3X2EA 5LXTB 1QQTA 1FFAA 2ZJ7A 2OO3A 1IHPA 2H2WA 1B8OA 1OX6A 1G7RA 2XMCA 4I55F 2WB4A 2NO5A 1ZI8A 2CUKA 5HP4A 2RH8A 4BKOA 4RKYA 4MVJP 4U3JA 5AVKA 3WB0A 4G1VA 5EHXA 1HQKA 1HDGO 1E3EA 3G1TA 5BRNA 3ZK8A 2B1RA 1HMPA 3PICA 3A9UA 4RJIA 1L7OA 5T6BA 4CNBA 3T9BA 3T9EA 1SC6A 4XQ9A 3ZLJA 5CA1F 4X8OA 4PXYA 3R9IA 3IRVA 5EUQB 1BFKA 5FOSA 2ZCVA 4KXFB 2HL6A 4P3NA 5AJUA 2EFHB 3LFHA 1HQDA 3IQHX 4JC5A 4K03A 3NB0A 4XUGB 1V35A 3WRXC 1JLHA 3OQNA 2WIGA 1RTKA 5T64A 1J9EA 4DQLA 3FETA 1QHNA 4PSUA 2KW5A 5JYDA 2FP3A 2XEDA 1OC2A 1G9XA 3LS2A 1DUVG 5DV9A 2HJGA 3UYLA 1JG7A 5DVZA 1DAHA 1DV2A 3U2QA 2JK0A 3F6PA 4E07A 4BKMA 1JV2B 1MDBA 4YJ2B 4WBNA 1ZZGA 1U3DA 4IJUA 3VDNB 3HKEB 3FF4A 1X86B 2NXNA 3P52A 4JJGA 3SE0A 4B79A 4ZYZA 2GT1A 1ZCBA 2IZ7A 4MQEA 4BZWA 5DK6A 4PTYA 5NULA 4ADSG 1W9MA 3RTEA 4TSKA 2XMGA 2FQQA 1II8A 3L6BA 4XPIB 4IDQA 4JGBA 3HYNA 1HSOA 1IN5A 2BFNA 4ZFNA 4M1ZA 4A0QA 4BAZA 1N6OA 3UT0A 4YMHA 1P1JA 3TD9A 4YFVA 2B6HA 4XCQA 4I8DA 1MZVA 2WU8A 1JH9A 2Q28A 4Z9BA 4KLAA 4WZZA 3FCXA 1GTMA 4QL3A 2PWPA 3NZEA 1O54A 2FMTA 1PN3A 3GJTA 3VQTA 4BV9A 2Q2OA 4LV5B 3EOAI 2PQ6A 4JLSA 2FJUA 1HYEA 1KNXA 4UDXX 4EGCB 1BCSB 4EMSA 4ZYLA 4EX6A 4JJ6A 4ZCTA 4NBKA 4OHPA 4B35A 2HRDA 3GJZA 5TR9A 3WR5A 2JZOA 3IKLA 1TUGA 3M7IA 2H4XA 2TSYB 1FFEA 3HKDA 3HJGA 4A0FA 3QVGA 4KYUA 5LDGA 1X7XA 1MOSA 4DVGA 1WPQA 3ZK7A 4FE7A 5GMOA 1YB6A 3TQTA 3WHKA 3K2BA 6AT1A 3OUZA 1AQNA 4P33A 3TZEA 2WT9A 2RHOA 3CVXA 4MW5A 2ZOSA 1EE2A 2PXXA 1UBJS 2GEJA 2WZDA 4PV7A 1QBGA 4B34A 3U3DA 4BGEA 5FL3A 3BIWA 3G89A 4AVYA 2X77A 2VUHB 4PTLA 3BGSA 1XTSA 1RXIA 1SXJB 1CJUC 2ATVA 1SWVA 2HEIA 3IP3A 3ZNOA 1Q14A 1S01A 3CCCA 3QOXA 1FY2A 3K1ZA 3FSEA 2JFZA 3VOAA 3FSJX 2H57A 4I1RA 1W52X 5E3HA 3CLSC 1XA4A 2HDOA 1RIIA 2Z08A 1NW3A 3CUVA 1G17A 3T7DA 2R8YA 3C0KA 1MO6A 1P2VA 3KTAA 2Q3HA 3RWBA 5DBFA 4ARSA 5K01A 3H65A 1XL1A 3N5KA 4MB2A 4BNIA 3UPUA 4LXXA 4NBTA 5BWOA 5KBYA 1KERA 1OT5A 2JBAA 2NYUA 3G6WA 4ZVOA 2VKQA 3VDQA 1TFUA 2JJ2D 2EBFX 3RIMA 3ISJA 1WB9A 1SHTX 2NZ8A 2FRDC 1BGXT 4CM9A 4ND5A 2GD0A 3NGXA 3NKFA 3O4VA 3VNUA 5ALUA 2GYWA 2X7HA 5KVVA 1PZGA 4ANFA 4F2WA 2OO5C 3A4NA 3J7AC 1NOKA 1ZD5A 3MJVA 4R16A 1TO6A 1Y34E 1Z0ZA 2XOEA 3R77A 3STTA 4QAQA 4XWYA 4NBUA 4ENUA 1CUIA 2RSLA 4XR4A 1DRKA 3TG8A 1W36B 1T1JA 4X1YA 4V1CI 1JLRA 3NOVA 1GZ7A 1KU0A 4I55A 2IDJA 5G0VA 2BFAA 3FKSD 2V3CC 4NZYA 4XWAA 1DTWA 1F38A 2BKLA 4XB6B 1HDYA 3PJDA 4UMEA 2Q6VA 1R66A 1NMEA 2C8VA 1E2NA 1G8PA 1MOQA 2EHDA 2OMKA 1ZHFA 3HUFA 3PNSA 1CY1A 2Q45A 1US8A 3GEPA 3I5UA 1IQ0A 4IJVA 2HRCA 1LPOA 1RCFA 3KD2A 4UFOA 2XXBA 4UNIA 4YRBA 3K0AA 2V74B 3DGFC 1OFTA 4TLDA 5CLIA 1DRWA 1L5FA 4ZA2A 3GZNB 3R75A 2BEUA 3WL6A 1HETA 4OJYA 5CA1A 3BMCA 3A32A 5JXWA 3GEMA 2FR8C 1PS9A 3TB6A 3GFVA 2F1HA 2QMZA 1G4AE 1SVOA 5DH9A 3VJLA 3KR1A 2IE8A 4DDUA 3W7AA 2VAWA 4YCMA 1ZMTA 3CZMA 3PEEA 1TYCA 3HDYA 5KNCH 4MWBA 5HJ2A 5FA8A 1UPCA 3JAWB 4GR4A 1PL7A 4M0MA 5LQCA 5K8UA 2JD1A 1OZ0A 1Y33E 3QX9A 4LSGA 3DDWA 4MROA 4O02B 4ZPJA 3UMGA 1XN1A 4R8RA 3TBKA 2AOVA 3UMJA 3TE6A 3RTGA 3DJYA 3UMSA 2P41A 1A04A 3QPWA 3C1UA 3DGEC 4TXLA 5CFQA 4ZEWA 5KYVA 3QEMB 2I54A 1KOFA 5FWYA 1AY0A 3GEEA 1NBWB 3L02A 5J2UB 1FP4A 2ZREA 4GRDA 2NZ2A 3GR6A 2DM6A 2SBTA 2HU5A 4FKBA 3CU5A 5C7LO 3FHOA 2QZSA 5AUNB 3LPDA