3BMOA

Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor (compound ax4)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
267
structure length
255
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 96
structure length 255
sequence length 267
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bmoA00
3JSAA 4RPGA 2B36A 3VKUA 2R6JA 3NT2A 4BB6A 1DSSG 5JMPA 2O3SA 3GEMA 5A4DA 1LDNA 1GZ3A 4YVFA 4Y6RA 1PX0A 4E2WA 3H7AA 4AJEA 1XU7A 4NPCA 3CMCO 2AEMA 2AE1A 2ZJ0A 5I7EA 3KV3O 4EJ0A 1SB9A 4PZEA 3DZFA 2B69A 3GRKA 3QSGA 2I66A 3ZH2A 1Q7BA 3KSZO 3H9GA 1PIWA 3HWRA 3WJAA 2O23A 4ND2A 3LF1A 2BRUA 2FSSA 3H4VA 4GX0A 4CLHA 4NI5A 4JK3A 4CUJA 1SMKA 1BXKA 1K5HA 1GV0A 1UXJA 1HDYA 2PKQO 3KEOA 4YJHB 5IDQA 5GZ3A 1ENYA 5CDSA 4KUHA 3ADOA 4U0JA 2FN7A 5U9CA 4MPDA 2Z1MA 4YPOA 1CQJA 3CEAA 1A7KA 1Q7GA 3KSUA 3OA2A 1NP3A 4Y9DA 2GN4A 2X5KO 1MC4A 3IL2A 5B4UA 5BR7A 1X1TA 3E8XA 1EVZA 3KRTA 1IB6A 1TB4A 1H2HA 3PGJA 1YOVA 3WXBA 4BO0A 1MG5A 1E6UA 1JW9B 1UP6A 3PHIA 4I08A 4E0BA 4M89A 4MINA 1T2DA 4HP8A 5ES3A 4BNVA 4CV3A 4DYDA 4JBHA 4N18A 1HDZA 2VRCA 3U5TA 1HZZA 1HETA 2X86A 4DUPA 1ADGA 1VJTA 2VYVA 4DIOA 4FQ8A 4TVOA 1YQXA 1IHXA 5G0VA 2HJSA 3IP3A 3RC7A 3QWIA 1LU9A 3NDIA 3ONFA 4D46A 1KVQA 5BSFA 5AXCA 3ZNQA 3PJDA 5FI5A 3KEQA 1YQDA 1G0NA 3AI2A 1JAYA 1H9BA 1H0KA 4A7PA 1KS9A 4C7JA 1UZNA 3L4BC 3B70A 4FJ0A 4K28A 4HFNA 4Z0PA 4P4NA 3OP4A 3BTOA 4PG4A 5A02A 1LRJA 1PJLA 1A7AA 3WGZA 3KZVA 2OXIA 3ZU2A 3OIGA 4RJTA 1D8AA 1YB5A 3OICA 4CMIB 2G1UA 3FWNA 2GNAA 4JQCA 4AJLA 1W6UA 2AEFA 2Y0DA 3ZW9A 1I2CA 1DLJA 1U5CA 4W6ZA 3GNTA 3NAQA 1PJBA 3WGHA 3WG9A 3EZYA 4BNKA 4AFNA 2OHXA 3K30A 4KUGA 1U9JA 5HTOA 1DEHA 4G81A 2ZATA 3H3JA 5ILOA 3OBBA 1M67A 4RVGA 4C4OA 3OJ0A 2FPGA 2FPIA 3AM3A 1BW9A 4PLTA 1VRWA 1GQ2A 1C0IA 2E4AA 2B83A 4D79A 3WGQA 3PXXA 4YBZA 1HZJA 2DUUA 1DIGA 2NSDA 3WQRA 2CF6A 3ZWYA 3I1JA 1LC3A 1A9ZA 1N9GB 1NR1A 1UJMA 2EW8A 3FSRA 3SEFA 4BGUA 5L4SA 1U2GA 3ABIA 2P9CA 5A9SB 5ITWA 4J43A 3HDQA 3SLGA 2E49A 2YFQA 3I83A 1UZMA 2X9GA 3SJUA 1U3TA 3RC1A 1C0LA 4FFRA 2C82A 1QLHA 1VKOA 1DIBA 3QVWA 3JTMA 2ZJ1A 1EVYA 4XRRA 3JYQA 2AG8A 3L9XA 1NYTA 4OSOA 4P22A 4CL3A 4PLWA 2JHFA 2DVMA 1GYRA 4BKUA 1I8TA 2VZ0A 1K3TA 1HYEA 3JYNA 4OGWA 1XEAA 5F3RA 1ZUD1 3ZNPA 4IDDA 3M1LA 4DQXA 4E33A 1HXHA 4M54A 3ETDA 3H2ZA 5DBFA 4GWKA 5CEEA 5JLAA 1DJQA 3NUGA 1KVUA 4S3MA 2EJWA 3HFGA 4MVJP 3PLRA 4NJMA 2W2LA 1J4AA 4E2ZA 2JD0A 1BXGB 5F1KA 4RF2A 1SEPA 2VUUA 1C0PA 1DRVA 1TA4A 3ITDA 2OORA 2GERA 3QJ5A 4KP7A 3ROKA 2JFGA 3JQBC 4XA8A 3TPCA 1FDUA 5A06A 3BHMA 2HO5A 4YRAA 4CQLA 5A3JA 3V8BA 1NBOA 3ON5A 5B12A 3RAJA 3JQAD 4OHUA 2BGMA 3C1OA 3DZJA 5C7OO 1SAYA 3H6KA 1C3VA 4N5NA 4I1IA 2Q45A 1K0UA 3AK4A 4DYVA 2PK3A 2AMFA 3Q2KA 3QIVA 3VH1A 1W8DA 3AUAA 4R4JA 1R6DA 2PFGA 3ZU4A 5HRUA 3DHNA 2H5LA 3MJEA 1LEHA 4MVJE 2C54A 5CDGA 2GN8A 1VLLA 3Q1LA 3EUWA 1LDGA 3X2EA 4AJKA 3F47A 4Q3EA 2XXJA 4UUOA 3BHIA 3O8QB 1EEHA 3PHJA 3PQFA 4WNCA 4CR6A 1NPYA 4R1SA 2G0TA 4JP3A 1M75A 4J7XA 4CM7A 4Z9XA 4BNZA 3PVZA 4Q3DA 4M86A 1N2SA 2C2YA 4CV0A 1KIFA 3NT4A 4JCOA 3VVBA 4W4TA 3ROMA 1ORRA 4WE3A 3G1TA 4U6SA 1X7HA 1DHTA 3BMNB 1EK5A 1FK8A 1YQGA 1SOVA 1BRMA 5KVVA 4GSLA 4RF5A 1GD1O 1QYDA 4BO7A 2VCYA 3ROQA 2OOSA 4RQUA 1H9AA 1QKIA 3B20A 1QMGA 2WD7B 1VM6A 4CODB 5CPFA 3DL2A 4TSKA 4U0KA 4UVGA 1P1HA 3O4RA 2AQHA 1R4MB 3Q3CA 4FD3A 4MDHA 5T57A 4HNGA 2B37A 4URFA 2GN9A 4IJKA 2PY6A 1H94A 1PR3A 2IXAA 4L73A 3RBXA 3AUTA 3MWDB 2NADA 7ADHA 3BMNA 2DTEA 5EN4A 4J9UE 1I3LA 5L53A 1R15A 4BQRA 4YJFA 1WP4A 5AXAA 1ZSNA 4K9DA 4CMAA 5KIAA 5JSFA 4JNKA 2X5OA 4YEDA 2ZQYA 3S2FA 2Q2QA 4ALLA 2WD8A 1JLLA 2JHGA 3TDKA 4CLOB 4XEHA 3DBHB 4MKXA 4W7HA 3WMWA 1HE2A 3GUYA 3AI1A 4KQWA 4II2A 2BGKA 2UYYA 1CETA 1FDTA 3BMCA 1ZXBA 2NACA 1I36A 4NU5A 4PN3A 5THQA 3TF5A 2WJPA 4DRYA 4TKMA 1XCBA 3NGXA 3PDJA 4JN6B 3IP1A 4FN4A 1ZMTA 1EDOA 1U8FO 4LMPA 4D44A 4XYMA 1BDBA 3UW3A 3KYDB 1PSDA 3LF2A 4GQAA 3ZHZA 1FJHA 2EXXA 2I3GA 1GPJA 4XR4A 2H6EA 2B4QA 5HA5A 3TZHA 3VPGA 4CR7A 1U3VA 1V3TA 4J1QA 1B26A 3D0OA 2V7PA 1JVSA 5JDCC 5T67A 3SLKA 5JAZA 1EE9A 5ENVA 2ZK7A 1P1RA 3E03A 1JN0A 3STHA 1QP8A 1WAMA 3F6YA 4RLHA 3WMXA 4K6FA 1B0AA 2FOIA 4UAGA 4BO1A 1NQOA 4FFOA 4KTVE 4BNNA 5I9LA 1TT5B 3LLSA 3BXXA 3INTA 3PDUA 1HSOA 1YXMA 4TWRA 3ASUA 1HKUA 1N7HA 4R54A 1RM3A 1VJ1A 3PK0A 4J0FA 5TRTA 1JKFA 3ZU5A 4F6LA 1R4NB 3F4LA 4ZJUA 1RM5A 1IPEA 3ZWOA 5T6BA 1RPNA 4M49A 2J6IA 1YGYA 1HDXA 1Z75A 2A35A 5LC1A 3VH4A 5K0ZA 1B3RA 3H9JA 5A9RA 5HS6A 4KOAA 5DNAA 3JQ7B 4XYBA 1T1SA 3I9JA 3NKLA 3NTRA 3ZNNA 4JJFA 5T5QA 3SVTA 4H16A 4XQEA 4E5MA 5BSHA 4HUJA 2J5QA 1T1RA 3HHPA 2OBYA 4ITUA 2UDPA 2NLOA 5MGBA 1LLQA 4DXHA 4WKGA 3CKYA 3GK3A 2I99A 1YO6A 4XX0A 5L51A 1E6EA 3JQ8B 3VTFA 4OAQA 1A71A 1VL0A 4BGEA 4NZ9A 3ZV5A 4FOSA 5BT9A 6LDHA 3GFBA 2Y99A 4PG7A 2I9PA 3WBFA 3HB4X 2YYYA 4BO6A 2CVOA 1EQ2A 2FZWA 1T26A 3S1LA 5JYDA 2AHRA 3VC7A 2EKPA 1J6UA 1P33A 2VWHA 4CMCA 2VHYA 4FJ1A 2PD6A 4RORA 2ZTVA 3OIDA 4M87A 4AVYA 3IS3A 4FFNA 3WFIA 1NASA 3KO8A 1U5AA 1T24A 4KUEA 2O2SA 4XB2A 4ZQHA 4HWKA 2PV7A 4IGEA 4BO9A 8ADHA 3C85A 5AVOA 3VPSA 4ZRMA 4LN1A 2EGHA 3JYLA 4NH4A 2Y66A 3WS7A 4W82A 1E7YA 5KJEA 4CM9A 4RL6A 5F5LA 1PL6A 2AG5A 1NX6A 4XDZA 3QP9A 4WJZA 1XHLA 1Z74A 2VZ8A 3WYEA 1HTBA 3U09A 3AOEA 3OSUA 4NIMA 1GUYA 2VT2A 1PQUA 5CDUA 1D3AA 3WGIA 1ADFA 4LVCA 4WUVA 1MGOA 4CLXA 5GY7A 1QYCA 5A03A 5CPBA 4RPHA 1E3JA 3CE6A 3GEDA 4HFMA 3DHEA 2YHIB 3HN7A 3VZQA 2UUOA 4WCFA 1OZAA 4CUKA 1P31A 4TRMA 2C2XA 5L45A 1DC6A 1MG0A 1E1LA 1YVEI 3LYLA 2LDXA 3PYLA 4IGFA 4D3SA 4XRGA 1A72A 3JD2A 3S2GA 3RCBA 3TRIA 2NWQA 2HMSA 1CERA 1Y8QA 2H1SA 1OMOA 4LRSB 1HLDA 2EF1A 1P77A 5TLSA 3L07A 1HYGA 2IRWA 4QXMA 1LDMA 4PVDA 5TJ9A 4BGVA 3GT0A 1F0YA 3DZIA 1ZNQO 2B5VA 1QLJA 2O2YA 2PZMA 4HKTA 4J3FA 4B4OA 5J23A 2X6TA 1UP7A 3E18A 2DT5A 3ZWBA 3GPIA 3QLJA 4ND3A 3DHYA 2BELA 4M8SA 3U49A 1OI7A 1DAOA 2Q1TA 2VN8A 3F46A 4HX5A 3RC2A 3KETA 3GH3A 2YHUA 3BYZA 4GGOA 2I5PO 4BGIA 9LDTA 1UUFA 2Q3EA 2X0NA 4GLOA 1KEUA 1PTJA 3COSA 1D7OA 3UFXA 4EJ6A 3FD8A 4JJIA 1AHHA 5JMWA 5L4LA 3TFOA 2X8LA 4ZQGA 3ZHXA 4J6FA 2YQ5A 4NFHA 3HZZA 4CR8A 3GQVA 4B7CA 2OO5A 4BNIA 3EVTA 2C5EA 2AW5A 3PFWO 1BVRA 4KZPA 2TMGA 3LC7O 4ALNA 2X0RA 1I3MA 1D1SA 3CSDA 4F45A 3E9MA 1ZXLA 1RYEA 4IZHA 1SCUA 2BI8A 3DC2A 4DWVA 4RO0A 1KVTA 3NDRA 4IS2A 5A9TA 3U3XA 1E3WA 1PS8A 4RPJA 4B7XA 5KVCA 3RWBA 2PLAA 4PRKA 1QV7A 4B4WA 1ULSA 3O9ZA 2EERA 4TRNA 2HDHA 2IZ1A 3WSWA 1WDLA 1LSOA 4N7RA 3UUWA 2VRBA 5CDYA 4R16A 3P7MA 2Y1CA 1LDYA 1ZO8A 2DQ4A 2R00A 3RC9A 1J49A 1LI4A 3I9MA 3IOYA 1PJ4A 2YV1A 3OQ6A 4WLNA 2E82A 1NNUA 3AM4A 4L4RA 4LISA 2Z95A 1KC1A 2VWPA 4R41A 2DUWA 4FS3A 3B1KA 3I9KA 1W73A 1XSEA 2B5WA 3RI3A 3I23A 3KHUA 1Y9AA 4QEDA 1HEUA 1PR9A 2Z1NA 5JY1A 4BOYA 4FDAA 3QY9A 3RBVA 3RSHA 5KVQA 2GO1A 3WNQA 2X0IA 3RUFA 3SXPA 4ZD6A 2X9VA 3BAZA 2DBZA 1GY8A 1N1EA 3UH1A 4E5NA 1NAIA 3A14A 4PLFA 2ZTLA 2VWQA 1PZHA 2DBQA 1XU9A 3GA0A 1NAHA 4NHEA 4UVDA 4Z9FA 5HWSA 2JAHA 4CM8A 2PZJA 4IINA 5TSDA 4AJOA 3RVDA 3DZGA 1PGNA 2GF2A 4ALMA 3SC6A 1AXEA 3MJCA 3WGTA 4RVFA 2QRKA 1DBVO 1P1JA 3G0OA 5T8KC 3WLEA 4Q39A 3FTNA 4FCCA 4UUPA 1B3BA 1SBYA 5JCJD 3IC5A 3NEPX 1I0ZA 4E30A 2VYND 3OECA 4IPTA 3AJRA 4X54A 1IE3A 1WDKA 2J8ZA 1VSUA 2GN6A 1O9BA 3OQ1A 5IXYA 1WPQA 1NHGA 3QWBA 4XGKA 4GVLA 4ZICA 4YRDA 2Q4EA 5JC1A 1SB8A 2HMWA 1UDBA 4KWHA 1FMCA 4YT5A 3S8MA 3LDHA 5CEFA 1R0SA 1PWXA 3QA9A 4L4XA 4XKJA 5I7SA 4I5GA 1EE2A 2CNBA 2Q1SA 2RCYA 4XYGA 3BMQA 4IQGA 3DOJA 1T4BA 4LK3A 4BO2A 4F46A 1V3UA 4XD2A 4A03A 5TF4A 1ID1A 2QG4A 4IQ0A 4TMFA 4L8VA 1YOVB 4XGIA 2EIHA 5TT1A 2PTGA 4XQ9A 4BKRA 2I67A 2NTVA 4GBJA 5G4KB 3GHYA 3W4KA 1BSVA 1RM0A 2Y05A 1WZIA 4F3YA 4GPD1 3HG7A 4HADA 5K9ZA 3DDNA 4RVSA 1DLIA 3ITKA 4RF3A 5DULA 3KB6A 1RWBA 2JCVA 3QWAA 3PRJA 2BLLA 3VH2A 3F5SA 4KTTE 2Q99A 4IY1A 4B3IA 1WVGA 3RROA 2X58A 1R0KA 3NT5A 5ITVA 1HLPA 5K6AA 1AHIA 1P44A 2E6UX 3KBOA 2DBRA 1ULUA 2FP4A 3D1LA 2NU7A 3V2GA 1PZFA 4MP6A 2ZQZA 4DIBA 5CP8A 3S2IA 2VQ3A 3IUSA 4P8RA 3LZ6A 3GPDG 5G4KA 3DOOA 4CM9D 3MZ0A 4EITA 4YCAA 1LRLA 5ILGA 3V2HA 1EUZA 1U2DA 3GG9A 1GZ6A 3UCEA 4MVJA 3RFXA 5TQVA 3EY4A 3JQCA 1PGPA 5DOZA 2BD0A 3WIEA 1ISIA 3AY3A 4Y98A 1DPGA 2RH8A 2Y1DA 5TJHA 5CDTA 4E32A 1BMDA 1NVMB 3AI3A 2FSVA 4ALJA 5JFOA 3EMKA 2DPHA 4E31A 5TNXA 1YL5A 4R1UA 4A5OA 3RASA 2P4HX 2J3HA 4PVCA 2W8ZA 4RV9A 1CIVA 3PHGA 3FR8A 1E1NA 1BW9B 4GGPA 4UEKA 3S55A 3ZV3A 2I65A 1PZGA 1LLDA 3OF2A 2FWMX 4O6VA 4CMKA 1H5QA 4ZA2A 1SPXA 5JDIC 4WPGA 2VT3A 3LQFA 3HNPA 4KWIA 5DCWA 3AWDA 1XDWA 4DBZA 4FGWA 1IOLA 3D4NA 2BGLA 5CG2A 3TJRA 3A9WA 5IN4A 1ONPA 3QE3A 1TXGA 1KETA 3KM0A 5JAQA 1K6JA 3O38A 5F1PA 4J4TA 1GUFA 3UOGA 3A4VA 3JQ9A 4RZHA 2PZLA 4YYZA 5CFZA 2J5RA 1L7EA 4HY3A 4WOKA 4E5PA 1QYXA 1VJ0A 3Q9UA 5C3MA 4ZQEA 1Y7TA 3FF4A 3I52A 3W8DA 4YT2A 4A0SA 3H9QA 3M2PA 3JQFC 4L76A 4GKBA 4NDNE 4HFRA 4NJMB 4ZN6A 3Q9NA 1S6YA 2V6BA 2GDZA 4G2NA 3K9QO 1I33A 2PH3A 2XF8A 4U6QA 3IKTA 4IS3A 1MXFA 2DTXA 4W9NC 3RUDA 4CLDA 3B1JA 1MP0A 2QRJA 1GCOA 2B4TO 3KYBA 4CQLB 1T2CA 4UUMA 1H93A 2WSBA 4PLYA 3LT4A 5FYDA 2EG9A 2ZYAA 1SZJG 2HRZA 3N74A 1L7DA 3IDSA 3OIFA 1QR6A 4I9HA 4QX6A 4RF4A 1ZCJA 4OXNA 4GMGA 5IF3A 1U3UA 3DAPA 2HJRA 1Z6ZA 4CQMB 2FHSA 5I9NA 3D4PA 3BA1A 3PI7A 4Z3DA 4XYLA 3RJ5A 4EJMA 1YDWA 3GF4A 1XG5A 1Q0LA 1F8FA 3MJVA 4DGSA 4OOFA 5L4NA 3AOGA 4HXYA 4UUNA 3GLQA 1U7TA 4J4BA 4UVHA 3F3SA 5EPOA 2Q4BA 4WLUA 2VUSA 1H6AA 2WM3A 3PZRA 4CMEA 4R01A 1FXSA 3WR5A 3ORFA 1RYDA 3ASVA 2FMUA 4PIVA 3CZRA 1CDOA 4KMSA 1MB4A 4FFLA 1XYGA 1UXHA 4C7KA 3UAGA 4RPKA 2CDCA 4BO3A 4PG5A 1O5IA 2PZKA 4J9VA 4XIYA 4BUCA 4CQMA 1BDMA 1T2AA 3OEWA 1B14A 5DBIA 2PH5A 2JFFA 4M55A 4YR9A 2G82A 1T2FA 1GEEA 4CJXA 3CZMA 3U4IA 5IZCA 1O6ZA 3QVOA 1GADO 3SBOA 3GN2A 2C07A 3QQPA 2OZPA 5JW6A 4F6CA 1B15A 1G6KA 3V2UA 2VHWA 1O89A 2C5AA 4YAIA 2O48X 2P5YA 4PFJA 3G1UA 1JU9A 1WW8A 3N7UA 2D4AA 4CPDA 3JD0A 3WTBA 2WYUA 4DL9A 3GG2A 4G5HA 4P4LA 4L9RA 3BMOA 4IDGA 1ZZEA 4PGFA 3VPXA 3I9LA 4AL4A 3HB5X 5FWNA 4WEOA 5B4VA 3D64A 4YJFB 1A5ZA 1KEPA 4IM7A 4LSMA 3E6AA 1LA2A 2AQIA 2VTEA 5G2OA 3WGYA 1V3VA 1F12A 1GCUA 1ISGA 3QVSA 1XA0A 1V6AA 3ZZNA 1O94A 2ZYDA 4BL5A 2QX7A 3GZNA 1QXSA 3ZWAA 1R12A 1JWAB 3MWEB 3PFFA 1DIAA 4O1MA 1ZSYA 3BMCB 5JO9A 3UHAA 3PHHA 2X1HA 5U4QA 1K6IA 3LU1A 4YTEA 3FTPA 4A2CA 5IXSA 3ANMA 1LQUA 3FCOA 4U8GA 5C7IO 1AUPA 3FWZA 4YB8A 3JQDA 2IODA 5IN5A 4O59O 3JQGA 4NU6A 5L95A 2HU2A 3OJEA 5CG1A 3FI9A 3OHSX 4DTIA 5CEJA 4JIGA 3ADPA 2B35A 4PG8A 5L7TA 5DT9A 1DRUA 3U4DA 3Q2IA 3GDGA 3PEFA 4YRBA 1LXCA 1TEHA 4R5MA 3W4IA 1EBUA 1MFPA 4DPLA 4E4YA 2Y1GA 3HUDA 4MP3A 3DR3A 4EDFA 5IG2A 2A94A 1XLTA 2OL4A 1I24A 4GI2A 1EBFA 5CAEA 1KYQA 1YB4A 2ZKLA 1TT7A 2GR9A 4PZDA 1UDCA 2PR2A 3DWFA 1VL6A 4CMGA 3E48A 4CUZA 3PPIA 1Y9EA 2EP7A 4CLRA 3OJFA 1P1KA 1BVUA 3DXFA 4YDRA 1XELA 2Q1WA 3ONEA 3ZW8A 5L40A 4XIJA 3WLFA 3AY7A 1CF2O 3ENNA 4DA9A 3QWHA 1O8CA 3TOXA 1JVBA 3LLVA 3PWZA 3NJ8A 1V35A 4CMBA 3L6EA 4YJGA 1MLDA 3KTDA 1PJQA 1UH5A 1WDMA 4ND5A 1AE1A 2VNAA 5BNFA 2VRCD 4IXTA 3WWZA 3K2EA 4WLFA 3VOSA 2VYVD 1F8GA 5JYEA 5KJFA 1X14A 3E82A 1U8XX 4YWJA 1ZH8A 4BO8A 2V6GA 2PGLA 1E0DA 3QW2A 5GMOA 2FZEA 1VL8A 1EQUA 4IBOA 4BVAA 4NK4A 3U4HA 1C14A 4I9UA 3G17A 1VKNA 1P1FA 3LC1O 3ZGYA 1EMDA 2DU8A 5CHEA 2J3KA 2YW9A 4J90A 2JL1A 3GGOA 2H9IA 3K31A 3NX4A 1PJCA 1R0LA 4FW8A 3QRWA 3E9QA 2Q46A 3SX2A 3HE3A 4ID9A 3WYCA 1V8BA 4K1LA 1DDOA 1K2WA 1QSGA 1Y5MA 3U4CA 4H15A 1GV1A 3GDOA 1UXGA 4TZKA 3WGGA 5BQFA 2GCGA 3GRPA 1IY8A 1PWZA 1J5PA 1XKQA 5JY6A 4W7IA 4BHTA 2IEBA 4R1NA 1YDEA 3JCZA 5JC8A 2FR8A 1GZ4A 3VVCA 1ZBQA 4CM1A 5IDXA 3IKVA 2BF7A 2G76A 2OGUA 3EGOA 1IULA 1NFQA 2BFPA 3CIFA 4J0EA 3DTYA 3PYMA 1DAPA 4ALIA 4MP8A 3RQSA 4Q9NA 1YH3A 1CRWG 5DCYA 3OETA 3CUKA 2O3QA 4IDFA 4OKIA 2VHZA 2W4QA 1FDSA 3PYXA 2PGDA 1UAGA 1E7WA 3RFTA 2ET6A 2H63A 4QO7A 1JTVA 4WCFB 4AJIA 5AYVA 5C5IA 5EERA 5H81A 2O3TA 1LRKA 2D5AA 1NPDA 4EBFA 1Y8QB 3PLNA 3W4JA 3DMTA 5BSEA 3WICA 5KTKA 1I30A 5GZ6A 5U1PA 3ANLA 5TIIA 4GSKA 3PWKA 3ZI0A 1V9LA 1ENPA 3FRJA 3GFGA 3CINA 3TZKA 5A5FA 3GC6A 4TZTA 4J7CA 5I7VA 1GPDG 1LDBA 3ANNA 1LQTA 1WMAA 3P2OA 1LBEA 1DB3A 2QRLA 4O63O 5DZSA 1U4SA 3WQQA 4WEQA 3H5AA 1ZEMA 4L75A 3FHLA 1EK6A 5KKCA 4WASA 3DO5A 5JNLA 3AW9A 3BTUA 4AJPA 2JCXA 1I5RA 1SO8A 4N54A 2EGGA 4XWYA 1H6DA 1GQQA 1FDVA 1Q0HA 3GGGA 5DN9A 2W2LD 1MC5A 3MJ4A 1X1EA 1PJ3A 1SNYA 4GL4A 3VZSA 3WNVA 5IZ4A 3KLPX 5L9AA 5EL0A 2HRBA 3VZPA 1DFGA 2XPCA 4XYEA 3C24A 1LLCA 1UAYA 4I5DA 2VOEA 4IMPA 3N58A 4ILKA 2P91A 4IUYA 3G49A 3HN2A 2NVBA 4H7PA 2ZB7A 3WX0A 1B8UA 4DPMA 5B37A 4LGVA 3M6IA 2G5CA 1HYHA 3CH6A 4QT0A 1GYPA 3IAHA 1SOWA 4YJDA 4CQMD 1VC2A 2J3IA 3WBBA 3U0BA 3FNGA 3A1NA 4JLWA 3RUIA 3TSCA 1YONA 2ZCVA 3K73O 1E3WB 2CSUA 5I7FA 3HADA 3I6IA 4BNMA 4CM6A 3CPSA 3D5QA 5A5EA 4I5EA 2E48A 3JD4A 2I6TA 5C37A 5F21A 4B3JA 5JAIA 3A06A 2GZ3A 4EUEA 1LSJA 3R3SA 1ZK4A 4JXKA 1AN9A 3L4SO 1ENOA 1MX3A 4IMRA 2GGSA 2O3UA 3W8EA 2HCTA 1PZEA 2YQ4A 5AQ1A 4Z0HO 1N5DA 1PQWA 1KEWA 4CM3A 4BNTA 4NG5A 4LVUA 5IDWA 1I01A 4R3WA 1KVRA 3UCXA 3HDHA 2Q1UA 2PD3A 2DLDA 1N1GA 2O4UX 3AUSA 4YT8A 1JWBB 1LLUA 4PZCA 5DBGA 3DBRA 2FRDA 3H2SA 4Y67A 2JD1A 4RQTA 2NUAA 4I8XA 2VUTA 1HRDA 1H2BA 1Z7EA 2D8AA 3DMYA 1P45A 3JD1A 5G0TA 1ONNA 4EUFA 3IUPA 1E7QA 2FY8A 4GMFA 4G65A 4NK5A 4OIMA 1H6BA 3VZRA 3EK2A 1X7GA 1DO8A 1HF3A 1EUDA 4MVJM 4BKQA 1PJ2A 4EGFA 5DCUA 2R2GA 3D4OA 2ZB8A 4FJ2A 5FI3A 1M76A 3GZ4A 1EDZA 1VI2A 4OSPA 3VPHA 3IJRA 1ZMOA 5TC4A 3HDYA 4CM8B 4ZHSA 1Q1NA 4NFYA 4L0QA 1E77A 3K8ZA 1GYQA 2GZ2A 3TOZA 1G1AA 2NM0A 3L4BA 2IZ0A 4AJ1A 1P0CA 3TL3A 1CQIA 6ADHA 4XQCA 3P19A 1YE3A 4BNYA 3MCVA 3ZHBA 3E9NA 4J49A 3L0DA 3I6QA 1U4OA 2D2IA 5F5NA 2HAEA 1JA9A 4MKZA 1CEQA 2AA3A 1C1DA 5G0WA 3JQAA 1S7CA 3KYCB 3UN1A 2X0JA 2O7QA 5I8WA 2P68A 4NBWA 1HDGO 4MIOA 1HDRA 2BFOA 3DAGA 1NR7A 4DMMA 4GAEA 2YJZA 2NVWA 3AFNA 3M1AA 1C0KA 5JBIA 1F14A 1QYVA 1D4FA 1GUZA 1YBMA 4MVJI 1UZLA 3WSVA 1TI7A 4IXWA 5G0SA 3ZNOA 1SEVA 1NQTA 4M1QA 1JKJA 1DHRA 3CMMA 3NTOA 3O26A 2DM6A 4QECA 5HM8A 1PGJA 2HK9A 4IIUA 1E3IA 4GX1A 3AOEC 1OBFO 3BMQB 3WJ7A 1ZEJA 2GPTA 5KJCA 2HMVA 2EW2A 4BO5A 5GZ1A 2PWZA 3P5SA 4BIIA 1V0JA 2OUIA 4A10A 3PZBA 3RUAA 3FNFA 3HSKA 3WWYA 3K5PA 4NFSA 1NWCA 3DEYX 3VPFA 4AJHA 2D5CA 2NVUA 3EAGA 1X7DA 3KYCA 1E5LA 1E92A 1VSVA 4WCFC 4BNGA 1P74A 3ZU3A 4WOJA 4YQYA 1VE9A 3NTQA 2BH9A 3JYPA 2W2KA 2OP0A 3K6JA 4MJLA 4YAJA 4J2HA 1HWYA 1IZ9A 1NQ5A 1ZK2A 3FNEA 4QFCA 4DVJA 2HMUA 4K6CA 4DLLA 1X15A 4CM5A 3KXDA 3H9EO 3PP8A 5EESA 4OMUA 1XQ6A 2YZ7A 3C1TA 3ZV6A 1UXIA 2I3AA 3E5MA 2HMTA 3DQPA 1XGKA 1YL6A 2POQX 1WLYA 2UUPA 3GMSA 1ZK0A 3K2BA 3H65A 4ZGWA 2HLPA 2YDYA 1ADCA 4LCEA 4E5YA 4IJWA 3ZWPA 4J1NA 4BMNA 4K26A 1WZEA 3QVXA 4XR9A 1ZKMA 3W1VA 1Z73A 2Y0EA 3DB2A 1ZJZA 2EEZA 4B7UA 4J1SA 2GASA 2VTDA 3ZWCA 1GU7A 4D0RA 1YS4A 4R1TA 1Z7BA 3PJGA 4CV2A 3JQBA 4L4SA 1RKXA 4YAKA 2X9NA 3R6DA 3ZDFA 1AXGA 1QRRA 4MOWA 1XR3A 3Q0EA 2DTDA 5TT0A 5JPIA 4WNIA 1UR5A 2EKQA 3G79A 1CJCA 3UGKA 2GLXA 1U28A 1ZK1A 2XXBA 1ARZA 4FIZA 2C0CA 3DAFA 3TZQA 5IDYA 1IL0A 2OFPA 3EZLA 4LSWA 1OC2A 2QHXA 1HDCA 1XQ1A 1PQPA 4HBGA 3PIDA 1NPTO 4E5KA 5HS4A 1GQYA 3FNHA 1DXYA 3DBLB 4FR5A 5I8ZA 4BKPA 1RJWA 4R51A 3DBVO 1X0XA 3R0IA 2Y0CA 1LDEA 1Q0QA 2WTBA 2E37A 1EFKA 3F9IA 1T2EA 1UP4A 3C3XA 5A3VA 1Y8RB 2V65A 3DFZA 3C7DB 1HT0A 1P1IA 3CTMA 3RUCA 3RIHA 3TQHA 3MOGA 2EP5A 1BG6A 2I76A 2WMDA 4FBGA 4D7AA 1DFIA 4RVDA 5DDIP 1ZSVA 4S1VA 5F1OA 3UCFA 4EW6A 2V6MA 3L6OO 4YJHA 2F1KA 5L7YA 3RFVA 1Q7CA 2R00C 4LMRA 4MIEA 3FPCA 2W98A 4IDEA 1I2BA 3GR6A 3GVPA 1LSSA 4DIFA 3I3OA 4DREA 3D7LA 2GRAA 1YJ8A 4LCJA 3DBLA 4ZQFA 4J4HA 3FBTA 1YKFA 4FPXA 2W90A 4BNFA 5LDHA 1M6WA 1PL7A 3PWSA 3V1YA 2Y68A 4EUHA 2Y1EA 4NBTA 5ADHA 3ICCA 4R3NA 4A27A 2AE2A 1Y8RA 2RHCA 2PA3A 2NQ8A 1OFGA 2GD1O 4HFJA 4RLSA 1KEVA 4DLBA 3I4FA 5COAA 4INAA 3DZHA 1IPFA 2HQ1A 4R5HA 2WDZA 5G4LA 2WE7A 2PD4A 4ND4A 4E6PA 4BO4A 2QYSA 4OXYA 1A4UA 2FPPA 4ZU3A 4PLCA 1I2ZA 3V5NA 1K6XA 2QZZA 2CDBA 4OXKA 1XIVA 2QZ9A 4NMHA 2EWMA 1IUKA 5DP1A 4JP2A 5H83A 3ZWXA 2X22A 3FN4A 1E7MA 5FEUA 1B2LA 2B4RO 3GDFA 3GMDA 2GUGA 4O5OA 5KKAA 1Y1PA 3RD5A 3UKOA 1MFZA 2JKVA 2X7HA 4BNJA 4OQYA 5THKA 4FGSA 2C7VA 3RU7A 1NVTA 4BB5A 4ND1A 4JBIA 4CMIA 4JGBA 3DOCA 3W6UA 3GAZA 1PJSA 2Y1FA 5AOVA 3OQBA 5L3ZA 3T7EA 5A05A 5A04A 1JAXA 2JD2A 3QV1A 3WYBA 3GEGA 1NWHA 4UEJA 9LDBA 1DIHA 1DFHA 4H3VA 3T4EA 1EUCA 2TMDA 5JDCA 4ZVVA 4U5QA 2VNSA 3AUUA 4JBGA 2QYTA 4QO8A 3VKVA 3ZWNA 5COQA 4BNXA 5G0UA 4NR0A 2A4KA 1PEDA 3L9WA 4JX8A 4DBVO 4OQZA 2IZZA 1X13A 4RVUA 4HV4A 3FPLA 1TVEA 3UF0A 3R1IA 3SJ7A 4IIVA 3W6ZA 7MDHA 1A9YA 2EJVA 2ZCUA 1KVSA 4N5LA 3BIOA 5FFFA 3BMOB 5ER9A 4OOEA 1N9GA 2BFAA 5LDGA 4MVJH 1F06A 1HL3A 3MTJA 5A9SA 4WK6A 3WOHA 1WMBA 3OJOA 3F1LA 4Z9YA 2CUKA 1ADBA 4QSMA 3INRA 1FDWA 5JAMA 1NTOA 3ICPA 5K6AC 3GVCA 3EHEA 4BNWA 4TRRA 1YBAA 4OYRA 3C8MA 4J2OA 3GZNB 3ZWVA 3ZV4A 1HE3A 2ZB4A 3WGOA 2UV8A 3DONA 5ENDA 3QWFA 4J7UA 2VOJA 4XQGA 2BKAA 1Z82A 5B4TA 1EFLA 2PKQP 4GVXA 4QTZA 4IZIA 1LX6A 1LUAA 3PQEA 2EKLA 3JQGB 1BXGA 3TZ6A 2VHVA 4GX5A 2ZTUA 1BTOA 1U1IA 3HQ4O 4QFDA 2O50A 2CVZA 2G17A 1ISFA 4UEOA 1PJTA 2AQKA 3MEQA 3ETEA 1I10A 3L77A 3IIEA 3F5QA 1CYDA 3LC2O 4BMVA 4I5FA 2CMDA 1DIRA 1YJQA 2NV6A 5TS3A 1NXQA 3C7CB 3GOHA 1N8KA 3AU9A 3LT2A 4NNJA 3D5TA 1E6WA 2D0IA 5KCZA 3MJSA 2WWRA 4PG6A 3GAFA 1MXHA 5IJZA 3JQ6A 4RCVA 5JO0A 1LC0A 3ZN2A 2HK7A 3PHLA 1HE4A 2C29D 3O03A 4TROA 2FR1A 3OM9A 2CFCA 5EIOA 4CLRB 4KDFA 2HKIA 2O7SA 3IMFA 1B8VA 3LT0A 1CWUA 2BI7A 4II3A 4Q3CA 4GLLA 2EHDA 4J1TA 2NTJA 4Q3BA 1XWFA 1ZW1A 3F1KA 2X5JO 4D0SA 2P5UA 3O8QA 1AGNA 1U3WA 1ZVMA 4YJGB 2O3RA 1X0VA 2YUTA 1M66A 1E3SA 2UAGA 2VZ9A 3D3WB 3NV9A 1NFFA 4IQ8A 4W99A 1EVJA 4DC0A 1KY4A 4Z6KA 5EQDA 3JQ9C 1TLTA 4TRJA 4Q3AA 4FFPA 3X2FA 4AJJA 3WIDA 1JDJA 1E5QA 1UXKA 1N92A 5JCXA 4R9RA 4QQRA 3EDMA 1Z45A 3LT1A 2QW8A 4FB5A 5MDHA 3VH3A 2WD7A 4MO2A 4OL9A 2WYWA 4E2YA 4DQVA 3B6ZA 1BXZA 2O4CA 3IQDB 3MOIA 4OO3A 4R68A 1P3DA 2AEJA 4NQZA 3ST7A 3H8VA 3ULKA 4BMSA 1BWSA 1R4MA 2CY0A 1GL3A 5BSGA 4LW8A 2OBNA 3D3WA 4DQUA 4L74A 4KQXA 4MVJD 2C7GA 4P38A 1Y81A 3UXYA 3OH8A 4B3HA 5KJ1A 3TN7A 1ZJYA 1KY5A 4P4GA 1DC3A 4MVJF 4GWGA 4WLVA 1E1MA 2QIOA 3JV7A 4ZQBA 5KWEA 4OH1A 4YAEA 4CV1A 1LJ8A 4PLPA 4PRLA 3NJ4A 4WCDA 3HFSA 3GNQA 4CLOA 1T4DA 3V1TC 2RHRA 1GR0A 2F00A 1B16A 3DBHA 5L7WA 3I9NA 1HDOA 2V6FA 2YFHA 3FBGA 3VDRA 2ZIZA 5KVSA 4JROA 2DFVA 4IJUA 5JCJA 4R69A 3UVEA 2VYNA 2ZYGA 3RJ9A 4EEZA 5AXDA 2X4GA 3K96A 3TWOA 3KYDA 1F17A 1JKIA 4CMEC 1NFRA 4FSHA 2P4QA 1PS9A 2BFMA 2BMAA 4ESOA 4CLEA 3PJEA 4Q3NA 1OOEA 3T7CA 3L6DA 3TFQA 2YV2A 2Q49A 3K92A 2RIRA 3DZBA 3AY6A 3ZHYA 1UDAA 3PQDA 1P9LA 4YQZA 4ALKA 4B4UA 5LCXA 1TT5A 3GVIA 3UICA 4KDEA 1J0XO 4BQPA 1MA0A 1DOHA 3I4CA 5IZCC 2D1YA 1Y5RA 3KVOA 3C1AA 2HSDA 2IEDA 1R4NA 2DKNA 3OA0A 1ZK3A 1ISMA 1LTHR 2JCYA 4Y6SA 4WLOA 1E7RA 2XOXA 3I5MA 4D42A 2VWGA 4UULA 2GYYA 4PCVA 3INGA 4ZRNA 2YDXA 4EYEA 3H5RA 3NYWA 1BGVA 4JJGA 1FF9A 3JQ7A 4B79A 2VHXA 1YBVA 2Y67A 1U7HA 4QUKA 2D3TA 1ZFNA 1I3NA 1I3KA 3PGXA 4YACA 2WYVA 1LSUA 4IDAA 3RBZA 3KSDO 2C59A 2IE0A 4BV9A 3CXRA 3F4BA 4PLHA 1QYWA 4U7WA 4FFMA 4A26A 1KBZA 3GHHA 2SCUA 2AXQA 1B7GO 1ML3A 2XAAA 3M2TA 5EINA 4E13A 1ISHA 5FF9A 1MV8A 1O95A 3TL2A 1OC4A 1QG6A 3JQ8A 3GVXA 1NM5A 3ENKA 1NQAO 3EYWA 1Y6JA 4DPKA 4ONEA 4RZIA 1ISJA 3EVNA 3LSYA 1K89A 4B8ZA 3V1UA 3PJFA 4YA6A 1YB1A 1R66A 2OMEA 3HJAA 4BKOA 3P2YA 1E3EA 2A9FA 2C20A 3LVFO 4NBUA 3VDQA 5JXWA 5T8KA 1H6CA 4RVHA 3BZUA 1IYZA 3VTZA 2PGJA 4ROSA 1P0FA 2UVDA 4B8WA 1R16A 4J16A 2Z5LA 3MTGA 2ZTMA 3OEYA 5EQFA 4DLAA 3WFJA 4GH5A 5KNLA 2HUNA 4E12A 2P2SA 1ONOA 4XJSA 3E5RA 5C7LO 1YL7A 1I32A 4MKRA 4D3DA 2FR0A 5EMHA 4D45A 4WGGA 4E21A 2JJYA 2QQ5A 2DPGA 1IZ0A 1MUUA 1PGOA 3BTSA 3FR7A 4Y6PA 4TVBA 3RKRA 4CMJA 4GX2A 4XJTA 2NTNA 1YRLA 2NQTA 5EJ2A 1YWGO 2ILTA 3RU9A 4RPLA 4IDBA 4DC1A 4LRTB 4D43A 2J3JA 1EZ4A 2GZ1A 3C7AA 3LK7A 3G3EA 3QVTA 3ROPA 1VPDA 1IHYA 1PGQA 3AU8A 3HDJA 1G0OA 3DBRB 5BNTA 1E7SA 3KOUA 3PTZA 4R9SA 4XB1A 4PLGA 2YHIA 5ER6A 4BNHA 2LDBA 2CZCA 1NHWA 3NGLA 3DFUA 5A1TA 3DZKA 4NBVA 3GY0A 3VAZA 4CL8A 3EW7A 4PLVA 1N7GA 2EV9A 4XDYA 4CMHA 1GTMA 3D3EA 2RBEA 3KLMX 1HSZA 1M2WA 2DFDA 3GN1A 2A92A 4Y8VA 4Z0TA 4XCVA 2O3JA 4CM4B 4GKVA 3B1FA 3AFMA 3AM5A 2Q2WA 3IJPA 4E3ZA 1DJNA 1C1XB 2OP1A 4NBRA 4N5MA 4XGNA 3T4XA 4YT4A 3H3FA 1O0SA 2Y93A 1E1KA 1E3LA 4UVEA 2P9EA 4OJNA 5AXBA 4IJVA 3GNSA 5TX7A 2HK8A 4UREA 4PLZA 2NU9A 4O0LA 4Z3KA 3NDJA 1RM4A 2ZB3A 4FOOA 3I9OA 3WTCA 2RH4A 1C1DB 4WLEA 1NVGA 2AQ8A 3JQAB 4OKNA 3BTVA 3EC7A 3U9LA 1QORA 3OJLA 1W0CA 2CD9A 2DC1A 5ICSA 4A73A 5H82A 2DAPA 1A27A 1B8PA 3WB9A 1PU2A 1BHSA 4MVJG 3QHAA 1SC6A 5DP2A 1OAAA 3RUHA 3WDSA 4CM4A 1W4ZA 2PKRA 3ZCXA 2B0JA 2Q2VA 2CVQA 4J91A 4BNUA 1C1XA 3SC4A 4D41A 4EZBA 8LDHA 2WEKA 2D59A 2DBVO 4B4VA 1KERA 2GSDA 3VHRA 1WXDA 4E2XA 1GEGA 5KOIA 1D1TA 1ENZA 2NU6A 5JDIA 2NVUB 2IXBA 1QV6A 3OMLA 5T64A 3U62A 4AG3A 1GAEO 5IAAA 1LNQA 1DC4A 4AICA 5COBA 2W2KB 1KOLA 3JD3A 3JYOA 5TGDA 3RKUA 4BV8A 4EEXA 3ZWMA 1JQBA 1L1FA 3DMTC 4EI2A 1ZIDA 4I9NA 5IFLA 5I9MA 4RDIA 1DRWA 3ETGA 4YXFA 5JE8A 2BHLA 4DMLA 3TZCA 1GFSA 3JQEA 2IYPA 3BHJA 2Y1OA 1R37A 4WECA 4XZ3A 4D3FA 2CDAA 4AJNA 5ICMA 3Q11A 2PNFA 1Q2XA 5HBRA 1WWKA 1DC5A 4NJOA 4OM8A 5DOVA 1KC3A 3W8FA 3H9UA 4RGBA 3JQFA 3KUXA 5B1YA 3R3JA 3ZWWA 2Q50A 4BNLA 1T25A 5BNIA 2X23A 2IYOA 2JFHA 1PL8A 3E1KA 4RDHA 3OFSA 3Q6IA 3H5NA 5JS6A 4AJ4A 2NU8A 2J5KA 5DF1A 4AJ2A 4MIYA 3GUCA 3S2EA 1WNTA 2P9GA 4YAGA 3NRCA 4W9NA 3PIIA 4UVIA 3WQSB 3GVHA 5KJ6A 2RAFA 1A4IA 1HE5A 4TQGA 3TNLA 3MJTA 1EVIA 2NNLD 3A28A 3DTTA 4FC7A 4IDCA 4BS9A 3RUEA 2IDZA 4FC6A 1GDHA 1PS0A 2YV3A 2WE8A 3GGPA 2CF5A 2JAPA 2YY7A 4TKLA 4HNHA 3ONDA 1M6HA
chains in the Genus database with same CATH superfamily
1L5GB 1G3QA 4QPPA 1II8B 4RPGA 3W2EA 4Q16A 5C2JB 1U1GA 4C1BA 4LF4B 2R6JA 3NT2A 3MM4A 3P0IA 4DWOA 3U4MA 1DKPA 2GXUA 1IUNA 2YJ3A 4BQEA 5A4DA 4PYQA 3BL8A 2X3UA 1GZ3A 2PS9A 4E2WA 3H7AA 4F2WA 3C87A 1XU7A 1Z0SA 2CXTA 1NJFA 3IP5A 1Z7YA 3OU2A 4X1KA 2AEMA 1RXSA 2AE1A 3I6YA 4JL6A 3ZIAD 5AI5A 3UM9A 2QL7A 5I7EA 3KV3O 2R68A 1FIUA 2ROQA 4FSXA 2HPZA 1SB9A 4IH4A 5LJLA 3QSGA 1W59A 5AOCA 5GONB 2I66A 4MVYA 5FULA 1D0IA 1PIWA 3HWRA 2XGGA 4AQ7A 5LD2C 4ZAFA 1MB9A 2VXOA 1G2PA 3LF1A 4ND2A 5M2QA 2EQAA 1G63A 2J32A 1Q1ZA 3H4VA 3LPDA 4MXDA 4I6GA 1GV0A 1YI0A 5CFNA 1L7BA 1OXSC 2QM8A 2ZPAA 2AC4A 3D0KA 3KWJA 1KDPA 3EGIA 4IV0A 3IKJA 3TRJA 2HIGA 3RAFC 3ADOA 1RI4A 2QN1A 1OBCA 2FN7A 4HAZA 2ZSEA 4JSRA 3N39C 2JCGA 1CQJA 3FZQA 5BUZA 1A7KA 5AUNB 2DPMA 1H2RS 2X5KO 1MC4A 1HT2E 3IL2A 3VMMA 5BR7A 1T5TA 2X8JB 3B8HA 1TUGA 2I7VA 4C2TA 4NNPA 1NJSA 4EMTA 3WXBA 1YOVA 3EVCA 1E6UA 2OOKA 3ETLA 1XZIA 2VJPA 4E0BA 3AXTA 4M89A 3UUEA 5SZJA 1T2DA 4HP8A 5ES3A 2QJFA 3EG5A 4JI4B 4N18A 2CE7A 4IQ4A 4QBKA 1HDZA 4QRDA 3IVAA 3K9WA 4CIBA 3U5TA 2X86A 4WY2A 1VSTA 4KGXA 1J42A 3FTEA 2B2XA 4DG8A 1VJTA 1U9YA 2CXHA 5FOVA 3H04A 5G0VA 1BCRB 2D4HA 2GD2A 2XJ9A 4FINA 4A8JA 3KWMA 3PKJA 3GPCA 3IP3A 5BVGA 3JZIA 3QWIA 3IPRA 1N5IA 4NQRA 4F2HA 3I5YA 2QVBA 1MENA 5CM8B 4CKCB 2EFEB 5FI5A 1WE2A 2Q5IA 3QLUA 4FIDA 3NAGA 3RVKA 5EC8A 2ORED 2CXQA 3OTIA 4C76A 2WJ3A 2OCXA 4X71A 2NAFA 3N7AA 1C41A 1H9BA 1OYYA 4GYWA 4C7JA 5K0FA 3OY7A 1UZNA 1NSYA 1WXFA 4TWZA 3G5MA 2YWXA 4PWZA 3B70A 4FJ0A 2QSZA 4QJ4A 4K28A 3K15A 2QEQA 3L0ZA 4HFNA 2MTBA 1E18A 1XJQA 1NMEA 5FWYB 3K9BA 3PC3A 3OP4A 3VNQA 1A7AA 1NKSA 1LY1A 1W25A 5A7HA 5LWQA 1D8AA 1YB5A 1JIXA 2OBMA 2C99A 2G1UA 3DKRA 4P5EA 4UHHA 3SM3A 1ABBA 1GZUA 4BYGA 1N6IA 2AV6A 2F62A 1JXQA 3NAMA 3WGLA 4W6ZA 3WG9A 1E2IA 3MC1A 1A7UA 1XF1A 4XSGA 1J2RA 5ELMA 4O4HA 5CYGA 2I8CA 2VYCA 1TM2A 1K6MA 3WV5A 2EKDA 4RH3A 2ZIXB 1PG0A 2GHQA 1Y4DE 4FR2A 1SXPA 3K6SB 1EEXB 2EFGA 3ZLBA 4OQMA 5DYWA 1MNQA 4US2R 1WIWA 4C6TB 3OBBA 3TI7A 3HA5A 1MVNA 3W9UA 3DXZA 3NH9A 4C6HA 4BV3A 2XJ4A 1BW9A 2XUJA 1R0CA 3C7KA 1GQ2A 1C0IA 3LDAA 1YS7A 2B83A 1GL6A 4RWZA 3FOFC 2WJ4A 1NW3A 1XCPA 1O54A 3LKBA 1T8SA 3OZEA 3PXXA 4Z53A 4Q9AA 4MUBA 2H2DA 1QH8A 1G5HA 2QJRA 3ILHA 1JX6A 2I2BA 3QELA 1ZHFA 3ICOA 3SDSA 2CF6A 2WWHA 4QA9A 4HL6A 4MJXA 5DU2A 4AUKA 1A9ZA 1NR1A 1RADA 3TD6A 4C2AA 4TSFD 4BGUA 1WMEA 1XOIA 3V8EA 3FJOA 2P9CA 5ALGA 5IXJA 4ZVKA 3F9CA 2E49A 1XZFA 3EZ2A 4WW0A 3BGOS 1WF3A 1T3TA 2IF2A 2IIVA 2L42A 1FLAA 1U3TA 3OX3A 5ED0A 4RETA 3HVUA 2J5XA 4EFDA 3CUTA 1QLHA 4YRGA 5CB4A 4QPJC 4DUGA 4MWEA 1VKOA 4C5AA 1CNFA 3KOOA 1TCBA 2VAWA 2QUAA 2VPWA 4XRRA 3JYQA 3LBFA 4BFLA 3L1IA 3L9XA 3PQ6A 1NYTA 3SZGA 1G5QA 2ZSKA 3JSXA 3KG2A 5KYYA 1KTVA 2QQEA 4G4SO 4GXRA 2QUHA 4OGWA 1F8UA 1K3TA 4BKUA 4IDHA 1NXTA 2FFHA 4A9AA 4IHQA 1JIIA 1QMPA 3M1LA 3G0CA 3KPJA 4P3OA 1HXHA 1I0IA 4M54A 2P4EA 3H2ZA 1BJKA 1YZFA 5CEEA 2VHUA 4IMJB 1EK0A 3IQZA 4G5FA 2I3DA 1KVUA 2QTMA 2XVMA 4G4JA 1CBUA 2PXCA 4MZDA 4N5DA 5GM1A 1V8FA 2JD0A 1E6CA 2JLUA 1Z68A 2XUGA 4JELA 1SEPA 3AYZB 3CX6A 1C0PA 4RF2A 1TA4A 2N0SA 3RGGA 3R9IA 3C4QA 2OORA 1LJLA 1RI5A 1CRQA 4DLNA 2V7GA 3CKLA 4OI2A 2RBKA 1GUDA 1S7GA 4XA8A 4GBGA 4D3XA 5A06A 1NVWQ 1I2DA 2H2HA 2WFAA 1S8OA 3DSRA 4YRAA 1CF4A 4ZP1A 4CQLA 4LYDA 1DAFA 1R8YA 3DR5A 3SI7A 5HRAA 5K20A 4PZ0A 2R6DA 5IARA 5B12A 1SCBA 4LQDA 3RAJA 4YDHB 4RZXA 3A1SA 1ZGCA 4H4CA 1A5TA 1I1OA 1KHHA 2VJDA 3C1OA 1GPH1 2QUBA 1SAYA 1C3VA 1U28C 4N5NA 4I1IA 2Q45A 4A16A 1G20E 4U7GA 4DYVA 3BXOA 1B0ZA 2E4WA 3TM4A 4FOPA 3WP1B 1WZUA 2AMFA 3I0ZA 2UVPB 2DECA 4HC4A 5B1HA 5IMSA 2AKEA 2JIBA 4R4JA 1R6DA 1X7YB 1NVFA 3GL9A 2BEWA 4LWQA 3ZU4A 2MSCB 1A98A 3O0DA 4MJ7A 3IDOA 3S7TA 2PLFA 5IF9A 3AF4A 1LEHA 3MJEA 1VJCA 2C54A 1TM5E 1Q20A 1GLVA 1A88A 2QL9A 1DUVG 1L0BA 2OQVA 2GN8A 4ZOAA 1UAAA 3X2EA 3LPAA 2FCAA 4Q3EA 3K05A 3ZE0B 5IASA 3MTQA 1KMHA 1OWOA 3A25A 3IV6A 3X44A 4QXQA 1T9BA 3B7GA 1Q22A 4CR6A 1PHRA 3RT9A 1SG0A 3KXIA 3QKTA 1P2UA 5B36A 3EIXA 4Z1OA 1ODCA 1P0MA 2C2YA 2WHXA 2ZVPX 4OHFA 4CV0A 5I9NA 3DVSX 1KIFA 5BMVB 3T9AA 1AB5A 1IBCA 1NNI1 2C96A 3GFOA 3G1TA 4HUQA 4WE3A 2O8BB 2PUHA 1TZMA 5I4BA 3H18A 3V4SA 3KPUA 3BMNB 3WLQA 1XRPA 2C9BA 5IC6A 1EDDA 1LI5A 3R6GA 4MGZR 1RYYA 5ELLA 1RZUA 1WVMA 4L3OA 5ALXA 2VCYA 4C6RA 2C94A 4Q1DA 3ADDA 1QMGA 2A30A 1VM6A 3BXEA 4CODB 1XRRA 5JPDA 3CO0S 3BH7A 3U48A 4MVWA 2WAAA 3MD0A 4KQCA 1KO7A 1II9A 2HI0A 2J9FB 2XDQB 4U0KA 1XD8A 5C4GB 3TINA 3K5IA 2IOHA 6YASA 3Q3CA 2BFFA 4FD3A 4M1TA 4MDHA 5T57A 5JAOA 4GYKA 2OCIA 1H69A 1YJBA 2FK7A 3AHGA 3GGSA 3RYFB 3GCGA 4ID3A 2H4FA 3VUEA 4BMDA 5C53B 2H48A 5BMVA 3AV3A 4IHAA 4L73A 3MCAA 3OEED 1C3OB 3AUTA 3M6XA 3RBXA 5K6TA 5JBNA 1JG1A 2XYQA 1UJCA 3CFYA 4LRUA 3BMNA 1J2UA 2DTEA 5EN4A 2X7XA 3TIGA 4DV7B 1M9NA 2REBA 4GIBA 1KP2A 2GFHA 3GV0A 4RKYA 5KIAA 4YQEA 1SKQA 1XPJA 4YRJA 3T7IA 4JNKA 5J2UA 2X5OA 1TAUA 1EIWA 4ALLA 4FFBA 4I55B 3S2FA 1DO2A 2ZYIA 1JJBA 1E62A 1JLLA 3KZ1E 3SQDA 3N2KB 4PXSA 1QH0A 3JU3A 4OQPA 4UU0A 3ND5A 4AF6A 4WN9B 3GWZA 3AL0C 3UWDA 1GLGA 4CTNA 3CA8A 2JAOA 5IBQA 2IELA 2J9FA 3DBHB 4K6HA 4B75A 4G0XA 4D4JA 1PD1A 5AJYA 4DZZA 3AI1A 3GJRA 4NP6A 2IUSA 1M34B 3MWEA 4RTMA 2BGKA 4BRZA 1CETA 2UYYA 3A6LA 1ZXBA 2NACA 4NU5A 3ZCUA 4PN3A 2C8JA 1KKMA 5THQA 2F4VB 4DRYA 4BE7B 4EHDA 3AVXA 1BMFD 4TKMA 1XCBA 1L4HA 3PDJA 1DUIA 3W90A 1BHJA 3FDFA 1SXGA 3PGMA 3FSJX 4I4TA 1VLVA 1ZMTA 4Q1VA 5CFOA 1KZ6A 1U8FO 5LOVF 2QT9A 3WLJA 4MQEA 2D1FA 3RVLA 3ZE6A 2JJ8A 4Y2TA 4HVCA 3LF2A 1RE0A 4S35A 4U4AA 4NV1A 4LY0A 1FJHA 1ZGJA 3A7DA 2I3GA 4H18A 1GPJA 2Z9BA 4LRYA 4QOIA 3VYRB 3ZC3A 2H6EA 2IV7A 4JLUA 1JDVA 1CYEA 1NW9B 4BEVA 2FDCA 1V3TA 4J1QA 4INJA 5JDCC 1JVSA 2QGZA 3PICA 1R0XA 4JDUA 4LQCA 3ZV5A 1P1RA 4EY3A 1JN0A 3STHA 4RLHA 3WMXA 1EUQA 4DG9A 5DLDA 1Y5LA 4LPSA 4UHCA 1L7MA 2FOIA 1K2VN 2W6IA 4UAGA 4WUTA 2V1UA 4FFOA 4BNNA 4M8LA 1UBTS 3QKRA 5TR9A 1U8CB 1CR6A 3H4TA 1FJGB 3BXXA 4ZZ3A 3TOVA 2JGJA 2QQGA 4LF5B 4Q15A 2W37A 1RM3A 1VJ1A 3PK0A 4LE1A 1A2KC 4OHCA 4XW2A 1OLSA 3EFOA 3V2IA 3HKBB 3V7FA 3ZU5A 5HF8A 1VDMA 1JILA 3E2IA 4HBZA 4M88A 2X3FA 5CX1B 4M49A 1YGYA 1Z75A 3KR0A 4UNRA 1AKEA 2D7CA 1XAHA 2V1XA 5LC1A 3AVUA 2CNWD 3SSOA 1VG0B 2Y1KA 4PAOA 4TLAA 2GBPA 3I0MA 4G1CA 5A9RA 2NUBA 3FLAA 5SY9A 4C4AA 2OBBA 4N0QA 3R3ZA 3ME5A 5B7QA 2HHAA 2YMLA 3A3NA 4MS1A 1GJRA 1YOBA 2CCJA 1GO2A 3ELBA 3G2NA 3NTRA 4YUAA 5BPFA 1L5HA 3AF0A 2P0EA 4A6PA 3SVTA 1TGYA 2R4UA 3A05A 2AMJA 3QFCA 4V2UA 3AIIA 3OESA 1SD5A 4L57A 1VIAA 1XMXA 2UDPA 3PHCA 4WH0A 5MGBA 1IQRA 1UJBA 2ZSJA 3N7TA 4NCNA 4KQ1A 5B6JA 2WZBA 4HCJA 4JXJA 4JUBA 2I99A 4C5CA 1YO6A 3VTFA 1PO7A 2ASVA 3RREA 3TQFA 4BGEA 5CX1A 4EG4A 3GFBA 4PG7A 7ABPA 1GG9A 5AKJA 1N0WA 5IDVA 1DPFA 2IPXA 2QMZA 3VJKA 1JJVA 4IFIA 4C9BA 4KAXA 8ATCA 1EQ2A 2FZWA 3QVJA 2ZSUA 3JTEA 1GXSB 2H2FA 3VHLB 2YNMA 2C2BA 1N5LA 2AHRA 3H2JA 4O2AB 1MHTA 3DB1A 5DO9A 2EKPA 3Q8XB 1NVVR 4FYIA 4S24A 3BH0A 1JLRA 1P1CA 4BE9A 3CWQA 4DNFA 4E14A 4M87A 2B1QA 3R40A 4N9QA 2J7PD 3WFIA 1J2TA 1JBEA 3L7LA 1D9ZA 1JJFA 1FNSA 1FU4A 3AY0A 4KUEA 2O2SA 2DERA 1UPAA 3MW8A 2PV7A 4EAQA 1U90A 2Z2KA 5EZYA 2ZM5A 1IBKB 5EJAA 1HGXA 1KK2A 4BZZA 1IZZA 5AVWA 4ZT6A 1B00A 1W85B 1XRLA 4H6XA 1U5BA 3S2ZA 3LTEA 3M34A 4QIHA 4V0LA 3UGJA 1I7PA 2I4NA 3AERB 4CM9A 4RL6A 2DOKA 5F5LA 3HL4A 1MEJA 2YVAA 4RKRA 5IEJA 2CEKA 2HSWA 3E58A 3H2HA 4JX9A 4XDZA 1Z74A 2HPHA 2WFLB 4A0QA 5B1EA 5DN6D 3IEPA 4JOSA 1GDDA 1O8BA 1DKMA 4HN4B 4NIMA 1GUYA 4GM0A 3HZHA 3VC1A 1D3AA 5KU7A 4WUVA 3AMVA 4QGSA 5GY7A 721PA 3I5XA 1SUCA 3K70C 3C3AA 4J1TC 5CPBA 1L9XA 2HF2A 1SD1A 5IHXA 3V1MA 5JADA 3D54D 4YN3A 4Q4HB 2AT1A 3EIHA 3LQYA 4HFMA 5FB3A 3TZLA 1O4VA 2P6NA 3HN7A 3IP6A 1YE8A 2HU5A 3RJTA 4WCFA 3VZQA 4DCPA 4TRMA 2OUKA 3O8NA 4V39A 1KS2A 4WHMA 1U0TA 3MS4A 1MG0A 3B9BA 1X7WA 4Y6QA 5DMXA 1E1LA 4JOQA 5C1IA 3LYLA 1MW9X 4IGFA 3JR3A 4XAQA 4D3SA 1A72A 3JD2A 3S2GA 1TYEB 3TRIA 4ZVQA 4A6EA 2HMSA 1X1BA 1KI3A 3DT6A 3K0SA 2H1SA 4GRIA 1QVZA 4IJQA 2MDTA 2EF1A 5E2BA 3CVWA 1X80B 1P77A 1YI8A 3DEHA 3R7WB 5TLSA 2IRWA 1M2OB 2PT5A 3MUFA 4R8LA 5TJ9A 3L7NA 3DEIA 4WAUA 3NHLA 3GT0A 4WIAA 2EWVA 1JE0A 3LP5A 2B5VA 1SCJA 1S2LA 2PZMA 3OZRA 4HKTA 4QTTB 3FLEA 5TEWA 2IA5A 1RWOA 3OZVA 2ONKA 4GQBA 2RAPA 3KXKA 3MYYA 5E7IA 4B47A 1KJIA 1XP5A 3CB4A 4LHSA 4V1CB 5G3YA 3SQXA 2QLNA 3GPIA 2CZGA 4HAYA 2NU9B 5EJGA 1MD9A 4MV7A 4G4IA 2H65A 1VMAA 3ICVA 1T0BA 4M8SA 3U49A 5CH3A 5EXSA 3UXEA 3RRXA 2AOXA 1XVAA 4HX5A 3RC2A 4ZZIA 4OP2A 3V48A 2MSNA 3BYZA 3BD8A 3PXBA 3ZCRA 4PQRA 3TAUA 4AO8A 2Q3EA 1QZXA 1JIJA 2X0NA 1N8SA 2WJVA 2WUDA 2OENG 1D2GA 1Z7GA 3COSA 1C30B 1D7OA 2A9OA 2H5JA 1KJJA 1NULA 4HEHA 1EM8A 4JJIA 4QU8A 4W7SA 4F4HA 4B2PA 1M2OA 2YH2A 3THOA 1U3GA 3EMDA 3LXUX 5L4LA 3B3QA 3TFOA 4MCAA 5IHPA 3E35A 2Q41A 2YQ5A 1RKUA 1PZNA 4LQ4A 2RJNA 1DADA 4JR2A 5DGHA 4JZKA 3NBMA 3HTXA 4ZOEA 2IWRA 1XC7A 2PA0A 3ZDQA 2C5EA 1ORWA 5HFNA 2QVCA 2GHIA 3QYFA 4XIIA 1WCWA 4FHEA 2HIMA 2VAXA 3ZCPA 4RTKA 1ZR4A 4TX1A 4ALNA 4V1CA 1FJXA 2C77A 1D1SA 1Q16A 1WV1A 2ORIA 5C5DA 1U8YA 2XD4A 3NHKA 1ZMXA 4JR1A 6ABPA 2OILA 4UCWA 3O3MB 1YR7A 1ZXLA 2NU6B 4IZHA 4UJ5A 5LBUA 3TW4A 5KX5F 2ARKA 1QB7A 2AF3C 2HV8A 1B2RA 3NZEA 4OHVA 4AC9A 2GPNA 2JZOA 3NDRA 3RTCA 4JA2A 1T9HA 4YTEA 2CWWA 2XH8A 2ODPA 3KKLA 2OBXA 5F78A 1Z13A 2DH5A 3AXSA 4P35A 2CMFA 2V5UA 5TPZA 2XXAB 1T9ZA 3AZOA 5TQ2B 4XWOA 5LP6A 3K0FB 3P9QA 4TRNA 2PUBA 4B4KA 2HDHA 4P08A 2OYRA 5C8YF 3T7KA 4IOJA 3WSWA 4ZREA 1SRRA 4NYJR 1QCZA 1SN7A 4LYFA 2WD9A 4N7RA 4DEVA 2MHCA 3ORSA 4MQ4A 3A4NA 4PX3A 4R16A 5DW0A 3VBEA 1LDYA 1PW7A 4BP1A 4UEWA 1GNLA 1P75A 4F9GA 1Q0ZA 4CIVA 5EVCA 3D0RA 1C1YA 3I9MA 5KHOC 1WXWA 3HBAA 3IOYA 4JJZA 1MU0A 4CU5A 1QIFA 2G71A 2YV1A 2RK6A 3D6AA 2E82A 3BGIA 3PL1A 1V43A 3TW0A 3Q8WA 3USZA 3VDMA 5BURA 4YYEA 1GARA 4RXMA 3EF1A 1KC1A 2B2CA 1W1IA 3B1KA 2P9YA 4NY1A 4YJ2A 2RONA 1UBMS 2A86A 1XSEA 3E70C 1QGOA 4DNXA 3RI3A 2ACVA 3D8UA 1ORTA 3EXFB 4FDAA 4QOSA 3QY9A 4IIJB 4UE2A 2BI4A 4BOYA 2VA9A 5BOSB 1GUAA 4BMXA 3MBOA 2GO1A 1CSEE 4HDRA 1R6UA 1OPXA 3T3GA 2OXCA 3VR5A 3S70A 3OQPA 5IVDA 1K5GA 2NYRA 4P4UA 1BA3A 2XUDA 1QOZA 3EBPA 1XKTA 1NAIA 2ONZA 2Q5EA 3MRSA 1QH9A 3FPFA 2HHJA 1XU9A 2QT1A 2Z5FA 2FWPA 2BEVB 2GTHA 4NHEA 1NAHA 1XAGA 3K2IA 2CNKA 3EE6A 2NO5A 4Z9FA 5HUQA 2Q8PA 2W4MA 4LZWA 2PZJA 4LBZA 2ZAGA 3EXG1 3RVDA 5JS8A 4TMZA 4J0CA 4BVJA 4HWOA 1P81A 3S29A 1SUSA 2WIGA 4K46A 3SC6A 4ZCSA 1KEEA 3AHEA 2JDID 1WJGA 4GBMA 1P1JA 3IB3A 3SF8A 3UMMA 3AVOA 1L8QA 2VKTA 1SC4A 2REQA 3AKYA 2SKEA 4HQNA 3C1UA 3MSCA 3BPSA 2JIOA 1CX9B 1SBYA 5JCJD 3IC5A 1M2KA 1NMXA 2ZRNA 1RHMA 2IGBA 4YCSA 4Z4QA 4EQZA 2XTZA 1WDKA 3FPHA 2V8OA 1IH8A 2WA1A 3FOEC 3V46A 4XD7A 1O9BA 4KIFA 3KT8A 2D5BA 3EGCA 2G4VA 1EFUA 3ANXA 4UBIA 1NXPA 2V8BA 3S5JA 1LBSA 1YR8A 4W9RA 4RIHA 1ISRA 1ZIPA 2J9GA 4OUDB 4YRDA 5FYQA 4Z2YA 5IKPA 4ENSA 2HMWA 1UDBA 3LPLA 3PVSA 4KWHA 4YT5A 4IRUB 3S8MA 3ZV7A 5KDOA 1UBOS 4L4XA 5I7SA 2Q1SA 2RCYA 4XYGA 2YWCA 3BMQA 4IQGA 1L7OA 5HOEA 4LK3A 1XFAA 2KLBA 1V3UA 3E4CA 4M9UA 3TNDA 2I2XB 4XD2A 4WD3A 2VT6A 3SX0A 2MYTA 3L5KA 4XI9A 2WG0A 3REQB 3EDRA 2WDPA 2IHNA 4YX9A 1A9SA 2P11A 2PAAA 4GBJA 4D98A 3BH6A 5HUJA 2I7XA 1U6JA 4LC0A 1T29A 5K3SA 3BUSA 3FUVA 3PF8A 4MV0A 4AY5A 4FZVA 3BK1A 4DJTA 4F3YA 1H4SA 2QE6A 8ABPA 4YRQA 3Q5DA 1F9AA 2WJGA 4DLKA 4MA0A 4JFAA 5DULA 1FRNA 1RWBA 2XUZA 2QM7A 2YN4A 3KB6A 1X1SA 3D4IA 3EXAA 4PZAA 3SHFA 4OUDA 4IY1A 3VH2A 2QR2A 5B6PA 4MI1A 5EFOA 3SEAA 4C7BA 1R0KA 2QV7A 3LP6A 2WF9A 4ZEXA 4F6RA 5ITVA 1D4ZA 1Z5VA 1F6WA 1M73E 1XO1A 1ZAKA 4P3YA 3RBAA 1H2AS 3WKAA 1P44A 2NYAA 2XR1A 1L5ZA 3ZK7A 3KBOA 4AMYA 2CLLB 3G2JA 2DBRA 3I01A 5KNBD 1PT6A 1ULUA 3EGEA 3HBFA 2NU7A 4X60A 4YK7A 3TDMA 4F8JA 4HT3B 5JIBA 3N07A 1QRDA 2DFPA 1YQTA 1G20A 1X9HA 3EEIA 2AXNA 1N6PA 3JZAA 2QYOA 3SQLA 5B57C 1MJGA 3IUSA 1AHPA 4LK2A 3GPDG 3O90A 2PWAA 3DOOA 5JARA 1TADA 4WL0A 3KTAA 5ILGA 1LRLA 2YQZA 3V2HA 1EUZA 4IXMA 5BWMA 4XWAA 3M9WA 1GKLA 3EJ6A 3EIUA 5IW8A 5M34A 4KYUA 2QNBA 2AN3A 5TQVA 3JQCA 3I76A 1PGPA 2FPLA 3WIEA 3AY3A 1TKBA 2EEPA 4F86A 2G04A 4UDNA 2F1HA 2QX8A 2VH1A 5CDTA 1BMDA 1ACJA 3AI3A 1KK1A 1KOJA 2UYHA 1EJBA 2DPXA 2YIJA 4ER7A 1QP0A 4KE9A 5JCZA 1COWA 4P7KA 5KTYA 3NHAA 2Y9PB 1VL2A 1U80A 1DEKA 3D3QA 3EA0A 4GM4A 3DBOB 5AJXA 2W8ZA 3KOZA 3WWPA 2GZAA 3INYA 4JWTA 2VPYA 3LV8A 3X1ZA 5E4YA 1ETUA 2FPIB 1LBTA 1J8QA 4DLRA 2EBWA 3S55A 5IYZA 4UEKA 1KFBB 8MHTA 3FETA 1SQGA 3HRIA 3QE0A 521PA 1W49A 1QYIA 3AQ4A 4CMKA 1E94E 1Y37A 3BX1A 2QOEA 2BFCB 5CX4A 2FN3A 1E1YA 3C8HA 3DD1A 1A77A 4L5YA 2VT3A 4ZCQA 3VBCA 3WDKA 2ERYA 3MRXA 4S1TA 1T36B 1Z5PA 3HNPA 2BKLA 1TQ6A 3OHMA 4GOKA 3VGJA 1XDWA 4D6YA 5T7BA 2A9PA 1IOLA 1F2UB 2PVCA 2R7MA 5ECGC 3L2OB 2JATA 1QRTA 4I2VA 1F0KA 4NJEB 3CVOA 3E3AA 4PC3A 4D80A 2YZMA 5JAQA 3TR0A 4A2WA 3JWIA 3TMYA 4CKBB 3DMPA 1JFFB 4RQBA 3A4VA 1JSXA 3LXRA 3RRNA 5JHHB 3WLOA 5DRTA 3B48A 1YFLA 4NCBA 1RTTA 1V1RB 3THXB 5CDFA 4ZQEA 1Y7TA 5TV2A 2UUAB 2W58A 3Q7PA 3FYDA 1U9ZA 5K7SA 2C3PA 1R4ZA 3H9QA 2VTBA 2D2VA 4NESA 1JJAA 1KBOA 5IK2A 2E87A 5LJIA 4UU7A 2VXYA 2OD7A 3KKPA 1JI3A 2V6BA 5F52A 3ZQKA 3G0BA 2GDZA 4MRSA 1QH1A 3D6HA 3ZE2B 1J2EA 2R47A 1PWYE 2V0NA 4IS3A 2F7SA 3TD9A 2B61A 3PA8A 4OF4A 2CLOB 3ZLVA 5A4IS 4M0EA 5HE9A 3EWAA 3ZK9A 4Q6WA 1GCOA 4BYMA 3FHCB 4WA8A 1AKWA 2AJDA 4UUMA 1H93A 4PLYA 2ZRJA 3E15A 1DCKA 4ND8B 2P41A 4AP9A 5KWJA 3DDCA 4ZZ0A 1K68A 3IEVA 2ZLBA 1J0DA 1SZJG 2HRZA 3FUTA 3O8OB 1QR6A 3QENA 4J6EA 4I9HA 4DTCA 4MW6A 1TVCA 4BQSA 3K35A 1NDQA 3RT1A 4EFMA 1WO8A 4WY8A 4KFSA 2FHSA 4EHKA 4E15A 3EQ8A 1V3QE 1F6BA 1O58A 2V45A 4R6XA 4BP8A 2Q6VA 1YDWA 5JECA 4O4LA 1HQYE 4TKVB 1Q0LA 5JVDB 4DGSA 4Q1BA 2HUPA 4LJSA 1KJ9A 4HO1X 1JPJA 1N3BA 1UC5B 3AOGA 4OD0A 2H31A 2NT4A 3PXGA 2OAP1 2CXNA 4RANA 2EJCA 3CEJA 3TBFA 4AF8A 3HGMA 5IJ0A 2QTWB 1UK6A 3WLIA 4CCWA 4UVHA 2LPMA 2Q28A 4WLUA 1NF2A 4YAFA 3DPUA 1VZ2A 1JQ3A 1G98A 1I1HA 4MKIA 1LPMA 1H6AA 2WM3A 4GDFA 2Q4RA 2XBMA 4LEIA 4TSRA 5AP9A 5I8PA 1BA2A 1I5EA 1RYDA 3MT9A 4N6NA 4PIVA 2IEZA 2D13A 3CZRA 4IOLA 4WZAE 3RODA 1JDSA 3N53A 3ZTYA 4ZT4A 2JGIA 2SECE 4P7BA 3SZMA 3S2YA 1UXHA 4S12A 3BIJA 1O97C 2WWTA 4JKIA 4BO3A 4BUCA 3FVTA 1USVA 4N0EA 4XIYA 2C5BA 2EZ8A 3L92A 1JHZA 1W9MA 2NQ2C 3TIIA 2FQYA 5DBIA 1HQCA 3PC8C 4I50A 4O4JB 4YPFA 1BEUB 2FXIA 5JVDA 3UMRA 3FJ1A 3QPAA 3CZMA 4OBWA 2P40A 1G8PA 1LV8A 2JARA 3D7RA 5IZCA 1UFOA 1JIVA 4IFBA 1GADO 2WU4A 1Q57A 3C3CA 2VDQB 3GN2A 2C07A 3ZTTA 3ESBA 3MBKA 5C80A 5MFZA 3OC6A 1B15A 4F6CA 1E0AA 2I1QA 1O89A 4XDHA 2C5AA 4R6WA 1XPOA 3QJGA 2IS2A 4FE3A 4MR9A 1CFZA 3M4NA 4P31A 2HQSA 1JU9A 1WW8A 2O7VA 3AZPA 3G1UA 5AOAA 4BJ5A 3IQEA 4EGAA 3GG2A 1CULC 5HF6A 3EXHC 4P4LA 4TYPA 1MO3A 2QTVA 2DQZA 3BMOA 4RIIA 3ET5A 1FDIA 4AL4A 5C18A 1N0IA 4KPEC 2JFXA 3DLHA 3L7BA 2QTGA 3PCRB 4MICA 4EK9A 1A5ZA 4PHHA 4LSMA 2GPYA 1UBUS 2AQIA 2UYGA 2VTEA 4N8DA 5G2OA 4O4JA 4UBOA 5LYJA 1DT5A 2YHBA 4K86A 5AM3A 1S8NA 4YV1A 1O94A 2R65A 1ZCZA 4BL5A 2G63A 2E85A 4DLPA 5AVQA 3GZNA 3WYFA 2MJLA 4HDSA 3S4YA 3UJDA 1CUEA 4RYDA 1ZRNA 2GUWA 3DC7A 3IVCA 1RI2A 2QRQA 4LOJA 2QMUA 3U1BA 1H3FA 2X1HA 3IIIA 1FFDA 1K6IA 2PQMA 4C30A 3TD2A 3IRVA 1R9MA 1WBJB 2J9XB 4A2CA 2BISA 3W79A 3ANMA 4HEJA 1T15A 2Q6KA 4R1LA 1ULAA 2FUCA 2ZBFA 3FWZA 5AOBA 5JXIA 3KB8A 2HFKA 2IODA 2JAXA 4OP1A 3BFJA 3JQGA 2VH5R 5L95A 2QVLA 2VK8A 4QRHA 3LXMA 3NXSA 4QHSA 1GTSA 1AMUA 4C0AC 3M4ZA 3OHSX 5CEJA 4CRWB 5L7TA 3ADPA 3OIWA 1GNSA 1M2FA 5DHSA 5LNK6 3MS2A 2COUA 4IWXA 3DZDA 1ZITA 3GDGA 1HLFA 3PEFA 1ODIA 2ZAOA 3HCRA 3KQPA 4P32A 3TJMA 3FYSA 5LXTB 4NAUA 4E4YA 4MQBA 1SXJB 3TG2A 4AMUA 3GPBA 2CMGA 1KJZA 1ZUHA 4E5UA 3OCWA 3JWJA 4HN2A 4RADA 2CWDA 4E5VA 3HLYA 1S4MA 3OLQA 4TT3A 1VOTA 5IC5A 1W36C 1EBFA 4OYHA 3H2IA 5JQWA 3LL4A 2BR4A 3DXYA 4G26A 5L3QA 1MR3F 4KQJA 1U0OC 4U7TB 3W3AH 3ZDXB 4C5BA 4ESEA 3AV0B 2FWAA 3LOUA 1J21A 4CMGA 5H02A 1P9WA 1EINA 4MUMA 1P1KA 2VHQA 1YCDA 3ONEA 2Z3WA 1JHUA 5D87A 3SOZA 4Y1GA 2EZ9A 4B6OA 1SIBE 1SBIA 2XOEA 3MXTA 3NCHA 3AY7A 5DWDA 1E5XA 1WF6A 2R6R1 3T5BA 1HMPA 3HABA 4CMBA 2CW5A 4XOUA 4JYAB 2G5PA 4YJGA 3WHIA 2WICA 3KTDA 3IP8A 3JRWA 4R2LA 1UH5A 5SYAA 1KDTA 2OA0A 5LR6A 1NG1A 5E6UA 1LX7A 5U4XA 5LZ7A 1IN8A 4PPQA 4YRCA 4NAHA 2VNAA 4MQFB 2VRCD 4D4GA 4Y7CA 1D6MA 5JNVA 3JASA 3WWZA 2RH5A 3VOSA 5JYEA 1WHSA 1BNCA 3G0DA 3OOHA 1KZHA 4BJ6A 1U8XX 3FRHA 2JFBA 3PUKA 3SYRA 4OP3A 3MUNA 4L51A 1NUSA 2V6GA 3D6VA 3H97A 3WADA 3JRNA 4XX0B 3T7RA 1E0DA 5SZHB 3EPRA 1E2UA 1I0LA 3THWB 1W4AA 1MB3A 2WU1A 1XN4A 2QKYA 3QSYA 4BVAA 1IOWA 2QTTA 2YS7A 3G17A 3C16C 5HKBA 1EWRA 1TRHA 1J99A 3HWSA 2O54A 2DU8A 4RIGA 3T15A 2J3KA 4ARVA 1UQUA 1KRWA 5T4FA 2B2NA 4KACA 1T0JB 3GGOA 1NBAA 2WU0A 1XQ9A 4A4DA 5F2KA 1QFMA 2Z8YM 4FW8A 3N2NA 1UK9A 3QRWA 4OPMA 3B7PA 1U2EA 2B9VA 4WBNA 5BR8B 4MUHA 3ADBA 4N49A 4YUWA 2Q46A 5K8VA 2G4LA 4MV3A 5IWAB 1PJRA 1V8BA 4K1LA 3QE9Y 3PEUA 3U4CA 2B25A 1GV1A 3GDOA 3JX9A 5B58T 2IY9A 2R3SA 4K9MA 4O29A 1U2QA 4G0YA 3MK31 1E4EA 1GZ7A 3P0FA 5JC8A 4RULA 2ZGVA 3P71T 3JVVA 1ZNZA 1BMQA 5FBKA 3VVCA 4CM1A 2ZIAA 3AFOA 5IDXA 4KR7A 3I42A 2OGUA 3VKHA 2HA0A 1JHRA 1R0ZA 4G0PA 3TTWA 4PGAA 3CJTA 1M7HA 1VKHA 1Z35A 2B5OA 3LY9A 3R3YA 4IKPA 1DAPA 5CHYA 5CYPA 4ALIA 1QCYA 4X00A 1A69A 1CRWG 1GPAA 1KO4A 3GFSA 2AG6A 4GZ6A 4YUYA 1GNTA 1E4OA 1NKVA 1W5SA 3GJQA 2VA8A 4JC5A 4LZOA 4LRQA 3PYXA 1FDSA 1N2OA 3FFTA 1O3YA 1OXBB 4Q9IA 5KWVA 3QTTA 2ET6A 3NV7A 1QIHA 2H63A 3RTEA 1C3JA 4NCHA 4L5JA 4AJIA 3IKLA 1SVSA 3X1DA 5EERA 2LXNA 4E22A 4KR9A 1M0TA 3LCUA 3KL2A 3LZDA 2GOYA 3D31A 1F2TB 3KUUA 4YIKA 1QBGA 1VPVA 3D5EA 2IU0A 1UOQA 4KK4A 4EJFA 1IDN1 3WICA 4FMBB 1ECPA 1NXSA 3ANLA 2CLEB 4WNAB 3PWKA 1GL7A 1Q0RA 2Z8ZA 4ZT3A 4BP9A 4OKSA 4H1HA 4J7CA 3OZFA 4ZKEA 1GPDG 4D2IA 1VE5A 3BWEA 4N82A 3SVLA 2QRLA 2XNJA 4AY3A 1GQFA 2Y76A 1ZISA 2V0CA 1ZEMA 3M8KA 1A2OA 4L75A 3FHLA 3HCWA 3FWHA 4AO7A 3Q2OA 2G40A 4BQIA 5ICFA 5GWXA 3AESB 2CJWB 1I5RA 1E4YA 2EGGA 2QN7A 4XWYA 3GGGA 1NG9A 3E22B 1VE6A 3QFSA 5EYPB 3JATB 5TXGA 4ZTZB 5ALZA 3UBMA 2WUWE 5HK9A 3WNVA 3M1IA 3LA8A 4GL4A 3FIJA 3VZSA 3U81A 3AL2A 4P34A 1LK5A 1PFQA 3KPYA 3OZAA 4DQLA 5K45A 1T6BY 4DKJA 3O5AA 2IVZA 2ZWPA 1QAQA 4PNEA 2EW1A 3U3JA 3CLSD 4XYEA 2ZBQA 4MR8B 1UAYA 5EUBA 4I5DA 4U1RA 3T99A 1P4GA 1ZRMA 4IW3B 1CQZA 1A82A 5DI3B 2QPAA 5K0BA 2GPAA 3N58A 3I37X 4ABTA 5FADA 2GESA 1FQJA 3SX4A 2YJGA 2LW7A 1XX6A 4WBSA 3PNBA 4KODA 1B8UA 3UJ3X 5B37A 4JLOA 4GYYA 1BVHA 3BDAA 2AJCA 5EXEA 4TVKA 4PRZA 2JHPA 3IAHA 5CLQA 3E27A 1SOWA 3AP2A 1BH2A 1VC2A 4R3UC 2M6RA 4F38A 1A1SA 3E22A 3B38A 1WSAA 4NSNA 2ZT5A 5FWXA 1PW5A 5SY4A 2IE8A 1GPBA 1P6UA 1Y3IA 4BP3A 3F2VA 4RTRA 1IAQA 1UKBA 1KYWA 1XE3A 2JGKA 3K73O 3MWJA 4MLPA 5ALFA 5I7FA 1DVRA 2HLHA 2J0SA 3BG5A 4KDCA 3FXAA 2ZRLA 3BRQA 4RD2A 4UNSA 3AH8A 5BOVA 3V55A 3KWFA 3CPSA 4UC0A 2E48A 1QVAA 3M6LA 1XZGA 3K1YA 2I78A 4TXNA 1R88A 3JD4A 4ZHQA 1EWKA 2FNAA 2IPMA 1KI2A 1PD0A 2H18A 4H27A 1AC5A 4CF6A 5C37A 2O8DB 2X77A 3EQ2A 2E4XA 4EUEA 3ZG6A 4GMXA 4I6EA 1N2CE 4B6JA 2D1SA 1I4LD 3O2SB 2GPBA 1MX3A 2QLMA 4IMRA 1KFJB 1TQ4A 4YMVA 1TCUA 2GGSA 3W8EA 1RMQA 3RV3A 2YQ4A 2AI1A 2WABA 3HYRA 4LHEA 5BN5B 2AN5A 2BFNA 1PF7E 1V9SA 2M1ZA 2PTHA 4Z0HO 4E11A 1EXDA 3KQTA 4Q3LA 4UXHA 2YRFA 3NM4A 2Z2XA 1GL9B 3CRNA 1ZM9A 1E89A 3IQWA 1XMIA 4CG1A 4JSTA 3HDHA 4G56A 2RC6A 1NUUA 2O4UX 4CT5A 1JWBB 4TSFA 2VQ6A 3OWXA 3IO3A 3DBRA 1HM5A 2UUCB 3SC2B 1TJYA 3H2SA 4MRAA 1R9JA 2M6LA 4LWOA 4KVFA 4O3FA 4KX5A 3EQZA 5DGXA 3GLGE 4JJEA 1A9XB 2O8DA 1HRDA 1TK9A 2GBLC 1Q7EA 1LD3A 1ZG3A 2W2TA 1P45A 1TVMA 3A6HA 3DMYA 3MCWA 3D2AA 4OM7A 2HYIC 2A5YB 1ONNA 3L82B 3HJTA 3P9SA 3PXDA 4G65A 4LZLA 4Y2SA 1KMQA 2OK8A 3EK2A 4H6PA 3VZRA 4JJAA 1DO8A 5C31A 1FEZA 3LLCA 4GP7A 4HTFA 1EUDA 3TTTA 3KAQA 5K4HA 2R2GA 3VSAA 3OT1B 5BN5A 2EQBA 4ZI7A 3GZ4A 1WXXA 3SE0A 3VPHA 1ZD1A