3BMOA

Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor (compound ax4)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
267
structure length
255
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 96
structure length 255
sequence length 267
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bmoA00
3ETDA 3KM0A 1J5PA 4J1NA 4CM3A 4EUEA 3KSDO 4R1NA 3CMCO 3JYQA 3WOHA 1C1XB 1DFIA 2G82A 1B16A 3G0OA 3F4BA 1UXHA 1PJ3A 2UAGA 3KZVA 3PWSA 3BXXA 4GPD1 2VQ3A 5T64A 2J3HA 2C29D 3WWYA 4UVHA 5A9RA 1KEUA 1V3VA 1LDYA 1NVGA 2IYOA 5B12A 5CPFA 1ZK3A 5C7IO 3DAGA 3DZBA 4CM4B 4ZVVA 2V6FA 3FR8A 4OM8A 3BTSA 2FHSA 4DLAA 2DAPA 1WW8A 2R00A 3P19A 2EXXA 1EBFA 3WLEA 4U5QA 3U0BA 5A3JA 2Q2WA 3DR3A 3PJGA 2R2GA 3QV1A 5TRTA 1DIGA 4IM7A 4B7CA 5T8KC 3OECA 1N1EA 1XYGA 2PH3A 4KZPA 4BNFA 3MEQA 4FR5A 3UOGA 1D1SA 4PLYA 4BUCA 2Y1FA 4IDGA 1YL7A 1X7DA 1HDRA 4E2YA 3WIEA 1F8GA 4CMJA 4W7IA 2DPHA 2X9NA 3EZYA 2NQ8A 5DBFA 3GDOA 1EUDA 4Q3BA 1YB5A 2ZB4A 1C0IA 3VKUA 2H9IA 1H94A 2JFHA 2CSUA 1O94A 1XQ6A 2VHWA 1ZSVA 3BMQA 4ZRMA 5TQVA 1WP4A 3GEGA 4O59O 1PJ4A 1BTOA 4LSWA 4YTEA 2BHLA 1GU7A 3LK7A 1SOWA 3HNPA 5ADHA 5CDUA 3SC4A 1DEHA 4I5FA 3HB4X 1OMOA 5ER6A 3BIOA 3UHAA 5TNXA 5IN5A 4RF3A 5G4KB 1SB8A 4B4WA 5IAAA 5JE8A 2QW8A 2AMFA 3CH6A 5IF3A 1JKFA 3INTA 1SB9A 2FOIA 1DC5A 3PVZA 4J0FA 4JN6B 1ZVMA 4J1TA 5HTOA 1P45A 4Q9NA 1NP3A 4Q3NA 1EE9A 3ADOA 4BKRA 1I8TA 5DNAA 3B1KA 1I01A 1HKUA 3AUSA 3KEOA 1E3WA 3L6EA 1S6YA 2HJRA 1J0XO 3GZNB 4QO7A 3ZWAA 4CMEA 5JCJA 5JPIA 3ZWPA 1GUZA 1ONPA 2HAEA 2DTXA 5T67A 5BSGA 4IDFA 1P0FA 5JYEA 3JQDA 1U4OA 3DHEA 1ONOA 4WOKA 1AXEA 1FF9A 3G49A 4IBOA 3IOYA 4RZHA 4L4XA 2OP1A 5CDTA 2EV9A 4H3VA 3ZV4A 4FQ8A 4D7AA 2GN8A 3BHMA 5HRUA 2ZQYA 3DOOA 4MVJF 3JQ6A 1DRUA 4I5DA 5DCWA 1WAMA 1ZEJA 2UV8A 3B20A 4I08A 3TNLA 3ANNA 3V5NA 1ISJA 3ZV3A 1N9GA 4I5EA 1JU9A 1M6HA 1VL8A 2J3IA 1E1LA 3PTZA 3PHIA 3ASVA 3INRA 1PQPA 2Z1MA 4EEXA 1BHSA 1R16A 1HE3A 4PLZA 1AHHA 2RCYA 4UVDA 3A06A 3QWBA 4AJIA 4Y6SA 3WJ7A 1NFFA 2AHRA 1GYRA 3RUHA 3ZHXA 4UEJA 3KYBA 4TMFA 5DDIP 2XXBA 3O26A 1H6CA 1ARZA 2VYNA 3NT5A 4GX0A 5CDSA 3I52A 3AUTA 1BDBA 2JHFA 2JKVA 1IL0A 2FY8A 1UJMA 3I6QA 3E9QA 1U4SA 1EFLA 3AUUA 4C4OA 1BRMA 4ALKA 3W8FA 2WWRA 3H2SA 1K3TA 4L0QA 4J91A 3V1TC 5IDQA 4WGGA 3KRTA 3VH3A 1U3TA 2OBNA 5KCZA 1SEPA 2AG5A 4AJLA 1SC6A 1MA0A 1E7QA 3JSAA 1YQGA 2PKQO 3VOSA 4CLDA 1BXGA 3NDIA 2I76A 1EK6A 3STHA 3T4XA 3E18A 2FZEA 4JX8A 5L4SA 1LRKA 4D3SA 1XKQA 3VPHA 1R0LA 1WLYA 1O9BA 2Y1EA 2OOSA 2ZIZA 5JNLA 3CINA 3D4PA 2IXBA 1EBUA 4R1TA 4IQ8A 1PJCA 2FPPA 1BMDA 1ZZEA 3ZU4A 4XWYA 3WYEA 1MLDA 1YB1A 1VE9A 2RAFA 3R3SA 5JDCC 2FP4A 2J5QA 3QP9A 2Y1CA 1NAHA 1V6AA 4YAKA 2B69A 1U3UA 2DT5A 3O8QB 3K31A 1W73A 1U5AA 4XYMA 4DMMA 2TMGA 2GLXA 4J0EA 4ZHSA 1CWUA 1QLHA 1EUZA 3WQQA 5IXYA 1VSVA 2B37A 2VTEA 3E8XA 4R5MA 4YR9A 4R1SA 1DBVO 4TZTA 5A9SB 4A26A 1NR7A 4NPCA 3FRJA 3DZGA 3LLVA 5L51A 3Q9UA 3C1TA 3ZDFA 1B3BA 4G2NA 1GEGA 1LSOA 5I9LA 1E3SA 1T4BA 2ILTA 3KO8A 1R4NA 2PWZA 1R4MB 3U09A 3ZWWA 2PH5A 4N18A 4PRLA 5A4DA 1HZJA 1OC2A 1PL8A 1X15A 3OF2A 3PP8A 5DBIA 2ZB3A 2OXIA 3V2UA 4UEOA 3VVCA 3D1LA 4P4NA 2O3QA 5EQDA 1IE3A 5JYDA 3V2HA 1VSUA 3V8BA 1E3LA 3ZWBA 3S2GA 3GFBA 2UUPA 5C3MA 3BHIA 1KIFA 2CUKA 5JW6A 1LQTA 3EGOA 4WUVA 1T24A 1Y5MA 4JBGA 4O63O 4E5NA 4R41A 2FWMX 3ROPA 5IJZA 4PG6A 1LRJA 4J7CA 3GGOA 4M8SA 2FSVA 4OAQA 3NUGA 1NQAO 3WIDA 1PJ2A 1C0KA 4CV1A 2O3RA 5C37A 1E1KA 1DC6A 1C14A 1PEDA 2X5JO 2YV2A 4ZQGA 5IZ4A 1A4UA 2J8ZA 4Z6KA 1P1KA 5LDGA 5TLSA 3CPSA 2BFPA 4IGFA 4EYEA 1IUKA 4BNKA 2YFQA 4EBFA 1GTMA 4BO9A 4UVIA 1V35A 4K6FA 1YBMA 4ND3A 3KYCA 3TRIA 4WEQA 3GVCA 2X22A 5JDIA 1EFKA 2Q50A 5H82A 4EDFA 3Q1LA 2X4GA 3IKTA 4BO5A 4BO8A 3FTNA 2POQX 1G1AA 5HS4A 1H2BA 2XPCA 3EVTA 3DHYA 1EMDA 3NKLA 2A35A 3SX2A 1HRDA 1KY5A 2O2YA 4J1QA 4CUKA 4K6CA 1E1NA 3RC7A 3IS3A 3ZWMA 4B4OA 4EI2A 5JCJD 3ROKA 4CLRA 1GZ3A 1P77A 1JWBB 4Q3CA 5EIOA 4YBZA 4YQYA 1GYQA 1NFQA 5JAQA 3BAZA 1D3AA 2W4QA 4F3YA 1E6EA 3U62A 4BV8A 4MP3A 2ZATA 5DULA 4JXKA 4PCVA 3ZCXA 1U3VA 3DBHB 1NHWA 5FWNA 2NV6A 4NR0A 4L4RA 1ADGA 5HWSA 5KJ1A 4YDRA 4MOWA 4N5MA 4XIJA 3RCBA 2ZYAA 4RVGA 4WLOA 5BSEA 1DFGA 3D0OA 2VHXA 3L6DA 5I8ZA 4N54A 2WMDA 3MOGA 3F47A 4E3ZA 4DYDA 2DKNA 1Q1NA 3PQEA 4YAIA 4YAGA 2QIOA 4I9NA 4DQVA 1E5QA 3E9MA 1NTOA 4A73A 3OFSA 4PG8A 3GRKA 3PWKA 1QYXA 1CJCA 4CL3A 4J43A 2NACA 1Q2XA 2GD1O 1IHXA 2ZJ0A 3IL2A 2A92A 4BGVA 1X1TA 5JY6A 1W0CA 1L7EA 4PFJA 3P2OA 1CQJA 2B4RO 2E37A 2VYND 4PVCA 3SJUA 5CEFA 3RUCA 1IZ9A 3RC9A 3DOCA 1DJNA 5ICSA 3ZNNA 4BL5A 3GLQA 4E4YA 3BA1A 1EZ4A 4AJ2A 5EESA 2DUUA 4AVYA 1U3WA 3JQAA 3HZZA 5TT1A 4AG3A 3Q2IA 4M1QA 3Q2KA 3RSHA 3L6OO 2NM0A 3H8VA 4ZRNA 5IDWA 5EPOA 3GA0A 3D5QA 1Z75A 2QRLA 5TF4A 3W6UA 1NBOA 3OJ0A 2GR9A 1HL3A 3E1KA 1FDWA 2W2KB 4MVJI 3G1TA 3QJ5A 4OMUA 1PGJA 3F5SA 4RCVA 2ZB8A 3WQSB 1F8FA 3ABIA 4IZIA 3S2FA 2I66A 2QYSA 1YQXA 2PR2A 4IS2A 3S8MA 4GI2A 3TPCA 1WDLA 4OQYA 4YWJA 1T1SA 5EL0A 3GEMA 4Y9DA 2C54A 1HDZA 3TZHA 4RF2A 3MJSA 4FSHA 4CMBA 1J4AA 4XD2A 3TZCA 4ALJA 4PG4A 3WFJA 1KY4A 4CQLA 4FFLA 4D0RA 1V0JA 2CY0A 3BMNB 3JQGA 1W8DA 5ES3A 4NBTA 4TRNA 5F5LA 4YJFB 4RVSA 4QFCA 4CLOA 3PJFA 1LU9A 4B3IA 5HS6A 3S1LA 2X5KO 1HLPA 4DUPA 1BSVA 3QVOA 5FFFA 4HBGA 2H63A 2QZZA 4ND5A 3NX4A 3TN7A 4MDHA 4ZQEA 3UCFA 2OMEA 1UP7A 3KETA 4ZICA 1ISGA 5ICMA 3DMTC 5FI5A 3DONA 2IODA 4LSMA 1ZFNA 2Y0EA 3ZV6A 1LQUA 4J7XA 4LRTB 3C1AA 3DZIA 5A5FA 3X2FA 1B14A 2EW2A 1YB4A 4JLWA 2O48X 1A4IA 2O23A 4M54A 3ZI0A 3RU9A 5I7SA 3IC5A 3RFXA 1B7GO 2OL4A 3ZZNA 1JDJA 4Z9FA 1P1RA 2O3SA 4PLVA 1A7AA 2X8LA 2NQTA 3DBLB 2VZ8A 2X0JA 5I8WA 4CV3A 4UVEA 4ALLA 1JVBA 2G76A 4Y67A 2C07A 3D7LA 3OJFA 2WE7A 1Y6JA 3JYNA 4GBJA 2QG4A 2P4HX 4ZN6A 3AOGA 1O8CA 4U6SA 5KKCA 1ZXLA 2VRCA 4YQZA 5U4QA 2A94A 4GX5A 1X7GA 2PZLA 4R01A 2ZB7A 3WMXA 2AG8A 2V7PA 3GFGA 1DIHA 1JW9B 2C0CA 2RHCA 3I9LA 1PWXA 1JTVA 1ZK2A 3AK4A 1R15A 1XWFA 3IJRA 2NVUA 2GN4A 1I2ZA 1Z7EA 1JN0A 3OIGA 1YBAA 4K9DA 4DREA 3PXXA 4BMVA 4CM6A 1UDBA 4FOOA 2IDZA 1C0PA 4RL6A 1AE1A 3LC2O 4PRKA 4Z3KA 2P5YA 1PX0A 4MVJE 3GMDA 4A10A 3OIFA 3R3JA 1K2WA 3CXRA 1WWKA 2AE2A 3FNEA 2BD0A 4XQ9A 4B7XA 4I5GA 3L07A 4GKBA 1RKXA 4FW8A 1DRWA 3KV3O 3M2TA 1QLJA 3O4RA 3CKYA 4WKGA 3H9EO 3F1LA 3OIDA 2QHXA 3WBBA 2DBQA 2HLPA 3E6AA 2CDBA 3H5RA 1VPDA 5B1YA 3UCXA 4GX2A 2BMAA 1PZFA 1SPXA 1EVIA 4IMRA 4LISA 1BW9B 1VJ1A 3MTJA 4JCOA 3JQFC 5DN9A 4I1IA 2YUTA 4JBHA 3SXPA 4KMSA 1GCUA 3EYWA 3DTTA 4A2CA 4A27A 1LJ8A 4OXNA 1EQUA 1AXGA 1EVYA 1D1TA 2GN9A 3GQVA 2JD1A 5JC8A 2X0IA 3VZQA 3PHJA 4IJKA 2CZCA 3EHEA 1PGOA 2VOEA 1SEVA 6LDHA 4L9RA 1NQOA 5IDYA 1ENOA 4HNHA 4FJ1A 3TSCA 2DU8A 3W4IA 1XIVA 1PSDA 3LVFO 3V2GA 4ZGWA 1MUUA 3CEAA 3GAZA 1EDOA 2EERA 4WEOA 4GMFA 3AY3A 2JL1A 4J4BA 3WGQA 1XQ1A 3LC1O 1TEHA 4O6VA 4C7JA 1X14A 4CV2A 1XU7A 4FFMA 2WEKA 2Y1GA 3WNVA 1C1DA 3FR7A 4OSOA 1E1MA 3I9JA 1MG5A 1PJQA 1YO6A 4CMIA 2DVMA 1ADBA 1CDOA 3DAFA 4DQXA 2BFMA 1VKNA 3DBRA 4WPGA 1RPNA 4BO6A 1R37A 3WFIA 3GOHA 4CL8A 3KXDA 4K26A 5F5NA 4GMGA 3Q3CA 4CJXA 3DZFA 4FJ2A 3RI3A 2BFAA 3RBZA 1U1IA 3ZWNA 1YJ8A 1TB4A 3FCOA 3KBOA 3ZW9A 3GUYA 1QV6A 3K5PA 4B7UA 1B2LA 3DFUA 3RKUA 2G0TA 5JLAA 3IP3A 4JQCA 3JQAD 4FIZA 4L74A 2Q4EA 1JKJA 3CTMA 2YV3A 1WZEA 3TQHA 4R68A 1GR0A 1YONA 2Z5LA 3PHHA 1HDXA 4M89A 3Q0EA 3MOIA 3GC6A 5I9NA 1H9AA 1GYPA 3P7MA 4RLHA 2EW8A 3H9QA 5EQFA 5TIIA 1UR5A 4RVHA 5F21A 4ESOA 5IXSA 1V3TA 3BMQB 4J1SA 1Q0QA 3RUFA 2V6BA 5KTKA 2IZ0A 1PR9A 3LU1A 3ZV5A 1WDMA 3NTQA 3VPFA 4IQ0A 2EJVA 4AJHA 4P4LA 2B5WA 4Y6PA 1ADFA 4L8VA 1F0YA 3V1UA 2E6UX 1MC5A 2EWMA 4AJ4A 4BQPA 2CF6A 2PTGA 1T25A 4BNHA 4KTVE 1JKIA 4LCEA 4JP2A 4OJNA 3RD5A 5H83A 3GHYA 2P9EA 4W82A 4YEDA 4MP8A 1EEHA 1OFGA 3KSZO 3T7EA 3GK3A 4LW8A 1F06A 2RHRA 4WE3A 1UAGA 3H3FA 3ONEA 1PGPA 5FEUA 5KVCA 2PKQP 1XLTA 5JC1A 4ZD6A 2BLLA 1I0ZA 4RZIA 1T1RA 4TSKA 1E6UA 4Z0HO 3WGHA 4UUOA 1YOVA 4CPDA 1LLDA 2WSBA 4CR7A 3H7AA 1EVZA 4JJGA 1GV1A 3IIEA 1E3WB 3KYDB 4PLFA 3G3EA 5FF9A 1NVMB 2A4KA 1JAXA 1G6KA 2RH4A 1Y7TA 2EKQA 3VDRA 4GQAA 4IIUA 1IHYA 2JD0A 3ZU5A 3DEYX 4YACA 5JDIC 5TSDA 4CR8A 4CV0A 1HYGA 2VYVA 3P2YA 3L77A 2EKPA 4M87A 4QECA 2HCTA 4BNMA 3OA0A 4W9NC 5AQ1A 3TOXA 4J90A 4G65A 4ZQFA 4NMHA 1XDWA 4PZEA 3DZHA 1LX6A 2W8ZA 3W4KA 1SZJG 3N74A 4HFMA 1H2HA 3ZNPA 4ZQHA 5G0VA 1O89A 1CETA 1T4DA 4F46A 1HDYA 4XB1A 2VRCD 2DM6A 4R69A 3NEPX 3JYPA 1E7WA 1K6IA 2I5PO 4MIYA 1N9GB 3RFTA 1U5CA 2GYYA 1B8VA 4XR4A 2CD9A 2PGLA 3JD0A 3TF5A 3JD3A 1AGNA 1ZJYA 3KEQA 4FB5A 1N1GA 3C7CB 3ZGYA 1UZLA 1O95A 3U4HA 3JD4A 1I3KA 4GWGA 4W99A 2P68A 4WLEA 4CMHA 3D3WA 3ZU3A 4CQMD 3COSA 1PL7A 4D0SA 2Q49A 5L3ZA 4MIOA 2HO5A 2Z1NA 4U0JA 2V6MA 2PD3A 4RORA 2X9GA 3WSVA 3C7DB 4CM4A 3GGGA 1LLQA 3G17A 1Z45A 3IQDB 2QRKA 3FNGA 3CSDA 3DZKA 1QV7A 2E48A 3F6YA 3DB2A 4MPDA 5CEEA 2EIHA 4J2OA 1TA4A 1P44A 4MIEA 2JFGA 3GF4A 5BR7A 2P9GA 3RC2A 4TROA 6ADHA 1HTBA 1EDZA 1D4FA 4LGVA 3EVNA 1ULUA 1VJ0A 1GPDG 2GZ2A 1I32A 4BNXA 3QVTA 1ENPA 4R5HA 2VWGA 3UKOA 4CM1A 4AJEA 4BS9A 5U9CA 2IRWA 2JAPA 1NX6A 1MXFA 4MJLA 2JCYA 3LT1A 3MWEB 3GUCA 3VZRA 1SBYA 2VHYA 4E5PA 3PHLA 3P5SA 2NU8A 1N92A 1LSJA 4MKXA 5L7YA 3RASA 5BQFA 1Y8RA 5JAMA 3QWIA 2BKAA 3RAJA 5L4NA 2W90A 2DUWA 1KEWA 5A02A 3GG9A 4GGPA 3I5MA 2H6EA 1B26A 3FHLA 1P31A 3FNHA 4RPKA 1DOHA 1F17A 2X0NA 3H4VA 2WD8A 1H93A 3ZW8A 4BVAA 9LDTA 5FYDA 1HXHA 4URFA 2NTVA 4TVOA 2XOXA 2OZPA 3D64A 4B8ZA 4BKUA 3NGXA 2PZJA 5KJEA 1DHRA 4BO4A 4Z9XA 1M76A 1J49A 3O03A 1CERA 3NGLA 3LDHA 2AQIA 3GNTA 1KEPA 5MDHA 4RPJA 4YRAA 5KVSA 3WTBA 2RIRA 2O4UX 2PY6A 3A14A 3MTGA 3U4IA 4I9UA 3FPCA 1EVJA 1P1HA 3JQ7A 2B4TO 1LC3A 2O3JA 1PZHA 3D3EA 4GLOA 1Q7GA 1OOEA 4XDZA 3UN1A 2QZ9A 4CM9A 4WCDA 2EP5A 4DQUA 4BQRA 4IJWA 1L1FA 3VC7A 4D46A 2O2SA 3QRWA 4HUJA 4IZHA 4HFNA 2HSDA 4PLWA 2IZZA 1I3NA 1L7DA 2RH8A 3GNQA 3OJEA 3AY7A 4XGKA 4E5YA 2VWQA 2NVBA 3JTMA 4IXWA 1A9ZA 4BMSA 4FCCA 3AM4A 4GLLA 4PZDA 4H15A 2R6JA 3AOEC 4J4HA 2XAAA 3MJVA 1E92A 1YS4A 2VZ9A 4WCFA 4JNKA 2YQ4A 5EMHA 2DPGA 5G0WA 4E32A 5JO9A 4NU6A 3BMCA 1GQ2A 3B1JA 2EHDA 4ZQBA 4ZJUA 2EF1A 4R3WA 4IUYA 1ZXBA 1LBEA 4XB2A 4YXFA 1HSOA 2E49A 3HJAA 4C7KA 2GUGA 5K9ZA 2PA3A 4R1UA 3KYCB 2JAHA 3I1JA 5HM8A 4KDEA 5GMOA 4CMGA 4BMNA 3E03A 1YH3A 1VL0A 3RJ9A 2PK3A 3WDSA 3QIVA 2OO5A 2C82A 4HWKA 1DHTA 5KVQA 1QYVA 1M2WA 1TT5A 3ETEA 3Q6IA 1YL5A 2BFOA 3V1YA 1DIBA 1G0NA 2ZK7A 4E31A 1E5LA 5A5EA 2GGSA 2HMWA 3H9GA 3FNFA 3ASUA 3PJDA 3WWZA 2O3TA 4IINA 3VH4A 1V3UA 1PS8A 2H5LA 4MVJP 5A3VA 1ONNA 3IDSA 2VYVD 4JK3A 2XF8A 2OGUA 5THQA 3JQ9A 4YRBA 3GVIA 3U9LA 2HRZA 4NK5A 1FK8A 1A9YA 4IQGA 3ANMA 3QWHA 1QR6A 3C24A 1FXSA 1XGKA 1K6XA 3LC7O 2D4AA 2UUOA 3WYBA 4TZKA 2HUNA 1QP8A 3WGYA 1UDCA 1RJWA 1EK5A 2P4QA 4PZCA 3ZNOA 3ZWXA 3E5MA 3KSUA 1ZK1A 4Q3DA 4NQZA 4BIIA 5JS6A 1YRLA 1O6ZA 1RWBA 3PK0A 4XZ3A 4DA9A 1P1FA 1UZNA 2PZKA 2WYWA 5T8KA 1N8KA 1VM6A 2YHUA 4WLUA 4XYGA 4DLBA 1WXDA 3TDKA 2B4QA 4OKNA 2VHVA 5AYVA 2JHGA 5B4UA 3ICPA 2H1SA 1H6DA 2W2LD 3H2ZA 4EGFA 4UAGA 3WGIA 4Y6RA 3NAQA 3MJEA 4MVJM 1T2AA 2Q1TA 4BNZA 3HHPA 3WBFA 7MDHA 4DXHA 3KTDA 1Y9AA 2Q1UA 1YBVA 1UH5A 1Q7CA 2ZYGA 1LRLA 3JQ8A 3JQAB 1VL6A 5JAIA 4KDFA 2HMVA 5JMPA 3C1OA 1GD1O 3PGXA 3PPIA 1MC4A 4WLNA 3GRPA 5ENDA 2EKLA 4PIVA 3WLFA 1CIVA 1P3DA 4N5LA 2EG9A 1WMBA 4IIVA 2I3AA 4YT5A 1YL6A 3MZ0A 4R54A 4LCJA 4IXTA 3ZH2A 1K89A 1JA9A 2C2XA 4NJOA 3HG7A 3L9XA 4BNLA 1VJTA 4YA6A 3LT2A 3EUWA 1ML3A 4DPLA 3D4OA 4TWRA 1QSGA 2BH9A 4EJ6A 2CVOA 4CQLB 3L4SO 5AXBA 3OMLA 4XDYA 2HK8A 3JQGB 3A4VA 4CLEA 5EJ2A 1N7HA 1Y8QA 4CLOB 2Y05A 3MJ4A 4HNGA 1I30A 2PGDA 4LRSB 1PL6A 4XGNA 4EJ0A 1KVTA 2X23A 3PQDA 5KWEA 4II2A 4HY3A 1KEVA 2Q3EA 2PGJA 3PRJA 3UICA 2ZTVA 4HADA 4E2WA 3AWDA 2J3KA 3QVSA 1YQDA 1FDVA 1YKFA 3G1UA 2Y1DA 4PG7A 4PN3A 2BGMA 2D3TA 4GSKA 2C5AA 1N5DA 3E82A 3HN2A 4BO1A 2OFPA 5KIAA 2OP0A 2VRBA 4S3MA 1O0SA 1E77A 2R00C 2C7VA 5F3RA 2GZ3A 1K5HA 5A06A 2ZKLA 4ND1A 4R16A 1IZ0A 3LZ6A 3LF1A 1BVUA 1XEAA 3H3JA 4HXYA 1ULSA 3I3OA 4LVUA 4Q3AA 3RUDA 1ZW1A 2GNAA 3GAFA 4TKMA 4INAA 4W7HA 1H5QA 3RC1A 3GZ4A 3HDHA 4J7UA 4HFJA 5LDHA 1GUFA 4CM9D 2I65A 2HRBA 1R0KA 1QKIA 2WTBA 4WOJA 2J5RA 5JAZA 4ND2A 5COBA 1SAYA 3RUAA 3WGGA 4PLGA 3WQRA 3JQBA 3F5QA 4FN4A 4YB8A 1PS0A 4D3DA 4DGSA 4E2ZA 3TWOA 1HT0A 4LVCA 3ST7A 3GVXA 3OETA 2O3UA 2BGLA 4OYRA 3RIHA 1PZGA 3VPSA 4CODB 4R3NA 3HDYA 5I7EA 1DIRA 1SNYA 1E3JA 1NXQA 5FI3A 2NVUB 3QWFA 1U7HA 1NR1A 5TC4A 3FTPA 4NU5A 2P5UA 1LSUA 3DOJA 4DRYA 4IJUA 3B6ZA 5AXDA 2NUAA 4CUJA 2AQ8A 4DL9A 3GPIA 5IN4A 3FBTA 4IJVA 1RM4A 1ISMA 1ZSNA 4AFNA 4NFSA 2GF2A 4EZBA 3HB5X 3KHUA 1TVEA 4R9RA 4LN1A 5L53A 3DTYA 4K1LA 5IZCA 3JD1A 3U49A 3PDJA 2Y93A 2ET6A 4PG5A 3WX0A 4CMEC 4YT2A 4K28A 3NT2A 4MO2A 1DDOA 5T5QA 3HWRA 4ID9A 4XX0A 4E21A 5JDCA 1IULA 1Z82A 2FN7A 1HETA 2I6TA 3HE3A 4RO0A 4A0SA 3LSYA 2CVQA 1RM3A 3GMSA 3HADA 1NQ5A 4MVJA 4I8XA 4QX6A 2VWPA 3OQBA 5G4LA 3K73O 5CDYA 3GDFA 4CQMA 2D8AA 2Y0DA 2D1YA 2HK9A 4P8RA 5HA5A 3T7CA 3WMWA 4DPKA 1W4ZA 4E12A 2Q1SA 4U0KA 1E3EA 2VCYA 3AI1A 3B70A 4KWHA 1LDMA 2D0IA 4B3HA 4F6LA 4DC0A 1YGYA 4JJIA 1GQYA 4KWIA 2Y1OA 3PGJA 4DIFA 5L9AA 4BGEA 1UP4A 2IE0A 1AN9A 3ONDA 1X7HA 4NBUA 3M6IA 5A05A 1LXCA 1C1DB 1ID1A 2WJPA 3NTOA 2VNSA 4YT4A 5I7VA 4D3FA 1Z7BA 3GPDG 4BO0A 4BNUA 1GZ4A 3JYLA 4KP7A 4OO3A 4FD3A 3R1IA 3DBRB 4CM8A 3DMYA 3AM5A 2Q2VA 1EE2A 4L75A 4MINA 3N7UA 3GT0A 4D44A 1LDBA 1NVTA 2WD7A 3AU8A 1DB3A 1ZJZA 2B36A 2VWHA 3NTRA 2BRUA 3F4LA 4RPLA 4XYEA 2F1KA 3O9ZA 3FSRA 2Q46A 1GEEA 1E3IA 4S1VA 2JJYA 3OSUA 1P9LA 4FGSA 4NJMA 3JYOA 3ZHBA 3FD8A 1D8AA 3K8ZA 4DBZA 3GY0A 4YJGA 1Y1PA 2GZ1A 3DBLA 1K6JA 5G2OA 4W4TA 1JWAB 3DBVO 5EN4A 3KLPX 2E82A 1NPTO 5ENVA 4GGOA 3KLMX 3N58A 3OQ6A 5DF1A 5IG2A 1PIWA 4B8WA 4BNJA 2BI7A 3ONFA 2CDCA 4MKRA 2YYYA 4TRJA 3BTUA 4YCAA 4D41A 1FDTA 1BXKA 3JCZA 3QQPA 4RPGA 2PFGA 4CR6A 4KUGA 1H0KA 2D5CA 4FS3A 4MP6A 5KJ6A 5A1TA 2DQ4A 4NI5A 1U2DA 2NSDA 1I36A 3INGA 1DRVA 2YDXA 3JD2A 4RJTA 2YDYA 4IDCA 4GH5A 1ZK0A 4PLHA 1A7KA 1OBFO 3VHRA 1CF2O 1Q7BA 3DQPA 2FPGA 3E48A 3QY9A 3OBBA 3UXYA 5MGBA 3PQFA 3WG9A 1VI2A 4F45A 2DTEA 1EUCA 3PHGA 1P1JA 1YJQA 1YOVB 1H6BA 4FOSA 4BGUA 4YPOA 2P9CA 2GERA 2BGKA 1VC2A 3EY4A 2IEDA 4X54A 2HJSA 3RJ5A 3ZNQA 1ZEMA 3BMOA 3BTVA 4NG5A 4NBRA 4XQGA 3K2EA 4J9VA 5DCUA 4Q3EA 3NJ8A 4RQTA 1BXZA 1DSSG 2VNAA 4ITUA 1HYEA 5GZ3A 3SVTA 1BWSA 3TJRA 1DLJA 2B83A 3QWAA 3RWBA 3B1FA 3SBOA 1HYHA 2GN6A 4QQRA 4YJHA 3OHSX 2EEZA 1NFRA 3QSGA 2I9PA 3ULKA 2NU6A 4KOAA 2Y99A 3FF4A 5I7FA 4GVXA 4BKPA 1QMGA 3H6KA 2JCXA 1NYTA 7ADHA 1RYDA 2CVZA 2Y68A 3S55A 1GQQA 1KBZA 3BHJA 1FDSA 5JBIA 5TX7A 1UZMA 3BYZA 4FC7A 4WECA 5L45A 4OGWA 5T57A 1DPGA 1MG0A 3H9JA 1WPQA 3FWZA 1ZCJA 1KYQA 1IB6A 3ROMA 1IPEA 4H16A 4BNYA 3D3WB 1LDGA 1MP0A 1I3LA 1R12A 1MV8A 3HQ4O 2WYUA 1UXIA 1MX3A 4BO2A 2DBVO 5BNIA 3OM9A 4OXYA 3CMMA 1R66A 5CAEA 4E13A 1YE3A 3ZU2A 4BNTA 3I4FA 1PZEA 3AI2A 4DBVO 1GADO 5COQA 2HQ1A 4L76A 3ZHYA 3DWFA 1DJQA 3EW7A 3C7AA 5JCXA 1E6WA 4XCVA 1XU9A 4XYBA 2CMDA 3NYWA 4RVDA 4JP3A 4TKLA 3UVEA 3VH2A 2NTNA 1T26A 3GVPA 3RBVA 1FJHA 1M66A 3HUDA 1MGOA 4WNCA 1DLIA 4HKTA 4Z3DA 4I9HA 5F1PA 4IPTA 2V65A 1UP6A 3VKVA 3F9IA 2ZQZA 3CZRA 3VPXA 3GH3A 5G0SA 2C59A 3U4DA 1B15A 2YHIA 4Z0TA 3KOUA 1QYCA 5ER9A 1NAIA 3H9UA 1NPDA 3IAHA 4FFRA 4ALIA 1RM5A 1SCUA 2VUTA 3SEFA 2C2YA 4MVJD 5J23A 1C1XA 3R6DA 1TI7A 1GPJA 1TXGA 1Y8RB 5GY7A 4BB6A 2AXQA 1KVQA 2NWQA 2VT3A 3FN4A 5ILOA 2Y0CA 4WASA 4B4UA 3RU7A 1SOVA 1PTJA 3C85A 3DMTA 1VRWA 3A9WA 4HP8A 4IY1A 3VPGA 2W2LA 3UH1A 1E7YA 2YJZA 4LK3A 4DIOA 5CFZA 2EJWA 2X58A 2AW5A 2IZ1A 2I3GA 1ZMOA 1GV0A 1HF3A 4WNIA 4Z9YA 3GHHA 1YDEA 3AJRA 5G0TA 1U28A 2J3JA 2YW9A 4B79A 4TRRA 3QVWA 5JY1A 3LQFA 2PD4A 3PZBA 5DBGA 3VZSA 1OAAA 1Q0HA 4FPXA 3VH1A 5KJFA 1U2GA 4PLCA 4YYZA 4BOYA 4U8GA 1DAOA 3I83A 5GZ6A 5B4TA 2ZCVA 3AFNA 4OL9A 5DP2A 4J16A 1GAEO 3ICCA 3ITDA 3KYDA 1DC4A 3ENKA 2WE8A 5IDXA 2LDBA 2O7QA 3EMKA 3DFZA 5U1PA 3NRCA 1BXGB 4NK4A 1LNQA 4QT0A 4D79A 5CG1A 3WXBA 5JFOA 1I2BA 5AVOA 3ITKA 3SLKA 3JQ7B 1KERA 1PWZA 3NV9A 3OICA 3QW2A 4LMPA 4AJ1A 3ANLA 4CLHA 1AHIA 3I9MA 4EITA 1Z74A 4BKQA 1LUAA 5DZSA 3I4CA 2X86A 1QYWA 2O50A 3L4BA 3TL2A 3ZWCA 1KETA 2BI8A 1D7OA 5BT9A 3DL2A 1I3MA 2QYTA 4BNGA 3TFOA 3QLJA 3IKVA 3GNSA 1WVGA 1GUYA 3WSWA 3JQCA 1T2FA 1V8BA 3R0IA 3LT0A 5F1KA 2PNFA 3WNQA 3GR6A 3OJLA 3VDQA 1MFPA 2OBYA 5G4KA 4BV9A 2QX7A 2Q1WA 2JCVA 4WCFB 4DMLA 3TZKA 1VLLA 3BMCB 2FZWA 1MXHA 2OHXA 1PR3A 4L73A 2ZYDA 1O5IA 4OKIA 3JQBC 5BNTA 1LDNA 2Q45A 1R4NB 4GVLA 4OIMA 1T2DA 5G0UA 4OSPA 3GZNA 2Q4BA 3DZJA 1ADCA 2PD6A 3PDUA 1PJBA 1WZIA 1XELA 5EERA 5CEJA 1XR3A 5F1OA 3ZWOA 3I9NA 1GFSA 1TT5B 1LEHA 3MWDB 1LLCA 4QTZA 5ILGA 3JQFA 2EP7A 5EINA 4G5HA 4PVDA 1UUFA 1YWGO 1Z6ZA 4XEHA 3S2IA 3TL3A 3FPLA 1XHLA 2D59A 3K30A 3EAGA 4Y98A 4BNIA 1ZK4A 4LMRA 4JGBA 2IXAA 4EUFA 3HN7A 4GL4A 4MVJH 4QSMA 3VVBA 3U3XA 3PWZA 4RDIA 1XSEA 3WTCA 4O0LA 3O38A 4O1MA 2X5OA 3PZRA 2AEJA 5IZCC 1OI7A 4Y8VA 1U9JA 3M1LA 2FR8A 4F6CA 4XIYA 1F14A 2AQKA 1HE2A 5IFLA 3Q9NA 1XA0A 3EC7A 4ROSA 3F46A 1WDKA 4RDHA 8ADHA 2CF5A 3PIDA 1HZZA 4RF5A 3K92A 2NADA 3NT4A 1HLDA 1S7CA 1ZBQA 1T2EA 4NNJA 4BNVA 1ZO8A 3K6JA 3HDJA 3VTFA 1X13A 4Q39A 4P38A 4EEZA 4QXMA 1I5RA 1ZSYA 4HFRA 2WDZA 1I24A 4UUNA 2Y67A 1LDEA 1M67A 1ISFA 3K2BA 3TZ6A 2QRJA 3KVOA 4WK6A 1PGQA 1F12A 2DTDA 2G1UA 3GDGA 1LSSA 4BNNA 2AEMA 3WICA 1HE5A 4HV4A 1QG6A 1R6DA 2X7HA 3LLSA 1BGVA 3MJCA 3SC6A 4YAEA 3SJ7A 3UCEA 4CLRB 3CIFA 3EK2A 4E33A 1NNUA 4RGBA 4DVJA 4YRDA 3U4CA 4B4VA 4CM7A 4PLPA 3OEYA 4JJFA 3JQ8B 5LCXA 2DLDA 3DHNA 2P91A 3QHAA 5ITWA 4L4SA 3NDRA 5CDGA 4WJZA 3VAZA 1RYEA 4DLLA 4EUHA 4II3A 4XJTA 4FBGA 4IDAA 3LT4A 1CEQA 3G79A 4FFOA 4M49A 4BHTA 2GSDA 4IDDA 5THKA 4AJNA 1TT7A 2DFVA 3L9WA 3ZN2A 4NDNE 4UULA 1XG5A 4AICA 1NM5A 3C3XA 2AA3A 3O8QA 1ENYA 3FBGA 2C5EA 5TGDA 2YY7A 1FMCA 5L95A 2HMSA 1P0CA 2PKRA 1DFHA 1UXKA 1KVUA 3SLGA 3WR5A 5C7LO 5JSFA 1FDUA 1NWCA 1OC4A 1IPFA 4CM5A 3RQSA 4AJJA 1PQWA 2BF7A 1Y8QB 5A9SA 3WS7A 2Q2QA 5CP8A 4QO8A 3NJ4A 4KTTE 4AJOA 4ND4A 5CHEA 1W6UA 5BNFA 2FR0A 2HMTA 3AU9A 3H5NA 5JMWA 1E7RA 1Y81A 3PLNA 1UAYA 1I33A 1SO8A 2GPTA 4O5OA 1HE4A 2AEFA 1R4MA 4R51A 1PJTA 3AUAA 4YT8A 4XKJA 4HX5A 1B8PA 4E5KA 4BB5A 5JO0A 3OQ1A 1B3RA 3CE6A 5CG2A 4NFYA 3I23A 5COAA 9LDBA 3A28A 1ZKMA 3RKRA 4W9NA 3AM3A 4J6FA 3QE3A 1A27A 2B0JA 2CDAA 2J5KA 1GCOA 2IYPA 1J6UA 1I2CA 4YJDA 1HDOA 3PYMA 5L40A 1R0SA 1UXJA 1DC3A 2LDXA 4DIBA 1CYDA 3BZUA 4D45A 4GX1A 1HSZA 1KC1A 4QFDA 1KC3A 3AI3A 1YVEI 4KQWA 3AY6A 4XQEA 2V6GA 3PJEA 2I67A 1NHGA 1ZUD1 3MJTA 1MFZA 1KVSA 1GZ6A 1M75A 4TQGA 2Q99A 3OA2A 1KVRA 4NZ9A 2GRAA 1H6AA 1ZNQO 3DO5A 1ISHA 1ZH8A 1NQTA 4OHUA 4DYVA 2PLAA 1LI4A 5K6AA 1WNTA 4JBIA 3PFWO 4CMCA 2ZTMA 5A9TA 1N7GA 1HWYA 3OJOA 1CQIA 1SMKA 1A72A 2VOJA 2W98A 8LDHA 3OH8A 4RPHA 3IP1A 4QEDA 4E0BA 5K6AC 4XRRA 4DWVA 4XYLA 1P74A 2DC1A 4E6PA 3PLRA 4GWKA 2J6IA 4XQCA 5AXCA 2I99A 4CMAA 2G5CA 3KUXA 2NVWA 3S2EA 4FFPA 5TS3A 3MCVA 3UUWA 2EGHA 4CLXA 4NBVA 3Q11A 1DAPA 2VUUA 4JIGA 2XXJA 4WLVA 5KJCA 3D5TA 3HFSA 1CRWG 4ILKA 2B5VA 4RV9A 4UEKA 1NASA 3ADPA 1Q0LA 4J49A 1U8XX 3ENNA 2BELA 4XRGA 1A71A 1Y5RA 3H5AA 4MKZA 3NDJA 3PYXA 3W8EA 2O7SA 3UFXA 4GSLA 3DBHA 3LF2A 1XCBA 1G0OA 3GG2A 3PI7A 1EQ2A 5DP1A 3WB9A 4E5MA 4UUMA 4GKVA 3OP4A 4J9UE 3RBXA 1U7TA 2NTJA 1X1EA 3M1AA 1PGNA 1GY8A 1ORRA 2QQ5A 4IMPA 3WYCA 4D43A 3RUIA 4IGEA 5TJ9A 2JD2A 4WLFA 2DFDA 3EDMA 4EJMA 1AUPA 1ZMTA 3AW9A 2JFFA 4FGWA 4CQMB 2FMUA 4CUZA 4U6QA 4J4TA 2RBEA 2VTDA 2C20A 2FRDA 1NPYA 3WJAA 1I10A 1KS9A 2D5AA 1Z73A 1LTHR 4KQXA 4BNWA 3HFGA 2WYVA 2ZTUA 3EZLA 1YDWA 3ORFA 1GDHA 2UDPA 5KOIA 2OORA 3UW3A 1MB4A 3TOZA 4YAJA 1IY8A 2HMUA 4N7RA 3DDNA 4RF4A 4AJPA 2PZMA 1BVRA 4XR9A 1X0XA 4FFNA 2HK7A 3CUKA 3DC2A 3ROQA 3A1NA 3H65A 4ALNA 4CM8B 4G81A 1DIAA 2UYYA 3FWNA 3LYLA 1UDAA 4XA8A 1DO8A 2WD7B 3RFVA 3DAPA 3E5RA 5L7WA 4PGFA 4U7WA 5KNLA 3UGKA 4OH1A 2W2KA 1BG6A 2F00A 3M2PA 2D2IA 3KB6A 3JV7A 4KUEA 3GN1A 4NBWA 4NJMB 5JXWA 1QYDA 1U8FO 3ZHZA 4YJGB 4IDEA 4NIMA 1E7SA 4BO3A 4FDAA 4XJSA 3AOEA 2E4AA 3GGPA 4DPMA 3RROA 1PU2A 1A5ZA 2GDZA 3F3SA 1N2SA 3BMNA 3W1VA 4YJFA 1E0DA 3DXFA 3PIIA 3VTZA 5CPBA 3GN2A 1QORA 3GVHA 4OOEA 4XGIA 4IS3A 1UXGA 4CMKA 4W6ZA 1BDMA 1P33A 2A9FA 4ONEA 1P1IA 2Z95A 1H9BA 2OUIA 3L4BC 3QVXA 2ZCUA 4PLTA 3VZPA 2O4CA 1ENZA 3RVDA 1JVSA 1LA2A 4CMIB 2B35A 4ALMA 1VKOA 3K96A 1LC0A 1GL3A 3PEFA 2CFCA 2NU7A 4NH4A 2X0RA 3BTOA 2G17A 4FC6A 1RM0A 4UVGA 5H81A 3WGTA 2P2SA 5I9MA 4A5OA 4J3FA 1M6WA 4E2XA 1QRRA 2UVDA 3W6ZA 5AXAA 1V9LA 5DCYA 5AOVA 2YV1A 1IYZA 4DTIA 4EW6A 3U5TA 3C8MA 2AE1A 5KVVA 4J2HA 1B0AA 3BMOB 1DXYA 2TMDA 4BGIA 1LLUA 5TT0A 1X0VA 3ON5A 3W8DA 4DC1A 3OEWA 3UAGA 5A03A 2CNBA 3I9OA 1QXSA 5B4VA 2X6TA 4JROA 4OXKA 1T2CA 3ETGA 4RLSA 2GASA 2YQ5A 2YZ7A 4BO7A 1KOLA 3PFFA 5B37A 3RUEA 1C3VA 2X9VA 3TFQA 2NNLD 4OQZA 2HKIA 2X1HA 4OOFA 5ITVA 4KUHA 4M86A 3QA9A 1ZIDA 4IDBA 3X2EA 4YJHB 4RQUA 4ZU3A 4N5NA 3E9NA 2GCGA 4R9SA 5L4LA 4NHEA 5LC1A 1IOLA 2ZTLA 4QUKA 2HU2A 4RVFA 2SCUA 1E7MA 5L7TA 5T6BA 2NU9A 2VZ0A 4A7PA 2EGGA 1HDCA 4FJ0A 2FR1A 4R4JA 2GO1A 4AL4A 3IUSA 3CZMA 3IUPA 1Y9EA 5HBRA 1PJSA 2YFHA 3HSKA 5DOZA 4ZA2A 3L0DA 3WGZA 2FSSA 4H7PA 1JAYA 1HDGO 3IMFA 3TZQA 2ZJ1A 3HDQA 3AFMA 4WCFC 1JLLA 4YVFA 4UREA 2DBZA 3WGOA 1C0LA 2AQHA 2DBRA 5C5IA 1B8UA 2VT2A 2WM3A 4P22A 5K0ZA 5DOVA 5DT9A 1WMAA 3ZWYA 3I9KA 1HEUA 5TJHA 5BSFA 3ZWVA 1PJLA 4GAEA 3D4NA 4TRMA 4M55A 3F1KA 1PS9A 4P4GA 4Z0PA 4D42A 4RVUA 5BSHA 5KKAA 1JQBA 2VUSA 3UF0A 1TLTA 4B3JA 1ISIA 1YXMA 1BW9A 3I6IA 4NFHA 3PYLA 3GEDA 3JQEA 3W4JA 4A03A 2VN8A 2C7GA 4AJKA 2Y66A 4UUPA 4BKOA 3K9QO 3IJPA 1K0UA 3FI9A 2NLOA 4TVBA 5GZ1A 1PQUA 1OZAA 1NWHA 2YHIB 2FPIA 2HDHA 2IEBA 3T4EA 4E30A 4MVJG 5A04A 5C7OO 3JQ9C 2PV7A 2VHZA
chains in the Genus database with same CATH superfamily
3MJFA 1J5PA 2H2FA 4CM3A 3BQMB 1TRKA 4ZDIA 1TTQB 5HUHA 4INPA 2YICA 2MYTA 2OC9A 3HU2A 3L05A 4KFRA 4MYTA 2QORA 1AB6A 1C1XB 3FCEA 4UTNA 2ZTSA 1R6XA 3F4BA 1UXHA 2Q41A 4BTVA 3GLFA 4Q4AA 3BXXA 2HTEA 4KQGA 2IBMA 4CKEB 1M1NA 6GPBA 4O4IF 1FXWF 3N0RA 1KEUA 1V3VA 2FSHA 3CWCA 4OBXA 3G8AA 3WWCA 2IYOA 4JR1A 4GO1A 4HAWA 1AQYA 1AF4A 1XZJA 2OG1A 2W2NA 3A3KA 3DAGA 3BJZA 4BXOB 1XD8A 2FHSA 2DAPA 1Z0SA 1WRBA 3P19A 3PEUA 2EXXA 1IEVA 2PJUA 3N59A 3U0BA 5KAMA 2Q2WA 3QV1A 2ZUWA 5TRTA 1DIGA 1XZLA 1RPAA 3B7PA 3BE6A 4KZPA 2JLQA 4X1OA 2W4MA 3NNNA 3N76A 4BMZA 1YDGA 5CIWA 2UYOA 1D4OA 2FKAA 3UOGA 1D1SA 1DQZA 2PJRA 1U0TA 2GBCA 2Y1FA 3AJ9A 4IDGA 1VMDA 3MVEA 4GOKA 3LOQA 1QGOA 2HY7A 2CJFA 4YPFA 1F8GA 2IXEA 4EG7A 5IBCA 3DBIA 2Z3WA 5FPKA 3HCAA 4LA4A 3ANYB 2NO1A 4Q1CA 1N3YA 3IVCA 2P9BA 3PQ6A 4B3GA 1NLUA 1CY4A 2H9IA 4H6PA 4AIIA 2OZEA 4ASUD 1EAYA 1KXJA 2JFHA 5HKAA 3RT1A 5K3EA 3A1DA 1O94A 4ZRMA 2QL9A 1P17A 4UZFA 3FKJA 3KUKA 4YI3A 2C61A 5F3WB 4LDRA 5AKXA 2PRYA 1MZPA 4A8HA 1Z7YA 4KSBA 5ES4B 1J8FA 1BTOA 1YJXA 2AHOA 2HSGA 1KH1A 1TCCA 3F67A 3L8HA 1QQ5A 3PUJA 4LJ5A 4QSHA 3SMVA 2BHLA 1GU7A 4RIFA 1T1JA 3OLZA 4R8LA 3F3YA 2F9LA 3HNPA 4JT2A 3OMWA 4NS4A 3S29A 4EPRA 5ADHA 3COVA 3R5SA 5CT9A 2ZI7A 3BIOA 1UKZA 3O1LA 1FYWA 4JYMA 4L7VA 2XOKA 3M83A 4RM2A 2OG2A 3BXGA 5IN5A 1WMDA 1KZHA 4KLCA 3NBKA 3C98A 2N75A 5ULLA 3BCHA 2QJWA 4IFBA 8GPBA 4L2IB 2YWBA 1JKFA 1I6LA 1H05A 1S1MA 2R44A 1WKCA 3HRHA 2I62A 1NW3A 3UXMA 1NN1A 2R5NA 1OR8A 5BWNA 1ZVMA 2PGOA 4KHZA 2YY5A 4ZDKA 3BGSA 3GU3A 3UAXA 5FBKA 4KPUB 4OY3A 1OIWA 4BGDA 5HTOA 3RPEA 1FE8A 2YXLA 5FNZA 4Q3NA 4KQKA 4OLFA 4GI7A 3SIRA 4BKRA 5BN5A 5IKEA 1V37A 5IK2D 5C8YA 1G41A 1OX4A 1I01A 1IG0A 3N8NA 3AUSA 3L6EA 1E4EB 4CMEA 1S6YA 1J0XO 1Y4UA 4HWOA 3ZWPA 2RBGA 3DYIA 4C2AA 4E15A 3FOCA 2Z56A 2HAEA 4ZIRB 4O33A 5T67A 3RS4A 3W8NA 4ZMBA 3EXAA 2PSHA 5A4AA 4BQSA 3PFGA 3RLIA 2P9FA 1FEZA 4DCSA 3NHLA 5C8ZA 2ZUUA 1ONOA 3AGQA 4YDQA 5HSGA 2IOFK 3G49A 5BQPA 1RXYA 1XMSA 5DK4A 1M34A 1SKBA 5LB2A 3VOAA 5KSYA 4OH7A 4KRGA 1VKHA 4YDHB 3U7JA 4EENA 3O92A 4RTMA 3IEMA 4D7AA 1S2DA 1W94A 2GN8A 1IEQA 1PK9A 3OURA 2Q4OA 4PQYA 2ZQYA 3M7IA 1ORWA 2AZXA 5DCWA 2REXB 2D2EA 3ZUGA 3PL5A 1Q19A 4KK4A 5I7WA 3AW8A 1ZEJA 3I92A 3VC2A 3JALB 3AL3A 5K6TA 1ISJA 3ZV3A 5I3ZA 1JU9A 4OHOA 4LBVA 3UB2A 1M6YA 3R0JA 4C4TA 3EUFA 3PHIA 2DUJA 3LRTA 4Y1RA 1PQPA 4Q5IA 4EEXA 1BHSA 4PLZA 2JFOA 2YVLA 2P27A 4YREA 2OFFA 3V97A 2BTOA 4UVDA 1PI3A 4YRZA 3QWBA 4AJIA 1OQAA 3K2QA 4DMKA 3AEKA 1NFFA 2Q5JA 1GO2A 2AWNA 3GA5A 3ZHXA 3PTLA 2XXBA 3O26A 4JAVC 3R6LA 3Q7TA 2VI5A 4LOAA 5CTJA 5TPZD 2G1AA 3HKBA 3NT5A 3I52A 4AP5A 2EARA 3NBAA 2JHFA 3QY0A 2XCIA 2JKVA 5BMOA 1KI9A 1OLSA 2ADFA 2YOHA 1HE8B 3MTDA 4JSYA 5FAXA 1WHSA 1OFUA 1G5RA 3AUUA 3H5WA 4GECA 4KFUA 2NO9A 2CMHA 5K8CA 3G88A 3K05A 5J43A 1WSAA 2QA5A 3RANA 4A0HA 4AY4A 3V1TC 2H92A 4NENA 4WZBB 3KRTA 3VH3A 2OBNA 3LO8A 1OFVA 3P4UA 5ED0A 2G1KA 5FBZA 4G24A 2NO4A 2PBFA 3O0DA 5K8UA 3FCAA 4NOJA 4ZDJA 2QI9F 3LQ4A 1MA0A 1SXIA 2FW1A 2HRDA 4CLDA 2R68A 3LHIA 4DAOA 1M1YE 4F4FA 2WUFA 3DFIA 3ZJ4A 1C9DB 1E1QA 1EK6A 4Y2QA 2BEJA 4YRJA 3RC8A 3C3PA 5L4SA 1XQYA 2W7TA 3K0AA 5PNTA 3VPHA 5AVZA 5D84A 4IJQA 4WXPA 1WLYA 5GOZA 4KO1S 3OPYA 4EI7A 1GCGA 2J9YB 1KJQA 4LHVA 4C0HA 5JNLA 2IXBA 3O4HA 5K0LA 4HDAA 4R1MA 3KT6A 3VAAA 3MAAC 3ZU4A 1MLDA 3R3SA 1PFUA 1KH2A 1ZI6A 2F3TA 1NAHA 4DKJA 4BVEA 3W9BA 2VPIA 1BU8A 1F4PA 1W73A 2JJ1A 4XYMA 3TW4A 1XL1A 3MS4A 2BEVA 2TMGA 4G5YA 3RVPA 3TLEA 1ZUIA 4Z7OB 4ED9A 5JFGA 4DR4B 1PT5A 3LXMA 1VSVA 4Z8XA 2VTEA 3E8XA 5K51A 2YHAA 1FFXA 1J2RA 1DBVO 2LW7A 3M6AA 3ME5A 2C42A 4K2HA 1B93A 1FA9A 2F43B 4BVBA 1W4CA 2JLSA 2QMUA 4XPZA 1QG2A 3FRJA 1GWNA 3DZGA 4NPCA 3Q9UA 5DGCA 2BGNA 5L51A 3PDHA 3LP8A 3IX7A 2QZPA 4HQRA 2Z5GA 1ZC4A 2J3LA 4JJKA 5DX1A 1INLA 2AFIB 2AOXA 4NEGA 3WOVA 3IR6A 1A8IA 5J59A 5KTRA 4NYJR 4GBGA 1EK0A 4P93A 2IWRA 1ULAA 1HA3A 1WXFA 1ZIXA 4EMUA 2XWBF 5DBIA 4BASA 5FBWB 4RULA 4MWSA 3AVYA 5G2OA 1XU4A 1E64A 2X77A 3D1LA 3NZEA 13PKA 4JC5A 4P4NA 3DDUA 1MAVA 1XRNA 3LPAA 3EWSA 4C21A 5EQDA 3WLAA 3PG5A 5GADl 3EPRA 2ZR9A 1XF1A 1MOSA 2H31A 2O0LA 3C8ZA 4ZHQA 4ZQIA 5KINB 2LCQA 4MO9A 2C5BA 3CISA 1HEYA 4AQYB 1RZRD 2UUPA 1MHPA 4NV3A 2EQAA 3BHIA 4H2DA 1A9XA 2OV6A 4PE5B 5JW6A 1N3BA 3MPUA 1HQCA 1C29B 5FQOA 3ZPXA 3DMHA 3A04A 3DUFA 2OHJA 5D51S 3OQPA 1Y5MA 2W6QA 1HDEA 4BFVA 4F3RA 2C2MA 2CCKA 4R41A 5IJ9A 1EX9A 1LRJA 1NE7A 4MR7A 2HDNB 3D6MA 2LD4A 3LJKA 4M8SA 3ZDQA 3WBJA 1T5OA 5FLYA 1C50A 4E09A 1PJ2A 1L7XA 1YB7A 4D4KA 3ZCVA 2EFJA 5KEIA 1Q74A 3TNYA 2YBDA 2FWBA 1FSSA 2X8BA 2K5UA 1J2JA 3I2HA 4Y9TA 3AEQA 3HNOA 1GU1A 2XVYA 3E9YA 1E8DA 1G2OA 1E0KA 3ZDBA 1NZJA 5HHTA 2PM8A 1VLHA 4OQQA 1N2HA 2QDXA 1SZDA 4O4IB 1WB9A 2B4KA 3O21A 3UB4A 1E63A 3Q10A 5IBPA 1GTMA 1TCUA 4FFBA 3O3OB 1V35A 2ERCA 2MR6A 4DIEA 2DX7A 2QW1A 4DRXB 2IQ5A 2VXCA 3DXYA 2AF4C 4J76A 4JU8A 4LGCA 2FQYA 1XZGA 3BFJA 4HVAA 3P2MA 5HZGA 5IAOA 2CXXA 3I01A 4DM4A 1SJ9A 5H82A 1QIIA 2B61A 2X14A 4HNUA 4EDFA 2A9OA 1RBMA 3IKTA 2KQUA 1O95D 2ZRFA 1JA1A 3FTNA 3PUKA 2POQX 4OLHA 3TPFA 4QNRA 4AB1A 4ZEVA 3CBGA 2Y2VA 3DHYA 3IHTA 3NTLA 4WDRA 3U81A 4AZ0A 3IAFA 4DA8A 1QIKA 4RH0A 5JYBA 3EF0A 2ZI3A 1C5KA 3T7DA 4CUKA 2W48A 4EI2A 4QPDA 1Q11A 1N1MA 3D2LA 1J2TA 2L17A 3ROKA 4CG2A 1KPHA 1SKYE 2AZMA 4TTVA 1JWBB 3C6QA 1ITZA 5CM8B 3ZGOA 3FOWA 5JAQA 2W4QA 5AJWA 3NOOA 3ROGA 1E6EA 3QLEA 1S0UA 2HA0A 3U62A 5BURA 1WW3A 4YRIA 3KXKA 4BV8A 3DFFA 1RAIA 1RWWA 2ZATA 3HA3A 3KHKA 4BP9A 5EA2A 1OWLA 2J6CA 1H2XA 1IY0A 1MT0A 4JXKA 5DULA 3U1VA 4IHQA 4BLPA 2DG2A 1NHWA 2FX2A 3ASZA 4PNEA 4FIDA 2OGWA 4NR0A 4PZ0A 3G9ZA 2WFLB 4DMUB 1A2QA 1KU6A 2P41A 3EIXA 2OSBA 4FXPA 1NQVA 4N5MA 3RCBA 1Y34E 3ABQB 2RDMA 3EXEB 3K9CA 4UNIA 4XIJA 4C4YA 2ZYAA 1KRHA 4B3CA 4IIFA 1KK1A 4HYEA 4J8PA 3RYFB 5I8ZA 4NZNA 5D3MB 5FPTA 1VP3A 4RWEA 5EXEA 1I80A 1NSTA 4P3YA 3IT1A 1XTPA 1XQWA 1L5SA 2Q6LA 4JP5A 4AECA 4RH3A 1HX7A 3EG5A 5DHQA 4YAGA 4DQVA 5AVQA 3ZJYA 4A73A 1NTOA 4YV2A 1D2MA 1VMIA 4LBZA 3L41A 2X0DA 1WUKS 5CK4A 2C04A 1G5PA 3TZLA 3DG9A 4S1PA 3CVWA 4ZI2A 2BM9A 1IY1A 1CW2B 1T4CA 1G7CA 4MUAA 1IHXA 4YCDA 5JD6A 2RI1A 2A92A 1KFEB 2ZT8A 1N25A 4LRWA 4RXMA 3IEUA 4BMCA 4DT1B 3GZJA 1Z15A 5BRAA 3HA2A 3KE8A 2JLXA 3P2OA 3RSZA 1V8OA 1EWRA 2E37A 2XODA 2VYND 4PVCA 4QYXA 5GV8A 3OCWA 4N01A 2H06A 4JJZA 3SJUA 5BWOA 1O96B 1RFLA 2IIVA 5HW0A 1IZ9A 3RC9A 3DOCA 5J5AA 1IFXA 4TT3A 2X2OA 1CRPA 3EFBA 4DV7B 3BF7A 2I2WA 1DRKA 2HEIA 3SIPA 1L1QA 5B58T 5AK0A 5TT1A 1QZ3A 1PW5A 2Y3IA 4GZ3A 2HDWA 4I6JA 3L6OO 3CUVA 1VJGA 5IDWA 1BH6A 1UFQA 3NQ41 4QVKA 4V39A 1T2UA 5EPOA 4FE3A 4KQ1A 3W6UA 2XGSA 2GR9A 821PA 1BCRB 4Z3OA 3G1TA 4IH1A 3A32A 2Q3LA 1QFSA 3D7KA 3DXXA 2ZB8A 4K1XA 3PDCA 4K9KA 5CB4B 3AO0B 3EDCA 4QYIA 3KYIB 5IMBA 2H1CA 3WL6A 5GTDA 3QEKA 4Z5XA 2I66A 4WJKB 3STYA 1QB7A 4HDRB 1COZA 2G5PA 1M7GA 4IS2A 3IBGA 4UBLA 4AZ3B 4ARSA 2C31A 4C6HA 1SULA 4F2GA 2WIFA 5EP3A 5EL0A 2WU3A 2PXXA 3AI7A 4XJVA 4HVTA 1G4AE 4ZYXA 1N57A 2CK3A 3U37A 1T9CA 1SUCA 2FMXA 4CQLA 1TIBA 2J46A 3BMNB 3JQGA 1W8DA 3KU4A 5E7JA 4NBTA 3THSA 1ZVVA 2OCAA 2UKDA 4YJFB 5BW5A 3TZEA 4CLOA 2ZPUA 4PX2A 3P27A 1IUOA 1SHJA 1K3UB 5AKIA 4KVGA 4CFSA 3IEPA 2DJIA 2PV0A 3QVOA 4R2WA 4F12A 3KT3A 2H63A 3TN7A 2R7NA 1B4DA 2OTCA 3NX4A 5FUWA 3OU6A 3MT8A 4X1YB 1P2FA 3PJRA 3NLLA 2XUJA 4TSRA 2ZUCA 3L4JA 1IBCA 1ZN8A 1XLVA 1ZH6A 4O4HF 3DMTC 4EUSA 2PEYA 1Y5IA 5JALA 2NU7B 2IEYA 4JXJA 4MUKA 1J7KA 2RFLA 5HIJA 1AC5A 1VJ5A 4N0EA 4F7WA 1DG9A 3DZIA 5A5FA 2QNRA 5DSZA 1CJTC 3C3KA 2QTWB 4AO8A 4W8OA 4WACA 1V6CA 3HP1A 4JLWA 3O2NA 1FDIA 3GLUA 2YKGA 4EVRA 4N76A 1AQLA 1GTSA 5GJWC 1JDJA 3OZFA 1J99A 5KYYB 4ISCA 1DJMA 2K6GA 3I5AA 4PLVA 2YJTD 1XA4A 2JJ8A 3Q9SA 4RD4A 4ZZ0A 2B9EA 5DI3A 5I8WA 3C0KA 4CV3A 4ALLA 1SM4A 4ZYVA 2G76A 2PWAA 2ZPAA 3OJFA 2COUA 1I2AA 1Z0FA 1ZUHA 2GWHA 2CLHB 3F7NA 2P4HX 2JFNA 3KG2A 2RJNA 1U65A 1M2GA 1O8CA 2GPWA 1AS2A 1EXNA 1I51A 1ZXLA 2EZ8A 1V1JA 3R24A 2R7AA 4G25A 2YS6A 2Z83A 3LBIA 3TX2A 2FPOA 3UK6A 5JH7F 5JTUA 3D7MA 1T6YA 1L4UA 1NXVA 4I50B 1HLFA 4QICA 5EHIA 2OC4A 2ZB7A 4YMWA 5AUOB 6NULA 1FNDA 5BW4A 2AG8A 2LUOA 4Q3OA 1DIHA 2HHAA 2C0CA 1Z4NA 3EWAA 2RHCA 1QHXA 3RS2A 2RHOA 4ZK2A 3W9SA 1PWXA 1ZK2A 4QELA 3P96A 3I61A 1Z4KA 3AK4A 1XWFA 1GPMA 5LZ8A 1GPLA 2WLSA 1JN0A 1YBAA 2GJ9A 2V7WA 2QUJA 1KMHB 1C0PA 4MRMA 3I1FA 4EI9A 4OP1A 4PRKA 1H2FA 3GCWA 3TL6A 3LUAA 1JLLB 3BGDA 1AKRA 4UU0A 4A10A 1XAIA 4R7ZA 3OIFA 1NI4A 3LXRA 1SOMA 3URMA 3L79A 1WWKA 2NSJA 1GSAA 1AA6A 4ZVLA 4KPEC 3FNEA 1AX9A 5IHPA 2BD0A 3CCFA 3QUAA 4UBOA 3FETA 4IEFB 4I5GA 1P7PA 3ETCA 4RE6A 3GJXC 2FDCA 3V4PB 3IA2A 3WISA 2PFKA 4TSFA 2J7KA 5GGXA 3MD0A 3ZHRA 3CKYA 1QCDA 3MUOA 4Y18A 4X3CA 5I9IA 3H9EO 1MHTA 1QQBA 2FLKA 1I4EB 1PT7A 1JL3A 4EB8A 2DBQA 1P6UA 2RKOA 3E6AA 4JLSA 3B5JA 1JG7A 5B1YA 2QLBA 1IQRA 4MB6A 3T7SA 1SPXA 1GJRA 2RHDA 4GPBA 4MW5A 5JSZA 1ZPDA 2WU8A 1ETUA 2GFIA 2VA9A 3JQFC 4LEIA 2YUTA 5DN9A 5K3BA 4W5TA 4RLQA 5KQGA 2GZSA 4FR0A 1X39A 4KMSA 1GCUA 2X19A 4A2CA 4A6DA 5IFKA 4ARIA 1LJ8A 3UUGA 1B43A 3FBWA 4I1UA 3GQVA 4XLTA 3RS0A 5FWAA 1RPJA 4C3OB 1QHGA 1QH1A 2B3TA 3NHAA 5F2KA 4K9OA 1PL0A 2FPIB 5H0IA 4E5UA 2B5OA 4MSUA 4OM7A 4FBLA 5KPDA 3OU7A 1NQOA 5IDYA 4CEIA 1ENOA 1F1JA 2JFZA 3LQRA 4XLZA 4DCGA 4YRKA 2CSXA 3VOTA 1XIVA 2RAUA 2P2CA 1OVGA 3LVFO 3V2GA 3HV0A 4KNYA 1YQUA 2GM4A 2FR8C 2X4IA 1RZVA 1SKAA 3EQ8A 3CEAA 3KWLA 5TPZA 1U81A 3HBAA 4NYIQ 1GZ5A 2RCNA 5ALGA 5T4HA 2GRUA 3GJ0A 4XWGA 3VNBA 3HN6A 3HZRA 4MEBA 1QRAA 2G07A 2Q5FA 3OOHA 4L27A 2JL1A 2YIDA 2OBMA 4Q4AB 3WGQA 3HCOA 4C7JA 1M1NB 1V5IA 3QUCA 4CV2A 1XU7A 1P2UA 3E9EA 2WEKA 1WOMA 4FFMA 4PSDA 5CIYA 1C1DA 4G5SA 4OSOA 4EY3A 1E1MA 5CFLA 1MG5A 5K5EA 3O73A 1N2IA 3JPWA 2DVMA 4K9PA 4UE2A 2I4MA 4YMHA 4WKOA 4DQXA 4ABYA 2R8EA 1T1EA 2OLKA 4ZO9A 1V39A 3RAGA 4PWZA 5KU7A 2VIIA 1LS1A 4GMGA 3DZFA 5FPSA 4QKQA 2BFAA 3BWBA 4BWFB 1XJQA 4M4SA 3KBOA 3ZW9A 1M1XB 2R5WA 4UZEA 4EMBA 1RQNA 3DR5A 2OHHA 3N2EA 3RKUA 3IP3A 3NVMB 2FDRA 4FIZA 1XEXA 2C00A 5AM0A 1GZUA 1TKAA 4JLUA 2Z5LA 3VGPA 3SAJA 5FTWA 1HDXA 1N8TA 1WZCA 3SN6A 3VPCA 3Q0EA 3S4YA 5AW4A 1KL7A 3PNVA 5C81A 3B9PA 4RIEA 5I9NA 1H9AA 1JS1X 1WXEA 2PYDA 1JYEA 2EW8A 1ULBA 2H1LA 1I7QB 4HB0A 5F21A 3EPKA 3NBZC 4UOQA 1B00A 4ESOA 2FPRA 1V3TA 4J1SA 2F9MA 1WA5A 2J3QA 2ZQ5A 2JI6A 5FPYA 5DHUA 1PR9A 2F8LA 2BHRA 3JARB 3ZV5A 3ZE2B 1WDMA 4U00A 1FRQA 2PUHA 2R1TA 2XUOA 5K8IA 5KYTA 2XWPA 3HBNA 4F72A 2B5WA 1TVCA 1F0YA 1U02A 2PRSA 4FKMA 1MEOA 1MC5A 2EWMA 2IPXA 3NV7A 4TL6A 3VSAA 2CF6A 3UEOA 3ZDEA 4KLNA 4AUNA 5ITSA 1XYYA 3CZCA 2FJ0A 4BLSA 2OCPA 1KQ3A 4DS3A 3Q98A 4KGZA 1E61A 4IIYA 5D1NA 4NPAA 3IIMA 2XQGA 4PGAA 3WQBA 2P9EA 1UBRS 1W76A 3GLTA 1F6BA 3D3JA 1W47A 2FSVC 3MPOA 2ID9A 2CLKB 2PKWA 4EFKA 2RHRA 3GEEA 1P5RA 3HEMA 3H3FA 3KFLA 2ZJOA 1R9JA 4ZD6A 1X19A 1T1RA 3B1YA 1ESCA 5T3YA 4UUOA 1D9XA 5EJ7A 5BN5B 1MU0A 4R2JA 1B41A 5C8YB 1OX4B 1ES9A 3AONB 1CDZA 3KYDB 4ROTA 2C9CA 3IUEA 3IH5A 4PLFA 5I7AA 4N0PA 1AK1A 2HRCA 2GPAA 5CT6A 1JFTA 2UZIR 1Z56C 4HK4A 4QDZA 3SS8A 2EKQA 1CZRA 2RBKA 5FHQA 4IIUA 4HCJA 4G5GA 3DEYX 3SHWA 3W2TA 1Z5OA 2FK7A 4CV0A 1IWPB 1XJWA 1K92A 3P2YA 4FMCF 1OLXA 2EKPA 2HPZA 2HCTA 4QECA 2HWYA 4PQEA 4EAAA 3T1YB 1M34B 3HYRA 4MYSA 1IHPA 4J90A 2ONYA 1DOAA 2JAXA 2VDNB 1M0SA 2QM0A 4NMHA 1SC4A 4AKGA 1NT4A 2FCRA 1EFAA 4UTOA 1J07A 3LIPA 4XPIA 1E2GA 2VAMA 1FLVA 3RGGA 3T5BA 1GCIA 1ZQ1A 3EASA 3N74A 3REFA 4HFMA 1AZLA 5JLJA 4HGPA 1A04A 4ZQHA 4B2IA 2H1OA 1XC7A 3R7AA 1CETA 3K4PA 2IUSA 1HDYA 4OPMA 4JLJA 2P9HA 1QM5A 3RTCA 4EB6A 3L7AA 5CD1A 3JYPA 1RYFA 4TWBA 3RFTA 1E8NA 2XH8A 4HX9A 2RJOA 3HXQA 3A4MA 1FTQA 1F9EA 3FYSA 4Y1RB 4B6PA 3OC6A 2FX5A 2B7LA 2O2HA 1ZJYA 2GBLC 4OD0A 1TAUA 1U6JA 5GWXA 1SUEA 3OLCX 1AKYA 2XQKA 2IS6A 3FNIA 3GRZA 1O95A 4EHFA 3AEKB 3JD4A 4W99A 2X5NA 3ET5A 3QKUA 3D3WA 5HFJA 4CQMD 4OA5A 3WHKA 2Q49A 1I13A 3WYNA 3QF4A 4HO1X 2AT1A 3G2LA 4U0JA 5DW0A 3HKBB 2RG7A 2JIBA 4RORA 5JROA 2ECKA 3G17A 1Z45A 4R8KA 4WZAB 4C0JA 3KD2A 1KJ8A 4DUZB 3CUEF 3DZKA 3GJ3A 1WHSB 3LGAA 2VTBA 5LUAA 1ZN2A 4BC1A 3OUTA 2XUDA 4QPPA 4CQJA 4MPDA 3O4JA 1KR2A 4LZWA 3ROTA 3UYLA 5CH5A 4DF3A 5CEEA 2VP0A 1ZM2A 2E7ZA 1OB2A 4FFSA 4PRYA 4INZA 5F9MA 3RC3A 3SIXA 4NENB 2JFGA 5BR7A 1H5NA 4BVKA 4IQFA 6ADHA 1HTBA 4IDNA 1QLWA 2EG5A 1D4FA 1D0SA 1SVLA 1GPDG 1VJ0A 4M0PA 2GZ2A 4E51A 3T1QA 1W36C 4K6GA 1ZM4A 3QVTA 4EKIA 4WDQA 3UUEA 1Y5LA 2JLWA 1ENPA 1CNEA 2WA2A 4R5HA 2VWGA 3QVVA 3FH0A 4LJ4A 3K0AB 4UHKA 4CM1A 4AJEA 1WY7A 2DWQA 2C4KA 4X63A 4BS9A 2HLHA 2IRWA 2JAPA 1OPRA 2OCXA 3OPYB 4MJ7A 1XPRA 1RLJA 3UMGA 3OEHD 3KR2A 4R9UC 3U7GA 2IYTA 2XXAA 4UKDA 2VCHA 2H1HA 1SBYA 3TSAA 4X1KA 2YWDA 1TZJA 1ISRA 4C4AA 3KCQA 2W6ID 1KAOA 2XNJA 3HLKA 5L7YA 5BQFA 2AN9A 1ZRNA 2DB3A 3QWIA 3AEYA 5L4NA 1O5OA 3P9PA 5CW2A 4CEJA 5A02A 2PMEA 1RZUA 3HP4A 1ESEA 3DGFC 2BEVB 4QE3A 3B8EA 1PHPA 4CCSA 1QNLA 1BQ3A 1W8IA 3F7TA 3LVBA 4GD3Q 1DOHA 1F17A 1FU7A 4MS1A 3UJCA 3AXTA 2IQIA 1ECJA 1FFXB 1H93A 1QK3A 2ODBA 4FGZA 3ZW8A 4UOZA 1MH9A 3QPBA 4URFA 3QVMA 5LZ9A 1RACA 4O29A 2OZPA 5CVTA 1JHYA 3K6KA 5BSRA 2J41A 4PQFA 5DJ5A 3HB9A 2HJ9A 4G0MA 3QBJA 4AX8A 5E1DA 5DNUA 4Z9XA 1M76A 4N5IX 4ZARA 1ODKA 3QFRA 4H7KA 4Q24A 2Y1WA 3TLZA 3GNTA 4NHOA 1WBDA 4JEMA 4YRRA 3TNJA 3HVUA 2BFWA 1MX5A 2PO5A 4M0LA 4HLDA 5KVSA 1FBTA 1Y1RA 1IBLB 5NLLA 5ICEA 2P7IA 1KFKB 1G4HA 1USIA 2CGEA 1X1SA 3C48A 3CX8A 5DHFA 3HVJA 4AG6A 3BHNA 1CXZA 3BJRA 5BXQC 3FPCA 3GJ7A 3ORSA 4G84A 2ZJ3A 1XZNA 1JJBA 4R2HA 4ZHQB 3D3EA 1MC8A 1Q7GA 1OOEA 1UBUS 2N0SA 3Q5DA 1NMXA 2QZ9A 2ZTHA 5TVKA 4CM9A 2EP5A 3TQOA 4PV7A 2JI7A 1A9XB 2NGRA 3DKRA 1L1FA 1D6JA 4V38A 1Z35A 2I2DA 5CFOA 2FPKA 2HSDA 4M99A 5EE0A 1FLAA 3DUFB 3TE6A 1GSIA 3IOBA 3EJWA 4L78A 4XD7A 1PDOA 1YC2A 2C83A 4ENVA 5HGXA 5A9SA 1OV4A 2NVBA 4ZOQI 5IJ9B 3F9CA 4MR7B 1U8AA 4IXWA 5P8WA 1Y6FA 1HOXA 3H2GA 4YLYA 3HDTA 4JU9A 1FUUA 2VAPA 1JKMA 4GLLA 1MB2A 4H15A 4L57A 2AMJA 2VHUA 4PZDA 3U3ZA 4BVFA 3AOEC 4DZZA 2XAAA 4WCFA 3AEQB 4QJBA 2DPGA 4KKXB 2PVSA 2B98A 4QRHA 4Y6QA 4JOQA 3H17A 3BMCA 4OHRA 5F51A 4QOEA 3PXDA 1X1DA 3M6LA 1ZXBA 1LBEA 2R85A 4IUYA 1HNWB 2C95A 1I4OA 1HSOA 1NTRA 5H4HA 4FFBB 4GZMA 4DV1B 3CZ5A 1RAFA 3K6SA 2V4ZA 2JAHA 3MMPA 1HQDA 1USGA 2FPWA 5K3SA 2X0KA 3H1EA 2JIRA 4C6RA 3ICQB 4CMGA 1SUBA 1L0BA 1TZKA 4BZQA 4AKSA 4PHGA 3UUFA 3S8EA 4XXHA 2PK3A 1JP7A 2RHLA 3HCNA 4C0LA 2OO5A 4HWKA 4JZYA 5KVQA 3TLMA 3SC3A 1YL5A 2BFOA 2OAEA 2B3DA 2P3QA 2ZK7A 4B85A 4RDXA 1UDRA 3C70A 3DMRA 3FFBA 3FNFA 3H9GA 3PJDA 3WMRA 3NKFA 4ZVSA 4C4PA 4EYKA 5LXTA 3ZY6A 2HPAA 5DLQC 4F93B 2Z2YA 1ZU4A 3G8DA 4YBRA 2OV4A 3VH4A 1G98A 1GRNA 5CA1A 4AKIA 1V3UA 1FTGA 4MVJP 5FORA 1ONNA 3FAZA 1VOTA 2FFHA 2P6MA 2VYVD 4JK3A 4Q37A 2IV3A 5K8VA 1DQPA 3AIMA 4JHXA 3EQ9A 4ZPJA 5THQA 3R8CA 1J8VA 2XJ4A 3WLTA 3CLKA 2P78A 2AI3A 1A9YA 4E08A 5JJKA 4IQGA 3JX9A 4RMIA 2V59A 3C24A 1PDVA 1GUAA 5IP5A 4NRDA 1IY2A 2B94A 3TS1A 3FSGA 1JVNA 4DJFC 3WYBA 1M1ZA 1RJWA 2P4QA 2CFTA 3A10A 2A67A 1HFJA 2D1RA 3ZDDA 3KSUA 3QLTA 3T7AA 4S1TA 1RQPA 4M1KA 1T9AA 1R8SA 3WGLA 1KFCB 1X74A 3N7TA 3ZY2A 3NB0A 1BFUA 4BIIA 3Q8WA 1GGNA 3TQIA 2BKXA 4P54A 1NONA 2A1TS 4RTNA 3QI7A 4IOMA 2QUBA 4JVNA 3FY4A 4QM6A 4U1RA 3PKZA 5ERXA 3T3HA 3NR2A 2ZYSA 4V0MA 5E7IA 1BN7A 1XDDA 1ADJA 1XT6A 1WBBA 4XYGA 1GM5A 5DHSA 3OKCA 1UOEA 3QOYA 4F92B 2FUCA 3D7SA 4XVHA 2VHVA 5AYVA 2G25A 2H1SA 4MR9A 2V97A 2WTUA 2W2LD 4GE0A 1EP2B 4YAUA 4HC4A 1KMIY 3ROXA 1CUSA 2Q1TA 4BNZA 3IE1A 3VI3B 2H8KA 3HEAA 7MDHA 3UA3A 3B82A 2VCEA 1SD5A 1AU9A 2BF4A 2I7XA 1H22A 2B6HA 2ZYGA 2EZ9A 5KTSA 5LNK6 1GG2A 3OEED 2Y9MB 4KDFA 3ILSA 4MVWA 4V24A 4FMCB 1MC4A 4X8MA 1EVKA 2V96A 3GRPA 2O5RA 5BRJA 2BKEA 1ZCBA 5TMPA 3WLFA 1Y3AA 1OVMA 2ZUSA 1CIVA 3QENA 3OD5A 5ECWA 5TV2A 4OUDA 5AFSA 3QU9A 2Q0SA 2RG1A 4F4JA 2ZWOA 3MZ0A 4KFTA 5CLLA 4BUJA 1S2GA 1DBIA 2C3UA 3UJ8A 4IXTA 4ZK6A 1L4BA 1QJ4A 2QRHA 4C5AA 1TYAE 5LOVA 2KX7A 4NJOA 3HG7A 4QM7A 3UJ6A 4BNLA 4WKCA 3EUWA 1ML3A 2JIQA 1OHHD 3STUA 4KPGA 2BH9A 5DHRA 5EVJA 2SECE 3TGLA 1I94B 2JZOA 2LIPA 2NOAA 3L4SO 3R76A 2R60A 4CQLB 3OMLA 1P19A 4D2IA 3DDWA 5EIAA 3ESZA 2J4DA 1M2HA 2IYXA 3A4VA 3JQGB 5EJ2A 3LY8A 3MD9A 5JT1A 4PYJA 4CLOB 2WU4A 2LZ0A 5CGQB 3VR4D 4ECEA 2IYUA 3CE9A 3EMBA 3M9XA 1NJ2A 4LRSB 1WHTA 3GLFB 2QVBA 5IULC 1JNYA 4PXSA 4XGNA 4UNSA 2B2XA 2XKKA 2X23A 2GJKA 2MSWA 3A70A 1LPOA 1KHHA 4ZAGA 3EEIA 1KEVA 2Q3EA 5FT9A 1KFBB 1RJGA 1PKEA 3AG5A 3AWDA 1NQUA 2J3KA 2VP3A 2IXFA 4UTXA 3L4KA 3W2FA 2QLTA 1FDVA 1YKFA 5JS8A 3PF8A 4N7BA 5JYCA 4GSKA 2VAWA 4KXUA 4YAFA 3HN2A 3E82A 4BO1A 2Q3HA 2H1VA 1ZONA 5LQSA 3ERCA 2ZKIA 5B7PA 4PSCA 5TQ0A 3AJDA 1O0SA 3I6ZA 1XZCA 1E77A 2ZE8A 4ZC1A 5F3RA 2EDAA 2GZ3A 5LBTA 2J7PD 4GW3A 1KQFA 4C14A 2ZKLA 1KKMA 4ND1A 4CKBA 4PTZA 1I7NA 1XEAA 2OCDA 3A37A 4Q3AA 2O1XA 2O2CA 3QFSA 1VIMA 5B64A 2IBSA 4LTDA 2BKUA 3RQIA 5DI3B 3GLRA 5F33A 5M34A 2VH1A 3HDHA 2ZXEA 2IY7A 4ZALA 4EMSA 1E2DA 3D6VA 1GPH1 1T8PA 4A4DA 2XA2A 4JJ7A 2FWNA 2HRBA 1U7ZA 1J5EB 4QUEA 1R0KA 1O4WA 2P9JA 2FEKA 4ES6A 1PR1A 1ESZA 3H1PA 3R7FA 1HKHA 2XCQA 2ZRGA 5IT9A 1SAYA 3RUAA 3WGGA 1RJEA 3BH7A 4LX8A 3I04A 4TN5A 4ETIA 1O94C 4YB8A 2ZYRA 2GDJA 3L7NA 3LX8A 1RAHA 2DHQA 2PRZA 3NP9A 3MWYW 4LVCA 5AO9A 5A4MS 2BEWA 3HGQA 5KNBD 2BGLA 3FPBA 4R3NA 1B6TA 1QQ6A 5BUSA 5TC4A 4JFAA 1E1RA 1MDFA 4QYWA 4ER5A 3Q3EA 3ID6C 1UEJA 4IJUA 2AYZA 1UM8A 4MRMB 2GA8A 1LBHA 2NUAA 4UBMA 5ALPA 3SKYA 2XTAA 3CNHA 2ZT5A 2ZRAA 5IN4A 4QU5A 1ECBA 2H2HA 2X9QA 1CCWA 4OFZA 1ODIA 3FOFC 5HVNA 3UOAB 3X2SA 1RM4A 2DCUA 4NBNA 4ZU6X 5EP4A 1S9DA 4NFSA 2QXYA 2GF2A 3L6BA 4EZBA 1TCBA 1EDDA 3BK1A 1NW9B 1GTZA 3HB7A 3ZOZA 1TVEA 4YRNA 1I14A 3A1VA 1F6WA 2AXPA 3OZSA 4LN1A 4R9RA 1FIUA 4EHHA 5IZCA 4MH0R 3AF5A 3R5HA 3U49A 2Y93A 3AEXA 4RMHA 3W2HA 2ET6A 3ZWDA 1DQNA 1OFHA 1Q3KA 4TQUS 3UAZA 2H8GA 4CMEC 4K28A 2BVNA 1UJ6A 5EJ4A 1YRAA 1EM8A 4HH0A 2OILA 1AK2A 4Q1DA 4XX0A 5JSZB 1F2UA 1QHHA 4PYRA 1BOFA 1Z82A 1C9YA 2FN7A 3FI0A 4BY9E 2AH5A 4E1BA 1E4YA 1SA0A 2DHEA 1QKJA 2H2GA 2LV8A 4MVJA 2Y9PB 1POWA 3MM4A 1RWXA 3RVQA 2Q8QA 3D2CA 4M98A 4V0NA 5CDYA 4QG3A 4CQMA 2QVZX 4D1YA 2Y0DA 2QSZA 4UM8B 3T7CA 2WG2A 3SYRA 5J4LA 5I5EA 5KSPA 5K0TA 3B70A 2VCYA 4N3BA 5JPDA 4NCHA 2Q3BA 4JYBA 4Y0NA 2E6KA 4B3HA 3QG5A 2Z5VA 1TUGA 4Q16A 4WFIA 2NXEA 1AOXA 2VBCA 2Y1OA 1E3DA 2PGNA 2GPBA 3O3NB 3V00A 4DIFA 1OSNA 4EB0A 1AN9A 3CG4A 4EO7A 3ONDA 5AHOA 3T9BA 2QWXA 4NBUA 3TIXB 1T13A 3OPXA 4U7TB 4MGEA 3RSGA 3W5SA 1C1DB 3AF1A 2O1EA 5AW5A 1XZAA 3FAKA 4D3FA 1KZ7B 1SU6A 1Z7BA 3GPDG 1X9GA 1ZA1A 3MGAA 5ILQA 1GZ4A 1XXHA 1HTWA 1PG0A 4OO3A 1JQEA 4PZYA 3T1TA 2D7DA 3JU3A 1JQJC 2Q07A 2IKSA 4JLPA 4DKXA 4CM8A 3NHMA 1DELA 2JFUA 2O6HA 2RHJA 1NUAA 1IN7A 4Q19A 3HKDA 4F5YA 1BDJA 4L75A 1FFAA 4MINA 3T3OA 3N7UA 3FWKA 1PK8A 1NVTA 2J9GA 3AU8A 3P4XA 4DY6A 3MCZA 2VWHA 3C3CA 2B36A 2PUTA 3C3YA 1JSLA 4LOKA 4JVLA 3TNDA 3USCS 3BC1A 2MT9A 3FSRA 2Q46A 1GEEA 2JJYA 1P9LA 3IR7A 5EIHA 1E6MA 3MTQA 3OEHA 4YALA 1QFJA 1V3QE 1XEXB 3BGOS 1OFIA 1YULA 5CA1F 1ZG3A 2YWRA 3EEFA 1GFZA 1MO5A 3GY0A 4L28A 4ZJPA 1ZR4A 2GZ1A 2ZBPA 5LWQA 3DF9A 3DBLA 3HDVA 3HNRA 1W4AA 3MAGA 1KNXA 4JJ8A 1EAMA 1JWAB 3DBVO 3L01A 3KLPX 4P3XA 5EN4A 3CCBA 3LX5A 1D5CA 1B8NA 2C4UA 3D1VA 5ENVA 2Q1YA 4Q9LA 1A97A 3C3MA 2EJCA 3CQ9A 1G20E 2BI7A 3ONFA 4LHZA 1TQHA 4JL5A 1ZESA 4EVSA 3CX3A 4YV1A 1FP6A 3GNLA 3JCZA 1LFDB 4OQNA 3R7SA 3ILYA 1H0KA 2R1TB 4U5XA 5EI5A 3OZ7A 4BLQA 4IJ6A 2ZSKA 1RYMA 1DMRA 1Y4DE 5A1TA 4CEIB 4NI5A 3GELA 1SRRA 3ZK9A 5FHRA 3O6VA 4XFDA 1CD5A 1R0YA 1D9ZA 3DYBA 3KAQA 3JD2A 1EXDA 4F86A 5A3SA 2YDYA 2J3MA 4GH5A 1ZK0A 1YR6A 3KPVA 3ODGA 3A9SA 4S04A 1G9XA 2JCBA 1A7KA 1OBFO 3AETA 4YCMA 3UXHA 5CR9A 3R9KA 1ZWLA 2CJWA 2WW8A 3NWOA 3DQPA 2F1JA 3VHRA 3R3HA 1YR1A 1RU3A 3R7BA 2XCSB 1EHYA 4BN0A 4DVGA 3UXYA 1UDXA 4I7EA 1IATA 2FW6A <