3BMOA

Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor (compound ax4)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
267
structure length
255
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
total genus 96
structure length 255
sequence length 267
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bmoA00
4BO2A 1P1KA 4E2YA 3ADOA 2AW5A 2B69A 3AM5A 3WLEA 5ADHA 4R5MA 5FWNA 3C1AA 3LT1A 5JC1A 2YDYA 1ONOA 4PVDA 3EC7A 3GY0A 4D41A 3JQAD 5IF3A 1Z73A 1FDUA 2C82A 1MB4A 1GQQA 1GUFA 3C7CB 3D4PA 3G49A 1I33A 1YBVA 4WLVA 2ZTMA 4U0KA 4MIYA 2E37A 3ONEA 3QWHA 4EEZA 3TNLA 5KVSA 3MOGA 5KOIA 2Q1SA 1PL8A 3RQSA 3OP4A 5F1OA 4UVGA 2PGLA 3HNPA 3DL2A 4ALKA 4OXKA 2IDZA 5L3ZA 4CL3A 2O50A 4Q3EA 3RUFA 3KB6A 4CQMA 5CEJA 2GYYA 2B4RO 2H5LA 2R00A 1MA0A 3MJTA 4CM5A 3NDJA 4PLGA 4BO1A 1I5RA 4FN4A 4Q3NA 2JD0A 3INRA 2Y0DA 4LCEA 5AVOA 5TX7A 2ZK7A 2OBNA 1GYPA 1O89A 3H5NA 4BMNA 2Z1MA 2PH5A 3WWYA 1DO8A 5A02A 4P4GA 1DBVO 3GNTA 2WJPA 4B8WA 1YJQA 1ZCJA 5KJFA 3PJDA 3GVCA 1UP6A 4J1TA 4MPDA 3U4DA 4LN1A 3WJAA 4MKXA 3ZWCA 3S8MA 4XDZA 1H9BA 4WASA 3OECA 4XYEA 3W4IA 4BKRA 1RKXA 1BVRA 5T5QA 5C3MA 3L9XA 4J6FA 5GMOA 2QQ5A 5JCJD 4MDHA 4R01A 3ZWVA 4QO8A 3D7LA 4R5HA 5TJ9A 1UP4A 4FSHA 3SLGA 4OXYA 5CDGA 4RVHA 1UP7A 1P0CA 4WKGA 4YQZA 4WEOA 1P3DA 1LRLA 2C2YA 2GRAA 1VI2A 3BYZA 4KTVE 3G0OA 3GEMA 3GT0A 4XYMA 1W0CA 2HDHA 4IUYA 2W2LA 1NQAO 4B7XA 2WMDA 2I5PO 4IS3A 5HRUA 1ZSVA 3DEYX 1VL0A 4J43A 2LDBA 2DT5A 2J3IA 3AUAA 4J0EA 5BSFA 1WPQA 3NYWA 1IYZA 4HFRA 4YACA 5G4LA 3LLVA 1F0YA 2R6JA 3L4BC 3DMTC 4GLOA 4YJDA 4PRKA 1D7OA 4MOWA 4E2WA 1C1XA 5L7YA 5CP8A 4BNFA 3EVNA 1GQ2A 1JWAB 1WW8A 4XWYA 3WYCA 2X1HA 5FYDA 2V6FA 3ICCA 1M67A 1Y1PA 2YDXA 3C7AA 5F21A 2NU6A 4MP6A 4ND5A 2ZTVA 4YRBA 3NDRA 2P68A 5T64A 3ANNA 3WICA 3OJLA 1DLIA 4J7UA 2AG8A 4JLWA 3RJ5A 3SXPA 2I9PA 4K6FA 3FWNA 5DNAA 4E13A 4D0RA 4FGSA 3LYLA 3Q6IA 4MVJM 1TT7A 3OF2A 2WEKA 4J4HA 4D3FA 5JCJA 5C7LO 5G0SA 1ADGA 3B6ZA 2IEBA 4YRAA 1PU2A 3COSA 1HSZA 4BNVA 3T7CA 1E1NA 4RVGA 3ZU5A 4BV8A 1LA2A 2OORA 2DAPA 3RBVA 4CQLB 3WGIA 2G0TA 1A27A 2UV8A 3PQFA 1T4DA 1UR5A 5AXAA 3W8DA 4XJTA 1PWXA 2C2XA 3HFSA 4FIZA 5ER6A 1R12A 1Z82A 4M87A 4LVCA 4TZTA 3TZKA 4UUNA 2QRJA 2VTEA 4XRRA 4AJ1A 1CERA 1DSSG 1J4AA 1FK8A 5CAEA 3L77A 3ASUA 5B1YA 1PJLA 3HUDA 1ZNQO 1H6BA 1ENOA 1T24A 1VJ1A 4XQEA 3JQ8A 1R0KA 5JLAA 5COBA 3VPFA 5CHEA 3CTMA 3ZNQA 5C37A 5JSFA 1XU9A 2QIOA 5DP2A 1LSJA 1K89A 2DBQA 2OUIA 1P1RA 2VHXA 4YPOA 1EVYA 1U9JA 3PHLA 3EZYA 1Y8QB 3GOHA 4II2A 1NR1A 1MUUA 3DZIA 4MP3A 3INGA 4TQGA 1YL5A 5K0ZA 3VTFA 3KLPX 2R00C 1N92A 3B1JA 4HFNA 4IM7A 4LVUA 5EQFA 5KVVA 1E0DA 2NTNA 2FSSA 5IZCC 2CFCA 2YHIB 1YQGA 4KOAA 2ZTUA 4GKBA 5IDWA 3QQPA 4NIMA 2P2SA 1E7YA 4ND3A 2BFAA 1D1SA 1D4FA 1SEVA 5LC1A 5LDGA 4PLHA 4IJVA 1HRDA 5A04A 3PWKA 4YJGA 4EJ6A 2QRLA 3JQCA 3MEQA 5KJEA 1VRWA 2RH8A 4WOKA 4E32A 2ZB8A 3FTNA 2P9EA 4DMLA 4FB5A 2FZEA 2GUGA 2AEMA 4MVJA 4FFNA 5JYDA 2BRUA 3PLRA 5C5IA 2NADA 4XIJA 5LCXA 5G0VA 3KYCA 4RQTA 5JO9A 2D2IA 3HB5X 3U4HA 1UDAA 2Q4BA 3GMSA 2R2GA 2B36A 2Q3EA 4D43A 4O5OA 1NPTO 2GN8A 2CDCA 4GWKA 4TRJA 1LEHA 3F1LA 2DVMA 2EKPA 3H5RA 5HWSA 2JCXA 1DFGA 4DC1A 1FDVA 5B12A 1LQUA 3GMDA 3OETA 3FPLA 5G2OA 2CSUA 2VUTA 2O3JA 5CPFA 2G82A 2J5KA 4TSKA 4BNGA 4TRNA 2B4TO 1I8TA 3BMQB 1GZ4A 2Q2WA 1IZ9A 2PZMA 1H0KA 1E1KA 1GCOA 1RPNA 4XGKA 1PR9A 1F14A 3DBLA 3NJ4A 1NVMB 3WIDA 1W8DA 2P9GA 4RF3A 1R4MB 1UAYA 1YONA 2QRKA 3R6DA 3RUDA 4C7JA 3VDRA 3OEYA 1PS0A 1K6JA 3BHMA 3N7UA 4YAEA 4BGVA 3RWBA 1F8GA 1KVQA 3GGOA 2DTEA 2EWMA 4B3JA 4IQGA 4OQZA 3EZLA 1EFLA 3D5TA 2C5EA 2D4AA 2HJRA 3OMLA 4J16A 4DLLA 3H9EO 4PGFA 4HFMA 1VC2A 1JA9A 1ZJZA 4JNKA 4AJJA 3JTMA 3JQBA 4L74A 4MVJG 5MGBA 1UDBA 4A7PA 5BSEA 2OOSA 3QVXA 5H81A 1NQOA 4OGWA 1J49A 1N1EA 3U0BA 3SVTA 2YUTA 2QYSA 3CINA 2DFVA 1MFZA 3KYCB 4W99A 3UAGA 4CMGA 1EUCA 4NU5A 1HLPA 3DQPA 4CM4B 1X7HA 2E6UX 1WNTA 3MWEB 3RBXA 4DMMA 4DTIA 3WNVA 3WGTA 4AJLA 1YQXA 2BI7A 2PGDA 3E9MA 1HYHA 1YVEI 4LSMA 2E82A 4AJ4A 1ZXBA 4N18A 3DAFA 4DPLA 3ENNA 1M66A 4H3VA 3FNFA 3O4RA 1LUAA 4L4RA 2GR9A 4P22A 4RDHA 3PIDA 3W1VA 2GZ1A 5THKA 3HJAA 1B8PA 3D64A 3RUIA 4BVAA 3GC6A 3H2ZA 2EIHA 1E6EA 4NFYA 4EZBA 2YV3A 3RD5A 3WS7A 4M54A 3U62A 3RC2A 1K3TA 4NJMA 4R4JA 4OXNA 4E21A 4DBZA 1AGNA 1SOVA 1UDCA 1FJHA 4XB1A 4MKRA 4HV4A 4OKNA 5A9SA 2X86A 1K6IA 4E4YA 5I7SA 2Q1TA 3VPSA 3RFXA 1T2AA 5DP1A 3GPIA 3AM4A 3KYDB 4XEHA 2DBVO 2ZYAA 4UVDA 4B3HA 4FCCA 5B4VA 1XGKA 5L7TA 1WXDA 1LLQA 1Y7TA 3QVOA 4FFOA 4U6SA 1PL6A 1LC3A 1QV6A 3UF0A 2X9NA 2UYYA 3Q9NA 1X0VA 4R54A 4Y6RA 3DB2A 1ML3A 1BXKA 2ZATA 5EQDA 1J6UA 2DKNA 4JN6B 3TL2A 1JLLA 4YA6A 2NU7A 5F3RA 1JVSA 2ZB3A 2CDBA 2RCYA 3F46A 2ZJ1A 3ONFA 3WQQA 5BQFA 2OMEA 2VZ0A 3AY6A 4GX1A 2JJYA 4HWKA 3UCXA 1E7RA 5F1KA 5KCZA 1G1AA 3LT0A 5AQ1A 3AI3A 3M2TA 3WTBA 3KO8A 3CZRA 4W7HA 3DTTA 4KDEA 4DRYA 1IZ0A 3P5SA 2BGMA 4FFLA 4E12A 7ADHA 1GUYA 1H9AA 3DZBA 3L4SO 5TQVA 1HT0A 2D8AA 4ZQEA 5CG1A 4NH4A 2Y1GA 5ENDA 4IZHA 5FF9A 3G17A 4O1MA 4WGGA 1E3WA 1OAAA 4NG5A 4BO3A 1QORA 3PFFA 1X14A 1BXGB 1LDBA 1ONPA 4Q9NA 3O8QA 1KERA 3KZVA 4Q3CA 5T57A 3TZ6A 3LC1O 4EJMA 1SMKA 4RO0A 1GTMA 1OMOA 3E18A 4K9DA 1ISFA 3O9ZA 4MVJF 3ZDFA 5EINA 1Y8RB 4JJGA 1QXSA 3WB9A 4XX0A 2XXJA 4BS9A 4CMIA 2P5YA 4WCFB 3E5RA 4PG4A 5LDHA 1O94A 1Q0QA 3TJRA 1PZEA 4WLFA 4CQMD 1PJQA 4ZQHA 5B4TA 3P7MA 1AXGA 2ZIZA 1DIAA 3UVEA 3R3SA 1T2DA 3I4FA 3JD1A 3ST7A 4RQUA 4BNKA 1T25A 1XHLA 3ZWYA 4NMHA 3MCVA 1E3WB 4H16A 1QSGA 4CMKA 1LXCA 1YBAA 3WXBA 3AU8A 1DRUA 3PK0A 1UXJA 4IPTA 3HDYA 3DMTA 2VHWA 3ZHZA 4G5HA 3PJEA 2O3QA 3RIHA 3SLKA 1HDYA 1HE2A 4AJEA 4OHUA 1L1FA 4TWRA 3RAJA 3DBHB 2CVZA 2EEZA 3HG7A 2YYYA 4BNIA 1KVSA 3IDSA 1H6DA 1KVTA 3FNHA 4BOYA 3D3WB 4E2ZA 2UAGA 3NTOA 4R1UA 3NJ8A 2AMFA 4OO3A 5U4QA 3EVTA 3IKVA 1ZSYA 3JD0A 4A73A 2GDZA 3E5MA 2FN7A 1YXMA 4PCVA 1Q2XA 4BNMA 4C7KA 3QY9A 3K2BA 1KEVA 3W8EA 3WYBA 5DULA 4IXTA 1CJCA 5IFLA 4CLOA 3ZHXA 3DHEA 3H65A 5IZ4A 1UXHA 2BGKA 3HDJA 5CDTA 4E2XA 3JQDA 1NAHA 3K31A 1GCUA 1I3NA 1XU7A 3BXXA 2NACA 4CM8A 2JHGA 1YB5A 3QV1A 4IJWA 1U7HA 1I01A 4GVLA 1QLHA 1IPFA 2PD6A 1HE4A 4NPCA 4HUJA 1D8AA 4J4BA 1ISGA 4D44A 4RF2A 4H7PA 3WMWA 1XKQA 3PGJA 3GGGA 3DZGA 3S2GA 1UH5A 4ZJUA 1WWKA 5H82A 1UXKA 5BNTA 1ULUA 2WE7A 5JAIA 3RI3A 4RPLA 1TI7A 4OM8A 4BNUA 3CUKA 1Z75A 3RUHA 4YWJA 3ULKA 2FPIA 1EQ2A 4BL5A 1E1MA 3F47A 4N5MA 1ENYA 4BO0A 2C07A 4E5PA 3INTA 3JQ9C 1HDOA 2JL1A 1SO8A 4NJOA 1V0JA 1ZK1A 3KOUA 1PR3A 4RCVA 4II3A 4XA8A 1DB3A 4XQGA 2DC1A 3IS3A 2CVQA 4MVJD 1IULA 2Y1OA 3W4JA 4LW8A 5KJ1A 4WK6A 5KVCA 1PJ2A 2PWZA 1RYDA 1ZFNA 3GLQA 4TMFA 1DAPA 2G5CA 4U5QA 3EHEA 1BHSA 3L07A 4QFCA 1LSSA 3V2UA 3IP3A 4WNIA 4RF5A 5JPIA 4AJOA 1PJCA 1ORRA 4TZKA 2D0IA 1U3VA 2IXBA 3H9UA 4M89A 3CMCO 1ENZA 2JD1A 2EG9A 3WJ7A 5ILOA 4ALLA 1WLYA 3F9IA 4J9UE 1MC5A 4IDEA 1P9LA 2HAEA 2AE2A 1Y8QA 3GZNA 3OICA 2AA3A 4I5GA 5A4DA 1U3WA 2ZCUA 5CDSA 3HQ4O 2HMVA 2GCGA 3AK4A 4I1IA 2VNSA 4UULA 4INAA 1J5PA 1BMDA 2C0CA 2CF5A 4KUHA 3WTCA 2W2KB 3FI9A 4XQ9A 5DDIP 1QLJA 2AQKA 2ZCVA 3WGYA 1M6HA 1FDSA 4L4XA 1T4BA 1R16A 3RJ9A 5TC4A 3LF2A 3K96A 4CV1A 1YOVB 1R4NB 3DBHA 4BNNA 5JXWA 2OGUA 2PNFA 2P4HX 1WDMA 5ENVA 2E48A 5DZSA 4BNJA 2PD3A 2V6GA 5L51A 1ZMTA 3UKOA 3PRJA 1TEHA 3ZNOA 3IC5A 4Z9YA 3OJFA 1YB4A 3VZPA 1C0LA 3L6OO 5AYVA 4JXKA 4Z0TA 1NTOA 2AQ8A 3M6IA 4W6ZA 3LU1A 1ONNA 4B4WA 1C0KA 3R1IA 1KY5A 2F00A 1PGNA 4ZA2A 3DZJA 1HDRA 4XR9A 1HDXA 2QG4A 1U4SA 4CMEA 4A03A 4K26A 5JS6A 4JIGA 1AUPA 1JAYA 5G4KA 1WMAA 3WGHA 4HADA 4TRRA 5FEUA 4YJHB 3TDKA 5T67A 2HK9A 2H1SA 1H94A 5KTKA 5K9ZA 5T6BA 3TN7A 5EMHA 4WNCA 4B4UA 4CV2A 4CM3A 4L75A 2TMGA 2A94A 3I9OA 2IRWA 1DLJA 1LLUA 2O3RA 3H8VA 5TJHA 3JQBC 3R0IA 3CIFA 5BNFA 3C85A 3H5AA 2UUPA 4CMAA 4Z3KA 2VYND 3K30A 4DWVA 2BMAA 1MP0A 3GUCA 2OP1A 3JQ7A 4E30A 4BO8A 4YAJA 2A4KA 4F45A 3TL3A 2DQ4A 3FF4A 1AN9A 1GZ6A 4RZIA 1NXQA 1I0ZA 4RVUA 1I32A 4A27A 4RPKA 1KETA 3GFBA 4YBZA 4BV9A 3OIDA 3SJUA 4IGEA 4W9NC 2FR1A 4XB2A 3ZWWA 4TKLA 4WLOA 4OSOA 3PPIA 4UEOA 3LZ6A 3PI7A 4FR5A 5EESA 4CL8A 3ZWXA 1Q0LA 1XSEA 6ADHA 2BGLA 1DOHA 3UUWA 4GAEA 1NQTA 2X5OA 1PL7A 3GAZA 3ZWMA 3A4VA 1MFPA 3PIIA 1C1XB 3PWSA 2G76A 4UUMA 3BTUA 5AOVA 2B83A 1QMGA 1LNQA 5BT9A 3VTZA 1B26A 4TVOA 4I9HA 3S55A 4HXYA 1NFRA 4K1LA 1HYEA 3OQ6A 3JYLA 3RKRA 1JW9B 2NU9A 3QWAA 4D79A 3IKTA 5EERA 4CQLA 1OOEA 2BLLA 1ADBA 1DAOA 2TMDA 5ES3A 3VVBA 1EUZA 3ZV5A 3E9QA 1EQUA 3WBBA 4D3DA 3ASVA 1A4UA 3OIGA 4FOOA 1HF3A 1UZNA 5JE8A 1UAGA 1YDWA 2W90A 1LRJA 3GQVA 1XWFA 3DBVO 4FJ1A 2QYTA 4NK4A 4ALMA 5G0UA 4DLBA 4Y6SA 4I9UA 3LF1A 1E3LA 2PKQO 4DPKA 4YJHA 2DM6A 3QHAA 4JK3A 1N5DA 4CLOB 1O95A 3GVPA 1VL8A 5CG2A 1WP4A 4QTZA 3S2EA 3D5QA 3GH3A 3MTGA 2OXIA 4YR9A 2VHZA 4PLVA 1SB9A 1U5AA 1X15A 2Q49A 3KSDO 2RIRA 1E3SA 1JWBB 2O4UX 3QSGA 1AE1A 3I1JA 4PZDA 3BAZA 1LBEA 4PRLA 4Z0HO 1U7TA 1GAEO 2ET6A 5TSDA 2WTBA 4BB6A 2BFMA 1T1RA 5L4SA 3UN1A 4D0SA 1FXSA 2FPPA 4CM9A 1QRRA 3Q2IA 5JFOA 2Y0CA 4RGBA 1EE9A 2VT2A 3QIVA 2WD7A 3Q11A 2Y1FA 4QXMA 4F3YA 3JCZA 1TA4A 1KEUA 4R1SA 4TVBA 1P0FA 2BI8A 2HK8A 2NV6A 4E3ZA 3AOEC 4IDDA 4PLTA 1Y5MA 3DXFA 2HRBA 2NU8A 4A2CA 4H15A 2FMUA 4BNTA 1I24A 1GPDG 2D5AA 3GR6A 2EHDA 4RZHA 3WG9A 1YQDA 1P1JA 1XCBA 4QFDA 3ANLA 2H6EA 5A3JA 3FR8A 5TGDA 1WZEA 3IP1A 3NT2A 1P33A 1I3LA 1EK6A 3SC6A 3QW2A 4MINA 2Q2VA 2X22A 2QZ9A 1FF9A 4O63O 4KUEA 4BKPA 5KWEA 4PZCA 3IIEA 1PWZA 1ISHA 4KTTE 2H63A 3GRKA 4J90A 5L95A 5TLSA 5U9CA 1NPYA 2VWGA 4YQYA 2AEJA 4X54A 3CPSA 1M76A 1ARZA 3X2EA 4JCOA 4M55A 5K6AA 1ZZEA 3ANMA 2JAPA 1CDOA 4GMFA 1GD1O 5B4UA 1ZJYA 3TZCA 1ENPA 4FW8A 1DJQA 1B15A 2AG5A 3CSDA 3PQEA 4XYBA 4BNYA 3O38A 1QV7A 2X0IA 1Y9EA 4CMIB 2VUSA 4KZPA 4YCAA 2BHLA 4UUOA 4D3SA 4NBWA 1N9GA 1Z6ZA 2OFPA 3H3JA 4MVJE 4ND1A 4R9RA 5I7FA 1RYEA 1U4OA 1W73A 1YDEA 4OOFA 5IG2A 1RM5A 1NWCA 4J3FA 1SNYA 2PY6A 4QEDA 3KEOA 1E77A 5I8WA 1FDWA 1Z7BA 1CQIA 4N54A 3ZNPA 4CMJA 4Q3BA 4NBRA 1NBOA 1LDGA 4BGIA 5T8KA 3QWBA 1FDTA 4K28A 2C20A 2NNLD 4IQ0A 2FHSA 1L7EA 3NUGA 4CMCA 4ITUA 2PZLA 1IOLA 4YJFB 1BW9B 4EI2A 2JCYA 3DOOA 3PHGA 3E03A 1NX6A 2WSBA 5A1TA 1HYGA 2Z95A 1DIGA 2VNAA 2O23A 3I9LA 4LMPA 1IY8A 4ZRMA 2I65A 1PS9A 2GGSA 4NK5A 5FFFA 2PGJA 1XDWA 4E31A 5CEFA 1ZK0A 2O4CA 4MVJI 2C7GA 4XDYA 1H93A 2C54A 3JV7A 3KEQA 2X7HA 2C59A 1EVIA 2FY8A 3I9KA 4DIBA 3KYDA 4ZVVA 3GG2A 4YAGA 2HJSA 5CEEA 2J5QA 3PP8A 3CKYA 3DMYA 1H6AA 3BHJA 4DIFA 2FSVA 3SC4A 2B5WA 2H9IA 3VPHA 5CFZA 2HRZA 4CMEC 4RVSA 2G17A 3ZV3A 5ICMA 2VRCD 2YV1A 1H6CA 2VCYA 3NT5A 3IUSA 3NTQA 1HLDA 3QVWA 4F46A 4PLPA 1GYRA 4WCFC 1T2EA 5DCWA 3F4LA 3MWDB 1DC5A 2NTVA 3RVDA 3IJRA 2X5KO 3PHIA 4GSLA 4YT2A 3OHSX 2LDXA 1B7GO 2DUWA 1U1IA 2VN8A 3BMQA 1GY8A 4XGIA 1DHRA 2FOIA 1HSOA 4PG6A 3WNQA 4BQRA 5TRTA 4JP3A 4JQCA 4E5MA 3DBRB 3ZHBA 2I66A 4FGWA 2X0NA 3G3EA 2D1YA 1EUDA 4NR0A 2AE1A 3NGXA 3PYLA 3RASA 3EW7A 4IDAA 3JYNA 3ZW8A 9LDTA 1E7MA 3AU9A 2VQ3A 1SCUA 3GDOA 3VH3A 3OA2A 2Q1UA 2I76A 4NQZA 1OZAA 3ITKA 4GBJA 4GLLA 1DFIA 1RJWA 4B8ZA 2QW8A 4R9SA 3H9QA 1JN0A 4YEDA 3VDQA 2VWQA 3B1KA 1OI7A 1EFKA 1P45A 3Q0EA 2QHXA 1EVJA 3L0DA 3GRPA 1NP3A 2X23A 4MKZA 4C4OA 3KBOA 5CPBA 1PEDA 2PLAA 1KEWA 2AXQA 3LDHA 1DC4A 1MGOA 2DUUA 4AFNA 2AEFA 2GPTA 3GVIA 3BMOB 5JDCA 3GEGA 4MJLA 1SAYA 5A03A 1V8BA 4B4OA 1ZUD1 3TFQA 1JU9A 2FP4A 1HDCA 1LDMA 5IAAA 1Q0HA 3OSUA 4KDFA 3H6KA 2IZ0A 2VZ9A 2WYVA 4L8VA 1BXGA 3GPDG 1KC3A 5TT1A 4E33A 3WOHA 1O8CA 2C7VA 2ZJ0A 1I10A 1VL6A 3O26A 2XAAA 5C7IO 4IXWA 5EPOA 2B5VA 4CLRA 4IJKA 5JY6A 3AUTA 1VM6A 3BMNA 3UCFA 3FSRA 4DREA 1BDMA 1E7SA 3IOYA 3QVSA 1CF2O 2IODA 4ZU3A 3H4VA 4HFJA 3DDNA 4IZIA 4PG8A 4OMUA 4MO2A 2IXAA 4EYEA 3QVTA 3IUPA 4BHTA 9LDBA 2G1UA 1GADO 2X0RA 4XJSA 1AHIA 4UEJA 3VC7A 4NZ9A 2HCTA 3FNGA 4GPD1 3HHPA 3G1UA 3K6JA 4FPXA 4GH5A 3OEWA 3ZU3A 5BNIA 3W8FA 2HUNA 1ZBQA 1XA0A 3DBRA 2HMUA 1P1IA 2EJWA 2HMTA 3BTOA 3QRWA 4ZQFA 1CYDA 4W82A 2DLDA 4LCJA 3D0OA 1NPDA 1CQJA 4LRTB 2Y05A 4EBFA 3ROMA 1GR0A 1I36A 1X1TA 1XEAA 3ZWAA 4Y98A 3ZWOA 1MXHA 1C3VA 2BKAA 2IYOA 1K0UA 3ZHYA 3M2PA 3T7EA 2X6TA 3PDUA 3GHHA 3IMFA 3VPXA 3F3SA 2VOEA 3AUSA 3C3XA 3KUXA 3AY7A 4YJGB 8LDHA 4IJUA 2ZQZA 4NJMB 4IINA 1VLLA 5EL0A 4BUCA 4DQXA 2E49A 3AJRA 7MDHA 1FMCA 1SPXA 1G0NA 3BMCB 3RSHA 1NHGA 4I08A 4NBUA 4PLWA 1A7AA 3C1TA 1PX0A 5COQA 4BGEA 1TT5A 3LVFO 4CR6A 3I6QA 1DPGA 4R1NA 1ZEJA 3I52A 3LC2O 1YWGO 5JNLA 1LDEA 4CMHA 1ZMOA 4TKMA 1BDBA 2O2YA 3HDHA 3V1UA 3BMNB 1WAMA 1P77A 4FFPA 4EDFA 4R41A 1B2LA 1BWSA 2Q4EA 2Y68A 2YJZA 4NDNE 4Y67A 3ZV4A 4RORA 3VHRA 1XQ1A 1VSVA 2EGGA 1RWBA 3ZNNA 4I5DA 3RU7A 2VRBA 4UAGA 1LQTA 2VT3A 4AJPA 3KRTA 1EBFA 4NNJA 4J0FA 1BRMA 4URFA 3NT4A 3BIOA 1Y5RA 3H2SA 2I99A 4LMRA 4DL9A 5GZ1A 4CR7A 4U8GA 4FOSA 4OH1A 4OQYA 4RVFA 5A06A 2OP0A 4WCFA 3VZSA 3C24A 5JYEA 4PN3A 2CY0A 3TQHA 3CH6A 5JBIA 4YT5A 1C1DA 1YKFA 2RHRA 3GGPA 1A5ZA 3GNSA 4IDGA 4N7RA 5L7WA 4U7WA 3E82A 3KTDA 5HTOA 1ZVMA 1PZHA 4J7XA 5L45A 4J2OA 3WSVA 4M1QA 4AL4A 4JJIA 1VJ0A 1WVGA 4W9NA 4E6PA 5EJ2A 3O8QB 4BNLA 3U3XA 5ILGA 3KV3O 2JFFA 1EZ4A 1XG5A 1U2DA 3PDJA 3S2IA 2VWHA 4M49A 4CLXA 1TXGA 1N7HA 2A9FA 3PHHA 2IZ1A 3WBFA 1PQPA 1SZJG 4GX2A 2UVDA 4A0SA 3T4EA 2X8LA 5KJ6A 3QWIA 1HETA 1Q7CA 4J49A 4QX6A 3RC7A 4FQ8A 3WX0A 4M8SA 4J1SA 3BTVA 4ONEA 3AOEA 1EVZA 3H9GA 4A5OA 2RBEA 4KWHA 1LX6A 4FFMA 4YAKA 4U6QA 2ZTLA 4WE3A 2XXBA 1HDZA 1IHXA 4HP8A 3C8MA 1AHHA 2OZPA 2B4QA 4E0BA 5EIOA 1A7KA 3RUEA 4DQUA 5DOVA 2NQ8A 3DR3A 3JQ9A 3DOJA 4ND4A 4BO6A 1VSUA 3E48A 4IGFA 4D46A 4XCVA 4PFJA 5A3VA 2VTDA 8ADHA 1LDNA 3WSWA 3ZCXA 1I3MA 4BMSA 3HB4X 5G0TA 3KM0A 1IUKA 1PJ4A 3WGQA 1R37A 1XR3A 3FRJA 2HMWA 3FBTA 5KNLA 1YRLA 4RPGA 1SBYA 3JQEA 3GF4A 3GNQA 3QLJA 4NFSA 2WDZA 1H2BA 3C7DB 5DN9A 3B70A 3B20A 5A9TA 3WFJA 4E5KA 3K8ZA 4HNGA 3F5QA 3HN7A 3GA0A 1JKFA 4CLEA 4ZQBA 4MVJP 3RUAA 3PVZA 1B14A 2GSDA 3G79A 1LDYA 2O7QA 1GL3A 4XIYA 1QYWA 1A71A 3EY4A 3F6YA 4IS2A 4RLHA 4AJ2A 3LK7A 1DXYA 2ZQYA 4KUGA 3ICPA 3WWZA 4J7CA 3PWZA 1IE3A 5I9MA 3FTPA 1PGJA 3GUYA 3JD3A 3K5PA 4P4LA 1UXGA 1GFSA 3I23A 4GWGA 4XQCA 4IMPA 4XGNA 3RROA 4R3WA 3ZW9A 4B3IA 5U1PA 1PJSA 1F12A 3TZQA 1YBMA 1B0AA 4CUKA 1IB6A 3DFZA 1PJ3A 2ZYGA 1DEHA 1U28A 3D3WA 2XOXA 4YVFA 4PG5A 3GZ4A 4Z3DA 4BKQA 3A14A 5HA5A 2FR0A 1F8FA 4Y8VA 4D7AA 5L53A 4UVIA 5DBIA 2DFDA 5GY7A 1Z7EA 2PKRA 2NVBA 2WYUA 4QT0A 2CZCA 1NR7A 4CM1A 4EEXA 4HNHA 4ROSA 4S3MA 3X2FA 4CQMB 3NAQA 4IDCA 3WDSA 1WZIA 3OFSA 4FJ2A 1B3BA 1KC1A 3IL2A 1JKIA 1B16A 4IBOA 4CLRB 3DZHA 3EK2A 2EKLA 1M75A 2X0JA 3LC7O 1B3RA 2C5AA 4BNWA 4CM8B 1VPDA 1F06A 5I7EA 4RV9A 1PSDA 3ZN2A 3BMCA 4IIVA 2FPGA 5IXYA 3SJ7A 2Q99A 1EMDA 3AFMA 3E1KA 4NU6A 1A72A 1QYDA 1ZO8A 5F1PA 4R68A 4CM6A 2GZ2A 2I67A 3L4BA 2PFGA 3RC9A 2BFPA 3JYOA 4JX8A 3WMXA 3QP9A 3JQAA 1LRKA 1P1FA 1U2GA 3GFGA 2EP5A 2PTGA 2HO5A 1XIVA 3UH1A 2NSDA 3JQ6A 4OSPA 1PJBA 2VYVD 4PLYA 1EK5A 1Y6JA 3I5MA 1UXIA 1EEHA 2X9GA 2YV2A 5B37A 3GEDA 1UZLA 2J8ZA 2PKQP 1ZH8A 2Y1CA 3Q3CA 1UJMA 3VH1A 4PG7A 5FI3A 3RFVA 1Q7BA 1YL6A 4OOEA 2YFHA 4R3NA 5JO0A 4J1NA 3JD4A 4Q3DA 1GUZA 1SC6A 4XR4A 3RC1A 1S7CA 4CUJA 2JHFA 2Y0EA 3UFXA 4W7IA 1OBFO 5ITWA 1DRVA 2CMDA 3SEFA 2IEDA 2PV7A 1YB1A 3PZRA 3QWFA 3UHAA 1GU7A 1PZGA 2WM3A 3UXYA 5JAMA 4GQAA 2HQ1A 4WLEA 4MP8A 4B7UA 1QP8A 4AVYA 3PGXA 1WMBA 1TVEA 1E3EA 4HX5A 4YXFA 3GN1A 2EXXA 1N2SA 2YHIA 3OH8A 4PLZA 2GLXA 1ISMA 3DOCA 4ALNA 1ZW1A 4J4TA 2AQHA 4CV0A 2A35A 2BELA 2IZZA 1KOLA 1ZEMA 1V9LA 2O7SA 2OL4A 2Y66A 2JFHA 1X7GA 4FC6A 5A9SB 3STHA 2NLOA 1E1LA 4JP2A 3DHYA 1E6WA 5F5LA 1C0PA 1ZSNA 4ZRNA 1GEEA 1DFHA 2EP7A 3JYPA 5IN5A 3IQDB 3Q1LA 1XQ6A 4BIIA 1GPJA 5F5NA 4Q3AA 4EUEA 4BB5A 2HU2A 1NFFA 3MJEA 4LK3A 2NM0A 3E8XA 4KWIA 3P2OA 3GVHA 3ZWPA 2DBZA 3HADA 4Y9DA 4YJFA 1ISJA 1GZ3A 1H2HA 1GYQA 1Q1NA 4G2NA 3WQRA 3PYMA 4ZICA 1YS4A 5C7OO 3A28A 2JFGA 3VPGA 1QKIA 1R66A 2Y99A 2HKIA 3Q2KA 3P2YA 3CMMA 1PQWA 2PZKA 3GK3A 3RBZA 2UUOA 1E3IA 1KVRA 3AM3A 1JDJA 5L40A 4Q39A 3NKLA 2AQIA 4BNZA 2AHRA 2JCVA 3P19A 1PJTA 1SB8A 1HE5A 4LGVA 4XZ3A 2GD1O 3Q9UA 4D42A 1IL0A 3KYBA 1NQ5A 4RDIA 3ZZNA 1DHTA 4CUZA 2D5CA 2BH9A 3VH2A 4HY3A 4JBGA 2W4QA 3CZMA 1TLTA 2GN6A 4R1TA 2HSDA 3RCBA 2BF7A 4GSKA 2XPCA 4R16A 2FRDA 3F1KA 4J9VA 4QO7A 3GVXA 1U8FO 4NFHA 4WPGA 4R51A 1E6UA 3TF5A 2EW2A 3TWOA 3FR7A 3GN2A 3IAHA 4LRSB 5L4NA 5K6AC 1ZK4A 2EKQA 5AXCA 2JD2A 1L7DA 3DZKA 1JTVA 1QYXA 4KQWA 1YE3A 4RL6A 1EDZA 4DYDA 3H9JA 1HDGO 5BSGA 2VOJA 2VHVA 3DWFA 3FBGA 3FHLA 3VZRA 4BQPA 3LLSA 4PLFA 1NNUA 3RU9A 3N74A 3EMKA 2WWRA 1HKUA 3JQ8B 1LSOA 3RUCA 1U3TA 3PEFA 3VZQA 3HZZA 4EGFA 3KVOA 1YGYA 3JSAA 5GZ6A 5KKCA 3DONA 2D59A 4Z9FA 4RPJA 4P38A 4CPDA 4EUHA 4CLHA 2CDAA 4CM9D 2EJVA 2E4AA 1Q7GA 5CDUA 1PQUA 3W6ZA 1T1SA 3M1AA 1Z74A 4RF4A 4Z9XA 3AUUA 3VVCA 3RFTA 4FS3A 5JDIA 3U9LA 4WECA 4GGPA 1NHWA 1XLTA 1BTOA 2NVUA 3S2FA 4M86A 2CF6A 4I8XA 5I8ZA 1EDOA 4OKIA 4MVJH 3WGGA 4B79A 3NDIA 4P4NA 4CM4A 1BSVA 2VZ8A 1U5CA 4KQXA 3EDMA 4EITA 2Z5LA 4KMSA 2ILTA 1A4IA 4S1VA 3U5TA 2Q50A 1DC6A 5H83A 2QX7A 4Z6KA 3B1FA 3VAZA 1E3JA 1VKNA 2WD8A 5KIAA 4NBVA 2SCUA 2EGHA 2YFQA 2B35A 3GAFA 1MC4A 3I6IA 4D45A 4O59O 2IE0A 1ZXLA 2FR8A 2J6IA 3DZFA 4GX0A 5KJCA 1PZFA 4O0LA 3WGOA 3HSKA 3PTZA 3ZV6A 3W4KA 5ICSA 1Z45A 3FNEA 5KVQA 4EUFA 3EUWA 3V1YA 3QA9A 3QE3A 3A1NA 3L9WA 3WGZA 3ETDA 3VKUA 3ORFA 1Y8RA 2J3HA 1NFQA 1PGOA 2I6TA 3E9NA 4LISA 1BG6A 2PZJA 1YJ8A 1ADCA 4CV3A 2A92A 1DRWA 1F17A 4DLAA 1KYQA 3BZUA 1LJ8A 3OQBA 1AXEA 3O03A 2CUKA 3I9NA 3KSUA 1N1GA 4I9NA 3JQFA 4YRDA 4WEQA 5IXSA 3AI1A 4G81A 1TT5B 1R15A 3OQ1A 2F1KA 5AXBA 3TSCA 2POQX 2Y1DA 3EAGA 5JAQA 3VOSA 4YT4A 2I3GA 1JVBA 1ID1A 1N9GB 1U3UA 1GV0A 4AJHA 1P1HA 1LI4A 3ETEA 3V2HA 2GNAA 1KEPA 4J2HA 3LQFA 3K73O 2J3KA 3NTRA 2YW9A 3JQFC 3ROQA 1N7GA 3KLMX 4UEKA 1PIWA 1KY4A 5IZCA 4LSWA 2CNBA 3A06A 1R6DA 4WUVA 1I2CA 3K9QO 3N58A 4WCDA 2W2KA 4DC0A 4ZGWA 4QUKA 2Q2QA 4DQVA 3DTYA 3ONDA 4G65A 2V7PA 1QR6A 3OJOA 3BHIA 4L76A 2EERA 4NHEA 2GERA 1A9YA 5AXDA 3U49A 1JAXA 1T2CA 3ZWNA 4ALIA 4CLDA 2PK3A 3E6AA 5IDYA 1MV8A 3GG9A 4YYZA 2J5RA 4ID9A 3FN4A 4L4SA 5DOZA 3DBLB 5JY1A 3TPCA 3W6UA 2JAHA 2PR2A 4BO9A 1MG0A 3WLFA 2X5JO 5IDXA 3NEPX 5HS4A 3OA0A 3D4NA 3D4OA 4GMGA 1TB4A 3DAGA 4YDRA 1A9ZA 2WYWA 3LSYA 3S1LA 3CE6A 4OYRA 2WD7B 4RJTA 5L4LA 3ETGA 1WDKA 3FPCA 5KKAA 4XKJA 1KVUA 1T2FA 4OJNA 3OM9A 1X13A 3I9JA 4EW6A 1IPEA 5COAA 1KS9A 5I7VA 1DIBA 4F6CA 1R0LA 2C29D 1E7QA 1UUFA 4NBTA 1R0SA 3I83A 1GV1A 4O6VA 3PLNA 2YY7A 4YB8A 3U09A 1SOWA 5JCXA 2VHYA 1EBUA 3VH4A 2ZKLA 3RKUA 2OHXA 1CIVA 1OFGA 3JQAB 3BA1A 2Q46A 3AWDA 4WOJA 3OJEA 1O0SA 5DBGA 3EYWA 4K6CA 2W2LD 1CRWG 1W4ZA 3JQ7B 1NVTA 3JD2A 4JBIA 1NAIA 3V8BA 3NV9A 1HEUA 5T8KC 3HFGA 2ZYDA 3OIFA 3PHJA 1R4MA 5DCUA 3DAPA 3V1TC 3ABIA 1T26A 2W8ZA 2X9VA 4CM7A 2DTDA 2EV9A 4ZN6A 2NQTA 3R3JA 3DFUA 1CEQA 1LLCA 3T4XA 3MJSA 3ZWBA 2PH3A 3A9WA 4RVDA 3CXRA 4MIOA 4OAQA 4AICA 4IQ8A 5JMPA 1C1DB 1K5HA 4CR8A 4YAIA 4BNHA 1HE3A 4DUPA 4BO5A 1DDOA 1Y81A 2NVUB 4GKVA 3AFNA 5MDHA 1BW9A 1V3TA 1YH3A 3SX2A 3UOGA 3VKVA 1IHYA 4EJ0A 1P31A 3HDQA 3L6DA 4B7CA 1I3KA 1NM5A 1E5LA 2GF2A 4JGBA 4L0QA 4PVCA 5A9RA 2BD0A 3K92A 4FC7A 2UDPA 3UW3A 2V6BA 2HK7A 3FD8A 3GDGA 1MLDA 4E5NA 5TNXA 2DPHA 4UVHA 1R4NA 3KXDA 3KHUA 3LT2A 5L9AA 1M6WA 4AJIA 5TIIA 2YQ4A 3GDFA 4DA9A 4DPMA 2VYVA 3KETA 2CD9A 1DJNA 1OC4A 1XELA 1K6XA 3ADPA 2OBYA 1CETA 3WYEA 1ADFA 4BNXA 1HWYA 3QJ5A 4ILKA 4JROA 5JDIC 1O5IA 1C0IA 3PFWO 3WQSB 3BMOA 2EW8A 4YTEA 4XRGA 3D1LA 2Y1EA 1C14A 3PZBA 4N5LA 5DCYA 4ND2A 1HL3A 1K2WA 4RPHA 2O3TA 1YL7A 5G4KB 3GZNB 2YZ7A 5HM8A 2ZB4A 3AI2A 2DTXA 2RHCA 2X58A 4F6LA 3EGOA 1QG6A 6LDHA 2FZWA 3SBOA 1PGPA 5IN4A 2Z1NA 1GEGA 5DT9A 3C1OA 5IJZA 1MX3A 3JQGA 2RH4A 2DPGA 3G1TA 4DBVO 3OJ0A 4XYLA 3TOXA 5BR7A 3K2EA 1X0XA 3NGLA 4I5EA 1LTHR 4GVXA 1QYVA 5JC8A 4A26A 1VJTA 3UICA 3DC2A 1G6KA 5G0WA 3FCOA 4FBGA 1NWHA 2W98A 4GX5A 4OL9A 1OC2A 1B8UA 2B37A 2O48X 4WLUA 1RM4A 3ZU2A 2NTJA 4IY1A 3L6EA 1MG5A 3IJPA 2V65A 4PZEA 5JDCC 2B0JA 1XYGA 4L73A 1YOVA 3ZH2A 1NVGA 4ALJA 3F5SA 3JQGB 4QQRA 3ZGYA 4IMRA 2Y67A 3I9MA 4U0JA 5THQA 1J0XO 4BMVA 1RM3A 4RLSA 1PGQA 2D3TA 2Q45A 4QSMA 3MTJA 1JQBA 1P74A 3AW9A 2P4QA 3ON5A 4Y6PA 3V5NA 1DIHA 3D3EA 2VWPA 1YO6A 1QYCA 2HLPA 3MJCA 4IDBA 1ISIA 1KBZA 2XF8A 2RAFA 4CMBA 4GI2A 2PD4A 1BGVA 2VRCA 4HKTA 3I4CA 1ZIDA 3TFOA 3H7AA 4ZQGA 2NWQA 5DF1A 4ESOA 3PJFA 4I5FA 4NI5A 2P5UA 4BKUA 1D1TA 1HZJA 3TZHA 5DBFA 1I2ZA 1X7DA 1ZK2A 1VE9A 3I3OA 1JKJA 5A5FA 4TRMA 4DIOA 1X1EA 4L9RA 1GQYA 2YQ5A 3LT4A 3PXXA 5A05A 3H3FA 1V35A 3M1LA 1ULSA 5I9NA 5I9LA 1SEPA 2DBRA 4XD2A 3PQDA 3JYQA 5TT0A 4IDFA 1LU9A 1O9BA 3HE3A 4WLNA 3MJVA 2DU8A 5EN4A 5HBRA 1M2WA 5BSHA 4KP7A 1DC3A 3UGKA 2GN9A 2NUAA 4TROA 5GZ3A 1KIFA 4JBHA 5JAZA 2VYNA 2ZB7A 1UZMA 3ZU4A 4W4TA 4AG3A 1BXZA 2P9CA 4DGSA 2V6MA 3AY3A 1HZZA 4UREA 2QZZA 2BFOA 2NVWA 3CEAA 1I30A 4BKOA 3F4BA 4DXHA 4DYVA 2OO5A 3DHNA 3MJ4A 1G0OA 1HXHA 4WJZA 3KSZO 1WDLA 4BO4A 3HN2A 3OBBA 4XYGA 4ZHSA 5TF4A 3UCEA 3ZI0A 3GHYA 1E5QA 3PYXA 2VUUA 4BGUA 2J3JA 1ZK3A 1W6UA 1MXFA 2X4GA 4ZD6A 4E5YA 2GASA 4A10A 3NRCA 5A5EA 3MOIA 4J91A 1V3UA 4UUPA 4GL4A 3MZ0A 4HBGA 1RM0A 5CDYA 1Y9AA 3WIEA 1BVUA 3WR5A 5J23A 4BO7A 1PS8A 1D3AA 1EE2A 2I3AA 2JKVA 4MIEA 4N5NA 2EF1A 2GZ3A 2FWMX 3TOZA 2IYPA 3WFIA 1N8KA 1LC0A 5ITVA 3TRIA 1VKOA 1HTBA 1U8XX 3U4CA 1O6ZA 5TS3A 1V6AA 4GGOA 4Z0PA 1I2BA 5JMWA 4CODB 1LLDA 5JW6A 5ER9A 1S6YA 1NYTA 1GDHA 5FI5A 2O3SA 1E7WA 4IIUA 1P44A 4JJFA 1B8VA 1CWUA 1V3VA 2Q1WA 1NASA 2O3UA 3DO5A 3ENKA 2P91A 2YHUA 3NX4A 1LSUA 4AJKA 2GN4A 4FFRA 3ROKA 1DIRA 1PTJA 4R69A 1H5QA 4FDAA 4YT8A 3AOGA 2PA3A 4P8RA 4UVEA 3PJGA 4QECA 4AJNA 1ZKMA 4PLCA 1E92A 2CVOA 2Y93A 5IDQA 3BTSA 2HMSA 3ITDA 5HS6A 3FWZA 4J1QA 3ROPA 3V2GA 2WE8A 4OIMA 4CJXA 4FD3A 4PIVA 4B4VA 4DVJA 2GO1A 4FJ0A 2O2SA 3U4IA 3HWRA
chains in the Genus database with same CATH superfamily
1EK2A 1D2MA 2GXQA 1P1KA 2C1EA 2GPJA 5KAPA 2LKDA 2BRUC 3UW1A 4A8TA 3EXFB 3LLMA 3IQEA 2OBMA 4EMSA 5TPZD 5ADHA 1NU8A 2QJTA 1DTSA 3EA4A 4INPA 1J0BA 1S2NA 1GNPA 1GZVA 5JC1A 2EP8A 1HKHA 1IN4A 1HE8B 1WG8A 4PVDA 1K97A 3EC7A 4XDHA 3JQAD 3QKSA 2WUEA 2XVZA 1FDUA 3BGOS 4EL5A 1MB4A 3KT0A 5L3QB 1SBCA 3C7CB 1X7XA 1SXGA 4I1RA 2Z9DA 4W8GA 4DR3B 2Q7OE 1YBVA 4MIYA 4O2BA 3BJIC 2E37A 2ZUVA 2D1FA 5LZ9A 4FMDF 2C04A 2HSEA 2N42A 2Q1SA 3OUZA 1PL8A 2NV2B 3QX8A 5KOIA 2G0AA 4GDFA 1EFDN 1CHDA 1MPTA 4UVGA 5F1OA 3HNPA 2ZWVA 1E69A 2XNDD 2UZAA 3LHIA 3RUFA 3KB6A 1YE5A 2XI4A 3DL4A 3H1FA 2ZQ5A 1YI8A 2B1QA 2O54A 2CEAA 3OTHA 2X8AA 5YASA 4CG1A 3JAKB 5THXA 3EH1A 3NDJA 2FX5A 4QTUB 1ODCA 2YJGA 4Q3NA 2JD0A 2G4LA 2NO0A 3PXUA 5AVOA 1DIOB 5AI9A 2JGDB 1WO8A 1H1TA 4ZXFA 2AMJA 4YDSA 1ZYUA 1J24A 1JFFA 3KX2A 4HR7A 3WWYA 1DO8A 2OAGA 4TSRA 3WHPA 3FKQA 2WJPA 4LBVA 3NVAA 3KR1A 4B8WA 3TW0A 3GVCA 4J1TA 3W5VA 4QC2A 3TTVA 4DLRA 2XMRA 4DLZA 5AD1A 5CXQA 2QTCA 1TM4E 1E1CA 1UPUA 1ZITA 2ENUA 4GLJA 1RZ3A 3PFNA 3PFHA 5TF0A 3UMJA 1BEZA 1J33A 1ORIA 4LN1A 4YC7A 3WJAA 5JVDF 1ABBA 1BDHA 4XDZA 4WASA 3MLAA 4X60A 3OECA 1FBTA 1QIKA 4EK9A 1CUJA 4XYEA 3M8KA 3W4IA 4L5YA 3S70A 3T1TA 2XXAA 3QMPA 2X0KA 3EGDB 3OMWA 1GR1A 5C3MA 3SYTA 4C4RA 4MDHA 2JAQA 4LXHA 2HA3A 4CHTA 1IUNA 3H11B 4R5HA 4E14A 1CUHA 1Z5PA 3BJEA 3SLGA 3O8OA 4PONA 1GUDA 2ZS8A 1NM5C 2PLNA 2XWQA 1EK0A 1XROA 1ATIA 4WKGA 5K0LA 3KYJB 3LUFA 4GYYA 1QVWA 1S9HA 2HDOA 4K9KA 4ZVRA 5AIAA 1EJ6A 1IM2A 1P3DA 1RE0A 1VI2A 1HMYA 2PANA 3G0OA 3EGXA 2Z5FA 3GT0A 4XYMA 1YUBA 3K0FB 4IUYA 2RGWA 3OZFA 3HEMA 4KGZA 1O2DA 1XF9A 1XBTA 4IS3A 2FN8A 3W2GA 1KU0A 2DZDA 3OPYI 4UTOA 4B7XA 2Z9CA 5EHQA 3DEYX 2X7XA 4GQIA 4GOXA 1VL0A 3OZRA 4XPIA 5KNDD 2GWRA 2WZDA 1EHYA 3AG5A 4OI2A 5CBKA 4J0EA 4NZOA 4LFCB 4DM4A 1TIPA 2QMQA 3NYWA 1IYZA 4BQEA 4RTKA 3BFXA 1AQUA 1X42A 5G4LA 2PX3A 2QGNA 5HRAA 3SE0A 3ZZMA 3VUEA 1LF5A 3DM9B 3MG9A 4GLOA 4MXDA 2KYRA 4Y6LA 4R8SA 1W19A 4B44A 1K98A 1RSZA 2Z04A 4BNFA 1GQ2A 3H1TA 3LDFA 4M7RA 3HPRA 2JGEA 1K5DA 2G67A 1U9CA 4UDYX 1EUYA 2X1HA 5FYDA 3AKYA 2YDXA 1YS6A 5CA0A 1YRBA 2QMUA 1OB2A 4MP6A 1ODSA 4ND5A 3RREA 4BC1A 3E2PA 3HABA 3NIBA 2P68A 1YZHA 3UAWA 3OJLA 4A6PA 2AG8A 4A1FA 1D4OA 3RJ5A 4DLNA 4MHOA 2AJDA 2YWJA 3C8DA 2I9PA 2QRGA 1V5EA 4BV3A 1PTKA 4R84A 5DASA 5DNAA 4DKXA 3I5YA 4RMNA 4LYYA 1D5WA 2JEOA 3TG2A 3Q6IA 4EGQA 1XRRA 1TT7A 3HY6A 2WEKA 4MQ5A 1XXHB 3SJZA 2YN0A 3ND9A 5KKNB 4P53A 1ZUNA 4I36A 4ID3A 5CYFA 3V4FA 2WHPB 3KFXA 2O2IA 1PU2A 2OHHA 2OVBA 2C4VA 3COSA 3WK5A 3O7WA 4S24A 3ZE7A 3GJ4A 3T7CA 2JGFA 4RVGA 3ZU5A 1JDZA 1XD2B 3H3XA 1A9XA 2JBWA 1TUGA 4LJ9A 2YXPX 4L3VA 4UCQA 3RYFB 4AUEA 3WGIA 4OLAA 1HH4A 2Q9AA 3AHEA 2P8SA 1JEAA 3FHCB 3RYHB 4QT4A 3T5GA 1PWXA 2C2XA 3HFSA 4FIZA 5ER6A 5TY0A 1DBQA 1YK1A 1SVWA 1Z82A 4LJSA 4TZTA 3KSAC 1AKUA 2BUBA 4AJ1A 3CUSA 2G0NA 2B7BA 3NBMA 4Z4FA 1Q20A 1J4AA 4NAVA 2DPMA 4KWCA 3TE7A 3V7WA 5KNDA 3BXPA 4Y2RA 1W94A 4K0KB 4IG4A 3ASUA 5B1YA 1OFHA 3I53A 3NBFA 1ZNQO 1DZIA 2CXHA 2JLZA 3PNMA 3DCJA 1X86B 4O2RA 3PX3A 1RRGA 1G21B 1T1JA 1U8UA 5ALGA 3F49S 3MJRA 2H31A 1O5OA 4R05A 4MV7A 1GNTA 5JWRA 2JHCA 3BEDA 3EBPA 2QIOA 2GD2A 2NSLA 1K89A 2XAUA 1PP4A 4NV3A 2XCTB 4Q9IA 1VCHA 3KFLA 3TCXB 4YPOA 3JW8A 1UBMS 3MSXA 4MMZB 3R9IA 4MP3A 4ZI7A 4TQGA 2YS6A 3INGA 5FBLB 5FTLA 3VTFA 5KOJB 3O93A 3D6JA 5LIPA 3B1JA 1DTWB 2MSWA 3Q12A 4HFNA 4IM7A 4LVUA 2QQFA 4XVUA 2OO7A 5KVVA 1YQGA 4GU5A 1YA6A 3IHLA 2J0SA 1NQUA 4QPJC 4XWOA 4FXPA 3QQPA 4NIMA 1C41A 3ABQB 5EE9A 821PA 3U3MA 1OREA 1SEVA 2AUTA 5IARA 5LC1A 1P2UA 4A8JC 5KTOA 1L5FA 4NHOA 1XMOB 3TLGA 4NS1A 4WACA 1TU3A 3RH0A 5M7EA 3JQCA 5FPQA 2QD4A 1B4DA 2R7MA 3B6IA 2QMZA 3N6RA 1Q11A 1PHRA 4AKEA 4EHFA 4RGYA 2Z3WA 5A4AA 1LY1A 2Q6IA 2J0VA 1NKTA 2X0FA 4QQFA 2ZB8A 1WZ2A 5C4IA 1NI3A 2VZEA 5KTPA 2DJIA 3T3OA 5DBHX 2RGYA 5ITSA 2FZEA 2GUGA 1Z9BA 2QUJA 3B89A 3QVKA 5K0NA 2P41A 1GUAA 2I33A 4Z49A 1R0XA 2DWCA 3M6LA 3RTAA 3BICA 5C5IA 1U8CB 2HJWA 2NADA 5G0VA 3I6ZA 3KYCA 4RQTA 4PC1A 5JO9A 4H1WA 2Q4BA 4AULA 3LS2A 2EFDB 3I30X 4OMDA 4PQGA 4GWKA 4QUDA 1LEHA 3JR7A 4TLMB 2PBZA 2DVMA 2EKPA 3AKCA 4EHAA 3R3HA 2R87A 1FDVA 2EFYA 3GMDA 3OETA 3AUXA 1J9EA 1AKTA 5CJPA 1RNLA 1XVAA 2DR0A 3Q7EA 1F0PA 1FYDA 1Y0BA 2VUTA 1JSLA 1VLMA 1Q3HA 2ZDHA 1NBAA 2PXAA 4TRNA 4TSKA 5F9MA 1I8TA 2FP4B 3N9IA 3AM1A 2YFYA 4CKEB 4FDTA 2Q2WA 2ZBVA 1IZ9A 5EJFA 2PUGA 1H0KA 2PUWA 3COZA 3EZ6A 3IUNA 1PR9A 1LTQA 1YB6A 1XZPA 2ZRKA 3NDPA 5UKDA 3OT1A 4H77A 1KORA 1ORWA 4RF3A 4TX1A 2AN3A 4X45A 4UD2A 3TSYA 4C7JA 2HEGA 1UOPA 1PFGA 1OBOA 2O0JA 1L7PA 1JG3A 4D96A 3G82C 3QLVC 3BHMA 3C39A 3WB0A 4LYDA 2O8FB 1PD0A 3B6KA 2EATA 4ZT3A 1E4EA 1KVQA 2GX6A 1KAQA 2DWQA 4MW1A 1SHTX 2HNBA 3IUBA 4N0QA 3AJAA 2D8MA 1DC8A 4ZVLA 121PA 4ENPA 1W5AA 2HRDA 3LQYA 4KGVA 4MW7A 1RTKA 1P6UA 3HDGA 3HCOA 3LPDA 3M6MD 3QU5A 4PY2A 4AG5A 2C5EA 1IMOA 1S2DA 1VJCA 4HAOA 5ALDA 4IXNA 2YICA 5CK5A 3ZXXA 2O2HA 4QFMA 3NHMA 1SCUB 1NMEA 4LRXA 5FBKA 4JNKA 4AJJA 1XL0A 2EARA 1TKBA 2W2OA 2YTZA 4R31A 5KZMB 2OK7A 4MVJG 3KZ1E 4KSCA 3DGEC 1X7YB 1PR0A 1NQOA 2R6GA 4I4IA 3NCHA 1N1EA 3SVTA 1XCMA 4AM8A 2QYSA 3UT5A 4B3XA 1A9RA 1RRPA 2C8VA 2EDAA 1AQNA 3FTEA 2IYTA 3QXJA 4NU5A 4M0KA 1LFAA 4UC0A 3GNLA 4CM4B 1P2DA 3R9XB 4PYNA 4M1WA 4AX8A 4DMMA 1C1HA 3NIWA 4DRZA 3TR0A 5JQGF 2GJ8A 1XCOA 1YQXA 1QIDA 1YZLA 3UMFA 3JX9A 2WB2A 3GLKA 1N75A 2GBIA 4LSMA 4QE3A 4KN8A 3UWSA 1XQVA 1ZXBA 2EX4A 3SX0A 4AJ4A 3EGIA 5JADA 2O8EB 3ENNA 1OROA 1V6CA 3N8DA 4OXIA 2ZYSA 1BROA 2I34A 2OQVA 2ZUUA 3RUIA 2ZPAA 4BVAA 1PDOA 2EIHA 3FH0A 4OFBA 5JZBA 4UBKA 1MRSA 1PWYE 1MD9A 5L8VA 4P4SB 3RD5A 3BRWA 4AURA 4M54A 1VYHA 5LMNB 3QSYA 2HHHB 1KDOA 1K3TA 1QFYA 4R4JA 4E21A 4DBZA 1UDCA 5DGCA 1X9GA 5C8YB 4MKRA 4YGYA 4V0LA 2HFKA 3O1JC 4IZOA 4OKNA 3GI1A 1Z6AA 5AW8A 5JS1A 1QTQA 1I7DA 1FMTA 4IILA 5IHXA 5K3EA 2VRWA 1MABB 5BWCA 2Q1TA 2MINA 4ZAZA 3VPSA 1T2AA 3H6HA 3HLYA 1RPJA 1MC1A 3TRKA 1W49A 3AM4A 2XYRA 2A9JA 1EU1A 3IDFA 2ZYAA 4UVDA 4XEHA 2KJQA 3KQHA 3G7NA 3O73A 4JI2B 4CIXA 5JZSA 1AM4D 4IOLA 4RZXA 3UJPA 4BEBA 3NS7A 2DH5A 1S0UA 4KKVA 4YP9A 1X0VA 1ANKA 1SVUA 3A4TA 1CBUA 2FX2A 3DE6X 1WW3A 4UNNA 1OGJA 1A5SB 1Z2EA 3LFTA 1AGYA 1RP7A 4WOBA 3TL2A 2QE7D 4I6GA 5AM5A 2FG6C 2Z8YA 3FLBA 2ZB3A 4CVNA 3WQQA 5BQFA 2EJBA 2NPFA 3AY6A 4GX1A 4M0EA 1GITA 4NABA 4RV5A 3TTYA 5KCZA 3D7RA 1T5BA 1XT6A 1H65A 1VMIA 3WTBA 4HGPA 1TADA 3JPYA 3C8HA 4QUJA 3C45A 2BT4A 5EY5B 4BFZA 3ELWA 4KLZA 1ZVVA 3P5SA 3X2SA 7ADHA 4E12A 5IANA 1GUYA 1XJ0A 2GTHA 4OQPA 4PYQA 5IAGA 2D8AA 3M5CA 5HNKA 4D6XA 2VF7A 3CKLA 4NH4A 4Z9XA 1T8UA 3P0IA 2CFSA 2Y1GA 3QKTA 4IZHA 4RELA 1E2BA 2PM8A 4LHWA 1U63A 3DDSA 1GT6A 4Y18A 3R3WA 3LCVB 3C1UA 1RBYA 3TTXA 5AICA 1OAAA 4NG5A 3E2MA 3JTEA 4BO3A 1JIJA 5EHGA 2YYSA 3TJMA 2QTMA 1DKUA 3LX5A 3RFUA 3SKVA 2WINI 4WZAE 2DEUA 1ZN9A 4KLCA 4PN7A 5J4YA 1O1YA 5JZVA 3TZ6A 4EJMA 3VYWA 4F4FA 4QTYA 2FI1A 3JU3A 1GVNB 3RR2A 4RQBA 2C5SA 1JG4A 1KDTA 5EINA 4BVJA 2V9CA 1TPZA 1Y8RB 4JJGA 2XB4A 1XC7A 3WB9A 3L0SA 4EW3A 3DWIA 3H5LA 1T3LA 3AMVA 1YJCA 1ZGZA 4PC3A 4OP3A 1N2HA 3LKBA 5KAMA 5ADUS 1X19A 4PG4A 2V03A 1TK3A 2WIJA 3THWB 1DWOA 1Q0QA 2ZI9A 2ZI4A 4AZWA 3WKDA 4WLFA 3OZGA 3GCZA 4MQLA 2QRVB 3LNTA 5B4TA 4Q4AA 2YUIA 1AHNA 4YAOA 3IQZA 2PX0A 3NV7A 1C7QA 3TOSA 5CB4A 2FG7C 1G4HA 3R3SA 3OZBA 2E87A 3IBSA 4JLBA 2B3DA 1U0SY 4Q02A 1PVDA 1KOGA 1VHJA 4DGQA 2ATXA 1C8BA 4NMHA 3J81A 3MCVA 4X90A 3S7ZA 1N34B 1KO4A 2RGBA 1KAMA 2OFWA 5E4YA 1W5FA 1WCV1 4GPEA 3WXBA 3DW1X 3IALA 1DRUA 2PV0A 1DDGA 3MTDA 1RHJA 1ST3A 4ZTUB 2QBYA 2GO7A 4IH9A 4ZT5A 2JFQA 5SY4A 3HDYA 4EYOA 1KZ1A 2YYAA 2X8JB 3JXEA 2BJHA 3PJEA 1HDYA 4MVYA 4OFXA 3QLEA 3R7BA 3GJ6A 1TF2A 1N5LA 1Y6RA 3HG7A 1T34A 3QENA 3DPUA 1W52X 3GRRA 5EE3A 1KVSA 3ZX4A 2ZAYA 3U4GA 1ISRA 2P65A 3HMKA 1H6DA 1YQWA 2EL9A 3GT7A 4MI6A 4N1AA 2GAIA 1Z0IA 2YVAA 3FNHA 4DTCA 3D3WB 5K0BA 3AFOA 4YRQA 5LR6A 3NTOA 2Y77A 4R1UA 3SQDA 3HR4A 5LP6B 3C6KA 5EJ7A 5BR4A 5U4QA 1JB9A 3FUWA 1CS0B 2WLTA 3IKVA 3QZUA 4PYKA 4A73A 1A1SA 1NYQA 3AY0A 3EXEA 1YVUA 2HBYA 2GKOA 2OV4A 2YQZA 4F91B 1KEVA 2BUAA 1SCKA 4TV9F 1CJCA 1JIVA 2F62A 5C46F 1CR1A 2GEBA 3AZOA 2OXCA 4TWBA 4OL0A 4Q34A 3T9CA 2Z8YM 3LQ1A 1F7UA 3KAQA 1RMTA 1KKLA 4RY0A 2QM3A 4ZYLA 2CV0A 5HQTA 3QEMB 4I55B 3I1YA 3UK6A 3WHIA 4PC7A 3W7VA 2ZJFA 2QUKA 3JQDA 4OJMX 4E2XA 5KTTA 1GCUA 1QUEA 2GEDA 3BXXA 1YRWA 3H17A 2H2DA 2NACA 1VKRA 4CM8A 1HEYA 3DS8A 1QVRA 3DO6A 2W2NA 4GVLA 1IPFA 1MAUA 4J03A 1R6AA 3SC3A 3BSWA 3H16A 3K9HA 3ZLVA 4UNIA 4J4BA 4D44A 3EOZA 3AKZA 2UXCB 4RF2A 3AHJA 2J9FA 3MRSA 5T4BA 1ESDA 1G2QA 1JEYB 2IZ6A 3WK4A 4RHCA 1I9CA 1UH5A 3DGFC 2ZUDA 4ZJYA 1ZM9A 4D9NA 2CDNA 1NXSA 4DV3B 4FEGA 3T3HA 3CYFA 5L3RA 5JAIA 5FBWB 3EGCA 4RPLA 4EZIA 1E2NA 4OM8A 3WLMA 4AD8A 1YIDA 1BKSB 1Z75A 4OM7A 2FPIA 5GGYA 3RUHA 1TAQA 3SZMA 3ULKA 1EFTA 3B82A 3LYAA 2G06A 4GO1A 1ENYA 3IVMA 1C9KA 3W2EA 1FFDA 3WWDA 3AFHA 4YUAA 4AY3A 4UBNA 3OE5A 1HDOA 4TSFA 2PHZA 2XV1A 1ZK1A 3KOUA 5ESXA 1NDHA 4HS4A 1X38A 3H2JA 3PX2A 2OBLA 4II3A 5ARCA 1DB3A 3HM9A 1G8SA 1N2BA 1WVMA 2DC1A 3ZCQA 3IS3A 5IJXA 4GT1A 4MVJD 4NPHA 3LPAA 5HKLA 4EG0A 1ZXXA 4LKRA 1W59A 3B1YA 4WK6A 1W4CA 3CKKA 3VSBA 3CLRD 3GLQA 3OZDA 2QP3A 5I48A 4JKIA 3RK0A 1E79D 3TK1A 4E15A 3HBMA 5DI9A 4FMPA 3TEMA 3W6OA 5AM0A 2CW5A 4WNIA 1QRTA 4HTAA 1ISSA 4RGVA 4ZOEA 5JSKA 1ORRA 4G3XA 2REBA 5BR1A 3MT8A 4M89A 4RH0A 1UQTA 3R77A 5CURA 2AD1A 2W22A 4KZKA 3O4FA 2NPIA 3CGWA 4EY6A 4ER0A 1SULA 3WJ1A 1L0BA 2V74B 1DARA 1MVNA 4HWOA 2BCJQ 1N25A 2WHEA 3UV3A 1AT1A 5D84A 2GNOA 2VJPA 2NUBA 5CIYA 3U4QB 2NV0A 2R8OA 1WUTA 2ZCUA 3PXAA 4S35A 4EGSA 2FP3A 3HQ4O 2ZI5A 2Z08A 3LYUA 4OFZA 5CDSA 3GYBA 2CLDX 4LI3X 5IXJA 4FCWA 4YX9A 2AB0A 2VNSA 2YWCA 4LDAA 5BQ5A 4INAA 1J5PA 2OD2A 1G3UA 3QEAZ 5CCDA 5E95A 1UQRA 2AFIE 5J2UF 1G5TA 2OCDA 3ZDBA 1PJZA 1UC5B 2DYKA 5ICEA 4Q4HB 2V7WA 4KE7A 4PEVA 4Z4IA 2W2KB 4LKOA 2AI3A 1JDSA 2AQKA 1QV9A 1Z5VA 2DE0X 3KE8A 4JJZA 1OZGA 2V3VA 1JECA 4ZAVA 2P4EA 3WGYA 4L4XA 3S2SA 1T4BA 4BIMA 1R16A 3AR4A 3RJ9A 2R65A 4MUFA 4CV1A 1CB0A 4INOA 5JXWA 1TYBE 2NTEA 4KXYA 4MKGA 4F11A 2P4HX 1WDMA 3LXXA 5ENVA 3WIVA 2G72A 4FHFA 4HQRA 1G20E 2PD3A 1SJ9A 3OQIA 3ZNOA 1G1MA 3PRJA 1XPUA 2D5IA 1RMYA 3OCCA 5FQOA 1KTVA 4D4GA 1YU9A 5AYVA 1HQDA 4E11A 1ZI8A 4RA6A 4Z0TA 4IR7A 4KITB 2AQ8A 1YHYA 4W6ZA 3PNPA 5AK4A 4EPWA 1P19A 1FNCA 2BAGA 3R1IA 1JDUA 1GNRA 2XNJA 3CVXA 4NICA 3DZJA 2PSEA 4NV0A 1HDRA 4W5HA 1XNJA 3D1JA 4M8LA 4NCJA 1SC1A 2J5BA 5EKUA 3FTDA 1II9A 3DB1A 1JAYA 5CVVA 4IHKA 5F73A 3WSTA 4DCGA 1ZISA 3WGHA 4HADA 2VNHA 3KL4A 2XECA 4YJHB 3M1YA 4I4LA 1I7SB 1JUDA 1XZIA 1MJ5A 2HK9A 1JPNA 2WIKA 3A6HA 3E3OA 3P45A 2Z9BA 4WA7A 3VJKA 2LWIA 3OFJA 5EMHA 2P35A 3EG5A 5JOQA 3VR3A 2TMGA 4KO8A 4KQJA 2VP2A 1JI3A 2EZ8A 1TE2A 5FUYA 3PC2A 2DJ5A 4EVIA 3IERA 5BNFA 1Z26A 1OD6A 2B78A 3C85A 2LXNA 5DWQA 2RHJA 3K30A 4B6EA 4V1CB 5J4VA 2I80A 1MP0A 5E7MA 5BSUA 2I2WA 4LNAA 3GFSA 2VT7A 5BRJA 1ZU5A 3DG9A 1DCFA 3F78A 3QUSA 4I50F 3T12A 1A96A 2IUFA 3RO7A 3MCAA 4UKDA 1G21E 1G9XA 1YULA 5LUAA 1OH8A 3KALA 1JHYA 3FF4A 5DJ5A 2FN9A 1NXQA 3B3AA 5IC6A 2IH4A 4UBLA 3OD1A 4UDOA 4ZHQF 2BH2A 1R7RA 4MQ6A 1WF3A 4X9XA 4IGEA 1EFPA 2RI1A 4EKNB 4TKLA 5AHOA 4HZIA 4TWZA 4DCMA 3JQQA 2Q6OA 4HNRA 1D09A 4PFQA 5EESA 4CL8A 5KHLB 1XSEA 2HQSA 1QFSA 5LOVB 1JPUA 1NQTA 1NE7A 1PL7A 4R1LA 3RIMA 4OIFA 1Z8FA 4AZ0B 3OD5A 1JJAA 3CPEA 1AK2A 3AUYA 1C1XB 3OHMA 4HRXA 4YY3B 1A7JA 1NF8A 2RGNC 2HY7A 3TQTA 3BTUA 3QVGA 3A6PC 2WZBA 3LFUA 2FLWA 1UJ2A 2EZUA 2AYYA 2G80A 3IULA 4GUDA 1B26A 1GTVA 3VTZA 2Z4SA 4M9CA 3S55A 4P4TA 5JVDB 1TDJA 4IIGA 1SXJA 1WZNA 1HYEA 2E4VA 2JLAA 3JYLA 3RKRA 3TOCA 3QWAA 2ZIVB 2NZXA 5EERA 2JVJA 2W8BA 2R8RA 3RODA 1BQ3A 2F1RA 3UT5B 1MR3F 1E1QA 1Z0JA 4JLDA 5FFNA 2EL7A 5EKDA 4GPTA 4WZZA 1NJFA 1OI3A 2GK4A 3ZV5A 2CL5A 5JBNA 1W0JA 3IXQA 3A0RB 2ZBDA 4ES6A 2ZRAA 3FUTA 3ZHVA 1BZYA 1GJRA 1KA9H 2WD9A 4BMPB 1A4UA 1NSYA 1PW5A 4ZQIA 4DJ5X 3OIGA 2FPXA 2OHGA 3F98A 2AUMA 4A0RA 1BQEA 1YDWA 4YMUA 2IYNA 2QL9A 4WVLA 3TM4A 3M81A 5G0UA 1FUKA 3FPAA 3QQ5A 3CUWA 4EG1A 1QO9A 1UQUA 4MCHA 3MAGA 3QTBA 4Y7CA 5FTWA 4I9UA 5ENZA 2PKQO 2IV7A 4YJHA 5E1BA 2YX1A 4JK3A 2QY9A 4I1YA 4O4LA 4QJ5A 1N5DA 1E99A 4CLOB 4B3RB 1M7BA 1W8IA 3ESCA 4PX5A 4KRXA 3SIWA 4RTNA 1XWIA 3FPFA 4HZGA 2QVCA 2B7CA 4M99A 1SB9A 4PLVA 4YR9A 5KO2A 3KK0A 3KSDO 5CH8A 2EBWA 5C8XA 1Y6ZA 3I1JA 5JS2A 2WTAA 3WA6A 4DA6A 1LBEA 4Z0HO 3ZE1B 1UM8A 4CIAA 5DH9A 3DBOB 1GAEO 1MB2A 1ZUHA 1EM8B 2WTBA 4L8LA 4XD7D 5EXEA 5AVUA 4U9HS 1FXSA 1B0PA 3PLAE 5LLDA 4L57A 3E8SA 3PC7A 1Q84A 3EODA 3TIXB 1VGRA 5FTNA 3VM6A 3JWHA 3FHOA 1EE9A 1SC9A 1UMBB 3IAS1 5KTSA 2Y1FA 4C06A 4PTYA 4DMGA 3JCZA 3QI2A 1TA4A 2PYZA 2YRWA 4L8FA 1XNHA 3HB1A 3SEQA 5D3KA 1PUXA 5A5DA 1P6XA 1QU2A 1YIOA 2JJ8A 1L4YA 1TQHA 2BI8A 4E3ZA 3K0SA 2HRBA 1MAVA 3HU1A 1GPDG 2D5AA 2EHDA 4RZHA 2PSSA 3EWIA 1XCBA 3MRVA 3N2GB 2QGFA 4QFDA 3LD9A 1P2GA 1HURA 2FEKA 5BNWA 1GT91 5EJIA 3EG9A 3CVYA 1O96A 3IP1A 4MZXA 4PSAA 5CLLA 3VYUB 3I04A 3A3OA 1W76A 4OB7A 2QJOA 3TNYA 4BCCA 3QW2A 2HWKA 1CUZA 1WQ1R 2VDUE 2Q2VA 4MINA 5IC4A 2V59A 2V1XA 5HPYB 4LYFA 1C3EA 3BWYA 4KTTE 2RK4A 2J67A 2Z83A 3GRKA 4ZOQI 3STYA 5L95A 5TLSA 3O21A 4IIJB 5IJWA 4B87A 4RCZA 2FV8A 5JMOA 2A3RA 3SSAA 1XDSA 4YMWA 1K6MA 2BBOA 4D3YA 1FCJA 1F5NA 2JAPA 3ANMA 3G1WA 1KOFA 4HDMB 1CDOA 1SM4A 3LVRE 3CR7A 3TZCA 4C0KA 1DJQA 4FEYA 3N2YA 1SIBE 2ZRCA 1UZAA 4DG8A 2ZWIA 4V24A 3V55A 1BIFA 1OLOA 5CVEA 2XUZA 4KZPA 5CLGA 4UUOA 2VDKB 2OFPA 5DGTA 1O54A 4EYKA 4IV0A 4R9RA 4HNQA 1OBVA 1M73E 2Q29A 2IYZA 4OOFA 1NWCA 4GLFA 2PXXA 1NRXA 4PZ0A 1RE1A 2RAPA 5J1TB 2JDID 4MAFA 2Q3CA 1DBPA 1SD1A 2H00A 3KEOA 5FADA 1US8B 1Z7BA 2WK1A 3I37X 3D8SA 3KR0A 2XA9A 1PFYA 2QDXA 3AF0A 4JENA 4N54A 3ZNPA 1Q0PA 3I3SR 4BGIA 1OXSC 1T91A 4ERNA 1MX1A 2EQ5A 4IO0A 4NATA 4XWTA 1KI4A 2ZI7A 3FZGA 1QONA 3NUGA 1L7EA 3RF6A 4Z54A 1N3BA 2PZLA 1IOLA 2DQSA 1XTKA 4H7EA 4D26A 2GQ0A 1HG1A 4QELA 2P6MA 3E03A 2NGRA 4ZANA 2PJUA 4QXPA 4J0CA 5EFOA 2NXCA 3FOEC 4MYHA 2IU6A 1L7AA 4L5AA 3VMMA 2H11A 5K8JB 2C88A 5C5DA 1L7VC 3C3KA 1IY8A 1P3Y1 1LPNA 1GKLA 1K7EB 1FUUA 2QMHA 4NK5A 1XU4A 1H8HD 3RSCA 5KWIA 5DM60 1XDWA 1ZD8A 1L4HA 4QRIA 1GRCA 1KSHA 2W71A 3U37A 5LYJB 3LDUA 4MVJI 1FNDA 2C7GA 1OVGA 5AJZA 1DX4A 3L8GA 4IDPA 4YCLA 2P6NA 4JX9A 5CVDA 3I12A 3CLHA 3GH1A 2X7HA 3ORRA 2P2CA 1OE0A 3MVEA 1AQJA 1PKEA 2FY8A 3FPJA 4DIBA 5FOVA 3GG2A 1T4GA 5T6MA 1ECGA 3PP8A 3QH4A 3AXSA 4UNSA 5EYPB 5K4GA 3CKMA 1RC1A 3SC4A 2CLMB 2IPLA 1E2GA 2B5WA 2H9IA 5DIZA 5CFZA 2QB5A 2FW1A 3ZV3A 2YN2A 5B1SA 1WEKA 1J2YA 3H05A 3LP6A 4IYJA 3K1YA 5IUNC 4P3PA 1W29A 2YOGA 3WGKA 3V7FA 2X1VA 2ZSAA 4Y1GA 1IN7A 1FL9A 3RYCB 3ZGOA 4W8HA 1V1MB 1NVFA 1T10A 2OLKA 1OF1A 4I66A 4RKQA 3SFZA 4F46A 1Y1QA 2LD4A 2A88A 1DAIA 2D2XA 1GYRA 3WLQA 3V00A 4UW9A 2GEKA 1EG2A 3F4LA 1QHHA 5IJ9B 3THXB 3WLTA 2RGRA 2QLLA 1DEOA 3SR3A 5ADWA 1O97C 3TMAA 2ZAGA 3QI7A 3IVXA 4CKCB 1GY8A 3REQA 5IP5A 1DHRA 5CFLA 4RTPA 1G2PA 3HA3A 1IMJA 1RQRA 1O87A 2BMFA 5TRTA 1X9HA 1X3SA 2CT8A 4QGGA 3TGPA 3JARB 3T7EA 4LDNA 5AJYA 4UU0A 3FXAA 3UJ6A 2X0NA 2XB9A 3ZHBA 2VDOB 5JZMA 1B6RA 1I1HA 2NOAA 4RXUA 4M9UA 3PYLA 1VP3A 4EA7A 4D8VA 3E2IA 4FGZA 1E7MA 4Y1RB 4QDKA 3UYKA 4JJAA 4NY1A 5K3SA 1UKYA 4I5IA 2G9RA 3T7TA 1PDVA 3ZJ4A 3M1IA 1S4QA 3KOWA 1SCUA 3GDOA 4HDSA 3TZLA 3VH3A 1EWRA 2CBXA 3OA2A 1OIWA 2X4IA 4P5PA 3ITKA 3QELA 3WY9A 1ND5A 4GLLA 4NG4A 4O2LA 5DHRA 2QW8A 4QNMA 3VQTA 4B8ZA 4R9SA 3H9QA 4PWYA 1D4ZA 2VWQA 4X1IB 1JI0A 1CVLA 1OUMA 1EVJA 3EIQA 5TS2A 2AJCA 3A1FA 3L0DA 1V43A 3I72A 3GRPA 4MULA 3AR5A 3TSWA 4DNFA 2G1JA 2DT8A 2YCLA 4NTZA 5A3QA 5CPBA 3FUUA 3MTEA 2P90A 1JF8A 2R6CA 3JAWA 3OOWA 2AXQA 1ZVKA 2WC1A 2JFYA 4YUYA 1DC4A 3BXGA 4NX2A 5LZ7A 3WL4A 4F04A 1J5EB 1M2EA 1H2RS 3GVIA 3CWQA 5A3RA 3NOQA 1AO3A 1PG0A 1Z5NA 1RMQA 2WSMA 4J0HA 2ZRJA 3PQ7A 4Z3OA 1ZUD1 3TFQA 1JU9A 1HDCA 4M46A 4D6PA 1LDMA 2Q5LA 1U0HC 4LRYA 5IDVA 2VZ9A 4DJFC 3L8CA 2BTQA 3N8NA 3Q3JB 3M70A 2RHBA 1KC3A 3C43A 4WCVA 4ZYUA 1XRPA 1M2FA 3X1YA 3RABA 2HRCA 5FOSA 3H1BA 2G5PA 1VQ1A 3ASZA 3RS4A 3SQWA 5C7IO 2L42A 4IXWA 3ZJUA 1Z13A 1I0IA 4YHBA 3WIUA 4E2FA 1ML4A 5CBPA 4WNAB 4PQYA 1CU1A 3GGSA 1TOAA 4D9KA 5JCPA 2FJ0A 3KR2A 3UUGA 3UCFA 2OKCA 2GWHA 1UWVA 4DREA 2WLSA 1Y80A 3GARA 1CF2O 2IODA 3MJFA 1JAIA 4K87A 4TYQA 4DNOA 4NCXA 1IN1A 3RV4A 4A2PA 2D7CA 2L0XA 3O91A 2R11A 2VF8A 3BRWD 1EIWA 3QHQA 1GADO 2CNWA 3FFAA 1YI1A 1E58A 5B2EA 4Q1AA 2IOFA 2J31A 4GPD1 4K9PA 2H29A 2H48A 1W87A 2GHTA 3G1UA 3HHPA 4DNPA 1CTQA 3OEWA 5HQ3B 4FI3F 1O9GA 2A33A 1EP2B 2EG5A 4GC5A 3W8FA 2X42A 3K1ZA 3K94A 3NHLA 3UAXA 1C7ZA 1S3SA 1OYWA 2BMDA 5D7BA 1RLJA 2WNHA 2OQIA 3KPJA 4NXMB 3STTA 4W82A 2UZ1B 1SVNA 2HCBA 4J76A 1KBQA 2IEYA 2WUWE 3K8YA 2QNIA 4WFKA 4EY8A 4ZV4A 3ROMA 1GR0A 1I36A 1PKXA 4KXQA 2O9JA 3DLCA 4PZYA 2IYOA 1K0UA 3OCXA 3PPWA 4EAAA 2FE4A 2JKZA 3GHHA 2XW6A 2AG1A 4O1IA 3AUSA 2BN4A 1VPWA 1UIMA 4OP2A 5F2OA 1YRAA 4IINA 1ZH0A 4Z86A 1NIPA 3B1WA 3Q41A 1N0HA 5IULC 3U1BA 4DQXA 1FFHA 3C3BA 1KK1A 1GA1A 3PENA 3AZQA 1AK1A 1G0NA 5HQ3A 4RK4A 3BMCB 2GXSA 3MCWA 4NBUA 3GFRA 2C78A 1TT5A 1ULAA 3KAJA 3LVFO 1WB5A 2CE7A 2EAUA 5TDHA 2I54A 1D2HA 1N1MA 2PXHA 5B53A 2QZJA 5JAUA 2P6OA 3HXOA 3HYNA 1XMJA 2H2FA 4HBZA 4B3FX 4J0QA 2VG8A 3PPVA 3LM8A 4QDUA 4UXHA 1IY2A 1WAMA 2ATEA 4GPZA 1QHIA 5K0GA 5AP9A 2XGJA 1TO1E 2ZR7A 4HRYA 1GXSA 2YC2C 4I81A 4JODA 1K3FA 1KZ6A 1F51E 1B2LA 1BWSA 1DAMA 2Q4EA 3DKVA 3DTNA 3PE3A 3RUPA 2ERXA 3RVPA 4BDSA 5KNCA 1U6JA 2XVXA 2GKGA 4QXQA 4RORA 3IE0A 2JGMA 3SZGA 3TLAA 1XZNA 4LRQA 1X3LA 3O4GA 3VHQA 1QPZA 2M1ZA 4KYUA 1P4RA 4LC1A 4MYUA 2EGGA 3ZNNA 2O59A 1DEAA 1EZZA 2O2CA 5KX5A 1XEXA 1L1RA 1SH7A 3BB1A 5HKKA 4BZPA 3TPZA 1LQTA 5BUQA 3V4RA 1KPGA 4AJPA 3ZWKA 5I9IA 3RVBA 1BRMA 1XZ8A 3NT4A 3BFKA 4B4KA 1WULS 3H2SA 3AIKA 3H42B 4CR7A 4RLQA 4PAGA 3VR5A 4K9NA 2QE6A 4Q7QA 1Z4OA 4P4UA 2R25B 1Y63A 2J6HA 3BD8A 5FYQA 2XRMA 3T9AA 3TNJA 2Q6KA 3TQHA 5JBIA 4RE6A 4C0JA 4YT5A 1YKFA 3GGPA 4CT4B 2WP8J 3GNSA 1U2DC 4OBXA 1WCXA 4XIFA 1T3TA 2BKUA 4AY2A 4Q93A 2RK6A 4TS1A 1I94B 5L45A 5TMDA 4H7JA 4M1QA 3WSVA 4CM7A 4A8HA 3M82A 5J63A 1CY1A 3FIJA 3U26A 4P4SA 5DEOA 1KRXA 2VHTA 3H2GA 5EJ2A 3O8QB 3ER8A 3U3XA 5ILGA 5D3ZA 3MYRA 1C2YA 2VZLA 1QDLB 3S2IA 1SXHA 4BUZA 2CL7X 3UJNA 1MPXA 3D2BA 2ZSBA 2HDWA 3I9V6 3L8YA 3KQUA 4AWXA 4P32A 3KZCA 3UWKA 3AI7A 3KL2A 5JS7A 1TU0A 4MYCA 2GA8A 2P67A 2IZ1A 4RNDB 4U7FA 4DDHA 4WESB 5HFNA 3WBFA 4ZI2A 1TF7A 1SZJG 3A32A 3OEHD 3C6ZA 2UVDA 3KLBA 4N3GA 3T4EA 4HQ0A 4ZT4A 4YMIA 2G1AA 1FA9A 2AMVA 2XEXA 4HQ6A 4G0YA 2PNJA 3SNKA 3ZCTA 1HETA 4AUKA 4Q4DA 2EWWA 5K51A 2QVBA 4GRAA 4CEJB 4V0SA 1L7QA 5BQXA 1EVZA 2E2WA 2RBEA 4GP9A 2IKQA 3I8SA 5F4BA 3E1SA 3NWEA 1GN8A 1UMCA 2ZTLA 4U6QA 2R7KA 3IYLW 4WE3A 4AYTA 1HDZA 1WX1A 2HHAA 3T5AA 1ZX1A 1MZPA 1Y4DE 3EDYA 2FU5C 1IDOA 5DOVA 4OCZA 3DVAA 1Q22A 3DR3A 3JQ9A 1LBIA 1N6HA 2XYQA 3I2KA 1T2UA 5GQSA 2XEDA 1X1SA 3KEFA 4XCVA 4LGCA 3SXUB 3HEBA 1HT2E 2F9MA 2ZT5A 4HAVA 3RGWS 1ZOPA 2NXNA 3C3MA 3WSWA 1V6SA 2JGAA 1V1RA 5G0TA 4FZJA 4QVKA 5DK6A 3I9FA 4ISBA 1FNNA 3FBTA 3HJNA 5SZKB 5HM6A 1DUIA 3QY0A 1X8LA 3F7NA 1S2GA 4FIDA 4DV2B 1K86A 3JQEA 3E58A 2IUEA 3A1UA 5DK4A 2FSGA 2IYUA 1JIUA 4IWNA 3LA6A 4M38A 3ZQ6A 1RADA 1RDFA 4J8PA 5CLFA 1UPTA 2KI5A 3B20A 3WFJA 4KRFA 1ZHFA 2H1FA 2I71A 2P62A 2WNIA 4C89A 3F5QA 4CKWB 2IPOA 4BAUA 2P40A 3HN7A 5AW6A 1W0KA 4QPCA 1XNGA 3G5LA 3RUAA 2MINB 1NW7A 1B14A 2D2FA 2NT4A 2UU9B 5FD8A 1GL3A 1PQ4A 4MJ7A 3PICA 4NBLA 1QKKA 1S8OA 4IS2A 1FXUA 3SHTA 2WJYA 5IH7A 3LK7A 4U02A 2ZQYA 4N40A 5E4JA 4TUYF 2DQKA 3ZXIA 1DAFA 1KP3A 4KUGA 4ZIRB 4HYYA 4I2VA 4HH0A 1BS2A 1IE3A 3HMQA 5I9MA 2IBTA 1DCTA 2BWJA 2G28A 2N1MA 3GUYA 4OI1A 1OR8A 4P4LA 2B2NA 3TKYA 1GFSA 4GWGA 4IAOA 4OGGA 1N4AA 1GAWA 2YW2A 2HF2A 5KYYA