3BMOA

Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor (compound ax4)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
267
structure length
255
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 96
structure length 255
sequence length 267
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bmoA00
3LDHA 1NQTA 1B0AA 3C7CB 3KHUA 4DQUA 4HADA 2B69A 2CY0A 3ZHXA 4MVJA 2D59A 3OF2A 4I5FA 4NBUA 4W82A 5L4SA 1CEQA 4GLLA 4AICA 4XD2A 4KDFA 5TT1A 3RUDA 4BV8A 3D3WB 2Z5LA 2VWGA 1HT0A 2OP1A 3L6EA 5T64A 4OKIA 3NGXA 4RZIA 1LLDA 4CQLB 1LDEA 2X0RA 3DFUA 2QIOA 2D5CA 3AY3A 1M6HA 1Z45A 3FI9A 1YH3A 2ZKLA 5CDGA 5CG2A 1ZUD1 1FXSA 4MVJP 2HO5A 2A35A 1L7EA 3IAHA 4RF4A 2X22A 1X15A 4MVJD 1BXZA 2VYNA 3GG9A 1SEPA 2AQIA 2FZEA 3F3SA 3LF1A 1GPDG 1HTBA 4OAQA 4P4LA 3PJGA 3VZSA 3FTNA 4I1IA 4E13A 9LDTA 4ESOA 4NBWA 2IEBA 4DREA 4GWKA 3PZBA 2ZTUA 4JGBA 3DOOA 1Y1PA 1GV0A 1RYDA 2BFMA 3PLNA 4GAEA 3U62A 1DDOA 1T4BA 2GZ1A 2NTNA 1Y8QB 1R4NA 5GMOA 4JX8A 2J8ZA 3HJAA 5K0ZA 1WZIA 3EZYA 2QZZA 3BA1A 1F14A 9LDBA 2W4QA 1YJQA 5TS3A 4B7UA 2HCTA 1HXHA 3WYCA 2AEJA 2VYND 3ETEA 3I5MA 5JFOA 1MLDA 3IIEA 1D1SA 2EW2A 4IM7A 1BRMA 2RHRA 1PGPA 1BDBA 2ZTLA 1I01A 2DFVA 3H7AA 4AJPA 1YL6A 3JQBC 3WGYA 2PWZA 5BNFA 3IS3A 1IHXA 4J0EA 3KBOA 1VRWA 1SMKA 5B4TA 1PTJA 4R9RA 2OO5A 5EQDA 2YUTA 3JCZA 4AJOA 3EY4A 3RU7A 5TT0A 5DOZA 4J6FA 3C24A 5G4KB 4J7UA 2YDXA 2YHIA 3EC7A 3F5SA 1KVTA 4ND3A 2E49A 2VNSA 2HKIA 3JQ8A 2FR0A 5F1OA 3I9OA 1F8FA 1YOVB 5DF1A 3UICA 4GSLA 5EERA 2NU6A 1BDMA 4F46A 1EFKA 2RH4A 2HMVA 1TI7A 2I3AA 2Q1WA 1JVBA 3OHSX 4PLWA 1BVRA 1V9LA 1BGVA 2DUWA 3DZBA 4A0SA 1OBFO 5A03A 2X9GA 4JIGA 1W73A 3ITKA 4Y8VA 4J4TA 1QYXA 3ENNA 1AHHA 5G0VA 4J9UE 4B7CA 1E3EA 2GR9A 1GADO 1H0KA 5G0SA 4XQGA 2X0NA 2PGJA 4DPLA 4GI2A 4M1QA 1SZJG 4OHUA 4QTZA 4R69A 3DMTC 3CMMA 4CL8A 3KOUA 4R9SA 3JD4A 4CQMA 5TRTA 1FDTA 4BOYA 4BMSA 2GDZA 4NNJA 3OM9A 3UW3A 1YE3A 1XQ1A 4EEXA 5T67A 3I4FA 4RVSA 3OIDA 1V3UA 4G5HA 2Y68A 4FN4A 3ZNQA 2Q3EA 5COAA 1GQQA 1P0CA 3UAGA 1XG5A 4OOFA 3F46A 3TWOA 4CLRB 2VHVA 1R4MA 3I6IA 1UP7A 1ADGA 3FPCA 2X9VA 4Y6SA 5THQA 4C4OA 5F1PA 3K2BA 2PA3A 2EXXA 2PR2A 2VWHA 4NBRA 1PGOA 2YV2A 1LNQA 1X0XA 2JCVA 2AG5A 6ADHA 4OO3A 3JQ6A 4XYLA 4IGEA 4CQMD 3JQGB 2BELA 4FGSA 3NAQA 3JQ8B 3T7EA 3JYOA 2B4RO 4Q3BA 3H2ZA 4D79A 1Q0LA 3U4IA 1E5LA 1Y6JA 2C54A 1HZJA 1K6IA 1LSJA 2V6BA 3L4BA 2O48X 4ZJUA 4FB5A 2PKRA 5L95A 4NIMA 1T2DA 4BNMA 2BFOA 4BUCA 3A28A 3N7UA 5C37A 2CDBA 3MCVA 4Q3AA 1NQOA 4J1QA 4BGIA 2I99A 3JD3A 3WYBA 1XU9A 1HSZA 1GZ6A 1VI2A 4BNFA 1V0JA 4CL3A 1VE9A 3M2TA 3KYDA 1GUZA 1KERA 4M49A 3WQQA 3GFGA 5BNIA 1DLJA 2YFHA 1IPFA 1FDSA 5EPOA 2G17A 2JL1A 2ZYAA 4PLPA 1FDWA 2DC1A 4ND5A 4L4SA 3AI1A 4NJMB 1CDOA 4RPKA 5L3ZA 4JP3A 5CAEA 2CD9A 2D8AA 4GKVA 1T25A 2Y05A 1E3IA 4IZHA 3OIFA 4BNHA 3SVTA 3MJVA 1NFQA 1ZK3A 1PJCA 3AI3A 1DHRA 2VTEA 3RBZA 1ONOA 3BTVA 4D45A 2OXIA 2J5RA 5A3VA 1KVQA 4L9RA 1EUZA 1LI4A 3AM4A 3E48A 2NU8A 3K92A 5IAAA 3ASUA 2E82A 1U3TA 3ZV4A 3OH8A 3SC4A 1H6BA 1C1XA 1DFGA 3Q0EA 2EG9A 4K26A 1X14A 1E1LA 1UAGA 4M89A 3VTZA 2VHXA 2VWPA 4A27A 3OFSA 3H8VA 3AM3A 3KLPX 4IZIA 3C1OA 4U7WA 1VL0A 1M67A 2OZPA 4BO5A 2OHXA 5AXAA 2YQ4A 1T24A 3GH3A 4PZCA 4RCVA 5A05A 4CMJA 5JS6A 1ZEMA 3DTYA 2FR1A 4XYGA 5EMHA 3A14A 4BGUA 4YBZA 1ENOA 1ZK0A 3E82A 4H3VA 1NTOA 2Y0DA 4I9NA 5IN5A 1ZK4A 3GZ4A 4XJSA 2X9NA 1ZW1A 5DP2A 5T8KC 4XB2A 1JTVA 2H9IA 3A06A 1ZZEA 3B6ZA 2GD1O 4RPGA 1CJCA 5I9NA 1I3KA 3C1AA 2ZQYA 3NRCA 4PZDA 3IJPA 2DU8A 2NADA 3RI3A 4E33A 3D3EA 3OICA 1LDNA 3F1LA 5DBGA 4L73A 3VPSA 3WTBA 4FPXA 4OMUA 1YXMA 3DOCA 3L4SO 3STHA 3SEFA 2X86A 4IGFA 1P1KA 1VJTA 3MZ0A 3NUGA 1ENPA 4UVEA 4HX5A 3E03A 1P1IA 3JD1A 3VPHA 3ZW8A 5IDQA 1HDOA 3GUCA 1E3JA 4J49A 2AG8A 4IDCA 3OJLA 4K6FA 2ZTVA 1YS4A 2JJYA 1YL7A 2E48A 3DBVO 1ML3A 4YRBA 3TZQA 1OZAA 4ZN6A 3PQFA 1V3VA 4TWRA 2ZCUA 1UZLA 3C85A 3W6UA 2PD4A 3EW7A 3JQBA 4W7HA 2VQ3A 4X54A 1PL7A 4XWYA 5T6BA 5I7FA 4DC0A 1FK8A 1ZSNA 3BTUA 2DT5A 4IJKA 4BO2A 3NT5A 1R6DA 5DZSA 4BO4A 3A9WA 1MA0A 1DAOA 4YAJA 1UXIA 1YB1A 1CRWG 1H2HA 3F5QA 5I7VA 1EVYA 1K6JA 3WSVA 4IDGA 4II2A 3RD5A 3UF0A 3O9ZA 2Y1OA 3WGQA 4TZKA 4IMRA 1JLLA 3Q3CA 2D2IA 2AA3A 4YJHB 3MTJA 3G79A 4CM3A 1ZMTA 5L7TA 2FPPA 3INRA 4CMBA 2G82A 2JKVA 4YAIA 5DNAA 2ZYGA 4WCFC 4YJFB 4FW8A 4ND4A 1DBVO 2QX7A 3UUWA 1F17A 1F06A 4N7RA 4MIYA 1B3RA 4FGWA 5JAMA 2IXBA 3ZNPA 1FDUA 3WWYA 1YVEI 2FY8A 3UVEA 1GYPA 2JFHA 1P1RA 3KSZO 4FFOA 1PS8A 3B1FA 2XAAA 1P45A 4CLXA 3AFMA 4WGGA 5I7SA 1I2CA 4GKBA 3WS7A 1E0DA 1K0UA 2B5VA 3TL2A 5TJ9A 4UVDA 1SNYA 1U1IA 3W6ZA 4W9NC 4S1VA 3H3FA 5IZCA 4RVGA 1DO8A 1X7DA 2O3QA 2IRWA 4BO3A 1DC3A 5DCUA 2J6IA 3Q6IA 3SLGA 4GLOA 3CUKA 4YEDA 3GF4A 2Y99A 3QP9A 5F3RA 2CNBA 3LYLA 3WMXA 2ZJ1A 4B8WA 3RUAA 1C14A 4YB8A 5I9MA 1ISFA 5EIOA 3TL3A 1ULUA 4PRKA 2EGGA 4YAKA 1V35A 2HRBA 3D5QA 2X58A 1PGNA 3JTMA 1N8KA 2H63A 2Z95A 5KVCA 1E7QA 1A4IA 5U4QA 2PH3A 4O6VA 1XR3A 1CETA 1WLYA 5HS6A 4GSKA 3ZU2A 4QO8A 1JKIA 5ES3A 3DBRA 1DHTA 4MIEA 2J3JA 2FPGA 4JP2A 4D42A 4ZRNA 3VH4A 4FCCA 2RAFA 4MP6A 4D46A 4U5QA 5C5IA 1ZSYA 4E5PA 1O89A 2PH5A 1PS0A 2DQ4A 3RBVA 1NQ5A 2J5QA 4GMGA 3RFVA 1SEVA 2OGUA 3ORFA 3WB9A 1CQJA 3H9QA 3AK4A 4NJOA 1WP4A 4UREA 1O9BA 4L8VA 4RO0A 4E5YA 3WWZA 5IG2A 4WASA 1Y8RA 1GEEA 4OSOA 1LSSA 3DEYX 3OP4A 1NASA 3PJFA 1NNUA 3SX2A 3ETDA 1ZK1A 3H6KA 3LSYA 5ILOA 1PGQA 5DBIA 4ZA2A 4QSMA 2EWMA 4PZEA 3K9QO 3WQRA 1EQUA 4AJIA 4K28A 1EVJA 1XLTA 3Q2KA 1GZ4A 1TT5B 4PLCA 5TJHA 2UUPA 3MJ4A 4LMPA 1PL6A 1XSEA 4PLHA 3HDJA 5AVOA 4IY1A 3LT0A 1LQTA 4I5GA 4BNKA 4D7AA 4DPMA 1G0NA 1I2ZA 1Y5RA 3VAZA 3PLRA 3ONFA 3BZUA 1MC4A 4PG5A 4W99A 3FR8A 3WFIA 4DLAA 5ICSA 1PJ3A 4IQGA 5JDCC 3HB4X 1Z74A 3GR6A 5KVQA 5L7WA 1E77A 1PR9A 1N5DA 3ABIA 3GEMA 4RZHA 1EDOA 3QVXA 4TRNA 3I23A 3I9KA 1JWAB 1FJHA 4CM8B 4YA6A 4KMSA 5CEJA 3TZKA 3Q9NA 1EQ2A 2VHWA 4DMMA 4XQCA 4UEKA 1UXGA 3O8QA 2WD7B 2ET6A 2YY7A 5HRUA 5BT9A 1RM0A 4PN3A 3JQ9A 3MOGA 3ZNNA 1EMDA 2XOXA 1R12A 3IQDB 5GY7A 1HLPA 1XIVA 1N7HA 1P77A 2HU2A 3F4BA 4IS2A 1QRRA 4I5DA 3TZHA 2NU9A 1NHWA 4ITUA 5ICMA 3BTOA 1HWYA 5T8KA 4LISA 2NVBA 4CUZA 1B26A 3U5TA 3CIFA 3JQAA 1VKOA 2C2YA 2BRUA 2VCYA 4XCVA 1ZXLA 2EIHA 1Y8RB 2BF7A 4CR7A 1PX0A 1XCBA 1J5PA 4J4HA 1MGOA 3BMQA 2EP5A 3PQDA 5IF3A 2CVZA 4RVHA 2WE8A 4U6SA 2B83A 2R2GA 4L74A 1I3LA 5JY1A 1UDBA 1SB8A 1V3TA 2A92A 3DFZA 3CEAA 4EI2A 2B5WA 1GPJA 1KEUA 4AJKA 1PJQA 3QA9A 3GVPA 3WGIA 4PLTA 3AY6A 3GQVA 4FDAA 2Q49A 3O03A 1ZH8A 1LC0A 4ALLA 4UAGA 5A9TA 2ZB3A 3BMCB 3H9GA 1QMGA 2NNLD 2I5PO 5EN4A 3PJEA 1WMAA 1X1EA 1SC6A 3JQAD 3PWZA 4KDEA 4MKRA 2CVQA 2JD2A 3GGPA 4XR9A 2LDXA 4CMEC 3GRPA 2BFPA 2BKAA 1E3LA 3B70A 3CINA 4ZQGA 2EW8A 4IDBA 3PYMA 3GUYA 1K6XA 1E3WA 1B16A 2DFDA 3BTSA 2I3GA 4D3DA 2P9EA 5A06A 4U8GA 1I24A 2QQ5A 4WK6A 3PJDA 4RLHA 4NR0A 3P5SA 1BHSA 4DLBA 4HY3A 2Y1EA 2VWQA 3RSHA 3LZ6A 3C7DB 4ALMA 3OJOA 5T5QA 3IUSA 5HS4A 4WLEA 3E9MA 3CTMA 3OETA 3C7AA 4XIYA 1VL6A 1W0CA 4R51A 3WG9A 4BKQA 5CFZA 1WNTA 5JC1A 1EBUA 2G1UA 1Z73A 1U9JA 3D4PA 5ER6A 2PZLA 3BMQB 2GSDA 2C82A 3PGXA 3QWFA 3I1JA 2NACA 1HYEA 3NEPX 3ZH2A 1B8VA 3ADPA 4RVFA 5IN4A 3IKVA 1EE9A 5MDHA 2Q45A 4BNXA 1HYGA 4E4YA 2W98A 2HMTA 3QHAA 3IJRA 5K9ZA 1C1DB 5JLAA 1H9BA 1N9GA 3LF2A 4GX1A 1DIGA 4OXNA 2OP0A 2AE1A 2Y1GA 4YT4A 1I3NA 4IDDA 2EKPA 1HDRA 5JYEA 1AE1A 5U9CA 1O8CA 1WDMA 4B8ZA 3PIDA 1NPYA 4EUFA 1CYDA 1OC4A 1O0SA 2EP7A 4K9DA 4RPHA 1E7MA 5C3MA 3AUTA 3IP3A 3WJ7A 3RFTA 1KEVA 3KV3O 3W8DA 4TSKA 3DZFA 1T2FA 3FPLA 4DMLA 1AHIA 1ZCJA 4QO7A 3U9LA 1H6CA 1XYGA 1NVTA 4IUYA 2ZQZA 5C7IO 2D3TA 4CLOA 1GZ3A 5ILGA 3Q9UA 5KTKA 4DXHA 1YL5A 3ZWOA 1ZBQA 3WGOA 3ASVA 1TT7A 1QYWA 1F12A 4YJGA 1J0XO 5DBFA 3WICA 3Q11A 1NAIA 2BH9A 3NJ4A 1OFGA 3N74A 1DOHA 2YV1A 3BMOB 2BHLA 3DAGA 4HFMA 5THKA 1DJNA 4FFPA 4R1TA 3ZWAA 4RORA 2EKQA 3FWNA 4EZBA 3PHHA 1HETA 1PZGA 4G81A 4YTEA 3RVDA 2Y0CA 1XWFA 3VDRA 4J2OA 1UXKA 3DHEA 4OGWA 3L77A 1YONA 4O1MA 4MVJH 3AW9A 3GDGA 1YB5A 3OQBA 4JCOA 3X2FA 3VH3A 3BMNA 1DSSG 3TN7A 3LT4A 1BXGA 3GLQA 1JW9B 2WWRA 4DLLA 2D4AA 2C5EA 4ID9A 1NXQA 1B2LA 3GPIA 2AHRA 1PJ2A 4GMFA 1WW8A 4INAA 4E30A 1Y9EA 2UVDA 1Z7BA 4FS3A 1UP4A 1I8TA 4CMIA 1WDKA 3PWSA 1LDBA 1QKIA 3D4NA 5AXBA 2VT3A 3RJ5A 3NDJA 4IDAA 5EESA 3WBFA 2OFPA 1SPXA 1VLLA 1UR5A 2PD3A 2DTEA 2AW5A 3L6OO 3ZWBA 2IZ0A 2C7VA 1DPGA 4MVJI 1VSVA 5IDWA 2YJZA 4CLOB 3QWHA 2GZ2A 1N1EA 4YDRA 3JQFC 2C07A 3EZLA 3I9NA 3GVCA 4PLVA 3TSCA 3E18A 3WYEA 1KETA 4FFNA 4U0JA 1N1GA 2GCGA 3AOEA 3HDQA 2VRBA 4AJLA 3UH1A 5KJ1A 2BLLA 2QRLA 4A26A 3W8FA 4L0QA 1YRLA 3U4HA 1KBZA 1UXJA 3KUXA 3WFJA 3AWDA 4BQPA 1GCOA 4JBGA 1LRJA 3K30A 1DFHA 1DB3A 4J2HA 1PJTA 3E1KA 3E9NA 3PGJA 1GU7A 3L07A 4YVFA 4XJTA 3IKTA 2O7QA 4ZQFA 4PCVA 2ILTA 5FF9A 3I9MA 5JE8A 1MX3A 2VNAA 1B3BA 3KSDO 3ZHBA 1X7HA 4BO1A 5LDGA 1A5ZA 1LXCA 5H83A 2QG4A 3UGKA 2JAHA 2XF8A 3DONA 4CV2A 2UAGA 4XX0A 1IYZA 3KB6A 1N7GA 1GQYA 4JBIA 5HM8A 1R4NB 1Q0HA 4CR6A 2V6MA 5DP1A 4XEHA 3IDSA 1I0ZA 2DTXA 3ZWNA 1GR0A 4DQXA 1I2BA 4CMGA 4CMAA 3UN1A 3QWAA 2P68A 1T2CA 4HNGA 2GASA 2PK3A 2NLOA 4ONEA 2DAPA 2E37A 4OQYA 4ZQEA 4QQRA 3KEOA 2A4KA 3WX0A 2ZB7A 4CMEA 2O4UX 3QW2A 2V65A 1A7KA 3BXXA 1Q7GA 1HDCA 4R1SA 5B4UA 4RQTA 1QR6A 4BO6A 2PFGA 4B7XA 4W4TA 3NTOA 2EHDA 2YHIB 4OJNA 1VM6A 3RASA 1QG6A 1VPDA 4URFA 3QE3A 3DO5A 4LSMA 3GGOA 1EE2A 2DVMA 4YYZA 3GGGA 1UXHA 3GVIA 3IUPA 4RLSA 2OMEA 3SJ7A 4EEZA 5JO0A 3RJ9A 4PFJA 2EJVA 4DVJA 1KY4A 4MP3A 5I8WA 1U4OA 1E1NA 2W2KA 3QLJA 3PYLA 2YQ5A 3F4LA 4MVJE 3ZWPA 3EDMA 1VC2A 2IE0A 3RKRA 3HN2A 3LQFA 1JU9A 3GOHA 1E6EA 1IUKA 1M66A 5EJ2A 1KEWA 1LU9A 1OMOA 3GNSA 5LC1A 2GZ3A 2QRJA 3GDFA 3G1TA 4RVDA 1R0SA 2Y1FA 3WLFA 3HDYA 3QVWA 2Z1NA 1NVGA 2B37A 1MG5A 4DYDA 4QXMA 3G49A 3PHIA 1KVUA 3EMKA 4PG7A 3LC1O 5L53A 2FSSA 5J23A 4CQMB 3LT2A 1CQIA 3FNGA 1LQUA 3RQSA 1VKNA 3AUSA 1YDWA 3KO8A 2PZKA 1RWBA 4ND2A 3PDJA 4J7CA 3BHJA 4QX6A 4ZD6A 4KZPA 1HE5A 4OYRA 3ZN2A 2YV3A 4HBGA 1R4MB 1YBAA 3WIDA 3ZHYA 4CJXA 2BI7A 5A04A 1BW9A 1LBEA 1YWGO 5TX7A 5L40A 5TLSA 4Q3CA 4ZVVA 3UCFA 3B1KA 4EDFA 2GGSA 5L45A 3JYQA 4R3NA 3LLVA 3R6DA 3JYNA 4HFRA 1TA4A 4PLFA 1HE3A 2ZATA 1A72A 3HNPA 1G0OA 3D1LA 5IDYA 1RYEA 2EGHA 2SCUA 3HN7A 4LCJA 4UUMA 5A02A 1SAYA 1D7OA 2DM6A 1YDEA 3UHAA 4BL5A 3ZV6A 4RQUA 2VZ9A 5G0WA 1ISIA 2H5LA 4CODB 5G0TA 3GHHA 3FN4A 3K31A 4Q3NA 1PJBA 4CR8A 2JCXA 1C0KA 1MFZA 4OKNA 3TFQA 4QFCA 3C3XA 4TZTA 3OA2A 1DRWA 3CSDA 4B3IA 4E3ZA 3VH1A 3HWRA 1YJ8A 5JDIA 1DRUA 3KYDB 1J4AA 1YB4A 2OL4A 5G4LA 5KJ6A 4IQ8A 4KWIA 1MUUA 3E6AA 1A9ZA 3N58A 3PP8A 1PQWA 1ZXBA 3V1UA 5JAQA 5IXYA 4DUPA 2AXQA 1J6UA 3DBHA 2BGKA 4O0LA 2JFFA 2E6UX 4E6PA 4MINA 4WECA 3O4RA 2ZTMA 2FP4A 4B3JA 2Q2VA 2Q46A 4AJNA 3QWBA 4ZQBA 4CV3A 1XKQA 3BHIA 4OIMA 2B4TO 3M1AA 5JCJD 4J4BA 2Q2QA 4IQ0A 3WR5A 4AVYA 1Q1NA 2Q99A 2J3IA 3VPXA 1R0LA 4TVBA 3PWKA 2AQKA 5TNXA 2UV8A 2DUUA 3LT1A 4WCDA 5B1YA 1GV1A 1LDMA 2IYPA 4OH1A 2R00C 2C5AA 1ADCA 1C1XB 2P4HX 3QVSA 3GC6A 3WBBA 4BNZA 7ADHA 1M76A 2VHYA 3I9JA 3GAFA 1NBOA 1U2DA 1Y5MA 2NVUA 4J1NA 1ONNA 1I33A 2O4CA 3PXXA 4EBFA 3P7MA 2O7SA 3WGGA 4NFSA 4WEOA 4IDEA 4R3WA 3PEFA 2Q50A 1T1RA 1FF9A 2X7HA 2C59A 5KNLA 3L9XA 1XEAA 4A03A 2PD6A 1ORRA 4DL9A 2CF5A 1KS9A 4XYMA 4Y9DA 1CIVA 5JW6A 1DFIA 1HE4A 5TSDA 2VZ0A 4L75A 3ZNOA 2UYYA 2Q2WA 1A71A 1XA0A 2I65A 3AU8A 3OJ0A 3PIIA 3WGTA 4WUVA 3JD2A 5KWEA 1M6WA 1X7GA 2VN8A 3PQEA 4DTIA 1O95A 3GZNA 3KLMX 3DAPA 3ZWXA 4YJDA 2A9FA 5FI5A 4Q3EA 3TF5A 3OQ1A 3L6DA 3ON5A 1WMBA 3IOYA 4CM9D 1PL8A 3FRJA 4JBHA 1NX6A 3PFFA 4YAEA 3DHNA 3OJFA 4D44A 1GUFA 3ZI0A 3AUUA 3H65A 4D41A 3DMTA 4N5LA 4ALKA 4JJFA 2JHFA 4BNVA 4LSWA 3TPCA 4ZGWA 3GG2A 3JQ7A 2I9PA 2Y1CA 3AFNA 4TQGA 4ZRMA 4M55A 1SO8A 1JKFA 3AUAA 1SBYA 1H6AA 1QORA 2NVUB 3EVNA 2NTJA 3QJ5A 5JPIA 5AXDA 3GNTA 3ITDA 3BIOA 4FFMA 4BO7A 2FZWA 1UDAA 2FRDA 3DDNA 1PWZA 1TEHA 2HQ1A 4WJZA 5H81A 5JAIA 1AXEA 1J49A 4UVHA 3VZQA 3UOGA 3U49A 1ISJA 4EITA 4EGFA 1C0PA 2NQ8A 1LLCA 2AQ8A 5BR7A 2PKQO 3S2FA 4PG6A 1B15A 3QWIA 4WEQA 1ZIDA 1CWUA 4EUHA 4ZICA 5CEFA 4I9UA 4OL9A 6LDHA 2GLXA 4UVIA 4RF5A 4XR4A 1PZFA 3C8MA 2NUAA 5JY6A 3VVBA 1YQGA 5JDIC 3RUHA 4J91A 1DIRA 2ZK7A 2F00A 4M54A 2JCYA 4BIIA 4W7IA 2QYSA 4J7XA 5GZ3A 4KUEA 4YQZA 3VZRA 3NTQA 2NWQA 5B37A 2HRZA 3ROMA 3BYZA 2VRCA 4NZ9A 3QSGA 4CM4A 4XYBA 2GERA 2IZ1A 4Z9XA 2AE2A 3OECA 3TZCA 1PEDA 1KVRA 4E2ZA 1PZEA 4P22A 4Q3DA 4TKMA 3W1VA 4IINA 3W4KA 8ADHA 5LCXA 3D0OA 3GEGA 2GF2A 3ZW9A 4BKOA 1P1HA 4U0KA 1YQDA 4A73A 2DBRA 1E92A 4KTVE 2WYVA 1Y9AA 4GQAA 4HNHA 3DQPA 3ZZNA 1YBMA 4O63O 4TRRA 3RCBA 2PV7A 4LVUA 5ITVA 4B4OA 1V8BA 4QUKA 5A9SA 4WNCA 3FTPA 3G0OA 4Z9YA 3KVOA 4JQCA 4XRGA 3GMDA 2VRCD 1H2BA 4NDNE 3U4CA 1GD1O 3VPGA 3CE6A 5K6AC 2IDZA 3ANMA 3VC7A 1B14A 1BSVA 4II3A 1ZO8A 5BSGA 1DEHA 3ZWYA 4A7PA 1R0KA 1Q0QA 1C3VA 4TKLA 2QRKA 2Z1MA 4GX5A 3ETGA 1HDXA 2QYTA 1AXGA 3DBRB 3IL2A 4RV9A 4D0RA 4E5KA 1IZ9A 4Z3DA 3WNQA 4A2CA 1P33A 4J1SA 2O3JA 5A5EA 2GPTA 3I3OA 4CV1A 1GL3A 1CF2O 4JLWA 4AJ2A 3S2GA 1GEGA 3INGA 3RKUA 2WTBA 4J43A 2GRAA 3K5PA 4CM4B 2B0JA 4JJGA 4WPGA 3EHEA 2CMDA 1LX6A 4Z0PA 3VKUA 2HMSA 3JQCA 4DWVA 5DULA 8LDHA 3LC2O 3WIEA 2Y66A 5COBA 2PTGA 4PLGA 2P5UA 2I66A 3PYXA 1GTMA 3FWZA 1NP3A 2PNFA 4E21A 3HDHA 1SOWA 1DAPA 2YYYA 4EW6A 2HDHA 5FI3A 3OA0A 1DRVA 3QVOA 4YAGA 2NVWA 3KYCA 3CMCO 4O59O 3SLKA 5HA5A 3ZWVA 3COSA 1BMDA 3KZVA 5JMWA 3FBGA 1WVGA 3ZU3A 5JBIA 3U4DA 1HDYA 1KVSA 4J1TA 1O6ZA 4QECA 4HKTA 3MOIA 4RGBA 1GYRA 4B79A 4LN1A 3PK0A 1XDWA 5C7OO 2O3RA 1EFLA 3O8QB 4L4XA 3D4OA 5JXWA 3AOGA 5FWNA 1D1TA 4NQZA 4B4UA 1HYHA 4CMKA 1K2WA 4IXTA 1KOLA 1SOVA 3ZCXA 1ZJYA 2IZZA 3GPDG 4CLDA 2DBZA 3HQ4O 3EK2A 1U3UA 4YR9A 2VHZA 4OXKA 3V2HA 4BNJA 1IHYA 4BNYA 3JQAB 2J5KA 2CF6A 2VYVD 1MXHA 3D7LA 4LW8A 1QYDA 4WCFA 5AYVA 3NT4A 3CH6A 4YRDA 3AY7A 3AJRA 4NG5A 5DDIP 2G5CA 4GBJA 4E2XA 4DBZA 3FR7A 2G76A 5HBRA 3GN1A 4G65A 5IDXA 4N18A 3GN2A 5B12A 2BMAA 4AJEA 3L4BC 5CDUA 3ROKA 3D3WA 5CG1A 1IOLA 3WXBA 4CMHA 1LRLA 4N54A 1HE2A 3DZIA 2GN8A 4R01A 4R4JA 1P74A 4MIOA 4W9NA 4CQLA 3GNQA 3EVTA 4CV0A 3CZRA 4R5MA 2X5JO 4AL4A 5TIIA 1ARZA 3NYWA 3R3SA 2VUSA 3IP1A 1LEHA 1E1MA 4U6QA 2QW8A 3RUIA 1LSUA 3UXYA 3BHMA 3QVTA 2TMDA 1NPDA 5KVSA 4WLUA 2EEZA 1X13A 1E3WB 4ND1A 4UEOA 2HK8A 3QRWA 4RF3A 3WQSB 1I30A 4ROSA 1KEPA 2P5YA 1UP6A 3GDOA 1WAMA 3P19A 4RDHA 1ZEJA 2BD0A 2VT2A 5DOVA 4NU6A 1QV6A 4CM1A 2FOIA 1TXGA 2HK9A 1HSOA 1UUFA 3LK7A 4TMFA 2Y0EA 2DBVO 2EKLA 1Y8QA 3WLEA 1E6WA 2RCYA 3EGOA 4BNNA 2PY6A 1U8XX 3CPSA 2Y93A 2C29D 2PZMA 2F1KA 4GX2A 3GVHA 3V5NA 5G2OA 4MVJF 3EYWA 3P2YA 4LVCA 3TOXA 4J16A 4KWHA 4M86A 3M6IA 3D5TA 4LMRA 4BKUA 4PIVA 4NK4A 4MO2A 5A1TA 5U1PA 1Z75A 3MJCA 4J9VA 4AG3A 1D8AA 3E5RA 3H2SA 1L1FA 3HG7A 1PZHA 3AU9A 3PPIA 2B36A 5KOIA 1RKXA 3DWFA 4HV4A 4DYVA 3K73O 5CDYA 1WPQA 1ZVMA 1P31A 1YGYA 1H6DA 3VKVA 3FBTA 1NM5A 2FHSA 4NFYA 3WJAA 3OMLA 5G4KA 2I6TA 1NWHA 1PJSA 2GUGA 3F6YA 1E6UA 5L7YA 3RC9A 2R6JA 3OSUA 5JNLA 1NHGA 3GEDA 3KETA 3ZHZA 2B35A 5ENVA 2X5OA 2HAEA 3K96A 4BGVA 3ROPA 3FHLA 5KKAA 1N9GB 1MG0A 2RHCA 1YOVA 2JD1A 1BVUA 1EUDA 1F0YA 4DQVA 2HLPA 2D5AA 1G1AA 2OBYA 5KJEA 1RM5A 3I4CA 1I32A 1K89A 2W8ZA 1LA2A 5CDSA 5DT9A 1T1SA 4FD3A 5EINA 5B4VA 3H9JA 5KCZA 1H93A 5A4DA 4B4VA 2O3UA 2E4AA 1UDCA 4CLEA 2XXJA 1VJ0A 4D3SA 1LUAA 3ROQA 3NT2A 4MPDA 3KRTA 4NHEA 4BO9A 5JDCA 1TB4A 1NYTA 1Q7BA 1PGJA 2W2LA 5K6AA 3WSWA 2EERA 1HL3A 4OSPA 2DPGA 5JYDA 4AFNA 5CDTA 3PDUA 3F9IA 5DN9A 3QQPA 2FWMX 3SJUA 3I83A 4YJGB 2O50A 1LJ8A 3MTGA 1HDZA 3OEYA 4FJ0A 4I8XA 3FCOA 2BGMA 1WXDA 4QEDA 1ZSVA 5L4NA 4LGVA 3R3JA 4TRJA 4Q39A 4RJTA 4RL6A 3ICCA 3PZRA 1JVSA 4KQXA 4Y67A 2Y67A 2W2LD 2XXBA 2GNAA 5EL0A 4CLRA 1P9LA 4AJ1A 1NWCA 1C0IA 3MJTA 3BMNB 4E32A 3FNEA 3KYBA 1D4FA 2YZ7A 1BXGB 4P4NA 1SCUA 2AMFA 2OUIA 4UUNA 1U28A 4J3FA 3JQGA 3SXPA 4BNLA 4YPOA 4EUEA 3DMYA 4BGEA 1DXYA 2TMGA 5KJCA 2X0JA 2G0TA 2PKQP 3GY0A 5CPBA 5JC8A 3NDRA 4XYEA 4KUHA 4CMIB 4K1LA 1QSGA 2O23A 4FQ8A 1EVIA 3R1IA 3HADA 4WLVA 3FSRA 1QP8A 4NBTA 4B3HA 1A4UA 1ADFA 4ALNA 2VUUA 1PS9A 1IPEA 2CFCA 4IS3A 2HSDA 3I6QA 4Z6KA 3P2OA 3PRJA 1L7DA 2X6TA 4FOOA 4CPDA 2GO1A 4BMVA 3INTA 3TFOA 3CZMA 4G2NA 1A27A 4BNGA 3VHRA 4CUKA 4UULA 1X1TA 2VUTA 4I9HA 2GN9A 4NJMA 3ENKA 4IMPA 5LDHA 2ZJ0A 1Z7EA 1E1KA 2CSUA 4NI5A 5IZCC 4WKGA 3ZU4A 1I10A 4WOKA 4OOEA 1NR1A 1GYQA 3JYPA 4CUJA 4TRMA 1LTHR 3H5NA 5EQFA 1DC6A 4OQZA 2A94A 2RH8A 5TGDA 1NVMB 4BNUA 4DPKA 1PU2A 3UKOA 5JSFA 2P9CA 3NX4A 1A7AA 5FFFA 1ENZA 3DC2A 3KSUA 4FBGA 4AJHA 1U2GA 2AEMA 3RROA 1XHLA 1O94A 1UZNA 4R54A 4P38A 4FSHA 3GAZA 4FFLA 3EAGA 5JMPA 4KOAA 3DZHA 2X23A 4YACA 2X4GA 1E7YA 3EUWA 4OXYA 4XB1A 4FIZA 1P3DA 4E2YA 1YKFA 1IE3A 3GT0A 1R66A 4R68A 3H3JA 4NBVA 1AGNA 3MWEB 1JAXA 2C0CA 4EJ6A 4FJ1A 1AUPA 1EK5A 4PG4A 5I7EA 4XZ3A 1H9AA 1R16A 1ZMOA 1OC2A 3DHYA 4H16A 3RUCA 1XGKA 4M8SA 2RIRA 5TF4A 1LC3A 5KKCA 4E31A 1ZKMA 3DB2A 2JHGA 2RBEA 4JN6B 3K6JA 4ILKA 2AEFA 2GN6A 4PRLA 4XDZA 1RM3A 2PGDA 4MKZA 3FF4A 4F6LA 5L4LA 2BGLA 3ANNA 5L9AA 3X2EA 2I76A 3GVXA 1WZEA 3T4XA 4JJIA 3ZWMA 1VJ1A 2NSDA 1DIAA 4AJ4A 5F5NA 1O5IA 4Z3KA 1N92A 2P91A 3I9LA 2NU7A 4BKRA 5I8ZA 2IODA 3S55A 1B8UA 1DLIA 1JKJA 5F21A 1T2AA 4R5HA 4ALJA 2DPHA 2W2KB 4FOSA 4GPD1 1OOEA 4GWGA 4P4GA 3FNFA 4P8RA 3WGHA 5JCJA 4MDHA 4WLNA 2HUNA 1PJ4A 5C7LO 3V2UA 3HE3A 2FN7A 1DIBA 3ZWWA 4I5EA 4FC7A 3TQHA 1TVEA 4R1UA 5IZ4A 1U5AA 1EEHA 3S1LA 3V8BA 3NDIA 2H6EA 3AM5A 3ONEA 4FC6A 4F3YA 3WMWA 1QYCA 1B8PA 2B4QA 2UDPA 4GGPA 3RC2A 4JROA 4W6ZA 1IULA 3DAFA 4NH4A 4XGIA 3E9QA 3H5RA 3OEWA 1ULSA 2PZJA 1H94A 1EZ4A 3PTZA 2P2SA 2D0IA 3RU9A 4ZQHA 4BO0A 3JQ9C 5A3JA 3G1UA 1ISMA 1DJQA 3H4VA 4EJMA 2DLDA 4YT8A 1BXKA 4AJJA 2P4QA 1U4SA 1JAYA 2IYOA 3ZV3A 5ER9A 1U5CA 3I52A 5AOVA 4KQWA 4YJHA 3T7CA 2EJWA 2BI8A 1W4ZA 1IZ0A 5KJFA 1U3WA 2C7GA 3FD8A 1BW9B 4YJFA 2EF1A 3L0DA 1IB6A 4CM7A 5JAZA 3DL2A 2YDYA 7MDHA 4LK3A 3U09A 5BSFA 3ZDFA 2GN4A 1ZNQO 1I3MA 3OIGA 4RPJA 3DBLA 3JQFA 4J0FA 1EBFA 2OORA 4N5NA 4NU5A 2AQHA 1PQUA 1EK6A 4A5OA 1Z6ZA 4A10A 4YT5A 4BB5A 4DGSA 3HB5X 4CM9A 4EYEA 5IXSA 4BNTA 1P0FA 4YXFA 3UCXA 4J90A 3LVFO 4GGOA 1NFFA 3GMSA 4HFJA 1E7SA 1M2WA 3WNVA 3SC6A 1HZZA 1JQBA 4XIJA 3ZU5A 1B7GO 4S3MA 3OJEA 2FR8A 1Q2XA 3PHGA 2V6GA 4MVJG 3PI7A 3SBOA 3HFGA 3RUFA 3DBHB 5TC4A 2HK7A 4GVLA 1G6KA 4PLYA 3NKLA 2PGLA 2WYWA 3A4VA 2PLAA 1W6UA 5HWSA 4IXWA 3ULKA 4QFDA 4YT2A 2VOEA 2WSBA 2W90A 1HRDA 4DBVO 1ISGA 5H82A 4BO8A 1F8GA 4UVGA 3PVZA 5I9LA 5CP8A 1QXSA 2HMUA 2YHUA 4FFRA 3U3XA 1PIWA 4JXKA 2VOJA 1S6YA 4IPTA 3TZ6A 3LLSA 3M1LA 1X0VA 1K3TA 1OI7A 1IL0A 4ALIA 5FEUA 5KIAA 2CUKA 3AI2A 1VSUA 4IDFA 1Q7CA 4Y6PA 2UUOA 3RC7A 1JA9A 3TRIA 2LDBA 2V7PA 2H1SA 3DZGA 4UEJA 3OBBA 4Z0TA 3T4EA 4RVUA 3TDKA 4B4WA 3DZKA 3MEQA 5ITWA 3PHJA 2NV6A 2HJSA 4GL4A 2WJPA 4KTTE 4WLOA 2WYUA 2NTVA 3DBLB 1SB9A 5JCXA 2P9GA 2WM3A 3VPFA 4XRRA 5IFLA 3A1NA 1MB4A 4LRSB 1DC5A 4BB6A 3FNHA 1Y81A 1MXFA 4JNKA 1ZFNA 2O3SA 3UFXA 3WGZA 3D64A 2WDZA 5CEEA 1QYVA 3R0IA 1TT5A 1LDYA 4L76A 1KIFA 3KM0A 4MKXA 5FYDA 4IIUA 1I5RA 4Q9NA 4HWKA 5CPFA 4FJ2A 4IBOA 3KEQA 1A9YA 2ZB8A 2IXAA 3GZNB 1IY8A 4YCAA 4PVCA 3WOHA 1T26A 3CXRA 1ONPA 2X0IA 3C1TA 1N2SA 3LU1A 4WE3A 1TLTA 5AXCA 4NMHA 3TJRA 3S2IA 3ICPA 4CMCA 2O3TA 3RUEA 1QLJA 4BS9A 2DBQA 4BNWA 1YQXA 1LLUA 1QV7A 4UUOA 4CM8A 2Q1SA 4HFNA 5A9RA 2Y1DA 4XGKA 5IJZA 1ISHA 2YW9A 4E5NA 5T57A 1T4DA 4IJUA 2WD7A 2CZCA 1NFRA 4WNIA 4H15A 4JK3A 1NQAO 2POQX 1W8DA 1XQ6A 2ZIZA 3IC5A 2NQTA 5CHEA 1NAHA 1V6AA 3JQ7B 2ZCVA 4Y6RA 2WMDA 2I67A 4R41A 2CDCA 5AQ1A 3QIVA 3BAZA 1XU7A 1LSOA 4NPCA 5JO9A 1NR7A 2EV9A 3DXFA 2VZ8A 5DCYA 3MJEA 1GCUA 2GYYA 1PJLA 2V6FA 4GVXA 3G17A 4IIVA 1AN9A 1KYQA 4D3FA 2D1YA 1WWKA 4XDYA 1EUCA 1ID1A 2XPCA 3PFWO 2WEKA 3V1YA 1U7TA 1OAAA 2C20A 1I36A 5GZ6A 1PWXA 3G3EA 1KY5A 1MV8A 3VDQA 1GUYA 4BQRA 2DKNA 4MP8A 2X5KO 4PGFA 1K5HA 1LRKA 3GHYA 3VTFA 5HTOA 3O38A 1HKUA 2CDAA 3MJSA 4KUGA 1HDGO 1MFPA 1DC4A 2JFGA 3BMCA 3NTRA 3E5MA 5BNTA 1GFSA 3VOSA 1PQPA 4PLZA 3JV7A 2HJRA 4GH5A 4RF2A 1BTOA 4E12A 3F47A 5ADHA 3HFSA 3B1JA 4LRTB 5ENDA 3S8MA 3RAJA 4XQEA 1MC5A 4RPLA 3ZWCA 1GDHA 5F5LA 1CERA 2J3KA 3U0BA 4HP8A 5F1KA 2C2XA 3JQDA 4CLHA 4DC1A 4DRYA 4HXYA 1T2EA 4WOJA 2IEDA 1HF3A 3AOEC 4GX0A 3DR3A 1UAYA 3JSAA 3O26A 3RFXA 3K2EA 3GFBA 3ADOA 3Q2IA 3H5AA 1BG6A 3RIHA 1KC1A 4O5OA 5TQVA 3DOJA 1Z82A 4BVAA 1PR3A 4D0SA 3H9UA 3QV1A 1FDVA 4BMNA 5A9SB 4NK5A 4NFHA 5BSEA 3QY9A 3M2PA 1U7HA 4PG8A 4OM8A 2R00A 4C7KA 4MJLA 1UZMA 4WLFA 1E7WA 3KTDA 1FMCA 1YBVA 2O2SA 1UJMA 4ZU3A 4XKJA 3E8XA 4IJVA 1HLDA 2O2YA 3VZPA 1LLQA 2X1HA 1LDGA 1YO6A 4TVOA 3VVCA 4YRAA 2X8LA 4MOWA 4Y98A 1BWSA 2VYVA 2QHXA 2Q4EA 1R15A 4BNIA 2BFAA 4K6CA 4CM5A 3ONDA 2J3HA 2FPIA 3K8ZA 2JD0A 1E7RA 1MP0A 1S7CA 2YFQA 2ZYDA 1GY8A 3B20A 1ZJZA 3HHPA 3W8EA 4F6CA 1C1DA 3DZJA 3GA0A 1JDJA 1U8FO 1JN0A 1UH5A 4YWJA 1RPNA 4E5MA 3ZGYA 3RC1A 3H9EO 3HSKA 4H7PA 4BKPA 4HUJA 1P1JA 1E5QA 3PHLA 5G0UA 4DIFA 4R16A 1EDZA 4EJ0A 2Q4BA 5L51A 5DCWA 4PVDA 5BQFA 4BHTA 2OBNA 3RBXA 4Z0HO 3LC7O 4E2WA 5MGBA 1ZK2A 2FMUA 4XA8A 4DA9A 3F1KA 3KXDA 1PSDA 4N5MA 5A5FA 3NV9A 3ST7A 1NPTO 1RM4A 1EVZA 3V1TC 4L4RA 3Q1LA 4F45A 5KVVA 1M75A 3RWBA 2OOSA 3GK3A 3HUDA 1ADBA 4CM6A 1ENYA 2Q1UA 4E0BA 5COQA 2CVOA 2JAPA 3BMOA 1C0LA 2DTDA 1RJWA 3S2EA 3KYCB 4QT0A 4XQ9A 1GQ2A 3W4JA 1Y7TA 3HZZA 4RDIA 2QZ9A 1E3SA 1JWBB 3NJ8A 3V2GA 1H5QA 2Q1TA 3VH2A 2WD8A 4MVJM 3JQEA 1HEUA 1KC3A 1GAEO 3OQ6A 3TNLA 1P44A 3DTTA 4DIOA 4IJWA 4FR5A 4BV9A 1D3AA 1VL8A 2HMWA 3NGLA 3WTCA 3ANLA 3UCEA 4D43A 4YQYA 4ZHSA 1DIHA 2VTDA 1R37A 2WE7A 3GRKA 4UUPA 2ZB4A 3JD0A 3IMFA 3MWDB 4KP7A 4TROA 4Z9FA 3L9WA 1XELA 2FSVA 3WDSA 1P1FA 4I08A 3CKYA 3W4IA 4C7JA 5BSHA 2NM0A 1QLHA 4M87A 3JYLA 5GZ1A 4XGNA 4DIBA 3TOZA 4LCEA 4WCFB 3ZV5A 1U3VA 1WDLA 4R1NA
chains in the Genus database with same CATH superfamily
3VR6H 2A0WA 2EFCB 3KHUA 1WXEA 3PE3A 2EJTA 1OLOA 2FWBA 4HADA 3SQMA 2IHTA 4MVJA 4IXDA 5E1DA 2XUHA 4I5FA 3RTBA 2RCNA 4AICA 4XD2A 1A9OA 1T34A 1FYVA 3G6KA 3NM6B 1FNBA 1CUAA 3WAGA 1Z5OA 2QTNA 2HCBA 4RD0A 4BV8A 4MR8A 1HT0A 3G2IA 1ZD5A 1JS1X 1VKRA 4OKIA 2WICA 3NGXA 2O19A 1U80A 2ANBA 2BFEA 2IOFK 1LLDA 3A6EA 3CT4A 2X0RA 4M88A 4UZFA 1RLOA 1QRTA 3CONA 2NP7A 3E2IA 3R7BA 3G8DA 1Z45A 4M0PA 4MV3A 2ZKLA 4BP3A 3AZOA 4JEIA 3IAHA 3WL6A 1FP4A 3UJ7A 2O1EA 2WM8A 3QVKA 4C2TA 3OY7A 2DR0A 1BXZA 4C0QC 3ICWA 4D6XA 4BNDA 1U9CA 3TIVA 1IUNA 3LF1A 4P4LA 3VZSA 5K0GA 1RU3A 9LDTA 1Y37A 4RSHA 3AIKA 2AEEA 3N8DA 2IEBA 4DREA 1XCJA 2ZYWX 4DB2A 3M6WA 3NBKA 1Y1PA 1GV0A 1YCFA 3B1YA 4QYXA 1TIPA 3G9UA 4Z0NA 2JIZD 3PLNA 4BYGA 5KEIA 2GJ4A 4GAEA 1T4BA 2NTNA 1LQ2A 3CPJB 3U62A 5JSUA 1L8XA 2ZW9A 1XD2B 2J8ZA 5GMOA 4DMFA 4NULA 2EFDB 5IVKA 3UC5A 4LJLA 3GRUA 9LDBA 3Q41A 4K81B 1XL1A 5IM4F 3A6FA 4F4DA 1N0IA 3ZE1B 2HO4A 4TS9A 1HXHA 1L8OA 2OHFA 1I7QB 1Y6FA 3TZEA 1WUHS 1ZL0A 3JRNA 4LC0A 4WI1A 2WM2A 3MFYA 2H7XA 4GOMD 5AKKA 1VCMA 2QJFA 1F0PA 4IM7A 1BRMA 2HSZA 3DLCA 2YJTD 1NJ2A 3OX3A 2IHJA 4NOMA 4PCLA 3THWB 2OV4A 2PYIA 5A6VA 3CLRD 5SZIA 1O4VA 1I01A 5G1NA 1UJCA 4P82A 1YL6A 1WUIS 2C98A 2IU6A 4L85A 1MH1A 1IHXA 1QZTA 1VCHA 4M7PA 1VRWA 5BWNA 2QVLA 3AEYA 4X8OA 4REOA 3EX7C 1V9CA 4R9RA 2YUTA 1CB0A 4HQRA 5ALPA 2JZNA 4EG6A 2POCA 2CMGA 4KFUA 1S0UA 2Y2UA 2A14A 3C24A 3SJCA 5KC9A 2YDXA 3EC7A 5LL6P 5E9QA 4DR1B 5GP1A 4F9EA 3OIWA 1XWIA 2VF4X 2ENUA 3CU5A 3I9OA 3PXEA 3BE5A 1F8FA 1YOVB 2I80A 3UICA 1G4HA 2QTWB 1ODSA 4GSLA 3KQHA 5EERA 1VIVA 4P4SA 5FULA 2PBRA 1SVWA 4JVMA 2Q5EA 4UTVA 5CFZA 1CW2B 1Y1RA 3F5MA 4ILEA 2RH4A 2HMVA 4QVGA 4UKDA 1TAUA 3TNFA 3AG5A 5JZSA 1KYZA 1ODIA 4DSUA 2XMCA 1JVBA 1VJCA 3TQFA 2DUWA 4ZVUA 1QPBA 2R7NA 4KGVA 3UMRA 4ML3A 3FPJA 5E6RA 4YRJA 4UNRA 1MB0A 4PNHA 2A57A 2ZT8A 2J7KA 1KK3A 1SHJA 3GJ4A 5B36A 5MFPA 2X9GA 1JJBA 1RHRA 2WF5A 1QYXA 3ENNA 1AHHA 4OKSA 4J9UE 3F96A 4ZI5A 2GR9A 1D03A 4AQYB 5G0SA 1QCZA 2MDTA 1H2ZA 5DSZA 4M1QA 4POOA 4QTZA 4R69A 1J1ZA 1ZVVA 4NV1A 3PUXA 2WR8A 3CZ4A 3KOUA 4ZOBA 2VYCA 3JD4A 3TMAA 4CQMA 3CRMA 3USCS 4BUJA 1TVKA 4RSMA 3PXUA 2W6ID 2Y0BA 2GDZA 1BS1A 2WOJA 2X13A 3OM9A 4IQ4A 4O4IA 4BMSA 4E46A 1QZZA 1XQ1A 1YCGA 3DOEA 3QKSA 4I5IA 1O7JA 4OHZA 4HR7A 1X7ZA 2B4KA 5L6LB 4X8MA 3E3OA 1L5GB 2PBFA 3VGJA 3ZNQA 1GQQA 2R6CA 2ZYRA 1ZOOA 2H00A 3AF2A 1T8YA 1QBKC 1XG5A 4OOFA 5H4HA 5I3ZA 3EXHA 1YF3A 1K27A 1U8AA 4I3GA 1R4MA 2ZSAA 2QRZA 3I6IA 2IPMA 3L0CA 3P9PA 4TQ9A 3HFRA 5THQA 7AT1A 4C4OA 2PA3A 1ZIXA 2PR2A 3EPHA 2H8GA 1YDMA 1PGOA 4JEHA 2YV2A 4LJSA 2DHDA 4WQMA 4BVHA 1SCUB 4C0SA 4CG3A 5A2GA 6ADHA 2D3WA 5JJ5A 2OD9A 3ZJVA 4JLAA 4LYJA 5HF5A 1UBTS 5ADVA 4FGSA 3HR4A 3NAQA 3JQ8B 3T7EA 3AI7A 3TIIA 1DCKA 2O0LA 4D79A 1Y6JA 3PEWA 2XB9A 1F9EA 5AJWA 2HEIA 3DTVD 1K6IA 1TYZA 3L7AA 5LZ9A 2O14A 5IAEA 3WLLA 2QUIA 2QZ4A 3N0TA 5JI3E 1TJ5A 2PFKA 3OBIA 4MW5A 4NIMA 4WK0B 1F38A 2PBLA 3M81A 2JFNA 2QJOA 3N7UA 3NDBB 3FYUC 4HXGA 1JEQA 1N5IA 2ATIA 2BEUB 4YLEA 1RAGA 1IMJA 4TLAA 4M76B 1OIXA 2UU9B 4B34A 3L7OA 2HDWA 2Q1XA 1DJMA 4BNFA 3WLQA 1NYQA 4QT4A 5B7QA 1GUZA 4M49A 3IQGX 2QTRA 3WQQA 2WKRA 1ZITA 3I6YA 5ESWA 1SU8A 3RTGA 1DLJA 1NDUA 2YFHA 3FCAA 5JEEA 3ICEA 1FDSA 1ORHA 1XTZA 3VUFA 3RE1A 1QWSA 3ELUA 2X3YA 3FDJA 3LX8A 2DC1A 3LK6A 4ND5A 3TNYA 1H1DA 4YONB 1R6AA 4NARA 2REXB 3OWHA 5F4BA 4DA7A 5CAEA 5L3ZA 3ZJTA 1NC3A 1IUPA 3D02A 3WKAA 5AICA 1G21A 1I1NA 2FMHA 1T25A 4GKVA 1E3IA 4LC9A 4Q34A 1HFJA 2GXQA 3S29A 4YLGA 3MJVA 4BN4A 4BNHA 1ZK3A 4E1BA 3LWZA 6ABPA 3AI3A 1DHRA 2CB9A 3VFDA 1Y82A 2B8WA 2VPTA 4LX0A 5IP5A 3ZLTA 5AW3A 4YUYA 3UJCA 4S0XA 5A3VA 2ZWOA 3KD3A 1EUZA 1LI4A 4L9RA 1PSWA 2I2AA 4WJKB 3EWIA 3JVVA 1HNZB 3ASUA 3IDZA 5J40A 3B6EA 2E82A 5EP4A 1NT4A 1LK0A 4F9FA 4QPZA 1X87A 2QTAA 3A1CA 3R09A 2JATA 3OCUA 4K26A 2GK7A 1TM7E 4GXTA 3W0LB 1E1LA 3V4SA 1UAGA 2ID9A 1CJBA 1MB9A 3VTZA 4A27A 2FSUA 4CKXA 4D8TA 3NHUA 1V1RB 4LIPD 3AM3A 2QN3A 1IBMB 1CXZA 1N3BA 1VL0A 1GZUA 6REQB 2O6HA 1GILA 2BGRA 4BO5A 4AO6A 2KM1A 2W6QA 3FAKA 4PY2A 4A6PA 5LXTA 3HB1A 2FPKA 4CMJA 4JYCA 5KBYA 3JRWA 3DTYA 3OCZA 1F6DA 3FIJA 4C05A 1TYDE 3A14A 3LG2A 1SU4A 3NIGB 4IOKA 4LSZA 4NFLA 1LPOA 1T8PA 5JMTA 1NTOA 1NOIA 2JLUA 4I9NA 4TN5A 5IN5A 3VHXB 1PHRA 1WBBA 3ZVMA 3L4EA 1H2XA 1LS6A 3WKEA 3QEKA 3THXB 2HPVA 1RZUA 1T6NA 4YQFA 4L9WA 1Z5ZA 4D26A 1GPBA 1ZZEA 4DDWA 3SFVA 3L1KA 2VP3A 3GLSA 1RJEA 2W0SA 5L3SA 1CJCA 2EL9A 5EZYB 1C41A 1NBMA 1SRQA 5A4FS 4NCAA 2ZQYA 1IY0A 1G60A 4PZDA 5ALZA 4K3VA 3B1VA 5C34B 3GV0A 3LYUA 1JAIA 1H2YA 4HDSB 1V2GA 2DQYA 3WZ2A 1LDNA 3RVRA 4FNAA 2JASA 3NIFB 4B6QA 1ES9A 2FOLA 4OMUA 4B3DA 1DQRA 1M2VB 3STHA 4LF7B 4IGFA 3SYNA 2Q6KA 5E4TA 2FUEA 2YMLA 3M9XA 3QKWA 2H31A 4IGIA 3MZ0A 1W93A 3PD0A 1GTVA 3NUGA 4JC4A 3VQTA 4AIIA 1K1EA 3JD1A 3I09A 3GUCA 1E3JA 4J49A 5D3ZA 2AG8A 2PUDA 2QDXA 2UVQA 4UE3S 1QH8A 4K6FA 5KPJA 2H1HA 4WZBB 1ZNYA 5AIAA 1RRPA 2XDQA 2E48A 3GCWA 2J1LA 1ML3A 2I2BA 4UARA 3TLZA 4YRBA 4ZN6A 9ATCA 1T91A 3L40A 4CKZA 1OWLA 1FYWA 1V3VA 2BFNA 1V11A 2AK2A 3S2UA 1UZLA 2XKBA 3W6UA 2PD4A 3SF8A 3EW7A 3JQBA 5I7FA 5EGSA 2IYUA 4ETNA 1TQ2A 5JYCA 3KOYA 1ZSNA 3BTUA 3RPEA 3IUBA 1W47A 2LKCA 4IO0A 4YY3B 1QRUA 1IN7A 3AP3A 8GPBA 1YR3A 1J8MF 4KYTA 1WHSA 3B38A 4P54A 4Y9RA 4YAJA 1B0UA 1UXIA 3IH5A 3AHGA 1W581 3KQTA 3W90A 1VIYA 3PCXA 1I2AA 5I4IA 1C4WA 1EWTA 2CXNA 5JFTA 1EVYA 2W6CX 1XMPA 4LJ8A 5LN1A 2YWXA 3IPXA 2AFHE 4IDGA 4R1LA 3WSVA 2E5LB 1E6KA 3UF0A 3O9ZA 2Y1OA 4X8LA 1GKLA 4OB6A 1IBLB 3KEFA 1IZYA 4DN6A 2F9FA 4DVGA 1TM2A 4ZVOA 2D2IA 2KB0A 2H0RA 4U02A 1ZC4A 3QKIA 4YJHB 3IAXA 4GI3A 4HEQA 2WSIA 3MINA 1QWOA 1U63A 2WAAA 1K9VF 1OFUX 2XDWA 5FWYA 3QUAA 2IIPA 2Q9CA 3INRA 4A0QA 2JKVA 5DNAA 3GB9A 3RO7A 4PYLA 2J9ZB 3R77A 4ND4A 4X1KB 2SHKA 3S0JA 3DHVA 1FXUA 3OFNA 1BMFD 1YKGA 2MSCB 4ZTBA 1F06A 4WBNF 4MIYA 3L46A 2IYEA 1DZIA 4KQHA 1JA1A 1FDUA 2E4VA 3RHTA 1R18A 4F3NA 5EIXA 3VR2A 2EDAA 2NO9A 5FHRA 3UVEA 1GYPA 2XYPA 2ZKIA 4J6EA 2KS6A 4FXPA 3PUZA 3WNDA 4ED9A 5JEDA 1PS8A 1P5JA 3EF3A 2HZBA 4JC5A 3REGA 1Y3FE 1ZISA 4JODA 1B8OA 3VO2A 4CLXA 1UOEA 1E0DA 1K0UA 4TGLA 2B5VA 5BQXA 2VTBA 3ZDQA 4N7MA 5TJ9A 4BCDA 3UAZA 3G2MA 1XZBA 4KGDA 4U2EA 4UBIA 5HGJA 1Q17A 5BURA 2QGNA 2NXWA 3H3FA 4RSRA 4HDQB 3L2OB 5ALFA 2VSQA 2A3RA 4KR9A 2D5BA 5D3KA 1E5VA 2IP4A 1DC3A 2D7JA 3IMGA 3N70A 4S24A 1BX0A 4BO3A 5JWOA 1RWVA 2Y9PB 3N3BC 3Q6IA 4W1QA 4R2MA 4YEDA 4ZWNA 4EKGA 3GF4A 6LDHA 2A0FA 1E58A 1ZI8A 1XKXA 3WGKA 4JFRA 3UQYS 3WMXA 1JHAA 4FE3A 1C14A 4WK4B 5FAXA 5KSYA 5M29A 1PFYA 1YFJA 5JJIA 1E0AA 1FTQA 1WXFA 3TL3A 4TWIA 5BV7A 3C3YA 1V35A 5ALGA 2X58A 1PGNA 1RACA 2V9ZA 3H17A 3JTMA 5J43A 2H63A 2YCLA 3U7QB 3B51X 4ECAA 3F0TA 1XJ0A 5KVCA 4FCVA 3S27A 1E7QA 5JJLA 4F0JA 4WCVA 1JDTA 1UOOA 2J33A 3CEMA 4O6VA 1O0CA 5KYUA 3L6RA 4N47A 5F2OA 3AUKA 4OQEA 1Z0FA 3PE4A 4L4YA 1FBTA 2VDKB 4B80A 1YA8A 3A9SA 3D4IA 5J59A 2FPGA 2ASEA 1Y42X 3VH4A 4U00A 4D46A 2RAFA 4MP6A 3LQRA 4RAOA 5C5IA 1PN3A 1Y1TA 4B6JA 1YVUA 2Z6UA 2J5QA 3L8DA 4Z7QB 5JASA 3AK4A 4ZANA 1KBOA 1YHNA 2WVJA 4RO0A 1KZGB 4EP1A 3WWZA 2QA5A 1ZN7A 3KBBA 5IG2A 2R1TA 2KLHA 4WASA 4UXJA 1AXRA 3G88A 2ZRPA 1D1QA 1NE2A 2DPLA 2HADA 3A4YA 1LSSA 4TUYB 2YN0A 4OQNA 1MAAA 3ABOB 2VTKA 3SX2A 3H6KA 3TZBA 3O8OB 4G8DA 2M2IA 5DBIA 2W5UA 5FI0B 4PCAA 4H4CA 4KE7A 4PZEA 1IOVA 1U11A 4RHTA 3SI7A 4AQ7A 4ZVQA 1V6CA 1XLTA 2BFWA 3Q2KA 1JV2B 4KGXA 4PLCA 5TJHA 3MJ4A 4LMPA 2GZRA 3VO1A 3ICOA 4PLHA 5FFNA 1KXJA 4CKWB 5AVOA 2BJVA 2YHAA 2D1FA 3LT0A 4PPYA 4B35A 3CKLA 4CIAA 4KPYA 3U19A 4JXXA 2EZ9A 4BMXA 2F3SA 2P6NA 4H60A 2PR7A 2LBPA 1ZOIA 1N25A 4EATA 2I4NA 1XTTA 4M21A 4W99A 2YWRA 3DBOB 5IMBA 3WFIA 3WIUA 2OY0A 5EP2A 5GJVC 1Z74A 2D1TA 3OUZA 2ZUBA 4Z7OB 1A2BA 2O8DB 1XDSA 2GN0A 2V7QD 1A0OA 4IUBS 2AJBA 3ABIA 4RZHA 1PD0A 1EDOA 3QVXA 3PC2A 3I23A 3DYBA 2I2FA 1JWAB 4KRXA 3SWWA 1Y33E 4G0WA 1U7DA 3L93A 4YA6A 4D9HA 2H3HA 3AUFA 1EJ0A 4XLZA 5K0BA 3TZKA 2OAEA 3WY9A 2VHWA 4P58A 5DX1A 1GFIA 4XQCA 1H85A 3FFAA 4KWTA 4QREA 3RS4A 5KNDH 4KN9S 2D7CA 2WD7B 3ZVNA 2Q21A 1G8SA 1MPTA 1JGTA 1EIWA 2G4CA 3E53A 2DCUA 1H65A 2O5CA 3MD9A 2E4UA 4Y1GA 3HCWA 3F4BA 5TR9A 4RTOA 1F3LA 4I5DA 3H5VA 1MNQA 3TEFA 3DCJA 2GLUA 1DXOA 3V8NA 4P7FA 3JU3A 2Z2JA 1UQRA 1HWYA 5T8KA 4PINA 4WKNA 1KI6A 4CUZA 1UJ2A 2WA1A 2I6SA 4TLCA 4IIJF 2WZDA 3R5HA 3WP0A 1KK2A 1NJ5A 3JWJA 2C2YA 2VCYA 4ZYVA 1C29B 3PX2A 2EIHA 3B5JA 2IY9A 1N3IA 2B1JA 1U28C 2X2PA 1UC9A 3V3TA 2B8JA 1HY3A 3BMQA 1C1HA 4HH3C 2ZVJA 5IF3A 2J59A 3JWHA 1JECA 1CFZA 4RVHA 4W1SA 2Y92A 1K7YA 2OR3A 4MWCA 3QTLA 1I3LA 2Q6OA 1T6BY 4F97A 1KQFA 3DFZA 3QTTA 4M6WA 2NIPA 4EI2A 1YUBA 1GPJA 2C4MA 1PJQA 1TRKA 3BULA 4PLTA 5ALRA 4L2IB 4TTSA 1Q0ZA 5K2MA 1UBEA 3MERA 4UAGA 3EGXB 4YCJA 2HF9A 2ZB3A 2FWJA 1BQ3A 2JFVA 3D31A 4M1ZA 3UJ3X 3IKLA 1GGNA 2I5PO 3TAXA 2F8TA 1M0SA 4E7OA 1WMAA 5HRCA 5IBCA 3PWZA 4AKSA 2CHVA 1FUYB 4D4MA 3SKXA 1RBMA 2VDWA 4BAUA 2G4LA 3FYTA 2BE9A 3LX4A 4DC9A 2DUNA 1QM5A 4NMWA 4P34A 4PSKA 2AG0A 3B70A 4N3CA 2EW8A 4IDBA 2DFTA 1YNOA 3RDPA 5CH3A 1DL5A 1ADJA 1N2CB 4IUDS 5IK2A 2DFDA 2I6XA 2P9EA 1C0EA 1OAOC 5D00A 4D97A 3GRCA 2LPMA 4INZA 2J6BA 2QQ5A 3HU3A 3R6WA 3G2JA 4WK6A 3V1KA 1TOAA 2F43B 4NR0A 3LRTA 4JITA 2P3QA 4PN7A 1SD2A 3ZD7A 5AI8A 2BH2A 2VWQA 3OPXA 3LZ6A 4HB4A 3W5HA 9GPBA 4UXIA 4TT3D 3IUSA 4NL4H 1KFJB 3TEMA 2YICA 3CTMA 3V4RA 2OB2A 3BICA 1RLTA 3OETA 4XIYA 1U3FA 2XYHA 1C2YA 4LJYA 1W0CA 2YYZA 5JH7F 3WG9A 3IPRA 1O94C 3UKDA 2G1UA 1Z73A 1U9JA 2QVCA 2ZGVA 4NATA 5ER6A 5F33A 3V55A 4WZAB 3L7NA 3RG2A 1AQJA 4AY4A 1M2OB 3ROGA 3WA7A 1EU1A 2RE8A 4OX9Y 4PCUA 1M8KA 1G2QA 1D2CA 1SUWA 1P4SA 3PGXA 2YQZA 3J80A 2HDNB 3HBLA 3MS4A 3DLHA 1R0CA 3NEPX 1Z36A 3MCUA 1B8VA 2D0PB 1L0BA 1OQAA 4RVFA 4G1CA 1O0BA 1EE9A 4W5TA 1EHIA 4BVKA 2EKDA 5MDHA 4V0NA 5T4BA 4CM9A 3HCRA 1S2LA 2FPIB 4D74A 5LYJF 2C2ZA 2HYIC 2QTCA 4NCBA 2XBUA 3G2HA 4FILA 3EZ6A 3B3QA 1H69A 1FFWA 2NO1A 2Q6IA 4JR2A 5JLAA 2BJHA 4DMRA 4Q1FA 1H9BA 4GX1A 3LF2A 3MRVA 1T6ZA 3NVAA 3OOJA 2GBIA 3Q7EA 4OXNA 4U3JA 4LKOA 4L8LA 3FVTA 1YJBA 1IDN1 2JJMA 2ZUVA 4HLCA 4M1TA 4TX1A 5A4JA 4R0NA 2FPMA 3HJNA 4KAAA 5AI5A 2P5SA 3RFUA 4R84A 3V48A 4RHXA 1AE1A 2IVZA 3CIOA 1P18A 3UQZA 5JJBA 3TNJA 4P3OA 3PIDA 1NPYA 1BOFA 2PIAA 1YB2A 3KKQA 4RPHA 2YMMA 2NO5A 4TMWA 3WBBA 3EW9A 3SHWA 5C3MA 4IDQA 3IP3A 2P35A 1XTRA 1GPAA 1WE2A 2Z57A 5FA8A 3RFTA 1FRNA 2HJGA 5JXIA 3R76A 1E66A 3WYNA 4DMLA 1WBDA 2RJOA 1XYGA 3A9VA 4HQ0A 3O3CA 1KE2A 2BZGA 4CLOA 4CLRA 2RGCA 1GZ3A 2DKOA 3E5HA 1RWMA 4WXMA 5ILGA 1JG1A 4C4RA 1CP2A 4YJKA 2Q9AA 1KZ7B 3FH0A 2FAXA 1ZNZA 2QORA 3D7SA 1GKYA 1TT7A 4L8FA 2P0AA 4YJGA 3W9UA 5TQJA 4PAWA 3RTCA 5CCXA 4X6XA 1AMNA 1OFGA 3MWFA 1DOHA 2NXNA 3BMOB 5THKA 3DAGA 4CKYA 4YJ2B 4M9SA 4EZBA 2OWDA 1N2CE 5SZKB 3ZHVA 3SBDA 5IKEA 5IPFA 1P9NA 3A1SA 4KSBA 1T3HA 3VDRA 4J2OA 1UXKA 3ZV7A 1JNYA 4QQ8A 3AHDA 4TYYA 2XMPA 3O1HB 4NYMQ 4OGWA 3ONNA 4YGYA 4HGPA 4MVJH 4JCOA 5BMVB 2BGUA 3VH3A 5FOQA 4LXQA 1QX3A 2JLQA 4L7QA 4U2CA 5DW0A 2PXCA 2CNOA 1O96B 3R40A 4EB6A 3GLQA 3H13A 4NECA 2LV8A 4OHFA 1A96A 4KPFC 1I6WA 4O4JA 4C4AA 1UEXC 3FRIA 4CIDA 2AHRA 1PJ2A 1SXIA 1USIA 3FZNA 4G1VA 4GMFA 4E30A 3F2VA 1VMKA 3UO8B 8AT1A 1M73E 3PEVA 1X92A 1YZVA 1W52X 3SEQA 5FAKA 2MT9A 2QBYB 2FPRA 3OPVA 5G3ZA 4CMIA 1SA0B 3U1BA 4WZAE 2DETA 1TJYA 1QKIA 4JSRA 4HQKA 3FZYA 3IT0A 2GD6A 4WFIA 4EHHA 3RJ5A 4JSTA 3NDJA 4CZ2A 3MRSA 5AVXA 2F9LA 1P4RA 3B36A 1PR1A 3INNA 1KAMA 3FB1A 3GEPA 3ZHQA 5KYTA 2IZ0A 3KOOA 4OFWA 4R8LA 5CCEA 1VHQA 1U2DC 4NJEB 1BKDR 3FSEA 1QMPA 4OVKA 5EUCA 4FOLA 5HHTA 3NAGA 1G291 1N5LA 4DR2B 1XRNA 2QLNA 1ACMA 3GEHA 1JALA 2YJZA 3WLSA 4OI1A 1TAQA 1XCGB 1N1EA 2IXFA 1RJGA 3FSGD 4YDRA 2IGBA 1EXVA 1M1XB 1RADA 1GQOA 2OORC 1RRKA 4RJ2A 4XSVA 4A6EA 3IV6A 4P36A 3IJEB 1WV0A 4QHSA 4QDZA 4C6TA 1QBGA 3NDPA 2MHCA 4MR8B 3U3ZA 4CG0A 1N0VC 3V4ZA 1KZHA 3M5CA 4FYVA 4JI7B 5KJ1A 2BFEB 3HRIA 5L3QB 4M1WA 1E0SA 2QRLA 2B30A 5LU8A 3AR4A 4IFIA 4PXAA 5LZ2A 5MN4A 1L5OA 3C4VA 2EFEB 4KV9A 1LF5A 5DM2A 1E1RD 2VHQA 4JBGA 1KFCB 4YRGA 1RAIA 3FPGA 1Y8ZA 1FP4B 1ND5A 1VL5A 2FN4A 2VI5A 1PJTA 4XWGA 3WWEA 3PGJA 4YVFA 4MUKA 1KI1A 1NI5A 1XRMA 4UM9D 2O7QA 2XHEA 1I5EA 4OXQA 4ZQFA 5HF9A 1I7NA 3R7SA 5JJKA 1USVA 3I9MA 1ULHA 5FWAA 4BNDB 4H59A 4HDKA 4NSNA 2VPQA 3BE4A 3WK5A 5K4HA 3VTAA 4A2WA 1A5ZA 5H83A 4L07A 3KWMA 4YUVA 2QG4A 2HH9A 3OCCA 2JAHA 2XF8A 3DONA 3GLRA 3IPAA 3H0EA 5D3QA 1QDEA 3HSYA 1IYZA 1VL1A 3LWBA 1K88A 4HAYA 1GLGA 3KFVA 1C1YA 1CZNA 4GZLA 4IIYA 1S3GA 5IX8A 4CR6A 2JI4A 4FHDA 2B25A 2NYVA 1Z4IA 1RAEA 4HH4A 4K46A 3ZWNA 5CFQA 1Y8AA 4LOIA 4CMGA 1RKVA 5AD1A 5DTQA 4CMAA 3GUZA 2DH5A 1WW3A 1T2CA 2P68A 2JRLA 3L0PA 3QLVC 3UN1A 3CLHA 1E9EA 3KALA 2CJYA 2E37A 1NY5A 4OQYA 1UIRA 2HTEA 1CJSA 1U94A 2XT9A 1Z38A 2FDRA 3JZAA 5AI0A 1A95A 1KP2A 1NJ8A 2V65A 3HZHA 1A7KA 1P2TA 3BXXA 3GX1A 4P9NA 2OBFA 4EENA 4LYDA 3FZEA 5B4UA 2A7XA 5IKMA 5B3AA 4KFCA 3TX6A 4XWKA 3LO5A 3O9MA 4Z4CA 2KW5A 2P2CA 3KPJA 4W4TA 3NTOA 5KSOA 3ES9A 2WHQA 2O1WA 1CR0A 1CTQA 4KSCA 3TI7A 2P9TA 2WLTA 4DDMA 3LWNA 2ZRAA 2MR5A 1IJKA 3QE3A 1N9KA 2PT9A 1UXHA 3GGGA 5EUBA 3V4VB 4EEZA 3SZMA 1E9CA 1IWPB 3PGLA 2EJVA 5EP1A 4DVJA 3FZGA 4P4SB 1JFLA 1TTQB 3AEKB 3E3AA 1JDPA 2RSLA 3IODA 1E1NA 3BXHA 5DNUA 2W2KA 4RZXA 2AWNA 1G59A 1NLUA 4GM1A 1ESZA 3AKEA 3E7DA 4MVJE 3ADBA 5AP9A 3Q8WA 1AOXA 2IE0A 3O2NA 4JXJA 3HN2A 3W5DA 3LQFA 1VZ2A 5E6RB 3OUTA 1FTNA 1G3IA 3GOHA 4QGBA 1FW6A 4BX9A 5CA0F 2YY5A 2A58A 4PX9A 3QYJA 5E38A 4NS1A 5C81A 4O0MA 2J4DA 2F3QA 2QLMA 3WLFA 1WM1A 2JIDA 2XZTA 1TCVA 4MYSA 1NVGA 4NZNA 1MG5A 4YCNA 2J3QA 2FX2A 2R97A 3G49A 2M98A 3OFKA 2GPSA 4PG7A 1TKAA 5GOTA 5L53A 4CQMB 3PU6A 1TVKB 1LQUA 3KPUA 4O4IB 3VI4B 4BE4A 4F1KA 1UJ6A 4D9NA 1HURA 1QO7A 2AZDA 3QKSB 1U2PA 3NNNA 3K09A 4I4LA 4ND2A 4DA4A 5K01A 2DSTA 1X7ZB 2EZUA 2OBXA 3GROA 4FFVA 4ZCPA 1CU1A 2WYIA 1O94D 4KZPA 3IALA 2C1EA 3GXOA 3O0DA 2JANA 3OPYA 4K88A 4OYRA 3EXHB 2VJNA 2YV3A 5EE1A 2ZXFA 3FZQA 1R4MB 1YBAA 2VF5X 1E63A 2XW6A 4G07A 1THZA 4X0EA 1ZGGA 2FSIA 3GLTA 4ZO7A 5A04A 1OBHA 1SUAA 4RVCA 3NHWA 5FCDA 5TX7A 5TLSA 5CCDA 3O8BA 4RE6A 4QATA 3MLAA 3JYQA 5B6IA 5LQMA 4PC3A 5ESDA 1QR2A 4LVOA 3JYNA 3HYNA 4HFRA 1TA4A 2PGIA 3A8TA 3B6IA 1PT5A 3SHTA 4DGQA 2ZATA 2PH1A 1C80A 1W87A 2BCJQ 4WSOA 2MOKA 4UDXX 1KPHA 4QSHA 5DU2A 5EUMA 4TXMA 1R2QA 1GGJA 3SN6A 5INTA 1JTFA 2EX4A 5GV7A 1JSRA 1QK3A 2EGHA 6YASA 2QD2A 3HN7A 3FG9A 4IDOA 2JAWA 2GH1A 5A02A 4BL5A 2WT9A 4MUXA 2QM0A 3B9PA 4N3GA 5G0WA 3CLTC 2F3PA 2OXRA 1JEQB 1ZD9A 3GHHA 4UM7A 4Q3NA 1URPA 2A6PA 4FKZA 2A59A 3A0UA 1MFZA 2JVJA 2W11A 4PYNA 2XNSA 4QFCA 3TFQA 4J3NA 3C3XA 4TZTA 4B83A 5F23A 1ABEA 2XVAA 3UWOA 3EZ7A 1NJGA 2M6KA 3HWRA 2AK3A 1DRUA 1MQAA 1QIKA 5CLQA 2DWCA 5KYYA 3LV8A 3PG5A 3CWCA 3ZIAA 2BISA 3N58A 5AM4A 2VAXA 3PP8A 3SJAA 4IRXA 3N76A 5HW0A 1ZXBA 3NHBA 3RHSA 4C4ZA 4XJVA 1B1CA 5JZOA 1KAGA 3DB1A 3DBHA 3KDSE 2GZAA 4O0LA 1PF7E 1W35A 3X1JA 2JFFA 4KRYA 4EYKA 2I34A 1NONA 4MTCA 2AC2A 4WECA 4B3JA 4F91B 4YRFA 2Q2VA 4NBSA 5E6SA 5K8VA 5CAEB 2H92A 3JZMA 4ZQBA 4AJNA 5K0TA 4HAWA 2ZVPX 2J5BA 3C3JA 1MVLA 2B4TO 3AP2A 1AGXA 1G21B 1WA5A 2VC2B 3M1AA 4ZQCB 1UKZA 5DRTA 1KYIA 2VPIA 3KU4A 1AV7A 3O94A 4ARBA 3WR5A 4BFTA 4UTPA 3THYA 2Q99A 1QG0A 2J3IA 5BUQA 1E8MA 4UPDA 2HPZA 3OAAA 4HZUA 1ODJA 1KJZA 3PWKA 3AO0B 1SY7A 3GJSA 3NV7A 5TNXA 2G04A 1GNTA 2IYPA 1K7SN 5JBQA 4OH1A 2AJCA 3UA3A 4US1R 4ARZA 2CL6X 3OTIA 2QSZA 1J5EB 3CLKA 2P4HX 2PJDA 3ESAA 4K5QA 5BRAA 3GC6A 1PFKA 4NENA 3Q3HA 4XVRA 2FFBA 1M76A 1SQ0A 2VHYA 4OYLA 5EJAA 4FX2A 1WOYA 3P0EA 1VPEA 3SNKA 4CQJA 1JU4A 2D5IA 2NVUA 4G84A 5LQAA 2COEA 3UMBA 1XVVA 3BJEA 1T5DX 4JUIA 4RY9A 1V71A 3M1IA 4Y2RA 2PGAA 3WGGA 2C88A 13PKA 3INYA 4QBHA 4IFTA 1XZKA 2PWPA 1IFXA 3DT8A 4AXBA 1B41A 4MV1A 3QX9A 4IJQA 1EFRD 5LXTB 1ESMA 3WRYA 3WGNA 5H59A 3IXLA 4HVLA 1TJNA 3OEEA 2H9YA 3QYPA 3ZYZA 1FMTA 3HU1A 3VSAA 4XYMA 2A86A 1SCIA 2C78A 1YZ3A 2DOKA 4MPTA 1ZD8A 2FW8A 2O2EA 1EQAA 1MB3A 5HDQA 4D0NA 2VZ0A 1WUTA 4ZYUA 5DNYB 1CJKC 5E3IA 2WPNA 2FQQA 2Q2WA 1XA0A 1PJZA 3BQNB 4HCJA 5FPSA 5CK5A 4OHMA 2C9OA 2CNWD 4RFLA 3PIIA 3B82A 3JD2A 2IBMA 4N3AA 5LBIA 2AMLA 5L3SB 1O95A 2B7BA 2B1GA 3KLMX 4YJDA 3EEBA 2A9FA 4G41A 4W63A 2ZROA 3EXEA 2HHJA 1K4KA 2C4TA 4L3VA 2ODQA 2Q28A 1RKUA 4FZVA 1JQLB 1RWNA 3G8YA 3FRJA 3RS0A 1JWLA 3GFQA 4UCQA 3AVXA 3DHNA 2Q62A 2WAOA 3WFZA 3HUEA 4M8IA 3VNBA 4MAFA 1VMDA 1CJUC 4C20A 5CB4A 2V0GA 2FGJA 2F67A 4I3HA 2V58A 2X8WA 2Y4NA 4N5LA 3QOFA 4J0GA 4PAOA 4YWHA 4KR6A 4ALKA 4JJFA 2AFVA 1C81A 3LUFA 4BNVA 1TK2A 4ZGWA 1SU6A 4G0ZA 1H9CA 3GG2A 2XUQA 1IC6A 1GLVA 4UNSA 3PQ3A 2Y1CA 3CX3A 4RE5A 3G5TA 4LBZA 4ZRMA 2XDQB 5DXAA 1SBYA 2SKDA 1TTPB 2D13A 3F98A 4M36A 2PBZA 2NTJA 1HDEA 5G02A 3SNHA 5AXDA 1V11B 1WSBA 1HGXA 1G7SA 1L7XA 3H2YA 1WO8A 4UBNA 2BFFA 2GKOA 5CX4A 3RSSA 3SF8B 2VA9A 4QU5A 4GLFA 3GLFA 4RJIA 3DDNA 1PWZA 1G21E 3RJMA 1FS6A 1ZUHA 4WJZA 5JAIA 3LXUX 4NMLA 4Z4GA 4ZMBA 5LP6F 3OTGA 1OB2A 1IXZA 3U49A 4HYTA 2YHSA 3FOEC 4EITA 2WTEA 3AR6A 5FTKA 3RJZA 5HVNA 4UE2A 1KO7A 5AKIA 4KMRA 5BR7A 2RC5A 2PKQO 4EI7A 4PG6A 3EDCA 2RG7A 4WEQA 1T1IA 1CWUA 1ZIDA 3RAEC 1NVEA 1UWCA 2FSVC 3P8ZA 4B6EA 1BHQ1 2BBOA 3KXPA 1UKEA 3KK0A 3MINB 4DA0A 2GLXA 5FWYB 2N75A 1M7GA 5HF8A 5BORA 2WVAA 3O2QB 1KRWA 4N9WA 1QANA 4JHLA 4WFKA 3VVBA 4U7JA 3LIPA 2XDYA 3RUHA 1P60A 4ZO8A 1DIRA 3SSAA 4PO9A 2F00A 4ND8A 1SIUA 4DLNA 1VHDA 3UMFA 3FKJA 4J7XA 4ZHQA 1ADYA 1N75A 3N8GA 4GP6A 4KUEA 2A88A 4EY8A 1QGAA 4W5NA 4EG3A 1R74A 2HRZA 5K8UA 4ZAWA 3UB4A 3DGEC 4GUDA 4MUAA 4TMKA 1J9GA 2VRCA 2X6QA 3LC0A 3VU3A 2PS0A 4UAUA 4I4TF 4Z9XA 3GPBA 4US0R 1KVRA 4P22A 3RTAA 2AFRA 4TKMA 5KINB 3W1VA 1E94E 1K5PA 3W4KA 5LCXA 3CZ9A 2YH2A 3PX3A 3D0OA 4HYYA 1P1HA 1YQDA 2QB5A 2H9AA 3L7BA 5FT9A 4A73A 2DUMA 2EHJA 4GPBA 4N7BA 5BN3A 2NQ2C 4HNHA 1S8FA 2RHGB 3HBJA 4MS3A 2Q8NA 1YBMA 4HUQA 2D00A 1KPIA 1T0UA 1YR1A 3QW4B 4S1TA 5ITVA 1L5ZA 4B4OA 3D8BA 5DFAA 5A9SA 4FN5A 2A5GA 4HGOA 3G0OA 3ZXIA 4D9JA 2ZWVA 3ZJ4A 1C4OA 1G7TA 3GMDA 4DS3A 2B6NA 5CIYA 1UQUA 1Y98A 4NDNE 2NUPA 5FTJA 3WWOA 3ANTA 2UZAA 3RVNA 1OGYA 1FFGA 1GAJA 2H17A 1AKEA 2IDZA 1OXXK 2JGMA 1Y4AE 1B14A 2JHPA 2XOKD 3VC7A 4DW8A 4ZI3A 1E32A 1TKRA 3GRZA 4X66B 4UQOA 4QBTA 4NE9A 4C9BA 1R0KA 3B9BA 5CRIA 3EN0A 4HX2A 3K1JA 5KYUB 4UQLA 2JAXA 2QRKA 2Z1MA 4BRZA 3CXUA 3FNQA 1HDXA 2BR5A 3ILSA 4AMGA 1CVRA 4HQOA 3HL4A 1F7UA 3MJFA 4G2TA 4MB0A 3Q7RA 2FPGB 1XROA 3SYTA 1J33A 4V0OA 4LF6B 5A4KA 2C9CA 1P33A 2RHDA 1U0HC 2WWGA 3SQDA 1KPGA 3JATA 4D3ZA 1OR8A 1GL3A 3ENVA 3EQ7A 2YZMA 3QIAA 4OUKX 4JLWA 4N41A 3HK2A 5E3JA 3ZC3A 1DC7A 5JMOA 1ZX1A 3V1LA 1GEGA 3U7FB 4WN9A 3INGA 4EX6A 3RKUA 2WTBA 4M0MA 1L3BA 4AU1A 4C01A 3K5PA 2V7TA 5LZ5A 1KU6A 4CM4B 2B0JA 3BFXA 1QO9A 3CRNA 3D7RA 3QBVA 2R1TB 3MB8A 1GKUB 4XGQA 4GXNA 3AHFA 1LX6A 4GM4A 1ZGHA 2N47A 3E05A 4CEIA 3F6BX 3HO6A 3MQ4A 3AL0C 4B40A 1ST3A 3NCTA 5DULA 5C35A 3NETA 5F73A 3GLHB 5HJEA 1AQIA 3CLTD 4E1AA 3I61A 3UXHA 1NZFA 3HDHA 2YYYA 3KJNA 1NUAA 2FKAA 2I4OA 4AO7A 1JSLA 1W8IA 1ZM2A 1PO7A 2ZVQX 3K9WA 3LFUA 3O92A 3COSA 2A9JA 4HGRA 3FBGA 1WVGA 2ZRFA 3D8SA 3SICE 4YRQA 3ZU3A 1VLHA 1V2HE 2CN1A 4M38A 5HZKA 1M6EX 4GPTA 1P5FA 4LXXA 1TZ2A 2BEWA 4P7JA 5DIZA 3UWKA 4QECA 1T4CA 4YUWA 4PSDA 4HKTA 1W9HA 2HGSA 1M0EA 2VJMA 3S4YA 1JXMA 4HC4A 4LN1A 1ZRMA 3PK0A 2L42A 1U7OA 5EGNA 1M33A 2HBZA 4HDNB 4DIDA 2QN6A 4C43A 5HZGA 1JLSA 2B92A 3AOGA 3KJFA 4D56A 5FWNA 1D2RA 3NRJA 3PLAE 1B23P 5CVEA 4B4UA 3WYAA 5CA1F 3CC8A 3NAZA 4MX8A 1K8YB 1SOMA 4DJJA 2NAPA 1EK1A 4HQ6A 3WRXA 3SP1A 2TECE 4CHTA 2IYQA 2XRMA 4HAVA 4ISCA 1AK9A 4WDRA 2IZZA 4QWWA 4CLDA 3HQ4O 4P35A 4BBPA 4YR9A 3KIPA 3T5MA 1KI6B 3FPHA 2VHZA 3VNUA 2Q5QA 2OWEA 4I9FA 2EBHX 3OO1A 4JGIA 2CF6A 3DULA 3LE8A 4J29A 2W83A 4MYDA 4F72A 3MTAA 3NT4A 4KZKA 1Y4DE