3BMOA

Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor (compound ax4)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
267
structure length
255
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
molecule tags Oxidoreductase
source organism Trypanosoma brucei brucei
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
total genus 96
structure length 255
sequence length 267
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bmoA00
4BQPA 1HDOA 2DFDA 4QFCA 3BTVA 3PFWO 4DYVA 3AY6A 4E5MA 1HZJA 1BXKA 4OKIA 4W6ZA 3AUSA 3AWDA 2BI8A 1ADFA 5L95A 4Q3AA 4FJ2A 4EJ6A 1GYPA 5DP1A 1YL7A 5BQFA 3FCOA 3HWRA 3W1VA 3BMNA 2O3RA 1YBAA 4JQCA 4S3MA 3DONA 2O50A 3UN1A 2D59A 5BNIA 2IYPA 3ZWVA 1ZK1A 1GCOA 1B26A 4ND3A 4HADA 4RVDA 4ALIA 1NPTO 5FEUA 1R0LA 1P77A 1T2CA 3MCVA 5KVVA 1YL5A 1TXGA 4H15A 2PA3A 2NVWA 3PYXA 2IZ1A 1I01A 3V1UA 3UOGA 5A9RA 2C0CA 3QSGA 4NJMB 4YQYA 1AE1A 5A04A 4MINA 3LSYA 4GKBA 2IDZA 3HSKA 4B4WA 4UVDA 1M66A 1WMBA 3Q2KA 3AU9A 3C85A 1OI7A 2C5AA 4I9NA 1HEUA 3PP8A 4BNUA 4DXHA 1U1IA 3M1LA 1VLLA 1HF3A 4MIEA 2LDBA 3AI2A 1T24A 4AG3A 2YHIB 4ZJUA 4BO7A 4ZHSA 3IJPA 4LSMA 2Q46A 5KVCA 1BWSA 5ENVA 1BHSA 1W6UA 4Y6SA 3PWKA 3F5QA 5I7VA 3DOJA 4NG5A 1DOHA 4MOWA 3ZHZA 2V6FA 3C1TA 3VH4A 2NQ8A 3WSWA 1NR1A 1R6DA 1C0KA 2VRCA 2J5KA 1PZHA 4ND1A 3ZWBA 1HDGO 5TC4A 3JQDA 4BQRA 4BO6A 1C1DB 3HB5X 2OBNA 3PTZA 3RC9A 3RKUA 2C07A 3AK4A 3TPCA 3INTA 4IJWA 4ZQGA 3ZV5A 1KC1A 5JFOA 4GWKA 3G3EA 4YRBA 3C24A 1SMKA 4C7JA 4Z3KA 3VH2A 1PWXA 1CETA 3FHLA 2ZCUA 3WIEA 4A5OA 4KMSA 4BNZA 3RFVA 2PZLA 3COSA 3QA9A 4RJTA 4GQAA 3V2UA 4RL6A 4IJUA 2ZB4A 4ZQHA 1XA0A 1DHTA 1ENYA 5L3ZA 1W73A 4N5MA 4RGBA 3JYLA 3U3XA 5HBRA 2ZJ0A 4GX5A 5TQVA 1PZGA 4FC6A 5G0TA 3VTFA 2Q2VA 4ZGWA 1HTBA 3ROPA 1SO8A 4KZPA 3CKYA 4RF5A 4XYEA 1CF2O 5B37A 5DCWA 4J0FA 2JFFA 3KTDA 1Q2XA 1JA9A 4RPJA 4YCAA 5GZ3A 1KC3A 3WGGA 5KVSA 3GHHA 4J49A 3JCZA 3T4EA 1R4MB 4YJDA 3ZHYA 1UJMA 3LYLA 3PFFA 3S8MA 5IG2A 4R9SA 1YB4A 4D3SA 3K2BA 1JWBB 3R3SA 4NIMA 4Q9NA 3DHEA 3OJOA 2P4QA 3W6UA 1GPJA 2QHXA 3KO8A 2DTDA 2GDZA 1EBFA 3H9UA 4DMLA 3CXRA 2EP5A 5H82A 2RCYA 2ILTA 3C1OA 4XIJA 2HRBA 4IIVA 1LI4A 2H6EA 3OIDA 3QVTA 2ZB7A 1Y8QA 3KYBA 1IL0A 2QX7A 3FR7A 1BDBA 1P1HA 4FDAA 4ND5A 1J49A 3U4DA 5L4NA 5TJ9A 1NVTA 2D2IA 2Y68A 3VKVA 4F3YA 4K6FA 3KM0A 3WTBA 1MV8A 2OMEA 3NV9A 5I7EA 4UULA 1EZ4A 3PJDA 1K2WA 5DBFA 3FNGA 1QP8A 4M54A 4U5QA 4LVUA 4U8GA 5EL0A 1N2SA 1DC5A 3RBVA 5KTKA 1SB8A 3KYCA 4JCOA 1CERA 3D5TA 3EY4A 3VH3A 1YOVB 5T67A 4B4VA 4E3ZA 3WGYA 4P4GA 3QVSA 1RPNA 1NNUA 1LSSA 2C20A 2PGDA 3ZV4A 3NTRA 2VZ8A 1QLHA 3EVTA 4QTZA 5A02A 2DT5A 1ONPA 4J2OA 4MVJM 5AXCA 4DLLA 5U1PA 4Q3CA 1DXYA 1VSUA 4OSOA 4WCFB 4U7WA 3GAZA 4O63O 3QV1A 2AHRA 4UEKA 2YHIA 2UVDA 4ZRNA 1A72A 1PGNA 1D1SA 4DLAA 4CLDA 1PWZA 4N54A 2FR1A 3OIFA 4M1QA 4FJ0A 1NYTA 2O23A 2GD1O 3WGZA 1F14A 2H5LA 3KYCB 1DC3A 3U49A 3WBFA 3BMOA 2OFPA 3O9ZA 1E3IA 4P4NA 3GF4A 4NZ9A 5EERA 1F12A 3BMQB 3CH6A 3JYPA 4CMIA 4NU5A 5COQA 1HE2A 3B20A 4ONEA 3WQSB 4WLVA 3JQ9C 1XDWA 4MKZA 1JN0A 4E4YA 4EYEA 4DWVA 2FRDA 2ZB8A 3OA0A 3P5SA 3VH1A 2AA3A 2V65A 1P44A 1PQWA 2X0IA 1EE9A 3KSUA 1KOLA 2GN8A 5BNTA 1YDWA 1KIFA 3BMNB 3IQDB 4PG4A 2C2YA 2EGGA 4ALMA 3WSVA 4E13A 1U5AA 1NXQA 1ZSVA 1X7HA 3M6IA 2XPCA 1QYWA 4J0EA 4DQXA 5A1TA 1K6JA 2DPHA 4BO4A 4N18A 4WLOA 5KCZA 4Y9DA 1H9AA 3DBLA 5EMHA 2NTNA 4DPLA 4CQLB 5K6AC 2F00A 1WZIA 3GOHA 1IZ0A 1VPDA 3UICA 1ZK4A 5MGBA 2PK3A 4YWJA 2D5AA 3UXYA 2VTEA 1A5ZA 3P19A 1A7AA 4RORA 5HS6A 4BMSA 4D46A 1DC6A 2DU8A 2WWRA 3WDSA 5T8KA 1SPXA 4KQXA 1E7RA 4E12A 2HMWA 4OL9A 3ABIA 3DHYA 2DBZA 2X0JA 3KEQA 5AXBA 4BGEA 4JLWA 3GFBA 4XD2A 4DQVA 2YV3A 1SBYA 3DMYA 1TB4A 3ETEA 4W7HA 4CLRB 2YQ5A 4RLHA 1E3EA 1UAGA 4Q3NA 2ZQYA 4GWGA 1JDJA 1OFGA 3G49A 3GPDG 3IL2A 5AXAA 4L76A 3GG9A 5GZ6A 2GO1A 4CMEA 1CYDA 1Z7BA 4OSPA 2NTVA 1PL7A 1LUAA 3ITKA 3GVHA 1X0XA 4NK5A 4JK3A 4AJKA 4KP7A 4M87A 3LDHA 1FDVA 5BSGA 1Y9AA 3I9OA 4L8VA 2RH4A 3NAQA 3U09A 4HBGA 4FD3A 5IN4A 3HUDA 5CFZA 3G1TA 1NFFA 4JX8A 1QV7A 2GGSA 4L4XA 4RF4A 2X9VA 1WMAA 1E7YA 3V1YA 4AICA 3RKRA 5CEFA 2QQ5A 4PZDA 3B6ZA 4CM6A 1QYVA 1LBEA 2P9CA 2X1HA 1P0CA 3GGOA 2HDHA 3GT0A 3M1AA 4B8ZA 5L45A 5FI3A 8LDHA 3FTNA 2O4CA 3DBHB 3ANLA 1HSOA 1XQ1A 1Z75A 2NUAA 2RHRA 2WYVA 3PPIA 4UVHA 5JMPA 2HMTA 2XAAA 2AG8A 4PG6A 1GZ6A 3Q2IA 2HLPA 1DHRA 2OUIA 1UH5A 4CQMD 1RKXA 1H2HA 3H9EO 3L4BC 4IGFA 3ZNPA 4NJMA 4BNVA 3DZJA 5G0WA 5JMWA 3AUTA 3ITDA 4BNMA 3JV7A 4GGOA 3NDIA 4U6SA 4YB8A 4BL5A 4FS3A 4LK3A 2W2KB 3ON5A 1NVGA 3VOSA 4Z0TA 5DCUA 3JQCA 4CMJA 4CPDA 4MJLA 1HSZA 4IDEA 2E49A 1ISFA 1I33A 1UZNA 2R00A 4GSLA 5IFLA 3UUWA 4NDNE 2X5JO 4PLWA 4YAEA 4CM8A 2I66A 3E8XA 4IS2A 3P2YA 3SC4A 2IZZA 1PS8A 3DFZA 2PH5A 5BSHA 2EKLA 2LDXA 2HJSA 3IP1A 1E7WA 3I9LA 3E9MA 2ZYDA 5JC8A 1QSGA 4CM4A 1T1SA 2X86A 1MFZA 4NFSA 4RV9A 5T64A 3ROMA 2QG4A 1Q0LA 4MPDA 5IN5A 5KKCA 1ZVMA 3RQSA 1E92A 2B69A 1UDBA 4L4SA 5G0UA 4IQ0A 3GY0A 5K6AA 2CDCA 3FRJA 2OP0A 2O3UA 4XCVA 4MVJH 4UAGA 3QE3A 3VDQA 1D4FA 1GYQA 4FFMA 3GEGA 2PWZA 3W6ZA 3NDRA 3L6OO 2JCYA 4FN4A 1F06A 4YT8A 4PLGA 3D0OA 3GPIA 1PR3A 2WYUA 1D1TA 3H2ZA 1LNQA 4DTIA 3E6AA 2ZQZA 1E7QA 1MA0A 4OAQA 1DLIA 4QXMA 2IEBA 1CIVA 5HWSA 1HXHA 1JU9A 3RUDA 5CG2A 4EITA 3IMFA 3IOYA 3RI3A 1YS4A 2B0JA 5KJEA 3GRKA 5TT0A 2CF6A 3W8EA 4CM9A 3BA1A 4WLUA 1S6YA 4DUPA 2B5WA 2OZPA 2FMUA 4RVUA 5JBIA 1C0IA 2FY8A 2YHUA 4ID9A 3H9QA 4WLNA 3K8ZA 5JPIA 3H5NA 2Y0DA 3PVZA 3JQ7A 4XR4A 4R69A 2PGJA 5JCJA 2JAPA 3I6IA 1M2WA 4GX2A 4L4RA 3FPLA 4QEDA 3E9QA 1IULA 3CSDA 2Q2QA 1C3VA 1LRJA 2X9GA 1EFKA 2PKQO 1H93A 1RM0A 1TLTA 1YB5A 2QRKA 1PQUA 1UXHA 4GMFA 4Z9YA 1U8FO 1U7HA 4FFLA 1KETA 1LC0A 3N58A 3H65A 1E3WB 1Z74A 2W90A 1KVUA 3DQPA 4Q39A 1XU9A 5HA5A 4E30A 3GGPA 4H16A 2RBEA 1JVBA 1OOEA 1C0PA 4R3WA 1RJWA 4MIOA 3ZGYA 1MG5A 4I5GA 3KEOA 3H9JA 1ULSA 4A27A 2FPPA 4Q3DA 3F1KA 1UXIA 3E48A 3O8QA 3QWHA 3K31A 2VN8A 1KVQA 2P9EA 3VHRA 4RZIA 3FWZA 2I65A 3GA0A 1Q7GA 4AJNA 1IYZA 4A10A 1PJCA 1PZEA 5DP2A 2ZTLA 4FOSA 5I8WA 4BMNA 1PGJA 2OL4A 1XYGA 1UXJA 3RBZA 3ZHXA 4YPOA 1R37A 1A27A 1QV6A 4FPXA 2CMDA 1DIGA 3CUKA 1YRLA 3OFSA 5AYVA 4I08A 3UHAA 2X8LA 4FBGA 2GNAA 1DRWA 1E7MA 1IOLA 2X0RA 3JQAA 4GVLA 1SNYA 1I36A 4KUEA 1Q7CA 2O2SA 2QZZA 4EEZA 2UYYA 3DC2A 4ZN6A 4BKOA 4GVXA 4JBIA 4XYLA 2O3TA 5LDGA 3TZQA 5A4DA 4D45A 1E3LA 3PQFA 4FFRA 1M67A 2IEDA 2TMDA 1I2BA 1IY8A 1L7DA 1U5CA 4PCVA 1DIBA 1NTOA 1F0YA 4JJGA 4A03A 2P2SA 3OH8A 4OHUA 1DFGA 2PZMA 3ZDFA 5TT1A 5F1PA 1YQXA 4W4TA 5JY1A 1DFHA 2POQX 3NJ4A 4TRMA 4DBZA 5JAMA 1Y8RB 1G0NA 4NU6A 3H3FA 4TRRA 4DVJA 3UW3A 1ZEJA 3HN2A 5TS3A 1DRVA 2J6IA 3DL2A 3ZWNA 1DEHA 5JDIA 3W4IA 5F5LA 3DZGA 1KY4A 1B0AA 1GUYA 5EPOA 4J6FA 4IUYA 2NTJA 3GAFA 5ES3A 3QWFA 2PZKA 2QRJA 3ST7A 4CLXA 3CINA 3Q0EA 4CLHA 5AXDA 5DULA 4CR8A 1ADBA 2JD2A 2X4GA 2X6TA 2YUTA 4W82A 5G4LA 1P1RA 1D7OA 3AJRA 3AM5A 3TZKA 3WGTA 3S55A 1RM3A 1VKNA 2OO5A 3JD2A 3N74A 1EE2A 5JAIA 1N8KA 1NFQA 1ZXLA 1DJNA 1LSOA 1YGYA 2AG5A 5EINA 2B4TO 1KVSA 2XOXA 4XGNA 4HV4A 1GEGA 4A26A 1JTVA 4FR5A 5DOZA 4IDAA 4K9DA 5A9SB 3JQAB 1O94A 4UVEA 2VUUA 1XIVA 4OOFA 4PVDA 3AOGA 1UP7A 3QVWA 4RVHA 4TKLA 3EHEA 4U6QA 3D3EA 2UUOA 4GGPA 4GBJA 3JQBC 2E4AA 5JYDA 2A92A 5A05A 5IJZA 2VHWA 1IHYA 3W4JA 1AN9A 3PGXA 3PQDA 4PZEA 3Q6IA 1T25A 3KZVA 3WWYA 4MKXA 2B4QA 4IJKA 4CQLA 2Q1TA 2PV7A 1TT5B 2CUKA 1JLLA 4RVFA 1P0FA 1P45A 5CPBA 2YJZA 3KV3O 4RPKA 4K26A 3DO5A 1O89A 1LQUA 1YONA 3NT5A 4WNIA 4N7RA 2WDZA 3KSDO 3PRJA 4R16A 4Y8VA 3AUUA 3KUXA 3NJ8A 4JNKA 2GZ2A 5FI5A 1CEQA 1ZMOA 2NADA 1GCUA 1H2BA 2HO5A 2ZKLA 4IDDA 3S2EA 3WMXA 3S2FA 3DAPA 1ZW1A 1Z45A 4YVFA 2FPGA 3NYWA 3SXPA 1R4NA 1ISJA 3JSAA 5AQ1A 4FGSA 4ZICA 2B83A 2RAFA 4JP3A 3GDGA 3WFIA 4IDFA 2F1KA 4BO5A 1EMDA 4MIYA 4JIGA 2DFVA 4BGIA 4BKPA 4K1LA 4NFYA 4EI2A 5BR7A 4QO7A 5JCJD 2A94A 1YJQA 3WQRA 4TROA 3I3OA 3KXDA 3LQFA 4J4HA 3GZNA 3ICPA 4DPKA 2JHFA 4D42A 1NAIA 4II2A 3MTGA 5HS4A 2GR9A 4BNKA 3QJ5A 3SX2A 1VJ1A 1PJ3A 4R54A 3RASA 4UUMA 1U4OA 1WLYA 2Y0EA 2D5CA 2ZJ1A 3GH3A 3O38A 4NBWA 1EVZA 4D43A 3AU8A 5THKA 5JO9A 3SJ7A 4WNCA 2FP4A 2VT2A 1HYHA 3ZWCA 3WB9A 4KQWA 4NBVA 4UUNA 3VC7A 1LDBA 1IB6A 1VL0A 3EZLA 4TVBA 4BO0A 4CM1A 4CLEA 3WMWA 3FBGA 5DNAA 3OMLA 5JE8A 4J3FA 1QYCA 3K5PA 3HE3A 5JS6A 3DAGA 3T7EA 4FB5A 2D3TA 2VNSA 1C1XA 3JQFA 4Z6KA 1U8XX 3MJSA 1B3BA 4BMVA 6ADHA 5EQDA 2DQ4A 3PJFA 4INAA 4BNLA 2Q4EA 4L74A 2VYNA 2QZ9A 3JD0A 3PHLA 1Q0QA 3QHAA 3GUCA 4B4OA 5J23A 2A9FA 1I2CA 3GNQA 3ZWOA 1ADGA 4CMCA 4J7UA 1JAYA 3WWZA 2PH3A 3LT0A 2VHZA 3L07A 1Y8QB 3V2GA 4BB6A 2DLDA 5KJFA 1EVYA 2DC1A 2XXJA 4WGGA 1ZZEA 1XGKA 2WE8A 2FZWA 3CZMA 4FFOA 4CM4B 1LTHR 3B1JA 1QR6A 4IIUA 2AE1A 5ITVA 4J90A 3QWAA 3PQEA 1FDSA 1I3MA 3DFUA 3I83A 3QP9A 2FWMX 4G2NA 4DC0A 1MXFA 4NBTA 3AY3A 1E1KA 2AW5A 4YQZA 4CM5A 4LCJA 4E2YA 2DM6A 4L0QA 3L6DA 4J9UE 4O0LA 3CEAA 1UP6A 2DUUA 3JD4A 1XKQA 3K96A 2W2KA 3JQGA 2O4UX 4YR9A 4WPGA 4ZU3A 2GZ1A 4TVOA 4I5DA 4M89A 4CMEC 2ZTUA 4Y6RA 2C5EA 4AJHA 1GTMA 2NU8A 4BO3A 3X2EA 2E82A 1BDMA 2H63A 4BNHA 2J5RA 1P74A 4ALLA 1K0UA 1SAYA 3K9QO 4IZIA 4AJ4A 4BO1A 1YL6A 5KWEA 5TGDA 1QYDA 3I1JA 6LDHA 4BNJA 3RFTA 4HUJA 1NASA 3VPXA 5IDWA 2AXQA 1U3WA 1ZJYA 4GAEA 2Q50A 1R15A 5TJHA 2Y93A 1I0ZA 3GUYA 1QYXA 2PLAA 2GUGA 2UDPA 4MDHA 4WASA 2PD3A 3NGXA 5THQA 5KIAA 4AJ1A 2VYVD 2W98A 2FOIA 1EQUA 1YOVA 3RUIA 4JJIA 3GZNB 2EGHA 3UH1A 4BNFA 1UUFA 1NAHA 1G0OA 7ADHA 4W9NC 1KEWA 1ADCA 3C7DB 3BTSA 3GEMA 4YXFA 4N5LA 3FI9A 3JYQA 1E77A 3WYCA 2CVOA 2HK9A 5EESA 4BUCA 2FPIA 1YO6A 1WZEA 4E5NA 4YACA 5A5FA 4R68A 4E5PA 3KHUA 4ZRMA 1TI7A 2J3JA 5AVOA 3I9KA 3RBXA 3R6DA 1I3KA 1U9JA 3EYWA 4XX0A 1KEUA 2JHGA 3PK0A 4BHTA 2P4HX 2G17A 3F4LA 1TT5A 2C82A 3JQEA 1B3RA 3HDQA 3JQGB 1HDCA 3FBTA 3QQPA 1AUPA 3GNSA 1PJ4A 2Z1MA 1NVMB 4CM9D 3GGGA 3VZPA 1I32A 3DZKA 2CF5A 2EKQA 1KYQA 2Z5LA 4R1NA 3DTTA 3NTQA 5L51A 3LZ6A 1BXZA 1P33A 1VKOA 2IODA 3LLSA 2DTEA 4I9HA 5L7WA 1I5RA 4N5NA 4M49A 3GVPA 4CUJA 3M2TA 3HHPA 4AJ2A 4FQ8A 3VZQA 3ZWAA 2HQ1A 4BNIA 1T1RA 1VL8A 4HNHA 2YQ4A 3RAJA 2IXAA 4B7UA 4YJHA 2PFGA 3OJEA 1SOWA 4KWIA 5TRTA 1SC6A 3JD1A 3PI7A 4P4LA 2DBVO 1PR9A 1QMGA 4E2ZA 2V6MA 3ADOA 3H2SA 3GDOA 3EMKA 3IC5A 3GQVA 1YBVA 4CV2A 1T2AA 4NJOA 1HYEA 4J4BA 4TQGA 4TRNA 2VWPA 1FDUA 2NU6A 4EW6A 1WPQA 4YJGA 4CMIB 1P3DA 3V5NA 3F4BA 3LLVA 5TF4A 3UCFA 2HUNA 3BXXA 1G6KA 2GSDA 2WM3A 4AJPA 1LU9A 2GERA 3TQHA 2JFHA 3VPFA 3LT1A 2EKPA 4O1MA 5CDTA 2UV8A 4QUKA 4G5HA 4YA6A 4LMRA 5GZ1A 1DB3A 2FN7A 2Q3EA 4IQGA 2GN9A 3KRTA 5DT9A 1ZJZA 5IAAA 1ID1A 3V1TC 4UUPA 3D4OA 3K73O 3SC6A 4O5OA 3GVCA 1PGOA 1HWYA 2PKRA 3PIIA 1T4DA 4WEOA 3I23A 3C3XA 4I5FA 4RDIA 4TRJA 4IM7A 5ICMA 2JD0A 2PTGA 5JC1A 1ML3A 1OC4A 3EUWA 4GH5A 1QRRA 1ZO8A 3D1LA 3UFXA 3V8BA 4RLSA 3RUEA 2JCXA 3A9WA 4CR7A 5H83A 3MJVA 3LC7O 3NRCA 2PY6A 3GDFA 2NVBA 1HKUA 4Z9FA 4AL4A 2JAHA 3QRWA 2SCUA 2RHCA 4DIFA 5JO0A 3DZHA 4BO2A 3OJ0A 1PJQA 4P38A 4TKMA 4C7KA 2G76A 3N7UA 3U0BA 1LC3A 2J3IA 5T57A 5IXSA 2GASA 4BNXA 1GAEO 1Y81A 3ZHBA 1ZK3A 1PEDA 2H9IA 2BFOA 5C7OO 4DA9A 4G65A 1XWFA 1T26A 5DF1A 5CAEA 2R00C 3H7AA 1R0SA 3G79A 1B8VA 5DBIA 5CHEA 3ZV3A 2E48A 3M2PA 5ILGA 3GEDA 3NDJA 1BTOA 2YDXA 3AFNA 3QVXA 4NH4A 3O8QB 1R4MA 1DSSG 5I8ZA 1X1TA 2E6UX 3F3SA 3KBOA 2WMDA 5ER9A 2OP1A 1K3TA 1WXDA 4Z0HO 2CVQA 1Q1NA 3BMCA 1H6BA 1LXCA 4WCFC 1XR3A 3L77A 1OC2A 1Z73A 2RH8A 2C54A 3UCXA 3I6QA 3INRA 4ILKA 4D0SA 2VWQA 2NU7A 4YTEA 1V6AA 4W99A 4KTVE 3PWSA 2PZJA 5JLAA 4DBVO 2EEZA 3SLGA 3KLPX 5FF9A 1O0SA 3BAZA 4I9UA 3VTZA 3AOEC 1R12A 4E21A 2YFHA 4J7CA 3D3WB 2VZ9A 1VC2A 2HSDA 1ZH8A 2QW8A 4J1NA 4BGUA 1JKJA 4BNTA 4CL3A 3RUAA 3GN1A 4XJTA 1LLCA 3DOCA 4KDFA 3ZV6A 4EUFA 5KNLA 4Q3EA 2Y05A 2C2XA 2GRAA 2VHYA 3ZI0A 4CV3A 4PLZA 4PRKA 3S2IA 3TZHA 2HCTA 1EFLA 1PJ2A 4PLPA 4YDRA 1OAAA 3PWZA 4CMBA 1O95A 4ZA2A 1NQTA 4OM8A 4HFNA 3JQ8A 2AE2A 1Y8RA 4P22A 3R1IA 4YJFB 1MG0A 4IMRA 4B8WA 3BHIA 1NWCA 4J91A 1KS9A 2CVZA 2JCVA 5IF3A 5EIOA 3WJAA 3FTPA 4IPTA 2W2LD 5KOIA 4E6PA 1YBMA 4FOOA 5JYEA 1E3SA 4TWRA 4D79A 1WDKA 2RIRA 4QT0A 3AM3A 4TMFA 3AI1A 5DOVA 3D4NA 2IYOA 2VT3A 2OXIA 2A4KA 3L4BA 4RVGA 5L53A 3RUCA 3PJGA 3RIHA 5KJ6A 2HK7A 4L9RA 1M6HA 1PJBA 3AW9A 3PYMA 2Q1SA 2XF8A 3TOZA 3NGLA 1GR0A 1N5DA 1LLDA 2B36A 2C7VA 3FN4A 2BMAA 4R01A 5G4KB 1DPGA 2CDBA 4DGSA 3OIGA 4RF2A 2ZYAA 3ZWMA 3FF4A 4II3A 2GPTA 5LCXA 1K6XA 1GV0A 4PLYA 4OYRA 2O2YA 5JAZA 2HAEA 3LK7A 4B3HA 1N92A 1ZK0A 4LRSB 1FK8A 4CUKA 4EZBA 3ANMA 3WGOA 3WS7A 3DEYX 5TSDA 1MGOA 1LDMA 1XELA 3ONEA 4FJ1A 1SZJG 4K6CA 5G0SA 3DHNA 4FC7A 5TX7A 1PSDA 3GNTA 4EBFA 1VM6A 1YH3A 4XYBA 1PZFA 3ZNOA 1I3NA 2NVUA 3TNLA 4PN3A 3VZSA 4R41A 1CRWG 1DO8A 1FF9A 1H5QA 1I2ZA 4JROA 2ZYGA 2JD1A 1TEHA 3W8FA 1CJCA 4HXYA 2DKNA 2E37A 1MX3A 1Z82A 2WEKA 2VUTA 3DXFA 2BGLA 5DN9A 1EK5A 3FSRA 1NPYA 1ENOA 1W0CA 3EVNA 4TZKA 4GI2A 2PGLA 2B5VA 3OM9A 1EUCA 1SEPA 3E9NA 2AEFA 3MTJA 4PVCA 1L7EA 1LDYA 4TZTA 1D8AA 2VYND 3PIDA 5F5NA 3RUHA 3JQ8B 1ZUD1 2AQKA 1ZEMA 5CDUA 5JDCC 1XHLA 1R16A 2P5YA 2Q1UA 5GMOA 3Q1LA 1JVSA 4EUEA 1V3UA 1YDEA 4G81A 3ASVA 2FSSA 3O4RA 4GL4A 4R5HA 1XEAA 2D0IA 4D3FA 1XCBA 4D41A 1A4UA 1AXEA 1NM5A 1NPDA 4M8SA 3OECA 1DC4A 2AQ8A 3NT2A 4FFPA 1EBUA 4YT4A 1PTJA 2Q99A 2BD0A 5ER6A 1KERA 3O26A 1EDOA 1DIHA 3JD3A 4NK4A 2Y99A 4XYMA 5A9TA 5IXYA 4CMGA 3TSCA 3W4KA 3D3WA 2HU2A 2CZCA 2HK8A 3ROKA 3MJ4A 4CL8A 2TMGA 3PYLA 3KSZO 3PDUA 4HX5A 1DIRA 5EJ2A 1OMOA 3HFGA 1Y1PA 1WW8A 3C1AA 1S7CA 2I9PA 3LC1O 5F3RA 1H9BA 4DRYA 5C3MA 9LDBA 1GZ4A 3FWNA 1VSVA 3P7MA 1BVRA 2B4RO 1UZLA 3GVXA 2C29D 2GYYA 4LCEA 2YY7A 3GRPA 3E5MA 3LF1A 3ZW9A 4BV9A 4ZQFA 3C8MA 5CDSA 4A0SA 4YT2A 5ICSA 5CDYA 3D4PA 3JYOA 2HRZA 1GUFA 3PHGA 1LJ8A 4IS3A 3R0IA 2FR8A 1ONOA 5K0ZA 3DBLB 4DQUA 1BRMA 1O8CA 4GX0A 4NR0A 4CV0A 3HQ4O 4KUHA 2BHLA 4XZ3A 3BTOA 1HDYA 3FNEA 3MJTA 4NI5A 4HFJA 3RROA 3BZUA 4YAKA 3L9XA 3HADA 2EW8A 2P9GA 3JQAD 4NBRA 4BNGA 4DPMA 2Q2WA 3JQFC 3TL3A 4FSHA 1NQOA 1PJSA 2NACA 4R9RA 3WBBA 1HE4A 1U7TA 5HM8A 3OBBA 4IBOA 1H94A 4R3NA 2PD4A 4R4JA 2ZTVA 4URFA 4F6LA 3FR8A 2Q4BA 1T2FA 2X58A 4GMGA 4XIYA 3GMDA 2YYYA 1JKFA 2J3HA 2VRBA 2VUSA 4IDGA 2OORA 5ILOA 2G5CA 1YVEI 2X22A 4YEDA 5L9AA 2FSVA 4ZVVA 1I30A 2QIOA 2AQIA 5CEJA 3EDMA 3C7AA 3CMMA 2Q49A 3G1UA 4OH1A 4H7PA 1B7GO 3EW7A 4ND2A 2WTBA 1JKIA 4MVJE 3ENKA 3O03A 2FHSA 4MVJG 3EGOA 4DYDA 3WNVA 1DAOA 1JAXA 2FZEA 1UDCA 2O7SA 2X23A 4PZCA 3GLQA 4YBZA 3K92A 5EN4A 2W4QA 4J9VA 4GLLA 1TA4A 3NT4A 3OICA 3PHJA 4DREA 3AOEA 4DL9A 2BKAA 1LRLA 4KUGA 3ZW8A 4WLEA 3RUFA 4AJEA 4PLCA 1U2GA 1KBZA 4CR6A 1U2DA 4KOAA 3IUPA 4YJGB 3MEQA 1Y7TA 3OQ1A 1PGPA 1TVEA 5KVQA 3QIVA 3B70A 1LDGA 3H4VA 4HFRA 4IY1A 3ZU2A 5A3JA 2Y1OA 1GYRA 2X5KO 1H6DA 4MVJD 5B4UA 2J8ZA 3H5RA 3ZU5A 1GZ3A 5LDHA 4A2CA 4CLRA 1SCUA 4CJXA 4OJNA 1MFPA 3FD8A 3G17A 4XQEA 1E5LA 2BLLA 1RWBA 3WIDA 4E2WA 1MB4A 3HDHA 4LN1A 4CMKA 4WLFA 1E1NA 2O3SA 3DWFA 3INGA 3RC7A 3OQBA 4NFHA 4E31A 3IJRA 2EERA 3PLRA 3JQBA 3EAGA 5A06A 2ZK7A 1E7SA 5I9NA 1NR7A 1Z6ZA 5JW6A 1ARZA 1KEPA 5A3VA 1U28A 4CM8B 4K28A 1GEEA 3FNHA 3I52A 4FGWA 4A73A 3BHJA 3E1KA 2YW9A 8ADHA 1W4ZA 4AJLA 1EEHA 2NQTA 5KKAA 3U4IA 3DZFA 1ISHA 3U5TA 4Y6PA 1BW9B 2XXBA 3MOGA 4Z0PA 1N9GB 2GN6A 3TZCA 1QLJA 4XYGA 3VDRA 3TL2A 3PZBA 4YRDA 4BO9A 4GLOA 1W8DA 2OOSA 1BG6A 3H9GA 3KETA 5FFFA 4BOYA 4Z9XA 3ZNQA 3ETDA 4IMPA 4WEQA 4YAJA 1IZ9A 1HDXA 4MVJP 1YE3A 4MVJA 4WECA 4NPCA 4CMAA 3DBHA 5AOVA 5KJ1A 3GHYA 3ZCXA 1DRUA 3RJ9A 3F9IA 4FCCA 1ZFNA 4EUHA 2VWGA 5TNXA 1BVUA 3BMQA 5HTOA 4CLOA 2YV2A 4XWYA 2VQ3A 2P68A 1HT0A 1M6WA 1MUUA 3BMOB 1T4BA 1XSEA 5BNFA 4KWHA 2VRCD 5L7YA 2NU9A 3WX0A 4OQYA 5JCXA 2CDAA 3HJAA 4BNWA 1I10A 3BTUA 4M86A 1PS9A 3NUGA 3HFSA 4NHEA 4XB2A 5DBGA 1MP0A 1V9LA 4JBHA 3CMCO 4B3JA 2YDYA 5CPFA 3R3JA 1QG6A 2R6JA 4WCFA 4OGWA 5F1KA 2I3AA 2WSBA 1J4AA 4WOJA 4BIIA 4XKJA 4E5KA 1N1EA 3RC1A 4BNNA 3F46A 3GR6A 5G2OA 3SEFA 2HMUA 2WJPA 2C59A 7MDHA 1LEHA 4BV8A 4EDFA 3PHHA 1KVTA 1GPDG 1ZMTA 2IZ0A 2ZIZA 3D5QA 1ZSYA 1PGQA 1H0KA 2BGMA 5B4TA 2EJVA 1B8UA 1X7DA 4U0KA 5FYDA 1Y9EA 2PD6A 1V3TA 4CLOB 3JTMA 5L4SA 2Y1EA 4R1UA 2BFPA 1OZAA 3CPSA 3WG9A 5T5QA 5T8KC 4MP6A 3KOUA 4DLBA 1E5QA 4CMHA 3OP4A 1V0JA 4UREA 1JQBA 2Y67A 1HLPA 4MP3A 2V6GA 2Z95A 1Y6JA 5LC1A 3NKLA 1EVIA 2CFCA 1J6UA 1F8FA 4DIBA 3E18A 5U4QA 2BH9A 2NM0A 3AY7A 3L9WA 4L73A 1ISMA 1V35A 3AM4A 4E0BA 2DTXA 3PDJA 4YJHB 3MWDB 1LQTA 4H3VA 1BMDA 1A9ZA 2BELA 1HE5A 2QRLA 5MDHA 3EC7A 1LSJA 4J2HA 3UAGA 1YQGA 4LGVA 4AJJA 4XA8A 3UGKA 4RDHA 2VYVA 4WK6A 4NNJA 4UVIA 1U3VA 5CDGA 3ZZNA 1YWGO 4LISA 2WYWA 3KVOA 3U9LA 1N7GA 4XJSA 1NP3A 3VAZA 3OQ6A 4J43A 5BSFA 3VKUA 1PJLA 3JQ9A 1E6UA 4PG5A 3ETGA 2GLXA 1U4SA 2O3JA 1U3UA 2JJYA 2Q1WA 3ASUA 4OOEA 3S1LA 4C4OA 4ITUA 4GX1A 4W9NA 5ADHA 3Q11A 1C1XB 2ZTMA 3JYNA 2DVMA 4EJMA 4FFNA 1DIAA 1KVRA 3WLEA 3UF0A 4D44A 2QYTA 2PR2A 4XEHA 3TN7A 2V6BA 3RC2A 1K5HA 1RYEA 1HETA 3T7CA 3L6EA 4F46A 3GMSA 5BSEA 2EV9A 5C37A 1M76A 1PQPA 3WTCA 5IZCA 4J7XA 2Z1NA 3PHIA 1WP4A 4UEOA 4Z3DA 3A06A 1EK6A 3UCEA 3TFOA 1UXGA 3H5AA 3HB4X 1ENZA 4GPD1 4P8RA 2I67A 1C1DA 3CZRA 3VVCA 4S1VA 4IZHA 3HG7A 3Q3CA 2D4AA 2X0NA 5TIIA 4XR9A 4QO8A 1Q7BA 1Q0HA 2EG9A 1GQYA 3ZU3A 3WOHA 2ZCVA 4CQMA 2AQHA 5COBA 3WNQA 4NBUA 1E6EA 2NNLD 1LDEA 3F5SA 3BIOA 1P9LA 4WE3A 1KEVA 3MZ0A 4YT5A 3DB2A 4BB5A 5JY6A 4BGVA 2OBYA 3ENNA 4R51A 4I8XA 5CP8A 2O3QA 1B15A 3HDYA 3MJCA 3OEWA 3PEFA 3ADPA 3TF5A 1C0LA 3ZN2A 5B1YA 2HMSA 3GN2A 1SEVA 4XB1A 1BSVA 5HRUA 3OJLA 2VOJA 3DR3A 1XLTA 3A14A 1KY5A 1X14A 2J5QA 4ROSA 1H6AA 5JDIC 1IPFA 2VTDA 1O9BA 5ITWA 3TWOA 3W8DA 3C7CB 2DPGA 3H8VA 4EJ0A 3ZWPA 4J16A 4AJOA 1X7GA 1GV1A 2WE7A 3MWEB 3IKTA 1BW9A 1CWUA 3TJRA 3V2HA 4LMPA 1N7HA 2PNFA 1ISIA 3KYDA 3ZWWA 1VI2A 3U62A 4O6VA 1M75A 5IDYA 1XQ6A 4ALKA 3OF2A 3TRIA 2JFGA 1P1FA 5L40A 3ZWYA 3ONDA 2W2LA 3TOXA 3RSHA 1ENPA 1WAMA 2DBRA 1ISGA 4IDBA 4IXWA 3A1NA 1BGVA 3IKVA 4CV1A 1HYGA 2EP7A 4RQTA 2EHDA 1T2DA 4JBGA 4HWKA 3AI3A 4RF3A 5A9SA 4NMHA 4BS9A 2VNAA 1B2LA 1ORRA 1LDNA 1PJTA 5U9CA 2YFQA 2VCYA 4O59O 4IJVA 4RVSA 4EEXA 2HJRA 3NEPX 2HMVA 1EVJA 3IUSA 3T4XA 4I1IA 2Y1DA 4OO3A 5JDCA 4BKUA 1IHXA 2VZ0A 4LVCA 3ZNNA 4PRLA 1GL3A 2D1YA 2I3GA 4XQCA 4J1QA 3PXXA 1CQJA 3WYBA 1ZCJA 1GU7A 2CSUA 3SLKA 4RZHA 1DBVO 1GD1O 4HY3A 2DBQA 1UXKA 3VZRA 1EUZA 4RCVA 3HDJA 3F47A 1LSUA 1PX0A 3IP3A 4IINA 1FJHA 2G1UA 3U4CA 1XG5A 4RPGA 2EJWA 3BHMA 1LA2A 4PLFA 1A9YA 3ORFA 1L1FA 4RPLA 1HLDA 4PFJA 3RU9A 4KTTE 1IUKA 4CM7A 1K6IA 4KDEA 3H6KA 1E6WA 4E5YA 5I9LA 1ZSNA 2Y0CA 1P1KA 4IDCA 4F45A 2HKIA 3WGQA 4TSKA 5DDIP 3S2GA 3WLFA 1RYDA 3VPHA 3D64A 1X13A 2WD7A 3E5RA 4HNGA 1VL6A 4PLVA 3A4VA 3FPCA 4CM3A 2CNBA 1BXGA 5DCYA 3WJ7A 4D7AA 2DUWA 2Y1FA 3WICA 1E3JA 2BFAA 1MXHA 2FR0A 4WKGA 1EQ2A 2DAPA 4MVJI 3E82A 2AEMA 4B7XA 5A5EA 1GDHA 3L0DA 4FW8A 4A7PA 4AVYA 2ET6A 4DIOA 2AEJA 1R4NB 4WOKA 1JW9B 1ZK2A 1EUDA 1X15A 3IIEA 3B1FA 4UVGA 4XQGA 1C14A 2B37A 3A28A 3RD5A 1GUZA 3WFJA 2I99A 1X0VA 4HFMA 4LW8A 1V3VA 2D8AA 4B4UA 1ZXBA 1G1AA 1R66A 3GFGA 1DAPA 3LU1A 1PL8A 5GY7A 2NVUB 1XU7A 2YZ7A 1YB1A 2Y1GA 3X2FA 1N9GA 1UDAA 1V8BA 1JWAB 2GF2A 2VHVA 5CEEA 3I9NA 1NX6A 4E2XA 3I9JA 1NFRA 2GN4A 1UP4A 1GQQA 4UEJA 3GZ4A 1D3AA 5C5IA 5JNLA 2YV1A 1K89A 4QQRA 4DC1A 1R0KA 3DAFA 3RCBA 2G0TA 4WCDA 3ONFA 4MP8A 4QSMA 4BVAA 3I4CA 1ZNQO 2QYSA 1FXSA 1OBFO 2OGUA 4R1SA 2EWMA 1U3TA 2C7GA 4CODB 2IE0A 4YAGA 1UAYA 4I5EA 4ZQBA 1J5PA 1NWHA 1B8PA 2Y66A 5JAQA 1E3WA 3RU7A 3F6YA 4B3IA 4JGBA 4OQZA 3K30A 3WXBA 3RWBA 2BI7A 4D0RA 1I3LA 2ZB3A 3ICCA 3KLMX 5EQFA 3QVOA 4XGIA 2CY0A 4R1TA 3ULKA 4ZQEA 2WD8A 4QFDA 2EXXA 3I9MA 2AMFA 3I5MA 1DLJA 1VRWA 1ZBQA 5ENDA 5F1OA 1HL3A 4F6CA 5B12A 1I8TA 1RM4A 4XGKA 3ROQA 5IDQA 3Q9NA 4YYZA 2VHXA 3L4SO 3JQ7B 1DFIA 3DBRB 1X1EA 2BGKA 5COAA 2X5OA 1F17A 4L75A 4RO0A 4JP2A 1J0XO 4GKVA 1A71A 3IS3A 3DTYA 4LRTB 4GSKA 4HP8A 2BFMA 4OXNA 4JJFA 1GADO 3AFMA 4NQZA 3RVDA 5CG1A 2H1SA 4ND4A 2G82A 1YXMA 3DBVO 4IXTA 2I6TA 4Y98A 3LC2O 1AGNA 1E1LA 1LRKA 2IRWA 4DMMA 4MO2A 5FWNA 1YQDA 4OKNA 1FDTA 1P1JA 1FMCA 2JKVA 3PZRA 4B79A 1ZKMA 1ONNA 1QXSA 3KB6A 4E32A 3WYEA 3OHSX 4E33A 5I7FA 3BYZA 2X7HA 4PG7A 2I76A 4PLHA 3EZYA 2I5PO 4JXKA 4MKRA 3G0OA 1PIWA 5F21A 1O6ZA 3RJ5A 2O48X 1O5IA 3OEYA 3STHA 4XRRA 4R5MA 4B7CA 3QWIA 3QW2A 3K6JA 1F8GA 3CE6A 1PL6A 3HN7A 2OHXA 1AXGA 4RQUA 4RPHA 3GVIA 2JL1A 4YAIA 4CUZA 1HDZA 3LF2A 3B1KA 3TDKA 3OJFA 2PKQP 2GCGA 5TLSA 4OIMA 2BF7A 4PG8A 3DMTA 1WWKA 1IE3A 1B16A 2NWQA 3K2EA 1GFSA 3PGJA 5B4VA 1A7KA 1Y5MA 1ZIDA 4IQ8A 2EF1A 4OXYA 3ANNA 3ZWXA 3D7LA 1TT7A 3RFXA 1LLUA 1NBOA 4BNYA 1VE9A 5BT9A 3SBOA 1A4IA 3EK2A 1DJQA 2P5UA 3JQ6A 3SJUA 3SVTA 3ZU4A 1AHHA 3KYDB 5I9MA 4QECA 5A03A 5G4KA 3VPSA 4W7IA 4HKTA 4OXKA 4Y67A 4ALNA 1B14A 1VJTA 4J1TA 4XQ9A 3DMTC 4XDYA 5H81A 3IAHA 3GC6A 3UVEA 3IDSA 2ZATA 5KJCA 1H6CA 1T2EA 1IPEA 4J1SA 1WDLA 2BRUA 5C7IO 2EIHA 3CTMA 4ALJA 4JN6B 1NHWA 2P91A 1CQIA 2V7PA 3DZIA 3PLNA 3DZBA 3NTOA 1HZZA 3NX4A 3ZH2A 1NQAO 4PIVA 1PU2A 5IZCC 5DZSA 3MOIA 4YRAA 3LT2A 4AFNA 4MVJF 1RM5A 4ZD6A 4PGFA 1SB9A 1HRDA 2A35A 1NQ5A 3Q9UA 3QLJA 3VPGA 3AUAA 4WUVA 3UKOA 2B35A 3HZZA 1UZMA 3P2OA 1E0DA 2IXBA 5JXWA 1YKFA 4YJFA 4X54A 1WVGA 3F1LA 5L7TA 1BXGB 4IGEA 3OETA 4WJZA 1Z7EA 3QWBA 3WQQA 5K9ZA 1MC4A 4D3DA 1P31A 2WD7B 2O7QA 4CQMB 2Q45A 3FNFA 2UUPA 1MLDA 1VJ0A 1WDMA 9LDTA 3I4FA 5IDXA 4QX6A 3PJEA 3CIFA 4U0JA 1HDRA 4EGFA 5I7SA 4Q3BA 4BO8A 1Y5RA 4ESOA 3DBRA 4BKQA 2EW2A 3TFQA 1HE3A 4M55A 2NLOA 1NHGA 5JSFA 3LT4A 4LSWA 3GG2A 1SOVA 2CD9A 3DOOA 1E1MA 5L4LA 3OA2A 4XRGA 4OMUA 1UR5A 4J4TA 4BKRA 2VOEA 1DDOA 5C7LO 1EDZA 1LLQA 3HNPA 4UUOA 1GY8A 5T6BA 2GZ3A 2W8ZA 1ULUA 1QORA 3H3JA 2X9NA 3QY9A 3LVFO 1CDOA 3WGHA 5IZ4A 5G0VA 3WGIA 2NSDA 2R2GA 3VVBA 1LX6A 1P1IA 3U4HA 3DDNA 1YJ8A 3TZ6A 3BMCB 1WNTA 3MJEA 2J3KA 1FDWA 1PS0A 4AJIA 4PLTA 4FIZA 2NV6A 2UAGA 1GQ2A 1N1GA 1I24A 1QKIA 1MC5A 4XDZA 3GK3A 3WR5A 3E03A 2VWHA 2Y1CA 1AHIA 3OSUA
chains in the Genus database with same CATH superfamily
2DWCA 2DFDA 1YHZA 2UVPB 2WZDA 3ZCVA 1W25A 2JA1A 2QG9A 4AKTA 1KDTA 3UJ6A 4E5MA 4ES6A 1L1RA 3NHWA 3QGMA 3L7DA 1VHLA 2Z2YA 3PXUA 3OOHA 4PU0A 2D2VA 1C2YA 1KI4A 3F2VA 3LX5A 2V55B 4LIPD 4W6ZA 1L5NA 4DLWA 1ADFA 5L95A 2H2FA 2M6SA 4K9QA 3A37A 1TYDE 3AHIA 1U2ZA 3O4JA 5ITSA 1T3GA 5DP1A 1YL7A 1T5IA 3FCOA 3OQMA 3QOYA 2FN9A 4ZODA 4ZO4A 4JVLA 2O3RA 5ICFA 3EQZA 4L7QA 4HXEB 4S3MA 3DONA 3UN1A 1GWNA 2BZ1A 3BE5A 4DDHA 3TLCA 3RARA 2AV6A 3RV3A 2YOGA 1EK2A 5BN5A 2IXFA 2PRZA 3D1JA 3NHUA 4ALIA 1N2EA 3WIVA 1R0LA 4WKNA 5FEUA 4FFWA 3AVYA 1P2TA 3ZVNA 3QOWA 1ONSA 1WDTA 5KVVA 1ABFA 4YALA 2FPRA 2OD2A 4Q7MB 5JVDF 5IK2D 1X1DA 4RH1A 1AO3A 3H4MA 1P5RA 3V1UA 3G2NA 4JOSA 4EB8A 5GIPE 3QSGA 4GM4A 4NJMB 1AE1A 4YQYA 5K99A 1PN3A 3KBBA 1K0FA 3L7NA 4GSYA 4D99A 3HSKA 3RUPA 2PQ0A 2WHRA 5KYTA 2ZVDA 3Q2KA 3C85A 1OI7A 3COWA 4BNUA 4DXHA 1MAWA 2PBLA 3P45A 3Q7QA 5F7JA 3FLMA 2BM1A 2BEWA 5K05A 2H3HA 2VUIB 4UE2A 4AY2A 3RAPR 1JQEA 2H57A 4EA6A 4QYIA 3CF6R 3BF7A 4HN2A 2XMRA 4TLMB 2WTMA 3CCFA 3ND8A 4AZTA 4ZHSA 1Q0PA 2CBZA 5LQDA 1PFVA 2H65A 1BWSA 5ENVA 1BHSA 1W6UA 1PUXA 4Y1EA 1XAGA 2E4YA 3T3NA 4CT5A 3F5QA 4NG5A 4Y2GA 1DOHA 1J8YF 1V1MB 4MOWA 4Q4AB 3VQTA 4IKOA 3WSWA 2Q8QA 4HQRA 1MRSA 1CNMA 4GIBA 1QGUB 4K6OA 5ELMA 5HF5A 5LQSA 2A6PA 2H5EA 4G0YA 2B5OA 3RRZA 2LIPA 3QKTA 4BO6A 4BBJA 5LQKA 1GVHA 1E3QA 2GSWA 3EXFB 4RMNA 4TTAA 1W5SA 4IJWA 1KMHB 2Z6QA 1KC1A 1M6EX 1GR1A 1APBA 1AUQA 3F3YA 5IYZB 4IV5A 1J9EA 3L92A 4Z3KA 3OG9A 4GF5A 1X1SA 3NTUA 4QXQA 4B35A 10MHA 5K0SA 1QBKC 4IVRA 3JVDA 3OZEA 2Z2IA 3FFTA 4IFTA 2G72A 2PH7A 3DS8A 3E1SA 2WZBA 1KH2A 4PC7A 1Y3IA 1AK9A 2PZLA 3COSA 3DT9A 4RJTA 2JLUA 4I6JA 1YUMA 4RL6A 5B5SA 2A4MA 2ZB4A 4IJUA 5K2OA 4MEAA 2Q5EA 1KZ9A 3RLIA 2RKBA 2OD9A 5TV2A 4MAAA 2KB0A 3ZLTA 5CJPA 1ZUIA 4X62B 3U3XA 2ZFUA 3JYLA 1ADJA 4KBFA 2PBFA 4GC9A 2DPMA 3FVQA 3DEJA 2N42A 3GW8A 3NAGA 5AKEA 5TQVA 3DMRA 5E9WA 1UEIA 2QN6A 5LA6A 1TAUA 4OPMA 1V8FA 3VTFA 3D1VA 2HBQA 4ZGWA 2OTCA 4REOA 3R09A 4GXRA 4KZPA 2F1RA 1ZUNB 2ES4A 4XYEA 3QM1A 4I66A 3ZQUA 2A5LA 1OHHD 2Q1XA 3CX6A 3D0KA 4G63A 2H92A 1SA0B 3FJ1A 3BVPA 5FWXA 5KYUA 4KGZA 5GZ3A 2FCAA 1KC3A 3HYRA 3WGGA 5EJGA 4X7RA 1J1IA 1J25A 1OXSC 4J49A 1MTZA 1JYSA 1R4MB 1P2SA 2B99A 5KDOA 1E89A 4G07A 2M6LA 5KYKA 1UJMA 3RKSA 3LYLA 3P4UA 5FTWA 3CRRA 2P9FA 2PMWB 4M7PA 3F90A 3G9UA 3QKSA 1P72A 3C7TA 1JU4A 3KWLA 3TAXA 4Q9NA 3UW1A 4OHYA 2ZJ7A 4XDGA 3C39A 4PSAA 4I2NA 4B3BA 3QZUA 3KO8A 1C7EA 1V5IA 4HAYA 2QZPA 4DMLA 2GOYA 3KXLA 4QXAA 2FPWA 2UZ1A 2EP5A 2HXGA 3W2HA 3DR5A 1R7RA 5FOTA 3C1OA 5KNBA 2HRBA 2PSJA 1LI4A 2H6EA 3N07A 4H7FA 4MW7A 5K8TA 1XLTC 1UC9A 1IL0A 4RSMA 1PFKA 4U3JB 1I4EB 3A4MA 1BDBA 4JLMA 1EFVB 1R6VA 5JADA 1MJNA 5DN6A 1OI2A 4MI3A 4F38A 3U4DA 2RK3A 4YQFA 1FYWA 3RUIA 2D2IA 1KK1A 2Y68A 1W0JA 4EARA 3AP2A 4KYIB 3GRVA 1MV8A 5I7EA 3GLUA 2DR0A 2YWHA 1B0UA 3P9RA 3PJDA 3F5MA 3DMGA 4P3YA 4JI2B 4IG4A 1QP8A 1CZOA 4QVGA 1U5BB 4OKSA 3L7KA 3WAJA 1B4DA 2QTAA 3AP3A 3SOZA 2A9JA 5IP5A 2W0MA 4F12A 1N2SA 1DC5A 3EH2A 1SZDA 3SHWA 4Z49A 1ZVJA 3KYCA 1OLXA 4Z1OA 1EDDA 4DJAA 4DA8A 2XQFA 5T67A 1L1EA 1FPQA 1Z47A 3TFWA 4E3ZA 1T8WA 2P6PA 4HTFB 4V0MA 1LSSA 1SU4A 1CG6A 2C20A 2J0VA 2PGDA 3A25A 3Q3VA 3ZV4A 1A4XA 4AAYA 5DN6D 5HJ2A 4MKIA 3CB4A 1AB6A 1FTWA 1NI3A 4JBWA 1Z39A 4FEGA 1UFRA 4DA6A 2WTXA 5A02A 5KTRA 2J32A 1Q7EA 1G4HA 1LV8A 1DXYA 3ZW7A 1M1ZA 4EY4A 4E4RA 1L7NA 4O63O 1WPXA 4J0KA 3V2IA 2XXAA 7MHTA 5J40A 5CT9A 4ZRNA 3TMYA 1D1SA 2ZBPA 1F0PA 2Q4RA 1QE3A 3OIFA 4KLAA 4RU1A 1NYTA 4F2PA 5LA6F 5B1IA 1F14A 2H5LA 3P9KA 4KXQA 2WTAA 1SCDA 2BT4A 2FVYA 3BMQB 3CH6A 3CJRA 1ABBA 4CMIA 3CKMA 1Z0FA 3OIUA 5EJ9A 5J2UF 2D74A 3FCSB 3FPKA 4B8YA 1MO5A 3RAEC 1FNSA 4UBLA 3KJGA 3HVUA 5JSKA 2JIZA 7AT1A 4GP9A 2OM2A 5EVCA 1AU9A 2ETVA 2FRDA 3KAKA 2ZJ2A 4Q6WA 4ZAZA 5CFNA 3GELA 5FNVA 2V65A 4IIEA 1T3TA 1BJTA 2JJ1A 2QF7A 4PQFA 4ZO8A 3W5JA 5C5EA 2W2XA 2GZAA 4K88A 3W6NA 3EASA 5KYXB 2BCJQ 3AIKA 3C5CA 2GN8A 4KGXA 1KOLA 3B1YA 4DUGD 3JVVA 2XVYA 2HHHB 1GG2A 2C2YA 2EGGA 4UNSA 3HCOA 3WSVA 1ZSVA 4K9RA 3UENA 2QSUA 4EA7A 3NXSA 3R4CA 1K6JA 4C5AA 1BGWA 1Y1SA 2RJNA 2NTNA 2AJ8A 1PCXA 2C77A 3CLSC 3QKSB 2C97A 3GOHA 1C9JA 1TNDA 4JNCA 1NT2A 3DDZX 1ZNYA 2ZSJA 4L0CA 1VPDA 4BFZA 1ZK4A 5MGBA 2REQB 1YQTA 3PIRA 1RQNA 1EXWA 4EF5A 4KLRA 3UXYA 3MSXA 1JS1X 2AFVA 2PG3A 4NMLA 1VSQA 3ESYA 4RORA 3WGKA 5D1HA 5HS6A 5TPZA 3IUEA 1C29B 2J6HA 4N03A 5CRIA 5CW1A 5ADUS 3CR7A 4LJYA 4RQAA 2RKWA 3OBIA 1ZUNA 1EA7A 4UBKA 1P29A 3IUNA 1SHKA 4MMZB 4Z54A 3FYUA 2IOHA 4KQXA 3UAXA 4H9GA 2BSXA 4E12A 1XQ9A 2AXEA 2QE7D 3C74A 2G08A 4ECAA 1IRXA 5FL7D 3AF0A 3DHYA 2J0EA 3A1EA 4BQOA 5IBCA 4OB6A 1XLVA 2XRMA 4G5OA 1Z7GA 3GFBA 4OYYA 1J8DA 5AXBA 2YV3A 1SBYA 2AJLI 4EA8A 1OU4A 1D4OA 1W29A 2BGTA 1KAOA 4W7HA 4RLHA 1O87A 1KI8A 2WFAA 2MR5A 2HUPA 4U9HS 2B4YA 1Y7LA 2DX7A 1PR6A 4G1MB 4DUZB 3AUKA 5JQWA 2IYWA 4TGLA 2QDKA 5HBGA 3G49A 3IL2A 1E4YA 1XTPA 5GZ6A 2GO1A 3W9UA 4LRQA 5DHAA 1F8UA 3JQQA 4OSPA 4J2TA 2V7GA 1LUAA 1YI0A 4FOPA 2YMMA 3SZRA 4OVKA 1FLVA 4BU1A 4EGAA 4BDTA 4B3FX 3EXFA 4C4TA 4DSOA 2A1UA 3HJCA 1SKMA 1CK4A 1FDVA 1A50B 1QK5A 1E60A 1YQEA 2CLEB 2V9CA 4MW2A 4S0ZA 4V3BA 3QEMA 3UMVA 2JZCA 4YXWD 1CUYA 3U09A 3ZJUA 1X8JA 3KQWA 1EGMB 3O1JC 3N39C 4ZGGA 1NN5A 4KK4A 3AKDA 5IABA 3ZVMA 1X19A 2UYHA 2H31A 4W1PA 1V1MA 4JX8A 1QV7A 2C5HA 1A7JA 1XFDA 1W88A 4G0ZA 4L4XA 1E7YA 3FPHA 1X2BA 3QQ5A 4S0XA 3CV3A 4II7A 5D2CA 3V1YA 2ZWPA 4AICA 2FAXA 2XT0A 3B6ZA 3G23A 4C0KA 1YU9A 1J9GA 2P9CA 1NMZA 4MVWA 5K20A 5LIPA 4KR2A 1P0CA 4N0MA 1KARA 3GT0A 2VDKB 1E8MA 4QYIB 1JXOA 4GI3A 5L45A 5FI3A 5SYNA 2O2IA 2O4CA 1JB9A 1VA4A 3ZJTA 1OIXA 1ZJ4A 5J2UA 4YHBA 4V24A 3UY4A 3DKIA 4MTLA 4UVHA 1C50A 3TLGA 1GZ6A 3HYLA 1P4GA 3H7IA 3IESA 3WLNA 2IPAB 2C4WA 3N5KA 1LVUA 5BYJA 3Q4GA 1RKXA 2C2BA 2R65A 4ZEOA 5IAKA 3UXEA 2AWOA 3VUFA 4UTXA 5CFMA 3AR4A 4NJMA 2WA2A 1KDOA 4PE5B 1H65A 4BNVA 4FOTA 4KQ6A 3B48A 5G0WA 1ZI8A 2WF7A 3X1MA 2XRFA 3JV7A 1CUDA 5IARA 4P5EA 3QOXA 1V4NA 4FS3A 4JBLA 4XVRA 2GA9A 5DX0A 5IKOA 2BY4A 3ILYA 4LK3A 3ZTWA 3LYUA 3M4YA 4P4TA 3RYHA 2JAUA 1NVGA 5HZMA 4Z0TA 4PPFA 3JQCA 3AG5A 1SUIA 3SF8B 1M8GA 4D5GA 4FNMA 4E4TA 4IDEA 3DJYA 2EWVA 1PWHA 1O96A 1W75A 4L9WA 3UUWA 1RIFA 3CGWA 4MQ6A 4PLWA 4N5DA 4G4SP 2I66A 1GXSA 4ZVKA 5C1IA 4ANFA 2PUEA 1KY2A 1M0TA 4A8JA 3VU0A 2F1OA 5FUYA 2XMBA 2PH5A 1ZD9A 2FFQA 4UMDA 3RDPA 1SXJE 3L01A 3U7JA 4UZFA 1P2GA 4UBNA 1AV7A 1QSGA 4CM4A 3KKLA 1T1SA 4NFSA 2A2ZA 4BVLA 2XOKD 1KJZA 3EVZA 5EZSA 2QRQA 5BNZA 1QYRA 2BP7B 2UVPA 3DMFA 4G25A 1YKGA 1DAFA 2B69A 5EMLA 4P33A 2B8TA 3CUUA 1C41A 2J3LA 4BATA 4DMFA 4UHBA 4MA0A 2J0UB 3KHSA 4N3AA 1AMUA 1CQZA 4RXUA 2YIJA 1JFSA 1Z5VA 3HU5A 2O3UA 3P2IA 4MVJH 3A6EA 4UAGA 3VV3A 4C4XA 2M32A 3ND9A 4ND8A 4FFMA 3GOQA 3VBCA 5DIFA 1DKOA 4UBJA 2FK8A 4RFVA 3W6ZA 2W6OA 1QVZA 3G9QA 3WV4A 3F7TA 1QE5A 4O1IA 4PLGA 1N5MA 3GPIA 1PR3A 5HIAA 1D1TA 2MOKA 3QX3A 3HR7A 3R6GA 1H42A 4GW3A 5EMNA 4ZALA 1NY6A 5JVDB 4HH4A 1KK2A 1FNDA 4RH0A 4Y6LA 3PKJA 2NZYA 3W77A 1MA0A 3H11B 4QXMA 4MA4A 1KSGA 2A86A 2PZAA 1SXGA 1G5TA 4J3JA 2ZAGA 3HEMA 1MJGA 1IEQA 2QTNA 2CF6A 3W8EA 3BA1A 4DUPA 2B5WA 2OZPA 4RSHA 1A5AB 3E22A 1SIOA 4LKRA 2V74B 4R1QA 4RVUA 4YV0A 5JBIA 1AZLA 1SUBA 1CUUA 5AKZA 1QHIA 2JIZD 4ID9A 4AZ0A 5HMMA 3C43A 2Y0DA 3MHTA 4GBMA 4XR4A 2W43A 5CYPA 1LCIA 3V4FA 2GJAA 5AUOB 4R69A 3LXUX 4NBLA 2V7QA 3I6IA 4GX2A 1M2WA 2IP2A 4LUCA 2HYIC 1QC5A 1TK3A 3EOBI 1NE7A 3HWSA 2C8LA 3FKJA 2ZR8A 3OLCX 3IAM6 5KSYA 3SJZA 2WINI 2Q2QA 1LRJA 4Z4CA 2JF0A 2J46A 1EFKA 1MAHA 1BCSB 1RM0A 1TLTA 2Q9AA 3KNZA 2QRKA 3CW9A 1PQUA 1PJAA 3LZDA 3OC6A 4L51A 4Q3OA 4WCVA 5KX5B 3WIBA 3FZGA 3RTCA 3WYGA 1U8FO 4H3HB 3WXMA 1TCVA 1KK3A 1E3WB 2QTVB 2WI8A 4TT8A 2WV9A 3DQPA 5IVHA 4LBYA 2H16A 2H4YA 2YWCA 1CY0A 1SUWA 3GGPA 4H16A 1JVBA 1CU1A 3X44A 5IASA 2WJVA 5DPMA 2I6XA 2PKXA 4MIOA 1QQBA 3RIMA 3ZGYA 1PEKE 1MG5A 4C0JA 4US2R 4YAFA 1AA6A 3R9KA 4A27A 5KTNA 3JWEA 1O5TA 1CQIB 3R74A 1M5TA 4O4LF 3DPIA 2HNBA 1KVQA 3RAGA 3X1ZA 3KWMA 1ZUWA 3WL4A 3B9PA 1AA9A 3FWZA 5CXUA 5CVVA 1Q7GA 2P6MA 2Q4DA 5HGJA 4AJNA 3IEMA 4LZNA 1PZEA 2IA5A 2GBIA 1PZNA 3PEUA 4Q9AA 3EGVA 1O58A 4AMBA 4FOSA 4D57A 1Q21A 1PW7A 3OT4A 4DCOA 1SCBA 3T1QA 5AFSA 1JAHA 1O0CA 1ORHA 3WNDA 5IKPA 1M9NA 2RGAA 5C8YA 3RHZA 4JXZA 4YPOA 3TW6A 1R37A 1A27A 1IQRA 1QV6A 5KNDH 3NWOA 1CZNA 2XOEA 1CF9A 1L4FA 2BMEA 2CMDA 1VB5A 1YRLA 3OFSA 4KRYA 1T36A 1ECJA 1V7CA 1T35A 2W11A 3AIOA 3G2QA 1P9OA 5EZQA 4A8HA 1P1BA 4LBWA 4PIMA 3COZA 3SEZA 4YDSA 2XWPA 1KZ6A 3N28A 3FFXA 3DPUA 4K8OA 1UIRA 2QN9A 1THMA 3CRZA 3GRZA 3URMA 1E7MA 1WKCA 1BFUA 2G28A 4KUEA 4UFNA 1TMKA 3GFQA 4HRAA 1O1YA 3N05A 2UYYA 1YZLA 1D5WA 4L50A 4GVXA 4O2AA 4ZYZA 5LDGA 4D8UA 2XVAA 1WIWA 4FFRA 1U7OA 3TLGB 5KWJA 4QEKA 2RE8A 2TMDA 5BPHA 3WHKA 2W70A 3UK7A 1P5JA 1IY8A 1L7DA 3KZ1E 1JMVA 3RIXA 2V8BA 3H86A 5JZSA 1CS4C 1DIBA 1KI2A 1LPBB 1NTOA 1WPGA 2L0XA 4JJGA 4P82A 3DQZA 3J81A 1MEJA 4KQ9A 5ERYA 1KMQA 4J03A 3QLUA 5F1PA 1YQXA 2W2TA 3TLBA 1ZZGA 2BHNA 1KJWA 5DTJA 3A6DA 4K1XA 1TUGA 1Y8RB 2OT3B 2PT9A 3LL7A 4K9SA 4OH7A 3RLFA 4FN5A 3PXGA 2YN4A 4DVJA 2XE6A 3E0XA 3ME5A 3TECE 2WU8A 3A10A 3GJRA 2CUTA 3ZOZA 5TS3A 4J29A 2W22A 1TJNA 3CH5A 3DL2A 4LXTA 3ZWNA 5HZHA 1TCAA 1O4WA 1Y4AE 2FLVA 3DZGA 1KY4A 5EIXA 3I62A 2FP3A 2ADMA 4Z3OA 3LBHA 2F6RA 3CVYA 3ADCA 2NTJA 4BMXA 3ST7A 2IELA 4CLXA 1CQJB 2P5TB 3Q0EA 1QRSA 1AQLA 2IYQA 4CLHA 3GFOA 2Q27A 5AXDA 2YUTA 2X4GA 2AW3A 4JSYA 3HS3A 1Z0SA 3K4PA 5G4LA 5A6SB 2VPQA 1QCDA 1CR2A 5EXTA 1G3MA 1RM3A 5NULA 5JAIA 2VYCA 1KHTA 2HF7A 3QNMA 2R47A 4MUYA 1FB5A 3MQFA 1KVSA 3GROA 4EIWA 3IDFA 4PRZA 4A26A 1JTVA 4Q15A 2ZBFA 1NVUQ 2MSKA 2NYRA 3H6GA 4XD7A 1ACLA 4B3XA 1GUBA 4TKLA 1UP7A 4RVHA 3W5AA 5B55A 1SBCA 5EMKA 2J31A 2GI4A 3B8HA 3UOWA 1VG1A 3QEAZ 2UUOA 4KFSA 2P6NA 4GGPA 4UM7A 4Y2SA 4QVKA 4GBJA 1T9KA 2M2IA 4I0WB 1ES9A 2A92A 2PU5A 1RQ2A 2ZJYA 4QJ5A 5IJZA 4LQ4A 3G1WA 3S2YA 4UFPA 3E84A 2REQA 1BEEA 5JAPA 4LFBB 1H5UA 3KZVA 1T5TA 4V39A 2AF4C 1JG1A 7GPBA 2ZJBA 3L8MA 2YJ4A 3I5YA 2PX4A 3PC7A 1W0KD 5L8VA 2J3QA 4RKYA 4B0PA 5AUQA 1CZLA 1OROA 1P0FA 2CVPA 2PN1A 3L7AA 3V4VB 4D4KA 1XNRB 2YC2C 2N3ZA 1L5FA 4K26A 1UM9B 4HSGA 3TOVA 1YONA 2UYGA 4QUAA 1N6NA 3HZHA 1HYBA 1JT2A 4Y8VA 5E7MA 5FI5A 3R3UA 3V34A 1I2MA 3E9RA 2ZKLA 1SG0A 4YCDA 5DGXA 2BKXA 1EUDB 2Q8NA 3HCRA 2Y0BA 4X60A 4Q9LA 2FPGA 3NYWA 4QLOA 1R4NA 2GPJA 2O5RA 5FTKA 3SXPA 1E9CA 4CG1A 4QICA 2IEIA 5EP3A 3TG2A 2UXDB 4TN1A 4R6WA 1DBWA 3DTNA 1NTRA 4KIGA 2PH1A 2FRVA 4K9NA 1BMTA 2F1KA 3VHXA 3VI4B 3KB1A 3OZCA 3WA6A 4C3ZA 5A5VA 1OLOA 3RF6A 4K1LA 5HUHA 3NJRA 4QO7A 5LBIA 1VGVA 3E2PA 4NCXA 3ZC3A 1FRVA 1YJQA 2CJWB 2G3YA 1ECGA 4LNUB 3TD2A 5K0GA 3KAPA 2WSMA 3VPBA 3GZNA 1XYYA 1W5BA 4XVUA 3S8YA 2DG2A 5FV4A 1E1QD 1G1MA 3MTGA 4OM7A 3ZDQA 2ZUEA 5BVHA 2GR9A 1UM8A 2WIFA 3NHSA 4ER6A 1O77A 5FV7A 4DLNA 1VLHA 2D0PB 1WLSA 3RASA 4KXNA 3UB2A 2ICAA 4UUMA 3JATB 1Q5PA 1ZM9A 1NP7A 1WLYA 2OV1A 2ZJ1A 3ZDAA 1XO1A 3CSUA 3GH3A 4Q4JA 4ARSA 4NBWA 1O97C 1KBOA 1QG2A 4FHFA 2Z30A 5THKA 1L4LA 3ZE7A 2VJPA 4D43A 2QS9A 1NSYA 3N0TA 3OAAA 4I5IA 2FP4A 3GBVA 2PRYA 1AH2A 4NBVA 4XGQA 4UUNA 3VC7A 1A69A 2OPBA 3V8NA 3G5UA 4DNXA 1SHUX 3PEEA 4XVHA 1I6KA 4DB4A 3EZLA 4BRSA 4BO0A 3DEKA 4G67A 3IVRA 3TMKA 4NYIQ 2W6ID 3V8VA 5DNAA 4EW3A 1D0IA 4ISBA 5BWBA 3K5PA 3HEBA 3TLMA 3HE3A 4CVNA 5H3LA 4IGAA 4CETA 3UKDA 4FIDA 2G4CA 5FWDA 2D3TA 2VNSA 3D81A 3JQFA 3T7EA 2I2WA 4FB5A 1U8XX 2BTEA 5HOQA 6ADHA 3A0UA 1GLNA 3GJ8A 5EQDA 3UG7A 4EVIA 5IAGA 2VYNA 3CC8A 5IKXA 1JDBC 1UBEA 4LAFA 5BRJA 1I6MA 1YUBA 4B4OA 3GUCA 2GFIA 4WA7A 5AJXA 3WHPA 3WNCA 1KYWA 2LTAA 2VH2A 3EOAI 5B64A 4ZI5A 4A15A 4PTLA 3WWZA 5ALEA 5CDHA 3D3QA 1T0UA 3L07A 5G41A 3TB4A 4MWTA 2RI1A 2AN1A 1GFZA 4RTPA 2ZRBA 4ZHQA 2XXJA 3GCZA 3TCKA 1W4BA 1TA0A 4WGGA 4M38A 1ZZEA 2WE8A 2V7VA 4MQMA 3U3KA 3KLNA 2VDLB 4DCGA 1NIJA 1ZRNA 3CZMA 3IDAA 1AF7A 3GEPA 3KOWA 3P0JA 4HH3C 3B1JA 1QR6A 3N0WA 4CM4B 3T1HB 4P0QB 2VK1A 3VMMA 5EY5B 2QUBA 3ER8A 3EE6A 2V03A 3QU4A 3G8YA 3PQEA 5AW8A 2WNSA 3OOEA 4L3VA 3LKVA 3I83A 1CQWA 2IGBA 2IPNA 3QP9A 5GJCA 2VPTA 1EDBA 2H29A 3WGVA 1E1KA 3CG0A 3O1HB 5LMNB 1NDHA 4E2YA 5KOHA 5KYUB 2XEDA 2BOVA 2C78A 2GVDC 5I51A 1NVWQ 1IWBB 1KZGB 4O0LA 4PX2A 3THRA 3CEAA 3UJ7A 5C32A 3HLKA 3QKRB 3NH6A 4JVSB 3K96A 3KWJA 1RBQA 3DV0B 2WMYA 1MRZA 1XVTA 4FD2A 4IOMA 4JELA 3WYFA 3L8DA 4PAOA 3GEEA 2H5IA 3M5PA 5CA1A 4K9MA 2NU8A 1V5GA 2O20A 3W79A 2E82A 4BO3A 4BNHA 1J06A 4RM3A 2MR6A 4JEIA 4F7WA 1OX6A 6YASA 3IAUA 1Y1KE 2MTBA 2WUGA 5EUCA 4ZEWA 1G21E 1K0UA 1SAYA 3DUFB 4AJ4A 3SVZA 1S8OA 2VP5A 5KWEA 2OKGA 3MGCA 2XZLA 1MH1A 5LLTA 2CNKA 3EXHC 3RFTA 5LSAA 1FXWF 3VPXA 4E94A 1GZUA 4TWAA 2KYRA 3QBJA 1WQ4A 3KVRA 3IQEA 2RI0A 3H84A 4LGCA 2WWVD 1VPVA 3T3PB 2ZRQA 1QYXA 5TMEA 4I14A 3HYSA 1CQXA 1NU8A 4CF7A 1G17A 2Q3JA 3V4RA 2E5WA 3FB4A 3IR7A 4IIFA 4BFUA 3HVIA 4JV5B 1N32B 5KIAA 2OHIA 1ZDMA 3AUFA 3HKDA 5DW3A 2FOIA 5AJUA 2JHCA 3QXCA 3RYTC 3A9TA 1O54A 1XB2A 2FGJA 2YICA 4M8KA 4MEBA 4R9VA 5EHQA 2XA1A 1DBQA 2EGHA 4RTOA 1A8IA 1T4MA 4OTZA 1UUFA 4INJA 1E8NA 1NLMA 2XQJA 1M1YE 4WN9A 5DNWA 1T5OA 5DXFA 1CUWA 3TRDA 1W48A 1P4JA 3LMKA 1YR6A 3X1WA 3BTSA 2QT9A 3AUYA 1A8PA 3H05A 4O02B 4EK9A 3I2KA 2JIPA 3S28A 3WYCA 1ZD3A 2OFXA 3HXMA 1SELA 4UUAA 1K7XB 1QZ3A 2HK9A 1CUAA 5LJLA 1WZEA 4E5NA 5BVGA 4W7SA 3IVGA 4L8YA 3IXQA 2IV3A 1ZY2A 8ATCA 2NSLA 4E5PA 3BRSA 1FDIA 2I1LA 4ZRMA 3AX6A 4PCAA 1X38A 1TI7A 2DSTA 4C3OB 1D8TA 3FDIA 1WTAA 3JVIA 4CW7A 4YX9A 4D6YA 2OFWA 3I9KA 4WZ6A 4LVNA 3R6DA 4JJAA 3UPDA 4G6ZA 2SKEA 2V58A 5FWYB 2JHGA 1VG9B 3FYUB 1U0LA 4P2BA 5EIHA 4H7JA 1XKLA 1GAWA 2QNRA 4KO3S 1U2EA 2AOTA 4KQ1A 3QQPA 2Z1MA 1CJMA 1NVMB 1VI6A 4RA9A 4BJ6A 4CM9D 4D92A 5B1SA 1XHFA 2CF5A 4HDSB 3BL5A 4UZSA 1YK0A 2GBCA 2A3NA 1XJQA 3R5FA 1PF7E 4R1NA 5EXXA 5L51A 4KQKA 1DIOB 2VF2A 2IS6A 2OZEA 2DTEA 1THGA 1R6BX 3K16A 3AVOA 4I9HA 4WT7A 3S1AA 5DLQC 3ZD8A 5JRZA 1R10A 5D8DA 4NV3A 3C5HA 3TUIC 4CUJA 4WIAA 2CNLA 3HHPA 5EIEA 1WUHS 2OCDA 1WQ3A 3SI7A 1TUBB 2XNKA 3AFHA 2H85A 5SV2A 1AO0A 2R8ZA 4BNIA 3GRRA 4E11A 3EQ9A 3CNBA 3HYNA 5HDQA 3PNBA 2AFHA 4ABTA 2HFKA 3B1ZA 4QFMA 3IBTA 5FLEX 2O8EB 3HO8A 2BCEA 2GNOA 5FB3A 1SC6A 1ORDA 1OIWA 4GI7A 4RTKA 1KJNA 1LNZA 5ELXA 1XZKA 3DAOA 1PR9A 3RWMB 5CA1F 1QMGA 4FHGA 3HV0A 3EZ2A 3D6JA 5M29A 1ZR4A 5J1TB 4JLPA 1AQYA 1TADA 2D4HA 2IF0A 2XR1A 2JDIA 1TU3A 3IC5A 3PNVA 1WG8A 1MQ8B 2JG3A 3ZLVA 4TQGA 4DILA 2J0SA 4PV7A 1OT5A 1WPQA 3OP1A 1T2VA 2WUDA 1GPMA 1UZUA 1YBHA 1V8DA 4KMRA 3EXEA 1G6KA 3LPLA 4BC0A 16PKA 4TS3A 2HCFA 1AZTA 2FR8C 2PWBA 4ZI7A 2HIMA 1NRJB 4TKVA 5CAEA 1HFEL 2HSJA 2PQ2A 1KYZA 1CPYA 2EKPA 4O1MA 4G5YA 4A6PA 5CDTA 1PNVA 4DJDC 4G5HA 3TIGA 2FN7A 2DEUA 4BGDA 1OXBB 2XA2A 2QLTA 1GOTA 2XD4A 5J3JA 1XCMA 4M0LA 1ID1A 3UQYS 3NXKA 4B6JA 1VPLA 2C2HA 3SC6A 1H8EA 2BRUC 5CCXA 2I87A 4QJBA 2W93A 1NYLA 2J0QA 1Z6QA 2FKAA 2XYHA 1OBHA 4PGGA 4R8RA 2GXAA 2PUFA 1RRVA 2QX9A 2JD0A 3EAFA 2GNPA 4MR8A 5DHQA 5IJ0B 3IEIA 5LU8A 4PZ9A 1JFVA 4RLSA 1PR0A 2ODNA 3UHPA 3AKEA 4ED9A 5AVQA 3GDFA 3FOEC 1NNI1 3PNKA 2KI5A 1U9YA 2E5LB 3EXIB 2NTYC 2BJWA 4HNAB 4F71A 3E3LA 3PA8A 3QRWA 2FUKA 3VHXB 1OCEA 2RHCA 1U2RA 4DIFA 1MNQA 1OYVA 4LX0A 3DZHA 1AKRA 3HVJA 4Y1GA 2ZXFA 3JWIA 2QRHA 1DTSA 4ZYTA 3HFJA 4LHEA 4KYVA 3HA2A 4MUNA 3BGDA 2XH8A 2C4MA 4C7KA 2BFBA 1JHPA 1QG0A 1PE0A 1PEAA 4P3KA 2R1ZA 3N7UA 1HE1C 4IXDA 2YMPA 2VHQA 1E2PA 5F98A 3HKBB 2N47A 3ZHBA 1R0ZA 2ODWA 1PEDA 2POCA 2QNIA 2ZREA 3FE2A 3LSTA 2P6OA 3AV0B 5DNVA 2D3WA 2H9IA 1QANA 2E3JA 3O9MA 4G0VA 5CCEA 4INPA 2QDXA 4EKGA 4KAJA 3AP1A 2P7IA 4G65A 1XWFA 2YNMA 5FPQA 5K8LA 1HDEA 4UATA 1R0SA 4UW9A 1U31A 5CLIA 1COZA 1ISRA 2MSNA 1HLFA 4NABA 2FEXA 5CHEA 2Z5VA 2Q0QA 4UKDA 5FFMA 1CDEA 2ZWAA 4XARA 1BTOA 1BMFA 2YDXA 3AFNA 3QVXA 4JL5A 3O8QB 1R4MA 1VHJA 1S8FA 2OAGA 4ZARA 4FINA 2JLXA 1HNWB 2PLRA 5EE3A 2E6UX 4YMSA 4YJKA 3TZBA 5BQXA 2WMDA 2XIJA 3VPDA 4AP6A 3U7RA 5IH7A 4UAUA 4YRLA 2PS9A 4QGHA 1PK9A 1V25A 3N75A 4DNOA 1HX7A 1X74A 3MELA 4YQEA 2WP8J 3G2LA 2HZ7A 1YR1A 4WCFC 3PDHA 1OC2A 1Z73A 4KIWA 4MS1B 1TUEA 4ZMBA 1Z0DA 2IPLA 2BMFA 4Q1DA 2DUNA 1OGYA 2F1HA 2OE2A 3FPBA 2FSPA 4MR9A 3NWBA 1TVCA 1XZ8A 2CXPA 2PZJA 3Q3HA 3O2SB 1EFCA 4KV7A 3E3OA 9GPBA 4ZPJA 2YMLA 3R23A 5FHRA 3F73A 4UHDA 3BAZA 4I9UA 4RVCA 1R12A 3AOEC 2YFHA 1YJCA 2XCIA 1Z2CA 5BW6B 4EYOA 1P9NA 3BDAA 4B0OA 1N2HA 1R88A 3I04A 3TLZA 3ZHSA 5HX7A 4RXTA 1H8HA 4BGUA 2CK3D 3EWNA 3NEYA 5EHGA 1ZIYA 5LXTF 4EYKA 1UKZA 3IFSA 3RUAA 4HWGA 4Q1FA 4WK0B 4EQZA 4QOEA 1UCFA 1P3JA 3IT3A 5AH0A 5I7HA 5REQB 4JGGA 4KDFA 1ZICA 1ODKA 2Z2XA 1EJ0A 2Q5CA 3F67A 1M2JA 4IG9A 2C58A 2CB0A 3EVAA 4Z99A 3RU2A 3ITNA 2CFRA 5KWIA 2ZIXB 3HACA 5J4VA 2ZS8A 3PNPA 4G9EA 2B7BA 4GWLA 4PRKA 4ZZ3A 2E85A 5JS7A 4JLOA 1QGUA 2HCTA 2P41A 3CZAA 4PLPA 4PAGA 5E6SB 1NZDA 2OAQ1 4RS4A 1DAIA 1OAAA 2GBLC 2MHCA 4MWZA 5C9ZA 1LZKA 3ET5A 3BZBA 1N8SA 1J23A 1Y8RA 2F7SA 4XJXA 1ZAYA 3N7TA 4P22A 3KT3A 3R1IA 4TMXA 4IMRA 1Z5GA 3H5LA 5KWVA 2RG7A 1KS9A 4J91A 3WJAA 2Q2NA 3FTPA 4IPTA 2W2LD 4YI5A 4BQNA 1UOPA 1CJUC 5F35A 3S2ZA 1E3SA 4DSZA 3AR7A 4P92A 4QWWA 4KQJA 1DWOA 3AI7A 3Q2OA 1WDKA 3WGMA 4D79A 2C3YA 3DVAA 4TMFA 4Y1FA 4EW2A 1L9KA 5C4MA 2X3UA 2HT1A 5KYYA 3BK1A 2G9ZA 1XKXA 3T9BA 5L53A 4Y3UA 3AV3A 4YP0A 3DLHA 2OVBA 2PA0A 4L9RA 3H17A 4KYTA 3BFKA 3D7KA 3AW9A 3PYMA 5EMMA 3OTOB 3IBFA 1MENA 1O08A 2Q1SA 2XF8A 3NTLA 2YS6A 2ZG6A 3NGLA 4F93B 1GR0A 2B36A 3JZFA 3GGJA 2R44A 4YP5A 2VSFA 5G4KB 3RT7A 1MB9A 4RF2A 4BV3A 4JJ8A 4S1PA 5AOAA 5JNUA 1PQ4A 2XD9A 3O73A 3BC1A 4PLYA 3ZEAA 1Q7RA 1Y6RA 2ZIGA 5ALYA 4G56A 5EZ6B 1JTEA 1V96A 4LRSB 2DPXA 2BR4A 2W8BB 1OVMA 2Z3ZA 1RYHA 3JWHA 3PNMA 5AKIA 1NA5A 4DCCA 4QGFA 2Q21A 3R7BA 4YV7A 3WGOA 1PHRA 3QG5A 3RYIB 3GJ0A 5TSDA 1XYVA 1XELA 2IIPA 4TSRA 4WHMA 3DEZA 5DSXA 2W83A 1SZJG 3KD2A 3QPCA 3KP1A 3DHNA 4FC7A 2V7BA 4LKOA 1PSDA 3GNTA 5E4JA 4JLSA 5TX7A 2IHVA 4AYWA 5CB0A 2XAUA 3H1GA 2ONKA 3B1VA 4PNPA 3F5DA 4MGHA 3TNLA 1BA3A 4NEHB 3VZSA 3F96A 1CRWG 1H5QA 2I33A 2D2EA 1X3LA 1MCZA 2QPOA 1TEHA 1F51E 2CUZA 2C5BA 2R6HA 3SBDA 1CJCA 2ZUSA 4L5IA 3CURA 3IMEA 4B4UA 4X3OA 2FHPA 5JH7B 2E37A 1MX3A 1Z82A 1KNQA 1YSCA 2MYNA 2VUTA 4KXLA 3WL6A 4EFNA 1Y9ZA 3DXFA 2AOUB 4ODIA 1NPYA 1ENOA 3FSGD 4M7RA 4LY9A 1NJ6A 4GI2A 2PGLA 3OM9A 5DTIA 3VR3D 4BLWA 2O6LA 2AEFA 3Q3GE 3MTJA 2R6AA 1LDYA 4TZTA 4BZWA 5F5NA 2ONCA 1OY1A 3JQ8B 4OQNA 4IJ5A 5FLKA 1GL6A 3ILXA 3SM3A 3A3NA 1XHLA 4PYRA 5DM0A 1PBTA 1TQ8A 2NO1A 4RS3A 5GMOA 1YJAA 4DR4B 2FMKA 3MIIA 4F11A 1V3UA 4G81A 3GLHB 3O4RA 1N2XA 4GL4A 4P86A 1FFSA 2A5DA 2KBEA 4D3FA 4ERXA 1NM5A 3V7UA 3M6WA 4WINA 5CCBA 3E2MA 1JYEA 3NYQA 1QHHA 1TEVA 2L18A 2JGJA 1OE0A 3ZLJA 1EDOA 1DIHA 3WRWA 2XVMA 1HR0B 4OK3A 5DSZA 3HDGA 3ZE6A 1FA9A 3D3WA 5BYAA 4HTAA 4KFUA 4GXTA 1ZN2A 1ZGBA 3ORSA 3PYLA 2UZIR 3VKHA 2IV7A 3I6YA 3SU8A 4DJTA 5HR5A 4LHYA 1BE6A 2QTHA 1Y1PA 2XUPA 1WW8A 3ZZTA 1S7CA 5HFNA 2NV2B 1H9BA 4KK3A 4DRYA 1AK1A 1XCJA 5AVTA 1GZ4A 4HI0E 5LP6B 5E2IA 4YAWA 1SIBE 5BSKA 3FWNA 1VSVA 2AFHE 5HK9A 2ZR0A 4RJLA 3P7MA 4Q16A 2B4RO 2FB9A 1Q1GA 2EL7A 2YRWA 3IVXA 3K1YA 2XGMA 4JITA 2I2XB 3EBOA 5EWLA 4CKYA 2QM3A 2X6QA 3JVUA 5FTNA 4LCEA 4TV9B 3D8HA 3THSA 4K9OA 3W7BA 2CXOA 3LGXA 3O74A 1YS7A 2H1OA 2ZT7A 1RNLA 5FBKA 3VO1A 4P0TA 5DI3A 5FLYA 3ZD9A 1Q77A 3I73A 2G1AA 4AWBA 2BBWA 4MW5A 4BJ3A 4A0SA 1CJBA 2G4VA 2AX4A 5ICSA 2COUA 3Q7PA 3TTTA 2BCGY 3KU4A 4EYGA 1MJ5A 1GUFA 3LNCA 3K53A 4MWSA 4RJ2A 4NAHA 1LJ8A 5AI6A 5HKKA 3R0IA 1K88A 2FR8A 3AL3A 4A4DA 4ZIRA 4AS1A 2YUIA 3DBLB 3RTEA 1O8CA 4GX0A 4CV0A 2HSEA 3S44A 1VIYA 4PGAA 3ZJYA 1XMSA 2VEDA 3KDSE 3BTOA 1HDYA 1LB1B 3PPVA 1XV5A 1XAHA 1DNPA 3DCNA 3EJ6A 3KJXA 1FFGA 2QQFA 3HADA 4QJIA 3BBLA 2P9GA 3K09C 3JQAD 3K9BA 4DPMA 4DQKA 2Q2WA 3NU1A 3TL3A 1RCTE 3U4QA 2FSUA 3BREA 4CIXA 4MDFA <