1KO8A

Crystal structure of gluconate kinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
172
structure length
172
Chain Sequence
TTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLKARKGHFFKTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Gluconate kinase
publication title Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
total genus 58
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2001-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ko8A00
5F98A 1JECA 3FMOB 1US8B 2PX0A 3AV0B 2IXGA 3UKDA 1MRSA 1EWRA 3U60B 1CF4A 2BEJA 2G83A 5FBWB 2VP2A 1GOTA 5FBRB 1PLKA 4R2IA 2OXRA 5FOUA 3QPUA 3E1SA 1AGRA 2FFHA 5KSZA 2J7PA 3OESA 3GJXC 1RW4A 2QP4A 5JWHA 1XD9A 3DKVA 1FX0A 5A0FA 2NO0A 3DMDA 1G3MA 4B71A 4B3XA 1D2NA 1LS6A 2NPFA 1YZTA 2DHRA 3V00A 2PLFA 2CDNA 1OKKA 1XXHE 2OCYC 1T3SA 2QMHA 2JIZA 2OV2A 2X2EA 4C30A 1ELOA 1UADA 3K1JA 4OKSA 4FI3C 5TY0A 4TL6A 2LCFA 2EYQA 2IYTA 1BOFA 2F1IA 5EUMA 1KDTA 3AVWA 3HJNA 4GP7A 3KTAA 2ZE7A 4TLCA 4X8OA 3UATA 4D26A 2QORA 3MD0A 2VSFA 4LHWA 5IK2A 2ATXA 2QGZA 3FMFA 2F55A 3TQFA 1R0WA 2J0SA 1YHNA 3TJZA 1Z3IX 5FTKA 1J8MF 4NZYA 3ZQJA 4BE7B 2ODNA 4OL0A 1JQLB 1KI1A 1TADA 5GJCA 5TXGA 3ZVRA 1W0KA 3C4JA 1LF5A 2GXUA 2R2AA 3W8NA 3AVXA 3IPXA 3HU1A 2VSOA 2A5JA 3P27A 1KMHA 2D4HA 3U3JA 3GP8A 2P6RA 4BFWA 3P4XA 1FX0B 4LYJA 1Z6AA 4GMXA 1QZXA 4WXPA 5KDDA 2P6NA 2WKRA 1EESA 5FTLA 3A4MA 4QKQA 4HEJA 3R7WA 4ASUD 2WSSA 3U3KA 1GWNA 2WOJA 4D4KA 5HE8A 1BKDR 4A82A 4HUTA 4V0MA 2GCNA 4B32A 3NTUA 3U7HB 4MH0R 4W5HA 5DISB 2YWGA 3GFTA 4IFBA 1G3UA 3THYA 1OFTA 2R8RA 4PAMA 1KK1A 1QVAA 4ON9A 2GKSA 4BQSA 2GF9A 3KTAB 4TQAA 4ZDJA 4CZ2A 3BFKA 4L4UA 3ZVNA 3NEJA 3QPWA 4JBWA 2IUUA 5B30A 3OFNA 3BOSA 4XVUA 3PJRA 1YR7A 4HDOB 4JLJA 4IRUB 2C9OA 3PG5A 3QKRA 2OUKA 2HDNB 1DAMA 1SXJE 2IEYA 2ZROA 3RS7A 4EQ6A 4KFSA 2GF0A 1KMHB 4GZLA 5K8TA 4A15A 2ATVA 4IEEA 3PITA 2J0QA 4EPYA 5G53C 1VG9B 2FU5C 5FPSA 1KIMA 1CP2A 3K9LA 1M1YE 4LJ5A 3NH6A 4TTRA 1DG3A 4RZ2A 2O8BA 4D6PA 3TUZC 2PZEA 5DH9A 1FZQA 3BXZA 2WJVA 3ND8A 3QXJA 4M9ZA 3ZIAD 4XD7A 4AIIA 5K8LA 3ADBA 2E9SA 5FOXA 4R2HA 1GL9B 2VEDA 2P5TB 2OBNA 3GEHA 1SKYE 4PO9A 1NN5A 2G88A 5DN6A 3TH5A 3F0TA 3K8YA 5EP3A 1SXJD 3QVVA 4JLKA 4Z1MD 4NKRA 4PX9A 1XU4A 5B64A 4IXNA 2IHBA 4GZMA 3X1XA 1N6OA 1VCOA 4BFTA 3HU2A 4XSGA 2GJ8A 5FFMA 2V3CC 1ZM9A 4DCTA 2JJ1D 2Q9CA 5FUYA 1U0LA 4Q1FA 3KKMA 4PZLA 2QRZA 3QKRB 4WBSA 3UANA 5TV2A 3GFPA 4EQ6B 2O8FA 3QOFA 3ZVMA 3PEUA 1GM5A 1BO6A 3NXSA 4AD8A 3MMPA 4DVGA 4R71A 1O87A 1VPLA 1A2KC 2ZSAA 2HEIA 4O0MA 2YC2C 3IBGA 2ZITA 4IOKA 1NMYA 1FPMA 2BKEA 5SZJA 2F3TA 5JHHB 4ZDWA 3O8RA 2AHOA 1EWQA 2O8BB 2J41A 1AZTA 1UEIA 3QXXA 3BB1A 2WAXA 2F7SA 2XZPA 4MRRA 1GIAA 4FMCF 1TNDA 5SZIA 4JBXA 1D5CA 2AWOA 4KHZA 1JAHA 2CNWD 4MITA 4O3MA 2XNDA 1CRPA 1NY6A 2G6BA 1UEJA 3AGQA 4U00A 2B8WA 2V1XA 621PA 5HKKA 1YRAA 2QA5A 4XTCS 3W5JA 2O52A 3NBXX 5GVRA 1MKYA 1N6HA 1RRPA 3FVQA 4Q47A 2WWWA 4HAVA 3MWYW 3O8CA 1DBSA 1L8QA 3PUZA 4CIDA 4HLCA 1W0JD 2W2VA 2VHJA 3HDTA 2FEOA 3B6EA 4A1FA 4KYUA 2VTKA 1ZD9A 4QNRA 4JZKA 2WJGA 4RZ3A 2MSDB 2VSXA 5AWFC 1GKYA 1KKLA 2BEKA 2VO1A 1E1QA 2WWXA 4OHWA 2AWNA 4JYBA 1P2UA 1ZP6A 1HURA 2BJVA 2PJZA 2ZRAA 1FTSA 5F9FA 5FBLB 5GJVC 5DHAA 3U4QA 2VLIA 2YVUA 1E2IA 2BMFA 1X8JA 3B1XA 1YZLA 3K0FB 1WBDA 4MYHA 5KDOA 1G4AE 1AK2A 2YINC 2Z43A 3VQTA 1K8RA 2RGGA 2XJ4A 2YZ2A 2XITA 4M1KA 4BUJA 1YZUA 3QSYA 1UKVY 3CLVA 2BBOA 4D2IA 2ZRCA 1RRGA 1U9IA 3UMSA 3W8RA 1XB2A 3FKQA 5E7IA 3I72A 4QOSA 2ZI4A 1R0XA 5C4MA 4IEIA 3EA5A 5G3YA 1NLZA 1QRAA 3VKHA 1XCGB 1E9FA 2QMUA 4US0R 3GLIE 3QG1A 3AQ4A 4TYQA 4YMUA 1SQ5A 1E0JA 2WPDA 4GFDA 4JIMA 3U4QB 2IA5A 4EPWA 5CITA 2REBA 2GK6A 1ZBDA 5EXSA 2BCGY 2D62A 2NPIA 2F9MA 4DDVA 2Z4RA 2PEZA 2HYIC 2GXQA 4JVSB 3EIHA 4LYFA 3CWZA 2BIFA 4DLWA 4NHOA 1KI2A 3CX6A 3LX5A 4X8MA 4DCVA 4C0KA 2FX3A 2PEYA 4DC9A 1UKZA 4UXHA 1JXMA 4N0DA 1ZM4A 2ZI9A 3G82C 3K9HA 4MYTA 1E2MA 4QFMA 3LX8A 3KQLA 5TMPA 3I92A 3AVQA 3F5FA 1F2UA 3AF1A 3FE2A 1GSIA 3KQUA 1Q0UA 1U8ZA 2QAGC 4FCTA 1BH2A 1W36C 4CVNA 5LD2C 4LYAA 2CHGA 3W6NA 3X1ZA 2EFHB 3QF4A 1KJYA 1A7JA 5F9HA 2P6UA 1IOZA 1KK3A 5FI1B 1E2EA 2X1VA 2BMDA 4AYXA 1G3QA 4PQFA 3H84A 2JEOA 4BZPA 1OSNA 1XXHB 4Q5IA 2P3SA 1XTSA 1EFTA 3AVPA 3FHOA 4DSUA 3RHFA 3WHLA 3KB1A 4JT2A 4OBEA 2WHXA 2RGAA 1VDZA 1ZM3A 2VHUA 4PHHA 1ZUNB 5JJKA 4A92A 3CNOA 1MR3F 1OLOA 1WQ1R 2ZS8A 1KDPA 2OG2A 2VF7A 5EE3A 4URXR 2ZJBA 5KNBA 2ZSDA 3T1QA 2GBLA 5FTJA 3ZIAA 4ITRC 1A2BA 1EX7A 1KZ7B 2ZI7A 1NN3A 4EPTA 5FPKA 1OH7A 1CXZA 1RJ9A 4ABYA 4QNMA 1CJMA 4MGIR 1F2UB 2QENA 5EZ5A 3PEYA 1AM4D 2WICA 5H8WA 5H1YA 2AX4A 3X1DA 1W49A 5TVKA 3SS8A 3KL4A 3O8DA 2BDTA 2RAPA 3QF4B 3T15A 3OAAD 2GJAA 1LNZA 4TZ6A 2ZVPX 2CE7A 3L2OB 3Q7QA 2JJ1A 4PPNA 5BYJA 3U3MA 3Q9LA 3VKGA 1W44A 3WYAA 2GJKA 3KDSE 1E6CA 3EIQA 1G8GA 4B73A 1ZIPA 1RKBA 1XRJA 2GA8A 3UPUA 3D3QA 2EFEB 2ZRMA 4TMKA 4JSTA 1VTKA 1CULC 3S1AA 3SOPA 5FOSA 2C2HA 2MSEB 3W6OA 1W4RA 1E9AA 1N5JA 3ADKA 4KLNA 2OCPA 1XBTA 2IS1A 1YZQA 3SBEA 1IXRC 3WMEA 1G7SA 1D8TA 5L8VA 4MDEA 3G0HA 1M6NA 1RJ9B 4C0AC 2ZJAA 4HDCA 4D0NA 2CNWA 2OBLA 1E2JA 3BC1A 4EJSA 4HATA 4LPSA 3EC1A 2XGJA 1T91A 5J4KA 5HTKA 4CW7A 1QHHA 5KSOA 2C95A 1JI0A 4DBLC 3CF0A 5C46F 4KSBA 1OYYA 3I3SR 3QEOA 1CIPA 5JWOA 2J9RA 5JFGA 1G20E 1YVDA 1E2LA 4ZIRA 1W0JA 4IVQA 2O8CB 3ONWA 1Q1BA 5GJWC 3CPEA 2WWHA 4MRVA 4B2LA 5HCIA 2XNSA 1SKYB 2IYWA 3S1AB 4UKDA 4A0HA 1ZRHA 5C2JB 1XPRA 4QHSA 1BYUA 2C77A 2FPLA 2R62A 3A36A 4LHVA 3NG1A 1FTNA 4A2WA 1ZD8A 4KAXA 3RRYA 3LLMA 2WBLC 2VP6A 4Q19A 2H16A 4B6EA 4DSTA 2HXSA 3SYLA 4RD0A 1BMFD 1QG2A 4EJSB 5TB5A 1NKTA 1SKQA 2Q3MA 3W3ZB 4B76A 3KXLA 3Q3JB 4DWJA 4DEYA 2CCJA 1U8YA 5CJ2A 3GJ7A 1QHHB 4D0LB 1SVOA 3FHCB 1TAGA 1L7VC 4A9AA 1IAQA 1OXSC 1WF3A 3EPHA 3MWJA 4PC2A 2YV5A 3CRVA 4LRWA 1LB1B 2VBCA 2QPAA 4GBMA 1Q1EA 1DARA 4ZIRB 1E9RA 2O0HA 2ODWA 1E1RA 1U98A 2ZJ5A 1LV7A 2QEQA 3R8FA 2CBZA 3WXMA 4JT4A 1OXXK 3L0OA 4OQNA 2N46A 2QTHA 1W2HA 3SQXA 1CU1A 4I81A 1KSFX 1HQYE 4A6PA 5B58C 5AUOB 5KU1A 2GESA 4FXPA 2LKCA 1OKKD 1HE8B 1KO5A 1AZSC 1KY3A 2JIZD 1Z83A 3MJHA 4C3ZA 5BYKA 2AXNA 3DVLA 4PSAA 4UJ3A 4FCVA 4JLMA 5B2ZA 4FMDF 4EAQA 1XEWY 1Z6TA 3IO3A 2NZ8A 1ZCAA 5UKDA 1RFLA 2WWGA 1P4SA 2ZYWX 1OFIA 2NG1A 4C7OA 3QI2A 1E2QA 4V0ME 1MOZA 3E2IA 3ZYCA 1AS3A 3HWSA 1ZUIA 1AKEA 2D7CA 3IUYA 3R9WA 3UK6A 1T3HA 4JLDA 4KU4A 5J4YA 1UPTA 1S1CA 1EK0A 4LJ8A 4D4JA 2KSQA 4B3CA 3B13B 3FPAA 3A4NA 3V4RA 1XTJA 4R9UC 1N5IA 5FPHA 3I5XA 1YJ5A 2GVDC 1R7RA 1G8YA 4GOKA 2R6CA 2WSSD 2W6JD 3B5JA 3EA0A 1FMJA 2REXB 2JDID 5LDDC 4TMXA 2ZRJA 4TL7A 5LBIA 2F1HA 4POAA 2W58A 4MGYR 3SNHA 4L9SA 2JATA 4LWZA 3QG5A 3U44A 2Q3HA 2BJWA 3ZS8A 2K5UA 5EQTA 1EFHA 2H57A 1AIPA 2JCSA 4Q1BA 4QM7A 1OT3A 4FCWA 4C7OB 3PENA 4IVPA 1T5LA 1S4QA 2XAUA 3SJZA 5H70A 1T3LA 1U94A 3ZGXA 4LHXA 5DYIA 4GOJA 4TTQA 1CBUA 3DZ8A 3PFIA 4HDQB 3GLIB 4DB2A 4TSFD 4IKEA 1RIFA 3AVOA 5J4HA 1XMSA 3T5GA 4NYMR 2D2EA 4YONB 3GCGA 3P1JA 1KI3A 2WZQA 4MUAA 2PCLA 421PA 3WYGA 1W46A 1N6PA 1GRRA 4OQMA 4RCYA 3U7FB 1OB2A 5ELXA 2DY1A 3OAAA 4MKIA 3NHAA 1YZKA 4AURA 2CK3A 3AKDA 3P20A 5BN3A 2O8DA 1NSFA 3SDZA 2GZAA 1LTQA 1N0UA 4JS0A 3DMNA 4HAUA 4W5JA 1SHZA 1E4VA 1NP6A 5SZHB 1Q3TA 3ZZTA 1ZNYA 3U44B 2EW1A 1GNRA 2WAYA 4KVAA 5FR1A 4C0HA 1FP6A 1OIXA 5G41A 4FIDA 4FMCB 5JECA 1E79D 1Z29A 4Q7LA 2FN4A 1KI6A 2QAJA 2OT3B 1JJ7A 2VP5A 4ACAA 1DELA 1IN8A 5DI9A 2R44A 2HLDA 4DDTA 2ZSEA 2CLDX 3GQBA 3K0AA 4N1AA 2J3EA 2BC9A 3VU9A 1MO3A 5FBVB 2ZYTX 3M4YA 3PUYA 3OE7A 2OCAA 1ZYUA 5EE0A 2IYSA 4AG6A 1OF1A 4A2QA 4CEJA 4EUNA 4B2PA 1R4AA 1TPZA 1RRCA 2O8DB 4GSYA 3I1FA 1F3OA 3N2EA 4K46A 5CDFA 3WHKA 1G8HA 3EXAA 4DXAA 3VKWA 4HLUA 1COWD 4W9MC 2XEXA 2Q9AA 4M53A 3F8TA 1GZSA 4UJ5A 4B44A 1B23P 4URYR 5EE5B 3T5DA 2EFGA 4GRAA 3CNNA 4IFEA 1IHUA 3BH0A 4Q4AA 3UXMA 4G0NA 4EFMA 2EFDB 1KI6B 1B0UA 1ZU5A 5FPTA 3RSOA 1TQ4A 4TT3D 2ZE8A 4JLBA 2PCJA 4RFSA 4US1R 3RAPR 2XXAA 3ZD6A 4KSCA 2WMOB 1NMXA 3K0AB 1BMFA 4L9WA 2GCOA 3VU9B 5BWMA 4G5SA 3PXGA 2H5EA 3KUCA 4NCIA 2XTMA 4P31A 1FW6A 4NONA 2O8EA 4RVCA 1S3GA 2A2ZA 3TRFA 4TMWA 4QHTA 1GTVA 1VIYA 3TQCA 4ZI2A 4JJKA 4CEJB 3AVTA 3TAHA 2UZIR 5AJVB 2QPTA 4TYNA 5BXQC 2JJ8A 1E1QD 3LW7A 3V9PA 3QY0A 5JEDA 3PUXA 3SU8A 1Y3AA 1GRNA 3W5IA 4YMTA 1U9IC 1NBMA 2RHDA 3CPJB 4HZUA 1FOEB 3EX7C 1VCMA 1EX6A 2F6RA 4P4UA 3GEEA 1VYTA 4Z51A 1MV5A 4LV5B 3FDIA 5KO2A 2ZQ5A 4M1OA 4NCNA 1XCMA 3L0IB 3OEHD 4WXRA 1BS1A 2H8KA 5EP4A 2HUPA 4NU0A 4Q4AB 2FPKA 2Q6TA 5JI2E 3U7EB 4DKXA 1G8FA 1KNQA 2XXAB 4PPQA 4GMDA 1Q21A 2ZUCA 1E2DA 4PPGA 4O2RA 4IOLA 2GCOB 4UQOA 3W9YA 5KNCA 4NYMQ 3BAFA 6Q21A 5CLLA 4F93B 1E96A 2IXEA 3D6TB 5AJYA 1VG0B 4FWIB 4AY2A 2O8EB 4XWKA 2HYDA 5FOVA 2L0XA 2HT1A 1G41A 2WSMA 2GAAA 3T34A 3LXRA 1XMIA 4LHYA 3BFXA 3DOFA 4Q1CA 4V03A 5HR5A 3U3OA 3CR7A 3CUEF 3KKPA 5FI0B 3SQWA 2C98A 1X8LA 1OH8A 1S1MA 1E4YA 2WPDD 2B7CA 2B6HA 3ZDQA 1JR6A 4LZZA 3RRZA 1R5BA 2N1BA 1J7KA 1GG2A 3EW9A 4HZUB 3T1OA 3LQRA 4Q1EA 4QGHA 3BIFA 2ANBA 3C15C 2W6JA 1TTTA 3THWA 2G0NA 1OYWA 1TQDA 2BM1A 2J5XA 2JDIA 4G5QA 1XEFA 2OXCA 1LFDB 1RC8A 4Q21A 2F43A 2A5DA 4A0FA 4KI0A 4TMVA 1AS0A 1JXOA 2AXPA 3Q5DA 4CF7A 1Z0AA 1E99A 3X1WA 3EPJA 2VA8A 4LJYA 3REFA 2R6GA 4MA4A 4XH9B 1I4TD 3CX7A 1VECA 1ODFA 3T12A 4LJ7A 3FTQA 4DT1A 5G40A 3LBHA 5CYOA 2W6ID 4XWAA 1XDBA 2GBLC 4TSFA 2JLZA 1KDOA 221PA 2FJUA 2I3BA 4U02A 3B1WA 4PQRA 2WM9B 4DDUA 2NTYC 1E2PA 4PO1A 4AKEA 4B74A 1SXJC 1DO2A 1ZMXA 4NE2A 3R7WB 1KAOA 3MGCA 5CYPA 5AUPB 3UWKA 3IEUA 3THWB 4Q4LA 3R9XA 3HR8A 3VFDA 3U2QA 1C4OA 3C16C 3AF0A 3P32A 2F43B 2ZR0A 1Q44A 3K53A 4IDNA 3THXA 1NSTA 5A5GA 1RYFA 1AQYA 2QT1A 4C2TA 1KSJA 4LC1A 1UKEA 1SULA 4OYHA 2X8AA 3VR3A 1YR9A 3IEVA 4AKHA 3ZLJA 1IJFA 1KI4A 4IW3B 3GEIA 1QHSA 4H1VA 1E79A 1IN7A 1SHKA 4PTLA 4M1WA 1CS4C 5DO9A 2JLWA 2TMKA 4JKYA 3L0SA 4OQLA 4Q66C 2ZU0C 2E1RA 3IIJA 1ZW6A 2G3YA 1U0JA 2QROA 3WRXC 3LBIA 1QG4A 1SVLA 2ZRHA 1DO0A 2FOLA 3ZJYA 2ZJZA 1ONBA 2QTFA 4M1MA 5IRCD 3B1VA 4TL8A 3WP1B 3QXSA 3I5YA 1OFUX 3PQCA 4EJSC 2ZTSA 4Q9IA 2V6JA 4GNKA 1YR8A 4HAWA 4ERNA 4Q18A 3H4MA 3ADCA 1W5TA 3KFVA 4Q9JA 3AB3A 5BQ5A 1CLUA 4L15A 1G6HA 2P65A 4HYYA 4C9BA 5KPJA 1JB1A 1ZINA 2ORIA 3THXB 2HXYA 2PJRA 3AKEA 4F92B 4X8LA 1COWA 2W2TA 2DFNA 5M04A 3TK1A 2C99A 4BLSA 3BFVA 3KFXA 2V1UA 1ZNZA 4Y0AA 2HF8A 5L3RA 3X2SA 1N5LA 2JLQA 1W2GA 2XTZA 3P26A 5DLQC 2WOOA 2GXAA 4A4DA 2FV8A 2FSFA 3B1YA 2JLSA 4EFLA 3THYB 4TT3A 4ARZA 4DLTA 1N6KA 3K09C 2A7QA 2BWJA 4ESVA 1R0ZA 1GFIA 4V0LA 2F1JA 1TU3A 2LWIA 5L3SA 2FEMA 3CWQA 2O8FB 4IDPA 4OQFA 1G7RA 2QU8A 4C0QC 4CDGA 5EP2A 4HAYA 4Q03A 1FNMA 4MGZR 4A36A 4LJ6A 3T06B 1WXQA 2QE7A 4A0RA 3TW8B 4NCJA 4NBSA 1M7GA 2BM0A 2X19A 4ZDKA 4EPVA 4NPHA 2ZE6A 4RZUA 1NI3A 4TYYA 1R6BX 1XPOA 3Q8XB 3L43A 3P4YA 3MCAA 4URWR 1A82A 2JAQA 3RSLA 2XB4A 2R9VA 3KJGA 3E70C 3IIMA 2OE2A 2GZHA 2VP0A 2REOA 4URZR 1E2HA 3EZFA 3QKSA 2ZVQX 4GOXA 1XMJA 1XWIA 1Z0DA 2CHQA 1JEDA 4MRNA 1U0HC 2ZETA 3OEHA 1KJWA 4FMDB 1M8PA 2YNMA 3WNCA 2IF0A 3BWDD 2XX3A 4TN1A 3UIEA 1RYHA 1XCPA 2HV8A 1Z07A 5IF9A 1NNEA 2DR3A 3NEYA 4JJZA 3BE4A 3KKOA 4WVFA 5FL7A 3BS4A 1CR0A 1DAGA 5L3SB 3MWLA 1XJ0A 4EIWA 4F7WA 3GLGA 1Z08A 1E1RD 2BBSA 3T1VA 3MAAC 5J5CA 4RSGA 4BFUA 2XSZD 2XB2A 3VR6A 4YMVA 1Z0IA 3AP2A 4MYUA 1HV8A 5TDHA 1HY3A 2RCNA 2Q3FA 1PUJA 2IYVA 3LVQE 5J4LA 1I2DA 5FPYA 1QHNA 3B8HA 1WE2A 5CJPA 5AUQA 5HZHA 1ESNA 4OHZA 3RC3A 4OI1A 4IXMA 3AF2A 2D74A 2FSIA 3FYHA 4UNRA 1TF7A 4EKDA 5D3MA 2ZAOA 1RRFA 2BKUA 1G9XA 2IS6A 1GL7A 4M4SA 1KNXA 3ZS9A 1G19A 2OLJA 4N3NA 2BV3A 4ZO4A 521PA 2ZJOA 3RS5A 3SEAA 3LBNA 2YWFA 1NMZA 2BMEA 1HEIA 5EXXA 2G1JA 4D0GA 4U7DA 3LD9A 3GLGB 4TZ0A 1GNPA 4DLVA 4F38A 3WBJA 1WB9A 3KXKA 2JLVA 4IJMA 2VF8A 4AI6A 2W6IA 4KVGA 3I73A 3BGWA 2ZREA 3FWYA 3MWKA 4DEXA 4D81A 3Q7PA 4W7SA 4LPKA 2BVNA 3ZD7A 1W5SA 3FKSA 4LC0A 1OH6A 1EFUA 1N6NA 5ANRB 1OPXA 1ZAKA 1JJVA 2RGNA 3CF6R 3HYTA 4LBVA 5JJIA 1XZQA 3M6AA 1Z8FA 1IY2A 5KUTA 4I99A 4LOAA 2ZJ2A 4Q00A 1RPZA 3NBFA 2QBYA 3GJ4A 3SBDA 3CR8A 1SVMA 4YXWA 4PHGA 2WTUA 5F2EA 4MKHA 5EJEA 1P5ZB 3W34A 1UBCA 2J87A 3CH5A 1AN0A 4DIDA 3ASYA 1NIPA 1T5IA 3ND9A 4RZXA 3SC3A 2IX3A 1ZNXA 5EXTA 1E9CA 3NHBA 1SVIA 3I8XA 4YC7A 2G0TA 2FWRA 3VR2A 2GJ9A 1ZJ6A 3EZ2A 5J40A 2A5FA 4DLRA 1P62B 3H2YA 1KSGA 1W4CA 2AD5A 3SJCA 2BCJQ 4NYIR 3A1WA 1G3RA 1DVRA 2KE5A 2CXXA 4TWZA 1CRQA 3WNDA 4B3DA 4BLTA 1XEWX 5JMTA 2ZJYA 1GP2A 1CKEA 1KDRA 2CK3D 2GDJA 2A9KA 3K0CC 4QGAA 2AKAB 4QBGB 1E69A 2ODBA 1XZPA 2NO6A 3HPRA 5DE3A 4Q02A 2C5LA 4XJXA 1X1RA 5AJXA 1DAEA 5FUVA 2QBYB 4B3FX 1VG1A 2BBTA 2FSHA 3B60A 4V0NA 5JHGB 1FFHA 1F2TA 2NZJA 4NTZA 5CDFE 1XJQA 3GMTA 2QM8A 5JS7A 1BIFA 1S9DA 2C96A 1HA3A 1CEEA 4P4SA 2IF2A 2RGCA 2HLDD 4QBIA 1E2FA 2RH5A 3SFZA 2XZOA 1R0YA 1V43A 3Q85A 3CF2A 2RGDA 1FQJA 1P75A 1Z6GA 2ZANA 4HLUC 3REGA 3CONA 3OE7D 4G5OA 1GAJA 4LJAA 3AH8A 4I1SA 5AR1A 3DPUA 2XTNA 1K6MA 5KSPA 3I62A 3VHXA 1XTRA 2QSZA 3B85A 3KKNA 4G1UC 4HB3A 2F3RA 1TMKA 3AUYA 3BRWD 2ZRLA 3DHWC 4HLQB 1U99A 1ZVQA 3G5UA 5HZKA 4UNPA 2IS4A 1TL7C 3ZH9B 2EVWX 2ZRKA 4DCSA 4NYJR 4PC3A 4LSGA 3LRPA 3THOA 3CO5A 3VR1A 4I1UA 1XTKA 5FH9A 2IYLD 1EGAA 1F2TB 3PV0A 2G9NA 4JLPA 4TLDA 5IT5A 3TVTA 2WIAA 1II9A 2QPOA 3RRMA 2C9CA 1AQUA 4CEHA 4JLOA 2A5YB 1KO1A 1NBME 3KJHA 3LNCA 4P4SB 3VHLB 1Z47A 2WVJA 2CL6X 1HUQA 1MH1A 1MO5A 2QP9X 3NWJA 3H0KA 1GKIA 3PUVA 3I61A 2LKDA 4RD1A 5K8UA 2PLRA 1G5PA 4M2LA 3N5CA 3WY9A 4Q7JB 1NVXQ 1F6BA 2ZRFA 2GILA 3EPLA 1KO7A 4QM6A 2ZI5A 4QJ3A 3IKJA 3CNLA 2J45A 2V8OA 4UNSA 1LW7A 5B57C 2O5VA 5KSYA 4OI4A 5DSZA 2X2FA 1NBMD 2V6IA 5AJZA 3K9NA 4B6FA 2XSZA 3QUSA 1NY5A 4AKIA 3LLUA 2QNRA 2C78A 1YE8A 2ZIAA 4ZCMA 1KMQA 3GLFA 5EE9A 3UMRA 3N2IA 2GETA 1CJUC 1ZIOA 1HTWA 4E22A 4LYHA 1OB5A 2GJSA 3R20A 4URVR 4OJKA 1TUEA 1U90A 4E09A 3EWAA 4Q9HA 3ICEA 2ASEA 3DOEA 4ZI3A 3FHTA 2ZAMA 4UXJA 2NOAA 4B75A 2OFWA 3K70D 2RGXA 1Q20A 3OIWA 4NYIQ 2C9YA 2ORWA 2CCGA 2GEUA 2ZYVX 3RRNA 3W6PA 1KOFA 4D25A 4LV6A 2ERYA 2R65A 3PUWA 4JLAA 4NMMA 2C03A 3IO5A 2NQ2C 1KYIA 1II0A 2P2LA 1JAIA 4DCNA 3QXCA 2G1KA 3M1IA 1SZPA 1IONA 2OM2A 3BH6A 3WRYC 3B2EA 5AJWA 2FMXA 3PR1A 2ZUBA 4C0JA 4OHYA 1FL9A 2A30A 2EFCB 1DAKA 2IC5A 1J2JA 3GLFB 4QJ5A 2CE2X 2J0VA 2YC4C 1VYVA 3TSZA 3CPHA 3ETLA 4P0TA 5JSZA 2GVZC 2VQSA 3DKPA 3NDPA 3AEZA 4BFYA 1K5GA 2IWRA 4DLSA 2ONKA 5C4GB 1HQCA 5E7MA 2N42A 3QBVA 3RNLA 5EXPA 2BBWA 1CTQA 1C1YA 3GLHE 2WKQA 1KGDA 2J59A 2BOVA 3N70A 4J0QA 4PPFA 2NO7A 4FWTA 4I4LA 4DIEA 4PQYA 3L8YA 1M74A 3I4LA 1IN6A 3QEJA 3TMKA 5HPYB 3Q5EA 1NN1A 3KQKA 4HUQA 2I1QA 2H1LA 2IYRA 1S3SA 3QXHA 4KBGA 4Q01A 3DDCA 1L4YA 5EUQB 3PIRA 2GZDA 2P5SA 2QM7A 4XTRA 5L3VA 4NYJQ 2QAGA 1TX4B 2FE4A 4WAUA 3KQNA 3ECCA 2HCJB 3B1ZA 1D6JA 2IK8A 2J7KA 1W4BA 3VX4A 1QHYA 1JR3A 4P3YA 2WV9A 3TSOA 2VIIA 2AKYA 5JSZB 1P9NA 1MRNA 1XMVA 1NL3A 2EWWA 1P3JA 3OIVA 1N5KA 4JL5A 3RS2A 3DM5A 4AKGA 2JASA 2QT0A 2CVFA 4MKGA 3SYNA 1XJCA 1ZUHA 1Z2AA 2DWOA 4PC1A 1D9ZA 3K9GA 5DIFA 4KO8A 2GHIA 3EZ7A 4BFXA 3B9QA 1N6RA 1YQTA 2ZU6A 4KYIB 3C14C 3CW2A 5DNYB 3PEVA 3OZXA 3KJEA 2SHKA 5GADl 3AVUA 1NLYA 4HUQB 4PANA 2J46A 1N0WA 1FUKA 3F3YA 3GFOA 2IYUA 2P67A 4Z8YA 3IDQA 1W48A 3GPLA 2Z83A 3CZPA 5IHPA 4PFSA 1YR6A 1OHHD 4K8OA 4RD3A 1Z0KA 4NL4H 4G5RA 3O47A 4HAXA 2AN9A 5HE9A 5KPDA 3CRRA 4I1OA 2R6FA 3KKQA 3MG9A 4O25A 4TYWA 1JNYA 3UMFA 4BLPA 4P32A 2G77B 2ZPTX 4BLQA 3T35A 4DRZA 1J70A 2W0SA 3FMIA 4LJ9A 4BGDA 1Y63A 3TIFA 1XPUA 1KKMA 1YRBA 2CLSA 4RD2A 4DLXA 1G16A 4KFUA 2F1RA 3A1UA 3TGPA 3BB4A 1PV4A 2FNAA 1MO6A 3IILA 2JLUA 1G1MA 1GVNB 2FFQA 2WWIA 3J81k 3TLXA 2IYYA 3CZQA 5DGXA 1T0HB 1T8TA 1VG8A 2OILA 2QSYA 1TEVA 4PZZA 3QKUA 4RD4A 2DB3A 1R5NA 1X3SA 2OFOA 2CJWA 4G3XA 1H8HA 2UZ3A 3MFYA 4V0OA 2NO1A 5JCZA 1KI9A 3TUIC 2ZJ8A 2PMKA 1VHLA 2QE7D 4O2LA 5P21A 2KB0A 3X1YA 1GDDA 2Z5FA 5CM8B 4EFNA 4AYWA 4AC9A 2EYUA 4W5WA 2GEVA 3BB3A 4IOJA 3WMGA 2IXFA 2ZRPA 3GLGE 2WJHA 3ZZUA 3NKVA 1K5DA 3MRSA 4B34A 4QC2A 2PMDA 1WRBA 1ESMA 3IQXA 1N0VC 1G4UR 1JPJA 4ILEA 1PZNA 1ZC3A 4EDHA 4OJQA 4WZBE 1G7TA 1XNJA 4JVMA 1NIJA 1KHTA 2NIPA 3D31A 4WZ6A 2W83A 4TLAA 4DLYA 4RFSB 5JRZA 2MMCA 1GRQA 2GCPA 2Y8EA 4BEJA 2O0KA 4PSVA 1JPNA 3EAQA 3PVSA 5FL7D 4M9SA 3ZZ0A 2CJWB 1II8A 2DCUA 2F9LA 1X8KA 5E3HA 1G17A 3AF3A 3MLEA 4ZDIA 3DEFA 5KYKA 2AFIE 2FSGA 5E4FA 1QHGA 2QN6A 5CIQA 1XX6A 2J1LA 1NKSA 4Q9KA 5DI3A 4BLOA 3GJ5A 4CGZA 4ZV4A 3LXXA 3Q72A 4OHXA 3ASZA 4B3GA 2P0EA 2AR7A 2ZXUA 3IQWA 4MYCA 1E9EA 2PX3A 2WJIA 4TMTA 1NN0A 4TL9A 1T9HA 3W3AA 1WDTA 2B8TA 1GL6A 2Z6VA 4GP6A 1AGPA 1S9HA 1TEXA 4DJTA 5K8IA 4FMBB 5DHFA 2D7DA 2JGNA 2Q9BA 3GJ3A 3WMFA 5JS8A 5SZKB 4CEIA 3CX8A 4M22A 2B7BA 5KTYA 2GTPA 1NLFA 1YU9A 4S35A 1TQ2A 3E5HA 3ICQB 3BERA 8OHMA 1Z0FA 1D2EA 2ZI6A 4PAQA 5BN4A 5GJBA 2GRJA 2VP9A 2RGNC 1UBEA 4JVNA 2QUZA 1II8B 3H86A 3LWNA 3K70B 2NO9A 4M9XA 1A1VA 3AUXA 1IXZA 2YKGA 5KOYA 1SVWA 4LBZA 4NDZA 5CB8A 5D3QA 1OV4A 3B78A 2ZEJA 4Q48A 1OXVA 2IL1A 3AKCA 5DI3B 2OESA 1JALA 2QGNA 4C4PA 2ORVA 4D4LA 3UG6A 1QBKC 1E9BA 3FKSD 2JLRA 4YQFA 4XSHA 4B47A 1UM8A 3BJIC 1UJ2A 3O8BA 2DWPA 4MRPA 2AD1A 1A4RA 2PBRA 3EPKA 4DB4A 4QBHA 4RJLA 3VNUA 3DL0A 4II7A 2XZLA 1S2MA 2KJQA 1XFAA 2OCBA 1E0SA 2AK3A 2OAP1 1E3MA 5E7JA 3GLHA 4YXWD 4CEIB 3JZAA 2IS2A 2FGJA 4K81B 3SJBA 2IYXA 3RS4A 1G8PA 1M7HA 3LO5A 3BD9A 2GAOA 3A4LA 4FINA 1PVOA 4CT4B 4DZZA 4KITB 4WOPA 3MUFA 1AA9A 1E98A 3AKYA 2WWFA 1KAGA 4A0GA 4BFZA 1E0AA 2ZRDA 1W1WA 4DT1B 2IT1A 1IXSB 1NG1A 2GEDA 4AWXA 1XD2A 3DZDA 3RDPA 2XOKA 4Q1AA 2ERXA 2IYQA 3CB4A 4C0SA 5JRJA 3U6BA 3KUDA 4OI0A 5AK0A 2ZRGA 1WBBA 2PT7A 2GNOA 2UVQA 3VR5A 4PR0A 3RANA 4L8GA 3NVAA 3CRMA 2HJVA 1J90A 1Q1QA 5EP1A 1VCIA 4G01B 2OEPA 1OHHA 3SZRA 2VL7A 2ZYUX 4M9QA 2FH5B 1PJRA 3GLHB 721PA 2ZSBA 5FOWA 4RY2A 4JL8A 3HU3A 4M1SA 3EASA 1IN4A 5FUXA 1E2GA 2YOHA 4KXFB 1AKYA 3CBQA 4IDQA 1Z63A 2WKPA 4LHZA 3TBKA 3IHWA 2PH1A 4WZAE 3NDBB 2DBYA 1LY1A 3QIAA 3SYKA 5JBQA 3QF7A 3WP0A 2ZUDA 3TSWA 3B9PA 5A4JA 2Q0HA 1JEEA 4IDHA 3U3RA 2EU8A 2QI9C 1FNNA 3C8UA 3SN6A 1M7BA 4BPBA 4NCHA 1P61B 1XD2B 3OIUA 1UDWA 2FZ4A 1Z0JA 2ZI3A 4MKFA 1HT2E 1EFRD 3KXIA 2DPXA 4DCUA 1CR2A 4A6XA 1P9RA 3FGNA 3WYFA 1NF3A 1QHXA 2V55B 3K0FA 2RMKA 3RVBA 4HAZA 3VAAA 3D7MA 4CT5A 1WA5A 4TYPA 4BRUA 3KJIA 4C0LA 1MABA 4R7ZA 2E87A 3K0EA 3AVVA 1A5TA 1SVSA 1KY2A 5FTNA 2ZS7A 1UF9A 4QHYA 5CLQA 2AL7A 2PZFA 2ECKA 3C5CA 4M21A 1WMSA 2VHCA 3SHFA 3V4FA 5KNDA 3KQHA 821PA 3GLFE 4U5XA 1R10A 4PC6A 3ZVLA 1TUIA 1KTVA 4PZYA 4DLZA 4B43A 1YZNA 1PUIA 3KZ1E 3SI7A 4ZKDA 1KZGB 4FW9A 2FDCA 3EARA 4ARZB 5J47A 1CJTC 4A8JA 2ZRIA 3I32A 4B35A 4DSNA 1F60A 2HT6A 3HYRA 4LBYA 4QXAA 1NVVR 1R5OA 4E5UA 5H68A 3AVYA 2H92A 3BK7A 4HI0E 4B48A 1KSHA 1VKJA 2WMNB 4KBFA 4BWYA 4YDSA 1PLLA 2AFHE 3LDAA 4XOIA 2RGEA 4KCGA 3QPVA 4LUCA 4RD6A 1XTIA 2A3RA 2C04A 2ZRBA 3A58B 4ZCLA 1IN5A 3VR4A 4Q4HA 1MABB 4C2UA 3MSXA 4A2PA 3CM0A 1XD8A 2CEAA 3QKSB 3CRW1 1QHIA 2YHSA 4HSEA 3NBZC 3C5HA 3GJ8A 2IWHA 4KV9A 3EC2A 3IPYA 4FD2A 1P2VA 1JBKA 1HYQA 3RS3A 2OO7A 2IW3A 4PAOA 4IOMA 1HE1C 4AYTA 4WIAA 5JWRA 4A8JB 3QKTA 5E95A 1Q12A 1XXHA 2GXSA 2WIBA 3B7GA 4OHVA 1DPFA 3JVUA 4BFSA 1ETUA 2A5GA 1H8ED 3BORA 4C0BA 1HH4A 4BRWA 3DM9B 3I8SA 2JA1A 1I4DD 1RZ3A 5GVSA 4ASUA 2FG5A 2RB4A 2VH5R 2FA9A 1UDXA 1WCV1 3KX2A 3RABA 4LV8B 4Q4HB 4MQBA 5CM9C 4KJZA 2GK7A 3R9IA 4QGGA 3EZ9A 3ZQ6A 2NGRA 3T1TA 1G3IA 1ZCBA 1Z6XA 3TW4A 3RLFA 1NVWQ 4OK5A 3AF4A 5CIWA 4XVQA 4QG7A 3LAWA 3BBPA 3QBTA 1W47A 3OEED 3EZ6A 3IHLA 5D3MB 1X1SA 4DHEA 3NC0C 4D4MA 1JR3E 4TQ9A 1QVRA 2OBMA 2OFXA 2OHFA 1IY1A 4GT1A 3UG7A 3A1SA 1T4GA 4F4JA 3AM1A 1UFQA 5EZ6B 5LPNA 1V5WA 4D82A 4KODA 1DADA 4UNQA 2UKDA 3BH7A 3HPQA 1P2TA 5G3ZA 2BMJA 1ZM2A 2FF7A 1Q1ZA 3ADDA 5JEEA 4BECA 2XJ9A 1XTQA 4TQUS 4JLVA 1G291 4QRHA 2YOFA 2RKOA 1W36D 2JLYA 4YMSA 1GUAA 1HT1E 1KI7A 1KJZA 3AP3A 2ZM5A 1N25A 4M0LA 1JR3D 3FB4A 1Q3HA 3EG5A 2EQBA 4H1UA 2RHMA 3EWSA 4Q1DA 1D2MA 5FL3A 4ZPXA 4EPXA 2QY9A 5JCPA 4DUGD 1RE0A 3NC1C 1ZNWA 3A6PC 2ODEA 2YWEA 1DEKA 1R8SA 1D9XA 1XEXA 2W00A 1SXJA 3L8ZA 3QVUA 1ZU4A 5FUWA 4Z1MA 2IUSA 1W7AA 2FZLA 1TF5A 4D80A 1G64A 4PHTA 3SE0A 2JJ2D 2OZEA 4E07A 3TVDA 3AP1A 1N3BA 2YYZA 1TQ6A 2B92A 4XWOA 3A1VA 3GJ6A 2PZGA 4KFRA 2ZS9A 3RYTC 1NVVQ 3WBKA 2I4IA 1WP9A 2O8CA 3TAUA 3T61A 5EE1A 1IM2A 2W0MA 3MJRA 1ZC4A 1E0KA 1E9DA 4LCBA 3B82A 4JBYA 3TNFA 4Z8XA 1Z06A 4X8HA 4MGKR 4OK6A 1VIAA 4JMPA 2OSBA 1IBRA 3SR0A 1O3YA 1EFRA 1GKUB 1Z2CA 2VYFA 3GJ0A 3IIKA 1VHTA 1VCNA 1H65A 2V7QD 3A37A 1XEXB 5BW8A 1SXJB 2ZRNA 3FFBA 1LS1A 1FMLA 4JKIA 1G18A 4WA7A 4Z54A 4NCKA 2OLKA 2NMVA 1FP7A 5JJLA 5C18A 1OJLA 2HCBA 3W90A 1CR1A 1KK0A 2CMKA 4LDJA 3L82B 1TU4A 2D2FA 2DFLA 4XVRA 5JZVA 4R98A 5FBQB 1T0JB 2WJJA 1H8HD 3TE6A 2R6DA 2QG6A 4HB4A 2VHQA 4DSOA 3U7GA 1U81A 2ZE5A 5CK5A 1G7CA 4RCZA 3K09A 2IUTA 4OI2A 3SJAA 1Z22A 1T8UA 3LY5A 3C7KA 2KBEA 1G5RA 1NJFA 1E32A 1T6NA 1ZD1A 4GL2A 2YWHA 2ZR7A 1E2KA 3EIEA 1YKSA 3VX3A 4L5BA 1P73A 3K70C 1AS2A 1FQKA 1LF0A 2CLCX 2PT5A 4LJ4A 4UNNA 4Y0VA 1IY0A 3PEWA 2DFTA 4M1TA 3KB2A 4JYCA 5TARA 1OE0A 1DAFA 3AGPA 4AK9A 4CEHB 3A8TA 4M8NE 1P7CA 4WW0A 5KDLA 5AUNB 3OIYA 4Q7MB 5IDVA 1MT0A 3LV8A 3TR5A 2HJGA 4HB0A 4F4IA 1OXUA 1EG7A 2J7PD 3RWMB 3GD7A 1XP8A 2WJYA 2CVHA 4Q9LA 1GITA 5FOTA 3R8CA 4RKFA 1OFHA 2QTVB 5CK4A 4HLDA 1PLJA 1UBGA 2ZSFA 1NJGA 5DYGA 2VHTA 1KO4A 4B2IA 1SVKA 3QE0A 4LK2A 4LY6A 1F5NA 4US2R 3TR0A 4PHFA 3VNVA 1OXTA 2J0UA 3LH5A 3QENA 1P60A 4JSYA 1N6IA 4QL3A 2VP4A 1H8EA 3L0PA 1DS6A 1Q22A 1KK2A 1CJKC 3JVVA 4MUBA 2QMEA 3RC8A 2KI5A 3U6KA 5BN5A 1UKYA 4F4CA 5IK2D 2IEZA 4IDOA 1QF9A 4UXIA 2HF9A 1G21E 1L2TA 1GILA 4IHQA 3LW8A 1L4UA 1W0KD 4GPTA 2Z4SA 5KHOC 3GLIA 4ZCIA 4BZQA 2IBMA 4JL6A 4BZXA 4NH0A 1VYUA 1R2QA 1CJVC 1QDEA 2QRNA 3OEEA 4FN5A 4QGFA 3FFAA 2C8VA 3SFVA 3FMPB 4OQXA 5L3QA 2QMOA 3VTKA 2PL3A 1NRJB 1OIWA 4KFTA 3JZMA 1Z5ZA 1RVDA 2GWHA 5FR2A 1TF2A 5J4VA 1UAAA 2Q21A 4LBWA 2J0UB 4LX0A 4TMZA 2I1VB 2H17A 3U61B 2VRWA 1BYIA 3LA6A 2AK2A 4TLBA 3CKLA 2W2XA 4MDFA 3U5ZB 3QJYA 1G5TA 4V02A 2CHVA 4RKEA 1GNQA 3IBYA 1C9KA 4P33A 4YLGA 1OW3B 1P6XA 4EPRA 3LVRE 1IQPA 1ZM7A 3CRQA 1I2MA 3OFND 1LVGA 4ZKEA 2D06A 2QQEA 2IHYA 2H18A 5HCNA 4DDWA 1KI8A 2A78A 4OK3A 4DUGA 1P2SA 2MMGA 4G5GA 4Q7KA 4Q4JA 1AJEA 3WNBA 4QBFA 5CB6A 4HB2A 4HZIA 3NH9A 4YDHB 3CH4B 1E9SA 2V54A 2YJTD 3OHMA 2V9PA 2FPMA 2FFAA 2JJ2A 2Z0MA 5L3QB 4PXAA 3LQQA 2CL0X 2XOKD 2IYZA 3PCRB 3DO6A 4BLRA 1U2RA 3OF5A 4ESHA 5JLJA 2EWVA 2X77A 2QP3A 2WWYA 1SGWA 4B33A 4XD7D 4M1YA 2MSCB 4LGMA 1G6OA 4MRSA 4B3BA 1DAHA 2DFKB 5DN6D 1I4LD 4JVLA 1XF9A 1Z28A 2QAGB 4GI7A 1W36B 2FGKA 1E94E 5LD2B 2BHRA 2QL6A 3SHWA 2ZR9A 4URUR 4H9GA 3H1TA 4AG5A 5JI3E 3UWOA 2DYKA 4XIGS 4N0EA 2JLXA 3K0CA 1P9WA 4L16A 1EXMA 1M2OB 4TLEA 5LB4A 4E03A 2RGBA 4PC7A 1S96A 1X6VA 4NP6A 2V7QA 3NBYC 4Q4JB 1OIVA 3VMFA 3C41J 1W4AA 1NG9A 2O0JA 1KO8A 2OAQ1 1S0UA 5F3WB 3QNUA 3RS0A 1ANKA 4ACBA 4CRWB 2KBFA 4IVRA 3HP1A 3M0EA 4QJ4A 3CIOA 4RFVA 2ONJA 3D8BA 1YZGA 4GDFA 3A1TA 1N2CE 4BFVA 1US8A 2YOGA 4BASA 1F48A 1Z6YA 1S8FA 4JLNA 2VPPA 4YMWA 1NVUQ 1UBFA 3NIBA 4KLZA 1X86B 2FFBA 2QZ4A 3TKLA 1IJEA 4PSKA 1J99A 5LB2A 4F91B 4TTPA 1DAIA 4CYMA 3K0SA 2XNDD 3HR7A 2ANCA 3LFUA 1R8QA 2V4ZA 2R6AA 1OH5A 1JQJC 1P72A 4BEBA 1DE0A 1N6LA 4PO8A 1FUUA 5HKKD 1CR4A 2H7VA 1U8AA 3IGFA 1VMAA 2DWQA 4P4TA 3TUJC 1E2NA 1Q57A 1DOAA 4DLUA 4A8JC 3RWOA 4LI0A 1MO4A 2B21A 4V0KA 121PA 4S2EA 2KWIA 1DTSA 2QQ0A 1DG1G 3FOZA 1J8YF 4I1VA 5FTMA 2CCKA 5C1BA 2CL7X 2D3WA 1M34E 1EFCA 3QQ5A
chains in the Genus database with same CATH superfamily
1WR8A 2PS1A 1P1JA 3FDXA 3ILHA 1JECA 1SUAA 3QU7A 3R7LA 4NU6A 1US8B 2OBXA 2H1FA 5JXGA 1VKOA 1G66A 3GDGA 3NAZA 1Z16A 4QUGA 2BEJA 2I2DA 3T9EA 3MIIA 3BZUA 3IMEA 2OXRA 2PG3A 1AGRA 4BX2A 1Q7RA 2JW5A 4X3PA 1AZLA 3JZDA 5AHOA 5JVDB 2W98A 4CM7A 2QRLA 1Y48E 3GJXC 3LDHA 4O63O 3HCRA 1FX0A 2BPOA 2EJTA 3TW6A 3WK7A 3U4CA 1IU9A 4L6IA 1BWPA 1J0AA 4MVJI 1N8SA 4ZK6A 6ABPA 5EY5B 4B3XA 2GCGA 2I6TA 1J24A 2QTTA 4MI6A 3TTUA 3ZI4A 2XBLA 3BICA 3ELDA 4YT8A 5AW0A 4JEMA 4F06A 1XXHE 4CQMD 4NOLA 1T3SA 2BUCA 3OZSA 4C30A 3ZNPA 1ELOA 1C0LA 3MINB 4HNUA 1AV6A 4OKSA 3RUHA 4CLRA 3VHRA 4ND3A 2HR1A 1CQWA 2XWQA 2LCFA 1XCJA 2QRGA 3DMRA 2YMMA 2NZUG 2XYPA 2FPWA 3MTEA 2B1IA 2E4XA 2F1IA 4RCVA 5EUMA 1F4PA 1KDTA 3HJNA 4TLCA 3K5IA 3KTAA 5JS2A 2YR0A 3UATA 4Q7QA 1ZOIA 3RYFA 1L4NA 3MD0A 3TQHA 5IK2A 2ATXA 2QGZA 3FMFA 3G2JA 4ZPJA 4F45A 3ZBTA 1MQAA 2QL7A 3DOIA 3TJZA 1Z3IX 4LDQA 1J8MF 4BE7B 5AW4A 2PNJA 3DJYA 4OL0A 3VO9A 5AKIA 3C5EA 5TXGA 3ZVRA 5HDQA 4DCOA 3T41A 3O21A 2PIAA 1XJ5A 1E3DA 2GXUA 3NASA 4ZOBA 2VS1A 1ISFA 2A5JA 1LPPA 1LBTA 1YBFA 1B1AA 1KMHA 1BGWA 1PX0A 3EOZA 4L0DA 3IE1A 1J2EA 3FW1A 3BMOA 3OCJA 9GPBA 4P86A 4LYJA 1Z6AA 4WOKA 3F6RA 4UTPA 1Z0ZA 3TLMA 4OCZA 1DQSA 5G02A 1SG6A 2XPCA 4HEJA 5TSDA 1UK8A 3R7WA 1WHSB 1JXAA 3G5AA 2W9XA 1S3IA 2Q5FA 3LQ2A 4D4KA 2WOJA 1FU8A 4DA8A 3BWXA 1KJIA 5HS6A 1BKDR 2C5AA 1XVTA 2YYYA 3INNA 4LZPA 4U7HA 5CVEA 5DTIA 2EL9A 2XBMA 3ZE9A 2GCNA 2G5TA 3GZJA 2XQVA 5TT1A 4B32A 4GC5A 1RMYA 2P6OA 3BWYA 3HBMA 3THRA 3THYA 2XQIA 4D57A 4ON9A 1QVAA 2GKSA 4BQSA 1L4HA 2WU1A 4PSCA 1A4XA 3RTEA 3DLCA 1U9ZA 2PE5A 2NTJA 3A2LA 1P44A 2I7DA 2JFHA 1JG7A 3VPGA 4L4UA 3ZVNA 3C45A 3KAPA 2IUUA 4F46A 3R5JA 5E6SB 4HQ0A 2A3NA 2IPNA 3P0RA 3A27A 2H7CA 3U4HA 1YR7A 4JLJA 1XLVA 2QN3A 2RKBA 5U9CA 3L8FA 1SU8A 1Z7BA 1D1QA 1FU7A 2HSZA 2HDNB 2FW9A 3BDIA 1GPNA 3GFSA 1ODTC 1X1QA 5FHQA 2FW8A 2CFCA 1GZVA 1ENYA 1Z25A 2GF0A 5T6BA 2I2XB 2Q4RA 3T7KA 5LVAA 3G5MA 2ATVA 3N0RA 2PANA 4D45A 5DMXA 2J0QA 4BBAA 1QRDA 1SIUA 4EPYA 3FZEA 2FU5C 3GT4A 4JEUA 1GU0A 4LMRA 1DT5A 5BY2A 2XF2A 3UK1A 4QODA 1DG3A 3FVRA 5L53A 4BKOA 1G0OA 2O8BA 4KTTE 2PKYX 4HPJB 1OLSA 3PQFA 4D6PA 5MN6A 1EFLA 5IAGA 3TUZC 4LF9B 4M9ZA 4D96A 2QRPA 1EG2A 2FLVA 1C4KA 4ZJPA 4B45A 5IDYA 5CVCA 2JAPA 2Y4OA 2F8LA 1GL9B 2IEIA 1GQSA 3BMNB 3DV2A 3GZNB 3MS2A 1NN5A 1PS0A 3TH5A 3TRJA 4KHPB 1VHWA 2VXOA 3WL6A 2XGGA 4Z1MD 3NHSA 3EVTA 5JXWA 4NKRA 4PX9A 3ZHZA 3O95A 5B64A 4JC0A 1W8IA 3AEXA 2J3IA 4GZMA 2HA7A 1RVV1 1Z0UA 1VCOA 2ECFA 1VXRA 1BCRA 2GJ8A 5EMJA 4IXDA 3CR3C 3ECSA 3CS3A 3OIDA 5DTMA 1RQRA 4XZ3A 1P1RA 4DCTA 4OQYA 4TXLA 3GPBA 2Z98A 3QKRB 3OTOB 4FMPA 1BVRA 2CFIA 2PXXA 3UJ7A 4CE6A 3A6ZA 2IE8A 3S8YA 3QOFA 3A9UA 1NHWA 2XRYA 3JRNA 4LE2A 4MS1B 3DW1X 5CLJA 3NXSA 4GXQA 4IJWA 4J43A 2VDPB 4J0EA 4DVGA 1O87A 4R71A 1FDUA 4S12A 1A2KC 1XZIA 1FP2A 2HEIA 2KYRA 2YC2C 2ZSAA 3DF9A 3IBGA 1ZQ1A 4N6GA 1I1OA 1C2YA 2P9JA 3NUQA 2F3TA 5JHHB 1TUGA 4W7HA 5A7GA 2XDYA 5LYYA 2J41A 3URKA 1AZTA 1QIDA 3H5NA 3T52A 1BVHA 4H59A 3BB1A 2WAXA 3ZWYA 4YYEA 4MRRA 4TUYF 2CUZA 3E7PA 5FA6A 3DNFA 3GAAA 1AQLA 2LV8A 4KQKA 2FW1A 1M6YA 3DQZA 2OR3A 5JTUA 3MT7A 4FMCF 4NABA 4XPIB 2PSFA 3HWWA 1E0DA 1JGTA 3PQ2A 4MW4A 4C5BA 5DNVA 1I32A 3HFRA 2WU8A 1G2OA 4FDTA 3KBBA 1Q3KA 4F1JA 4OUDB 4OU4A 4FFDA 1DQRA 1NE7A 8LDHA 2NZ2A 1AKWA 1C9YA 1UXIA 1I80A 3LPNA 1EK6A 3ZK8A 4BJ1A 3NBXX 4IV8A 1MKYA 3FVQA 2QN1A 4HAVA 4GWLA 3PUZA 4CM1A 3E53A 4GSLA 3HB9A 4CIDA 3DAOA 1PKEA 4QXQA 2W2VA 1M76A 2VHJA 1J20A 4J0JA 3TZEA 3A6EA 3B7WA 1ECFA 1N3YA 1Z4OA 3M4XA 2OC9A 4LXYA 1WL8A 3IERA 4D9MA 1VHQA 4RZ3A 1TMGE 1LTKA 2FRVA 4WERA 4MHSA 3E2MA 3F49S 1A5AB 1E61A 3QFHA 3JTMA 4EG8A 2BEKA 4QVIA 4OHWA 5A4IS 4R5MA 4QU0A 4JYBA 5F76A 3TTWA 1F0PA 2B4AA 1NF8A 3R0QA 4BNWA 3U4QA 4WNAA 4EW6A 4OAPA 4E21A 1W59A 2E6KA 4XX1A 4Y6RA 3B1XA 1X8JA 4ND5A 4X6UA 3AV3A 3WDSA 1M2EA 3DE0X 5AM5A 1C0PA 4ISCA 1KVQA 1WBDA 4CMIA 4IJVA 1H2BA 1WCXA 3RYHB 2AQHA 1F14A 1OV6A 1YGPA 1MORA 2Z43A 1UZLA 4PV7A 1WHTB 1ZGHA 1WVGA 2ZTLA 5TQ2A 4QDXA 4DQUA 3JAWB 1CY8A 2XIJA 4D2IA 4CWAA 2HA2A 2R5WA 2ZRCA 4DCJA 3RSQA 3W8RA 5J58A 3AM5A 2FMFA 5IBCA 3B1FA 1A96A 2NO4A 4ZYLA 3VU1A 3I72A 1Q0HA 4KL8S 5DYWA 1ACLA 1USIA 2FAXA 1OBCA 1CZLA 2GFQA 2HRQA 3TOXA 3EA5A 2AR9A 4KAAA 2P8JA 2VSNA 5G3YA 1Q0PA 2VYVA 7AT1A 1NLZA 1PFGA 3N2NA 1XCGB 1E9FA 2QMUA 2O7VA 3LUKA 3PUHA 3R5XA 4R8RA 3RSFA 3TR6A 4TV8A 3C3JA 2NU9B 4PGFA 4RZIA 5K0LA 1GNTA 2GFIA 2XQGA 4GFDA 1MQ9A 4HXGA 4EPWA 1UWLA 1WXGA 1RLJA 2REBA 1E59A 5D87A 1C7QA 1FP4A 2XMCA 3N8IA 1JZQA 2NYVA 5EXSA 3GARA 1NQUA 3CTPA 4QUJA 2F9MA 2HA3A 2P0YA 1F1JA 1RYEA 2PEZA 3CJRA 4GL4A 2GXQA 3GGPA 3U0BA 1PWYE 5BP7A 5F7XA 4LYFA 1V71A 1ZGZA 1M34B 1USKA 4NHOA 4QSMA 3NHZA 2ZKIA 5B1DA 3CX6A 2PEYA 4XI9A 3HFSA 3ENNA 5EJAA 1QP0A 1U7HA 4UXHA 1X1AA 1UXHA 2R00A 1KFKB 1IZ8A 1E2MA 3SBXA 4KB5A 4A27A 2GLTA 3I92A 5L40A 1ORIA 3LQYA 4LFCB 4KFCA 2D2XA 3RHTA 2PJUA 1CRWG 3B5EA 4IIJF 2R4TA 4PLHA 4B17A 4QTYA 3IPRA 1TZ2A 3FOCA 3HWX1 1IOLA 1Q0UA 3V4OA 1Z7YA 3HUDA 4LYAA 3W6NA 5LD2C 2EF1A 1KJYA 4RYLA 3EIFA 4OHMA 4WNCA 1KK3A 4X84A 3AESB 5CFOA 2X1VA 1G8SA 5BNWA 4BMOB 1EA7A 4XR4A 1QJ4A 3L6BA 1DSSG 3VOBA 3H84A 4F2HA 5BR1A 1O03A 3C5VA 3FUTA 2WZBA 5KWVA 2QTAA 3EVEA 4DSUA 1TJNA 5A03A 1O58A 3KB1A 2OVBA 2ZCUA 4KXLA 4OBEA 2WHXA 1BGVA 3M89A 4LXXA 5LU9A 3VISA 2VHUA 3PGMA 3GNSA 4AMZA 3CNOA 3IBTA 1OLOA 2B78A 5KVAA 1XLTA 1ULAA 2QRKA 5EE3A 1GY8A 4YJ2B 5HG0A 2ZSDA 1PJBA 1AF7A 2GBLA 4Y3UA 5FTJA 4GOND 5A3SA 4ITRC 1NN3A 3QUBA 2HRCA 5D5HA 3SC2A 1O5OA 1FQOA 1EX9A 1ZJJA 4LNAA 4MGIR 4RIEA 4QYSA 1WV1A 4GRDA 3PEYA 1R50A 2IXTA 4AZ0B 2BZ1A 2WICA 3D2LA 3L79A 4D3XA 3V2HA 2AX4A 5E6UA 1QP7A 4EITA 1Q7BA 1W49A 4YUYA 2I76A 3AFHA 5T4HA 2BDTA 4M0EA 3T15A 4H1WA 1TM7E 2GJAA 2XWJI 1LNZA 3OOHA 2DUNA 4FHDA 4TZ6A 1NBAA 3L2OB 4HGNA 2WIDA 4PPNA 1N5DA 3UEOA 3ZWDA 2EGUA 1UPUA 3U7JA 1I2AA 2Y0BA 1P29A 4IRXA 3VKGA 1C0KA 1D6NA 2GJKA 2DH6A 5AH0A 1JKIA 3NDRA 5TS2A 2K87A 1TA0A 3DGFC 4PZDA 3W4JA 3JYLA 4D7AA 4D8XA 5KOHA 4C43A 4ARBA 3NWPA 4MV3A 3PTLA 1GUBA 1LWOA 2CLIB 3S2SA 3ADKA 4ZVVA 3QOWA 1RJFA 3ZCPA 4DSZA 3T54A 1NAHA 2I4NA 3JV7A 3PU6A 5HZGA 3WMEA 5IWCA 3OECA 2IUYA 2OV6A 2Q99A 1M6NA 4XFDA 2NXJA 4ZCRA 2O3SA 2OB1A 3ABOB 2EXXA 5K0BA 4HDCA 4KPEC 5EI5A 2ZUFA 1W94A 2ZUSA 1T1SA 1GO2A 1JEOA 3BRSA 1VCHA 1JIXA 3BC1A 1IUKA 3KOOA 4EJSA 3OF2A 3LUGA 3RBZA 4JXKA 4LPSA 4EGQA 3UYLA 1JHQA 3HC7A 3BL6A 3FWNA 5BSGA 1L4KA 1QHHA 5EWLA 4CW7A 2CNNA 1TZKA 3B6IA 4HNGA 4RABA 3UCXA 5KSOA 3F5QA 5KYWA 1K3FA 1JH9A 1M1YB 5FLEX 4CG1A 4D8VA 4YJHB 2V59A 3LHDA 4ILKA 1VB5A 5JFGA 3OTIA 2RH9B 4FU0A 4IVQA 4BRZA 3OI7A 4FFMA 4KXYA 2D54A 3ONWA 3AO0B 1U0EA 2J32A 2WWHA 2FYTA 3ESXA 3HJUA 1J1IA 3I2GA 3ICCA 2RBGA 3I9V6 2ZSIA 2G9ZA 2PT6A 1SKYB 2AMVA 2YV3A 3NBUA 4B6RA 1IVNA 4HHEA 4UKDA 1W2WB 2JFXA 1T8WA 1YUBA 5H4HA 3TD2A 1XPRA 4QHSA 4BNMA 4M0LA 2V7WA 1LC0A 1DXYA 2NUPB 4LHVA 3V1MA 2CUNA 2J0EA 2HREA 1CP3A 4A2WA 2BISA 3QU4A 4TX1A 3LLMA 2H16A 3U80A 4DSTA 3QU2A 1V7QA 4E2XA 4YCSA 4MEJA 4RD0A 5CVTA 2IYAA 3U13A 1I2BA 2OWEA 6CHYA 3ONFA 4LXUA 1EGHA 4TWIA 2AN4A 1RRVA 3QFFA 1SKQA 3MWFA 3W3ZB 3QUQA 4JT9A 3S27A 1CQIA 4BOYA 4OVKA 2B69A 3E84A 1ZXBA 1P7PA 3FHCB 1MX1A 4JSRA 1TAGA 3V55A 1IAQA 1O9BA 3FPHA 1BNCA 3QZUA 4I3GA 1YVPA 3CRVA 2X9GA 4PICA 4O4IF 1LB1B 2W2KA 4GBMA 3VHQA 4AF7A 3G9ZA 3PFNA 3UGTA 4EL0A 4ZIRB 2VDRB 2ODWA 4M7PA 4JU8A 1UPXA 3DMFA 3OCWA 4KYTA 4BEVA 2CBZA 1NXPA 2VLBA 3WXMA 2H63A 4H7PA 1OXXK 2DQYA 3M34A 5ALNA 5E3IA 1XHLA 1UC4B 4R1UA 4BO6A 2XRMA 2Q3EA 3HGQA 3N59A 2E4VA 1JHRA 3EPPA 3IEIA 4I81A 4BVEA 5IJ0B 1NJ8A 1IK6A 5B58C 1H2WA 2H07A 2DETA 2GESA 3SAJA 4ZAVA 1OKKD 2LKCA 2PWYA 1ORDA 2WD7B 2Z2KA 4Q12A 1Z83A 5A71A 1JJBA 3F9IA 2Z6QA 1M5UA 1QIIA 2W6NA 3ODPA 4OJYA 1QC5B 4PSAA 3TZCA 3G2KA 4FCVA 2AZDA 4E2ZA 2OTCA 1OAKA 3AHEA 3IO3A 5AM1A 4PYRA 1N57A 4KW7A 3WNVA 2X7JA 3WLTA 1RXVA 4LXIA 4LWQA 4O0LA 4D44A 3TIXB 3QTLA 3GVHA 3QI2A 4EGAA 2CXTA 2VQ3A 4K7JA 4I1IA 1QWSA 1XZAA 3WS7A 2V6MA 1ZUIA 4KN9S 4EF5A 3VA7A 2AC4A 4R1LA 1TCBA 1HYHA 3I37X 4TWRA 2TECE 2HSGA 5C3MA 2D4AA 4I6GA 2G36A 1ECJA 3FPAA 1VRVA 4R9NA 2O2IA 3KEGA 1XTJA 4NBUA 4R9UC 5EERA 5LP1A 3EODA 3MMZA 4V0RA 4OYLA 5H3CA 5JAIA 5LKAA 3SJUA 2EIHA 1RAFA 1X7XB 1U3UA 5HF6A 1V6SA 1KAQA 4D9BA 2GEBA 1FMJA 1Z4LA 2VKQA 4CMJA 3VI4B 2JDID 4ID9A 1GV1A 1WPGA 4TMXA 4TL7A 5LBIA 2F1HA 2W58A 4MGYR 1IHPA 2WINI 1C7JA 2YV2A 4OQDA 3H2HA 2Z9CA 3SNHA 1X42A 4QVGA 4KNYA 4MQEB 4AY3A 2GERA 3FNIA 4MYRA 4ZHSA 4K6KA 3MOSA 4K28A 3TD9A 2D7DA 5K3OA 1Z4MA 2JCSA 4WDRA 3O4RA 2I8AA 3HSYA 4C7OB 1TFRA 3PENA 1BN6A 3PXCX 1T5LA 4LWPA 2NXEA 1T9ZA 3AHFA 2IODA 3ZGXA 4NCBA 4LHXA 2CFOA 4BNFA 1AMUA 4TTQA 3DZ8A 3GLIB 3L7CA 3GJYA 3DFIA 3H9QA 1M8FA 2RC6A 1RIFA 3IKMB 3FSRA 3WNZA 2D1FA 1XMSA 3RFUA 4B4OA 2RSLA 1BX1A 1CJCA 2XOEA 1EIZA 2CWWA 4NYMR 1YTUA 3TG8A 1MX9A 4WI1A 1W46A 2FWAA 2HK7A 1DP4A 3GX1A 3PE4A 4OQMA 3S40A 5LYJF 5ELXA 1OBOA 4MKIA 3HEAA 3VPCA 1YZKA 1H22A 1B16A 3QYPA 4A6DA 1Z6QA 2MSNA 1TJPB 3E82A 3HY6A 3M81A 3PCXA 3PSHA 5AVJA 3P20A 4AS1A 4K9SA 4L6CA 1N0UA 1VJ5A 2GK3A 3DMNA 3M6MD 3A06A 3PD7A 3B2NA 4W5JA 3K9QO 3ZWVA 5SZHB 5GGXA 1QUEA 4QTTB 1Q3TA 4QQRA 4W82A 3ZZTA 1A2QA 2EW1A 3EMDA 4PG6A 4TUYB 5I9TA 2WAYA 4KVAA 4TS3A 3QMPA 1HMYA 4I7EA 5HM8A 4A7PA 4FMCB 2QK4A 4FDVA 1BDHA 3L93A 3GCXA 1M9NA 2FN4A 4AT1A 4LC9A 1KI6A 3R5HA 4RJKA 1XR3A 1BA2A 1JWAB 1PR4A 1ZDMA 1GR0A 4UAGA 4CKBB 5DM2A 3TBHA 5CDTA 1B8PA 2VSYA 4FNOA 1WLYA 5DI9A 4J2TA 2GWRA 4DDTA 5FWXB 2X86A 1VE1A 3GQBA 1BTOA 1R0BA 1SNYA 2JKYA 3JQ8A 3K0AA 4B4UA 5U4QA 2D0PB 3LYLA 3M4ZA 1H6BA 1YO6A 1ZHHA 4L3WA 4C22A 1U4OA 2JZOA 4E88A 1TGYA 2YUIA 3MBIA 1J09A 4MR9A 2A9JA 3UO8B 4QICA 2Y1XA 4NRDA 4A2QA 3Q15C 1NVMB 4YIHA 2H48A 3DYBA 2OC4A 3KVYA 1ND6A 4G0XA 1CHNA 1SUDA 3HGMA 1F3OA 3E9CA 5KNBH 5CDFA 1UAYA 2FEWB 5FEUA 1YOVB 1C8VB 4O8ZA 3LX4A 4XDZA 4DXAA 5JDCA 1XRSB 3AEQB 4KIWA 5JOQA 1LPOA 3OE4A 4CM9A 2PMWB 4R05A 4CUJA 3F8TA 2ZULA 4G0QA 4Y98A 2GM4A 3K05A 5EE5B 3QEBZ 3PXDA 3L1KA 3H5IA 4E3WA 1P1FA 3QX3A 3R8XA 3HA3A 2H4ZA 3BHJA 4IIBA 2OKGA 3EBLA 3I3OA 3RAFC 3BF7A 4R3NA 4JI6B 3BH0A 3CF4A 4UULA 3NVKI 4Q4AA 4N0QA 5AI0A 4G0NA 4YJ3F 1V2GA 1B0UA 1RP7A 3FNFA 4UD2A 1LVUA 3DDSA 5DRTA 3BWBA 2ZE8A 3CNHA 3SEQA 3WKEA 2PCJA 4US1R 1BXGB 2GPAA 3ZD6A 1IOWA 4G0MA 4MVJE 2OBBA 4D43A 5EGNA 2O3JA 1LLUA 2ZZKA 4YRAA 1FYVA 1CZKA 2ZWMA 4YALA 2IDKA 1NVDA 2B3DA 1NXOA 3PGJA 4P31A 3UHPA 1R6DA 4RVCA 4TKLA 3TRFA 4CCYA 1Q14A 4JJ8A 4EJ6A 3H2SA 1HRKA 4U5QA 4F6RA 2QPTA 2YIMA 4O4JB 3ZDRA 2BI7A 3WGHA 4BBJA 2VZLA 4W7IA 2HA4A 1UXOA 1Y3AA 4LXGA 1D4OA 3L5KA 4MTLA 3Q5GA 4E4YA 1NBMA 3FTEA 2RHDA 5BR8B 3CPJB 4R1NA 5ERXA 5KTRA 4JR1A 1FOEB 2E2WA 1TJ4A 1EX6A 3KSUA 4P4UA 1NR1A 4Z51A 2O14A 3RV3A 1MV5A 5KO2A 1RPTA 1N8KA 5AW9A 4RVDA 3FDFA 2H8KA 3NQ41 4JJIA 4YJFA 4HEA1 2YNMD 2FPKA 2Q6TA 1R4ZA 4NI5A 3STVA 1GTSA 4MUXA 4DKXA 1GXSA 1KNQA 3ESZA 1C3OA 1O4WA 4GMDA 1IY9A 3H8VA 1XALA 3WJ2A 4IOLA 5DM0A 2Q5CA 3WLEA 4YHBA 3JALA 2BTEA 2GHTA 2R6R1 3T4PA 5DF1A 3LCMA 2Z2ZA 2FDCA 4IIJB 3HYSA 4PGGA 3T34A 1ZLYA 4QUBA 5HR5A 3U3OA 3B6ZA 3E9MA 3G8BA 5FI0B 4L51A 3LFTA 3RVNA 1MC5A 1U2QA 1X8LA 1OH8A 4EOGA 3ZI7A 1BXKA 2BEUA 2B7CA 5LQRA 3PFHA 2ESRA 3ZJTA 4LZZA 1T13A 2I6XA 3RRZA 1Y7PA 1BEZA 3ZLVA 1SKMA 1JEYB 4EBBA 3MQFA 3T1OA 2Q1TA 2DC1A 2FEPA 2CLFB 5DM60 1QCDA 1RLTA 1ZOLA 1PL7A 1PZGA 3TBFA 4DM7A 1KOGA 3H5OA 3QOXA 1U2GC 2HWKA 4XVHA 2BSXA 4L2IB 2G0NA 1NHGA 1OYWA 1TQDA 2ZT5A 5FA8A 4Z0TA 2BM1A 2XMPA 3WQBA 2J5XA 2JDIA 4RTPA 1EA5A 1DZ3A 1QV6A 3DMGA 4B82A 4Z4EA 5HOQA 2LTAA 3HY4A 5P8WA 1I5OA 4FN4A 1JXOA 3WRYA 1A76A 1A8SA 3N5KA 4N49A 3TSYA 1IY8A 3NJ8A 1T2AA 3SEFA 1Z2EA 1ZJ4A 3G3EA 5LWQA 1BWQA 3I2IA 4DT1A 4RLFA 3MELA 4U7TB 3GUUA 1JEQB 4A03A 4XB2A 4YAWA 1XZNA 2PXHA 4NWIA 1ZJ5A 1XLTC 3Q6IA 1UFVA 4WGFA 3T4UA 4BP3A 2BHSA 4ZT6A 2XA9A 1PIWA 2GBLC 2FTKE 2Q3LA 3FN4A 4XB6B 1JDJA 3LHFA 1ZK3A 1H0KA 2JFYA 4RK5A 2FWPA 1ZJYA 4IGEA 4F4UA 5HYVA 3EF0A 5C8XA 3G13A 1OX4B 2EKPA 2WM9B 2R87A 4C6TB 4DDUA 1E2PA 4ZEVA 4INPA 3T3GA 3I6BA 3BSSA 3LXMA 4ZU3A 4HH3C 4ALMA 1N9KA 1KAOA 5K0EA 4QDTA 3EVDA 5CG2A 2H8GA 4Q4LA 3M6VA 1NRWA 1LQTA 2J6HA 1C4OA 5KNBD 4DR4B 2W2NA 3JQEA 4LWOA 4YV1A 1Q0TA 4YT5A 2SECE 2F43B 1FSZA 4OHBA 5AM3A 5FWYA 1V37A 3H6KA 4P6VF 1U7XA 2YZGA 4JYAB 5A5GA 1RKXA 2QT1A 1AQYA 2LZ0A 2QX6A 1KSJA 4IZHA 4DJAA 5BWOA 3R0XA 2EIXA 4JGGA 1RXCA 2P6MA 1SKUA 3IEVA 1YR9A 5BT9A 4FYYA 4NXNB 1U8UA 2EZ4A 3PJGA 5TQ0B 3GEIA 1QHSA 4HNSA 4TWBA 5DO9A 2G1AA 1CUEA 3KLPX 2YH2A 4ZMSA 2C5HA 4OQLA 2JF0A 1JMVA 2Q2VA 4BPRA 4ZGWA 2M32A 1S8OA 2FZKA 2JGRA 3BCRA 4QO8A 2EOAA 1N77A 1ZW6A 3RHZA 1SXGA 4MW1A 5ECYA 5I7VA 4DMFA 2BFMA 2QZSA 4HDRA 1SBIA 4LY9A 5LC1A 3WRXC 5AQ1A 4QT4A 2GD0A 1X74A 3DZBA 3NBAA 2FOLA 2YL2A 3W5HA 4BMNA 4F86A 5EJ8A 1KPIA 2RFLA 1ONBA 2HWXA 2XIQA 3JRXA 3JQCA 4TL8A 4GW3A 3QXSA 3I5YA 2Q1WA 2QW8A 3GXOA 3PQCA 4JY7A 4EJSC 4BYMA 1U80A 4FEAA 3SHOA 4GNKA 4GIBA 4C4TA 5BQ5A 3AB3A 3R9XB 4WY2A 1Z15A 2I7CA 2DTXA 2XWBF 3EDQA 4ZODA 4HYYA 4V2UA 1JB1A 3THXB 1FIUA 4F92B 1KKUA 3UQYS 2W2TA 4N82A 4KI7A 4OXIA 3LCCA 2C99A 3AZPA 4PCLA 3BFVA 5IPFA 1EZ1A 3P2MA 3QHQA 1ZNZA 4OOFA 2HF8A 4Y0AA 5L3RA 1LPMA 3GA5A 4EMTA 4YROA 1V5EA 2I29A 5DLQC 2ZBRA 5DBGA 2GXAA 4A4DA 4HMPA 4FYMA 2JLSA 4EFLA 3P0FA 4ARZA 4ESVA 3AZQA 2OZLA 2QD3A 1QJCA 1R0ZA 1TUBB 1X1CA 1Y98A 4I36A 1GFIA 4JFAA 1TO1E 4DCPA 2GM3A 4KK3A 3KC2A 4YMGA 3W2EA 2ZSJA 3IQFA 3OG9A 3CWQA 3ZV3A 4OQFA 1ZCJA 1G7RA 1U02A 4C0QC 5JS6A 5EP2A 1JAZA 1UQRA 3W05A 4LJ6A 3T06B 4C14A 2FR1A 4O4IB 1RHUA 2JFVA 2QE7A 1JDNA 3Q98A 3VNBA 5H0IA 4NCJA 1U8TA 2Z1DA 1RXYA 3QP9A 4M7WA 3TNDA 2BM0A 3KYCB 4ZDKA 4NBVA 4OF4A 5I9BA 3WWDA 2LUOA 3ACDA 6LDHA 1R6BX 1UBJS 3JQAA 1XPOA 1QO9A 2XUZA 3KYBA 2P75A 3NFYA 5HEKA 5G0VA 3DUFB 4URWR 4CDMA 1V1MB 5CTAA 2XB4A 3TLGB 1KWGA 2JARA 3GJRA 2OE2A 2QN7A 2VT6A 2PTHA 5F77A 1PL0A 1RACA 3F47A 1ZOOA 4QG3A 1A7KA 2XVAA 5K8CA 1WABA 2OOSA 2YNMA 3JQDA 4H6XA 3WNCA 4N39A 3RUDA 2YIVX 4OQQA 4XGQA 4CUZA 1E64A 2XWPA 4L0QA 3IPCA 2HV8A 2VQDA 4L3OA 5JARA 2JFUA 4WVFA 2BMAA 5L6MB 1UJ4A 3NO4A 5FL7A 3LUBA 1P0CA 2WD9A 4CV0A 1FVXA 2CXNA 2GN4A 3AT1A 3MAAC 2QZZA 3LUFA 4M8IA 3L8GA 5JXHA 1MW9X 3KRTA 3VR6A 4YMVA 4I4NA 2PAAA 2YXPX 1V96A 5REQA 5ALJA 5JAUA 3C6QA 3AI1A 1VGRA 1UP4A 4LSZA 4ZGGA 5EXDA 2XCRB 2CD9A 4KQJA 3QEMB 2A0KA 4B6QA 1VFPA 2B1RA 1WE2A 1Z39A 4WZBA 1DFHA 2FPIB 2OUIA 2UVPB 3DB1A 2J30A 4QOGA 2WYOA 1N1GA 5BR7A 4N6NA 3ON5A 5HZHA 4GYWA 2XKJE 3BD7A 3D3KA 3ZHXA 1NJSA 3UKOA 2XD9A 1NW8A 1V45E 5BSEA 5IDXA 3AM4A 1CX9B 1OAAA 2FPOA 2FSIA 3V1TC 1BDMA 1TF7A 3WQRA 4EKDA 3SVTA 2C4VA 4ND4A 2EFJA 2YWDA 3JARB 1JYEA 3GGCA 3JQGA 3AM3A 4MI1A 4B84A 4Y18A 4KXVA 5KKCA 2Q8PA 1J9EA 3JVIA 5IWAB 4XYGA 1KNXA 1DV1A 1G19A 1B6GA 1X0XA 3O4HA 3EJ6A 5JSKA 1P0FA 3HM9A 3AONB 4UMEA 4ZO4A 4QTZA 4ZU6X 3RS5A 1KJ8A 3SEAA 1HEIA 2VNAA 5ELLA 4G9BA 4U7DA 2VC2B 1XRRA 1GNPA 1YH3A 4F38A 4C4YA 1APBA 1WB9A 2IELA 3KXKA 3HEBA 2OORA 3TVYA 4YWHA 2VF8A 1NPTO 4IY1A 4AI6A 1ZSVA 4ZVPA 3M1LA 2Q1SA 2AOXA 3BGWA 4IWNA 3MWKA 4X00A 2P2SA 2BFEA 3I42A 4ZQIA 4EO9A 3AFMA 1KJQA 3ZIUA 1LK0A 3JD4A 3W5UA 5LNK1 5LYJB 1I24A 3DDOA 3AUFA 1EFUA 1N6NA 1Y7IA 2Z1MA 2QE6A 5JJIA 2YHUA 3HYTA 1GZUA 1SZDA 4XQEA 5LZ9A 2JIOA 2O20A 4PZCA 2OHOA 4LOAA 1ZMTA 3QVMA 4HMOA 3GJ4A 1WY7A 3SBDA 3C3MA 3M3DA 2I71A 5JYDA 2B83A 1SVMA 4PHGA 2WTUA 1YC2A 2B1GA 1HM5A 1A5SB 2J87A 4IJQA 3DJFA 4N03A 1HNWB 1D2RA 2E1PA 5HSGA 1ZO8A 3ASYA 3B3QA 3SC3A 1I33A 5EXTA 1RQXA 4C5AA 4NFYA 4HJRA 3RFVA 2G0TA 4GKVA 5J40A 1DAOA 1ZJ6A 1FQWA 2ACWA 2HSJA 2I3ZA 4HYQA 4I4TA 5DOZA 3CO0S 3ZXSA 2ZBGA 1JDVA 3RGWS 1LUAA 1U3CA 5FHRA 3RI3A 1NQ5A 2ZTVA 1IB6A 3BL5A 3QLVC 4LXQA 5EWMB 4BKRA 1TJ5A 1C7FA 5JNRA 3GH3A 2YXBA 4CTNA 1ZA2A 3NKFA 3PTZA 3DLBA 1NF2A 1Y5IA 2DH5A 4B3DA 1E5DA 1FRQA 1XEWX 2CLHB 4BLTA 1DAPA 2ZJYA 1ATZA 1CKEA 5IULC 1QF7A 2A9KA 2E5WA 5KMGB 2BGWA 3FB1A 3PQ5A 5CT8A 3QM1A 2OWDA 4OAOA 2ZB7A 3HPRA 4XVCA 3RKUA 3MM4A 3EULA 5CFZA 3DONA 2C5LA 4CV2A 1X1RA 2IHKA 4GI2A 1DAEA 4RDCA 3H9JA 1NXWA 5FUVA 2IKQA 1VG1A 5I51A 3IBCA 1NQVA 2O7NA 2PA0A 3LF2A 2EJCA 2F1KA 3Q7RA 2BMWA 1T8RA 5FP0A 3A70A 1C9DB 2R47A 3UOWA 4BFLA 4EMUA 1NUPA 2PWZA 1NNUA 5DV9A 4WKNA 1XJQA 2HPHA 5JS7A 2XE4A 1S9DA 1Q91A 1ORRA 4P4SA 1QK4A 4DAOA 1E2FA 2RH5A 5CNJA 1YGYA 4LI3X 1T0BA 3BGSA 2ZRQA 2HCRA 3CF2A 4YJ3B 1P75A 3FJOA 5JDCC 3TS1A 3BTSA 2ZANA 3T5PA 4N01A 3D3WA 1X7WB 1Z26A 1DXHA 4JI5B 4JXXA 4I1SA 2UUOA 1QS0B 2XTNA 3OCZA 3WC4A 2EJUA 3PQ6A 2P2ZA 3IUPA 2QSZA 1RRKA 4UUBA 3LOUA 1IC6A 4TQGA 2RGYA 2W2MA 2F3RA 1I3NA 1JA0A 1AUOA 3F7NA 2F17A 4Q3OA 4S0ZA 1JKJA 4XEUA 5AW8A 1ZR2A 2LDXA 4HLQB 1FNDA 4NV1A 1ZVQA 4DA4A 2XOXA 3H1EA 4JWTA 2GFHA 3OLWA 3ZH9B 1XMQB 4I1PA 3U3XA 2CXSA 2YN2A 4NYJR 3HUEA 3I39X 5E2BA 3WOHA 2WKSA 2XA2A 3TMYA 4MAMA 5H5JA 3HU5A 3DCNA 4PLYA 1YI0A 2IYLD 5JZBA 1F2TB 3SVLA 4FFBA 3HXTA 5EQJB 5IT5A 5ITZA 2GJ4A 1II9A 4GM4A 1IDOA 4UM7A 1AQUA 4TKUA 3UJPA 5AI4A 3MAJA 2ONCA 3FZYA 5EEHA 1KO1A 4HVTA 4L72A 4BV8A 3VHLB 1SUEA 1VXOA 1ZRMA 2WMYA 4C01A 3W5CA 2MDTA 3IDZA 1LI7A 3M2PA 1DBQA 1MO5A 3LYUA 4OMDA 4ETNA 4YRIA 1K8XB 2A7XA 3G0IA 5AHXA 3G2LA 4DY4A 5C8ZA 1GKIA 4J4TA 1RJWA 1XT6A 1VZ2A 3MILA 3GLUA 1KIFA 1JHXA 1RABA 2QLJA 3L7AA 4ZU1X 1L5KA 3TM5A 1QYXA 5J2UA 2AE2A 2PLRA 3KFLA 4DQXA 3EGCA 4I6JA 1P0PA 3CW8X 3WQSB 2H2IA 1ECGA 1OTXA 3ONDA 2BHLA 4FEGA 1UM9A 3ENZA 3G23A 4Q7JB 2ZRFA 4QEKA 3WY9A 5F7OA 5BMVA 1VKNA 4JNCA 1UP7A 1B15A 1BU5A 1LWNA 2QRVB 1HDEA 3IKJA 1MU0A 1IWBB 1JIIA 1U1FA 1VE6A 1ZI8A 2PSHA 4G86A 3RS9A 3VAYA 4EHAA 3STWA 1QOQB 4QGSA 1MOQA 1NY5A 3T7EA 3WLQA 1IBKB 2YHIB 1ENZA 2CDRA 1IVYA 5K6TA 2C78A 3WLFA 4TZKA 4UFPA 2CYCA 4ZCMA 3SVZA 5EE9A 3UMRA 3N2IA 2G7MC 2YWXA 5GINE 2VPWA 3FBWA 3RU7A 1CJUC 1ZONA 2JZNA 3DBHA 3ANXA 4F8EA 1Q6ZA 1RQNA 1U0RA 4KQFA 1R37A 4QELA 1SCKA 3B48A 2ECOA 4OJKA 2CHFA 3EWAA 4ITVA 4MV1A 1VDMA 4Z49A 3OPMA 4FK8A 5DEIA 3MCWA 1FFEA 4HNAB 3BXOA 3EDOA 1CCWA 2E85A 4RKQA 4S2UA 5K3AA 5BO5A 4DIKA 5IJ9B 4J9VA 1K0FA 3ZOKA 1ZJWA 1Q20A 4OM7A 3WQQA 4C7BA 1FK8A 3D7RA 2CCGA 2GEUA 2HC9A 2IJGX 3E9QA 3W6PA 4F2PA 2YHAA 1MEJA 3RU9A 2AFHA 1PFUA 1U2ZA 5LU8A 1B4DA 4NMMA 4XIFA 2JCVA 2VOEA 3W79A 1KYIA 3RAGA 1E8DA 3DAPA