1KO8A

Crystal structure of gluconate kinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
172
structure length
172
Chain Sequence
TTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLKARKGHFFKTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gluconate kinase
publication title Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 58
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2001-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ko8A00
4ACAA 1NY6A 1YZGA 1SKYE 1KDPA 4G5SA 1X8JA 5EXXA 1N5KA 1M74A 5HCNA 4B76A 2ZUCA 2BMJA 2C98A 4NCHA 4Q00A 1NVVR 2EFDB 1YZQA 3ZYCA 4C0BA 1YZLA 2QORA 2FPMA 2WKPA 1IM2A 1IHUA 2D7DA 1DAKA 1U90A 1T0HB 1QF9A 1DAMA 4IHQA 4UNQA 4Q7KA 1U94A 4ZDKA 1GL9B 1DPFA 2XB4A 4HLDA 1NNEA 2JLUA 3QXCA 3L82B 2HF9A 2VLIA 1P75A 4Q5IA 1MOZA 4FWTA 1OFIA 1G18A 2GCOA 1KSJA 5FR2A 1G3MA 1JXOA 4C3ZA 4DLSA 4Q48A 1ZNWA 4IDOA 1XZQA 1ZM3A 3O8CA 2G1JA 2IUSA 4US0R 4AWXA 1YRAA 2D7CA 1G7TA 3QOFA 4MYCA 2ZJZA 4V0MA 3TUZC 3AP1A 1N6PA 1XBTA 4BFUA 5DYIA 2B21A 4RSGA 1RKBA 3CPJB 2XX3A 3DZDA 4A82A 4ZCIA 4JJZA 1QHYA 4CYMA 1XD9A 3C16C 4EFNA 5FBVB 4LYJA 1KYIA 3OHMA 4ZO4A 4Z1MD 3AF1A 4IKEA 2OCYC 3BERA 2VIIA 2IF0A 2OCAA 2WAXA 3U5ZB 1JI0A 1WQ1R 5D3MB 1ZRHA 2GBLA 2ZETA 2ZSAA 1P60A 1G5TA 1COWA 2JLRA 1IBRA 3T1QA 2CE7A 4OHYA 4GP7A 4LOAA 2ZAOA 3M6AA 2WJGA 5BN5A 5ELXA 1K8RA 5EE0A 4JJKA 1Q22A 1UADA 3BFVA 4TN1A 4DUGA 1MABB 2NO6A 1OH7A 2H92A 2V6JA 4KU4A 1R8SA 4Q21A 1C4OA 4GOXA 5TV2A 2HT1A 1NSTA 3TR5A 1X86B 1IN8A 4OKSA 1UDWA 2O8BB 3ZVMA 2C95A 1GILA 3N2IA 4EAQA 4TSFD 2ZJOA 3EXAA 4TLAA 4AYWA 5KO2A 4B3GA 5B2ZA 3A1VA 4MUBA 5CJPA 3LLMA 5C4MA 3U3KA 3SJZA 2BCGY 1VHLA 4FIDA 3MSXA 4JLBA 4LDJA 2WZQA 2BMFA 2IYTA 5DE3A 5UKDA 3T1VA 5EE9A 2RH5A 3CW2A 4YLGA 1XTQA 5KSOA 3E2IA 3RC3A 1L7VC 1G4AE 2MMCA 4TTPA 3THYB 4L5BA 1TEXA 5FTJA 2G1KA 2HF8A 4W5HA 1E98A 5JI3E 2WTUA 4RD4A 5JRJA 1O87A 3TKLA 4POAA 3CWZA 3WRXC 4IDNA 1E94E 3CLVA 4B32A 5J4LA 3EPHA 5DH9A 1CJTC 2H7VA 3ND8A 3ADDA 2ONKA 1HQYE 3B1WA 3OE7D 2RGCA 3TSWA 3KXKA 1RYHA 3GCGA 1E79A 1Z3IX 2YC2C 3SHFA 2X8AA 5KPDA 4GDFA 1HURA 4D4LA 1F6BA 5BQ5A 4I1OA 4TMKA 1IN4A 2QTFA 1KNQA 4NCNA 2BKEA 3I72A 4LJ6A 2GZAA 1XJCA 2YOFA 2AFHE 3ZVLA 2CLSA 4LHWA 1LS6A 3W8RA 3CH5A 4LJAA 4JBXA 3BB3A 3CZQA 3CKLA 5CIQA 5JSZA 4PZYA 1DO0A 2JAQA 1AKYA 4US1R 2CCKA 2ZI6A 2C77A 2ZJ5A 3K0CC 3CNNA 1QVAA 4M1WA 2ZVPX 3Q5EA 4MYHA 2ZRCA 5B64A 1ZJ6A 2O8EA 2J5XA 3THXA 2IT1A 1KDOA 1ZIPA 3OF5A 4LYAA 1LTQA 1LS1A 3VU9B 4MQBA 1TEVA 2XOKA 4Q9LA 1OIXA 2W6ID 1A5TA 2VP2A 1LB1B 1OHHD 1SXJE 4LJ5A 4RKFA 5CB8A 1MT0A 5TMPA 4QHSA 3EARA 1S1MA 1TF2A 2ZRLA 2O8CB 4BZQA 1VYTA 4QJ4A 4IFBA 4IFEA 3SDZA 2QSZA 3GFPA 4M1OA 3FYHA 2WIAA 1QG2A 1SQ5A 2WJVA 3BD9A 3EPJA 5JBQA 5H8WA 2JJ2D 3REFA 3W5IA 2ZITA 2WMNB 1ZNZA 3A1WA 4ZDWA 2VO1A 4Q03A 4ZIRA 1N5JA 3X1WA 3WHKA 2J59A 4W7SA 2CLDX 2GAAA 3AF3A 4QL3A 2B7CA 2IF2A 3CO5A 3TH5A 1NVWQ 1A2KC 3PV0A 5C2JB 3QJYA 1N6OA 1F2UA 3ND9A 4FCTA 3X1XA 4JS0A 4BEBA 2GNOA 3LA6A 1KAOA 2WWYA 2IBMA 5EP1A 2AXNA 1RIFA 5FPKA 3GLFE 2JIZA 1KK2A 2ZE5A 2NPFA 1I2MA 1L4UA 1XPRA 3FKSA 4QGAA 2WKQA 3TRFA 3WYGA 2OCBA 3TR0A 3PIRA 3BB1A 5KSPA 3SYLA 1GDDA 4BLPA 4D4MA 2YWGA 1R5BA 3NDPA 1GNPA 4Q1AA 1FP7A 3S1AB 1H8ED 1CRPA 2WWFA 2HT6A 1TU3A 2C99A 2EFGA 1I2DA 4BLOA 1JPJA 2WMOB 5FOTA 1SHKA 1Z0DA 2ZRIA 1T6NA 2KJQA 5JJIA 4DLYA 1J8MF 2UKDA 3OFND 3G0HA 2ZRBA 3KQLA 2Q6TA 3TK1A 2NG1A 3SBEA 3MCAA 2YOGA 4JVLA 2J0UB 4EPVA 5HKKA 4NCJA 3ZQJA 2CL6X 1KHTA 3CR8A 5E7MA 2R6FA 1Z63A 2XZLA 1V43A 1R5OA 1HQCA 1DVRA 2OO7A 5LB4A 3U6BA 2XGJA 3LD9A 1AJEA 4DLUA 2AKYA 2GEDA 2NTYC 5JFGA 1XPUA 3RSOA 1S3GA 4MRNA 4HDCA 4IEIA 4NPHA 3TAUA 2JCSA 3ADCA 3GJXC 4GP6A 1OH8A 2IYZA 4C2TA 2V8OA 2GCOB 4CEHB 2QRNA 3IDQA 2F1JA 1NMYA 1KK3A 1X6VA 2MSDB 3Q8XB 4BZPA 1ZYUA 4W5WA 4BLRA 4E22A 3AVUA 4X8LA 1Q3TA 3TAHA 2JDID 1CP2A 1W4AA 1Z08A 4LY6A 1M6NA 3F8TA 1QBKC 2ORWA 4UXIA 3VQTA 2F9MA 5GJWC 4BFZA 4QRHA 4TLBA 2P6RA 4B3FX 4N0EA 1G21E 2W83A 4P3YA 4JBWA 2AXPA 1KOFA 1S4QA 3BE4A 1BYUA 2G88A 1CLUA 1TMKA 2LKCA 5KDOA 5JS7A 3ECCA 4XTRA 1P2TA 3WYFA 1A4RA 2ZU0C 4XJXA 1TUIA 3MMPA 3RWMB 1R8QA 1BMFD 4FMDF 5F2EA 1UBEA 4C0SA 4A0FA 2OEPA 2ZI4A 4PAOA 4B34A 2QGZA 3EA5A 3FHOA 1WBBA 4Q9JA 5E7IA 4CT5A 4EKDA 5KUTA 3X2SA 1KMHA 1QHXA 1UJ2A 2XITA 4V03A 3O8DA 4V02A 1ZM9A 3AVQA 3KXLA 4OK3A 2ZIAA 3BH7A 3DOFA 3NHBA 1UPTA 4AURA 4HI0E 1P72A 1U8AA 1JQLB 1XDBA 2Z5FA 3MWKA 1DAEA 1II9A 4LHZA 1E2FA 5JHHB 4V0OA 4LHYA 1PLJA 2P6NA 2DPXA 3H0KA 3MWJA 4F4IA 4HZIA 2GKSA 4TMWA 3WP1B 4HLUA 3T1TA 1AIPA 2BHRA 4FMCF 3BFXA 1Z6TA 4RCZA 2A5JA 4AKEA 2H8KA 4B6FA 1G7RA 3ZH9B 2EU8A 2ZRAA 4NYMR 1A7JA 4DKXA 2WKRA 2PZFA 4NCIA 2ATVA 4RFSB 2REXB 1XB2A 2QNRA 3E1SA 3LXXA 3CM0A 4HAZA 3R9WA 2ANCA 2PBRA 4DJTA 3Q72A 2ZJ8A 1ZU4A 4MYUA 4JVNA 2C78A 2C9OA 3B1XA 4MRVA 2UZ3A 2X1VA 3QVUA 4J0QA 4TYNA 2WJIA 2WSSD 4JL6A 3KB2A 1RC8A 1OYWA 2OM2A 4WA7A 3HR7A 1VKJA 1KY3A 4B6EA 1EESA 1G3UA 3THWA 3TSOA 5KNCA 2CLCX 1N0VC 4KFRA 1S1CA 2CEAA 3EIEA 1G17A 1XTKA 2IX3A 4U00A 3NG1A 1K5DA 2O8DA 4JSYA 4TMTA 3H2YA 3AP3A 4Q4JA 1KDRA 3RRYA 2NOAA 5EP3A 3ZS9A 4BRUA 5E4FA 1X8KA 4TL8A 1KI6A 3K70C 1GIAA 2PEYA 1LF5A 5CDFE 3TQFA 2DYKA 2IS4A 4Q1EA 1XJ0A 2WWXA 4OQNA 4DT1B 5FI0B 1T8TA 1T5LA 1XD8A 1Z47A 5FI1B 4KLNA 2PT5A 4MITA 3K70B 3FB4A 4OI2A 4O2RA 5FFMA 3FE2A 3LAWA 4M9XA 3V4FA 5AJVB 3WMGA 5J4VA 4HB0A 3ZD6A 3PR1A 2A5DA 1KDTA 1E2HA 3LX5A 3FDIA 1W1WA 4IEEA 4PSAA 1KI7A 1RE0A 2AD5A 4KSBA 2ZXUA 1E2PA 4PPGA 1COWD 1GNQA 1MRNA 1FNNA 3CF2A 1NVXQ 2ZROA 4PAQA 1NIPA 1P9NA 4NBSA 4DDUA 4TYWA 1MR3F 1ETUA 4U7DA 3U7HB 4C0HA 2F3TA 4A9AA 5JWOA 4DUGD 3VR3A 4ZIRB 3U61B 1ZIOA 1ZCBA 3W8NA 3KTAA 4M2LA 1V5WA 1P2SA 4DIEA 4DDTA 1WMSA 4V0LA 4JKYA 3R8CA 4PQFA 1OFUX 2B8WA 3WYAA 3PEYA 1C1YA 2QBYA 2LCFA 1E9RA 1IONA 4P4SA 4C0LA 4N0DA 3B13B 1SULA 2D2FA 3SQXA 1H8HA 2WWIA 4URWR 4KYUA 4F38A 1AGPA 2DCUA 4LBZA 2V1XA 3GLGB 1U81A 4WZAE 1FP6A 2NQ2C 1M7GA 2O5VA 3B60A 2CL0X 1CJKC 3KKNA 3LH5A 3QF4A 1W2HA 4MYTA 4P0TA 1P3JA 1QHHA 4PSKA 4JLAA 1GM5A 2QT1A 2GHIA 1E2MA 1RPZA 1NF3A 1W36C 4KLZA 3LBNA 3IQWA 2FDCA 4LJ9A 1EFRA 4I1UA 3C41J 3FMOB 1OPXA 1LV7A 1ZC4A 3BJIC 3MRSA 2BM0A 3NIBA 1VG1A 2VHQA 821PA 2XAUA 5HR5A 1RRFA 5TARA 5CB6A 1W36B 2VP9A 1Z6GA 1AN0A 3GJ5A 1D2NA 4OL0A 3L8ZA 1W4BA 4JT2A 1FQJA 3MWYW 4M4SA 4DLRA 1VIAA 2HLDA 4QHYA 2D3WA 5E3HA 3KFVA 3WBKA 3W9YA 1W46A 4HDQB 1WB9A 2BVNA 1QVRA 2NIPA 1NVVQ 2LKDA 3F0TA 1U99A 1KO8A 2WWWA 1Q1BA 3OESA 2XNDA 2VYFA 1ZD9A 5JS8A 4OYHA 3A37A 4CEJA 2FSHA 1KI3A 2C9YA 3WMEA 2GF9A 3OEED 4M8NE 4MGKR 1IN6A 5FR1A 3FTQA 3R7WA 3EIHA 4TZ6A 3VHXA 2H18A 4Q9KA 4I4LA 1Q57A 4EJSA 4MUAA 3GD7A 2A9KA 1KGDA 4CRWB 3K70D 5EE5B 4LPKA 4I1SA 4S2EA 3LY5A 1DO2A 1NVUQ 2XOKD 4Q01A 4EDHA 1G7CA 4WW0A 3WNBA 2WBLC 1VTKA 2QAGB 3BS4A 4Q1CA 4RVCA 1CBUA 2ZQ5A 1KI8A 1VHTA 1P6XA 1W47A 2GJ9A 2JATA 4YDHB 5JMTA 2ZRJA 2FSIA 1KO1A 1I4LD 2G83A 1PLLA 1Q3HA 2PLFA 4HAYA 4TLEA 2RHDA 2BMEA 1WE2A 1KSGA 1G1MA 2C96A 4B71A 4QBHA 3I61A 2OFOA 1ESNA 3UMSA 2QPAA 4XSHA 4UJ3A 2QRZA 4RCYA 2ERYA 2D2EA 1R7RA 3FMIA 5HZKA 3U3OA 2KI5A 3E5HA 4RD6A 3AF0A 2BBTA 2ZJAA 1DAGA 2BJWA 2IYLD 4UNSA 3W5JA 4PO1A 1N3BA 2A5FA 1L4YA 1IN5A 2REBA 4FW9A 1HYQA 5G3YA 3P4YA 5TVKA 3RAPR 1E9EA 2FSGA 2MMGA 1G9XA 5EE1A 3LO5A 1GRNA 1EFUA 2CBZA 3V00A 1VIYA 1E0SA 2VPPA 2W6JA 4XSGA 1R5NA 3FKSD 2NMVA 5AUNB 3BH6A 3F3YA 1CIPA 4R2IA 2J7KA 3WY9A 3ZD7A 5DYGA 4JYCA 4C9BA 1OXVA 1GP2A 4H1VA 2XXAB 3GJ3A 2QEQA 5AJYA 3CRRA 4D81A 1N6LA 2YYZA 1SVIA 2QU8A 3BBPA 3ZZUA 4HLQB 2OV2A 4RKEA 4BPBA 2NZJA 3OIVA 1NBMA 4PC7A 1GL7A 2R65A 2GZHA 8OHMA 2ZR9A 5KNBA 2AD1A 2DFLA 3U6KA 1E0JA 1YZNA 3SFVA 1IJFA 1KI9A 2QSYA 4P4UA 3T1OA 3VHLB 1JJ7A 3VKGA 1W36D 5HKKD 2R44A 1TQ2A 3K53A 2ZRHA 1N6KA 1SHZA 3LQQA 2ZUBA 3KKOA 3PEVA 5EUQB 5LBIA 1EWQA 2D74A 1CRQA 2DBYA 1G5RA 3PUXA 1Q1QA 2Q3MA 2UZIR 2FSFA 2RKOA 1OLOA 5HTKA 4ON9A 3CNLA 3U7EB 3THWB 3EWSA 3EC1A 2PJRA 4KBGA 4DXAA 1ZMXA 3G82C 2XNSA 4RD1A 2X2FA 1GAJA 2ZS8A 4B75A 3PVSA 1EK0A 4ZDIA 1XCPA 1XPOA 3C14C 4Q4JB 5HZHA 1XMVA 3NVAA 2ZYVX 3A4MA 3D7MA 3K09A 5KSZA 4XD7A 3AVVA 4LJ8A 4FMBB 2NO7A 4A1FA 1E1RD 1KI6B 5FOUA 3FMFA 2MSEB 4DLTA 3IO3A 1KO5A 3M1IA 4QJ3A 3TIFA 3H86A 3PG5A 3W6PA 5FUXA 1E2GA 3RYTC 1YJ5A 1DS6A 421PA 4TZ0A 1HE8B 5CITA 1YU9A 4Q66C 4JSTA 2WIBA 3LVRE 1F3OA 4LBVA 1Z2AA 4PX9A 2YOHA 4GRAA 5DSZA 4RZ3A 1E3MA 4LJ4A 1R0ZA 3ZZ0A 1E9CA 3TUJC 2OZEA 5G53C 3GLHA 1F48A 3LWNA 4AKHA 2C04A 4HZUB 1JPNA 3CX7A 4ZDJA 2PCLA 1MV5A 1KI4A 2BBWA 1WDTA 3IHWA 2OHFA 4TWZA 4AIIA 3AVYA 1E4VA 1YE8A 3LXRA 3TJZA 1OE0A 2NZ8A 1R0WA 4P32A 1HTWA 1S8FA 2VP0A 4RD3A 2ZSDA 2F43B 4GOKA 2ZR7A 4LX0A 4B2PA 3A8TA 2C8VA 3ZIAD 2EYQA 2ORVA 1OF1A 4L9SA 4OQLA 3T34A 4DLXA 5BN3A 3OEHA 3T35A 2QBYB 1J8YF 2FGKA 4AKIA 1ZP6A 4P4SB 5IK2A 1Z28A 4QM6A 1JBKA 3GLIA 4LUCA 1Z22A 2AX4A 5AJWA 2YVUA 5EZ6B 3VR1A 3QEJA 4FWIB 3N5CA 4HAVA 4PHTA 1UBFA 5TDHA 5J5CA 1QHHB 4E09A 1IQPA 4OJQA 1ZNXA 5G40A 4Q47A 3CRVA 1IXRC 5DI3B 1KJZA 3SQWA 4E5UA 4HAUA 4R71A 1DOAA 3C8UA 4DIDA 4RD0A 1DTSA 3KKPA 4KCGA 3ZQ6A 5SZIA 1AS2A 4W9MC 3GP8A 1KMQA 1E9FA 3DM9B 5DGXA 1ANKA 1AK2A 1M1YE 3M4YA 1KO4A 3HYRA 4M53A 5B57C 4NZYA 4W5JA 4YMWA 1XXHB 3RHFA 2CHGA 3ADKA 1PLKA 1YKSA 2C03A 5BXQC 2W0SA 4LYHA 1F2TB 2A78A 2ZI3A 4PTLA 2HDNB 2GJKA 2ZJ2A 4QBIA 4I99A 1KKMA 3CRQA 4D4JA 5KNDA 3KB1A 3LNCA 1FUUA 1ESMA 3X1ZA 4EJSC 1N25A 3QF7A 4IXMA 4NDZA 1WP9A 1TAGA 4TL7A 5DI9A 3TLXA 1Z6AA 2Q9CA 3KQUA 3U4QB 3R7WB 2DWOA 4ACBA 3EPKA 3ICQB 5JJLA 4B74A 2BEKA 3JVVA 1PVOA 4EJSB 3QG1A 3KZ1E 3OAAD 3P26A 2N1BA 4XIGS 3QPUA 3I1FA 4PQYA 4YQFA 2FG5A 3LLUA 3K1JA 1XEFA 4PAMA 4P31A 1HA3A 4V0ME 1FMLA 5JEEA 1G8FA 2NPIA 2ZREA 2FEMA 2QMUA 2ZE6A 3TW4A 1JB1A 3K0AB 3WHLA 4C0KA 3B1YA 5FPYA 3VKHA 2D4HA 2RMKA 1B0UA 3PFIA 3R20A 4M1TA 5FUWA 4PHGA 5C18A 3GQBA 5H1YA 1AZTA 1GNRA 1XP8A 3NWJA 3AKEA 4QGHA 4EPWA 1RVDA 1BH2A 3BXZA 2XJ4A 4IVRA 4RZUA 5L3VA 4QFMA 4JKIA 2HCBA 1KZ7B 2WJHA 4AYTA 3LBIA 3AUYA 3C15C 5L3QA 2YWEA 2FPLA 3HPQA 3CNOA 5CK4A 1T3HA 2EYUA 2GJAA 4WAUA 2ZRPA 3WNCA 3O47A 2J87A 4CGZA 3HJNA 3T15A 5A4JA 5C1BA 3EWAA 2IYRA 2J3EA 5CLLA 2GJ8A 2IWHA 4CVNA 5EP4A 2FH5B 4PR0A 1S96A 5J4KA 5FL7A 2GEVA 1E4YA 1H8HD 1TL7C 2QENA 4A0HA 3EX7C 2Q3HA 4B48A 3BORA 1JR3A 1G19A 2W0MA 4K46A 4B35A 2A30A 2VBCA 2Z6VA 4HAWA 1G8HA 1W48A 5AUQA 4WVFA 1PZNA 1FNMA 5B58C 5SZKB 4B47A 4LBWA 1FMJA 1OXUA 2WOJA 4R98A 1KNXA 4HLCA 4LYFA 2AKAB 5TB5A 2R6DA 4MRRA 1G3IA 1HY3A 3PJRA 1Z0KA 3QI2A 1ZBDA 1U9IA 3B9QA 4NYMQ 2JJ1A 4IDPA 4Q4AB 1EFRD 1JNYA 1KAGA 5BW8A 4WIAA 4X8MA 1NN3A 4DCUA 3ZGXA 2ZPTX 2QA5A 4HUQB 1YQTA 2F1IA 4NMMA 1W2GA 5K8TA 4WZBE 4KSCA 5FTNA 4NYIQ 4H9GA 1JR6A 1E9SA 2W2TA 4L9WA 5CM9C 5F9HA 4JZKA 2PMKA 1IY1A 2HLDD 4C7OA 3K09C 2P0EA 1I4TD 1OT3A 2FEOA 2GRJA 3AUXA 3RS7A 2H5EA 1E32A 3D3QA 1Z0AA 2RGGA 1CR0A 3CZPA 2XNDD 5FTKA 4CIDA 5GVSA 1C9KA 4TMXA 3ADBA 3HU1A 2O0HA 1M7BA 4Q4HB 1E1QA 4URVR 2PCJA 2GTPA 2SHKA 3LVQE 3MJHA 4JMPA 1XU4A 4OI4A 3VNUA 1Z2CA 3L0IB 2H17A 3CF6R 2CVHA 3UWOA 4A6PA 1PJRA 4H1UA 3DZ8A 4D82A 1TPZA 4DEXA 2ODWA 3GEIA 5FBWB 2OBNA 5CLQA 3ZDQA 5KPJA 1N0WA 1P2VA 1GRQA 2E1RA 3RRNA 1TX4B 2P5SA 1VG8A 2AL7A 3RS2A 2VH5R 1M34E 5ANRB 4TMVA 4AG6A 4XH9B 5B30A 3SNHA 4XWKA 2OBMA 5IHPA 5AK0A 2WWHA 2JLSA 3EAQA 5DHAA 2BDTA 1I4DD 3K0EA 2RGBA 2BM1A 3NC1C 4DCTA 3IIMA 3GLHB 4TT3A 3HPRA 2QGNA 2RGXA 4GOJA 4TQUS 2XTZA 3UMFA 2QQ0A 2QP9X 1KJWA 1OXXK 2CMKA 2RGNA 2XZOA 5FUYA 1ZM4A 4JVMA 4B3CA 2GXQA 1CS4C 4RY2A 2Z43A 4L4UA 2IHBA 1XCGB 2FPKA 2DY1A 2GDJA 1CJUC 1S9DA 5L8VA 2GBLC 1UEJA 3QSYA 2IS1A 1VG0B 3UK6A 1NMXA 5EXTA 3EC2A 1N5LA 5A5GA 1E2EA 3A4NA 4PZZA 3H1TA 4Q1DA 3A58B 1ZD1A 4HB2A 3DO6A 1NG1A 1G64A 5A0FA 2W6JD 1RW4A 4M1SA 4BRWA 2KBEA 1U2RA 1ZD8A 5CJ2A 2ZVQX 4B73A 2B8TA 2Q3FA 3OIUA 4MDFA 1UFQA 1OB2A 2ECKA 4Q1FA 4ILEA 3KJHA 3GLIB 4NTZA 4EQ6A 4UKDA 1ZUHA 4YMVA 1KSHA 3QE0A 3DMNA 5AUPB 1IOZA 3GLGE 1NKSA 1Q44A 2P3SA 1NBMD 3DVLA 4R7ZA 2YKGA 1FX0A 3A1TA 121PA 2GA8A 1G8YA 4TTQA 1ODFA 3AKDA 1KI1A 1JXMA 1RRGA 1AQUA 1NI3A 1NJGA 4CEIA 1E9AA 3MFYA 2VEDA 1TNDA 4FN5A 4B33A 3C4JA 2OT3B 4KJZA 4PO8A 4B3BA 4PPQA 4RJLA 5JRZA 4WXRA 2HEIA 3SYKA 4A0RA 4IVPA 3SJAA 1JEEA 4XVQA 1OXSC 4B43A 1X8LA 4D4KA 2BJVA 2H16A 4XVRA 4TLDA 3SJBA 4BUJA 2ZRMA 3D8BA 1XD2A 4L16A 4QM7A 2IEZA 1WCV1 4Q4LA 2IYUA 2GILA 1S3SA 4MRSA 3V9PA 1AGRA 621PA 2AWOA 1QHGA 2DR3A 4NYIR 4DB2A 5G3ZA 4ZKDA 2IK8A 4WOPA 1RRPA 5JCPA 3JZMA 3DOEA 2YWHA 3W34A 4BFTA 1Z07A 1GFIA 1OXTA 1P7CA 4Q18A 4KVGA 5FPHA 3J81k 2VHJA 2ZAMA 2ZSBA 4GT1A 1TF7A 5D3QA 4DCSA 1HV8A 3F5FA 4EPYA 3CX8A 2A5GA 4ERNA 5F3WB 5K8IA 3LX8A 3NHAA 4MGYR 4BLQA 3FMPB 1GVNB 1AM4D 4DBLC 2XJ9A 3QIAA 4C30A 4F91B 2BWJA 5P21A 1OH5A 2FE4A 1DELA 3FGNA 3B8HA 4US2R 4PZLA 1SVSA 5FOVA 4TSFA 4C4PA 5FUVA 4IJMA 4Q1BA 2JEOA 3L2OB 3RSLA 4DSTA 5JSZB 521PA 3VKWA 1H65A 1UAAA 3UG7A 4NU0A 2YNMA 5BYJA 3U2QA 3H4MA 1YHNA 1Z0IA 3GMTA 2EWWA 1MO6A 2O8EB 4MGZR 2BOVA 1CKEA 3THXB 1LFDB 1S0UA 4BLSA 1Q12A 2EVWX 4LJ7A 1TADA 2YZ2A 2A2ZA 3B5JA 3VAAA 3EPLA 1US8A 2GK7A 2IYQA 3KL4A 1CF4A 3UXMA 4TYYA 1NMZA 2PL3A 5EZ5A 4DCNA 5FL3A 2QMHA 1P61B 4KO8A 1SVWA 3IBGA 1FPMA 1KSFX 2CCJA 4R2HA 3OEHD 4OQFA 2ONJA 3I92A 3B1VA 2JLXA 3DL0A 5IK2D 2R9VA 2RB4A 1IXSB 2CVFA 2VP4A 1OFTA 4URYR 3FWYA 2PX3A 4B2IA 2GVZC 4OQXA 4KVAA 1VPLA 4A36A 2QQEA 2ZYWX 3L0PA 4PC6A 3T5GA 2C9CA 2EFCB 3CR7A 4M1MA 1K6MA 2FFAA 3U44A 4FMDB 1AZSC 2ASEA 2GWHA 2XEXA 1TUEA 5FTMA 4A2PA 3L8YA 5E7JA 3W3ZB 2FZ4A 1U8YA 4NL4H 3SI7A 1M2OB 2PZEA 1F2UB 1EWRA 1AS3A 5CYPA 1G6HA 3VTKA 4B44A 2WAYA 2QP4A 1NP6A 3EW9A 1VCIA 1AA9A 3BK7A 5DN6A 2VHTA 4EFLA 1NSFA 2BEJA 4D0GA 4KODA 5E95A 2AHOA 1N6NA 2V7QA 2ZR0A 2R6GA 2W6IA 1OHHA 3NKVA 2WPDA 4MGIR 1P62B 4ZCMA 1E2QA 2AK2A 4DSOA 5JJKA 1DADA 3EA0A 4Z54A 1T91A 1IJEA 2CE2X 4M1YA 4O2LA 4QNRA 5SZJA 2IYYA 4Q7LA 3AF4A 3ETLA 3HR8A 3U7FB 1RRCA 1MRSA 3CPHA 4GFDA 3REGA 1R6BX 3A36A 4F4CA 3QXJA 1EFHA 4D0LB 1M7HA 2BIFA 3AM1A 2IXEA 2BBOA 1MABA 3R8FA 1P9WA 1Z5ZA 1XWIA 1E79D 2HCJB 4BFVA 3AH8A 4G3XA 4V0NA 3IPXA 2VTKA 1Z6YA 4BFWA 2RGDA 2QN6A 4TQAA 1S9HA 1UBCA 4LV8B 4B3XA 3NH9A 1VG9B 2ZS9A 4CF7A 5JWRA 3CONA 2ERXA 1Q20A 2I3BA 2OE2A 4LRWA 5DHFA 3NXSA 3QQ5A 2IUUA 1ZINA 2CNWA 2RGNC 4P4TA 1T9HA 3VR4A 1FOEB 1MO3A 1UKZA 3KDSE 1XEWY 3NBFA 3U3RA 4FCVA 5JZVA 4LHXA 3TW8B 5GVRA 2XTMA 5DISB 1JAIA 4AC9A 3I32A 4XVUA 1XZPA 4PXAA 3CPEA 3E70C 3SS8A 5C4GB 1TQ6A 1GWNA 1T3LA 3QKTA 2QAJA 2B6HA 4KYIB 2VRWA 2EWVA 3THYA 4YXWA 2F3RA 1LVGA 2YWFA 2DWPA 5L3SA 3Q5DA 2IC5A 2ZI5A 2VL7A 4ITRC 1R4AA 5LDDC 4TYPA 1DE0A 4MH0R 3KKMA 4BE7B 1NIJA 1DARA 3CF0A 3SU8A 1P73A 3UIEA 2Z83A 3DPUA 1UDXA 2QE7A 2RHMA 4TLCA 4A92A 3I4LA 1JR3D 2G0NA 1RFLA 1BO6A 2WSMA 4JLNA 4LZZA 2DFTA 3TVTA 2R6AA 3DHWC 3QBVA 4X8HA 3TE6A 1EXMA 1QRAA 3M0EA 1U0JA 2A5YB 2J7PA 4EQ6B 1KMHB 4ZI3A 1MKYA 5JWHA 3RRZA 3GEEA 1UEIA 2BC9A 1TTTA 1T8UA 1FX0B 3QXXA 4ESVA 1D9ZA 4KBFA 5LD2C 4HLUC 4NYJR 4GPTA 1FL9A 221PA 1IN7A 4LPSA 5K8UA 1CR2A 2JIZD 3SEAA 4NHOA 2B7BA 3BIFA 4OJKA 3TUIC 3IGFA 2F1RA 1T0JB 4CEIB 4Z8YA 3VU9A 2JDIA 3QPWA 2VHCA 2ZYUX 5GJCA 4OHZA 3T12A 2OLJA 1Z6XA 4QKQA 1SGWA 2IXFA 2R6CA 1KO7A 4CZ2A 4DLWA 4TL6A 5C46F 3HP1A 5EXPA 4I81A 3BGWA 3FPAA 1XXHE 1JEDA 2VF7A 2ODBA 4KFUA 1XD2B 2ZRKA 3AB3A 2KWIA 1E1QD 1D2MA 1N6IA 1FUKA 4A2QA 1OV4A 1R2QA 3VFDA 4YDSA 4GZMA 1YZKA 1BMFA 2JJ8A 2N42A 3HU3A 5F9FA 3WRYC 4DC9A 4IDHA 2G77B 3AVPA 4G5OA 2IYVA 2VP6A 2WVJA 2HV8A 2R8RA 1R0XA 1L2TA 1W4RA 3WBJA 4QOSA 2CCGA 2F7SA 4JVSB 2VSOA 5EP2A 3CX6A 3ZJYA 1CJMA 2BMDA 4RD2A 2IYSA 5AUOB 4CW7A 2IS2A 1GITA 3QUSA 3RNLA 3U7GA 2FN4A 4LGMA 2O8FB 3DEFA 2O8DB 3KXIA 3IPYA 2NO9A 2F6RA 4Q7MB 1XJQA 2I1VB 3CB4A 1ZNYA 2VSFA 3PUYA 1TF5A 4UNPA 1OIVA 6Q21A 4BWYA 2ZTSA 1LNZA 3TMKA 4AK9A 5FOSA 4B2LA 4MRPA 4QGGA 4NKRA 1S2MA 3IBYA 1BYIA 4PANA 4LSGA 3A4LA 1ZW6A 2QTVB 2ZE8A 4JL5A 4LWZA 1YR7A 4HB4A 3IIKA 4Q9HA 5JCZA 4XTCS 2F9LA 1QHNA 1VMAA 4GI7A 3AQ4A 2ZU6A 1XEXA 2XB2A 4LC1A 1NN5A 4YMUA 2P5TB 1PUJA 4IRUB 4K81B 1TU4A 2J0UA 2WSSA 3QKUA 1NKTA 3SBDA 2UVQA 1X1RA 1JAHA 3LBHA 2GXAA 3K8YA 1OH6A 4DSUA 3UWKA 2BBSA 2KB0A 3PCRB 3UPUA 3ZVNA 3W3AA 2VSXA 3RS5A 3GFOA 1CR4A 2HYDA 2IL1A 3GJ4A 3Q85A 3BWDD 3I8SA 1WXQA 4BZXA 3MWLA 1FW6A 1YZTA 4Q7JB 1E9DA 3I5YA 4M22A 1J90A 2QMEA 3IEVA 2DFNA 2FGJA 5K8LA 1GSIA 5HE9A 3SC3A 2WJYA 3U44B 4KFSA 3KTAB 3RANA 4CEHA 1QDEA 1GUAA 1VDZA 3DM5A 1UM8A 2CXXA 1NBME 4Z51A 5FBQB 4URUR 4XOIA 1OKKA 3HYTA 4FD2A 4HDOB 3KJEA 4JLVA 1NL3A 2ZRFA 4PSVA 2KBFA 4OK5A 2DB3A 3O8RA 2ZI9A 4ZV4A 1Q1ZA 2FV8A 3MUFA 4URZR 5KOYA 2FF7A 4GMDA 3SE0A 3ICEA 3CRW1 5KTYA 5H70A 3L0OA 1A2BA 3B9PA 3QF4B 2WV9A 1SVKA 1Z0JA 4C0QC 2VP5A 4N1AA 2IS6A 3IKJA 3B6EA 3C5CA 3K9HA 2X19A 3DKVA 2FOLA 1R10A 2QTHA 3RABA 1UKYA 4BGDA 2QPOA 3GFTA 2EW1A 5HPYB 1SXJA 3FFAA 1CR1A 5BWMA 2ODEA 3IILA 4OHVA 2REOA 5BN4A 2GK6A 5FOWA 2C2HA 4QNMA 2O0KA 3PQCA 3RRMA 1XTRA 4HAXA 4HYYA 2HJGA 4Y0AA 3B78A 1W7AA 4BASA 1HH4A 1E9BA 1FFHA 2CJWA 2Q9AA 3LW8A 3U3MA 4D2IA 3P32A 4N3NA 3NC0C 1G5PA 4F92B 3BRWD 1Z83A 5KU1A 2V3CC 3OIWA 3EG5A 2FWRA 4YMTA 1J7KA 3VR6A 4HSEA 4XWOA 4LJYA 3PEWA 2EFHB 4XWAA 2HUPA 4UNRA 3I5XA 4CEJB 2BV3A 2RGEA 2QM7A 3RDPA 4ZI2A 4C0AC 4RZXA 5GJVC 3JVUA 3GLHE 3GJ0A 4RFSA 3RS3A 3B85A 2P2LA 1YRBA 5LB2A 2O52A 3K0FA 5AWFC 1KJYA 2CDNA 3AF2A 4BQSA 1PUIA 5J4YA 3D6TB 3KKQA 5CYOA 3GLFA 2IA5A 3HDTA 1NLYA 4LV6A 3OIYA 4CT4B 1E2JA 1E69A 2D06A 2O0JA 1MO4A 5KYKA 5L3SB 2Q9BA 1NLFA 4DB4A 2ZE7A 2Z0MA 1E2KA 4S35A 3KUCA 3MGCA 4DCVA 2JLVA 1E0AA 1IAQA 1G8PA 2J1LA 5IT5A 3P20A 3LRPA 2VF8A 4PFSA 3CRMA 1ZU5A 3SOPA 2GF0A 2PLRA 4PO9A 4IOLA 5J47A 1K5GA 2OAQ1 3EZ7A 4ASUA 5FTLA 1KKLA 5IF9A 1G6OA 1XCMA 3W6OA 3GLIE 1KI2A 1SKYB 2NGRA 1OB5A 1XX6A 3EIQA 2WHXA 2ODNA 3Q9LA 3B1ZA 4LCBA 3TSZA 3IO5A 4DSNA 1SVOA 3ASZA 3EZ2A 5FOXA 4TL9A 4DT1A 2AFIE 1J99A 1WF3A 3OEEA 3QPVA 4Z8XA 4URXR 1E0KA 1P9RA 2EFEB 2IW3A 3CBQA 4JLDA 4MKIA 5DO9A 4GL2A 5DN6D 1GKIA 4BECA 4EPRA 1YZUA 2V1UA 2ZRDA 1OJLA 2PMDA 5F98A 2V7QD 3AVXA 1UF9A 3HU2A 2OCPA 3IHLA 1MO5A 1HT2E 3UMRA 2WM9B 3G5UA 4PC1A 2WPDD 3MG9A 1GKYA 2OESA 4MDEA 1W0KA 2G0TA 2FNAA 4IXNA 1G8GA 2J45A 2J0VA 2Z4SA 4KAXA 5FBLB 4YONB 1G4UR 1X1SA 3DKPA 2V55B 5H68A 3UANA 1CEEA 2CK3A 4TMZA 1Q0UA 2CL7X 4V0KA 1OSNA 2DHRA 3FOZA 4UJ5A 4KXFB 2FX3A 4LK2A 1XEWX 5EUMA 4E03A 1E96A 1RJ9A 2RGAA 1GRRA 3PUWA 2P67A 2FZLA 2QY9A 4ZCLA 2H57A 3UG6A 2G6BA 4LBYA 4BEJA 1DAHA 1BIFA 1SVLA 2OXRA 4AI6A 3QKRA 1U8ZA 3P27A 3LDAA 2O8FA 4IW3B 2PEZA 3ZZTA 4IOMA 4L8GA 1Y63A 3EZFA 1XRJA 2QP3A 2A3RA 2GEUA 4O3MA 5LPNA 1EFCA 2CNWD 2GESA 4NONA 4IOJA 1SVMA 2J9RA 4G01B 3Q7QA 2PZGA 3K9GA 3RS0A 1XNJA 1G291 4DDVA 4GNKA 2W2VA 2J41A 4KHZA 3GLGA 1G41A 2PH1A 5JECA 2XSZA 3ZS8A 4EIWA 3K9NA 2XZPA 2PT7A 3KJGA 5GJBA 1G20E 1N2CE 1RYFA 1N6HA 2ZRGA 1UKEA 3TQCA 4DZZA 4GMXA 1LW7A 2ZM5A 4MA4A 4YXWD 3AVOA 5DLQC 3BFKA 1EX6A 2FFBA 4AYXA 1U0LA 1XTIA 2ZEJA 1XEXB 1NN1A 3NBYC 1UKVY 2OILA 3U3JA 2XTNA 2B92A 3TGPA 4G5GA 4O0MA 2G3YA 2QE7D 1W0JA 2Q0HA 3ZVRA 4OK6A 1O3YA 1T3SA 5KHOC 2RCNA 3MLEA 4A0GA 2LWIA 1BS1A 2J7PD 2IYXA 1JR3E 1YR6A 1LY1A 3RVBA 4Q9IA 3T06B 4JLMA 4EUNA 2EQBA 4NCKA 1DG1G 5JI2E 3ASYA 1ZVQA 2IEYA 5CK5A 1XF9A 4M9ZA 5AR1A 4BFSA 2FMXA 1E1RA 2QT0A 1ONBA 3N70A 4JBYA 4M0LA 3CUEF 2J0SA 3SR0A 3UKDA 3QENA 4G5RA 1GL6A 2MSCB 3QKSA 1WBDA 2IXGA 2QAGA 4JT4A 2F1HA 2ZANA 1D2EA 4EFMA 4JLOA 2GCPA 1J2JA 2ATXA 2P6UA 1HEIA 4G0NA 3WP0A 2NO1A 2QPTA 3PXGA 3X1YA 5CDFA 1IXZA 2JA1A 2ZI7A 4II7A 4D6PA 3NBZC 5HE8A 4UXHA 2RAPA 5IRCD 4QXAA 4TYQA 3AP2A 1SXJC 4WBSA 5IDVA 1PV4A 4KI0A 4ARZA 4A15A 2Y8EA 1NY5A 2JGNA 3L0SA 2YINC 3I8XA 3GJ6A 4EPXA 3SZRA 1F60A 4FINA 4WZ6A 1II8A 1SXJB 2OSBA 4DLVA 1VCNA 3CH4B 3FVQA 5DNYB 3PUZA 2V6IA 4K8OA 3MAAC 1HUQA 3B2EA 3CIOA 4Z1MA 2FU5C 1ZM7A 1N5IA 3R9IA 2H1LA 2CJWB 1XMSA 3AEZA 3ZIAA 3IEUA 1N6RA 4PHFA 2V4ZA 3GJ7A 5TXGA 4XD7D 4OQMA 2QUZA 3FKQA 2FFHA 3AKYA 1BKDR 4F4JA 1VECA 1VYVA 2ANBA 2P65A 4LHVA 2F55A 1U98A 3EZ6A 1RZ3A 4IDQA 2XXAA 1FTNA 1E2LA 3RC8A 3N2EA 3UATA 4KFTA 5AJZA 1Z29A 3VR2A 2JLZA 2OUKA 3W90A 2HXSA 3K0FB 4NH0A 3QBTA 4KV9A 1ELOA 2IWRA 1Y3AA 3GPLA 3KFXA 5J40A 3Q3JB 3QG5A 4HB3A 3B7GA 2R2AA 4A6XA 3NBXX 4D80A 3GLFB 4AY2A 4A8JA 2OFWA 4JYBA 1IY0A 3P4XA 3SJCA 2JLYA 1VCMA 1KY2A 1G3QA 1YVDA 2WOOA 4ZPXA 3NEJA 4NE2A 4NP6A 2R62A 2BKUA 4OHWA 3VX4A 3GJ8A 3I73A 1BOFA 4FI3C 4JL8A 3PITA 3X1DA 2KE5A 4ABYA 4QBGB 3AV0B 1VCOA 1NG9A 5FBRB 2JLQA 2GXUA 1P2UA 3LQRA 1KTVA 1P5ZB 2WICA 4U02A 3NH6A 2DFKB 2QI9C 4PQRA 5FH9A 1GZSA 4DEYA 5L3QB 3AVTA 4IVQA 1CTQA 1ZCAA 1IY2A 1SZPA 4DRZA 2ZRNA 4JLJA 4DLZA 4EPTA 1D9XA 1A82A 5J4HA 2FJUA 1FQKA 3MJRA 3SHWA 1OKKD 1CXZA 5BYKA 3OE7A 1XMJA 1DAIA 2TMKA 3QEOA 4AKGA 3IUYA 1L8QA 3AVWA 3OAAA 1CULC 2QMOA 1AKEA 2AN9A 2HJVA 4NYJQ 1AS0A 3FFBA 2ZSEA 1Q1EA 1U9IC 4LI0A 2KSQA 4C0JA 2GCNA 1Z8FA 4LC0A 3EZ9A 1D5CA 2E87A 3RWOA 3VMFA 3BAFA 1JALA 4ESHA 3FHTA 4G1UC 1Z0FA 2PJZA 4HZUA 3GEHA 2Q21A 1QZXA 1ZC3A 5JLJA 4JIMA 2W2XA 4PC2A 4DWJA 1HE1C 4F93B 1LF0A 4AG5A 2OFXA 4BLTA 4B3DA 4HEJA 5DIFA 3AKCA 3ONWA 2GJSA 1G7SA 4M9QA 1QHSA 1SXJD 4WXPA 1T5IA 1UBGA 2GVDC 2AWNA 4FXPA 5G41A 2V9PA 3VR5A 3VNVA 2V54A 1R0YA 1RJ9B 1E2DA 3B82A 1GOTA 1NJFA 2OBLA 2F43A 4GSYA 3KJIA 4DHEA 1DBSA 3WMFA 5JHGB 4C7OB 3HWSA 3QKRB 4Q02A 1NN0A 5KDLA 4L15A 4TQ9A 3U60B 2OXCA 2WWGA 3DMDA 5D3MA 5HCIA 1D8TA 4FMCB 3AGQA 1T4GA 5GADl 2ZYTX 1U0HC 5SZHB 2N46A 2YC4C 3EASA 3PENA 3SFZA 4YC7A 1W5SA 2JJ2A 4UNNA 1Z06A 2BCJQ 4R9UC 2GZDA 3OZXA 1OW3B 2IYWA 3SN6A 1GKUB 2FFQA 3IQXA 4PC3A 1NLZA 3I3SR 1GG2A 4UXJA 5EXSA 3QY0A 2AR7A 5DI3A 2YJTD 4IOKA 3CWQA 1F5NA 3KUDA 2O8BA 2ZUDA 1OFHA 1OYYA 4BFYA 2ZJYA 4M1KA 3VX3A 1Q21A 2QG6A 2Z4RA 4D26A 4HUTA 1II0A 3JZAA 5L3RA 2YHSA 3T61A 4YMSA 2NO0A 1J70A 2E9SA 2QROA 1XXHA 4QG7A 3L43A 2ZJBA 2DWQA 3QXHA 4D0NA 1F2TA 4RZ2A 4MKGA 4PHHA 1JJVA 1KIMA 4RFVA 4ASUD 3THOA 4QGFA 1JECA 1CJVC 1KZGB 3RS4A 1H8EA 1EFTA 1MH1A 1E6CA 3QNUA 2CHVA 4OBEA 3MD0A 1HT1E 3W6NA 4QJ5A 5M04A 4CDGA 1FZQA 1E99A 1VYUA 1W4CA 2L0XA 3OFNA 1AQYA 2D62A 3TBKA 3FHCB 2QAGC 3U4QA 721PA 2PX0A 3LV8A 1GTVA 1W5TA 4KITB 5FL7D 4U5XA 1JQJC 3Q7PA 4Y0VA 4DDWA 1SKQA 4A4DA 1G3RA 4I1VA 4OHXA 3QXSA 4F7WA 2OLKA 3PUVA 3QKSB 1M8PA 4QC2A 2IUTA 1XTJA 2ZS7A 1E2NA 3SYNA 4UQOA 1W0KD 3K0AA 1ZUNB 2JASA 4GBMA 3NEYA 2CK3D 5KDDA 3V4RA 4PPFA 3TVDA 2W58A 4P33A 2JJ1D 4G5QA 1WRBA 4O25A 3C7KA 3BC1A 3I62A 3KQNA 4ARZB 4MKFA 1G16A 2OG2A 2K5UA 2GXSA 4BFXA 1QG4A 1CU1A 3RLFA 4Q19A 4A2WA 3BOSA 5EQTA 2IHYA 5CIWA 2QZ4A 3TNFA 4M21A 2C5LA 1II8B 3BH0A 4E07A 5LD2B 5CM8B 3K0CA 1W49A 1X3SA 3P1JA 2OAP1 3QVVA 1N0UA 1TQ4A 3DDCA 4JLPA 2O8CA 1NRJB 1ZM2A 3NTUA 2X77A 2HXYA 2G9NA 1YR8A 4QBFA 2X2EA 3WNDA 3R9XA 3WXMA 1KK0A 4MKHA 3LFUA 5JEDA 1DEKA 3BB4A 3H84A 2J0QA 2YV5A 3K9LA 2GAOA 4OI0A 1XTSA 2CHQA 2XSZD 4FCWA 4LV5B 3D31A 1XMIA 4C2UA 4OI1A 2QM8A 1TQDA 4A8JC 2WJJA 4ZKEA 1WA5A 1DG3A 4M9SA 1XFAA 2VQSA 1DAFA 1OIWA 3ZLJA 2I1QA 2JLWA 2I4IA 5EE3A 1EG7A 3KX2A 1ZUIA 4GZLA 2QL6A 4Q4AA 5KSYA 2ZSFA 4HATA 5AJXA 1D6JA 3NDBB 3KQKA 1ZAKA 3IIJA 4A8JB 1KK1A 2HYIC 1W44A 4HUQA 3C5HA 3PEUA 5FPTA 5EJEA 4D25A 1E2IA 3T5DA 4TT3D 4JLKA 1A1VA 3O8BA 3LW7A 1EGAA 1W0JD 2FA9A 3A6PC 1B23P 2VA8A 4AD8A 3AGPA 4QHTA 2A7QA 2GETA 2VHUA 3S1AA 2J46A 1QHIA 3A1SA 5TY0A 1FTSA 4DVGA 3A1UA 3KQHA 1EX7A 4PPNA 2AK3A 4Q4HA 4X8OA 5FPSA 3K0SA 1P4SA 2ORIA 4TTRA 1US8B 1YR9A 2W00A
chains in the Genus database with same CATH superfamily
2XIJA 4PW0A 3QLVC 2IIQA 2PHZA 1SZDA 2LE0A 3GLVA 3P9KA 1YZGA 3KT8A 4FNOA 3BMXA 1B6RA 3W04A 4U2KA 1N5KA 1M74A 4WXHA 3H83A 4AWAA 4B76A 4EF5A 5JG7A 3MHTA 1M2KA 2FXVA 4HN4B 1CYDA 2HLPA 1B43A 1YZQA 4NCHA 4IMJB 4XQGA 3UGKA 2WILA 4ZQIA 2YDYA 3U4AA 2WKPA 1IM2A 1GJRA 1IHUA 4Y2TA 1DAKA 2F8TA 2I4OA 1F4LA 3MCUA 4J7AA 5FYQA 5AW3A 5IEBA 1EJ0A 4AMUA 5IVKA 1YS1X 1M1ZA 3L1HA 3D81A 3NNDA 2I6XA 5BT8A 3RBZA 2GBPA 1W88A 4ZDKA 1EKXA 4MIKA 1FBTA 4HLDA 4WCFC 1JIXA 2JLUA 1OBCA 3L82B 1P75A 2HA2A 2YY5A 5K1ZA 4Q5IA 1P0CA 1OILA 1KEUA 1HSOA 3L05A 1J8VA 2NV2B 3IHKA 1ZNWA 4Q48A 1SELA 3B7PA 3D2BA 2Y1GA 2OVBA 1SRRA 4IDOA 5FQOA 4NRDA 2HZBA 2WD9A 1A8SA 1U3DA 1YRAA 2PG3A 2XXJA 3C3BA 3G59A 4E2YA 1PNQA 2ZJZA 1ECLA 1DTWB 2C5BA 4V0MA 3OT5A 1F8XA 2CYCA 2HMTA 4D0SA 1XBTA 4G9GA 3HGQA 5DYIA 2RARA 3CPJB 3DTNA 4HWSA 1FNBA 1I32A 4JD5A 4CYMA 2TYSB 1P2FA 3ECAA 3C16C 4EFNA 3HY4A 1MN6A 3V8VA 4RLHA 2Y27A 2OCYC 2CDRA 3L7MA 2GFHA 3EVNA 1G9TA 4JDPA 3VOTA 3H5WA 1I7NA 2DECA 3AG6A 4WY2A 2VRBA 1JI0A 4P3XA 5I7WA 4FNAA 5K20A 3AHJA 3ZCQA 4I1IA 2GBLA 2Z9DA 2ZSAA 4Q7QA 2ZDGA 1XZLA 3FUWA 2F17A 2W6PA 4QTZA 4YFVA 5F5LA 5D7BA 2CE7A 2R48A 4N9WA 4GP7A 3DLAA 3BK2A 2X4IA 2EW2A 4INJA 5EE0A 1XALA 4F7DA 3I2KA 1Q22A 1ORWA 1UBLS 3OKFA 4RSHA 4TTVA 2PUGA 2PGJA 3O6VA 5BNWA 2CXTA 3INNA 1JYSA 2V6JA 1KJ8A 2D5CA 2WFLA 5IBRA 3UQZA 2B4TO 5EJAA 1JKXA 5TV2A 1DXOA 4I9NA 1A7UA 1UBUS 2WM2A 3O1JC 5AM1A 3A2MA 2BFOA 5DP2A 2C95A 2VDUE 2ZAGA 1JZQA 2D5IA 3N2IA 2FK7A 4FJ1A 4JFAA 1UMDB 4TSFD 2NZWA 2ZKLA 3JV7A 5A7GA 1HR0B 2MOKA 5B2ZA 6NULA 4MUBA 5HOQA 3KZKA 1Y8RB 2YUTA 5CJPA 2Q62A 1WB4A 3U3KA 1PNVA 3PJEA 4XX0A 3G68A 2CDBA 2BCGY 2Q1YA 1K9VF 5DSTA 3P71T 1Y7IA 5AK3A 4CKWA 1E5LA 3U0BA 4N0QA 4CV0A 3CW2A 2PYIA 2R25B 3T5MA 2IFTA 2XAAA 2A0KA 2OB1A 1L7VC 3H3FA 2MMCA 3D7LA 4H31A 4AU1A 1C7IA 2H2IA 4CKCA 2G1KA 5CT4A 3A6GA 2UUPA 1E98A 4FX2A 1DBWA 4W5HA 5K0TA 4DV2B 4MUEA 1O87A 5BSFA 4POAA 1S8NA 1SQ6A 3G2KA 2IYPA 2B4AA 4YRMA 4JDUA 5DH9A 2H7VA 1N5MA 1LBIA 1GYQA 3MTAA 3Q4GA 3A11A 3COVA 3ICPA 1YQQA 4MUHA 4LVNA 3DFZA 3QK7A 3GCGA 1BXRB 3G0OA 2W42A 5ALZA 1E79A 4GDFA 2O19A 4KE8A 3SC6A 5HILA 4D4LA 5BQ5A 3CY6A 4I1OA 4EGCB 4TVSA 1WD7A 5GV7A 4OXRA 3C3YA 4NCNA 2WTXA 1IH8A 3D1LA 3MYYA 2LRHA 4G1CA 3PQ2A 4M0PA 3AETB 1DKLA 3FCOA 4RYLA 2NVUB 1USKA 4QXQA 2CLSA 3ZVLA 1CEEA 1BC5A 4LJAA 2PGOA 4F6LA 3NONA 4MCHA 1FXSA 2CCKA 4BDTA 4IAOA 2C77A 4ECAA 3K0CC 4PYNA 5B2EA 3R23A 1M34A 5K2OA 4ME6A 2ZRCA 3VR5D 5KU7A 3WAGA 4XWTA 5C5IA 4LYAA 5CD1A 5EFOA 3G5MA 5ALRA 1TEVA 3FWNA 1A5TA 4RKFA 1LB1B 2VTDA 3L7KA 3NAZA 3PHCA 2W48A 1MT0A 3AL3A 3U4IA 2OYRA 4IIUA 4QHSA 1N8KA 1TF2A 4HX9A 3UMJA 4QU0A 2LXNA 3VYVA 2O8CB 2HGZA 5HIJA 2EHJA 5LA6A 4IFBA 4RJIA 4IH9A 2BGMA 2O2HA 2H1CA 3SE7A 1CETA 4HNVA 3NFRA 5EIOA 3FYHA 3VR0A 2WJVA 4R51A 2CXOA 3IQHX 4LF4B 4Z3OA 1QU2A 3EEYA 2NVWA 3M4NA 4HS4A 2XMQA 4P22A 3W5CA 1TZMA 1KFEB 3DOIA 3PHJA 4LQDA 1NYLA 3V4ZA 5JBNA 1HM5A 2FW7A 3Q8LA 1N5JA 1E3IA 4V1CI 3RT1A 2AB0A 2XMPA 1NU6A 1HLPA 4FDAA 3SBOA 3ZN2A 4EVQA 4P7JA 2B7CA 3GZNA 3TH5A 1QIEA 4FFBB 5C2JB 3HK2A 2ZB3A 3QJYA 1QJ4A 3B8EA 3K9BA 4BVHA 4XWYA 4UM8B 4ER0A 2QM3A 3W8FA 1BDIA 1U28A 4YQYA 3I9FA 4QLOA 3I9NA 3M3PA 1KAOA 3IPAA 1QKJA 3X2EA 3WQSB 2IBMA 3DDOA 5EP1A 5F3DA 1JS1X 1NJ2A 2JIZA 2OKCA 1KK2A 4H27A 4TSKA 3WL7A 3GMIA 3NHLA 4RTOA 3RUHA 1I2MA 2H1HA 1QCZA 4QDJA 2SNIE 2ZBQA 3TRFA 1DWPA 1DIBA 3KR9A 4ZO6A 3TR0A 5KSPA 3PJGA 5CDHA 5IMSA 4O4JF 1TYDE 3HSYA 3NDPA 3IXQA 1QH8B 4Q1AA 5EFZA 1R6XA 2CKMA 2GVNA 4B40A 3DZCA 1O8BA 1EGVB 2C99A 2DUNA 2HT6A 3CLTD 1YQEA 4EHDA 5CJJA 4BLOA 1JPJA 2WMOB 2XUOA 1Z0DA 3JPYA 2C4UA 3OU7A 4GIBA 3GLTA 4KMRA 3R7NA 4EECA 5JJIA 2UKDA 2X5XA 5ER6A 4J7XA 3TK1A 1XRQA 4XYGA 1CK4A 1LGYA 3MCAA 2DMRA 3A6JA 5G1PA 5I7OA 1DQSA 3BUSA 2I22A 4CG0A 5JCXA 2J0UB 4S0XA 5HKKA 3ZQJA 4CV2A 4JBIA 1GYRA 3CH7A 2GRAA 1KHTA 1OWLA 2CYBA 1HTBA 4HNRA 5E7MA 4Z3KA 4QQ8A 3W9SA 5HBRA 1KBZA 3KEFA 2R6FA 2XQJA 4KQJA 3WICA 4AP5A 4P9NA 2QMQA 3BWXA 3COSA 4E5VA 3D4OA 1HQCA 1DVRA 2OO7A 4C4RA 3U6BA 1OOEA 2FR0A 2A5LA 3LD9A 5T4EA 1AJEA 1H2BA 4DLUA 3S2YA 2Y0DA 1S3GA 3D3JA 4L5AA 1E4EA 4DXDA 4JOBA 4AICA 2VH1A 1DIOB 5AJHA 1KAQA 2ISQA 4W99A 5E6RB 5FYDA 3V9AA 1I8TA 4J90A 4IICA 4GP6A 4KSYA 3TBFA 3TLGA 4UEWA 3TW8A 2IYZA 2BKAA 3R3JA 2V8OA 2GCOB 3GH1A 4GBGA 5CU7A 4BWVA 1Z4NA 4FGUA 1NMYA 1KK3A 3S5UA 4Y9UA 1AVTA 4D9KA 1U0TA 4W5WA 4E22A 5DULA 2CN1A 1R37A 3MCZA 3BEOA 3TAHA 5CNJA 3ZCUA 1CP2A 3N76A 3MT9A 3MSCA 4LMRA 3FDFA 1TCBA 2WP8J 2J4CA 4Z0NA 4JX8A 3F8TA 4HFRA 7GPBA 5KJ1A 2DTXA 1PDVA 2ORWA 2WIDA 2FYTA 3HJHA 3Q0EA 3NGMA 3ZNQA 3QU2A 4BFZA 2NTVA 1PJLA 2P6RA 5A9SA 2W83A 4P3YA 4RHXA 4JBWA 5FWYA 2ZWIA 3P97A 2R85A 2G88A 4H7DA 2LKCA 3NTXA 3UM9A 2W7TA 2GOYA 5KDOA 4CM8B 4OHFA 3IP1A 1DKUA 3WYFA 3AU8A 1A4RA 1ABFA 1I14A 1GQQA 1RIIA 4FMDF 1P5RA 1UBEA 2BFBA 2I6FA 1SC4A 2PUTA 3N59A 1YR2A 5AW7A 4DR1B 1G2PA 4DGQA 3ETHA 1FCJA 1WCIB 4PAOA 4JELA 3KLPX 2QGZA 1MU0A 2RHTA 3EA5A 3VVLA 1WBBA 1PNRA 2H00A 4CN8A 1ZK0A 1T9CA 3VC1A 3VTAA 3X2SA 2CUZA 2MIIA 1DC8A 3ZX5A 4KOAA 1RWKA 2EIHA 4H7IA 4HDSB 1K6JA 1M3SA 3KXLA 3KLOA 1BQEA 1ZO8A 3BH7A 3OUUA 1FP2A 4NXMB 3JARA 3E8SA 2C7GA 2LR0A 3DAGA 2O6HA 3AVWA 1XDBA 2Z5FA 3JATA 4I1RA 3JYOA 4JJ4A 1II9A 1SCNE 3NU1A 4IX9A 4HQFA 3DBHA 1M76A 1CS0B 2LTAA 2OD2A 4LHZA 5I7RA 3DZBA 3O9ZA 3GLUA 3MMXA 1QTQA 2DPXA 3D5EA 1C3OB 4GQBA 3UHOA 2DAPA 5ALKA 1MAWA 1VMIA 1AIPA 3O74A 4RCZA 2E21A 4AKEA 4F21A 2OQRA 2H8KA 1S7GA 1OI3A 2ZRAA 4E2WA 4NYMR 1E3DA 5C9ZA 1ZXBA 1Z4PX 1XVIA 1NQTA 2AXQA 2LUOA 3JWJA 1J22A 2NZVG 4M8SA 4NCIA 4R3WA 3OKAA 3BRCA 3Q6IA 4R1LA 4RY0A 5GM1A 2UAGA 4HAZA 5IKXA 3R9WA 3O4FA 1ST3A 1PS9A 2ZJ8A 3GC6A 3OPYI 2C9OA 1JQAA 4BS9A 2IH5A 4MRVA 1K5PA 3VI3B 2WJIA 5LWQA 2BFMA 1RQPA 4AJ9A 4REMA 2W2MA 2HRRA 1RC8A 2OM2A 4BVJA 1C2YA 3Q3GE 1JTEA 4O2BB 1QX4A 3FY4A 4LSWA 4RK1A 5BR8B 2WJ4A 3O95A 1IZ9A 1Z15A 4FYIA 3R3HA 3DT9A 4KG7A 2ZIFA 2AUTA 3SS9X 1VPDA 2CEAA 3EIXA 3WGQA 1E1MA 3QX9A 5EIBC 4FYKA 5EMLA 4J2TA 3MK31 3A4TA 3DHNA 3SX4A 4U00A 4BWGA 5KQSA 2IX9A 2O8DA 4JSYA 2OO5C 2QGFA 1KDRA 2GPYA 3NYIA 4W1SA 5EWLB 3BSSA 1AG9A 1AQLA 5TF0A 4QT0A 2NOAA 5JU6A 4FHEA 1J1IA 3LF2A 4BV8A 1CVIA 1X8KA 1J24A 3HNOA 2PEYA 3VSCA 1LF5A 4UE3S 1PYGA 5CFOA 4G65A 3UGTA 5E9JA 3H19A 1XJ0A 2WWXA 3OJ0A 3EFEA 2Z04A 2AG1A 2QYTA 3CSSA 1WX1A 4HGOA 4U7JA 5EXEA 5FI0B 4MGHA 1T8TA 1XD8A 1O96A 5C8DA 2GI4A 4KIGA 4ZAWA 3HM2A 2CNDA 3PDJA 4IIJF 4BQFA 1MA3A 5TGZA 3K70B 1REQA 3GELA 1IUNA 5LKAA 4J16A 1I80A 7ABPA 3MMSA 5JBIA 1NR5A 2BT4A 2AI1A 1KJ9A 2PWYA 4KWHA 2GN4A 1ISSA 2FVYA 2P3QA 3NKLA 4G23A 4GEGA 4QSHA 3V4FA 3WMGA 3U4CA 4B7ZA 1AO0A 2ORED 1L5QA 1KDTA 2RH9B 3ESBA 3FDIA 5AHOA 4PSAA 4N7MA 5KINB 1KI7A 1DXHA 2AD5A 3E8MA 3MHPA 4X65B 1COWD 1M73E 2GEBA 4LRTB 3T5CA 1FNNA 1NVXQ 2ZUTA 4JI7B 1C80A 1HE5A 2BSQA 1SOAA 2CBGA 4LGYA 3VJMA 1NIPA 1P9NA 3IURA 4CL0A 1JQEA 4DDUA 1MR3F 2BZSA 4PXYA 1CUBA 4TUYA 4XFJA 5FLKA 1QAQA 4YTEA 3H13A 4FGLA 3UCEA 1RHMA 1U8EA 5JWOA 4MQFB 3UT5A 3DTVB 1JBEA 1TM2A 3CUYA 2R8XA 3GVHA 1G59A 4FW8A 1J25A 2DLCX 3U61B 3WV4A 5K0GA 4N0MA 4Z4HA 2C9BA 1DC4A 4WD3A 1TQ8A 2ZT5A 4BQOA 4DDTA 3KWJA 3PGA1 4V0LA 1DG9A 2ZWAA 4AX4A 4PQFA 1FSFA 3E0XA 4IMIB 5FI3A 4YYZA 1M72A 3EIWA 3FBGA 3PGMA 4KWIA 5FEUA 4K86A 3L7IA 2OPBA 2QBYA 1ORDA 4EYOA 5BP7A 2FLVA 4QPJC 3L77A 4PNHA 5KNCH 1PDWA 1NBEA 3PA6A 1SULA 2Q3BA 1JAYA 2WWIA 1LFAA 3HCEA 1BCSB 3K73O 1E18A 3MAJA 4H1HA 4PYOA 4MVJG 3PTAA 2H9IA 5L6MB 1XOIA 2PD4A 4KZPA 1U81A 3P2JA 4OLJA 4WZAE 4CDRA 4EKIA 5AD1A 3WLPA 4IG4A 2NQ2C 1M7GA 3ZHOA 2DUJA 3LH5A 1W2HA 5HJ5A 4QPDA 1QAMA 4KQ6A 4PSKA 1WETA 2WQZA 2GHIA 2BE7A 4Q9AA 1T4MA 1NF3A 5JANA 4G1FA 4KLZA 4R3UC 4NV1A 3TS1A 3SVLA 2FDCA 5EGNA 1DDGA 1TQHA 1Z4IA 3UTDA 2OL4A 4BMXA 3NHWA 2JH8A 1E77A 1K98A 1M1NA 1WW3A 2EBHX 3C41J 4QYSA 3KEGA 5E2IA 2WUGA 5F64A 4WBNA 4QPPA 2HJRA 3MRSA 3OX3A 5JNVA 3NIBA 1ODKA 2PVCA 2VHQA 4Y7CA 4CIWA 821PA 3HA3A 1M6EX 1V16A 2XAUA 4U9HS 4URHA 2E89A 4YROA 5TARA 1YJAA 1AN0A 2VUTA 3RRJA 1EVEA 4DWVA 1SCDA 1F9AA 2ST1A 1W4BA 4FZ3A 2DEUA 1FQJA 4HWTA 3H2SA 4Y2HA 1BDJA 5FT9A 5EGSA 5KYGA 3QNWA 2ACVA 2DQZA 3BCHA 1OI7A 1D0SA 4KX5A 5E3HA 1ODIA 5T4FA 4NCBA 4LE2A 4AJHA 4R8SA 1V37A 3DF9A 3SLKA 1QVRA 1GPYA 4YJFA 1MO2A 4G37A 9ATCA 3TLCA 5JD4A 5CX4A 2WWWA 3W2EA 1AA6A 1T2AA 7MHTA 1E8DA 5KVSA 3CUKA 3ZGZA 1ZD9A 4RHTA 3ZE7A 4KXUA 2C9YA 2X9GA 4Q3DA 4WNCA 2AYYA 5JQGB 1XVLA 2AC2A 3OEED 1IN6A 3KP1A 4MUNA 4MROA 1CUIA 4J4HA 4E31A 5KJEA 3VHXA 4TZ6A 1WKBA 2GERA 4I4LA 1Q57A 4EJSA 5BQ3A 4W5OA 3GD7A 4MUIA 1K27A 3FTDA 1X92A 4LZLA 1J2TA 1DXQA 3CLSD 2YS6A 3A3OA 3LXMA 1EWKA 2XOKD 5JCOA 1O1YA 3FDZB 1NGSA 4CPDA 1EZ4A 1RWQA 2FLWA 3EVDA 2QG9A 2X1LA 3BS4A 4QO7A 3ZWKA 4ZJYA 1CBUA 1K8YB 5C52B 1PGQA 1KI8A 2CWDA 2GJ9A 2JATA 2ZQ5A 3K16A 1IZ8A 1SK8A 4RPHA 4WZZA 3UB2A 3B12A 5DM0A 1KO1A 3T3HA 2PLFA 1PLLA 1Q3HA 2HIAA 3AJ8A 5JTUA 1FNSA 2C1ZA 4IXWA 5U1PA 4XWGA 1X7YA 4UTRA 4L22A 5K6AA 1G1MA 4YJHA 4TKLA 3RFXA 4FC7A 1KRWA 4IWYA 4B7CA 5BV2P 4XSHA 2HRCA 5U4XA 2WQ6A 4NULA 1UJNA 4D9CA 4FYYA 5CNMA 2UYQA 3DHEA 5KTTA 5HZKA 3SZMA 1A9ZA 5IBCA 3BREA 4GSKA 4U3JA 4WNYA 4TSRA 4RD6A 3V4VB 5JRDS 1DAGA 1LRJA 3DDUA 4UNSA 2A1IA 4D3DA 3MMNA 1XZHA 2WLSA 1L4YA 2EP5A 2C1XA 1UJ4A 2REBA 1W8DA 3BIOA 3QV2A 4NMLA 3R5FA 4W8OA 5E1DA 4PY2A 4F5ZA 4DR3B 1P39A 4HJXA 4DYDA 1T36A 3ETEA 2QLTA 1U6IA 1RYZA 2OYSA 3LO5A 4OGKA 3CGGA 1EFUA 1VXOA 2CBZA 2XECA 1QGED 3B2QA 1ISHA 4RDCA 5T7BA 2I2XB 2J3HA 2PBLA 3G0GA 2DHQA 5B58T 4XSGA 3X1JA 3FKSD 4B6RA 4IINA 4EZEA 5AUNB 5BVHA 3BH6A 1Z62A 2FR8C 4LF9B 2JKZA 2OY0A 1UXJA 4MP6A 4DMCA 3D2AA 3NBUA 3N7UA 5BRNA 2XXAB 4BMOB 1TM4E 2OSVA 1EFVB 1NT2A 5HJ2A 4ZI7B 1W75A 1SVIA 4MB6A 3ZCXA 3ZZUA 4IJ5A 2OV2A 4DNQA 4WOCA 2O06A 3UAWA 3L9XA 3OIVA 2E0IA 1E1YA 2VA9A 1IVNA 2HLNA 2RHWA 2VJMA 3OKPA 1NNLA 4GPZA 4JGIA 1TLFA 4PRYA 2FPXA 3NM6B 5F35A 1EDOA 5AVTA 4R1PA 3TQOA 5KQGA 1RWXA 1Y6QA 2YWBA 1J00A 2DFLA 1E0JA 1HG1A 1YZNA 3I34X 3SFVA 4D4HA 2GHRA 3T1OA 2YVLA 1I0LA 1QIDA 2CNNA 3QBJA 1VI6A 2R44A 3K53A 4BEWA 1SHZA 4H6VA 3ZDCA 4ES6A 1CRQA 1PGPA 3PT9A 1ZA2A 1Q1QA 1DINA 4FDLA 3O7MA 4J1QA 2RKOA 1T8RA 2ID8A 4C7XA 4KMSA 1ZR4A 3WSVA 4N5DA 2DZDA 4KMMA 2J09A 3L0ZA 1T25A 3IE2A 4FS3A 1LBSA 4UARA 3HO8A 4IQ4A 1JPUA 4B84A 2Y67A 1H5UA 1R5JA 1GAJA 1RFGE 3GMSA 4IQGA 1UCFA 4RD1A 5ALTA 1EK0A 4L9AA 4ZDIA 1D4FA 1M5TA 3C14C 3KU1A 4Q4JB 1XMVA 2MSWA 3NVAA 3UWDA 3V6LA 4AZ3B 3TE7A 3ICWA 5DYWA 3D7MA 3K09A 4AJPA 2DOKA 2HDOA 3HKBB 1V9LA 4XW2A 4D8UA 3L4KA 4ZC8A 1A76A 2VF5X 4FMBB 4A1FA 4TZKA 1E1RD 2GYYA 3I04M 4OYYA 5I4IA 3HCRA 1GU7A 2A1TS 3IO3A 2RK6A 4UPEA 4D79A 4PRLA 3TIFA 3UGQA 1OAOC 5KOHB 1CWUA 1KE1A 1BWPA 2G5TA 3BL5A 4GYWA 3WSWA 1HL7A 3ZDBA 421PA 1DS6A 1TE2A 2I3AA 4QUIA 3D64A 5CITA 4RGVA 4O4LB 3TSCA 1Y5MA 4AS1A 2WIBA 4R54A 3WL6A 2UVDA 1YDWA 4RLFA 1Z2AA 5LJLA 1UXIA 1FFGA 1XNHA 5DSZA 3MJFA 4RZ3A 1YRQA 3NRBA 4LJ4A 4PSUA 4B4UA 2XH8A 1E9CA 16PKA 4BN0A 1DC7A 2WEKA 4N18A 3LWNA 2Q27A 1Z4KA 5ICEA 3DE0X 2Q7XA 3LPDA 2PCLA 3E58A 1HFKA 1MV5A 2DSNA 1WSBA 2BBWA 4UDOA 1WDTA 1N33B 3LQKA 2AOXA 4K05A 3RTBA 3BGOS 4N8SA 3IHWA 1DCMA 2ZUUA 2OHFA 4GOND 3OG9A 4A8TA 4OJNA 3OFKA 4HL6A 5HXAA 1CQIA 1YE8A 4Z2YA 1A9RA 4UHEA 2OAGA 1JX6A 1SHTX 2L82A 1HTWA 2XZDA 4IPTA 4RD3A 2H7CA 2PZLA 3TZHA 2X0EA 2ZSDA 2EDAA 1LWOA 4QWMA 4P7KA 2W22A 3JQ6A 1GG9A 2NWQA 3N8NA 5FO0A 4ZZ1A 5KB3A 4YJ3B 4AF6A 4E1AA 3IB6A 3D4IA 2X7JA 4AB1A 1T4CB 2CXQA 2ORVA 1D2RA 2AMYA 2BP7A 2EX0A 4L9SA 1V39A 3B70A 4OQLA 2PTGA 3T34A 3OEHA 2A9OA 2VK8A 4V24A 2FGKA 3ZV5A 2TECE 4EGAA 3L1UA 4NPAA 1KAEA 5B1SA 1CHDA 1K7SN 4QM6A 1RXCA 1Z22A 4LUCA 9LDTA 4Z9BA 3KT0A 2I62A 3SQOA 1GCIA 1WHSA 2Z57A 4H7PA 1ZJYA 3TN7A 4LMBA 3SKXA 1HL3A 1XRPA 2NU6B 3U26A 3K4QA 1DBPA 2FJPA 3IUMA 4A10A 4JUBA 3VKUA 5TDHA 4DPLA 3LT0A 2AFIA 3BWVA 3KSAC 1F20A 2ZR8A 4HH4A 1ZNXA 3IA7A 3BWCA 3CRVA 1Z7YA 3QPCA 3UC5A 5HK8A 3HBMA 2QLBA 4JN6B 2LIVA 4NJMA 4R71A 2W2QA 1J33A 1Y7TA 3PNLA 3SQLA 4BXOA 1Z4MA 2FP3A 3H9UA 3ONFA 1DTSA 3L4BA 2D0OB 1GTL1 5IN5A 3S1SA 3GP8A 1MAUA 2JH9A 1RYNA 5DGXA 4NK5A 1FVOA 1V9CA 1FLVA 3BMCA 3M4YA 4F1JA 3R3WA 4RCVA 1OX5A 2HQSA 4MV7A 3LL4A 3PI6A 1T0IA 2C03A 2B3TA 2XGMA 1W25A 5DEOA 1TA0A 1O97C 4MI9A 3TQHA 3VU8A 4J7CA 5DVZA 2ZJ2A 4E4RA 2DU8A 1GKLA 3I45A 3P45A 2QSJA 4D4JA 4L27A 1XU7A 3WLLA 1FUYB 1FUUA 1LI5A 3X1ZA 3W5BA 1JSXA 1Z5UA 5AK6A 1B74A 1LNSA 1XG5A 3AC0A 2DKOA 3CPSA 1NFFA 1C7JA 1ZGAA 3KOUA 1NJ8A 1WP9A 5ER9A 3KFLA 4RQTA 4JEMA 1P19A 3KQUA 2Q9CA 2X8LA 3Q2KA 2DWOA 3SMQA 2H3HA 3EPKA 3ICQB 5JJLA 2DWUA 2BEKA 2ERCA 2WA1A 4NG5A 5IM4A 3PHHA 3QPUA 4JP5A 3D8NA 4YQFA 4W9NA 4E08A 5JPDA 1XEFA 4PAMA 1KEZA 4Y2QA 1FMLA 3RC7A 1CJBA 5TX7A 2Q3DA 2QF7A 1H9BA 2ZE6A 2AVDA 1PFGA 1WXIA 3E1GA 1D6MA 5DCUA 5FPYA 1XQ1A 2D4HA 4RTSA 1W94A 1ILWA 2AT1A 1D8AA 2W2LA 4M1TA 3V1NA 3V8RA 3HY6A 4RL6A 4R41A 3GQBA 2QU7A 2YXNA 5DCWA 1KOJA 1AZTA 3DPSA 4KR9A 3UN1A 1N5RA 1ZBQA 5I9NA 3GGPA 3SQDA 1N1GA 4EPWA 1I7PA 1BH2A 2AF3C 2XJ4A 3BXZA 1V3VA 3M7IA 3QMVA 2HJSA 2HWXA 3NT5A 3LT5A 4CQMD 1Y8AA 3IQFA 4JKIA 3P9XA 3VR3D 2HCBA 3S1LA 4AYTA 4HMOA 1JRLA 3LBIA 1T2CA 1X1QA 2CUKA 1Q95A 2HU8A 2J3MA 1H9AA 3C15C 4ZVKA 2ZSHA 2FPLA 3HPQA 5CK4A 4AY5A 2QTAA 1K6IA 5CA1F 1O89A 5EMNA 3C8MA 2OFFA 1GADO 4WAUA 3IALA 2YZGA 2H11A 2ZT6A 3DBRA 4GF5A 4A2CA 1UXGA 3VBEA 2J87A 4N76A 3HJNA 2QQFA 1EVQA 2YHAA 2IYRA 1M2VB 1FYXA 2J3EA 3RC2A 2IWHA 4YRCA 5EP4A 2EL9A 3A9CA 4PR0A 4FB5A 5DNUA 1VGRA 2WUFA 5J4KA 2NZYA 4K9DA 1FVHA 1TVCA 5FL7A 2GEVA 2R7AA 1E4YA 1Y98A 1C7RA 2O2CA 1AB6A 2UZAA 3DEIA 2YICA 3T0FA 4BCDA 1JHDA 4J0DA 1V96A 2IQ5A 4AZVA 3MJEA 1JR3A 4GLOA 3OWXA 1JJFA 1IPHA 3H7IA 3W2TA 4B35A 1XZGA 2Z6VA 3M6FA 4F5EA 1XA0A 2VYQA 3QM1A 2EF1A 2EARA 2Y99A 3H87A 3Q98A 1CX9B 2W6MA 2BYTA 4R98A 3HJTA 3MC1A 3PQEA 5L53A 2V98A 1BMQA 3LE8A 4MS4A 1KZ1A 1ZBDA 2QG4A 2V97A 3B9QA 4QARA 4Q4AB 2C7RA 1KAGA 4WIAA 3F7TA 1HDZA 3R7BA 3X44A 2XMZA 4X8MA 4BTVA 3EZNA 3FMVA 4RHCA 2I3ZA 1QDLB 1YQXA 2HA3A 4UVHA 4XZ3A 3QP9A 1EDEA 1YU6A 4RK6A 4WZBE 5K8TA 2CEKA 2R8OA 3EEFA 4KSCA 5B12A 5BN1A 3S55A 1HKUA 2W2TA 4EO4A 4HDKB 1XGKA 1JT9A 3STYA 2HLDD 1XZDA 2HV9A 3CC8A 4AIRA 4C7OA 2B4QA 2BEWA 2QTBA 3NYQA 4NMHA 2COUA 3BYZA 2O3TA 1E32A 1BMDA 1LJUA 3D3QA 1M6YA 4UREA 3CZPA 1P9OA 2FK8A 5IDYA 4YCBA 1C9KA 4TMXA 3AESB 2GZ3A 4O59O 3FPCA 1EJ2A 5LB4A 2GTPA 4REQA 1QX3A 2HD4A 3MJHA 5AVSA 1I1HA 2H6EA 3VNUA 4XEUA 1Z2CA 3HBJA 1XLWA 2P5UA 1V26A 2HQRA 3JWIA 2EJWA 4ZHQA 4BKQA 4D96A 3BDVA 1R4NB 2O2JA 4R2LA 5CLQA 3RBAA 1CNFA 2V65A 1EB8A 3FOBA 3STWA 1XCOA 5ALGA 1TX4B 3ZNNA 4CHGA 4CIAA 3TX6A 1VG8A 4D1YA 3RS2A 1UANA 4LEIA 2P7IA 4EJ0A 1GTRA 1SUSA 3F78A 1X19A 1DJQA 3CLRD 2OBMA 3OEYA 2WJWA 5D1NA 5DBGA 3SNHA 3OTHA 4CMIA 1W88B 3ZY2A 1V1RA 3OO0A 1GPAA 1C0IA 2QNIA 3BMQA 1ZKMA 1NW7A 2GN6A 3BD7A 3E4DA 4DC0A 2BTQA 1MW8X 5E2AA 5FFFA 3BX1A 1M67A 4XLTA 4EY8A 4EG8A 1JQKA 3A06A 1MOPA 1STOA 4TT3A 3CRNA 1XQWA 2QGNA 4HVTA 2XTZA 2PZMA 3B9BA 1JHZA 4UAJA 2QP9X 1KJWA 3OQ6A 3LYLA 2QIOA 2QJWA 1U7WA 1L0BA 2YN0A 4JVMA 1RJEA 1I6LA 1QAOA 2XTJA 2C00A 1Y7PA 1L5ZA 4FN4A 1ZONA 2FPKA 2Q4DA 3OOHA 5JJBA 5M29A 1CJUC 3OZAA 5L8VA 1KL7A 1WJGA 4UTOA 4G25A 2GTHA 1YZ3A 4HY3A 2NYUA 4QDXA 2G67A 4RXTA 4MVYA 1QIMA 3JQFA 2PQ2A 3B6IA 4WUTA 1E2EA 4DABA 5LN1A 3PFBA 1I3KA 2B4YA 3PXEA 4Q1DA 3PRKE 1DAPA 2AG6A 1G64A 1DQNA 1SFRA 4M1SA 3L40A 4L8WB 1NXOA 1ATIA 4BRWA 5BVGA 4KKVA 1ZD8A 4JQCA 2B25A 4GYJA 1SXIA 2B8TA 4OOFA 3CE6A 3PF8A 3UKJA 4MDFA 1UFQA 2UVPA 1YQUA 1WDLA 4UM5A 3GLIB 4HRAA 1H2XA 3O91A 2PD6A 4AJIA 4NZZA 1W2WB 3AK4A 3QE0A 4RMNA 1IOZA 4IZ6A 3GLGE 4F9FA 1NBMD 4MPTA 1T1RA 2JBWA 1J8DA 1FJHA 1ORVA 2FSPA 4RENA 1NW4A 1UC4B 3UAGA 3X2FA 4UMDA 2JRLA 3OFVA 2GO7A 3O1LA 2I6SA 1AB5A 1FSGA 4TTQA 5G1NA 4WADA 2HIHA 3FYTA 3K9WA 3BGVA 3OJXA 1D2GA 1NXSA 1E89A 1ZD5A 2G76A 1AK9A 1Y48E 2VEDA 2IP4A 2CHUA 3AT1A 4G2NA 3I6YA 1Z7EA 3GFFA 3LUKA 3C1OA 3L41A 4PO8A 1JG7A 4PPQA 4L74A 3BA1A 2P9YA 2ZYHA 4IVPA 1AMUA 2J6HA 4KXLA 3DEZA 2OBBA 2OD9A 4XX0B 4XVQA 5J59A 3ENNA 1RKQA 2IU3A 3CGWA 1X8LA 2G06A 3HNPA 2BJVA 2YQ4A 2B1RA 3BSFA 4UBJA 4TLDA 3SJBA 4CKWB 4HD8A 1OZAA 2G5CA 4L16A 3AWDA 2IEZA 1VQ1A 2PWZA 3K15A 2B30A 4MW1A 5A06A 2X41A 3V9PA 4DB2A 1SCJA 2FR1A 3P4UA 4CE6A 3HP7A 2Q4TA 2XRFA 3NV9A 1FB5A 1SURA 3S68A 4JASB 3I01A 3RFUA 5JSFA 1PT8A 3ESRA 2IGBA 1Z07A 1ZS9A 1OXTA 1EBFA 4KVGA 5FPHA 3DQQA 2QUBA 4IF6A 5JNTA 2BH2A 3FPGA 4EPYA 2O2IA 5DX1A 1RWWA 3BHNA 3NM4A 3ORYA 5GMOA 4TWAA 1E6EA 1KORA 1PJ4A 3CYFA 3FETA 3H6GA 4P53A 3R77A 3ZQKA 1RCTE 4B6SA 4BWFB 2YVKA 2CFIA 4MGYR 4U2BA 4OPMA 3RUCA 1AM4D 2O8FA 3LY8A 1WR8A 2BWJA 4D6YA 1N2XA 2D5AA 1DELA 3CVYA 3B8HA 4DAEA 2OZKA 3FTEA 1E8NA 1SVSA 5BWCA 1UXHA 2VWPA 5AHWA 4NDNE 3HEAA 3TMAA 3PI7A 4AAYA 3L2OB 4P36A 1H65A 2E4WA 5JNWA 3QOWA 3W9UA 4NU0A 5BYJA 2VNAA 3D2CA 1D04A 3H4MA 3GMTA 3WE7A 3O75A 1B16A 1WO8A 4LKOA 2P1RA 2DKFA 3HDVA 1SBZA 1BE0A 1R0BA 3GWZA 3F5DA 3MTQA 3PKZA 4DNOA 2B78A 3H9QA 1Q12A 1FTYA 3GFGA 1RRVA 2A2ZA 3GRKA 3VAAA 1YF3A 4FXOA 3TIIA 4OKNA 4TN5A 2XKKA 1RE1A 5CVEA 1U2GA 3DXXA 1CF4A 1W34A 1Z5GA 1QQBA 4RJKA 1NMZA 1CNMA 3K1AB 1K8QA 3GJRA 1KWKA 1SVWA 3EH2A 1Y6JA 3FF1A 3HXKA 4Y2SA 2I7TA 1KBOA 2X23A 3I92A 1XSEA 3B1VA 2HB6A 2HWUA 4ZVSA 1SCKA 2RB4A 3AIKA 1V7PC 3N0XA 2VP4A 4KIWA 3ZCSA 4KQXA 1U2SA 4BJHB 1XLUA 4KVAA 4S12A 5A7FA 2C7PA 1CW2B 1FXUA 5T5QA 2ZYWX 3L0PA 3AJRA 4PC6A 3H4VA 4HBGA 1BDMA 4G0YA 1VMKA 4A91A 4PYQA 2C9CA 3G7NA 3HCNA 4RYDA 3PUKA 3O8OB 4FMDB 2ASEA 2OCGA 1BW9A 3CKMA 3GZNB 3WGNA 2GK4A 3L8YA 5K3SA 2OV1A 2P9CA 2PVSA 3W3ZB 2O0LA 2FZ4A 3LPCA 4RHYA 2JGIA 1SG6A 3DB1A 1ISIA 3FVRA 1EWRA 1AS3A 2IIPA 3M9WA 2FW6A 3VH3A 4ZEVA 3OZDA 2WAYA 3RVNA 4YV1A 2YIJA 1PT6A 3A70A 1HNWB 3OSZA 5DWQA 2FCAA 5K0JA 1AA9A 4CLRB 4L02A 4L08A 4RS3A 4C89A 1LSUA 4EFLA 1ZG3A 1NSFA 4Q1VA 4KODA 2OENG 4FQ7A 2AHOA 4EB8A 1CSEE 3MINB 5AVUA 1I94B 3AMVA 3UFBA 5JNSA 2R6R1 4F5YA 3G13A 2W6IA 4X3OA 4R81A 1OHHA 2HU7A 3NXKA 2XODA 3PVCA 1P62B 4IVRA 4NZNA 4TWIA 1LK5A 4IVNA 2E4XA 4M0FA 4FFDA 2ZULA 1IJEA 5FPPA 3NJ8A 3Q7SA 4O2LA 1G0NA 4RC9A 1K3UB 4P2GA 3DLPX 3HCDA 5J3JA 1C8VB 3LDHA 2X76A 3VA7A 2Q45A 3AF4A 4ILKA 1RRCA 3LNTA 1T6ZA 2W4IA 3MQFA 1MRSA 2C2ZA 3BL6A 3T9FA 1R6BX