1KO8A

Crystal structure of gluconate kinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
172
structure length
172
Chain Sequence
TTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLKARKGHFFKTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Gluconate kinase
total genus 58
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2001-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ko8A00
1UDWA 2VHQA 4E5UA 5CDFE 1F2UA 4QBHA 3IKJA 5CM8B 3SDZA 3QXJA 4NP6A 2E1RA 2XSZA 3OIWA 4UNRA 4GBMA 3SYLA 3IBGA 2ZI5A 4MRVA 1B23P 4LX0A 2J0QA 1OF1A 1RJ9B 5HKKA 2NPIA 4PQRA 4S35A 5CB8A 4HEJA 3IO5A 2ZE8A 3IHLA 5TV2A 3AM1A 3SYKA 1CEEA 3U4QB 5H1YA 1HV8A 4FN5A 1OB5A 2FSFA 2QENA 4KV9A 1D5CA 2ZJAA 2BWJA 2IYWA 5FL3A 2EW1A 5JSZA 3WHKA 3LXXA 4M1MA 4HLCA 3S1AA 5DLQC 2ZSFA 1HT1E 2CVFA 4O2RA 3FDIA 5JRJA 1YZKA 2VA8A 5EE9A 4B43A 2IWRA 4KHZA 5KNBA 4C0BA 1WCV1 3REGA 4MYUA 2GHIA 3UIEA 4LC1A 2ZRDA 3B9PA 521PA 3K70D 1DAEA 5E7IA 1NSFA 3ZJYA 5LD2B 2ONJA 4MKIA 5DI3A 1AK2A 3IPXA 1N2CE 3TIFA 1OT3A 4Z54A 5JCPA 3U4QA 1OSNA 5GJBA 1FP7A 1G6HA 1EFUA 4AK9A 3EWSA 4W5HA 3IDQA 4B3DA 3EX7C 3PEWA 4BZQA 4PAMA 1QDEA 3K9GA 5BN3A 1XCGB 1GOTA 1GL9B 3B2EA 3NVAA 1GNRA 3LAWA 1W36D 1P2UA 4JKIA 1SKYB 3CB4A 1PUIA 1BO6A 1Z8FA 2X8AA 3BD9A 3MD0A 1OH6A 4NTZA 4JYBA 3Q5DA 1DE0A 1XJCA 1XPRA 3KL4A 1NG9A 1BMFA 3WBJA 2R2AA 1G291 4MKHA 3BK7A 1H8ED 1XWIA 2OFOA 4HDOB 2F1HA 4Q4LA 5DISB 4A82A 4BWYA 2FN4A 2JLQA 2QUZA 3FKSD 3QIAA 2QRNA 1KI2A 4AI6A 1T8UA 4JZKA 1F2UB 1MO6A 3A8TA 1JI0A 1UKYA 4ERNA 1ZU4A 4A6PA 1XEFA 1P72A 3LVRE 1N5IA 3OIUA 2BBTA 4GPTA 4NYMQ 1W47A 4B74A 5JCZA 3K0SA 4Q5IA 1E96A 3C15C 1IN4A 3HU2A 5B30A 2H18A 1U9IC 4OQNA 4AKHA 4Q1CA 2ZRAA 4WZAE 3R8FA 1T5LA 1QHSA 1M2OB 1Y63A 5JS7A 3I5XA 2AWNA 2ZSDA 1ZNWA 3AGQA 5FOVA 1TNDA 1G8PA 1JPJA 2IF0A 3EZ6A 2JJ2A 3TMKA 3I62A 5BYKA 2RGNC 3QPWA 1ZNZA 3SU8A 5IHPA 1US8B 3KKQA 2O52A 4CGZA 1T3HA 1U8ZA 3FKQA 4BFTA 2JCSA 5J4HA 3K70B 3B8HA 4AC9A 2G9NA 1MABB 1J7KA 2WJVA 4PSKA 5FBQB 1OHHD 4GFDA 4KYUA 3VU9A 4D6PA 1NNEA 121PA 2FPKA 2ZE6A 5HCNA 2VP5A 3U2QA 1E2GA 2XZLA 3P4YA 2GCOA 3WBKA 4MYTA 2YINC 3VFDA 2Y8EA 1Z0JA 4E09A 2EWWA 1D2MA 2Q3FA 1X8JA 1CR0A 1MO5A 1QHHB 4BZPA 3TVDA 2H8KA 2H17A 3MJRA 3U7EB 5DN6D 3TUJC 2GXUA 1CBUA 4G5SA 1U0LA 4Q48A 2IX3A 2A78A 3EASA 3RABA 5TMPA 2QI9C 4LZZA 5LB4A 2QMUA 1N25A 4NYMR 1AGRA 3IBYA 2W2XA 4KBFA 1KI9A 2W2TA 1DARA 1JXMA 3I8XA 1WE2A 2CNWA 4LC0A 4GOXA 4Y0AA 3BGWA 4XWKA 2OCAA 2OLKA 2V7QD 4NU0A 1ZUNB 5EE5B 1CS4C 1W5TA 3AF0A 5DIFA 3W5JA 3NBXX 3R7WB 1X86B 2J7PA 5AUPB 5C4GB 2R65A 1Q22A 4LCBA 3UWOA 1X8KA 2BM1A 4UXJA 4HB3A 1XJ0A 5K8LA 4XVUA 3GLFA 2GEDA 1MT0A 5GJWC 1SHZA 2P6UA 1OFUX 2YWGA 5EUMA 1X1RA 3JZAA 5KTYA 3K0CA 4MKGA 4DRZA 1NY5A 4QGFA 3QKUA 1DOAA 4NBSA 1W0KA 4JT2A 3TUIC 4KSBA 1QZXA 3EIHA 2OCBA 3PUWA 3TAHA 2EWVA 3X1XA 2F43A 4QM6A 3ZD6A 1ZC4A 2J46A 3WXMA 4Q4HB 3FOZA 4RZ2A 2FNAA 3I3SR 1CIPA 3TQCA 1E9EA 3ZS8A 3CPHA 1E2NA 2O8BA 2XNDD 3IIKA 3QENA 1N6OA 4TTPA 2YC4C 3UKDA 2A5GA 1V43A 2F6RA 2ZRPA 3AP1A 1FOEB 4Q4AA 1PVOA 3FB4A 2BEKA 1ZMXA 2G1KA 2VHJA 3OFNA 4RD2A 1XD2A 3LLMA 2G83A 4GI7A 3D31A 1E2FA 4KODA 1NVXQ 2H5EA 4F7WA 1CRQA 3RRZA 4JLNA 1N5KA 5C1BA 1RFLA 2OE2A 5FBLB 2CEAA 1E79D 4LSGA 3Q7QA 3BFKA 2X19A 2IF2A 1OKKA 1G64A 1M1YE 2CLSA 4LUCA 3RSLA 4X8MA 3MSXA 1G8GA 5DI9A 2ZETA 4WXRA 3PXGA 4IOKA 4PPFA 3KJEA 1E2QA 3K0EA 2J0SA 1Z6AA 1X1SA 2RKOA 4JVNA 2FV8A 5FL7D 4TWZA 5FUWA 3I4LA 1XPUA 3U44A 2CHGA 2HLDA 4OHXA 1Q44A 1RRPA 2RHMA 4TLCA 3FHTA 3LW8A 1LTQA 1ZM3A 4ABYA 3KQKA 4B3GA 5HCIA 4MYHA 1VMAA 2REBA 3JZMA 1YZQA 3QBTA 4B3BA 4IFBA 5JHGB 4HSEA 2JIZD 2J7KA 2XTNA 3OEHA 3RWMB 5C46F 2Q3HA 1N5LA 1K8RA 3EA5A 2ZUBA 1OH8A 1G17A 2ZQ5A 4NMMA 3NTUA 1VCNA 4MDEA 1KDOA 3JVVA 1K5GA 2GAAA 5DO9A 3V4FA 3CF2A 2ATVA 1FNMA 5HTKA 1UPTA 4M2LA 3RLFA 4LJYA 1N0VC 1Z0FA 1XD8A 2BV3A 2VRWA 4ARZB 1Q20A 1OFHA 1Q3HA 1S9HA 2FA9A 4XWAA 4DSNA 4DZZA 4DSTA 3AF3A 2QAJA 4BFZA 3N2IA 4LJAA 3CF0A 2NZ8A 1EGAA 4ON9A 1T91A 2N42A 2UZ3A 2EFEB 4BECA 2ZJ2A 3SNHA 3TW4A 1Q3TA 2P5SA 4CRWB 2GILA 3C14C 3N5CA 1OH7A 4UJ5A 2A9KA 3BB3A 5A5GA 5CK4A 4BASA 1NG1A 1W0JA 4HAZA 3NHBA 2J5XA 2UKDA 1Y3AA 4XH9B 4XJXA 5CYPA 5GADl 1LF0A 4P4SB 2NPFA 3B85A 4GDFA 4AIIA 1XF9A 1I4LD 1XTRA 2PX0A 3G0HA 3RRMA 4AD8A 3SJAA 2EQBA 5CJPA 3OAAD 1N3BA 1GDDA 4II7A 3RC8A 2JEOA 3KKNA 4NZYA 4B35A 2OSBA 1NBMD 3ECCA 4URYR 1XTKA 1AJEA 1NI3A 3KUDA 2QU8A 4TMKA 1UJ2A 2EYQA 3GJ8A 1GL7A 3NBFA 4GSYA 5FPYA 5TVKA 3KTAB 4FWIB 1Z6TA 1IJFA 1Z2CA 2CMKA 4M1SA 4BRUA 1E3MA 4DBLC 1OB2A 3QF7A 1P3JA 1SVMA 4LOAA 2IYVA 3TR0A 3Q72A 5KOYA 1C9KA 2CVHA 2R6GA 1E9DA 1GG2A 3TE6A 1Q1ZA 2WBLC 4BFSA 1GRRA 3ZYCA 4DJTA 4LGMA 4YDHB 2W6ID 4D0GA 1NSTA 2F1JA 4A8JB 1F6BA 1XZPA 3H1TA 3L0OA 2CCGA 4BLPA 3L82B 2FEMA 2ZAOA 5G3YA 1DAKA 1TADA 3CF6R 3RS0A 5BXQC 3R9XA 5HPYB 4BRWA 1AM4D 2GDJA 4CVNA 4CZ2A 2CDNA 4DDUA 3J81k 1HA3A 2QTVB 2ZR7A 5EP2A 2QROA 3NXSA 1H65A 2IBMA 1VIYA 3E1SA 2BMFA 4LYHA 1HYQA 721PA 1XXHA 4RFSA 5L3SB 3GP8A 1P2TA 4PHGA 1MH1A 4ACAA 1CR1A 1RW4A 1HURA 3I1FA 4Q1EA 4EFNA 1GNQA 4A2PA 3WY9A 3QKSB 4EPWA 4UQOA 2HT1A 4Q9HA 5F98A 1ZNXA 3H2YA 2BBOA 4QBFA 1SXJB 2F55A 4LPSA 2ZU0C 3LO5A 1A7JA 4TT3D 4EPRA 4W9MC 1FX0A 1G21E 3PUXA 4WZBE 4O3MA 3EPKA 1AQYA 3BBPA 3QXCA 2F1IA 4TL8A 5FTNA 2AK2A 3RSOA 2ORWA 4KAXA 1N0UA 4HB0A 2WIBA 4L5BA 3AVOA 3VMFA 3FFAA 3OZXA 4M9SA 1ZIOA 3R7WA 4D0LB 1G1MA 3QG1A 1E2PA 3ZS9A 3EZ2A 4QGGA 5DI3B 3ZZTA 2VLIA 3QOFA 4P0TA 5G40A 2RGDA 2GEUA 5TY0A 4LDJA 3TW8B 4XSHA 1KO5A 1Z2AA 5CM9C 3L8ZA 3U6BA 3P20A 4TYQA 4NHOA 1Q1QA 4D82A 4DVGA 1ZC3A 2A3RA 4JJKA 1G6OA 1YR7A 2HT6A 4P31A 1FW6A 3AF4A 1U8AA 1TF2A 4R71A 1HTWA 1CR4A 1N6KA 4US0R 1J70A 5IK2A 3C16C 4PQFA 4JJZA 1KI7A 2OESA 4IRUB 4BEBA 3EAQA 2GVDC 3MJHA 1VHTA 3T1TA 1FMJA 1G3UA 1W2GA 2G0TA 3QQ5A 2QG6A 4FMDB 3VAAA 3PIRA 2PBRA 3HDTA 2EU8A 2GF9A 3UATA 1KHTA 4ZCIA 3THWB 1W36B 3KJGA 1EFRA 3BAFA 2HUPA 5TXGA 3CR8A 3AVXA 5L3SA 3U7GA 3ADCA 2XNSA 3O8CA 2PMDA 4MGYR 3K9LA 4QGAA 5EXXA 4LBYA 3L2OB 3NBYC 5FTMA 2FSIA 3W34A 2GAOA 3HPQA 1J90A 1JPNA 3F5FA 1DAIA 5HE9A 4D81A 1E2EA 1VYUA 2OV2A 3ZIAD 4JL6A 4Q9LA 2AX4A 4GZMA 3T12A 4ZV4A 1Z6GA 2AXPA 4JLBA 3RS7A 3VX3A 1P60A 3AGPA 3GLHB 3SN6A 5H8WA 2EFHB 1DAGA 1F2TA 2J45A 2V55B 1YZUA 5D3MB 2GBLC 4G5GA 1DVRA 3NDBB 3C5CA 4B6EA 4ZKEA 2XITA 4URWR 2IUUA 3C5HA 1G8HA 1OFTA 3A1VA 2GA8A 2WKRA 3I5YA 1J8MF 1Z07A 1Z06A 3KTAA 4OK6A 4P4TA 4PZLA 3GLIE 5AK0A 3KQLA 2D74A 2FE4A 4EPTA 1M74A 4LYAA 4QHTA 3MUFA 4CT4B 3ETLA 2J1LA 3GLGE 4C0KA 1OXXK 3CBQA 4AKGA 2ANBA 1II0A 5E95A 1YZGA 3T5GA 1NVUQ 2QAGC 1QHXA 1XTSA 2AHOA 2AK3A 4LJ6A 2YV5A 3SBDA 3I72A 4LV8B 2PL3A 3HP1A 2OBMA 1MOZA 4O0MA 1KMHA 2G1JA 5IDVA 6Q21A 2JASA 2IS2A 4QHYA 2P2LA 4MH0R 3MWYW 4EQ6B 4FINA 4R2IA 5CITA 3LH5A 5CDFA 3SFZA 4EAQA 3VKWA 1NLFA 2PCLA 3SR0A 1N6IA 4P4SA 2QP4A 1W2HA 2RMKA 3OEED 5AR1A 2FDCA 5AUNB 1SVWA 1BYUA 3NEJA 4PC7A 5LPNA 1M34E 4B34A 2V9PA 1G4AE 2V7QA 1UF9A 3ADBA 3AF1A 3FHCB 3LNCA 4TLEA 1RRFA 2WWGA 2Q0HA 2F9LA 2ZJBA 1GITA 4P33A 2C04A 3ZVRA 3W3ZB 3NDPA 4JLDA 3SEAA 3HR8A 2FJUA 1EK0A 5FL7A 3WRYC 2A30A 5FTLA 1R0ZA 1GM5A 3IEVA 1GFIA 4IXNA 1T0JB 4UNNA 2QGZA 4HAXA 5F9FA 4ARZA 2IUTA 4IDQA 4XSGA 3BRWD 5GJCA 1U90A 1YR9A 3M1IA 4IDNA 2VH5R 2KI5A 1FTSA 2CXXA 5JWOA 1ZM9A 2WOJA 3U3MA 3CUEF 4W5JA 3D6TB 3EPHA 4HUQA 1TQ2A 3L0SA 4DCVA 2IL1A 1W44A 1RC8A 4HB2A 1ESNA 4OJQA 4M22A 1AKYA 1KK2A 1N6LA 3K0AA 4MITA 3K0FB 2WM9B 5LBIA 1OXSC 2ZYVX 1OIWA 5KSYA 3UMRA 1Q21A 2F1RA 2YOFA 3ZDQA 4A4DA 4WXPA 1SXJE 1EG7A 3TKLA 1YZNA 2GK6A 3TQFA 4RD6A 5D3MA 3TRFA 1S1MA 2D2FA 621PA 1IN6A 1N6NA 4OQLA 4JLMA 1XMVA 4KU4A 1OJLA 1L2TA 3MG9A 1K6MA 1JNYA 1HT2E 3K53A 4A36A 4R9UC 3NIBA 2B7BA 2ZVPX 4H9GA 1CR2A 2CHQA 4YMWA 4Q00A 4B3CA 4N3NA 3T61A 3U7FB 3QEJA 1CJVC 4RD0A 1LB1B 1SULA 3EA0A 3SBEA 4QFMA 1S1CA 5ANRB 1UBEA 1OV4A 2G77B 2QM8A 3A36A 2SHKA 4RCZA 2VP4A 1JECA 3OAAA 2ZTSA 2ZI4A 4DCNA 2QRZA 4BLSA 4Z1MD 1FQJA 1FMLA 4A0HA 3DO6A 1BIFA 2BOVA 2Q9CA 5ELXA 1KY2A 1XCPA 4LRWA 2JLSA 1WMSA 1ZINA 1W36C 1E9FA 4FIDA 1KI3A 2IYSA 3CPJB 3KUCA 1ZP6A 4Z8YA 2YJTD 1EFHA 4G5OA 1KMQA 1ELOA 3HYTA 4B75A 4BLRA 4RD3A 2A5YB 4DLRA 3AF2A 1TL7C 1FP6A 3PEVA 5FOTA 3AUYA 3VNUA 3KFXA 2GZHA 1OPXA 4TQUS 5JFGA 3MGCA 3EXAA 2IUSA 2J41A 5KDDA 4RD4A 3X2SA 4Q9KA 1E98A 2GEVA 1RVDA 4TSFA 1UDXA 3GLHE 2RB4A 4TYPA 1KNQA 3AKDA 2GETA 2PZEA 4JLAA 2PT5A 3AH8A 4MUBA 4B71A 4M1KA 2WSSA 1U98A 4HZUB 4JBYA 4PO1A 1MR3F 2A2ZA 1VYVA 1R5OA 4NPHA 4B44A 4HLQB 1P2VA 1XZQA 1Q12A 2ZRJA 5G53C 3AVTA 4MGZR 2WAXA 4TN1A 3QNUA 3TR5A 3NC1C 2FSHA 3BFXA 2P6NA 4QRHA 1ZJ6A 1R0YA 1D6JA 1S3SA 1G3RA 3OIYA 5JWHA 4CIDA 1JR3D 1DAMA 2N46A 1Q1EA 2XSZD 1KO4A 1KKLA 2ZREA 2J9RA 4EPXA 2J7PD 2XB2A 1T3SA 3MMPA 5CLLA 4FMDF 2C03A 1JJ7A 2D06A 1KOFA 2QORA 1G18A 2G6BA 2NTYC 2WIAA 3IIJA 2OAP1 4KLNA 5L3VA 5P21A 2GNOA 3QBVA 4I81A 2QQEA 1CJUC 1XXHB 5AWFC 4TLBA 3QF4A 1D9ZA 2YOGA 4MKFA 1AA9A 3BJIC 421PA 3RYTC 2PLRA 4EJSC 4IW3B 2O8EB 1YKSA 3GEIA 1XXHE 2VP2A 4E22A 1JXOA 3EG5A 3D3QA 3LD9A 1VPLA 1CRPA 2OCYC 1G3IA 1VG9B 1NF3A 1ZCBA 4M53A 2EFCB 3LQRA 4DIEA 4GL2A 3W9YA 2H16A 2AN9A 1HQCA 3WMFA 1II9A 3R9WA 3CH4B 2CE2X 2W6IA 2ZSEA 2DFKB 2VSXA 5BW8A 2NMVA 4JLJA 2O5VA 3HPRA 4NKRA 1TQ6A 3PV0A 4ZI3A 3C4JA 1II8A 5CJ2A 4PTLA 5GVRA 1FNNA 3TVTA 1SVSA 2JJ1D 2QL6A 5AJVB 5J47A 3KJIA 1JALA 2V1XA 2WJIA 1G7RA 2AD5A 3IEUA 2WKPA 4TTRA 3B78A 4CEIB 1PZNA 2ANCA 4BZXA 3CZQA 3M4YA 2AWOA 2RGNA 2XZOA 4I1UA 4TT3A 2MSEB 2ODNA 5DYGA 1H8HD 3BB1A 1JR3A 2OO7A 1X8LA 4TL9A 3SJZA 2PCJA 4JSYA 3I92A 4KBGA 4PC1A 4Q19A 4NCKA 2GBLA 4A2WA 2GF0A 4LBVA 1GSIA 2RH5A 1DPFA 3VX4A 3IQWA 1W1WA 4I1VA 1H8HA 1DO0A 3QXXA 1O3YA 3Q5EA 2CL0X 3DDCA 1OYYA 3UMSA 3MCAA 4LK2A 4HLUA 3AVPA 3G5UA 3REFA 1YQTA 3BFVA 3KZ1E 4Q7KA 1LY1A 4XTCS 2NGRA 1T9HA 4BE7B 4OQXA 2PEYA 4ASUD 4EQ6A 1M7GA 2WWFA 5KYKA 1Z5ZA 2CK3A 2RGCA 1QHHA 1EFTA 3AKYA 1U99A 2ATXA 4C0HA 5CYOA 3V00A 4C4PA 1G8FA 4BFXA 4YMUA 2RGEA 4URVR 1AS0A 1W7AA 3N2EA 2C78A 2PMKA 3W3AA 4PO8A 3LWNA 1WA5A 5M04A 3QXSA 1XJQA 3DVLA 5FOWA 4FD2A 2OBLA 4QM7A 5DE3A 4JT4A 1KI6B 2ZYUX 1NY6A 2DFNA 2JLWA 3EARA 2FFBA 2KBEA 4YLGA 2VQSA 3WYFA 3V4RA 2QMOA 4LV6A 4U02A 4L16A 4UNPA 2O8CA 2ZI7A 4M21A 1F2TB 1Z0KA 3CM0A 3R8CA 4EFLA 2HEIA 1GKIA 1P73A 2FFHA 3T15A 4BPBA 1A4RA 2ZRBA 2HYDA 2KBFA 1U2RA 4OHWA 5JS8A 1YRBA 4TLDA 4IHQA 3TJZA 4DUGD 4PC6A 3TSZA 4KLZA 1QHIA 3KQHA 2DFTA 4WBSA 5JHHB 1XCMA 2WAYA 2WWXA 4PPQA 4DLTA 1KSJA 2JDIA 3GFOA 4C3ZA 5CK5A 1R2QA 3KFVA 3MAAC 2RAPA 3GJ7A 3TSWA 2GJ8A 1DADA 1M7HA 5E3HA 4DXAA 1SQ5A 2A5FA 2JDID 3QG5A 1KK1A 2O8BB 3EC2A 4JVMA 1VDZA 1S0UA 1UBFA 1TAGA 2GZAA 1DAHA 3CNNA 4Q18A 2BCJQ 1JQLB 1WXQA 2R62A 5E7MA 3K0AB 1W4BA 1S3GA 4CEHB 3K9HA 5FI0B 3AP2A 1NJFA 3B1VA 5FOSA 2QBYB 2HF8A 3AVUA 2ZRLA 4IJMA 4O2LA 2Z43A 3RS3A 4KVAA 1C1YA 4DB2A 2W2VA 3QKRB 2QPAA 4BUJA 5IT5A 3MWLA 2C95A 3GEEA 5BN5A 5KPJA 3MFYA 1KY3A 3H0KA 4UNQA 3IQXA 2GCNA 4AYXA 2A7QA 1IQPA 5SZKB 3DOFA 5G3ZA 1DG1G 2WVJA 4DCUA 1G5PA 3PUVA 2QGNA 2YHSA 2WPDD 5FH9A 4Q4JB 1KGDA 2QTHA 3KQUA 3SQWA 1R8QA 1W46A 3A4LA 1NLZA 4I1OA 1R0WA 4PQYA 1KSHA 2KWIA 4G0NA 3UWKA 2O8FA 2ODEA 2QAGB 4NCNA 3CRW1 3WMEA 4NYJQ 4W5WA 2CJWA 2FZLA 2QPTA 2N1BA 3LX5A 1XMSA 1GAJA 2IYQA 3NEYA 5AUQA 4IVQA 3B5JA 1P5ZB 3RWOA 4DLWA 1Z28A 5IF9A 4DHEA 3EIQA 1KO8A 4CEIA 3CIOA 1KMHB 1G9XA 1NVVR 2PX3A 1ZD8A 2AFHE 3IPYA 4C2TA 8OHMA 1ZIPA 1VHLA 3TGPA 1CU1A 1NVVQ 3ONWA 3VHXA 3VU9B 2FEOA 5EZ5A 4OK3A 1NKTA 3A58B 3QVUA 1MO3A 2QN6A 2D3WA 2OG2A 2BBWA 1KJWA 4RD1A 2PJRA 2E9SA 2J0UB 3HU3A 2XXAA 3NWJA 1YE8A 1AS3A 3PEUA 1I2DA 1Z29A 4B33A 4NYJR 3W6PA 4IFEA 4BFUA 4YQFA 5JJKA 2J59A 4D4LA 1YR6A 4TMXA 4M9XA 3ASYA 1A2KC 4WOPA 1QVAA 4DLVA 1DTSA 4TZ0A 2YZ2A 1SXJC 5JZVA 4MGIR 2VIIA 1HUQA 3TK1A 3K1JA 2IXEA 2ZIAA 4UJ3A 1P6XA 2FZ4A 3RC3A 3BE4A 3GEHA 1XMIA 5B57C 4PHTA 2BMEA 2CL7X 4DIDA 4YDSA 3LBIA 4RY2A 1Z6XA 3RS5A 1WQ1R 2WSSD 2A5DA 5H68A 4BEJA 1GKYA 4LWZA 1E1RD 1NN0A 2XOKA 4HDQB 5EE0A 4ACBA 3B6EA 3LXRA 3M0EA 3PG5A 4DDVA 4OKSA 1NN3A 4JIMA 1U81A 1VIAA 2CNWD 1KI8A 3ZVNA 2ZE5A 1E9AA 1GNPA 3ZIAA 2YWFA 5GVSA 3VR1A 2IS6A 3K0FA 1G3QA 5FFMA 2QNRA 4WW0A 4Q4HA 4WIAA 1KDTA 3DMNA 2R6AA 2IYUA 1E1QA 5L3QA 2F3TA 4QL3A 2B21A 1QG2A 2GXAA 3K09A 4A0GA 2IT1A 1BYIA 2PLFA 2ZR0A 3VHLB 1IXRC 2O8DB 1DEKA 4N1AA 3CR7A 4PZZA 2CBZA 3THYB 4TYWA 4HATA 5D3QA 2QP9X 4LV5B 3DKVA 1XEXA 2HV8A 3U3JA 3E5HA 5B64A 2ZSAA 4NONA 2YWHA 1ZVQA 3FMIA 3ND8A 1ZUHA 3X1WA 2AD1A 1L7VC 1VECA 2W0SA 2WWIA 5JECA 2XTMA 2LCFA 1RRCA 2ZJZA 1YZTA 4TZ6A 3L0PA 1G19A 2R6DA 1G7TA 1YHNA 3FHOA 2HF9A 4JL8A 4U00A 3U7HB 5HE8A 5J4VA 2GJ9A 2X2EA 1HY3A 5DNYB 3L8YA 1WDTA 1F60A 3DZDA 3CX6A 3QY0A 3FFBA 4KYIB 3PCRB 3VR2A 3BH7A 1VG1A 2WSMA 1Q57A 4LYJA 1RJ9A 5KDOA 2IYLD 3GJ4A 2QQ0A 1G4UR 5JMTA 1TMKA 1N5JA 1XPOA 4CEHA 1R10A 1COWD 1PUJA 3BH0A 4FMBB 3THYA 1G3MA 2BEJA 1CF4A 3C8UA 4OI4A 4XIGS 2HXYA 4ZI2A 3QXHA 1FX0B 4B2PA 3EPLA 1CTQA 3LX8A 5DHAA 821PA 1E2HA 1GRQA 1ZD9A 1I2MA 1LNZA 1GTVA 5EP1A 4N0DA 3QEOA 3T1VA 4EJSB 3RANA 2VYFA 5HKKD 3SE0A 5EE3A 3ZH9B 5FTJA 3RAPR 4N0EA 1IY0A 1RYHA 5KO2A 4YMTA 3W90A 4KITB 1U9IA 3QVVA 4OHZA 4FCTA 3Q85A 5FTKA 4OHYA 4XVRA 2ZRMA 3FVQA 4JLPA 3ZLJA 3VR6A 1IONA 2ZM5A 2BVNA 2ODWA 3FPAA 3KXLA 4A6XA 4B48A 4DC9A 3TH5A 1XEWX 3UG7A 2WMNB 1D9XA 4WZ6A 4YC7A 4L4UA 1D2EA 4ASUA 1KAGA 2R9VA 4B32A 3VKGA 4FCVA 3SJCA 4OK5A 2YNMA 3O47A 4UNSA 5SZIA 2J87A 4Q1DA 4ESVA 5FI1B 4E07A 4DCTA 4AG6A 4EJSA 3SHWA 3OESA 5LB2A 4PSAA 2FGKA 1KI1A 1MO4A 4OI1A 1E0KA 3SS8A 3GCGA 1KI6A 3PQCA 5TDHA 1SKYE 2OLJA 2V6IA 3B60A 3OF5A 1P75A 3OEEA 2OXCA 4XD7A 3V9PA 4V0LA 4HI0E 1XBTA 2OEPA 3THWA 3U3KA 4IOMA 4X8OA 1Z63A 2ZVQX 2ZR9A 4F4CA 1NJGA 1P9NA 1EFRD 3KKPA 2CCKA 1OE0A 4A8JC 4DLYA 1U94A 3B1XA 3DM5A 4GOJA 1XTJA 2QA5A 1Q0UA 4TQ9A 2QAGA 1Z3IX 3VR4A 1AIPA 4ITRC 1L4UA 1OYWA 1SXJD 2NG1A 3W6NA 3NHAA 1VCIA 2AR7A 1L8QA 5FUVA 4CT5A 2G88A 3A4MA 4HZUA 2QPOA 4OI2A 3FMOB 4YONB 3AVWA 2DY1A 2ZUDA 3PFIA 3NH9A 3U3RA 3B1YA 1PLJA 3AQ4A 2WWYA 4US2R 5AJZA 1E0SA 4AURA 1Z83A 5EXSA 3QJYA 2OUKA 1ZU5A 3R20A 1T5IA 3EZ9A 2C77A 4MQBA 2ONKA 1JBKA 3CW2A 4TQAA 1GVNB 3KXIA 1A82A 3LV8A 4LJ8A 3A1UA 1UKZA 4B76A 1XTIA 2JIZA 1E2LA 1G20E 4L8GA 4D4MA 2FF7A 4NL4H 4Q66C 1VTKA 2VF8A 1W4AA 2BJWA 2GCOB 1BOFA 4TMZA 2WV9A 3BOSA 2Q9AA 3PITA 4CEJA 2P0EA 2UZIR 3WNCA 3CNLA 3GLGA 4DCSA 4FMCF 2AFIE 4MRRA 2Q6TA 2W83A 4QNRA 4QXAA 3UXMA 3TAUA 1SHKA 1RPZA 4BQSA 3WYAA 2JJ8A 2C8VA 3P1JA 5TARA 5EXPA 1CKEA 5KU1A 1LS6A 1P9RA 3U60B 2IHYA 2IK8A 4GZLA 4GP6A 2IYXA 4PX9A 3UPUA 4JKYA 1OIVA 4PXAA 4C0AC 4HZIA 1NBMA 3ADKA 4EPYA 1MV5A 2QM7A 1W4CA 1Z47A 3FWYA 4M1OA 3UG6A 4IVPA 1GILA 2NO9A 3BB4A 2LKCA 3QI2A 4Z1MA 3I61A 4TMTA 1JAHA 2ZRIA 5AJWA 4IEEA 4RSGA 3GLGB 1J99A 2IHBA 4ZO4A 4CEJB 1T3LA 4Q03A 4RZ3A 2O8CB 4HLUC 2V4ZA 1XRJA 4ZPXA 1DO2A 1U0JA 2O0HA 2Z83A 2HLDD 4I99A 1U0HC 2QSYA 4GOKA 2IYZA 3T1QA 4A0RA 3WRXC 3X1DA 1ODFA 3HYRA 2GZDA 1OIXA 5JEDA 2ZITA 3LDAA 2ZANA 2ZAMA 5A0FA 2GJSA 1ESMA 4F38A 3SFVA 1WF3A 3G82C 2GESA 1NRJB 1Z0IA 2EFGA 2R8RA 1NN5A 3DPUA 1JR3E 4KFUA 4NCJA 5CIWA 2QMEA 2XJ9A 4G3XA 4NYIR 3PJRA 1EX7A 2OBNA 4GRAA 2ZROA 1UKVY 2GWHA 2NQ2C 3TLXA 2VBCA 4FI3C 3O8RA 4IDOA 2KB0A 2CHVA 2FFQA 4URZR 5K8UA 1EESA 1F5NA 3K0CC 4OJKA 5EP4A 4I1SA 5FPKA 4BLTA 3THOA 4QBIA 2FFAA 1EX6A 2Z0MA 2WMOB 5FR2A 2VHUA 3EWAA 2XZPA 4CF7A 3CRRA 4KCGA 1YU9A 1NBME 1XEXB 1QHNA 4M9QA 4QJ3A 1P4SA 4LJ5A 5JI2E 4DB4A 2DHRA 2LWIA 1C4OA 3LY5A 1HQYE 1KTVA 4NYIQ 5AUOB 2Z6VA 2DWQA 2W58A 4PSVA 1KNXA 1XTQA 4OBEA 3F3YA 4OHVA 3B13B 4RZXA 4ZDWA 2DB3A 2WPDA 3LQQA 5B58C 3LRPA 3LBHA 2L0XA 4XWOA 1UAAA 4HLDA 2Q21A 5B2ZA 1DELA 2WHXA 1EWQA 3P32A 1E79A 2IYRA 2RGAA 2NIPA 2H92A 4DLZA 5F2EA 2NOAA 1G41A 2D2EA 2E87A 3THXA 3ZQJA 2J0VA 2GKSA 2BHRA 2ECKA 3HWSA 1QHGA 3SI7A 3ZVMA 2OZEA 4Q1AA 3T5DA 3BXZA 4A9AA 5C4MA 2WWWA 1IBRA 4DT1B 3H4MA 4KI0A 1AGPA 3IO3A 4LYFA 3KX2A 2JJ2D 3RS4A 4DWJA 2ZPTX 4RZUA 1MKYA 1UKEA 3P27A 4MYCA 3M6AA 1TUEA 3BORA 2V6JA 3CRVA 4OI0A 2I1VB 1HH4A 4HYYA 1OXVA 2BMJA 1IN5A 4C0SA 1ZM4A 2VEDA 4XD7D 2I1QA 1AZSC 4WAUA 2D7DA 1E2IA 1ETUA 2RCNA 1NMXA 1XU4A 1AKEA 2I4IA 4C0QC 4DLSA 4DT1A 4U7DA 2QSZA 4AY2A 2KE5A 1E9BA 4A0FA 1ZCAA 4X8LA 1G7SA 2HDNB 2IEYA 2FWRA 3FTQA 4PAOA 4YMVA 3BS4A 2CCJA 2FX3A 4MDFA 3DEFA 4Q1BA 4V0KA 3SZRA 1KI4A 4J0QA 1BMFD 1TU3A 3TNFA 2FU5C 2ZE7A 1ONBA 3WNBA 4NCHA 2JLZA 1HE1C 1OXTA 2P6RA 2HJGA 3RS2A 1RKBA 2F43B 2G0NA 3F8TA 2H7VA 1E94E 4HUQB 1S96A 3NG1A 4ZIRB 1G8YA 2HCBA 3PUYA 3QE0A 5K8TA 1VCOA 3CRMA 4MA4A 3OHMA 4JL5A 4YXWA 2F9MA 1SVIA 2RGBA 4K46A 3WP0A 1W0KD 4P3YA 2MSCB 3U5ZB 1CLUA 3P4XA 3GJ5A 2V1UA 1E1QD 4PPNA 5EUQB 3FYHA 1S4QA 4XOIA 2PH1A 2W0MA 4URXR 2VF7A 2EFDB 1QVRA 3CONA 4IOJA 4C7OA 1KJZA 4XTRA 5FPHA 4A92A 4JBWA 3L0IB 3ASZA 3U3OA 2KSQA 3K8YA 4DKXA 4EKDA 2GVZC 3C7KA 3DOEA 3L43A 2C9YA 3RRYA 2IS4A 2CK3D 4L9WA 5FOXA 3IGFA 1E99A 4B2LA 1IN8A 1N0WA 4ESHA 4RFVA 2QY9A 3VR3A 2HYIC 2NO7A 5UKDA 3A6PC 2A5JA 2FGJA 3FE2A 1UFQA 2G3YA 4DEYA 2P67A 1II8B 1ANKA 3AUXA 4POAA 5LD2C 4JLOA 3QKSA 5GJVC 4LY6A 3CX7A 5EXTA 1S2MA 2ZRCA 3AKCA 2XB4A 3EW9A 4IVRA 5FPTA 3T34A 3U44B 5CLQA 1SXJA 1RIFA 2JGNA 2GJKA 3AB3A 3NBZC 5BWMA 1OKKD 1E9CA 1R4AA 1QHYA 1RE0A 3R9IA 1ZYUA 4TTQA 3O8DA 2X2FA 5BQ5A 4JLKA 3IUYA 2XEXA 1M7BA 4D0NA 2O8EA 3MLEA 2FPMA 5DGXA 4CW7A 3WHLA 2BBSA 2JLYA 4PC2A 4QC2A 1UBCA 4YMSA 1R7RA 3W8NA 4DDTA 2B6HA 2HXSA 3GLIB 3SC3A 2NZJA 4K81B 3GFPA 1UBGA 4W7SA 3FKSA 3AVYA 1LV7A 1IXZA 4KO8A 3FMPB 2F3RA 2W6JD 4A15A 4Q47A 1KJYA 3LA6A 4QNMA 2AXNA 1E2JA 1GUAA 2PZGA 2IYYA 2ZI3A 1NLYA 4Z8XA 1NVWQ 4TYNA 1AQUA 1JEEA 3LW7A 4LPKA 1IY2A 4FMCB 3F0TA 3ZGXA 2WOOA 1NKSA 5J4KA 2GXSA 4M1WA 4IXMA 5AJXA 1CJMA 2BDTA 4GMXA 1GL6A 4CYMA 4X8HA 3I32A 3KDSE 4V0NA 1AZTA 5J5CA 3SJBA 4HAYA 1N6RA 3QSYA 4MRPA 1B0UA 4M4SA 2FG5A 1TEVA 4IEIA 2QT0A 4C0JA 1IAQA 5DN6A 3EPJA 1M6NA 5SZHB 3KJHA 1NP6A 4ZDJA 4M9ZA 1KKMA 2REOA 4B47A 2BKUA 5IK2D 2IYTA 4KJZA 4AKIA 1EXMA 4OYHA 3A1TA 1D8TA 3GJ3A 2WKQA 2XX3A 3I8SA 5FBVB 4MUAA 3Q9LA 1BS1A 1T4GA 4PO9A 3T06B 2JLVA 1W48A 2IW3A 3CWQA 4HDCA 3CX8A 1R8SA 4GT1A 4TLAA 5J4YA 3QPUA 4EDHA 2DCUA 1E9SA 1LW7A 4C30A 2CLDX 1DBSA 2ZJYA 2WWHA 3UMFA 2QZ4A 3NH6A 5CIQA 1XP8A 4Z51A 2NO1A 3AVVA 1TF7A 3S1AB 5BYJA 1N6HA 1M8PA 3CPEA 3HJNA 1XDBA 1XNJA 1BH2A 1P2SA 4LHWA 2QBYA 3QKRA 3EZ7A 4IKEA 1NMYA 3W6OA 2B7CA 3RVBA 4O25A 1VCMA 2WJJA 1Q1BA 4OQMA 3ICQB 3U61B 1P62B 4XVQA 4MRNA 1VKJA 2OILA 1FUUA 2QEQA 2RGXA 2BC9A 3IIMA 4H1VA 4US1R 5TB5A 3NC0C 4WVFA 4BFVA 3FMFA 1E4VA 1Z22A 2K5UA 3DMDA 3CNOA 5SZJA 2XTZA 1P7CA 5HR5A 3HR7A 2ZJ8A 2D7CA 4Y0VA 5HZKA 3OEHD 5KSOA 1NMZA 2FH5B 1XFAA 2ZS7A 2O0JA 3DM9B 3PR1A 4KXFB 2IEZA 4DSOA 1RYFA 1TQDA 3GD7A 3P26A 4IOLA 1YRAA 2CE7A 4HAVA 5FBRB 1OLOA 3A1SA 4MGKR 3SOPA 2EVWX 3QKTA 2JLRA 1GIAA 3CWZA 1FQKA 2YC2C 3Q7PA 2MSDB 5KPDA 1J8YF 2ZI6A 3AP3A 4K8OA 5E4FA 2C5LA 3K09C 2Z4RA 4P32A 5FPSA 2OM2A 2B8TA 4PAQA 4WA7A 2NO0A 1ZW6A 3SYNA 1HEIA 1Z08A 2OCPA 4QJ5A 1N6PA 4IDHA 1YZLA 4QJ4A 1XD9A 4RJLA 1IY1A 3OIVA 1ZRHA 4OL0A 3GJXC 5KNCA 4PHHA 5J40A 1E1RA 1AN0A 1E2DA 1NIJA 4ZKDA 4KFRA 3X1ZA 3AVQA 4DLUA 2WTUA 3ZD7A 2FPLA 5EQTA 2R6FA 4C2UA 1DAFA 4TMWA 4DUGA 2RHDA 4Q02A 4URUR 4Q7LA 2PJZA 4B73A 3CO5A 2BM0A 1S8FA 1G5RA 1QG4A 5F3WB 1IN7A 4JLVA 2GXQA 3AV0B 1Z0AA 1PJRA 4TL6A 4V0OA 1PLLA 5DHFA 4OQFA 4RVCA 1E0JA 2Z5FA 4NCIA 1UM8A 2FSGA 1KO1A 3CZPA 4G1UC 3B82A 1ZNYA 3K9NA 2ERXA 1KAOA 4C7OB 4LBZA 2C99A 4KFSA 4ZCLA 1IXSB 1WBDA 4GMDA 4GNKA 2O8FB 3KXKA 3TBKA 5AJYA 4I4LA 1WB9A 1E0AA 1KIMA 4A1FA 2IXGA 2C2HA 3CLVA 4DDWA 4L9SA 4M1YA 4RCYA 2OT3B 1AS2A 5FUYA 1TF5A 5FOUA 2JA1A 2B8WA 2ZUCA 3EC1A 2DBYA 3ZVLA 2WZQA 1GRNA 2XAUA 1FPMA 4F92B 1E32A 3I73A 4BLOA 2WICA 3O8BA 4Q7JB 1SVKA 4G5QA 1SKQA 5H70A 3MWJA 3GMTA 2ZI9A 2VO1A 2VHCA 3OE7D 5CB6A 4NH0A 4JSTA 4Q9JA 3NKVA 2NO6A 5IRCD 4UXHA 4HB4A 2ZSBA 2WJHA 2I3BA 2DWPA 4E03A 2ZEJA 1YR8A 2MMCA 2VHTA 1KYIA 1SVOA 3PUZA 2GTPA 2VP6A 5KHOC 4H1UA 2DWOA 1OFIA 1QBKC 3MRSA 3QUSA 1IM2A 2Z4SA 1JB1A 2ODBA 1H8EA 1US8A 5HZHA 3UANA 4UXIA 2AL7A 1CULC 2QP3A 1E69A 2V8OA 4NE2A 4YXWD 4EFMA 4IDPA 1I4DD 1IJEA 4D4KA 2IWHA 1QF9A 2VTKA 5KUTA 1JR6A 1KDRA 1TPZA 3W8RA 1T8TA 1Z0DA 2LKDA 2ZRGA 4M1TA 3GLHA 4DSUA 1IOZA 3KKMA 2B92A 4PPGA 1A1VA 1SGWA 4QGHA 1A5TA 1UADA 3IHWA 3LVQE 2WJGA 5DSZA 3RRNA 5KSPA 3KB2A 4Q4AB 5EP3A 1FFHA 3VNVA 2GK7A 2OAQ1 1CP2A 1XD2B 2FOLA 4LJ7A 2XNDA 4DEXA 3RNLA 3W5IA 1VG8A 2H57A 2DFLA 4ZDIA 3U6KA 4FWTA 2PT7A 1MRNA 4R2HA 2XXAB 1JEDA 2EYUA 1KSGA 2QT1A 3QPVA 1ZD1A 2IC5A 1LF5A 3VKHA 4D2IA 2ZS8A 2ZXUA 4D80A 1R0XA 2C96A 4LHXA 1J2JA 2O0KA 2OFXA 2ZU6A 1V5WA 3H86A 2VSFA 2YYZA 5DYIA 4ZDKA 4V0MA 3AEZA 4JVLA 5C18A 2D4HA 4M0LA 1IHUA 3PENA 3ZQ6A 4U5XA 2JAQA 4PC3A 2BKEA 3TSOA 2JLXA 5LDDC 4JBXA 1YVDA 4L15A 2HCJB 3Q3JB 4Q01A 3HU1A 2P5TB 3RDPA 2R6CA 3Q8XB 3ZZ0A 2C98A 4LI0A 4R98A 2Q9BA 4JMPA 3GLFE 4B3FX 1K5DA 4F4IA 1VYTA 4CDGA 1KK0A 5JBQA 1LVGA 4B3XA 4V02A 1R6BX 5JWRA 1KSFX 1TQ4A 5JJLA 5EZ6B 3SHFA 4AYTA 2W6JA 3E2IA 3EZFA 2VL7A 2ZRHA 4RKFA 2WJYA 4D4JA 1I4TD 1TTTA 4BGDA 5G41A 2BCGY 1FUKA 2C9CA 1CXZA 4BFWA 3GJ0A 1NN1A 4M8NE 2ZS9A 3B1ZA 1A2BA 2YKGA 3IILA 3DKPA 5J4LA 1LFDB 4QBGB 1E2MA 1NIPA 4HAUA 3WYGA 4QG7A 3N70A 5KSZA 5A4JA 1UEIA 4LBWA 3EIEA 1TUIA 1OHHA 1XB2A 2VP0A 4TSFD 1GWNA 3WMGA 5EJEA 5L3QB 1JAIA 1KO7A 3GQBA 1DS6A 4C9BA 4ZCMA 1TU4A 5K8IA 4AKEA 1T6NA 3KKOA 3OFND 1QRAA 2DR3A 4AG5A 1MABA 3A37A 2TMKA 5F9HA 1FZQA 1F48A 3D8BA 4F4JA 1CJTC 2CLCX 2REXB 4AWXA 4D26A 3UK6A 2ASEA 3A1WA 3B1WA 3BERA 4PZYA 2GCPA 1W49A 4FW9A 2YOHA 2OHFA 4EIWA 4A8JA 1GKUB 2AKYA 2AKAB 2JJ1A 2ZRNA 5JLJA 4V0ME 3CKLA 4BFYA 2BIFA 2XJ4A 3DHWC 4P4UA 1FL9A 4B6FA 2ZYTX 2QMHA 4ILEA 1P61B 1W5SA 2HJVA 1ZUIA 3ICEA 1EWRA 1HE8B 4R7ZA 2QTFA 4UKDA 4V03A 2P3SA 3VR5A 1XX6A 3DZ8A 3GJ6A 3THXB 5L3RA 3DL0A 4G01B 4RKEA 4LHYA 2VPPA 1WP9A 3PVSA 5EE1A 3WNDA 1UEJA 2C9OA 3ND9A 5DH9A 3MWKA 3A4NA 4Q9IA 4HUTA 5C2JB 3GPLA 2QE7D 2PEZA 2ZRKA 4MRSA 1W4RA 3CH5A 1EFCA 4QHSA 1VG0B 1E4YA 2J0UA 1JQJC 2IXFA 2KJQA 3BIFA 3BWDD 3KB1A 2ZYWX 4KVGA 1X6VA 1Z6YA 1WRBA 3E70C 3ZZUA 4LJ4A 3FGNA 2QE7A 4EUNA 4D25A 5FUXA 2DYKA 1RRGA 1S9DA 1R5NA 2VP9A 3ADDA 1DG3A 3BC1A 1G16A 4TL7A 2R44A 4PANA 5FR1A 2ZRFA 3T1OA 4C0LA 5JRZA 2V3CC 3PEYA 1TEXA 4TYYA 5JEEA 3VQTA 1P9WA 1COWA 1E9RA 4HAWA 3GLFB 1KZGB 2GJAA 4PR0A 4F91B 2YWEA 2JATA 1SVLA 4Q7MB 3LLUA 3RHFA 4QKQA 2CJWB 1GP2A 3LBNA 4Q21A 4G5RA 1XMJA 4GP7A 1LS1A 1OH5A 2OFWA 4FXPA 4Q1FA 4B2IA 5JSZB 1X3SA 1ZM2A 2DPXA 4Q4JA 1G7CA 1FTNA 2BJVA 1KDPA 4JYCA 4NDZA 2ORIA 2OXRA 1WBBA 4FCWA 1GZSA 2D62A 1E6CA 3T35A 1D2NA 5BN4A 2BMDA 1YJ5A 1ZAKA 3JVUA 4ZIRA 1R5BA 2W00A 3CRQA 2X1VA 4LJ9A 3B9QA 1NL3A 3GFTA 2RGGA 2JLUA 2PZFA 2P65A 2ZJ5A 1XEWY 2IA5A 1MRSA 2J3EA 2VSOA 4BLQA 3K70C 1TX4B 2GRJA 4F93B 2O8DA 2ZJOA 2UVQA 4KFTA 2ORVA 1KK3A 1G5TA 1ZBDA 5E7JA 2XGJA 4JVSB 3C41J 4KSCA 1BKDR 3SQXA 5KDLA 1OW3B 2Q3MA 5JI3E 5JJIA 3D7MA 1PV4A 4QOSA 1U8YA 4JS0A 4S2EA 2ERYA 2V54A 1SZPA 3BH6A 4RFSB 3LFUA 4LHVA 3X1YA 2MMGA 4AYWA 3GLIA 221PA 1O87A 2H1LA 2FMXA 3VTKA 5FBWB 3AKEA 1OXUA 1RZ3A 4TMVA 3OE7A 1ZM7A 3KQNA 3TUZC 1L4YA 2CL6X 3QF4B 1F3OA 1T0HB 4LHZA 5L8VA 2YVUA 2IS1A 3WP1B 2F7SA 4A2QA 1PLKA 1E2KA 1JJVA 4PHFA 5KNDA 3H84A 4PFSA 1KZ7B 4DLXA 1CJKC 2XOKD 2X77A 4EPVA 1W0JD 3B7GA
chains in the Genus database with same CATH superfamily
3BIXA 1LX7A 2W98A 3NQ41 3O8OB 5L95A 3LE8A 1BX0A 4H2DA 5A3JA 3T6KA 2J4DA 3PQ2A 3LDGA 4QJBA 3EVTA 3SDZA 1M5TA 4HOYA 5CURA 4O4JB 4Y1FA 4EW3A 2E1RA 1H2HA 2CDAA 4AKSA 1MU0A 2JFOA 3IBGA 5LZ8A 1LI5A 2GD6A 3WDKA 5LQUA 3I01M 4LX0A 1X7XB 5C3UA 1OF1A 1P4RA 3V80A 3WLPA 1Z4OA 2NPIA 3OLWA 4PQRA 2W70A 1HE4A 2I34A 1XQXA 2PWZA 2ZCUA 2ZE8A 5TV2A 2LGJA 3H1PA 3UA4A 1DDOA 4GLBA 4FN5A 4TXLA 1OB5A 1Y8AA 2H7XA 2QENA 4KV9A 3S7TA 1D5CA 4YUAA 5TPZA 3KT0A 3JCZA 1BDJA 3PZBA 4E2YA 5JJBA 5JSZA 1KPHA 4M1MA 4HLCA 3DT9A 3PK0A 1I24A 1VRWA 3INTA 2ZSFA 3H9GA 4HTFA 3RVQA 2CVFA 4O2RA 5DVZA 3FDIA 4OHUA 2VA8A 1OI3A 4I4TB 4YT8A 2H5LA 5FEUA 4JUBA 1CX9B 5AW2A 1I3KA 3E5MA 1FQOA 1OUMA 1ZOSA 2V7GA 4YUVA 4YRCA 1WCV1 4C0BA 5JMOA 3B2QA 4G0XA 4LNUA 4RKRA 1ZMBA 3IULA 1V8DA 4IF4A 3UIEA 1YZVA 1YULA 3DLIA 3B9PA 4MW4A 3K70D 1OBCA 1GTSA 3MN1A 1BCSA 1NSFA 2PR7A 3ZJYA 5LD2B 4Z4FA 2NXJA 4Z54A 3IPXA 5BVHB 1F0YA 4Q6WA 3RS9A 1O89A 5GJBA 5A7FA 1MORA 1E64A 1L5QA 1G6HA 1EFUA 3GJZA 1QSGA 1GZ4A 5CHYA 3AOGA 3U31A 3VUFA 3S0JA 1UBLS 1X2BA 1X7XA 2FZWA 3ZDBA 5DW0A 4BZQA 4D9NA 4QX6A 3CXUA 5K5EA 1R6TA 1GOTA 1GL9B 3PRYA 1NP7A 1X74A 4C5BA 3LAWA 3NANA 3HCFA 4LGYA 1P2UA 3WJAA 4BGEA 1LDBA 2I6TA 3COPA 5BO5A 3ETJA 3BD9A 1D2GA 2K2WA 2X8AA 3TTTA 5IXYA 1KRXA 2WILA 3IALA 3ETHA 4KIWA 4ZAGA 1WV0A 2EIXA 1NG9A 3WBJA 1EJBA 2R2AA 4G56A 4WECA 2WR8A 4AUKA 3PD7A 2F1HA 3LQYA 3CUTA 4A82A 4F85A 3ER6A 2QUZA 2JLQA 1X1AA 1G5IA 1ZGJA 1ZFNA 1EP3B 2QRNA 2COEA 2QF7A 4GC5A 5ENDA 4TRJA 3TO5A 3K6KA 5HUQA 5JNVA 4OEHA 2CF6A 3NM4A 1GG5A 1ZU4A 3EVDA 3SF8A 3ABSB 3LVRE 1OWPA 1RJEA 4ZCPA 3OIUA 3QM1A 4B74A 3HVIA 1CR6A 4QOFA 3DFIA 5EHNA 2JD0A 4LQCA 2J6IA 4Q5IA 2WFZA 2OQVA 3SIRA 5CRIA 1J0DA 1E96A 5A5DA 1I80A 3MOGA 3H5OA 3PKIA 4G0OA 4NJMA 3DO5A 1U9IC 2BSXA 5FJJA 4AKHA 4Q1CA 1PWZA 1Z75A 2OMKA 2ZRAA 4WZAE 4IX1A 1UOPA 1T5LA 1QQ7A 2HQBA 1N5RA 1KH2A 4GWKA 2QUHA 1W5AA 5FOVA 3OPMA 2ZPAA 1TNDA 1AMOA 3E9QA 1BJTA 2GKGA 2FWNA 2G25A 2RGNC 4NEHB 3SU8A 1UWLA 1ULBA 2HF7A 1US8B 2O3QA 4EZIA 5IHPA 3D6UA 1T3HA 2OAEA 2P9EA 3NV9A 3LOUA 2NUPB 1FNBA 4BJ6A 1XZDA 2CVPA 4AC9A 1RWXA 2G9NA 3I05A 2VPIA 8MHTA 1V26A 4AJHA 2WJVA 1GAWA 2QR3A 3RYFB 2PKRA 3VU9A 4CF4A 121PA 4JASB 2FPKA 3LBAA 4HDSA 2VP5A 2VHYA 4LY0A 1WVMA 2GCOA 1V7QA 4MYTA 4M87A 3VFDA 2XCUA 1SBTA 1Z0JA 2NUTB 4LOKA 3STWA 3KQVA 1X8JA 4KKVA 4PU0A 1CR0A 1Z82A 4EABA 3L6UA 3TVDA 2H17A 4ER3A 1EFLA 1R0SA 2JC3A 4WGGA 3DG9A 3H5RA 1J23A 1JHDA 1NDUA 3OPYB 5E1MA 2AW5A 3K05A 1I13A 5CPFA 1JI3A 3ESYA 3RABA 4CM1A 5JD3A 1YFJA 5LB4A 4HRXA 3GJSA 2QMUA 2CYCA 2GM9A 4WA8A 4PYRA 1AGRA 1SIWA 3IBYA 4HQFA 4YJ2F 1KI9A 2W2TA 4G5FA 4PN7A 3I8XA 2IH2A 1WE2A 3JASA 5KKCA 2YASA 4XWKA 3H2JA 1UPBA 4H18A 3PQ8A 4MIEA 1LUAA 1ZUNB 4R6WA 5C8ZA 2PHZA 1CS4C 1ZGCA 1W5TA 4RYLA 5EE5B 1RJWA 4DJ5X 5LOVF 1QTQA 1DBPA 1N5MA 1LLCA 4F5ZA 1KHHA 2VUIB 1X86B 2N47A 3D4IA 3H5TA 3L9WA 5C4GB 4EA8A 5AUPB 2I3AA 2HR1A 1QV6A 3IEMA 2BM1A 4UXJA 1B8NA 1AK9A 3COSA 3GYGA 5EPEA 1N2JA 4I6GA 5KNLA 2YXNA 1N92A 2GEDA 3GUVA 1HLGA 1NZDA 3DE3X 1JDSA 2HRDA 4W63A 4K6MA 5GJWC 4M0UA 5ESRA 1SHZA 2P6UA 4M1ZA 1OFUX 2VHXA 2EJTA 5F52A 4WDRA 5KOHA 1K6XA 4MKGA 5ALXA 4WUVA 3QKUA 3P0FA 3AETB 3CHYA 4I2NA 4EGSA 1X77A 5JQGA 4JT2A 3TRIA 1ZJYA 1CDOA 1UMCB 3FPJA 1N9KA 2WZDA 1B0PA 2O4CA 4CXMA 3E3AA 1OGJA 4HSGA 1FSFA 2F43A 3KQOA 4QM6A 3N7AA 1Z74A 3GV0A 2LRHA 1MIHA 3EEYA 4DIBA 1CEYA 3FOZA 4JYZA 4C6TB 3IB3A 3WYDA 2FNAA 4HXYA 3L02A 1QCCA 5EIAA 3A05A 1PL8A 2GS9A 2C2ZA 3SX2A 1J5EB 1H1LB 5CM2Z 2JANA 4Z7OB 3QENA 4DV5B 2O8BA 1N6OA 1LKZA 2YC4C 1MGPA 3FPBA 4Y1RA 4ENUA 1RI5A 2D2IA 2E48A 4F3KA 1XTUA 5KQPA 2G1KA 3OJXA 3NLLA 1RS0A 3OFNA 4P58A 4C4ZA 1X38A 1IEXA 4YWHA 1QDUA 1E2FA 4GX1A 1TYCA 3HA5A 1ULHA 3KVVA 2H5EA 4X92A 4F2PA 1CRQA 3I9OA 4F5DA 5C1BA 3KVOA 2FMTA 4A6DA 2X7JA 4CI0B 4NI5A 1E79D 4LY9A 4LSGA 1B76A 3BFKA 3KZXA 3O4FA 1LLFA 1RMTA 4IV8A 1G64A 5SY6A 3VSBA 4LUCA 3WZ2A 4BO6A 5AVRA 3CRNA 2J08A 4X8MA 5FAXA 2QVBA 4AMVA 1GFSA 4EECA 1RCUA 2MWMA 3TSAA 4FFSA 4KPUA 4TV9A 1VE6A 3RHZA 3QELB 2OQRA 2AJCA 4TVSA 2VSNA 2LUOA 1HRKA 1QRTA 1N7GA 2DUUA 1S2OA 3KYCA 1GG8A 1VBNA 2Q1SA 3OY7A 1EB8A 1WEKA 4FZRA 4OHXA 4PZ9A 4P38A 5FO1A 2RHMA 3WX0A 3FZQA 4MKXA 5CH5A 1LTQA 2RK4A 4IUCS 3V3TA 1CF2O 4ABYA 2VPXA 1RYBA 1KS9A 4ZI5A 1VMAA 5GMOA 1VRCA 1L3CA 4BC1A 3FDFA 4IFBA 5AXCA 4HSEA 3RJZA 1ZJZA 4RK5A 2JIZD 2NZYA 5C7YA 5JHGB 2CNNA 3OEHA 1KF0A 2I3GA 4MUKA 3RWMB 2YW9A 1PZHA 4YV2A 4ZTBA 5LYJF 4H4DA 3ZUPA 3QVMA 3A1NA 2ZQ5A 1DQPA 3TRHA 4U2BA 3AM5A 1VCNA 2M2IA 3HXKA 1THMA 2PUHA 3JVVA 3ZCRA 1K5GA 4WESA 1L1RA 2GK4A 5T8KA 2Q45A 1GPUA 4OQQA 3V4FA 2ATVA 5A0VA 1YH3A 3ASUA 4EF6A 4XPIB 3I2FA 1QO0A 5HTKA 4M2LA 1M0SA 3RLFA 1Z0FA 3AY3A 1XD8A 4MWEA 3PXAA 1M3SA 4NMXB 4BNYA 5AO9A 1OFHA 1Q3HA 1V39A 2FA9A 3WLKX 3RLIA 5M34A 2MU1A 3AYZB 3HB0A 3N2IA 3VV3A 4Z4HA 1H9BA 5EYPA 3QE2A 3RT9A 1RWMA 5HGXA 2Y4OA 3O92A 3OC6A 2EFEB 2X22A 4E31A 4BB5A 4XFJA 3TW4A 1EK1A 4ADSG 4CG1A 1Z9BA 4BNXA 2DG2A 3EIOA 1JFFA 3H75A 2DE0X 3DTNA 2A9KA 2NSLA 3BB3A 3EQ2A 2ILVA 1NG1A 1W0JA 4HAZA 3NHBA 4Y2UA 4I3FA 1PWEA 2QN1A 1QQ6A 3I04M 4TMFA 2H4XA 2GN0A 3HFRA 4XH9B 1LF0A 4RX1A 2GM3A 3DHNA 1FYXA 2NPFA 4QICA 3RSCA 2E4VA 3T5BA 1WQ4A 1YO6A 3EUEA 2NUTA 1XTRA 5MN5A 2PX0A 5H3LA 3H3FA 4MSUA 1CS0A 2HDOA 2UYOA 4ZOEA 2HDHA 3GT0A 4RLSA 1BZYA 3SJAA 3GRPA 1NUPA 1C1XB 5CJPA 3IEPA 1M2EA 5F4BA 4FR0A 1EVKA 4KZPA 1RBMA 2TS1A 4B35A 1VPWA 3W7AA 2ZJ6A 1ENZA 3FYSA 4URYR 4KWHA 4A8HA 2VBFA 1I1QB 5LKRA 1XTKA 1VSBA 3UKJA 4P93A 3LI2A 2XMZA 4KXWA 4DMUB 2EYQA 2C9MA 3GJ8A 3NBFA 4OYYA 4WZAB 5FPYA 4ETIA 1J21A 1A7UA 2FFJA 4M1SA 3SK0A 3WMRA 5ALVA 2V97A 3QF7A 1P3JA 2O2CA 3NDJA 2PFSA 4DR7B 3GZJA 3Q72A 3SC2B 2IV2X 1C9KA 3GEBA 1U7PA 3TBFA 3AB7A 1E9DA 1X42A 2L17A 2VNAA 3HZRA 3L5OA 3JQAD 2G72A 2WBLC 1PNQA 1TAHA 2XA1A 4O4IA 2MSLA 3HRHA 2APJA 1VIMA 2F1JA 4BQIA 5A1JA 3H1TA 3H8WA 1BNCA 4HP8A 4BLPA 5G3YA 2ZAOA 5AM4A 5T67A 1DAKA 1TADA 4KDEA 1OWOA 3RS0A 5HPYB 2QTCA 2F62A 4CVNA 2XMQA 4NHEA 4GVLA 3TKAA 4CZ2A 2KLHA 1TLFA 3AUKA 4U6NA 3T8YA 2QTLA 2SKDA 3S27A 3NAQA 2HHAA 4NJEA 2BMAA 1H65A 1XNHA 3NXSA 1U7XA 3OFJA 2YHIA 2QRUA 4X24A 4V1CA 1FFAA 4K40A 2Z1DA 3QYAA 1SBCA 4IJWA 5L3SB 1XXHA 5HOEA 2P7IA 4PHGA 4J7UA 1XG5A 5T41A 3WNDA 4EW1A 1RW4A 3I1FA 4PRZA 1UMBB 4N3CA 2V7EA 2YV3A 2HT1A 1FDIA 1ZEJA 3UCXA 1QZZA 5JMWA 1JMVA 4QBFA 1SXJB 5E7QA 1A7JA 2COKA 3IUQA 1UQTA 1G21E 2C2YA 1U4SA 2E2WA 1V3UA 3JQEA 3EPKA 1L4EA 2O7RA 3BBPA 3QXCA 3ZLBA 1TRKA 4PICA 4OBBA 1H1DA 1AXEA 1TZKA 4XJVA 4A6EA 4C88A 1WDKA 4JA0A 4JUIA 1O8BA 4ZT3A 1N0UA 1EEXB 5EVCA 3VYTB 3AJRA 3AVOA 4J29A 4V24A 2JFVA 3VMFA 4D0LB 2R4TA 4MYSA 1G1MA 1ZZGA 1IHYA 4JXJA 5BSTA 3TQRA 1XDGA 1MJHA 2QMZA 3A9WA 2IOFA 2XZDA 3HACA 5ALOA 5K8CA 1DWUA 4WN9B 2RGDA 2GEUA 4EQZA 1CY8A 5TY0A 3ZX4A 4GOOD 4BCCA 4DRYA 5GZ1A 1HX7A 1KO5A 3V1MA 4KOEC 2QLMA 3LUKA 5CM9C 3MAGA 3W9SA 5K6AA 3U6BA 3AEQA 1QNLA 3B3AA 1DUIA 3QKIA 4XLZA 3FWPA 3BILA 4PF1A 2CNKA 5LQRA 1Q1QA 4DVGA 1ZC3A 2XH8A 5EXEA 4PLFA 1U65A 3UKOA 2FX2A 1GU1A 1PGJA 2HT6A 4BU1A 2DBQA 4Q9DA 1FYWA 1U8AA 2X14A 1EUZA 2RJNA 5L4LA 4US0R 3ZZ1A 5LDHA 3A9TA 4L78A 3D8NA 2WE8A 4TROA 3DVAB 5IJ0A 4JJZA 5KHLB 5K9ZA 1Q84A 4IRUB 4D8UA 5ESWA 2GVDC 2J33A 4KB5A 3GUHA 4YAEA 4Z7NB 3CUYA 1C7QA 4FMDB 3FYUC 3MEQA 1FXUA 4G07A 4NIMA 2PBRA 4A7PA 4X54A 4LN1A 2VRBA 3HO1A 1NBHA 3EBPA 1Y5LA 4CKEB 4FX5A 3B1JA 5CB4A 1Y3DE 3UJAA 1KHTA 4ZCIA 2VAWA 3O7WA 1EFRA 1T3GA 2TSYB 4I4NA 3CR8A 4YR9A 2Z04A 5JV5A 3U7GA 4B3TB 1JSZA 3BGSA 3Q3GE 4U9IS 5DLYA 3ZE0B 1B42A 3C3BA 4X0EA 4QDZA 2ZYAA 4CLOA 3B70A 3ORYA 2W4MA 3W34A 1YAHA 5KYYA 4DHWA 2H1HA 1JPNA 4N7BA 3SLKA 4QUDA 4UDNA 4FWBA 2RIPA 5HE9A 5KOIA 4RGBA 3ESAA 5G4KA 3DPIA 4ZHQB 2DECA 2AXPA 2AMFA 3VJKA 1XU9A 1ISMA 3C3MA 3R3ZA 1P7VA 1OBFO 2GUWA 3SN6A 4CKBA 3D8SA 2XMBA 1JIIA 2VQEB 1TKBA 3DOCA 3WWPA 4F2DA 4QGSA 2D3TA 1KMNA 5E4JA 4K5QA 1DVRA 4AUMA 2GR9A 3N6RA 3AEKA 5AJHA 2VPWA 3C5CA 1AK1A 5BT9A 4B6EA 1CQJB 1GTRA 1CIJA 2IUUA 1G8HA 1YVUA 4XYEA 2GA8A 2OZVA 1JG3A 2WKRA 4YAGA 3RYCA 1UXIA 3PDJA 4OK6A 3WISA 4QFCA 5TPZD 1UKBA 4JC0A 3I4FA 2FE4A 1M74A 1Q3KA 4LYAA 4DA8A 1ZVKA 3MS4A 3E35A 3AIKA 4YRFA 4QHTA 3U7IA 3PICA 4FT4A 3ETLA 5C4IA 3CKMA 3PNOA 3GRFA 1QYXA 4RPHA 4C0KA 2B2XA 4DM3A 1SG0A 4II3A 3CBQA 2J48A 3RVDA 4AKGA 1NVUQ 4D9FA 1XTSA 1YB2A 4LJ6A 2EEPA 5CXQA 5J2UA 2OK7A 2HHHB 1WBJB 3RUFA 1L9XA 1ZR2A 4C0XA 3OJWA 3IBSA 1Z35A 1E3DA 1MOZA 1HNNA 1FRFS 5IH3A 2MYNA 2O07A 4GXTA 4I50B 4W1QA 5AK3A 5IDVA 3SYRA 3P9CA 2ATCA 4MQFA 4GS5A 1SELA 5LJLA 3HUEA 1XJ5A 3LH5A 5CDFA 3SFZA 4JBHA 3AM4A 3N5KA 4H7DA 1KJJA 4YPFA 1N36B 4KN9S 4EHNA 1FYEA 2H07A 2ZYHA 3OEED 3VSDA 1L9KA 2MSWA 1EK5A 1SVWA 1BYUA 1W34A 2BZ1A 3OCXA 5BURA 4X45A 2AEJA 4B34A 2GCIA 5JPCA 1R16A 1OVGA 4FDLA 4XEHA 2XI4A 4A0SA 2NU6A 3F2IA 3E7DA 4NOLA 3AF1A 5T3UA 5A05A 5CDYA 4TLEA 2ID8A 3ITDA 1RRFA 2WWGA 2YWRA 4DY6A 2V45A 2ZJBA 4C1NA 1GITA 2PLNA 4DZRA 4PBTA 3TMYA 3NDPA 3SEAA 2AF4C 4KAAA 1HT3A 3HCCA 1GPJA 1OY1A 1U4NA 1BHQ1 1GM5A 4L3WA 4FGJA 4IXNA 4W7HA 4QIHA 5F9FA 4ARZA 4IDQA 1LLQA 3EFOA 2PRJA 4ROSA 4XSGA 2BTEA 3EGXB 1Y8QB 4YNBA 4MQEB 2VH5R 1STOA 1V25A 1V6AA 2KI5A 3HJBA 3IV9A 3TW6A 5JWOA 1UZUA 1Z17A 3G5LA 1YE3A 2WOJA 1JJFA 2JH3A 1AMUA 3K9FC 1IUOA 2BELA 3EPHA 2YQZA 5JSYA 5JQGF 1ZIXA 1ESCA 1W44A 3C8MA 4DCVA 4E1VA 3IP5A 3H9CA 4LF8B 4G85A 2JHAA 2ONZA 4WK4B 3T7IA 1XTZA 2D1TA 2HN9A 3FOBA 3IUPA 1N6LA 1OYOA 3KFLA 4QFDA 3K0FB 5ESXA 3VDQA 5LBIA 1OXSC 4GL4A 5K20A 5MDHA 2ZYVX 5JLAA 2K7FA 1JKFA 1IH8A 5KSYA 1O9GA 2F1RA 4NECA 3GH1A 3RROA 1DRUA 1K3UB 4A4DA 2GK6A 4Y2XA 1YNOA 1ODJA 2XE7A 3TRFA 4DMFA 4ZARA 1S1MA 2IDKA 3AHFA 4AS2A 2LV8A 4OQLA 5B7QA 5FBHA 1XMVA 4Y9TA 4B6QA 4P3XA 1TTPB 3RQIA 4MR9A 5AM2A 2DLCX 1L5ZA 5FLKA 5HMLA 2QJTA 3K53A 4A36A 1Y1KE 2RI6A 1CR2A 2CHQA 4PHCA 4Q00A 3HSYA 4YMWA 4B3CA 4N3NA 3T61A 3U7FB 1CJVC 3ZTTA 3I9KA 2HSZA 5B2EA 5DCWA 2WJZB 1S2GA 2ZAYA 1J0CA 3EXFA 5ANRB 3VXKA 1Y33E 2QM8A 2VP4A 4JDUA 1JECA 3TS1A 3WVNA 1KIFA 2ZI4A 1TCCA 4DCNA 2Y76A 1FQJA 1R0KA 2NUAB 5KOJB 3ZGVA 4HNAB 3DO6A 1BIFA 1JHXA 2CJFA 3ENKA 1RNLA 3GPIA 1CQXA 2AE2A 2FPRA 3OQ6A 2WUGA 3QA3E 4Y8VA 4K1LA 5ENZA 4LRWA 5TF0A 1USUA 4BE9A 1WMSA 1Y6JA 1W36C 2QAIA 1Q7TA 1MXHA 1ZJ4A 1DJPA 4FIDA 1KI3A 4RY0A 1VSVA 3GT4A 4HS4A 4JJGA 5DTRA 1HC7A 2DX7A 3ORFA 4FEYA 2G4LA 3DS8A 3HYTA 1ELOA 3MFQA 2O6LA 4IL5A 5TRTA 5CLJA 4RD3A 3I9JA 3JZIA 4RVGA 1Z34A 2NSJA 3GJTA 4URFA 4AJJA 4D92A 1TL7C 2ZBUA 4XCQA 1NDQA 3A9RA 2B20A 4QWWA 2GZHA 2FZGA 4E6EA 2Q5FA 1EB9A 2XRYA 2EP5A 1TKAA 2J41A 5F7XA 4B6GA 2DPYA 1AQNA 1XVIA 1ZSVA 3H6HA 5CNMA 2ATIA 2D13A 2GEVA 5AI0A 1T1SA 1GEGA 3GLHE 3PX2A 4GD3Q 4MO2A 4TSFA 2XOXA 2BMVA 2GETA 4J0JA 3P2OA 3TCNA 4M1KA 4TVBA 3KYJB 2WSSA 4EH1A 1HDIA 1QF7A 2C2BA 4HZUB 1Y5IA 3NEPX 1D2RA 3UUEA 2Z2ZA 4R51A 2A2ZA 1VYVA 2MJLA 3NJ4A 3CO0S 1J24A 1KPGA 1PG2A 2QSUA 3ID6C 3K96A 3JARB 3R09A 4J16A 4NPHA 3L41A 3LQFA 3IT0A 3P8ZA 4J7CA 3ZY2A 2DUJA 1DKQA 1GEEA 1LTHR 3MGGA 3EMKA 1P1IA 2AJ8A 5G53C 5KNCD 2WHYA 3V2HA 1NBEA 2G4VA 1C1DA 4R8SA 2FSHA 1MHPA 4ZXFA 2Q5JA 5DNEA 2FDRA 2P6NA 1X9GA 1GA4A 2XUOA 3SLGA 3CLSD 1RE1A 2Y0EA 5EI5A 3E8XA 3HY4A 1DAMA 4KW7A 4PSUA 4QSMA 5K1ZA 2RKWA 3L4EA 3HO8A 3HN6A 3CVYA 2VJNA 2HF2A 2YTZA 2M6KA 1HMYA 2MINA 1SQGA 3RVKA 4DTIA 1OBHA 3UHAA 2RONA 4IAOA 1HOXA 3BIJA 4NE7A 1PP4A 1J2YA 3MMPA 4FMDF 5CLLA 1JJ7A 3UK1A 1KOFA 3IIJA 3WXBA 5L3VA 4H7PA 4NMWA 1TPYA 1WMAA 3OMLA 1CJUC 2XPCA 3OZCA 4E46A 4TLBA 2FWMX 3LQKA 1WCXA 4D9CA 3JD0A 3FJOA 3BJIC 421PA 1GCAA 1UC4B 1JP7A 2DHCA 2PLRA 2Y99A 3DHYA 3FW1A 3H42B 3N05A 4BWVA 5DNVA 3ZY3A 2WM3A 5ICSA 3B12A 1PL7A 5MFZA 1GTMA 4JFRA 1PJSA 2WT4A 4G4GA 3MTEA 1ZVJA 4DSAA 1RLOA 1YKSA 3EBOA 4NV0A 1Z6QA 1S3FA 5CDTA 2JRLA 2VP2A 4LXXA 1JXOA 3EG5A 3OKFA 4FGKA 2XCRB 1G3IA 1JSCA 1VLMA 4RH3A 4CQLB 4B3JA 3CS3A 4NNPA 2Y93A 2EFCB 3DKIA 3LJKA 4DIEA 1NW4A 4AF7A 1JKJB 5JXIA 3GUCA 4WZAA 2FN3A 3EFHA 3ESRA 3QX8A 3WMFA 4RL6A 1M2VA 3CH4B 3KETA 2CE2X 5EJEA 3U4CA 3UGJA 2DFKB 5SYNA 4YCNA 4LRQA 2NMVA 1G20A 2O5VA 2ZR8A 2HMWA 2VNIA 2AJTA 3RJ5A 1HTTA 4BQNA 4CF5A 4H6XA 4PTLA 1FMCA 3TVTA 1JSLA 3EMVA 3M3PA 2JJ1D 2QL6A 5AJVB 3LP8A 1RAGA 3KAJA 3O73A 1JALA 2YHBA 4I9GA 3RUHA 4RK7A 4OKIA 2G17A 4BO3A 5H3CA 3ZX5A 4TTRA 3LA8A 1H2EA 1ZW1A 4JGIA 3CN7A 4EUHA 5IVDA 4Q4CA 4U7GA 3M4YA 2XBLA 1T9KA 3HKBB 2RGNA 3GEGA 4I1UA 1V8BA 1CWUA 2ODNA 3EH1A 1MC1A 4JP2A 4LTDA 3T7CA 2BDUA 3D4PA 1KE1A 3TIXB 4JITA 1IEWA 1N0IA 3H3XA 2WKWA 4PC1A 3HGMA 2PXHA 5DP2A 2GF0A 4LBVA 3DOJA 1RBQA 4YMIA 3M83A 5ALZA 3VX4A 1JN0A 3IQWA 4ZAXA 4QE3A 1DRJA 4LY3A 1CEQA 1FB5A 1MEJA 1DO0A 2GLUA 3HB9A 5CLFA 1O3YA 3Q5EA 2CL0X 5FPPA 4HXEB 5KNBH 1M6VA 3AVPA 1ORDA 3G5UA 4P80A 4Q24A 1JBEA 3MT0A 1KAQA 3BFVA 1L8LA 2YBEA 1E4OA 2Q1TA 4Q7KA 3Q3CA 3FCXA 3HADA 4OQXA 3K73O 2AI3A 4ASUD 4RXTA 3W5VA 2X0KA 3ZDZB 4FMPA 1OAKA 3ZDDA 1MX3A 2CK3A 2WJ3A 1WD7A 2VJKA 1E5QA 1TAQA 2RGCA 4E14A 3TQQA 5IS2A 2X5OA 3QV1A 1Z0ZA 4HWPA 1VPDA 1I7DA 2ATXA 4JJ8A 4Q34A 4ALLA 1C7JA 1AHNA 3KRTA 5F35A 3SC6A 3LTNC 2IH5A 3JS5A 3O82A 4HMOA 3FPKA 4N5MA 2RGEA 3LFTA 4URVR 1BA2A 2C5AA 4AM8A 2HMYB 3MT8A 3HCWA 5CMLA 5FWYB 4CL8A 4YRRA 2PMKA 4RBNA 2JARA 5DGIA 3A6JA 4ETMA 1E59A 3QVXA 4PO8A 1NVEA 5M04A 3VOBA 4D0SA 4FOLA 1P77A 1FFDA 2FUNB 3QLTA 3DVLA 5FOWA 2NO5A 4CTKA 3V1YA 1UAGA 4QM7A 1EH5A 2ZYUX 1M8GA 1NY6A 2DFNA 4L4YA 3RT1A 2JLWA 3EARA 2YJ6A 2FFBA 2KBEA 4FHCA 4QDUA 1QX3A 2QMOA 2IYFA 4ZAFA 4U02A 2QTVA 2ZI7A 2HA0A 1F2TB 2JVIA 1JKJA 1Z0KA 4KQJA 3F5SA 3CM0A 4C89A 1CDZA 2HEIA 3N0WA 3UFBA 5JAOA 3T15A 4BPBA 3SMQA 2ZRBA 3C1AA 2Z2JA 1M2OA 1ORWA 4JK3A 4JI3B 4OQEA 3AU9A 4OHWA 4PG6A 5JS8A 4WNYA 2AJBA 4PZPA 5KYUB 4IIJB 3JPYA 4IHQA 1FUYB 3TSZA 2QUKA 1T5BA 3KQHA 4FVTA 4WBSA 3ZNOA 1EA5A 1PJCA 2QRVA 3OH8A 1FXWF 1E1YA 2UVPA 1PZXA 3RYIA 4DLTA 3ROZA 5CK5A 3TTYA 2R5WA 2H1VA 1OFVA 3IJPA 2G7MC 4Z6KA 2H4JA 3E27A 4KG7A 1YQXA 4L50A 4OM7A 3OMWA 4RDIA 5CR9A 5FBKA 3TSWA 3UJ8A 1B15A 5EJMA 2AG5A 3L4JA 4N7RA 5TMEA 3DNFA 4PYKA 1V37A 4X6YA 1OBVA 4JVMA 1VDZA 5IN5A 1QYRA 2WJ4A 4Q18A 1XZGA 2BCJQ 2R62A 3HB5X 2E4WA 2M1XA 3K0AB 2OCIA 5IM4A 1XDZA 3CA8A 1VGVA 3EISA 3K9HA 3AP2A 3L3BA 4E13A 2CLIB 2P2SA 1ZH2A 3OIGA 4MVJA 4XYMA 2O2XA 3DYVA 4PEVA 2R6JA 2VCHA 3SXUA 2C5FA 5LQDA 4KR6A 3A3NA 3QLVC 2ZYDA 5DCUA 3GHHA 3PGMA 3USES 1A8HA 1CUCA 1FXSA 4UNIA 1Z3CA 4BUJA 3K9WA 5IT5A 3I58A 4JQZA 5KPJA 1E5DA 1ID8A 5JAUA 2B1QA 3GELA 4CG2A 4CTJA 1Y37A 1XA4A 4FHEA 1YL7A 2VNJA 2RJOA 3EB9A 4PCVA 2I6QA 5E8JA 5EHQA 2JIOA 3I9MA 4WCVA 1KJ8A 2I6UA 2WPDD 2MR6A 4FFDA 1RQGA 2G5PA 1CV2A 1KGDA 4G9BA 2CXSA 2QTHA 3MINB 4ZOLF 3A4LA 3SKVA 4CU5A 4I1OA 3UWKA 1PFKA 3A6HA 3MCVA 4O4HF 1Z6PA 2BZGA 2CSUA 2G9QA 3GR6A 4H3VA 3JQGB 3WMEA 4PGFA 4ZICA 1NI4A 4MRMB 3BZBA 4IDCA 2QPTA 1CY6A 2N1BA 3LX5A 2ZZNA 1GAJA 3L7JA 4BVJA 3B5JA 3LPAA 1Q2XA 4J0GA 3M6VA 5AHRA 3WYNA 5B1YA 5IF9A 1I10A 1KO8A 4CEIA 5IMSA 3R75A 4FFWA 1NVVR 4EJMA 1T15A 4RS3A 1P0CA 2VSQA 4F3CA 4X20A 4JI2B 4MQUA 3FDXA 8OHMA 3BUSA 4OHKA 1GARA 1KKUA 1NR1A 2ZIXB 3RTCA 5L40A 2JAWA 1BQ3A 3C7AA 3LK6A 4K3UA 3VU9B 3A04A 1MA3A 2Y0DA 1NKTA 4IINA 2HMAA 4I55B 1MO3A 3LU1A 4QTZA 2JRCA 2AH5A 1KJWA 4RD1A 5DM4A 2E9SA 2GLTA 1L8OA 4NBWA 3M6WA 5IDWA 3TLAA 1FFEA 1V5EA 2BKAA 4QUKA 4BX2A 4YQFA 5BVGB 5CFRA 3T3DA 5JJKA 3ROMA 1MVOA 1YR6A 5F2NA 1GGKA 1KERA 2QZJA 3NT5A 1QVAA 4P7BA 3LT5A 1D03A 5DBEX 1H0KA 3OSUA 5KWSA 3FRHA 5KTTA 1NBAA 3GOQA 1ZUD1 3PP8A 3GLQA 1E3SA 3T5CA 3TK1A 2X8JA 4GMHA 5BR1A 3M70A 2V7TA 2IXEA 3I42A 2CLMB 1PGNA 2GN1A 4JXZA 1ZPDA 2WG2A 2ZIAA 4UJ3A 3FOWA 1CC1S 1P6XA 2FZ4A 4FHZA 4FEGA 3BE4A 5H02A 2HQSA 4RA9B 1MB9A 5LP1A 3O74A 3P0IA 1ZRMA 1ZHHA 4K9SA 1JE1A 4DIDA 5I4CA 1R4NB 1CUEA 1TECE 5DHPA 1DOHA 2W8BB 3HDGA 4G97A 4GQAA 3OE1A 3QKWA 2A5DA 4Z2YA 3WMWA 1ZCZA 1GKYA 2OZLB 3VPXA 2BUAA 4BEJA 4CMIB 1JTEA 4HDQB 5EE0A 1A5AB 4DLLA 4E5YA 1A9PA 2KQUA 1WMFA 4AS1A 3CC8A 1VIAA 4MUJA 1IU9A 4IZIA 2Q3LA 3ACBA 5CBPB 4QUAA 3ZVNA 3ZIAA 3KBBA 4H15A 1E7WA 5CA0A 3ICWA 2OC4A 3D6FA 2OD9A 2ZXEA 3DFKA 2QG4A 3RNOA 1G3QA 1BAPA 1HBJA 4OSPA 4F3YA 1E6WA 4RDCA 4WW0A 1W59A 2BP7B 2EHJA 4HNTA 2GXAA 1E1QA 2F3TA 1QG2A 1NLUA 2ECFA 3H9EO 3KDPA 2IT1A 2ZR0A 1FYVA 4U2GA 3ANLA 1FLAA 4J1TA 3UXYA 2XMCA 1ZA2A 3VISA 4CDMA 4HNVA 3TOZA 2GSDA 2RD2A 1GRVA 3OZSA 5CX1A 1VQ1A 1BGXT 1JLSA 2O5RA 4DYVA 5DN9A 4ZOQI 3U3JA 5CA1F 3UHOA 3OEYA 2QTZA 2Q5EA 2Z9BA 1A7KA 2ZSAA 3IVCA 4UD6A 1C3EA 1JE0A 3PI7A 3IR7A 3ZDFA 1DHRA 1SOAA 4Q05A 1UJ6A 2WU0A 3SVTA 5C5EA 4GUAA 3GPDG 1VECA 2W0SA 3G2LA 2PH3A 4J43A 1YZTA 2B7LA 2Y77A 1SCQA 3AJ9A 3KQSA 1XROA 3L0PA 3NBAA 3L6BA 5AOAA 3FHOA 5J4VA 1PNRA 2JK1A 3D0RA 3KT8A 1G2QA 4N5LA 2GJ9A 4XGRA 4BDTA 4MJXA 2P91A 2VJOA 4R1NA 5DNYB 3NOVA 1RAFA 4Y1GA 1ICIA 5J43A 3CX6A 3ILYA 2IJGX 2XGOA 1JXAA 3FFBA 3K1ZA 3OZBA 5EMJA 1WXXA 1ULTA 2WSMA 5A3SA 2ERCA 1IULA 1IIBA 3ACCA 1YR2A 3NP7A 2IYLD 3GJ4A 1DOZA 4R4JA 4RIFA 5LSAA 4DMRA 5EJ8A 1DJMA 1M8JA 3IAUA 4B1FA 1W30A 4KQMA 2ET6A 4UBJA 2IIVA 1Z25A 3LZCA 3ZWVA 4CKWA 1OX6A 4S1NA 2WF8A 4W4TA 3C8UA 4JYAB 4REOA 4ZI2A 2VPQA 3QXHA 1FX0B 1KP9A 1G21A 1MPTA 2OORC 4IGIA 5LA6F 5REQA 5TGZA 5HQ3A 3LX8A 2HIHA 5K0JA 2JAXA 1ZD9A 1I2MA 1LNZA 4MW1A 1L4HA 4XQ0A 2J8ZA 4DV3B 3QEOA 1QH1A 2ZKLA 1SPBS 3T1VA 4N8DA 1JLRA 1UWKA 4LMAA 5FTJA 4ZYLA 4N0EA 4J07A 5EZYB 1BRMA 3W90A 4RTRA 3A9CA 2O48X 1E1MA 4QVKA 1KWKA 3ZHVA 4CL3A 1VFPA 1Z7BA 2ZRMA 3RYCB 1D8AA 5L6MB 3E0QA 3AIOA 4EG1A 1JQDA 4RDHA 5AKXA 1P0PA 1CQJA 3T7KA 3N58A 3FPAA 2ZM5A 4A6XA 1M72A 1ZLXA 1SUPA 4DV6B 5CVTA 1XEWX 4LDNA 3UG7A 1Z2PX 5FDFA 3OFVA 3NASA 4X9XA 1Y1LA 4B84A 1VPTA 1NUUA 1YA8A 4O3FA 3T0FA 4LMPA 1V2GA 2JGFA 1CUIA 2ZDQA 4X1OA 3VSCA 3SJCA 4PG7A 3WRYA 4B32A 4E1BA 3O47A 3QW2A 4FQ5A 4GKBA 4F56A 4Y9DA 2P3QA 2NYRA 3GRRA 2PS3A 3SHWA 2LBPA 5AT1A 1RHMA 2AA3A 3V55A 5T8KC 1QMPA 4YP1A 4MPDA 2BD0A 1BGWA 4E3ZA 1JDTA 5EIFA 4EJFA 3G5AA 3OJCA 4KYVA 5DRTA 3A9UA 1L1QA 5DBHX 2NVUA 2V6IA 3ESCA 4JGBA 5ARBA 3V9PA 4DA6A 1MX5A 4F06A 4OYRA 2CD7A 4NAUA 3U3KA 2R8YA 5LQCA 3U13A 4QAQA 4B4UA 4QOGA 3BMCB 1JJBA 1NJGA 1P9NA 3P0HA 1F38A 4IDAA 3UOWA 4CFSA 5CDUA 2CKDA 3CX3A 4CIWA 2JLBA 3TZQA 1SFRA 1EBUA 2HQOA 3C6ZA 3L6EA 1OE0A 4J0EA 3PXEA 1XWWA 3FF1A 4O4JF 2JGRA 1HE2A 3C1TA 3DXYA