1KO8A

Crystal structure of gluconate kinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
172
structure length
172
Chain Sequence
TTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLKARKGHFFKTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Gluconate kinase
total genus 58
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2001-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ko8A00
4LHYA 3A58B 1FUUA 4B3DA 3A6PC 1J70A 3B60A 2JLQA 2J0VA 3SEAA 5KDDA 5IRCD 1S9DA 2VSOA 1AQYA 4P3YA 1G3IA 2GEVA 2IYQA 1OW3B 2IS6A 2HV8A 1W0KD 3MWKA 1H8HD 1S4QA 4BECA 4GL2A 3LXRA 4RD6A 4F38A 4AY2A 5HCNA 1TTTA 2D62A 5JJKA 4A8JA 1NY5A 5SZIA 2FF7A 1V43A 2ZRPA 3OAAA 4PO8A 2OO7A 4OK6A 5AJYA 2CHVA 4ERNA 4NP6A 1S1MA 2IYZA 2JLXA 4Q9IA 1W47A 3LNCA 3NG1A 1AN0A 2YVUA 1E1QA 3NBYC 2RGAA 4TTQA 5FPHA 1VIAA 1CS4C 4FMCB 1J2JA 4TL7A 2BMEA 2Y8EA 3VR2A 1E2HA 4TLAA 4KFRA 1DELA 2R2AA 3B1ZA 4JBXA 1B0UA 2PL3A 1Z6GA 5CLLA 1VG1A 4IOKA 1NN5A 4KAXA 2ZR0A 3K0CC 1I2DA 2VIIA 3M4YA 4NYIQ 2NPIA 5KYKA 3U4QA 3PEUA 3KX2A 4Z8YA 4JLPA 4URWR 5EE0A 1X8LA 4QGHA 1OXVA 1YR6A 2GF9A 1A7JA 1QHYA 1S96A 2IK8A 2I3BA 2ZE6A 1P7CA 3FPAA 4HAUA 4LY6A 4RD1A 5CK4A 3FMFA 2QTVB 4ITRC 4PHGA 3GPLA 2ZAMA 2C96A 1SXJC 4RZ3A 3DOFA 4LHVA 4XTCS 4YDHB 3AF0A 1Q1BA 2XJ9A 4G01B 1FX0A 4DC9A 2AKAB 4ESHA 4QBGB 4CT4B 3N2IA 4QGGA 5HPYB 1SHZA 1P73A 4TMTA 4HZUB 4B34A 3R8FA 2WWFA 3TGPA 3ZLJA 1EXMA 4PPNA 1NY6A 1YZGA 2CNWA 1J8MF 4NMMA 4HUQB 4PC7A 4B6EA 1HT2E 3OEHD 4HB0A 5HE8A 2W6JA 1W0JA 2ERXA 2R9VA 2JJ8A 2V9PA 2WSMA 3C4JA 4PC3A 1E1QD 5EXPA 1GSIA 5TVKA 3O8RA 4R71A 3ADCA 4QBFA 2IXEA 5DH9A 3FDIA 1NLZA 2I1QA 5AJZA 2QMUA 2QM7A 2JJ2A 2MSCB 3EIEA 4NCKA 3BIFA 3K9GA 5FFMA 1W5TA 4KXFB 4A8JC 2RHDA 1XMJA 4S35A 2WSSD 1XXHB 1CTQA 4UNPA 3WY9A 1A5TA 3OEED 3SYKA 2OCAA 4ABYA 1JR3D 1HYQA 1LFDB 3SBDA 3NIBA 2F9LA 3PEWA 1TQ6A 4OHYA 3GJ8A 1FTNA 3TAHA 4FIDA 5JLJA 3ADDA 2OCPA 1R5NA 2F55A 5P21A 4LSGA 2BBTA 3LXXA 1KK1A 1YKSA 4BFWA 3R7WB 3ZS8A 4DLWA 3K9NA 1GNPA 2WKRA 5EP2A 3WNBA 2IXGA 3HU2A 1ZM3A 2WOJA 3EC2A 3BJIC 4KV9A 3UMFA 1P6XA 1KDOA 1COWA 1O87A 5IDVA 2GBLA 3SFVA 1Z6AA 1KZGB 4TMKA 1RZ3A 1M6NA 4JLVA 5KPDA 3R9IA 2GJKA 3CRW1 4MYHA 3WP1B 4DSNA 2HLDA 4UNSA 1KNQA 3EW9A 2FH5B 1M7HA 2QUZA 5KU1A 1OXXK 3EA5A 3HYTA 3RVBA 4LX0A 1EFHA 5CJ2A 2O8CA 4HI0E 1OH6A 5JWHA 1R10A 4M9SA 3I4LA 4ARZB 1I4DD 2VSXA 3THWA 2FPMA 3PEVA 3DEFA 1DE0A 3PVSA 2NO6A 3QKSB 2CLCX 2XOKA 2KWIA 2A5JA 4M9ZA 4GMDA 3PUYA 5EP1A 1W4AA 3RS3A 4DCSA 1NF3A 2JIZA 4RD2A 1DTSA 2CCKA 3ZQ6A 1YE8A 1MABB 2FFQA 5CYPA 3VQTA 2AWNA 4LBYA 4EQ6A 2VQSA 4D4MA 3IQXA 4YQFA 3CB4A 4KHZA 2QMOA 4BE7B 1TX4B 2GAOA 5FI1B 1IN6A 4AYXA 4D4JA 4A6PA 1QHNA 3H1TA 4EJSB 4O3MA 4I1SA 4DLZA 4YXWD 3VKHA 1IQPA 1OXTA 4LJ8A 2QY9A 2ZYVX 2FG5A 2P6NA 2PLRA 3CNOA 3K0CA 3TK1A 4DKXA 2NO9A 2ZTSA 3ND8A 3R20A 4N0DA 3W9YA 5LBIA 3SJZA 4NYMQ 5DYGA 4FMBB 1ZUNB 1J99A 1RJ9A 721PA 2WJHA 1JB1A 2ZM5A 2RGNC 4BQSA 5AUOB 3ICQB 5KO2A 3IUYA 1AZSC 2FFBA 1LVGA 3UIEA 2WZQA 2YC2C 1UM8A 2LWIA 4DJTA 5JI3E 1J7KA 4V0OA 1Z29A 1VHTA 2H16A 1IOZA 5HKKA 2H8KA 1NRJB 1E0JA 1BS1A 4A2PA 3MSXA 4ZI3A 1CULC 1U8YA 3TVDA 3T06B 1CJMA 3GFOA 1XZPA 1EFUA 2Z83A 2ZSBA 1K6MA 4DDWA 4CW7A 1G41A 2HF9A 3BH7A 1L4UA 4NH0A 3L8ZA 4LV5B 3PFIA 3QF4B 4TYNA 1YZLA 3TRFA 1VG0B 1TQ2A 4MUBA 4EFNA 1XWIA 1XXHA 3Q7PA 4JL8A 4TSFA 1NVVQ 2XB4A 3QF7A 4CEIB 4M0LA 3RS5A 5JRJA 1SKYE 1ZNYA 5BWMA 2VO1A 1ZCAA 3H86A 5FUVA 3VHXA 2XXAA 3B78A 1ZM7A 3QENA 1N5IA 4W9MC 1KJWA 2H17A 1NKSA 4BFZA 4C3ZA 1MRNA 1U94A 2QAGC 3LW7A 2C8VA 4I1OA 4NE2A 4GFDA 1SVMA 4B32A 2J0SA 2GILA 1NKTA 4A4DA 4WOPA 1Q1EA 5K8LA 3GCGA 3LFUA 3RSLA 4TL9A 3O8DA 1N2CE 2BM1A 3VNUA 1E2MA 2P0EA 2CLSA 3NBXX 4DEYA 4G5OA 2ORWA 3KFXA 1IJEA 1TU3A 2CXXA 1R5OA 2O0JA 3QKUA 4M9XA 3RS4A 5HKKD 3AUXA 5CITA 3TIFA 5DSZA 3SU8A 4X8HA 2QNRA 2WPDA 3RNLA 1U90A 2TMKA 1FMJA 1JXOA 2BKUA 3QVUA 1UKVY 2J45A 3TQCA 1KKLA 1US8A 1XX6A 1ZW6A 2W6ID 1NMZA 2GEUA 1WXQA 3C8UA 1R8SA 5C4MA 4AWXA 1AS3A 4DCTA 4ZDKA 5L3QA 1OSNA 1OYYA 1AZTA 4HB3A 1J90A 4IDOA 4PR0A 2W00A 2A3RA 4FMDB 1L8QA 1O3YA 1DAMA 3SYLA 3I61A 1N6PA 1CXZA 4EJSC 1JEDA 1KKMA 2GZAA 1RFLA 2FOLA 1NBMA 1KIMA 2YV5A 3KKMA 4DLTA 2IUUA 4QNRA 2EWVA 3P4XA 1E4VA 3EC1A 1XTSA 2VHTA 5KTYA 5CIQA 1OFHA 5DN6A 3L2OB 1XD8A 4H9GA 4YLGA 1PLLA 4U5XA 3PXGA 5DLQC 4C2UA 2A7QA 3W34A 4DSTA 3TSZA 2YNMA 3GJXC 1WF3A 4MQBA 1W4CA 4A82A 1OIXA 2ZEJA 4JL6A 4NKRA 1HQCA 5J5CA 2ZRLA 1ESNA 1T6NA 2OESA 2OBNA 2J46A 3UANA 1UKYA 2BBWA 4OI1A 3BFKA 1NJFA 4URYR 4B2LA 3WMFA 2ZPTX 1OXSC 4AKEA 2ZJ8A 3LQQA 5C4GB 2QN6A 4AURA 2HLDD 4Z8XA 2EFEB 4DXAA 3I3SR 4DCVA 5L3VA 4EPRA 2QMEA 1HUQA 5E7JA 3TUZC 2UVQA 5HTKA 2JLWA 2A78A 2JEOA 3L0IB 1YQTA 4ZDIA 1G7CA 2WIAA 1OKKD 2WWIA 3FKQA 4WZAE 3C5CA 1Z6XA 2C78A 2CE2X 5FR2A 3RSOA 1RC8A 4ACBA 3UG7A 3NH6A 5BN5A 4OQLA 2EW1A 3AF2A 5AUNB 4TLEA 3WXMA 1Z8FA 3QVVA 3UG6A 2OILA 5FTNA 4AYTA 4UNQA 3AP3A 4MGIR 1KO5A 1E9CA 1RRCA 1AKYA 5CYOA 3TSWA 1BH2A 4C0LA 3I5XA 2BC9A 1FNMA 1KY2A 2PJZA 3MMPA 4JVLA 5H70A 1KO8A 2VEDA 2XTZA 1RVDA 2GZDA 4DIEA 1X8KA 3D31A 2N1BA 4LZZA 3KB1A 2WMOB 3QG1A 3T34A 2AR7A 1KDRA 4OQFA 5SZJA 2ANCA 2VHQA 1W5SA 4XOIA 3OHMA 4JT4A 4US2R 4XSGA 4MITA 2XGJA 5JSZB 3I62A 4Q9HA 3A36A 4QJ3A 3T5GA 5ELXA 1XZQA 5GVRA 3UMSA 3W6OA 1F6BA 1YRAA 4FINA 5HR5A 4TLCA 4DLYA 1IXZA 1A4RA 3TW8B 4JLAA 2CL0X 1BIFA 4PQFA 3QY0A 3PEYA 1W49A 3NEJA 5KNBA 1QHIA 5G40A 3K1JA 3ZVRA 2IYTA 2OFOA 2K5UA 4DBLC 1T8TA 4EQ6B 2P2LA 1WA5A 4POAA 3PJRA 1QHHB 2XZOA 4A36A 5IHPA 3EZ2A 3HPRA 1JR3A 4US1R 1UBEA 2EU8A 1E2JA 1Z0DA 4RSGA 2C5LA 2PLFA 4EAQA 5KUTA 3ONWA 3ZD7A 2ZRKA 1E32A 5E4FA 2A2ZA 3GEIA 4NYJR 4RJLA 2DWQA 1PV4A 2GETA 4LRWA 3U2QA 2FSHA 2XJ4A 4L15A 1GAJA 2NG1A 3JZAA 2B7CA 4JLJA 1XU4A 1GKIA 2HCBA 2ZS7A 5B57C 1NN1A 4DLXA 1YR7A 4ZCMA 4KLZA 3ASZA 3X2SA 2Q21A 4C0HA 2CNWD 2HUPA 4Q03A 1KI3A 3K0EA 1E6CA 4Q1BA 3LLMA 2BBOA 4HDCA 5FOSA 5TY0A 2GA8A 2OV2A 2MMCA 4QNMA 1KMHB 2C9YA 4TN1A 2O8FA 4XVQA 3GLFB 1QHHA 2OT3B 4EPTA 3AVPA 3AF4A 3R7WA 4BWYA 1KI4A 3GLFE 2JLVA 4L9SA 1ODFA 2G1JA 4IOMA 1W2GA 4RD3A 1R7RA 3Q5EA 3UATA 3DKVA 2AFIE 2QMHA 2BBSA 1KDPA 3W6NA 3IHLA 3QNUA 2L0XA 4KITB 4FI3C 5EXSA 2J87A 1M7BA 4P4UA 4DT1B 1KI8A 1KI9A 1U9IA 4LJ6A 5CB8A 1KI2A 3TLXA 3VX3A 2WM9B 3WBKA 1KK3A 1XRJA 1Q1ZA 3NH9A 4QKQA 5DI9A 3WYFA 4MYUA 1T0HB 1E9FA 1Z07A 2SHKA 4TMZA 4PC2A 4GOXA 4RCYA 5KHOC 1WBDA 4PAOA 4MDEA 2VSFA 2IT1A 5FOTA 3B6EA 4A0RA 3THYB 2VTKA 3RWMB 5A4JA 1NP6A 4RKEA 1KNXA 4I99A 4D6PA 1JAHA 1F2UB 2QL6A 5GJWC 3I5YA 4PO1A 3THXB 2OAQ1 1YZTA 4NL4H 3WRYC 4QGAA 2DR3A 4B3GA 3B9PA 4C0JA 3BS4A 4FW9A 2GJAA 5CDFE 4XD7A 3U61B 1R5BA 1T9HA 2C77A 2QTFA 3NHAA 1LY1A 2WAYA 1LTQA 1X1RA 3EPJA 3QXHA 2ZREA 3OZXA 3THYA 4DUGA 4Q66C 4LV6A 2YWFA 4AKIA 2V6JA 1Q3HA 1G6OA 1NVWQ 4QJ4A 3FHTA 1E1RA 5FR1A 4A1FA 1Y63A 3OIVA 1D2EA 1JALA 1TUIA 1YHNA 4Q21A 2YHSA 4IDPA 4PSKA 4Q18A 3DOEA 1TF5A 1JAIA 3GJ7A 5H1YA 1CR0A 4D4KA 3PG5A 5AJVB 3EASA 1KAOA 5EZ6B 4AC9A 2VF7A 4LOAA 4P31A 1VHLA 4E5UA 1ZMXA 1GRNA 1WMSA 5FPYA 1TMKA 1OF1A 4D0LB 1QVAA 1SVOA 3L82B 2FMXA 4Q01A 5J4LA 3BH6A 2ZITA 4EKDA 5FL7D 3X1XA 5K8UA 1EWRA 2ODWA 3M0EA 1XPRA 2BMFA 1DAFA 4ESVA 1S8FA 2CMKA 4A8JB 2RKOA 1XEFA 1PVOA 4PFSA 5KOYA 1N5KA 2NPFA 3M6AA 5FBVB 2CK3A 2XNDA 2PZGA 5CM9C 4EIWA 2ZR9A 4Z51A 1QRAA 3A4LA 4OI0A 3QI2A 1W2HA 1E2FA 4OQXA 4P4TA 4QHSA 1N6LA 5DIFA 2OE2A 1DG1G 3HR7A 4ZIRB 2ZJZA 5E95A 4QOSA 4UQOA 2WHXA 3GJ0A 4TYWA 3LVRE 5JEDA 1ANKA 3K70B 2FGKA 4C0AC 4BLSA 4DLSA 3R9XA 3LBNA 3MJRA 4MH0R 2ZJ2A 3AVTA 3VR6A 4CEHB 4IEIA 1P4SA 2FSGA 2V1UA 2FWRA 5C1BA 1PUIA 5JEEA 4IDNA 4ZKDA 1N25A 121PA 2D7DA 4DDVA 4ARZA 1QHGA 4MKIA 4MGKR 4NBSA 1BOFA 4KBGA 3FFAA 2WAXA 1E9BA 1MO6A 1T3LA 1HURA 3NC0C 221PA 1JI0A 2GRJA 3LX8A 2ZE8A 1FUKA 4YMUA 3V9PA 4QJ5A 2C95A 3CF6R 1V5WA 5DISB 1G19A 2AXPA 4LI0A 1KDTA 3CRVA 3RWOA 4JLNA 5EQTA 2ATVA 3GJ6A 2QRZA 2OHFA 5JWOA 4Q5IA 4D80A 1U0LA 5EE1A 2JLUA 1E9EA 3KKPA 3ZD6A 2XXAB 1Z5ZA 3RS7A 5D3MB 1FPMA 1EGAA 1G7TA 4NDZA 3WYAA 2QTHA 2REXB 1EG7A 4JLMA 4KFUA 4BFTA 3CUEF 1T4GA 1UDXA 2KB0A 3REFA 4BLRA 2CL7X 4AD8A 2OCBA 3AM1A 1AKEA 2X2EA 1P9NA 1G3RA 1II8A 2OXRA 2ZU6A 3B1YA 4JLKA 4Z1MA 5JI2E 1SKQA 1CJVC 4PANA 3VKWA 1ZRHA 2OZEA 1FQKA 3EA0A 4BZPA 4HAZA 1XB2A 1TF7A 1ZUIA 3N2EA 4DDUA 2ZS9A 2ASEA 2ZSEA 1UKEA 3ADBA 2ZJAA 4MUAA 1A2BA 4CVNA 1IHUA 5JFGA 4OBEA 2REOA 4RFVA 4BLTA 2WIBA 3MD0A 4X8OA 1UF9A 1YZKA 1R0XA 2NO0A 3QBTA 2N42A 4NU0A 1E3MA 3RS2A 4B44A 4GOKA 3P4YA 4O2LA 4X8LA 1W44A 4FXPA 5KPJA 5AJXA 2C2HA 1DEKA 2EFDB 1XMVA 4N1AA 4K46A 4M1MA 3KUDA 2WTUA 1RJ9B 2O5VA 2GCOB 2B21A 3EG5A 5A0FA 1ZC3A 2W2TA 5CM8B 3HYRA 3FMOB 3NXSA 1G3QA 3AKEA 1KSJA 4IXMA 2ORIA 4R98A 1G3UA 4Q4HA 1KI6A 1T3SA 1D8TA 4JSYA 1E2NA 2WWXA 3IIMA 2H57A 3AEZA 5FOWA 3T1QA 1RPZA 1NBMD 4F92B 5F3WB 3TMKA 4C2TA 1ELOA 4ZCLA 5FTKA 4CDGA 1U8AA 3B1WA 2V3CC 4MKFA 3U3JA 3FHOA 1N6KA 5FL3A 2ZRBA 2F3TA 1ZBDA 3D6TB 4M9QA 4FCWA 2WJVA 4GOJA 2CEAA 2VHUA 1L2TA 4HLCA 3C41J 1Z63A 3OIWA 4HEJA 2DB3A 1TEXA 2Z5FA 3HP1A 5HCIA 3NBZC 4A0HA 2HYIC 1P3JA 4MRSA 1SKYB 3A1WA 4YMVA 2XZPA 4PC1A 4LYHA 2KBEA 1DBSA 1BMFD 1XEWY 2QP3A 2D06A 2AK3A 8OHMA 1Z06A 2IYRA 2O8CB 2V7QA 3OFNA 3TVTA 3DDCA 1LF5A 5UKDA 3J81k 1DARA 3LBHA 1K5DA 1CR1A 2YWGA 1PLJA 4S2EA 1U8ZA 3FYHA 1P75A 3BAFA 5IK2A 3KDSE 4YMWA 2J41A 3WBJA 2O8DB 2VHJA 2AD1A 3MCAA 4M22A 4IEEA 1XCMA 3VFDA 3RRMA 4WXRA 1WQ1R 1TUEA 2ANBA 2Q0HA 3G82C 1VG9B 2CJWB 4DSOA 4TQAA 1KI1A 2NQ2C 2W0MA 3IKJA 1XEWX 4ASUA 2QBYB 3CPJB 2CL6X 2VP0A 2ZVPX 1N0VC 2D74A 2WBLC 1YZNA 3CW2A 4OI2A 4EDHA 2KBFA 2IYUA 3Q72A 4GZLA 4PTLA 2QE7A 3FHCB 3REGA 2IS4A 1G64A 1GNRA 1GG2A 2IHYA 3BB4A 3PITA 4M21A 2C9CA 4WAUA 4TSFD 4IOJA 5J4VA 3CNNA 1U98A 1GTVA 3T15A 3PIRA 2ZRAA 1ZVQA 4HAWA 2CE7A 1GRRA 4M2LA 3BFVA 2RGGA 1SULA 2QQ0A 3GLHB 4B33A 1TNDA 1OFUX 4G1UC 1E94E 1NN3A 2DWPA 3QEJA 4LJ4A 5B2ZA 1DS6A 4XWAA 1OH7A 4TQUS 4B3XA 2JIZD 4ACAA 1DG3A 2E1RA 3AKYA 2BM0A 2VP6A 1EFRA 3DL0A 3EAQA 1Z0IA 2J7KA 1XPOA 1TAGA 4N0EA 2VYFA 3T35A 1F2UA 2FPLA 1TL7C 4HB4A 3U7HB 2RH5A 5DNYB 4A0FA 1CRQA 4OQMA 4LV8B 4Q7KA 1E0SA 2KSQA 1KHTA 4N3NA 1NG1A 5GJVC 3VMFA 1LW7A 2QE7D 2OBLA 4W5HA 3TR5A 3KTAB 3CRQA 3SFZA 2DWOA 1XEXA 5G3ZA 2EYQA 3RHFA 5AWFC 4KO8A 2YOFA 2PEZA 1YRBA 4Z1MD 2OM2A 5LD2C 4XTRA 1IN7A 3BOSA 4HB2A 3CX8A 3TUJC 3IPXA 2Q3HA 3DZDA 3GEHA 2XSZD 1T3HA 3W5IA 4DCNA 3TR0A 3CR8A 3K9HA 4PHFA 3O47A 2RGBA 2ZRCA 2GXAA 3FB4A 4A2QA 1XBTA 2IS1A 4PAQA 1W46A 2WV9A 2ZUCA 1UAAA 1D5CA 1M34E 2YWHA 5JRZA 4QFMA 2B6HA 3SHWA 1C9KA 5EP4A 3Q9LA 5AK0A 5IK2D 2FGJA 1A1VA 2FFHA 3QIAA 3V00A 3FTQA 1RRGA 4MGYR 2HDNB 4M1OA 2GNOA 2JAQA 2YJTD 1NSFA 1LNZA 3W3ZB 1U2RA 2ZANA 3FMPB 4Q7LA 4AI6A 4I81A 5EE5B 3RC3A 4A2WA 4W5WA 4NTZA 4QC2A 3AVQA 5FL7A 2FX3A 4F93B 1FTSA 1CJTC 4EFLA 3EWAA 2PT5A 2ECKA 3GFPA 3L43A 4L16A 5EUMA 3EPLA 4YXWA 1EK0A 3BD9A 3ZZ0A 1A2KC 1G4UR 3IDQA 2YKGA 2NTYC 1U0HC 1Q44A 1KSGA 3UMRA 1XTKA 2VP5A 3GQBA 3OF5A 3E2IA 4CT5A 2O8BA 4LK2A 5L3RA 4YONB 4M4SA 4RFSB 1YR9A 1AQUA 1XD9A 4G5RA 1S1CA 2IHBA 3HR8A 3LV8A 2JASA 1FNNA 1SVLA 3MLEA 1A82A 5A5GA 3I1FA 3U7EB 3T61A 1KK0A 1BO6A 2PZFA 4Q48A 4JZKA 3WMEA 1AM4D 4KBFA 4NCNA 4D25A 2R6FA 1Q12A 5K8TA 4IRUB 1Y3AA 2H18A 3GLGA 5JJLA 4LPSA 4UXIA 2KE5A 4WZ6A 2ZROA 1W0JD 1GKUB 1KJZA 2Z4SA 3PCRB 4MRPA 4DWJA 2IS2A 3OEHA 5F98A 2QPAA 5EUQB 1ZNWA 4BFXA 4JVSB 3F8TA 1CLUA 3Q7QA 2HT1A 2QENA 5EP3A 2IEYA 1COWD 3VU9B 1X3SA 2AX4A 1VYVA 5J40A 4DB4A 2QAGA 4V0LA 1N6OA 4DHEA 3QJYA 1GRQA 2VBCA 3IILA 1L7VC 1OIVA 1UBFA 521PA 1NVUQ 1AIPA 2GHIA 2EVWX 1AA9A 4PQRA 4D0NA 1F48A 5B64A 3MGCA 4R2IA 1HEIA 3EIQA 1OH8A 1US8B 3TJZA 2ZRNA 3BXZA 4C4PA 2ORVA 1Z2CA 3T5DA 4Q1CA 4QHTA 4C7OB 4PO9A 5KDLA 2ODBA 2Z6VA 2Q9BA 2XX3A 4G5GA 3KTAA 2P6UA 1ZU5A 2ZE5A 4PX9A 2RCNA 1KTVA 5EXTA 4LHXA 4UKDA 3KXKA 3K0AA 1E9RA 2QSZA 1SVIA 4FD2A 1MRSA 1VCIA 2Q9AA 4R7ZA 1KO7A 4XIGS 3TQFA 4TYYA 4Q4HB 1IN5A 4OK5A 5M04A 2F43B 2BJWA 3LW8A 3SDZA 4OHVA 2IYLD 2H1LA 2J0UA 3SQWA 3PR1A 2X1VA 4JYCA 2P5SA 5JHHB 2QP4A 2GBLC 3B82A 4BEBA 2VP2A 4PXAA 2HXSA 3C14C 2P65A 2V54A 5FUYA 1MKYA 1ZNXA 2C98A 2NMVA 4V03A 3SOPA 621PA 4LBZA 1Q21A 4F4JA 4K81B 2IA5A 1XTJA 3F3YA 5E7MA 5KSOA 4G5QA 1E9AA 3FFBA 3PUVA 4GI7A 4GP7A 4NCIA 4UXHA 4Q47A 1G4AE 4B76A 1C1YA 2P5TB 1BKDR 4U00A 5LB4A 1CF4A 1RIFA 2J7PD 3AH8A 4MA4A 4F91B 2QPTA 1II9A 4JIMA 1G5TA 2ZAOA 1CJUC 4LJAA 3G0HA 3VNVA 3Q85A 1S9HA 1SXJB 2OSBA 3BH0A 1VCMA 5JCZA 2D2EA 1W1WA 3U6KA 2Q3FA 5BN3A 1E2GA 2IL1A 4NCJA 4V0KA 1S3GA 4TYPA 1WCV1 2BOVA 4U7DA 4Q9JA 3DM9B 1XFAA 3TAUA 3RC8A 1M2OB 3A1UA 2DBYA 3OIYA 2BJVA 1S3SA 2BKEA 5AJWA 3SQXA 4PHHA 1IY2A 4E09A 2JGNA 1GL7A 4TT3A 5DI3A 4V02A 2CHGA 1E0AA 2ZETA 3QE0A 3KKOA 3ZIAA 4DRZA 4KU4A 4XSHA 2BMDA 1G6HA 3RLFA 2NOAA 3CM0A 2G3YA 1VIYA 1JPJA 4BGDA 3GLGB 2W0SA 2AL7A 2MSEB 4PSVA 2YOHA 1R6BX 4G3XA 3OE7A 2ZRIA 3VKGA 4RFSA 1RRPA 3B85A 3RDPA 5FBLB 2P3SA 1E1RD 1FMLA 1NLFA 1W0KA 4URXR 1WDTA 2F3RA 2XB2A 4IVQA 1U9IC 1YZUA 4RVCA 2BHRA 1UBCA 4QM6A 3KL4A 1AGRA 4G5SA 3U44B 2AHOA 4CEHA 2FU5C 1LS6A 3RAPR 2GDJA 3BFXA 5B30A 1GL9B 3I8XA 4AKHA 3S1AB 5J47A 2YC4C 2GEDA 1ONBA 1FFHA 3LO5A 4JL5A 5JECA 3DMDA 3TW4A 5J4KA 2PEYA 3CWQA 1E2IA 2FEOA 2QG6A 4HDQB 5SZHB 4A15A 4Q1DA 2OLKA 3AF1A 1F2TA 4OL0A 4RKFA 2EFHB 3N70A 3IO3A 1XD2B 5EZ5A 4OHWA 4KFSA 1KI6B 1VKJA 1Z83A 2WICA 2UZIR 3KKQA 5HE9A 3CKLA 3WYGA 2JJ1D 1LS1A 5KSZA 1HT1E 1OFTA 3K0FB 4AG6A 4CYMA 2W2VA 1NIPA 2VP4A 4LGMA 2VL7A 3BC1A 5L3SB 1JBKA 3AVVA 4ZKEA 4P0TA 2F43A 3KQKA 3W90A 4AKGA 5KNDA 1G7RA 1ZM9A 2P67A 4UJ3A 3HDTA 4H1VA 2C99A 2AWOA 3B2EA 1VPLA 4B48A 2V1XA 3X1DA 2QP9X 3P32A 2ATXA 4UNRA 2MMGA 4GPTA 4HLUC 3Q3JB 5F9FA 2IX3A 2ZRFA 2VLIA 1T5LA 4WVFA 2W58A 3RRYA 1I2MA 3Q8XB 5CJPA 3K0FA 1G3MA 1GM5A 2A5FA 5DN6D 3AVOA 2FNAA 5FH9A 4DZZA 1P9RA 1T0JB 3C7KA 4L5BA 2RGEA 3KQUA 2QORA 1F2TB 2REBA 1ZM4A 2DFLA 1CU1A 3GEEA 3MRSA 4IVPA 3X1YA 1NIJA 4BUJA 4Q00A 3H0KA 4D26A 2D2FA 2EWWA 1H65A 1U81A 2ZI6A 1P72A 1XF9A 4D81A 1Z0AA 5EE3A 3RRNA 2NGRA 4O0MA 4II7A 4QGFA 1ESMA 2BCJQ 3QXJA 3WNCA 4ZI2A 1Z6TA 5L3SA 3R9WA 3CNLA 1IAQA 4H1UA 2FZ4A 4MYTA 2RGCA 4B3CA 1GP2A 1Z0JA 2BCGY 3AP1A 1IM2A 4NYMR 1ZJ6A 1DADA 2WWGA 1G5PA 4TL8A 3KJGA 3R8CA 2DHRA 3ICEA 3AGPA 1YJ5A 3THOA 5KDOA 4IFBA 1Q57A 1G8PA 3THWB 1X6VA 2GK7A 4WA7A 4HZUA 2A30A 3DVLA 1R0YA 4EPXA 1HA3A 2BDTA 3VR4A 1XMSA 5TDHA 4KYIB 1GWNA 3NKVA 3I73A 1CR4A 3FWYA 2OXCA 4JBWA 2IEZA 2X2FA 1ZYUA 4TLBA 1FOEB 4G0NA 2QM8A 1JECA 3LBIA 1E9SA 4UJ5A 4FWTA 2PX3A 2O8BB 2V7QD 1QVRA 3BB3A 1IXSB 4URZR 2XSZA 2DY1A 3NTUA 4DLUA 2R65A 2C04A 4YMSA 2ZI3A 3QXSA 1E2LA 3DM5A 3BRWD 1R8QA 2CBZA 3NVAA 4YMTA 1OKKA 2QI9C 2EFGA 5G41A 5BQ5A 4Q9KA 1VYTA 3RS0A 3BK7A 3U7FB 4W5JA 4URUR 2IYSA 3QKRA 3SN6A 1E2DA 3B1VA 4NYJQ 4B6FA 2W83A 1TPZA 1T8UA 3BBPA 3BERA 1GL6A 2N46A 5FUWA 3RANA 4M1TA 2O8DA 3AUYA 1HQYE 2YOGA 4B73A 1ZD1A 1TADA 4M1YA 5DO9A 1CRPA 4B2IA 4FMDF 1GIAA 5GJBA 3KZ1E 1JNYA 3AQ4A 1W48A 3A8TA 3WHLA 4JMPA 2LKDA 2I4IA 1QHSA 2AD5A 3CPHA 1Q22A 4FMCF 4XWOA 5BN4A 2ZJBA 4EFMA 4C0KA 1KK2A 4KSBA 5L3QB 2GF0A 5FTJA 3BORA 2QGNA 2X8AA 4XWKA 3RRZA 1MR3F 3K09C 4PZYA 2VPPA 2ZIAA 1CJKC 1N5JA 2G1KA 4Q1AA 1VG8A 4OQNA 2ZYUX 3V4RA 3W6PA 5JMTA 3EIHA 2H7VA 1VECA 2PX0A 4UNNA 1OLOA 1W4RA 1I4TD 1T5IA 3CH5A 4IKEA 4YDSA 3PUZA 1DAHA 1RYFA 4P33A 4GP6A 2A5YB 2ZU0C 1NLYA 1EX6A 2QEQA 5FBRB 4EPVA 2QRNA 3SE0A 1VMAA 1KMQA 4RZ2A 3U3OA 1I4LD 4LYFA 3V4FA 1DAEA 4Q4AB 2IUSA 1UFQA 4BFSA 1XP8A 3ECCA 4BFUA 4HAVA 5LB2A 3T1TA 2ZI4A 2OAP1 4JJZA 2PCLA 4TL6A 5JCPA 1DAIA 3E1SA 1HE1C 2V8OA 3B7GA 4M53A 4QBIA 5JSZA 2EYUA 1KGDA 4FCTA 3DO6A 1XTIA 2QAGB 1KO1A 1E2EA 1B23P 2QZ4A 5IT5A 3MG9A 4C0QC 3TSOA 2B7BA 1Z0FA 4LPKA 1IY1A 3AVXA 5J4HA 3ND9A 4U02A 4CIDA 3ZZUA 3TE6A 2QAJA 1FL9A 1GVNB 2CLDX 2F9MA 3M1IA 4V0ME 3TH5A 3HJNA 3QKRB 4AIIA 5C2JB 3SZRA 5F9HA 2F1RA 2MSDB 1Z47A 1SVKA 1ZUHA 4NCHA 4B47A 3HU3A 1LV7A 2IUTA 1JXMA 2ZI9A 4ASUD 2G0TA 1ZIPA 1N5LA 2HCJB 3ZJYA 4A9AA 4L8GA 3S1AA 5J4YA 1G1MA 1F3OA 1TQ4A 4KLNA 2PZEA 2GJSA 1NMXA 2ERYA 2WPDD 4LCBA 1XTRA 1AS2A 1NJGA 3PQCA 4Y0VA 4IXNA 821PA 3ZS9A 3CX6A 5FOXA 2JDID 1UEJA 1II0A 2OUKA 3KQLA 2NZ8A 4CEJB 2DPXA 2WMNB 1KZ7B 5AUQA 4WBSA 1DO2A 1FZQA 2LKCA 1PJRA 4KVGA 2VH5R 2CCGA 4PSAA 1E99A 4DCUA 2GVZC 4PPGA 2CK3D 3EWSA 2PH1A 2RHMA 1XJ0A 3WRXC 4ZV4A 1ZD9A 2FEMA 1QHXA 2AN9A 2BEKA 4FN5A 1N0WA 4KODA 3NC1C 3OE7D 2JJ1A 4TTPA 3U3RA 2D3WA 4KI0A 4CEJA 4MRRA 4A6XA 5KSPA 2CVHA 1YR8A 3IQWA 2GCPA 2GJ9A 1Q1QA 1BYIA 2WWWA 4MGZR 1LF0A 1SHKA 3ZIAD 3AGQA 1XDBA 3FOZA 5HZHA 4K8OA 4NPHA 2VA8A 2B92A 3LY5A 2F1HA 4ZIRA 4F4CA 3U3MA 4AYWA 2IF2A 2WVJA 5H8WA 2PBRA 1AK2A 4OKSA 3QKSA 1EFCA 3C5HA 1G18A 2JLZA 2R8RA 3A37A 3KKNA 3LA6A 1NSTA 2RAPA 3SNHA 3B1XA 5SZKB 2ZE7A 2HEIA 4LJ7A 2WJIA 5TXGA 1CKEA 1HE8B 1OV4A 3SYNA 2PMDA 2XOKD 4JLOA 3MWLA 4IDHA 2WJGA 2ZS8A 1NNEA 4B43A 3AVUA 2Z4RA 4BLOA 5CDFA 3SR0A 2ZJYA 1N0UA 5K8IA 3GJ3A 2BVNA 4MKHA 4B3BA 2Q6TA 4Q19A 2O52A 4RD4A 3SC3A 4AK9A 3ZQJA 4O2RA 2G77B 2RGDA 3EX7C 2GXUA 2ODEA 2HJGA 4IFEA 4TT3D 1NVVR 3DZ8A 5AR1A 4HAXA 3K0SA 3SHFA 5FBWB 1UKZA 2CDNA 3I32A 1S0UA 4E07A 1N6HA 4WXPA 2KJQA 2QPOA 3EZFA 2EQBA 5JWRA 3NDBB 1S2MA 1XD2A 2WOOA 5E7IA 1U99A 2R62A 3FGNA 4LJ5A 4HAYA 5JJIA 1E69A 3FE2A 1FW6A 3PUXA 5E3HA 1QG2A 4MRVA 3QSYA 3QPWA 1DPFA 2ZUDA 1EX7A 4J0QA 2FJUA 2XAUA 4QRHA 2R6CA 3A4NA 4M1WA 2HXYA 4BZXA 3MFYA 4HDOB 3KQHA 4GZMA 4DDTA 1VDZA 5LPNA 1SXJD 4Q4JB 3P20A 2OBMA 4P4SB 1P2TA 2Z43A 2AKYA 2J1LA 3WMGA 3X1ZA 3KJIA 4DIDA 4GSYA 3F5FA 1OT3A 3CRMA 1VYUA 4HYYA 5BYKA 4TQ9A 3KUCA 4US0R 2E87A 1ZCBA 3ZZTA 4HLUA 4XD7D 1XJQA 3OEEA 4PZZA 4Q9LA 4OI4A 5TB5A 3TKLA 3NBFA 1G7SA 1X1SA 2OFWA 2XITA 4GRAA 4RCZA 1JPNA 1NN0A 4ZPXA 2C03A 2ONKA 3GLHE 1YZQA 2VHCA 2ZUBA 1UDWA 1GFIA 3D8BA 3AB3A 1QF9A 3W3AA 4DLVA 1RW4A 2JLRA 2QU8A 3GLHA 2QBYA 1SVSA 1ZNZA 2O8EA 2NIPA 4BLQA 3HU1A 3U3KA 3EXAA 2IYVA 4C9BA 2DFTA 3A1SA 3IIJA 1ETUA 1G8FA 4B75A 4BFVA 1G21E 1SZPA 5FPKA 4GT1A 4B2PA 4HUTA 2O8EB 1Z3IX 4JBYA 5DI3B 4DT1A 4TZ0A 3NEYA 3EZ9A 5FPTA 4MRNA 3QBVA 1R4AA 3VX4A 2OG2A 4OJKA 2FN4A 3H2YA 3IBYA 3IIKA 5CLQA 4EJSA 5G53C 2ZRJA 4WZBE 3JZMA 1N6RA 2IC5A 2J5XA 1SXJA 1E2PA 1FQJA 3QQ5A 2XNDD 4PPFA 3PV0A 2PJRA 3LAWA 1XPUA 3B8HA 3KJHA 4TMXA 4JVNA 4ZDWA 1WP9A 1DO0A 2O8FB 2BMJA 3MJHA 4IW3B 2ZYWX 4P4SA 1DAKA 1JQJC 4HLQB 5EXXA 4D2IA 3LD9A 1OH5A 1KAGA 4Q4JA 1QBKC 1ZD8A 5TV2A 1OPXA 4Q02A 2G6BA 4XVUA 1XNJA 1G20E 1CBUA 2W6JD 4DVGA 5G3YA 3IO5A 2GAAA 4PAMA 3Q5DA 1E2KA 4KJZA 1NL3A 2IBMA 2ZSAA 1TF2A 3B9QA 1NG9A 3B13B 3CO5A 2ONJA 3U60B 3JVVA 3WNDA 1F60A 2QGZA 5JHGB 3BWDD 2WKPA 4MYCA 3SI7A 1D2NA 1D9ZA 1WRBA 2ZSFA 3BB1A 2G83A 2PCJA 2OFXA 3CPEA 1M8PA 4QM7A 4RZUA 3CR7A 1X8JA 4NONA 1JQLB 2R6GA 1NI3A 1NBME 1WE2A 3C15C 4Q4LA 4TLDA 2WJYA 5DE3A 5JBQA 3ZVNA 4RZXA 5FTLA 2ZRDA 2QA5A 3F0TA 3K9LA 5D3QA 3WP0A 1P2SA 4D82A 1X86B 4ON9A 5FOVA 4DSUA 1M1YE 4XH9B 4LBVA 4DUGD 2ZR7A 1Z0KA 1RRFA 2FSIA 2JDIA 2ZRGA 2J59A 4BFYA 1P5ZB 5FBQB 4BLPA 2WJJA 4DEXA 2ZRMA 3ZYCA 3P26A 1CR2A 4PQYA 2DFNA 5GVSA 2XEXA 4LYAA 4MKGA 1YU9A 4V0NA 1PLKA 1MT0A 2XZLA 4YC7A 3VTKA 3SJAA 1G16A 2NO7A 2H92A 2G0NA 1HV8A 2HYDA 2YWEA 4M1KA 3VU9A 4F7WA 4F4IA 3K53A 3KQNA 1C4OA 1F5NA 2X77A 3OAAD 4LHWA 3T1VA 3AVYA 4EPWA 3SS8A 3DPUA 2J3EA 3KXIA 4OJQA 3ZDQA 4KYUA 3D7MA 1DOAA 5L8VA 3ZGXA 4PC6A 5D3MA 2GCNA 4CGZA 1H8HA 4O25A 1H8ED 2BEJA 1E9DA 1IN8A 1PUJA 3L0OA 1OXUA 3SBEA 1QG4A 3HPQA 3SJCA 3VR1A 1G17A 3FVQA 1G8HA 2JLYA 3KFVA 4HUQA 1FP7A 1OFIA 2F7SA 4I1UA 1WB9A 2Q9CA 1KJYA 1VCNA 3GLGE 3CF2A 2A5GA 2IYWA 2KI5A 4XJXA 2A9KA 3H84A 4NYIR 3I72A 2GWHA 3MAAC 3VAAA 1AGPA 4BASA 2BIFA 3CRRA 4GNKA 5JS8A 1FP6A 3K70C 1GZSA 3ZVLA 1NMYA 1DAGA 4IOLA 1FX0B 2VRWA 4IVRA 1HY3A 1XXHE 4KCGA 1R0ZA 1XJCA 4QL3A 1GDDA 4EPYA 1MV5A 2NZJA 5FI0B 2IXFA 4JKYA 3QXXA 3CIOA 1JR6A 4IHQA 2UKDA 2QSYA 3CH4B 3EZ7A 2FPKA 4TTRA 1CP2A 3EZ6A 5FOUA 1M7GA 4L4UA 5FTMA 4TMVA 3K09A 1UEIA 4I1VA 1IJFA 1Z2AA 4C30A 3IBGA 1VTKA 2AK2A 2J9RA 5CK5A 4BEJA 1IXRC 3FKSA 2CJWA 2W6IA 2Q3MA 2YYZA 1G5RA 2DYKA 1R2QA 3IHWA 1GUAA 4IJMA 3W8NA 4CRWB 1P2VA 2ZI7A 4B3FX 5IF9A 3H4MA 2Z0MA 1XMIA 1SGWA 1GITA 2G88A 1W7AA 5TMPA 3PUWA 3AF3A 5KNCA 2IF0A 2AXNA 1DVRA 1SQ5A 2OCYC 1JJ7A 1MH1A 4OK3A 5B58C 1KSFX 4E22A 2D7CA 3A1TA 1OHHA 4LUCA 3SJBA 1CIPA 4D0GA 1LB1B 4LHZA 2F6RA 2HF8A 1R0WA 2IYXA 4XVRA 5DYIA 3KXLA 3FMIA 2ODNA 3I8SA 3GLFA 2F1IA 4Q4AA 1IBRA 5F2EA 5AUPB 4ZDJA 2GK6A 1E79A 1OYWA 2ZJOA 3UWKA 3VR3A 3KJEA 3L0PA 421PA 5H68A 3IEVA 3TBKA 3PENA 3GLIB 1IONA 4HSEA 1XTQA 4LDJA 1XEXB 2GKSA 4PPQA 3CX7A 2IW3A 4HLDA 2G9NA 3RYTC 4WIAA 2R44A 3W8RA 4LJYA 5ANRB 2J0UB 1EFRD 2CCJA 4KFTA 4M1SA 4E03A 2C9OA 2O0KA 4BRWA 3U5ZB 1IY0A 1OIWA 4L9WA 2OEPA 3KB2A 4R2HA 2EFCB 3I92A 2IYYA 4QG7A 4CZ2A 5DGXA 3LVQE 3L8YA 1D9XA 5CIWA 3CWZA 4RY2A 1HTWA 2GTPA 2QROA 1OB2A 1YVDA 3O8BA 5BXQC 2ZI5A 3MWJA 4JS0A 4LWZA 4Q1FA 4DB2A 3QOFA 1JJVA 2J0QA 1E0KA 1E96A 2XNSA 4LJ9A 1AJEA 1D6JA 6Q21A 1W4BA 3LWNA 4KSCA 4C7OA 4JLBA 4TYQA 1D2MA 5GJCA 1E79D 1HH4A 4LC1A 1U0JA 2V6IA 4UXJA 4NZYA 4JYBA 1MO4A 1NVXQ 4B35A 2LCFA 2CVFA 1M74A 4ZO4A 2OLJA 5JS7A 4GDFA 2R6AA 1MO3A 4V0MA 2D4HA 4QXAA 1KI7A 2W2XA 1K5GA 3U4QB 4GBMA 4NHOA 4C0BA 3ZVMA 3UWOA 2CHQA 1ZIOA 4B74A 1PZNA 4AG5A 2X19A 2GJ8A 4JT2A 1P62B 2FFAA 4FWIB 3LLUA 1G8GA 3QG5A 3GLIA 5JZVA 1ZAKA 1P61B 4R9UC 2R6DA 3CF0A 3NWJA 2JLSA 2WKQA 1N6NA 2WWHA 1EESA 3UK6A 3A4MA 3FKSD 2GXSA 4I4LA 2RGXA 2DFKB 1GOTA 1RKBA 1Z22A 1OE0A 1P2UA 3E5HA 3OFND 3QEOA 3QUSA 4GMXA 4PZLA 3AKDA 3CZQA 4JKIA 1JR3E 1BMFA 1K8RA 2BV3A 3MUFA 3WHKA 1Z6YA 1KO4A 4WW0A 1GKYA 1JEEA 1T91A 3IPYA 3QPUA 3ADKA 4URVR 2F1JA 1N6IA 1QDEA 2GZHA 1KMHA 3U6BA 3K70D 3LX5A 3ZH9B 2GVDC 2JCSA 5C18A 3LDAA 1E4YA 2AFHE 2O0HA 1GNQA 4IDQA 3UXMA 1W36D 1P60A 1XCGB 1J8YF 1MABA 2ZQ5A 5GADl 2IWRA 2XTNA 5LD2B 2ZVQX 2ZJ5A 4BRUA 4HZIA 4JLDA 1XCPA 2ZYTX 3P27A 5FPSA 4OHZA 1KOFA 5BYJA 4CF7A 2FSFA 2GESA 1KYIA 3CONA 3GP8A 1UJ2A 1Z08A 2UZ3A 3BGWA 4OHXA 4FCVA 2XTMA 1OHHD 4Z54A 2E9SA 2B8TA 2ZRHA 3T1OA 1Q0UA 3U7GA 4RD0A 4D4LA 3K8YA 4QHYA 2VP9A 5HZKA 3EPHA 1ZINA 1TQDA 4PHTA 2NO1A 3DHWC 3DMNA 2WWYA 1H8EA 2GCOA 5DHFA 2P6RA 4Q7JB 1AS0A 4P32A 3IEUA 4LC0A 1ZU4A 3C16C 1UPTA 3GD7A 5KSYA 3AVWA 1OJLA 2QQEA 1Q20A 4ZCIA 3K0AB 1CEEA 3BE4A 3O8CA 1BYUA 3VR5A 1P9WA 1W36C 3T12A 2A5DA 3ETLA 1EFTA 1UBGA 1G8YA 1VCOA 1E98A 3IGFA 2FE4A 1ZM2A 2YINC 2HT6A 5CB6A 3ASYA 4A0GA 2RB4A 2IWHA 1Q3TA 2V55B 2FDCA 3MWYW 3QPVA 4CEIA 2YZ2A 3P1JA 3D3QA 1MO5A 1GILA 1KY3A 1TEVA 1Z28A 3QF4A 3L0SA 3GFTA 4JJKA 2ZSDA 4M8NE 3DKPA 4LYJA 3VHLB 2ZXUA 3LH5A 2DCUA 3G5UA 2BWJA 2QT0A 4Y0AA 4EUNA 4X8MA 4JVMA 3X1WA 1WBBA 4HATA 1II8B 3AV0B 3RABA 2WSSA 1ZC4A 3CBQA 3QXCA 3TNFA 4C0SA 3EARA 2J7PA 4BPBA 2JA1A 1OB5A 5DHAA 1RE0A 2RMKA 4LBWA 4A92A 5LDDC 2FA9A 2JJ2D 3U44A 3GLIE 1E2QA 4TWZA 5EE9A 1G291 2VF8A 2FV8A 3HWSA 2GXQA 3A1VA 3LQRA 1TU4A 5TARA 4Q1EA 3CZPA 3THXA 1N3BA 1UADA 3AP2A 1SVWA 2RGNA 1RYHA 5EJEA 3NHBA 3OESA 2QT1A 1G9XA 3QKTA 2V4ZA 5FUXA 1IN4A 3EPKA 4JSTA 2PT7A 4MDFA 3CLVA 2HJVA 3NDPA 4QBHA 2I1VB 4Q7MB 4TZ6A 4ILEA 3B5JA 4OYHA 5BW8A 3UKDA 1ZP6A 1EWQA 3LRPA 4BZQA 4W7SA 5C46F 3GMTA 3W5JA 4B71A 4DLRA 3UPUA 2FZLA 3GJ5A 3JVUA 3AKCA 3N5CA 1L4YA 1SXJE 2JATA 1MOZA 2B8WA 3TUIC 2PMKA 1W36B 4KVAA 3OIUA 1KSHA 1QZXA 3E70C 3GJ4A 2H5EA 4TMWA
chains in the Genus database with same CATH superfamily
1JG2A 2FQQA 3MBOA 1RM0A 4B3DA 1YFKA 1J70A 5HIKA 1VGVA 2JLQA 1M2JA 2O7RA 1JG3A 2HHCA 3DTNA 4RABA 5C35A 2A8YA 1OW3B 1DLJA 4JJFA 5TVGA 5IP5A 1W88A 1H8HD 2PFSA 4EL0A 1U8XX 1Z73A 5CVCA 3BYZA 3LKBA 4GL2A 3AR2A 5HCNA 1PT7A 2J85A 2CF5A 5BSEA 3FOCA 1NY5A 4PO8A 1UFRA 3SK0A 3OAAA 3DBIA 5AJYA 5ALDA 1LGYA 4A6PA 2XQGA 1JIUA 2JLXA 3V7FA 4C04A 3ZHVA 1L5MA 1X3LA 3LNCA 1SUEA 2YVUA 3ENVA 3MWDA 4LXYA 4D9BA 1E1YA 2RGAA 2IQIA 5IBRA 1X92A 1H93A 1VIAA 2XWJI 3M6FA 4UULA 1J2JA 1YQWA 3ZE8A 2BMEA 4XWYA 3AHHA 2CV0A 3WGJA 1E2HA 1ISGA 4LQLA 5J23A 4BQEA 3IBCA 4WOCA 3BIJA 4JI0B 1XLVA 1QH1B 4LNUA 1NOKA 1QTNA 5CLLA 1KQ3A 1POXA 1VG1A 4DPLA 3JU3A 3FRJA 1K3FA 1EK5A 5M5BA 2C2KA 3K0CC 1I2DA 3U4QA 4NYIQ 2NPIA 1MXHA 5D00A 4EHFA 1NXXA 2PUWA 2Q8NA 2FN9A 4EJFA 5EE0A 2R4UA 3DT8A 4QG3A 2ZE6A 1P7CA 3UB2A 2VQ6A 1G38A 4F46A 4ITRC 5BQOA 2C96A 4FOPA 3O9VA 4RZ3A 4AS1A 5KSWB 2Y1CA 3R7LA 4JP1A 4FP9A 1RQXA 1JBQA 4L4XA 1XZJA 3JAWA 5H16A 4PZPA 1ORHA 3TFWA 4MMZB 1ZBQA 5TEVA 4CT4B 1H1DA 2Z09A 4DREA 3HVJA 1KS9A 4F2HA 1JHPA 3ZK7A 3MT0A 2WY2D 3ED5A 2VDOB 1LWNA 1RHUA 4O02B 3PC8A 1W35A 2FZCA 5CXSA 2C3UA 3JW8A 3NHKA 3H2HA 4RVGA 4YH1A 3W2IA 1T1EA 2PBZA 4OSPA 3B12A 2ERXA 2R9VA 2JJ8A 2WSMA 3B7PA 3IOCA 4AJEA 1GSIA 2ORED 5BN4B 1HLDA 4UW9A 4R71A 3ILSA 3V48A 3SX0A 4QBFA 2IXEA 2QUBA 3FDIA 4M99A 5AJZA 3VI3B 5IT4A 5DX8A 1PCXA 2QM7A 2QMUA 1KBOA 2I2FA 3EIEA 3MT8A 4O1IA 2R1TA 3WXBA 4HPJB 3L8HA 3AR9A 1OC4A 1SC1A 3K20A 5FFNA 4A8JC 3M6XA 1VPDA 1E3JA 1VRCA 5EZQA 2ZZNA 4MQ5A 2G8NA 1U80A 3BD6A 1QV9A 4YUZA 2AG8A 3WY9A 4P34A 3SYKA 1J0XO 3ZWPA 4HVCA 5B2EA 3KETA 4CLDA 3GROA 5BPHA 1K2WA 3SBDA 5DBGA 3I01M 1TK3A 1KJ9A 2MU1A 5TC4A 4BWFB 4KUHA 1JAZA 1Z7YA 3IAUA 1BD3A 3GJ8A 4UVGA 1FTNA 4FIDA 3JQGB 1VFPA 3NYWA 4MR8A 1EVYA 2Z2IA 4DAEA 3ADDA 3X0DA 3L4KA 3FYUB 1QVWA 1O6FA 2J9YB 3H3JA 3IBTA 1LPSA 1KK1A 2MINA 3LC2O 3LGAA 4AN0A 2XUJA 4CV1A 5DCLA 4G0XA 4BFWA 4ZODA 3WLPA 3I76A 4I5GA 4QT0A 5JROA 3R6DA 1AVTA 3H16A 5ELLA 3AB7A 5LJLA 1E92A 3UWPA 2Y1DA 3SD7A 3ZI0A 5K20A 1HLFA 4LAFA 3BTVA 3BJIC 4KV9A 3O7MA 1KDOA 1COWA 1O87A 1S6YA 5L4NA 2WYVA 3UHOA 4RQTA 3H2KA 3LOPA 2HUNA 3SFVA 1QTIA 4FR0A 5LNK1 1U5BB 5B3JA 1M6NA 3WLEA 1AUXA 1BHSA 1GPKA 1SCUB 3H9GA 3WP1B 4HDKA 1EM6A 4JI8B 1B3RA 3JATA 4B3IA 3TQOA 1V9CA 5FKJA 5HUJA 5CA1A 3RAEC 2O8CA 4ZOAA 3OOEA 3R40A 1OH6A 2FG7C 3HSYA 3ZHUA 2QRQA 3QKSB 1HDYA 4D8YA 4IWXA 2XOKA 1ID1A 2KWIA 2A5JA 3MB8A 4GMDA 4X71A 3D6AA 3PUYA 1W4AA 1CJBA 4RTRA 4JLSA 4LOLA 3L84A 4HDRA 4ER7A 2BGWA 1DTSA 1UXKA 5T4BA 3SJUA 3LPDA 1EE9A 1R9MA 1V4VA 3LWZA 1MABB 2G25A 1P4AA 3CZRA 1TTHA 1Z4PX 3IQXA 4N49A 3PEFA 5HMLA 2W6OA 3CLKA 4PYQA 1TX4B 4Y2HA 4ZI7A 1QFZA 2AQKA 1IN6A 4AYXA 4YJGA 5H3CA 4LI3X 1IHXA 1P19A 4I1SA 1X7WB 4RHEA 5ER9A 4UVHA 1YTLA 1ZRMA 3VZCA 2P6NA 2ZTSA 1JLHA 2ACWA 1MF7A 1NBHA 1UBOS 3KYBA 1DV1A 1UMDB 1UOPA 3HP4A 4FKZA 3WAJA 2Z2JA 5DYGA 1YDGA 1B0PA 2Y99A 4FMBB 4MVJI 2RHLA 1RT9A 1RJ9A 3COSA 3O5AA 2WJHA 5SICE 3WWDA 2ZM5A 4RVHA 3STUA 4DMGA 3R0VA 3QSGA 3GVIA 4Q3AA 2R1VA 3BGOS 1TLFA 4Q3OA 4DA8A 4FYYA 3M4NA 1XQ9A 1Y82A 4RY0A 5E6SB 3F1LA 5EIAA 2VDKB 2WAOA 1EFVB 5JPCA 4M6WB 1VHTA 2PBFA 4D98A 3WFIA 2H8KA 1M8JA 1NRJB 4WESA 4ZI3A 1U8YA 2CHEA 2CXRA 2PWBA 2Q62A 3JPYA 3PFHA 4NY1A 2FRDC 3MS4A 1Q0RA 2I03A 3IJPA 2BKVA 3KWJA 3PNYA 4FONA 2Z9DA 4CQNA 1XZPA 4FIZA 2Z4TA 2O3QA 1EGHA 2WD8A 2E4VA 2VPIA 3LT2A 2H31A 1EFPB 3JQ8A 2J5BA 5D51S 4DDWA 5AVQA 3IR5A 1HSZA 4I4IA 2VDWB 2ACVA 4IFIA 2BFCB 4WKGA 3ZE7A 5KTMA 3PFIA 3QF4B 4QICA 4F84A 1VG0B 3RVQA 5KIAA 1TQ2A 2HF7A 4QFDA 1XXHA 4I36A 4JL8A 1ND6A 4TKVB 5CH8A 4ZT5A 3H05A 4N7RA 3L8CA 5FV7A 1UWLA 5KYUB 1TC2A 1FMTA 1H2YA 5P8WA 5JNRA 1ZNYA 2FZGA 5BWMA 1TA4A 2PBLA 1FJ2A 2JKYA 3EXIA 1GEGA 3REQA 2Q7XA 2R7MA 5AW8A 2O2GA 5L7TA 1CUUA 3QH4A 3SFTA 4W9MC 2FQ1A 2H17A 2H07A 2PSHA 2XNHA 4C3ZA 2Q1TA 3GPBA 1A88A 4RM3A 4I1OA 2C8VA 5U9CA 4Y2XA 4NE2A 3C3KA 3WKAA 1V3VA 3K9WA 3R5HA 1SVMA 4RIFA 5KNCH 2BEUB 2GILA 4Y2RA 1CEYA 1SD2A 2ZAYA 1XSEA 3D0KA 4D4JA 3GCGA 4OMCA 4FOOA 2BHSA 3HA2A 4AECA 5FV4A 3RSLA 1GHTA 2CYAA 2W2KB 4OHKA 4KE7A 2Q49A 3O8DA 1N2CE 3LIIA 2ATCA 2HU5A 3LZDA 3L77A 4G5OA 3VNRA 4NX2A 4P22A 2CWWA 1TU3A 4HGQA 1DQYA 3FNFA 2O0JA 3QKUA 1JFSA 2CV2A 5CITA 5DSZA 2X14A 4AM8A 2WPDA 2UXCB 4V39A 1FB5A 4BLWA 1OWPA 2DRIA 3UC9A 5EJ2A 5K0SA 1IWOA 2J45A 5U1PA 3ND6A 1C4WA 5A5VA 2EDCA 1ZW6A 4KXXA 3KTOA 2GEUA 2DQKA 2VN8A 4ZVNA 2EQAA 2L19A 4YWJA 1YL7A 3R7NA 2IBTA 2EL7A 5LQSA 4ZDKA 5L3QA 4MR9B 3BSSA 1ZKDA 3E84A 2BGIA 2F8MA 2C31A 4PIMA 4WK0B 4GSKA 4LZAA 3T4XA 3CT6A 4J7UA 2Q6OA 4IYJA 4PZUA 2FPPA 4W9NC 4MR9A 4QA9A 3OCCA 1WF6A 4M0FA 3VYTB 1L8QA 1O3YA 1DAMA 1AX9A 2SNIE 5JCOA 5AW5A 3TO5A 1Y3CE 1A97A 3D4BA 1NBMA 1KIMA 1P2DA 2GPYA 3WDKA 4D6YA 1Z36A 4QNRA 3R6GA 4H27A 3BMQB 2IVFA 3DC2A 3HJGA 4R16A 1U1IA 5F2KA 3O93A 1OFHA 3LHIA 4P7GA 4YLGA 4WH0A 4ZCRA 1CHNA 4XJSA 3OIGA 1AY0A 3PNQA 4I1IA 2PX4A 1RMYA 2VT7A 4NMWA 5G0WA 5IVDA 3W34A 1ZA1A 1WF3A 4MQBA 1W8IA 1W4CA 2PXCA 4JL6A 3V42A 5J5CA 1HQCA 2LCQA 2QVXX 3ZEAA 1UT5A 3INRA 2XUFA 3C3DA 3NOVA 4DTIA 4RGVA 4Q4CA 1BDIA 2O2JA 4MWEA 4AKEA 1N2JA 2ZJ8A 2A86A 3DF7A 2I71A 1GN9A 2XR1A 4BVHA 2GKOA 4TV8F 2EFEB 1E7SA 1OLXA 3I3SR 1RXCA 3C39A 3NBMA 3H97A 1I3MA 2PSFA 2ISQA 2EJBA 3GRKA 4MVJF 5CEFA 2G82A 4NMHA 4XM2A 4DBLE 1HOTA 3EUAA 4DG9A 3UK0A 1OGIA 2HTFA 3BG5A 2VF4X 2CLMB 3JWHA 3FTEA 5EZYB 2R4QA 4IDBA 1AO0A 4G0PA 3DHVA 4D0RA 3OZIA 2F2TA 3OY7A 3SF0A 3C5CA 3HM9A 3O38A 2QL9A 3EBLA 3EXIB 3VMMA 3NH6A 1BOOA 1GCIA 1PR2A 2CXHA 3AF2A 4UZSA 4TLEA 2ZBUA 3WXMA 3QVVA 4LF8B 2ZZKA 4UOZA 2OILA 3T9CA 1JFFB 4CF3A 1EDZA 2HSWA 4F9GA 1E9CA 4O5AA 2H0AA 4Q24A 3PSAA 3PE4A 5JSFA 3ODPA 2J0EA 1RRCA 2HHHB 3ROXA 3VU1A 4W6QA 5JZMA 4ZHQA 2XA2A 1KY2A 2RONA 1NJ6A 2XMBA 3C3PA 3QFCA 2PJZA 1N2CA 1VSTA 3CCCA 2VEDA 2F62A 5LDHA 4FSXA 1J1UA 1T10A 3U1BA 1E3TA 3L6UA 2JJMA 1X8KA 5FO0A 3A4VA 2XD4A 1YB5A 2VJMA 4C89A 1RYMA 3KB1A 4YYZA 4NOJA 1GU1A 2ECQA 2R1VB 4OQFA 2VHQA 4AZ3B 3TDKA 4OXXA 3UJ6A 1OBVA 2VJPA 1E89A 3I62A 3DOIA 2Y1XA 3A36A 1EX9A 1KL7A 1BU8A 4ES6A 3UMSA 3W6OA 2OWDA 1XCBA 2NYAA 1YRAA 3OF2A 2RBKA 3MJEA 4DLYA 5EIEA 3CSSA 5U4XA 1PNQA 3L4JA 4QDUA 3TX2A 4QATA 4MI1A 3WGUA 1M5RA 3T5TA 1EUYA 3N2YA 1U28A 1TRKA 2XD9A 2AGVA 1BIFA 1Y6QA 1YQUA 2P7HA 4JT8A 4PQFA 3PEYA 3W5DA 4RKRA 1HDIA 3NEJA 3R5SA 5JE8A 2HU8A 4PLFA 1U5CA 3OBIA 3ZY4A 1XV5A 3A7DA 1XL1A 2V9ZA 1QHIA 1FDTA 1MVLA 3G6WA 2IFTA 1J1ZA 1H6BA 4UEOA 4WDRA 3EEYA 2UUOA 4YJGB 4AZSA 3PJRA 2B5OA 3EEIA 5IHPA 3EZ2A 2XZOA 1E7WA 1IDOA 1OXMA 5CNIA 1QWSA 1E2JA 5A6SB 5KBYA 3R3SA 4PYLA 4DM3A 1F8GA 1PQWA 2JIDA 4RK7A 3PWTA 3ONWA 4HGPA 4JUFA 5EN4A 2DBRA 4QZVA 2HCRA 2ZQYA 2ZJ7A 1ZS9A 3E0QA 1QH1A 4GI5A 2QSUA 2VUUA 3JZAA 1QMGA 1XU4A 2R5FA 4R2JA 1GZVA 4G97A 3CU5A 1BW9B 1SIOA 3I9OA 2C2ZA 3C87A 3JTMA 3QPDA 4HWOA 4RCVA 2HCBA 1ZK2A 5JXWA 2ZS7A 4X00A 1VPTA 4ZCMA 4KLZA 3I2YX 3X2SA 4C0HA 2BEWA 2CNWD 1ZVMA 3FPGA 5AK6A 4JK3A 1K8QA 1KI3A 2ZPAA 2ZUTA 3UYLA 2QUIA 2R1UA 3F6EX 3CNQS 3QW4B 3STHA 3VTFA 5KQSA 2FWNA 3UK1A 3OD1A 3BRCA 1V7QA 4RGBA 4L6CA 4X90A 3O83A 3WQRA 4J3NA 1STOA 4KX5A 2OV2A 4UCQA 5HRAA 1QOZA 2VTEA 3DT6A 4Q3CA 5F7ZA 5FWAA 4TWAA 5JANA 3D6UA 1ZQ9A 2WTNA 4NK4A 2PIDA 4EPTA 2E2WA 4J0CA 2BFEA 3N0WA 5J63A 4BWYA 4OXKA 1P9LA 3VDRA 1DLIA 4EO7A 3GLFE 3DEHA 5IUKC 2OCIA 1ODFA 1CQPA 1Q50A 1PI3A 1W2GA 3JQPA 3OM0A 1CVRA 4IOMA 3S70A 5IS2A 2QZ9A 5EVCA 4EABA 3I45A 2Y1GA 1QTQA 2WB4A 4FJ2A 5EWMA 3W6NA 3G2NA 4Q82A 5CTJA 4R8LA 3GRZA 5J2UB 1KVRA 3NW9A 3WADA 4KR9A 1G0NA 1KI9A 3EGCA 5CB8A 1J5XA 1H2FA 1V9SA 2HLPA 2OD9A 1OI2A 2G80A 3F4LA 4YRQA 4YRJA 1MPXA 1GLVA 1X1EA 2O2YA 2WM9B 3QLVA 4WY8A 1AD2A 2O57A 1KZ1A 2Q99A 2VJOA 3EFBA 1ZWKA 2Y0BA 3MEQA 4UAGA 10MHA 4QO8A 1CUYA 3WYFA 1K7EB 1CF2O 3JARB 4RCYA 5KHOC 4RTSA 3NHUA 3RPEA 1WMAA 1WSAA 4IIYA 2VSFA 4V2UA 3UENA 3B6EA 3SC2A 4WPGA 4A7PA 1JWAB 4GR4A 1QOPB 2G9UA 3UBMA 3GT0A 4F2WA 4AJLA 4I4NA 4YV7A 5KVSA 1F2UB 4RA6B 3PQFA 3I5YA 4G07A 1GPBA 2LW7A 1H1LB 1EUQA 2DKOA 4L51A 4X93A 4QGAA 1L7PA 4LTDA 4OKIA 5HKLA 5LNK6 2ZP1A 4HUJA 4Z3DA 2POQX 3B9PA 3N2GB 4C0JA 1RQ7A 3BS4A 2GJAA 3H2SA 3BCUA 5CDFE 3M49A 3RODA 1I0LA 2JGKA 3NDJA 5LQMA 1LY1A 5FFFA 4D5EA 4AJ2A 4Z7JA 2ZREA 1ZFNA 4QDZA 5JNWA 4JENA 1NWCA 1KE2A 4IJ6A 4JI1B 4N01A 1K7XB 5LWQA 4GKBA 1NASA 1Q3HA 4J1QA 1G6OA 3AWDA 5EZYA 4RL6A 4QJ4A 2O7QA 1I3OA 3N8HA 1NXSA 3D5QA 3GDFA 5FR1A 4NH4A 3OPYB 1CQJA 4KQJA 4A1FA 4C6SA 5JY6A 2MIIA 4LGCA 4YCBA 1LDMA 1NX6A 3AL3A 5K3EA 3X1KA 1YHNA 4Q21A 5DNDA 2OCGA 4MVJP 2GBFA 2P3LA 3LCJA 4PSKA 3WHPA 3CNHA 2VK1A 1VXRA 2VK8A 4TOIA 1JAIA 2Y9PB 3K1TA 4LOHA 5H1YA 3PHIA 4WXMA 3BM5A 3CEHA 3OPYI 3KQVA 2H85A 3TLEA 4AJNA 1X74A 4M6WA 4ZCTA 3FWHA 1CD5A 4C4ZA 1ZMXA 1UZNA 1XQXA 3D8RA 1YF3A 1YJ8A 2ZSHA 1BE0A 1WMSA 1LPNA 3FYCA 1OF1A 2QYTA 3FFTA 1U1DA 4L8VA 2FMXA 2H9IA 4F6LA 2P1ZA 1ZJWA 5E2AA 2VYQA 1L5QA 3NHYA 3TQIA 3KP1A 3T5PA 1UZLA 2PJDA 3K35A 3GFQA 4J1NA 2Y0PA 1UR5A 4N40A 2B2CA 5K8UA 2BGGA 1YS2X 2ODWA 3EY9A 3M0EA 4JCCA 3W0LB 4BUCA 2BMFA 4EG8A 3FJYA 5IFKA 1D4FA 4MULA 1ZSNA 2CMKA 1VA5A 4DWVA 4ZOBA 3FLBA 4EHDA 2YV4A 4P3KA 2C4MA 2NPFA 1X19A 2YW2A 3NRCA 1PWZA 5CYFA 3OVMA 2AHRA 2XNDA 2CB0A 2WU4A 5F1KA 2G5CA 1E2BA 3EUEA 4NCXA 1OROA 4G0UA 2XCTB 4YT4A 2Z8YA 3GDOA 3FTDA 4FDVA 4TRNA 3NGLA 3I8OA 2C8KA 3HLKA 1B93A 1G60A 3DWFA 3T7IA 5IEJA 4XQGA 2QX4A 2WHXA 3GJ0A 2GM4A 5F1PA 1ANKA 4REQB 4BRSA 3R9XA 2BEVA 4RAOA 1CUWA 1WDMA 2WF7A 3QUCA 3VR6A 2Y05A 1RADA 5F1YA 4IEIA 2NP6A 3B6KA 3T3MB 2HH9A 2C29D 2HKIA 3EDRA 4U7GA 3VYVA 1PUIA 5EHIA 4IDNA 4ZKDA 2LTAA 2HJHA 2YXPX 1SHUX 3IJRA 4KH0A 4EY5A 1PV1A 2GCEA 1JU3A 2A0WA 1M6HA 2HPZA 2JGAA 1ENZA 1OZFA 1WO8A 1LTKA 1T26A 3FFAA 4N4AA 3FIUA 1T3LA 1XMPA 2OHXA 5BV2P 3ESXA 3CB2A 3IA2A 4MV8A 2X23A 5KMGA 3HXQA 3LF2A 3PTLA 3UAWA 1FUKA 2OOSA 5F23A 3T3OA 2EGGA 3HDYA 3V9PA 4QJ5A 3AU8A 3CF6R 3MAGA 1XDDA 5AW2A 1NXTA 1L7AA 2XQKA 4N3BA 4BBZA 1KDTA 2HBRA 1PZXA 3RTDA 3T1YB 3HB7A 2NWQA 4FC6A 4Q5IA 1RIIA 3AHIA 3RUDA 4D80A 3VZQA 1KYXA 3VC1A 1FSZA 2VOEA 1FP2A 3TZLA 4R1LA 3ZD6A 5T5QA 4UPDA 4REQA 1Z5ZA 2YWJA 3GRYA 3D7RA 3RRBA 1FPMA 4BQRA 2Z5GA 5AM1A 1ZL0A 3IAEA 3KIPA 4REMA 3CE6A 2REXB 2AFIA 3BZUA 1X7HA 4KFUA 3CUEF 1T4GA 1UDXA 2KB0A 2PQ2A 4BLRA 5EJ9A 2CL7X 1PT5A 3AM1A 1AKEA 1I7SB 2QDKA 1YB4A 1P9NA 2G09A 3I28A 3M83A 3B1YA 1YDEA 4JLKA 4UQPA 4UUMA 3VO9A 2RGYA 3FLAA 1CJVC 3H1AA 5B1SA 1Z34A 3UZUA 6PFKA 2OZEA 3EA0A 4L2IB 5EYPA 1E8NA 2CMFA 4HAZA 2QNIA 1P3Y1 2P9CA 4FOLA 1XVUA 1Y7PA 5B1HA 2ASEA 2LZ0A 2ZSEA 3I6YA 1T2UA 4DDUA 4YPVA 4U2DA 4MUAA 5IEBA 2AEJA 2BZ1A 3ITDA 3EAGA 1WB4A 2REOA 1C9YA 1KPGA 3CUVA 1KQFA 3MD0A 4MUMA 4X8OA 1UF9A 3DVRX 4CG0A 1FFEA 3VVMA 2QW1A 3M1LA 4HWSA 1P4RA 5ILQA 1E3MA 3ZHBA 4GOKA 1IWBB 4DMFA 4FXPA 4ZD6A 1M8KA 5KPJA 3HYLA 2NP7A 2BGNA 1GT91 3PRHA 2JEZA 3GPIA 3ICVA 4FYMA 3WQHA 2C2BA 2EFDB 1XMVA 4N1AA 3UO8B 4MEJA 4M1MA 1VFNA 2A58A 2PD6A 3KUDA 2O5VA 1P80A 2B21A 3GDHA 2W2TA 4Z9AA 2XY4A 3NXSA 4L0CA 1RZUA 1G3QA 2GAJA 3FHJA 4QELA 4RNCA 5ERXA 5DHTA 4ABTA 3EOZA 2VT3A 4KWHA 4Q4HA 4Z4QA 3LBFA 1J2TA 4MP6A 1T3SA 2E4UA 2V4UA 3R7AA 5IG2A 5FOWA 2EWMA 2XHZA 3HWRA 1X1QA 1M72A 3Q11A 4Y2GA 1ECPA 3T1QA 5KMGB 1RPZA 1B4DA 4LJRA 3OP1A 1ULBA 1YD7A 5FWDA 3TMKA 3TLCA 1ELOA 5C8VA 5KNBD 1K0FA 2K4MA 4ZCLA 3U3ZA 5FTKA 5BY2A 4WASA 4B4WA 3FUUA 2IYAA 2O7NA 4MKFA 2OG1A 3IUPA 1L5OA 3C7AA 2X8JB 4ZT3A 4EMTA 3IXQA 4WHMA 4M9QA 2WJVA 1YU6A 2PGIA 1JQ5A 1L2TA 3BHIA 4GEKA 3ZJUA 2VJYA 4HPWA 2BM9A 2E4WA 1J42A 1RLUA 1TEXA 4MK4A 5ENVA 4UM7A 4U9UA 4A0HA 1L6RA 2A1IA 3IR6A 1JWBB 1PJ2A 2Q7DA 4UVEA 1ZO8A 1TMYA 1ZZEA 3A1WA 4I3FA 2HYIC 3UEOA 1WX1A 3TTVA 4HEA1 2TYSB 3DONA 3ZXYA 4LYHA 4TX1A 1L8XA 1FNBA 4BJ3A 4LSWA 2D06A 2BSQA 2CLHB 2IYRA 2XUQA 2V7QA 1R00A 4C7JA 3SQMA 2WJ6A 2BD0A 3PHHA 2CV1A 5UKDA 3J81k 1DARA 2GJ4A 4H18A 4WXEA 1CR1A 3L8MA 1PLJA 4LXTA 3KSMA 4S2EA 1YUNA 4JI2B 3FYHA 5AJHA 1FCJA 3KDSE 3L6DA 3NU1A 4YEDA 1SOAA 2B3TA 1KXZA 1QAOA 1FYWA 3VPAA 4A6EA 4M22A 1XCMA 3L4SO 3N75A 4WXRA 3DAYA 3UTCA 5HBGA 4MQMA 1WXHA 3TPCA 2I7DA 3ZWQA 2ABWA 4KQ6A 4PLHA 3UN1A 5KVAA 1KI1A 1K75A 4YR9A 2W0MA 4JWTA 5HQ3A 4WADA 5LMZA 2J3HA 3QU7A 1DT3A 1XEWX 1N2OA 2ZVPX 4BO5A 4YP1A 1N0VC 2HMAA 4JFAA 5L95A 2WBLC 1FX1A 1V1RA 2QYOA 4EDHA 2IYUA 1E1CA 1KH2A 3Q72A 4IEFB 1T5HX 2EHDA 4GZLA 2XGOA 2QE7A 1RKQA 1B43A 4R9VA 2C2MA 3G9UA 3GRPA 3WDLA 5BOSA 3TN7A 4M21A 1GG2A 1HRKA 4YRIA 4RVFA 2C9CA 5IASA 4RKQA 3CNNA 4PX5A 5TPZD 3JYHA 4HXFB 4RW0A 5THXA 2O50A 3AB8A 5EJ5A 3OQVA 4EM6A 1GRRA 4DIFA 1NQAO 2XT0A 4JITA 1N2BA 5KEIA 1A5ZA 1A50B 2QQ0A 4BVEA 3FKJA 1GCUA 1MC4A 1JTVA 1ZIDA 5BRNA 1BWRA 5KYUA 2FPIB 4B4OA 4B33A 4YFVA 4G1UC 2QL7A 3ITEA 3IP1A 1G5IA 2GDZA 4IIJF 4LJ4A 1B6TA 3SKVA 3HXPA 3U37A 1OH7A 4PGFA 5ISMA 4K9QA 4XYMA 1WLSA 2JKZA 1ODKA 2JIZD 3ZOKA 3IAM1 3W1VA 2CMGA 1A9RA 2E1RA 4V0QA 4CM6A 2XQVA 1DC5A 3T95A 3OCYA 3ILXA 3RJZA 1RWOA 2BM0A 3WWYA 1PJSA 1J06A 1OI7A 4RF2A 1DX6A 1TAGA 4N0EA 2VYFA 1IYZA 3PD1A 1EDDA 1F2UA 2OENG 4RTPA 4D44A 2JFNA 2RH5A 2XPCA 5F76A 5JAMA 4CV2A 3EOAI 1E0SA 4JX8A 4OQYA 1KHTA 3NBKA 1W30A 3ZV6A 5CDUA 5GJVC 3OIDA 1LBIA 3VMFA 4EW1A 1GTJ1 2VCEA 1P6UA 1F6DA 2JC3A 3IUMA 4QYWA 5ICGA 3RTCA 5H9WA 3TLGB 5LA6F 5G3ZA 1D1SA 2Q5EA 3DLAA 2VJAA 2JARA 5AW4A 4KO8A 4HX5A 4PGGA 4BVAA 4Z1MD 4LG1A 2OM2A 2DM6A 1IN7A 2JGEA 4YAFA 3TUJC 3DZDA 1CR6A 1N7GA 4QAJA 4NZZA 1DPGA 2XVAA 2XSZD 1PN3A 1T3HA 3H5IA 4GBGA 4I8XA 3CR8A 3IAS1 1U9JA 3LECA 4RGQA 4X97A 3O47A 1WM1A 3MHTA 4LF5B 4TV9B 1G21A 4F3TA 1Q3KA 3VSDA 3PLAE 4NRDA 4TKUB 4WCFA 4D3YA 4Z9FA 1D5CA 4EG5A 1YOVB 2IYFA 4JJ7A 4P5DA 4R2MA 1NURA 2C1XA 5AK0A 5DLEA 3RU7A 2KYRA 3TCKA 4E5VA 2CT8A 1A8HA 1WZCA 1A1VA 3QIAA 3RUIA 2P5UA 1XA4A 1D6NA 3V00A 4M0CA 5B4UA 1D1TA 4MGYR 3ZGLA 4M9UA 1F8FA 4M1OA 2X7HA 5D1NA 1NSFA 1OTXA 4RVDA 1AHHA 2LVBA 4OHUA 4I81A 5LZ5A 2O8NA 4NLLA 1DQRA 2JFBA 5ICFA 2VYVD 3QNWA 1PZGA 4U7HA 4X63A 1Q7GA 1W73A 1YE5A 3FNHA 1E6KA 1UAYA 2EARA 1X0XA 2I2BA 4AJHA 1M3SA 4DYHA 4F93B 3EVCA 3HVRA 3CV3A 5DSTA 3HEMA 1M2WA 2OTCA 2I66A 4WFQA 2PPLA 4YASA 1U0FA 2C4NA 4A91A 5LXTF 4FYKA 5AM2A 5C9ZA 2B61A 3IQHX 1K6XA 5A71A 4AZVA 4V1CI 4L78A 2ECFA 2JAPA 1KU0A 2YQ5A 3D8UA 4MUYA 5HFJA 3ZZ0A 1JSXA 2XADA 3IDQA 3OD5A 3RJTA 1Y48E 3H5NA 5CB4B 1WHTB 2NTYC 3RADC 2YKGA 3PUHA 3JAKB 2FPSA 1KSGA 3NPMA 1I4WA 1P0IA 1DFHA 2AG6A 2VP5A 2NX2A 2GPJA 4XB6B 4CIWA 2LPMA 1N5OX 4H1TA 4CT5A 4NAUA 2O8BA 1HEUA 4MV5A 4M4SA 4BNMA 4EFKA 3AONB 4RFSB 4PYOA 1XD9A 4G5RA 1PTJA 4RDCA 4W5NA 3LV8A 2DF8A 3I9KA 2PKQO 4N8DA 4ZYXA 1SVLA 3F1KA 4XZ3A 2ON6A 2HIHA 5AVZA 3DWGA 3GFRA 1GVHA 3KKLA 5D7NA 4RL4A 2I6UA 4RIIA 2D13A 1GPLA 4FFNA 4GUAA 5AI6A 4JI3B 4YRAA 3NT5A 3N8DA 3WMEA 2XCIA 3FNGA 4A0SA 3IXLA 4Z4HA 4MP8A 5EPOA 1KZYC 3BHNA 2KE5A 1HO3A 1MQSA 3VZRA 1GSAA 4ZVUA 5CDYA 2Z30A 1W0JD 1GKUB 3IYLW 3PCRB 3GAAA 2E18A 3OFSA 1PF7E 3PC8C 4NIMA 2TMYA 1U3WA 4IAOA 5EUQB 2OBFA 4IPTA 4Z0PA 3VI4B 4BBJA 3LCUA 3V4ZA 1JFRA 1CLUA 2B20A 4PCAA 4FR5A 2HT1A 3O94A 1I9CA 1X42A 4H3HB 3FSGD 2FCAA 2VJQA 3DLPX 3QJYA 5BORA 5ALTA 3NWOA 1KAEA 3VKVA 2VBCA 5LQAA 4HS9A 4OFXA 2M6SA 2QNBA 2CDAA 4OYRA 4A2CA 1WDLA 1YHYA 3JRXA 5B64A 4RORA 4NEGA 1B0AA 4BMVA 1XDSA 2AOUA 3EIQA 3N74A 4FR2A 1WMDA 3TJZA 2ZRNA 3ZTTA 3BXZA 4IIXA 4F8EA 1QP0A 2C82A 4KDCA 3T5DA 2VHXA 4HDSA 4YJ3F 4C7OB 3M9WA 2J3LA 4KQKA 4BQPA 4IS2A 1GL3A 2DUJA 4WMLA 4TV8B 4J49A 3HCAA 3KTAA 2X8JA 2P6UA 1TKCA 1GTSA 1PGQA 3V4PB 1HFWA 5IJAA 2JLAA 2ZE5A 4XPIA 3DJFA 5EXTA 1X1CA 5JT1A 2DXIA 4G1MB 4QEZA 1WWKA 3WQSB 4UKDA 2FLVA 4F9FA 3M9XA 3A4TA 3C7TA 1E9RA 3ROEA 1SVIA 4TYYA 4QREA 2Q9AA 3TQFA 1V5EA 1Y1QA 3MYYA 5M04A 2VAXA 1PU2A 4GECA 3O0TA 4U7WA 1WMEA 5ENZA 2F43B 2BJWA 3PXXA 2VRCA 3LW8A 3GJQA 5CFRA 4AU1A 2YYAA 3JR7A 2Q5CA 4OHVA 5LUBA 4XR9A 1R37A 4JYCA 3TS1A 4W5QA 1CW2B 1EA7A 2PX5A 1BU5A 2J6HA 2QP4A 2J5RA 4BEBA 5AVUA 1YB6A 2EHJA 5AD1A 4UFOA 4PXAA 1C3VA 3U5TA 2P65A 2RHBA 4IMPA 1H0HA 5FUYA 2C98A 2NMVA 2C92A 1D7AA 1RAHA 3O8OA 4LBZA 4S24A 4BVBA 4I9FA 3BN3A 3V7UA 4F4JA 3QJGA 3NHJA 1FXWF 4RH3A 4CQJA 4F7DA 1SCAA 2BRUC 2BUBA 4F0JA 3TXYA 3HCWA 4MIYA 7ABPA 4URHA 2HHAA 1E9AA 3FFBA 3AI1A 3G17A 3IELA 3PUVA 1FFCA 3F6PA 4B76A 4F4HA 5KTKA 1V95A 2PVPA 4U00A 2GCIA 3MCUA 2J7PD 5AVWA 4EHHA 3T7AA 1E6MA 2H08A 2P4SA 2PAFA 2VRBA 4NG4A 3EUFA 5DHQA 3K73O 3OBBA 1SUFA 4UEJA 5LLSA 3WV5A 1K63A 3AUJB 1QGED 1W34A 2OSBA 3BH0A 2QJRA 4JA0A 4OH1A 3RK4A 1OGYA 3ZGNA 4C5BA 5JCZA 3O84A 4HH1A 4RA6A 2IYEA 1PGJA 1E2GA 3QFTA 4NCJA 3AL2A 4V0KA 4TYPA 1I7LA 1A8PA 3RC8A 4Q9JA 3TAUA 3T8YA 3KC2A 4CKBA 2QQFA 2GB4A 4KPUB 1M2OB 2AZMA 2UXDB 1IL0A 1GG8A 2DBYA 3OIYA 3JRNA 2OORC 2WFAA 1JVNA 3OZRA 3REOA 3VYRB 4YLYA 3Q7RA 5AJWA 4DZTA 3G2IA 4UBJA 1ZHHA 2JFYA 1F14A 3OF3A 1AF4A 1V6AA 4PHHA 5JJBA 1UBLS 1GL7A 1WP4A 2A1TR 4RVOA 4TM7A 2CHGA 4V02A 3VR2D 3GCWA 2WFZA 4KU4A 4XSHA 1G6HA 5INTA 2NOAA 3LZCA 2QRVB 4BGDA 5KREA 2NM0A 1UQTA 4KQFA 2FW6A 3H5OA 1I01A 3PRJA 4QU0A 3ETHA 1JE1A 3IPCA 4D8VA 4G3XA 3V8EA 3HACA 3ZU3A 1D3AA 3ANMA 4UFPA 5CVEA 3HMKA 3B85A 5TPWA 5HJ5A 2WJWA 1DMRA 2Z98A 2P3SA 3HLYA 3K9BA 4WLVA 4JUIA 3VGJA 3DTYA 1NLFA 1G66A 1W0KA 3D1JA 4GOMD 4QWWA 1WDTA 3RVRA 4Q16A 5SY6A 3RYIB 5TQ2A 3SZOA 3AJEA 5CAEA 4LE2A 1YS1X 2H7XA 1NYLA 1OVMA 2XF2A 5EINA 4NBRA 1AGRA 2C8LA 2IZ6A 4CEHA 1LS6A 3HFJA 3EFHA 3S1AB 5CXUA 1EX1A 3R23A 2GEDA 1ONBA 1U9YA 2FEAA 1FXSA 2QVBA 3O4GA 3QU4A 4UHHA 3CYFA 4UZEA 3TW4A 2RK6A 1D2HA 4YREA 2JAHA 3VJLA 4P83A 1MORA 3CWQA 3KLOA 4AWAA 4BKQA 2EKBA 4FI3F 3ER6A 2H2DA 1VZ3A 5IAKA 3VPXA 4CN9A 2H1FA 3IH5A 4CIXA 4TKMA 3AF1A 3H1BA 4OL0A 2EFHB 4XGQA 4LDZA 4KFSA 4OHWA 2VRCD 3TI7A 2VC2B 2UZIR 4IXWA 1P7YA 1O94C 1IB6A 1UKBA 2BP7A 3EF3A 4J0DA 5HE9A 2ALJA 2A0FA 1HT1E 3CW8X 4AG6A 4CYMA 3P97A 3BF7A 4RF4A 2J9ZB 3A10A 1H85A 1TVEA 2C5BA 3FETA 3BC1A 4WE3A 5CGZA 4DDMA 1SU7A 2ZB3A 5ALWA 5FA8A 1YOVA 1PDOA 1SG0A 5L6MB 2HIAA 3KQKA 1XAGA 3DTVD 1V8FA 2APJA 3E5NA 3E9EA 3FPHA 5EMLA 4AKGA 1ZM9A 2JIMA 2P67A 1MMFB 4HQFA 2MYTA 3EGDA 2CUZA 3LVBA 2IXTA 3TGWA 1F17A 1KP2A 5AICA 2DY0A 2QLJA 4B48A 2D1YA 1R0RE 1SBIA 2WFLA 1CS0A 3ASVA 4HLUC 4RENA 2VLIA 5JAHA 3HKDB 1RBQA 4B8YA 2Z6AA 3L0CA 4KZPA 2W58A 1I2MA 4B5LA 2V3VA 3GI1A 3QWAA 4Y6GB 2V5AA 1M54A 2Q3LA 2ZIXA 1GM5A 2OYCA