1KO8A

Crystal structure of gluconate kinase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
172
structure length
172
Chain Sequence
TTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLKARKGHFFKTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gluconate kinase
publication title Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 58
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2001-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ko8A00
1G8GA 4PHGA 4FIDA 5AWFC 3GJ3A 4KJZA 4NYMR 4MH0R 3P1JA 4LHZA 1ZD9A 4AYTA 4Z51A 1J8MF 1W4AA 2BKEA 2EYUA 3EW9A 3QKSA 1QRAA 5CM9C 2BVNA 2QMOA 3LH5A 2OCBA 4M9SA 3KX2A 1H8EA 2IC5A 4B34A 3RRZA 2VH5R 3C15C 3NWJA 4KYIB 5EP4A 1K5GA 4PPGA 2ZR7A 1XTJA 3ZDQA 3GFOA 2OCPA 2VP6A 3PUYA 4TT3D 1E96A 2Y8EA 3C5HA 1OLOA 3OEEA 1WBBA 3HYRA 4LI0A 1GTVA 2PMKA 3CR7A 3P32A 1UAAA 2QTFA 2REXB 2FWRA 1E94E 4OI2A 3AEZA 1Z29A 1MV5A 2O52A 1Z0FA 3WYGA 3RC3A 4IOKA 1WRBA 1GWNA 1UKEA 4C7OA 3BIFA 5AJXA 1AIPA 1GRQA 3QIAA 4YQFA 2ORWA 2WBLC 4HZUA 1HURA 3BH7A 1FP7A 4LX0A 5A0FA 3CONA 4YC7A 1VTKA 3RYTC 2GCOB 4EFLA 1JQJC 4P4SA 1BYIA 4XVQA 2CCJA 1RFLA 1SVLA 2FSHA 1EG7A 4FCVA 4WBSA 1L7VC 4QBIA 1F48A 4JL6A 1P3JA 4Q7JB 3CUEF 4CGZA 3ZD7A 2G77B 2C78A 2W2XA 2ERYA 4KSBA 3EZ7A 2GZDA 2DWOA 1Z5ZA 1M8PA 4MGIR 2WKQA 4MDFA 1JR6A 4DT1A 1KHTA 2IYXA 3MFYA 1HY3A 1NI3A 2IBMA 1KK1A 4LZZA 3RRNA 1VCMA 4MKHA 4TMWA 5B30A 3RWOA 1MKYA 1NJGA 3U2QA 1NBME 1AM4D 5DYGA 3TVDA 4EPTA 3U7FB 3L0PA 2VHUA 5EE0A 4Q9JA 1G16A 5M04A 2ZRGA 4JVNA 3VR4A 1KI7A 1X8LA 2J7KA 1E2HA 5CDFE 2C03A 4JT2A 1QHGA 2H1LA 3EARA 4TYWA 4BQSA 1PUIA 3KKMA 4C2TA 1W47A 2NZJA 5FBRB 3PQCA 1TTTA 3P27A 1N25A 4DLVA 2ZJBA 1ZD8A 4DSTA 4MGZR 4CVNA 3U3OA 4PC2A 4EIWA 4XSGA 2IK8A 3L43A 1HEIA 2VEDA 3L0IB 3K70D 1LY1A 4FN5A 1EFTA 4JBYA 2ZR9A 1H8HD 221PA 2DYKA 3MD0A 3W8RA 1LF5A 4NPHA 1E0JA 5GVRA 4IJMA 2XJ9A 4BZPA 4QOSA 3TAUA 1GM5A 1XMSA 2ZSBA 4A2PA 4X8HA 3I72A 5EE1A 4HI0E 3VKWA 4DDTA 1IY1A 1XEFA 3SI7A 2IF2A 2PCJA 3X1YA 3TSOA 1GFIA 3WNBA 1E79A 2ZRJA 4FMBB 1JALA 2GETA 1XRJA 2QPTA 4OKSA 2GNOA 2X2FA 1NSTA 3K70B 2A5YB 1ZNZA 1M7BA 3VR6A 2IX3A 3A4MA 4Q03A 1MABA 1YZTA 2GBLC 2J7PD 3RS3A 4G3XA 4TYYA 1HA3A 4HZIA 4LYFA 1TNDA 4JKYA 4RD3A 1UDXA 4JLNA 2QP3A 1JXOA 2GAAA 4OHVA 4DLSA 4NTZA 4PHFA 5AJZA 3PG5A 4OBEA 4EFMA 5KSOA 2ZROA 5HKKA 2PCLA 5FBVB 3QKRB 1YRBA 1CLUA 3FKSD 1R10A 1E69A 5TMPA 1KI8A 2N46A 2ZRPA 1E9AA 4EJSC 3C16C 5SZJA 5JEEA 2WAYA 4TMKA 5E7JA 3UXMA 4O25A 2ECKA 3O8DA 1IN4A 2IS2A 2NO9A 3W9YA 1S4QA 1SHKA 5KNBA 5L3RA 2OFWA 1OIXA 3IIJA 1YU9A 3DMDA 4HSEA 4ZCLA 3GLGA 1MT0A 1UKVY 3T15A 4IXNA 1NL3A 5GVSA 3K53A 2PZEA 4L8GA 3I73A 4PPNA 1OH5A 1XZPA 3AVYA 2R44A 3IEVA 1SVOA 3EPHA 2W0SA 2RGBA 2XNSA 4A4DA 1AS2A 2O8FB 2VBCA 2ZSAA 1DELA 3HPQA 2WSSA 2OESA 1FX0B 3DOEA 1OHHD 4RJLA 3B78A 1RKBA 4JLAA 5DGXA 4PR0A 1DVRA 1UBFA 1DAEA 4Q48A 3LX8A 3VQTA 3MGCA 1TF5A 2PJRA 1P4SA 1AA9A 2RGGA 3Q7QA 5FTJA 5K8UA 1XEXA 3UWKA 5SZHB 3WMGA 5FBWB 1TAGA 1WMSA 1WA5A 3KZ1E 4LCBA 5FR1A 4C0SA 3PEWA 4PO9A 4RVCA 4D4MA 2WWYA 3FFAA 1JBKA 4KFTA 1NRJB 2V8OA 1U2RA 1W2GA 4TYQA 3CF0A 5GJCA 1NVVR 1LVGA 2WKPA 4L15A 4FCWA 1XEWX 4EUNA 3THOA 1IAQA 1OW3B 1EK0A 2J9RA 2IS1A 3HJNA 3HR7A 1G4AE 4WOPA 3PCRB 4TLBA 5DLQC 2QROA 1VYUA 4IXMA 3B13B 3TIFA 3WHLA 3FMPB 4A15A 3AKDA 2NOAA 3GLIB 4JLPA 2CMKA 3FMOB 1UEJA 4E03A 4B2PA 5FH9A 3ZQJA 2C98A 3CX7A 1YR7A 2GF0A 3B7GA 4M1OA 2XNDD 3SHFA 2E9SA 2JLYA 1HQYE 2P0EA 1FQKA 1KO7A 4II7A 2IS4A 2Q6TA 3J81k 4B33A 4Q9LA 5EP3A 4UXIA 2XXAB 2A5JA 4DLUA 4Q66C 3WMFA 4DLWA 1XXHA 1D2NA 4LUCA 2X2EA 2LCFA 4DHEA 2XGJA 1F3OA 1ZC3A 3H2YA 3NBYC 2JJ1A 3MLEA 4OYHA 4XTRA 1P62B 4JBWA 3X1XA 3NTUA 5L3QB 2GVZC 1TL7C 4C0BA 3OAAD 4POAA 2FFBA 4KITB 5EJEA 4H1VA 1Q1EA 1WP9A 3SZRA 3OIYA 3K0AA 1Z2CA 1G41A 4PXAA 4OHZA 2A30A 3QJYA 2YNMA 1NG9A 5KNCA 1KI1A 4M9QA 3CH4B 3AF3A 4LHYA 2IUUA 1T8UA 3AB3A 5FI0B 1UEIA 3K09A 4BRWA 3BOSA 3B5JA 1M1YE 2WWXA 2QBYA 4AIIA 5BN4A 2BWJA 1MH1A 1XU4A 4RFVA 3U44A 3B9QA 4V03A 2GESA 4IDPA 4BFXA 3TQFA 4QM7A 4JLBA 4ZCIA 4W7SA 3L8ZA 3W8NA 1L4YA 4ASUD 5FPYA 3I61A 1G1MA 4M1SA 4PPFA 2QAGA 3RABA 4RZXA 3LW8A 1QHSA 5IT5A 1D6JA 4XVUA 2FU5C 3M1IA 1JAHA 1FZQA 1DEKA 2OE2A 2QPAA 3NXSA 1Z63A 5KPJA 2JATA 3IPXA 4OK5A 2XB2A 1FNNA 1G3QA 3TUJC 4E22A 1CR0A 3U3KA 2H7VA 3TUZC 3E2IA 2FOLA 1VMAA 2GJSA 1W1WA 1K8RA 4IDQA 4Y0AA 1ZBDA 3QENA 4TTQA 4B3CA 4QRHA 4LJ5A 1X86B 5EUQB 1W2HA 1RC8A 4JSTA 1F5NA 3THYB 2B92A 3K0CC 4US0R 3EXAA 1AQYA 1G8FA 4F7WA 3CX8A 3AVPA 2A78A 1N0UA 2FN4A 4AWXA 3NKVA 3SJZA 2ZS8A 5EE3A 1GOTA 1YZLA 3SFVA 3W3ZB 4B3DA 4G5SA 5F9HA 4U5XA 4HYYA 1SQ5A 3Q85A 2A7QA 5CLQA 5E7MA 2QMEA 3SN6A 4CDGA 1V5WA 5HZHA 4L9WA 3TGPA 2HLDD 3X1WA 1GNPA 1TF2A 3PUVA 2FSFA 2VF7A 2CE2X 3B1WA 4MUAA 4I1UA 2QE7A 1NIPA 4BLOA 1UBEA 2BMDA 4NE2A 1NP6A 1XNJA 5EXSA 5AUQA 2P3SA 1J7KA 4LV5B 2NTYC 2OILA 4Q4AB 2W83A 1R8QA 1NG1A 2ANCA 5FOXA 3BORA 4M8NE 1JJ7A 1QHNA 1KI6A 2BBSA 4LV8B 4K81B 3DPUA 4RZ2A 2ZXUA 1EESA 4PHTA 4CEJB 5KDDA 2IXFA 1E1RA 4UXHA 4LY6A 3RSLA 1I2DA 5TXGA 3B60A 1SXJA 1T0HB 2VHTA 5DI9A 4JIMA 1YZUA 4GPTA 2O8DB 1F2UB 5JCZA 5SZIA 3Q9LA 4YMUA 2RMKA 3MWLA 2HJVA 1GDDA 5L3SB 3RRMA 1ZU5A 3VMFA 1MO6A 1B0UA 3W6OA 3GPLA 2PBRA 3AM1A 1GL7A 1GL6A 4CT4B 1P61B 3HU1A 1KDOA 4NP6A 3CRMA 2OXRA 1JEDA 1YQTA 4OJKA 2GCPA 2YZ2A 2B6HA 1T3LA 4HDOB 2IYLD 1RE0A 2E87A 2GCOA 2VO1A 3PUZA 4LBVA 4A0GA 4C0AC 4FMCF 3DHWC 1NLFA 3TW4A 5JBQA 4DSNA 3GLFB 3MCAA 2YV5A 5G3ZA 1SVWA 4B48A 1G19A 2PEYA 1UADA 4P3YA 4TL6A 4A1FA 1UBGA 3GLGE 3U3RA 1R5NA 4EPYA 2D2EA 3A1TA 2ZETA 2JCSA 3AVVA 4AI6A 5DO9A 1VHLA 1CRQA 2FGJA 5FUYA 4UXJA 4TL8A 3AKYA 3U4QA 2VA8A 2EFDB 2R6DA 1YKSA 1E9DA 2P5TB 1MR3F 4NHOA 2W6ID 4Q1EA 1CJUC 4NCKA 2ZJ8A 4OI1A 1JECA 1SGWA 2GEVA 2ZI3A 4KHZA 4FMCB 4ERNA 4DXAA 5ELXA 1G3RA 1IN6A 4GBMA 4Q7KA 4X8MA 2XSZD 3FOZA 2Z5FA 3WYFA 4DWJA 1W0KA 2UKDA 4GL2A 3ADKA 5DNYB 1E2FA 2QGZA 4JLMA 4LHVA 4PFSA 1CU1A 4KO8A 3SE0A 1W5TA 4NBSA 3IIKA 4DLTA 3KKNA 4RKEA 5FOVA 1EFHA 1KAGA 3SJBA 4QXAA 4Z8XA 1NKTA 1PLJA 3OFND 4KV9A 3ASZA 5J4VA 2EWVA 3EA0A 5HPYB 2HXYA 1IJEA 4DCTA 3KUCA 3LLMA 4NYIQ 3EWAA 1OXVA 1CP2A 1N6KA 1IY2A 3LO5A 1N6IA 1E2JA 3Q5EA 4ON9A 3IPYA 3UMFA 4MKFA 1US8B 4HEJA 2W0MA 4GOJA 1DADA 5ANRB 1ZNYA 3T1VA 5JLJA 5CIWA 2VLIA 3T12A 4Z8YA 1XXHE 3ZVMA 4N0EA 1H8HA 2VP0A 2F3RA 3VU9A 2FA9A 4GRAA 1U9IA 4F93B 3EG5A 4TMVA 4LBZA 3PEUA 3N5CA 5EP2A 5E7IA 4UNNA 1IOZA 2AK2A 4TL7A 4NCHA 4UQOA 3W5JA 2MSEB 721PA 2ZI4A 5FL7A 4C30A 3O8BA 3R7WB 1GRRA 3GJ8A 3QKRA 4LWZA 2AXNA 1Z6XA 4OHXA 5JHGB 2FF7A 2CXXA 3AF2A 4LYHA 3A1SA 1A2KC 2F9LA 2J7PA 4Q01A 5JRZA 1E2KA 4I1SA 1DO0A 1GVNB 2VIIA 4IOLA 5H1YA 3ZS9A 1SVKA 5BYJA 3RS7A 2KSQA 4ZIRA 4Q00A 4NDZA 1ZYUA 2CE7A 3G5UA 1FP6A 2FGKA 1KOFA 2NG1A 4AK9A 3K0EA 4RFSA 3UMRA 4V0LA 2G0TA 5IDVA 2Z0MA 4Y0VA 4DIEA 5AR1A 4M4SA 3RVBA 2KBEA 4BFSA 2BEKA 3NVAA 1Z06A 3LQRA 2GWHA 3HWSA 4L5BA 3FKSA 1IQPA 3CR8A 2JGNA 4F4IA 1YZNA 4BLPA 3CRQA 1KI2A 1U0JA 4LJ7A 4B6FA 1YRAA 3C7KA 2PLFA 2O8FA 1R8SA 2FNAA 2J1LA 1HE8B 2R6CA 2YC4C 3GJ5A 1IONA 1QG2A 1FX0A 1K6MA 4FI3C 3SEAA 4TLDA 1CR1A 5GADl 3LVRE 2FH5B 1OXUA 2ZU6A 3KL4A 4TSFD 3EA5A 1OFTA 3L8YA 4Q18A 4F38A 4LYAA 4M9ZA 1IN5A 2REOA 3PVSA 1RW4A 1ELOA 5TVKA 3GMTA 1EX6A 1KK2A 1PLLA 3U3MA 4BLQA 1QHIA 4I4LA 1QHHB 2XZLA 4PANA 2F1IA 4LPKA 2QTVB 1QG4A 1GKUB 4KCGA 1S1MA 2ZE8A 2ZSFA 2BM1A 1OHHA 3A37A 2QAJA 2V9PA 3C41J 3GLHB 1G7SA 4UJ3A 4F91B 3RS2A 1LW7A 2QMHA 4B6EA 2AX4A 4CEIB 2HCJB 2Z6VA 2H18A 2EFGA 2Z83A 1DAIA 4Q4JB 4J0QA 2J41A 1JR3D 3MJHA 2XOKD 1YZKA 4Q1FA 2A3RA 5K8LA 1XJQA 3TQCA 2GVDC 4CZ2A 2VHJA 3CLVA 4QBHA 1E2MA 3SYKA 3NH9A 3VKHA 1VG8A 1PV4A 2NPIA 5JRJA 1X1RA 2ZJZA 2UZIR 4TLAA 3AVXA 1CR2A 2J45A 5CITA 2WVJA 1X8KA 4E09A 1Q20A 2XXAA 4M1YA 1CR4A 4NZYA 5G3YA 5L8VA 2A9KA 1COWD 3FHOA 5FPKA 3A36A 1E9BA 1SXJE 2AXPA 2BC9A 1OV4A 4B3GA 2DFTA 1IN8A 3CF6R 5FL3A 4ZDWA 4PPQA 2YC2C 3PEVA 5EXPA 4G0NA 5L3QA 1M7GA 1Q3HA 1Z6GA 3Q72A 4E5UA 1NN5A 1VECA 2DWPA 2R65A 2XNDA 3KUDA 1TEXA 3QVUA 2O8CB 4LYJA 3HP1A 4JLJA 3WXMA 4B43A 1DG1G 1YHNA 3HDTA 3LWNA 1N6NA 2XJ4A 4PC6A 1IBRA 1D2MA 2HT6A 3AGQA 2Z4SA 2ZREA 4HB3A 2WV9A 3UG6A 5E4FA 1TQ4A 2N1BA 2H92A 5JJLA 1YZGA 2IYZA 4IOJA 1I4LD 3UMSA 3S1AB 3EC1A 1KJZA 1IM2A 2BMEA 3AUYA 1II8B 1KY3A 2G0NA 4XWOA 4ZKDA 2AR7A 2QSYA 1Z3IX 5LBIA 5AUPB 3OAAA 3H1TA 3TR5A 2CBZA 4DLRA 1LNZA 2P5SA 2OZEA 4RCZA 3I62A 1G6OA 3SYLA 2XX3A 3BB1A 2QG6A 1JJVA 2OBMA 2WMOB 5UKDA 2WTUA 2FFAA 2X1VA 2VTKA 2X8AA 3H84A 1N6HA 2DFLA 3KTAB 2GZHA 1ZIOA 4BFVA 4AD8A 3KJEA 1XCPA 5CIQA 2GILA 3OE7A 2DR3A 4JS0A 2J0UA 4KFRA 4PAOA 4ARZB 1VCOA 3ZH9B 4DKXA 4TQUS 4QGFA 3LVQE 1CKEA 3AKCA 3BD9A 3SYNA 2O0HA 4LV6A 1P9WA 1UJ2A 4PQRA 4JL8A 3K9HA 2CL0X 3THYA 3LXXA 2QQ0A 4EDHA 2DCUA 2IUTA 1W7AA 4MRVA 4ZV4A 4PQYA 3A1WA 2QZ4A 4NU0A 2ODNA 2ZANA 3TRFA 4D80A 2GBLA 4GDFA 1XD9A 4EAQA 1OIWA 3SJAA 2QGNA 4PSVA 3T06B 1S0UA 1FQJA 1N6PA 1EWRA 1VCNA 2CNWD 1ZC4A 3KKOA 4RD0A 3GJ7A 2O8EB 2O8BB 2GXAA 1W36D 3IQXA 2LKDA 4MKGA 2R6FA 2ZRIA 4WZBE 4JL5A 4A0FA 5JMTA 2OV2A 1FW6A 2V6IA 1BMFD 2ZRDA 2O0KA 3NIBA 4LOAA 1U0LA 2AWOA 3CPEA 2AKAB 3GFTA 2F7SA 1ZJ6A 2IT1A 1KJYA 1AN0A 1W4BA 4JBXA 3REGA 4D4JA 2DFNA 4I81A 2KBFA 4B44A 3KKPA 5K8TA 1XD2B 1RPZA 3EC2A 2EFCB 1II9A 4MRPA 4EJSA 2QSZA 1N0VC 4IFBA 4Q4AA 3BH0A 4B3XA 3H86A 4GNKA 3IUYA 4OHYA 4HAUA 5KDLA 4LGMA 1W36B 1ESMA 3A1VA 3R20A 2RHDA 3B6EA 4Q4LA 3IDQA 2KI5A 5IK2D 1E1QD 2OM2A 4FWTA 4JJZA 1OPXA 1TUEA 1ZNXA 3E70C 1KI3A 3BGWA 3C14C 1YR9A 1G3MA 2RGNC 3I92A 2QMUA 2FMXA 3OIVA 4LBWA 3VR3A 2FSIA 1NBMD 1U8AA 2DBYA 2ZSDA 2O8DA 2BHRA 2ORIA 4URWR 2VP4A 3QBVA 2AHOA 1T5LA 2J46A 5L3SA 4JYCA 1KMHB 1RRCA 3LBHA 1SVSA 3QF4B 3LXRA 4NKRA 2HT1A 2IS6A 1PLKA 1AKYA 4WVFA 3VR5A 1DTSA 2WHXA 5HE8A 2JLXA 1VHTA 1NMZA 4KYUA 4XD7A 1ZD1A 4QBGB 2HYDA 2D7DA 3GLFA 3K1JA 3CWZA 2I4IA 1XMIA 2JIZD 4DUGD 1S2MA 2PT5A 3AVOA 2CLSA 3KKQA 1E4YA 1VIYA 1JXMA 3AF4A 3LX5A 1CJMA 1E9FA 1ONBA 3QEOA 1E9RA 1ZUIA 1Z28A 3N70A 1GZSA 5CJ2A 1OFIA 4KU4A 2YWEA 3TMKA 4BGDA 2FPLA 5JSZB 5KSYA 4NYMQ 3RANA 1UKYA 2AWNA 2QORA 1TU4A 1UKZA 1DBSA 2RCNA 3OF5A 1Z0DA 2ERXA 2WWFA 5LPNA 2O5VA 4Q21A 4HB0A 1I4DD 5B57C 2CJWB 3QNUA 4MYCA 1D9ZA 1G7RA 2IHYA 3EASA 3FWYA 3IILA 3GCGA 2B8WA 2EWWA 2PZGA 2ZJOA 2V3CC 4EFNA 3ZLJA 5IHPA 3UG7A 2B7CA 1RIFA 4JMPA 2EYQA 1SVIA 2OSBA 1P6XA 5DIFA 4C0KA 4JVMA 3T1TA 2B21A 4KVGA 3KXIA 3P20A 4WIAA 4NCNA 1OYWA 4R2IA 1BKDR 2OG2A 1C4OA 2ZAOA 3U6KA 2W6IA 1OFUX 1DAGA 5EXTA 4TYPA 4U00A 4MRRA 3GJ4A 2IYYA 4GOKA 1F60A 4G1UC 4KVAA 1H65A 4CEHB 2W00A 2XSZA 2IYUA 3THWA 3C4JA 3BJIC 2NIPA 2WMNB 1Q57A 1E9EA 4FCTA 4QC2A 4R98A 4G5OA 3U61B 1LTQA 3QE0A 4GFDA 1US8A 4DC9A 4HUQB 3VFDA 4AC9A 2WSMA 3B8HA 3ND9A 4MYHA 5J4HA 2ZI6A 4LC0A 1NIJA 4R7ZA 3IHWA 4Q1CA 3ZVRA 3OFNA 4B71A 5CJPA 1F2TB 2HF8A 2BIFA 4F4CA 4EPWA 4PSKA 1KAOA 3KXKA 2FFQA 1HT2E 2ZQ5A 3TSWA 1TQDA 3DMNA 1ANKA 4UNPA 4AYXA 4QJ5A 2OFOA 3D31A 4XH9B 1DARA 2V55B 5DSZA 3ZQ6A 3SC3A 1TEVA 4DDWA 5TDHA 1KK0A 1DS6A 3RLFA 2HXSA 3ZYCA 3R7WA 2F55A 4F4JA 1VG0B 4D0LB 3OEHA 4HDQB 2RGAA 1BIFA 4GP7A 3I1FA 4C3ZA 1QHYA 3LA6A 1ETUA 1KY2A 4HB4A 1P2TA 2D2FA 3WBKA 4A8JC 4ACBA 5FPHA 4GOXA 2GEDA 4ZI3A 3K0CA 1EFRD 3X1ZA 3SOPA 1U94A 3WP1B 5EE5B 3V00A 1CJTC 5KOYA 3L82B 5KTYA 1OKKD 1JB1A 2OLKA 1KO1A 4QBFA 1XTKA 4L9SA 3B82A 1T6NA 4TQ9A 2GXSA 4PZYA 1AS0A 4DSOA 2PX3A 4IVRA 2KJQA 3W90A 3PR1A 3THXB 4A2QA 3AUXA 3IKJA 3UK6A 1A1VA 3ETLA 1W0JD 1DAFA 1LFDB 3ONWA 3K0FB 4MITA 4PQFA 1Z0KA 3CWQA 4NCIA 1OIVA 4KXFB 4GSYA 3UKDA 1H8ED 5HZKA 1YJ5A 1UFQA 4N1AA 4W5JA 1E6CA 5FI1B 3ZGXA 4P33A 2XEXA 4WAUA 5P21A 4ACAA 2IA5A 3D7MA 1G21E 2PJZA 3I3SR 4KSCA 4RY2A 3A58B 3PUXA 2REBA 2HF9A 4A6XA 5J40A 4B74A 3T5GA 4DCVA 1A4RA 4O2LA 1QHHA 2P6RA 1ZIPA 3QKSB 1XJ0A 1N5JA 3FDIA 5DYIA 3X2SA 1LF0A 1XJCA 2PMDA 2ONKA 3CIOA 5L3VA 1IY0A 4GMXA 4AKEA 1NF3A 1S9HA 4K8OA 2KWIA 3QXHA 2RHMA 2AL7A 4CIDA 3I32A 4CEIA 2PL3A 3LW7A 3P26A 2GRJA 4V0KA 2JLQA 5KSZA 2BMFA 3BS4A 3KXLA 4IHQA 4G5RA 1HV8A 3CM0A 4PX9A 2A5DA 3ADCA 2GTPA 3AP2A 1R4AA 4I99A 3I5YA 1ZCAA 3VHLB 4R9UC 5TARA 1P2VA 4MGYR 1NVUQ 1XMVA 1L8QA 2H16A 1NVXQ 1OH8A 1C1YA 1I4TD 4C7OB 4YXWD 4PC7A 1ZM4A 1N6OA 2CDNA 4QGGA 2F43B 3AKEA 2CL6X 4UKDA 2Q9BA 3FB4A 3A4LA 2CHGA 5H8WA 4NYIR 2XOKA 5CYOA 3R9WA 3BAFA 2RB4A 3EIEA 1DAMA 3SBEA 1M34E 2FZ4A 3EZ9A 5C4MA 1GSIA 4IDNA 3MJRA 5BW8A 3QG1A 4DT1B 1XPUA 1J8YF 1FFHA 4TN1A 2FSGA 2YINC 3CNLA 2ZYTX 4JJKA 4M2LA 1COWA 3FKQA 3NBFA 5J4KA 3KQUA 4KI0A 4LJ8A 2ZE5A 3KFXA 5BYKA 2CK3D 3QEJA 1II8A 2IWRA 1TF7A 4BZQA 1NVVQ 4HAZA 3HR8A 1II0A 4JLVA 4PAMA 2ZYWX 4DLXA 3QY0A 5JJIA 5JJKA 3LLUA 4IKEA 1IXRC 2HDNB 1ZM3A 4EPXA 1A5TA 3KQNA 3KTAA 2I1QA 3TJZA 3KQHA 1VCIA 3MAAC 3RS4A 3ZIAD 2N42A 4Q1BA 2G3YA 1QVAA 4WZ6A 5TB5A 5HCNA 5JS8A 1P75A 1R7RA 5D3MB 4DCUA 3R8CA 4TT3A 1KO4A 1U90A 5EZ5A 1Z6TA 1RZ3A 3P4YA 5HR5A 3CRVA 2JLWA 2YOGA 1G64A 3EZ2A 5DN6D 4JLOA 3FHCB 4GMDA 1GG2A 1RVDA 4TTPA 4JKIA 1G3IA 2XAUA 3B85A 1EXMA 2JLSA 1N2CE 2ODEA 3BFKA 3F3YA 1TUIA 4GT1A 4GZLA 1VPLA 4M1WA 1E9SA 2TMKA 4OJQA 2J5XA 2WIBA 3TKLA 4YDSA 1SKYB 4WA7A 3GEEA 2QM7A 5CK4A 4YMSA 2ZAMA 3CW2A 3Q3JB 1CIPA 2ZI7A 1O3YA 4NYJR 3BFVA 4JYBA 1ZRHA 4ILEA 1JPNA 2O8BA 2GF9A 2RAPA 3DO6A 5C2JB 2JDID 1T0JB 3U7EB 3IIMA 4B73A 3CKLA 1UF9A 1NMXA 2D62A 2IYVA 2ZE6A 3IEUA 3NHAA 4BPBA 1G3UA 2FEMA 1YZQA 2GJAA 1E2QA 3RNLA 4I1OA 4ZO4A 3T5DA 1G5TA 2Q3MA 4KLNA 3ZVLA 2CHVA 1M6NA 4QHSA 2L0XA 2C2HA 4A8JB 5J4YA 2WWHA 5FOSA 2HV8A 4A0HA 4KODA 4ABYA 3WMEA 2WJIA 1KDPA 2ZJYA 1UPTA 4A36A 2VL7A 2ZU0C 1S1CA 2K5UA 4D81A 5AUNB 1JEEA 1ZAKA 2PZFA 4C0HA 1OFHA 3EPKA 4LK2A 1NY5A 1S96A 1E2DA 3BE4A 3OIWA 3RS5A 2OBNA 2WSSD 2FJUA 1WDTA 3KJIA 4HLUC 1BH2A 5E95A 4O0MA 2CL7X 3K9NA 4PTLA 4ZDKA 3BFXA 2EU8A 2QT1A 3X1DA 5JECA 1XTIA 1XTSA 1PVOA 2P2LA 4NH0A 4EPRA 1G8HA 3JVVA 3WNCA 4D0GA 2IYSA 3ECCA 2ZYUX 5F98A 5AJVB 2P6UA 2I1VB 2RH5A 4QHTA 3SS8A 3M0EA 3NC1C 1E0SA 2AN9A 2MMGA 1E2LA 2UZ3A 3L0OA 1XF9A 3QF4A 2IXGA 4WZAE 4BFWA 2VPPA 4UNRA 4US2R 4BFUA 3RS0A 2ZJAA 4QM6A 4P4TA 2AD5A 2J0VA 5BQ5A 2NO0A 4JVSB 2C8VA 5FFMA 5KNDA 1W5SA 4V0NA 1KO5A 4BASA 2CCGA 1YR6A 3KQLA 1XPRA 1G9XA 3NHBA 5AJWA 1XEXB 4RD1A 2F6RA 5B64A 2GHIA 1ZM2A 3EWSA 3CZPA 4KFUA 3FFBA 5JSZA 3O8RA 1E3MA 4Q4HB 2WWIA 3MWJA 1G20E 2VP9A 1D5CA 3FE2A 4BLRA 2ZRHA 1UBCA 3Q7PA 3L2OB 4URXR 4B75A 2WJVA 5KHOC 2WAXA 2JIZA 3GJ6A 4IW3B 4P32A 4C0QC 2CVHA 3AVTA 1XD8A 1W36C 4LHWA 4A9AA 3U7HB 1XTQA 1L2TA 2JA1A 4A92A 3N2IA 4LJYA 2MSCB 3NDBB 4TLCA 2OHFA 4OQLA 3GEHA 2XTMA 4Q9HA 4Q9KA 2ZEJA 3LV8A 1KNXA 3GJ0A 3D6TB 3AF1A 4DJTA 1KKLA 1R2QA 4IVPA 3V4FA 1XTRA 1Q1QA 2VSXA 1XXHB 3LY5A 1KYIA 4C9BA 4IEEA 3QSYA 3DKVA 2C5LA 4G5GA 1J2JA 1FTNA 3KB2A 4JT4A 3DOFA 4N0DA 1Y3AA 3K9GA 2FPMA 3WRYC 2QRNA 1T9HA 1JI0A 2QRZA 5FTKA 3BRWD 5C4GB 1AZTA 2SHKA 4G5QA 4GZMA 1DAHA 4DVGA 5BN3A 2BBOA 1G4UR 1VYVA 3B1ZA 1E2EA 5HTKA 3SJCA 1GITA 4PC1A 4BLSA 1KSHA 5DI3B 3DM9B 4KAXA 3SFZA 3QG5A 4ITRC 1F2TA 2JJ2D 2G1JA 2KE5A 2NZ8A 2Q0HA 2GEUA 3DL0A 4WXPA 2V1UA 1QZXA 3CPJB 4LJAA 2WJJA 3QXCA 5GJVC 3EAQA 2JAQA 2IHBA 3BB4A 3HYTA 3F8TA 3GLIA 2WWWA 2QAGB 4AY2A 1Q0UA 4LDJA 3B1YA 4N3NA 2V1XA 2OLJA 5J5CA 1E2NA 4M1TA 2ZUDA 4DRZA 3O8CA 4RSGA 3N2EA 3ND8A 2ZE7A 2ATVA 1LS1A 1W49A 5F2EA 4C0JA 1TX4B 3LNCA 1BO6A 3B9PA 2WIAA 3WNDA 4CRWB 4JVLA 4ZDJA 3QVVA 4TL9A 3ZZTA 4OQNA 2C9CA 2R2AA 5FUWA 3EPLA 3W6PA 4M53A 5JZVA 5EP1A 4FWIB 1XEWY 2G1KA 5FPSA 1T8TA 2ZSEA 4C2UA 5EUMA 1BOFA 2VHQA 4EPVA 2QI9C 1P9NA 3TVTA 4RD4A 2BCJQ 2GXUA 1JAIA 3THXA 1QBKC 2B7BA 1XCGB 3B1XA 1EFRA 2D06A 2ZIAA 3BBPA 3DM5A 3H4MA 3W3AA 2ZRMA 2WZQA 3TUIC 5A4JA 1ZVQA 4LJ6A 2ZJ5A 2ASEA 3FPAA 4RKFA 1AKEA 1KKMA 1E1RD 1TADA 2YHSA 1WE2A 1YVDA 1NLYA 2VF8A 2C99A 3E1SA 2J0SA 5JI3E 3T35A 4ESVA 2ANBA 1JNYA 5KU1A 4HLQB 1P7CA 4H9GA 3VR2A 1A7JA 1V43A 3NEYA 1AK2A 1RYFA 3GJXC 1OXSC 4Q5IA 1W0JA 4TQAA 1X3SA 4US1R 5IRCD 4QHYA 2RGNA 3FHTA 1HQCA 4PSAA 5JEDA 4B76A 2OBLA 3WBJA 5LD2C 5KO2A 2NMVA 4QNMA 1KI6B 4W9MC 2IXEA 2ODWA 3R9XA 2Q9CA 1SKQA 5CYPA 1SXJB 1EFUA 1W48A 4ASUA 2ZRCA 4QJ4A 5GJBA 4P31A 2QTHA 1Z47A 1ZINA 4Z1MD 1XP8A 4LJ9A 4AURA 2J3EA 2QUZA 1R0WA 3D3QA 2QQEA 3QPVA 4QL3A 2R62A 3VR1A 4B32A 3LAWA 3V4RA 2C9YA 3C5CA 3KFVA 5H68A 1N0WA 1CULC 2R6AA 3QKTA 3CBQA 2ZITA 2YOFA 3CNOA 1CEEA 2J87A 2OCAA 5F9FA 3VKGA 2F43A 1G7CA 1GUAA 2H57A 1XDBA 1Z08A 5TY0A 2BKUA 3QI2A 5DE3A 1KZGB 3W6NA 5JHHB 5CLLA 1Z0JA 1DO2A 1SULA 3GFPA 1AGRA 1KI9A 1SHZA 4MYUA 4OK6A 2GK6A 1KNQA 4LSGA 2G6BA 2NO6A 2YOHA 5J47A 3HU2A 4WW0A 4B47A 4HAXA 1MO4A 1U81A 2QU8A 3MUFA 5G53C 4YXWA 1S8FA 1E99A 1W0KD 2IUSA 2H5EA 2QNRA 1N5LA 4O3MA 2VSFA 1NJFA 1ESNA 3U4QB 1VYTA 1VG9B 2V4ZA 1KGDA 2V7QD 2YYZA 2DHRA 3DZDA 3FGNA 3FVQA 2Z43A 3GEIA 2HLDA 4QGAA 3RWMB 2BJVA 4UNQA 4CEJA 2CHQA 1GKIA 1VDZA 1VG1A 3EZFA 1Q1ZA 3BC1A 4TMXA 3SQWA 4HAYA 2PLRA 1RYHA 4OHWA 4EQ6B 2WKRA 3ZD6A 2QP9X 2CEAA 3CRW1 1DG3A 1F2UA 1Z83A 2RGDA 1KSGA 4BRUA 3H0KA 3KJGA 4C4PA 1SZPA 3ICQB 4W5WA 5HE9A 2C95A 1C9KA 2H8KA 3MRSA 4OK3A 5LB4A 4AYWA 2YJTD 1P73A 3K9LA 1XBTA 4NONA 3PEYA 2CK3A 1G5RA 2ZS9A 3PJRA 4YDHB 5D3MA 1OYYA 3E5HA 3ZZUA 3RAPR 3PV0A 1FMJA 1FPMA 2F9MA 4TTRA 1M2OB 2ODBA 4URVR 4PZLA 2Q9AA 1IXZA 1DPFA 1T91A 1CXZA 3ZIAA 1GNQA 2P6NA 3ZZ0A 1QVRA 1HH4A 4MDEA 4BFTA 1WF3A 4B35A 5FL7D 5JCPA 3VNVA 1MRNA 2P65A 3NEJA 4QFMA 4BECA 1E0KA 1ZMXA 4A6PA 3PUWA 2X77A 2XITA 3IO3A 2CLCX 1WQ1R 4RD6A 3VU9B 5D3QA 3T61A 2QP4A 3PIRA 4M22A 5DN6A 1OF1A 1Q44A 1G7TA 2VRWA 3PENA 1E9CA 4Q7MB 2FPKA 4O2RA 3RC8A 2ZRBA 3A1UA 3MSXA 2NGRA 3BH6A 1CBUA 1RJ9B 4M1KA 4A8JA 621PA 2J0QA 1KJWA 3QBTA 5FUXA 1NMYA 1M74A 3IBGA 5HCIA 4AG5A 3T1QA 2FX3A 1U0HC 4OI0A 4MUBA 1RRPA 1FUKA 5JWOA 1U8YA 1J99A 1OXXK 2JDIA 2MSDB 3EIQA 2C04A 1P2UA 2Z4RA 1OXTA 2WOOA 3C8UA 4ZIRB 3FYHA 1GAJA 2D3WA 3GQBA 2D74A 3Q5DA 4L16A 2D4HA 3G0HA 4YMTA 3QUSA 2EQBA 4KBGA 2WJYA 4G01B 2W2TA 4QKQA 4RFSB 1NKSA 1Z22A 5B58C 5KDOA 3GLIE 1GP2A 1TQ2A 521PA 3U6BA 4UJ5A 1U99A 3QXXA 2WPDD 4HAVA 2P67A 2PH1A 4URUR 5E3HA 3FMIA 3WY9A 3IBYA 1B23P 3BB3A 2HEIA 2GK7A 1R5BA 3IGFA 4YMWA 1N5IA 1P60A 4TYNA 4DLYA 8OHMA 3ZS8A 1HYQA 3EX7C 1U98A 2CVFA 2W6JD 1KDTA 3CH5A 3LBNA 1E4VA 3CB4A 2G88A 5TV2A 4E07A 1ZM7A 5F3WB 3U7GA 4LHXA 3MMPA 4MYTA 2IYWA 2YVUA 5EXXA 4D2IA 4DEXA 4PAQA 5LD2B 2JLRA 1G8YA 2DB3A 1EFCA 1WB9A 3HPRA 4AKHA 4IFEA 1KZ7B 4IDHA 1FTSA 4JLDA 4Q7LA 1F6BA 1GNRA 3TLXA 3AVWA 4B2LA 2RGXA 2DFKB 1HTWA 4Q4HA 5LB2A 5JI2E 4PHHA 1MO5A 2D7CA 1T5IA 2BEJA 4YONB 2GJ8A 1YE8A 4ESHA 1X6VA 2GJ9A 5FUVA 2CCKA 4XWKA 1XMJA 1U8ZA 2BOVA 2UVQA 1XCMA 2FFHA 3LRPA 2WJHA 3D8BA 3TSZA 2NQ2C 4S2EA 1D9XA 3VX4A 1T3SA 2RKOA 4LPSA 3VX3A 4DEYA 1TU3A 4QGHA 3I8XA 2R9VA 4K46A 3JZMA 2QPOA 4HAWA 1NN3A 2ZPTX 4TMTA 5AUOB 4TWZA 3PXGA 1WBDA 2PEZA 4BEBA 4QG7A 1QDEA 1X8JA 4BFYA 2WICA 1AZSC 4IVQA 1CRPA 3JZAA 1CJKC 2IEZA 2JEOA 2WOJA 4IDOA 4A2WA 1CF4A 2HUPA 3OEED 4AKGA 4RZUA 4DSUA 4FW9A 2JJ8A 3VAAA 5C18A 3ZJYA 3ASYA 1AQUA 1I2MA 3BWDD 4ZI2A 3EZ6A 3MG9A 3NBZC 2ZRAA 5EQTA 2LKCA 1MO3A 2DWQA 5DHAA 5DI3A 4BUJA 4Q47A 5J4LA 5KYKA 4GI7A 3KQKA 1GKYA 1OJLA 3GLHA 1NN1A 4V02A 3OE7D 3L0SA 4BWYA 4BEJA 5C46F 3TH5A 4IEIA 2IF0A 1GRNA 4Q4JA 2IYTA 1KSJA 4FINA 4TSFA 1HT1E 2FEOA 3NH6A 4W5HA 1TMKA 4XWAA 4RCYA 5JWHA 3R8FA 1T4GA 1G291 2F1HA 4OI4A 2H17A 2NO1A 3U5ZB 3EIHA 2PT7A 2BV3A 3JVUA 1G6HA 1FOEB 1Q1BA 2JJ2A 5G41A 4D6PA 2BJWA 2QEQA 3DZ8A 2J0UB 121PA 2J59A 1XZQA 2XB4A 2YWGA 4HZUB 5BN5A 4Q19A 4DB2A 4TLEA 3DEFA 1G17A 1JR3A 2GKSA 2FZLA 4P4SB 1OE0A 3BXZA 3TNFA 2ONJA 1RRFA 4PZZA 4KBFA 4OQXA 1E2GA 1KTVA 2C77A 3B1VA 3RRYA 4D25A 3WHKA 1QF9A 4U02A 1J90A 1Z6YA 5IF9A 5JWRA 4A0RA 2O8CA 3DVLA 1CS4C 2BBWA 3I8SA 3KB1A 3LD9A 4FD2A 1SVMA 4EKDA 3OIUA 4XVRA 1CTQA 3I5XA 1XB2A 3T34A 1PUJA 2AKYA 4QJ3A 1WXQA 1E0AA 3BERA 1A82A 2F1RA 3Q8XB 4HLDA 4URYR 5C1BA 4D0NA 3CZQA 1Q12A 2ZR0A 3KJHA 4V0MA 1XX6A 3S1AA 3GLFE 1PJRA 1OT3A 4HLCA 1IXSB 4XJXA 2XZPA 2ZTSA 4DB4A 1Z6AA 1N3BA 2EVWX 1KO8A 4LBYA 2HYIC 4OQMA 3SHWA 1K5DA 4QNRA 5AJYA 3K09C 2ZI5A 3A8TA 1RRGA 1S9DA 2AK3A 2KB0A 2OXCA 3F5FA 3M4YA 4V0OA 4EJSB 2JLUA 1SKYE 2ZRFA 2E1RA 1P72A 4H1UA 1R0YA 4DLZA 2X19A 4ZCMA 2YWFA 1OH6A 1LS6A 2DPXA 4HLUA 1KI4A 1T3HA 2IYQA 4OL0A 5B2ZA 1E79D 5SZKB 1IHUA 3NBXX 4A82A 2LWIA 4ARZA 2QAGC 1J70A 3LBIA 3W34A 4DDUA 2V54A 1FUUA 3B2EA 4I1VA 1FMLA 5FBLB 4XD7D 1E2IA 1GILA 4DBLC 2QY9A 4HB2A 2XTZA 2C96A 2CLDX 3OESA 1PZNA 3QPWA 5G40A 4JSYA 5A5GA 4TMZA 3K0SA 1JQLB 2AD1A 1UDWA 2OAP1 4B3BA 1KSFX 3UIEA 2FE4A 2OEPA 4XOIA 4DCNA 1ZP6A 2RGEA 2YWHA 3WP0A 4P4UA 5HKKD 2PX0A 3CX6A 4Q9IA 2O8EA 3QXSA 3UATA 4XIGS 1X1SA 1OB5A 2MMCA 5AK0A 2ZVQX 3TW8B 4M1MA 2NPFA 1MABB 2ATXA 5KUTA 4IOMA 3UANA 3QF7A 4Z1MA 5FOTA 4RD2A 3A6PC 1R6BX 2GA8A 1DE0A 1P5ZB 4M9XA 3LFUA 5JS7A 5FTNA 3U3JA 1M7HA 2IW3A 4HDCA 2FG5A 1XD2A 1TPZA 3MWKA 3PITA 4FMDF 2B8TA 5GJWC 5BXQC 1G8PA 3U60B 4ZPXA 3SQXA 2NO7A 1ZUNB 2CNWA 2QA5A 3CNNA 3W5IA 1GIAA 5H70A 2IL1A 3WYAA 4X8LA 2VP2A 4M21A 3VTKA 1QHXA 2BDTA 1KIMA 3AVQA 1BMFA 4MGKR 1E32A 1XFAA 1AGPA 1R0XA 5CB8A 1E98A 4D4LA 2OT3B 3AP3A 2AFIE 4BLTA 3AH8A 3UPUA 1MOZA 3TK1A 1IJFA 3I4LA 4BE7B 4EQ6A 4DCSA 1DAKA 1W44A 4B2IA 1D8TA 2BM0A 2ZUBA 4R71A 2R8RA 1R0ZA 4LRWA 5FTMA 2WWGA 4RZ3A 3AQ4A 3AGPA 1FL9A 4ZDIA 2GJKA 3GLGB 1KMHA 4AKIA 1SXJC 4FMDB 2WJGA 3QQ5A 1E2PA 3CO5A 2V7QA 1ZNWA 2QN6A 3CRRA 1EGAA 1XWIA 2XTNA 2ZRLA 3M6AA 1E1QA 4GP6A 4YLGA 5IK2A 3F0TA 3FMFA 3LDAA 3OZXA 5FOUA 3VNUA 4TZ6A 1N5KA 4LC1A 1NVWQ 2EFHB 1Y63A 3TE6A 4Q1AA 3SDZA 4HUTA 1G5PA 2F1JA 1NBMA 4OQFA 1ZW6A 3THWB 6Q21A 2HJGA 4ZKEA 1ODFA 3QPUA 4CF7A 1ZCBA 2ZRNA 1S3SA 2QT0A 3ADBA 821PA 2ZJ2A 2IWHA 2BCGY 3V9PA 2G83A 3BK7A 3NC0C 4PC3A 4CT5A 5DH9A 5CDFA 1AJEA 3QKUA 1IN7A 2JLZA 2ZYVX 5FPTA 3RSOA 2VYFA 3OEHD 4R2HA 4S35A 1P2SA 2GDJA 2EFEB 3REFA 2IEYA 5KPDA 1S3GA 4TZ0A 4D4KA 2G9NA 4X8OA 2Q3FA 2CJWA 2ZUCA 1P9RA 1ZU4A 1KMQA 4DUGA 1HE1C 4Z54A 1YR8A 2V6JA 1VKJA 2ZS7A 1EWQA 2JJ1D 2ORVA 2VHCA 1RJ9A 1R5OA 3IHLA 3QXJA 1G18A 1BS1A 3DKPA 3VHXA 3SNHA 2W2VA 3NDPA 4F92B 2JLVA 3GD7A 5FOWA 4P0TA 3TR0A 3P4XA 4PO1A 1HUQA 5DHFA 3GLHE 3RDPA 3AV0B 3ICEA 4U7DA 5CM8B 5FBQB 1KK3A 2ZI9A 5K8IA 2A5GA 2ZRKA 1OSNA 3O47A 4Q1DA 4CEHA 1EX7A 4AG6A 1AS3A 2OFXA 2OUKA 3AF0A 2QENA 4L4UA 2IYRA 4MQBA 1Z07A 3NG1A 1FNMA 4URZR 4NMMA 3TAHA 3SU8A 3LQQA 3TBKA 2BMJA 4FXPA 1Q21A 2AFHE 3K0AB 3OHMA 4KFSA 4NCJA 4WXRA 4HUQA 1A2BA 4BZXA 4MRNA 3EPJA 1Z0IA 2GZAA 3K8YA 5EZ6B 1Q3TA 1W4CA 1WCV1 2FV8A 2ZVPX 1NSFA 4NYJQ 1NY6A 4NL4H 1N6LA 2O0JA 5EE9A 1JR3E 2QBYB 4M0LA 3T1OA 2C9OA 1GL9B 1O87A 1Q22A 1Z8FA 1JPJA 3IO5A 3U44B 2WPDA 2I3BA 2VQSA 4CYMA 1KDRA 4DDVA 3K70C 3DDCA 4KLZA 4HATA 2ZM5A 2OCYC 2DY1A 2W58A 2Q21A 2QL6A 5JFGA 5CK5A 3R9IA 1U9IC 2HCBA 2OO7A 4YMVA 3MWYW 1ZM9A 1BYUA 2A5FA 2A2ZA 1DOAA 4LJ4A 2QM8A 4CW7A 2W6JA 4B3FX 3ZVNA 4BFZA 3WRXC 4V0ME 3CPHA 5BWMA 1LV7A 5KSPA 3SR0A 4D82A 2RGCA 1W46A 2FDCA 3CF2A 1XPOA 3G82C 2OAQ1 1Z0AA 1W4RA 1ZUHA 5LDDC 1NNEA 1OB2A 2VP5A 3PFIA 1MRSA 4MRSA 2EW1A 2GXQA 4IRUB 3IQWA 4DZZA 2QE7D 1VIAA 3SBDA 2F3TA 2GAOA 2R6GA 3QOFA 4DIDA 3A4NA 5CB6A 2GCNA 3AP1A 1L4UA 4PO8A 1Z2AA 4XTCS 1TQ6A 4XSHA 1N6RA 1NLZA 5FTLA 421PA 4C0LA 3GP8A 3K0FA 3FTQA 1NN0A 4JLKA 4MKIA 5DISB 2BBTA 5FR2A 4JZKA 3UWOA 1CJVC 2WM9B 1UM8A 2JASA 2XZOA 3RHFA 1OH7A 3KDSE 4UNSA 3AVUA 2YKGA 3ADDA 1LB1B 1OKKA 4Q02A 4D26A 2Q3HA 4MA4A 1D2EA 1SXJD 2VSOA 3HU3A
chains in the Genus database with same CATH superfamily
4AS1A 4PHGA 4E51A 3DLIA 1P5HA 3ETGA 4YP9A 1X80A 4DVJA 3FZGA 4Z51A 1J8MF 1I14A 2EYUA 5E1BA 5A7FA 1JXAA 3VGJA 2QD2A 3I01M 3KSAC 1XUOA 2O2DA 1H3EA 4TKLA 1UXJA 4G56A 4GRIA 4MZDA 4OHUA 2B2NA 1E7SA 1LRJA 2X8JA 2WU3A 4HGPA 4M9SA 1KORA 3AERB 3FOBA 3H5AA 1DWPA 3PGVA 5E6UB 3NWJA 4ZVQA 1GGKA 3EDOA 5EP4A 5HK8A 3RUEA 1WETA 1U65A 2WT9A 4DMHA 3J81A 1KH3A 1XTJA 3PXXA 3ZDQA 5ITWA 1RI3A 1ZMRA 3ZWWA 2VP6A 3IVXA 3EB9A 1BEZA 5KYVA 1SC3A 2Y8EA 3OEEA 1XZEA 1CUBA 4OO3A 3P32A 4RGQA 4PYNA 2FWRA 4OI2A 3ESXA 5JARA 1UBTS 4OXRA 1UMBA 4Z9FA 3Q3HA 3EVZA 3PD0A 5H82A 3LL7A 3WYGA 1U2DC 3OZIA 1ZGJA 4IOKA 5DNVA 1QIMA 1K6JA 1JEAA 3BIFA 1AIPA 1GRQA 5AI5A 3QIAA 4H59A 5HEKA 4F06A 4YQFA 3VU3A 3GAMA 1GPKA 2WBLC 2HLHA 2XADA 4HZUA 1BDHA 4M7OA 1D4ZA 3E4DA 2YXNA 5A0FA 3CONA 3U40A 3RYTC 1WXEA 5KYXA 5MN6A 4AVYA 2PXCA 1JQJC 3LWBA 3PR3A 1ZISA 2O2IA 4O5OA 1D0SA 4XVQA 4KXWA 2K2QB 5TQ0A 3L7BA 3UUEA 4X00A 4FCVA 3FPSA 2EXXA 4GECA 2JPDA 3Q10A 1L7VC 2AJCA 4YMIA 1X7WB 2IZ1A 4EHHA 4Q7JB 1C8BA 1EQUA 2ROQA 2Y67A 1QTQA 2BGGA 1GGJA 2C78A 5BSFA 4MDFA 2CFSA 1Z5ZA 1JHPA 4MGIR 1EZ1A 1XHFA 4R9NA 1QGYA 4XQGA 3PNSA 1KHTA 3Q7RA 3MFYA 3UF0A 4AZTA 2CMHA 1NI3A 1WR8A 4BCCA 3RRNA 4NOLA 3I6ZA 3LI2A 2FP4B 2ZWOA 3AEKA 3INNA 3FH0A 1I5RA 2AI2A 3VO9A 4NESA 3NIFB 2Q4RA 3TVDA 2IBSA 3Q7TA 3FNFA 3N8GA 3GCZA 4HDKA 1I5EA 3AM5A 1K89A 4KMMA 3SC6A 4CR7A 1NFQA 2DE0X 2QUBA 3DEJA 1NKVA 1X8LA 3DOUA 4IM7A 5I7FA 4RVGA 2PKRA 1E2HA 1GZDA 4GSKA 5BRNA 4CL3A 5CDFE 2XUPA 2H1LA 2PSDA 4ID9A 4OIFA 5DM60 3EARA 4TYWA 5AHRA 3G2QA 3ORHA 5AK6A 2QLNA 3TXYA 2ET6A 3PQCA 5IMBA 4DLVA 2WTMA 4MGZR 2ID9A 1VPDA 5IEJA 4XSGA 4KDCA 2DEUA 1OPRA 1RMTA 2AF4C 3DFZA 3HB5X 1HEIA 2JJQA 3L0IB 2VQ3A 1LY1A 4KN5A 3U7QB 3MT9A 4ALIA 1Y80A 3DE4X 3FUWA 1NA5A 5BVHB 1EVKA 5DNEA 1SEPA 4P22A 5ALIA 1E0JA 1KWGA 3DE1X 4IJMA 4XWTA 5FNVB 2PV7A 2HHAA 2XE4A 3JRXA 3TAUA 1GM5A 4A2PA 4MR9B 2QNIA 1UAGA 5EE1A 2HBRA 4MK4A 4L5CA 1Z18A 3T4EA 4DDTA 1HLFA 1IUPA 4OH7A 5ISMA 3TL6A 2XOEA 1NTRA 1YL6A 1W96A 1WHSB 1WKBA 3AM3A 4MB2A 2QN2A 2ZRJA 3I37X 5CVDA 1AV6A 1UK6A 4DA8A 2PFSA 1L1FA 5THKA 2PUEA 4EA6A 3WLAA 4BQEA 3TCNA 3CMMA 4MDYA 3R2JA 2X2FA 3GNQA 4ZCQA 3UJBA 4DA0A 4EY8A 3TTTA 3K70B 2B9VA 3RG8A 3QEBZ 3VR6A 3TW8A 2CJXA 2AOUA 2Q4TA 2J7PD 2P11A 2PD3A 3C70A 4N6NA 2BTEA 4HZIA 3AY6A 1N33B 4UFNA 2QRMA 4RD3A 4NMHA 2QP3A 2HZBA 4HDAA 3VJMA 4PHFA 1V7ZA 2AYYA 1VBMA 1Y3BE 2QMQA 2XE6A 4OBEA 2JC3A 4EFMA 3JZDA 5EJ4A 5LMZA 1MLDA 4YQYA 3SJUA 4XGQA 3L1UA 4PQEA 5IFKA 2ZBVA 3S8MA 1DQYA 2ZRPA 1L5GB 5FB3A 3G02A 3NJ8A 3B1FA 1LJUA 3JYPA 4KQ6A 4AY5A 4B7AA 1DDGA 1FDWA 5E7JA 4D9EA 3B5IA 5K0JA 5IAOA 4O4LF 6LDHA 1S4QA 3V46A 2R6R1 5BSWA 3JQ8B 2DH6A 2OFWA 3B48A 3OA2A 1YU9A 4KWCA 1NXXA 3RSSA 4D99A 4Y2RA 3E22A 3CO0S 1MT0A 4M6WA 5GVSA 3PQDA 4I4IA 3TNYA 2AYXA 2GHTA 1QO0D 3FTNA 3I73A 3PYLA 4L8GA 4II2A 4PPNA 3RBAA 3U37A 1XZPA 4IXTA 5BRAA 3OICA 3TZ6A 2YFQA 4R1UA 1SVOA 1J00A 2W0SA 1JLHA 2VTDA 2IV2X 2VBCA 2WB2A 2I34A 1SHUX 1JKJB 3BL6A 3M5DA 2XMDA 4BU1A 4ZANA 3DOEA 4RJLA 3B78A 1T4DA 3EQ9A 3VDNB 4AKTA 1RKBA 3UXEA 2J5BA 1UBFA 2ZZKA 1DAEA 4OXIA 4AECA 3LX8A 2H7CA 3Q6NA 1XQ9A 3GA0A 3ZE9A 1VPVA 3C48A 3CRZA 3R77A 1AN9A 3VQTA 4DMMA 1H4QA 4X1IB 3VZBA 1CRLA 2DQYA 3OU2A 4U2BA 1BE0A 2WUFA 2Y1DA 2ZJ1A 1XDZA 4A27A 3NWBA 4WOPA 2YN4A 1LTKA 4RQBA 4BEVA 4N5MA 3SPXA 5F76A 2G36A 1WA5A 4LCBA 3MBKA 4C0SA 2WWYA 1XZ8A 3TYXA 3MXTA 1LW6E 4TYQA 3H0CA 1W2GA 1SIWA 5GJCA 1F20A 2WJWA 3CF0A 3LP8A 1A2OA 5EIAA 5HIIA 3LUGA 4CIXA 1OW3B 4FR2A 3S8YA 1UOOA 3KB6A 3GCXA 4L9AA 4UHKA 1G4AE 1OWOA 3PCRB 2W9XA 4TLBA 1CF2O 2QROA 1IRIA 1XLWA 3EIFA 3RFFA 3WHLA 3TPCA 4N4AA 2O2ZA 4P7JA 5IS2A 2HLPA 1YBHA 3KTDA 1JDNA 1OOEA 4LDNA 5C32A 3A25A 4E03A 4B2PA 4J7AA 3MHPA 3ZQJA 1UBLS 1GPNA 1YR7A 5AKKA 3SZOA 3D8UA 2GF0A 4M1OA 1FDOA 2XNDD 1U5BB 3QY9A 4YRJA 4II7A 4BNDA 1QMPA 1P1RA 10MHA 2Q6TA 2JBWA 3OIGA 4JU8A 4L3WA 4C6TA 1ONOA 5EP3A 3NRJA 4AJIA 2W48A 2A5JA 2CJYA 5AVSA 2XXAB 1VJRA 3ZHRA 5JJBA 1MB0A 3GUHA 4LUCA 3GVPA 5G0SA 2D5IA 3PF9A 4H4DA 4F6CA 4UBMA 1LPBB 3QUCA 1ZC3A 1JDVA 2WHPA 2JJ1A 3BWXA 2POCA 3ESYA 1P62B 3WGQA 1PKEA 2XBUA 3BQNB 3PGLA 3CINA 4BYGA 3ZWVA 2GVZC 1SUPA 5J63A 3HFGA 4D6YA 1XKQA 4H7KA 4KITB 4D8WA 2QVXX 2RH8A 4ML3A 3NXKA 4ZN6A 3OIYA 3PPVA 3FPGA 3K0AA 1Z2CA 4P58A 1GPYA 4FHZA 4N0MA 4WJKB 4PXAA 5DTEA 3WGNA 4U4AA 5CP8A 5K1ZA 4JBLA 3TTWA 1NG9A 4REQB 1KI1A 3AF3A 1HDRA 3IB3A 1FVFA 4EGQA 2ZTLA 1GYPA 1X7HA 2LNDA 3BZUA 3K09A 2BMAA 5K05A 2QBYA 1M1YE 2XQKA 2JFBA 4I7EA 1QQAA 5BN4A 1MH1A 4WXMA 4ERXA 3HY3A 3U44A 3NGXA 4IDPA 1ENYA 4I5IA 4JOSA 3FPCA 1MIHA 4JLBA 3TQFA 4ZCIA 4Y9SA 1A9QA 4CKEA 1DUIA 3W8NA 4YREA 2J3QA 4ASUD 1C4XA 4H1TA 2YW9A 4Z1OA 2AUNA 3QV1A 3RABA 3V2IA 3LW8A 1NDUA 1QHSA 4N5IX 4QUEA 2FU5C 1JVBA 1FZQA 1UXGA 1JR2A 3FOWA 2CZGA 2QPAA 4IRXA 4ZO8A 4U9HS 5HFAA 5KPJA 1F2DA 4ETIA 3DV2A 2QLFA 1FNNA 4R05A 1FP1D 1IJKA 1I30A 3Q2OA 1CR0A 4E22A 4LSZA 1LWNA 2XDYA 3L93A 4PZ0A 3U3KA 5JSUA 2PGOA 3E2IA 1OGYA 2WUGA 3C7AA 3FPAA 3LHKA 5G0UA 5G1NA 4UOQA 2GJSA 4IHJF 4CLRB 1W1WA 4EHBA 4Z53A 1K8RA 5DMHA 3BD8A 4TTQA 3FYCA 2FEKA 2YIDA 1CZKA 1GAQA 1CJSA 5FI5A 1W2HA 5SYNA 1HEUA 3H5OA 4JSTA 4OAOA 2B92A 4F97A 1AQYA 1G8FA 1AGXA 2I1LA 5DHUA 3CX8A 4HDNA 3GQVA 1OU0A 4NZNA 4PLZA 1AF4A 1L8OA 1N0UA 2FPIB 3ONDA 4GKJB 4L72A 1ZOIA 3MIZA 2ZS8A 1T4CA 1ZJ4A 5A1JA 2JH3A 1RS0A 4PZEA 1YZLA 4ZREA 5F9HA 4R01A 4U5XA 4BDTA 1E6WA 1ZR2A 3G88A 4AWBA 4DY4A 5EWLB 4HD8A 2A7QA 5E6SB 5TNXA 2F4VB 1QTNA 2QMEA 4FX5A 3SN6A 3RVMA 4EZIA 4HGZA 2RK4A 1Z6QA 4NBNA 1TVKA 1X7YB 1A8PA 2B78A 2J9GA 2B1RA 1GTL1 3JTEA 2VF7A 3OWXA 4R0VA 5LMCA 2OB1A 4MUAA 3CZRA 1ZIYA 1JS1X 1V71A 3JPWA 4R3NA 1DKUA 1NIPA 4BLOA 1UBEA 3DZIA 1NP6A 2G17A 2XB6A 4NXMB 4LV5B 4BGEA 1U7ZA 3JX9A 4ENWA 4J94A 3IUSA 3KHSA 2ANCA 5FV4A 1DV2A 3OPVA 5FOXA 4ALJA 4ER0A 3VO1A 3S6JA 1YL5A 4M8NE 3BL8A 2B30A 4O59O 1JJ7A 2O19A 1JQAA 2RE8A 3JAWA 1F17A 4LV8B 3L05A 4YAJA 1SO8A 4JI7B 1BOOA 5KDDA 4WCFA 4RA9B 1FW8A 2QIOA 3T1NA 2VAMA 1YQGA 1F1BA 1N1MA 3B60A 4GM0A 4QVIA 1B0PA 4YY3B 4EATA 2XW6A 4TMFA 5DT9A 3DWGA 1TMOA 2OD2A 5TPZA 1TJPB 1Y1LA 2WJ6A 4GO1A 1D1QA 1SKAA 3UN1A 1H66A 1D04A 2HRRA 2W6OA 5SZIA 5JCZA 4YMUA 2RMKA 2VZLA 2HJVA 3GPLA 1EIZA 1ZU5A 3HH8A 1MO6A 4JLUA 1RVV1 3VMFA 3W6OA 3AOGA 2AC4A 3IUMA 4NP6A 4F2HA 1JEDA 3RYHB 1I7PA 4DXDA 1ZGAA 2VZ9A 5BQ3A 3EF3A 2XRMA 2GCOA 2E87A 2VO1A 4WBXC 3UB3A 3VC3A 4P0PB 3DHWC 4MUMA 4R8SA 4TKUA 2V7BA 1GPJA 3LOPA 3WAGA 4BNGA 3VH1A 1SVWA 4CLHA 5KOHB 1G19A 1QFXA 3AUJB 3BE5A 4N9WA 1D2HA 2YV2A 4ISCA 5ALQA 4PN3A 3GRPA 4P3YA 1BE8A 1MB4A 4DA4A 3RJMA 1KOJA 1RQNA 4HMQA 4KRYA 1JPUA 1TT7A 2D2EA 2VDWB 4DMKA 4HPXB 1H5NA 3A6HA 3CEAA 4MINA 4KQMA 4ND1A 2JCSA 2ZW9A 1UJCA 4R1SA 2GRAA 5LIPA 3KVNA 3M7IA 2VJDA 5FUYA 1V1MA 2NZYA 1BA2A 3HL0A 3FNGA 1KFBB 1RQ7A 3DOJA 4YP6A 2EFDB 1KAQA 4AZ0B 3HVRA 3QVJA 3SNKA 1JHDA 3TLZA 5K0FA 3R7LA 5GAJA 3V4LA 1CJUC 3AL0C 5I7OA 4X7MA 4E1AA 3H2BA 5L4SA 2WTAA 4FMCB 3FF4A 5KBYA 3WL3A 1FMFA 4LQ4A 4W5NA 4DJFC 3W7AA 5AT1A 5BV8A 4DRYA 2B4QA 1PFYA 4X8MA 1SQSA 3TOVA 3FOZA 4L74A 3KV1A 4F71A 1S89A 4FFOA 4G67A 4GWLA 4EELA 3SY8A 1SCNE 2UKDA 5EQJB 5GP1A 1JJBA 3S2GA 4PYJA 2XMSA 3VGPA 2QRHA 3HK2A 4ED9A 1E2FA 2IY8A 4CKWA 4JLMA 4GQBA 4LHVA 4AO6A 2CWWA 3FMVA 2WF9A 4FFPA 5C5IA 4CL0A 4CR8A 3W9BA 2PZ8A 1BEEA 4RKEA 4DLTA 2DMRA 3E05A 5ER9A 4BNLA 4FFBB 3K6RA 4ZAWA 3SSOA 4QXAA 5L51A 2XWJI 4BHTA 4YQEA 5J4VA 3JTMA 3EA0A 5ECDA 4W1SA 5BMOA 1M2OA 2G7MC 5DZSA 5ALHA 1IJEA 1OYOA 1D4FA 2JIBA 3LLMA 4NYIQ 2D0DA 3HACA 3VSCA 2UUCB 5HKBA 3NWEA 5DM70 3LO5A 1N6KA 2Z9DA 2RH9B 1N6IA 1TCBA 1M3SA 3Q5EA 2WNSA 4ON9A 4R4JA 5ENDA 5JNVA 3CLHA 1XG5A 4MKFA 1US8B 1MEOA 4AJOA 4HEJA 1NHWA 3W2HA 3AXSA 2QVGA 3O8OA 2FMUA 2Z6UA 3DFFA 1GG8A 1PJ8A 4H15A 4BVFA 4Z8YA 1XXHE 3ZVMA 4N0EA 1H8HA 5KC8A 1S3IA 2P62A 2PR2A 3R0JA 4GRAA 3AILA 4N7JA 3QOWA 2V98A 3GP5A 4UEJA 1RAGA 2H2FA 1IB6A 2TMGA 3N5CA 3S3TA 4YV2A 5E7IA 2EJTA 4UNNA 4A8HA 1IOZA 3DL2A 4TL7A 4DG8A 4HAIA 3VPDA 4Q3BA 5CDUA 1W76A 3WRXA 3GJ8A 3HFSA 2HPHA 3R5HA 1ULHA 3RSGA 3QKRA 3KL2A 2C7GA 3T5TA 4ER3A 5A3RA 3ZJ5A 1JNXX 5KVVA 4DV6B 1YVPA 1EHIA 1PR9A 4MS3A 5IEBA 4W6ZA 4Q01A 4RULA 5JRZA 1E2KA 2W2QA 4ZVRA 2HB6A 4IOLA 4X61A 3AU8A 4HEA1 3SZGA 4Z7NB 3RYCA 4CKXA 4AQYB 3JQ7B 4Q00A 1YC5A 1GQFA 4NDZA 5KQMA 4MQUA 4P7KA 4HRVA 4RC9A 2FGKA 1AXGA 1RLOA 1N7JA 2NADA 1B8OA 2ZIGA 3L0CA 3UMRA 3WDMA 4C3VA 1OBCA 1OLSA 2E4VA 2G0TA 4DIEA 1ETHA 2EATA 2ZTMA 1YC2A 1KDYA 5AR1A 3RARA 3AY7A 1R9JA 5B4UA 3M6UA 3IX7A 2BEKA 4TT8A 4DMUB 4NOMA 1DWUA 1Z06A 4RZIA 5CCBA 5JS6A 1JBQA 2E1PA 4IUCS 3GBPA 4YUAA 1QTIA 3V42A 3OCVA 4DMRA 3O74A 3KAKA 4P81A 5DGHA 4BLPA 1NYTA 1I51A 2Q2QA 3CW8X 4UTVA 1VI2A 4HNRA 4LJ7A 2O8FA 2PLFA 3PVCA 3BXFA 4HHEA 5AKHA 1CY8A 2J1LA 3OO1A 2YC4C 2R6CA 1N8NA 3H05A 4IL5A 5AVRA 3ODGA 4C5AA 5JBNA 4BEWA 4EUFA 4YCLA 5GADl 3V1KA 2NVUA 3E3NA 3HYLA 4HDRB 2V6MA 5JVDB 1J06A 4EHKA 4W5RA 2X6TA 4GXNA 4O4LA 3SZUA 1CDZA 4TSFD 3L8YA 4LYAA 2BSAA 2OYRA 4JMLA 4EYQA 1U5AA 1EFDN 1ULBA 1ELOA 2Q5CA 4WK0B 4YP5A 4AT1A 2HF2A 3CX3A 1PLLA 3EXHA 3TKAA 3WRVA 1ONNA 4BLQA 3RFTA 4O4IF 4PANA 1IM5A 3L7CA 4RTSA 2QTVB 3IAM1 5AM1A 1Q1NA 4BU0A 4I3FA 1S1MA 1JVNA 2ZE8A 4FDAA 5BWNA 3MF4A 3L8FA 2QAJA 1PYOA 3C41J 1L8AA 4F91B 2UAGA 1LW7A 2QMHA 3AZOA 2BDUA 2RI0A 3C7DB 3EOZA 4IVNA 4MWBA 2CDCA 4KAAA 5I7AA 4BO6A 1O9GA 2Z83A 4TTVA 2DG2A 2V7XA 2X3UA 2EDCA 1E3DA 4Q4JB 2H0AA 2J41A 4R16A 2OV4A 5FPKA 3TQCA 3CA8A 3S2EA 1O96A 1H2XA 4QBHA 5EYPB 1JILA 3ZLTA 1HDGO 3ZWOA 1PV4A 5JRJA 1X1RA 1CFJA 1B00A 1PFQA 3GNSA 4TLAA 3RK1A 2X4GA 1EJ0A 3AVXA 1CR2A 2BLLA 4Y6RA 5B6JA 5CA0B 3RT9A 2AFHB 1JHXA 1Z4OA 4JOCA 1Z7WA 1JMVA 2A58A 4Q15A 3CEMA 1Z38A 1Q20A 3TRDA 2FR1A 1HSOA 1J97A 2FN3A 2BFPA 4NZYA 3WGGA 5HVNA 2A9KA 4FEEA 2BC9A 2JI9A 1OV4A 3WR5A 3X0DA 2JARA 4DCPA 4UARA 2J09A 2YC2C 2ZWPA 3HDJA 1ZK3A 5ILOA 1T0IA 1QJCA 2HNAA 5EXPA 2BFDA 1ZIDA 1DNPA 1UBSB 2AB0A 3SIPA 4S1TA 1DT3A 4KQGA 3MCUA 4E5UA 1QZ3A 1VECA 2DWPA 2XMRA 3EZNA 3LUBA 1U8EA 3W5AA 3QVUA 4ENVA 2E4UA 1TYDE 3ANYB 3WXMA 4B43A 1DG1G 1ZH6A 4E5VA 1YHNA 3IQZA 1N6NA 2Y1CA 2XJ4A 2HT6A 2JKZA 1WTCA 2Q3BA 3N2KA 2IZ0A 2ZGVA 2JGFA 2WV9A 3MBOA 3UG6A 2N1BA 3KKZA 5TGDA 1JE1A 3NANA 3QYAA 2WWVD 1NVFA 1UEXC 2C92A 4ZKDA 1KWKA 2PUAA 4CM8B 3D59A 5C3UA 1MZVA 4CM7A 2P1RA 3H1TA 1WEHA 2CBZA 1AV7A 4LTDA 4MW7A 4RESA 5AM0A 4M89A 2P4HX 1MHTA 2YWBA 4AW9A 2P91A 2WU0A 1JJVA 2Z5VA 4ZGGA 3ISJA 4GDMA 4Z3OA 3KTAB 3H84A 3WYDA 3Q8LA 4YH1A 1ZIOA 1DG9A 1U6KA 1LU9A 4AD8A 1V25A 4LWPA 1PX0A 4H7DA 3DCJA 4WI1A 2GILA 3DVAA 1YVRA 3OE7A 5JH7B 3P5BA 4YRQA 3AIOA 1I1QB 2DULA 4RQTA 1UMKA 5F35A 1R5JA 2B0CA 5A7GA 3OQOA 1BHQ1 2H9IA 2P6PA 1CEXA 4KQ1A 4AZWA 5A04A 1ZBQA 3BD9A 2O0HA 1R8XA 1JFFB 2CW5A 2P0YA 3AJDA 3EG9A 4LV6A 1ZSVA 3WLOA 4L8LA 2CL0X 4R8RA 3LXXA 2JK0A 2QQ0A 4PRLA 4EI8A 2DCUA 4M3NA 4YAKA 5DHQA 1SPXA 1G21A 2CDBA 1AK1A 5KVQA 2GO7A 2JJYA 2ZANA 3MJ4A 1I10A 1XD9A 3D2BA 5H3CA 4QPZA 4D80A 4EHJA 4YCNA 3I2HA 3OZAA 4EO9A 1FQJA 1N6PA 4C4ZA 3ESBA 1ZC4A 3QX9A 4PRKA 3EIXA 1FMTA 3I0MA 3LXMA 3NC4A 3IQXA 3RYIA 4MKGA 4A0FA 1CUAA 4CLEA 1MW8X 2V6IA 1V8FA 2MWMA 1ZGBA 4RM2A 4BKUA 1O95D 3VDQA 3IHKA 4GL4A 4I55B 2R00A 4IHJA 4LE2A 1LFAA 4DQDA 1EWYA 1ZJ6A 3FDFA 2MSWA 2YYYA 5U4QA 4C6SA 1KJYA 4E21A 4EECA 4JBXA 5JNLA 4JB8A 1QR6A 2DFNA 3ZWYA 1UJ4A 1KYZA 2XF2A 2YMQA 3TI7A 5I5GA 4DYVA 3RUCA 2PKWA 5CHEA 4EJSA 5A4FS 2I33A 2QSZA 3RAFC 1T43A 5ITZB 4DQVA 1HPLA 3LVBA 4O4JB 3S4YA 4NFSA 1NOKA 3WBJA 4K0KB 4LGMA 1ESMA 2ZWMA 3A1VA 4JR1A 3R20A 2JAXA 3B6EA 4QSMA 5EGNA 2ALJA 3KU1A 4FE7A 3KLNA 2CWDA 4KIWA 1Z0ZA 4BN0A 4MVJI 3UJ9A 3CCCA 4CG3A 2OM2A 2WP0A 4FWTA 1MTZA 1LQUA 1ZNXA 2IS1A 2REQB 4LJSA 4TRRA 2PA3A 5FWYA 3SIXA 1X9GA 1R6UA 3T7KA 2FSIA 2ZSDA 2DECA 2ZIWB 3ON5A 3PB3A 4U3JB 4MMZB 3UMJA 1XMOB 3L4EA 2O8DA 1S7GA 1ZD2P 1A8UA 3P0IA 3MTIA 4URWR 3ESQA 4WKPA 4LI3X 3P2EA 1GZ5A 4CFYA 1J0DA 1T5LA 2OWDA 2AIRA 4JYCA 1KMHB 4IUYA 4Q3OA 4INOA 2C4KA 4FNMA 1SVSA 1TLFA 4BGIA 3DDWA 3H13A 4F3RA 3GFFA 4NKRA 2HQBA 2R1ZA 2HT1A 3WMRA 3LY8A 3EDYA 4OHFA 4WVFA 4N47A 1NW6A 1DTSA 2GN4A 3NV7A 1NMZA 2AMLA 5IWCA 3BMOB 4WTOA 3EZGA 3IQIX 2D7DA 3IE0A 2CSUA 1MV8A 4ZVVA 4HEA6 5DCYA 3N6XA 1ESZA 1S2MA 3HLTA 2NU8A 5JZOA 1Y5MA 2PY6A 2I4MA 5SY9A 1OJ7A 4CI0B 3IDFA 2OD7A 5BQFA 4BNMA 3L1VA 3OPMA 2E5WA 4PXSA 4TRMA 5CJ2A 1OFIA 5AMXA 1Q2XA 2O06A 2VTBA 1EUZA 2FETA 3B6IA 1HSZA 2FPLA 3ENZA 3LE8A 5JSZB 3CVOA 3OMLA 3PSHA 2RB5A 4K0RA 5DP1A 3G9QA 3FPJA 4U8HA 2Q1WA 1TJ3A 1UKZA 3DQQA 3OVMA 2WWFA 3W7BA 1KY5A 4ER5A 1YB2A 3H2IA 5JJLA 3COVA 4EVQA 1U3GA 3E18A 5EKTA 1WXIA 3HCCA 4R1MA 4LOHA 5EZYB 2HGZA 4AICA 1YAHA 4YT8A 5JQGB 1JHZA 1Z7YA 3LCJA 1C3OA 1RHRA 5A3VA 3TD9A 4JJIA 1D4OA 1XEAA 2ZJOA 3AR8A 3ZLJA 1QP0A 3GRKA 3P5SA 1JMYA 1F06A 4ZVNA 4D3YA 2OAEA 4FOOA 1RIFA 3TOSA 4RTRA 2BF7A 3FNRA 3C4QA 1P6XA 5DIFA 2VDPB 2BKVA 3TLBA 5REQA 4Z0TA 4RJKA 1V26A 1OYWA 2OZLA 3GOQA 4CF5A 2AVDA 2D0IA 2W6IA 1VA5A 1OFUX 2Y27A 3HMKA 3DCIA 4KIJA 4EA9A 5A3SA 1RM3A 4F4UA 3IAM6 1H4VB 2AC2A 4L08A 1S7CA 4GOKA 4MQFB 3VYRB 4G1UC 1UMDB 2GAJA 2OHJA 4KVAA 3TQOA 2ECOA 4E08A 4BXOA 2QX4A 4B85A 1D0IA 2I3AA 3JPYA 2WMNB 3ZXIA 4CN9A 5FYDA 5E8RA 1WTAA 3LT5A 4PZDA 3ST7A 4QC2A 5AXCA 4G5OA 3GEGA 5KAPA 1BX3A 1KJJA 3N7TA 4CMBA 2VJKA 5F3RA 1I1OA 3BWVA 4GFDA 3ZK7A 4E0BA 5JYEA 4AC9A 2WSMA 2OV3A 3BHMA 2PPVA 3IHWA 4GX0A 1EE2A 4MUFA 5E9AA 5P8WA 1F2TB 2C2ZA 2PGNA 4C4OA 3GZNA 5DW3A 3TSWA 1JDBC 2ZQ5A 3NUZA 3B1KA 4EB0A 5E6RA 1C41A 4F5EA 4OUDA 4BMSA 3SC3A 4U2GA 4ZXPA 3PGMA 5J9FA 1TO6A 4DDWA 1KBQA 3N3AC 4R83A 4FD3A 3T3HA 4F3KA 2C2OA 1I01A 1F5SA 3HKEB 3CWCA 3STTA 5DJ5A 3S2FA 2HXSA 3PJGA 3CHYA 5D86A 4FONA 1VG0B 4WZZA 5DULA 2QL5A 2E4ZA 2CXNA 3OEHA 3ROPA 4HDQB 2B1QA 1EDEA 4GP7A 2DX7A 4C3ZA 2VNHA 1I3LA 3JQAA 1E6LA 3LA6A 4C5CA 1WD7A 3OPXA 4HFRA 3N2NA 4F1KA 3QVGB 4GOXA 5HRUA 1EFRD 1LI7A 1DJLA 2H31A 3X1ZA 4CF3A 4B2YA 4J0HA 3WWOA 1U94A 2A5LA 1L4KA 2X5KO 3B1JA 3V00A 4DADA 3NP9A 2WYWA 3E9YA 3GVIA 4J3JA 3QFHA 2JG3A 5F21A 2UYGA 1U8XX 4RL6A 3RJTA 5JADA 1YJQA 3PLRA 3TCXB 5B7PA 3TEMA 2Q28A 4L9SA 5D7NA 3R74A 3U4MA 4TQ9A 2GXSA 4PZYA 1AS0A 4DSOA 1TM5E 1FX1A 2Q5FA 4RHUA 1QGZA 2GEKA 3W90A 3IOMA 4OBBA 1FSFA 4JXJA 4A2QA 1SCDA 3IKJA 1A1VA 1I80A 1OFUA 5AW0A 1R3UA 3DDUA 1DIRA 1W0JD 3IOBA 4MQMA 3ONWA 1ZXXA 3K0FB 3G0IA 1Z0KA 3CWQA 3QUBA 1ECPA 4MITA 3A9TA 4KXFB 3A3KA 1H2RS 1SBTA 1C3VA 5HZKA 1YJ5A 2HHHB 2B9EA 4C21A 1OLXA 5DHRA 4N1AA 4CGZA 4W5JA 3CLSC 1E6CA 5FI1B 2KLHA 4TKZA 3W5DA 1SXPA 2XLCA 5KNCD 1E77A 3CVVA 4P33A 1N7HA 4WAUA 5A5FA 1ADCA 5EERA 4ACAA 1E3WA 1QYCA 3M6MD 1O4VA 5LUBA 4BQIA 3PUXA 2HF9A 1RWVA 3BAZA 1XXLA 3O4VA 4OHCA 4I3GA 5LR6A 4O2LA 2XZDA 1N5JA 3FDIA 4BNFA 2DR2A 2QD3A 3PHLA 1Y6QA 1LF0A 2PMDA 4PSDA 2ONKA 2Z30A 3X2SA 3FJYA 4KDFA 5CB4A 1N2HA 4GMXA 1NF3A 3IBSA 3SD7A 5PNTA 2PUTA 1NFFA 1NYLA 2AL7A 2NM0A 3D3NA 4CEIA 2PL3A 2OK7A 5CM2Z 3RF7A 3S29A 1QB8A 3LDGA 4IHQA 2CNLA 2NW6A 4RJJA 4YRTA 3ADCA 3ZHYA 2GTPA 4W8GA 1VI6A 1R4AA 2Y1LA 4YRDA 4D9CA 4ZO7A 1N2SA 2ODQA 2Q6OA 5AXBA 1E1DA 1XMVA 3ZDEA 1C2TA 5FTWA 1ST2A 1U0BB 3CLUD 1C1YA 3UZUA 4JFRA 3P2KA 4O4IA 5E4JA 4YXWD 1FQOA 1ZM4A 4XKJA 4BQOA 3U4GA 3GJTA 1WUJS 2CDNA 3NM5A 4GBED 2C94A 4XB1A 3EUAA 2YBEA 5F2OA 4LCJA 4Z7QB 4BO1A 1LK5A 3TBHA 4QUIA 5BUCA 4G4SP 2A9JA 1NQTA 3OLXA 2HMTA 1S02A 2G08A 2VJMB 3CN9A 3OD5A 2ZCVA 4RKQA 4F9FA 2HV9A 2HSZA 1N2JA 3PUKA 3L4KA 1TGYA 4MPTA 2Z5GA 4EENA 1JHMA 4GIBA 4E2WA 4OD0A 3GHYA 1LPOA 3F73A 4R6XA 2FZ4A 2OGSA 4DDMA 2CY0A 1FFHA 2VYQA 4JNCA 3NBQA 1K2VN 4OFZA 2BE7A 5EKXA 3CNLA 2CV1A 2ZYTX 2ZSUA 3FTPA 3NUGA 1MC4A 3PL5A 1THTA 2VPTA 4M2LA 1C9YA 1CB7A 1COWA 3JYOA 3K05A 4O33A 3ZJ4A 3JZIA 4BCDA 4D5GA 5LMNB 2IP1A 2XB8A 4NDAA 4LJ8A 1Y6FA 2CK3D 3IUNA 1USVA 1WBJB 3L4BA 4GMKA 2HA7A 2IWRA 3BCRA 3LUAA 3IOCA 1Y1SA 1TCUA 2L17A 3CY6A 1Z7EA 2XIQA 1H6CA 1PEDA 2VDUE 4HAZA 1AZWA 3KEOA 4YK7A 3UJPA 4GE3A 4DLXA 1DCTA 1WUIS 1Z4IA 2HDNB 3H87A 1YOVA 2EHJA 4EYEA 9ATCA 3U17A 4EPXA 4CKBB 4DA6A 1PRYA 2Q1YA 3GF4A 3P71T 4BMNA 4DYDA 1G0NA 1H4TA 1R0KA 2VI5A 4L22A 4NI5A 1Z12A 1YMUA 3MAAC 5I4BA 2N42A 4Q1BA 1GCGA 5CEEA 2WVAA 5JMPA 4WZ6A 5SYMA 5CNMA 2DBZA 1P75A 1XROA 4E5SA 4EG7A 3GI1A 3JU3A 3N8DA 4QQKA 5KHAA 5KSWB 1BJTA 2PL9A 3BA1A 1YACA 3R8CA 2X5NA 4TT3A 4BKOA 3ZE7A 2LGJA 1Z6TA 4DV1B 1P4AA 1A7AA 1RZ3A 4XIYA 2JLWA 2OQVA 2YOGA 1G64A 2BHTA 1LBEA 4JLOA 1UWCA 1CVRA 4QUKA 1RVDA 3DDZX 3N0VA 1RLJA 3B85A 1EXMA 3WLHA 2GQ0A 3KOXA 4C2BA 1C2YA 2EIHA 2Q41A 5C52B 2DC1A 4NG5A 3MLAA 2J5XA 3B6MA 3NHSA 1K92A 4RMNA 2JKVA 3WK4A 4YDSA 1FFXA 1SKYB 3H5IA 3AHCA 3GEEA 4O0LA 1Z16A 3GP8A 1JT2A 2EZ4A 3R5XA 3CW2A 3Q3JB 1CIPA 2ZI7A 4YMLA 2HO5A 2QRJA 3DYVA 3HBAA 4XWGA 1ZRHA 3Q6MA 2O8BA 4LF6B 4ZCPA 4BL5A 1C1HA 4ZC8A 2JDID 3TM4A 4BP1A 5B5SA 3U7EB 3IIMA 6REQA 4B73A 5FUQA 4WKBA 1UF9A 3IEUA 2ZE6A 5DDIP 2BEUA 4PZ9A 3NHAA 4BPBA 3IALA 2AOTB 3E5RA 4H0NA 3T5DA 1E92A 1G5TA 2AMFA 3HZRA 1PDWA 2WKSA 4YJDA 4A8JB 5DTRA 4M9CA 3FY4A 4AZ3B 3IP7A 1QXSA 1GPBA 2F8LA 3R3VA 4ZOBA 1DMRA 2WJIA 2ZJYA 2BI4A 3WMEA 3ZYZA 4YRZA 1MF7A 1S1CA 2LDXA 4ARSA 2K5UA 4RJIA 1MOQA 4Q05A 2B61A 3NIDB 3LKVA 5C4IA 5JYDA 1ZAKA 4S1PA 4E5DA 2QVZX 1Y8RB 2JKYA 4JSRA 2PZFA 1IHXA 1FFEA 2V3WA 3ABOB 3SR4A 5TQ2A 1NY5A 4EHDA 2ZB7A 3UAYA 3AEUB 3KYDB 3KVVA 3KJIA 4HLUC 5DM2A 1Y6JA 5A2QA 1C29B 1A9OA 2CXUA 3SXJA 2EU8A 1QAMA 2AH5A 1IEWA 3P2YA 3X1DA 2V6FA 3QU2A 2ECFA 2GZ2A 2K6GA 2VAPA 3PL1A 5IMSA 3KWFA 4EPRA 3WNZA 1YQQA 3WNCA 2IYSA 5SY6A 1JLLA 3WLTA 1YDGA 1EQ2A 1XSEA 4Q16A 2ATCA 2UV8A 3TPFA 4Q39A 1N1GA 4I3HA 3SKYA 1E0SA 1EDDA 2MMGA 3SS8A 4GMGA 2A7XA 1HEYA 2WHEA 2QN7A 3HL4A 1KMMA 2Q50A 2BE9A 4UNRA 4KEAA 4ZYUA 2CLEB 3GZJA 1Y9EA 4KQWA 3RS0A 4QM6A 2XDWA 4B82A 3NZEA 1GUZA 2J0VA 1AU9A 4RX1A 2C8VA 1NWHA 3FRIA 1KO5A 2DUNA 4W5QA 2FSUA 1QGUA 1FYDA 3HB1A 3GAFA 4NBWA 4PLCA 5BUSA 2R85A 1QSGA 2YRWA 4GC5A 4RD1A 5BSUA 2IQIA 5CXXA 2AZXA 4A8PA 4FNAA 5B64A 3CZPA 1XALA 4IDFA 4NEHB 4BV8A 5IKMA 3O8RA 3KJNA 3LUFA 1NHGA 4Q4HB 5ER6A 4CMKA 4ENTA 3X43A 4BE9A 3VM6A 3Q7PA 2J48A 1QU3A 4URXR 2ATIA 3WS7A 4B75A 5KHOC 2WAXA 4L85A 4PLVA 2VPQA 3P0FA 4EJ2A 2NXEA 4P32A 1XZCA 2IODA 4P5DA 4QTUB 4EM6A 3TR6A 1X94A 5K6TA 4K2HA 2X0RA 5FHRA 1P4HA 2ZYDA