2AF4C

Phosphotransacetylase from methanosarcina thermophila co-crystallized with coenzyme a
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
332
structure length
331
Chain Sequence
VTFLEKISERAKKLNKTIALPETEDIRTLQAAAKILERGIADIVLVGNEADIKALAGDLDLSKAKIVDPKTYEKKDEYINAFYELRKHKGITLENAAEIMSDYVYFAVMMAKLGEVDGVVSGAAHSSSDTLRPAVQIVKTAKGAALASAFFIISVPDEYGSDGTFLFADSGMVEMPSVEDVANIAVISAKTFELLVQDVPKVAMLSYSTKGSAKSKLTEATIASTKLAQELAPDIAIDGELQVDAAIVPKVAASKAPGSPVAGKANVFIFPDLNCGNIAYKIAQRLAKAEAYGPITQGLAKPINDLSRGCSDEDIVGAVAITCVQAAAQDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphate acetyltransferase
publication title Structural and functional studies suggest a catalytic mechanism for the phosphotransacetylase from Methanosarcina thermophila.
pubmed doi rcsb
source organism Methanosarcina thermophila
total genus 116
structure length 331
sequence length 332
chains with identical sequence D
ec nomenclature ec 2.3.1.8: Phosphate acetyltransferase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01515 PTA_PTB Phosphate acetyl/butaryl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10750 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isocitrate/Isopropylmalate dehydrogenase-like 2af4C02
3.40.50.10950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2af4C01
2AF4C 1TD9A 1QZTA 1VMIA 2AF3C 4E4RA 1XCOA 1R5JA
chains in the Genus database with same CATH superfamily
5IM5A 2I65A 3CWCA 1CJCA 3D81A 5IYZA 5L3SB 3TQCA 1COZA 3NEYA 4MR9A 2GRAA 4O4LF 4R2WA 1UFQA 3FGNA 4Y6SA 5KTNA 3H11A 2WQ7A 3W5VA 4WIAA 5TQJA 3M83A 4N5DA 2D1TA 2QTWB 1R0LA 4CQMA 4Q4LA 3K1TA 4MITA 1NLUA 4X5OA 4CCYB 1WKBA 2CLHB 3GCDA 1FFHA 5F51A 3EW9A 1E8NA 1FFAA 1ZD1A 4G1EB 4QXOA 4RLHA 1DEHA 4ZCIA 4KOAA 4UBJA 2RGAA 4QTZA 1T1GA 2RHLA 2YCBA 3H9JA 3OU2A 4MAMA 1JECA 4QATA 5TARA 1H1TA 1LBEA 3CCBA 4MIKA 3CN7A 2QRZA 3ZKAA 4EMTA 1UUFA 3DOOA 2Y0BA 4IZIA 4UUAA 3FYDA 4RK1A 3IIJA 3LXRA 3PQ4A 5DYYA 3W7AA 1SB8A 4R7TA 3F78A 3CKYA 4UTNA 4O25A 4G8BA 2OY0A 3W04A 3FVVA 4MX8A 5IG2A 3TCXB 5EE1A 3A1DA 4DJTA 2XCTB 1QKKA 3NBUA 2OFOA 3E2PA 4RPGA 1VXRA 2G9UA 4P08A 4WXHA 3TL3A 4KQ9A 2H0AA 1J56A 1XAIA 1Z38A 4JDUA 4RK0A 1KVQA 4ENQA 4EF4A 4Q9KA 1CDOA 2BBOA 2PA3A 2XRYA 2GD6A 2JIPA 2AOXA 1KRXA 3R75A 3I09A 1YONA 4NMLA 1V1MB 1T2FA 3TMKA 4KNWA 3ZX4A 2VHEA 4YPOA 3H05A 3OPXA 1Y7PA 4UVIA 5IBQA 1ZVVA 4RGVA 4PCAA 2GCNA 3DP9A 1E1QD 2ONKA 5JROA 4Q1EA 1UXIA 1RHRA 3DKIA 5CXQA 5LJLA 1NKVA 1RXEA 1GGKA 1U2GC 4IDOA 4NMXB 5F2OA 1LB1B 1YC5A 1P61B 2CFIA 2PO5A 4IHJF 2WILA 4MKFA 4R0VA 5ICEA 1E32A 4OLAA 1WV0A 4M86A 3BTOA 4B7ZA 4LV8B 1OWOA 4PGFA 3ANSA 3AG6A 1VHWA 3TW0A 3DW3X 4MWOA 3IBCA 4HVAA 1W7AA 2JJ1D 5IK2D 3PDCA 3F46A 4IIBA 4E51A 4TMVA 5FLXA 5HDBB 2GK3A 2UVDA 2DWUA 5JCXA 3SDZA 5KOYA 3EXIB 3SE7A 5KHLB 3JASA 3FKSD 3PC8C 5IHXA 5BWMA 1UEXC 1NVFA 1HURA 4V1CI 3ZD7A 4I4NA 1E0JA 3X1DA 2D7JA 1TMOA 4BMYA 4DLLA 5AW0A 1FX0A 4YAEA 4LYDA 3NYIA 3GQVA 3TNFA 4RAOA 2PG3A 4ZZ2A 1CEEA 3F5MA 5FBKA 4CKWB 3QI7A 4MIEA 4TUYF 2HSZA 5E6RB 2Q62A 4TLCA 1E7RA 1Q0HA 3D8HA 2JB9A 3DMYA 1IHDA 2NUPA 1SGWA 4AUMA 4Z2AA 3OZTA 1AJEA 3I1JA 2UU9B 1C0PA 5FA5A 2FMTA 4BE9A 2I4OA 3C97A 4QGBA 4K9NA 3MIIA 4UNSA 1YBAA 2VJMA 2Y4NA 4MQUA 4K28A 1ORWA 4L22A 1UKAA 2DZDA 3L1JA 2X4GA 3N53A 4ENPA 5IFLA 1RYNA 3U9SA 4RKFA 1R64A 3HXTA 4LMRA 4ND4A 3F47A 5EJFA 5ETJA 3VC2A 5BUZA 1EUCB 4XLTA 4Z53A 1ECFA 3EZXA 4LVNA 3E7DA 3H6KA 4FE7A 5L4NA 1YB5A 3A4VA 4EPXA 2JG3A 2ZBDA 1COWA 1FDOA 3GL9A 3Q87B 4N8DA 5CCBA 1A9QA 5CLFA 1A9XB 1TM7E 3GVCA 4X24A 5JASA 4JUBA 5H3CA 2W8ZA 3SM3A 1ESCA 3HU5A 4LGMA 1ULTA 5AXDA 5BQPA 3STUA 2VPYA 2HDHA 3X2SA 1GCAA 3DM5A 4M4SA 1APBA 2BEKA 4I19A 3JZMA 3KQPA 1FY2A 3HMQA 3ZZTA 5AVKA 4ECAA 1TAHA 5KTMA 5GZ1A 2CNWA 4RORA 1I94B 2Y1CA 2WVJA 1UBSB 3LU1A 5L3QB 5JQGF 3WGQA 1JFLA 1SH7A 5IZ4A 3PFFA 5EJEA 3B7GA 4QNMA 2R66A 2JFXA 4NJEB 1IN5A 4K88A 4X1OA 1RXWA 3S28A 4RMJA 2V65A 4WKOA 3B3GA 1Y7HA 1U9JA 3GGPA 2UAGA 2FZWA 1QVRA 3OKCA 3AFMA 3AUXA 3JVEA 1JKXA 3DE2X 5EMHA 3ZNNA 5DGTA 5CYOA 1PQ4A 5AVZA 2Y92A 1Q2UA 4P6VF 1FFGA 5C31A 1O03A 1NAIA 4EVQA 5LQCA 4A1FA 1RAAA 2J1LA 4FYXA 5KDOA 1G2OA 2PSJA 5LXTB 1EXVA 4FXOA 2P3SA 1V43A 3WQRA 1YT5A 4BVJA 5AT1A 3ZZNA 3NO4A 2P4UA 4ZQIA 3NV7A 4RVNA 5EIOA 1PT9A 1W2WB 4G37A 2Q6LA 2HWKA 1IDOA 4PR3A 1JR2A 4QSHA 4ARBA 1QWOA 4RPLA 4BO2A 2HPVA 5AHWA 1K7SN 1WXQA 1Z06A 1YQTA 5B37A 3ENKA 2NVBA 4LISA 1U2DA 5H4GA 4DR6B 5BV2P 3GLGA 1R3DA 4C30A 1NGSA 4YWJA 2DWQA 1ZRHA 1XL1A 3GROA 1YCDA 5TE9A 2CC2A 2HMUA 5F5NA 4BO0A 3A28A 1ZOIA 1Y8CA 4MUMA 1HR0B 1VLQA 3ESAA 3R20A 2Q0SA 3AJ9A 4QAQA 3JAWA 1JIJA 1R9GA 4C4SA 5C0OE 1K8YB 2DQYA 3AQ4A 1SPXA 3M0EA 3NYWA 3LPLA 4NFHA 1ZLYA 4DYHA 3CVWA 1M8PA 3FZGA 4WOKA 1NXWA 2FR1A 1YIDA 3OQNA 1KIFA 1E89A 4GP6A 4RM3A 4OOFA 2CSUA 2OBBA 4DPKA 3BBPA 1M0SA 4GX0A 4CI0B 3H2JA 2HWWA 3KU1A 3NVMB 4CF7A 4LSGA 1KMHB 2AHRA 3DXYA 3I9V6 4UU8A 3U3OA 2C95A 2J0EA 1G9XA 1V2HE 4OY3A 5KNLA 4QPDA 4EVRA 1JTEA 5FUBA 3RFCA 4B2YA 1DWOA 2OFXA 1J8FA 5KYNA 1QB7A 1ZN7A 2I2FA 5BUQA 5I4CA 2VNKA 4XGRA 4AF7A 3V6LA 4OCZA 1ZPDA 1BD4A 4XOIA 1Z4NA 1Z75A 4D82A 2F64A 2M2IA 1LI7A 4R1QA 2AG0A 5FNVA 5A9SB 1J0EA 5K3CA 1H0RA 3KSBC 4JI6B 1UDRA 3M7IA 5AKEA 3EZFA 3WIUA 4AYXA 3EXEB 2O2IA 3OI7A 3QMWA 3QWFA 4EENA 5KNBA 3I6ZA 4CCSA 5L45A 2PSHA 3NM4A 1JI3A 1ADJA 3C7DB 4MI6A 2CCKA 4UM9D 3L1VA 4AP9A 3QOWA 3E0XA 1M2VA 3WAGA 4GMDA 4M1OA 5HF8A 2IXFA 2ZPAA 4OUDA 4MIYA 4Y3UA 3H2GA 1IL0A 5JH7F 1NTRA 2EFHB 1YMVA 5THKA 3BHMA 4JUIA 1XRJA 2BMEA 3MCZA 1A9SA 2YRXA 4JAVC 3NKFA 1ZH0A 3PQ5A 4OSPA 4TQUS 4I4IA 1T6YA 3CKLA 3DC2A 1E96A 4F4IA 1AV6A 1GLVA 2DJIA 1YL6A 2V98A 5GIOE 5BUSA 4ISCA 4KHPB 1E6WA 1NMSA 1M1YB 2DFLA 2EFDB 2I0FA 3LIPA 1IULA 3NDRA 4RY0A 3OE7D 5EJ5A 3HH8A 1QIIA 1NJSA 2R1UA 2NV0A 2WNSA 3FH0A 4CI9A 3P9PA 5L4LA 1ICEA 2C8JA 1KI6A 1TI7A 3LVQE 2GFIA 1KBOA 2WSBA 1EFCA 3Q72A 4Q1VA 2LP4Y 2GO1A 1M6VA 4YRDA 1E6CA 3W5SA 5E4JA 1G20A 4DV1B 3GF4A 5HA5A 1GAEO 1ZOOA 1GY8A 3UHFA 3MJHA 3MPUA 5JANA 1A5TA 1YOVB 2C8LA 1VGVA 3NOOA 2QP3A 1EXNA 4PZZA 2OXTA 3ORYA 4MV6A 1BX3A 2NV6A 1L8QA 4G1CA 1VE5A 2O8BA 4OP1A 4R41A 2G06A 4X1YB 5DGIA 1PSZA 2R4TA 1AN9A 3Q2KA 1MPXA 4DT1A 1VP9A 1EJBA 3ZR4B 4DQUA 5H0IA 1X1QA 2Q6TA 4BCBA 2HYDA 4BC1A 4E3ZA 4HAVA 4INZA 3MPOA 3L7AA 3VR5H 4KKVA 5FWXA 5U4XA 1G6OA 3RIMA 4ZCTA 4JEIA 4V02A 1KH2A 2JBAA 3WWPA 3PJDA 5J2TA 3MN1A 3NGMA 4GGMX 1G38A 5B2FA 4OXIA 3VZSA 2VZ8A 3GRKA 5LDGA 5F1PA 3I39X 2XUAA 2XAAA 3K1AB 1K63A 5CVJA 4IOKA 3NHUA 3L93A 2JS7A 2AMYA 3HEBA 3CNLA 5LP1A 3I01A 2NYUA 3LXMA 3WNVA 1CR0A 1F0YA 1JPUA 2ZS9A 1R0YA 2PL5A 4IOJA 4CLEA 4PSKA 5REQB 2IY8A 4EO7A 3PZBA 1EESA 2Q8QA 4YHHB 2IHVA 1YKGA 4FLFA 1MG5A 4B83A 4F06A 2JNWA 2ZJBA 3HVUA 4D9NA 1OBOA 1FB5A 3DYVA 1FYDA 2HRDA 2Z2XA 3B6MA 4P7JA 1HYHA 1PR6A 4Q3LA 4QGGA 4QOIA 4QOJA 3UW1A 3WGTA 3ZH9B 3W5DA 3AR5A 5DLPA 3QMMA 4DJ5X 4DLYA 3HO1A 1JHYA 1XA4A 1YZLA 2ZBUA 3MAGA 3TLJA 4C1BA 5JECA 1DIBA 4BLTA 2JAHA 1F51E 3EJ6A 3RTEA 3B6KA 3U3DA 5B2EA 1KYVA 2NUAB 1E1YA 3MHPA 2WWFA 3Q8MA 1E77A 2RHDA 3H0KA 1EGMB 3RODA 5FTJA 4LF8B 1F3OA 2C54A 1RHMA 1YSCA 4YRFA 3OMLA 1KO4A 2WJYA 4DUZB 3EVZA 4R51A 4MYCA 1NLYA 4HR7A 4QOHA 5JXGA 3VHXB 4ITVA 3GBSA 1LK7A 4OI4A 4J0CA 2HHLA 4S2EA 2X1VA 2UV8A 3SSOA 2ILTA 3WRXA 5TIIA 5EMJA 1ZDMA 2NO7A 3UHOA 5DGCA 1SCIA 3AVPA 1K88A 4V2IA 5E6UA 4AJ9A 2R6FA 4KN6A 3BVPA 5KC8A 3PDHA 2EATA 4JLKA 5ADVA 5FWNA 1GZHB 1YGYA 4LFCB 3NIGB 4DMFA 3ND8A 1BWQA 2QPTA 5FBVB 4P4GA 4TS4A 1YA4A 1WCV1 3ISVA 1PFGA 3NV9A 5DCYA 1MC4A 2FFJA 4FYYA 3ZUGA 2C5BA 3F6CA 1M0TA 4B0OA 1UMCB 2FSUA 3Q9UA 5EKUA 1N92A 2JH9A 1HQKA 3SHTA 3JYNA 2PU7A 3TEMA 1Z6XA 3MJTA 5LQJA 1XXHB 2ZE5A 1ZL2A 1RQNA 3DMRA 5JC1A 5LNK1 3JQ8A 1EBUA 2OGSA 4KRXA 2Y2UA 3USES 5E1OA 4J7AA 3VRHA 1I4TD 2EKBA 4EJMA 2OBXA 2AI2A 2F3TA 1XFDA 4TS1A 4IMJB 1M8GA 2NAPA 3H3XA 1Y8RB 4MEAA 4DRXB 2ADFA 3JQ9A 1JRLA 4QELA 1KDTA 1N0VC 3SIRA 5FHQA 4G0QA 2VXOA 4Y1RB 3EEOA 4FDAA 1WP9A 5K6AA 1U7PA 1X38A 1E4EA 1KI8A 4R1SA 5LU9A 1GQOA 5LZ7A 3QG5A 1C0EA 3ID6C 3NTUA 3VZDA 4B6FA 2O2ZA 3ZWNA 1SVIA 3L02A 1DC3A 1GFWA 4AKTA 3PL5A 1AHHA 4CG2A 3A26A 5F7JA 2QP9X 3FIJA 4HZGA 3PNSA 4L0MA 3NUGA 1J07A 2ODBA 3ZIAA 2PZFA 4EY6A 3PX2A 2EP5A 3LT4A 2VH2A 4WASA 3VOTA 2QGZA 2CEKA 1N0HA 2J3KA 2RARA 2WC1A 2WM8A 3MW8A 3N70A 1YJ8A 4YT8A 2OKGA 3D4NA 4HGQA 4Y9SA 4KDRA 1DGQA 1UPXA 3ABQB 4MYUA 5BN4B 3M2PA 1MV5A 4LJYA 1K7CA 1GKLA 3UT5A 1V1RA 1GNSA 2DUUA 3QRWA 4Z3OA 4BX9A 5DTRA 5KIAA 3CF4G 2VS1A 1L5NA 5GWXA 2FQWA 1SXPA 5ALVA 4Z51A 5DM70 3MUNA 3JY6A 4CEHA 1VIAA 3CF2A 3GMDA 4ARUA 4R9SA 1CJBA 3K70C 1QYXA 1W36D 3R5SA 4PTZA 1YKSA 4RYLA 4HNTA 2F9LA 2PR2A 1AQUA 5LQUA 2VN8A 2WF5A 5AM1A 2ILVA 4KIGA 4JU9A 1U1FA 4TVBA 2ZEJA 4MVJP 3I2FA 1Z5GA 1T8PA 2FPSA 4TV9B 3AU8A 2XZPA 5JO0A 2QLFA 2QY9A 2X7HA 3DDZX 2I7CA 5JD6A 4JGGA 5DCWA 4CLRB 4RJLA 4BLSA 1QFMA 5F3DA 2HHJA 2WVAA 3R23A 4J29A 3N2IA 2HMWA 1T1RA 3WICA 2H00A 5I7UA 2J5RA 4PQYA 1CUUA 1XF1A 3ABIA 3OLVA 5FI0B 3G2IA 1S3GA 4FGLA 3VGPA 4ZEWA 4B47A 1L0BA 1VLLA 4D42A 3E03A 2GASA 2NTNA 3Q7EA 2P6RA 1UQTA 3RJ5A 3ASVA 4PRLA 3LYAA 4J0FA 5FB3A 3KPUA 3J7AC 5HKAA 3R3VA 3ZXIA 5IKXA 1Z0JA 3JQGB 4JBGA 2FPMA 4B7AA 2HRBA 1R00A 1U81A 2Q28A 4FEYA 1RVV1 2ETXA 5EIWA 5DNWA 2YICA 4X8HA 1LUAA 1P81A 4LGYA 3AL0C 2HFKA 1NG1A 1Q15A 2P7HA 1JA1A 3DPIA 3KPJA 3C1AA 2JRLA 4OQEA 1PSWA 3LO8A 3K6SB 4ZCSA 5C4GB 5SV2A 2IE8A 5K3FA 4NCNA 2GEVA 4UZFA 3R0VA 4PCLA 2ZYWX 3PFCA 4EYGA 1JG4A 2BEUA 1UC9A 3P4YA 2DH6A 4B46A 1JU9A 2YJGA 4R9RA 2BH2A 3OQOA 3D5QA 2AN1A 2UZ1B 4QLBA 3P71T 1OW3B 1T5OA 2HLDA 4G5GA 4Y1EA 2W6ID 1IHUA 4ZXPA 3CX4A 3E3NA 1BH2A 1R1DA 4MVCA 4TYQA 2POQX 1AH2A 4TMFA 1TMGE 2AFHB 2PZEA 4EHAA 2ASEA 5BN5A 3EZ6A 3HV2A 3IV9A 4L6IA 4MW2A 1MHTA 4HV4A 4M0LA 1ADCA 1NL3A 3MC1A 2XWSA 2OR3A 3DTTA 2O1SA 4GOJA 4KNYA 5LC1A 3WK8A 5I48A 1ZUNB 1KPGA 2WG2A 3OY2A 1T8TA 2PH3A 2W11A 4IIHA 5A02A 5CB6A 1WXXA 1PDWA 3KT6A 5H3LA 1KFEB 3NORA 3PJFA 5LYJA 4IUDS 3ROZA 3UAVA 1J42A 4NYIQ 3GUZA 4L73A 3TLMA 5AI5A 5IBPA 2OPBA 3G68A 2BGJA 4WXRA 3SIPA 5C52B 4W9MC 4E31A 2B8WA 1GKIA 1K8XB 3FHJA 5KTTA 3S1AA 5EL0A 1TJ3A 2WU4A 4ZI7A 4G8DA 1AHIA 5JDIC 2HN9A 2Q3CA 3PPXA 1KBZA 1IWOA 1R5OA 3CT6A 4KO3S 2VYND 4UPVA 3PXGA 1NRWA 3GLHE 3ZU6A 2A86A 2JJQA 4TS3A 4JQYA 5CVEA 5HUQA 1IATA 1U8UA 2HT1A 1W6UA 1G7CA 3AHDA 3VNSA 4RFVA 2JGAA 3FSEA 3OF5A 2Q3HA 3OOSA 2JFQA 1GOTA 1AZSC 1ND6A 1RRFA 3R8XA 4OQPA 5DO9A 4PX2A 5A9RA 2B7CA 5HKKA 4BQSA 3OEWA 3RWOA 1XJCA 4HNHA 4I2VA 3U6KA 1TAUA 2P40A 3IAS1 3KO8A 2PUCA 2B94A 2AV6A 2JLAA 3AJEA 1RACA 1X74A 1UPCA 4HATA 1H2YA 3A3PA 5AW7A 2QLJA 3I4LA 3Q8WA 1TRHA 2XD9A 2BM8A 3OCCA 3HVJA 1I51A 1T5HX 2HCFA 3RPEA 4XIYA 1FYVA 3SOZA 1XLWA 2FN7A 2FN3A 4L0CA 2FPLA 4II3A 4JI3B 3B1JA 3TFQA 1RKXA 1DUSA 1U4SA 1A8PA 1CJMA 2XEXA 3GJQA 4KREA 1L4YA 4O6VA 1Y4DE 5CLQA 3EMDA 5A5DA 5JS6A 1ZIYA 2WAOA 2X5XA 3KV3O 5MGBA 2PUDA 1WR8A 4DSZA 3H6HA 4INOA 4DSOA 2GZ1A 2VDPB 4OFXA 3F71A 4K1LA 3NT5A 3SBDA 4OLHA 4AK9A 4NKRA 2VPTA 4WZBA 4QU5A 3O91A 4FX2A 4YUAA 4UASA 1V1JA 2ZIEA 3TN7A 4EGQA 3K71B 1G5RA 4X1KA 2C04A 2HA6A 3CH7A 4HGPA 2HCJB 2OXCA 5HCNA 1Z25A 3OPYB 4S1OA 1CE8B 3C3WA 1GPYA 2VTEA 4NICA 5JYBA 1P7VA 4Q4HB 2DPGA 4NF2A 3MGCA 5DBOA 3ONVA 1WVGA 1P72A 2E48A 4YCJA 5K6AC 4KGVA 3MK31 3B85A 5JAQA 4GI1A 3UOGA 3WI7A 4YLEA 1NRIA 4G1VA 3SCZA 2VZ9A 1UOPA 3WX0A 2BI4A 1ZONA 4RFSB 4TTRA 5HPYB 2ODEA 4HQNA 3O03A 2YN0A 3IR6A 1J4AA 2Y9PB 4BLOA 1YQQA 3CF0A 1KJIA 1A4XA 1JAYA 4UDYX 3P2MA 4Z4QA 1EUDA 4INAA 4GMHA 1OUMA 1K86A 2PYZA 3N8DA 1JLSA 3OM1A 1DO2A 5JCPA 1R8QA 5K0NA 4KRGA 3ZWWA 1M1ZA 1ITZA 2PYDA 3CSUA 1PYDA 1PQWA 1PL0A 3H8JA 4YJFA 1BAPA 1JSRA 3T12A 2XR1A 3WQQA 1M7HA 1WRBA 1JG7A 4IV8A 4DCPA 4DY4A 2GK7A 3C3KA 4BNTA 2O5RA 3OWHA 1YVEI 4NJMB 4BP1A 4E33A 4QJ3A 1U0OC 3LOUA 2V58A 2FMKA 2W2KA 4NR0A 4OHUA 2FEXA 1URPA 3PNYA 1E2GA 3NHRA 4EHNA 4FK8A 1CUWA 3H2ZA 1TC2A 2AR0A 2XA2A 3CBQA 5KOHA 1KKUA 4FYPA 4PLTA 1VB5A 1C1DA 1SOMA 2FN9A 4UAUA 4WNAA 1PIWA 1B8PA 1UOOA 3OU6A 2FYTA 5AW8A 5CDYA 2FR0A 3R5XA 1NBOA 2ZYVX 2D3TA 1RXYA 5JFOA 2WD7A 1TZ2A 3GPDG 3ZI4A 1CYEA 3ZY3A 4NBUA 1O9GA 2PQ2A 2B0JA 2PT9A 5JADA 2ZR9A 4NHEA 4F12A 5JI2E 3LVBA 3LHIA 3KFXA 1FPMA 1Z2AA 4CT0A 4GXNA 4DR3B 5HQTA 4DMHA 4G4SP 3L4EA 1YULA 2POCA 2QLNA 2J3HA 2YMQA 1LC0A 3DV0B 3PWKA 3ZTWA 3ZDQA 1G3IA 2BHSA 3KU4A 5IARA 3DCIA 3P0EA 5SYAA 2V55B 3OCJA 1A8HA 1E1RA 2RHOA 1WB9A 5C8YA 8GPBA 3KETA 3INGA 2NSLA 4QLOA 3BGWA 1PUJA 4HWSA 4LYFA 4L1KA 1P9RA 4IL5A 2D06A 3TPFA 4GW3A 4ZQGA 3PQ7A 2WNIA 2VUIB 4EHKA 2HIMA 5LB2A 1OFVA 2PL1A 2XNHA 4MAAA 3MT8A 2I8AA 5G1OA 1U0SY 2JLBA 1E3WB 3CR3C 2AKYA 3GFGA 3R5FA 5JWHA 2C4VA 2WJWA 2FFQA 4LHWA 5KX5A 1BCSB 4UUQA 3LUCA 3HGTA 4U39A 1PVVA 4C4PA 3IT2A 1DG1G 1DL5A 1RDFA 4C6HA 3T5GA 4YXWD 2Q4RA 4BTVA 5WRFA 3GUCA 4G2NA 1U3TA 1XUOA 2CYBA 1JHZA 4KSYA 4RHEA 2ZI6A 4ZO9A 2VBCA 2MSWA 1JPNA 3D2AA 1M73E 3FE2A 3G0OA 4WHMA 4CMIA 1KYTA 1AVTA 2O4UX 3DWEX 5F9MA 4DJJA 1VOTA 1OLOA 1OXXK 3DUFB 3EVTA 1RS0A 3E8SA 4K03A 3ZC3A 2C3PA 3RJTA 1X39A 2EW1A 1I10A 2BFMA 4K9MA 3CONA 4ABYA 1BHQ1 5BSFA 3CJRA 1JZSA 4JHXA 3KJGA 3U1VA 1MX9A 1U9YA 2BUCA 2JJMA 2VC2B 2OBMA 2H51A 4KX3A 2ADMA 3QLTA 3PBKA 4NOKA 4TV9F 4TSFA 1LPAB 4YWHA 2D13A 3GFFA 3VO9A 1UAGA 3RDPA 2C7QA 3RJMA 1F8FA 4AWAA 2ID8A 2WHPA 2YWBA 3O9VA 5CJ2A 3UPDA 3UK0A 3GEDA 4AY4A 1WL8A 2RFLA 3STVA 1OXKB 1D8AA 4NPAA 1R0XA 2NO5A 3SLGA 3BF7A 1LY1A 5DTIA 4CL3A 3V33A 1NN3A 2DKOA 1KSGA 3NIFB 3REOA 5FUXA 2GAAA 4G5RA 4ZO4A 3Q3EA 2Q4OA 3AKCA 5IABA 4AY5A 3GFQA 4DNFA 3ML1A 1F2DA 1LA2A 2R6HA 2WPDA 1Y6QA 2ZS7A 4NNPA 5F2KA 4E22A 3K0BA 1KWKA 2K7FA 2I4RA 3ZGLA 1YU6A 5JNTA 1GUZA 1ZR4A 4EUEA 2XKJE 2E4YA 2HLPA 3HJAA 5EHQA 1ULSA 3C8UA 3KJHA 5A62A 3TLZA 3DEIA 4ZKDA 1NUTA 3NJRA 3DPUA 5AJHA 2BFFA 3ZNQA 2MYNA 2CVZA 4YREA 4Z6KA 1PWZA 2N47A 1QHXA 3Q1LA 1GCOA 1GZ6A 1ZBDA 1BHO1 1X8LA 3HWX1 2JLVA 3PKIA 4PQFA 4AC9A 3PU6A 3L41A 2O14A 4UNPA 1H2RS 2JJ2A 2BTQB 3H5RA 4I50B 5EY5B 3IB3A 5CGQB 1PDOA 4G01B 5H3HA 1W49A 4I6EA 1U80A 3L4KA 2Q5EA 1A97A 1QHYA 5EJ7A 2DU8A 1NI4A 3FM9A 3O7MA 1HXHA 3WKBA 1WUKS 4DDUA 3I28A 2FUG1 4RV5A 5DCUA 3GGJA 3CVVA 1JFFB 4ZTBA 4OL0A 4PLWA 3GQBB 2Q6VA 5GTDA 5EXDA 4G4JA 1HZZA 1YZYA 2I6SA 5LP6C 1X7XB 3K96A 3SZMA 1QHHA 3TTVA 2KLHA 1JWAB 3IURA 4BRSA 2WAMA 5CEEA 4IQGA 2ZVDA 3HJUA 4Y0AA 2QTTA 2WMNB 2YVKA 4WTOA 3ZGVA 1RZRD 2J0QA 1A0OA 4G41A 5CXXA 3NWEA 4RK7A 4EFMA 5TMDA 3AM3A 4L4ZA 1T2DA 3PFWO 2HZ7A 4LXQA 4BLUA 3QPUA 1UH5A 3VDXA 3LHDA 4PQEA 5JNRA 1LTHR 1O95A 2V45A 4R16A 1L1FA 5DBFA 3FW1A 3BL5A 2AZTA 1EA5A 3OA0A 4KI7A 5LVAA 5CXSA 2CGEA 2G3YA 4LW8A 4C07A 2CHEA 1K7EB 4XWOA 1G21B 2HT6A 1Q91A 4QXMA 3RU3A 4U0JA 1UZAA 3UHAA 1HQCA 4HL6A 4WI1A 4EO9A 4HDKA 2CK3D 2WOJA 1ZVMA 2ATXA 3OLWA 1CD5A 1EUZA 2VO1A 2WAYA 3WNCA 4CMJA 5FPPA 2XODA 2QIPA 2BJVA 1EGAA 2PNFA 4C0BA 4ENVA 3GD7A 4IH9A 2B3DA 3ROKA 5CDUA 4MS3B 4N3NA 3C16C 1X94A 3SQDA 2ZSUA 3FPCA 2G4VA 4C14A 4V0KA 2Q1TA 2XX3A 3IJPA 3RAJA 3EH1A 3OEED 5AKJA 1JDVA 1QH8B 3KWFA 3NU1A 1F4LA 3VR3A 3WIEA 2G70A 5B7QA 2GRJA 1KOLA 1JFVA 4DLWA 1PQPA 4XM2A 1YR7A 4BFLA 2H8GA 3OO1A 4GL4A 3C4VA 3K0AB 4F5ZA 1NUQA 1QV6A 2CHVA 5ALRA 5IAGA 4XASA 2IYWA 4XJSA 2VAXA 2PL9A 1KC3A 1E1MA 4IGIA 4ED9A 4FGJA 1ODTC 1G2QA 5IC6A 4YRAA 4RWZA 3DBRB 4LG1A 1OYWA 1VBFA 1ZM7A 2F59A 2BHNA 1UPAA 2QL7A 2RK4A 4MB6A 2ZOSA 4TLAA 5CNMA 5G1NA 1C3OB 3L5OA 4DG5A 2AEJA 2AOUB 4LKRA 1Y8QA 4Q7MB 5EYPB 1K3TA 1XCLA 2I4LA 3SZGA 4F5DA 1VJ1A 4FOLA 1PJTA 4M55A 2RONA 4NXNB 1AO0A 1ODFA 3O75A 5ECWA 3QLVA 1RJ9B 1SZJG 3NGLA 4Z9AA 3VI4B 3GIWA 4MW9A 2L42A 3IUNA 1Q14A 3NAGA 3PFNA 5DULA 3R0IA 4BNDB 5DP1A 4Y6OA 5J4VA 3DG9A 4URVR 4XDGA 3MMSA 4KW7A 5CB4B 3I5UA 2A9FA 3P8ZA 1Q0LA 2FGKA 2AI3A 4JBWA 2AZDA 4RU1A 1GZDA 2AVDA 4TKVB 1G98A 3VR6D 1FYEA 3QTBA 2GBFA 2V3WA 3GWZA 3WY9A 2ZXUA 4J3FA 1C14A 4O3MA 5DDIP 3ZLBA 4J3JA 2CXQA 4M1SA 2VAWA 4TSKA 3ESRA 4I55A 2IIVA 3GLQA 2ONCA 4YQZA 5FTWA 3VR5D 4AJLA 5BW8A 1WMDA 3RROA 3DLBA 2PZKA 4JWKA 4XTRA 4LZWA 4HKTA 4AURA 1T1SA 3I12A 1NDHA 3NVDA 3UMMA 1T9BA 5ISMA 1DQZA 4KRYA 1RI3A 2EX0A 2J4DA 2A6PA 3PDUA 1PN3A 2CXSA 4EAAA 2GO7A 5FI3A 4TTSA 3RW9A 2DFKB 4DMGA 2FUEA 1HQYE 1RKBA 2ZE6A 5FT9A 2WQ6A 1G1MA 1BQ4A 2BZ0A 2OV1A 1RWKA 1YZNA 1I0LA 3C7CB 3UY4A 3FOWA 4BVHA 2JI4A 5H9VA 5HF6A 4DLBA 1Y9AA 1OWPA 1N9GA 1NW3A 4S1WA 5AK0A 4DA7A 2AN9A 2I2XB 3HDTA 2QTLA 5GMOA 3DL2A 3PDJA 3M3PA 3RIEA 1MH9A 5JY1A 3ANNA 5T8KA 4JD5A 3Q98A 4C4AA 2GPJA 1L7BA 4J4HA 1JLMA 2HF8A 3W4JA 2E4UA 3NTXA 4XIIA 5G4KB 1R0CA 1KO7A 2G9NA 3WYAA 5CXUA 4G56A 1Z0SA 4LWQA 1ESMA 3B53X 4OV6B 4FFBA 3TGWA 2Y8EA 2FXIA 1JG1A 5J4YA 3WKCA 1DBIA 1PHPA 4JB2A 4Q18A 4XKJA 5CM2Z 3PWZA 4P38A 2Y67A 1T10A 1WPXA 2HQ1A 2P9EA 2IJGX 4PHGA 1Q1GA 1JBQA 3HABA 1T0JB 3VDQA 1HDXA 4BUCA 3NP7A 2YJ4A 2ZJ3A 3HYCA 1D03A 3SY8A 3VPGA 1D0VA 3OFND 3QKWA 4UJ5A 1W73A 1N32B 3DYIA 2EOAA 4EBFA 4P4SB 1LSUA 2W98A 3P2KA 1KO8A 2BFDB 3RYHB 3K73O 1RVDA 1J0AA 2X9LA 2XCLA 5JSFA 1YS9A 3EYWA 4M8SA 2RK6A 4C22A 3M82A 3LF1A 3LDAA 1FYFA 1RLIA 1GPLA 3QXXA 3UKDA 4OA5A 1R5NA 2JFBA 1NPYA 3E3OA 1ZMBA 4D02A 4JJGA 3LW8A 2QHXA 3VSEA 3DVAA 4ESEA 4L2IB 4WESA 3O84A 1X9GA 4MTCA 5ILQA 1H8HD 1BD3A 4ZO8A 5JZOA 4X8LA 4DIMA 5BSRA 2Z5GA 1EFPA 1XP5A 2EZ9A 3OZIA 4FYJA 3UMCA 1KHTA 3AETB 3HU1A 3MQ2A 4PNHA 4RIHA 4V0OA 3ZDXB 1IZ0A 4ZVOA 5G02A 2DG2A 1ISRA 2Q5OA 2XB8A 2XMSA 2YV1A 3ILHA 3YASA 3TG2A 3ICEA 3ZWMA 2VDLB 3KAPA 3O21A 1CW2B 3KAKA 4QWWA 4JGBA 4FZVA 4OM7A 1F60A 1YNSA 2ZB7A 2CNDA 2OLKA 2WOOA 2B21A 2HQOA 1K6JA 2LE0A 5TS2A 4DMRA 2PUFA 2GUGA 3A1SA 4YI5A 1KQNA 3V4OA 2E5WA 4KO1S 3DZ8A 2BMDA 4BLVA 1CY1A 3FTFA 3ZKWB 3VUFA 3W8EA 1PNQA 4AUNA 2B6NA 3C3CA 1TEXA 3IBFA 3T54A 1CQXA 3K70D 4H1WA 5ALEA 4RW0A 2O7VA 1PW5A 5FPQA 3T4UA 3AM4A 2XQKA 4YJ3B 2C9BA 4H59A 3MF4A 4WOPA 4LRXA 4MS4A 3R5JA 5AVWA 3QP9A 3GZTB 4NENB 4OJQA 2V6FA 3E3MA 4WBXC 4POOA 3NCTA 4TWRA 2C94A 4U2EA 5JCZA 1OFUX 1GAXA 2FEAA 3ZWQA 1AMOA 4AS1A 1KEPA 4D8UA 3ILVA 4RF4A 2W6OA 2QVCA 4IFTA 4PG4A 3ZY2A 1U5BB 1TC1A 1XMIA 3UUWA 4ZOLF 3ZWBA 1W76A 3VR4H 3L6DA 4BAZA 4CGYA 4C3VA 1QR2A 1ZOPA 1P4AA 2J09A 4Q4JA 4RA6A 4KJXA 1SK8A 5MDHA 2QNIA 3ER6A 4PYRA 2XDQB 1SM4A 2XIQA 4BBJA 1YVRA 2NZYA 2PLWA 2XLBA 4GWKA 4QPPA 3GLIE 1HQDA 2Z2KA 3N28A 2DR2A 1KQPA 3GJSA 3LF2A 4KQ1A 4CM8B 5E7QA 4OH1A 1E9EA 4A9AA 3ADKA 1JNYA 4Q3NA 2C20A 3QEOA 1TLLA 2GRUA 2WNHA 4JOBA 4LWOA 1Z7BA 2GM5A 3NIBA 3HCOA 4H31A 1QKJA 1WZIA 2CXXA 4HDCA 3HPRA 4CV1A 2FOIA 5ALSA 1HT2E 1IRXA 3EYAA 3JRNA 2C5EA 4G5HA 4R3NA 1O96B 1ZC4A 4AAYA 4LJLA 3PFBA 4L57A 4WVFA 5AICA 2HF9A 5IMBA 3QPCA 4QTTB 2E6KA 2IZ1A 2UZ3A 4TOIA 4TV8F 5KJEA 3X1ZA 4J91A 1MRSA 3CVYA 1BE1A 1EVZA 3UGTA 4HBGA 5CA0A 3IGFA 2WFMA 4WXPA 4RADA 3HL0A 1FZTA 1PL7A 4F45A 1EKXA 1P8AA 1QG4A 2JCGA 2V5VA 4KLRA 3E0QA 3LD9A 3QLUC 5SZKB 3TNLA 4PC1A 4ZHSA 1RU3A 1VL8A 4N3GA 4DZRA 1Y3BE 1ODIA 3FTCA 1MIHA 2OHVA 3BHIA 3CYFA 5JBIA 2DSTA 5KWSA 4QUEA 3JRWA 5DHAA 3BE8A 2R4UA 4ND2A 1QYWA 4XB1A 2B82A 4CIWA 3ASZA 3M4ZA 3UV6A 1GAQA 3KHUA 3L3BA 4NU5A 3PIIA 3HB4X 1TD9A 2FKNA 4N7JA 4DYVA 1O6ZA 2C2KA 1ADBA 5MFZA 3EVDA 5L6LB 2PWBA 1JQAA 3O83A 3IEVA 1U99A 1NXQA 1EK1A 2R85A 3JVVA 1WG8A 3OC0A 4FJ2A 1PKXA 2HIGA 3C48A 3E22A 4BAGA 4NBNA 2F48A 1G8SA 5ITZB 4CCWA 3JSAA 2OV6A 1X1DA 4JOCA 1IH8A 2OXIA 3ZCPA 3C3BA 1PJBA 2COEA 5LQRA 2RIPA 3M4NA 1FP7A 4URXR 3NEAA 4IXDA 1GPAA 1MD9A 2PZLA 1HE8B 4R2HA 3VPDA 5B36A 3SR3A 5I4IA 5J9FA 2VAPA 3C6XA 2ZDGA 3QVJA 1RC0A 4LYJA 3IDSA 4QYWA 1DAIA 1LVHA 2C4WA 3DB1A 3PRJA 4Q93A 1ZNYA 2VI5A 4F1JA 4ZN6A 3WTBA 3ZBPA 1T2NA 3CRMA 4U2DA 3KOUA 5EWJB 4B3DA 5BYAA 2OYSA 2YW9A 2AF4C 2FUKA 3NWJA 4L8LA 1KMNA 4YH1A 4MVJI 3ND6A 2MR5A 2ZQYA 3L0ZA 4GYWA 3SKXA 3E8XA 5I7HA 3UB3A 3OU7A 4NCBA 5A4MS 1U7XA 1QFXA 3U4MA 3C4QA 1UDWA 4IXTA 4NBWA 2GAFA 2GA9A 4AQ7A 3AJ8A 3AUFA 5JWOA 3R40A 3MQFA 3GRAA 2Q27A 1A50B 2A0XA 1XTSA 4I4TA 1QP7A 1MLDA 1JDPA 2NXWA 4FMBB 4MVXA 4YB8A 4MMZB 3OF3A 3EEBA 5CR9A 3B1KA 4D3XA 1B26A 1TM5E 1KDPA 3W4KA 4GXQA 3HTXA 4RZIA 2VDWA 3RVKA 5FWDA 3MYYA 4YCAA 3QUQA 1FLNA 3IKLA 3SQNA 2NXJA 2NZVG 1KGSA 3AJDA 3KUDA 3S2SA 4XQ9A 5HIKA 1CR4A 2QZ4A 3LY5A 1W93A 2GBGA 2H59A 1IOLA 1V3QE 2J67A 3BJMA 3IAFA 3IUQA 1U7HA 3O1LA 4LIPD 1RQ7A 1VTKA 1A9PA 1KJ9A 2MIIA 3BWVA 3LL7A 3HY3A 3HP1A 2XNSA 5D6OA 5EJ2A 1RAHA 3SU8A 3DFUA 2RHHA 1KMMA 2VBGA 2WR8A 1Y1SA 4QTUB 3C39A 1G7RA 3RYFB 1DAMA 1MKYA 2CL7X 2YVQA 3D6NB 2P68A 3BAZA 3O3MB 4RUKA 1N1DA 3B9BA 3B6ZA 4EDFA 2YZGA 4WGFA 5CGZA 1EI9A 1FFDA 3EGXA 3HSSA 4Y2VA 4F97A 1K4YA 3KB6A 1J22A 4GM1A 1JJBA 4LGVA 3EDMA 1I3MA 2AZMA 3WGHA 3ZY5A 5TLSA 3JQAB 2ADOA 4GI2A 4ZU3A 4BFWA 3WWEA 1G5FA 3DEYX 4PRZA 3DM9B 3ESQA 4DLUA 1MB3A 3VNAA 3DBLB 2O8CA 3MWEB 4WZAE 4G85A 5FD8A 1P7ZA 1DAHA 2JGDB 4ZT5A 3ZW9A 3AESB 3BTSA 1GCIA 3N39C 3P5SA 2IH4A 1BJKA 2C78A 3DBOB 2P2GA 4O02B 4PGAA 5DHSA 1O0BA 5CA1A 5AI4A 4D9KA 4E30A 3KOMA 3A6KA 4YGYA 3RRFA 1EVJA 2Y71A 3O1HB 1N2CB 2YJ6A 2UYOA 1UDAA 1UBCA 1E92A 5CX1A 1V8ZA 5DNAA 5F7ZA 2CNWD 3RUIA 3CVXA 2CB9A 2X41A 2X6RA 1L5KA 3UCXA 4U2CA 2VP5A 4G09A 1JWBB 1J9EA 5G0WA 4ONEA 3R7FA 3FVRA 3VPSA 1EA7A 3Q40A 2CEAA 5LNK6 2OXEA 4JEHA 3VSBA 1XZKA 4OFBA 4QJBA 4KVAA 4UTZA 1NBAA 5IXYA 1N25A 3ECAA 3SS8A 4YP7A 3ZE2B 2DERA 2QKYA 4HJRA 1WW8A 4EABA 1LDNA 2AQIA 4ACAA 2A5LA 3IP9A 2ACVA 2R48A 4IQ0A 1FUYB 3G7SA 5CT5A 3D6VA 3RE1A 4RA9B 1OA0A 1TA4A 1I4WA 1KORA 1RRKA 3AF3A 1AURA 2PFKA 3EXG2 2J9ZB 3OMWA 4I08A 4LYGA 1Q0PA 4US0R 4ARVA 5BO5A 3C8MA 3G2JA 3FFBA 2AYYA 3EG5A 3HBAA 3KDAA 3K2IA 5AIAA 3KOZA 3TMYA 2DH5A 4DR2B 3UATA 5KEIA 4FJ1A 4RXTA 3S0JA 5ERYA 1PUXA 3LUBA 4A8HA 1B43A 2TMDA 3BZWA 3VVLA 1SCBA 3DD1A 1XNQB 1DRJA 1FP4B 3WLFA 2EFGA 4LZJA 4EA8A 3RVQA 1SOUA 1JQ5A 2O8DB 2D62A 2BKVA 3EDQA 4J9UE 2ZCVA 1E2DA 1TUBA 1S4QA 4JZYA 2C2GA 2IP2A 3OURA 1N0IA 4LMPA 1XLVA 3GUVA 3GJ5A 2IYFA 4ZAGA 1AKRA 3T1NA 5B4UA 1I14A 5I7SA 3NOXA 4G5QA 3K7EA 4X91A 4DXDA 4ZO6A 4DUGA 3F8WA 1EE1A 1ZKDA 2VT2A 3DDSA 3C3YA 2V6BA 2P3QA 2W37A 2WWXA 4EX7A 2F4VB 1N33B 5F1KA 5DM60 2W2QA 4F3YA 3GLHA 2DSNA 3HKCB 3TTTA 3K16A 3DV2A 2QF7A 1WBDA 2Z3VA 1KH1A 3TLEA 2HMYB 4PHCA 1KAGA 1MB9A 1QONA 1T4CB 3RGWS 1LI4A 1ONNA 2E9SA 3K31A 3PF8A 3Q2OA 2XMQA 4R1PA 4ZIRB 5DEOA 5EMLA 1V48A 1E60A 1SEPA 4Z7QB 4UEWA 1G66A 2MSKA 1YA8A 4EL0A 5ESXA 3I1FA 3KE9A 3DJYA 2J0VA 2B34A 2R8YA 3OAAA 2FEWB 5CLJA 5EHZA 1GZVA 1W1IA 2ZUDA 1P44A 3Q41A 5DOZA 3F7NA 4N54A 4V3CA 4B6EA 5M34A 4J6EA 1U7ZA 3RS7A 4WLOA 4ETWA 2YXBA 1K66A 3DOJA 4PHFA 3VZBA 4GPZA 1OTYA 1P1CA 2FR8A 3H5NA 4URZR 1HI9A 1UQUA 4YJ3F 4IWYA 2ZS8A 1V71A 3COYA 2IZOA 2X8JA 5DTJA 1E5LA 4FZ5A 3HXKA 3NG1A 4PXYA 3ND7A 3SF8A 4KR6A 4DWWA 2IOQA 4CNQA 3ZE8A 4F8EA 1F6WA 2X3FA 4JZKA 1L4BA 5IAKA 1VG0B 2C98A 1L4GA 1FNDA 2XV1A 5DLQC 1Y5RA 1D3AA 2F9MA 2O3UA 3FDZA 4JYCA 4KLNA 4LCEA 2IYVA 4JP2A 4G9BA 5EPOA 5TSDA 3AMVA 1EP3B 1W0KD 3EZ9A 3KLNA 1FU4A 4S0ZA 1N2HA 5H70A 5KREA 4KXYA 1KY3A 4Z8YA 4CM5A 3CNNA 1L5HA 2F3SA 4Q7KA 1SUFA 3O0DA 4MKZA 1ZO8A 2O2SA 4Z8XA 4EG7A 4Q24A 5DK4A 4BGUA 4AZ0B 2CSXA 3GJ7A 3O4GA 1N78A 5D8DA 2NAFA 4BQRA 2R65A 1IY0A 5CIWA 1WAMA 5D3QA 5T4FA 3RC9A 1QPZA 4DMKA 1V2GA 1E3TA 3IHKA 2A9JA 1JU4A 1OVGA 4KN9S 3VKUA 5CBPB 1DHTA 5HUJA 2FP4B 3JZAA 1SA0A 4A91A 2PGOA 2AD5A 3C8ZA 4KDFA 4R1UA 4HZUB 1A9ZA 4XJTA 3LA8A 1EHCA 2JCSA 4Y9TA 5GJBA 2IT1A 3L0DA 4K9OA 3R7WA 3RWBA 3VKWA 5EIXA 3MAAC 4NV1A 1OV6A 3C7TA 3G8YA 3S6JA 1KDYA 5M29A 4Q4CA 3B1YA 1K8QA 1XJ0A 2VSFA 1C0LA 2I55A 3TZHA 2CBGA 4MO2A 2WABA 2K2WA 5IUKC 1JDZA 4E12A 3OWOA 4ZYYA 1NUSA 1RQXA 2ZJOA 2D3WA 4GZLA 1FDTA 3LUAA 1DBRA 5I8ZA 1EGVB 2PMEA 5KSYA 4GE0A 1VHJA 3E35A 5ELXA 2P0EA 3U7EB 5EESA 4PS0A 1C4WA 4ZYLA 5A3VA 1T36B 5LP6B 2PUJA 2FA9A 3GY0A 4PWZA 1CHDA 1EX7A 2B20A 5EFOA 3RF6A 4JP3A 1H9CA 1O6FA 1WMSA 4N8SA 2ZJZA 4CJXA 1GKYA 3IODA 4XLLA 4QDZA 5CHEA 2WHRA 4XR9A 4ID9A 4E5NA 4L28A 2PH1A 1GRQA 2R00A 3C3AA 4AP5A 2GETA 4GWGA 4HGRA 4LE2A 5HMLA 3RRZA 3O74A 4MQLA 4WN9A 3GW8A 5AKLA 3E9CA 1I33A 5C5IA 4TWJA 3AEUB 3JQFA 4P86A 3AWDA 3L77A 3IQIX 3U9TA 1LNSA 4Y2JA 3KEMA 2G1KA 3MRTA 3LLCA 1XEWX 1J90A 3ZZ0A 1XCGB 4MLDA 4DDWA 4WUVA 4FE4A 3OBIA 3QEMB 1AK1A 1HNNA 2V5UA 2WICA 5CRIA 5C1DA 4QPNA 4C7MA 2HSEA 2PVPA 4QHYA 1N2GA 5F52A 3RB8A 5HUHA 3IAS6 2BLNA 1XDUA 2W6JA 3RRBA 1E2PA 2A84A 1UP6A 1AN0A 1X7ZA 4YUVA 2JZNA 3A6HA 4J6FA 1R0ZA 1P5FA 3BRSA 4R8MA 3DLPX 2C5SA 2J6IA 2JGMA 3OQIA 4YCDA 1UK6A 3THOA 3IUPA 4I5EA 1RBZA 3WLIA 3KT8A 4B2LA 2YH2A 3Q11A 4IDCA 4JENA 4OKSA 1GIAA 3JQEA 2Z8YA 1MJGA 4MUIA 5EJIA 3AVYA 1QCYA 5IKEA 4RE5A 2JBHA 5LUBA 2P6PA 2PH7A 1JNXX 4B5KA 2Z6UA 4L15A 2X42A 2XUKA 1TK9A 3ZI7A 5E4TA 2YRWA 4ARAA 3KVNA 3CWQA 2J4CA 4ARSA 5I7WA 1F1JA 4C7BA 4GKKB 1PX0A 2V9PA 1OI4A 2VR1A 3PQDA 1HLDA 4AL4A 4G1BA 1WUHS 3B9QA 4MUFA 4CTKA 2D2EA 1PZEA 4TZ0A 4DSAA 1QWSA 1RKVA 2QJTA 2HADA 4GPD1 3KD3A 2BSAA 4C2BA 2BFBB 4AG6A 1N75A 4C7KA 2JEYA 2J07A 1VRVA 2VNSA 1F2UA 3BFXA 5TQ0B 1ODSA 2FG6C 3S68A 3V46A 3WNZA 4Z99A 2BPOA 4AICA 2CDNA 4OAQA 1NBMD 2PGJA 1J09A 2YJ3A 1U1DA 1PS8A 2QD4A 1ENYA 1B15A 1ZJ6A 2PKQO 2WFZA 2YMPA 1HE5A 4HP8A 4JMPA 2H9YA 1FTQA 3TR0A 4KVZA 4E5KA 1S8NA 3H4TA 4XD7A 1G64A 2EWWA 1OZFA 16PKA 1R4ZA 2OXRA 3FJ1A 3D4BA 1OB2A 4BHTA 1X7DA 3BB3A 2QMQA 3AGPA 3IL2A 3V97A 5B7PA 1KU6A 4F3CA 4WEOA 1VPWA 5IASA 4W8HA 5IC4A 2ZYSA 5GJVC 4U7HA 2B92A 4R2XA 1IUKA 2J3JA 1YZFA 2OFWA 4H27A 4IUYA 4X3CA 2CCGA 1CNEA 2VYFA 3ORQA 5AOBA 3KQSA 3AF2A 2W5UA 1KNQA 3UMGA 1C7QA 5KO2A 2FZ4A 5C8VA 1GRNA 3UMBA 3X0DA 4OMCA 1IVNA 2G36A 2HCTA 2IUYA 3U4QA 3L9XA 4P2BA 2WD8A 1W8IA 2ZUVA 4PN3A 2N75A 5DBGA 3PK0A 2Q29A 1QP8A 1NULA 3W3AA 1NP7A 4HS4A 5DLEA 3OIWA 1UKZA 4DDMA 5TGDA 3ABZA 1UXGA 2ECOA 1C7EA 3FFTA 2LCFA 2Z1NA 3QXCA 3NXKA 3UV7A 3CRW1 2GAOA 4R3UC 5KQGA 1BFKA 2M1XA 1QO0D 2TMYA 3GT3A 4HQLA 1GNPA 5ICFA 3H2IA 4KE7A 2Q7DA 3T7KA 1CUIA 2VH1A 4L9WA 4N39A 4MLZA 3WFZA 2ZBGA 4J7XA 5AKZA 5JFTA 2XBUA 2HQBA 1QCDA 4US2R 3ZPXA 3KJZA 4BNWA 1VI6A 2WB2A 4BY9E 4NXMB 1WDMA 3NDBB 4XDZA 2VHCA 2VNHA 1VA5A 3ZXUB 2PGXA 2NTJA 3L7YA 4BQIA 3IJEB 2QMUA 5I9BA 1JHDA 2OWDA 1XE3A 3M6LA 4RFSA 1X19A 2JVJA 3OD5A 2XAUA 2V03A 3FFXA 3P94A 5KSWB 2A5FA 2QAGB 3BSFA 2TSYB 3B5IA 2I3AA 4MYDA 3BA6A 1NXXA 1QO7A 1VMDA 2B35A 3P32A 4AJHA 3IKMB 5KWJA 3KQNA 4WDRA 5JSHA 3HGQA 4YQYA 4JX9A 1D0IA 1YUNA 2ZRQA 1HOXA 3IPYA 3RVLA 4FYVA 4AFNA 5FP0A 1XDSA 4D9IA 4OSEA 3HYTA 2WKSA 3VYVA 1P9WA 3IJ5A 5CT8A 1X2BA 2XGGA 1K7YA 4LY9A 2C00A 5L3VA 1Z5VA 3N0RA 1NATA 3O8BA 2OCPA 2VJAA 4S35A 3SHVA 3EHDA 2KW5A 4OUKX 1NUHA 2H4ZA 2VCEA 1GVHA 4K9SA 4QO8A 1NFFA 2QVLA 2XJ4A 4OKNA 2P5UA 4FR5A 3V8BA 4XYGA 4L5IA 2CJWA 4BQEA 3VJLA 1H5UA 1RLTA 2DETA 4WFQA 2CVHA 4Q1FA 4DV7B 1Y7IA 3GFPA 3FZNA 2VOEA 3R2JA 4JYAB 4BEWA 2J4FA 2CHUA 1B1AA 3H86A 3QUTA 1NOKA 1IB6A 3C6QA 4JJ8A 1VLVA 3TXAA 5KYXA 4AJKA 1ZGHA 1X3SA 2CNBA 4N0DA 2I9KA 1BGXT 1JSXA 2BGWA 4UAJA 1YR3A 3RVPA 2OB2A 1R9JA 2C97A 2ZT5A 3JWEA 1LRLA 1YL7A 4HTFA 3PI7A 1EWYA 2FZ5A 3N7UA 4EZBA 4Q9LA 2XSZD 4C89A 4TWIA 4B34A 3B70A 5A05A 4HG2A 1QHEA 2PA0A 4M8KA 3H8VA 2GN2A 2GSDA 3CW8X 1SVWA 3RSLA 1J00A 1F8UA 4R4JA 5AHOA 1XPJA 3BE4A 5FLKA 3NW9A 4OQLA 4XUGB 5GONA 3ENZA 2EXXA 4DV6B 1EH5A 2FSVC 2JDIA 2CVQA 1RAFA 3OTWA 2H18A 3QH4A 5AO9A 3K0CC 3ZV6A 3ZU4A 5KC9A 1E6EA 1CFZA 1H93A 4IDNA 4HGYA 5B7NA 5A4IS 1MJ5A 1DB3A 3W6ZA 1NJ2A 3G3EA 3PGVA 4G5SA 1NMYA 4L76A 4EPYA 3PNBA 4UOZA 3DYBA 5EWLA 3GLFB 2G7MC 2QLTA 2C5LA 2ZATA 4V0SA 2PVCA 3ZGYA 4CLOB 3F90A 4JBHA 1CEXA 1MO3A 1BW9A 4D79A 4Z0PA 3W8RA 3VI3B 4BO7A 3H18A 2WHQA 5BV7A 3NWBA 3HK2A 2C2WA 1DT3A 2VHZA 3HO8A 1PJ4A 4HS9A 2C9MA 1ZHHA 4J1QA 2AZXA 1W581 1SXJC 3HCAA 4UHJA 3H4IA 4EB0A 1WETA 2C92A 3D6UA 1W4AA 2QE7A 4GNRA 5IU6A 3T7DA 1ZUWA 2X3YA 3BXOA 3BERA 1ZMRA 3GEHA 1A69A 3IQDB 4LQLA 4PZAA 4CM4B 4YR7A 2AX3A 3EWNA 1P75A 4ALLA 1VI2A 4BX2A 4LOAA 4MUKA 2A1UB 1GARA 1I80A 4RK6A 1SY7A 4MVYA 4PGGA 4YP6A 2H5IA 2O19A 2NU6A 2FUG6 4PVDA 4KPUA 4ZVPA 1SIWA 1Q0UA 1PV1A 2JATA 1Z15A 2PFGA 2ZYHA 3H5VA 4H3HB 1AKYA 3RWMB 3MUFA 2TMKA 4LOKA 4G89A 3E58A 3LGAA 1KZ4A 1SHLA 3ZXXA 1Z56C 2ALJA 2XMDA 3ESXA 3R7DA 5U4QA 1VHLA 1P1BA 2HK9A 3DZIA 3VR4D 4JC4A 3L7OA 5KHAA 5TQ2B 4CTNA 1HGXA 1OLUB 1HNWB 4L8YA 2XB9A 1XVLA 3OG9A 4O4IF 5AVJA 1AGRA 4Z3DA 4BZPA 2CDCA 3CN9A 1M1UA 3VKFA 2IS1A 1ZP6A 2O5VA 4ECEA 4K8RB 2G4CA 3C85A 1DTEA 2Q7XA 2QLBA 1RT9A 1YH3A 2WYWA 3K1JA 5LB4A 3V00A 1TU4A 1PL6A 2I6TA 1ZD4A 4MYSA 1WEKA 3ZS8A 1R37A 3EFHA 3UC5A 2AJDA 4IUCS 5BSWA 4ZANA 3P2IA 5LN1A 4B85A 1LBTA 1FQJA 1MEJA 2OO5A 5FOSA 1IPFA 2QN7A 2I4IA 2J48A 2DQKA 3FX2A 4R5HA 1QIHA 1TMYA 3C5VA 3L8ZA 4IH1A 3DT8A 1QRRA 5G4LA 3TAXA 1KPHA 3OA2A 3VBEA 3SEFA 3HBJA 1JSLA 2FZEA 3TQOA 1SVLA 5ER9A 3AVVA 2G9QA 3DMNA 3UK2A 4Y6LA 1WCIA 4ZYTA 2I2CA 2YXPX 5B5SA 5F64A 3IDOA 1SD5A 3IQFA 3O73A 1T34A 4FMDB 2NT3A 2QRVA 3LCVB 4FGSA 2QX9A 1YFZA 4CYMA 2R86A 1JMYA 3ONFA 5JEEA 1I2BA 4KPYA 2GJ9A 2ZUFA 4JEUA 3V4VB 3UN1A 2I5PO 1DUIA 4ZAYA 3SR4A 1E1LA 4PM4A 4C6TA 1A9YA 4TM8A 2A14A 1JR3A 1SCUA 3KTAA 3UM9A 1JJVA 2VDVE 3IPRA 4NAUA 1YL5A 4M8NE 1LX7A 4MQBA 2CHGA 2LRHA 1UF9A 4Q9IA 3RANA 4PYOA 3QPBA 4NZYA 3OTOB 3A9VA 4OHFA 4R6WA 4V0RA 2ZJ0A 3EZYA 1VE6A 4BKMA 1SG0A 3CSSA 5IJZA 3UFXA 1RJFA 4B4OA 4V03A 4CODB 3OTGA 2QRHA 4I66A 1ZYUA 2Q41A 5ENDA 3B9PA 3QVOA 4CE6A 3UJ6A 4FINA 3E5HA 1A72A 2JARA 1IK4A 4QNRA 3D6JA 3K6RA 4HAIA 5KSPA 4XWWA 1VLHA 3IRUA 1EYZA 3CGWA 1V96A 4II7A 4N41A 3FI0A 4YN3A 2P8JA 3X2FA 3UPTA 2G04A 4TZKA 3IQZA 2FY8A 5HKOA 2JLYA 4G8JA 5FBZA 1KL7A 3P9KA 1TZJA 5DHQA 1M1YE 2WUFA 4QPZA 5K8UA 3B2NA 1AKMA 2Q5IA 4KUEA 4EHBA 1H8EA 5JSKA 3WFJA 2ZJ4A 4YJHA 4O4JA 3D3WA 4FOOA 4MSUA 5EI5A 5EHIA 2YWDA 2F43A 3QBDA 4RBNA 3EIOA 3RSZA 1Y3HA 4UEJA 4DIKA 2Q9AA 2JGNA 5LDDC 2D7DA 4CMBA 4GKBA 3D3KA 1N6NA 1INLA 2MSEB 1EU1A 1TX4B 2PPLA 3NBXX 3OZXA 1VPTA 2ZRNA 3EY9A 3ONDA 1EUYA 1HPLA 5M5BA 2H2FA 3PIRA 1NW9B 5HP4A 3N6XA 1Z2PX 3HCNA 4PIPA 1E1RD 4JC0A 4LNHA 3GLIA 1HYGA 1PEAA 3H5AA 5T57A 4WWHA 5FYDA 3AF5A 4ZYWA 1BYUA 2GF9A 4TXNA 3WLPA 4G25A 5ICCA 2FZKA 5AOCA 1ZD3A 1T9HA 4QL3A 2AL7A 5FPTA 1GPH1 3N0TA 4HRAA 3K92A 5KAPA 4AW9A 1X7GA 3KYBA 3EQ6A 5LD2B 4EJ6A 2G25A 5JISA 4H60A 1XZHA 1WCXA 3FPSA 1E61A 3EQ2A 3M9LA 4HDMB 4H7FA 3AONB 4F93B 1AMUA 3KEQA 4Y2RA 5HJ7A 1QK5A 2O0MA 4B71A 3EZGA 2Q1XA 1EEHA 3MM4A 3Q15C 1U0RA 2G63A 1LZLA 1PD0A 2WF6A 4FDUA 2I1VB 2R79A 1CTQA 3RV3A 1XTPA 1BXRB 2P2NA 2Z1DA 3FGZA 4DSTA 2WSSA 3PENA 2H7VA 2A78A 2HIHA 4TT3D 5IXJA 4NE7A 3VU3A 2FPGB 4J16A 2BP7B 1CF2O 1ORRA 3MJSA 4Z0NA 3LC7O 4OB8A 3DTVA 2IYPA 3RTCA 4EY8A 4LCJA 2HDNB 3C14C 3PHCA 3SC2B 1EK5A 3WGZA 4RTPA 4JUFA 3UBTA 2ISQA 4OMFG 2VP2A 4ZJYA 2IW1A 4UD2A 4WACA 4YRMA 4XW2A 4H4CA 1GTRA 1ATZA 5B53A 2XNKA 3ZQJA 1E2EA 2GTHA 4GI5A 4XE5A 2PUAA 3CUYA 3G1UA 1UANA 2PEYA 4TTQA 3FHTA 3UF0A 2A3RA 1W5AA 3FOZA 1SCNE 4PPQA 2IXBA 4AMGA 2DBVO 2X58A 4DEYA 2GTIA 2VNIA 3KEGA 4IX1A 3U2QA 2QN9A 4OI1A 1I0ZA 1OFTA 2K4MA 2FETA 2BZGA 4G23A 3QE9Y 4X61A 1BE0A 4F7WA 1QC5A 2PMCA 1KU0A 5HDQA 3KEOA 3QUSA 1GTZA 4KI0A 1WSAA 5AVXA 5MF6A 1I9GA 3DHVA 2QRQA 2FQYA 1DCTA 3OCUA 1HL7A 4W82A 3B2EA 4Z1MA 2QN1A 4MICA 3O94A 1KS2A 4GO1A 4QDJA 4YLYA 1X9HA 3OVMA 4HYEA 3RLIA 4HXFB 1J8QA 2RHWA 1Z8NA 2VHVA 3KOWA 3U4DA 1QUFA 1PBTA 2A92A 1YB7A 4MP8A 5AI8A 2DECA 5TPZD 2QL6A 4S0XA 5B1HA 1O5OA 1PS9A 1CY0A 2FVYA 3HG7A 3PRHA 4DRYA 2XGOA 1KP9A 3TB4A 4ARZB 5JSZA 2WJZB 4FNOA 1O9HA 1P0MA 2DQZA 2EJUA 1HKUA 3M1YA 1MXFA 1E6KA 2OO7A 3M49A 3AR8A 4U6NA 4WK2B 4EO4A 2AVNA 3EBOA 4QQRA 2O2HA 4G1FA 2C42A 1G4HA 5CNKA 5DASA 2X0NA 3PFKA 1XD2B 4G0MA 1Z88A 3GFSA 4HPJB 4N0QA 3RSFA 1PSDA 1QOZA 3RI3A 4LVOA 2G1JA 1VRWA 1C8VB 1BG6A 3B13B 1ORTA 1SC9A 2XUQA 4P93A 1B0PA 1E5VA 2PD3A 4X20A 5EFZA 5TV2A 5FBWB 3SHOA 4BVLA 1KP3A 5KTKA 4JUDX 2Q9BA 3QA9A 1FXSA 3C4JA 5CT9A 2I6XA 1NHWA 2MINB 1Z45A 1NDUA 1I1OA 1IEXA 4H0CA 3CPJB 3WLHA 2RCNA 2ZRPA 4UOEA 4HSGA 3PPYA 3NJ4A 1FZQA 2G17A 4UUBA 2FI1A 3DUWA 3IXLA 4OFWA 4Q39A 1RWMA 1U0TA 2Z95A 5L3ZA 4DZZA 2OD9A 4YUWA 5D1HA 3CEAA 5I8PA 4D2IA 3UH1A 5A7HA 3D5TA 5SZIA 3M9XA 1V8BA 4QE3A 1G2IA 1X8KA 5D51S 4WFIA 3C6ZA 3TBFA 4CKBB 5KJ6A 1EINA 1RLOA 3ESDA 1YE8A 3LUKA 5BW4A 2GPWA 4CMKA 4GOMD 3C8HA 4QM7A 4B33A 3UCFA 1UXKA 4G8CA 2K6GA 4NARA 4TTJA 6REQB 2O0KA 4RPIA 3TTYA 4Y2XA 4EM6A 4NV3A 1U4NA 3UJCA 2XQGA 2UZ4A 4EMBA 3OC6A 1O6CA 4NU6A 1X7YA 2J8ZA 2QA5A 4LNUB 4KL8S 1DRUA 1KZ9A 1FDUA 1G60A 2GKGA 4Z4HA 3PUKA 4MWTA 1EFAA 1KYYA 1Z7WA 4D6XA 4LKOA 2HJWA 5K05A 3H97A 3AR6A 2WUGA 1T9ZA 3T3MB 3I2YX 3PNLA 2Q2QA 2ZREA 1IC6A 2QRUA 2EZ8A 4J76A 5LZ8A 5ERXA 1VMKA 3ZBUA 4HRVA 1KOGA 1JDSA 1NHGA 4KQGA 3BRWD 4AB1A 3QTLA 5JXIA 1OT5A 4TL9A 4W5QA 5J4HA 4FWTA 4LFBB 1PG2A 3TQRA 1E3MA 2G0NA 2GJ4A 3G5AA 3LX8A 4QUBA 4WCFA 5IN5A 3PCTA 2IKSA 1TEHA 4Y6PA 4XA8A 2DX7A 2FRVA 4K3UA 4O5OA 2WTUA 3LBAA 4S12A 2W7TA 3Q0TA 2GILA 3EC7A 3ROMA 2G83A 1BVRA 2O3QA 4EB6A 5JAZA 5H8WA 4E46A 2VHWA 1VBNA 3ZVKA 2VJDA 3AZQA 3DWFA 4NE9A 4CEJA 4FNAA 2J87A 1LJUA 3E9QA 1SKYE 5CT4A 2WKRA 5FEMA 1Q92A 4UDOA 4GBJA 1XZQA 2GEJA 4QD3A 4YJGA 3DO5A 1Z2EA 1Z33A 4NDNE 3IUEA 1U31A 2CFTA 2FWPA 3OT5A 2IHBA 4RENA 3IVAA 3LDFA 4E6EA 1GRVA 1ZM3A 2XT9A 1ZXBA 3RFUA 1GTG1 5FR2A 4M1YA 4J0IA 1SURA 4FMDF 4RMGA 4B8ZA 1R4MA 2OGUA 5FQOA 1CUGA 1MR3F 1MTOA 1HDIA 3I2JA 3RKRA 4AIRA 1CJUC 2GJKA 4N6NA 2WM3A 1L3CA 4F84A 3HC7A 4NZPA 1I5OA 1TA0A 1YIAA 4IHJA 4MCHA 4PC3A 4XPZA 4B80A 1M75A 4JYBA 1YS7A 2F1KA 3FYUA 2RGRA 3HB0A 1YJAA 1K6XA 3HDHA 4GSYA 5BYKA 3BKWA 4FFOA 4J43A 5CB8A 3EEQA 4YJ2A 1KXZA 2WK1A 2JD1A 4MHOA 1MNAA 3NAZA 1C8BA 4U7JA 2QRKA 4GZ3A 4NY1A 1R4AA 2OBNA 9GPBA 2IUEA 3HN2A 3OZBA 4HNQA 4U7GA 1UJCA 1N3IA 3M6MD 4INPA 2AFHE 4IJVA 2XT0A 2Q1YA 2VUTA 3TQIA 4M1TA 4M88A 4ESHA 2RC6A 2ZZKA 4G3XA 4NC9A 5B2ZA 4E1VA 3JXEA 1GXSA 1VCIA 2J9FA 2P6UA 3I0MA 2EBUA 5FAXA 5KCZA 4C7OB 2HK8A 3IVXA 1E7MA 2O6HA 2XCIA 4YQFA 4W5TA 1QFZA 2XVXA 2CLMB 5BSGA 3NDJA 2Z5LA 1XTUA 4GLLA 2PBFA 4KN5A 2DAPA 3ZV3A 5JSQA 4J2OA 4TUYA 2HWUA 1UINA 4QVGA 1LDEA 1AO3A 4UATA 3ZQ6A 1YVDA 1YDEA 1A71A 3FRHA 3P52A 1ZU5A 1T4GA 1NVXQ 3AKEA 4QYTA 4MMXB 4K26A 1W88B 5CH8A 1VJGA 3LG2A 2BTOA 2OQIA 4HMQA 1QH1A 4RH3A 4BN0A 1VIMA 2PS3A 3A10A 3PE6A 1JGTA 2RAUA 4PAWA 3OJLA 2V6IA 3M3DA 1MN6A 3RU2A 1NMEA 1UKBA 5EXEA 6NULA 4HFRA 5FTMA 2GPTA 3TDNA 4DG9A 1QRDA 4KTTE 5E3JA 5LA6B 1Z68A 1EFVA 3MTDA 5DT2A 1Z6YA 4XIFA 5DLYA 1DKPA 3VOAA 3OUZA 2ZQ5A 2A9OA 1AKWA 1C0IA 3IIEA 5C34B 2B5WA 3T9CA 2QG6A 2Y3IA 2XYVA 3N6VA 3W9SA 1XEXB 4PZEA 5K51A 4CR6A 3MFYA 1A95A 2A7QA 2BEWB 1BCRB 2IY7A 3GIDA 4JI0B 2WU0A 4ENRA 4YTEA 3A37A 1E69A 2C9DA 4KQ2A 4Y18A 5H4HA 3VU0A 4P7FA 3USZA 4BE4A 2FZCA 2G5CA 4TYNA 1TYDE 5LJIA 2OAP1 4F04A 4PQRA 3BDVA 2EL7A 5E9JA 3GRZA 2GPYA 2HU5A 4I9FA 4MVWA 5FOVA 4ZTUB 1S9DA 2FHSA 4G0PA 1CU1A 1I3KA 4G84A 1R88A 1MH1A 3FNEA 3NYQA 3PIDA 4FW8A 1GAJA 4ICIA 4M76B 4HTAA 4QUAA 4LJSA 1ZHFA 2PX5A 2M6LA 3GAZA 4HI0E 5EIBC 2HSWA 3M5WA 1ZRNA 4RZXA 5JO9A 2OHGA 3UT6A 3QKIA 5BQOA 3ZHQA 3UGKA 2ID9A 2L19A 1RM0A 2WIGA 2QT9A 4GGPA 4UZEA 1BU8A 3W90A 2Q0HA 4YRIA 3K0FB 4RV4A 1AGXA 1VL0A 1WX1A 3AINA 2LKCA 3LQ4A 3ZEAA 4AD8A 2A0FA 3NHJA 4GD3Q 4YMLA 2QSZA 3HRHA 3VV3A 2P5TB 1W48A 3ZCXA 3LCRA 3TUIC 4GSLA 1CV2A 3F96A 1MOSA 1QZXA 4R01A 2NYVA 5FPYA 3R9XB 3NPMA 2GPAA 1O6GA 4GVPA 1ZIPA 1SNYA 3RUHA 1JV2B 4BU1A 5JG7A 3BSWA 5TF4A 1MXHA 4X54A 4IOMA 1Y6FA 2HKIA 4JELA 1SKUA 1C3VA 1FRZA 4QJ5A 1V4BA 3WGMA 4TKUB 3SFZA 2RD2A 1H42A 2JGDA 3SXUA 3UAWA 5IJ9B 1H2BA 2LD4A 4E0BA 1H2AS 1AS0A 3WJ7A 3MOGA 1GGVA 3ZWDA 1F9AA 1UJ4A 4RZSA 1S7CA 3OESA 2Y76A 3CMMA 3IP5A 5HBRA 1PJ3A 3O8OA 3K5HA 1NG9A 2BM9A 2IGBA 2PSDA 1NA5A 3D0RA 3IX7A 3LIIA 3OZWA 3U13A 3W1WA 3ZU3A 3CEMA 4W5RA 2GT1A 1TK2A 3EEYA 4PSAA 3HFJA 2GLTA 2NGRA 5F4ZA 4CKXA 2RHJA 2IEGA 4EPWA 2QMZA 3RSOA 1DNPA 1PFVA 3ICWA 1WPQA 2IDJA 2ZJYA 1NNUA 3CO5A 4W6ZA 3DMHA 4K87A 1T5IA 2DUWA 3UXMA 1H4QA 3GLUA 1QIKA 2OZKA 2OZLB 3BGIA 1C9EA 1E2JA 3FOCA 4F4CA 4MA0A 3IEMA 4B4DA 1M2OA 1IDN1 1IEVA 4AROA 1KS9A 1RQLA 1XZGA 4H3SA 3RTDA 4CKEB 6PFKA 1TT7A 4B0PA 4AN1A 4HUQA 3KYCA 5AHKA 3TVYA 3VHQA 3NONA 3RRMA 4AO7A 2NU9A 2B5VA 3C3DA 4O1HA 3PA6A 3EXG1 1ZEJA 4OHBA 4P0TA 5B4TA 2CYCA 2X1LA 3LCCA 4OOEA 2NN3C 4J0GA 1V5WA 2DFVA 1RYMA 1BXGA 2B61A 3LGSA 3N3AC 1L5SA 2FU5C 5E6SB 3MLBA 4L4SA 1DKUA 3JCZA 2C0CA 4COKA 1W19A 2JHAA 4XVCA 4FFNA 4CF5A 1EE9A 1F7VA 3WRXC 1QVAA 2O20A 2HAEA 1FFCA 2ZSBA 3ESCA 3P9RA 5JS2A 1TJNA 4Z54A 4EKIA 4BLQA 2EFYA 5D5HA 4MAFA 3BIWA 3D7MA 3GCZA 3C41J 3IDQA 4O2AF 3D31A 3W1EA 1ODKA 2M6SA 1G8GA 4HLDA 1ZWKA 3FKQA 3AEYA 3QXJA 4UKDA 3GVHA 4AG5A 1TUGA 5JH7A 2DEUA 1DHRA 2QBYA 2A1IA 3N8NA 3KEFA 3O82A 5FBRB 1ZRMA 1GNTA 4GEKA 4OK3A 1XFAA 5H1YA 2QTMA 2XE8A 2I78A 3LHSA 4KLZA 3W8NA 2PUWA 2GBLA 2VSXA 2RH8A 2PDAA 3BWBA 3E9RA 4KQCA 2AF3C 3DHEA 4QQ8A 1LWOA 2MMCA 1OYVA 4LF5B 2IIPA 5SZHB 4R1OA 1GT91 1LDGA 1SXJB 1D04A 4B6JA 4G1UC 2O3TA 4CKCB 4R1MA 3SM9A 4XTCS 4L02A 1ZJYA 2V7UA 1F12A 1GGFA 3BF8A 3GUHA 3JQ9C 4Q15A 3GLRA 4U3JB 1EFRD 3CZ4A 3WHIA 5HOEA 3HGMA 4KLAA 5ITVA 1JN0A 1S0UA 5CDGA 3N74A 1BHJA 4FKZA 1JEQB 1X1BA 1ZOSA 3EULA 2QU7A 3JVUA 1BEUB 3LSTA 4I5DA 5EZ5A 1ZG3A 3BXXA 3TAUA 1Z8HA 4E1BA 4L8FA 2C77A 2Q5CA 3NTVA 4KAJA 4B75A 3KAJA 3K9CA 1HF3A 1KNXA 3E1KA 3FF4A 4HDSB 2F3RA 1CIVA 1Q95A 1J97A 4MULA 4KCGA 2V7WA 4A8PA 3PX3A 4D0GA 1CVRA 4EHFA 3QVWA 1V11B 3K9WA 3SQMA 3HZOA 4RDHA 3U62A 1FJXA 1WBJB 5FBHA 3TJRA 4LWPA 2PFSA 1Y42X 1N8SA 1R9NA 4Q5IA 5ADUS 1JHUA 3HNPA 3I3SR 5DBHX 1HLPA 5JNLA 1LX6A 2EKLA 4WE3A 4B81A 4D74A 4D4LA 1P0FA 4C0SA 1O2DA 1YB4A 2IIBA 1SBIA 2P6OA 1YIOA 1QE0A 3OBBA 4TROA 3TLAA 3ZZMA 5JCJA 4D5GA 1TNDA 3UOAB 2GNAA 1W5SA 5JBQA 3CSDA 4F2GA 3FMPB 2VDJA 3GHHA 3ROQA 1G291 2JCVA 3ZHSA 4M9QA 3U49A 5L7YA 1W87A 5TJHA 1SBNE 4BZQA 1NVDA 1LCIA 1EZZA 2I3ZA 2A2ZA 3R3SA 1NOIA 1VSQA 4EVSA 1E1KA 1RM3A 5CJJA 4DA4A 3U60B 1NF3A 4ARCA 5ARDA 4DLPA 3H2SA 4C4OA 2X7JA 2V8BA 4KR3A 2I8CA 4LGCA 5JZVA 4MQFA 1PP4A 4J2TA 4CHTA 3CO0S 2EFJA 2VK2A 3BX1A 4GUDA 1EP9A 1UEIA 2O06A 5ILGA 3LHKA 3ZCTA 1UADA 1V5IA 2JJ1A 1FBTA 3EAQA 2GM4A 2HOQA 2FWJA 3JPWA 3GGDA 3PXXA 1JVNA 4OJNA 4YFYA 3LO5A 3UWPA 1XZEA 3KJIA 3JD4A 3CH4B 4KAAA 5BR7A 3QUCA 2OCGA 3OFKA 4MQ4A 5AM4A 3C98A 3FKSA 1W4BA 1R66A 4BMZA 4TXLA 3GYGA 3S5JA 4MWCA 2IITA 3NIDB 4QC2A 5ERGB 5CG1A 1XCJA 3EX7C 2CLFB 4DANA 5IT0A 3L1HA 3OT4A 1LDYA 4ENWA 1PGPA 3F7MA 5DNVA 1IB0A 3L7DA 4Q9JA 3TKYA 4KFTA 4UTPA 3Q8LA 5ALLA 3T3DA 3QMPA 3HJNA 3VU9A 1AUQA 2B8EA 2NW6A 3WRYA 1Z2NX 2AMVA 2RGWA 3OTIA 1TQ8A 3CJQA 1GZ3A 4H35A 1UZUA 1VE1A 1NQOA 3BJEA 3TFOA 5LQSA 3N8HA 1C30B 2AN3A 2VBFA 4HDNA 5D2CA 4N47A 1RHUA 1BXZA 1EM8A 2ZRJA 3UWOA 1PFWA 2MR6A 2PZBA 2QUBA 3R0ZA 3R6TA 5C8DA 3AUAA 4FSDA 2Z6QA 1BQ3A 2Y4OA 3DCNA 4C76A 5BRJA 5KOJB 2BKUA 3L05A 2CV1A 5KU7A 3OE4A 1IXYA 1GNRA 4ACBA 2F1IA 1C3LA 2H11A 3PHBE 2QY6A 2QVXX 4NHOA 4PSDA 2B1QA 2ZRFA 4HH1A 3AIMA 1JIIA 1D2GA 1NVVQ 2JW5A 3HDVA 1U0GA 3EA4A 1MC8A 4B8YA 2YZNA 3RF7A 1O5TA 4KXQA 2X0JA 2G5PA 3E2MA 2P78A 2QNRA 4KEAA 4MUEA 5LA6F 4NS4A 5JZ9A 4EFDA 4JLBA 5EMNA 2VK8A 4RZQA 3TCNA 1FUEA 3OECA 2O05A 1XVVA 3EZ7A 3IILA 1P5ZB 1JG6A 2BWJA 4AZ3B 4ID3A 3ANXA 5HYVA 1LNZA 1HDEA 1QIJA 3D3EA 3KG2A 1A76A 1P8JA 3T9EA 1XAHA 2BAGA 2GCOA 2QROA 1Y5LA 2YZ7A 4JOSA 1Y1TA 3IBGA 1YA6A 5JSUA 3UK7A 4A3SA 3ADCA 2CBXA 2RKOA 3RJ9A 1EWTA 1U7TA 3OF2A 3OT1B 4XLZA 3STYA 2JHFA 5LIPA 3L4SO 2OECA 4NH0A 5JHGB 1F4VA 3RG8A 3N05A 5C1IA 2O8EB 3J81A 4IMIB 3CTMA 1LVUA 4MZXA 2QOEA 2JHCA 1NY5A 4UUNA 3EH2A 3CR7A 1NW8A 3FLBA 4M6WB 2SCUA 3K8YA 1MIOA 2C2MA 2PS1A 3GRUA 2AD1A 2GD0A 4EL5A 4J4BA 5IYZB 1CJSA 1BIFA 1WXWA 2W43A 3GEMA 5I9LA 5K8IA 1KE2A 1NI3A 4ES6A 1DMSA 3JRXA 4MR9B 3H11B 4TTVA 1RP1A 3C2QA 1Z12A 1I5EA 2OV3A 4NOLA 2R6DA 4JBNA 1W9HA 1E2MA 4QHTA 1KO5A 3NETA 4CQMB 3GH1A 1Z2OX 4PZDA 1CVLA 1OLSA 1UT8A 2XWJI 3LYUA 5IVIA 4MRSA 2GZ3A 3PNKA 1KAMA 1X1CA 4IDGA 5IEJA 2XHEA 4WKGA 3HCDA 1U3GA 4H4DA 3LUJA 4PTLA 1U28A 4PLFA 1NVAA 4MQEA 1KJWA 5ESDA 4ZOBA 2JIOA 1PZFA 4EG5A 3EC2A 2DBYA 1DX9A 1XNGA 4S1TA 4LQDA 5CMLA 3ROXA 3THXA 2BLLA 2WJVA 1QB8A 2GMWA 2IHTA 3ANYB 5E8RA 3K35A 5H83A 2PUBA 1PTJA 1VYVA 3OICA 4N5HX 1QFSA 5ALPA 2WFLA 3GWGA 4BMPB 1UKEA 1WBBA 1H85A 3DL4A 2OC9A 3GJ6A 1E3LA 3STHA 3KYDA 2JBWA 4REOA 1P6UA 3CVUA 2JI8A 3D3QA 2ZWOA 2HFJA 4CF6A 4R1NA 3QSYA 3AP1A 4D7AA 5JR3A 1OKKD 3R0XA 3F4BA 1F06A 3MBKA 3TW6A 2P2SA 4E5UA 4JLMA 2I03A 5CNIA 1CZKA 5DN6D 5DWDA 4ZK2A 2VT3A 3COJA 3ETHA 4L95C 1SUIA 2ENUA 4I5GA 2QPLA 3EXFB 4KZKA 5KYGA 4A2CA 2D0PB 3ZBQA 3F9RA 4ZAVA 3NBMA 3PGXA 4MW4A 4QG3A 4Y0VA 1L1QA 3LV8A 1RLJA 5TMBA 1TOAA 1WHTA 2HK6A 3H1AA 1JJAA 3D9QX 4IKEA 2BN4A 2Z09A 4QDKA 4CLHA 4I1PA 3A3YA 2WE7A 2Q9UA 4IYRA 1UXHA 4YO8A 1EVEA 5CCXA 3M8KA 4YUXA 2AFIA 1P45A 4RULA 3AY7A 1TVEA 2WP8J 4JUAA 3ZE0B 2H2GA 2HHAA 4PO1A 4WCDA 4TKZA 3KE8A 4DA9A 3FPBA 1V7QA 1UWLA 1BWPA 4AWXA 1NM5A 3CE6A 4LHVA 1XB2A 3TH5A 1LPOA 3P9ZA 1L7QA 3E7WA 3H9CA 1E5QA 2WIKA 3TRIA 4YV2A 5J58A 3JASB 4FILA 4KFRA 4NRDA 4HDRA 1XNHA 4A03A 2H06A 5JNSA 4MRRA 3D4IA 1HTBA 1RE0A 4HLUA 2XMZA 1QJCA 2XYGA 1GUYA 5HQ3A 4V39A 5HS6A 1FX0B 2FQ1A 3E82A 1D5CA 1OXUA 3A9UA 3PFHA 1KMQA 5AJZA 3TK1A 3UAGA 4A0HA 1NV9A 4B4UA 3GI1A 2H2WA 5L7WA 3MXTA 3HWRA 4U6QA 3EUFA 2GH1A 3M70A 3OE7A 3PFIA 5EGNA 5KYVA 4O4HA 3ZDEA 3INNA 3RVJA 1XTVA 4OAOA 1BMFA 2HY7A 2B2XA 1K4KA 5FOUA 3UWDA 1SCAA 5DTMA 3ITKA 4J07A 1FQWA 4W99A 2NUPB 3PQFA 3ZCRA 4L50A 4CT4B 1HYBA 2P2YA 4FR2A 2YUTA 1YR2A 4OQFA 3CW2A 5CX4A 1JYFA 3U81A 2G76A 2KB0A 2AZ4A 1V5EA 5T4EA 1R27A 1XQ1A 2OD2A 1PNRA 4JLDA 2VJMB 3T4PA 4FI3C 2AJCA 2AMLA 3WNBA 2OUKA 3JYLA 4IEFB 4PSVA 4TTTS 4QT4A 1TD1A 5FFNA 2E4AA 1L1RA 1I6WA 13PKA 2CUNA 2JFUA 3CPSA 3N5CA 4X65B 2O9JA 1XZMA 4G4GA 4OBBA 1KDVA 3SJ7A 2W70A 2ZT8A 4PPYA 1NJFA 3KIPA 4QVKA 1A88A 1AUXA 2PEZA 1KOFA 2WLSA 4IRMA 2YOFA 4AZWA 3D2CA 5CK4A 5LDHA 1L7NA 1NZFA 3LHFA 4BNMA 3PXDA 1FFYA 4L6AA 2MT9A 5A3RA 1JEJA 5F23A 3FCEA 1REQA 1WP4A 1SQ5A 3CUVA 3IHTA 4LS3A 3OJCA 4F0JA 4NJOA 4YCNA 1GKKA 3D4PA 3KQVA 4CMGA 2O2YA 4YS6A 4BMDA 1B2RA 5C3UA 3NEPX 1DQNA 1L4EA 1NV8A 2WF7A 4JNKA 1QXSA 2ZWAA 1RYEA 1I01A 1E6LA 2H4WA 5DB4A 2VHJA 4NZOA 1CY2A 1XBTA 3VC7A 1EDOA 5GGYA 2OO3A 4C2UA 2VF8A 3IPCA 4BQQA 4X85A 2FW9A 2FRDA 2A9QA 1U1GA 1F38A 1NQWA 1MBZA 1CUVA 2YWRA 2F67A 4JL6A 2P9QA 2ET6A 4JI2B 3RFFA 1XEFA 2D4HA 2VFAA 3C3EA 1J2YA 4NQZA 4ZDKA 1ETHA 1N57A 3LLUA 3OIVA 4H1UA 2KM1A 4OA8A 1THGA 2AKEA 1NVGA 2QUJA 4CL8A 3KZ1E 3QE0A 1A04A 3DT9A 1M2EA 1DO8A 4K2HA 2QTRA 1L7AA 2Q4DA 5KNDH 3COZA 2XUJA 4D0LB 3KB1A 3W6OA 3FRJA