2AF4C

Phosphotransacetylase from methanosarcina thermophila co-crystallized with coenzyme a
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
332
structure length
331
Chain Sequence
VTFLEKISERAKKLNKTIALPETEDIRTLQAAAKILERGIADIVLVGNEADIKALAGDLDLSKAKIVDPKTYEKKDEYINAFYELRKHKGITLENAAEIMSDYVYFAVMMAKLGEVDGVVSGAAHSSSDTLRPAVQIVKTAKGAALASAFFIISVPDEYGSDGTFLFADSGMVEMPSVEDVANIAVISAKTFELLVQDVPKVAMLSYSTKGSAKSKLTEATIASTKLAQELAPDIAIDGELQVDAAIVPKVAASKAPGSPVAGKANVFIFPDLNCGNIAYKIAQRLAKAEAYGPITQGLAKPINDLSRGCSDEDIVGAVAITCVQAAAQDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphate acetyltransferase
publication title Structural and functional studies suggest a catalytic mechanism for the phosphotransacetylase from Methanosarcina thermophila.
pubmed doi rcsb
source organism Methanosarcina thermophila
molecule tags Transferase
total genus 116
structure length 331
sequence length 332
chains with identical sequence D
ec nomenclature ec 2.3.1.8: Phosphate acetyltransferase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01515 PTA_PTB Phosphate acetyl/butaryl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10750 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isocitrate/Isopropylmalate dehydrogenase-like 2af4C02
3.40.50.10950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2af4C01
2AF4C 1XCOA 2AF3C 1VMIA 1R5JA 1QZTA 1TD9A 4E4RA
chains in the Genus database with same CATH superfamily
3DBIA 1D0SA 2HJWA 3U3OA 4RH0A 3T54A 2NWQA 1E99A 4IXNA 4Y7DA 5LYJF 1M2KA 3UV6A 5BRAA 3ZVNA 1Q3TA 3R0QA 5BV7A 4P82A 4UM5A 5KNDA 1F0PA 3UMMA 5JAUA 3L7OA 1KBOA 3CLRD 1ECLA 1P1CA 1X7XA 3GMSA 3H5LA 4HNGA 4KI0A 5PGMA 5SZKB 4BQNA 2YHIB 2FVXA 5DK4A 2CHEA 3SQLA 4IZHA 4YGXB 1HNWB 5CLJA 3HVUA 2E21A 3THYA 1YTUA 1N1MA 4JASB 3UNXA 3KR2A 1BX1A 1OXVA 2P40A 4PHFA 4DYVA 3W3AH 1BE8A 3ICEA 3FOFC 1NXQA 4RESA 3ED5A 3UWKA 1WXHA 2QAGC 1YRAA 3UMCA 3GUCA 4IOMA 3H75A 4UHJA 1JBKA 1ZOIA 1P2GA 3OZFA 1IVYA 3TFOA 4AIIA 3AF4A 1HEUA 3ANYB 1P2SA 1N6KA 5FL3A 3QEKA 1GCGA 4FEYA 1O6FA 3VTAA 2XB2A 5BPFA 5CH3A 1RI3A 2C3PA 1U3UA 1JG3A 4S2UA 5JS8A 1EQAA 3HKCA 1REQB 3OLZA 2IZ6A 5MGNA 2RG7A 4WWHA 5BNWA 3H7AA 2V0GA 1UFQA 4JFAA 3TB6A 4BLUA 2PRIA 1L7EA 2WVGA 3PD0A 1PNQA 4Y9DA 3ZCUA 2GYYA 1CQPA 4J76A 3SF0A 5B6JA 4RCYA 3PJGA 1JG2A 4C7BA 1KVUA 1RSZA 3EEQA 4L4YA 2H7YA 3B1JA 3ETGA 4LOIA 5DHQA 5AO9A 3T0IA 1FTWA 5KCZA 3WGJA 3H9UA 2JD0A 4QEDA 3ICOA 4TL6A 3B38A 1KRHA 1H4TA 1DBWA 2ES4A 4CJXA 5CDGA 4NICA 1E2MA 1M1NA 3JYHA 1ECGA 2PUTA 2XUPA 3FNGA 4JC8A 3MJDA 5DBOA 1L1EA 4GNRA 3ZY2A 1F51E 1TO2E 1KZ1A 4JITA 3ROKA 1LB1B 5FAXA 2FP4B 1C7ZA 4UOQA 1ZWKA 1PDWA 2M1XA 3RRXA 5AW3A 4MTLA 4EGAA 3Q15C 1L5HB 3KXKA 4EEXA 1DCTA 2Q45A 2H3EA 1EUQA 2QV7A 3PBKA 4M6WB 4IVQA 1NOJA 1Y9ZA 2VYNA 3CH5A 4M8NE 5D01A 5EHQA 4AAYA 4KQIA 4EDHA 3F5SA 3RVOA 1KFCB 1YKGA 1UADA 3AUTA 4ITUA 4M49A 4BMYA 1U0GA 1CFJA 4GKAA 1ZJ5A 3W1VA 4MX8A 4G0ZA 4R9VA 2ZUSA 3U4GA 5ELLA 3CQ9A 1N25A 2FOXA 1TW2A 1N7HA 2WWTA 4RH3A 1QRTA 4H1TA 4ZZ0A 3PF9A 4A03A 3QITA 3A1NA 4J1QA 3ANSA 2WHQA 1FJXA 3ZDFA 4ZEVA 2QMEA 4HQFA 1SRRA 1TAGA 1YB1A 2WM3A 1AMUA 1YQWA 1ZVVA 2NXNA 3L8CA 3QLJA 4FLFA 1B3RA 2F9MA 2FRVA 1ZEJA 2GPYA 3U4AA 3ZH9B 3SR0A 3QXGA 1W4LA 1QYRA 1I7LA 4I2VA 4X1YA 4Y18A 3RRJA 4ZAVA 3HH8A 2G25A 2NPIA 2YXPX 3HKBB 8OHMA 5JZMA 3RLIA 4JQYA 4XYGA 4O8CA 3DVSX 2JKYA 2A59A 4WNYA 1VPDA 2ODPA 3P5BA 4C6RA 1G7TA 4TL9A 2YNMD 2VF4X 1A82A 2Z8ZA 3ZHSA 4YMUA 2FK7A 2NTYC 4FGSA 3I61A 4L16A 3ISTA 1QP4A 4F11A 1KI9A 1UMCB 4FLEA 3I45A 5CT5A 4Q9DA 4KIGA 1GCAA 2HA2A 3UHPA 3AOEC 4G26A 1R0RE 2C2OA 1KP2A 3CB2A 4DRYA 1LX7A 4KKVA 4NOKA 1NQVA 2XYVA 4WFQA 3OIFA 1MOQA 1T5SA 3CV3A 5B37A 3ZTTA 1Q15A 2I6SA 721PA 2DR2A 1G20E 1V96A 4GI5A 3WFZA 1TVKA 1DZ3A 2I2BA 2VJMB 3TVTA 1RI4A 2F4VB 4DZRA 1XAHA 1SG6A 4BMCA 1NUHA 2VQ6A 1RYEA 2OHOA 3TPZA 3G8AA 3KLNA 1RBMA 5DBEX 5TEWA 5TQ2B 4ENVA 5HUQA 2BBSA 4HH3C 2WBLC 1KVQA 4BVLA 5JY1A 4XD7A 1Z7GA 1N2ZA 4WV3A 1NKVA 3CO0S 3HCFA 3FMPB 4UM9D 1IZYA 3GMTA 4B80A 5DHSA 1GGNA 2Q6LA 3AKYA 1NFRA 1YE8A 1DQYA 3HR4A 3HV0A 4AZ3B 4EHLA 3L1IA 1KKMA 3COVA 4MV9A 1I1QB 4KSBA 1I32A 2R751 3V9AA 4FOOA 3K3PA 5DX8A 5U9CA 2QQGA 4GBGA 4H7DA 3IOEA 2F9LA 4G0OA 4MIKA 1HE4A 2WYOA 3GJYA 4AT1A 2DERA 3KSMA 2R66A 1YJ8A 2VYVA 4QUGA 4WADA 3MJ4A 1CU1A 4NAHA 4ESEA 5ADHA 2YWJA 2QN2A 2YJZA 5IX8A 4EVSA 2A8YA 4HAYA 4J7UA 6ADHA 5IDWA 4J6EA 3U48A 3CTMA 4A1FA 4E6PA 3MRXA 3VO1A 3N2KA 2SBTA 2ZIWB 1BEUB 3CR7A 3KV3O 4X9XA 3GFGA 2FOIA 3UW1A 2Q6TA 3HU1A 2PN1A 4BGEA 4RL6A 1UJCA 1R8QA 1ZH4A 2BELA 3DUWA 2BFPA 4HGYA 1Z0UA 3MLEA 1QVVA 2XMRA 2VPPA 4JBIA 5I9BA 5E3HA 4DIEA 4YRSA 4GZ5A 4JL5A 3KQHA 1D5CA 1QPBA 5JVDB 1AQYA 3BXXA 4ZXPA 5I4KA 3AJEA 1X87A 4FNOA 3CY6A 2HXSA 4MHSA 4MI9A 1Z3CA 1DIBA 1NJFA 2PGIA 4RA6B 4F5ZA 1J06A 2XHZA 4ZVMA 1SXHA 3DLTA 2VWPA 3RAGA 2VVTA 3IUEA 1R2QA 3WL8A 4JYAB 4L5AA 2X58A 4K9RA 4JI1B 4HH0A 1ZG3A 1VLHA 1Z39A 3NNNA 3S1SA 3GA5A 3PQDA 2W2MA 1JHPA 2D5CA 1LRKA 1O9GA 2QW8A 2W37A 2X3UA 2AI2A 4Q7KA 1UFKA 5L7TA 5DBIA 3J81k 5A3QA 5KOJB 4IL5A 4CEIA 1UMKA 3WO1A 1U7TA 5HUHA 1W0KD 3OZUA 5DNAA 2C84A 1T8YA 3W3AA 4MRRA 2IIQA 1IBLB 4NESA 2CHUA 2JFNA 4XLZA 5LP6F 4PZEA 1RKQA 5CVCA 4L02A 4RIHA 2IX3A 3P2KA 3BTUA 1EWYA 1OBCA 1XDSA 1ZI8A 3PF8A 4PU0A 4R1QA 3CNQS 2C7OA 4OFBA 2DWCA 1JU4A 2HMSA 3DS8A 3H5AA 3D59A 1V3UA 2H7XA 3KP1A 1CXZA 2ZIUB 3BKXA 4R54A 1P45A 1QLHA 1U7WA 5JAMA 3FTEA 3ANNA 5DI9A 3PZRA 5FLYA 1DKLA 2WNSA 5HF5A 4AS3A 4LGVA 2I4TA 3I8SA 2WAAA 4MCJA 4BAUA 3G79A 2GK4A 1NZDA 3ESCA 4Y6SA 2Q49A 3BPSA 3DLIA 4L07A 2X0RA 4YXWA 1G63A 1RADA 3M1LA 4KO4S 3TSCA 4OMFG 4C4PA 2WABA 1RAEA 5DGCA 2NADA 3CX7A 3NBAA 2HLDA 4M0FA 1T13A 2O6HA 3TJMA 3FDJA 4AJHA 4B2IA 4UAGA 1GQQA 2VAVA 4JBXA 1OKKA 1O58A 1IONA 5KDLA 1JQ5A 4H6VA 4LJKA 4O0MA 1OHHA 5KNLA 4S1OA 2I8LA 1JJBA 2NLOA 5LIPA 1XD2A 3B6KA 1JR3A 4Y9UA 3WIEA 3EEFA 5A9RA 3ENZA 2JANA 4Z7OB 1RWBA 2Q3EA 5IH7A 1PZFA 3DKVA 5I8PA 3NU1A 1Y9JA 3UWOA 1CZLA 1WXQA 2CLLB 3GF4A 3VSEA 4K9OA 1ODKA 3JZIA 2XMQA 4PONA 2CDCA 4IIHA 4UBNA 5EIWA 1T2AA 5JSZB 1JQKA 3QNWA 4HEA1 3WP0A 3P1JA 3PI7A 1ZC3A 4X6XA 4TQUS 2O2XA 2D2XA 1OAKA 1WD5A 5T3YA 4A73A 3OPYI 1ADFA 4CQMB 2P2ZA 1DARA 1A9TA 5LMNB 5BUSA 3RJ5A 1Q6ZA 1T8TA 4DV7B 3Q4GA 4X85A 3ZQUA 1EIWA 5I9NA 3PG5A 1JFLA 5HOQA 4RK1A 4R68A 1Y42X 4WFIA 4B6GA 3TAUA 1IG3A 2XIJA 2PH3A 3H2HA 4BFCA 3RGGA 3NC4A 3LDFA 3IR5A 4H3HB 1VMKA 1K06A 1FP4B 1MG5A 3CPJB 3M5DA 3KQPA 2G6TA 3N76A 4M1YA 4MVXA 1EFKA 1Q91A 1KEWA 1CUDA 1PAUA 2H8GA 3A9CA 3LCMA 2AOUB 4JVOA 3RLFA 2FU5C 1KYVA 1QK4A 3F0TA 4I4LA 6REQB 5IUNC 4ZC8A 1OV6A 3KB2A 4PO1A 3CA8A 4QBIA 4LFAB 3RYCB 2CKMA 3UHJA 5HA5A 1EWTA 1ESDA 2Q4EA 3TZLA 1AS2A 2V0NA 3UWMA 4BAGA 4YREA 2EP5A 3VHXB 1QE0A 7MHTA 1GQ2A 4P22A 1NV9A 1O2DA 5D85A 1EVYA 4B74A 1UC8A 2ZSBA 1XVAA 5C5CA 4Q5IA 2J59A 2W42A 3AXTA 2AUMA 2ZBGA 4HWOA 2YJ5A 2B3DA 4GZMA 1ZXXA 3QU2A 5FQOA 2R1VB 5GONF 4B3BA 2BFMA 1OLUA 2J5BA 3DSRA 1KZGB 3CRW1 4PSDA 3A9TA 3TQTA 4ESHA 4PE5B 3UG6A 2C78A 4HEHA 2FETA 3MJSA 1NF3A 2B7CA 4X6UA 4CM1A 4MUFA 4EELA 3QSYA 1IRXA 3LT5A 4DMRA 2B78A 5JOQA 1N57A 4BFTA 1ZNXA 2G9UA 2VSNA 4G63A 3RVSA 2A88A 1O96A 3FCYA 1Z2EA 3PU6A 4MVJD 4WZAA 3G0CA 1T1EA 4UJ3A 4V38A 3HZZA 3R5HA 3I0NA 4RTQA 1UAAA 1E5DA 4YASA 5LZ4A 1M8JA 2R85A 3T7EA 1WQ3A 1VMEA 1YZKA 2ZYVX 1UEXC 3OCWA 4LXYA 3JQFC 3T5CA 4EW3A 5HWSA 2HJVA 2Q5QA 3VPXA 1DRVA 1SVSA 2GOYA 2FR8A 1PNOA 4I4IA 5P21A 3AX6A 1HM5A 1WZNA 1TMYA 3UATA 4S1PA 3GCGA 4TWRA 5SYMA 4ASUA 3GNSA 1KNXA 1K3FA 3NHBA 3GPDG 3IUBA 5ENDA 5B55A 4GW3A 5LZ2A 2OQRA 2E49A 3TCXB 5DX1A 1N5LA 1WL8A 2WKRA 3KBOA 5EEGA 3TD6A 4HH4A 2XCQA 3GLGE 3OIVA 4PPNA 3WWDA 3QMVA 3O9ZA 3VYSB 1H42A 2O2GA 1MB2A 4RQUA 4GPEA 1Y4AE 4KO3S 3DBRA 1RZ3A 1QLJA 1UM9A 4PYLA 1ZSNA 2ZT8A 3H9CA 3JX9A 3WYAA 5A4FS 1W46A 1OTYA 3AEUB 1Y6QA 1YBMA 3AY3A 4UOZA 1XLVA 4ZFNA 5FWAA 5ESDA 2O2JA 2Y76A 1LI4A 4LE1A 1XRQA 1G3IA 5JD4A 3S2ZA 4F9EA 3GV0A 2C42A 2VYND 4UDYX 3EGVA 1QBGA 2ZIZA 1DNPA 1VSQA 4WCFA 1HE3A 2E4WA 2YDXA 4XGKA 2J5RA 4YT5A 2A9FA 5A9SA 1Y6FA 2W2PA 1Z5GA 5ITZB 1U9YA 2DBZA 4G1EB 3O94A 3RS8A 2NZ2A 1HOXA 3VJMA 4URXR 1PT5A 2HIGA 5D3ZA 3VU8A 1T36B 1NQ5A 1HEIA 4B3JA 2Q1XA 3EGIA 1HLDA 1OFIA 3AINA 3JVUA 5CLIA 5IDYA 3V8QA 1BKSB 4AJPA 1RAHA 1K3UB 4C0HA 2P4QA 5A4JA 5CMLA 4BO3A 3PX7A 5FTJA 1IVNA 4MO2A 2QU8A 2I1WA 1KGDA 3LY5A 3L7KA 3LUGA 5JNVA 1D6NA 3I2GA 3I9MA 1DX4A 2FFAA 2R4UA 3G2MA 1I5EA 3HDVA 3M1YA 3NDJA 4TV9B 3WY9A 3P4YA 1PSWA 4B7ZA 1EDBA 3OQNA 1AKNA 5JXWA 1F06A 5EHZA 2G5GX 4MUEA 4MV4A 5EXTA 5KS2A 3GLTA 3KZOA 4L2IB 1AKMA 1Q0HA 2HCRA 1CZOA 4ZHQB 1P4HA 1M66A 1U99A 1ZJZA 5M7EA 5C35A 1UP7A 2P65A 2E4UA 4RU1A 4KQFA 5ALVA 3I2JA 4U63A 1QC5A 2FNAA 2OCYC 1JPVA 4JT9A 4IGFA 1QH1B 4Q1EA 3AV3A 1TRKA 4I4CA 1SXIA 2AQHA 5THXA 4JI0B 4XVQA 4HNSA 1VKNA 4UMDA 4CUZA 4J0QA 3HSSA 1QVWA 4MCIA 4PIPA 4NHEA 4GMFA 3L46A 4MI6A 1NWCA 1FNNA 4ZALA 3RRFA 2IBMA 3VR4D 2HQOA 4BEBA 1MA3A 5JZSA 3HDYA 4JLMA 4E3WA 5JH7A 1T0PA 2UYQA 3ICVA 1ND5A 5AM5A 1BCSB 4QUAA 5HCIA 1DBVO 2IRWA 3PC3A 4KRXA 3T3GA 1E9CA 3OWHA 3Q1KA 3MJRA 1X7HA 3ANMA 2PXXA 4L8GA 4RJIA 4TMYA 1EYZA 3B20A 3GD5A 3UMVA 2Y05A 3OHPA 5DIZA 3E5NA 3O8QA 3S3TA 4C21A 4BJHB 2H4JA 2FUNB 3T94A 4PEVA 3P2OA 3DQPA 3D8RA 2X8AA 1USIA 3MOSA 3NKLA 3N3AC 3M4YA 4M83A 5JAPA 1YK0A 4WAUA 4IY1A 3O0TA 1NI4B 2DC1A 2QTRA 3AF0A 3KZXA 4KN9S 4XWTA 3AFIA 4LJ8A 3EQ2A 3K4QA 4Z9AA 3A1WA 1JEJA 1U94A 3FCXA 2I6QA 4NDAA 4DCNA 3CB4A 3NV9A 3T12A 1VPTA 5C1DA 4DV5B 3GL9A 1AZTA 1ECPA 5TR9A 3IJPA 2Z3VA 4L22A 5JAQA 3THOA 1SULA 4CM4B 2E4AA 2C3MA 5LFAA 1CYDA 3FLBA 3C3YA 1T9AA 2YQZA 3I42A 4AZ0A 3GQBA 4MLDA 2AXNA 4KU4A 2VYQA 5J3JA 5IC6A 2NU7A 5DDIP 3COJA 1VHQA 1RBZA 2BKVA 3DT8A 2I2XB 4XUDA 3E23A 2OP0A 3L8EA 1A5TA 2GXSA 4X60A 5FOQA 2HEIA 1CUEA 2WA1A 3T5GA 5A7FA 4C76A 4ETWA 2QSUA 1TYDE 1XROA 2V7BA 4Y98A 1UBKS 3H86A 5E7QA 1AK2A 4TQAA 2WU8A 1JH8A 2KSQA 1JXOA 3E22A 3VU9A 1XZLA 3HRIA 1LBHA 3I09A 3EXEA 3WJ2A 1DADA 2I22A 1L1FA 4B4DA 3WL4A 5CAEA 4LSZA 1PE0A 3GCWA 4QOFA 3HO1A 2H9AA 2WF8A 5JPDA 1IEVA 1P3DA 4ZK2A 1U2GA 2PX0A 3N1UA 1CR1A 4BWFB 4KE7A 2G7MC 1XL1A 2W6JD 1QZTA 2O05A 4HF7A 3OECA 1TF2A 1NP3A 4X1KB 4D4LA 1QV6A 3C3PA 3IP7A 2WLSA 2ETXA 121PA 2P9TA 2V4MA 4NF2A 4QWWA 5C5IA 3HXOA 3QE4A 3G82C 1PZMA 3W7BA 3ZK9A 2GEBA 4IH9A 4DR5B 1GLGA 1KO7A 4L9WA 3IULA 4LV5B 3JASA 3ZU6A 4JI2B 2R6JA 3AVXA 1N32B 3AR7A 2BJVA 4P3KA 4MJXA 1EMDA 3HU5A 4ZTUB 2QUHA 2Q28A 3MWLA 3GEMA 3PNOA 3RFVA 5IBRA 1HG0A 1TLLA 1DL5A 4CKBB 2DR0A 5FNVA 5C8ZA 2XZPA 3PA6A 3LVBA 1KQNA 4QPPA 5LL6P 5J4HA 4INJA 3OX3A 4Q1FA 1A3CA 5KYGA 4NE2A 1L5FA 1GZUA 3D31A 1JI0A 4CDGA 4JR1A 3K2IA 4DHWA 4B87A 1AJEA 1C29B 3N28A 1SD5A 3PUIA 1WCXA 4G65A 4IJWA 1JR3D 2HREA 2NNLD 3IB6A 1A76A 3B78A 3MTIA 4DIUA 4W5OA 3PZBA 4DLAA 3H17A 3O4GA 3G9ZA 4TMZA 1P0QA 1WS6A 4LIPD 1TKRA 5CPFA 1I4DD 2G8LA 2XBLA 3LQRA 1JJ7A 2LCIA 4OM7A 4QICA 2C2MA 1XZBA 3UUGA 5B1YA 2OHVA 4YY3B 5E1DA 1QAOA 1J9GA 3BIJA 1JLLB 5CXUA 4MVJP 1JGTA 2O0KA 4CR6A 1M1YB 4KIFA 2ORED 1GZSA 2QJRA 5FR2A 3S44A 1AO3A 3FM9A 2Z9CA 3SX4A 3TK1A 3EC7A 1VE6A 3IHWA 4E5KA 2O7NA 2QRJA 1GNSA 3FNFA 3LYAA 5M3BA 4GEKA 5ED0A 1N5JA 5C7OO 4I1SA 1YQEA 4GWKA 4MLZA 1C7IA 1T9DA 1SQ0A 1FTYA 1SA0A 4WW0A 4G9EA 2DQZA 4DQUA 3VHQA 2EFGA 2O0LA 4XDYA 4ND7A 4WH0A 3VGJA 1OASA 1JBQA 3K1JA 3LO5A 3VNVA 2M6RA 3I2IA 5C5EA 2E48A 2ZBDA 1A0OA 4MMXB 4BZQA 2B61A 3NBFA 2HF8A 1DUVG 4C4SA 1KMHB 1E6WA 5K8TA 2JLSA 4X00A 4ZVRA 2ZCJA 3H6KA 1Z16A 3LF2A 5J4KA 1DEAA 2WG2A 3I9NA 3GLFB 3RT7A 4QSMA 5AJTA 3N8GA 4FCWA 3BE4A 3EH2A 4K9DA 1ZH2A 1N2OA 1J23A 5FV7A 5LB4A 1Q0TA 3HRKA 1G59A 1KTVA 3DEIA 2B1IA 4LK3A 3OEWA 2Q2VA 5HZMA 1KK3A 1Z6PA 4LXUA 3JQ7B 3LT2A 4N7JA 4CNBA 3SEAA 1ACJA 2FAXA 1KAOA 2GHIA 2PMDA 3NM6B 3GYBA 1A4IA 3KV1A 5H3HA 2AFHE 2NTEA 3U1VA 4LOAA 1E5VA 1VG1A 2GBGA 1Q95A 1I0LA 2FPUA 2G70A 3PEUA 1MQAA 4G4JA 2X2OA 4PHCA 1Y9EA 2B8WA 3UK0A 1WSDA 3ZBTA 5BSFA 5HRCA 3UJAA 1RPTA 1U6IA 2JAQA 4P4UA 3I5XA 3G8YA 4MDFA 1S2MA 1ZMOA 2G40A 1A97A 2O2SA 2PG3A 1FFGA 4CE6A 1H8ED 1F4LA 1T9KA 1U6JA 4PX9A 4V03A 3ZHCA 4HDNB 1T5DX 3L1VA 3R8CA 3DXZA 3QVSA 4DLSA 5IMSA 4L51A 4ROTA 1USVA 4X1OA 4PRKA 5H02A 8ABPA 4NNJA 9ABPA 1SZDA 1S02A 2VYFA 3ZU4A 2IDKA 3AETA 3KHSA 2ZRHA 3OOJA 5JAOA 4KYVA 5H1YA 4M1MA 5E8JA 2VI5A 2KM1A 2PKQP 1QF7A 1WTCA 3LY7A 4BNVA 2IDZA 2P9QA 2PWPA 4OMCA 5HFJA 2GN6A 4J1SA 4MJ3A 4BTVA 3QEJA 4C0XA 5FUMA 3AOEA 4B3MB 5BV1A 1E0DA 3W7VA 3ZCVA 3EFHA 4A8TA 2ATCA 1CNEA 1CB7A 3NG1A 5I8ZA 5TRTA 3YASA 1TUGA 3Q7RA 3RHTA 4ZYVA 3HVJA 3IPRA 3ZU2A 1AGXA 2WFMA 4F97A 1CS0B 2QGZA 4MS4A 2CDAA 2CF5A 1T8WA 2DFDA 2FSGA 2GCOA 4HFMA 4C43A 1TU0A 4OHXA 1II0A 2N1MA 1MO4A 5DV9A 1GSHA 1D4AA 2OAP1 1ECFA 1MF7A 2IXTA 1OFUA 2OENG 3OOYA 3S1LA 4BNJA 3KLPX 3ZYZA 3GGPA 3IR7A 4WOBA 5F4BA 2YWXA 2D13A 1PEAA 3MELA 1E79D 1BXRA 2BM1A 3OQBA 3QELA 4LI0A 4DEYA 3O8CA 1SKYE 1D4FA 3M6LA 4H3SA 3S81A 3KVVA 4AMGA 1OFTA 2JHCA 2DY0A 3SQMA 1C7JA 2RGNC 2DVMA 4UVEA 1PFQA 3JZAA 5FB3A 1TPYA 3G5LA 1ABFA 2DWOA 5AOBA 3DV2A 3H04A 1S0UA 3OJCA 5KU7A 5FHRA 5E4YA 5KC9A 1QVAA 1Y8CA 2JFUA 4B4KA 1S2NA 4D0LB 1CE8B 1UOQA 4R01A 5J1TB 3ZQ4A 4YLEA 4BQFA 4MWGA 2GXQA 3D2AA 4JEIA 3KETA 1HXHA 2BMVA 3HYTA 4RD0A 4GFDA 5JALA 1YCDA 4ENUA 3G2HA 1DQZA 1QHHA 2G4LA 3BL6A 1W25A 5FBWB 3ZXYA 1M6VA 1TQ4A 1OBFO 1Z18A 4E5VA 1K7YA 2W00A 3Q8XB 2OP1A 1OYYA 3LUJA 2JZCA 3OCYA 3RWBA 2FW1A 3H9JA 3WZ2A 3DEYX 1RNLA 5CB4A 2YHIA 3AIMA 1M7GA 1V8ZA 2C5GA 2Z1DA 1Y4UA 3MUEA 4KR9A 1O4VA 1L1QA 3BK2A 3LGXA 1BJKA 4LNUB 5EESA 1HFEL 5H5JA 5DZSA 3DZ8A 4REQB 4DJEC 3AUUA 1XXHE 3GFPA 2ZK7A 3QRWA 1M74A 1Q7CA 2ZWMA 5A2QA 4R1UA 4I8DA 1QP7A 2C1ZA 4YO8A 4CMIB 1PUJA 4HNAB 2K7ZA 3E9ZA 1SUDA 1PGOA 1KOLA 4F3TA 1NN3A 3E1SA 1WXGA 1KAQA 3QKSB 4D9JA 1LLFA 4LBZA 4DIKA 4OSPA 5HS4A 3RKSA 3WI7A 5HZHA 4ND3A 4P83A 3VOBA 5LMUB 4TN5A 1U8ZA 1OX4B 1REQA 1ZMBA 4I6JA 2Q4RA 1R88A 3PGJA 4FYMA 3KYIB 3TQHA 2O8DA 1Z0IA 4IR7A 3RS9A 2ET6A 2QUAA 4JSTA 3VZRA 5JMWA 1JFSA 1ULHA 4INAA 4ZA2A 1SQFA 1EUCB 3N0RA 4GVLA 3ZX4A 2OXFA 4E1BA 1AKTA 5BN3B 1E4VA 1RYNA 2VJYA 1I6LA 4GYYA 5DSXA 1IY1A 1GAQA 4R2WA 3D6MA 3IEPA 3U1TA 3HBAA 1C3VA 3L6UA 4ZARA 1KY4A 3V4FA 3OT1A 5FI5A 1J7JA 5EE9A 4A8HA 1WCIA 5BNZA 4BFVA 5E0KB 4Q82A 1Z0JA 1CHDA 5IARA 4BKMA 2PXHA 5JH7F 3MCWA 4IO0A 1BVUA 3DZIA 3CUSA 4CGZA 3NBUA 4ISCA 4M8SA 1DX9A 2ZRMA 3FW1A 4HZIA 4HWRA 3MTGA 1TTPB 1L5HA 1BVYF 1MX5A 4EEKA 1EI9A 1YO6A 3BXEA 4QG3A 1CY6A 1QDEA 2G36A 1ZRHA 1DOHA 5LQUA 3IE2A 4EHNA 1VG8A 4HAXA 3GJRA 3L8YA 4JX9A 1PL8A 3WRYC 3HJTA 3WQSB 1KBZA 3VKWA 4CEHB 1LFDB 4LOJA 4FC7A 1RR6A 3I3OA 1XXLA 3VAYA 3E05A 4JIMA 2WWYA 5IJXA 4UVDA 2XQVA 3JQEA 2XT9A 3IA7A 1EXDA 2DHDA 4DDVA 3F96A 2YFYA 5KSWB 3WYDA 4YLYA 4JJ4A 2CF6A 3U4MA 1YIOA 1BN7A 4QT0A 4M1TA 2WB4A 4ZVUA 3KPUA 2QTLA 3WG9A 2CFRA 3R0JA 4YRJA 5KTMA 1KI6A 4Z0PA 3L8GA 3G0OA 4GRDA 4A6DA 1RWOA 1KYYA 3Q9UA 4HPXB 4ND8B 1XTBA 3SYMA 3N87A 1ODTC 4HQLA 4RQAA 4BKOA 1J42A 2AHOA 3EGEA 5AESA 1N5RA 5AVRA 2JGDA 6ABPA 3OQOA 5KREA 4BUCA 4RH1A 3SDSA 2GLXA 3DBOB 4WY5A 1VGVA 5IKXA 1AXGA 3E6AA 4XTCS 3SZUA 1OXUA 3JTEA 1KI8A 1C4XA 4IG4A 2CHVA 3OX1A 4B3XA 3AI7A 2VT2A 1YZFA 3BOSA 4M9SA 4I8IA 1MB3A 1P29A 3F7MA 3VSDA 4RZIA 4Y2XA 1Q0ZA 2A9KA 1DAHA 2OXCA 2VJMA 3FHOA 3L01A 1PLKA 4MZDA 3TD9A 3W8NA 4IIXA 1VG9B 1XRPA 2EX4A 1HYQA 4DNFA 4E08A 1ZUWA 3G5UA 5TQ2A 2O2CA 1E6UA 3Q3HA 5KJCA 1JUDA 2P2SA 3B89A 3MMZA 3AHEA 4L78A 4V24A 1HK7A 3A31A 4IDGA 4U2GA 5AJWA 1I10A 5B58C 2YS6A 5G41A 4F8JA 3CLSD 3FMOB 3WKBA 2MR5A 1D8TA 4V0ME 3MWDA 1YUMA 3NFRA 4BVGA 2WWRA 3EA4A 5BQ5A 4CN8A 1C5KA 4CKYA 1UKVY 1VJ1A 1Z37A 5LYYA 1GP2A 4JIGA 4HFRA 3A25A 4BX0A 3FMVA 3V4SA 2FRDC 1O94D 3V3KA 1ND6A 2GHRA 4H6XA 4RHYA 4F7DA 1BFKA 1NNLA 1DXHA 1XTJA 3EGXB 1RZRD 3JQFA 5E0OA 2IY7A 1AHHA 1P44A 2PQ2A 3BMCB 5FNVF 4H60A 1H23A 3NCTA 1HLGA 2B8NA 1RP7A 4JD5A 4N5IX 4PY2A 1UXKA 1CJSA 4HPWA 1ZO8A 5IJAA 1RT9A 3KQQA 4LZZA 6CHYA 5I7OA 1QB7A 1GUDA 1RQLA 2ZTSA 4GMDA 3GUUA 1Y6RA 4F93B 4G8JA 5EWLA 2P6RA 3ZXIA 1OE0A 1EKXA 3RIXA 4IINA 3UMFA 1BMFA 2QW0X 4EENA 4ZO6A 1J8DA 4XWKA 1E94E 1FNBA 3IS3A 3ROMA 3K20A 2GD6A 3JVIA 2X9VA 3E7PA 1UBCA 5LDDC 1IM8A 1Y7TA 2FPXA 3HQ4O 4CIWA 1Y98A 2QSJA 4GL4A 5HGJA 4J4TA 3U61B 2CL7X 1J70A 1X42A 3IEMA 1KRXA 4OAOA 2J5KA 5KOJA 3T34A 3AILA 2IPLA 1A9OA 4ALMA 2O9JA 1ZQ9A 4MR9B 4CLOA 5CIYA 4MKIA 3EWAA 4OBEA 3FIJA 4J9UE 3DLCA 4MCAA 3R7NA 2AF4C 3O2JA 4JCOA 4J2HA 3HLTA 1P0IA 3QW4B 2B5WA 2LR0A 5KYWA 2ZVJA 3WGMA 1DJNA 1ZGJA 1WDKA 5EGSA 1RABA 2PPLA 2Z8YA 1TUBB 1W5TA 1R3UA 2DKFA 1K08A 3FUCA 1ZJYA 4KNVA 1SUCA 4LTDA 3DLAA 1NRXA 1RBYA 3D4PA 3EMKA 3UAVA 4TZKA 5IT0A 2A0FA 4NYMQ 3FWPA 1Z62A 2RK4A 4JMPA 1FC0A 2ZB7A 3EFBA 3SJ7A 1X1QA 1CP3A 3LC0A 3K0AB 3N7AA 4ZMRA 3OE5A 4DLUA 3WFJA 5JXGA 4RX1A 2GHQA 521PA 1OGYA 2ZIGA 4WXRA 4ZAXA 5EJEA 1UBJS 5G1NA 3TLYA 4IILA 1DIAA 1TZBA 2FEWB 4YQZA 1C0LA 2ZSFA 1BWPA 2I80A 2JIZA 2YWDA 4UXIA 3UHOA 3AEKA 3SQWA 3AIKA 1IAVA 3MA0A 4LZWA 3AKCA 4OI0A 5I9TA 4B6JA 1G98A 1HEYA 3IV6A 4MV8A 2BH2A 4I36A 1LBQA 4BE7B 5ILOA 3ZDZB 2WWHA 3Q88A 4LRSB 5T4EA 4QSHA 2ZVDA 4L5YA 4OCZA 3WRWA 2YY5A 4GZ6A 3ZY4A 1NW5A 2W2OA 1QH9A 5KWJA 5EP2A 4G1MB 4WXMA 2R7MA 1WZ2A 2AJDA 3PDHA 1X19A 1HV8A 4CMGA 4HEA6 2GM3A 1U9IA 4YRFA 2J3QA 2P2GA 4NONA 1VE5A 1H2RS 3AJAA 5EZYA 2HJHA 2I3ZA 3AT1A 3ITEA 2OVFA 3H8SA 1YBAA 1Z5VA 3A06A 4MGKR 5BN5B 2VHQA 4V3BA 1J22A 3DR5A 1K7EB 1VP3A 3DTVD 2R6FA 4YROA 16PKA 3WMWA 4BNLA 1KEZA 5IS2A 2WHYA 3QMPA 3KJGA 3R0VA 4A3SA 4RTPA 1BG6A 2PD6A 2MIIA 1JHUA 1CR6A 1NRIA 2EDAA 3PPYA 5ICMA 2FUKA 2GERA 3WK7A 2CDBA 3VH3A 2H0RA 2ZUTA 2JLZA 4LYDA 5JNLA 1K66A 5TJHA 2OAEA 1CVLA 2VHYA 2ZDQA 3DNFA 2C20A 4KMMA 3GLIB 1I3CA 4V3CA 1JDUA 1E6KA 2IGTA 1AY0A 2AJLI 2P5SA 3VKFA 1E98A 3HBJA 4QOIA 4CTMA 5A62A 2Z83A 5K5EA 5KPDA 3EN0A 5I9IA 1GY8A 2I7XA 1FYFA 4NPAA 1Y80A 2J07A 4I5EA 3QFHA 3RRZA 2Z5GA 1I4TD 1SVWA 3AONB 1OOEA 1ZK0A 4YFYA 3P2MA 2OZKA 4NFHA 4MICA 1QKJA 4FZRA 2EZ9A 4LV6A 3W3ZB 1OROA 3ZZMA 2PEZA 4Q1AA 2PZMA 2R1VA 3TOVA 3NNSA 3VMFA 1LPBB 4JLKA 2V8BA 1TUIA 3PQEA 4EY4A 5CCBA 3VKUA 3EX7C 1PF7E 1G1AA 2RH5A 3IJEB 5EXDA 3TKYA 4DBZA 2PLFA 4JHXA 1PTJC 4EBFA 2FMIA 3OZAA 9MHTA 2IHUA 4OK3A 10MHA 3LWBA 3PDIB 2Q50A 4NFSA 3B82A 4CQNA 1JWBB 2EIXA 1YR3A 2WT8A 3D8UA 4FKBA 4KWEA 4XDGA 3T1OA 1V1MA 4ZN6A 5L4LA 2J3DA 2Q1SA 3UK7A 2LV8A 1K7FB 4QDXA 5JROA 1EGQA 1DWPA 3DWIA 2GTIA 1Z2NX 3ILYA 1ZK2A 3K32A 4WY2A 3N0XA 2W2NA 4UCWA 1X7WB 5J59A 3E8XA 1PKEA 5HDBB 3WGYA 3ZY3A 5JSFA 4WVLA 1ZM9A 2KMLA 5C8YA 1O87A 2F67A 2PBLA 1RJ9A 3KTOA 3ZVLA 4EMUA 3KPVA 4L7VA 5BN1A 4LRWA 4RE5A 1X7DA 3NO4A 4IFIA 3FGZA 3CT4A 5BSUA 1LNZA 4KMSA 4R6WA 1HNZB 2L42A 2ZUBA 1QMPA 4O4IB 4YC7A 4MB2A 5EIBD 4E2XA 1XDGA 5JPIA 5ISMA 3IMGA 5L6MB 5KVQA 1N4AA 1XZHA 3SYLA 5A0VA 4Q6WA 4LNAA 2H08A 4V2UA 1OH6A 3L06A 2G63A 3IYLW 2RGWA 1XL0A 2XOEA 1SVLA 1KI1A 3M2PA 3IQIX 4GG1A 2I2AA 1H2WA 2Q1WA 3G1TA 2ZRQA 3I5AA 5ADVA 4OBXA 5E2BA 2XNSA 3DZCA 2OLEA 3H1BA 3NJRA 1LPSA 3HCWA 2CWDA 3SFZA 3I8XA 1UC9A 2H85A 3LBAA 3R3WA 4LJ7A 3KE8A 2ZAIA 5CH5A 4CTOA 5B2EA 3PEFA 2ZR0A 3K0BA 4OXIA 4C2TA 3TJRA 3ANXA 3FCEA 4B35A 1R66A 1ADJA 4HXFB 2DQ4A 2VH1A 3RYHB 1C4WA 5DGDA 1J1UA 2W6IA 1G21E 2FPGB 5I01A 2A86A 1TCUA 1T36A 5HF9A 1PVDA 3GA7A 2ZWOA 5ANRB 4Z49A 2H57A 5EIOA 2F1HA 4G1UC 2NTJA 1K9SA 3LHKA 2FE1A 4WGFA 4X7MA 4ZDKA 3QHQA 4J03A 3AZPA 5ITWA 2Z8YM 3AFNA 3EUAA 3EXHC 4KXWA 1PBTA 4KL8S 2BJHA 3PWZA 5HKOA 5B36A 2VJLA 1B8UA 4ARIA 4TV9A 3FBTA 1VA5A 3BE8A 3D2BA 2YZNA 5I7VA 1QS0B 1W7AA 2H1OA 2JJQA 1NMZA 2X42A 1JXQA 5AOVA 3HP7A 4JP5A 4YCCA 1DJQA 4CLHA 5JE8A 4XW2A 3FZGA 5IKEA 3W04A 3DGFC 4ETIA 2Q21A 2C61A 2Y9PB 4HTFB 3UJ9A 3Q12A 4EKGA 3M6IA 3QY9A 4DSTA 4AUEA 3LBFA 3VZCA 4HAZA 4XB1A 4PFQA 3SHVA 5KC8A 1THGA 3BHMA 1XTQA 1DXQA 3FSRA 3MWGA 3GH1A 4RK7A 5DT9A 3WGGA 4ZREA 4G5QA 3T7KA 1T2CA 2GVDC 1U9CA 3KALA 4JDUA 2W6ZA 4A0HA 3W8FA 4BV2A 2HXYA 1AF4A 2VK4A 3BRWD 1O0CA 3L0SA 1I7QB 1UDRA 5BRNA 4ROSA 3FPAA 3ZIDA 3EIEA 4QEKA 3F3MA 4TZTA 4ZGWA 2C7RA 4WXYB 2GKGA 1CK4A 4RVOA 2WOJA 1D1SA 1NLZA 1A9ZA 3PHJA 3NALA 1MAHA 3HY6A 3SSMA 3T06B 1OJ7A 1AIPA 1BCSA 1GFZA 1Z4JA 3REOA 2FSPA 5B7QA 2CVZA 3F5QA 5E95A 3F5MA 3S40A 2FCAA 2C59A 1AZWA 3CZRA 3DE1X 4P4NA 5TQ0B 4ZZIA 1KI4A 4Q16A 4JGGA 1G4AE 5JBNA 2A0YA 1T8RA 4U6SA 1FJGB 3Q2KA 1TT7A 2F3PA 1XAJA 3OSZA 2FZGA 1ZJ4A 4OQEA 1ENOA 4AO8A 3FKSA 4QRDA 3QK7A 4JEHA 1JF8A 1NI4A 5I4BA 1I36A 4WINA 2GRUA 1NRJB 2JB9A 3BGWA 1G4HA 4G23A 4J91A 2XA9A 1YMUA 3D0QA 4J94A 2JIRA 5CBKA 4HMOA 4C3OB 1A4XA 2WAYA 3P94A 4CKCB 3N8HA 4G8CA 1PD0A 1ULAA 4ZCIA 1P61B 1B6SA 1SELA 1Z74A 1QFJA 4BWGA 2PX5A 4FUQA 2Y1KA 4F5WA 4PHHA 3PPIA 5TQJA 3NTVA 1ECBA 4PSUA 4CM4A 3F46A 1AGYA 2XWSA 2HHLA 1YQ9A 3WISA 1SXJB 4U2EA 221PA 2GVZC 3T5DA 4B4UA 2R7AA 3QVGB 1DJOA 1ZUD1 1TJ3A 3QBEA 3GUVA 4F71A 1VIYA 4U00A 1G2IA 1BD4A 2JFVA 3CONA 1S2LA 5SY6A 4RMGA 1F1BA 2OKGA 1GVNB 4RTLA 4XWOA 5FBHA 1XZKA 4L5CA 4FB4A 1NVXQ 2WYIA 3DPIA 4JI7B 2OFPA 4DBLE 3PRJA 2VQSA 3JD0A 5JDIC 1ZGHA 1HLFA 3V7FA 3OU2A 1E2JA 1QX3A 2E85A 1KQPA 4PG4A 1XKQA 1EWQA 1NMXA 3KDAA 5SZIA 4BLTA 3BB1A 3VKHA 2P0EA 1XA4A 4O4HA 2FE4A 5HEKA 2AYYA 4B3CA 3FCUB 4DPMA 4KXQA 5C18A 4R5HA 5K0LA 3WYNA 4FP9A 3ETHA 2YQ5A 2JLWA 3ZDEA 1NZFA 4WXHA 2DLDA 2EW2A 1J21A 1VCMA 1ISJA 4OIMA 2WJZB 1XTVA 2V7VA 1U2DC 2C4WA 3NIBA 1K5DA 2B1GA 3HR7A 3BERA 3KHUA 2OK8A 1S2OA 1Y6ZA 1DEHA 2DFPA 4DLYA 4E13A 3P8ZA 1ZHHA 1Y81A 2VEOA 1NOKA 3L05A 1T2FA 2BFDB 2WJ4A 1WXWA 3FHLA 1SC4A 3LBIA 4NX2A 1WX1A 4JT2A 4DUYB 1A77A 1QGYA 1V8PA 2EFCB 4EZBA 4O2LA 1ESZA 1N5KA 2V65A 3BQMB 3BREA 1TM3E 1W4ZA 5AKYA 5ILGA 4BO6A 2WHEA 1WQ4A 4JKOA 3R5SA 3L7IA 1R0XA 4JSYA 4QUJA 4TTSA 4AZSA 5IAKA 4C3UA 2X7XA 2ZITA 4BVBA 4FIZA 2ILVA 1I2ZA 3W8DA 5K8VA 2HSZA 3Q9LA 5D7BA 5JATA 1XEAA 4W5QA 1FL9A 3UTCA 2JBHA 1IPEA 1Q11A 4JJ8A 4QD3A 4UVGA 2Z2YA 3KUUA 3WB2A 2BTEA 2PUGA 1XTRA 2CCJA 5EQDA 5F77A 1JAHA 1W85B 2YQ4A 2ZLBA 1TEHA 1L7RA 2BTOA 5HKBA 3BAFA 4MB0A 4XIYA 4URFA 3BD9A 4WI1A 3AJRA 3E9YA 1Q0LA 1EK5A 2I62A 2EKBA 4V02A 1JLLA 4LF5B 4R51A 4MWEA 2OHIA 4ER6A 2HSGA 3BTOA 3PXBA 1MAUA 1DQSA 5KHLB 3HFJA 5FYQA 3C87A 1WABA 1QR6A 2PKQO 1VCHA 5TEVA 1W5AA 5TNXA 4XQ0A 1Y89A 5K4GA 1YMVA 5EZ5A 1R0LA 2JBAA 2QZJA 3DAGA 1PFVA 4G01B 3STWA 1OH5A 5KSPA 4FYPA 3E9RA 3E3LA 3F6RA 4M60A 4FZJA 4PC7A 4NZ9A 2XCUA 3PNLA 1R4NB 1W4RA 1XMSA 2CMKA 2XVMA 3KYCA 1EVZA 3ZQ6A 1HE1C 3PR1A 3C8ZA 5EP3A 1ZD4A 1BX0A 3L7LA 3OPXA 3L6OO 3C85A 3L82B 3NXKA 4MLCA 4QXRA 4FCCA 1KMHA 4K05A 2MR6A 3K73O 2RHDA 1YDGA 1YDMA 4HTAA 5EZYF 5DM0A 5F21A 4DLXA 3CMCO 3FMGA 3KB6A 4RE6A 4DJ5X 1RXCA 4G0NA 1PYDA 1UPFA 3A1DA 1X3SA 3RVKA 2CJWB 3WWCA 4IFBA 3GLFA 3G0HA 1HSOA 4DT1A 2B4KA 2PV0A 2VTEA 1CY1A 1NR1A 2V9CA 1KE1A 4H9GA 3T7SA 1CRZA 5B4TA 3ED1A 4MW7A 3B7PA 13PKA 3GNTA 1XMVA 2A1UB 2PZAA 2RJNA 2C5EA 3LT0A 3SK0A 1JU3A 3JQAB 1VE1A 2PR2A 3AHIA 1N8NA 1B6RA 3I4FA 1X6VA 4MEAA 2V55B 1E4EB 4O2AA 3PRKE 5IM4A 1GZ4A 3M5WA 4G0MA 4NHOA 3K0SA 1IHYA 1OFUX 4EG4A 3OH8A 1ULSA 1KDPA 4DDTA 2WIDA 1Z5ZA 3C8MA 4MVYA 4U2KA 1CCWA 1WVIA 2IU4A 4C0KA 4HDNA 1ZHFA 5FWYB 1CY2A 5IAEA 2EJVA 5LLDA 1R50A 1UL1X 3QP9A 1YJ5A 2SHKA 5C4IA 2P9CA 1HURA 2X0IA 1B0AA 1E7YA 1VHTA 2DECA 2Q7XA 4GYJA 2Z2IA 2JGFA 1PZEA 1WZCA 1PGJA 4AY3A 4QJ3A 4U7TB 5C1BA 2BGNA 1M2OB 1VTKA 3SU8A 2A2ZA 3Q40A 4CV1A 3CEHA 5A4DA 1UPAA 3QHPA 3GLKA 3TEJA 5LVAA 3OD5A 1SXJC 5IVDA 4I55B 3EZ9A 1OXXK 4ZT2A 2VAPA 5AIAA 4CM7A 3KQUA 5ICEA 3FPCA 4DR6B 1C3OB 1ZUIA 4NVRA 3TFQA 4HT3B 3D64A 3B1YA 3X2SA 1XEXA 2EGHA 1ESEA 2JC3A 1LTKA 3IDQA 5T3UA 4UVHA 4MQFA 4A92A 4CTJA 2L18A 1O08A 2JLUA 4UDXX 1OZHA 1VXRA 3OPYB 4IFEA 5H3CA 3UGQA 1DWOA 5EZ6B 1TCVA 4K26A 1YFJA 3ND6A 5K2MA 1L5LA 4Y2JA 4D9EA 3RK1A 3NBZC 5C8YF 5U4QA 2HPHA 3EB9A 3VX3A 3NS7A 5TMDA 1OW3B 3R3SA 2PS9A 2W7TA 3JRNA 4F4IA 3OZRA 3QKIA 3GN2A 4RVFA 1SCNE 3N5CA 1EJBA 3T5MA 1H1DA 3OY7A 1FUUA 1FZQA 4C03A 4A36A 1SB8A 1TVCA 3IHLA 2AV6A 4GKBA 4HAUA 1D2NA 1OA1A 2O8NA 4NBKA 1T8UA 2F1RA 2KBEA 1RKXA 4GIBA 3EYWA 2K4MA 5CDFA 1KS2A 4JVLA 2CXXA 4EUFA 1GTMA 1DAIA 3GDFA 1X7YB 3KQKA 1HR0B 1UBMS 1DMRA 3GGGA 2HDWA 1JSLA 4IXMA 2WD9A 3DPSA 2FPKA 2ZRLA 2Q7DA 1VJRA 1HFWA 2ZKLA 3D3WA 4PX5A 3VPFA 1SNYA 3RR2A 4CLRA 4BQOA 4OYRA 3LP8A 2MWMA 4DCVA 5F1OA 5IASA 1WP9A 3FCOA 2A57A 2RI0A 3O75A 2ZUEA 4S1NA 1IY8A 2QSYA 2GK7A 4TRRA 4D96A 3VPHA 2V7EA 3AR8A 3KZNA 4DRXB 2B9EA 3ZD7A 3CKYA 1FS5A 1XNQB 4ER7A 1PIWA 2H5EA 4LXXA 4LJ5A 3JQGB 5JO9A 2NPFA 1VBMA 2GFQA 1IQ0A 2AR7A 5KYYA 1I3OA 4AN0A 2YHAA 1RHUA 2O0HA 4ML3A 4W8GA 2V7XA 3IBSA 4HNAA 2TMYA 5FPSA 4CMJA 1RXSA 1T3LA 4B9AA 1P5ZB 1H4QA 3I01A 3MCAA 4DQVA 4ZK6A 3CLUC 1XZPA 3QKSA 4TV9F 1FFXB 2YHBA 4BAZA 5GTDA 4MA5A 1FDUA 1GZ5A 4Z99A 1PT9A 1OX4A 2GFIA 4YALA 1R0WA 1YR1A 3D02A 1CUCA 1N2HA 4BVEA 3FCSB 5ESRA 5BSTA 1P9NA 1EXVA 4ZOAA 4NOMA 3SVTA 2I55A 4HAWA 3CRQA 4QTTB 1KMCA 2DHRA 2GUWA 5EHXA 3T3OA 1T0BA 2NUTA 1CJVC 4DMMA 2CXQA 1QSGA 2AR9A 4HS9A 4PBSA 3DMYA 4L0MA 3QFSA 1Z0SA 3CNHA 4YYEA 4D9BA 3DBHB 1EVIA 1DAMA 1R8YA 2PR7A 2XITA 3D4NA 1SCKA 4ECEA 2XQFA 2OD2A 2ICAA 4ADSG 1JJFA 1ZJ6A 3HLYA 4JJ6A 2W2KB 3LUHA 4QNMA 3W2FA 2C9BA 4LQLA 2H54A 2P62A 1TF5A 3F6BX 4N49A 4Z4FA 1Z68A 1IUNA 3ON5A 1TTHA 2R6AA 1FTQA 4GXNA 2XRZA 4FFNA 1WA5A 1Z34A 1XJQA 1E1YA 1HDZA 2RAFA 2YVAA 1SKUA 3C7CB 2HCTA 4IHQA 3ZKAA 4B7CA 2EBWA 4BO9A 3ZWNA 4FQ7A 2PZBA 4NAUA 1YIDA 3WTBA 2FN4A 3OCXA 1B3BA 3JTMA 3WHKA 1F9EA 1L5VA 4ILKA 4Y2YA 1E69A 3Q0EA 4IIDA 1RRPA 2QD1A 3AHDA 1OI7A 1OBVA 4XFDA 1GCOA 1NKSA 1T5IA 2I4OA 3EIFA 4FR2A 5E7MA 2W2VA 3CUWA 1QQTA 4U2DA 4DOMA 2PSFA 3A26A 2G9RA 5DFAA 4LWZA 4WOCA 3U3MA 4WBNA 3ENWA 4Y1EA 1T24A 2X3YA 4DXDA 2QYTA 1TQDA 2XADA 4YIKA 1XMIA 4ND8A 4R3WA 2KI5A 4UUNA 2JGIA 4Z2AA 4BOYA 1E32A 2ALJA 2L2QA 3PL1A 4OU5A 3RWOA 2R8OA 3D4LA 3FG9A 5EPOA 4AMUA 3KB1A 3ZJTA 3M4XA 1NE2A 1UBTS 3AHJA 2X14A 3OKPA 3UMRA 2Y2VA 3V9PA 5CXQA 5KMGB 1T0JB 1ZX1A 2F6RA 3U7HB 1Z6QA 1V5WA 3RVDA 1EDEA 1DKUA 4C0SA 1E1DA 1G2QA 3MQ2A 5JZOA 1J00A 1NBOA 1NN1A 2QRHA 4OFXA 2XTAA 1RS0A 1T3HA 5CCDA 5BR8B 3G9TA 4O4HF 2NP7A 2JA1A 1N33B 4LXGA 2ZJ8A 4CHTA 3SICE 3OAAD 5P8WA 3PFGA 1XFAA 3JWIA 4R31A 4TPKA 5ALIA 3M7IA 1RC0A 4UE6A 2OCLA 4FHGA 3U7QB 3ZNOA 7YASA 3WIDA 1Y0BA 4XVCA 1ICIA 3MTEA 3HGTA 3GJ8A 3QLTA 5H68A 3LOUA 1GL7A 3MRVA 3N2GB 1D7OA 4TLAA 4F91B 1KSHA 4CF4A 3WGUA 1F3OA 4QHTA 4LF9B 2IV3A 3KTDA 4RCVA 4EYEA 5MN5A 2NAPA 2Q5HA 4YAFA 3UT5B 4UHDA 1PJQA 1QAQA 1V43A 1EE1A 2FLVA 2C5SA 2IF2A 4OQQA 5CLHA 5D2CA 2RGXA 2OYSA 1YBFA 4WLFA 3IE0A 2PDAA 2DMRA 3EF1A 3WWYA 1D2MA 3JQ8A 1DTWB 1MTOA 1PFWA 3O8OB 2XUJA 4DJFC 1GPWB 4X24A 4FMBB 1Z0AA 3ZZUA 2EJBA 1P5RA 3CNLA 1NUTA 2ZB3A 1ECCA 3ZGLA 3BMCA 5KNBA 1GUZA 3QIVA 4GQBA 2IS4A 2X0NA 3DB2A 4BGDA 2AFVA 1GIAA 4A1OA 4B3DA 2HWUA 4HZUA 4K46A 2J33A 2FXVA 1H6AA 3F67A 3V8MA 3IDFA 4EJ2A 3UK2A 1QHFA 2Q8PA 4ZRMA 4B3FX 1EM6A 4L08A 3ZV6A 4E07A 4MLPA 1ULBA 2GZHA 4XX0A 4QYMA 3U31A 3HL4A 3QW2A 3UZUA 4GT1A 3C7AA 4FONA 1TA0A 2Q2NA 1SHZA 1D0VA 3T4EA 4WN9B 2P6MA 3B1VA 1GJRA 3NIFB 1ZD5A 1JHYA 1N78A 1W47A 3MBKA 4GE3A 1RLUA 3LW7A 1PK9A 3HFGA 1O5OA 4MUIA 3NM4A 4M7OA 5BVHB 5JCJD 4CIBA 2IL1A 1CZNA 3LZDA 3UENA 1C3XA 2HDOA 4TLMB 4LYJA 1UKZA 2BFEA 2WJJA 4BFSA 1CPYA 3L8DA 5EJAA 2XT0A 3AVPA 4IWXA 1GNVA 4R7GA 2PSEA 3TZEA 4URWR 3L9WA 4OPMA 1NMYA 4PXAA 4OGWA 4TTJA 1Z36A 2W58A 3CYFA 3I01M 3JZDA 5JY6A 1G5IA 3T7DA 1GKKA 2DFKB 1OZFA 2DFLA 2GWRA 3Q41A 4C4OA 1QH8B 1KVTA 2C8KA 1L7BA 2GPNA 4I08A 3TDKA 3V1TC 1VSBA 1OTXA 1C8VB 1TUBA 3L79A 3FHJA 5DI3A 3EWSA 1U02A 4Y1GA 5IULC 1OJLA 4Q7MB 1H6DA 3F3SA 3SE7A 1AUQA 1SJ9A 3BSWA 2Z30A 3JAKB 2P3LA 3EXHA 3MN1A 1ML3A 1OD6A 5DVZA 3K0AA 5F1KA 1ZLYA 1V35A 1IYZA 1LCIA 3HJHA 4HGPA 5J40A 3ZOKA 5A02A 1TYCA 2PL9A 3ADCA 3TIXB 1Q0SA 1QFSA 2B1QA 4OG2A 2R4QA 4HDRA 3L7NA 3BH0A 1IQRA 3IOMA 5ALLA 5A6SB 5IK2D 1MLDA 2VP9A 3AKEA 4R83A 5FTKA 4TS9A 5EMLA 4NBVA 1FPQA 3S27A 5DSZA 3TRKA 1I01A 4I5GA 2XUHA 4RVDA 1X92A 2X9NA 1IZ8A 4L9RA 2BONA 4S2EA 2Y1LA 4WASA 4KK3A 1IN7A 1FBNA 1B15A 1FQKA 4J9VA 1OH7A 4KSYA 4TXLA 1IIBA 4TL7A 1FYDA 2I7DA 4PYRA 2PFSA 3B6JA 4O2AF 1ECJA 2CNOA 5IM4F 2ECFA 3C3CA 3OIWA 1K92A 2PPVA 1UANA 1VB3A 4NBWA 2V5VA 4O33A 4RF5A 5A6VA 1BWSA 2HSEA 2OCXA 1TA9A 4LCBA 1KRWA 1XQWA 5FPKA 3KJEA 4D7AA 5ERGB 2J9RA 1BWQA 3NTXA 4QLBA 1RQ7A 3HY4A 1XT6A 3ZWKA 1J5EB 4DGSA 3QSGA 4IIJB 5BN5A 4BWYA 2QRGA 3BEOA 3FYDA 4ZHSA 3WLSA 1KO1A 5I7EA 1Z7EA 3ETJA 4WT7A 1WB4A 2PHZA 1HT1E 1P4JA 3OF2A 4XDHA 1HRKA 3TGPA 4X93A 2I9PA 4XCXA 4F6LA 3GEEA 1N3BA 3PD1A 4EYGA 4DWOA 3F74A 2AG0A 1KYXA 1BU8A 5DO9A 3EY9A 1M1YE 1LXCA 4EGFA 1TMOA 4NJOA 1HOTA 4NCHA 4H0FA 5I9LA 3QVVA 2AN5A 4EL0A 4QDTA 3ETEA 3VOAA 2OBYA 1M8FA 4R0NA 3KBBA 1FFAA 2RG1A 1AK1A 2WOOA 4F38A 5JS6A 4MWZA 2L0XA 4RPIA 3RS5A 3WZLA 2SKEA 5K8IA 4E4TA 2B25A 2J3HA 4AYTA 1U3TA 3L6DA 4WZBB 2X9GA 3LCJA 3PTZA 4KRGA 2O3UA 4FKZA 4MR8B 1PEKE 1IXKA 2GN0A 1Z4MA 2O3JA 3FCCA 4TKVB 3O3OB 6YASA 1EZ1A 2VPWA 1NQAO 1WKVA 1WMFA 2C4UA 3TKAA 4XYLA 1JI3A 4RTOA 3IVCA 3LVQE 2NX2A 1YL7A 3EXAA 2F8MA 3TM4A 2Z4TA 1L5KA 3WKAA 4P0QB 3AIIA 3I1YA 4H4DA 2YOGA 4FILA 5I8WA 2MYUA 3L8FA 4FKMA 2EQAA 4F8EA 3QUCA 2IYYA 4KQKA 3HVHA 1FMJA 3CKKA 2ID9A 3LDUA 2OUKA 3GC6A 3LX4A 1EPUA 2C7PA 3HYRA 1P3JA 1QFMA 2WIFA 4MEJA 3FNRA 5F35A 3PRYA 2GTPA 3IB3A 2OGZA 2P2CA 3K15A 4G8BA 5ARCA 3A2NA 4RMIA 3TUIC 4KQMA 3M6AA 2ZSDA 4Q3BA 5EJ4A 1A1VA 2UXCB 4FS3A 1J0EA 5FNZA 3T9FA 1RRFA 1U2DA 1X7WA 4P81A 3VH1A 4OLBA 3RI3A 3AV0B 2NUAB 3ENVA 1OLXB 4C6TB 3WK8A 5AI9A 5THQA 1O97C 2Z2KA 5BWCA 5ELMA 3K09C 3IGFA 4OBWA 4C89A 4Z4CA 1SXQA 3REGA 2AI1A 1KMQA 5G4KB 1US8A 2P11A 2ZAGA 4IJUA 4DMLA 1KBQA 4V1CI 2XJ9A 1GYRA 2IDJA 4PBTA 4DWJA 2RGRA 4D43A 2FUEA 2BE9A 4MYUA 2FWMX 3EIWA 1P2TA 1RJFA 2A92A 3HYCA 3LC7O 3DAYA 3EXG1 3NR2A 2YZGA 4ME6A 4MPDA 3A6ZA 4M0LA 1MV8A 4N4AA 3S5JA 2HM7A 1X7ZB 3GRFA 2P9EA 2VDQB 2CL0X 1Z17A 1H2YA 3FBGA 4M46A 4RJ2A 2IYTA 2ZOSA 4DJDC 5FYDA 2QVXX 2BBWA 1PK7A 1FX1A 1TK9A 4GI2A 3P4XA 1LW6E 4WJZA 2H48A 4MRMB 4C3VA 4ZU3A 3ABOB 2D1TA 2W93A 5FEMA 1E2EA 1QUEA 2UUBB 3R4VA 1T2DA 1NVDA 1HG1A 1R8JA 3D7MA 3FPKA 3K9QO 3INYA 4MGIR 4PG7A 2QLBA 3RIEA 4J29A 2FPGA 2ZYRA 3QX8A 4FX2A 3KG2A 4Y67A 4XAQA 4OB6A 5EA2A 3I62A 1IFXA 4JNKA 2QVGA 2DRIA 2PA0A 3H1TA 3PC2A 2RCYA 4IEFB 4P2GA 3RVLA 2EW1A 2G82A 2IYWA 4IMIB 4JBNA 3J7AC 1G6HA 4ENPA 3H05A 4EGQA 4OI4A 4DY6A 4RPHA 1VYVA 3JVEA 3M0EA 2B5VA 2EGUA 3WRXC 4AXXA 4B2YA 1L9XA 1Q83A 3QZUA 2Z6VA 3ELYA 4MWSA 3QU9A 2PZJA 5CJJA 3PLAE 1QS0A 2P3OA 3B3JA 5DSTA 4NU0A 3H4MA 2I7CA 1DBSA 1J39A 2AMYA 4JN6B 2GVNA 4JENA 1LK7A 1TCBA 1KAEA 4XIGS 1EZZA 2NO6A 1XZDA 4KODA 4IOLA 4HO1X 2VDRB 3UCXA 1F7VA 4RLSA 1G3QA 2ID8A 1IOVA 1M6WA 2F8LA 4DA8A 5B7NA 5FA8A 3DXYA 5DWQA 3N74A 2RSLA 3JPWA 4ZQHA 1PNTA 1V5FA 2WJWA 3Q7EA 4EB6B 3L6CA 4Y1FA 4XVHA 2A0KA 3ASUA 1W93A 3QE0A 5SY9A 1IDN1 4MS1A 3OO1A 3O83A 4GX1A 1BJRE 3TW6A 4Y6LA 3TQQA 5KKAA 3K94A 4A0FA 3FNEA 3FWHA 4LBWA 5CYPA 3BGOS 3FSGA 4M0DA 2GAFA 2JGJA 4F92B 2PTHA 2Q0QA 4BB9A 1NBIA 2BGMA 4WBNF 2FFQA 2C04A 3BWMA 2W2LD 1JDBB 1VRWA 2B0CA 2PWAA 2ZPTX 3MCTA 5HR5A 2FWJA 1VKOA 2BL4A 2BF4A 2CE2X 4FMDB 4LDNA 2R6HA 4C14A 4IMJB 4C0QC 2XJ4A 4UEWA 4F3RA 4D3ZA 4JI8B 1KK0A 4JL6A 2ZJAA 4CM6A 1XMOB 3FLAA 1J1ZA 4GL2A 4RHCA 2WJVA 4EX7A 1G9SA 2HA3A 4C1BA 3R5JA 2PT6A 3F6EX 3LLVA 3VC7A 4IXDA 3BWYA 3C7TA 1D4OA 1ZOPA 2CLIB 3OEHA 4H35A 2HF7A 4DARA 5BYJA 1GL6A 4J7AA 2IXDA 4J0EA 2JRLA 2ZRIA 1I0ZA 3WV4A 3SPXA 3DUFA 4PR0A 3BVPA 4BRWA 3CIFA 3F9RA 1ZRMA 3DMHA 4WE3A 3CF0A 3DMGA 2GPTA 2ZYTX 4KDRA 2EJCA 4W7IA 1QJ4A 1W34A 1UMDA 2VHCA 2ABWA 1UAYA 1SMKA 1SXJA 1NU6A 2B20A 3LY9A 5LQAA 1WUYA 2D00A 3C6MA 3OLQA 4EUKA 4RNDB 4REOA 2V7TA 4K40A 3GCDA 4ES6A 3QJ5A 4G86A 2AJTA 3DW3X 4RIGA 4U0KA 1SZJG 3ZOZA 5JLJA 1WR8A 3I3SR 3I6YA 2D1SA 4GXRA 3A8TA 2BR5A 4WOPA 1WMBA 4LTMA 3K8ZA 1B41A 2YIJA 4DR2B 4NZYA 1O6ZA 1QE5A 1Z4IA 4UMEA 2HTEA 3IT2A 2AKAB 5ELXA 1TK3A 1DQRA 3K8OE 1PL7A 3AG6A 3H7IA 2IP2A 2VZ9A 4KLNA 5GGXA 1CQXA 4KE8A 3LWDA 3PCRB 5KDOA 5T8KA 4AQYB 3UB2A 3ECCA 1GTJ1 3DOOA 1PLLA 3VR3A 4CM9A 2ZYDA 3DFKA 3DNMA 4MKXA 1THZA 2YN2A 2YWRA 3O1JC 5BV0A 5ICGA 1HE2A 3QXJA 3QU5A 4S04A 1WU7A 1NI5A 2RGAA 2QM0A 3GPBA 4ZAGA 5TJ9A 4FB5A 2HWYA 4BCBA 1KMNA 4YPOA 5AJVB 3D8HA 1EK6A 3HNRA 5AVQA 3K0HA 1FRNA 2BFDA 2JCXA 3A1VA 4D8VA 5J5CA 2P9FA 1EZ4A 3E9MA 2R97A 2RHCA 5ENVA 3WLJA 5F23A 1M8PA 2CD7A 5DHUA 3RANA 3THRA 1FUYB 5JASA 3B8EA 2XA1A 3QE3A 3I76A 2P6NA 2R8BA 4EG7A 5E4JA 3RUAA 3LI2A 5A7GA 1UCFA 2I71A 1F3LA 3DAPA 4R2KA 1VJGA 3P0HA 1IQPA 1ZK1A 3NATA 4O59O 1COZA 2DPMA 1IXRC 4G0YA 4US1R 2Q3JA 1WETA 2HQRA 2DUMA 2CW5A 2OKCA 3M8KA 4IDNA 5AW6A 4KH1A 4XKJA 4X62B 2VPQA 2Q0SA 3A4NA 1AURA 4U2BA 3TXXA 1ZGAA 4F4JA 2VPYA 4U6NA 1PI3A 1K6IA 2GBLC 4ERXA 1ESNA 1P7CA 3FNBA 1W85A 3H8WA 3B85A 1X1TA 1P0CA 4XA8A 3CJQA 4E70A 2RONA 3VR1A 4AC9A 3PRHA 1GUAA 1U0EA 3CN7A 4QBGB 5CG1A 4DQDA 4CIDA 2H2GA 2BW0A 3DL7A 3TF5A 2Q5IA 2DPLA 4EPWA 3GMIA 2JAUA 3AR4A 5FKJA 1QLWA 2PZLA 3SIRA 3H42B 4U1RA 1Z2AA 4D9CA 3FSEA 4OHZA 4GMKA 4L0QA 1KJ9A 1T6BY 5K8UA 5CCXA 2FPMA 1IN4A 3L1UA 2HPZA 4ZPXA 4G0XA 4LVOA 3U7RA 1E3JA 4JJGA 4CLXA 2WIKA 2B8JA 4Q12A 4BNFA 1YBHA 1XAIA 2TMGA 1G16A 3AL3A 1CJKC 4HCJA 4OKSA 3R8XA 3DBLB 3I6MA 3WL5A 2Q5CA 2UVPB 3NEPX 5IUJC 1XNGA 4ANFA 4DA0A 1Z56C 2FMUA 2HB6A 2OK7A 4I1RA 3OMXA 2VRNA 3TZKA 3IESA 1ISSA 1CJBA 3GW8A 2MYNA 4WJKB 1E9BA 5A5FA 1PFUA 1J99A 2QGNA 2V6GA 1HNNA 4YUAA 5AXBA 1ZDMA 4ZODA 4URHA 2IU3A 4PRZA 1KETA 1NA5A 4BATA 1TZKA 3IQDB 4BV9A 4LW8A 1KOFA 1SG9A 1YDFA 1SWWA 3L7YA 2VP4A 3BWEA 3HACA 4MHTA 1PVOA 2V03A 5JNSA 1P9OA 1SKQA 4N12A 3WYEA 2JI6A 2PS1A 1M8GA 2HMTA 5COAA 1OWMA 3WMRA 5EQTA 1WUHS 3G7UA 4JB3A 5FTMA 1XHEA 1VMIA 3PGXA 4L76A 5FRDA 1Z25A 4BP1A 5L4NA 2PKRA 2BZGA 1GCIA 1AS0A 2VDPB 3CU5A 4EBBA 4YRMA 3PKIA 5K8JB 1E6MA 1JDBC 4KQ6A 3L77A 2Y1FA 3Q0IA 1SY7A 2A9RA 2CLKB 1GO2A 3CKLA 4PZCA 1CB0A 2XZOA 3LDHA 1T8PA 2WYHA 4LNHA 3WV5A 2HC9A 2H17A 1E64A 4I14A 4D3FA 3FUTA 3ZWVA 1R5JA 3WLEA 2XYGA 3HI4A 3WR5A 1H0KA 1Z0KA 2G1AA 2IOFA 3FWYA 5FO0A 2O8BA 4F45A 2P4UA 3DM5A 2Z6QA 5ALXA 3EVEA 1M7HA 3AP2A 2R8YA 4JAVC 2AXQA 5AD1A 5I3ZA 4RZ3A 4UATA 3IKMB 1OU0A 3I39X 5FWYA 1J1IA 2A4KA 3BD8A 3S2FA 1TCCA 2ZJYA 3TOCA 3SHWA 2VOEA 3G0BA 4LFCB 2PMKA 1GU1A 2WAXA 4P98A 3X44A 2O5RA 1EFAA 1N2JA 3F5DA 3DLPX 1QF6A 1X13A 2A5JA 2PZGA 3LNTA 4YAEA 3ZCXA 2C3OA 4GF5A 3U81A 4QGSA 3U0VA 1M2OA 5FCDA 7AT1A 5C8XA 1TT5B 4PNPA 1EFUA 1RM4A 4DQKA 3C3DA 2Y4NA 4I55A 4HXYA 4MS3B 3U13A 4A82A 2REOA 2CNWA 4HVLA 3FWKA 4B5KA 4UTVA 1E0AA 1LTHR 2TRSB 4JU8A 1AQNA 2BN4A 3ZGXA 4MULA 2YMPA 5EHIA 5L53A 1GPYA 4BXOB 1FS4A 2WYWA 1BS2A 1C9NA 5LWQA 2WE7A 2HHHB 3OT4A 3ZNQA 2PX4A 2DE0X 2CL5A 3MVEA 4G1BA 4P1ZA 1VL0A 2ZT5A 4KACA 3FYHA 4HQRA 3LIIA 4FBLA 1VSTA 3MMXA 4FZVA 1DG3A 3FMFA 5FBQB 3SXJA 4A0SA 2GHTA 3TL3A 4DCPA 3NEAA 4WLEA 1SBNE 2YR0A 2I4LA 4CMCA 4F06A 1RXWA 1OYVA 3TI9A 1C30B 4I46A 3I28A 3MINB 5LA6F 7REQA 5KOYA 2RHBA 4TXMA 3VR5H 2IH2A 4QM6A 4GMHA 4JLOA 4JLVA 2P0YA 5IZ4A 1RKBA 3TUJC 3AM4A 1KVRA 3KRTA 3GY0A 4WESA 3PX3A 2YZKA 4H6WA 4KAFA 4NH0A 2EWMA 3V2IA 1B8PA 5AKJA 3U49A 1CZRA 1QRRA 5TGZA 4TMKA 3L40A 4N5DA 3E9DA 2BOVA 2ZJOA 2GZMA 1JXMA 1AQUA 5BORA 3BHJA 5JUWA 4E5YA 4NAVA 3TI7A 4TUYB 4G56A 1R8SA 4N18A 1QTQA 4N3CA 1KTIA 4E1AA 3M82A 1Y1TA 3AY6A 3ORRA 3WADA 4KE6A 2NTVA 2PGDA 3R5KA 1EGMB 4DWWA 3PHHA 1BVHA 1G7CA 1ZRSA 1QJCA 2EF0A 3GLIE 3W34A 4CBVA 1PGQA 1YMQA 2MTBA 3O2SB 4O6VA 4PWZA 3VAAA 3MTQA 3TOZA 1GXSB 3OMLA 5FAKA 3E27A 4HRAA 4PIVA 2Q9UA 1MEEA 1YZQA 3E3AA 4GSLA 4K6MA 1X39A 2YJ3A 4MJLA 4LQCA 2LW7A 1E9FA 3B1FA 5TE9A 1T9BA 2PQMA 3AW9A 1N0WA 4CG1A 3RVMA 4D0NA 4M76B 3JQGA 3Q72A 2IW1A 1Z3IX 2A14A 2P5UA 3AWIA 4HMQA 2VTKA 2XF2A 4PXSA 2X1LA 4X3CA 2PNJA 5GGYA 3E35A 3I92A 4BRZA 3QG5A 2QTTA 1E2HA 2X3FA 2G1UA 2REQB 1BYIA 4GSKA 3T15A 3D7RA 2OZLA 4DV2B 4XIJA 1YVUA 1P5HA 2IODA 2X5XA 1PX2A 1U9JA 1W2HA 3FNQA 3CG0A 3GFTA 4HATA 1QKKA 3ESBA 5AW4A 3L7CA 1FU4A 5DPMA 2ZBVA 4QFCA 4BPRA 2AWNA 2GPBA 4L4SA 4H7HA 4P4GA 4ZI7B 1DPFA 4JOQA 2PQ6A 4P3PA 2CNKA 5B1DA 5K6AA 3JD4A 1O8CA 4PLTA 5JYCA 1O77A 5CFNA 4DNPA 1V0JA 5F7JA 2GO1A 3D43A 2FTKE 3C16C 3QLVC 2FPLA 3QE2A 4AICA 2CMFA 2IT1A 5LQRA 2I1LA 3WXMA 4WA7A 2UZ4A 4WN3A 3FZEA 3OE7D 4Q4HB 2WLTA 3L4BC 4BNXA 2H65A 2VF7A 1TTTA 1JWLA 5JFOA 1W4AA 2AIRA 3SWWA 4KR7A 3IVGA 4FQ5A 1SQ6A 3EPPA 5LYJB 4PSVA 2QVZX 3T8YA 3U5TA 4IGEA 1OFGA 1FNDA 3GFRA 4RHTA 3NDBB 3JVDA 3NGMA 1NSTA 3HYNA 3JAWB 3U16A 2FHSA 4IJKA 2FMXA 5LQSA 2C99A 1E1NA 3EF0A 1NL3A 3DKKA 3ZLJA 2IGBA 1U28C 3ETNA 2FEMA 4M9ZA 5GIOE 1SPXA 2G28A 3UQYS 4QDKA 4IVPA 3DDSA 3T4PA 4F7WA 3L41A 1A5AB 1SKBA 3QENA 1M6HA 4QDOA 3LL4A 2C54A 3SMQA 4WPGA 5C4MA 3LM8A 1GUYA 4P5DA 5KTNA 3R7SA 1KYZA 4NZPA 1YONA 4BVHA 3EXIB 1P60A 4NH4A 4CQLB 4FFVA 3OHMA 2RH8A 4XX1A 3UXYA 1EFVB 1P6XA 1DKMA 3DVQX 3IEKA 3OOEA 4NKRA 4DUGA 3THWB 2AH5A 2IBSA 4JP3A 3I4LA 2OBXA 3AR2A 5EY5B 1GADO 2NV0A 4UZSA 2CJFA 4C20A 3FVWA 5LPNA 4M7WA 3Q3CA 1RYFA 2P78A 4P53A 1NW7A 3SM9A 5FTWA 1XD9A 1ZD8A 4G5HA 5LZ5A 3MRSA 3OQHA 4ZYYA 2O4UX 4ZOCA 5JCJA 2Q3DA 2OAQ1 1EDZA 2POCA 3LPMA 2UXDB 2YRWA 4M1ZA 2P9HA 1HC7A 2AKYA 4RL4A 4QUKA 4WDRA 5KMGA 1M34B 3EUEA 1JTFA 1QCDA 2WWFA 2CNLA 3M6VA 5JPCA 1DQPA 1MQ9A 1TGYA 1BMQA 1YZ3A 3CUYA 1QPGA 1EFTA 5GZ6A 3W8RA 2D3TA 4ZVPA 3OE1A 1W29A 4AO6A 2G5CA 3CZ5A 2UYCA 3QKWA 1QHYA 2GXUA 5CT4A 4E09A 3I6IA 3VNAA 1B00A 3NTLA 5D1NA 3SXUA 3RUHA 1FXSA 5BWOA 1YT5A 2P0AA 2HU5A 4OGGA 2GN4A 1T9ZA 3FD8A 3HB5X 2CDRA 3I73A 5FPPA 1RTTA 1NLUA 2IY9A 3HWWA 4ICIA 1CDZA 4UCXA 5DX0A 1E92A 2WMOB 2FFHA 4MRPA 3U7QA 3M1IA 4CG3A 2CXNA 1DEOA 4EUHA 2I99A 5E6UB 2PL5A 4OEHA 4Q34A 3W9YA 1NTRA 3OESA 4CF7A 2DB3A 3L8ZA 2W83A 4M9CA 4OXRA 2X0JA 1TJYA 1W5BA 3FWNA 3G2NA 5K0CA 3ZJUA 3CJTA 4PYIA 5COBA 3OCZA 1L5RA 3L0ZA 2VP3A 3WICA 4D98A 1F8YA 1H1LB 2FGJA 3LA8A 5EHGA 1BD3A 1G7SA 1R00A 2OO3A 3IAHA 3J7TA 3AI3A 3N0WA 4UAJA 4M7PA 3UT5A 1GPJA 3SKVA 2FF7A 2LDBA 2VF8A 4PHGA 3W5JA 3O9MA 1SVUA 1RP1A 2PSDA 3HCBA 5A71A 2Q46A 3O8OA 1RC1A 1ZSVA 3GVIA 3JWHA 4HPJB 2OA0A 4D74A 4AKGA 3FETA 1L4NA 3LCVB 2C7QA 4XD2A 3WQHA 3VQTA 4YMHA 1X3LA 1DTEA 3BILA 1CF2O 2Z5VA 4PANA 1U1IA 4D44A 2D7DA 1CP2A 3DE5X 2N42A 2PBRA 2QP4A 4LS3A 4MIYA 2RBEA 4G4SP 4F1JA 3R23A 2YOFA 1H0RA 1PW7A 3OPNA 5DF1A 5AKLA 2Q6VA 2AJCA 4YP6A 3UUEA 2VBFA 5CDSA 2CV0A 3A6JA 1J56A 1UBRS 2OGTA 3W4IA 3RK0A 4D6YA 3M6UA 1MJHA 4GPZA 3JQCA 1GT91 4RS4A 2HQ1A 1TKAA 1XUOA 3WB0A 4DJJA 1ORRA 4C6HA 4WN9A 4OYLA 1QZUA 3JY6A 4QQKA 4CIXA 4KAAA 2QPTA 3BB4A 1J2JA 3OO0A 5JCZA 2VDUE 1ZQ1A 5FOTA 4O0LA 1V8OA 3KKQA 3TQSA 4AMBA 4F5EA 1QDLB 4G5XA 1XK7A 4A6EA 1Q92A 3IVXA 1KJJA 1S2GA 1U3VA 2IIBA 4KQGA 4OUDA 4R40A 1X1RA 3RTCA 4C9BA 1M1UA 2QT0A 4RK4A 5FEUA 2LXNA 3PD7A 2KJQA 2OMKA 2PANA 2C4HA 3LY8A 1L3BA 3M83A 4P4SB 4RXTA 4JUIA 2XYRA 1CVIA 1A5ZA 5B3JC 5A7HA 3S99A 5MN4A 1E9VA 1XA0A 3FB1A 3RKRA 3O4JA 4Z7NB 2AN9A 5EMHA 1WXFA 1GDHA 4ATNA 2O52A 5AICA 1QH8A 4N3NA 3UAWA 1JEYB 3KXPA 4ZVVA 3DMTC 1H93A 4LJLA 5CLGA 3QM1A 3D2LA 2PZFA 1DAOA 2FMFA 3K6KA 4OMDA 5DP2A 4EIWA 3QX3A 1X80B 3T4UA 4QJBA 3PE4A 3HP4A 1NPYA 3PSAA 3WRXA 3F71A 1F48A 3I9V1 1W59A 2BKAA 2IEGA 4UM9B 1NVKA 4M8IA 4BNDB 1JPUA 4BVJA 3DCYA 3EQ7A 4LVUA 4AJ1A 3ZQJA 3ADKA 1YR6A 5A6SA 2EYUA 1DSSG 2C0PA 4PAMA 1S3SA 2RC5A 4FNMA 4NEHB 1Q19A 1N2CB 2QVLA 3BJMA 1C4KA 2H5IA 3DH0A 2QMZA 3TAXA 1U1CA 3C6YA 3K5WA 5EP1A 5J2UB 5IABA 1RZUA 2QPOA 1P8AA 4B3SB 4UHCA 1ISRA 2CLMB 3EE6A 4M1OA 2WRZA 3W2IA 2O4CA 4CCWA 4KPYA 4BBJA 4PHTA 3BYZA 4XYBA 4EGCB 3RM3A 3TQOA 2VXYA 5B6IA 2NO4A 4R8LA 5DHFA 1SBQA 2MYPA 3TD2A 2OZEA 2QL5A 1O89A 2IZOA 2VRCD 1X9HA 1LY1A 3GBPA 1MMFB 2ZB8A 4AZWA 1H1TA 4HRXA 3PNSA 5LP6B 4RHEA 4HP8A 3SBXA 4IDAA 1ZICA 3DE3X 3TWOA 3D3JA 5BSRA 1RQ2A 3P96A 1JX6A 1VJ0A 2SECE 2Y1EA 2D5AA 4IOKA 4RM3A 3DAOA 4MYCA 4XYEA 3RSOA 1LPMA 1U7ZA 4FDLA 1MXFA 3L5KA 1MDBA 3T7TA 1QOQB 2GZ1A 1H65A 3FMIA 3LJKA 4I55F 3RYIB 1Q16A 1NQUA 4IV5A 5JTTA 3CUKA 4C4AA 1D7AA 1LLCA 2FSVA 5DN6A 3C43A 2WUWE 3D0RA 2QMOA 3O74A 1BE0A 5TC4A 3QWIA 4R2IA 4FE3A 5CP8A 2E37A 1UXIA 3DOJA 2QROA 2JLQA 2HSJA 2JLRA 2XXBA 1WXIA 3GAFA 4LRYA 3RO7A 1E3MA 5ILQA 5ALJA 4D3XA 4QOJA 3KTAB 3DVLA 4LF6B 3L7AA 3TPCA 4PG8A 5BN4B 4XEHA 3PGMA 4KOAA 2OECA 5EI5A 5KAPA 3VKGA 3U9LA 2BM8A 4ENSA 1B73A 1RMTA 5ICFA 1C7QA 2Z2XA 3A3OA 4TLDA 3B5EA 1IN5A 1SUBA 4YWJA 4RPLA 1OYWA 1C9YA 3PFWO 1DO8A 1EJ0A 4IKOA 3EGDA 3L0DA 2OT3B 4BV3A 1VI5A 3IP3A 3FRIA 4XZ3A 3LH5A 2WUGA 4G1VA 1IHPA 1NQTA 3DE2X 4PCAA 1ZW1A 3TVYA 3GJ5A 4NJEB 3ETDA 3T5PA 4HGQA 2LVBA 4INPA 3O8LA 1PQWA 3FYUB 5JZVA 1JKJB 2Z9BA 3PXUA 1E8DA 2MDTA 5B53A 3ZXUB 4YIHA 4QARA 1YZTA 2CL6X 1TRHA 5AUQA 3RJMA 3ENQA 1L7OA 2XMZA 1ACLA 2GESA 2G9ZA 3COZA 4M37A 1D6SA 3WIUA 3LXUX 3L49A 1G8GA 4AG5A 4BB6A 1L5YA 2VDOB 2XVXA 3JU3A 4CTKA 3BAZA 1I0IA 1X1CA 2YXEA 1YRLA 1YS2X 1ODIA 3KSRA 4OI2A 4PLVA 2O06A 3KZMA 4YN3A 3GHYA 3V8EA 3ZJYA 4EMTA 1VCOA 1NYRA 1ODSA 3GDWA 1RD4A 1BXZA 3R7AA 2YJ4A 4MKHA 1E2GA 4UU8A 3VUEA 3WGHA 1X2BA 5JISA 3HJCA 4RETA 4ZEWA 1FVOA 5LJLA 4HWKA 5A3JA 2FJ0A 4KKXB 3OWXA 1A9YA 1U0SY 2O07A 1W4BA 1MGOA 2WSLA 4YB8A 5DKFA 4MWDA 5JLAA 4JWKA 3U4QA 4Y9RA 5K6TA 3PPVA 4H7JA 3REQA 4ZCRA 6PFKA 2BGKA 3KAJA 1GTVA 4Z1OA 3AU9A 1PRYA 3JR7A 2H06A 2AOTB 2PRSA 3CFYA 3HUDA 3NHSA 2PUJA 5CR9A 2WVAA 2YFQA 4W5NA 2B34A 1V11A 2PBFA 5M29A 4RKRA 1FDTA 3CPHA 5KTPA 5GONB 1FDRA 3RASA 5CM8B 2Z08A 3GJTA 2H7CA 3Q1LA 3Q3GE 4DDHA 1JDPA 1RYBA 1YGYA 1CQZA 4KIJA 3NOXA 4JBHA 1CW2B 4EX6A 3IODA 2IZ0A 4UDOA 3TB4A 3ZI4A 1Q7BA 3JXEA 5A1TA 1Z7BA 4DVGA 1PJBA 1KJ8A 4KVZA 5L95A 3WNCA 3V97A 3HABA 4BDSA 1XDUA 1OA0A 1YS7A 2DT8A 4YJGB 2IYQA 4CWAA 1ICEA 1J97A 2Q1YA 5C32A 4AF8A 3OT5A 4URZR 2REBA 3HGMA 3RFXA 4G9GA 2HY7A 1S1MA 1K63A 5EVJA 2DR3A 1IXZA 4FN5A 3H0EA 4R2XA 2QTMA 4NXNB 3AJDA 4UHHA 1S7CA 1X7XB 2AC2A 3LKBA 5TY0A 1SPBS 4DV1B 4LG1A 3MB8A 3O90A 4JP1A 3KT8A 5SY4A 4RHUA 4ZKDA 1HYEA 5B12A 3KJNA 2ZXEA 3S2UA 3G1UA 1L5NA 1VZ3A 2ISCA 4LI3X 3TTXA 3WYBA 5EE0A 4KHZA 1LWOA 3WK5A 4JUFA 2RFLA 1QO7A 4IUBS 4IIBA 2CNNA 4EJ6A 1DKPA 3T7RA 1SHKA 3UG7A 2R8EA 2VJPA 4EB6A 2F3RA 4F1WA 1Y1LA 2F8TA 2JIDA 5F1PA 1PTKA 2MSNA 3CHYA 4I1OA 1X8LA 5E1MA 4RS3A 1JSRA 3E2IA 3FE2A 3I6BA 2DPXA 3QJGA 2DHEA 3QH4A 3HKCB 3RVBA 2VRWA 4G37A 1AH2A 1G64A 1W581 2X86A 5EUQB 5B1IA 1SVOA 1RWVA 2QLNA 1YR2A 1N9GB 1TJPB 4G1FA 2YBDA 1RHKA 4RZUA 5LP6C 1FMTA 3LKVA 2XT6A 4JLUA 1SBYA 5JNUA 3LXRA 2VUIB 5SV2A 4ETNA 3BN3A 3PICA 3NNDA 1JT9A 3VJRA 3R7DA 1KJZA