2AF4C

Phosphotransacetylase from methanosarcina thermophila co-crystallized with coenzyme a
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
332
structure length
331
Chain Sequence
b'VTFLEKISERAKKLNKTIALPETEDIRTLQAAAKILERGIADIVLVGNEADIKALAGDLDLSKAKIVDPKTYEKKDEYINAFYELRKHKGITLENAAEIMSDYVYFAVMMAKLGEVDGVVSGAAHSSSDTLRPAVQIVKTAKGAALASAFFIISVPDEYGSDGTFLFADSGMVEMPSVEDVANIAVISAKTFELLVQDVPKVAMLSYSTKGSAKSKLTEATIASTKLAQELAPDIAIDGELQVDAAIVPKVAASKAPGSPVAGKANVFIFPDLNCGNIAYKIAQRLAKAEAYGPITQGLAKPINDLSRGCSDEDIVGAVAITCVQAAAQDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphate acetyltransferase
publication title Structural and functional studies suggest a catalytic mechanism for the phosphotransacetylase from Methanosarcina thermophila.
pubmed doi rcsb
source organism Methanosarcina thermophila
molecule tags Transferase
total genus 116
structure length 331
sequence length 332
chains with identical sequence D
ec nomenclature ec 2.3.1.8: Phosphate acetyltransferase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01515 PTA_PTB Phosphate acetyl/butaryl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10750 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isocitrate/Isopropylmalate dehydrogenase-like 2af4C02
3.40.50.10950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2af4C01
1QZTA 1XCOA 2AF3C 1R5JA 2AF4C 4E4RA 1TD9A 1VMIA
chains in the Genus database with same CATH superfamily
3KR0A 3I53A 4UTOA 3T4UA 5GZ1A 4DG8A 2H1RA 4XFDA 3QUTA 2V6JA 4XASA 2GM9A 4D8UA 3TSYA 4MAFA 4EPRA 3EPKA 5C2JB 5AM3A 3FNIA 1BE6A 2H92A 1B41A 4R2KA 3WADA 2HF9A 4JLMA 4Q0MA 1M1NA 3ZCPA 4YDSA 4RTJA 2VTKA 2G9RA 2J3QA 3OLZA 1MPTA 2D2IA 1AUXA 1ZCJA 4CI9A 1TAGA 5KVAA 1PNRA 4TTTS 1DIOB 2JI9A 1DBRA 1TIPA 4Q4HB 4AKTA 4PWYA 5CRIA 3AI1A 5CW2A 3RVMA 3S1AA 1YZQA 4V02A 1TQ8A 2OV2A 3BX1A 4KXNA 1KHTA 1WPQA 3A4TA 1EHIA 2YQZA 2YY5A 3PF8A 3TL6A 1B6TA 3UB2A 4GOLD 2RG7A 3A7EA 5FOXA 4EMSA 1NJGA 4D9IA 3BTVA 3HN6A 1US8A 1V5EA 1FEZA 5GINE 5MN5A 3QE0A 1N9ZA 4BC1A 5IKEA 3ZZNA 6AT1A 3AUFA 3SS9X 2D13A 4KVZA 5BW6B 2XT9A 3C0KA 3U26A 4PTZA 1JU9A 3C3PA 1VKHA 4E31A 5U9CA 1Z6QA 5FNZA 3UUFA 1GO2A 2BFBA 5ETJA 1OAKA 3H5NA 2XKKA 2G5PA 3F6RA 4GECA 4O4HA 2Q3JA 4WBNF 4Z0TA 3DT8A 4BXOA 4EB0A 1N3LA 2R3SA 1LJ8A 4O6VA 5HMMA 3G6WA 3HR8A 2R44A 4FFRA 1B8VA 4RJLA 3UKDA 5T41A 5IKOA 1LJUA 2ZWAA 3ORHA 4RELA 3WG9A 4Q4JB 4LF9B 2BMAA 4DV7B 2P75A 3H42B 2R5FA 1RWMA 1W44A 1WS6A 4U7JA 1Y1KE 2FP4B 5DHPA 3U1BA 1VI5A 2V7GA 4W5WA 3MERA 3PE3A 4QPZA 5FLXA 3GGOA 1HQDA 3D7MA 3I9OA 1Y8ZA 1U5BA 3RSZA 2NO9A 3OZFA 5EE3A 5JBNA 4MITA 1R8XA 3PQDA 3Q6IA 1IHDA 3QYPA 2RB4A 1CY7A 3AW9A 4YJGB 3WGZA 4XKJA 4ZVRA 1FDUA 2GPNA 2A84A 2XGJA 3KXLA 4PIPA 4DC0A 2JIDA 4NMWA 4G09A 1FU8A 1KMMA 8AT1A 4PZ9A 5ELLA 3V4LA 3DL4A 3VSAA 1GNTA 3KYDB 4I6JA 4LNUB 2JASA 2O7VA 1SVWA 2PYIA 3QBEA 3WICA 4D74A 4P58A 4RKWA 3RJTA 3TLZA 2EKZA 3FOBA 1ZH0A 3T3MB 2HSJA 1BYUA 2C82A 3NALA 1KZGB 4RMHA 5H3CA 1PV1A 3UK6A 5F21A 4GPTA 4WX2B 2IS4A 5D6OA 5AMXA 3T7DA 3VJKA 3DWGA 3WK9A 5EWLB 3SZ3A 3N2GB 3NTUA 4AAYA 3T5PA 2M98A 4KO3S 5IARA 1PTJC 4UAUA 1AKYA 2PMFA 1OGYA 3VU9A 2GEJA 1ESCA 3CONA 1ILWA 1XEAA 3JALA 3P1JA 3IQFA 2JH8A 3VAAA 4E22A 1N2XA 1DXOA 4AJ9A 1J2RA 4NYIR 2VDWA 2ZYSA 3HY3A 1QMPA 2RIRA 1UUFA 1UJ5A 2FEKA 2OBFA 2R4TA 3OEHA 4WK4B 3AH8A 3S2UA 4RTKA 3ZQKA 3HCDA 1LZLA 1YAJA 2C99A 3UENA 3U19A 2QTLA 5LYYA 4RVNA 4YPOA 3RC2A 1JKFA 1ULAA 2QL9A 3B9PA 3EVZA 1VSVA 5KQPA 3OQJA 5BRNA 1EFUA 1IQRA 1DQZA 4WXRA 2ODNA 2LCQA 4EUHA 1PWHA 4F1WA 2QORA 4MULA 5H8WA 2W83A 3V8QA 2W6MA 4YMIA 4KYVA 1GZVA 1ND5A 3DGFC 3NTXA 4NYJR 3MT8A 3RBAA 4MRPA 1FU4A 1XEFA 3AIIA 4HGQA 5T4EA 4HUQA 5BR7A 2DF8A 1QRDA 3I9FA 3MMPA 4EA9A 3A4NA 1V6AA 1JHXA 5DP2A 1J33A 3X1YA 2UV8A 3PQ6A 3TG2A 1MO6A 1DBQA 1SKYB 2G0NA 2IUYA 2JFUA 5EJFA 5IC5A 2JJ2A 4D96A 2DFDA 5IWCA 2F3TA 3U61B 1X8JA 1OW3B 3KB6A 4GMHA 1KOGA 1TYZA 1WHTB 3WO1A 4HVLA 3JQ7A 3E9YA 4D8VA 1NZJA 2XYVA 1GLVA 4MYHA 4BWGA 1P0QA 1TU4A 4EPVA 4YWJA 2ZRMA 3BD8A 4LC0A 4A27A 2V7TA 3NIBA 4S0XA 4Q05A 3KJXA 2NXCA 1XEWX 2VP0A 4UUPA 1W36B 1SZPA 3A2NA 3DDCA 1WVMA 1E5LA 1JR3D 1PJQA 2WE8A 2XYRA 4D3SA 3ON5A 2RCYA 3W5BA 2NVBA 4C0XA 1JEDA 1U2PA 5G0VA 4QKQA 2GCOA 2OCPA 2I4RA 5B6PA 1DV1A 3FIJA 5HE8A 3ZIUA 2AC2A 3CE6A 4MCJA 2IU0A 1TEZA 5AVVA 3CGGA 4RD2A 4GP6A 3STXA 2C5AA 5AW7A 1PG2A 4L8FA 3TAXA 1U7PA 3CVYA 4KR0A 1A3CA 1AKRA 4COKA 3AXSA 1GGNA 5JI2E 2VTEA 2IA5A 1U7UA 3FHLA 3FMGA 1LTQA 4BE4A 1C81A 3DZ8A 3O95A 1JNYA 1MENA 2F43A 1RWPA 2GJ4A 5FOQA 2HUNA 2P3OA 2IRWA 1ZMBA 2HBRA 3HGQA 1ARZA 1SC4A 3TAHA 3AY6A 2FZ5A 4C05A 4GX1A 1Z22A 1TM5E 3IEIA 2YHBA 1SD2A 1XCBA 3ME5A 2GBPA 4GS5A 3GVPA 4FGUA 4OKSA 2WFLA 3TN7A 1OX5A 2ASEA 5KVSA 1ZVVA 1PGJA 1ZM9A 1QWSA 3R6LA 3C7AA 4IQ8A 4LJKA 4UAJA 1FF9A 2G71A 4B7AA 3GXBA 2WKRA 1ZAKA 2XUGA 2P4EA 3NUQA 4O1MA 3U9SA 1A0OA 3RRFA 5BR1A 5C5IA 4UVDA 1FZQA 1MDFA 4U00A 1YHYA 3G2MA 2C3MA 1YJAA 4HQOA 4D0NA 1NMYA 2V0CA 2C8VA 2EYUA 4JLJA 1C0KA 3RS0A 4KLCA 5AK5A 4B87A 1MB2A 1U9IA 2XUHA 3ABQB 4L9SA 5FWYB 4JJEA 1UBNA 1PX2A 4NCBA 1UZAA 1P2GA 3RUAA 1EYZA 4L0MA 5E1MA 5C8YB 5JIBA 3IUSA 1LLUA 4N0EA 2VSQA 4A8PA 2EFJA 3PJFA 4F5DA 3CCCA 5HUQA 3UUWA 1LK5A 3SFTA 2QUBA 1HETA 1KBOA 1WRBA 1PSZA 4WH0A 2QRVA 1KJJA 1V7ZA 4ISBA 5FUVA 4FZ5A 5EXPA 2PKQP 2GM5A 4QDTA 4AZTA 4FE7A 5DMHA 3EMBA 5F3WB 1FC0A 3LX8A 4G9EA 4PGHA 3GLGB 1RLIA 1NI4A 3NG1A 3FA2A 4JP3A 4OJNA 4X6XA 5FWAA 1MF7A 5ALDA 1NI3A 4WNIA 4E88A 2C0QA 2COUA 5CH3A 3EZ6A 3H87A 3VOBA 1GQOA 4ZK2A 1G18A 1M2HA 1KZ6A 4ND1A 4XPZA 4JV5B 2YZGA 4EAQA 3ERCA 3PFWO 1OXBB 4WXPA 4E70A 1NVFA 4YLYA 1NRXA 5AFSA 2ZBFA 1NC1A 2VH2A 2WD9A 2HQ1A 1YRWA 4WESA 4Q9LA 3ZXUB 1VYTA 4Z4IA 1G19A 1TEVA 1YUMA 3HDYA 3U7JA 4LVOA 1K98A 4DPMA 2VQFB 5CA1F 1IU9A 2YINC 5DJ5A 1RXIA 2L18A 1EE2A 4YAEA 2HBQA 2ZLBA 2A7QA 2VA8A 3PPIA 3K3PA 4DTCA 1O95D 3DF7A 1KJWA 4HEJA 3KD2A 3OT1A 3HV2A 2ZVQX 4ZO8A 1ZUNB 1JSRA 1NYLA 1SKMA 4GG1A 2O54A 1OXUA 3L7MA 4QHSA 5EIAA 1X7ZA 5IU6A 4K9KA 4TTIA 2I29A 3WO0A 2QAJA 4JQYA 4B7CA 1CRPA 3IP9A 4IVPA 1Z7GA 1KO1A 2XT0A 3IHWA 3OEED 3CIOA 2QZSA 1BNCA 3BRSA 3DAPA 1ZD2P 1R9NA 4FWIB 4IO0A 4DJ5X 4EUNA 1G5RA 1GPBA 1XKLA 5A0TA 4N9QA 1PR3A 4PXYA 1W4CA 4ERXA 4RQAA 4WI1A 4AY3A 1SUSA 3VR4D 3R5FA 2JBAB 3MF4A 1IOLA 2GJKA 2CD9A 1P3JA 4ILEA 4PFJA 4B8YA 4DLAA 5K0BA 5THQA 2BFOA 1AB6A 5E2IA 1HYEA 2FPGA 4IZIA 1P0MA 1NE2A 1VHWA 4R1SA 5F3RA 4XVQA 3ZU5A 1UDBA 4F4IA 3NIFB 4QBKA 3D31A 2B4KA 3VVBA 1XCMA 5DXAA 3IERA 2O57A 4S3MA 1QC5B 4BIIA 2A9FA 5FHQA 4IL5A 2IZ7A 1J8YF 1E9SA 5K4HA 1NFRA 2WTAA 4QM7A 3FB4A 1Y1SA 1XZPA 2QVZX 1PQ4A 4KXWA 4DAOA 1Z15A 3IT0A 4ARVA 2GSWA 1BVHA 1NMXA 2A58A 1I4LD 4I66A 1SCUA 1EX1A 1JKJB 2VQ3A 2XTMA 4J0EA 4KO8A 3RRMA 3E9ZA 1JEOA 5H7XA 4ZT4A 4AK9A 2YWBA 4PZ0A 4WOKA 4DDHA 4AQ7A 1HTTA 5TPWB 1DIGA 1T25A 4Q9JA 3QTLA 3OMWA 3GNQA 3HBNA 4PICA 1MHTA 4BFXA 3Q3VA 1UQRA 2WM3A 5EVJA 4F60A 4L22A 3UYLA 5DHUA 5JFTA 1SWWA 4BX2A 1DKMA 3PR2B 3A6PC 2LE0A 2Z4TA 4JLAA 1N0VC 3CLKA 5DNUA 2JIOA 4AIRA 2PXAA 3WQBA 1WZNA 2QN2A 2CEKA 1Z36A 3K4HA 3VI4B 3USCS 2HRDA 4BTLA 4YRBA 1RQ2A 4NNOA 5ALIA 3UPTA 3H5AA 2GXAA 2PUJA 1G9TA 3LV8A 4WBNB 3FTCA 1K5HA 2W0MA 3EF3A 2MR5A 4ZO4A 2R7AA 5FLEX 1I5EA 2G8LA 1GLGA 4K46A 3MAJA 2CWWA 1V25A 2RAVA 5G0TA 3PFHA 1P2DA 4KV7A 1N57A 3WGMA 1H94A 1NF8A 3PXDA 4OFWA 1Q1BA 1QO0D 1Q17A 2O2JA 1JILA 3PGJA 4TQUS 1MHPA 4MGKR 2IPMA 3DFFA 1LBTA 2OQIA 3D2AA 4F4JA 3DZJA 1KSFX 1PR1A 1QF9A 3WLJA 2VUUA 3T7CA 3QX3A 1NVVQ 4OHPA 3FOCA 3NWBA 3VDQA 4ODIA 2XUFA 1H0HA 3O84A 1L7XA 1HG0A 3GLTA 2JLWA 5HJ7A 1IN1A 1U02A 2FY8A 2WA1A 3INYA 1BXGB 3T38A 3RG2A 1W96A 4DOMA 3FR8A 1OV4A 1GZUA 1EVKA 1OX4B 1P9WA 3GF4A 2O5RA 2ZDQA 3QBTA 2B9EA 3QVWA 4LI0A 4PNZA 3O7MA 1H8ED 2HLPA 3VZDA 4AJIA 5KQSA 2A1UB 3AM5A 4K6CA 5CU7A 3UJ3X 4DBLE 1G8JA 3PGVA 3TSAA 1GM5A 1GPMA 1LJLA 4ILKA 4Q3CA 4FYXA 2XNHA 4YCAA 3WMXA 1F7UA 1CZOA 5JH7A 2VWQA 4TVSA 1O94D 5JS8A 1BSVA 1S89A 2Q1TA 4M89A 3OD1A 1XMQB 3WMWA 1ISGA 2B1QA 1XNJA 4K86A 2PKRA 1YL7A 2P4HX 2BFCB 3KALA 4HGNA 1YR3A 2BEUA 1NASA 2JATA 2XGSA 3I8OA 3LPLA 1CERA 4ZC8A 2CXSA 2EFHB 3O9ZA 2BYTA 4WOBA 1YQWA 1X1QA 2IFTA 2UVDA 1LPMA 5F5LA 3ZWVA 4EMUA 4I4TA 5JVDF 4F2GA 1GUAA 1NQWA 1X0VA 2HHHB 2HUPA 1GG2A 2X22A 4BZPA 5KHOC 2RGRA 1MU0A 3AR6A 1YCGA 1KXZA 4JVSB 2V65A 2FUG1 4BQNA 4GICA 2PH1A 1YNSA 2D1FA 3A14A 4MUIA 1XTJA 4QNNA 3D64A 5ALKA 1G8MA 1Y3FE 3B6KA 4B2LA 4I19A 1BDHA 1E2UA 3JATB 5DBEX 2HXGA 5EPEA 2X0JA 4R2MA 5LLSA 2DH6A 2EF0A 2Q29A 4R2JA 3URKA 4DLBA 3TX6A 4CM3A 5T6MA 1I3OA 1SXJB 2BIFA 4NBVA 3RUIA 2FUG6 2HT6A 4E5MA 2XR1A 5K3FA 5FPTA 4B34A 3OA2A 2HHLA 1TQDA 2BLNA 4RVDA 2ZJYA 2RBGA 2ZRCA 1GN8A 1JDVA 1Y5RA 4G1FA 1XDWA 5LXTF 4ZYZA 3H0EA 3J81k 2CHUA 5LZ9A 4BTEA 3ZV6A 5JSZA 4B0PA 1PSWA 4IY1A 1Y81A 1I7SB 1QVVA 3R9WA 2BGWA 2IX9A 3EUFA 2FUNB 4G5QA 3RVQA 1E96A 5J1SB 3V4VB 1VZ3A 3DE6X 3JD2A 3O1JC 1DKPA 4X6LA 5T4BA 3A1TA 4R0MA 3D3JA 3D43A 3IUPA 5ALSA 3KXPA 4R8SA 3P2IA 5EIFA 3N76A 3WV4A 2WKPA 3A04A 3RYHB 3H9BA 2RHCA 3T12A 1JMYA 1GQYA 1QH8B 4P08A 3X2SA 1DAHA 2AG0A 5CLFA 5GVSA 2VNKA 2DQ4A 1RRPA 2G5TA 1H85A 1TVKA 2BHNA 2E4ZA 3FYDA 3TIFA 3CPHA 2DJIA 5C7OO 4X8OA 3EYWA 2IBMA 4NFHA 3CX8A 3TCKA 1W9HA 4X54A 5LZ4A 1T0JB 3LXUX 4QPDA 1O4VA 3PDIA 1YZVA 3OQ6A 3JAKA 3AUXA 4WN9A 3RC9A 2HMUA 4GSKA 4QFDA 2L2QA 3ITDA 4C29A 4YRNA 2FMFA 4M1SA 3WIEA 3C3JA 4B7ZA 2ZM5A 1IONA 1R5OA 1ADBA 2D74A 2QTBA 1NQOA 3EA0A 4C78A 4RETA 4E5NA 4FCCA 1CNMA 1YRQA 1CJBA 5EUMA 1RQPA 1ORTA 3IDZA 4X20B 4MQEB 2BTEA 3RTDA 4I4CA 5HTOA 1KR5A 1IY2A 1A5SB 2WB2A 2LW7A 4TS9A 3KOOA 2W8ZA 4P4GA 3UJDA 3RSHA 3DUWA 4D9BA 2R00A 4TLEA 1L4LA 1U2RA 3QVLA 5FULA 1F4VA 4CIBA 2FJ0A 2ACVA 3E3AA 3GVCA 3WHLA 5EIEA 3S8EA 2PS3A 4ESOA 1KXJA 2AOTA 3O0TA 1LCIA 1CP3A 1M5TA 3OWHA 3GNTA 3QFSA 4BMZA 5EP1A 4KQFA 4BV3A 3ESYA 1SUBA 3STVA 3H9GA 5ERYA 4DLZA 2ZJFA 2GGSA 2BV3A 2DHEA 3EQ8A 4LYDA 3A2MA 5DK6A 2YIDA 3GJ4A 3H9QA 3HEAA 1QTNA 3K09C 4YJ2F 1WXQA 1QQAA 2XWBF 4OIMA 4U7PB 2REXB 3SF0A 4BLRA 4DQXA 4HRYA 4LE2A 1PEAA 2OZLA 4OQNA 1KIAA 2RGCA 3EUWA 3DKRA 5F77A 3OO0A 5B3AA 2EQAA 5FJJA 1KAHA 4AWBA 5FX2A 4AU1A 2WWHA 2YWHA 4WZAE 4I55B 2Z8YA 1KFKB 4DSNA 1V1MA 1RAFA 3VYTB 1NKTA 2WABA 1OD6A 3O2SB 4KQWA 4XYMA 5AKXA 2OHHA 3HKEB 4A0QA 4IOMA 3WQSB 1XLUA 5TMBA 5CFQA 5HZMA 2R8XA 4WLOA 3SYLA 5B4VA 5KJEA 4F96A 2ZQYA 2Z98A 2J4FA 3VPDA 2XOKD 1ZX1A 1VG9B 3EVDA 2C2MA 2W2VA 3FE2A 1U3VA 2W6CX 1ANKA 1NSYA 4OHXA 3CKMA 1C9DB 1ZEMA 1JDBC 4P5EA 3S2IA 3W5SA 1E7SA 4FR0A 5G53C 3T35A 2H1WA 5B30A 1SJ9A 4XJSA 2WJGA 2V3CC 1H65A 4KGDA 5CK5A 1GXSB 2AUNA 1IL0A 3TZEA 5KKCA 3JD0A 3OX4A 2LCIA 2D7DA 2I22A 2NZ2A 3RG8A 4OBBA 4C4OA 3BRQA 3EZ7A 1LFDB 1TA4A 3D4IA 2O20A 1NIPA 1ABBA 1ZSYA 2H29A 4YO8A 1ODIA 4ZDWA 1EMDA 1PK9A 3CX3A 3CMMA 5LWHA 2CL0X 4QUAA 3JSXA 421PA 4EY5A 3IBTA 4RHUA 3BSWA 3UC5A 2ISQA 3B82A 5KTMA 4U3JA 5A0VA 2XLBA 3VR3A 2PZAA 4A82A 3IVCA 3PT5A 4L2IA 4GOMD 4XWWA 4YQFA 2DVMA 4Q1FA 5AXBA 3QXXA 3B9BA 3MJRA 4XVCA 5FNVF 4OOEA 1PX0A 1CF9A 3JZIA 2FJUA 3TZQA 5M2QA 5IFKA 1C3OA 3G2HA 4NBUA 2B83A 2C1ZA 2VL7A 5JV5A 2J0SA 1JFSA 4AUKA 1DXHA 2WYOA 3DVSX 3O91A 3QOXA 3UWSA 4NFLA 3S4YA 1IHUA 3EULA 3VXKA 2DTXA 5I9TA 1KO8A 1OWPA 4CIYA 4CMKA 4EJFA 1SELA 2D0DA 3MWEB 4GOJA 5H02A 1OBFO 2EHDA 1GPUA 4WJLA 1V9CA 1JBQA 2Q1SA 3L0SA 5EIWA 1ZHOA 4B3IA 2DPXA 3SSMA 5A7GA 4WWHA 3VUEA 1EXWA 2BKXA 3IVXA 2VF7A 3A25A 3PX3A 5DKFA 2D5CA 1OKKA 1W85B 4O4JF 4ZJZA 4ETIA 1GSOA 1T0UA 1TGYA 3ORQA 4ZPXA 5TB5A 2BKLA 3NXSA 5EFZA 5HKAA 1C0EA 3E35A 1TTQB 3BERA 2HDNB 3KTDA 4G97A 3PEEA 1YB4A 3M9WA 1KI6B 2H2WA 1BD4A 2HEGA 2LPMA 2ZRHA 3P32A 4JJFA 5BYBA 3RYCB 2RCNA 1NNUA 5NULA 2JJ1D 4F6CA 1PQYA 4UHDA 1AKVA 3D4LA 4MJ3A 1Z2CA 3T9CA 4H60A 1ZH6A 3OQVA 4G85A 4UOZA 2B5WA 1ISHA 3NOQA 1UIRA 1M9NA 1XU7A 3JD4A 1P2SA 4RLHA 3G5TA 2WJ4A 2CNLA 3QKSB 2IYYA 4ZU1X 1I7LA 2R11A 1Z38A 3MOGA 3ICQB 3DULA 1E3JA 2QMQA 5IJAA 5J63A 1GPKA 1JG6A 1YWGO 2W6JA 1NSTA 3OCWA 1LVGA 2BFNA 3EEYA 3R1IA 1T3ZA 4L4SA 4A1FA 5FTKA 3PFCA 5CH5A 3MQ4A 1LPSA 2PKCA 4P3OA 1FSSA 1ULZA 4S1WA 2G1JA 3HVIA 5HIJA 2QL5A 2WSSD 4UMVA 4WNYA 3WZLA 3B85A 3FN4A 3HVJA 3N0VA 4TQAA 2A9PA 4AJ2A 5HFJA 3H2IA 2VG8A 4FMCF 1KEWA 4NU0A 1AS3A 3LCCA 4DCMA 3P9CA 2O59A 3RKUA 1T6NA 2XI4A 1IUOA 4FJ1A 1L5YA 1N1EA 1VHQA 3PG5A 4NFSA 4ZOBA 4AG3A 4DYHA 4Z7OB 5JAUA 1CNEA 4R7TA 4X61A 4FQ8A 1Z25A 5SV2A 5ABPA 4EEZA 1YS2X 4QJ5A 2AVDA 3HGTA 3AF4A 4OGLA 3EYAA 3LLVA 1Y34E 4JJ8A 3U39A 4KQ6A 2XXBA 2JW5A 9ATCA 3DR5A 1JQLB 4B40A 5KWSA 2Z04A 521PA 1U0EA 3JVIA 3A6EA 2XBMA 1ZOPA 1LB1B 2ZJ4A 2O2IA 1X74A 1Y8RA 1K68A 1D2HA 2AJ8A 2EKPA 3JQGB 3Q98A 3IT3A 4KIFA 4L5YA 3EBPA 3FPEA 3T8YA 4BQFA 4DIMA 1IN4A 5A3RA 2PQ0A 1I7NA 2D6FA 1FOEB 3R7NA 4MRMB 3Q5GA 2E4XA 5ICGA 3R7BA 1T36B 4LWPA 3VNUA 4JBXA 2D2EA 3F96A 1HORA 4JBIA 2W93A 1T8TA 5BXQC 2PK3A 4WV3A 1PFKA 3JARA 1NVAA 2AJTA 5ESWA 1JMVA 2B4QA 2P4UA 1YI8A 1GHTA 2IHUA 1O5TA 2HWYA 2AEJA 2VCHA 3GAAA 4J7AA 4CODB 1DJLA 1G20B 1R8QA 5JCZA 4BFZA 1FDSA 1HH4A 3KL4A 3AVYA 2FF5A 1D5CA 3OECA 2AYYA 3QX7A 3L41A 5IBRA 4XIJA 1V3QE 1Z0FA 4Y2UA 2WAAA 3T7EA 5KDOA 1XRRA 1UWVA 1V1RB 4OB8A 3V6LA 3L7KA 1W19A 2Z30A 4RY2A 1UBUS 1DTWA 2HAEA 1USWA 1YIDA 3PCRB 3RYIB 3VPSA 1V48A 4EW6A 4HFRA 3D7NA 4G26A 3UB3A 4M37A 1QU2A 2WINI 4JLPA 5J3JA 4DSOA 1EHCA 2ERCA 1VFPA 2HK6A 2JGMA 3GPBA 3ZCUA 1SCAA 1TAQA 5BSMA 4CGYA 4C4XA 3C3DA 2CHFA 1FYXA 5LXTB 4KPYA 4GL2A 1ODFA 3PFFA 3EF0A 2V03A 5UKDA 2UXDB 1DSSG 3GT0A 4XD7A 4B17A 2UAGA 2KI5A 5JTUA 1JKXA 2I3ZA 1YL5A 4ZEWA 2OBXA 3TQRA 5K0NA 2GEFA 1TM3E 1P74A 1YACA 1FFXA 4JBWA 4QOIA 5L3SA 1QHXA 3FOAA 4LXXA 3HDVA 5DSZA 3MWDA 1T5IA 2QS9A 2H06A 4DMRA 3CUYA 3B51X 1Y37A 4PZLA 1XZQA 2MHCA 2YWGA 3I0ZA 2EKBA 3ZD7A 3CU5A 3FSJX 5DGTA 3SHWA 3I09A 2X8JA 9ABPA 3SX0A 5JSQA 2PFGA 4UTXA 2Q4OA 3JVDA 2V7PA 4Q3AA 4QVKA 4QYMA 2VBFA 3R23A 3DE5X 1E20A 1P0FA 3TLEA 2PKEA 4F84A 5IM5A 4Q39A 4KQHA 1QQ5A 2CVZA 2Y99A 3BHIA 3JAMA 3MGAA 2JFZA 4X7RA 1U2DA 1AK9A 5D84A 1CNFA 3FNFA 2O2YA 3FDJA 3ORFA 4AX4A 1NUPA 2JDID 1JQAA 2QRLA 1RC0A 4GXNA 2B92A 3DLIA 2WT9A 2ZXEA 3GBSA 2HPZA 2GK7A 3O38A 4G1EB 1UPBA 5AVKA 4C0HA 1J39A 1MRZA 2OCIA 3JQDA 4ENWA 2G9NA 1UBHS 4NK4A 3DUFB 2PIDA 4H6WA 5CJ2A 1CDZA 1VIMA 2RI6A 2HIGA 2CNOA 2R6R1 2Y93A 3JQBC 4DA9A 4IKOA 1SQ0A 1L5HB 121PA 1KJQA 1VECA 4AJNA 4AMVA 3X1JA 3A26A 3NETA 1UM8A 3GUYA 2VYVA 1WW2A 5KDLA 1AY0A 1U8EA 4FE4A 4GX5A 3IOYA 4D5GA 1D1SA 3CF2A 1E6KA 4UC0A 1CE8A 3NDBB 2P78A 2GZHA 2Z3WA 1G8HA 2WE7A 2IH5A 1DFIA 2Y4NA 3NHAA 3NR2A 2IOFK 2VRCA 3ONWA 4MMZB 1DJMA 1BW9A 2FLWA 1EIWA 3H11B 1GRRA 3EWNA 3ZY6A 1ISIA 1IEXA 4NVRA 1NGSA 2PUCA 4W5JA 3CF0A 2ZBQA 3C6BA 4K9SA 2GNPA 4UEQA 2DWPA 2EYQA 2J9YB 2OGZA 2R48A 1T9DA 4GLOA 4B09A 3E18A 3WXBA 4PYJA 2CXTA 4QOGA 4UXJA 1F4PA 2AFHA 1XALA 2Q2VA 5E7IA 3DCJA 5BOSB 5HR5A 1ZH8A 4ENSA 2P1ZA 2NSJA 9GPBA 1Z13A 2DEUA 1Z6ZA 2CB9A 2C2XA 4QUHA 5F12A 1BHQ1 2WHQA 3PSAA 2E7ZA 1YAHA 2Q6OA 2WTBA 4JNCA 3TPZA 3GA0A 3CVJA 5AOAA 4CDGA 3GJTA 3M3DA 2M1XA 4WZ6A 1ETUA 4AF7A 3QJGA 3NHBA 3SE0A 3ZW8A 5JEDA 1P1FA 3B1JA 3D2CA 2WKQA 4FWBA 1AGPA 2I1QA 2ONJA 2ZRLA 4F3TA 4YJDA 3NIWA 5JSHA 2ZTUA 3RT1A 4RD3A 5HF6A 1NBOA 1D6NA 2PX0A 1XT6A 2JLRA 5KQMA 3IP7A 3GARA 4XOIA 3NYWA 5DK4A 3DEZA 2DC1A 4N65A 3IUEA 2DLCX 1CRLA 1C8KA 4PPQA 1FLDA 3DQZA 3LK6A 1NMSA 2W7TA 1J5PA 3DO6A 4ZTZB 1E1LA 5D51S 1XZKA 3ZLTA 1RWXA 2PX4A 1PT7A 3EDOA 4L4RA 3LT2A 3KQKA 2HA7A 4I50B 4OBWA 4AZ3A 2YOHA 2YOFA 5FPYA 4CMIB 4W5NA 1UZUA 3MQ2A 2AMLA 2Q5QA 3IOBA 3PLRA 1W75A 2Z4RA 4F9TA 2Y1KA 2I3BA 3QPCA 4PLYA 1UANA 1COZA 3QLVA 5IDYA 1EK1A 3B20A 4B4OA 2A9KA 3L4KA 3QXGA 1VL8A 2FPOA 1EX6A 1XDUA 1YJ5A 1PNTA 3HN7A 4R40A 3ROQA 4OOFA 3L40A 4TKZA 4B3GA 1VMKA 3LUGA 4EJSC 2AEFA 2WIKA 3IAAA 5FNVB 4X45A 4DW8A 2FPIA 4EVIA 4WLUA 1DRVA 3HHEA 3V9AA 3AWIA 4HNTA 3A3PA 4I14A 4UQOA 1Q5PA 1SIUA 4C1BA 2W22A 2EZTA 3V8VA 1W25A 4CF5A 2ZWIA 4LS3A 3CJQA 3O8BA 4R9SA 5U4QA 1ZKMA 4HH0A 1RYMA 3EVEA 3CUUA 2F4NA 3MCWA 5C32A 1EAMA 1M0WA 3P0JA 2EL7A 5C31A 3LFUA 4UHEA 4LXUA 1U3FA 4Y3UA 3EZNA 4L3WA 5IXJA 4R0VA 2GBGA 2YVQA 3L9WA 3MHPA 1BQEA 1J24A 2PR7A 5AJTA 1VE9A 3IQGX 3ZK9A 4G5YA 3DZCA 4IVRA 1BN7A 4UJ3A 4XW2A 5TY0A 1KQNA 3ADDA 3AB8A 2F9LA 2WF6A 2ZJOA 2QG9A 4NYMQ 3ZE2B 2FFRA 1UMKA 4B35A 3WL6A 1AKUA 1USUA 1U1FA 1RRGA 1GQ2A 3C6KA 4NV0A 2CBZA 2GAIA 3MD9A 3NIGB 3VR2D 1QDLB 1F1BA 1U3UA 4ZYVA 1H9CA 1L7PA 3ONNA 1AB5A 2LP4Y 4PR3A 1RRFA 4TYWA 1FUIA 3ENVA 4CL2A 5G1NA 2D2XA 1QGYA 3MAGA 4MQFA 2CXUA 3A1SA 4IZ6A 4M99A 5JWHA 4QDXA 1EVZA 2GR9A 3LVFO 1DRUA 1XTKA 2CFOA 4OA8A 3V1TC 5JADA 4BAGA 1ACLA 2DQSA 2QL6A 3A7DA 1A27A 1LWOA 3DV2A 4NBLA 3GDWA 4DV4B 2WV7A 4IIXA 1O96B 2I3DA 4FYJA 4BQQA 5IUJC 1JHUA 5KMGB 1JFVA 1ZLXA 4J76A 3UJHA 3AZQA 2QRUA 3RBVA 3SLGA 1SR8A 4C0KA 3AIKA 2FMIA 1MAUA 3DOHA 4GBGA 4KWTA 2I3GA 3TUJC 4AYTA 1NC3A 2E37A 1GCOA 3U4HA 1SGWA 2PY6A 1UFRA 2HW8A 2XH8A 3AY7A 3NPAA 3DOCA 1ZWKA 2A0KA 5TVGA 4FMCB 1EUCA 3K0CA 4G5FA 3K70B 1VMIA 1GQSA 3V2IA 4M7OA 2X2FA 3I01A 2H4JA 3M1YA 3ESDA 4LY0A 2NUTB 2V8BA 3ZE8A 4QVGA 5FR1A 1FTWA 4K88A 4L7VA 1XROA 1FTSA 2VEOA 2OT3B 3E9QA 4KBYA 4UATA 4UDXX 2V58A 2QTRA 3GP8A 1E0KA 1KVSA 2JANA 1Z33A 1D2NA 1X13A 3C4VA 3UICA 4B6JA 1XPRA 2UYQA 1VSQA 3LCUA 4L9RA 2IU3A 2VPTA 4KAFA 4QDUA 2GARA 3IE0A 3VMFA 2OMKA 3SKYA 5A4MS 1X3SA 4LBWA 1QIHA 2GWHA 4L8VA 5CMLA 3MQFA 3IULA 5I7FA 1TQHA 1T8PA 1JIJA 1RC1A 2V6IA 3R40A 4M1EA 3EY9A 4RTQA 3ZIAD 3UW1A 1UDXA 5K3BA 4CIDA 4XA8A 3RD5A 1E2EA 4M9CA 2IWRA 4F3KA 4KUGA 4LG1A 5K0LA 4J6FA 2NTJA 1Q7RA 2C7VA 5IYZF 3IOMA 3ZX4A 2H11A 1E9BA 2X13A 4NULA 1AU9A 4I7EA 4DR6B 2HWXA 1GTSA 4EOGA 4J0CA 1N2HA 3CC8A 3GAFA 3JAWA 5ALRA 2YWFA 1NWHA 1RLUA 5J4KA 4ZCPA 3R4VA 1UH5A 3P45A 1RJEA 2XQGA 2FMTA 4JI8B 3BF7A 4INAA 1JHDA 1SVKA 2H1LA 4R1QA 3CLUC 4DLUA 3RFVA 1RQLA 2HRRA 2WOJA 4DSTA 5DE3A 3WDSA 1GKKA 1UEIA 1J8MF 1ZVJA 4IH1A 3BJZA 5EFOA 4HOYA 2VDVE 5AW8A 2XCTB 3OZVA 3NX4A 4OVKA 4MOWA 3B13B 2YNMA 3BMNB 3EGDA 1LK7A 1LQUA 4NENA 1DAEA 2R87A 3GLSA 1PGNA 3LW7A 3SLKA 1XDGA 1DAKA 1P1HA 2Q3LA 3GMIA 3KEGA 2V9ZA 1DT3A 1YDMA 5DCWA 3CPEA 4K9RA 4PZAA 3R76A 4WUTA 2H08A 2Z1DA 4DMLA 4M1TA 1MX1A 4PWZA 1ZJZA 2R84A 3LY9A 1E9RA 2ZRJA 4RYDA 4YFVA 5CD9A 1N7IA 3FHTA 4KAAA 4EO4A 5T7BA 3C39A 2QJWA 1AKQA 4ZCSA 3F3SA 3CCFA 3B38A 2B5OA 4KYTA 3ADBA 4XVUA 1U2GC 2OESA 2Q3FA 2IK8A 1L4FA 2C03A 2X76A 3HA5A 3DEKA 4LKRA 3HABA 4EHNA 2D5BA 5FD8A 1G21B 3KHSA 3G7NA 4GKAA 4M0CA 2DJ5A 1T34A 5F9FA 1E8NA 1CF4A 1ZCAA 1P17A 1J0CA 3I83A 4Q7MB 4KZKA 5K8TA 4BO7A 1NXWA 3IT2A 2NUBA 4HQ0A 3FW1A 2JKVA 5D85A 3SQXA 4RUKA 3SJ7A 1C2YA 2XMBA 2DR3A 2TMYA 3K1JA 3Q9UA 2AYXA 4GI5A 3UKJA 4JUIA 2OCYC 4IF4A 4EEKA 2E82A 4AZ0A 5JNLA 2OXFA 2QRZA 1SCQA 5ESDA 5MGNA 1NNEA 1SVMA 2ZJ7A 2Z0MA 4DCJA 1P5ZB 4PZCA 4BRUA 1BDBA 4D57A 1YI0A 1HE1C 3ZY5A 2F2TA 2ODWA 4KIUA 1ZNXA 4OQLA 3U7RA 3B2NA 1X7YB 3M4YA 1LSOA 1OZFA 1YSCA 3BSYA 4Z4GA 1D6MA 1TU3A 4LJ6A 2RK6A 2FV8A 1O6BA 2BMEA 2C3YA 2X42A 3GLRA 1NP7A 4RSHA 5FBQB 6REQA 1J97A 1E3WB 1OXTA 5DRTA 4CTJA 4E11A 3ZLJA 3BWCA 1YR8A 3C74A 1Z37A 4IAOA 2IKSA 1VSTA 4C20A 3GYBA 4PSAA 4JJ4A 4ZD6A 1BZYA 1NY6A 3IMKA 3LBHA 4HNGA 4J91A 4B4WA 1JEAA 3AT1A 4G0PA 1I24A 3MWYW 3PWZA 3ZWWA 1ENZA 3V8EA 3AU8A 2VP2A 3OZSA 4DMUB 4J49A 2HA4A 1OZAA 2V6GA 1XD2B 2ZRBA 4WA7A 5AHRA 2ZAOA 4ZRDA 4Q24A 3FMIA 3KLPX 5TDHA 2XPCA 3HGMA 3PFBA 3SFZA 1ZSNA 5TV2A 3DXYA 4FHFA 4TWBA 3ROFA 3VYUB 2IHTA 1MX9A 3HKCB 3VFDA 5CDUA 1H0KA 4WD3A 2XMZA 3KR9A 4TN5A 4XVHA 1AXEA 1GPH1 2A3RA 3TW8B 3UAGA 4ADSG 4CF7A 3HN2A 2HN9A 4MKFA 3T61A 1KZYC 5IDWA 4LJSA 2ONKA 3K15A 1RBZA 4AY4A 2Z5VA 1QFXA 5CITA 1WTAA 3QWIA 3SHQA 3H1TA 5EC8A 4TMKA 1WY7A 5KZMB 4PFQA 1UT8A 2X1HA 1BCRA 2OFFA 4E6PA 4I4NA 2JAUA 4RTRA 1VBMA 1J90A 3LWZA 1GUYA 1Z26A 1PR5A 3RNLA 1YFZA 1JDSA 4XYLA 5HUHA 2HQRA 2OQRA 4Y1RA 5B3LA 5LSAA 4KGZA 1R9GA 5BRJA 2E49A 2PS0A 1GPLA 1C1YA 1Q6YA 4P3XA 3OMLA 3GRKA 4ZXFA 1QIFA 5AW3A 1W5FA 4N3AA 5EIXA 4JIGA 4KACA 3G2PA 4QRDA 4ZA2A 5EQTA 4MK4A 4QQNA 3I5XA 4C3OB 2VUSA 3TSOA 4GMGA 5TR9A 3OOEA 4QPPA 4EHHA 1K9VF 4J07A 4LMBA 3OPYA 5CA1A 1XDZA 3IIJA 3PGXA 3Q3HA 4JITA 1FMJA 2ZXUA 2AJDA 3DMGA 3FCEA 4R81A 3SYKA 2AFIA 2XDQA 2VAXA 3KK0A 3UAYA 5DO9A 2WWXA 1YBVA 4DA6A 2IF0A 5EESA 4DJAA 2BC9A 1NKSA 2ZIGA 3FYTA 4RGBA 1XQYA 1DO8A 3ZCRA 4LE1A 1NPYA 3W7BA 3ABOB 4ASUA 1MD9A 4L8LA 2GHTA 2WMNB 4NKRA 1MW8X 1JAYA 1QVZA 2C9ZA 2WTUA 1VL0A 4NAHA 3TCXB 1CZUA 2JLQA 1TYBE 4TKVB 1SBTA 5J1TB 4TLMB 4F6LA 2G9UA 4PYLA 1EHYA 2X23A 1N8KA 4K81B 2GTHA 4Z6KA 1QIKA 2Y1OA 1S9DA 3CX7A 3ENNA 1KMIY 1VMDA 2V3VA 4LIPD 2PO5A 5FBLB 3A70A 3VPXA 1DTEA 4LXIA 2OL4A 1AZLA 2MSWA 4IW3B 2CNDA 1S4MA 3HYRA 4HGZA 3SC2A 4PYKA 5L7TA 4P4SA 5CBPA 5FADA 5JATA 2A0FA 3T0FA 3ZYZA 4LDRA 4NEQA 5ARBA 1Z07A 3EPLA 1M6EX 4HNQA 2WFAA 4Q4LA 2OZVA 1HT1E 4M86A 2IY8A 1ZL0A 4LBZA 3LQ2A 4MICA 2R60A 4WK2B 1OBVA 1PVVA 3HBFA 5I9SA 4K1XA 5C46F 4RHFA 1XJ0A 3D6FA 3L7NA 1XMXA 4UNQA 1NVTA 4X3OA 3BMOA 1WHSB 3KT8A 4C6TA 4CUZA 3QPDA 2BFDB 4M1MA 1XMPA 3IESA 3ZHRA 3QKWA 2UYYA 3Q0IA 5I7UA 2DPYA 1ISPA 5K6AC 3MBKA 4HLQB 1R6AA 4ZEMA 3B1XA 4MI3A 4QARA 5B1IA 2D2VA 1IATA 1N5KA 1SA0B 3NW9A 4KTTE 5DHSA 5FYQA 3VVMA 1P29A 2DR2A 1T1SA 1C14A 3A6HA 1QLWA 1TO6A 1NU8A 2WT4A 5AKZA 1SIBE 1EK2A 2ZOSA 2ATCA 3CIFA 1DFHA 4L0CA 3KLMX 4NS4A 4OHOA 1NATA 1EVEA 1E2KA 1HDZA 5AIAA 2EDAA 4JHLA 1HYQA 4NICA 1URPA 1E18A 4HWKA 2GPJA 1Y6JA 5EP3A 4WXHA 3T5DA 3PJRA 1L7MA 1QGAA 3NDIA 3NZEA 4L74A 4CQMA 3CISA 1W6RA 3CW9A 4XCQA 3AM3A 4LRSB 4XRGA 1NTOA 3HDTA 1QR2A 2X9QA 3G5MA 2OV1A 3OTQA 1MO2A 3ZWAA 4BNTA 1FFBA 1FU7A 3KJHA 3O74A 5D8DA 1PD0A 3FBTA 1ADJA 2GVZC 1LZKA 2WJVA 2YXLA 3EGOA 4P7KA 4O08A 3OM1A 3BDVA 4PLTA 2D06A 4EW3A 3JYHA 3PPXA 1GUZA 3F9CA 1Y4SA 1SMKA 2NTNA 4M49A 4YR7A 1EFPA 3L02A 3NI2A 1D03A 4YJFB 4O33A 1ACMA 4BFWA 4FFWA 4IJKA 1ZU4A 1LDBA 4J1TA 5CVJA 3MGCA 2CNBA 4FYYA 3UWDA 4BWVA 2EV9A 3BFJA 3L8GA 4ZO9A 3LX4A 2V8OA 5GOTA 4D43A 3SX2A 5BN3B 3FROA 4YJ3F 5IPFA 4W5QA 3B12A 1GAJA 5BNFA 1JEQA 4MUXA 4BNWA 3F46A 4J29A 5B6JA 1PWZA 2YTZA 1HUQA 3AIOA 3SQDA 3KJQA 3DLBA 2RC5A 4TRRA 3HCFA 3NBQA 1G2QA 4Q9IA 1BJTA 2I8AA 3H9CA 1CUAA 1J1UA 3ILYA 4D44A 1E9FA 4HAWA 3W4KA 2Q49A 2HLDD 1UPUA 5F3DA 3RRJA 2A5FA 1KQPA 4HK4A 1BKSB 3DTNA 3KLNA 4HQFA 2ODEA 5JVDA 5EJIA 1UFVA 2O5VA 2FK8A 3I64A 5ANRB 3RAFC 3QLUA 3EW9A 3MRSA 4HF7A 4AY2A 4PQGA 1M6VA 1ADGA 1PGOA 2OK7A 1UMDB 3U48A 3EXAA 5BQ5A 3AETB 4NE2A 1VHTA 3WGYA 2WZDA 1UR5A 4TWIA 3O1HB 3PNLA 1FQOA 2QSYA 3QIAA 3EQ6A 4RQTA 1QK3A 4JLUA 4Z4HA 1CLUA 4RLSA 1XDBA 5EKUA 1I2MA 3G0CA 3NTOA 5C9ZA 4I6EA 1DQPA 3RJ5A 1GPDG 2B30A 4L07A 5EWMB 3BUSA 1RPAA 3P2KA 5JCJA 4LBVA 2IKQA 5JMWA 3MC1A 3KUDA 3HBAA 3L4BA 4IYJA 3RBXA 4CF3A 1R12A 1KEEA 5KNBA 2CSUA 2JIPA 4U2BA 3ZY4A 5MGBA 2O2XA 4GQAA 1GR0A 1MFZA 2FJPA 3JWHA 4WXEA 3GLIB 1XF9A 1YR2A 5EUBA 3MNFA 2YJ5A 3FY4A 2C96A 2IPNA 3QKUA 4P4LA 2A1IA 4OP3A 2CLCX 2ZWPA 3IMGA 1DKNA 1G2IA 2PVCA 2XQKA 3FWHA 5FUBA 3DBVO 2W58A 4TXMA 3M82A 4OJTA 1J70A 3SJCA 1Y4DE 3PNQA 4WNAA 4AB1A 2Z4SA 5DM1A 4EG6A 1TC1A 4Z4FA 1XP5A 2XB4A 4OX9Y 4BV2A 4PLWA 4A7PA 3K4QA 1Y9AA 1ZMXA 2VH5R 3PR1A 2P9EA 5BN5B 3JTMA 4D8TA 1EFLA 1A9XA 2FE4A 3OLQA 4UCXA 4U2GA 2BP7B 2FLKA 3ZWBA 5JXGA 1H9AA 5EXEA 1EVQA 4F0JA 1UINA 3NCTA 1Q1EA 4ER7A 2I4MA 2VYQA 3ANNA 1SY7A 4BO8A 3W78A 3OE4A 3S8MA 3PQ2A 4KI7A 2HF2A 2DLNA 1A8PA 3DGEC 1MN6A 1QCCA 5CX4A 4QZVA 1XTRA 1ZM7A 2X8BA 1C1XA 2DWOA 3NRCA 4KW7A 4LKOA 4N4AA 3UC9A 3F7NA 4YX9A 1C9KA 4PBRA 2FPMA 2J9ZB 1O8BA 1DG3A 4ZQIA 2OFWA 3NHKA 1RDFA 1OXMA 3HJBA 1WMEA 4L15A 3C7KA 2DBQA 2HCFA 3LBFA 3MTBA 2JFWA 4U5QA 4WOJA 1FJHA 1TEXA 2HEIA 5FUWA 2C1XA 2FWNA 1Z0KA 2EERA 2O2GA 2AI2A 4FGKA 1A76A 5HBGA 3NWPA 3EUEA 3RVOA 2EDCA 1DC7A 1E5TA 1LPBB 1VB5A 1YR9A 2EC5A 4G25A 4OPMA 3RU2A 4O2AB 4DZZA 2VQSA 1VMEA 4TZ6A 4BFLA 4XQ9A 2XTNA 2F1IA 3B5EA 3F49S 3KBBA 3W5VA 4EB3A 3AYXB 5MHTA 3LSYA 2H51A 4C3VA 1IB6A 5CGZA 1L4UA 3H8SA 2J48A 2CW5A 4YJ2A 1QH1A 1FNMA 1Y80A 4M55A 3F5MA 2PE5A 2YXNA 3CUVA 1ZGAA 3P2JA 3N7TA 4OBEA 3ZV3A 4XFJA 1GU7A 4RZXA 4Q4DA 1ESMA 2F90A 4PZPA 1W581 3U3OA 2CC2A 3W79A 4LXTA 1Z47A 1BX0A 3ND5A 3WMEA 4FBGA 4LJYA 5J9FA 3TAUA 1RZRA 4N41A 3F7OA 1FRZA 1FVXA 4UM5A 2ZIXA 1L3CA 1SUDA 1JYFA 4XJVA 2Y66A 3HJRA 2GD2A 5F9MA 4KP7A 2PGLA 4ZAYA 1CUSA 1R37A 3MLAA 4TT3D 5LP6B 1HDOA 1OXXK 1TJYA 2QTVB 4M1OA 4N03A 1UXIA 3KTAA 4WT7A 5KNCD 4NZYA 1JL3A 4L8WB 4W99A 4OLBA 2VK4A 1GITA 1XSEA 2H1FA 3ND7A 4KRGA 3M9XA 2PZJA 2R47A 5LWQA 3MTIA 1HV8A 4HH4A 4CV1A 5FPSA 1JYEA 5FWNA 4DR7B 4H7EA 3AEZA 2R1VB 5D5QA 2W90A 1VJGA 3FYUB 2FWBA 2H7CA 4R31A 4UEKA 2I6XA 3HEMA 4RYLA 1I32A 3QJYA 4BL5A 5KAMA 4QICA 2WTMA 1HT3A 1R0ZA 1SC3A 1WQ1R 2G5GX 2ZDGA 3BFPA 2CBXA 2NIPA 2GCGA 3MWFA 3EAGA 4LCJA 2OG2A 1NLUA 1AF7A 4HNVA 1TRHA 3N2KA 2H18A 3K0HA 1BDJA 1R1DA 5TS2A 4V1CI 4YCCA 3P9RA 4PN3A 1BROA 1N33B 3TFOA 2IXTA 2ZITA 2ZAMA 4UCWA 2RFLA 3Q3GE 4NABA 4ZC1A 1D1TA 1TYAE 2Q5LA 5COAA 4B44A 1LPOA 3H7AA 3ZHQA 4XRRA 2WJIA 3CBQA 1E77A 2XITA 3F2VA 1NBEA 4B31A 2CYBA 2CE2X 2I4LA 3RVSA 2WY2D 1E89A 1N3BA 2W4IA 1E98A 3AKYA 3NVMB 3K1TA 3M6MD 5E2AA 1O0BA 1AA9A 4WECA 2XQJA 3FDZB 5JSKA 1XX6A 1SC6A 2ZZNA 1TC2A 5F33A 4L5AA 5AI8A 2YYSA 2XCOA 3I32A 3MFQA 1TB4A 5F4BA 1FL9A 1O8CA 1DPFA 1P61B 1QS0B 1MB4A 1B6GA 1PT5A 3ASYA 4M6WB 4GZ3A 3W8RA 3IIIA 1K8QA 4W7IA 4WN3A 2F9FA 4EABA 3MHTA 3TXXA 3RSLA 1W9MA 4O4JA 1LVUA 2X1VA 1K8ZB 1TLLA 3OPQA 3QYAA 1LTHR 3EGEA 4BLUA 2K7ZA 1E1RD 3N2NA 4PYMA 5L7YA 2PNJA 1UPXA 4CUKA 5DP1A 3HPRA 1H3NA 2WSMA 3I9JA 3WBBA 2MIIA 2JS7A 4EWLA 1H0RA 1XQ6A 1X38A 3T3PB 2QMHA 2RGXA 1ODCA 2EF1A 3DOIA 1CJMA 2HSWA 3QE4A 3SDSA 3IIKA 3U7QA 1SRRA 3P26A 2PXCA 2ASVA 4M38A 5L3VA 4NBWA 1QZTA 4ND6A 2J87A 1G4HA 1FUKA 1JZQA 1X1DA 1U81A 2JD1A 2NU8A 1ADCA 2FVYA 3U16A 2P7IA 2YOGA 3KYCA 3NJRA 4Z3DA 5ENZA 1Z82A 2I5PO 3CHYA 1RJ9A 2Q0HA 3AFHA 4OK5A 1JIXA 1E4EB 2VSFA 4ZRNA 5DWQA 3A0UA 1Q6ZA 1K5GA 2Y3IA 2ZSFA 3I34X 3KRTA 1W87A 1YVUA 2X2OA 4LWOA 2CDNA 4UCFA 4XPIA 1SQSA 3RHFA 5KYWB 1P7WA 3IDSA 4PS1A 1XZHA 5KYNA 1TTTA 2JCBA 3IEMA 2WD7A 1T43A 2QLNA 3A6ZA 4WADA 5IAGA 5KKAA 4EGAA 5C7YA 1RYYA 5BV7A 4KXFB 3QWHA 4RLFA 1VYUA 4K05A 4B6GA 2ZB4A 5JMTA 3DPUA 1Z5OA 2ETXA 3G8CA 4L8GA 3PC7A 4PG7A 4YEDA 1RS0A 5F1PA 4DADA 2N46A 1WDLA 4P3YA 4KH1A 4LW8A 2MCFA 2V54A 1CEYA 2JJYA 2OV4A 3E48A 4EX6A 1J20A 4RQBA 5JBQA 2HJWA 3QUSA 4B3JA 3QITA 3M4XA 5DBHX 3T7SA 3WWOA 3ESZA 5LL6P 2LTAA 1P7VA 4OAOA 4PHGA 2FR0A 4B74A 1B74A 3WL3A 3GR6A 2YDXA 3QXSA 4G67A 4IMRA 1U99A 3RLIA 3V1KA 1EESA 1M67A 4JEIA 3K2EA 2PGAA 4FD2A 4ROTA 3D0RA 1WAMA 2EWMA 1XA3A 3GFBA 1XYVA 2IIPA 3IUJA 1T3HA 4EMTA 5JQGB 2UYCA 1XQVA 3R2JA 4LNHA 1TNDA 3JZDA 3DOFA 1Q3HA 1TYDE 4AO6A 1WSWA 2H9AA 3OIWA 1XV5A 2P77A 1P72A 1W4ZA 3OLVA 2WPDA 3VPGA 3EXHA 1M1XB 2FRVA 1JIVA 4GLJA 2B5VA 5LBUA 2P5SA 1F2TA 2VYND 4IFBA 4PXSA 3ZWQA 5C4MA 2PMEA 1OCEA 1T2DA 3ZU3A 3OO1A 4BNHA 3HB0A 3I3OA 1P1CA 3KZXA 1SUIA 1E69A 1Z0JA 1IVNA 1ZD3A 4MCAA 4AJHA 2F8TA 2GJ9A 4DRYA 3CWZA 1Y3BE 3HJHA 4YXWA 2BMFA 2G3YA 1H6AA 4HUJA 5DI3B 3UQYS 4CR6A 1CUCA 3FTDA 2B36A 1LPPA 2IY9A 2JIZD 3H1GA 3I2FA 5CX1A 3Q11A 4ROSA 4KVGA 3U3KA 2Z1NA 1DX9A 2YW9A 2PX3A 5A2QA 4B6QA 1G3RA 4IRXA 4L76A 1Q0UA 1YUBA 2BRUA 3TTSA 1E3LA 2RH8A 3GEIA 4Q5IA 4Y6LA 4EHBA 5JC8A 5K0GA 1HOTA 2DFNA 4UHFA 4RY9A 5SZJA 2KS6A 2PX6A 1FTYA 2XNCA 2Q9BA 2GEVA 1R10A 4M7PA 4N18A 5TJ9A 3HUEA 2Q6TA 3CT6A 3GWGA 4X00A 4XCVA 1A98A 1TOAA 1UQTA 2AWNA 1TU0A 1KZ4A 4JBLA 1DQRA 3IRVA 4I5IA 1U1CA 1L4GA 2PD4A 4XLZA 1AA6A 2JFOA 2JLBA 3NVAA 1MVNA 2QV7A 4HGOA 3QVTA 1VRWA 4OHUA 7REQA 2ZZKA 4IJQA 4DLRA 3QZUA 2FFHA 4EGJA 2X1MA 1QOQB 2H5LA 1P7ZA 1QHIA 5AVRA 2BSQA 4JELA 1O77A 3LL4A 4K9OA 4NU8X 1X7HA 4AT1A 3WIBA 4HNSA 4II2A 2GILA 4EHAA 2G1AA 3NBUA 4DM3A 4DE5A 3N7AA 2IDZA 2WYVA 1S8AA 4ML3A 3CEHA 1FSFA 4PCUA 1A4UA 2YJ4A 4U9HS 2BGLA 4K8RB 4RQUA 3ZIDA 1K63A 1ZOOA 4YDQA 3RTEA 3BHJA 1JSCA 2D0IA 1MIOB 3LYLA 4M1WA 4BV8A 5L6MB 4GRDA 1XJWA 5DCUA 5THKA 1BMDA 3R0XA 4MV5A 3E84A 4X3PA 4LYJA 5GPBA 3W04A 1FA9A 3K0FB 1KDOA 2CVOA 4G81A 3FJYA 1U6KA 3CH7A 3DXXA 5EGNA 5FBKA 3S7ZA 2G80A 1Q77A 2F55A 4ZTBA 2OXTA 1PJSA 5HYVA 3PX2A 4EG3A 3E9MA 1TMOA 2GKOA 1X1SA 2XA9A 1C3EA 1HT2E 1LW7A 1Y6ZA 1F2UA 2MINB 1E0JA 3CTMA 3GEPA 3MVEA 4UPDA 5EHQA 4ZI2A 3PXEA 3R41A 4EI8A 2D1YA 3LNCA 2TMGA 3HBMA 1NRJB 3OIDA 3ABRB 4MKHA 4PU0A 2XMGA 3M6XA 1N0WA 1E1NA 5K3DA 3N5CA 2BE9A 2HPAA 1QMGA 3K1ZA 1XHEA 4RF3A 1JU4A 2O8FB 1CS4C 1XDSA 4OQMA 3VKGA 1GYRA 1H0SA 1M1YB 1ZH4A 2D5AA 2FQXA 3WYAA 3FETA 4RIHA 3D8BA 3B52X 3TD2A 4ED9A 3QEKA 4MYCA 4ARZA 5TPZA 4EKEA 3JWIA 2VTBA 2PS1A 1E92A 2GBIA 3FFWA 1YTUA 5EZQA 2ZB2A 4FMDB 3E23A 3RCBA 3FJ1A 3SIWA 5LN1A 1PHRA 4EL5A 5B36A 1VJ0A 3ZJTA 1AV6A 4IIUA 2A3NA 3K53A 2PNFA 1U11A 3UHPA 2KJQA 3DZDA 3K2IA 4HDRA 3WL5A 4B46A 5KOJA 4MLPA 3IPLA 3NTQA 1OTXA 2CNWD 5DBOA 1I01A 3GLUA 1SKQA 3N2IA 3AEQB 2H3HA 2P3QA 3MS7A 1RQNA 1DKQA 5E3JA 5AW1A 3SOPA 2QA5A 4O3MA 5GJBA 3D6JA 2GFIA 3LPNA 3K0AB 4BDTA 3IB3A 1AN9A 2QD3A 4MYTA 5ES3A 1JG1A 3T4EA 3TRKA 4HWTA 5BQFA 3L0OA 4KLAA 1WF6A 3LGAA 3OLCX 4GKJB 5P21A 3SFVA 2OORA 3P5SA 4FDAA 1YT5A 2XVZA 4Z9BA 5FF9A 4BNGA 3TNLA 16PKA 1UP6A 5K7SA 2C83A 2BI8A 2XA1A 3H8JA 3GJ3A 3G2JA 3I2JA 5G0SA 2ZUUA 4J3FA 1JDZA 4HSGA 4MARA 2PH5A 4C21A 2C7PA 2B35A 4W9RA 5FI0B 1KS9A 2BE7A 2HNKA 2ORIA 1FFEA 2Q9CA 3K73O 3G9TA 4KMSA 3WV5A 1EU1A 3IIEA 5DTEA 1NXSA 5K4AA 1D9XA 2ZR8A 2NUAA 4CM8B 3PNPA 1MOPA 7GPBA 2DHQA 1EA5A 1R0RE 1KY3A 3OIGA 2XDWA 3P4XA 3V55A 2EFDB 1IY8A 5F2OA 2BZ1A 3FPJA 1SOVA 3STYA 4B3FX 3NGXA 4HATA 3SKVA 1QKIA 3LQ1A 4NCXA 4ZCRA 2IY7A 2OM6A 2WJYA 4OSPA 4YAFA 5DN9A 2QT9A 2QXUA 3EDRA 1EWQA 2I9PA 3EJWA 4BO5A 1N6IA 5CVDA 1JHPA 2E48A 2YBDA 2YWJA 1HDCA 1INLA 1SKBA 1O4WA 3EZFA 1VIAA 4JGGA 4H1WA 4ZEVA 4WPGA 3L0IB 3PUHA 1X86B 2XNJA 4UTPA 4CKBB 2E21A 4PPYA 4KPUB 3SVZA 5BT8A 1N75A 1CR0A 2AS0A 2J0UB 1S3FA 3F5DA 5KOIA 1MGPA 4YLEA 3AF0A 2NUPA 1PP4A 5J5AA 4BAZA 5ICEA 3QY9A 4OMFG 1AC5A 3LYHA 3TNYA 3NWOA 3AL3A 2IHJA 2P41A 1ES9A 1E1CB 1ZNYA 1NZFA 1RI5A 2P5TB 3GZNA 4IVNA 2ON6A 4L72A 1FPMA 1Z5ZA 2HREA 1XHLA 2WU1A 2Q7OE 5JJBA 2VC2B 1C4XA 5K8VA 2ONYA 1B0ZA 2RGGA 3S2SA 4LHXA 1VBFA 2Y0EA 4ZOEA 4Q18A 4DCTA 1K5DA 3SNKA 1H5UA 1DJPA 3HUUA 4B3XA 4I6GA 4WA8A 3EQ7A 1KO7A 1V11B 3GPIA 3OHMA 4ZICA 1AS0A 3JSAA 1F8FA 3FPHA 1K27A 4HX9A 1AUPA 1RMYA 5KYTA 5K03A 4B4DA 1T0HB 4M9UA 3LOUA 3OJXA 4LOHA 1KP9A 2HGSA 3RHZA 2R00C 4MA0A 4UQLA 5JD4A 4K2AA 5KYYA 1EK5A 1EGVB 1GEEA 2WDZA 3KVOA 3QG5A 2JGFA 4JLSA 2FB9A 5KOYA 1X0XA 4D4LA 2D2FA 2O8CA 1M6YA 5K1ZA 4D9HA 1M10A 4LY9A 1NN3A 3GQBB 4I1YA 2FSSA 5G02A 3TNDA 3WGTA 1Y7IA 3MM4A 4LYAA 4RPHA 3KOUA 2G0AA 2QEQA 2INGX 4BLPA 3IDQA 2RGUA 4DA8A 5KJ6A 2GN2A 4MWZA 2YV4A 3D3WB 2JHGA 1XNRB 3AL0C 3AHJA 5GZ6A 5GZ3A 4LJ4A 1A9YA 2MU1A 4PGGA 1X92A 3H84A 5B3JA 1CY1A 3KWLA 2DAPA 5EKTA 4Q6BA 2V7XA 3AK4A 2C2WA 3CKKA 3JQCA 2JGKA 2HO5A 4L3VA 4IICA 5G4LA 1DAFA 4A6EA 3HVRA 4X64B 4GWGA 1RC8A 3L43A 3OURA 2ZT8A 3TR6A 3KVYA 1NQAO 1NULA 2PU7A 3H2YA 2PUTA 1OU4A 4HNAB 2QGZA 5FQOA 2XRZA 3COSA 4TZTA 4CTNA 2BFEA 2EGUA 4LZPA 2J3KA 5K3AA 2RAUA 1E0AA 1CS0B 1TUEA 2A1TS 3I5UA 3DHWC 2FWJA 2WSLA 4WTOA 3CA8A 4WKOA 3TLXA 3G0IA 3UAZA 1WBDA 5DULA 3HCCA 3QKRB 1UMCB 4DDMA 1Y7TA 2XKBA 2M6SA 2ZIAA 1NUSA 1VXOA 3CGWA 2NQTA 4WCFB 4FHDA 1T2VA 2I99A 1QFSA 3EIXA 2PQ6A 3I4LA 1RSZA 1OI4A 4RK7A 1VLJA 2L69A 1DO2A 5D3KA 3IO3A 5J58A 2JAXA 2OC9A 3CRVA 4M87A 5A9SA 5KI6A 2P6OA 4N8SA 5IC4A 4IWYA 1OLXA 1FNSA 5AI0A 3OUUA 1B42A 1U8XX 1N7GA 2ZT6A 3NOVA 3DTVA 4JT2A 2VUIB 4MQLA 3PE4A 4CT4B 4M1YA 5HKKD 2CVHA 2Y0DA 2HHCA 2M6KA 4Z7NB 1UOQA 3MGKA 1HO3A 3CUTA 1ZRMA 3LGXA 3R20A 3HKBB 4JP5A 5D7BA 4YI3A 2WD8A 3WLOA 1MEOA 1Q3TA 3JTEA 2D0PB 5TQ2A 1MB9A 1ZVKA 3OPXA 3V7FA 4AX8A 3VRHA 3U3ZA 1RWWA 2G04A 1JBEA 3CZMA 3NDPA 2Z2JA 2VDLB 3E05A 3H5IA 1J8DA 5ECYA 4WKGA 5AVUA 5IYZA 4RFLA 2I34A 1V7QA 3A1DA 4RS3A 3UAOA 1Z17A 4D9EA 3VTAA 4A26A 2WTEA 3DOEA 4JP8A 2R6HA 1V4NA 1YDHA 2WV9A 1O97D 3Q85A 4UBLA 3T9EA 4OLAA 4RA6A 3RVBA 3KYJB 4R05A 4HDNA 1V41E 3GRUA 1DADA 4PAOA 5K09A 2D1RA 1CKEA 4OQEA 1J8FA 2XMSA 1BVUA 1KYTA 3P27A 1ZUWA 4EG4A 5L3QA 1AKNA 3EZYA 5B12A 3RC7A 2BFFB 2WZCA 3K30A 4FUQA 4IEFB 1WB9A 1RKBA 3DE3X 3IPYA 3TRIA 3LUHA 4OJYA 3ZGZA 1VE1A 1ZN9A 5EE1A 3N0XA 5M34A 2ZBEA 3ZDDA 1E99A 1JDBB 2IE8A 1C4KA 3VH3A 1G8SA 2O3RA 3KQUA 2QSJA 4YMTA 2Q8QA 5GONF 1NM5A 4FN4A 4TM8A 2GLXA 1QIJA 5BWMA 3M2PA 2PYZA 1NNSA 4IVQA 1LBHA 4D8YA 1D5WA 2FTKE 2O1SA 2WIJA 4K3VA 1G2PA 3LF2A 3KC2A 2R68A 1TCCA 2B8EA 3TOZA 4AMBA 3OU6A 1L5RA 4K7JA 4MYRA 4WZAB 1L7NA 1M2FA 1K7XB 2PUWA 3FFXA 4FFLA 1ESDA 1RCTE 1ZA1A 1L0BA 1O9HA 2WHXA 3AUUA 5J5CA 2JFGA 4Y6GB 1JPUA 1KJNA 1Q3KA 1UBOS 5JT1A 1GAWA 1DWUA 2A5YB 1C4WA 3PVSA 1Y1RA 1V6SA 2HMYB 3DL7A 3IELA 3DBOB 3LH5A 4S1OA 2X0KA 4KQXA 3NUGA 2OYRA 3EXIA 2Y1FA 4YK7A 5H59A 1CUXA 1XZMA 3AJAA 3R0IA 2FQWA 4CCYB 3K31A 2OE2A 1KORA 3UHFA 4RKRA 1VCIA 5FQNA 3DSRA 6ADHA 1P6XA 3ANTA 2CHGA 3GCZA 4Z8YA 5LMUB 1N6PA 1NRWA 4B4UA 2YC2C 1KAOA 1EWVA 3QU5A 1MG0A 1QU3A 5DW0A 3VZCA 3AL2A 2NPFA 4GWLA 4DEXA 3M70A 4CCWA 5I5GA 2PUDA 1YF3A 1Q11A 2SNIE 3DW1X 2CLMB 1KRWA 1G291 2A2ZA 1JAIA 5D86A 1X94A 4ZVSA 3T5GA 4YRZA 3G49A 4JSYA 4EKYA 2Z5LA 2P0YA 4FYHA 3KM0A 4L9AA 2IS1A 5AI9A 1J23A 1J2JA 2I33A 1JJ7A 1Y4AE 2C07A 4F8EA 1UPFA 3P0RA 5C35A 4GBJA 2QSUA 3EIOA 1HE4A 5J2TB 1KA9H 5FOUA 5EJEA 1TIBA 3Q88A 4MR9B 1RPZA 3R75A 1OBCA 1SIWA 3DR3A 3CUEF 3IUNA 3NM6B 3TZCA 3W6ZA 4ZVUA 4CLRB 4JLWA 4DQLA 5JZMA 3G17A 4WZBB 4EQ6B 2REOA 3FPKA 4B4VA 4FSXA 5JD3A 3WNCA 1B8UA 1M54A 4KLRA 5ERXA 2V98A 1CULC 1WW8A 3N86A 1HLGA 3M6AA 3MOIA 3MJVA 4ZYYA 5CURA 4E5UA 5BVGA 2ZSEA 4D5EA 2XHZA 4Q3DA 1SKAA 3IYLW 3QOWA 1WUKS 5H3LA 1YXMA 1E9AA 1TRKA 4KWCA 4XTRA 3HCBA 5AM2A 1VSUA 2GN0A 2JBHA 2JGDA 4QUBA 5M5BA 3KOYA 4Q1AA 1P1JA 1L7OA 2ZUSA 1WUYA 5EOVA 1L8LA 2WF5A 2WHPA 5J47A 3HKDB 2XMDA 3A4MA 2GD6A 4GXQA 4MS4B 4NQZA 3AESB 4ND5A 1SHZA 3BCHA 4CF6A 1QHSA 5HG0A 2ZAGA 4BKUA 1AM4D 4Q19A 4MTCA 1HG1A 1KMQA 4IR7A 4G2NA 5CYOA 3WB9A 2ARKA 5JHGB 4KJXA 4JROA 3KOXA 4CRWB 2E6UX 2JK1A 5EE0A 3EZXA 1KI4A 3M0EA 4W6ZA 3OE7A 2HIAA 5GJVC 2XCRB 4F85A 2J0QA 1QCYA 3R5SA 2VHVA 2YY6A 2AQHA 3KVRA 5A7FA 3S28A 5CEEA 4RCVA 2MSLA 1LLFA 2HK8A 2QN3A 5F52A 1CVRA 1PL8A 3PV0A 4TS1A 1I3LA 2CVFA 2PYDA 4UREA 4YREA 3VZRA 1DAMA 1MB3A 2GYVA 4OSEA 1KBZA 4RNDB 4H7KA 2XVMA 3IAS6 4Q3BA 2UXBB 1H6DA 2QTGA 2E5FA 3ZGLA 4CQJA 1YR6A 1KH3A 4KL8S 2IVZA 1A5BB 4C0LA 1GCGA 1YR7A 1V2HE 4RU1A 3R0JA 3ZVNA 1LU9A 3KYIB 4GNRA 2YRFA 3DXFA 4ZEXA 1OWNA 1PTJA 3H8WA 2JFBA 4LDAA 4BVGA 4OF4A 1U2DC 2XWJI 3E3NA 3TOVA 5GM2A 3T6KA 3O3NB 1YZTA 4JUFA 4TLLB 4MKRA 2EFGA 3VBEA 3RYFB 4O4IB 1D2CA 2UYOA 5K51A 3KSBC 4FZRA 1Q57A 1K8RA 2J41A 4IIDA 3U5TA 3CZRA 4U9UA 2JFNA 4P2GA 4X1YB 4DA7A 4HN9A 1KIFA 4MAMA 2ZUDA 4FHCA 4TYYA 1OE0A 4Q3KA 4KCGA 4GLFA 2Q5HA 3P9KA 4W5RA 5LUBA 3OCXA 3OQNA 1KP2A 2F8LA 5BT9A 3DTTA 2REQA 1HFEL 4HFJA 1KEUA 1UAYA 5CB8A 2CL7X 1W0KD 1CUWA 1CUEA 1ESEA 1F1JA 2IC5A 2IHYA 1MA3A 2CBGA 5LD2B 2NSLA 3INGA 1XRSB 2XE4A 4YH1A 1WDWB 2QXTA 3LUBA 1E8MA 1B8NA 5JAHA 3KAQA 2PXXA 3HXMA 4CEHB 3U7IA 2CDCA 3E2MA 1GA4A 3EC1A 4NAUA 5DZSA 3ETLA 4MKZA 4BNIA 4MR8A 2RGNA 2B9VA 2VRWA 3BK7A 3STHA 3EVAA 5EYPB 3VZQA 2HWKA 1E63A 3QVUA 1FP4B 4FX5A 1F12A 4W7HA 3ELDA 3H18A 1FMCA 1NVDA 5EIOA 3M9LA 1FS6A 2RARA 3IBSA 4RC9A 4UFNA 5H80A 3ILHA 1Q84A 1NLYA 1W1WA 4FXOA 3ETJA 4AMUA 2A0XA 3L0CA 1Y6FA 4HH3C 4Q9AA 1PDWA 4EI7A 3ZDYB 4XDHA 4MUAA 1QF6A 4GMFA 4PZYA 1FFGA 2GUWA 2BELA 4PQFA 4OK6A 2R7NA 4L5JA 5JRDS 4JI4B 1UOOA 4HYEA 1LDGA 1UDAA 4HQLA 2QRQA 1CD5A 4W8OA 4CG2A 1CQWA 2HRCA 3ZOZA 1I2BA 1AQYA 4XJTA 5FWXA 1DBVO 2XGMA 3I58A 3NAQA 1YB2A 3NM5A 3B6ZA 4HADA 2CCGA 4KNWA 3UHJA 3WNVA 4YUXA 1QDUA 4YJHA 1AZTA 5HTKA 3HU1A 5HBRA 4C89A 2A88A 5JY1A 3WJ7A 2PUAA 1ABFA 4CKYA 1Z83A 2J9GA 4GGMX 2QX7A 3B5IA 3B9QA 1B6RA 3W9YA 4EKDA 4YJ3A 1JIIA 1RAAA 2R62A 1N0HA 3OLWA 4ENUA 5CA0B 2GKGA 4F86A 2FPLA 4EFDA 5FTMA 5K20A 3FWYA 3QLVC 3H5TA 3TD6A 4BZWA 2I2DA 3BA6A 3PNYA 4MQ4A 5I9NA 2TRSB 5AUOB 1POWA 1QG2A 4M9XA 2PT9A 1A72A 2WU0A 2YV2A 5CPFA 2XE8A 3G8DA 3KKQA 3EFHA 4J7XA 4FYPA 1C9NA 1HRKA 4U02A 1PYDA 2DTDA 2BVNA 3WGLA 1VOTA 5CGQB 3ROPA 4AN0A 5IF9A 2RGWA 2PAFA 3IXQA 5I51A 5JARA 4FJ0A 4PFKA 5JWOA 2J6IA 2XWQA 2IBSA 2O0MA 3BM5A 4RPJA 3KO8A 1FLNA 4TV8B 4UBKA 3GLVA 4KG7A 1R0XA 2W6IA 1PUXA 1G63A 5TC4A 1DJQA 2GHRA 1ECCA 5CXSA 4LFBB 4QJ4A 2EJCA 3KLOA 1VDZA 1YHZA 4C76A 1XD9A 2V7VA 5AR1A 4DC9A 2PV7A 2Z95A 1AD2A 4HQKA 1KOLA 5K8JB 4MX8A 5HE9A 2CFSA 3VR4A 4B6EA 1H2ZA 2P2DA 3UG7A 1CG6A 1IN8A 1IN7A 2E18A 3OZ7A 6YASA 3HB7A 4JT8A 1SCIA 1W0JD 2JAQA 1R4ZA 1VHDA 1S7CA 4KE9A 1E4YA 3EODA 5DGXA 3ZXIA 3U3RA 1I80A 2CMHA 1M7HA 1A96A 3L01A 5M3BA 1RLTA 1SK8A 1XIVA 2HZ7A 3EDCA 4NBRA 1RHKA 1KRHA 2W4MA 2B82A 2YBEA 4YV0A 2EJUA 1EAYA 2GNOA 1EP9A 4JR0A 4KNVA 5CIQA 2NSYA 1IUNA 3S68A 2A9VA 5FA5A 3NHZA 1BVRA 4QU9A 1W4AA 5CIWA 2HBZA 1WMSA 2AQ8A 4PQRA 4F7DA 4BGIA 1QQ6A 2XHEA 2HU8A 2VNJA 4MRVA 2W2KA 2XUZA 3PD0A 4IDEA 5HCIA 5BMOA 2Q4EA 1V71A 3UMSA 3DAOA 3K05A 2F3PA 4Y30A 2UDPA 1L1EA 4R83A 1OQAA 5I7SA 3K1AB 5IM4F 2RG1A 1C8VB 3WSTA 3SBEA 4TN1A 1ZY2A 4FWTA 1ZJYA 4PZEA 4PY2A 3BULA 3A6DA 1UBKS 3B6MA 4HNRA 1FSGA 5LIPA 4HX2A 1J09A 3UO8B 4PLVA 5HEKA 4WRRA 4P2BA 4GU5A 5KNBH 2P68A 4FC6A 4EJSB 2X0DA 5LA6F 3RFTA 3K0CC 2P6PA 3RTGA 2PTGA 2C2YA 3H6GA 3LGSA 3QEMA 1EXMA 5JBIA 4Z1MD 1G66A 2WQZA 4RKEA 4C5CA 2MWMA 2PKQO 3E2IA 3PPWA 5ALGA 4GRAA 3FWKA 4PC7A 1MIHA 3KWJA 2OHXA 4C06A 2Z8XA 4QLAA 3E8MA 1F5NA 1LEHA 2EP8A 3AMVA 4DMKA 1X14A 1SN7A 5TJHA 4IIFA 4IMIB 5BN4A 1G1AA 3D8UA 3MD0A 1YB7A 1UXKA 1F51E 1O1YA 4P4TA 5D3MB 3RVDA 1ID1A 2YXDA 1RJDA 3HNOA 3KQVA 1REQB 1Z9BA 3G2OA 5F7XA 5CDHA 3E61A 1KNXA 4Z0PA 3ZGVA 1P31A 2YW2A 3BD9A 4C2UA 3C8HA 4IEEA 1ZD5A 4CIXA 3KE9A 3PR3A 4N3GA 3WLFA 2ZUFA 4MH0R 4WAUA 1KE2A 2WFMA 3ZGNA 1Y3IA 2OHGA 3LPAA 3NC0C 1HI9A 2NPIA 1E1DA 1FYFA 3TX2A 4JEHA 1VPTA 3F98A 3CLSD 4CN8A 1P3Y1 3M4JA 3P4YA 4U2DA 4YQZA 5C34B 3LO8A 1PR6A 13PKA 2CKDA 2C5LA 3S0JA 2K4MA 1H8EA 5DYYA 2XMCA 4Y1EA 3X1WA 2APJA 3AR7A 4PO9A 4QUDA 3WGKA 1P4RA 3FWZA 3N3BC 3VTZA 1ORWA 1LGYA 4Q4AA 1JVNA 2Q45A 3GPDG 3TRDA 4ZYLA 3BZBA 3EXFB 4QAQA 4JX9A 5EAIA 1PFVA 5CX1B 3EZ9A 3D3EA 5KUTA 2O05A 2R85A 3RS3A 1K66A 2CLIB 4GP7A 2R7LA 4BVFA 3SC6A 1BX1A 2OB2A 2QLMA 3EEOA 2LWIA 2LR0A 2ZE8A 3KDPA 4CQLB 2R9VA 4EFLA 4Z51A 2FWAA 4PYQA 3ZLUA 3LZDA 1I4WA 2BF7A 2QMUA 1ZIXA 3E2PA 4YHHB 2OYCA 4LTDA 4MR7B 1DAGA 3VR6A 3HY4A 4WKPA 3UPDA 2PUEA 1CQIA 4KYIB 1VPDA 1EI9A 1JLMA 2QN8A 1OLUB 1U0TA 4ZVLA 4HC4A 3ZW7A 2QT0A 2KPOA 3A58B 3F71A 3DMPA 1FQWA 1VCOA 5FOVA 1V39A 1DQNA 2DP4E 3H16A 3B7WA 3QKIA 2VBCA 2AK2A 4G23A 4MRSA 1WUIS 2EZ9A 1A7AA 4D9KA 5KQLA 2UUAB 4BNKA 3P9QA 1KWKA 2NVUA 1NAIA 4FKZA 2PA3A 3ZZTA 4P53A 3GG2A 4CLOA 2ODTX 2VEDA 3CLUD 2ZRGA 2QBYA 3A0RB 4H0CA 5DGIA 4ZALA 4IDQA 2EOAA 3KKNA 1E79A 4FGLA 4I8XA 3AHEA 4LEIA 1EM6A 1LQTA 3COWA 1VKRA 1MNQA 3PK0A 4EELA 3KV1A 1G7CA 1GT6A 4QUJA 1CR2A 2RJNA 3NAZA 2NW6A 3DV0A 4X8MA 3VO2A 5DX8A 3L7LA 3UK0A 4POOA 3THYB 1Q0PA 1SBQA 4G1VA 2LGJA 5LQKA 4DR2B 2DUWA 1NWCA 5A5EA 3HB4X 3JD3A 3T3EA 2Y1DA 3IR6A 4TMWA 1Y42X 4HAIA 4PTLA 4E5PA 4E30A 1C5KA 3D1VA 3WWZA 3IUMA 3RRZA 3HL0A 4RF4A 4Q34A 4LCEA 1EM8B 3PDUA 2YRWA 2NT4A 5IJ9B 1M2JA 1X7WB 2OG1A 4PS0A 1L5VA 1YS6A 2A57A 1ZVMA 3RJMA 3UAXA 3ER8A 4CIAA 2C4NA 3SBOA 1YCFA 3OU7A 1OLSB 1YA4A 2AOXA 2LDXA 2I03A 2H54A 4N5DA 4PLGA 3ONFA 3F7MA 3OJ0A 3QF7A 2H31A 1JG3A 1XCLA 3UGJA 4AJPA 2ZS7A 4BFYA 3ZDZB 3MT0A 3QPBA 4EPYA 2HSZA 3V4ZA 5AKIA 1Q1QA 4U39A 3GJ5A 4P31A 2OBLA 4JC5A 2IEZA 3OG9A 4Q9DA 1AMNA 2GLTA 1PJRA 1E3TA 1Q50A 2GJAA 4JASB 4CLHA 4EGSA 4U0JA 3WLIA 2XXJA 4WUVA 2XE7A 3IP1A 1V9LA 5DBIA 2OLJA 1C7JA 3HYCA 2J0EA 2A0YA 3OM8A 5F7JA 2HCTA 4FFSA 3QWBA 1P1RA 4UMEA 4TKUA 4XUCA 1O87A 1NU6A 1WEHA 4LY3A 4TL7A 4K3UA 4ACAA 4U4AA 3PTAA 1EFCA 3Q7PA 3TTVA 3ICPA 4N5MA 3WLHA 5M04A 1KSGA 2HRBA 1QYXA 2O23A 3P9XA 4BPRA 4FGSA 3PWSA 1SXPA 2BBSA 1ISRA 3C7CB 4M60A 5B1HA 2AFIE 4GM1A 3GLHE 4KWIA 4UE6A 1Z88A 3QQPA 1E64A 1CUUA 2IV7A 4IIJF 5DN6A 4DUGA 4EFKA 1HQKA 2JKZA 2P8SA 2RH4A 3C8DA 4LX0A 4XGNA 1T1JA 3LZ6A 4ZT5A 4K9QA 4DARA 1PJ3A 1I9CA 2JIRA 5DTJA 4AMYA 1S1MA 4MDFA 1ETHA 4U2FA 3WISA 3NBXX 5IDQA 1H4SA 1IEQA 3MWLA 2PZKA 2DY1A 3HWWA 1TYCA 4JFAA 3CR3C 3R7WB 3OJWA 1Z18A 2H2HA 5CNJA 5FR2A 3IC5A 3WDKA 1VA4A 4L4YA 2QW8A 3GK3A 3IQDB 4D4HA 2JGRA 4IMPA 3TDMA 2X6TA 3CKLA 3V33A 2QAIA 5KJCA 4BJ5A 4F9EA 1SOWA 4WFIA 3TLGB 4MWSA 4GMKA 2WM9B 4WY8A 3RK4A 4J6EA 2VHWA 1SEPA 4MYDA 4YP5A 3H2KA 1BMFA 3ZHTA 3SICE 4YV2A 3JRXA 1ML3A 1E7WA 1SVNA 2P40A 4HTFB 4ECEA 1OWMA 4RXMA 4D97A 1Y5MA 2VIIA 4OQZA 1E5DA 2R0QC 2PHZA 2XOKA 4EZIA 3PEFA 1Q2UA 4P92A 4HBZA 5L4LA 3GH3A 4UU8A 2I7XA 4YRFA 3L9XA 4A2WA 3ASUA 1X80B 1YONA 1SCBA 3KPYA 1KO5A 1BH6A 2RHMA 4JYAB 2FPPB 3QVSA 5DI9A 2ATIA 4F6RB 3HPQA 3P9SA 1I7DA 3ONEA 4NJEB 1ILEA 2FCRA 4ZWNA 1A82A 1JV2B 3CM0A 1H2XA 3PENA 3PL5A 3U4IA 4I5EA 1KAQA 1N9GB 3K09A 1IXRC 1IOVA 4BX8A 1IHXA 1JKMA 2IOFA 4FX2A 3SR3A 3I45A 1QZZA 1ZM2A 2IEGA 1FRFS 4QDZA 2CXQA 1D7OA 4GGOA 4GX0A 3SIRA 4MEJA 1DXYA 4ARIA 3VO8A 4RSGA 1YMVA 1Q16A 3B60A 3IEVA 2FN9A 2HRQA 4RVCA 4OHCA 1L7AA 3RAEC 5AOCA 1NVBA 5L4SA 1RFGE 4XXHA 4F3CA 1JAXA 4QXQA 3BE4A 4TV9F 2AE1A 3MFYA 2HJVA 1U2SA 2C4KA 2IVFA 1I4TD 4BLOA 3SCZA 5KX5B 1SU6A 1QTQA 3IUYA 2WUVA 3IVRA 3HI6A 1PRYA 4DRXA 1A71A 1U5AA 1ZOSA 3K32A 4PC3A 4B2IA 2AZ4A 3BJEA 3IILA 3UMJA 3T3OA 4I4LA 4IJUA 4NL4H 4P5DA 4PONA 3N2EA 2CZGA 1Z3CA 1CZHA 4DWVA 1IN6A 2C57A 4JB0A 1OAAA 1TD9A 2ERYA 2P91A 4KFTA 4PANA 3Q8WA 1I6KA 5JNTA 5CCXA 1FDIA 1UJMA 3G8YA 2XXAA 1M34E 3MCZA 1KYVA 1PJ2A 1I2AA 2VS1A 3PNMA 4XCXA 1VDMA 4XZ3A 1VI2A 4J0QA 3ELBA 4KKVA 1E3EA 1J0EA 2Y27A 3BJIC 4G1BA 5CCBA 1S2NA 2ZM6B 2DH5A 5AK0A 3AHDA 4URHA 1QAQA 4CU2A 3KSZO 5JTTA 2HHAA 4CLRA 2YRXA 1FLVA 3LQ4A 1SFRA 2YKGA 3B3QA 1U7OA 2Q3HA 4WKBA 2A67A 5E6RA 3UPUA 4I5FA 4DLXA 3A9WA 5FT9A 1U65A 3K6JA 2EZUA 4RIIA 3FCOA 1SKUA 3DCIA 5C81A 1VQ1A 2PT7A 1GV0A 4G0VA 3AY3A 4QTZA 2B6NA 4L75A 4RZ3A 3TKAA 3QBDA 2D7CA 1OIVA 1SVIA 1NUAA 2B20A 3GV0A 2WZQA 2B3DA 4CG3A 1NT2A 1AKEA 4U2EA 2HF7A 2VA9A 1GG5A 2AD5A 2IU6A 2VI5A 3BMCB 3KKPA 3M5PA 3Q3IA 3TM4A 3WLSA 2WTXA 2Y1CA 4RW0A 1U0GA 4DR4B 1A9RA 3MZ0A 4FDTA 5LQRA 1ZR4A 4J1TC 1HA3A 1VE5A 3TH5A 4ACBA 3DEJA 2DKOA 1NUUA 1HQCA 4B76A 5B4TA 4QGBA 1I33A 2AN5A 4FLFA 3OEWA 4K8OA 4G0QA 5HFNA 4BMYA 1NKVA 3W1WA