2AF4C

Phosphotransacetylase from methanosarcina thermophila co-crystallized with coenzyme a
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
332
structure length
331
Chain Sequence
VTFLEKISERAKKLNKTIALPETEDIRTLQAAAKILERGIADIVLVGNEADIKALAGDLDLSKAKIVDPKTYEKKDEYINAFYELRKHKGITLENAAEIMSDYVYFAVMMAKLGEVDGVVSGAAHSSSDTLRPAVQIVKTAKGAALASAFFIISVPDEYGSDGTFLFADSGMVEMPSVEDVANIAVISAKTFELLVQDVPKVAMLSYSTKGSAKSKLTEATIASTKLAQELAPDIAIDGELQVDAAIVPKVAASKAPGSPVAGKANVFIFPDLNCGNIAYKIAQRLAKAEAYGPITQGLAKPINDLSRGCSDEDIVGAVAITCVQAAAQDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies suggest a catalytic mechanism for the phosphotransacetylase from Methanosarcina thermophila.
pubmed doi rcsb
source organism Methanosarcina thermophila
molecule tags Transferase
molecule keywords Phosphate acetyltransferase
total genus 116
structure length 331
sequence length 332
chains with identical sequence D
ec nomenclature ec 2.3.1.8: Phosphate acetyltransferase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01515 PTA_PTB Phosphate acetyl/butaryl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10750 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isocitrate/Isopropylmalate dehydrogenase-like 2af4C02
3.40.50.10950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2af4C01
1VMIA 2AF3C 1XCOA 1R5JA 2AF4C 1TD9A 4E4RA 1QZTA
chains in the Genus database with same CATH superfamily
3HYLA 4KO2S 2V7QA 4F60A 1QYRA 1RZRA 5LZ9A 3A1NA 3H5WA 5AOVA 1I5EA 3NGLA 3TR6A 4X00A 3NBYC 2BFBB 3WLRA 3KX2A 1O5TA 1J2RA 1AXRA 3LQQA 4IG4A 4TXLA 3JASB 3L1KA 1OZGA 2HLDA 1L5WA 2R7NA 3WMEA 3QKRA 5KC9A 3VJRA 4JHXA 3ME5A 3LCUA 1ZVMA 5FPHA 1XQYA 4ENRA 5AIBA 4WKPA 2WSYB 4PZZA 4Q16A 5L3QB 3KSMA 1X13A 3H0EA 3UT0A 4DQKA 5A9RA 4TRMA 2F62A 2VT6A 5BT9A 4E1VA 1XZDA 2GBPA 4DWVA 4NQRA 3AHHA 5IKPA 1P9LA 2AOUA 2BH2A 1ATIA 1PV2A 3QVSA 1Q1ZA 2PUTA 3EAGA 3PGKA 4LRUA 2OQ2A 3NBFA 4UUMA 3U7GA 2GEVA 4RKYA 2PKRA 1C4KA 3BYZA 1NLUA 5H3HA 4RACA 3LC2O 3PDWA 5GAJA 2X2FA 3EAFA 1Y8CA 2C88A 3FXAA 2H51A 1I5OA 2GARA 1V3TA 1MV8A 2IEBA 4AZ0A 4JJ4A 2IUFA 3I42A 4Q02A 5BPHA 5J4YA 1PR3A 2CHQA 2FSIA 1PL7A 3RC2A 2X5OA 2Z9DA 4YAGA 1GLVA 1JBEA 4TLEA 1UBGA 1Q1AA 1T4CB 4YT5A 2ZWOA 4QOIA 3UGTA 4PXAA 4DNQA 4ZVUA 4QGHA 3A1TA 3QFFA 1ODTC 2IP2A 3O26A 1CUJA 1QO9A 4KLRA 2ODQA 4M1KA 4F3YA 2BGLA 3G3EA 1DKOA 1FSSA 3GDWA 4BLTA 4R2KA 5IXYA 1R5JA 4NG4A 1ITZA 1SG9A 3DW3X 3KAQA 1IG3A 2XQKA 5CM2Z 2XTAA 4QT0A 2H7VA 4JYMA 1SVWA 5IHXA 1IN6A 4IDCA 4RENA 3BHJA 2EW2A 3WHPA 1QH1A 2H3EA 2EG5A 3JVDA 4O1IA 1SUIA 5GONB 5A5DA 2PH5A 2WF9A 4G56A 5LNK1 1U9IC 3FUCA 1RQ2A 1JAIA 4UCQA 1C7RA 3NOQA 3FFTA 4E2XA 2GAOA 2ZYWX 4NYIQ 4E32A 1JGTA 3ZE9A 1YAHA 1L4LA 3SOZA 4DLVA 3WVNA 4EPXA 3FDZA 4BO0A 1UKAA 1JPJA 2NO6A 4X65B 2Q0XA 2R11A 1XZQA 4UHDA 4LJ4A 5DTIA 4BB5A 4GLOA 1FXUA 1V2GA 4DR6B 3DC7A 1V5FA 3HHPA 3K4PA 1P2GA 3IP7A 2QVZX 3EMBA 5J58A 5CM9C 2PBRA 5BXQC 4FDVA 3IB6A 3QUCA 4LV6A 5HGXA 2QVXX 2ZJYA 3QUQA 4R05A 4J1NA 6Q21A 3D8HA 1DCKA 4PSDA 1M1YA 3L8DA 3DAFA 2VATA 2OV1A 1M76A 3KXLA 4JU8A 2RONA 5KVAA 4U2BA 5B4TA 1BDJA 2GLUA 2XUKA 5I7WA 2VF4X 5AKEA 2PMFA 5AHRA 1VHWA 3V9PA 3GHHA 3M2TA 5GTDA 4JEIA 2ZYRA 1U0HC 1V9SA 2HJGA 4LHSA 5H3CA 2ZJ1A 2GJ8A 3MZ0A 1Q2UA 4UTZA 4OG2A 4IDQA 1QGOA 1T2CA 4Z4CA 1FRVA 4L4XA 5BV2P 2YMPA 1Y4UA 3VAYA 3CG0A 1MXFA 4YT4A 3DXZA 3HJHA 5C8DA 1P4RA 1JVNA 2CF6A 4HDMB 3AERA 3GLGB 2I8LA 4QYIB 3VZRA 1UWVA 3FCOA 1DEAA 1PJQA 1XZNA 3I4LA 1QV6A 2CXHA 2HX1A 2X76A 3LE8A 3OQ6A 4LEIA 4DCGA 1FF9A 2O3TA 1AKNA 3ZHUA 4EYKA 4MJXA 3RRYA 1CUIA 2JHCA 1S0UA 2NSDA 2O5VA 5I9LA 3V8VA 4P8RA 4LFAB 5IBCA 1I5RA 1RZ3A 3HVKA 4FC7A 2EHJA 2VKTA 1LD3A 4X1IB 5REQB 3SI7A 2Y1EA 1CVRA 4FSDA 3KD2A 3T4PA 5I45A 4QFCA 4DN6A 5D3MB 3PA6A 1AGNA 3BF7A 5FTLA 2REXB 5AVVA 2VBGA 1N57A 5K0CA 3AR2A 1KMHA 4JITA 4QNMA 4H08A 1IPFA 4YUWA 3DF7A 4U63A 4MV4A 4BP3A 3LDGA 4KPFC 3IO3A 1H1LB 4IDFA 4KKXB 4NNPA 1Z4LA 1GNLA 4O4JF 4I1VA 2PT6A 3ZIAA 4B82A 2I55A 1NU6A 4AICA 3N8NA 5AVKA 3UK6A 4UVIA 1DT3A 1JT9A 2CXNA 1UQRA 1Z9BA 3KUXA 5COBA 1I30A 1DRJA 1F2VA 3LG2A 3QPDA 4X60A 2I8AA 1VFPA 5TEVA 3VOBA 2YYYA 3B3FA 1VCMA 2FUEA 2ZBGA 3PQEA 3M2PA 3SHVA 3KYJB 3AHEA 1NJSA 4ME6A 3E3NA 4YQYA 1A9XB 1U3TA 2HK9A 5A02A 4P84A 4G1FA 5E1OA 3CE6A 421PA 5C3MA 1X1BA 3IDZA 3JVUA 4XA8A 3TSYA 3V00A 3DONA 2IE0A 5DHTA 2PUCA 1CWUA 1P2DA 6REQA 4X5OA 4M1TA 3FCXA 2VCHA 1X7HA 2PZFA 4JD5A 4KFUA 2ZI9A 4P0PB 2ZRAA 2Z56A 3QVLA 1BS9A 4H7JA 3KT8A 3OESA 5ITVA 2W58A 3FWNA 1KK3A 2IEIA 2YUIA 5IUNC 2FMFA 1P73A 2WIJA 5GWXA 1D6NA 4V1CB 4FHEA 3COJA 1VBFA 4U2DA 3R6DA 1BG6A 2ZRCA 1Y5LA 5J3JA 1OXSC 4V39A 1ZUD1 3VH1A 1GR1A 2JK0A 3GFFA 5EJFA 3HCNA 2FHPA 3ZY6A 1QLJA 2J30A 4KO4S 5JVDA 3OZDA 5AM0A 3AW9A 2VF5X 2JLZA 4PG5A 3ANMA 1WMEA 3WGQA 3EHDA 2WJ4A 1KYXA 1O58A 2PO5A 4M6WA 3HI6A 1FVHA 3TLGA 1V5EA 3WGOA 2ENUA 2C98A 2PQ6A 3AM3A 3E4DA 4TPKA 1AUOA 3KOXA 4D9FA 4UOZA 4HEQA 1EK6A 3IAHA 4OBEA 5DFAA 4AD8A 1EQ2A 1A69A 2NU9B 1RYNA 5AD1A 3EWNA 1CEEA 1BHO1 2JHFA 1Z2EA 1DQSA 4IR7A 4PV7A 2LCQA 5DU2A 1R6VA 5I3CA 1HG1A 3BWVA 1CUDA 2J0SA 2JI9A 3O2JA 3TXAA 1SUCA 1ZK1A 4X1OA 2P9GA 4ER7A 3PS9A 1U8YA 1U1CA 1O08A 4YUVA 2COKA 1QRTA 3WY9A 3RVPA 2W6JD 2OXTA 3JZFA 3NHKA 1U0TA 3KZNA 4ZEOA 621PA 3MWDB 3TK1A 1PJ3A 5BUQA 3GWGA 3VTFA 2NNLD 2YNMC 1B41A 2EX0A 3HKEA 3LGSA 3U17A 5AESA 1HC7A 1N8KA 1PZXA 3G9QA 1X2BA 4K2HA 4FFWA 5F2EA 1TZBA 1OI3A 2W6QA 1FJHA 5KHAA 4TQGA 4FLEA 4IIUA 1K5HA 4MWGA 2B3TA 4BCCA 5ALNA 5JANA 5FNVF 4P81A 2R8OA 3L7DA 4C1BA 4YCCA 4C9BA 4B4VA 3KYIB 1CKEA 3B3AA 1H69A 1Z4MA 2QN9A 4L5CA 1Q22A 2ECPA 3ZV5A 5SY4A 1PTJA 3GOQA 1N2CA 3ZY5A 3F74A 1JXAA 1DLJA 1RXYA 3CX7A 1U6IA 3IUPA 2C5BA 3R77A 3DTVA 4ZMSA 5MFPA 2HPHA 2DUNA 1PQYA 5E6SA 2H0RA 1KORA 1V1RA 2WWVD 1UXIA 1NR7A 2FJPA 5FNZA 4C7OB 1D0IA 2EZ4A 3HP7A 2YV5A 5AKXA 1T1EA 3WWZA 3WL5A 1IZ9A 1U7WA 5D5HA 4ZZ1A 5JXGA 1A5AB 4FYVA 1NW4A 2GR9A 4N6OA 3TQHA 1IK4A 4R69A 2RIPA 3LYAA 3REGA 1R0WA 1JDJA 4ZYVA 4RA6A 2QTVB 3CKKA 5CYGA 3PZRA 3W8EA 4DSTA 3KU1A 5BSHA 4EO4A 1WHSB 3CT6A 4OB8A 5G4KA 2XD9A 3CUWA 3KJXA 3PPWA 3QVOA 4MR8B 1TQHA 1JDUA 1AT1A 4AY5A 2NTVA 1NE2A 2VP2A 3D6VA 3L04A 2J9XB 3VU9B 3U4MA 4NOJA 4F5WA 1IY1A 1ZG3A 3DUFB 1FQWA 3E4CA 4JVNA 4X6LA 4RWZA 4C04A 3WJAA 4MO9A 3GU3A 3VH4A 3ETEA 2R8YA 4CM3A 4II3A 1Q1QA 1T4MA 3KPWA 5DNDA 4BE4A 2ZWVA 2GD0A 3ELUA 4K3UA 3CNOA 3FYDA 4R31A 4TRRA 2ZJ6A 5D7NA 3VH2A 1TYZA 1RWQA 2NTEA 4K8OA 4LE0A 2NGRA 1UBEA 4UE3S 5LBTA 3X1XA 4GNRA 1U94A 5H80A 1SQ6A 3DZBA 1CY0A 4D0GA 2CHUA 3BQ9A 1TCCA 4Q3DA 1IJEA 1YB6A 4W1SA 5H83A 1TA4A 3AM4A 5U1PA 1KS9A 5EJ9A 3OMLA 4NJOA 2A9RA 1KAGA 2YMLA 4M0UA 9LDTA 3HDJA 1HKHA 3JQFC 4JT8A 4Q9IA 4TV9A 3QNMA 2XADA 1WCYA 3OC6A 3ZHOA 3ER8A 3JQ9C 1MQ9A 2O0JA 4OQLA 3CNQS 5FWYB 1M8JA 5AHWA 3BFJA 2FZWA 4B83A 1MENA 4Q12A 5AUNB 3S1LA 5CFNA 5DW3A 4B7AA 4RWEA 2VC2B 2QUAA 1O7JA 1SA0B 3HDHA 2ZQZA 4CIAA 4ZQBA 1PYOA 3B70A 2ZB2A 4MPJA 5AW9A 4EMSA 1DFIA 2HNKA 5DLYA 1DLIA 4MGHA 1HBJA 4O4LA 2OOSA 4IS2A 4RD1A 3RGGA 4O3FA 3RT1A 3U4CA 1O0BA 1N3YA 1SGWA 3KQQA 3DEHA 4P83A 4YLYA 4J75A 3V34A 4TUYA 1KJQA 2P7IA 3N0TA 1EG2A 3LSTA 3NV7A 1S1MA 1ZSVA 1Z63A 3RUDA 3ZLJA 4H7FA 2NP7A 4OJKA 1TM5E 3BAZA 1E1QA 1XCGB 2IL1A 4Y0NA 1HDOA 1PT7A 4PLCA 4YI3A 1JQLB 3A04A 1HLPA 1RJ9A 1RWBA 3AJRA 3HLTA 1WDLA 1TK2A 4ZVMA 4B8WA 1NGSA 3ADCA 1ZN7A 3RTCA 4KAXA 3PQ2A 1NXSA 2C5HA 1RAIA 1X8LA 3OEEA 4L85A 4LZJA 2FEXA 3ZE1B 2FW7A 3AV3A 1R5NA 3UG6A 2ZVQX 3QX8A 2C2MA 1SD5A 2DUWA 2ZYAA 3LKZA 1R3DA 4IJ6A 4H0CA 5EIAA 3GZ4A 1JXMA 4MDEA 2EWWA 1EFKA 2O3RA 3QU5A 3QLVA 4EMBA 4NYJR 2DHDA 1E9FA 2IY9A 4ZAGA 3OD1A 5E7MA 2DT8A 3PC7A 1RWVA 1TJYA 3C5WP 3UK2A 2R79A 4PQYA 4HSGA 4IHJF 1WXEA 2IDMA 5FJJA 4LOLA 2BP7A 1IOVA 2GK7A 3K0FB 2W4MA 3K53A 4CTNA 1R8XA 3ZU3A 3KVNA 3EVNA 4ZAYA 4GE3A 3Q72A 1DOHA 1ZGBA 4HWGA 4IDPA 5BNFA 3WLHA 5FEUA 3TTXA 3AT1A 5JH7B 1QRSA 1DI0A 1PKXA 2CV1A 1VHDA 2R96A 1LRLA 3ZW8A 4ES6A 5IANA 5J1SB 3JQAA 3AFIA 3DV9A 2FEKA 1A88A 1DDGA 4RIFA 3T1HB 2AN9A 2BBSA 4ZQIA 3B9PA 4E2ZA 3QEOA 4RTPA 1J1IA 2W2OA 1J8FA 4BUJA 3EIFA 1U2GC 3E9MA 3DH0A 4P3XA 1XQ6A 2OCPA 5B6JA 4W9NA 4DR5B 4GI5A 4W5HA 3U5ZB 4C7XA 1ZCZA 2HA0A 3CKLA 4Q9KA 3TW0A 5D6NA 2F8TA 1SOAA 1MR3F 1LWNA 1WHTA 1MNAA 2E4UA 2VIIA 4NP6A 5I7AA 4GOKA 3IBSA 2OLJA 3K5WA 2HXGA 5ALZA 2EFEB 2QT9A 4IF4A 2ZQ5A 3G6WA 1X9HA 2IA5A 1V48A 4P82A 4HNRA 4KQHA 3T1OA 5J2TA 4XOIA 3VO1A 1TEZA 1IPEA 3NAZA 1BU8A 5DTQA 1SCBA 4LWPA 5JFOA 1M83A 4NDAA 4TKUA 3TE7A 1DRUA 3TLMA 4ABYA 1CR6A 1ZOLA 3EDMA 1E7YA 3B1FA 4GZLA 3V2HA 4DLNA 4DV6B 3H7AA 2ZXFA 2QZ4A 3GUHA 5BN4A 3U7HB 1BO6A 2VJMB 2YHIA 3FSJX 1G2QA 3RR2A 4BE7B 5JNUA 1GZVA 3LLMA 4CDNA 1BCSA 3MJSA 1UPUA 3VJMA 1V71A 1T8UA 3R6GA 3GGJA 1NQXA 1DCFA 1TVKA 3CF4G 3AOGA 4IZIA 5DXJA 3ZOKA 5BOVA 4RK6A 5JPIA 1K75A 4IMIB 4DM3A 5EJ4A 4Q3KA 2IV7A 4A6XA 1NNUA 1G8HA 4FZVA 5BN4B 3USZA 4CM8A 2HHLA 1ILEA 3R3YA 2X7HA 3BFPA 5MN6A 1GSHA 4GHWA 1MIOA 1Z16A 2PUBA 1TLTA 3HGTA 3S2UA 3PXGA 5KHLB 3C6ZA 4J9VA 4LBZA 5DTEA 4OY3A 3U4QB 4LV8B 3S1AB 2RH9B 4EY3A 5AVYA 4RMHA 2BGWA 5E7JA 1RZVA 1Y8AA 1H0RA 3LS2A 3NHFA 3R3ZA 4J6FA 4MVWA 2ZYTX 1R4NA 2EBWA 3QV1A 1XHLA 2P2YA 1FTYA 3K4HA 2WABA 4GXNA 2FSVA 4ZICA 4YAIA 3DBIA 3DE2X 5LOVA 1ISPA 2JCSA 4MWBA 3R74A 5H9WA 4XD7A 4C22A 1ZCBA 5JVDB 1PSZA 3BORA 3OUZA 4MKRA 2PMEA 3W6OA 3VA7A 4AUMA 1F7VA 3EVDA 2EWVA 2VJAA 4KGVA 1JBKA 4HDNA 4OU5A 4XDZA 3G2MA 3CUTA 3KR0A 3PFNA 5FBWB 2UYQA 3ORYA 1ORHA 4LNAA 1HTWA 5E6UA 5AK6A 2OXFA 4UHJA 4I50F 4MV8A 3K1ZA 4BFYA 2XUOA 1GTVA 1Y4DE 4NMMA 4YUYA 2IUTA 2NAPA 5MGBA 3UYKA 1T8TA 4LMRA 3U7EB 1JSLA 4B3DA 1GDTA 2J0QA 1ZA2A 3H13A 3MS4A 2Z3VA 3PUIA 4WV3A 4F4JA 2IXBA 2CSUA 1G8FA 1NHWA 1CIPA 2GUGA 2QRKA 1Z8HA 3K0AB 1AKQA 2J1LA 2HRDA 2Q6KA 4JWTA 2H0QA 1FPQA 2H2DA 3EQ8A 5K5EA 2NYRA 2ODBA 3CZQA 1SVNA 2V7QD 2WYIA 4RA9B 1TVCA 2CL0X 1N1DA 1SQSA 1NNI1 1FB5A 4CKEA 2A84A 5H02A 4PZYA 1RJFA 1TJ5A 1A77A 2CFTA 3G2JA 3C15C 3I1JA 3KWFA 3NIBA 1Y3IA 4U2GA 1Y4SA 2ZRBA 5BYKA 3KL4A 5F64A 5BXYA 5I3ZA 3SR0A 5HXAA 1K3UB 1N9ZA 4K1LA 3INYA 3EWSA 3ACBA 3HXLA 1CUEA 3GLKA 5FJIA 4CR6A 3RUEA 4LRYA 1HE8B 4KLNA 2JI8A 4YAUA 5J4VA 1AURA 2FV8A 2BEJA 3X44A 4DG9A 1XKXA 2Y0DA 3PIRA 3RBAA 4MS3A 1V3VA 4GYJA 3WGZA 4BC1A 1DJLA 2PWAA 5DHSA 4CG3A 5JCXA 1YAJA 3ZD8A 2BOVA 3E22A 4MW7A 5BQFA 4GWLA 2GZ1A 4IWNA 2P68A 4BDTA 2RHCA 2QSYA 2P0EA 2CBXA 4E5UA 1Q3KA 1C0KA 5BQPA 3TZEA 4D82A 3IBYA 2H2IA 3OZBA 4EB3A 1LPSA 1VL6A 3ESBA 5FBZA 3L1IA 2PS9A 1PNVA 4AXBA 1XV5A 1T3GA 1U80A 2L42A 2Z3WA 1ZD5A 1M6WA 2PQ2A 1XKTA 3F6CA 5AM4A 5BSMA 5KWSA 3L3BA 5DNCA 1L2TA 5ADUS 4QOSA 3GBPA 4UXHA 3T4XA 1JAXA 2PKCA 3A6FA 3K1AA 3L9WA 4JP3A 4RXMA 5CG2A 4D4KA 2W2KA 3PQCA 4CEHA 1I0LA 1G5HA 2WB4A 1OXVA 1OT5A 4RFSA 2JFYA 4X7PA 3V48A 3OO0A 1RXWA 2MSWA 1H5NA 3GLIA 3OFND 4ZT7A 4HLQB 3W8DA 5KVQA 4KN8A 1D5WA 4QSMA 3LPMA 4ZOQI 2B1RA 2WJHA 2WKPA 3ZNPA 3QWFA 4KE7A 4Y2YA 4CKEB 3FNRA 3MT9A 5EZYA 3IL2A 3IV6A 3UOGA 4IV5A 4HDSA 2C94A 1KR5A 4N8SA 3AEZA 4HAZA 3WBJA 4AX4A 4CDGA 2WEKA 2XMBA 1Y7IA 1Q0QA 5JG7A 5CGZA 1DMSA 2VSFA 1QPGA 3EQ6A 1VBNA 4NCIA 4XDHA 2VSYA 1DIOB 3LBAA 1DBWA 5ITZA 1XXHB 2VSOA 3RIHA 3CFYA 5E9WA 3EODA 2HEGA 4ZYYA 4PYLA 3VBCA 4QFBA 2C4UA 4D9KA 4LPSA 5KJCA 4LF9B 2Q6TA 3W6UA 4KR7A 3L06A 4G0VA 1HWYA 5E8JA 1WB4A 3WO1A 2CMFA 5DNEA 2VXYA 2A0FA 1DTEA 3KOYA 1L4YA 1TTHA 2X9VA 4ZAVA 3WADA 4PFKA 3OJXA 2QD5A 2OCBA 4JUCA 1Z82A 2CFRA 4NONA 3UHFA 4C4YA 2CLKB 1ZGHA 1GADO 1M6VA 2ARKA 3DOIA 3U7RA 1LNZA 4IINA 3TVYA 1LDBA 2CKMA 2FWRA 4FINA 2ZOSA 3KFVA 1RWMA 1VB3A 2WYHA 1Z6AA 3RHSA 2HLHA 4TMTA 1BS1A 1HDGO 2B99A 5D1HA 3U3OA 1IH8A 1WSWA 2V6MA 3EXEB 4IHJA 4BWVA 5BSFA 4BGDA 4ZTBA 1WD5A 4R8VA 1KI8A 2FR8C 3JWEA 4PO8A 4M46A 3Q9SA 3N3BC 1BQ4A 2IS2A 2FX5A 4DR3B 4JYZA 3BN3A 4R0MA 1ZJWA 1MB9A 1A8QA 5G0SA 5ERYA 5CK5A 3TLJA 3EFEA 3OA0A 1GCGA 1MTZA 2QAJA 3SIPA 1M5TA 3ZE2B 4BJ1A 4UUNA 1P7YA 4L0DA 1JIVA 1IBCA 3QFHA 5IUKC 4MLZA 1ZH0A 1GCAA 2DECA 1C8KA 1LS1A 1IXRC 2ON6A 2VLBA 4WHMA 2X8BA 3ED5A 3F46A 3CO5A 4KXYA 1JHXA 2C9BA 3TD9A 1FU7A 3WJ1A 1EUCB 2VPTA 4P93A 3GJ5A 2AC2A 1JKJA 2IHKA 4WECA 5JJCA 1WU7A 4UW9A 2R6ZA 2RGXA 3L5KA 1EDEA 4DIBA 5ICSA 5FBLB 1YCGA 1JQKA 4LVCA 4AJJA 4PYIA 5FX2A 3B1YA 4RTQA 3KQOA 4Q24A 3ZY2A 2JA2A 1QXSA 1V8FA 3E2MA 3FYSA 3ZWOA 4M7PA 3ZGYA 4EATA 5DISB 5IKMA 2VBFA 2YJ6A 3WB9A 3WB0A 4OJYA 4L76A 4KNVA 2R6AA 1R4ZA 1Y5MA 2P0AA 4OGKA 1WVMA 4RY0A 1EVQA 1D2NA 3PCTA 4XWAA 5DNYB 1G8KA 2HQOA 1V45E 2DUMA 4P7FA 4RJTA 5D86A 4R71A 2WD8A 2AOWA 4WKNA 3GUCA 4LUCA 4PHCA 3I1IA 4BO7A 4ATNA 4WY5A 4L0MA 5IVDA 3DTVD 1SJ9A 4JZKA 4LCBA 1NXXA 2ZUFA 3CLSC 4LGYA 1UQUA 4I0WB 1Y8ZA 4OXYA 3OTOB 1WB5A 1CU1A 2W11A 4H1HA 3Q5EA 2H5EA 3EQ7A 4A0RA 4CMIA 2V7UA 1A2OA 1NP3A 1YCFA 2FKNA 3B7PA 2B5WA 1PZGA 3NBQA 2QVLA 2W2LA 1VP3A 3EZ9A 5E4JA 3FVVA 3WB2A 2N9UA 2Q5IA 2F59A 3CH7A 1QIIA 4DT1B 4ASUD 1D5CA 3A1UA 4WEQA 4YJFA 4BMOB 5JDIC 3RVLA 7GPBA 3D1LA 1AGYA 3OEWA 3BHMA 3V1UA 5CCXA 3F98A 4WEOA 3BB3A 4F6RB 2NT4A 4ZHQF 2CNNA 3FI9A 3Q6IA 4HB0A 4TS4A 4KR2A 3HKCB 2EFJA 3AR6A 4DMMA 4HQ6A 1MB2A 3DDSA 3LECA 3U7IA 1YASA 1UAYA 2JI6A 4J49A 1DG1G 4HL6A 4PS0A 4DLPA 3BXEA 2G71A 2DPYA 2NQTA 4MUFA 1TM3E 1QQTA 3RSGA 3WMWA 1YCDA 1GAWA 3JQGB 2XDQA 4TVKA 5HS6A 3SHWA 4EZBA 2JFOA 2RGCA 5DYIA 5K6RA 1FQKA 5C1IA 1H1LA 1IQUA 4PNPA 1XNJA 1BMFA 3ZGVA 2Q5EA 1RU3A 4J91A 4URVR 2REQA 3NH6A 2CJWB 1W5AA 1NM5A 3VOTA 2QX9A 1QB8A 1STOA 1OE0A 4ND7A 3PHLA 2H1LA 3TFWA 2F1HA 4US2R 2X0NA 4K9OA 4QDXA 4OKSA 3NBAA 3T95A 4TLBA 3GLVA 1SQ0A 4AJ2A 1ND5A 1YACA 4XSGA 2BGKA 4N5IX 2P27A 1KXJA 5LM3A 3HU3A 2H18A 5MF6A 1UKZA 1Z4IA 1F20A 4MR7B 2NSYA 2ZREA 3HXKA 3M6VA 3A6KA 3W6PA 4RJKA 4EKEA 1V8DA 3OOWA 1GTJ1 4OHWA 1ZY2A 5EJ8A 2WOOA 1TYBE 2OGZA 2ETXA 3L7AA 4IIHA 3URKA 3FTDA 1HLGA 4WCDA 2XE8A 4H6XA 4RBNA 4UM9D 5ALOA 1VJTA 2XXAB 1X0VA 4XJVA 5CA1B 3R7FA 5FFMA 4AJOA 3BGWA 3K31A 4EB0A 3JWHA 4MHSA 3A7EA 1LLUA 2PXXA 1X77A 2FEWB 5KTOA 3O9ZA 2BJVA 1WMAA 4IX1A 1EFDN 5KYVA 2VNKA 2AZMA 4A8TA 4ZZIA 1KPIA 2A57A 5AYVA 2R85A 1J24A 3FR7A 2NU6A 4HFNA 4H9GA 4UDYX 4RIGA 5THKA 2G7ZA 3CHYA 1JJAA 3M5CA 4DJJA 3QKIA 2XWJI 3EF3A 3WO0A 4GH5A 2EJVA 3IVCA 2G1PA 3LRTA 3IVGA 1O54A 4Q48A 4YRSA 2RHBA 4ZC1A 5HF5A 1HZZA 5J5CA 1H66A 3ST7A 3W78A 4DCOA 4NFHA 5DI9A 1L5OA 4J76A 3BMCA 3TOXA 1HLFA 1QCDA 4JSRA 4ZODA 2DTXA 3EXHB 3G0OA 3ROZA 3EC1A 2VYNA 3C48A 1GL6A 4E7PA 4RIEA 5DGTA 1JQAA 2I22A 3PKZA 1R5BA 3PGMA 5KTPA 3UJPA 5CA0A 3TIFA 1KO7A 4CIDA 3FSGD 3H2KA 1KJNA 5BR7A 2QRNA 2IYFA 5DXAA 4O2BA 4D8VA 2WWHA 2QMYA 4K28A 2O7VA 2DBRA 5DM4A 4RTRA 2OK7A 3LPCA 4GGPA 4N0MA 4B7ZA 3FM9A 1N34B 2YNMA 2FWIA 4V0NA 1KEVA 2FF7A 3C3PA 3R7WA 1AN9A 2I67A 2B34A 3K94A 1DC6A 2CMHA 4RS3A 3AXTA 3RC3A 4M0EA 4UM5A 3W2TA 3F5DA 4U2EA 5EYPB 2IDJA 2BVNA 1ZGJA 3DDHA 3FWKA 4RKQA 1G291 4D5EA 4F7DA 3N07A 3T7TA 4EHDA 5FLXA 3WRVA 2ECOA 2H31A 3RSLA 3T7IA 5BVHA 5CPBA 3AUUA 1ZM9A 2O14A 2P79A 3GZJA 3MD9A 1YJCA 3M8KA 2GYYA 2CLDX 1L8AA 3BMXA 2CMGA 3MTDA 2QP3A 4ITVA 2WUWE 1LPNA 3QU9A 4L4YA 1JLHA 3UMGA 2YRWA 4G2NA 4C14A 5CLFA 2J3HA 2G63A 3I3OA 4HQLA 3H1GA 2EBUA 4OGGA 2RHHA 3ITNA 4WNCA 3WP0A 3ZTTA 2ZCJA 4D25A 3F1KA 2MU1A 3NOOA 4RD3A 1ZAKA 1ZFNA 1RXCA 3O4RA 4WMLA 4CR7A 3AF6A 2EW8A 2P5SA 3ZI4A 1IMOA 3WAJA 1KKMA 2XYPA 1Y9JA 3D54D 4NJEA 1IXSB 2XA9A 2Q4OA 4K0RA 2DULA 5LR6A 3EBPA 2FZ4A 4Y9RA 2VHXA 4J0EA 3I2JA 1AK2A 1QQ5A 1JAYA 3WHKA 4A9AA 3OA2A 1M34A 2HREA 4GI7A 4WADA 4QGBA 4NFSA 3TL6A 2R8XA 4TN1A 2ZB8A 5I7SA 2NOAA 5ALXA 1E1NA 1ZU5A 3X2FA 2C84A 3IAS6 3VR6A 3V8BA 1E6UA 1SH7A 3S44A 3TQQA 2IBTA 3BCRA 4RYLA 1MT3A 1PUIA 5AWFC 2GVZC 1ZZGA 1QUEA 2DHEA 1QH0A 3C3YA 3CSDA 4R98A 2JFWA 1M1NB 9MHTA 2HJHA 3S68A 2XR1A 1GKIA 4NARA 4ALIA 3EEIA 3QOXA 3ONNA 2IHUA 3A2LA 2YJ5A 3LBYA 4L72A 5COAA 5FL7A 3ZIUA 1AKWA 1A1SA 2EKBA 2PT5A 2QR5A 4JYCA 2IPLA 4QTUB 3IIKA 4R6XA 3WTCA 8AT1A 4PLGA 5KTRA 2PVCA 4Z4EA 1RXEA 2WT8A 1HE1C 4X41A 4HVAA 3HJUA 1AQYA 2VZEA 4CLEA 4TLMB 3VJKA 1P6XA 2C7PA 1XVTA 1ONBA 1RHQA 2OILA 4PGGA 4RK0A 1GTRA 3EXG2 3LUGA 1NAIA 2ZAYA 2MYUA 2HJ9A 1PLKA 4HNGA 4L2IB 4Q93A 1B76A 1KHTA 1RI1A 2CXOA 3CCFA 3O3OB 4AC9A 1XCBA 4B6JA 3MWGA 2BZ0A 3DVRX 1JHPA 2EHDA 4CQMD 2WV7A 4PQRA 5CYPA 3WLJA 2MT9A 3GRRA 4KIFA 3BJRA 1ECJA 4F5YA 2CXRA 4KMRA 3CEJA 2N1MA 4UNSA 1MJNA 1V41E 3IHKA 5HG0A 1QTRA 1RYMA 2PU7A 1HETA 2O59A 3BKXA 5DIFA 5LVAA 5JS1A 2VTDA 1K2WA 2YHSA 2YWHA 3VPCA 3A05A 2X8JA 3AFOA 4BNYA 2BGNA 1SCKA 2Q1TA 1YC2A 1ZW1A 2R48A 2UVQA 3CV3A 3HRHA 3PQDA 3QF4A 2A0WA 1CTQA 4DABA 3TF5A 2Y4NA 5JS2A 5F9MA 4Y7CA 3MWEB 4W8GA 4POAA 1ZM2A 2QZ9A 3OOJA 3U9LA 2XUAA 4H18A 1LRJA 3HUFA 3LBHA 5K6AC 2H3HA 2X7JA 3D4NA 4INOA 2IZ5A 4MRNA 5EJ7A 1BRTA 3C16C 3FOAA 1IOZA 1U1EA 2PKQP 4YRPA 1LJ8A 2VHTA 4E3ZA 3RI3A 5EL0A 2PXHA 3GEEA 2PWPA 1V6SA 4J16A 4M9ZA 2IX3A 3W5AA 4HXGA 1WWKA 3ZZ0A 1RJ9B 1UIRA 2X77A 3QPCA 1IWBB 3RRZA 5IAOA 1J5EB 4DNOA 1UFKA 3MJRA 1SQGA 3CY6A 3P2JA 4MYTA 4URHA 3I28A 2JCVA 4HEJA 5IDXA 4HLDA 3FSGA 2QGNA 2ZPUA 3V80A 2E85A 3WLOA 1M75A 1QFXA 5FI0B 2WQ6A 1P9OA 2OLKA 2OV6A 1ZH6A 5COQA 2I2BA 1CS4C 3I0NA 2FWJA 3FNGA 4NY1A 2VXOA 4QUBA 2L2QA 3IHLA 4HQKA 4OLFA 3RAEC 5TF0A 2R5NA 3M6FA 4H27A 1O9HA 2RI0A 2AD5A 2EQ5A 3GB9A 2MMCA 2M6RA 1PK7A 3CCCA 2FJUA 4FJ1A 2NO7A 4HOYA 2QROA 5DB4A 3WLIA 4BNZA 4BB9A 1YK1A 4R83A 4XWWA 1VFNA 1YTLA 4ZFNA 4POOA 2IS1A 1L3BA 1DRVA 1QVZA 1N78A 2AH5A 1PL8A 4TV9B 3RV3A 1XCLA 2C0CA 1FZTA 5LP6C 2W83A 4DLAA 3AHFA 1EFPB 1E18A 4G8DA 4MV7A 1T0BA 2B7LA 4WXMA 3CRQA 3RRNA 1KGDA 4UTNA 5HRUA 4UUOA 5C52B 3VQTA 5DLQC 1ZD1A 4ZPXA 3TJZA 4ZCQA 6YASA 4BE9A 2A9JA 1T34A 3AG5A 3MGCA 2ILVA 4J7AA 1UK6A 3A8TA 4UUQA 3AOEA 5B4UA 3RU9A 2WTUA 4PLVA 3D8NA 1J1ZA 2CDBA 3NOVA 3P7MA 1RQLA 3CLKA 3Q3VA 4HFRA 4LSGA 2HIMA 4BKRA 4BNTA 4S24A 4UEJA 5A3RA 2VP0A 3WNCA 1KAQA 5KOYA 2BDTA 2JBAB 3CCBA 4U9HS 1QMGA 2GCIA 5FI5A 1XYGA 3GR6A 3PNSA 4UUPA 3V1MA 3L8FA 1BFDA 3EFOB 1JPUA 4NBRA 4EUNA 4LDAA 4FZJA 2E48A 1IPHA 2AFHB 1SCUA 4XSHA 4ZVNA 2CD7A 3DZCA 1ULSA 1WXHA 4WY8A 3H5LA 3E1GA 5DV9A 4Y2TA 5DBHX 2CSXA 1UJ4A 4HNQA 3UA4A 4DMUB 1T24A 3H9CA 2V4UA 4KSYA 1TJNA 5FPKA 4M0DA 4O59O 4QARA 2C83A 4AMZA 4AYXA 1M2FA 4X97A 1PR1A 1XTVA 4AKSA 4DHEA 4IDHA 3LT5A 5K0TA 3ZK7A 1I6MA 2NM0A 2WYVA 3NHSA 3OFKA 3EZ2A 3WKAA 3DL4A 1I4OA 1WXWA 3QH4A 4B9AA 5G0TA 3ZDFA 1UBNA 1G42A 1KYWA 2YVQA 2XUFA 3EDOA 2WOJA 2EXXA 4W1QA 3IPCA 2YXPX 4JT2A 4XX0B 1JA1A 4RMNA 1Y48E 5LP6A 4YRRA 1D09A 2FWMX 3WDMA 3IKMB 2VXCA 2HU5A 3BTSA 3F6PA 4HMPA 4N9WA 3GPCA 5K2MA 3TLCA 2J6CA 4OP3A 1MC8A 2QMQA 2EERA 4GXQA 1B3BA 2QW1A 4HR7A 5DMXA 2C42A 1U7UA 4O5AA 4OHCA 1GGEA 4X8HA 1RRMA 1W0JA 2V54A 1A9QA 2WIKA 3EASA 4NFLA 4P3NA 4PLPA 1WB6A 1LK5A 4CKYA 4O4IF 2OMEA 4BLUA 3I2YX 2G0NA 1NY6A 1BWQA 4Z7OB 4PZ9A 4CT4B 3RYHB 2DQ4A 4JSTA 3LA6A 1CDOA 4A3SA 2ZP1A 3OQJA 2F64A 1GPH1 3VSCA 1Z2AA 4W5WA 3C8MA 1L8QA 1OYVA 4MGIR 1QOZA 3KAPA 4HUQB 1IY0A 1N7HA 4TMZA 4JI0B 4DDVA 1YSCA 1GPBA 2AI3A 3G59A 3M4JA 3NIDB 4P22A 4BMDA 5E3HA 5C4MA 2B4QA 3AFGA 3OX4A 5M5BA 1GRCA 2HHCA 3EA0A 4R2JA 3LPNA 3O9MA 3KTAB 5DF1A 2VLIA 1EUQA 2WJZB 4HATA 4KGZA 5E2BA 3AF5A 3ROMA 4ZYTA 3NC4A 3GL9A 3STUA 4MQFB 2BIFA 3RASA 1OH7A 1F2TB 1W0KD 2WSSA 4UASA 3OCYA 3KLPX 5T3UA 3T7SA 4H0NA 1LDMA 5LXTA 3O8OA 3UJDA 5F23A 1PJBA 1SCQA 3RFVA 1PDWA 3PNMA 3BXOA 1JX6A 3F47A 1U5BB 4AJIA 1XGKA 4D97A 3O5AA 3MINB 3GAMA 3SMQA 1SVKA 3ZV7A 3FD8A 2QN7A 5H7XA 3KB6A 3I9JA 1UZLA 4NCXA 1AB6A 2GEDA 2ZAGA 4QPPA 3RTGA 4UQPA 1GRNA 4J4HA 1WKCA 3GARA 3GDOA 1S2OA 5A5EA 5BV0A 1E89A 3LC1O 2VCYA 3NMUF 1CE8A 5CAEB 2MMGA 3EGOA 2IKSA 4B47A 1BN7A 2ECFA 3CVJA 2V96A 5AVTA 4F6CA 1RIIA 1LTHR 1PTKA 2SNIE 3GAZA 3VHRA 4DQXA 3QWBA 1HNNA 3HHEA 4HUQA 2V6GA 4MCHA 4O3MA 1SCNE 3L8MA 3N2NA 2YJ3A 1K5GA 3ZDEA 4RM2A 1O6GA 5FWNA 2I66A 4DS3A 3LBIA 4GP6A 3AI3A 4FEYA 3UMSA 3VC1A 4ZTZB 3ZI0A 3NKLA 5HKKA 2ZRJA 4HO1X 1JIQA 5HE9A 2O2IA 1RYBA 4UZFA 2Y68A 2D6FA 2AEJA 1I4WA 2BFDB 1CDEA 2CHGA 1GXSA 1I51A 2JLSA 3PHBE 3OZWA 4WUVA 2E4AA 2Q7XA 1IZ8A 1TUBA 3P1JA 2IELA 2I03A 5ALIA 1NOKA 3FVRA 3KHSA 4FYJA 1SCDA 1MVOA 4F3TA 1G6Q1 1S8OA 2PGNA 4WXEA 3LZ6A 2HPZA 4I5IA 4W5OA 2NXCA 1MH1A 1UMDB 3HFGA 2WU0A 3FPKA 4BPBA 3FDXA 1JEYA 2ZJ0A 2VR1A 2M98A 5LWQA 1A2BA 2BW0A 4HWKA 3VKUA 3FMGA 4IZHA 5TGDA 4XWKA 4BKUA 1W4AA 3JZDA 1JEQB 3I53A 3KLMX 3ZD7A 3A4VA 3S2SA 5JU6A 2JIMA 1M2KA 1V5WA 3DZDA 3FN4A 3DM9B 2OV2A 3HR7A 3AYXB 2XBLA 3JR7A 2O54A 1V11B 1ZCAA 5CLIA 2DM6A 2QUZA 2WMYA 4KAAA 2R2GA 5BY2A 1JR3E 2V65A 4H6VA 2X6TA 1FX0A 3TGPA 5CT9A 4TYNA 2I2CA 1NRIA 3COVA 4UULA 3E5HA 2PX4A 3SIRA 2QL9A 1MKYA 2MYNA 1FLDA 1QFSA 2G8NA 4KH1A 4WZBE 1EH5A 1G20A 3G2PA 1K7EB 4J6EA 3AGPA 4MQ5A 3VISA 4BBAA 4D02A 4URXR 1ZN8A 4INPA 2WZCA 3DKPA 5G0VA 3OLQA 1USKA 4CL3A 1XRNA 3ESXA 3BC1A 4CXMA 1VE1A 4H3VA 3VYVA 1WS6A 4ARIA 1CP2A 4GW3A 2R00C 5DE3A 5GJWC 3RABA 1P5RA 1NULA 2QE6A 4KNWA 3PJDA 1CZOA 4EHBA 3O95A 4GLJA 4HZUB 1ML3A 2PBLA 1T3SA 1JEJA 2B0CA 4XI9A 3P19A 3JQCA 1Z68A 3NVDA 1WVGA 2PA3A 2VSXA 3OIGA 1LI4A 2XT9A 3TSAA 4MUXA 1E4EA 4YFYA 2XNSA 2R4QA 2X9LA 4YN3A 4IOMA 4KQCA 4DDKA 1QHIA 4MIYA 1PL6A 4PYOA 3WGMA 3ABOB 1QP0A 2P6NA 1H9CA 3QIVA 2UZ3A 1F0NA 1DAOA 2HJSA 4YJHB 1JQ5A 3IE1A 1R6XA 4UFNA 5CT8A 4H1UA 4MUYA 2YDXA 1T6BY 3C6XA 3I2GA 4TTVA 5E0OA 1NKVA 4LSWA 5A5FA 1XLVA 1TCBA 3E3OA 2HC9A 5AJHA 3HJBA 1R12A 3MS2A 1OGYA 4IHJB 4PYRA 4TS1A 1X80B 4FTWA 5KVVA 2EP7A 2YJNA 2H2AA 1UFOA 3H2JA 3U9SA 2AMYA 1A8HA 3BWEA 3HDTA 3PP8A 4N54A 3DV0A 5BR4A 3UCEA 4I6JA 4MQUA 4IQ0A 3KV3O 5FPQA 5HCIA 3L46A 3EHEA 3O38A 5EUCA 3V7FA 1WLYA 5SY9A 4EG5A 2FNAA 2G5GX 2VHJA 3A14A 3GLTA 3IUBA 4K6OA 4MGKR 2R97A 4WK4B 3TW6A 4BJ6A 2AN5A 4UAUA 4UCWA 3PQ5A 3IXQA 5ANRB 1OZHA 4WW0A 4NL4H 4C88A 4M9RA 4UM8B 2ZULA 5F21A 2EDCA 2BM0A 4R2IA 2IIPA 1OH6A 4MW0A 3PKJA 4DMGA 4X8MA 4DIEA 3CB2A 4D4LA 2QVYX 2JLQA 4KACA 1K4YA 3GJRA 3GY0A 2HO4A 4C4AA 1RQXA 2OGSA 4TKVA 1JDSA 4X3OA 1DU4A 3NTRA 4O2AB 4V02A 3A70A 1Z2OX 1P6QA 4S1PA 1YO6A 3BREA 1XU7A 1Q0RA 3OP4A 1POWA 4JBYA 1B0UA 1NVGA 2XDYA 4ZEWA 5BQ5A 5J2TB 3S5UA 3EN0A 3QSYA 2J59A 1YI0A 1EQAA 2IXGA 2Y0CA 3IUNA 3QXHA 3I39X 5T3YA 2RBEA 2W9XA 4E31A 5ENVA 3REQA 1SVLA 2PY6A 4F8YA 5EP1A 1QO0A 2XB9A 4MIKA 2QRJA 3EW9A 3NKVA 4N9QA 1ARZA 2H2GA 4CM9A 3ORRA 2A0KA 1Q0SA 3B82A 5EKDA 2G8LA 3PHIA 3V4LA 4F2GA 2PBFA 5CCEA 1TKAA 2BTQA 2PDAA 3L1HA 1MC1A 2R6GA 4EHJA 4PIVA 3CIFA 3UMBA 4ID9A 1MHPA 3MTBA 3GP8A 1QRAA 1AQUA 3OOYA 2JVIA 2YMMA 1C29B 1NBMD 2ZJOA 1FTGA 3IBCA 2J9GA 3NNDA 4F3CA 1ENOA 2IHTA 2VK4A 3HUDA 4I1SA 3D64A 4BZZA 3PC2A 3BFVA 1IWOA 1NUAA 1W88B 1X74A 3Q7SA 3Q2KA 1E1YA 1XXHE 2CJYA 4OI4A 2H7YA 4RSMA 5JH7A 1TX4B 2JIQA 3ROKA 4OOFA 5D3ZA 3GYGA 2G80A 3JTEA 4DUGD 3E15A 1W48A 3PVSA 1BH6A 1F9AA 1XJ0A 4YRDA 3HJFA 4Z4GA 4IXWA 3AIIA 5JWRA 1VMAA 3C3MA 3UAWA 1CUVA 4CCYA 1OLSA 2PANA 3KG2A 4WCFC 5DASA 5I7OA 1D2GA 2VUTA 4LXYA 4M7OA 4MPDA 4IDNA 4Z0TA 3WK9A 1ZCJA 2ZITA 4DC9A 1ULZA 4HNHA 3AZQA 1KQNA 1DFGA 1W2WB 4P35A 2V1UA 1N2SA 3NETA 3IULA 4LDJA 4IX9A 3WAKA 4YP6A 3H11A 3ZDYB 2I6XA 1UBLS 2D0DA 1IQ0A 2H4YA 2RHJA 4OJNA 2R47A 2C82A 4Q1VA 3W34A 5AVXA 3NRCA 2O2DA 4WNIA 1ZGZA 4TSFD 1FYXA 1P9RA 2BGJA 3TRDA 3TNLA 1RKVA 2J85A 2OSVA 5J1TB 3OZCA 1F8FA 1HNWB 2ISCA 2GO7A 2ZRDA 2EL7A 4XRRA 1ACJA 3CF2A 4UJ5A 4MV9A 5KQGA 4LYDA 2OO3A 3LQ1A 3G23A 16PKA 2R6HA 4N6GA 4Q9AA 1JKIA 4R9VA 3T9AA 4LMBA 5DGHA 3IQWA 4BO6A 2Y9MB 3OJFA 2QKYA 4BVLA 4YYZA 5HNKA 1W4LA 2BEVB 4IIJA 3P97A 4EJ0A 4UFPA 2OM6A 4GMGA 1RKQA 1MT0A 4UCFA 1QQ6A 1OW3B 4OFZA 4F9GA 1M7HA 4GR9A 5EWJB 1SBTA 3EF0A 2RGUA 3O8NA 3F9RA 4MCAA 4WKGA 4D9IA 4E2WA 4GT1A 2CW5A 2NADA 5AFSA 1V6CA 1JHUA 1UOOA 2BKXA 2JDIA 3JAWB 2MCFA 4DJ5X 1G4UR 3M5WA 4B9EA 4QDZA 3TZKA 1OC4A 1PR4A 4B4UA 2OG2A 1ONNA 5REQA 2YWDA 4LY0A 4OLHA 1G3UA 1AKUA 2PWYA 3ILXA 1EGAA 5AKKA 4F4DA 5JWOA 4LYJA 3ZHTA 1H2EA 1RLMA 2X1HA 3DOJA 3WGNA 1K3TA 1UBOS 2XH8A 4GMDA 5EMNA 1U2RA 1ZIXA 3IIJA 4EY5A 4YX9A 4D92A 3PI7A 3AVTA 1GEGA 3DFZA 1EDDA 1ZD9A 1OXKB 4BNFA 1PNOA 4OQQA 5DSTA 4OL9A 2XVMA 3BRWD 1OFGA 3EGVA 4KJXA 5D8DA 1Q21A 1KZ6A 3IDOA 4X84A 3B6IA 4B7CA 4P6VF 4J2HA 1K6XA 4CFYA 2G70A 1VJ1A 1NNLA 2FW8A 1TEHA 3CUEF 1MHTA 1IHUA 1CUYA 3WYFA 4LFBB 1GGFA 1CLUA 4HNUA 4OPMA 4QU8A 1UZMA 4O4JA 1YIAA 3TL3A 3H9UA 2DPXA 3HJTA 1XO1A 2ZRKA 2CY0A 3FOCA 1TJ4A 5BO5A 5JCJA 1ILWA 3GEGA 1OWMA 1TZ2A 5EJ2A 2YZNA 2FWAA 5DM1A 2Z4TA 3R9WA 5ALWA 1T9DA 5MGNA 3LHSA 3WYGA 3CU5A 2C9YA 1E61A 1TJPB 1USGA 4D56A 2VUSA 3IPYA 2QN6A 3R4VA 3HKDA 3OZVA 2I5PO 1J2YA 1WG8A 4JGGA 4F2WA 2J4FA 3KSBC 3DMTC 1U7HA 4ZA2A 1YBAA 3W2EA 3WGIA 1Q0LA 3Q40A 3QGMA 1P1FA 2SKEA 4QBTA 1AOXA 2J09A 3S6JA 5C51B 5CX1A 4TROA 3CYFA 1K68A 5MFZA 3S1SA 4G23A 2PUJA 4EMUA 1W9HA 1P62B 2GOYA 3FNEA 4H59A 3VZSA 4D45A 3HDVA 3RDPA 4HS9A 1WO8A 1WW8A 5JSKA 4B4OA 1QRRA 4HH1A 2C07A 4P3YA 5DXFA 4G0PA 4BPRA 4S2EA 1FTNA 2GFHA 2V3VA 4IGKA 1A9YA 1CUXA 4GKBA 3UHJA 5IJ9B 1OTYA 3DBOB 1NVMB 2VWGA 3F3YA 3ZCSA 3KTFA 1SU8A 4AKHA 2FFAA 1WQ4A 2ZYDA 2X2OA 4AKEA 3OZSA 3E82A 1M2OA 1Y3BE 4WNAA 4BVHA 2VJQA 4ZHSA 1E4OA 2D1TA 2WNHA 2IVFA 3H2IA 2AJCA 1VPDA 2OCKA 4IDBA 4LBVA 2JD0A 4PQEA 4M3NA 2IH4A 1QFJA 4F93B 1ULBA 3DMNA 1Y63A 3OKFA 2AJBA 3Q9UA 3QE9Y 3UATA 3BD8A 3V1LA 4E4TA 5LXTF 1DARA 2BV3A 1VYHA 2GPTA 1U0OC 3E61A 4EYEA 4QVIA 3THXB 1RBMA 1EBFA 2PTGA 4AY4A 4DZRA 1PZNA 4ROSA 1NSFA 3KPUA 1YE8A 1Z36A 2IYQA 1P80A 1ZHHA 1QRDA 1VGRA 2NVBA 4BU0A 4V0RA 3GA7A 1PGQA 1UWCA 5ITWA 1DWUA 3STXA 4JL6A 4YI5A 5EUQB 3ZCVA 3CLHA 1N2ZA 1TMYA 5C7IO 1CY1A 2DBYA 1WUTA 4G6ZA 5CB4B 3R23A 4HDKB 4HWTA 1FBTA 5AI0A 2B7CA 1CUSA 1II8B 1ZSYA 3IQFA 4U1RA 4YV2A 4ZT6A 3RSOA 3WQBA 1DTWA 5FFNA 4D4JA 4XWGA 1QCYA 1DT5A 1X8KA 3NXKA 3NOXA 1WJGA 3RS5A 2JIZA 1PTJC 3K2IA 3PWZA 4F0JA 4CMIB 1AKEA 4RV5A 3LUPA 3IT3A 3JATA 1QDUA 4H3HB 1I3LA 1JU9A 1QTIA 1FJ2A 1KJ8A 3I58A 2CKDA 3W9SA 3ZGNA 4BBZA 4CHGA 1IBRA 4U7DA 1H4TA 2YW9A 1PE0A 3I52A 2F3RA 2JRCA 4J0IA 4NQZA 1VPVA 4RZSA 4IQFA 5CAEA 1DP4A 2IYXA 3AKDA 1S3FA 2ZI4A 3GRCA 5JPDA 1GARA 1YGYA 4I8XA 1OBOA 3SOPA 2DY0A 1VI5A 3SJ7A 2RCNA 2XITA 5HMLA 3IJPA 5BYAA 2PZLA 5JAHA 4NCBA 4C29A 2YIVX 1SC9A 4RHXA 1GCUA 4U00A 2NO5A 3O4FA 4J29A 4MTCA 1RP1A 2W2TA 3BCHA 1OBVA 3IESA 4KN5A 5HZHA 1N0WA 2PEYA 4CM7A 4OXKA 3HGQA 3AF0A 1AJEA 1YJ5A 1U98A 1GGNA 1THZA 1LNSA 1FP4B 4DVJA 1RMQA 4CI0B 1SUAA 3B78A 2WV9A 4DM7A 3K09A 1DXQA 2AZTA 4QKQA 4JOQA 2N42A 4P2GA 2Q5OA 2VJYA 4EFKA 3T5BA 1EVZA 2IYAA 1ORDA 4MB2A 5K0LA 3GLGE 1UBTS 1VMIA 1JMYA 3JD0A 5L7TA 2Z04A 3O82A 5IJ0A 1TF2A 4F3RA 5BWBA 4UXIA 1UT5A 2EQAA 2OHOA 3SQLA 4Y6LA 4IIGA 2P62A 2HQBA 3H2HA 4LNUB 4OMDA 3BL6A 5LD2C 3GCWA 2ODPA 2FFHA 1CZUA 2ZAMA 3L82B 4FVTA 3M4ZA 3CJQA 3ZZTA 3DD5A 4IIJF 1ZAYA 2RIRA 2FOIA 1RRPA 1MF7A 1YIDA 2FVXA 2Z8XA 3CLTD 4TZ0A 3UCFA 2EP5A 1RABA 2PGJA 3IVRA 2VP4A 2J3IA 2FZ5A 2QQFA 1WHSA 2YRXA 2FQYA 4MUEA 4O4HB 5G4KB 1H3NA 4AVYA 3EE6A 1EFUA 2KMLA 3DR3A 1CQJB 1Z6PA 2JGLA 2BSQA 2ONKA 2X5JO 1ZQ1A 3LXUX 2PKEA 2PSFA 4ITRC 3QY9A 2G5CA 1A4IA 3RANA 1Y3CE 2QVGA 3W7VA 4JY7A 2GEUA 1TPYA 3HI4A 4EO7A 4KFRA 4HUJA 1CETA 4FDAA 1HH4A 4B87A 2WYWA 5L51A 1NC3A 4ZALA 5BUCA 5GIOE 5F98A 1EESA 3HH8A 5AOBA 5A71A 3T52A 2BEUB 4KU4A 1VI2A 5DX0A 3TLEA 4AO8A 5JJ5A 5AOAA 3F2VA 4LJAA 4QEKA 3X1YA 5JALA 5KKCA 5KMGB 4HUTA 3KU4A 2FXVA 5JBNA 4YAWA 4TVSA 3MMXA 3U1TA 2UDPA 3COYA 1OLXB 3GZNB 3J81k 4HGNA 1VPTA 4C6RA 1XXHA 2ID7A 3MK31 1HDXA 1FFBA 2OC4A 3EMVA 4QPNA 2N75A 3L6UA 4ZRDA 3G1WA 4ISBA 3KYCB 3AVVA 4KWIA 2Z9CA 3ZU5A 1LXCA 3G2QA 1GZUA 1F2UB 1WV0A 4FOLA 3UZUA 3ZKAA 2C4KA 4MQ4A 3AR7A 3M81A 2C03A 3URMA 4MVJP 3ZWPA 3D5TA 5CA1F 4KFCA 4JLPA 2QTRA 3BFKA 5A0VA 3M9WA 3ZNOA 1LFAA 3PYMA 3MJDA 2V9PA 4IVPA 2FGJA 2JLYA 1TIPA 3GNLA 4DY6A 3EA4A 3SQMA 1D7AA 3BHNA 2JBHA 5KWVA 4HX5A 1G5PA 1Y89A 1RTTA 4LYEA 3WJ2A 5LOVF 3LY8A 4D81A 1BIFA 4REQB 1W44A 1OFUA 1X6VA 2BEWA 2ZBRA 3AVXA 6AT1A 3N58A 3OO1A 1L7OA 4PHHA 4DQLA 1H6CA 3JRWA 1YJBA 1NUPA 3P9IA 3FGOA 3HR4A 4QO7A 1DTSA 1Y37A 2H2HA 5FA5A 3HFJA 4W7IA 5FTMA 5H70A 2Q8PA 4FK8A 4MUKA 3BGDA 1TFUA 3LRPA 1XMSA 4S3MA 5TF4A 3GEIA 1Z15A 2B1GA 1EFPA 2D62A 2ZE5A 2GAAA 3EZ7A 3ZGOA 5C5DA 2P78A 4G1MB 2FMUA 1JHRA 3ZOZA 3T3OA 5JT1A 2OMKA 3LNTA 4GM4A 3W4KA 4XASA 3A9VA 3RSSA 4DNPA 1ZK2A 3ZWBA 2NUPB 3ETNA 3UV3A 2XT0A 1REQB 1KZ9A 4FNGA 1D2RA 4A8JC 1KP9A 9ABPA 2C61A 5EXEA 4IQGA 1Z33A 3RYCA 2AMJA 3DWGA 1GFSA 3B38A 4U2CA 4PQGA 2IITA 2WD9A 4BLSA 4CTJA 1KE2A 2WG2A 3UVEA 3G7NA 4ZHQA 5TR9A 2DFDA 4PYQA 3UAXA 5LQMA 1E7SA 2WF8A 1Q0TA 1USUA 3NX4A 4LOAA 1W0JD 2ZIXB 1PL0A 3GJ4A 3AUAA 2I71A 3BA1A 2NSHA 3OCJA 1G8JA 4L8FA 3QXJA 4HGZA 4M1QA 5F5LA 4ZU6X 1M0TA 1KBZA 4IIEA 2ILTA 2NXEA 5CUQA 2QAGB 2Q0SA 5FTKA 2R1TA 2BF7A 3K8OE 5DULA 5IEBA 3VVLA 5J4KA 2G08A 4P0TA 2G82A 1Y8RB 2JVKA 4O2AA 4JBHA 3U7QA 3QX3A 3MGBA 1PD0A 1UBKS 3KOWA 3PG5A 1EJ0A 3PYXA 5IDVA 2SBTA 3DE6X 3PUXA 1E6EA 3N39C 3UTDA 5CG1A 4N0QA 3CONA 2AHRA 4EHIA 3RAGA 1PEDA 1XF9A 2YVKA 4EVSA 5K8IA 1RHJA 4OHZA 1VKJA 4GEGA 2BF4A 4AS2A 3D6HA 4Q7QA 2W2QA 4IOKA 2HZBA 3H2BA 1L8OA 4N0PA 4ZOLF 2VTBB 3IDSA 4MRSA 2H5LA 3UKJA 1NI3A 2O7NA 4LFCB 3ET5A 2C4WA 3U4IA 3HNRA 1F3LA 2D2XA 1SHZA 2GJ4A 2J87A 5IK2A 3T41A 4LW8A 3WLPA 5FAKA 2NU8A 2CNLA 5GADl 2CMKA 3NC1C 4B46A 5JEEA 2V7PA 4BAZA 1Z35A 2ZSDA 2VDWA 3DBHB 3E3AA 1XNGA 2OHVA 3E6AA 3F7TA 2OLEA 4NCJA 3I62A 4PZDA 4RPLA 3N76A 4LSMA 3FA2A 1JFFB 2V0NA 3FIJA 4KYIB 1ZMTA 4OFBA 3DZKA 3HUTA 4RKRA 3HSYA 2PIDA 2QD2A 3A1EA 3JU3A 3QZUA 4ON9A 4W7SA 5SZHB 4JKIA 4DLLA 1KWKA 1FRZA 1Y80A 3I72A 4Y2SA 2P5UA 1XRMA 1KZ7B 4KRYA 1B2LA 1A72A 1PJRA 1ZICA 2CUZA 2X6RA 1JSXA 1MFZA 1X38A 1B00A 3IILA 2H8KA 3SHQA 2W4QA 2JA1A 3L6CA 3X1ZA 1C3EA 1RYEA 1FOEB 2N47A 5AVJA 2J45A 4DCNA 3WBKA 2PYDA 2GPAA 2G9NA 1V7QA 3DYIA 2C4HA 4G9BA 5EIHA 4H7DA 2BT4A 5KAMA 3U0BA 1YRAA 5KTYA 2OUKA 1WNTA 1WD7A 2Z9BA 2AGVA 5B1EA 4RY2A 2ASVA 2KWIA 5KPJA 3VV2A 3NT5A 2ZRGA 1I9GA 1ULAA 1V5IA 4RXTA 2CYAA 3LP8A 2CXTA 3IP3A 4C3VA 3THOA 5B36A 1LLFA 3ANSA 1FYFA 2GJKA 3CUUA 4IVNA 4W9RA 3WQHA 1X15A 3DZIA 5C8VA 2XUQA 4YREA 3K6SB 1E2GA 1FK8A 1KAHA 2XF8A 4KQIA 2OHHA 5AVWA 4HNTA 4DZTA 2V9CA 2O8EA 3BXGA 2XIQA 5HIAA 3GROA 1EZ1A 1VECA 2AF4C 3EEQA 1FDVA 1C0LA 2C20A 4MX8A 2FWBA 3KAKA 1E9AA 1UWLA 1ZM3A 2Q2OA 4YCJA 3ESQA 3U37A 4BU1A 1JHYA 3L4BA 2WI8A 4N18A 1DWPA 1KEKA 3CH5A 4HD8A 1BX0A 1TUIA 1IN1A 3MW8A 3BMNA 1AZSC 5DWVA 1U4OA 3KSUA 3U2QA 1QHFA 2HAEA 1E3EA 2I3DA 1PS8A 3I3SR 3DAGA 1FUEA 4AROA 1MV5A 3A4MA 1L5SA 3GH1A 4N3CA 4RSGA 4ZYUA 5TT1A 3CVWA 4Y6OA 2BDUA 3MJVA 4QBIA 2GUWA 2X0JA 4TMVA 4AUEA 3C5VA 3QK7A 4Q47A 3EPHA 1Z47A 3O1JC 4W7HA 1LTKA 1OPRA 4M0LA 3VUFA 4V2UA 4X91A 5UKDA 5FTJA 1TK3A 3OIYA 4B34A 4DRZA 1I7DA 1I80A 2OQRA 2BBTA 4N65A 3RT9A 3HUEA 3EGWA 2NTJA 2OESA 4N5NA 1P1RA 3VR3A 1LDYA 2IYEA 1JQJC 4US1R 5DCWA 4U6NA 3L0IB 1BX3A 3O8BA 3A0UA 3L43A 1BXRB 1Y7PA 2VHYA 4BTLA 3C8HA 1TZKA 1OX6A 1N2OA 1AB5A 1V1MB 3RLFA 5CFPA 4MW2A 3PE6A 4WBXC 3UOWA 3UT5B 3DEAA 3CINA 1QDEA 4ND3A 3FX2A 1HORA 1N2HA 2H57A 2QYTA 5EWLA 3HY6A 1XLUA 1W85A 2ZIWB 1IWPB 5U9CA 4DR1B 3TVDA 3RVMA 1KNQA 4AJEA 3C5CA 1MGPA 1UK7A 5EPEA 1XPRA 2ZI6A 5AXDA 1G5QA 1UEIA 2V55B 2VKQA 1J8VA 3HBMA 1ECBA 1OROA 2FWPA 2RK4A 3M6XA 4ZEXA 4LRSB 3TEJA 1X7WB 1WULS 2AZDA 1HOTA 1HK7A 1RXUA 1P19A 2FUCA 3JWPA 3DKKA 3RS8A 4G07A 2M6LA 3N5CA 1XRLA 2QQEA 3G9XA 1EI9A 2ZPTX 2CL7X 4R1MA 1KFBB 3CLTC 4UPVA 4WL0A 4IRUB 3SLRA 1W4CA 3LH5A 4PO3X 3VPFA 4BN5A 5A4DA 4GR5A 1XDGA 2P91A 2DQYA 1EWTA 1LVGA 3B1XA 2ZTLA 3GMTA 1P75A 3FFAA 2JLUA 4RMJA 1FVXA 2AKYA 1AUVA 1ZO8A 4OQYA 4JASB 3G8YA 3TSZA 4BVJA 5KWEA 5LIRA 1Z45A 3BJEA 3TZLA 2HJVA 2W6OA 1P7WA 3S2FA 2X9NA 2CB0A 1Z56C 2O2SA 1VJGA 1D07A 3WLKX 5JTUA 1VTKA 2OGUA 3L7OA 3WGYA 2VZLA 2LCFA 1Q6YA 1SOVA 5EPOA 4GU5A 1TFRA 4WLOA 4DB2A 4QUGA 2ZSIA 2Q7DA 1T5IA 4KR0A 1Z4OA 4LXXA 4YTEA 1ZZEA 2O8BA 1Y7HA 5KX5A 5AW6A 1T8WA 1XTUA 4NJMA 1I4DD 4E46A 2OFPA 4WZ6A 1D7OA 4R5HA 1WKVA 4C7MA 3LOPA 1P1CA 2D0OB 4HDOB 2QN2A 3F67A 4FDMA 3V97A 5IC6A 3W5VA 2RBKA 3TB6A 3WI7A 1J5XA 4I3HA 4BYGA 4H16A 2BKEA 2BE9A 3LDUA 5FOTA 3KQSA 1J39A 4GWGA 5C0OE 5CBPB 2RGRA 1K86A 4AP9A 2PKYX 5BQXA 3N05A 3ODGA 2UUOA 4WDQA 3QX7A 3R3VA 4GZ5A 2G9QA 1L5QA 3PXAA 4YDSA 3L18A 2D2FA 3C45A 1XTRA 2IYSA 1DOZA 4G4JA 1IXZA 1T6XA 5BV8A 3ABZA 1NN1A 3WRXA 4L6CA 4O4IB 4LXTA 1JU3A 4YAOA 2BHSA 3DAYA 1VKHA 1OV6A 4PQFA 1LZKA 1P3DA 1YZUA 2YVAA 3HKCA 5EQFA 4HPJB 3LGXA 1FTSA 1K0FA 3IALA 4QQFA 2OHGA 2BR4A 3UQZA 3PHCA 3UUGA 4DBLE 4DCVA 4HNVA 2SICE 2WKQA 1J6UA 2QAGC 4R1TA 3EFHA 3SDSA 1PNQA 2ZEJA 1EX6A 1OWLA 1RLTA 4D1YA 2FRDA 4WY2A 3U3MA 1AQJA 4ZHQB 1PG5A 3KZCA 4QAJA 4B17A 1Z88A 1TPZA 1N75A 4NKRA 3DPSA 2NYAA 4Y0AA 5BN1A 2E4ZA 1F1BA 3S55A 3WK6A 4ZOBA 3SP1A 1IMJA 1M33A 1KVUA 5HK8A 1Y9AA 4TTSA 4WINA 5LQNA 4WQMA 3FZQA 3K72B 2HCTA 2XCLA 1G0NA 3O7MA 5AJYA 2NPIA 1YB7A 4RQBA 5DHQA 2BPOA 3UIEA 3LCVB 4XDYA 1V8OA 3O8DA 5U4XA 4ERNA 4GKKB 1T36B 3V42A 1UXGA 3RKUA 2I65A 2NSJA 4R0VA 4R8MA 2O23A 4XUGB 5CB4A 1JG4A 3AUXA 2HOQA 1OWPA 2OYSA 4HDRB 3KS9A 2YZMA 3RREA 1PGOA 4MR9B 5G53C 1FDOA 2B8NA 1VLMA 3HCRA 4JLKA 2ZUWA 4C6HA 1J8DA 4ER3A 2DRIA 2D7DA 3GJSA 1OGIA 2EARA 1NWCA 2BSXA 4M54A 2I76A 4MVJG 1ZCFA 4IEFB 3SSAA 2KBFA 5JCOA 2RGEA 3N74A 2A14A 1CFZA 1SCJA 1GQOA 2WJJA 1RKXA 4QREA 5DK6A 5DNWA 3SNKA 1YTUA 4V2IA 5GMOA 2GEKA 4I2NA 1UOQA 2VHUA 3QVJA 1M10A 3IO5A 1KI3A 1KQPA 3QEBZ 1N0UA 1WSAA 5JYEA 2PJDA 2C9CA 4D8YA 2RFLA 1GV0A 3IMEA 1GGHA 1D9ZA 1L9KA 1EUCA 1QG6A 4QOFA 3GFTA 1M2WA 2YZ2A 3FUVA 1YOVA 4DA8A 2FRDC 5IYZB 3DEFA 5D51S 2PZAA 4BGUA 4QLOA 5IKEA 4LF6B 4DYHA 1NP6A 5HKLA 3CG4A 1VE3A 2FETA 3NEPX 2FSVC 1VL2A 3G8DA 3FH0A 4G41A 4YH1A 5KMGA 3QELB 4IEEA 4TTAA 4CFSA 4BFVA 1KYVA 1G6OA 2JCGA 3GT4A 1XRSB 2XMDA 1V37A 3G2NA 3LUBA 2RKBA 3O21A 1K8RA 2Y1DA 1SM4A 5JAZA 1UP4A 3MHPA 4YRQA 1G1MA 3A4YA 2BR3A 3LUJA 1VLLA 2GEBA 4G1BA 2WAAA 4Z9AA 5FADA 4HJXA 3STTA 2ZT5A 1YI8A 1QGZA 5KTTA 3SQWA 4RW0A 1PZEA 3DOCA 5EEGA 1SVSA 1H1DA 2H9YA 3P2KA 2OPBA 3OZFA 1D1QA 5IM5A 3SWWA 4RHUA 3QV2A 3BICA 2Z6UA 1N6KA 1M2NA 2HTEA 2LD4A 1QORA 2WM9B 1EVJA 3NP9A 3ON5A 4IWYA 3U62A 3IR6A 4DW8A 2Z5GA 4RV4A 3X1DA 3KJZA 2DE0X 3IQIX 5ALDA 3UK1A 2GT1A 5HFAA 1ZPDA 1WBDA 1JIXA 2E1PA 4XTRA 1VYTA 1DC8A 2FDXA 1MO5A 1XTSA 2KHZA 1SURA 2G7MC 1F48A 3B52X 1EUZA 1E5VA 1X9GA 1N9GA 4JC0A 2AIRA 3F3SA 3CEMA 4QHTA 2XUPA 4FIZA 4O4LF 2W8BA 4S0ZA 2LZ0A 1X87A 1VDZA 1J99A 1CY6A 3IQEA 4DV2B 4FYPA 5LPNA 5CA1A 3W5SA 2VT3A 5GV7A 2AQ8A 1QCZA 3M6UA 1V4BA 1DWQA 5EMMA 1PFUA 5FXMA 3HR8A 2O3JA 4MMZB 4CCSA 4CCWA 3PE4A 2D5BA 3C5HA 4NBSA 1JQ3A 1NVTA 1KI9A 2L17A 5HQTA 1C50A 1MAVA 2VYCA 4UHFA 5FUQA 1T2EA 1DCMA 4CTMA 5KOIA 2NU8B 4FE3A 4B33A 5IT9A 1HR0B 2M32A 5AI6A 1MC4A 2R6FA 4ETIA 1PK8A 1AQNA 2FSUA 4GGMX 1EDBA 2C7VA 4HDMA 4XYLA 5JJLA 1KBOA 3IKJA 1E2MA 3EIQA 2CNWD 3OIFA 2Q8QA 1V26A 4LJLA 5HBGA 3WL4A 3C3JA 2OBYA 2IDKA 2IGTA 3V1NA 3PCRB 1IB0A 1C3VA 2XXBA 4MNTA 5IP5A 1NUUA 3PDHA 5B1HA 3ROGA 4XWOA 1YHZA 1N6HA 2AN3A 1HE3A 1LI5A 4A1FA 4PZEA 1MBZA 4HWPA 1OF1A 1VRWA 4OXRA 4LGVA 4ZQFA 1IU9A 5HF6A 4URYR 3M7IA 4L4UA 3AX6A 3W9UA 1HO3A 4ZVQA 3U9TA 1GQFA 4FNOA 3RG2A 1HE2A 2BGUA 3IEXA 1DGQA 1JLMA 4XQGA 3V8EA 1CDZA 1QWOA 1RC1A 4W6ZA 2ZUUA 3L7YA 3FPFA 2V8OA 3FYHA 4IXNA 5EQJB 3JATB 1CJCA 2CYCA 1WP4A 2OAEA 1C7IA 2RH5A 4KQ9A 3WL7A 1V16A 1ONPA 4QQKA 4PO9A 4RDIA 4AM8A 1ADCA 3W0LB 5JADA 3IUEA 3MJEA 4D8XA 1CG6A 4ER0A 3ZJUA 4ETWA 4BMNA 1URPA 5IM4A 4D80A 1GD1O 4HTAA 3ICQB 3EDYA 2FZKA 3GD7A 4M86A 4G1EB 2HPVA 1AZWA 1YUBA 1T5SA 1A71A 3LWNA 3IA7A 3VHXB 2QA5A 3WNZA 1ZEMA 2PL3A 5T8KA 1ACMA 1OI2A 2X9QA 3BMOB 4L5YA 3ZR4B 2B4RO 4ZVLA 3RFUA 5GIPE 2HTFA 2D59A 4OEHA 1TM2A 1RCFA 4AZVA 2OD7A 1H2AS 3LHKA 3LWBA 5IFKA 3E8XA 1E63A 1JVBA 3AVQA 5JZMA 3QEAZ 1L4NA 3HCFA 1T15A 4JP8A 1C4XA 4MHTA 1SQ5A 1GZ5A 4LI3X 4DFDA 1I1OA 3RAJA 2J3LA 4J1SA 2C7QA 1XNQB 1L5ZA 1GVHA 4JB2A 3RG8A 2IH5A 1EAYA 1PLLA 2OO5A 1P8JA 1Y81A 1A50B 4LK2A 4ADSG 4BQNA 3AR4A 3KSDO 2QORA 2AFIA 4XZ3A 3OURA 1CQIA 1Y1LA 1YR2A 2EKZA 2VN8A 4WOPA 4AG5A 2WSIA 5BNWA 1YONA 2CLSA 1VCNA 4BMXA 2H52A 2VS1A 4WOBA 4KI0A 1E2LA 1E9SA 1Z17A 3OG9A 3QU7A 4B3JA 3EXFA 5K0BA 3D4PA 4PCVA 1ZP6A 2PSJA 5IG2A 3O8CA 3KKZA 1VC2A 4H4CA 3O9VA 3Q12A 3LX5A 4YK7A 5DCUA 5CMLA 2BKAA 4JJAA 1G21A 3BH7A 3H5TA 4HAWA 3OCXA 1XX6A 3HU1A 3IOYA 4M9CA 4LOHA 3LT0A 4PRZA 1E9CA 5TMEA 5BR8B 1Y6GA 4JI1B 1ZLYA 2P0YA 3GZNA 4UU8A 3MLAA 3GVXA 5DWDA 2JEYA 4MAMA 1C9KA 4TM8A 5A9TA 2PA0A 2XMPA 3HKDB 5AK3A 2DJ5A 2PMKA 3JRXA 3SZMA 3FPLA 3HXOA 1L1RA 2R65A 2I91A 2J6IA 4EDHA 1K4KA 3KC2A 3PHHA 4MJ7A 1N36B 1FVFA 2JKVA 2BTEA 4FEEA 2UV8A 2GRJA 4LBWA 1KH2A 3K5HA 5HRAA 1US8B 1MH9A 2P4SA 4GE0A 4K9LA 1KO4A 4P34A 2AA3A 1YRQA 5HIJA 2AQIA 4OK5A 2PGOA 4KI7A 3GLIE 2H08A 1Z0AA 3SICE 5TPWB 3PV0A 1IOLA 4LK3A 1RYFA 1CBUA 3CN9A 4WLNA 4WK2B 4WX2B 3RRJA 5KYTA 3CRMA 3HY3A 1GUZA 1ULUA 3AIKA 1BVHA 3WZMA 2NTNA 3A3KA 4QQ8A 4DLBA 1U8UA 2IXDA 4GPBA 4HN4B 2OCIA 3JWIA 1HDZA 2RG1A 2V1XA 3JQ7A 2DXIA 4BASA 4BOYA 1TE2A 4TUYF 1ODIA 4NE7A 5TQ2B 3IEIA 4RZQA 4RJJA 1VP9A 1ZRNA 3YASA 4TLCA 1K7XB 3TNJA 3NAGA 1H2HA 4KPEC 2GA9A 4BNJA 2XUIA 4DWJA 1YR9A 4BQQA 3MILA 5EIOA 3VAZA 3I1FA 1XVAA 2FPPB 1UPXA 4HF7A 4M22A 4YRKA 3H9JA 2I2FA 4G86A 4RJLA 4XCXA 2ZS9A 4Q3NA 1WSDA 3S7TA 3GLQA 3NBMA 3K32A 3VOSA 1GGVA 3K16A 4IQ4A 3OP1A 1E4EB 1TECE 2HEIA 5G1NA 3TZCA 4F11A 1PWHA 3KJNA 2N46A 4FOOA 2NXJA 2PL9A 4NZOA 4WLVA 1F8UA 4DCJA 5FUXA 1H4SA 1YUNA 2W98A 3EZYA 3AB3A 3UHPA 2W7TA 3QPWA 4N0DA 1XQ1A 2WZQA 3HCAA 4IWXA 3VPAA 1Q77A 2G0AA 2JAHA 4IGIA 5EP4A 2FMTA 3CEPB 3TSCA 5EHNA 4HYTA 2J6HA 3VZPA 1IEXA 1M8GA 3P2YA 1JR3A 4FYKA 4TRNA 1PJZA 5I47A 4UQLA 3ZWKA 3HM9A 5IKXA 3LI2A 2AVDA 2V7BA 1HE5A 2FSSA 2HSEA 4US0R 1SB9A 2O7SA 4WZBA 3VV3A 4JC8A 1D4FA 3WLTA 4G81A 1BE6A 1SAYA 1TW2A 3LUHA 4H1WA 2GGSA 1IQPA 3M6WA 5A03A 4EEZA 4XARA 3TE6A 2OENG 5D01A 2GYUA 3VU3A 1TKCA 1Y9DA 4XM0A 1UPFA 3KT3A 3RHTA 5B2FA 4WGFA 3HB1A 2OE2A 1UODA 4QECA 1HDRA 4J43A 1PDVA 2AG1A 1KR2A 4D9HA 4HH4A 2QX7A 2C8KA 5IMSA 2YH2A 3KWLA 3E22B 4N39A 4Z9YA 1LKZA 3FGNA 2YINC 5DLPA 3RSQA 2KLHA 3KDSE 2A2ZA 5E38A 5T4BA 5I9IA 5K0ZA 2XRZA 1VA5A 3EUFA 2ZI5A 4HXEB 4DBLC 4XJSA 1FJXA 2O5EA 3DOHA 1TOAA 5A9SA 2VWPA 3VZCA 4KR3A 4I1RA 1W88A 1ECPA 1Z8NA 4ITUA 4K9PA 1GITA 1N5RA 2A5YB 3ZWYA 1SIOA 1ZM7A 5AHKA 4XEUA 3ZTYA 1UT8A 4ZI7B 2YC2C 3FY4A 4QUIA 1OLUA 2IW3A 1LF5A 4KPUB 4R51A 4TXMA 4WZBB 3WGUA 4AZ0B 5CH3A 1XZEA 2A35A 3HCBA 2QUIA 1UANA 1T6YA 1JN0A 3LT2A 4FGJA 3TDNA 1QK5A 1YA6A 1JFSA 5CDTA 2YY5A 5KKNB 2C4MA 2WMNB 5C1OA 4XIIA 2QTCA 3QE2A 4FYIA 5BW5A 2H1HA 1WCIA 3TI9A 2XIJA 3UTCA 1J5PA 3RC7A 3L4KA 2NO9A 2X4IA 3C6KA 3RIXA 4Q6WA 5ECWA 1J8YF 4YS6A 4ZD6A 4DEXA 2YQ5A 1LBHA 4UBKA 3ZDDA 2X4DA 3GJ8A 4XLLA 2VNHA 2VH1A 4AX8A 4CQLB 4AQYB 3STVA 3BIXA 4QOEA 1O77A 3QYPA 1HOXA 2YXEA 1ECFA 3OKCA 3R40A 2CB9A 1F60A 3B12A 3K09C 4MWSA 4S1VA 5PGMA 5I8PA 3GCGA 4PXSA 3ORSA 3P20A 4GX1A 1FUYB 5IXJA 1GRVA 1U3FA 3WQRA 1NW3A 1CSEE 1SZJG 3B8HA 3IAUA 4IKOA 1VBKA 4IUDS 3SF0A 2H4JA 4B2IA 2A9KA 1L7DA 1P60A 2ONZA 2PSSA 1VKRA 2JC3A 2XAAA 3PSAA 4GMKA 4QUDA 3TMAA 4LZAA 1J22A 1C81A 4ZVVA 5B1IA 3QHPA 3K96A 1XTZA 3TLYA 4RJIA 1OZ0A 2YYZA 3FVTA 3PU6A 3ED1A 5F73A 2MOKA 4FUTA 3E48A 5CDHA 4WFIA 1R0BA 2WTAA 5CCBA 4NBTA 3UAOA 2EFHB 3AWIA 1V7ZA 2ZDQA 4PYMA 4WAUA 3U09A 1GVNB 2QT1A 3CX8A 1U5CA 1X19A 2FQXA 2WF7A 2QJTA 3BK7A 4MW1A 2GI4A 5ITSA 4BP1A 3LIIA 1IAQA 4IHKA 5G02A 1NJ6A 2WZDA 3KEGA 4EHLA 4EUFA 2CLCX 1NUHA 1X7WA 2Y1GA 3SZ3A 1FXSA 4FKZA 4Q4JA 3ROXA 4TMYA 2PMCA 4G5HA 4JU9A 2MDTA 2HLPA 2Y99A 3DTVB 4R9NA 3DBRB 3PQFA 3KR1A 1ESNA 3WOVA 4F91B 1Q19A 3K30A 1VI6A 2BJWA 2PX6A 3H3XA 3O3MB 3P94A 5BRJA 1E3MA 2FZEA 3CC8A 3DW1X 4JI3B 4C03A 3QITA 1SBHA 3ZVLA 4ESOA 1LBSA 4CLXA 5LLDA 4DV4B 1YFLA 2GHTA 3NEYA 3QHQA 4XR4A 2HT1A 2QPTA 3KZVA 4OH1A 2BFMA 4JB3A 1TD1A 3CJRA 3SE7A 3VNSA 5KQLA 1V25A 2B4YA 2RGNC 2XE7A 4QPDA 4YMHA 5A06A 3R9XA 4F71A 4IGEA 4PGFA 1XDDA 3UANA 2XDWA 4GBMA 1YDFA 3FTEA 1EK2A 1SBZA 3N6VA 4XSVA 4X44A 4FYMA 4XEHA 1QTQA 3RLIA 3ZX4A 1AGPA 2WNIA 5GJVC 3LUCA 1OI7A 2XYHA 3FCCA 3K9BA 4BRZA 4C4SA 4ZQCB 4ZDIA 4E51A 4RD2A 1JEDA 3PX7A 4XIFA 1MCZA 2FPMA 2OEPA 4JLJA 1ZL0A 5TIIA 2OAQ1 3TPZA 5DJ5A 3PC4A 2ATVA 4DDUA 1P0QA 5JAMA 3H19A 2B8JA 3IAM6 4HFJA 4CYMA 1Z5PA 1ZRSA 1NTOA 1R9JA 1U0NA 4HBGA 1KAEA 1KH1A 1RHRA 1O95A 4KVZA 1WOMA 3PICA 1LF0A 1LPMA 3RJ9A 3T3GA 1XAGA 4OFWA 2JH3A 3TFQA 3LTEA 2PBZA 3UB3A 1DL5A 2V7VA 4ONEA 4Q4AA 3G0GA 1R3UA 3MERA 3ZXSA 5B2EA 3A36A 1Y7TA 4JLVA 1C1HA 1V1JA 5BSUA 2BMFA 3FWPA 5JPCA 3LPAA 4O4HF 1C3OB 4EG3A 3AINA 3VPSA 5JMOA 3FTFA 1IZYA 1Z08A 2ODTX 4L5BA 4DSZA 5G3ZA 4IGAA 4S35A 1DSSG 2E82A 3MTAA 3PFCA 3GFVA 3GCXA 1K4MA 2CLLB 2E0IA 2RJNA 4Q9JA 2C5LA 3C8ZA 1RWXA 4JLBA 2FUKA 3ICVA 4RPIA 2OBNA 5EJEA 5JNLA 2QUKA 4FU0A 5KCZA 1PDOA 3OQ1A 4EYOA 2WMOB 1OAOC 1W1IA 1XF1A 3A1CA 3R3HA 2FR1A 4KMSA 1SELA 2JAWA 3ZX5A 4Y6RA 3RFFA 1SKUA 2JFNA 3E53A 2J7PA 2PXCA 2ZSKA 1WLSA 1CZKA 5ER6A 3TRFA 2OOKA 3LQ2A 3SE0A 1N2XA 2ZROA 121PA 1GKLA 1U2ZA 5K3FB 4M49A 3R5SA 3TQFA 4KNYA 5EXXA 1PAUA 3D0OA 1MJHA 2UVDA 4Q19A 3RIEA 1PSWA 1X1DA 1SBCA 4A8JA 3G8AA 4X3CA 4CJXA 5KINB 3R3JA 3DQQA 1XTTA 3NYIA 4IOLA 3B6JA 4MOWA 1JJBA 5H59A 2BFNA 3L6OO 2Z0MA 1N6NA 2CGEA 3NHYA 3L05A 2PEZA 3JR3A 3ZH9B 4EKIA 3J7TA 5FHQA 3ZN2A 1ORWA 4OUKX 1DIHA 1ESDA 2WZBA 4NH0A 4DUZB 2RGWA 5LL6P 3BK2A 5LBUA 1UKCA 5G3YA 2Q4TA 1MAWA 2JBWA 5FBKA 5BMVA 5EKTA 1QFMA 2AYYA 1L5NA 2WVHA 4LCJA 4BXOA 1IRXA 1OYYA 2BJHA 3B7WA 3X2SA 2FPPA 5B7NA 4W4TA 1EXMA 3LO8A 3OPYB 4N8DA 1NG9A 2H7CA 1JFFA 4LQCA 5BSKA 1AIPA 1Z6XA 3NTOA 3PQ6A 1ZNYA 4I66A 5F35A 4GPD1 4YCBA 4AUKA 1PR0A 3REQB 1SG0A 3B48A 4X8LA 5FIUA 2ZJ5A 4D8UA 5L3SA 5AQEA 4JGIA 2WC1A 2VBIA 4RUKA 1T5LA 4QYIA 2D2VA 4IM7A 1IONA 2Y71A 1YZFA 2PJRA 4FDTA 1C3XA 2OFOA 2KPOA 3UUFA 4EKYA 1C2TA 5A62A 1YU9A 4ND1A 2Q1SA 4OQXA 1B0PA 1WUJS 3IRUA 3ZWVA 4GMXA 1QHEA 4CMAA 3GD5A 4IL5A 4A2WA 1XCPA 1RHKA 1RAEA 2ZIFA 3MTQA 1EXDA 3UMVA 1T9HA 2JZCA 5LNK6 1EE2A 1GNTA 1ZRMA 2GERA 1IHDA 3MG9A 2CXPA 3NWBA 4TSRA 4WGGA 5E8RA 5EHQA 1N9GB 3R7NA 1FFSA 1QH9A 3WGGA 3I04A 5JNTA 4MHOA 3KTAA 4GQAA 4E15A 1EVEA 3LFTA 3DBRA 4HVCA 2OV3A 3ZXXA 1TVKB 2VJNA 1GJRA 4Q4JB 1JLSA 3JPYA 3LW8A 3Q8XB 4QUHA 4FR5A 2AL7A 4MEAA 4MP8A 1QQAA 1CNEA 4WLFA 2X15A 3FAZA 4G26A 4YBRA 1P2SA 5GPBA 1NV8A 2XEDA 2ORWA 3WFIA 5KDDA 2A5FA 1U9IA 2LXNA 4TWBA 1RE0A 5FWDA 2Z98A 1LX6A 1YR1A 1RYHA 4O5OA 1NVVR 3DTNA 4DV0B 1JAZA 2HSDA 4JLWA 4CEJB 4MSUA 5L3VA 2F9MA 2EJCA 3E0QA 3T4