2AF4C

Phosphotransacetylase from methanosarcina thermophila co-crystallized with coenzyme a
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
332
structure length
331
Chain Sequence
VTFLEKISERAKKLNKTIALPETEDIRTLQAAAKILERGIADIVLVGNEADIKALAGDLDLSKAKIVDPKTYEKKDEYINAFYELRKHKGITLENAAEIMSDYVYFAVMMAKLGEVDGVVSGAAHSSSDTLRPAVQIVKTAKGAALASAFFIISVPDEYGSDGTFLFADSGMVEMPSVEDVANIAVISAKTFELLVQDVPKVAMLSYSTKGSAKSKLTEATIASTKLAQELAPDIAIDGELQVDAAIVPKVAASKAPGSPVAGKANVFIFPDLNCGNIAYKIAQRLAKAEAYGPITQGLAKPINDLSRGCSDEDIVGAVAITCVQAAAQDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphate acetyltransferase
publication title Structural and functional studies suggest a catalytic mechanism for the phosphotransacetylase from Methanosarcina thermophila.
pubmed doi rcsb
source organism Methanosarcina thermophila
molecule tags Transferase
total genus 116
structure length 331
sequence length 332
chains with identical sequence D
ec nomenclature ec 2.3.1.8: Phosphate acetyltransferase.
pdb deposition date 2005-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01515 PTA_PTB Phosphate acetyl/butaryl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10750 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isocitrate/Isopropylmalate dehydrogenase-like 2af4C02
3.40.50.10950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2af4C01
2AF3C 2AF4C 1TD9A 1VMIA 1QZTA 4E4RA 1R5JA 1XCOA
chains in the Genus database with same CATH superfamily
5ARBA 3RUFA 3T3IA 3TOSA 5PNTA 3TZCA 5HZKA 2E37A 3EN0A 3IPXA 3UT5A 2ZIXB 1Z26A 3DNFA 4QODA 5TMBA 3IEMA 3BHNA 3SJZA 5FNVF 2IY9A 3CVXA 1ILWA 2WMDA 4R3NA 4KWCA 1B41A 2B92A 3AY3A 3MPUA 3KDSE 5DGXA 5AHRA 5CFOA 1CUWA 3CB4A 4R2MA 3T1TA 3O8DA 2ONKA 4GS5A 1IHOA 3EC2A 4NK5A 1DQSA 1WMSA 1JG4A 2L2QA 3USES 2ISCA 5LXTF 2OBBA 4B8ZA 1XRPA 1AMNA 1P6UA 2OHGA 3TTSA 2XGMA 1LQTA 1QHNA 4OXQA 2XOXA 5J47A 3HI6A 5D00A 2Q1SA 4DVJA 4XGRA 1NQTA 3OVMA 1WULS 3FHLA 2AG6A 2BFAA 4G07A 2VJOA 3ZX4A 4RVUA 1M1YE 1MR3F 5EJ4A 4G5YA 4JCOA 4PRLA 3ETCA 3GRRA 3VI4B 1UOQA 4QDTA 1U0GA 1KOLA 3OF3A 2ZETA 5KCMA 4J2TA 2PZEA 2CNOA 2CUZA 7YASA 3EZ9A 2EHDA 2N47A 4NARA 3PF9A 4CKWA 2VZ9A 2P1ZA 3PC2A 1SHKA 3LDFA 1TM4E 3VYVA 5FXMA 3CF4A 2HRQA 1TC2A 2X3FA 5F73A 4TLLB 3INGA 2V3VA 2YJNA 4O2BA 5DTEA 1KYXA 2WE7A 3KRTA 1YS7A 3H9JA 4HD8A 3RWOA 5AOVA 4R8LA 4AWXA 4D2IA 1B6GA 1M1YA 2DP4E 2J9RA 2DTEA 4ENQA 1C2YA 2YS6A 5FDFA 1CBUA 1OZFA 1ZUD1 2Q0QA 2BMJA 4FONA 2GSDA 2VRNA 4OJNA 4TZ6A 1XYYA 3AF1A 2X9QA 4ZI2A 5HM6A 4TM8A 3BK7A 1R6VA 5BURA 3M5DA 1SCBA 4Y2JA 3LUJA 4V1CB 3ANMA 5T4BA 1ZD2P 1CZNA 4IXNA 4BQRA 1E3QA 1FL9A 3BB3A 3ZVNA 4PG7A 2QGNA 3UOGA 2Z6AA 2UYGA 3QU7A 1SBHA 2PFKA 2OSBA 4RH0A 2H08A 3E9MA 2KM1A 2QGZA 3KVVA 3IUQA 3DF9A 4EK9A 2BVNA 1ADGA 3S0JA 4QBKA 3SE7A 1JFFA 3I32A 1DKLA 2HWWA 2H2FA 2YWRA 3L40A 5AW7A 3RIHA 1OFVA 1O58A 1ZQ9A 2WDZA 4MUBA 2KE5A 1YULA 3L84A 5BNWA 2JANA 1Y4AE 4CDGA 3S2FA 3K8OE 2HRZA 3KZKA 4B6EA 3QFRA 1QPZA 1JDBC 1N2ZA 4CIXA 2C2YA 1NVGA 2Q2QA 1RMQA 1GGKA 3E2PA 4FQ7A 4NCIA 1YC5A 5F1KA 3X2FA 4Q6WA 4EELA 2OKGA 4BV9A 1SKBA 3HYNA 3AFMA 5GWXA 3NJ8A 4H6VA 4B6SA 1MPXA 2INGX 1RT9A 4O3FA 6Q21A 3S8MA 2HA7A 5AOBA 1GCAA 2QJWA 4INAA 2JZCA 1KAMA 4UUBA 3HNPA 2J3IA 3EFBA 4EKNB 1T8RA 2C9OA 1MB9A 3JQGA 2VXBA 3GXBA 4H1UA 4ZDKA 1FYEA 2ZJ2A 3OX1A 1IEWA 4PRKA 1NAHA 2DPGA 1EVYA 4GMFA 2WTUA 1AK1A 2WUDA 3IVCA 6LDHA 1QHHB 1SAYA 1U7ZA 2CUNA 1NGSA 2F3PA 3UAGA 3DXYA 1GAJA 3F47A 4QGAA 2FSIA 2NQ2C 4BUCA 3IAEA 5JXJA 3G5TA 5E95A 1IWBB 2FFBA 2P7IA 4Q24A 4WOPA 4P54A 4CM7A 4MZDA 5JBNA 3AL0C 1OY1A 3TW0A 4RVGA 1DFGA 2E48A 2RHRA 4IIUA 2XAUA 1A9QA 3MNFA 1BSVA 1ZRSA 2XA1A 3GJTA 2P65A 3NFRA 4U8HA 2UXBB 3BHJA 3LPCA 4C9BA 1NXOA 5FWNA 3I6MA 1JE0A 2Y9PB 2BHTA 2E6KA 4AMBA 4AJ4A 4Z99A 3WLJA 3G59A 1YIAA 4RPCA 3UANA 3D8HA 2R44A 2I2BA 3HV0A 1UINA 1F0NA 3FE2A 3PEEA 2OMEA 1K2WA 1ZP6A 1GTG1 1MAHA 1PCXA 2V7BA 2YICA 4ZO4A 5HJEA 1CFJA 1RYBA 2CE2X 2O8BB 2WJGA 3DBHA 4NCJA 1CB7A 1NM5A 3SSNA 3ZW7A 4CTJA 1WHTA 3DVAB 1QG2A 1WLSA 2P3QA 3BXFA 2IPOA 2WVAA 3JAWB 5H70A 2JVKA 3ECSA 4YXWD 5DNUA 1USWA 1IMJA 4KYIB 3H2GA 1NP3A 3AHDA 5JO9A 4J3FA 1S1CA 2XB2A 2CW5A 4JR0A 3PKZA 2BL4A 1T0PA 3M2TA 2DQSA 3ZHXA 3RYIA 1ZN7A 3CE9A 3EZGA 4LJ5A 2GRAA 4TTJA 2ADMA 2D13A 5C8XA 1U6KA 2PT6A 3W2FA 3FOAA 4PLCA 1PUXA 2I29A 1NQXA 3OX4A 5E6SB 4QUEA 2IHZA 1S2NA 2HRCA 1L5WA 4LYGA 5IUJC 1MJNA 3RC2A 2IITA 3LYAA 4Y2XA 1JEAA 1XD2B 3SQMA 4NR0A 4IOKA 4L5JA 3LV8A 3RVSA 1H5UA 1VMAA 4Q7MB 2PPVA 3GGGA 3A1TA 4Q4HA 3EPJA 4KE8A 2IHUA 5GPBA 3C3JA 3LUDA 1UJ5A 1I0IA 1SUDA 1PWHA 3BRCA 4M1ZA 3T0FA 3I64A 1QNLA 1JHPA 1AKMA 1S4MA 2AEJA 3ADKA 2FDXA 2PSHA 1DTWA 1YQEA 2CNWA 4G23A 4OLHA 4PCAA 3LPAA 4QU8A 5FKJA 5HE8A 5SYAA 3X1KA 1JVNA 4JH0A 1EXVA 3W04A 5KJFA 3P9XA 4D1YA 1MO4A 4YACA 1GFWA 3IAUA 3H8JA 5I4IA 3E05A 1TU0A 1MQ8B 2HV9A 3T1NA 4JP5A 5KMGB 1UJBA 5AHXA 3PXAA 1ZJWA 3SQWA 1I94B 5AVVA 4LE0A 2X15A 3ISJA 1XPUA 1UBRS 4PZCA 4FW8A 4RZHA 4ZYXA 3EH2A 2RGUA 1V1MA 5HYVA 3SG0A 4EJ0A 1UXKA 2JKVA 4JL8A 4W1PA 1A7JA 4LOIA 1AU9A 4DL9A 3MWFA 1IM8A 2J6BA 3I8XA 2LP4Y 1U2ZA 3TAHA 2R84A 5JXWA 1Z63A 1TO2E 1TM7E 3ZWAA 3BJMA 1HH4A 2XMDA 3GEDA 4JT4A 1Q0ZA 4MULA 4BNIA 4IX1A 4D9JA 4BIMA 3LT1A 1U7WA 3GGJA 3GFRA 4OTZA 2B5VA 4RWEA 1BDHA 1KMQA 2QP3A 3DTTA 2F9MA 1J8DA 2XKJE 4F6RA 4C6TB 5BUSA 3C8UA 5DNWA 1POWA 2PM8A 3SBXA 2YV1A 3VX3A 4XGKA 3G0BA 3OE7A 4BLSA 2V6IA 4LWPA 4OQEA 4IHQA 4HRYA 1JHMA 3P32A 4TWIA 2JHCA 1Y37A 4UQOA 1FDWA 1KRXA 4Y6PA 3TECE 4YRAA 1JEYA 4D9HA 5DFAA 3W5CA 5BY2A 2YYSA 2IYLD 2ZIGA 3DVQX 1R5OA 4QOGA 2ZB8A 5JBIA 3UY4A 5JMWA 1DJMA 5J5CA 3FFTA 5BSTA 4TSKA 1FYWA 1H2HA 1SR8A 2NO7A 2YHBA 1WTAA 3DWFA 2ZSHA 5FX2A 5BVHA 1JTFA 3P2IA 1H8ED 4P4SA 5TARA 3T5DA 5C81A 1D2GA 1N2JA 4B85A 3CNLA 2O3TA 1HY3A 2GNPA 3EGDA 4UUAA 3X2EA 4E5UA 1Z4NA 4TKMA 1C0PA 4CF4A 1INLA 1RXWA 1PVVA 1P91A 1UOOA 2DVMA 1E0JA 1CULC 4YJGA 5K3AA 3FVVA 4HVTA 1V95A 2ENWA 3B7PA 4O6VA 4C6SA 4NS4A 3LKZA 2IC5A 4Q15A 3JWPA 4YV7A 3RM3A 4O63O 4ZAGA 4G0WA 1Y9AA 1Y4DE 2RJNA 1Y6QA 2WJ4A 3NKFA 1VECA 1KO4A 3SIPA 2I7XA 3PE3A 4PCUA 3ENZA 4PNHA 3T3MB 3U4AA 4AW9A 4GKVA 1K88A 1TTQB 2NU9A 2AW5A 3PDHA 4BO5A 1W5EA 4PHGA 3K0CC 4E4TA 3KZXA 3PDIA 4W9MC 4RKFA 2CCJA 3U44B 3OIVA 3GEIA 4CKZA 4KJZA 5MFZA 3WLKX 1JQJC 1I5OA 3WNQA 3WNDA 2PD6A 1SBTA 3IV9A 4C01A 1K7CA 4RVSA 2YMMA 1P6QA 3OIUA 3REFA 3VPAA 1CEYA 2GXSA 4OXKA 3U62A 4Z6KA 3O9ZA 2RK3A 1PYOA 2AB0A 1VGQA 3EGXA 4M38A 2OK8A 2GBPA 2QPTA 4YJ3A 3AR4A 1KMMA 2A7XA 1MGOA 3IALA 5I47A 2FPPA 4OGGA 5CCXA 1LJUA 1ZFNA 3SHVA 3TZKA 4RD0A 4I6EA 4XJVA 1Q57A 5EZSA 3EC7A 2QX9A 3U7QA 3EPKA 4RHXA 1NLUA 4CEJB 3PTAA 3JZFA 2GEVA 5C8YA 1SHTX 5EIAA 2J1LA 2P11A 5EIHA 3KPYA 4RV5A 1SNYA 1TC1A 1TCVA 2GGSA 2PK3A 4MKRA 1UXHA 2Y4OA 3D64A 2FX3A 1UZNA 1ZKDA 5DXAA 3V3KA 4BP9A 2IHKA 2J07A 3QEKA 1LNSA 4B2IA 5G3ZA 4DXHA 2W7TA 4Y2GA 1TYBE 1CIJA 2B82A 1RYDA 3FJOA 1L8XA 4FQ8A 4KH1A 5EZQA 1WBBA 1EH5A 2ET6A 1QZ3A 2PZFA 3OG9A 4X8MA 5G1PA 2B1QA 2B8NA 2VHUA 4M49A 4KPYA 4FE3A 1H0SA 5KWJA 3IVGA 4P4UA 2ZB7A 1Q16A 3AF3A 1OLUA 4F3RA 5HKLA 3DT9A 1T24A 3AFGA 1SA0A 3F5FA 3NBMA 4KPUB 4IIFA 4WPGA 5LIRA 1VXRA 2MU1A 1OH8A 4NCAA 3NATA 1BU5A 1EK1A 4OG2A 3TMAA 2O4CA 3DPUA 4UOQA 4X9XA 4CIDA 4BU1A 5FAXA 1KYVA 3H0KA 2IL1A 4YAOA 3OQNA 5K0TA 2DQZA 3WGLA 3GAMA 3LPMA 1A9XA 1CUZA 2J5KA 2VKTA 2XHEA 2JDID 1HE3A 2ZRIA 1NN3A 4AMYA 2KLBA 2BFFB 4FX5A 2EGGA 3O21A 1I3NA 2ZB4A 1DELA 4MJ3A 5HZMA 4FFDA 2WIKA 2JD2A 5KSOA 1G3QA 1ONSA 1NPDA 2DFPA 3CUTA 2JAXA 4RDIA 1V8BA 2ZM5A 2PUEA 2BFCA 3CXRA 3NHAA 3H1BA 3ZWWA 3LP5A 3O8BA 1E3JA 2BY4A 1E0DA 1JEOA 1M6HA 3E7XA 4BNGA 1QRAA 2IE8A 3C3EA 1IOZA 4G4SP 4K1LA 3RYFA 5LQNA 1SG0A 3NAZA 2Q41A 1E79D 4Q6BA 4F85A 5K9ZA 2PUDA 2IU3A 4GWGA 3DMHA 3TR5A 2ZKLA 3A0UA 4LSZA 3OO1A 5CPBA 5KJ6A 3PPWA 4J0QA 2R7AA 1EINA 1GYRA 2CE7A 2VNAA 1YZNA 3KFLA 4WCFA 4ENTA 4QECA 2OBXA 5DP1A 2G80A 2PUCA 1RXEA 2UV8A 1Z5UA 1ABFA 4CF3A 1U98A 1O4WA 1U0FA 1MPTA 4Y2RA 3ITNA 3TLEA 1XNHA 8ATCA 2ATCA 2QL6A 2J0UA 2DWUA 1E3TA 2J0VA 2NUAB 2A9QA 1F2VA 1RRGA 3C87A 2V6BA 3IB6A 1N1EA 2FMTA 4PYJA 4R2WA 2X1MA 2Q4TA 4UTNA 2ETVA 3I2GA 2O3UA 2RHMA 4BJ6A 3P20A 1QRSA 2OYRA 7REQB 5KYTA 2P30A 4C0AC 3L04A 4OPMA 5HPYB 1UDCA 1XTIA 3PEYA 2FPIB 2XQVA 4BASA 5HS4A 4LF5B 3CVWA 4US2R 3IERA 2EWWA 3Q1LA 3VTKA 1R8SA 3EARA 1N0VC 1LF5A 2DBYA 1M33A 3DV0B 1KDPA 2AFVA 1NQVA 4HGOA 1RBZA 1SVUA 2QSUA 3JZIA 3QLVA 2NPOA 4UPEA 1VRWA 1JJBA 1HE8B 2D74A 2OMKA 3B89A 3ETDA 1AQYA 3PG5A 1XRRA 1SCKA 2L18A 2V4ZA 4PONA 4PWYA 4HVLA 3GR6A 5FWYA 4KKVA 1YZUA 1YZLA 2YYYA 3WAKA 1QFJA 3S40A 4ZQGA 2C9ZA 4K28A 3K09C 4TMYA 3A2NA 1KKUA 1X87A 1B43A 3FDZB 5DM60 2XWQA 1J7JA 2PKCA 2FFHA 4EUEA 2BJWA 3MJEA 4M36A 2CXOA 4BE9A 2YWCA 2GBGA 4TX1A 4X6UA 1BE1A 2PIDA 4RZUA 5HCUA 2WLSA 1N5JA 3NTQA 3OC6A 4HDQB 3TUJC 3V42A 1E61A 3T3HA 1AS2A 2REBA 4I7EA 4D74A 1Y8RB 1EEHA 3ETLA 3GNSA 1RIFA 2IOQA 4FHEA 4U3JA 2ZQZA 4ZO6A 4C1BA 2AQ8A 2ZANA 4DY6A 5CG1A 4IO0A 3F96A 5KU1A 3ICPA 4K86A 4HXFB 1KI6A 3OOYA 2BRUA 2QBYB 3H4IA 1FFBA 1Z29A 5JS2A 1FP4B 3C6XA 3CNEA 3KQSA 2GJ8A 4H4DA 2CGEA 4WXMA 2OP0A 3TDMA 4BN0A 4CG2A 5CYGA 5MN5A 3EEYA 1USVA 4BVGA 1XZAA 4K2HA 2W4IA 4MICA 4JAVC 2J31A 2WU1A 1NFFA 3BB1A 1RKBA 5SY6A 4O2AF 3ER6A 3R5HA 5CFNA 2O1XA 1NFQA 1VG0B 2XQFA 3OU2A 5HILA 3UWKA 3PX7A 4B3DA 4L72A 2C5HA 1BDJA 2A6PA 1RCUA 3LZDA 3NNNA 1DU4A 3QVXA 2A0UA 4JKIA 4Y6LA 3P0EA 2C84A 4GE0A 4KZKA 4R54A 2J7PA 3FLAA 5HFAA 4ZGWA 3LOUA 2IZ1A 4RK6A 5LL6P 4YCNA 4EGCB 3EE6A 4IS2A 4XDHA 3KNZA 3UMGA 4ZCIA 3T4XA 2AKAB 1P0PA 1PS9A 2Q0SA 5BUCA 2XMGA 4KQ1A 4NAUA 4R2XA 4JOBA 4FT4A 3VPHA 3KBBA 2ZLBA 3IILA 1P9NA 2H63A 1FSSA 3DYBA 1ZU5A 4TL7A 1RYHA 2ZITA 3DXXA 1SCNE 1JHQA 3QBTA 3KKZA 4L4ZA 4RDCA 1XLUA 2JKZA 4L78A 1PT8A 4X8OA 4YWHA 1XUOA 1Y8QA 3NQ41 3PLAE 3A70A 4GKJB 3PHIA 5B55A 5DN6D 1I1OA 1ZXXA 1U7UA 3W1VA 1W49A 2RGCA 3PHHA 1JI3A 1GGFA 2ZJ4A 2XLCA 3G2HA 3GLRA 3MJDA 5FLEX 2MSCB 5AKXA 5EVCA 1L7VC 1T9BA 1SHUX 3G7UA 1JHAA 3PKIA 2JKYA 2XSZA 3L1IA 2FMFA 3TIFA 1LW7A 1UEIA 4BO7A 5IAOA 5KYXA 1GT6A 4P4NA 1E5TA 2VSYA 3RIEA 1HSZA 1Y1LA 2IYFA 3HGMA 4NBKA 4ZTBA 4CL0A 4MRVA 1U7DA 4YEDA 2JLCA 2PWBA 3D43A 4DJ5X 5ALWA 4P7BA 4D9CA 4HBGA 4I19A 1DX6A 1RNLA 1GNTA 1HV8A 1MDFA 1PUIA 2CFRA 2ZRLA 1GGEA 2PKRA 3EEIA 1GFIA 4W8HA 3CEAA 4UMVA 3PC8C 5EWLB 4ER6A 2QN7A 3VUEA 4FOTA 4LY0A 1I1HA 5FQOA 4YV0A 4NZPA 1JLSA 5BW8A 4E5NA 2I87A 2WD7A 4OKIA 2REOA 4ZAYA 1X38A 2QN8A 4EHJA 3J80A 1PHPA 3PS9A 4H4EA 4HEQA 2WJYA 3G6KA 3GT3A 4OREX 5AVRA 2EOAA 2JLAA 1GM5A 1PR4A 3PGLA 4C3OB 1XJQA 1YFLA 4YMVA 3OF2A 4M4SA 5CG2A 3N3BC 3K3PA 3NNSA 1M83A 3D5QA 1HDEA 4UMFA 1FYDA 3EG9B 3NAGA 3RJTA 4INOA 4HUTA 3VOSA 1WY5A 2C3OA 3G2JA 1G5PA 4L1KA 3OTHA 3QMWA 4Z2AA 1UM8A 3REGA 3UMVA 2IXEA 1JLMA 4ARZA 4WI1A 2VXYA 2HLNA 5A4IS 2VAWA 3BQNB 5KVSA 4TV9F 3D59A 4QM6A 1NF8A 3CONA 3DEFA 1Y8CA 1OTHA 5FNVB 3DDSA 2I7TA 4Y2TA 4EHKA 5G0SA 3IUEA 3OMLA 5CA1A 1NJSA 3KELA 3STUA 4R51A 1LS6A 4E94A 4FHDA 4KL8S 5IJWA 4OK5A 4P80A 1O94D 4HCJA 4POOA 2GBIA 4DQDA 3FOBA 4X1IA 3W2TA 5LXTB 3IAXA 1HBJA 2IZ6A 3KPVA 4BB0A 2EJUA 1Y6FA 4RORA 4XYMA 5CLLA 1QOPB 3DXZA 1HKHA 1YMVA 3TBFA 5U4XA 1V26A 4R2KA 2QDXA 4GI5A 3VDMA 3BIOA 1HT1E 1Z7EA 3CCCA 4MO9A 3TKLA 1W5BA 4KQCA 4ZKDA 3A4TA 5F1YA 3KZOA 4Q3DA 1AD2A 1N0IA 1PEYA 3HFSA 4BQPA 3R4VA 1JSCA 2EEZA 3M1AA 4LY3A 4HH3C 1SKYB 2XZPA 3GU3A 4D79A 16PKA 3ZCQA 1D8TA 2XE6A 5CAEB 5KC9A 2HMTA 4YRBA 2Y0DA 3BL6A 2G77B 5BN5B 2IHJA 1EFPB 1P0IA 1KZ6A 4Q1EA 2DLDA 4QELA 4PZLA 1VLHA 1B42A 4P9NA 3ENNA 4PTYA 4X62B 4H35A 4DV7B 3MYRA 5INTA 3HKBA 3QPAA 4AO6A 2J3EA 3SZLA 4QL3A 2C4KA 5IVHA 2HA4A 4AIIA 2PH1A 3RNOA 2WIFA 4CQMD 2WU8A 4OSOA 5DGIA 4KH0A 4M8IA 3RB8A 1ZK2A 5M2QA 1E3WB 1UDBA 3G0CA 1EE2A 4LVOA 3PVZA 4KE7A 3W1WA 5BWBA 5D3MB 2I8LA 1W4ZA 2Y67A 3PA6A 3NTLA 4ROSA 3FYTA 5BT8A 1E4VA 2Y0BA 5JPIA 4AZWA 2BMVA 2CFOA 3L6EA 2EJVA 2FDRA 3LLVA 1U3CA 4G09A 5E8JA 4B2LA 3KETA 4KR2A 2QRQA 1ZNWA 2CNBA 3O82A 1TVMA 3N75A 1J00A 3VHRA 5AJXA 3MGCA 5AOCA 4E5YA 1JA0A 1VDMA 2ZRJA 1YO6A 1M1UA 3C1AA 1W2WB 4PQFA 3K0BA 2F1OA 4DXAA 3JCZA 4NESA 1FE8A 4Y9UA 3NJ4A 3AY6A 2NVUB 4E2FA 1GJRA 4HBZA 3B6KA 1OU4A 2Q5LA 3BK2A 2VYNA 2J4FA 2BFEA 4BO2A 2XHZA 4BB9A 2ZXUA 2ZTMA 3WNCA 3A25A 1P1RA 2VTVA 1RKQA 3DWGA 5SZKB 1N9KA 1R50A 1GAQA 1Q21A 1TXGA 3UF0A 3B5IA 3C0KA 5H3LA 3VU9A 5T4EA 2FSUA 1KC3A 3ZQUA 4GM0A 1HQYE 2RIRA 2ILTA 1O97C 3AFNA 3N8DA 2DRIA 4IGEA 5TEWA 1BYIA 1F12A 4MUYA 2XGGA 3B53X 3MB8A 1PQ4A 2VZ0A 4CCWA 4LDZA 3O7MA 5JI3E 3ZGNA 4KK3A 5ER9A 4RETA 3NHBA 2AN4A 2P8JA 2ERCA 3D6AA 3OCVA 5GGYA 2ZRAA 4UVHA 1HFKA 1O6GA 3BBPA 4GOOD 1MB0A 2O48X 1UMCB 1H4QA 5EOVA 4HDRA 3RQIA 2XYPA 4ZVSA 3REOA 2JK0A 4IMPA 4IIJF 1JHXA 1BXGA 5L4LA 4RMHA 1E2MA 1R3UA 3AVQA 2Z9CA 2B37A 4IOLA 1VA4A 3C41J 4OYRA 2ZRBA 4PHCA 4CM9A 3ZLJA 1BMFD 4XFJA 1RI3A 4UBLA 1N2BA 2A0KA 3L7OA 1QPBA 3PWSA 5H3HA 2QAGB 3ZIDA 5JSUA 1XFDA 1Z7GA 1XEWX 1TL7C 3COYA 5E1BA 2R85A 4EQ6A 4YLGA 3IO5A 2ZWIA 2XF8A 2AQIA 3CR8A 1AHHA 3JVEA 2WM3A 1C0KA 2AZMA 3EULA 4C7KA 5EHIA 1P2VA 4NRDA 3NALA 3OQBA 3WQBA 1R0BA 5JMOA 4BO9A 4DCPA 3RVNA 3U4QA 4FYPA 2EP7A 1MX3A 3L4KA 1TO1E 4GLBA 4HQ6A 5EIBD 4RZXA 2C2BA 3ND7A 3PQDA 2GN4A 5TDHA 5BWCA 2MSLA 3ICCA 3QF4A 2JC3A 4N7MA 3X0DA 3IKTA 2FPGA 2FZEA 1E3LA 1X39A 3BTUA 4BATA 1FDOA 2FOIA 2VLIA 3AEXA 4DRXA 4BKPA 4ZVKA 3K1AA 3PLNA 2R4UA 2YJGA 1RPAA 2VQ3A 1JG6A 5ER6A 3GGCA 3R76A 4DSAA 4L6IA 1DHTA 2Q5HA 2Y76A 4ARVA 2ZRMA 1RI2A 4LYEA 3NXKA 2O0LA 1S9DA 4YROA 3K0KA 3PC4A 2OGTA 4C0KA 2OO5C 4TTTS 4KQ9A 3I2HA 4YO7A 2X76A 4DCNA 1VP3A 5B6IA 2M9MA 4EG6A 3ZU5A 4LTDA 2FSVA 4K46A 3V7NA 1CY7A 4QLOA 4BWYA 4NCBA 2KB0A 3PUHA 4FXOA 5CTAA 3T7TA 3SE0A 4DYDA 3GFBA 1RC0A 2G71A 1KIMA 2ORIA 3HQ4O 3HVJA 3HMKA 2XUHA 4Y6SA 4ZVOA 1I13A 2ZI9A 4G5SA 2P2YA 2G9NA 1MD9A 3WMRA 1U8FO 1EWKA 1OI2A 1SK9A 1SVSA 5F5LA 3OZFA 5B7PA 3EXHB 3OUUA 1NBHA 2NO1A 2IYRA 5JXIA 1ISMA 1GNPA 1ORVA 3FNIA 1N75A 1FNCA 1WKVA 1VBNA 1UMDA 2HMYB 2FN4A 3BOSA 4MK4A 4WKOA 1G5FA 1HDGO 3HBJA 5AUNB 1Z47A 2LTAA 1JIVA 3CRW1 3L06A 3AR3A 3QKRA 3OQIB 3RJMA 2BSAA 4RSMA 2ZJYA 4M6WB 5DHTA 3B8HA 3RYTC 1E5QA 3W2HA 3AJRA 4AF8A 2QTWB 4Y2HA 1N36B 4LHVA 4DMUB 2Q3BA 3DZDA 4KSYA 3CIOA 2PLRA 4NZ9A 1GU0A 1V6SA 3ZVKA 2Z04A 4UU0A 3C6KA 1P5HA 4RE6A 2CNLA 5C3UA 4TTSA 2X41A 3FWZA 3K9GA 4QPCA 5HUJA 1H4VB 3I1FA 5AIAA 2F00A 2PBFA 4MPRA 4P38A 4N3NA 1TQ6A 4NXMB 1OXSC 4WQMA 1GNRA 4FPXA 3BD6A 3R24A 1KWKA 4U7TB 3V2HA 3I6ZA 3KT0A 3MILA 3IUSA 3N5CA 4M22A 4RJJA 5CHEA 2DGDA 4UQLA 1CRQA 4UREA 1YAJA 4DNQA 1EGMB 5JSZB 5JDCA 2TYSB 3CVOA 2JF0A 1DG3A 3I3SR 1RAGA 3NHJA 4LOJA 3VO9A 4EMBA 5HJ5A 3NV9A 3QGMA 4W4TA 2QYHA 1ODCA 3KAQA 5DNYB 4KDRA 1LFDB 2C42A 5GV7A 4M9CA 3OE5A 3TSZA 3N2GA 1MA0A 1Q5PA 2A4MA 1QHXA 4YFYA 3ETJA 3AR9A 4IIHA 5E4YA 2CUTA 3MUEA 4C4RA 5IBQA 2HSDA 1MZVA 3HNRA 3LLCA 2YV3A 1T91A 3Q3GE 1ID8A 4Q3OA 3BG5A 3A3OA 3BXHA 1D4ZA 4XKJA 3OF5A 4HAXA 3A9UA 3FMOB 4ZT6A 1LX6A 3DZKA 4G84A 1HRDA 1RRKA 1YKSA 4KFSA 4L0CA 1W36D 4RS4A 2HUNA 3Q7PA 3KEOA 2X8JB 5F33A 1E2NA 4AKEA 5LBUA 4C0LA 5EP4A 4EB8A 1GGNA 3RE1A 1N5MA 1KI7A 3FPSA 3ILSA 5DHRA 2G9UA 4EKYA 5AVTA 1IXYA 4BWFB 2VDPB 4YECA 2PO7A 2BMDA 1Z15A 5JD5A 5JMTA 3QE4A 3SF0A 3W2EA 1XELA 5I7EA 1GCIA 3F9RA 3H6GA 1S8NA 1A2BA 1QO0A 3FNHA 1TYAE 4LDQA 2VPIA 1KQNA 3BA1A 1UCFA 5JQGF 1EXDA 2JG3A 2QXYA 5DBFA 5IHXA 2ZAYA 1XRSB 2VPXA 4ITUA 4RIGA 5ABPA 3NVMB 4IJ6A 3UB2A 3BCSA 2VT3A 1ZD8A 4YQYA 2BI4A 2QQEA 3IAFA 4OMDA 3FBTA 2A78A 4QPJC 1JI0A 3B5JA 3U49A 1AO0A 1SRQA 4A10A 1H1LA 3U4CA 3ONEA 2IUTA 5GGXA 4NDNE 4COOA 4DA9A 1XQYA 4REMA 1EM6A 2HGSA 5L6MB 5J63A 1N7GA 3UMFA 5HRCA 2HA2A 2IX9A 3ZZUA 3DTYA 1E2BA 3S8EA 1NOKA 3VOAA 4F5YA 2ZRGA 1KY4A 4K6OA 3SICE 4X6XA 1QMPA 4LWOA 3EZLA 3P4YA 1ADCA 3FY4A 2VJAA 4XWGA 5C34B 4DR2B 1JEYB 5FTJA 2FLKA 2XY4A 2I2WA 1FDVA 2ZIZA 3NUZA 1AZLA 4OH1A 4M7WA 3AKZA 2AIRA 3THWB 1U0TA 3SHOA 3N39C 5GV8A 1JSRA 3R9IA 4B82A 2F9FA 4R0VA 3J81A 2B5OA 1Z6AA 3EHEA 3NWBA 3EG5A 4OCZA 4OQQA 3RT9A 3TLXA 3UK2A 4D3SA 3VXKA 3LPNA 1II0A 1ZRHA 1WMAA 3NHKA 4OMCA 3A1EA 4YRGA 2C7RA 3G9UA 1FYFA 4KACA 1K66A 4B09A 4Q12A 3GF4A 4IJMA 3B1XA 1KZHA 3IB3A 2ONYA 3KB2A 5M7EA 4QTUB 1DZIA 3T9BA 4K6GA 4M2LA 4K3VA 5G02A 5CFMA 3QEBZ 2VYVD 4W9RA 3LX4A 3O75A 3T61A 4J7AA 2HU7A 3O3OB 1AA6A 2EJTA 3MT0A 2IUEA 4CMCA 1JN0A 4YS6A 3CBGA 4JI4B 3DE0X 1ONNA 1CJSA 2OK7A 4G63A 3WLAA 4RTKA 2VHCA 1VPVA 2XUJA 1ML4A 2QTCA 3QA9A 1AV7A 5CPFA 2KW5A 1AK9A 2V1UA 2NYUA 2AHOA 4HMOA 2CNNA 1NW9B 4AUKA 1VHWA 3PQ5A 3RCBA 3TGWA 1UMBB 3MWLA 4X24A 3JAKA 1QOQB 2QDKA 3N9IA 1ZD1A 3UC9A 1XL0A 3EA0A 5LA6F 2PUTA 2EX4A 2SECE 5EP3A 3GQBB 5LPNA 1CY4A 5FOXA 4XVQA 4FOPA 5BV8A 3AETA 3OQJA 2WHYA 3ND5A 2RGWA 2J9FB 1M1NA 3H1PA 4TV8A 4ZK6A 5KDOA 4XYGA 1X86B 1NUPA 3LFTA 2LD4A 4OXYA 1DV2A 4RTMA 2O7VA 1Z5VA 3HXQA 1E6EA 4UUMA 1VLVA 2WTAA 4Q4CA 3I9V1 3ZHTA 3TM4A 4E5SA 2G8NA 4NZOA 1TCAA 3R3UA 5FNZA 2GASA 3UJ7A 4ZC8A 5EZYF 3KL4A 5T8KA 3B3QA 2EIXA 4HAIA 1HEYA 4JBIA 3D81A 1V2GA 3RGWS 4PPGA 5KVCA 1RJFA 1U2SA 3MT9A 1NW8A 1PJCA 4G0PA 4CGZA 4ZO9A 2AUNA 5CX4A 1Q50A 3G8AA 2HO4A 2NAPA 4EGQA 1IIRA 4KQMA 2A9PA 1EG7A 2X77A 3VFDA 2ZPAA 3OQPA 2AWOA 4JSRA 1W0JD 3EY4A 2IKSA 1M7GA 4X1YB 4BFWA 2WZCA 1T26A 2BKLA 4WNCA 4BMDA 1BX3A 3RRFA 5JI2E 1ICIA 4L2IB 4LI3X 5I8WA 4INPA 1ZNQO 4M3NA 2JBWA 2XYGA 3M5PA 1OPXA 3W5IA 2JAOA 5FH9A 1FCJA 1LBEA 4DM3A 2XW6A 2O8EB 2H11A 1CS0A 4WOKA 1XFAA 1NLYA 1VJDA 2CEKA 4CDMA 1B6SA 3DVRX 3U31A 1E3MA 4DUGD 4ZV7A 2ZRPA 3VVMA 1SU6A 1UJCA 3U6KA 2QTVB 2NX2A 2GVZC 2Q9UA 3OZWA 2EFCB 4PYLA 1NURA 4UM5A 3RV3A 5I8PA 3CPSA 4XVRA 1OLOA 1T9DA 1SVWA 4HFNA 1CUVA 5FB3A 4RLFA 2Z5LA 1C3OA 2QNRA 2QR2A 3N87A 3RTGA 3CLSD 3PUKA 3D5TA 3S29A 3WK8A 4XYBA 1B16A 1EBUA 2DBQA 4X54A 1K2VN 1QH9A 2AJCA 3DYIA 4IDGA 3AT1A 4LF7B 1RI1A 1YI1A 4DDMA 2YUIA 2YCBA 1CHNA 1RIIA 1KDZA 1ZSVA 4JLUA 1J70A 3WV5A 1WR8A 4X8HA 4H7KA 4I9UA 4X94A 4ZAXA 3OQVA 3VDQA 3W6UA 3RR2A 5FEUA 4UBMA 4WK0B 1UK8A 4R68A 3OKCA 1IWPB 4ER0A 4V02A 5LLTA 3TCKA 2FG7C 2PU5A 2GKGA 3QVVA 2OBFA 3V8EA 1SCQA 3L8GA 3FI9A 4R9NA 3WQRA 4P2BA 4Q34A 4MX8A 4PRZA 3T6KA 3ZBQA 3ZWBA 3KR2A 2VC2B 5EJFA 1G6HA 4DG8A 3I6YA 4AJKA 5CP8A 3W9UA 1VBFA 3C3CA 4NDZA 2ZDQA 3FMVA 1H5QA 3SFVA 3K9FC 2YY7A 3N2KB 5FEMA 1K5PA 3ZXUB 3NAQA 5FPQA 4WJKB 2H9YA 5C5CA 2BTEA 3C3WA 4C2BA 1YH3A 2I6GA 3D4BA 3HVHA 2FUKA 4NBTA 4G37A 3L0SA 4GXNA 4JBXA 3MWEB 2B1RA 3Q2OA 4MRNA 5KEIA 5HUQA 2Q2VA 4Q9IA 4P33A 1FUKA 1Y9DA 3FYUB 1YCGA 2GK3A 3ML1A 5KVVA 2AQHA 4UAJA 1USGA 1VSBA 1SKUA 4YLEA 2V6JA 2XGJA 2Q4OA 4XIYA 5BNFA 1UWCA 1HQCA 1PUJA 1WV0A 2G40A 1U0JA 3ZOKA 3BAFA 3EGVA 1G7RA 5A06A 1G8GA 5KHOC 1ORDA 5IVDA 3WSWA 3VVLA 4J43A 4O2AB 4OXRA 4O3MA 5ALGA 1D03A 1LBIA 2VPYA 3WGYA 5LR6A 3MIIA 4JIMA 4TVBA 3H9CA 5E8RA 2ZVDA 5LMUB 2WYUA 3KEMA 4CV0A 1CR4A 1D4AA 4IOJA 2GZ3A 1B3BA 3PC6A 3WYCA 2P27A 1LDYA 3K1ZA 4FLFA 4QFBA 3VNAA 1ORRA 4AP9A 4EMSA 4ZDJA 3ZCPA 4B9EA 2DT5A 3LVFO 1JQKA 4A8JC 3JASB 5KNDD 4K1XA 2OZPA 5F51A 4IP0A 4F3NA 4PN7A 5TIIA 3FPJA 5FUWA 2XUPA 4RTPA 2ZRKA 2AKYA 5BQXA 3I5XA 5IKMA 1U02A 3UAWA 4PZAA 5DISB 4LXTA 5K3SA 3H11A 4WHMA 2FUCA 4H6WA 4X97A 1GTRA 1W19A 5JRZA 4BQIA 2H0QA 1C1YA 2PLNA 4YLYA 3IAS6 4YRTA 1G19A 2R8RA 3GPIA 4E51A 5BN4B 1PR6A 4BRSA 3IQEA 1ZMXA 2ZBFA 4IUYA 1EG2A 3A04A 1X9HA 4KDCA 4LK2A 4OQYA 4RY2A 1F7VA 1M2OA 3GAAA 1TJ4A 5KREA 4MW2A 2IEAA 5K3FA 3JQ8A 4BFLA 4WZAE 4JI1B 2P1RA 4PLPA 4LHYA 1SULA 1EGVB 2BHRA 1BEEA 1N5RA 2GAOA 4OK6A 6ABPA 3WLFA 4NJOA 3EXFB 2P40A 1BU8A 3IE1A 3H9GA 1Z2PX 1UMKA 4N3GA 2HPAA 2GM9A 4QFMA 5EXDA 2PE5A 2NSLA 3L0OA 4HF7A 1ORWA 1GZUA 2PHZA 5KSWB 2QZSA 2CXQA 1USKA 5CEEA 2VQ6A 3FLBA 3KLOA 5JR3A 3IOMA 1TJPB 4JLOA 1J24A 4WZAA 5BSGA 1IBMB 2AGVA 5BVGB 2WMNB 2QI9C 2R1TA 4B46A 4ZJUA 1S89A 5KOHB 1BVRA 1FNDA 1BS2A 3RSZA 4DZRA 1U1IA 4Z54A 4HNVA 3QE9Y 2IH2A 3A9VA 2ZTUA 3GVIA 3WIBA 1V39A 2QL9A 4LBZA 3HYTA 3QWAA 4TQGA 5IEBA 4Z7JA 2PQ2A 3QE3A 3HVKA 1D2MA 1YKFA 3CUKA 1UZLA 3ORQA 4NG4A 3KIPA 4UAUA 3K9NA 5DTQA 2GPYA 2GAAA 3KUKA 4B3RB 1XXHE 1YI8A 5C5EA 2XUDA 3MQ2A 2A84A 4HLQB 1Q74A 3V4VB 4TV9B 4M9ZA 2DCUA 3LRXA 4TMXA 4B3SB 5FWAA 4YJDA 3OQOA 1IN7A 4QBTA 2I54A 1N6PA 2C5GA 2LCFA 1V5GA 1EX9A 1RYMA 3UXYA 4M1MA 2WFLA 3O92A 5KYUA 4XX0A 5BO5A 3QX3A 5KYVA 2QNBA 4N8EA 3BH0A 3BK1A 4R9SA 4C7MA 2HLPA 5F64A 5BRNA 1NXVA 1Z39A 3NM6B 3ZTWA 3L6CA 4D5EA 5AXAA 5JIBA 3RQSA 4AJ2A 1JDJA 5EIXA 4KLZA 4UVDA 2PUHA 5DK4A 5ALUA 2VAVA 3DVLA 1XXHA 4NBVA 4BFCA 1LKZA 4QXQA 1U0NA 3K0EA 2I1VB 1GUZA 4ITRC 4JLJA 4NPHA 4CT4B 9ABPA 4CKYA 5BOSA 1EE1A 1U4OA 3L7DA 3V4ZA 2BHLA 2VDJA 3LVBA 3WE7A 3DT6A 3ONFA 4CV3A 1FXSA 4R31A 4N6NA 1G8PA 1S0UA 1Z2CA 1PVOA 1BXRA 4BEVA 4O4JA 2WV7A 3GP5A 2F7SA 3P9RA 1TUGA 4M0PA 1VKRA 2BF7A 3VHXB 3HDYA 3VR5H 3ISVA 4MVWA 3VPSA 5C46F 2BH9A 4FX2A 3HO6A 1DEXA 1ML3A 4NF2A 3MJHA 2Z4TA 5DULA 1I80A 1B76A 1FW8A 3AIIA 2IEDA 4GPIB 4KBFA 4TRMA 2IFTA 2ZTLA 1FMCA 4RFVA 4W8GA 1EK0A 2G88A 2EEPA 1XZMA 3NHWA 5H81A 5DMXA 1PNOA 1Z33A 3IBTA 3KKLA 1JZSA 1JAXA 3VR4A 2YDXA 1EZ1A 1U65A 1G64A 1HFJA 1WDTA 4W1QA 4H7IA 1DG9A 1SXJB 1U5BA 1NUUA 3LIIA 3UQZA 4AY3A 1Z82A 3W8RA 1JYSA 2I2DA 3DDUA 3IODA 3PL5A 3JQ9C 4C20A 3K8YA 3DCIA 2GPNA 1UXGA 4C4AA 1DB3A 1CT9A 1EAMA 3DO5A 3L8EA 3LK7A 3JS5A 2YXNA 3HKCB 3QE0A 1OFUX 1QC5A 4J3JA 1JIJA 3FKSD 4ZZ2A 3UUGA 2JLUA 4AZTA 1AQLA 1PF7E 2HMVA 2PRZA 2YOGA 2HRDA 4AG5A 4S04A 1U5AA 1UBSB 5AJTA 2E85A 4PLWA 1YHNA 3EEQA 4R8MA 4PQGA 3EVNA 3IJPA 2WHPA 3MUNA 1CV2A 1UC4B 5I7SA 1ADFA 4G26A 4L15A 2CMKA 4JQZA 4MR9A 2FJ0A 1TK2A 2Q1TA 5IC5A 3SM3A 3ZU6A 4I66A 4P7GA 4Z7OB 2CV0A 2KBFA 1JFLA 4Y2QA 2EBFX 4N9QA 4RXTA 1L6IA 5HUHA 1OZHA 1DX9A 4ALNA 3WTBA 1PS0A 2BFBB 5FI3A 4DXDA 1XF9A 4LYJA 1QH8A 4YRFA 5H9VA 4P31A 4HI0E 3ESYA 5HBGA 2EYUA 1T10A 2I7DA 4G0VA 1PR3A 2DT8A 3C7CB 4OGFA 2ZSFA 4JL5A 4PAGA 4ZCRA 4MVYA 4NCKA 3UMMA 5LNK1 3K6KA 3LCUA 2Q1XA 4WNAB 3DE3X 3K15A 3ST7A 3C3BA 3TSCA 5IJ0B 3GLQA 2YXLA 5EP2A 4YAUA 1ST2A 1SU4A 2FW9A 2YYZA 2Y2UA 2DJIA 2ZYDA 2BISA 2IYYA 1J2JA 4I9FA 4ROTA 1QIJA 3EF0A 1YR1A 3OTIA 3JQAD 3Q85A 4LJSA 1Z13A 3AUXA 1JQ5A 3H4MA 5HKKD 4G5RA 2PTGA 2QX8A 1E2HA 1G5IA 3BKWA 3O8OA 4I4TA 4WACA 4IIJB 3HSYA 2EP5A 2QZJA 3KB8A 6ADHA 2VKQA 1OLSA 3IBFA 1QTNA 2QTNA 1LU9A 5FYQA 4LF6B 1WDLA 2HNAA 4B6FA 5L4NA 3ZUGA 4UEWA 3R3SA 5DBOA 2QJTA 3SXUA 2BHNA 1GQ2A 4Y2UA 4NWIA 3OPNA 3CISA 4YRNA 1WXEA 3O4FA 2CLHB 4V0NA 3K0CA 3ANXA 1WDMA 2ABWA 2VDVE 3AXTA 3ZYZA 4DIMA 5JS6A 2WSMA 5DT9A 5LYJA 1LX7A 5L8VA 1YOVA 1H3FA 4AZ3A 6AT1A 3D7SA 2Q8NA 4RY0A 5KB3A 4F4DA 3GRYA 4LXGA 5IM4A 4ESHA 4QSMA 2X0RA 2EBHX 3GEMA 3P9PA 1F48A 4KO2S 1MJGA 4HNAA 1SC4A 4MLPA 4RY9A 3W6NA 3CWZA 4BLUA 4CLEA 1F51E 4ZT3A 4F4FA 2N1BA 3L8CA 1ZBQA 3SIXA 5J2TA 1A69A 3MBOA 2X2OA 4F3CA 3Q98A 1BYUA 3O8QB 4F4IA 4GE3A 1VJ1A 4RV4A 2OB2A 3QBDA 4M8SA 2Z2KA 3O1HB 2Y1GA 2GTIA 4NH4A 4C4OA 5EY5B 5IZCC 5JC1A 3EIUA 3M83A 3LQRA 2GKOA 1L0BA 2NACA 4MS4B 1KKLA 2QIPA 4MS1B 2ESRA 5F7XA 2I67A 1FZQA 1XRQA 4FFVA 2W6JA 1F20A 3U3XA 3TRJA 2DLCX 3IP1A 4HZGA 3LC7O 5A9TA 2NSJA 1V5IA 4IUBS 4MOWA 2EL9A 3CFYA 1X7XB 3UKJA 1E8NA 4DAOA 1FXWA 1A8QA 1H6AA 2OFOA 4EJSC 1JU9A 1JX6A 2BZ1A 2CYBA 1EWVA 2H54A 2Z2IA 5F7JA 3MTEA 4GAEA 3H1EA 5EERA 2RDMA 3UJNA 1MW9X 3OBBA 1ECCA 2I99A 4Q3AA 1DI0A 1KVTA 4DM4A 1P29A 5HSGA 1E63A 1OUMA 1RWXA 3B7WA 2Q3MA 1LF0A 4UAVA 3S1LA 5J4LA 1UF9A 1WJGA 2ZG6A 3UG6A 5C8YF 4IEIA 5REQA 4G01B 3B38A 3PNPA 2JLWA 1HT3A 2C2HA 1SIUA 4WESA 4I1RA 4LK3A 3OJ0A 1R18A 3D6MA 2C96A 2VYFA 5IYZF 4KUHA 3JR7A 3VR6H 1AF4A 1ZCJA 5DBHX 1ZN2A 4JBLA 5HG0A 4QUJA 3WHIA 2IW3A 1GAXA 2FWNA 4D4HA 2DHQA 2GXQA 3HR4A 4WIAA 1ITZA 4AO8A 1K4MA 2UVDA 1N1DA 1CK4A 2E5WA 4BN5A 3UPUA 2OG1A 3P9YA 1G0NA 4IH9A 2PDAA 4B44A 2FPLA 2A9JA 1ONPA 2B21A 3BHIA 3BSSA 4E3WA 4A6PA 4OB6A 4GVPA 1DDOA 5TF0A 1WZIA 2CXNA 1NVAA 4WLOA 3AR7A 5EFOA 5EQJB 1E2LA 2XRYA 3H5RA 3VAAA 2AXEA 3C7DB 4Z7QB 5IVPA 1X7ZB 4A8PA 4UBNA 4YI5A 1PAUA 4U7FA 2JLVA 5F23A 2GJKA 5COBA 1V48A 2JB9A 1NBIA 1XTBA 2WTBA 2YHIB 5ERGB 1GPLA 4BO3A 1EGHA 2REQB 2Q6VA 1LC3A 1B8OA 1Y1TA 4CMEC 3DE4X 2NV2B 2GZAA 3OTWA 4WGFA 1KNXA 4ZYYA 1AVTA 1UL1X 4PFSA 3I1YA 3OSUA 2BH2A 2FOXA 3BWEA 3FUUA 4HQFA 1T36A 3ZY2A 4GXRA 4G5FA 4DQVA 3MB5A 4NEGA 4EHNA 5LUBA 3FPCA 1M6YA 3DTVB 4R6WA 1FDIA 1N0UA 3F5QA 1EVJA 4PC6A 4UHHA 1JLHA 3IFSA 3BILA 1PGPA 2PX5A 4WUVA 3C1TA 3N2EA 4KGZA 5EESA 1X77A 2Y6VA 4EG1A 4CVNA 3AHCA 1SUWA 3GGSA 1CVIA 4ZOLA 4ASUA 1RR6A 1ZL0A 4HT3B 3U1BA 4PXYA 1T1SA 5AJYA 3IPYA 4D80A 1CJKC 3WYFA 5JQGB 3DC2A 3HJRA 4WY5A 4PYRA 4E5KA 4CLRA 2CXSA 3V4LA 1F6BA 1VLZA 3KEGA 3M3HA 5DVZA 1RWVA 1EHYA 3NANA 2A5JA 4N8SA 3CTPA 4B9AA 1FOEB 2C2MA 2ZDGA 1E62A 3Q10A 2QJFA 3S2YA 5CNMA 3UK6A 2NAFA 3ZY4A 2HM7A 2W2TA 3AF5A 1DDGA 1EDDA 2V98A 4C88A 2WSSA 4N3AA 4G8DA 3WYEA 5JNWA 1SQ6A 4ER5A 1HE1C 1UJ2A 2YYAA 4HH0A 4UTOA 3K09A 1AHPA 1PFWA 2VH5R 2ZIUB 3P9NA 3QVJA 3TSAA 10MHA 4NP6A 2ZIFA 3HCFA 4XPIA 4KI7A 3T12A 1W88A 2YVUA 4BNFA 3TQQA 1AMUA 3EX7C 4BNYA 2BZ0A 1H9BA 3C8HA 3W3AD 3WOHA 4DIUA 4TZKA 2BR3A 3MCWA 4TKVB 3JD1A 4DWJA 4ERXA 2VXOA 1KMNA 2PGDA 2EW2A 2Q99A 3BYZA 5K6AC 1H1TA 4FI3F 3DLTA 1WOYA 2VSNA 4EY8A 2AOUA 3BFJA 2IDKA 1GZ3A 1A9YA 1FLVA 1VE5A 3KOXA 4RBNA 2XZDA 3AU8A 1MOZA 3V33A 4BP3A 4GYWA 2BKEA 4TRJA 1Q0LA 1V1JA 1QYXA 2YINC 2ZUBA 4LE2A 5KVQA 1IHPA 3HS3A 1C3LA 3HRKA 4KAXA 3TLGB 4TXJA 4NBRA 4IIBA 3FYHA 1A7AA 4G85A 3FBWA 1R4MA 4QGSA 5LQKA 4OF4A 5JAIA 3BEOA 3I09A 1ODTC 4JC8A 3DBVO 3PHBE 2XKBA 2ECQA 3TFWA 4WZ6A 4WX2B 1P3DA 1T5TA 3KSUA 4B3IA 4MQ6A 1TLFA 4EENA 4D26A 1B15A 2GYWA 3MEQA 3WQSB 1YK1A 4XM0A 4BBAA 3O3MB 4ES6A 1GRRA 1M8JA 3CVJA 2JGEA 9GPBA 4K2AA 2CCKA 2D00A 4IFIA 4PSUA 3OKPA 1TW3A 5D6OA 2WAAA 3A05A 3I92A 4S1NA 1E6LA 2QOEA 3AFOA 3DNPA 1C14A 1NBMD 2P2ZA 3LWZA 3A4NA 3DB2A 1M0EA 5AHKA 2DZDA 3PPVA 3SYLA 1JKIA 1NJFA 1HRKA 1LBHA 2HIMA 3CRVA 3QNMA 5LQDA 3F9CA 1PWYE 5CH8A 4RK0A 5EZYB 5KNCD 1MRNA 2C78A 2O52A 3FLMA 1VKHA 3HCOA 1RHMA 4P7KA 3SYNA 1RP1A 1O96A 4A0GA 4MARA 4U7JA 5L45A 4CR8A 1QGOA 2P3OA 4IBOA 3WV4A 3FIJA 4AX8A 4K81B 1KIFA 1E99A 1T4GA 3A37A 3PGVA 4LOHA 4B87A 2BZGA 4L0DA 3BDVA 3F5DA 2ZKIA 4P7JA 2J32A 1U1FA 3PNMA 2QIOA 3D4PA 3KUXA 5MN4A 1AK2A 1IHUA 2UVPB 3K0AB 4D98A 4QG3A 4EHFA 4X1KA 1OWNA 1MW8X 4JQYA 2PNJA 3QXXA 3PFNA 4L9AA 2FSSA 4HN9A 3L18A 5DTRA 2QN1A 2CWWA 2ATVA 1E9FA 4XE5A 1VP9A 4HDMB 3AOEC 3PC8A 5IWCA 1IDN1 1XZBA 2HYDA 2G06A 2V6FA 3DOFA 4UUPA 3VH4A 4IJWA 3IP7A 5FUYA 2FWPA 4F9TA 1DBRA 3SBDA 3B5EA 4NQRA 3VSBA 1DIOB 3GJSA 4IG4A 4KB5A 3T7IA 3CW2A 3IVAA 5AUPB 4GZ6A 1CY8A 5I3CA 2XB6A 1XVLA 1YF3A 5JSHA 1ZVMA 5H02A 1CY0A 3RFCA 1DOAA 3EXG1 5G0WA 1NMZA 4UD6A 2I9KA 1Z0FA 2PGAA 2XCIA 3NGXA 4CF5A 2LV8A 1JP7A 3PDWA 1RXVA 4EYKA 2QXUA 1GPDG 3E27A 4GZ5A 1ZCAA 4XD7A 4IHJA 1Q7GA 3E5HA 3P2JA 5A4MS 1IN5A 2RI0A 3AHFA 3G1WA 4C03A 5EXPA 3L7LA 3CLUC 3E9QA 3WA7A 1GITA 3VPXA 1CLUA 1N9GA 1KAHA 2BTOA 4WXYB 2VAMA 2AEEA 3Q1KA 3SGLA 4DV2B 2ZSEA 1M67A 4GPAA 5JJ5A 1GUBA 1QG0A 4XTRA 2YBEA 2ZS9A 4A27A 1LDNA 2QE6A 1WZEA 4QQNA 5BUQA 1JALA 1ODIA 1F5SA 4XASA 5KTMA 1U2RA 1ZI9A 4G86A 3EJ6A 3LA8A 3L4EA 1BEUB 1N33B 3EYAA 4P0TA 2O0MA 1CX9B 3G0GA 3MTAA 3V6MA 3ZBUA 4BP1A 4EAAA 4RTQA 3R7WB 1YA4A 1ODSA 3SKYA 4GMGA 1HYBA 2O6LA 4I1OA 3UO8B 3W06A 4AI6A 1IN1A 3IQWA 5TT0A 2RKOA 4FNGA 1DRVA 5HTKA 1VJGA 4ZU3A 1H42A 4DC0A 1V16A 3ZU3A 3WGGA 1BGVA 4H4CA 1P1FA 2WZBA 1CQIA 3TN7A 2Y1DA 3DEZA 3O73A 3QVTA 1XJ5A 4FGLA 4YBZA 1ZUHA 1UC9A 4BKOA 5C2JB 4JI5B 1W85B 4JLPA 4MUJA 1TNDA 4NABA 1LDMA 4OHFA 5CA1F 3IO3A 1THGA 2PMKA 3NUGA 3RPEA 3ZWXA 5IH7A 2FY8A 1WPGA 3AYXB 2LBPA 3KQOA 4JUCA 3AK4A 1JNXX 4RQTA 2BCJQ 4WDRA 2XOKD 3UT6A 3ZHCA 2FHPA 5BRJA 1U04A 4GP6A 3T5MA 1R74A 3TNLA 3CZPA 3W3ZB 2RBEA 2WG1A 4Z1MD 4NV3A 2C1XA 1P1JA 3QA3E 3ONNA 4FMDB 5AVWA 4INZA 1UM9A 3O1IC 1M76A 3PFCA 1KIAA 1VSVA 2H4WA 2GI4A 4KXMA 1OBOA 2BMAA 1NX6A 2QTFA 4L8GA 4RKQA 3DG9A 4B81A 5E4JA 1J09A 2OXTA 1CJVC 3AIKA 4HEJA 4CT0A 2H1WA 2NQ8A 4Q4DA 3HN2A 2PUFA 2PYZA 2ZVJA 2F3SA 1TPZA 2XV1A 1KC1A 3E0QA 4CQJA 4E1VA 4BO4A 4HGPA 5FTWA 4BMOB 5TMDA 5CNKA 3OZUA 5ICFA 3TMKA 5CD9A 3DV2A 3ZDRA 3L7CA 1YZYA 1NNSA 1LCIA 3ROXA 1U0EA 3ZU4A 2HU5A 4XGQA 3IJRA 5AM0A 3V6LA 4HLCA 1AHIA 2C5SA 5KAPA 1J23A 4YMSA 2FLVA 4P82A 4N6OA 4MLCA 3EWNA 4CKBA 1Z7YA 5CNIA 5EUCA 5B2EA 3RAPR 3F0TA 4UVGA 5ILGA 3TQTA 1AKVA 1Z0SA 3I9KA 1WU7A 5TQ0A 2HDWA 1Z6QA 1P62B 1TE2A 1W5FA 5CGQB 5TPZD 4XFDA 1V3QE 1DKMA 4NNPA 3P26A 1QG4A 3RDPA 3TUIC 1YR8A 5IUKC 2POCA 2IWRA 4F86A 3ZWYA 4KR7A 4QBGB 2VQDA 4KDFA 2FX2A 1NOJA 3DE5X 1ULSA 2OUIA 4D92A 1J0EA 4NBWA 4HWGA 1GTSA 2FVYA 4B8WA 2X14A 4MDFA 1FX0B 5IBPA 2PUJA 2GTPA 4BY9E 2PQ0A 3HZRA 2GA8A 2SHKA 3FVRA 1TEZA 1TCUA 3DPSA 3I0ZA 5E7QA 4BRZA 1VGRA 3VX4A 2EWVA 2NSDA 3P1JA 3A6DA 2QTAA 4CN8A 2CMHA 4YCDA 5KPJA 2RGXA 3MCTA 1X7HA 4HYYA 3OIGA 3FTPA 3UUFA 2ZE7A 4HNGA 4D6YA 2JI9A 1F14A 2D4HA 1P0MA 3HN7A 4R9RA 1H66A 4Q9LA 5AKKA 5FL7D 4ZHQA 3L93A 4ICIA 1T5DX 4HAUA 1SKQA 2Z1NA 1MQAA 4UMDA 3SK0A 2XKKA 3CU5A 3F1KA 2PGNA 3I5UA 1TT5B 1B1CA 3DEAA 2DWQA 2WJIA 2XZTA 3H16A 3QWBA 4M37A 3P9CA 4UTZA 3W5HA 4DR1B 3FXAA 5BV1A 4JY7A 2Z6UA 2B1IA 4UCWA 1PZEA 2WUEA 3EBLA 2I2CA 2NXWA 4WINA 3NUQA 1Z68A 3AEUA 4DYHA 4LA4A 1P77A 2EJWA 4U0KA 1A2OA 1URPA 4HWTA 2GRJA 1IH8A 4B33A 4OIMA 5FA8A 4F2HA 3CGGA 2JJ1A 1EDEA 4WXEA 3U3KA 4ACBA 2MOKA 2EQ5A 3PIDA 1BCRB 1JU3A 1P1IA 2GWRA 1ZM4A 3RC9A 3V4SA 5B1EA 1MQ9A 2ODTX 2PWYA 3ASYA 4PSVA 2Z3WA 1AUPA 4DE5A 2BMFA 2C92A 3DHEA 3V1LA 1A8PA 2K6GA 3QUCA 1TA4A 2P6UA 2G0NA 3MJFA 5A03A 3W5SA 1FBNA 2EZ4A 4IDCA 4PF1A 4CKEB 1FB5A 3DD1A 3IKJA 4JQSA 5D51S 2HR1A 2W98A 4RFSA 4OQDA 2G04A 2G70A 2XBUA 4UTPA 3FYSA 5ICEA 5E9WA 2BSXA 2D5BA 3UOWA 3OM9A 1A5BB 1M2JA 4AX4A 5FPSA 4JZYA 2WJ6A 5TY0A 2J8ZA 4DNFA 3IHTA 3QVGB 2AJLI 2OO5A 1DBIA 1II8A 4J4HA 4F0JA 2UUCB 3KUUA 4MW9A 3ZBTA 2HO5A 4OEHA 1YZ3A 2A9RA 2R6ZA 2R6JA 4A0QA 4X7PA 4CG3A 3K05A 2GJ9A 2BEWB 4DSUA 2IWHA 1STOA 3ZZNA 5IDWA 3Q8KA 2HU2A 1J21A 4TLCA 1C80A 1X2EA 3JATA 1U90A 5DWVA 2XI4A 3F7MA 3SPXA 5EPUA 3TB4A 4ZI7F 1FW6A 3RV4A 1G2PA 3PNKA 3M5CA 3MTBA 4BFTA 3O3NB 3E84A 5ILOA 3FHCB 2N75A 1E64A 4CMHA 4EZEA 3AESA 4ZTUB 1WMFA 5JCZA 1KERA 1JA1A 1U9JA 1VPLA 1WUTA 3PCXA 3WS7A 2O2IA 5K3OA 1PSDA 4E33A 3SLRA 2EATA 4HS9A 2NO4A 2WIAA 3V3TA 5DKFA 5BSWA 2KWIA 3NW9A 5CVTA 1I4LD 5G53C 2V4MA 4U8GA 1XQ1A 5T57A 2GF0A 1IAQA 3ICVA 1MO5A 1GNQA 3RJZA 3HFRA 3M34A 1ZEMA 1E3EA 1N2CE 3UC5A 2HWKA 1XALA 3ZWMA 2PMDA 1XZQA 2HHHB 1QAOA 4TTRA 2NNWB 4K8OA 1XB2A 3O2JA 3AW8A 5ERYA 5JFGA 3K70D 1KDOA 3NC4A 4F72A 5C7LO 1KMCA 1M3SA 3GLVA 5DF1A 2PLFA 4AZVA 1GPH1 4GXQA 2HD4A 3FVTA 2PSEA 4PZPA 4UC0A 1YL6A 4DLTA 4CEHB 1EU1A 3G79A 2OCPA 3A26A 1GPKA 2X7JA 1F06A 1UDAA 2UUAB 1V1RB 1BWPA 3EWSA 3I2IA 4G1FA 4A6EA 1AKQA 3L79A 2OLJA 2OXFA 1N2CA 2JHAA 3NAMA 4HEA6 3OBIA 3Q6MA 2QRPA 1O9HA 2C61A 4XRGA 2VF5X 4RPLA 3UAYA 2BGIA 1X7DA 1DQYA 2RAFA 3CX7A 4HSGA 5IDYA 1ZDMA 2G1PA 2ZSBA 3A3YA 3RRZA 3ZZMA 1O6ZA 2FJUA 3QJ5A 5BMVF 3QEMA 2PXHA 1T9KA 1E1LA 1JSZA 1Z45A 3H2KA 3NDIA 4NZMA 5E1OA 2NYVA 4YCBA 3P2KA 5A5GA 3CLVA 5GAJA 3WLIA 1DC5A 4PG5A 3E22A 5FTNA 3WMFA 1O7JA 5CA0B 3EDQA 2H1HA 4P83A 2O2JA 5ALOA 4BTVA 5IDQA 2OQ2A 3A31A 4FHZA 4Q7EA 1R2QA 2H9AA 2ZS8A 4XM2A 3R0IA 3HZHA 1FNSA 5BPHA 3M6XA 1BG6A 3N8GA 2FCAA 4HFMA 2XCOA 1O1YA 3MXOA 1QQBA 1ORIA 1O3YA 1UEJA 3I9JA 4TMKA 4DVGA 3B3AA 2CHVA 4BMCA 3C97A 5JEEA 5BN3A 1JEJA 3EVEA 1KVQA 4TL6A 2UZ4A 1TI7A 3TOXA 1B8NA 1P4RA 2VG8A 3ILVA 3SR4A 1TAGA 2I76A 4F5DA 1SIWA 1WDWB 4L5IA 5JHGB 2CDBA 1PT9A 3V7FA 1GRCA 4WN9A 4JB2A 4MWOA 3EVAA 4GYYA 4RNCA 4AMZA 1VYTA 2I1LA 1RLIA 2Z8YA 1JFSA 2ZWAA 1Y3IA 5FULA 1KH2A 1PD0A 3UA4A 4EI7A 4K9DA 3ZY6A 3RFTA 4H08A 1GU1A 3IPLA 1V3UA 1VJCA 4ZP1A 3E4CA 3CN7A 1MJ5A 1OKKD 1U0OC 4HTFB 4JS0A 2Q50A 2XCLA 1X7YA 4Q3LA 1QCCA 2EX0A 4PYKA 1TADA 4BZPA 2B3DA 4YGXB 1JRLA 4FJ0A 2IZ5A 4FP9A 3OFND 3URKA 2P9BA 2WKWA 1AUXA 1P1CA 1NTOA 1W25A 2IYUA 2Q0XA 2ON6A 5T5QA 4UHCA 1QQ7A 1MABA 4IW3B 2Y0CA 1KTVA 3ZKWA 4DMKA 4YUXA 4EQZA 1SCUA 1L9XA 2Q3JA 3D1VA 3PDIB 5AI5A 4KHPB 1RKUA 4B2YA 2Q5EA 2SCUB 1CF9A 1Q3KA 1YU6A 3BWXA 5I5GA 4TXMA 3E82A 4U0JA 3MHPA 4HAVA 1QPGA 1YRHA 3UHAA 4DV3B 3CJTA 2VUHB 2O2SA 1XDDA 2JA2A 3B3GA 4BNZA 3KQHA 1WP9A 1D7OA 3CEPB 2GLXA 2PL5A 3GGDA 1FQOA 5KTSA 2CYCA 4QXPA 3LY5A 1SWVA 4PQYA 2QRUA 4Z9BA 4KLCA 4GKKB 4DMRA 4NKRA 4HWSA 1OIVA 4N0EA 5EYPA 4MVJD 3E9YA 5KVAA 1HNXB 3KYCB 1C1XA 3CLHA 3UMBA 1X80B 3ANSA 3N0VA 2NZVG 3QLTA 1W1WA 4XCQA 5A9RA 3ZJ5A 1P80A 1LPOA 2WIGA 3MJCA 3EFEA 2VYCA 4IQ4A 5C8YB 1K8YB 1EYZA 1U4NA 4KUEA 1U3DA 3CPEA 1Q0HA 1Q91A 2PAFA 5B2FA 5IYZB 3UWOA 4E30A 4PG4A 4L76A 3HADA 4LTNA 1ZBDA 2HQRA 2BEVA 1Z4PX 4FE4A 4ZKEA 4PVDA 2GCGA 1IY0A 3HABA 2A14A 2HT1A 2IEYA 1X70A 2VP9A 3VAZA 4DMGA 5LP6A 3G8YA 2FU5C 1GOTA 4I50A 3V8BA 2LWIA 3EIOA 4QYIA 3R7AA 3OZ7A 1WXWA 3D6NB 1PU2A 3LXMA 3OFSA 3PGKA 2QMZA 3AFHA 1MGPA 3PL1A 4F1JA 2GMWA 2ZU0C 4BNTA 3W8EA 4OFZA 3CG0A 4KOEC 1RM3A 3AL3A 1QAMA 3MTQA 4FIDA 2UXCB 5CB4F 4GOKA 4H1HA 1LQ2A 1T3GA 4HNSA 5FR1A 3VNRA 1U7HA 3AQIA 3BRQA 3KQPA 1UPXA 3M7IA 4ALIA 4PIVA 3JALA 3PQ3A 4EMUA 3EAQA 4NV1A 2BGKA 4F84A 4HAOA 5F9FA 2AG0A 3RVQA 1E1CA 2VDNB 3A1CA 2FH5B 3NZEA 2P77A 2W2VA 3ZHYA 2DECA 3FGNA 4JROA 4URVR 2BHSA 1QIGA 4ZEMA 4ZFNA 5EJAA 3KEQA 1O6CA 1R1DA 5C51B 1A4XA 4S0ZA 3PHLA 2YNMC 4KXFB 4QUBA 4B6JA 1PNQA 4BYGA 2Q6TA 3NHPA 2Q7OE 2EDCA 3A27A 4MKZA 4URUR 2A59A 2B36A 3FFWA 2W8BA 4Y2VA 3ZCTA 3Q5GA 1QO9A 3K5HA 3KUCA 5DLEA 2YJ5A 1E0SA 1KZ4A 4ETNA 2YZMA 3USZA 2JVJA 3PXEA 1E9EA 3B1VA 3A4VA 1W0KD 1ZMBA 2FUEA 3AUAA 3VC2A 4RKEA 2FPMA 1WQ3A 4G1VA 5GY7A 4HKTA 2HI0A 2AE1A 1MIOA 4MWGA 3UJ8A 2G72A 3M4YA 1IL0A 3W3AA 5YASA 1DFHA 2DPYA 1J4AA 3RRJA 1S1MA 1JTEA 4PYMA 2V7WA 1WPXA 2NM0A 3FAZA 4HQ0A 2HMSA 4A16A 4D46A 5IRCD 2LW7A 1U1DA 3DKVA 3I0MA 3KXPA 3L05A 3QFSA 5ENVA 4EJ6A 1JXMA 3QUBA 2E7ZA 2OM6A 4MZXA 3A3KA 4YDHB 2ZWOA 5EJ5A 2OPHA 3RJ9A 3T7JA 3AI1A 4WK6A 3BKXA 3IGFA 2P6NA 2FZCA 5B2ZA 1CQPA 5SYMA 4L07A 4DA4A 1QYWA 2M1XA 2PQ6A 1K7XB 1TM2A 1Z5OA 2LIPA 5HKOA 3EEOA 4LRTB 1NI3A 1WKCA 3CX6A 4LJYA 4MJ7A 4Q3KA 3KKOA 3NHLA 4HB0A 4PX5A 3WIOA 4V0OA 2OXEA 4PZEA 1N7HA 4RK1A 4EH1A 1T4CA 4KODA 2HDNB 3LY9A 1KH1A 4P84A 3U5ZB 1PT5A 2BD0A 4NV0A 5ANRB 1MTOA 1R64A 2J3LA 2OR3A 3PQ2A 4E1AA 5EJIA 5JWOA 4F38A 4NZZA 4U9UA 5D01A 4POAA 1N3IA 1VLQA 3WISA 1T9CA 4C0HA 1OMOA 3K72B 3CURA 3GZNA 3M9XA 1ZI6A 3WTCA 3MN1A 2JI7A 2ZBDA 1L3IA 3QBJA 1KI3A 4NYIQ 3SM9A 3U48A 1EJ0A 3DCJA 1I7NA 2A4KA 2Q4DA 3UV3A 4QD3A 3HU1A 3LUPA 3GQVA 4N0DA 4DLKA 2DU8A 4FNMA 1DJQA 4KNYA 1GP2A 1GG8A 2V7PA 2VT6A 2ZRQA 4PAMA 1COWA 1Z0IA 4GW3A 1KNQA 1VIAA 2KPOA 3SQXA 4ESEA 3E2MA 4MQUA 5AT1A 5JNTA 1EGQA 3RRYA 2I6XA 3UGQA 5IMSA 5I48A 2I3AA 2C4UA 2Z2YA 3GV0A 4DPMA 1JXOA 2GPTA 2RHBA 5ELMA 3MK31 3SR3A 5CYFA 4G2TA 4CR6A 3MD0A 4EB6A 1SC6A 2FRVA 3KQWA 1SBYA 4MWBA 4QBIA 3QI7A 4TSRA 1CZLA 4A8JA 5HX7A 3COZA 2X1VA 4DR3B 1AKRA 2C94A 5FUMA 4MJLA 4IMRA 1G1MA 3MYYA 3UCFA 1NTRA 4DJTA 4CJXA 1I1NA 2M6SA 2V5VA 4JVMA 5E3JA 3K9WA 3IR6A 1O5OA 3EOBI 3KLNA 4FCTA 1GZ6A 3DE2X 2YFKA 1YQWA 4L5CA 4YUVA 4G3XA 5WRFA 2WWVD 3SHQA 3QIAA 4QUDA 5AW0A 3A6PC 4CM3A 1EDZA 3Q5DA 1KJ9A 4X60A 3LP6A 1A4IA 1Q3HA 4GP9A 4D8UA 2JIZD 3NP9A 1XTUA 4GC5A 2ZUWA 3N2IA 5CK5A 1UBTS 1WUYA 3HUDA 4P5EA 5FJJA 4A36A 1N6KA 2WVGA 3T3PB 4CETA 3L01A 4RCYA 1RFLA 4HXGA 3ZX5A 2CT8A 5LM3A 5ADUS 4K9PA 3ZHSA 4O1MA 3AVYA 1Z0ZA 3F8SA 1YUMA 1PK7A 4JYMA 3GLIB 1FFAA 1RHUA 4XUDA 1ZLYA 1G5RA 3OX2A 4H3VA 4FNAA 4DANA 5J23A 2X6TA 3GIWA 1RXYA 1X0XA 3INTA 5BNTA 1KZYC 4LVNA 3U7IA 2HSGA 4R40A 5ADHA 4UTXA 5K01A 3R6GA 4RD4A 4LHSA 1RQ7A 3PITA 3LKBA 4ND6A 1KJIA 1M66A 3UKOA 4PO1A 4BVLA 3VDNB 4BFSA 1PWXA 1N2OA 4L8VA 5DHPA 1GPUA 3S55A 3O8NA 4KOAA 2BV3A 4MUAA 3V4OA 3IQXA 4KQEA 5CXXA 4YONB 2B8JA 1DBWA 4OUDA 2GFHA 3LW8A 1AY0A 3D3WA 4IQ8A 4L02A 5EAIA 3RS2A 3ZLVA 3K1JA 3BD9A 3MTGA 1Q1ZA 1QHYA 2P4UA 5DGHA 4D56A 2FEXA 1Z4OA 1H0KA 1I9GA 2IDJA 2PS9A 3JQPA 3CEHA 3PGA1 4BEJA 1RLJA 4DGSA 2W6IA 4EF6A 5FADA 4MHSA 1G4HA 3PHJA 721PA 1QRUA 4HK4A 3E8XA 2WYHA 4FOSA 2P9JA 4DC9A 3L02A 4I55A 4A82A 3HEAA 3JX9A 1NUTA 1MOQA 1B93A 3BUSA 5A6VA 5EWMB 4HPJB 3PJDA 3G2QA 1X2BA 2WAYA 2Q6LA 1IB6A 1VOTA 1TUBA 1H3NA 4WXRA 4BNUA 2DWCA 2CSUA 5B3KA 6REQB 2WT4A 3R5TA 5EQFA 1L5RA 1K6MA 1PHRA 2AFIB 3B3FA 4NY1A 4HDOB 4JX8A 3OT4A 4N0QA 1VCIA 1CVLA 1IBSA 1UPBA 2EG9A 1SXPA 1KXJA 1QGED 1FU4A 1ILEA 2WM2A 4FDAA 4O59O 1YNOA 5B1HA 2DFNA 1E2DA 3ZHRA 3X1YA 1XNGA 3D8BA 5F1PA 1Z28A 3DWIA 3U3DA 3HM2A 2WM9B 3OETA 1ZSYA 2I3ZA 5EMNA 3ZTYA 3CH5A 1I3MA 4ME6A 4DT1A 5AW2A 3A1FA 3VJMA 9MHTA 1VCNA 3IR7A 1WB4A 1OVGA 2H4JA 1E1RD 5TR9A 1L7BA 3OIWA 1E59A 3E1GA 2VWPA 1CQJB 3M4XA 4XQGA 3K1TA 4C08A 2XDQA 1NNEA 2VFAA 4KFUA 1G18A 3CSSA 3SCZA 1UZAA 2XEDA 3QY0A 1CIVA 2IPNA 1UKAA 1NBWB 1D9ZA 3GG2A 4D9IA 3K9BA 2X42A 4FDLA 2SBTA 4YP1A 521PA 3V2UA 1GNSA 4KK4A 3ED1A 2N42A 1VE6A 3RBXA 1NE2A 1RQNA 5AIBA 1MDBA 2O2CA 2QQFA 3GCZA 3OCJA 1BW9A 3IXMA 1YHYA 2G9QA 4OYHA 2FFAA 1NLMA 1FEZA 2QMHA 3AI7A 1UKVY 4N49A 4RZQA 1BRMA 3UHFA 2C2OA 4DLYA 3H0CA 4BXOA 3L49A 3RHZA 3RS0A 1CE8B 2CKMA 4GF5A 4O2LA 3B1WA 4TLAA 3S99A 1ZR2A 4AK9A 4P3OA 4KXLA 3T5PA 1PZXA 2YWBA 4P92A 5DX8A 1E4OA 3G8CA 1DIBA 4OHMA 1NX9A 5K09A 1CTQA 4NOMA 4O4JF 2WYIA 4MB2A 1ULUA 2XMQA 3P8ZA 1JKJB 3EGWA 5D5HA 4DMCA 5D2CA 5FYDA 4ENWA 2Y0EA 1ZHOA 4BO8A 4V39A 3L1JA 4MQFB 1ZY2A 1XROA 1OHHA 2VF4X 3UENA 3GUVA 5DLPA 5EQDA 1S01A 2PYDA 3QOYA 3VKWA 1CPYA 4IY1A 4HEHA 3CR7A 1I51A 1NVMB 3T9CA 1X3LA 1C7RA 1NSYA 4GOMD 4O4HA 4I8XA 4I08A 4M1KA 3WK9A 3QBVA 1RQPA 3MZ0A 1TQ2A 4R5MA 3JQ7B 1NU8A 5CU7A 5DCYA 5JUWA 1W5TA 1YE3A 1WCIA 4RFLA 2XADA 3EQZA 2E4ZA 5CFRA 3N6XA 3DBIA 3QZUA 3RFFA 2FF7A 1Y3HA 4WBNA 3K6RA 2YQ4A 4OXIA 1F9EA 2VP6A 2Z2JA 5TPWB 3ZDCA 1TZMA 3QLJA 2HV8A 2QUAA 2UZ3A 4OM7A 3TL3A 1TF5A 1C1DA 2CBXA 2XECA 3C8MA 3OPMA 4R8VA 3UVEA 2PJRA 1QHIA 1FTWA 4LSGA 4XQCA 1R88A 2OO3A 3KSDO 3VR1A 2A0WA 3GUZA 1PEAA 1RQLA 2ZIWB 2W93A 3NTOA 4HV4A 2IHYA 2VUIB 4REOA 2O7QA 3HCWA 1SIBE 3HR8A 3FB1A 3ZZTA 4BMSA 5GJBA 1P2UA 4URYR 4XI9A 2EF1A 2BEKA 4RD3A 3D8TA 4DLWA 5A7FA 2WWYA 2B4KA 4IIDA 4PPYA 5B4UA 5F2KA 4DR5B 2C99A 5G4KA 3TRKA 3QOFA 2OZLB 1TCCA 2OXIA 1AX9A 4V3BA 3DMFA 1E7QA 3T8YA 5C1BA 5JARA 1O95C 3AJEA 2ODQA 4FCWA 1CXZA 5ENDA 3GWZA 3ZQJA 1H93A 4JNKA 4PGMA 1D6JA 4JGGA 4RIIA 5ALHA 2PVCA 3TIXB 1KSHA 3TJRA 3TQIA 4XVHA 1L4KA 2WNHA 4J0DA 4LOKA 1ZR4A 2ANCA 3PRHA 4JI7B 4GXTA 4TMWA 3BMCA 3BXEA 1NR1A 3EMKA 2XCUA 3MD9A 1REQA 2PCLA 3Q88A 3S2ZA 2NMVA 4GLLA 4UASA 1N6LA 1DT5A 2O3SA 1M9NA 4LJ6A 4O4LA 4RJIA 4LGYA 4XIFA 3TD2A 2GETA 3JWGA 1JPNA 4ZMBA 2VDKB 2GBFA 3FFBA 4BQFA 2ZR0A 3RWBA 4KMMA 2VWGA 2BFMA 2WIBA 1K3UB 1FFHA 3GEGA 1OBVA 2YJ3A 3SX2A 3TAXA 4AVYA 4CQNA 1K3FA 2ACVA 5C31A 1F2UA 1N8NA 1P9OA 2A1UB 2BLNA 1KMHB 2HZBA 1CUAA 1Y33E 2XJ4A 2YOHA 2X9LA 1NDHA 1WXXA 3CLTD 3FUWA 5EE3A 3W1EA 3G82C 3MW8A 2E4AA 2O3RA 1VHJA 3BGIA 1XEXB 3E48A 4JJEA 5F1OA 3WMWA 2WWGA 3EZNA 4YCJA 5KTKA 2AJBA 3MSCA 1ZI8A 4N82A 1DQPA 4HMPA 5BW4A 4KXVA 1ULTA 1YL7A 2BFOA 1E1QD 5LYJF 1C29B 1WCYA 5CLFA 4EECA 1LZLA 1PWEA 3RK4A 1P8JA 3FPKA 1SCJA 1MO2A 4UMEA 1SVLA 3EW7A 3ZTTA 5C7YA 2WSIA 1VG8A 4ZI7B 1U2GC 2NTEA 4TWBA 3KPUA 1W47A 4F2GA 3ZZ1A 1XJCA 4XVUA 4PNPA 1OWLA 1XDWA 3G6WA 2PA0A 1UBHS 5ETJA 3LM8A 3K1AB 3DC7A 2QUJA 1NVVQ 1EIZA 3PE4A 5J2TF 3U3RA 3IHKA 1N32B 1DAHA 2AYXA 2GOYA 1SGWA 3GDHA 3Q12A 4ZMSA 1LWNA 3CE6A 4BUZA 3HKEB 2X3UA 4QYTA 4I5IA 4D4KA 5C4MA 4AG6A 1A5TA 4FLMA 3OA2A 1DARA 1LSSA 4DQKA 1XIVA 3LECA 1H4TA 4U7WA 4V0KA 3RVKA 1J0CA 4G1BA 1JAHA 3QH4A 4GM4A 1G20A 1LFAA 2XYRA 4H17A 1FDUA 3GDWA 2ZYVX 3A6FA 2CYAA 3MINA 3ZK9A 1FXWF 1JHZA 1EWQA 1XR3A 4LHWA 1YUNA 1M8PA 2B99A 2QD2A 1XF1A 3F6SA 4LDAA 2P78A 1DAMA 3CKMA 3R5JA 1R8QA 1TKAA 3GN1A 4B43A 3QKRB 4FFSA 4BE4A 4BCDA 4L6CA 1RU3A 3KQTA 3MTDA 5EL0A 2HRBA 2IYPA 1M2WA 4DHWA 4F4UA 4EY4A 2QYSA 2WWRA 3I2YX 4FFOA 1BDIA 1GLVA 1JPVA 2XEXA 3G13A 3WB2A 4N65A 5LMNB 1X8KA 4YIKA 2VATA 1KFJB 4AJLA 3I52A 4JENA 4UFPA 1XZKA 2VP0A 4R7TA 2YH2A 1DCKA 1EBFA 4OHWA 5K8VA 5BMVB 4IVPA 2OHOA 1CRZA 1FTSA 4TS3A 2RGNC 4X71A 4D5GA 2EVWX 3BD8A 3CUVA 4GX1A 4C04A 4CMEA 1SXGA 3NWEA 1KEEA 3P2MA 4LDNA 1JTVA 4A15A 3I28A 4EG5A 1Q2XA 3HFGA 5F2NA 4MQEA 1XPJA 2VS1A 4OIFA 1RBQA 1WRBA 2R60A 4YPFA 1JE1A 3TW8A 3DXFA 4A2WA 4OX9Y 5ICSA 1K4YA 4MJXA 4XTCS 1JH9A 2IH5A 4ZARA 4WKCA 4CMKA 2BYTA 4FUTA 3UV6A 4LY9A 4G8BA 1DMRA 4CM8A 4F21A 3SSOA 1LK7A 2WSBA 1Q1AA 1JDVA 3RTCA 4EW2A 5J4YA 5JHHB 3ERCA 1TRHA 3NH6A 3K6SB 3K9HA 3RYCB 3AEKB 3V9PA 2BI8A 4WLUA 1MJHA 3LX8A 4BZXA 4HNQA 1BD4A 3I37X 4QOIA 1WB6A 2GERA 4XM1A 4ZQFA 3RLIA 4C4YA 4E3ZA 5HOQA 1YBHA 2WU4A 1BQ3A 2H8GA 1DC7A 1GQYA 3MLBA 4O0MA 5GONF 3VR3D 4EG3A 4G1CA 2ZWMA 4KYUA 4MEBA 2JL1A 3R9XB 3KP1A 2F8SA 1QVVA 3LTEA 2WW8A 3ZV7A 1EMDA 1I24A 1MA3A 3ELYA 3OZDA 2VA9A 4URXR 1NG9A 1T0JB 4FWTA 4HGRA 1ECGA 1XZJA 2NV6A 1LLCA 3BXOA 1S7GA 2O06A 5TMPA 2E89A 4Z8XA 1YQDA 4FSDA 5EGSA 3SHTA 4M99A 4ZOLF 4FFWA 5BW5A 3CSDA 3KQUA 4M60A 2ECKA 1HZZA 2XYQA 2ZI6A 1ZM3A 3BZWA 3N86A 3HH8A 3OT5A 3PQ6A 2NU8A 4UU7A 2I7VA 5K6TA 1XLVA 4AJIA 3RVOA 1KR5A 4TMVA 1ODKA 1DIHA 2QM3A 5K6AA 1LD3A 1OJ7A 3CCBA 5CA0F 1PLKA 2C7BA 5GVSA 3WAJA 4D25A 2OC4A 4Z4IA 4BHTA 3FWYA 1TVKA 2UUPA 2R66A 4ZICA 1OYVA 4WKNA 5B6JA 3IMCA 3DT8A 2RIPA 3IVRA 2P2NA 3UFXB 2PUBA 4F5WA 1WXGA 2R8EA 3WJ7A 3OZBA 3VJLA 1G42A 1GO2A 4NX2A 2YJ4A 1J99A 2G9RA 2LCQA 3A1DA 4OSPA 3T06B 3E9EA 4QUHA 3TRFA 4F6CA 3AF4A 2OXCA 1QZXA 1QO7A 4HB2A 4XYEA 4C3ZA 4UE3S 3L8ZA 1U8ZA 1G41A 4DB4A 3FW1A 1YR3A 1IZ9A 1MOSA 1M0TA 2G4VA 5DNEA 1L4YA 2FA9A 2J48A 1BVHA 5F4ZA 4E2WA 4XR9A 2GFQA 5B1SA 4MV3A 4A6XA 2C2GA 1IN8A 2NN3C 3S44A 3QX9A 4GLFA 4QWWA 2UZ1B 1NVBA 1U3UA 2CFCA 4MR8B 4K9QA 3LYUA 1IVNA 1GT91 1EEXB 1P5JA 5JCJA 3RABA 3ZW9A 3GL9A 3LQ2A 4TRNA 3TI7A 5IAAA 2B4RO 2WA1A 3HGQA 1XXLA 2WB2A 1H8HA 3CNOA 1SBNE 1RYEA 3BIJA 4QDJA 4DLRA 4Z49A 1SD2A 1OX4A 2PEZA 2HL6A 3I72A 1I7PA 4QEKA 5JANA 4RX1A 5DM1A 4ZCQA 5IBRA 4P5PA 4A6DA 2G63A 3U0VA 2POQX 1RYZA 2QAIA 2G9ZA 3G2IA 3VU0A 1ZK1A 3BMOB 2X5OA 3KLMX 2JGDB 3BXGA 2ZVPX 4LQ4A 1Z3IX 4GO1A 1TQDA 2AEFA 5CT8A 5CEJA 2JCYA 1QP4A 5CB4B 1QGUA 2HLDA 2OWEA 5CVUA 2DE0X 1U9YA 4RTLA 2II6A 4QGGA 3QTTA 1E9SA 3DZJA 1CJBA 3BQMB 4ND5A 1YSCA 3DZIA 3UGJA 1P2GA 3AOEA 3V4PB 3OLXA 3WI7A 5KOJB 1C7EA 1T2DA 2HREA 1Z2AA 2OZVA 1R4NB 3ACBA 3G5MA 1WZCA 1XZLA 3G8BA 4BNHA 3VNUA 2AOWA 1QHGA 2EV9A 2W6OA 5A0TA 1ZICA 4C2UA 1LBQA 5MHTA 4GYJA 1Y0BA 2BTQA 5L51A