2Z2YA

Crystal structure of autoprocessed form of tk-subtilisin
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
318
structure length
318
Chain Sequence
QPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTCMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Tk-subtilisin
publication title Four new crystal structures of Tk-subtilisin in unautoprocessed, autoprocessed and mature forms: insight into structural changes during maturation
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 110
structure length 318
sequence length 318
chains with identical sequence C
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2z2yA00
1V5IA 1ZVJA 1TMGE 5JXHA 1TM5E 5I9SA 1TM7E 1IC6A 1SH7A 3PRKE 1T1IA 1AF4A 4ZOQI 2GKOA 3DE4X 1MPTA 3A3OA 1C9NA 1THMA 4HX2A 3GCWA 3Q40A 1Y1KE 1BH6A 1Y48E 1SIUA 4KPGA 1DBIA 1TO1E 1TM4E 3F7OA 1KDZA 3VYVA 5CW1A 2PRKA 4CFYA 1SCDA 4JP8A 2SNIE 2Z58A 3WHIA 1KDYA 4OMDA 1AQNA 3GT4A 5JXGA 1BFKA 1BE6A 2IXTA 3PTLA 3LPAA 3AFGA 1PFGA 2WUWE 1TM1E 2Z2ZA 3F49S 4LVNA 2WV7A 5AMXA 4ZARA 2W2OA 1GTL1 1LW6E 2DQKA 5AVJA 1SN7A 3LPDA 1KE1A 3P5BA 1SCAA 3QFHA 1AH2A 2WWTA 2Z2XA 5AVKA 3EIFA 1KE2A 1GA6A 3DYBA 5ARCA 3GCXA 3CNQS 1SIOA 4B5LA 2G4VA 2P4EA 1Y33E 3A3NA 1EGQA 1Y3DE 1EA7A 1YJBA 2B6NA 4C3VA 5FFNA 3BX1A 4I0WB 1GT91 1Y3FE 1NLUA 1IAVA 4H6VA 1GTG1 1AU9A 1JEAA 1PEKE 2DUJA 1T1GA 5JXJA 1OYVA 3DE0X 1Y9ZA 1DUIA 1CSEE 1Y4DE 5ARDA 5FAXA 1S02A 2HPZA 2XTJA 2W2QA 2PKCA 3EDYA 2WUVA 3DDZX 1TECE 3DVQX 2W2NA 2W2MA 3SICE 1SUPA 2ID4A 3TI7A 3QMPA 4OMCA 4H6XA 1SUAA 4WOCA 1Y3BE 1SPBS 1P8JA 1TK2A 4YN3A 1WMDA 3GT3A 2PWBA 4DWWA 1BFUA 5B1DA 1SBTA 3DE3X 3TECE 4DZTA 1SUCA 1T1EA 1YJCA 1Y4AE 3I30X 3BPSA 4OV6B 1SCBA 1SCJA 1GNVA 1GA4A 4FONA 1CNMA 1NDQA 3DW1X 1HT3A 4AKTA 3T41A 2X8JA 1Y3CE 4AKSA 1SUEA 1BE8A 1GA1A 1R64A 3AJ8A 1A2QA 4LVOA 1P7VA 4J94A 3LXUX 2Z2YA 1SUDA 1GTJ1 2ST1A 1XF1A 3I2YX 1ZVKA 3D43A 1GNSA 4CG0A 2SECE 5SICE 1AK9A 2Z30A 4BWGA 2ID8A 2PYZA 3I34X 1P7WA 3VV2A 4DJ5X 1PJ8A 2X8JB 1R0RE 1KDVA 2V8BA 1YJAA 1AV7A 3DE1X 2IY9A 3VHQA 3DW3X 3HJRA 1V6CA 3WQBA 2SBTA 1GCIA 3BGOS 2QTWB 4WOBA 5JXIA 3SQOA 5JMOA 2W2PA 1BJRE 5ARBA 3H42B 3L1KA 3DWEX 1SBNE 3ZXXA 2DP4E 4HVLA 3WIUA 2PQ2A 1C9MA 3LPCA 3I37X 2TECE 3WIVA 1SVNA 1ST3A 1SCNE 3DVSX 4MZDA 4CFZA 3D9QX 3F7MA 4KB5A 1VSBA 3QTLA 1SBCA 4NE7A 2HD4A 4M1ZA 2ZRQA 3VV3A 1S01A 1TM3E 4RYDA 4KG7A 3Q5GA 1SBHA 1R6VA 1ST2A 3ZXYA 1WMFA 5AQEA 1Q5PA 1NDUA 3UNXA 5K7SA 1PTKA 3OSZA 1SBIA 1WMEA 1YU6A 5B1EA 1MEEA 2E1PA 3DE5X 1C9JA 1UBNA 4Z2AA 3A3PA 3CO0S 2SICE 4H6WA 3TI9A 2XRMA 1OT5A 1SELA 1Y34E 3AJ9A 3EE6A 4NE9A 3DE7X 2Z56A 1SUBA 2PWAA 5FBZA 4GI3A 1SIBE 4C3UA 3DE6X 1WSDA 3DVRX 1AVTA 1S2NA 2ZWOA 1WVMA 1OYOA 2PMWB 3DE2X 1TO2E 2Z57A 3VSBA 2ZWPA 4NMXB 4K8RB 1C3LA 3VTAA
chains in the Genus database with same CATH superfamily
3QW2A 1JJIA 3IOCA 5CIWA 4Q9JA 3E70C 3LTEA 3ZBUA 3UJBA 1CS0B 2ECKA 5J2TF 1W88A 1O6ZA 5ECYA 3RYHB 1GR0A 5BOSB 3ADBA 2VDMB 4WT7A 1FTYA 3OHPA 3MERA 2P0EA 1TM5E 3CX3A 4HBGA 4NU0A 3J80A 2ARKA 2BFFA 1SH7A 4D3XA 5KYTA 1PV4A 3PNYA 5HGXA 4EQ6B 5LQNA 2HDHA 2ZJZA 2P79A 4WXRA 1ORRA 4IOLA 4JZYA 5KUTA 2QW0X 3MINA 3UAWA 3GAFA 4F96A 4KQHA 4HWGA 2UXDB 1LSOA 4MW1A 4J0JA 3IOEA 4RTOA 1D6SA 2AMJA 2BMWA 3BL6A 4RVUA 4L95C 4HX2A 3UCFA 2RGNC 2ZB8A 2EGUA 2QDKA 3AUSA 2A57A 4ZV4A 4NCAA 2JLCA 3H8WA 4XB6B 2OHXA 4MR7A 4XTCS 1U2DA 1MBZA 4O2AB 3K20A 3ORYA 2H65A 2BZ0A 2Q0XA 3IE0A 3Q7TA 2GMWA 1J8YF 3G85A 4HB0A 4KTVE 4DZZA 2TMDA 3IT0A 4IFIA 3O91A 1N8TA 3OM0A 4W4TA 5KNDD 5JO9A 5KSZA 3VNBA 1JHYA 3PFKA 1S8AA 4GZLA 2M1ZA 4ZOAA 3O2JA 4WY8A 3MCVA 1T8WA 2Q4OA 3D59A 3AI2A 4UBNA 3KAQA 1JBEA 1H93A 3AERA 4O2BF 3U7EB 2FEPA 4HTFB 3MMZA 4LZJA 1H6AA 4RTRA 3U26A 1F8GA 4QYSA 2G67A 3F74A 3CF2A 3H6HA 2Q2QA 4XIYA 1Z06A 5D00A 1GG5A 1T2UA 3JD2A 4UVEA 3GFTA 5JJCA 2W6ZA 2NXEA 3WLOA 1DSSG 1ADGA 2P9BA 3BL8A 3D7LA 4Q0MA 1U9IC 4C4RA 5FI5A 1PFGA 2QTNA 4HP8A 2IEDA 1XZEA 1BG6A 3REQB 3SX0A 1QGYA 1PR9A 5B53A 3LPMA 4PYJA 2EERA 2J9ZB 3GPIA 4A6EA 1X15A 4O08A 5L4NA 1SVUA 2VQFB 3WLHA 2II6A 1X8XA 5AMXA 3QEKA 1CVIA 4YRPA 1JHXA 1J0AA 3HDYA 3NX4A 3RJ5A 1ZLXA 4HWTA 5IASA 5JQGF 4FR5A 1EWRA 1YB4A 4AQ7A 3O3OB 4DLLA 4NXNB 4IJQA 3LK7A 3R1IA 3MJCA 1H2ZA 3OEHA 1E2PA 2OSVA 2GN4A 3BE5A 2PSEA 1AOXA 1G98A 2A8YA 4G37A 1AH2A 2HNAA 2CHVA 3RHTA 2C9OA 4OQXA 5KHOC 2Q49A 3E1GA 4EVSA 4MW7A 4KXVA 2QWXA 4ZANA 2C4KA 1GA6A 3AF6A 4UJ3A 3TZHA 3IPAA 3GDGA 3DQQA 3IOBA 2Q5HA 1XYVA 4QOEA 4QVKA 1KYTA 5EJ4A 3HXQA 5LZ5A 2Q1WA 1BZYA 2GN9A 3GEDA 4B5LA 2X2EA 1UDBA 1N2GA 1FSSA 4KRXA 4DIDA 3HRKA 2J7PD 1H94A 1IJEA 1HKUA 1ZS9A 2IUTA 2M98A 2WF6A 2Q28A 3FCYA 5JSKA 4PR0A 2IVFA 3GP8A 3TKAA 3DGFC 3FIUA 1DZ3A 3W5BA 2RHTA 1LPNA 1RI2A 2FRXA 1V5WA 4ZVMA 5GOZA 3ZWBA 1EUCB 2WM8A 3II6X 4C3VA 3GBVA 3VPFA 4BQQA 5FOUA 4EX7A 1GT91 4X97A 1JAHA 3MCAA 1Q1GA 2WQZA 3IAS1 3V1TC 1IHDA 2ZZKA 1TKCA 2IJGX 3IDAA 1Z4JA 1WUHS 4EL5A 2A7QA 4PO9A 2A3RA 2RHCA 1AN9A 1AU9A 2F3QA 4K5QA 3IELA 4OHWA 4WGFA 3OJ0A 4OGGA 4IY1A 1M75A 1YOVA 3DZCA 3GA5A 2PNJA 2QAIA 3OZAA 3QWAA 3R75A 3K1TA 4TSFA 1SC4A 5BUCA 2B4AA 4ENSA 5IWAB 5IAEA 2LV8A 4QUEA 3AUYA 2EIXA 4CV2A 1S1CA 3H5AA 1E2MA 1UOPA 1DUIA 2H0AA 4Q1BA 1QYDA 1O97D 4UVDA 1DJQA 1NQVA 2BCGY 4WKPA 1XHFA 4KGVA 1GNPA 1P77A 3DAGA 2GBGA 2J6HA 2OECA 2ZJ0A 4WKNA 1LEHA 4QBTA 5E8RA 2VF8A 3JASA 1PZNA 2UUBB 1SXQA 1NW3A 3KXPA 4R2WA 5C1OA 1G2OA 4EB8A 4G0XA 1Z2OX 1EQAA 4BL5A 1PD0A 3R6DA 2BFEB 2SKCA 2GD2A 3C3PA 5JSZA 5DEIA 1ATIA 3EODA 2W2QA 3UBMA 3S2SA 4YMTA 1R6DA 1QYIA 1R9NA 2I34A 4J16C 1GADO 4S2EA 4U7PB 3VKHA 3NJRA 1YZ3A 4LC9A 5D7BA 1VLJA 2CDAA 5HKLA 3T1YB 2DXIA 3EIQA 4R1MA 1FFXB 2R1VA 2FW0A 2XT0A 1TK9A 1L5QA 1T8YA 2P4QA 2Y0DA 3KJFA 4WECA 4H77A 4HRYA 4X7RA 4IIJF 2LCFA 1KQNA 4WCDA 3JYLA 2B20A 3ELUA 1I8TA 3ZHSA 4XD7D 4ETNA 1P1RA 1JHZA 2AN4A 3AOEC 3DYIA 4DV4B 1YULA 3T9EA 1JEYB 2EBUA 4EUEA 1QYVA 4LBZA 6CHYA 4DCJA 5CYPA 1JKMA 3K31A 2ACEA 4WZZA 4DR7B 1F2UA 3N2LA 1PQYA 4U8HA 4HNAA 4KPYA 4NPCA 1RACA 5HQJA 4BEVA 4C07A 2R44A 3OLVA 1PG5A 1EDDA 1QGUA 3SHOA 3R3UA 1QRUA 2F55A 4YC7A 4I19A 4JI4B 3HXOA 3MILA 4KYVA 4TL8A 1C2TA 2G4LA 5A3SA 5A5FA 1JRLA 2JIMA 4JVNA 3D6MA 3DFFA 2M6KA 5JO0A 2CXXA 1XZGA 5F12A 4RA9B 5BMVB 3O1LA 4C4AA 1LZLA 3DEKA 5CT5A 3TRHA 1NWHA 4ZT5A 4YDSA 1JLLB 4R2JA 1GR1A 1ZHFA 2XDQB 2SKEA 3Q85A 3ZTWA 1XT6A 2ZR9A 5FFFA 3ZUPA 1U8AA 4ER3A 5IULC 5JH7F 1D2HA 1T8PA 2YIMA 3ZTYA 3JSAA 5LOVA 4MVJF 4GLOA 3W6UA 1UJBA 3AESA 1RXYA 3RTAA 3U4DA 4AYXA 5IJZA 2JBWA 3KJHA 4BNMA 4AS1A 4PHHA 3SIWA 1Z62A 1KNXA 3NT5A 4M1WA 1FS6A 1E5LA 4L6IA 1MX5A 3A14A 3CHYA 4R2HA 1LNSA 1DQPA 4PIVA 3ZWMA 3C24A 1NOIA 1OFVA 2ZCVA 4E70A 4B6JA 2EW8A 4BX8A 1JX6A 4D9JA 5GJVC 3DC2A 4KQJA 3WB9A 2FEXA 4R5MA 1KF0A 4YCLA 1RS0A 2XCUA 4FOOA 3E3OA 3KTOA 4I5IA 4HMPA 3F97A 4KXXA 4C29A 4ESVA 1Z0IA 4IGEA 4MR8B 3RWOA 3TD9A 1ISRA 2W8BB 1JE0A 3E9ZA 5CAEB 2PH3A 3AUKA 3PI6A 4WE3A 5JCXA 3CR8A 4HN2A 5HRUA 1BU5A 2E4XA 4UM5A 3T54A 4AMBA 1Q44A 2OA0A 3I64A 1FDIA 2IL1A 2AG6A 2Q7DA 4M1MA 2HM7A 3OC6A 1ZISA 3D6JA 5KIAA 1GTMA 1P2GA 2VNSA 2ZSDA 3ZV5A 5A4MS 2AZXA 5F3DA 1Z83A 1I4TD 5FA8A 2I8AA 2CEKA 2ZIXA 4W5JA 4X20A 3SJBA 3T0GA 4KITB 1I9GA 5IG2A 4S1PA 3SVLA 4N8DA 3I5YA 3SOPA 3VU8A 3VX4A 4UDNA 1QE0A 1MF7A 2CLMB 5C7IO 4ASUA 1JQKA 4UCFA 5JCPA 5LJIA 4HPWA 1KC3A 3VI3B 2AOWA 4DBZA 2IHKA 4S05A 5BWLA 3KYBA 4O4JB 1Q1QA 2RBKA 4V2IA 2M6LA 3AINA 1ZBQA 1CHDA 3VNSA 4KE6A 4MVJE 4UPDA 4EW1A 1POXA 4GL4A 4ZYVA 1VBFA 4ALLA 1DBWA 1DWUA 1CDOA 2CDCA 1E2EA 1QIFA 3Q9UA 2BFWA 1ADBA 3KJEA 4POAA 3A4YA 2FAXA 2P27A 4JUFA 4C2UA 4IH1A 2WTAA 3GFSA 1FVFA 3NATA 1FQJA 4BE9A 2QX8A 1K88A 2AFHB 3B5IA 1MAUA 4MS4B 2QUKA 1USVA 1KOJA 4MKIA 3FGOA 5AJZA 3IPXA 6REQB 1LC0A 2R6GA 3D3WB 2NAFA 2ZI6A 4IH9A 6ABPA 1JEJA 1OXKB 2YWDA 3WFIA 5LIPA 4AAYA 3OMWA 3OKPA 2J3QA 1YBFA 3L79A 5A7HA 1KI4A 1AY0A 2OVBA 4IQ4A 5GZ6A 1GXSB 3O93A 3V4VB 1NBOA 2JJ8A 3OZDA 1L7AA 2DKFA 5DMHA 3KYDA 2IEGA 1GL7A 4HY3A 3TIXB 5AVZA 2WKPA 5LFAA 1KVRA 3NWBA 1G6Q1 1PK9A 3W2TA 3BTVA 2H57A 2AIRA 2HKIA 4LHEA 4MICA 4AUKA 2QPAA 3FM9A 2B5VA 4UU1A 1JMYA 3LDGA 3HJRA 3QNWA 5GP1A 1KJQA 2WTBA 3A2MA 3J81k 2J0EA 2MSLA 4H1VA 4MWTA 1WLSA 2WM2A 3R77A 4UU7A 4BAZA 4C1BA 3CLKA 4H4DA 4S1NA 4L5YA 4X6YA 3DFIA 4UULA 4Q34A 1TLFA 2PUJA 1KJWA 4JLJA 5B1YA 4MS3B 3WB1A 3U44B 1DJLA 1LSSA 4IZIA 1RWXA 1PL8A 3D4NA 5ARBA 1YVPA 2FZLA 1SVIA 5H59A 3A0RB 4EGJA 1B23P 1JPJA 2YZGA 4ZVPA 4KFCA 5CNKA 4LNUB 2I7DA 3AT1A 3I53A 1C9MA 1X1EA 1PLJA 1JR4A 1IEQA 1NJGA 1U5BA 2BPOA 2G08A 4JVOA 4WESB 1ST3A 4M22A 4XUEA 4OI1A 5CVTA 1MW8X 3TKYA 1OXSC 2A9QA 4PLFA 1ZEJA 3KNZA 4HQLA 4A2CA 4EJSA 1Q14A 3K0CA 4JI0B 1R3DA 5AWFC 3Q1KA 1GRCA 4N6OA 4YO8A 3M6IA 3S44A 1QHEA 1NW4A 4JB0A 5A6SA 1KFJB 8ATCA 1W73A 2IFTA 4OEHA 3IKLA 2O9JA 4JC8A 3NWOA 2GEVA 5EKUA 4X00A 5FWDA 3VOSA 3ZE2B 4BUZA 4HQOA 4LJSA 3PQ5A 3QSGA 2V7XA 4L0QA 3ZI0A 3ZWPA 1UBJS 5JW6A 1XZNA 4FYXA 2VJQA 1R0KA 2FNAA 5LZ7A 3VC1A 2NZWA 3UB2A 1KTVA 3UK6A 1GG9A 3UOGA 1G0OA 3DKVA 1U02A 4QHYA 2WJZB 4JHLA 5E0KB 2AG0A 1Z5PA 1ZC3A 2GOYA 2HB6A 2DJ5A 3MS2A 3U7RA 4BB0A 2IUSA 4L3WA 4MV0A 3O95A 2O7QA 4MKFA 3QIVA 3RW9A 3PQ3A 1S3SA 2V7EA 2ZI7A 3KBBA 3ZV3A 4F2WA 4F4IA 5KNBA 3B8HA 1JXOA 3GJ0A 4CT4B 2VQSA 3RKUA 2X7HA 3UKJA 1CZHA 5DCYA 4XIGS 3AHEA 4RVCA 1W96A 2I7VA 4KYTA 1FB5A 3GHHA 4QBHA 4L8LA 2HAEA 3G5LA 4E46A 3U7QB 1E5QA 5I7RA 5KJFA 4DOMA 1MEEA 2BAGA 4LCBA 4XD2A 4XGQA 4DIOA 2B8JA 2HSWA 3DBHB 2Q5QA 3W5DA 5JCJD 4MAFA 4ID3A 4LIPD 2PQ6A 2G9ZA 3L4KA 4Z51A 2B7CA 3EGCA 4L5CA 1H66A 5MN6A 2XRMA 3NDJA 1KAGA 1SELA 4M89A 3E35A 4P32A 4UNSA 4EG6A 2H8GA 2UKDA 3WFJA 4MUXA 3ZNQA 2I2XB 3ROKA 1WRBA 4C20A 3HFRA 4ZHQA 3A1VA 3HC7A 4K3UA 4YV2A 3PHGA 1APBA 2PWAA 1M2VB 3FDJA 3CW2A 4GPD1 1QCZA 2CGEA 2G1UA 3GEBA 4PYRA 5J5AA 3TINA 4C4YA 2ZJ4A 4HOYA 3FHOA 4Q4HB 1WOMA 4L75A 4W9NA 4C6TA 5DNUA 3KQHA 5JWRA 1GSHA 3RJZA 1WSDA 3KUXA 4Y1RB 4C2TA 3NTRA 3A9UA 3JS5A 3QOFA 1S2IA 1OQAA 3O92A 4B84A 4GD3Q 4KNWA 3VR6H 2CFIA 2VTEA 4UE3S 3RTGA 4AG6A 1OYOA 2KLBA 1KKLA 3ZWYA 3U37A 3HACA 4XDGA 1PWEA 1CY8A 1QYWA 1NMXA 2YZNA 3PWSA 5AW9A 5EUQB 3LX8A 4MQEB 4WTOA 5ALPA 4ML3A 5HM8A 1Z34A 3BGDA 5AIAA 1O54A 2XMPA 5CLHA 3KQVA 5D3QA 2Z8ZA 2YJGA 4M9RA 4YXFA 2HF2A 5EIAA 5A6VA 4JC4A 4V0KA 4KU4A 1H4QA 4WNCA 1I4OA 3Q6IA 2IXDA 3CRZA 2V98A 4LPKA 5HBGA 3RC8A 3EXG1 2I91A 4EG8A 8MHTA 1T0PA 1NT4A 1VJGA 1Y1LA 3TNYA 4GHWA 4WN9A 4BEBA 3AXSA 3D2BA 5E7IA 1PJBA 3REOA 2GLUA 2OZEA 4OF4A 5K9ZA 1M5TA 3KVOA 2F6RA 3WLAA 3M1AA 1J8VA 4G65A 3UMGA 3H87A 4JAVC 1WXEA 1YZQA 2PRIA 1WAMA 2X9VA 1NYRA 1GY8A 2JD0A 3AEZA 3L8ZA 1V8ZA 4M60A 4PZZA 3ZBTA 4BE4A 3DHYA 4LISA 5F1OA 2CLDX 4KX3A 3SGLA 4L57A 3B85A 3TDNA 5KTSA 4D3SA 3HCRA 3K94A 2WEKA 4K81B 1G63A 3S3TA 1ZD3A 2VR1A 3AR5A 5BV0A 2BN4A 4NCNA 4P5DA 1TJ5A 4LYDA 3NBUA 3OFNA 3PYXA 3MQ2A 3K8YA 3OZGA 3PC2A 2VJMA 4MWZA 2FWNA 5CNJA 5J2UB 3GYGA 4C4SA 2E9SA 2F43A 5DGIA 4IICA 2QW8A 3DTNA 1UK7A 1Z7EA 2ZE7A 4QTUB 3VYSB 4R3NA 4A8JB 4BJ5A 3TNJA 1QQ5A 1Q17A 2OFXA 2POQX 1PKEA 4L4YA 4D9IA 5BY2A 5EJ7A 1SIUA 4TXLA 3K0AB 5F1PA 5H80A 4D56A 3FI9A 4QHSA 3NHBA 1O4VA 2B4TO 2BEUB 3DV0B 3AVVA 3SJCA 1U2PA 2C7BA 2JW5A 2JF0A 1NN0A 5BQ3A 3R5SA 1W6UA 1Z2AA 2XAAA 3BWEA 2BRUC 3E7XA 3UHPA 2D5IA 4UE2A 3WGOA 1KGDA 4XARA 1U1EA 3UFBA 4CETA 2SNIE 2BD0A 2XR1A 3AIIA 3WL8A 5EUMA 3WTCA 3WQHA 1NG1A 1J70A 4DCUA 5KTPA 1ISHA 1PX2A 4OMDA 5A4JA 4DA4A 2NO6A 2JGDB 4X1YA 5BV2P 1D8AA 1VOTA 3ZD6A 4MEJA 2NSYA 3LHFA 2AYXA 2R1TB 5IM4A 4UKDA 1BE6A 4X7MA 2Q6TA 4BVLA 4A5OA 5KNCH 3ZXSA 1AQYA 1FX1A 4N0DA 2GWHA 2ZI9A 3LPAA 3JY6A 1SBYA 4JENA 4LHZA 4LK3A 2O23A 1KWKA 1IH8A 3BIFA 2DH6A 2YQZA 3HY3A 4RSRA 4ZO4A 3KHSA 1K8ZB 1YTUA 4FMDB 3T8YA 4NV0A 4K0RA 2WV7A 4HH3C 4V0RA 3NORA 3VKWA 1M10A 3KOOA 1V1JA 1JAZA 1RKVA 5BSEA 1J90A 3PI7A 4J2HA 5DHRA 3SC4A 3SU8A 1P73A 3QFTA 1YZFA 2J85A 3SF8A 3SEZA 1IXRC 1LW6E 3L6DA 3S68A 3SZUA 2QL9A 4GQBA 2A5DA 4WI1A 4I6JA 4ZZ2A 2XUQA 4Z9BA 3GZNB 3SFVA 5IXYA 3USCS 4DYVA 1Q0HA 2B9VA 3WK6A 3S70A 2ENWA 3B9PA 3PXDA 3FYUB 3MMPA 1VA4A 1YJQA 3HPQA 4PE5B 2ZJ8A 3F3MA 3V8EA 2N0SA 5K3SA 5FI0B 3ZGVA 3SHVA 3URMA 4ZO9A 1IK6A 3IRVA 2LE0A 4C43A 5KNBD 3AEQA 2O06A 4QC2A 1O3YA 1PW5A 4MINA 3IIIA 5DNWA 1GITA 1VXRA 1YC5A 1RFLA 1VRWA 2BT4A 2WWRA 4IO1A 4RNDB 5JCOA 2QMQA 3L4BC 3A4IA 5JNRA 4K9LA 1VGVA 2GHRA 3RUPA 1XB2A 5K8IA 3PUJA 3HXLA 1WXWA 4JB2A 1PQWA 3JQEA 5F51A 2XNJA 2ONJA 4Q82A 3TJRA 3PIIA 3IT1A 4JQSA 2ZP1A 3ZHZA 2ONYA 5AESA 1NYTA 1BO6A 2QTCA 2H1WA 2PT9A 4KW7A 4QTYA 3H7AA 4M3NA 3GFVA 3H2HA 2QSUA 4PYLA 3L6OO 4GKVA 1WMBA 1XCGB 2DR0A 3JYOA 4FKBA 4YREA 4YMWA 3TCNA 4CQNA 2QTHA 3AL3A 1CCWA 3L49A 4JELA 4HNUA 1OAOA 4U2EA 1J0DA 3DEIA 4E2WA 2OBBA 3R0QA 7REQB 5JY1A 1JDSA 1T1GA 4TRRA 1PJ4A 4QO7A 5CA0A 1G60A 2JGMA 5TQ0A 5C8YB 3KDPA 1GFWA 3HP7A 2I87A 4EELA 2C5BA 3LL7A 2MYUA 4IX9A 2FN7A 4XLTA 1EFPB 1FSZA 1C3VA 2VHCA 5TQVA 2CBGA 2YVKA 3LWZA 5JAQA 2ZRLA 5FNZA 2ZU6A 5GV8A 2AL7A 2YHAA 1HOXA 1XRMA 2ZUFA 3ADKA 2I0FA 2YH2A 3N0VA 5C5DA 2AJBA 1IMJA 4FK8A 1Q0ZA 5TMDA 4JJ6A 1Z75A 4JWKA 2R68A 1E7YA 1U3CA 2BGNA 4R8MA 1LU9A 4W6ZA 1Z17A 1U4NA 4JKOA 4AJLA 1ML4A 2GM4A 1PD1A 5K4AA 2XYPA 3EIEA 4RWEA 1V0JA 2GEKA 4EGFA 1JP7A 2XXAA 1SJ9A 4UU0A 1TYCA 1RKQA 4HXGA 2XZDA 3AVUA 1JG2A 2ZB4A 1GG2A 4DDHA 2I6UA 1HQCA 2MT9A 1QYCA 1B0ZA 4H18A 2QYTA 1K1EA 3CISA 3G8AA 3OFKA 4OQFA 2C96A 2ZBVA 4TYMA 3L7CA 4AS3A 1A27A 3QBVA 4XIFA 1U0TA 1EE1A 4HDKA 3P0EA 3WRXC 3NETA 2OAGA 3LG2A 4EY3A 2WDZA 2PEZA 1UANA 3ACBA 2WOJA 3PICA 4LOKA 1MQAA 1JQDA 3HKDA 5KC9A 3NNNA 2ZRJA 2I3DA 4IV0A 1A04A 4LJ8A 1S9DA 3QPBA 4R9NA 4G2TA 1ZGZA 4HJRA 3HTXA 3BAFA 4E21A 1EDEA 2H1LA 1YXMA 2HRDA 3DZDA 2E49A 5B6PA 2PIDA 1G3IA 4OGWA 3WIDA 1Y80A 3GROA 4MW5A 4A3SA 3JQAA 1DOAA 3OUTA 4GM1A 5PGMA 4JOBA 4M0DA 3R7FA 4YUXA 5HF9A 4RPLA 5ESXA 1MIOB 1MEJA 1PNQA 1UZMA 1V8PA 1CR2A 2H4FA 2GCIA 2ZSAA 1SG0A 3EXHB 2NVUA 3LU1A 4UBOA 4XGIA 4EGAA 3TECE 3I6ZA 4KLRA 3U3JA 2XCQA 4BV3A 1V8BA 4YJKA 1F48A 1LB1B 2QVLA 2V7PA 4TZ6A 3DBIA 3COWA 1JR3E 3FIJA 4FHZA 4QE3A 3V8NA 2Y6VA 3HLTA 2WHQA 3K8ZA 2OD2A 5DRTA 4B34A 4NPAA 3ZW7A 2Z83A 4FU0A 4OKIA 3DOEA 1L2TA 1A5SB 2D2VA 4UUBA 5K3DA 2XUJA 4MDEA 3ZQ4A 1L1QA 2JGFA 2RHMA 3BMQB 3FNRA 3L1HA 4TGLA 3BTSA 5DOZA 2L17A 5FO0A 3WAKA 1HYQA 1EUDA 3GBPA 3L4EA 1UZNA 2F1JA 2G06A 4XDHA 3UG6A 3ZY6A 5IJ0A 3L8FA 4MW6A 1QHSA 4YYEA 5KOYA 1K8YB 3AEUB 5CTAA 1ND5A 2BTOA 2GFQA 5JBIA 4P3XA 2O5VA 2ZT5A 4UCQA 3DW1X 3I76A 2OKGA 4DC0A 1KAHA 1Y7PA 1ZIYA 2OGSA 1HH4A 5EXSA 4HAXA 4YT8A 1Z39A 1RRKA 1OIVA 1XVUA 1ZM7A 5JRJA 1M0EA 3TTUA 3KHTA 2UV8A 3B89A 3I9V6 3V4FA 3OOEA 1B3RA 1E5VA 2AR0A 2V96A 3IXQA 4D8YA 4Q7JB 3H5TA 4FIZA 2IF2A 4QRDA 1HC7A 2G28A 3IAUA 1WD7A 2FW9A 5EZSA 5CLFA 1FYWA 2F1IA 4V39A 4O8ZA 4G41A 3PWTA 4O0LA 4CM7A 4MRNA 1VZ2A 1QV9A 3TZ6A 3CX7A 3IP5A 3PX3A 3TEMA 1MXHA 3HJBA 4KH1A 4AO7A 4C0QC 3GLFA 1LDMA 5F73A 1WXDA 2QRHA 4ANFA 3K1YA 4AJ2A 2Z5VA 3UUWA 2HOQA 3EAGA 3K0EA 1GUZA 3QU7A 3FCAA 4L8YA 1GTJ1 5MN5A 3OT5A 1PE0A 2ST1A 2X8WA 2JGAA 4JLDA 5BVGB 4BPRA 4XEUA 2FGKA 3DMHA 1GKIA 1XALA 2Q4BA 4S0XA 1QVVA 1UQUA 1SBQA 1XVLA 4B83A 4W5RA 2V1UA 1K5HA 1F17A 1T0JB 2PXAA 2XVAA 4KRYA 2VYNA 1RWMA 1GPMA 3IURA 4FWBA 3WZ2A 4D81A 2ZK7A 3R3WA 3I8SA 2QQ5A 2H4ZA 2XB4A 3KYIB 4P1ZA 3KHKA 3HJNA 3VO9A 3RVJA 4A2WA 3P94A 3EAFA 4CCYA 2JAPA 2FVXA 4CTMA 4QELA 5KVCA 2E4UA 1IB6A 3AKZA 4UEKA 1F6BA 4ENUA 4RD6A 4MKRA 1M5UA 3VV2A 2VJKA 3GEEA 4ER6A 2DKOA 2IPXA 1L9KA 1ZCFA 1PJ8A 2XUGA 1LX7A 2GHQA 1NQAO 3Q8XB 4DLNA 4JLNA 4B8ZA 2V9PA 3REGA 3TMAA 1V9SA 4HG2A 4K46A 4ALIA 4OFZA 2W58A 3IEPA 4PBSA 4P2BA 3FHLA 3LE8A 2EIHA 5JNSA 3W78A 2MR5A 1RIIA 1UBSB 1YRBA 4GOKA 1F5NA 3LX6A 4FYYA 3P9XA 4YAEA 1DDOA 1NOKA 3DBLB 4JJZA 4L27A 4UUNA 5G2OA 2IXGA 5IAJA 2WU4A 2YFQA 3ACCA 4P22A 1EM6A 3TW8B 4B3TB 4RVNA 7MDHA 4I3FA 3Q9LA 4WVLA 4AX8A 5CEJA 1GCIA 3HU1A 4H7DA 1DLJA 4DQUA 2EFCB 3KSDO 3F7TA 5IYZA 2V3VA 2ZDGA 2ANBA 3T06B 4O4HF 1NC3A 4YVFA 1JDUA 1L6IA 5KREA 2O1WA 4ZCPA 1RRCA 5BNFA 2PWPA 2VQEB 1UC4B 5FJJA 4BNUA 3WGUA 2O8BA 4BVHA 2XMCA 4RADA 3WE7A 4I66A 1ODFA 1GN9A 3NUGA 4RIEA 2WABA 3VH2A 2P8JA 4BXOB 2O2SA 1KL7A 3LUKA 3R5JA 4P3PA 4QDTA 3W9YA 3OQIA 4R8SA 4W9RA 3JQBC 5JROA 3U4QA 4Y2SA 4EJFA 4D1YA 1T35A 4MRAA 5AVXA 1YDWA 2MYNA 2XE7A 3HY4A 3NWEA 4IKEA 2B21A 4MYDA 5KNCA 1K7YA 3FOWA 1VIVA 3RJMA 1EM8A 4P3OA 3V1LA 4NCHA 5LMZA 1YDFA 2R47A 4P92A 1OHHA 2G36A 3VHXA 3N5CA 1SBCA 2WMNB 3E81A 3H4IA 3I8XA 3O2SB 3OQBA 2ZSEA 3SXJA 4E2YA 2YX1A 1NW6A 1JIQA 1ZGCA 3HDGA 1CUEA 3BFJA 3OM1A 1VTKA 4R54A 4BE7B 1L3CA 4H60A 5A4KA 2OUIA 3HWRA 4YJGB 1V8FA 4Q4AB 2E4VA 1T36B 2CMGA 2J6IA 2WVHA 3BK7A 5E9QA 3PVCA 3IC5A 1XZ8A 5LBTA 5KWIA 1KEPA 3TGLA 4B7XA 3JVEA 1DAIA 4QFDA 5AQEA 1AKTA 4MUJA 2RGAA 4GI5A 3AEKB 4LJAA 1CZKA 5AUOB 3EZYA 4DV2B 3H11A 5DK4A 5E7QA 4EY4A 3ROTA 3HBNA 3FTQA 4RAOA 3RT7A 2HF7A 3TBKA 4ITVA 4B7ZA 3MSXA 4DTCA 2O54A 1LPBB 3C3XA 1NRIA 1PT7A 2NM0A 2W6NA 3CKYA 4KAXA 4YACA 5LP6F 4BYGA 1NURA 4LFCB 4A03A 1V5GA 1Z0ZA 5G0TA 3TXAA 3A6JA 3PNKA 1ARZA 3I9LA 4TTJA 5C46F 3PHHA 4A91A 4BECA 2PBZA 3CRW1 4HNVA 4KUEA 3MZ0A 3ZGLA 4YH1A 4BGVA 3SSAA 4R1TA 4Y67A 2RGEA 4UTRA 3U49A 4U7JA 1I3KA 3ZHBA 4KNYA 1PR2A 3SLGA 3V4RA 3F96A 4MYRA 1YQXA 2ATEA 4I8XA 5ERYA 2ZRMA 4ND7A 5FEMA 5JNWA 3FYDA 3HYCA 3KIPA 3PDUA 4IX1A 2RCYA 3HNRA 4LYJA 2IIBA 2BKAA 4NS1A 5EHGA 3EE6A 3EVFA 3V9PA 4DHEA 3NEYA 2DULA 1T9GS 4GYYA 3NM5A 4Q7LA 3B3JA 2PY6A 4TLLB 5GMOA 2MINB 3ZR4B 1W36D 2A67A 1R6BX 3NONA 3ZJ4A 1AHIA 1EFHA 1H6BA 1IDN1 3P0JA 3ANYB 3FNBA 2OV2A 4FCCA 1Z7GA 4LG1A 4OP1A 4WBNF 1QGAA 2OFFA 1G59A 4MEAA 1GL6A 1M34E 4HAYA 3LQKA 1ZJJA 2FUKA 5D5PA 2O8FA 2VZ9A 2PZEA 1IMOA 2VJAA 3D7MA 1Z07A 2VAWA 2QLJA 1XZAA 1YI8A 2XUHA 2ZSUA 3BORA 3HU5A 4YP5A 3RB8A 3SQMA 1UH5A 5I48A 5AK3A 3WS7A 1Z25A 3LC2O 3F7NA 4DC9A 1PTJA 1X92A 1GQSA 5IT5A 4LGVA 3DWIA 3ZC3A 4BATA 3W4KA 2PUDA 5ALJA 3S27A 1QYRA 4MK4A 3ZV6A 4ZEVA 1M1YE 5TT1A 5AM2A 4J0DA 2N1BA 3TLZA 4BP9A 4DKJA 2P2GA 2YJTD 3A6GA 2Q0SA 3F9RA 1RYBA 2OL4A 3N75A 3ENZA 5EQTA 4ZVOA 2I6XA 4BO6A 1QTNA 1U9CA 3WY9A 4PAWA 2VYND 3PVZA 1JTVA 2ETVA 1TAQA 2JFZA 3QJ5A 3GQBB 4YRDA 5HF6A 3KELA 3QMVA 3SC2A 4WLEA 4YRRA 1ZXLA 2J33A 1US8A 4UFOA 5F78A 1V3TA 3D4BA 2DTXA 1C1YA 1KZ6A 1NIJA 1E89A 2QK4A 4PEVA 3R76A 3I61A 5K6RA 2XMGA 1OWOA 5KWVA 2ZEJA 1CQJA 1T6BY 1XVVA 3UMFA 1WWKA 1QK5A 2QZ9A 5CNMA 3SFZA 1OSNA 2BFOA 1GN8A 2ZSIA 1P2DA 1M2WA 4HQ6A 3DFUA 4TL9A 2IDJA 4XB2A 3PF9A 1AF4A 2A9JA 3TIIA 3VNAA 4ZOQI 3FBWA 1C7RA 4Q4LA 2O3SA 2C5FA 3OPVA 4MIKA 1L7EA 4P35A 4V24A 1LPAB 3LYUA 5TQ2A 4CI0B 5FA6A 4UQPA 4AO6A 1DDIA 5I4CA 5I3ZA 1GOTA 2DCMA 2HUPA 5I8ZA 3NT4A 3NHJA 4ZQFA 2HF9A 3EGEA 1BXGB 4GGOA 2Y1XA 2GPYA 3IJEB 2RKBA 4BZQA 2H63A 3A37A 3G9QA 4J1TA 2EEZA 3KETA 1IOWA 2KQUA 2YS6A 2R1UA 2RKWA 4EOGA 4G24A 4OH1A 3D5EA 2PRZA 1PLLA 3H5NA 3QLJA 5DLQC 4EY6A 3PGKA 5EZQA 4DC1A 3VDNB 2WIGA 3K30A 3F7OA 2YY7A 1KDZA 5KYYA 3DHEA 4QNMA 1NBMA 1QHHB 1KI9A 4CFYA 2JLVA 2C4WA 4EYOA 3OP4A 1TZ2A 1RRMA 1WUTA 2OLEA 5DBEX 1JA0A 1XC7A 3WNCA 4HHEA 1DQYA 1PF7E 2JEZA 3RABA 3IILA 4IVQA 2I6GA 1UZLA 2ZB7A 3HVIA 5JDIC 2VZLA 3ER8A 1P7PA 1JEOA 1PJRA 1ULZA 2X7XA 2FZ4A 2XJ4A 2ZJ6A 3HCPA 3I04M 4RU1A 3U3RA 3ZI4A 1PL6A 1BX1A 3CUYA 4G0OA 1W59A 1KP9A 4LDNA 3N86A 2XMRA 2PX3A 5AIBA 1HDZA 1X7YA 2F9LA 2X0IA 5KNCD 5CM8B 2WSLA 3PGA1 1P0QA 2V58A 4TXNA 3UT0A 2R4UA 4L2IA 4MGZR 3KKQA 4CKBB 3BQNB 5KWSA 4LV5B 3RSGA 4P82A 1NI3A 1PQPA 4R40A 3FVQA 1OHHD 1RLOA 2RONA 3G2KA 4RIHA 5CVEA 3NXSA 4FR2A 2YV4A 2ZYTX 2QLTA 4NS4A 3SLKA 3M2PA 3DDSA 1OXVA 3C3AA 1R0YA 3NASA 1EFRA 4MV4A 3R7WA 4RZQA 4X84A 2ES4A 1AZWA 2CC2A 2BMEA 4YAFA 3AJDA 1Y8RA 4EKIA 2KI5A 4O4IA 3TFQA 2O2GA 2EQBA 1U3WA 4P7BA 3NGLA 5FNVA 4Z4FA 3MB5A 3OT1B 1Q1NA 3LPDA 3ODGA 1RM0A 1SAYA 5CB4F 3OOWA 4H7HA 2Q8PA 4PLWA 2H2GA 2I6SA 4IV8A 3KKLA 1A9RA 3R3ZA 4YCBA 2PX4A 5U1PA 5F3WB 1R4NA 2O0JA 3OJFA 4MRSA 5C51B 3L8EA 4I50A 1EVJA 1GT6A 2X2PA 3O2QB 5ADWA 2B0JA 4MLCA 2H0QA 2PLNA 2HXGA 2X0RA 4N40A 4IL5A 3LQYA 1RCTE 1TVKB 3PDCA 3TE7A 2C84A 3VJKA 5BT8A 1EXVA 3SY8A 5A7GA 2CFRA 2GS9A 3PKJA 1AUXA 1D0SA 1VMKA 2VYVA 3EXEB 4CLOA 3V3TA 1XEFA 3FTPA 2ZJAA 3IBYA 2V5UA 4HQNA 5IN5A 2I4OA 3GFGA 3U80A 3C6BA 1N57A 3KSZO 3ZD8A 4UNQA 5C7OO 5I7HA 3VYUB 3GVPA 2NNLD 2RHDA 3NYWA 1Y1TA 3EZ6A 2WM9B 1VHJA 3HDTA 1WHTB 3TS1A 3ZV7A 4UOZA 1P5RA 3QENA 5FRDA 4M54A 2HPVA 2WU1A 2F4NA 3P7MA 4NEGA 2YJ5A 1W1UA 3LT1A 4QD3A 4UM9D 4E11A 1IE3A 2AMFA 3PDIA 4NJMA 4B6RA 4CKEA 3H9UA 1WCYA 2NU9A 1EXNA 4H6VA 3MTGA 5BSRA 4L3VA 5DYGA 1G5IA 1SCIA 2P11A 1NWCA 1H2HA 5BV1A 1YUBA 1PEYA 1FF9A 1X1TA 4I9HA 2H7YA 4BLUA 1B26A 1NNSA 3I3SR 5CFNA 2C2YA 2YWXA 3MQ4A 3O21A 5CBPA 1KNQA 3TLYA 4D0LB 5EJ6A 1XX6A 2DPYA 1TLTA 3RSQA 3OKAA 5J3JA 4Q4JA 2C78A 4OB7A 1KO1A 3B13B 4YJHB 1CUJA 3PPIA 3KFVA 3DLTA 4NC9A 1OGIA 3KU1A 1ZIPA 2RAPA 3BD8A 3I23A 4MQLA 4WY2A 5LLSA 2H2DA 1B76A 1S9HA 4C7XA 4EFDA 1MZPA 4Z7JA 1ZN9A 2WW8A 3L0BA 4X95A 1B1CA 2AC4A 1MO2A 2JCSA 2P2LA 3A9SA 5AM0A 1G0NA 3PRJA 2NPIA 5E6UB 5EQDA 2RI6A 5IVKA 2J0UB 2QKYA 2EKDA 2R6JA 2BTQB 2WJIA 3C48A 4I4NA 3GJ7A 3IIKA 4WNAA 1YWGO 1ZO8A 4GOOD 3E5MA 3MVEA 4NIMA 5K8LA 3FNGA 5CEFA 4GX0A 2H4WA 4NYJQ 1UZAA 1AKVA 1WCIA 4MHTA 4Y3UA 3WGZA 3OF2A 4BY9E 1I4LD 3KPWA 3VZBA 5F3RA 4UOQA 5K3FB 1J8QA 1RBZA 2JA2A 2P5UA 3BFXA 4KBGA 5T41A 1PBNA 1T2AA 2AI3A 3R09A 1CR0A 3VAZA 1OVMA 1C9EA 1BQEA 4G01B 4YIKA 4PM4A 3A31A 4H6XA 1HOTA 4EG7A 2GN8A 3UMCA 1N0IA 3C4VA 1CEYA 1A3CA 3MG9A 1IN5A 5BN3A 2B83A 3PQCA 1RBYA 4GLLA 3KEFA 1LX6A 1SRQA 2DSTA 4HQFA 4LX0A 1JQAA 4I4CA 4KP7A 1N0UA 3WJ7A 5L7TA 3ZDAA 1XN1A 4L7VA 1M83A 1Z6AA 5FWXA 2BL4A 2ISCA 3T7TA 5BO5A 2HCFA 2HJWA 3HXPA 2CD7A 4FDMA 4MVJG 5F2KA 3EC7A 2O8DA 1YGPA 5J4LA 3FPBA 2ZRIA 2VUUA 1Z6XA 3EVBA 2R7AA 1MH9A 1XZDA 1ZRSA 5DISB 3K9FC 3MUNA 5AM4A 1E79A 4X1IB 2NUPA 3VTZA 2FN8A 3AZPA 1QMPA 2O8NA 2ZIZA 4KXWA 4ZFNA 2XBMA 3NVAA 1Q0UA 1KEUA 1FLDA 3OX1A 4R8RA 4YB8A 3ZE8A 3PHIA 3ZWAA 2CLEB 2ODNA 1PJLA 1G21E 3I62A 2C97A 3M4YA 3P2JA 3D6FA 1RZRA 3FPGA 4QOHA 2F1RA 1D7AA 4DSOA 2IW1A 1IHOA 4B8WA 4J0HA 4RHUA 3TZKA 4ZEOA 2WA2A 2OXFA 2VHWA 3OU6A 5A9TA 2IV3A 1LA2A 2W43A 1L5LA 3ZZUA 2OM6A 2C07A 3FYCA 2P91A 4PSVA 4AL4A 4UHHA 1IHUA 3PWKA 3QY0A 1YAHA 2HEIA 3C8ZA 4ID9A 2O7SA 4ILKA 1G20A 1F2TB 1ZY2A 3BE8A 4D9BA 3L4SO 4ZYLA 2I6FA 3VI4B 3PUXA 4PY2A 3WBFA 1E9SA 1OX4A 1SC9A 1U9ZA 4OFXA 3CLVA 3HHPA 4OOEA 4J90A 3G0BA 4ZQIA 3MK31 2XRFA 2QAGC 2X4LA 3NAGA 5T8KA 1NXOA 5EP2A 5CDTA 1PSZA 1Y4UA 2JGLA 3NYQA 1IIBA 3DLIA 4BMZA 3C6QA 2ZAOA 2C4UA 5EN4A 3FDZB 3AH8A 3MCUA 4OYLA 1N8KA 4BVGA 4NARA 1V3UA 2QTAA 3RODA 3UKDA 2AG1A 5FLXA 1JQLB 4YI5A 1PIWA 3GGPA 3VU0A 3E2IA 1O95A 4UTNA 1NVAA 1CHNA 2XMZA 4HPJB 1U8EA 4IIUA 3G6WA 4NYJR 1QH9A 4KVGA 3KR0A 1WB5A 1ODKA 3JAKB 4N5IX 2P8SA 2QTVA 3EVDA 4KZPA 1FLNA 4JJ8A 3S2GA 1FP2A 5CA1B 5CIYA 3OCYA 1T10A 2E18A 4TSKA 1SUDA 4KIWA 1PP4A 1T2FA 1NF2A 1NTOA 2WF7A 1PCXA 5DCLA 3UPUA 2O05A 2WFLA 2ZBDA 1OBFO 1NX9A 1ZX1A 3HB0A 4JLKA 3MT8A 1P1KA 1OAKA 1Y5MA 2I2BA 4IV5A 1DE0A 5L3ZA 3QBEA 3ETLA 3D43A 1V11B 4QUAA 3VMFA 4W7IA 1OBVA 2AE1A 1P5ZB 2VVTA 2WF5A 4XQ9A 5IKMA 5GM2A 2OCYC 2AR7A 4HD8A 4CG0A 3UJCA 3QGMA 3AFMA 5G4LA 1K3TA 5TXGA 4DJEC 1E9CA 3PGMA 2PUAA 4R9SA 1U6KA 2OZPA 3G9TA 1U5CA 1AA6A 2Z43A 3FPLA 4U2GA 3VKVA 1FQKA 2PYZA 2BEVA 4JK3A 5D84A 3RADC 4M8NE 5CJPA 1CKEA 3B3QA 1SD2A 3BGVA 1UBOS 1BHQ1 2FSGA 4TRNA 1GPYA 1M2KA 4CL3A 1SGWA 2EW2A 2BFNA 2CZCA 3RVPA 2QNBA 1KYYA 5TQJA 4AMUA 4B31A 2XB9A 1BCRA 5KYVA 3EVTA 1KSGA 1U0FA 3I92A 4HUJA 4C7OB 4XPIA 3CKKA 4FZVA 4ZREA 4Q3LA 5A04A 1DO2A 1M7BA 1L6RA 1W4BA 2BI7A 3H4MA 3LFHA 1V4NA 3GF4A 4BVFA 3UQYS 3NVMB 2Y67A 3HWX1 3VPDA 4B9AA 4HYYA 2FFHA 4MZXA 1YZVA 4D4JA 1PQUA 3BIXA 3Q2OA 1P80A 5TVKA 3HO8A 4LFAB 3BKXA 3THOA 2W2KA 3W5VA 3MBIA 1G18A 2Z5GA 5AJVB 1YVRA 1HT2E 2JLWA 2WYOA 2GXAA 2YV3A 1SEPA 1H22A 4Q47A 3ZE6A 1U8FO 3HE3A 4HDNA 1ECCA 2X0KA 5CFZA 2WSBA 4M8IA 1GAXA 4KGZA 3EXG2 5LXTA 4Y9DA 1W52X 3P9KA 4EHLA 3L4JA 1QGOA 1EE2A 1MLDA 1WB6A 4NFLA 5L6LB 3HJFA 4PZEA 3C3DA 1VJRA 4HEA1 4J6FA 1UP4A 1XZCA 4KXFB 1NSTA 4MO9A 2TECE 5KKCA 1A0OA 1ACJA 1MMFB 1D6NA 2JFOA 3ZEAA 4I1OA 1I5OA 4D41A 3TMKA 1ZGHA 4JL8A 4BLVA 3EEYA 1OBOA 1RD4A 4LWQA 1O0BA 4MPDA 4Y7DA 1M54A 2VQDA 3HWSA 5F23A 1EP3B 4UCXA 1INLA 3MFYA 5C37A 1JLHA 2JBAB 3DTYA 3ZU6A 2PDAA 1DBPA 2Q0HA 4B44A 2HD4A 1ULUA 5HS6A 2QQGA 4EABA 3N6VA 2Z09A 2IY8A 2LTAA 4XWYA 1KVQA 4FOSA 4F9FA 3EA4A 2CMHA 2MJLA 2BHNA 1G9XA 3HA2A 3K35A 2Z6QA 5FPSA 1WHSA 4EX6A 2C31A 3EW7A 2XB8A 3F47A 1YJXA 5E1OA 5CLQA 1KVSA 1VZ3A 3BDVA 3ENNA 5CNIA 5IK2A 2EKPA 3GPBA 4RESA 2Q8NA 4AJPA 3KOMA 3RAGA 3AR3A 4ZVRA 2ORVA 3KPVA 2A5FA 3HA7A 4UATA 4W5WA 3JATA 4DIBA 2B37A 2R6ZA 3HU3A 2GDJA 4D9GA 4H1HA 1G6KA 5BW6B 4ESEA 1RZRD 3UNXA 5K8UA 1ML3A 1TQHA 1VLQA 1WMEA 2D1YA 2ZTLA 3GIDA 4IIXA 4BJ6A 3ILSA 1N4DA 2CV1A 4LE1A 5DW0A 1LDYA 1YU6A 3RI3A 2D5LA 4W82A 4WJLA 4QOIA 1Z3IX 4NCXA 1OGJA 3HYNA 4V38A 3K2IA 1DNPA 4KQEA 2YYZA 3OJWA 4LF8B 1GPLA 1ZUWA 1DRUA 4MITA 1DBQA 3PHJA 1UINA 3DJYA 1LK5A 2FQXA 5KJ6A 3WGTA 1KTIA 5F7ZA 1E69A 1Z5GA 2J6CA 1MKYA 1JLMA 1OT5A 4TWZA 3R3JA 1UFQA 1XYYA 3ZH9B 2P9QA 4X9XA 5TGDA 3TR5A 3BTOA 4ZJPA 3LC0A 4DLRA 5HNKA 1KI2A 4PZLA 4PGMA 5K0LA 1JALA 3CEAA 2GXSA 2WVAA 3NJ4A 4QQ8A 3WB2A 4XTRA 4CM9A 4EDHA 3V00A 4KI0A 3DKIA 3QLVA 1T8TA 3L6EA 5J47A 5AHKA 2YYSA 1JUDA 3LI2A 4K3VA 4IVPA 4EVIA 3BA6A 4FYVA 4V0ME 1C3EA 2A0UA 2ODAA 4DUZB 3VC2A 1IY8A 1DCKA 1K4KA 1GL9B 1BWSA 2E21A 1FSPA 1E8MA 1JU9A 3AF5A 1O95D 1OU0A 3KFXA 4FUTA 4HLDA 4FSXA 3PXXA 3BSFA 2J46A 4R9UC 3IHWA 1QO9A 3A9VA 1RDFA 3N2ZB 2C57A 2YWFA 5IAKA 5T4FA 4CG2A 3LHIA 4BRWA 3TTVA 2QTTA 3LT5A 3DLHA 3FKQA 3N3BC 2WRZA 1X42A 4GR5A 1TC1A 1E1NA 3MCWA 4M9CA 1XEAA 3TE6A 2J08A 4F60A 1B3BA 1OFUA 1XA3A 2RGUA 4FTWA 1RKBA 2QN1A 4I5EA 4MDHA 4AYWA 4E4RA 1TPYA 4LJRA 3ABZA 3EG9B 3JWHA 4Q16A 5T3UA 3RD5A 3AVXA 4E03A 3U7IA 1ESDA 1UT5A 2YIVX 3ET5A 1LF5A 3RFXA 3WHLA 3ND6A 1B0AA 1QDLB 4QJBA 2F67A 5EPEA 1Y6JA 1O0CA 5FWYA 1PS8A 3K0FA 3FB1A 3PU6A 1QRRA 3V9AA 5KOIA 1LGYA 1Y4ZA 1V5IA 3TWOA 2C3OA 1I3LA 4X8OA 5AW3A 2X4IA 1BS1A 5TDHA 5F1KA 4ZGGA 1M2OB 3KSAC 4IDCA 3WLRA 1CUYA 1ADFA 2CL5A 2VP0A 3FHJA 4ROTA 5BN5B 4EW6A 2FN3A 2XYRA 3PRKE 4LRWA 4BO3A 2J0SA 1AV6A 4KWIA 4OFBA 1L5NA 3LECA 1TJ4A 4Q9AA 1G2PA 5IC5A 1H4SA 1JAIA 4AXBA 4MPRA 4ZD6A 5C53B 3UC9A 2I1WA 3TLJA 2PCJA 2INGX 4QU0A 1N6IA 1QV7A 2IITA 5JTUA 1TRKA 2C9MA 2XF8A 1T4BA 1EESA 2TSYB 4DV1B 2HREA 3I9MA 1MX1A 4LDQA 3O47A 4QT0A 4Y7CA 4XRGA 3QKWA 3Q40A 4OSOA 1L8AA 1XVTA 3HI4A 1Y1KE 3RASA 1BMDA 2RMKA 5JLAA 1T4CB 1NY5A 1WXHA 3VZDA 2UUCB 4KPGA 5EL0A 1KP3A 4KREA 3DZBA 2I33A 3GELA 2FZEA 2IYZA 1XL0A 3LY5A 3ZNNA 5FBRB 4YCMA 2O2JA 1MR3F 4CKWA 5HZKA 3UMYA 1BRMA 2ZUDA 3H16A 3T99A 3HR8A 1BDJA 3CXUA 5DF1A 1EVZA 3ZNOA 1XZLA 4REQB 4Q1EA 3UA4A 1HZJA 1RXUA 1RLIA 3BHNA 3O1IC 3B51X 3OOHA 4I55F 1JTFA 4FI3F 3NAZA 1F8FA 2PGJA 5TPWA 3U61B 2IPOA 2QN8A 2CLIB 3L0YA 4PZDA 3MAAC 5B1IA 3OO1A 4K86A 1Q19A 2IU3A 4UDYX 1GYQA 4ARVA 1CC1S 1CULC 3NAMA 3QH4A 1L4LA 2QPTA 1NQOA 4HLCA 2NO0A 4OHUA 4PZ9A 5AI4A 2ZIWB 3AG6A 2H16A 3RQIA 1RSZA 1Y7TA 3UH1A 3VPAA 3SBEA 1PG0A 2QVBA 4BTVA 4DR5B 4KV7A 5LZ2A 1O2DA 1CQIA 1D2GA 2G0TA 2OT3B 5G0VA 2XRYA 4G4IA 4YXWD 2DQYA 2O0KA 1TM1E 2DSNA 5EQJB 4GC9A 3K2QA 4DQKA 1ECBA 2C2OA 2IOHA 3DNMA 2AOXA 4B3DA 5DBGA 3QEBZ 4P93A 1A8IA 3LUHA 1Y5NA 4TTQA 4JJAA 1U81A 2Q8QA 4BB9A 2DUWA 4UEOA 2KWIA 4DV7B 2A1UA 4GPBA 2DT5A 1T8UA 2CVFA 4R31A 1GTL1 1JDPA 2E7ZA 1WUKS 5EQFA 3KE9A 3OZUA 4S12A 4E7PA 3AF2A 4IGFA 5L3QA 4KR7A 1LNQA 4H35A 1SN7A 3KC2A 1LZKA 2JVIA 1QWOA 5F7XA 5K6AA 1DJMA 1V71A 2W6QA 3C1UA 4Y9SA 5IK2D 1EFVA 1C9KA 2QA5A 2AQHA 3PQ4A 4FHGA 1CUAA 5FI3A 4ZC1A 3AV3A 2JLRA 2BCEA 3R0VA 4RH3A 1DI0A 2CE2X 4F12A 1NKTA 3AP1A 4YUVA 1KO8A 1U0BB 1XU9A 2FDCA 2WG1A 3IODA 2QMOA 4ZYZA 2IYRA 5I7WA 1MNAA 2EZ9A 1QZUA 2OZVA 2VEOA 1ZI8A 3BIJA 3T7AA 4FFOA 1PR4A 5KCMA 3TRDA 3CNLA 3D6HA 1JN0A 4TKVB 2E5LB 2PAAA 1Y33E 2PEYA 1EYZA 5DYNA 3RU9A 3O8OA 2WWWA 1QF9A 3OZIA 2WSSD 3B5EA 3G8DA 1ZH8A 5EWJB 3JQ7B 3H3JA 5JWHA 2QJFA 4N12A 4QGHA 3TZCA 1AG9A 4RXTA 3VU3A 3EJ6A 1XPUA 2B35A 2ZQ5A 5FEUA 4D6XA 4G5QA 2FUG6 1DVRA 2JI9A 1ZOPA 5AXCA 5AW1A 2VH5R 2QMUA 1EAMA 3KS9A 3NV7A 1Y3FE 3M5CA 4J03A 3DVAA 5IW8A 2X42A 4E3ZA 5D3MB 2EFEB 4CM9D 4MULA 1IAVA 4RLQA 4YCNA 1PVOA 3O83A 4GZ6A 3WJAA 1DRKA 3A6LA 2C95A 1IPFA 1JFFB 1K4YA 1JFRA 3ENKA 2UUPA 3P2OA 4GBGA 4OREX 5DX8A 3WMGA 1JHUA 4R1PA 1SVWA 2QL5A 3AIOA 1YR8A 4QSMA 2UUOA 2FUCA 3TTYA 1GZVA 1YR1A 4BV9A 3FVWA 2DPXA 4L3OA 3AL2A 2XUPA 1JWLA 3E9YA 3SVTA 5CHYA 2GEFA 1A76A 1VG0B 3O31A 3BEOA 4RH0A 4WCFA 4F1KA 1SZDA 3JVVA 2WOOA 1YHNA 3PXAA 2ZUUA 4BGDA 5HKOA 4YLGA 2I7XA 2B2NA 3IPLA 3RS0A 2A6PA 5CB6A 1ZSVA 1VYVA 4ALKA 3OA0A 5TEWA 4LYEA 4JCCA 3K9LA 4LBYA 4E3WA 2VRNA 1S0UA 1T1RA 1U0GA 2A0FA 2PGXA 2X1VA 3P2EA 4KGXA 4L4ZA 3TVDA 2Z6AA 4HH4A 4AWAA 3OZ7A 1RI5A 4LDAA 5G53C 5J2TA 4OYYA 3CJRA 3D3EA 2YHUA 3JWPA 3S7ZA 3SNKA 5KTOA 2GPSA 4TN5A 3IAXA 3QK7A 4LRYA 1GYPA 3PJFA 3O3CA 4B46A 4EA8A 2CFSA 3EUFA 4ZOCA 4G1VA 4DUYB 3ZDBA 3QUQA 1KY5A 3ETCA 4J0IA 3LD9A 1SU7A 3RRMA 4D3ZA 1JDTA 3JRNA 3KKEA 5DWVA 4M1KA 3AY7A 5A4DA 4KGDA 4EARA 4A73A 1TZJA 4LRUA 5FP0A 2J9FB 1C8LA 4MW0A 3GBSA 3Q10A 1QYXA 2D8AA 5DYTA 3RK4A 3USZA 4F3CA 3G2QA 1T9AA 1YRWA 2J3HA 2FPWA 3ANLA 3CRQA 3DXYA 3RHFA 2YWBA 1KEEB 1E3IA 2ZUCA 4KWEA 5IH3A 5JFOA 1DIOB 4CEJA 1NSFA 3U3KA 1M2GA 2L69A 2IE0A 3LP6A 2ZIGA 5HCNA 1ISJA 5KYXA 4EO4A 1ECJA 2C3YA 3C3CA 3U1BA 3H99A 1U4SA 4LWPA 4ZEWA 3N7TA 1O8BA 4HH0A 1JPNA 2XGMA 3EDRA 2VPXA 3QKUA 1YA4A 5F33A 2GTPA 4RELA 5HBRA 1M2FA 1FU8A 4J3NA 3RVNA 1BWPA 3KZOA 2JHGA 2GF9A 2V8OA 2ZWIA 4Z99A 4D46A 1XZKA 2B94A 3DO5A 1R4MA 4Y2XA 4R81A 1DO8A 5ALVA 2FRDC 4C0WA 1AUVA 4OK3A 2Q99A 3QKTA 1QDEA 4O2BA 4ZT7A 3AFOA 4ARUA 5BR4A 1NBHA 1QTQA 2Y1GA 1JNXX 3I3OA 2PZFA 1LBHA 1UKVY 4ZEMA 1PNRA 3QBDA 1YJCA 1YRHA 2JIBA 4MV9A 4ZTZB 3I30X 5ANRB 2HPAA 3PKIA 4EHAA 3BPSA 1BDBA 1PNTA 1G9TA 4JI1B 5C7LO 2QRVB 3K4HA 3S4YA 1HRDA 1SMKA 1SCBA 1E0KA 1WBJB 1BHSA 4QXMA 1L7OA 2BSAA 3CVOA 4RY9A 4S04A 5FPPA 4Q15A 1GNVA 1NBEA 3DS8A 4C4XA 2FFJA 4DCPA 2D3WA 2I4IA 1MX3A 3D2CA 3FVTA 1JSZA 4BLRA 3U3ZA 1KYIA 2UVPB 1UOQA 1PWHA 2GA9A 3SR0A 1Y0BA 3FZQA 2GJ4A 4J1SA 3DBVO 4Q7EA 2UZ0A 1I4WA 3IMKA 2RG1A 1E2FA 5JQGA 5TARA 3JPWA 2QVGA 4AJIA 1Z18A 4C0JA 3RSSA 4ENQA 1VXOA 4FIDA 2OO5A 4XW2A 5EP1A 3P4XA 1K3FA 4K2HA 3UXYA 2YJ6A 3GV0A 1VRVA 1VYHA 1WJGA 2FPPB 3WYDA 5IFLA 4G07A 4JXZA 1EWQA 3VPCA 1X7GA 5D8DA 3HNPA 4NABA 4NBRA 3VR5H 3VUFA 4D9FA 5LQUA 2Y3IA 4XX0B 4HDSB 5IEBA 1Y37A 2HFKA 5NULA 4L6AA 3RSFA 1P72A 1Q20A 4UPEA 4FGKA 4P7JA 2RGBA 1IB0A 1L3IA 1U2DC 1UBCA 2EP5A 2GARA 4EYEA 1RT9A 4KDRA 3M3PA 1ZI6A 2GM5A 3FZEA 1E32A 5EUCA 4UAJA 2WKWA 1JU3A 4B7UA 2HK7A 2A88A 2WVJA 5D87A 2CHUA 2FB9A 3JQCA 2B61A 4F4UA 2YN0A 3OIDA 1N6RA 5IAOA 2WTXA 1ZD1A 1G3QA 2B82A 3LXUX 2VATA 3U3DA 3AONB 3IQIX 3FPAA 1FRNA 1M34B 3EDMA 3HFSA 2ZCJA 2R7MA 5FBHA 1J6UA 2O8CA 3OG9A 3WQQA 1G38A 4NP6A 1XEWY 2UDPA 3KYCA 3K6SA 1UZUA 2HXYA 5H3CA 1I3CA 1GUYA 4ND3A 3VAYA 5KOHB 4AJ9A 1CR1A 3INRA 4Y1GA 1VCMA 2B99A 4EUNA 4MS1A 4LWZA 4IOKA 3GPLA 2FG6C 2IH2A 2Y1WA 1EHYA 1RWVA 1GQ2A 3P26A 1M1YB 2IIQA 5CURA 1LI5A 2R96A 4Y2RA 4OYHA 2Z9DA 4M1EA 5ALZA 5A5EA 1FNNA 1QHIA 1LK7A 5LP6B 4K9DA 2Q0QA 1E2LA 3ILVA 1GSAA 3A06A 4EHBA 3PC8A 3TR6A 1L8QA 4RZHA 5ALGA 4EITA 4G09A 1R5BA 2EX4A 2ZI4A 1ILWA 4DJ5X 1MDBA 2CJXA 4PG7A 5GY7A 4F3NA 2AG5A 1NIPA 1KDVA 4BFLA 1I7DA 1D03A 4CI9A 2VBIA 4XA8A 2P41A 2JARA 3UC5A 2JEYA 2ZRDA 4N8EA 3W7AA 4F5YA 3F5SA 3TLCA 3WLJA 2NO9A 1CUVA 2Y1LA 2YXPX 3UJHA 4LA4A 4UDXX 4D4MA 4L8FA 4JWTA 3T5PA 4MPJA 4WMLA 2IHTA 2PMDA 5CDFA 4RGVA 4B6SA 1H8EA 1LQUA 1PBTA 1TCVA 3JTMA 5K01A 2J45A 5K4GA 1HY3A 4F9EA 3D7KA 2O8EB 3UXMA 1QF7A 4MVCA 2XB6A 2FEKA 4IZHA 4NMLA 2ZM6B 4G26A 3KOXA 4IIGA 5BT9A 4LS3A 1E1CB 1QUFA 1JVSA 1DG3A 2FFBA 3O8NA 4L8GA 4IIJA 4QQKA 3GRAA 4YLEA 1L5WA 5E0OA 4JLWA 1ZJZA 3VFDA 1QRDA 4X94A 4A6DA 4OUKX 3KAKA 3GMTA 2HY7A 1HDRA 4GXTA 1KEVA 2G72A 3WL4A 4Y6RA 4YP6A 2WMYA 4BQNA 4DVJA 3B7GA 4A27A 3D6NB 1U0HC 4K6MA 4J07A 4F7DA 5I7EA 3U6KA 2F62A 4FXOA 4UUOA 2I5PO 1SVNA 3BJEA 3GUYA 1YVUA 2EFDB 2QUBA 3MBKA 4DV6B 3AVTA 4G4GA 4BOYA 2AB0A 4EECA 4EBBA 4FOPA 4JLUA 4NBUA 1YVDA 2GN6A 3FN4A 1OKKA 1BMTA 5DBHX 1G3RA 1GNLA 1QLHA 2KBEA 3W90A 1IWOA 3HYLA 1RQPA 1VSBA 3UAGA 3FAKA 3H0KA 3N8HA 3DMTA 1HYEA 1KAOA 4D8WA 1I9CA 4Y2PA 2NZYA 3ZS9A 4NJOA 2CV2A 2O2DA 1K7XB 1U80A 2AT1A 2PZGA 4M1ZA 5AR1A 1Y98A 2XA1A 3BMNB 4W63A 2GSWA 5F35A 5EVJA 3T7KA 2QTZA 3F3YA 2EP8A 3VV3A 4E88A 3PPYA 3EFOA 1YZKA 2R6HA 5JH7A 1LS1A 1WVGA 2YYAA 4EJ0A 1DXQA 2JH8A 4CQJA 3T9BA 4MVJA 3LLUA 3ORFA 3PQDA 4UZEA 7YASA 3I8OA 3KB2A 1E18A 4G84A 3HA3A 4LHYA 2CVPA 2JAXA 1Z0AA 5AW5A 5CLIA 3EWIA 4GEKA 5FPYA 5A71A 1JHAA 4HZGA 1HM5A 1KI6B 2HGSA 2OMEA 4G1CA 5HDBB 4BO5A 5JSFA 5KQMA 1NATA 3LWDA 1I01A 1QCCA 2Q3CA 3DCNA 2C9YA 2F7SA 3L6UA 3H2ZA 3OZEA 4LOHA 4IOMA 3UAXA 3WQRA 3ITKA 2F8TA 1UDWA 2XMDA 3COZA 3E82A 1RRPA 3T1NA 1K5GA 5DBOA 1XJQA 2C7OA 3CN7A 1DFHA 3FJOA 2XGJA 1E2UA 3GRYA 5BXQC 4G85A 1C9JA 3DOCA 3E23A 3DNPA 3BFVA 1MORA 2BFCA 3BD9A 3KG2A 1A9QA 2CWDA 4GO1A 3TI9A 1RMYA 3FCUB 1ZOLA 1ZUIA 3EZXA 3FETA 3KWLA 4EY5A 2RB5A 3DBRB 3PJRA 1Q84A 2OQIA 3THWA 3AJ9A 3AY6A 5HMMA 4YRJA 1XZFA 3U4CA 3AVOA 4CGZA 2NZXA 3F5QA 4Y0VA 4NK4A 3P52A 5JARA 3KWFA 4D0NA 4GI3A 1OH6A 4NEHB 3SHQA 5TIIA 2LBPA 4REMA 4IW3B 4BNLA 2D1SA 1UEXC 2HNKA 1T8RA 5LD2C 1QANA 2GBIA 3AO0B 5C5CA 3ANMA 1UJNA 2H29A 3I05A 4FMBB 3EG5A 4TUYB 2XZOA 1GTRA 1IBCA 5D3KA 3F5MA 1WPXA 2H1OA 1EX9A 5F77A 2J3DA 4HDMB 2C1EA 3GL9A 1QRSA 4N3GA 2C7GA 5LA6B 5HX7A 3CCBA 4XQCA 4XYBA 4YCSA 3A7EA 2Q29A 4FKMA 5LB4A 3TR0A 4CLRB 4BWYA 1QG0A 3ZVMA 2RJOA 3NYIA 4DDWA 1N0HA 1JT2A 3NEAA 5BVHA 2Z3VA 3LW8A 3N2YA 5CDSA 4Y6GB 1H05A 1EGHA 2EJWA 4WJKB 4NNOA 2FOXA 1M76A 2O19A 3G49A 2OY0A 1ISMA 1XCOA 1GKUB 1I2BA 3BK2A 3ESDA 2R6CA 3H19A 3M3DA 4BUCA 2ZJYA 3M3HA 3OWHA 3L7LA 3MWDB 3W2IA 2IPNA 2OUKA 1EK5A 4U7GA 2QG6A 3O7MA 1KPGA 1XTUA 3QLUA 2I2CA 4OAQA 5LYJF 4AM8A 3Q6MA 1ZFNA 2CSXA 4MYUA 1DB3A 2QTFA 2G9NA 1Y9EA 1OZGA 1TM7E 3D4PA 1VP3A 2FEAA 3NP7A 4GX2A 3LLSA 4BMPB 3N76A 4Q1DA 4DF3A 3SYRA 3LIIA 1YV9A 4MPPA 1TMYA 3DXXA 2C3UA 5J4HA 1M2NA 1DEXA 2IKSA 4Q19A 3AETB 4B75A 1MPTA 1YDGA 1CP2A 1LWNA 2CL7X 3QUCA 7AT1A 1C9NA 2X1HA 3EVNA 3HEAA 4MKZA 4X63A 1WU8A 3NQ41 3R2JA 4CM8B 5KVAA 4OU5A 4OU4A 4QPNA 1ICIA 1NUAA 2BCJQ 3Q8LA 5HXAA 1EUQA 1V26A 1OLXA 3ID6C 2ZJBA 3M0EA 4AQYB 3FFXA 1IQ0A 5FAKA 2YY5A 1NW7A 3NUZA 1WW3A 4FW9A 1LSJA 2PL3A 4GYKA 4IDEA 5ILQA 3TPCA 4PZ0A 3RRNA 3OPXA 3UWSA 4CDMA 2NSHA 3TZBA 5G0SA 5DT9A 3M70A 1R00A 2YWJA 3E2PA 521PA 2ZAIA 1OLSB 2WJGA 4XWAA 1F2VA 1DC3A 3BWYA 3GJ3A 3EFBA 3CH4B 4HGYA 4G4JA 2ZOSA 2FV8A 4PU0A 4DXDA 4JP8A 4TXHA 3QYFA 5IKXA 2WUEA 4XFDA 4TKMA 1J39A 1EP1B 1N25A 1AK2A 3A2LA 3HYTA 3FX2A 1E64A 1CR6A 1P3Y1 2LVBA 3HMQA 3M5PA 3R0ZA 4XASA 5FF9A 1X38A 5I4IA 1RWBA 1LBSA 1RYNA 3OFSA 1XMIA 2BEWB 4D9EA 1G21B 2BBTA 1CTQA 1YS7A 3JVIA 4NYIR 3COJA 4DLXA 4EHFA 4YR7A 4LQLA 1JJAA 3OJEA 2Z5FA 3R41A 2Z4RA 4X3OA 1ISGA 3PSHA 4LGMA 4NNPA 5CXXA 5EEHA 1SOAA 4JI6B 3WAGA 4HUQA 4J0CA 2A7XA 4JEHA 4PYOA 2Z04A 1T9DA 2Z95A 3GVXA 1NXXA 4URXR 4CXMA 2QAGB 3TMYA 1IUOA 1N5OX 1Y9DA 3AFHA 3D4LA 3FVRA 3PIDA 4BMXA 2HX1A 2IEYA 4EPRA 2H1HA 3QOWA 2C54A 4YX9A 1G6HA 4IF6A 4ZARA 1BMQA 3OD1A 1M8JA 2A0KA 1HNXB 3E9DA 2R2GA 4HH1A 3ZHOA 4LF6B 4GMFA 1UWCA 1VSUA 2EWWA 4KPUB 1WKVA 1EVKA 2A5JA 4PO8A 2JGNA 4WK6A 1WV1A 3RBAA 1IQUA 3PRYA 2ZWAA 1K8QA 1WO8A 2PZJA 1A4IA 1HURA 1QE3A 1SM4A 1UWLA 2BP7B 2Z2XA 4ZA2A 5FTMA 3T95A 4ZYUA 4TOIA 1T26A 4H15A 2REBA 4RSHA 3K70D 2GAFA 4Q9IA 4ENPA 3R23A 3R8FA 3I28A 3RGGA 4TMYA 2P2YA 3DTVA 2D0IA 3NGXA 4JXJA 3GCXA 4WZAA 3PPVA 2KBFA 2BBOA 4TKUA 3WIEA 5K3OA 1PNOA 4V0LA 3N58A 1JS1X 1LSUA 1FP4B 2XCTB 4ZCSA 4AXXA 5JDCC 3AUJB 3L8GA 3NOQA 3EEBA 3HVRA 2EHDA 1RRFA 3HRHA 1P0CA 2HQ1A 2L18A 5CHEA 4CV0A 1QQ7A 1KH2A 4M0MA 1Q11A 1N9GA 1JSXA 5IT4A 2ID7A 1A7KA 1L5GB 2WSMA 2Z8YA 4YI3A 2GM9A 5IHPA 2OE2A 5J43A 9MHTA 1SWVA 4EHNA 4J43A 2NU7B 3T94A 1RXCA 3UCXA 4EJSC 3K0CC 4CZ2A 4RL4A 4H1TA 1LY1A 3ZHRA 1WP9A 4U9UA 1EXMA 1G5RA 2JC3A 4RCZA 4KFUA 2CBZA 2XODA 1YT5A 2OV6A 4K40A 1NASA 2AYZA 1ONNA 3HKBB 3DAPA 3EIUA 4UTOA 1RKXA 3TQOA 1M1ZA 1QUEA 3C6XA 4YJFB 3FH0A 1TAHA 3HWWA 2WJAA 4A4DA 2QZSA 3PYLA 3SLRA 5IKOA 2WU3A 1E8DA 1FTWA 3B20A 2PL9A 1MH1A 1B0PA 2HMWA 3NGMA 2AKYA 2JIZD 3N2KB 1F8UA 3PC4A 4KIFA 1V4VA 4KNVA 1VKZA 3ETGA 2R8ZA 3ZZ1A 5AD1A 5LQCA 1VHLA 2XZLA 3RRJA 2ESRA 1DIRA 1IWBB 3KWJA 3WNZA 1BMFA 1XU4A 5H4HA 3OY2A 2FR1A 3F6SA 3TSZA 3GRFA 3WGHA 7ADHA 4ZTUB 3FYSA 5FUBA 2XTJA 1CUXA 1UJ4A 5L45A 4BRUA 2BUBA 2CHFA 2H08A 2ODQA 3N5KA 1NU8A 1QOQB 4OMFG 1ZG3A 4RXUA 4WADA 1V39A 4EIWA 3T3GA 1P3JA 3EGXB 5IZCA 1E1QA 3JQGB 3TXXA 2A9KA 3DDZX 3M9LA 5EAIA 1U9JA 2GUWA 5ETJA 4OBBA 4MWCA 2OZLA 2VH2A 4X44A 5FA5A 3WP0A 1DWQA 2Q2OA 4FZ3A 4FHDA 1FMCA 3TLAA 3JZDA 3WLMA 3CVXA 4EK9A 2NSLA 4D6PA 2J7KA 4G0QA 4UM7A 1AS3A 1UBTS 2X9GA 3JQDA 3MYYA 3RCBA 3QBJA 3QMPA 1E6WA 1WA5A 4M0LA 1SXJA 3DA8A 5AKKA 2OD9A 4NXMB 1CE8B 1X7WA 4J0KA 2NXCA 4YUYA 1J5EB 5HHTA 2JZOA 1WNFA 3M4XA 4WBXC 4WK2B 3ZE0B 3IOYA 5EZ5A 1X80B 2B5OA 4P86A 4YGYA 2IH4A 3C3MA 2QZJA 2GPJA 2P5TB 2AQ8A 4KBFA 5JSQA 4KQ6A 4HNGA 3VA7A 1VBNA 1YHZA 1G3UA 1JFLA 3T5DA 4W9NC 3B38A 3VDRA 5A0TA 3J7TA 5REQA 5K0SA 2GRJA 3GWGA 1HTBA 4C0KA 2ZRPA 1NQ5A 3OFJA 4EFLA 5HSGA 1WMDA 1R2QA 4QOJA 4M8LA 3AQ4A 4ZAFA 1F5SA 3WSTA 1R8JA 3TGPA 1UXGA 2HSDA 3I5UA 4JBYA 3HDHA 2GM3A 5COBA 3VPXA 3AGPA 5EA2A 1MNQA 2H5IA 3AB3A 2W6MA 4UXIA 4CF3A 3IQWA 5IJ9B 3QQ5A 4PYNA 4DCMA 3NP9A 4O02B 4BVAA 1ORIA 3B48A 1V5FA 4XGNA 3OOSA 4BNFA 3PCRB 4ND6A 3I2KA 2JZNA 3FFAA 4RJIA 3REFA 4RY0A 1GQFA 2PX5A 2KW5A 1DQSA 4UQLA 5JPDA 2PJDA 4U0KA 2NXWA 3OJOA 1G5TA 2YBDA 1NTRA 4AIRA 4D9NA 1RNLA 1JIKA 2ZYUX 4Q5IA 2ZJ3A 3GYBA 1ZVVA 3V97A 1FX0B 1RWNA 5I6DA 4JQCA 2HCRA 3GJQA 5KVSA 3W8RA 3IIJA 1GA4A 2DBZA 3E2MA 3O38A 4Y98A 2FWIA 4V1CI 3ERCA 4ZRNA 2DHCA 2BBSA 2G71A 1FUIA 2GAAA 3QELA 4ZTBA 3FUCA 5EYPB 1J9ZA 2Y76A 1NJSA 2FSPA 2BJWA 2WAXA 3DOOA 3K16A 3LC1O 4PINA 5E6SB 3VBEA 2XNSA 2JHAA 3DB2A 3EVAA 3JD0A 4KRGA 3QVGA 3UK0A 2MIIA 4JT2A 1RXWA 1XRQA 1VL8A 2QM8A 4ZAWA 2A4KA 1S96A 3T41A 3WBBA 4IR7A 4DE5A 5B58C 4CT0A 2QD5A 1KHTA 3FUTA 2I4TA 3X0DA 1ZD5A 1S4QA 2G8LA 2JFYA 3ND7A 3OLCX 4PPYA 4Q3KA 3GK3A 3SXUB 5BWBA 1I51A 3OE5A 4EI9A 3M2TA 4PWZA 4O1MA 4G0VA 2B4RO 2O2IA 3T12A 3TO5A 4B6QA 3AP2A 1KMHA 2TMKA 4PQFA 1BHO1 5DLYA 1C80A 1KDTA 2ZE6A 5DI3B 5DTIA 1HL3A 3QVUA 4OSEA 5KSPA 4JJKA 4F04A 3OIWA 4J94A 3IDFA 1LJLA 3GLGB 3N3AC 3V2HA 4ND4A 1HR0B 2Y99A 4IOJA 3QE3A 1UMCA 3ZLUA 1TYBE 4WW0A 3P96A 4DJJA 3E4DA 1E3DA 3D8HA 4JR0A 2GK4A 2NUAA 2NWQA 3EHDA 2VNKA 2ZXFA 4Y2TA 1ZL2A 1II8B 3FPCA 1AGNA 1B0UA 3AF4A 4H0NA 2XCSB 2JCXA 1WTAA 2RH9B 1DELA 1YQEA 1F6DA 5CX1B 1KYQA 5IVIA 5JADA 5CA0F 4DEVA 2NXNA 2Q3HA 4P2GA 4A82A 1L9XA 821PA 1A95A 1TU4A 2X5XA 3FF4A 1PU2A 4KHZA 1FNSA 3A8TA 3JCZA 2I6QA 3I4FA 1MT0A 4M7WA 4JGIA 3BWVA 2QT9A 2VXOA 4B6EA 3L1IA 3E8MA 1VIYA 5HM6A 1GHTA 2GX6A 1RHUA 4AMVA 5C5IA 3LVFO 1CUBA 5TMBA 4LV8B 2CMDA 3EXFB 1NJ5A 3FNFA 1AGXA 3PFFA 4XSHA 4NR0A 2QUZA 1YL6A 3CRRA 2K5UA 1UL1X 1TQ4A 3HCFA 4EZEA 5AKXA 4JI7B 3HI6A 4XYLA 3AY3A 3F8WA 3JZIA 4PNHA 4ALMA 3BSYA 1JR3A 3K5HA 2XWBF 4Q9NA 5HE9A 2FJPA 4RKFA 2IU4A 2X22A 1BMFD 1ND6A 4A0GA 4I1PA 3JWGA 4UUAA 1HEYA 1PHRA 1DAFA 1L5OA 2H54A 2YIDA 2IP1A 3DV2A 4LZLA 3ZCRA 4ATNA 1T9ZA 1Q22A 4FSDA 4YJ3F 5I8PA 3WQBA 1T15A 1UIRA 4L28A 4PGAA 3KOUA 3F67A 3JALA 4WOBA 5TY0A 4MDYA 1E1QD 1TZMA 2IYPA 5EZYF 2HDNB 3EVZA 5JCOC 4JFAA 3U5TA 4ARIA 1V4BA 1ABFA 2X4DA 1P29A 2G5PA 2GYVA 1Y8QA 1EMDA 4YRAA 2DBRA 4L8WB 4GNKA 4K0KB 2I9PA 3R40A 1Z82A 1YC2A 4YRQA 3P45A 2XKJE 2FG5A 2PQ2A 3H2SA 4FE7A 3I37X 3IV9A 5DE3A 1DC7A 2IKQA 1RMTA 1MW9X 2WU8A 3I9FA 4ZN6A 1XTVA 4R41A 1FNCA 1P4HA 2WYUA 3L8HA 1P0MA 2QIPA 3AX6A 4MI3A 2BFBB 1JECA 1A8QA 3K7EA 4KB5A 2ILVA 4QQFA 4XWGA 2Y2UA 3M49A 5CLGA 3U31A 1ZIXA 2H4XA 3GDHA 5CBKA 1JJBA 4DY4A 1RQLA 1OAOC 2W11A 4OHXA 3K6KA 1CUCA 1ZH0A 2OENG 3FB4A 5FXMA 5B3LA 1KRXA 1DMSA 3STWA 4CKZA 2X5JO 1B2RA 4Y6OA 4BFYA 4I2VA 2Q1YA 3BXZA 1XO1A 3QW4B 5L3SA 1ZZEA 4ZI7B 3QKSA 1OA0A 1FDVA 4HFJA 2LRHA 4N5MA 1FFAA 2F3RA 2Q3MA 3GQVA 2Y93A 3CZ5A 5HG0A 4GPAA 3W7BA 3FI0A 3ESXA 2QRGA 1XTRA 2X3FA 2HH9A 1UBEA 3OCWA 2QX7A 4EFMA 2HIAA 2BDUA 1KJ9A 2I22A 4OHVA 3C39A 4N65A 1XVIA 4UNIA 4D6YA 1E4EB 1SG9A 3C6ZA 5COAA 2W90A 4LVUA 3NS7A 3KRTA 3KDAA 2FF7A 3RRZA 3WLPA 4DSAA 5EIEA 3GP5A 1KJNA 3OQMA 4ZCQA 1RQRA 1WEHA 4GVXA 3K3PA 3ENWA 1L5ZA 2O3QA 3WKEA 2VT7A 4HYQA 2VTBA 2XZPA 3E9NA 3IQFA 1W47A 1EK1A 1JDBC 1P2BA 2EAUA 5CK5A 1FP1D 1YQGA 2E1PA 3GJ8A 4QXPA 1NVTA 2JIOA 2YVAA 1FDSA 2I7CA 3CLUC 3CXRA 2EBWA 3HLKA 3VBCA 9GPBA 3H1GA 4B6FA 1ZD2P 4D0RA 3C43A 3OIUA 3NTOA 3CPSA 4BGEA 1N2BA 3DNFA 4KTTE 1G6OA 2KPOA 4FDLA 2HNBA 5EXDA 3CWZA 5D01A 4ECAA 3ZGOA 4CN9A 2IA5A 1OTHA 4PN3A 3RIHA 5K45A 5CP8A 1DG9A 1BDMA 1U8TA 4XWKA 1OLOA 2HJ9A 4U7FA 5FBZA 5DXAA 5I47A 1P5HA 3LYAA 3PSAA 5AJXA 1V48A 1UFVA 3NW9A 5H3LA 5JEDA 1SC1A 2F8SA 2FWBA 1PDOA 3K9NA 4H4EA 2HV9A 1I1NA 1XCMA 3SR3A 3KT6A 4F4FA 3OOJA 3CB4A 2FMUA 4U2KA 5FOSA 3B9QA 2CHEA 3UZUA 1E3SA 4D3YA 3G9UA 2OD7A 2V7QA 3ZWWA 1S2MA 1B00A 1LWOA 1NV8A 2B78A 2HRQA 3DD1A 4N54A 4TKLA 2JZCA 5DN9A 4BBPA 3KLMX 5DB4A 2FKNA 4ZPXA 3TI7A 2G77B 3L0CA 4WZ6A 2ZAGA 4TV9B 1IYZA 1U8UA 1L4GA 1IXYA 1BCSA 4G0YA 1D3AA 2EOAA 3C16C 5L9AA 4TQAA 1E7SA 4R7GA 4KOEC 2Y1KA 4LHVA 5F4BA 4KYUA 3DFMA 3K1AB 4ZQCB 3D1VA 4RMHA 5KEIA 4RX1A 3AU8A 1OE0A 1FP7A 2VUTA 1NLZA 2OGWA 2P4SA 1T2DA 3BAZA 3P97A 2WNHA 2XECA 2AOTB 1LLDA 3CX6A 2QU7A 5KWEA 4R8LA 4TWAA 3ZN2A 4G8JA 2HA6A 1Q12A 1K9SA 3OQ1A 4RZSA