4M0UA

Crystal structure of human prs1 q133p mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
310
structure length
303
Chain Sequence
b'NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASPIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKEDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-phosphate pyrophosphokinase 1
publication title Crystal and EM Structures of Human Phosphoribosyl Pyrophosphate Synthase I (PRS1) Provide Novel Insights into the Disease-Associated Mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 303
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2013-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m0uA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m0uA02
1G2QA 3OZGA 1YFZA 1ZN8A 1LH0A 1ECGA 1QCDA 1NULA 1U9YA 1UFRA 4PAWA 1UPFA 1XZ8A 3GGJA 4QRIA 1QK4A 3S5JA 2P1ZA 2PRZA 1I14A 3ACBA 1G9TA 1P4AA 5IPFA 1ZN7A 1WD5A 4JLSA 2GEBA 2PS1A 3OZFA 5HKLA 4Z1OA 4LZOA 5HIAA 4PFQA 4RHYA 4RHXA 4RAOA 4LZNA 1G9SA 3QW4B 5KAMA 2JKYA 2JI4A 4LYYA 4RV4A 1BD4A 1DQNA 1A97A 1XTVA 4P84A 1ECFA 5JV5A 2H08A 1P19A 2IGBA 5KAPA 1FSGA 4IJQA 1NONA 3N2LA 3NAGA 1PZMA 3ACCA 1R3UA 4P80A 1GPH1 4P82A 2JKZA 2YZKA 3M3HA 3ACDA 1D6NA 4RHTA 5EUCA 1OROA 2FXVA 1IBSA 4OHCA 1VSTA 1MZVA 3O7MA 4QYIB 1ECBA 4S2UA 4ZFNA 4RHUA 1L1RA 3LPNA 5ESXA 1XTUA 4TWBA 4RQAA 2HCRA 4P81A 4X44A 1XTTA 2EHJA 1QB8A 1AO0A 2AEEA 4RQBA 1VCHA 2H07A 1DKUA 1UPUA 1GRVA 1W30A 3LRTA 4LZAA 1BD3A 1HMPA 1STOA 1ECCA 1Y0BA 5BSKA 1O57A 1V9SA 4P3KA 3EFHA 1DKRA 2JBHA 1J7JA 1O5OA 1XZNA 2XBUA 3DMPA 3H83A 1JLSA 3KB8A 4WMLA 2DY0A 4P83A 1G2PA 1A98A 4P86A 4JITA 5ESWA 1QK5A 3MJDA 1ECJA 5E38A 5K51A 4M0KA 1QB7A 2WNSA 1QK3A 3HVUA 3GGCA 4KN6A 4QYIA 5IAOA 1VDMA 4MB6A 1A3CA 4F8EA 1L1QA 1P18A 2E55A 1I5EA 5BQPA 3MBIA 4LYGA 4X45A 3DAHA 1TC2A 3G6WA 4M0UA 1A4XA 1U9ZA 4RACA 4FYMA 2PRYA 4WN3A 1P17A 4M0PA 1JLRA 1I13A 1Z7GA 4RANA 1QCCA 1CJBA 1A95A 1TC1A 1I0IA 2VFAA 1HGXA 1DQPA 4RABA 1A96A 4RADA 1OREA 1BZYA 4RAQA 1DBRA 3DEZA 5BRNA 1OPRA 5BQOA 5JSQA 2H06A 3OHPA 1I0LA 3GEPA 1ZN9A 2C4KA
chains in the Genus database with same CATH superfamily
5CCDA 1KI1A 4X54A 3D02A 4UBOA 4BMSA 4RZ3A 3IEUA 4BKMA 1IPEA 5CT5A 2GPYA 2O54A 1EPUA 2Q3MA 1M8GA 3GGJA 4BE7B 5M29A 1JIKA 1E9RA 2GBFA 5FTKA 5LCXA 1PGNA 4KO3S 4QUBA 2WE7A 3PT5A 3UXYA 1Y5LA 3CMCO 2O2IA 4S1VA 2P4QA 1TKRA 2YXEA 1RCTE 2G6BA 2NVUB 3K6SA 1DJPA 3C6ZA 5DOVA 1O7JA 3CVOA 4K9RA 3E70C 1DQZA 3PXBA 5EYPB 4JMLA 5T3YA 1RLMA 3TW6A 2GBIA 4MRMB 5JJIA 4J76A 3L06A 5FUWA 5J4LA 2QQ0A 1GRCA 4X1KA 3IHWA 2ZS8A 3RR2A 1XIVA 2PLRA 1LFDB 5AUQA 2CXNA 4E70A 5JV5A 1C7ZA 1XDDA 3G7UA 3H9GA 4IY1A 4QDTA 4DM7A 3U09A 3CT6A 2NZWA 2W4IA 5J2UA 1DE0A 1C1XA 3B38A 5DF1A 5DTIA 5GY7A 3V48A 4NC9A 3D4NA 3IUYA 3UK2A 3RUAA 2JKZA 1QONA 4KIGA 1AH2A 3BG5A 4AO8A 2PUWA 2WNIA 3AJAA 3GZTB 5GWXA 5ICEA 4PZCA 4LY0A 5B3AA 1Y98A 3PJFA 4MP3A 2HHJA 4UHFA 4LHXA 3VPSA 5DO9A 2G0TA 1TNDA 3DD1A 1KEEB 4K9NA 5TPZD 4GPEA 2WMYA 3AL2A 2O1XA 2I91A 1VE1A 1B43A 1E77A 3AM4A 3H1AA 5L4LA 1PFYA 2A0YA 3VPBA 4OATA 3R0IA 2QDKA 1HQKA 1ESCA 5KNBH 4AO7A 3M5CA 2I3AA 2IYEA 2JGDB 4QDKA 1KQGA 2BFPA 4KPEC 2HBZA 3SZRA 1O94A 4TVKA 1QVWA 1R4MB 3R75A 2ZTVA 4DE5A 2Z58A 5BPFA 1DAMA 1JWAB 5JCOA 5SYMA 2ENUA 5LKRA 4B5LA 4X85A 2W9XA 2WF8A 1ESZA 3ELWA 2ADMA 4CPDA 4ZJZA 5CLJA 2GCOA 1GPKA 3S2GA 1QWSA 1IXSB 2AFIA 5KX5A 4AKTA 3AF5A 1WUHS 1T5HX 1WCYA 4URUR 4ZVKA 3PHJA 2FZ4A 5DMHA 4ZVOA 4LE1A 4WIAA 3IPAA 2QY6A 3LA6A 3CINA 5TC4A 1ZD8A 3NO4A 4BMXA 4M1OA 1R0RE 3KXKA 1KK3A 3D6FA 4EI7A 3EY9A 4D80A 5KB3A 4ITRC 2C97A 4HAIA 2JLCA 5H4HA 2JAHA 2ORIA 2V5UA 4J3FA 3ERCA 2R8RA 2PYIA 1K4MA 3HXTA 1NMEA 4NY1A 3OD1A 4CT4B 1HDXA 2P4SA 4AJLA 5ALUA 2QR2A 4WW0A 2X2PA 5K3OA 1Z7GA 3EDOA 4WN9A 3IUQA 4JS0A 3W1VA 5AW7A 2VFAA 4EVQA 3DZBA 1L5NA 1X7YA 3LK6A 3SR3A 4MWGA 3T8YA 1JAYA 5TY0A 3VQTA 1QGOA 3DP9A 4V24A 3NM4A 3L8YA 5ELXA 3ILYA 3ER8A 1M2EA 1VI2A 3KKEA 3ZDCA 1QG2A 5BXQC 1FDVA 3DZCA 3GLIE 4N1AA 2P30A 1KWKA 2G04A 3MGBA 5K1ZA 5BV8A 4Q18A 2VNAA 1C0LA 4UNPA 3JX9A 4LDPA 1M0WA 3FVTA 1UOEA 2AJTA 2HZBA 3DV0A 2VRBA 1T8PA 5FCDA 3COSA 2OK8A 3MOSA 3I5YA 1P1JA 4TXLA 1Z34A 1NBWB 3CONA 1JHMA 1RWQA 1PV4A 5CA0F 4MPJA 1RIFA 1RHQA 4DADA 1D4ZA 1DEAA 2G08A 3CH6A 4L8LA 2YXBA 1QIHA 4JB8A 5KS2A 3AEZA 5JMOA 2UXBB 4EPXA 2POCA 1U81A 4KMRA 3BTVA 3S28A 2MYUA 4NU6A 2VL7A 1QORA 2YHBA 2ZBDA 3H04A 3WYGA 4L02A 2YFYA 2MTBA 2CFRA 2CKMA 2F8TA 2ZJ7A 3EVTA 3BL5A 2JFWA 3PEUA 5CT6A 2AFVA 1PJTA 3KRTA 5E1DA 4C6HA 2P6UA 5EIAA 3VOAA 3L0ZA 5JS1A 1RJDA 4V38A 1K9SA 1W0KD 4YJGA 3IE1A 1E99A 2O0MA 2HD4A 4RLSA 4Y1GA 2ZRGA 3CE6A 4FWTA 5KTSA 4BO2A 3HB7A 5JJ5A 3VH4A 2WQ7A 1V39A 2O4UX 3L7JA 2HO5A 3GOHA 3F97A 3VU1A 2XBLA 3CSSA 3OPXA 2P3OA 2QMEA 1PWEA 3JQEA 1PW5A 5EKSA 3K9WA 1TIPA 2H0AA 2IUTA 3CIFA 3ENNA 3TZEA 3R3SA 1N3LA 2Y05A 3P97A 3MGCA 3E15A 2DFPA 1TJ4A 1U0LA 3SHOA 3RWMB 3UKOA 5MFZA 2CJWB 2Y67A 2RH4A 1BHJA 3K0KA 3CLTC 2Z4TA 3NNSA 1GL3A 2HK8A 3ZS9A 1WLYA 1VE9A 3QELB 4DCMA 5ALDA 5DNYB 5AI0A 5TARA 2TS1A 2HJ9A 2P2GA 4FMDF 4OGGA 1NI5A 5G41A 3TBHA 2HA4A 4C3UA 1GLGA 4QYMA 1ARZA 3VR5D 1N0WA 3AVQA 1ZUNA 2GWRA 2ZB7A 3AX6A 4IFTA 4QTXA 4EYGA 4KFSA 4MV1A 4KXFB 4D7AA 1FMFA 1XLWA 1ECJA 4JOBA 3LXMA 1QHNA 3G1WA 3FCAA 4YJFB 2IYPA 1M75A 4G25A 1X8KA 3D2BA 3KHUA 3NYRA 2QI9C 2V7QA 3CLTD 2C1EA 1U1FA 2EQAA 3LA8A 3WJAA 1J2TA 3KFLA 2XOKD 7ADHA 4DDHA 1I5EA 4ITVA 1RI5A 2CCKA 4LTMA 4ND3A 2ICAA 3X44A 4GRIA 5KSOA 1SIOA 2E3JA 3H1TA 5EEGA 5LUBA 1IJBA 3VR6H 4ZTUB 1DKLA 1LK0A 3WGOA 2OGUA 5TGZA 3SQDA 2JHAA 4XM1A 4DLRA 3IMEA 1A95A 2OM2A 2QM0A 4O02B 1WHTB 1L9KA 3NHYA 2D1YA 3O7WA 2I6SA 1K8YB 5KPJA 4RTNA 1MJFA 4HXEB 1EVEA 2FMKA 3UJ3X 8MHTA 2BGTA 1MC4A 4LJAA 2X6RA 1FFYA 4BV2A 3LY9A 5DGDA 2OCYC 4YY3B 1MB0A 3A1UA 2NW6A 3BD7A 3LW8A 1IZZA 1NNLA 3BIJA 1QRTA 1E3WB 3P9QA 1U9YA 4KQKA 1FRNA 1FRVA 4WNYA 5A9TA 1YO6A 1AG9A 2VYVA 4HNVA 3T12A 2ADOA 4MIYA 2FR0A 2R85A 2EOAA 1Y3CE 3H11A 2ZUSA 3GDGA 1OH6A 2D1SA 4F38A 2VP4A 5GADl 3BE8A 1VIAA 1E8MA 2V96A 3VGJA 2HCFA 4B3GA 3N2NA 4Y2PA 3HY3A 4UCFA 4RZUA 4Q01A 4MKXA 3DPUA 2Q7OE 3FCSB 4YCNA 1O5IA 2VQSA 5JAQA 4YRZA 2PVPA 5KVCA 1ECFA 1TAHA 2Y0BA 2XDAA 2XMZA 3TXYA 1KU0A 4DDVA 3P26A 3SC6A 5K8VA 3OBBA 1ZRMA 3U3JA 1U4OA 1ESMA 1NDHA 1RTKA 4M1KA 4DXAA 4O4IF 4TWRA 4R5HA 4YRNA 2IHVA 1ZCFA 1LPMA 1K5HA 1RYZA 2C5FA 1MAWA 1Z35A 2EL7A 2VNHA 3AKDA 3CTMA 3KVNA 4NATA 2PJUA 5CNJA 3RC3A 4OHCA 4F3CA 2K2WA 4I1RA 3WKEA 1MB4A 3EFOA 3TLZA 1P3Y1 4LNUA 4MEAA 2YX1A 3I4FA 4CL3A 1UANA 5DASA 3TSAA 1G5FA 3GZ4A 1KVRA 4JEHA 4TKVB 1AK2A 2WWIA 1C8KA 3LCCA 3PNMA 3T3EA 1OAKA 1P2TA 1X1RA 1U7OA 4XCQA 1R2QA 1M72A 2QNRA 2HB6A 4JBHA 1FE8A 1JQDA 1J33A 2CV0A 1Z3CA 1OYVA 1D0IA 3A9CA 1AMOA 3JS5A 1T3SA 1Y0BA 3GJSA 1O57A 3OE7A 2P77A 3QLVC 2FZKA 2WJIA 1Y82A 4I14A 1KEZA 1GFSA 3SSAA 1E6MA 2FPPB 3HDTA 3TDKA 1XZCA 3JTMA 1Z9BA 4BB5A 5KVVA 1TTTA 3AUAA 4PLYA 3PWTA 4RD0A 3SXJA 1XZIA 4PLGA 2GKOA 5FI5A 4JDUA 3PXGA 1FX0B 3G5LA 4GE3A 4WXPA 1YB5A 2CMFA 2VHJA 1XD9A 2XB8A 4UTNA 2BE7A 2VAMA 4L16A 4WFQA 2X2OA 4NCAA 5BMVF 1NXTA 2JJ1A 4ZTBA 1HH4A 2LKCA 3IUBA 3MT8A 1HNXB 4AG3A 1N6HA 1FFHA 1ND6A 1BH6A 2GNAA 3B82A 4QREA 1FDOA 2I1WA 1T2NA 2CDRA 2L0XA 1BGXT 3E82A 4F7DA 3Q8MA 3IH5A 1UC5B 1UC4B 2RSLA 1P17A 2BSAA 3IUEA 3JQ7A 1QNLA 3ZY4A 1AUXA 2QZZA 4JR0A 4Q1BA 3ZEIA 2WVJA 1OV4A 3UFXA 2ZANA 3NWEA 1EWYA 3JRXA 4RADA 3WMRA 2I4TA 3GRVA 3B51X 1XRLA 3E1KA 4US0R 2G06A 3SBXA 5I7WA 1V5WA 3QQPA 4X5OA 5MFPA 1PP4A 3N3BC 4BP1A 5JAHA 3OPVA 1KVSA 2HPAA 3F4BA 1QCDA 1E5LA 2ZB3A 5BXYA 2BKVA 1LVGA 3AT1A 1WNFA 4H15A 4QDZA 5ED4A 5AP9A 2XQJA 3E0QA 3SQMA 4RGYA 4HH4A 3CCFA 5BYAA 1TA4A 4ZT7A 5YASA 4KN8A 1RXYA 4PQEA 4BWFB 3U7QA 3L7NA 4B4DA 4XA8A 5JFGA 3OY2A 4K81B 3Q2OA 1P6XA 2VVTA 3B3JA 3ESQA 4O2BB 4JB0A 2HDOA 3RUCA 2WJYA 4XYMA 3U9LA 3SVLA 5JSKA 4DBLC 4YQEA 2G70A 5IUNC 4DDTA 2PWZA 2GPTA 3G89A 3Q8LA 2XMPA 4FB4A 1OHHD 4Z99A 2ZIFA 2YWEA 4HMOA 1H3EA 2PS9A 3TQCA 3K9NA 5TXGA 1EAMA 5E8RA 3MCUA 2XXAA 4S1WA 3VC1A 1NWCA 4NQZA 1N2ZA 1E4EA 2OVFA 4JENA 3C4VA 3BWXA 2OHFA 3E35A 3ONEA 5IBPA 1OH8A 1KI7A 1W4RA 2WKSA 1CS0B 3CLKA 3JR7A 3LWNA 1KZ6A 3TNDA 4CZ2A 4I3GA 2WJHA 2E4UA 4PRKA 2I6QA 1J56A 3U7EB 5E6UA 4DCTA 1ZGBA 5KTTA 2I4IA 1G0NA 3QLTA 2M6RA 4CCSA 4GQAA 4K03A 2VXOA 4Y2VA 1D2RA 4HVTA 3QLEA 2JI7A 3VU8A 4NFSA 3VKVA 1CYDA 5FYDA 2GUWA 3EUFA 1NW9B 1M83A 2BJVA 2HJRA 4HDMB 5KJ6A 1N9KA 1T0BA 1PHRA 5HFJA 4HDNB 4DSOA 2BRUA 2OFWA 1OX4B 2VDRB 2YFKA 4OHBA 4WZZA 5CLIA 4ZP1A 4C7BA 2Z83A 3PEYA 2Y3IA 3UUFA 4BKUA 1BXGA 3AIIA 1EVLA 4MEJA 2A5DA 2C7QA 3CX6A 2TECE 5ALRA 5CXSA 5EXXA 5KINB 4YWJA 2ZIAA 3BMQB 1F48A 5FB3A 3W9UA 4DKXA 4MIOA 3AF3A 5CFNA 4OLAA 4U2GA 1CUCA 1O03A 2D5LA 1FA9A 3ETDA 2VPXA 3R6DA 2V6IA 4YRQA 5HM6A 4D79A 2R1TA 3KYCA 4PZDA 1J23A 3N3AC 3TCXB 4DC9A 2REBA 3HDVA 2RHJA 2QAJA 1GPWB 3MYRA 1RRPA 1S89A 4EPVA 1L1QA 3CGGA 5BRJA 3DCIA 5KQLA 4KR7A 3GJZA 2IFTA 2X5KO 4KYIB 4MZDA 2WG2A 1EX7A 4ZGGA 5BRAA 1PRYA 5LQUA 3RAPR 4OQ4A 3H99A 2XZOA 3MJRA 2P9TA 1LSUA 4ER3A 2QMQA 2AUMA 3T06B 1QJ4A 3ZWQA 4RA9B 1LJLA 3CZPA 3IBFA 3HY4A 2PZKA 1X7XA 3USCS 2XUAA 1B3RA 1L8QA 1KXJA 1M1NA 3KPWA 4LJ4A 3K4HA 4PXYA 4QA9A 521PA 2ZJ0A 1KP9A 3AHDA 3FGNA 3L8ZA 4U5XA 5A03A 1L1EA 1R1DA 2PBFA 2PT7A 3KG2A 4HBZA 3GRFA 5LXTF 4WE3A 4LF7B 5KDLA 4UUPA 4IXTA 1RJWA 4NDAA 1X14A 3C0KA 4HYYA 5CD9A 1YACA 1Z4IA 2YW2A 4HYEA 3PDHA 5EKXA 2GSDA 5TPZA 1FYVA 3ONWA 3NJ8A 4U2KA 3T7KA 5AXCA 1SQ5A 1X94A 1R0KA 5K0BA 2FN9A 1E1KA 4KXYA 4X62B 3VJMA 3GIDA 4H7DA 1UXJA 3NVKI 3R5FA 4MWEA 4B0PA 4DA8A 4I0WB 2RB4A 1QTNA 2WRZA 1D2AA 1HSZA 1DMRA 1NVEA 1DI0A 3EWIA 1UMCB 3LC7O 3LKDA 5G0SA 1GAQA 1YJBA 1L5OA 3K5WA 2VK8A 3MOGA 1QBKC 4L9AA 4XR4A 2XITA 1DTEA 3BB3A 1F0YA 3HN6A 1GN9A 2CMKA 4HR7A 5DGIA 2BTEA 3UUEA 5ALZA 4CETA 4JVSB 4YCJA 1R6TA 3TLMA 1DQRA 3RCBA 2E4YA 5AW2A 1ILEA 2FRVA 4HJXA 2VJLA 1XJCA 2BFOA 3HBMA 4X6YA 4JK3A 1U4NA 1A71A 2V1UA 4W4TA 5M2QA 4V39A 1MVLA 4WKNA 4QKQA 5EUQB 4C0LA 2WIKA 3V97A 5JE8A 1EK2A 1SEPA 1YJ8A 1RZRD 1VYUA 4EHNA 5JYCA 1VPWA 1ZH2A 1SC4A 1CFJA 2YWCA 5ESXA 1PDOA 3LZCA 2C2YA 2P65A 4OJMX 3V55A 4Z4CA 1WXXA 3N07A 4BVAA 2FLWA 3VZRA 2P78A 4ZVRA 1TZ2A 3J81k 4RDHA 4PTYA 3RKUA 4KXQA 1KZ7B 3PYMA 4C30A 3DM9B 2VTDA 2G63A 3PU6A 5D3ZA 4BMVA 4DTCA 1GU0A 1Z7BA 1WAMA 2F2TA 2GTIA 5D6NA 2R60A 2ZB2A 5CYPA 1H0RA 1ADBA 2F3TA 1YC2A 4BYMA 3QJYA 3IOCA 2ZZMA 5BVHA 3E2MA 2AZDA 4W1QA 1XGKA 1CUDA 1W0CA 2AE2A 1O4WA 4QEKA 3ZI0A 5HZKA 1YRLA 2EZ8A 1OC4A 3RTGA 2C5SA 3HZRA 1HC7A 2RONA 3BJIC 3DOJA 1TKBA 2IZ5A 3JAWB 4UM9B 5HGJA 3RS0A 3N8IA 1TI7A 1CZNA 3I52A 4M9ZA 1JKJA 3TZCA 1IL0A 4HXGA 1QFZA 2ZE6A 5B3JC 5AOBA 1I36A 1MGPA 4EVSA 2WD7B 4F8EA 4BKPA 3ORFA 3RIGA 3LTEA 3HR4A 2CNLA 5TQVA 1DC8A 1JAHA 4NP6A 2E18A 3A37A 1KKUA 1MA3A 5L3ZA 3SZ3A 1GL7A 1BIFA 1YL5A 1O6CA 2N0SA 3E58A 2HRCA 3P32A 4IO1A 3VV3A 3RSSA 2HU8A 2QT1A 3QSGA 2I33A 1DRUA 5JPCA 2F9FA 3DKPA 4O4LF 5BV1A 2P2ZA 1WKVA 1CY0A 2HRQA 2O48X 2WF6A 2D06A 5E9WA 1V2HE 1V7QA 2FNAA 2IW3A 3CGWA 4H59A 1CV2A 4TMYA 4OAQA 1N6IA 3SBDA 4H3SA 3TPFA 4DDKA 5IMSA 4Z0TA 4W5QA 1GCGA 1IATA 3U56A 2ZRJA 1N1GA 5LYJF 3BZWA 1DBRA 2PQ0A 2MSLA 1TD9A 2IU4A 2J3IA 4L76A 3HVHA 1OC2A 3AHJA 3K31A 3HBLA 1W0KA 2OG2A 4HEA6 1CJMA 4K5QA 2NO5A 1Z8HA 3STVA 1Z36A 4FU0A 4BWVA 2X40A 3ADBA 3IXLA 2M1XA 4IDBA 1QFSA 1C7FA 1RJ9A 4P3NA 2GEKA 2W2KB 3IRUA 3LS2A 3MTEA 4BC0A 1E7MA 3K0CC 1Q0UA 2AIRA 3RO7A 4AQYB 2P6OA 1O6GA 1YR8A 3QUBA 1LDYA 5T6BA 4A8JA 3V8BA 5IJZA 2WWYA 3FCXA 3BHIA 1SFRA 1MABA 3EPJA 5KYKA 3G2OA 3GEDA 3UJDA 2WICA 3VJKA 4BVKA 5B5SA 1AMNA 2WIBA 1TX4B 4MJXA 1JMKC 4MSUA 4QXMA 2A7QA 5D3MB 4R2HA 3U13A 2JFZA 2ZI3A 3HJHA 1GQFA 4LJYA 4UJ3A 1QAQA 4U7TB 1ADGA 3CVJA 4V03A 1M0EA 4XDZA 4G8DA 4G9GA 3VR5A 1NVVQ 1RM5A 1A27A 1PU2A 1L4UA 2J48A 1TE2A 1MFZA 1R4NB 1IFXA 1YAJA 4A82A 4CHTA 1HUQA 2HEGA 3LO8A 2FPWA 4MPPA 4NQRA 1J25A 1Z75A 3DEHA 2GXUA 2AT1A 1WB9A 1EJ0A 5THXA 1QZXA 2ZYDA 1EEHA 1A77A 2JCSA 4KXNA 4C0JA 3Q8KA 3KLOA 4S35A 3QM1A 1VBKA 3MJTA 2XOKA 5IZ4A 2QR5A 3R44A 1RHRA 4IZIA 2CT8A 4BN4A 4FCCA 1LDBA 1VP3A 1NUAA 2AWOA 1YS2X 4V3BA 1YCFA 1NE7A 1T2UA 5TT1A 4HHEA 4TLBA 5DCUA 2C2XA 2IEZA 2GXQA 4OY3A 4PS1A 4I50F 4ZARA 3RRBA 4I2NA 3ROFA 4BV8A 4EVIA 2WTUA 2IHNA 2E85A 5JZMA 2G72A 4A8HA 3QWBA 5HCUA 4ILKA 1TPYA 1CPYA 1YR6A 3KDAA 1CUGA 4NDZA 2HUNA 4X8LA 1X8LA 2P5YA 3FVVA 2QEQA 1ZK2A 4H3HB 4KNYA 1L7VC 5IASA 1WBJB 3THOA 2C2OA 4XFDA 4TLEA 2O8CB 4OQZA 4GT1A 1YVPA 3DFUA 4OMCA 3PPXA 3PNYA 3K09A 1CP3A 4ZQIA 1DBWA 3KOYA 4FHZA 5I9IA 1Z2EA 4OGKA 4EY5A 5KYYA 4J4TA 2UYHA 2RGDA 1LFAA 4ZT4A 1MJGM 2REXB 5FBVB 4FYJA 1DRWA 4UHCA 4MMZB 3ELDA 1Z6TA 2E1PA 4FFOA 1IZ7A 1YB2A 5B53A 3SQLA 3F49S 1ZC3A 4B3XA 4MUAA 2A78A 2JLBA 3FN4A 3ZD6A 1EFTA 2OZLA 4JL8A 2Q21A 2ANBA 3SKVA 4BFWA 1YZNA 2O20A 3PZBA 5AVRA 1FDSA 1DJLA 4EJFA 1RKXA 2NIPA 1VI6A 2AC4A 3SF0A 2C5AA 3CX3A 1ISHA 2PU5A 3E2PA 5SV2A 3EGWA 1BCSA 4FEAA 4RVDA 1CZLA 2Y4NA 2XA1A 1A4IA 1DEXA 3C7TA 3H3FA 1OWPA 4EARA 3ZWOA 2B21A 2EWMA 4Q05A 2OOKA 3P2JA 4M6WB 4BNVA 1O0CA 1ABFA 1NI4A 2VBFA 4A3SA 2W37A 3NIGB 1S8OA 721PA 4UXHA 1GLVA 2YXLA 2D3TA 1Q1BA 2W6PA 4GM1A 4RK6A 1TVCA 5I7SA 4KOAA 1S0UA 3DBRA 1FJGB 2FEOA 1Z6XA 2C7OA 6REQA 2F1HA 3BQMB 1QANA 2VBIA 4WOJA 4EUKA 1COWD 1QM5A 4HFNA 2F55A 4TLLB 3BL6A 3FYCA 3PXCX 3RG2A 1DOHA 2JB9A 3NP9A 4EY8A 2BGNA 3H2ZA 1NSTA 1X80A 2YY6A 5C32A 1PJRA 5IU6A 1DBVO 4ZAWA 1WSWA 5J1SB 3N8GA 3WP0A 2VSOA 2GEBA 4G5OA 5F35A 4K9OA 2EBUA 5AI8A 2WWRA 3ZHYA 3LLUA 3OZWA 3DEIA 4FE3A 4JLJA 5F12A 4XM0A 3LGSA 1X1BA 4XWTA 3T3NA 1VLQA 5EUBA 4KV9A 5KWJA 1AUOA 3P45A 1OW3B 2E82A 2HU7A 3WICA 5E3IA 1N2IA 1B7GO 1WU7A 4LZJA 1THTA 3NG1A 1J5EB 1IMJA 1OTHA 1W35A 4OUDB 5E1MA 5LZ9A 2EW2A 1FU4A 1M6EX 3OMLA 2AOTA 1M76A 2MHCA 1WR8A 2VSNA 3B3GA 3B2NA 3H3XA 2C99A 4WDRA 5EXPA 3CWZA 5GM1A 3OM1A 3QENA 4G1BA 1WXDA 1E1DA 2FKAA 3BSWA 4ZI7B 4B3JA 1GO2A 1XZHA 1IVNA 3AUYA 2O7NA 3M3HA 2YBEA 1V4BA 2JVKA 5GZ3A 3OQIB 4NAUA 3R2JA 1Y4ZA 2B61A 3QLVA 1CQPA 1IBSA 4TYWA 2E89A 3L7CA 3NB0A 2FEAA 2VQ6A 4P98A 1JHQA 1OQAA 3LZDA 2BEWB 3VPDA 3C48A 1EJBA 3BZBA 5JBIA 3EAQA 4E88A 1T3LA 2DPHA 4PIPA 2XE7A 1SD1A 5AK5A 4JX9A 1DIOB 4ZYLA 5E6SA 2O3UA 2PS3A 2HBYA 2OBNA 1DARA 2IIVA 4LPKA 4RUKA 2JLVA 2R6GA 2CVQA 2B0JA 3OQVA 2HCBA 2HV8A 3NAZA 4BNUA 3LH5A 2GDZA 4QUDA 3X1JA 4CU2A 4GPTA 4ARSA 4LJ8A 4URWR 2XSZD 3ND5A 2P3SA 3R41A 2BFDB 2FUEA 1R9NA 2LPMA 2WUGA 3NUGA 1SIBE 2CHUA 1M34B 4TYMA 3JQAD 5B55A 1YT5A 3PQ7A 2DBZA 3AIMA 3FYTA 4KDFA 3JQQA 4IINA 1JRLA 2AUNA 4LIPD 4X7PA 3C6YA 3UFBA 2W0MA 1S8FA 1IBRA 1MRNA 2R1ZA 2YIVX 1RC0A 4QD3A 4FJ2A 3VDNB 2V59A 2C4MA 4IOKA 3A9SA 3AESB 1FU8A 3C3YA 3DHWC 1C3OB 3EQZA 3L8DA 3M33A 4I4TB 4C14A 1KPIA 4ZK6A 3NT5A 2IGTA 2IHBA 3VH2A 5C1BA 2O3TA 3NT4A 4XARA 2Q4OA 4KXUA 2J3QA 4WQMA 1PTJA 1N0UA 3I72A 3IJ5A 2GK4A 4ZVQA 2YASA 3GUUA 4CF6A 4EK9A 1H6AA 4P31A 2VHZA 3P9KA 4BZPA 3A4TA 1WDKA 2FFJA 4H7JA 4CYMA 1XQ9A 1ST2A 5JMTA 1JG6A 3HR7A 3E9ZA 4E2ZA 3M6XA 1G8PA 4UMDA 5KBYA 1P1RA 1OLXB 4O4HB 2AW5A 4QG3A 4BFSA 5K0GA 3A6PC 2B4AA 1V1RB 2WJ3A 2V7PA 2P41A 3PA8A 4MS4A 4QXOA 2RGBA 4F7WA 4G4GA 5BR1A 3DVRX 1Y4UA 1Z0FA 2ODTX 3V1UA 1TUBB 3MELA 1N3IA 2AUTA 4GVLA 1UQRA 4CVNA 4JI1B 3AHIA 5FPSA 1P62B 1FVFA 2VDLB 4C43A 4LI3X 1EVKA 1QIGA 4S2EA 1WU8A 3QH4A 4M7WA 4BAUA 1QJCA 4Y2JA 4KVAA 2O8EA 4LXYA 4BUCA 5TLSA 1K08A 1AQLA 2OHIA 4KGXA 5JIBA 1F1JA 1LU9A 3RFXA 2O2XA 1RI2A 3N8NA 1M7BA 2J3MA 3OX1A 4FXPA 3B7PA 3B52X 3EZ7A 3N2KB 1ZCJA 2EEPA 5L3SA 1G5IA 2PMCA 3IERA 1JR6A 1PJ4A 3D7KA 4R2MA 1YQTA 4CIVA 1W49A 3X43A 3FYUC 4LJKA 2WM2A 2JIRA 3I6YA 1Z5VA 2X7JA 3HJTA 3M1LA 3EIUA 5JZSA 1KEKA 2O3RA 4BQEA 4EFLA 2RHTA 3TPZA 4K40A 1SQGA 2C0CA 1W85A 4KGDA 3V4ZA 2VJMB 1ANKA 2C82A 3KEMA 3VPXA 2HMYB 3AR2A 3TCKA 1X15A 5CR9A 4FK8A 4M0MA 4BFLA 1J20A 4W1PA 3U26A 3MRVA 2FMXA 1JA1A 3A1DA 1W59A 4QQNA 3L05A 2BZ0A 1H4SA 5K45A 3AKZA 2PMDA 3BH7A 4PPGA 2NUPA 3BIFA 3FWHA 4Q4LA 2O8NA 1HF3A 1K7XB 4O08A 1IM2A 1TJ5A 1I2CA 4O5OA 4QRHA 5KYTA 1G41A 1UIRA 2D13A 1PFVA 1YJAA 3IODA 4GC9A 3RIYA 4GVXA 2AMYA 4Q3AA 5EP3A 2VATA 5FBZA 3WLEA 4DPKA 1WBDA 2Q1WA 5A3VA 1E3MA 3M2TA 4H7IA 1F7VA 3EFBA 5EQTA 2GYWA 4UAJA 3ZBTA 4H7FA 2AKYA 1LQ2A 1Q77A 4OJQA 1BYUA 4JLPA 3C39A 5A3QA 3LPLA 3WHIA 1Z7WA 2GA9A 1RM0A 1YQWA 1BWPA 1VCOA 1WUYA 1Y4DE 1C2TA 3V8MA 1NM5A 3HYLA 3KZMA 2OLEA 4X6XA 4B17A 4XD2A 1NUHA 1NBMD 2I29A 3ELYA 2VP9A 5K8IA 3OIYA 1RQLA 4I9FA 1T34A 3LY8A 5FOXA 1DZIA 2QZJA 4B32A 4DMHA 2IYXA 2SECE 3AZQA 2HX1A 3B6EA 3UO8B 5IFKA 1AQJA 5FWXB 3NMUF 3SIPA 2C58A 4HC4A 1Y1SA 3ZKWB 4ZT2A 4A6DA 1J4AA 1U7ZA 4ZVTA 3KSBC 1NNUA 4NOJA 4QOEA 4Z4IA 2B2XA 1N2CB 2QAIA 3TNLA 1KSFX 3SHFA 4ZRDA 1XRSB 2CD7A 4HVAA 1A3CA 1SPBS 2CHVA 4FW9A 3FDJA 2ZUWA 3QMPA 2HTFA 1T26A 3AXTA 5AM5A 3TZHA 2DUJA 5CA1F 1QRSA 4BQFA 4BGDA 3I1YA 4Q39A 5G2OA 3RVNA 2GT1A 3Q3VA 1ZEJA 1N0IA 1BH2A 4J1NA 4M55A 3TWOA 1CEXA 1MHPA 2FVYA 2GBPA 2VP2A 3H3JA 5AHKA 3ZZUA 5BSVA 1OI4A 2NTYC 1RS0A 2LCIA 4R71A 4PHHA 1SOMA 5FI3A 1M34E 2GX6A 5H70A 2IS2A 3CF0A 2R6CA 3N75A 2PSEA 4MUBA 4AFNA 1U11A 4XD7D 1DXHA 3DHYA 2VIIA 1GJRA 1GG8A 1B8OA 5FL7D 1QTRA 3Q3CA 4QWWA 3A27A 5EHIA 1MO3A 1KMHB 2MSNA 2FPGA 4OHZA 3U61B 1YF3A 3B3QA 3K8ZA 1KE1A 3A28A 3DDNA 1KYQA 3F74A 1OE0A 2OYSA 4G1VA 1RZRA 1MD9A 3H5NA 2IPOA 2ACEA 2V5AA 1S9DA 3LUGA 4QL3A 3OE4A 4V2IA 4GBMA 1AXEA 2O14A 2RGCA 3T95A 4EQ6A 5I3CA 2EGHA 1OWMA 3WMGA 2BFNA 2GM9A 2ES4A 4JLSA 4WPGA 3W78A 1NQ5A 3CEPB 3Q1KA 4KTTE 1CEYA 3R5XA 4IR7A 1LSJA 2IYAA 1AKNA 1YR3A 2R7MA 4HQNA 3WV4A 3KYDB 4LVOA 5FADA 1EGHA 2A35A 4HX5A 1P72A 1EBFA 4NL4H 1K63A 1P3JA 3V6MA 1OMOA 2G1UA 4XQ9A 3ICQB 3CKKA 1P7ZA 1HNNA 2JKYA 3HRIA 5J1TB 1ZVVA 4D9FA 5BMOA 4NZZA 4BX9A 4BNXA 3A3YA 2CHFA 4A0SA 3UAWA 4K05A 1MDBA 2YUIA 3JYHA 1G8MA 3KR9A 3TLXA 1GDTA 5DSXA 4II3A 3FMVA 2OAP1 1XN4A 4EW6A 2PIAA 1QKKA 4YMSA 3RFVA 4CEJA 1YI1A 3OICA 3JQBC 2YFHA 3PDWA 5CVTA 2HNBA 4Q4AA 3BMNB 4JASB 3UJ6A 2H2WA 3AEQB 4RDCA 3ANTA 1ECBA 3QUAA 3GRYA 4II2A 1RC1A 3KTFA 4CV3A 4UE2A 3GQVA 1LDNA 2GZDA 2CV1A 4WK2B 1PJLA 2W6QA 3ITNA 4Z8XA 1USWA 5E0KB 4F11A 1YFKA 1ZOIA 5BN5A 4GNRA 4AN0A 5K4AA 4OQMA 2QT9A 4R2IA 2W00A 2M6SA 1SXJB 5HMMA 4I55A 1PNRA 3RT1A 4M0EA 2ETXA 5IAEA 3ZK8A 5FA8A 4IL5A 2Z2ZA 4IH9A 5B3JA 3WGUA 1R5BA 1F6WA 4XDGA 3IQZA 5B4VA 4HUQA 2H4XA 1V1JA 3BC1A 1XMPA 2PWPA 3PHLA 4WLEA 2ZJ3A 5CHYA 5I48A 2GM4A 3AHEA 3G5MA 1YKSA 4Q9DA 4YAEA 5CYGA 4MJ3A 3D3WA 4OFBA 1Q74A 3BGVA 4Y1RB 2BFCB 1AGRA 4N54A 5E6RA 4BWGA 2GUGA 1ISIA 1DIRA 2TMYA 1ABBA 3H13A 4CG0A 1U94A 4ZANA 3AP2A 2ISSD 4Q7KA 3F2VA 3UNXA 4G4SO 5B7GA 1J8YF 3EG5A 2CK3D 2W42A 3ZXIA 4I5FA 3C2QA 4CQLB 3HUTA 3IAM1 3EZXA 2WPNA 4YMVA 3PQ3A 4BCCA 1CS4C 2HIAA 3ER9A 4Z86A 2Y9MB 3SYRA 1L5GB 1GCUA 2V0GA 5JXGA 3ZY6A 1GYQA 2J9GA 3I30X 5B1DA 5IC5A 5JYBA 3EPHA 4IDQA 3MINB 4NOMA 4U1RA 5I7UA 2WMNB 1Q1ZA 1T4MA 3G7SA 3L7BA 1ZEMA 1ZH4A 4LJ6A 1SCQA 4LRYA 3UQYS 3RC2A 1FFXA 4CNBA 1PCXA 2PRYA 2R68A 4LXUA 2HRRA 3K0CA 1J42A 1AA9A 2JEOA 4UXIA 3TLGB 4C9BA 4BEBA 2C7BA 1D8AA 4XLLA 5DJ5A 4GOLD 3WBFA 4IV5A 5WRFA 2WILA 5CBKA 4QYTA 2B30A 1VA4A 3AF6A 4MR9A 1PR4A 1HV8A 1PD1A 3PQEA 5D7BA 1SBTA 3AUTA 5FOVA 4A2CA 5KQSA 3U4DA 2VPZA 3GJ6A 4RTSA 4IILA 4JC5A 3MWEB 4AG6A 1R0XA 2ZB4A 3O0TA 4RF3A 3FOAA 1N2CE 2QTAA 4EAQA 5IVDA 4OFZA 3A9RA 4J3JA 3BUSA 3LUAA 1UPFA 4ZC1A 2QA5A 5C7IO 2OCGA 3O4JA 4MTLA 4TSKA 3O8LA 4GX0A 3GC6A 4O2AB 1H3NA 1GUFA 3GVPA 3N8KA 2Y1GA 5DM4A 3MIZA 1XUOA 1EHYA 3HP4A 4E32A 2H1VA 2H0QA 2VJOA 1RWKA 4NEHB 3UGKA 4F93B 3MMSA 3QEOA 3D4IA 2I78A 1XA3A 3TLCA 1HRKA 3S1LA 3W5JA 3E9QA 4MLZA 1ZMOA 2XKAA 4CNQA 4EHBA 2XZLA 3VKFA 5H4GA 2ETVA 1XMIA 3OTGA 1FQKA 4RU1A 2KW5A 3G68A 1JE0A 1R5NA 5B2ZA 5TQ2B 5DP1A 5FUMA 3EYAA 5HSGA 2QLTA 3HUFA 1LBEA 3LLVA 4BJ5A 4MJ7A 1JR4A 1Z25A 3W06A 1VL5A 5BSHA 4OYYA 4RJIA 4KREA 2EW1A 4WHMA 1T9BA 5E3HA 1IUPA 1JLHA 1I4OA 4P7JA 4QBTA 3C97A 3QX8A 2P2SA 4GICA 2MCFA 2ATEA 2O0JA 4MW4A 1DKOA 1P73A 1ZUD1 5HKAA 1UMBA 1PL7A 1E9FA 2P62A 2CNOA 1A4UA 1BMFD 1M6WA 1ULHA 3DBLB 4HXFB 1GL6A 3BL8A 1L5KA 3D8HA 4GIBA 2J0UB 4DGQA 1C1DB 3L1UA 2UZ1B 4KK4A 3EC2A 1KEWA 4N49A 2PBZA 2QTCA 4S2UA 3HKBA 1IY0A 3G2MA 3CNOA 3AW9A 2HFKA 1K3TA 4DW8A 4QNNA 1JWLA 1QR2A 2AN1A 1EFVB 1TM4E 3ZTWA 2X7XA 4U7GA 1FW8A 3E5RA 2PR2A 1XRNA 4X7RA 1JEQB 4PGMA 4Q3LA 3X1XA 5ICMA 3DLCA 4QTTB 1VTKA 5A2GA 3WXMA 2O8FA 1KE2A 1XU7A 3HPRA 1OB5A 3DOHA 1DAIA 2GO1A 3LRTA 3OIUA 4IHJF 3V9AA 1CETA 3OE1A 2Z6AA 2HXYA 4J4HA 4RIHA 2IH2A 3WYCA 4M54A 3HKCB 2UVPA 4GNKA 4RTOA 3DWIA 2GZ3A 4B4OA 3IO5A 1MC1A 3EUEA 4EW1A 1DWOA 3B9RA 2VSXA 3IP1A 3DZFA 4RCVA 2AZXA 3ZW9A 4DA4A 3IDSA 2PZFA 2W6OA 3HDYA 3IBYA 4I4IA 4P3PA 1JTFA 1E59A 1COWA 2BFMA 3QOFA 4M0LA 3N8DA 5FWAA 3BSYA 4AP6A 5JFTA 1CY7A 4DV7B 4W6ZA 5EQDA 4M9SA 3W6PA 3ZIAD 4W99A 4DIEA 3OLCX 3NRJA 2J3DA 3M0EA 3AO0B 2V7TA 1F4PA 3FZQA 4E13A 2E2WA 4WUVA 2HMAA 1FNBA 3ADDA 3G7NA 1G8SA 1SXJE 4TQUS 4AYTA 1R0BA 3N7AA 3P4YA 3P9XA 4JYPA 3KEQA 2YY7A 1NJFA 1RYYA 3KUKA 5P21A 3TLYA 4ILEA 3WLRA 4HN4B 3ZBPA 2O59A 1XQWA 1YZVA 3L82B 4PC1A 5K0SA 3NBUA 4NE7A 2ZAGA 4K9PA 5KYXA 4LE2A 1FBTA 4Y6OA 1CNEA 4F2PA 2BBWA 2VH5R 5DI3A 3UY4A 2WYWA 2ZRAA 5LQJA 2YYYA 1J39A 2AXPA 4NEGA 4XPIA 1M2NA 2NU6B 1JEJA 3D4PA 1IUKA 1LPAB 3K8QA 3LUDA 4NNJA 3UCEA 4EGJA 2NO9A 2Z9BA 3GEPA 3QITA 1NQWA 4N6OA 3DB2A 1RMTA 3FUTA 4TRRA 2QV7A 1KZGB 3EWSA 1H2YA 1K88A 1CEEA 3FMGA 3V4LA 2WF9A 1A1SA 2ZZKA 3PUWA 4HY3A 4LQ4A 2JK0A 4F8YA 4A5OA 1EZZA 2Y0EA 2IHUA 3JALA 2NNWB 2I6TA 2O1WA 3A9UA 3CB4A 1ETUA 3NHAA 1R0YA 1VPVA 4JOQA 4KB5A 4L5AA 1KSJA 3B9BA 4WFIA 4WJLA 2GEJA 4D3ZA 4JC8A 3WTCA 2XSZA 1XVIA 2CLOB 2FJUA 4KDRA 3INNA 1TQ4A 4WOCA 4YH1A 5FJJA 2V3CC 4C6RA 2XTAA 1RKQA 2CL5A 2EKQA 4H7KA 1I6LA 4E51A 1VZ2A 2JGEA 4I1OA 3WJ7A 3FROA 3KVOA 5K2OA 1ULTA 4KXVA 3QI2A 3JQAA 3TL2A 4OMFG 2AR9A 4EEKA 3OWXA 3SVZA 1FL9A 2VPTA 3MK31 3ONVA 5JVDF 3DDZX 1JQ3A 1O6BA 1P77A 1UFKA 1X86B 3IR5A 4FJ1A 3W5IA 4AZSA 4G89A 1PUJA 1ATIA 1UEIA 3OJXA 4UD6A 2F3RA 2Q6VA 2BFBB 4N03A 3GLTA 2VTVA 1SUPA 2YZKA 2C2KA 4DR5B 2B8NA 1Z0KA 2YHIA 3QXSA 4IDNA 5A4IS 4GSKA 5CDSA 2V9PA 2C5LA 2DG2A 1V6CA 4LNHA 2IDMA 1TAGA 3WSTA 4BASA 4IVNA 3ZE1B 4F6RB 1RXEA 4LUCA 2G6TA 2JGJA 2GF2A 3IAAA 3OPYB 4HNUA 5HA5A 4JJ8A 2ZJ1A 3G2HA 4K2AA 4NNPA 3VHQA 3QLJA 2OB2A 3DT6A 3GA0A 3WB0A 1K8XB 1KJ8A 2A0FA 3ISVA 1KVQA 2OFOA 3OFND 2P2CA 5FFMA 3L8GA 4AECA 3N0VA 1SZPA 3TX2A 2E4WA 2AG0A 3AQ4A 1U8XX 3PNOA 4CM6A 1MG0A 2XRYA 1TTHA 2M98A 4WA8A 5F9HA 1MDFA 1JILA 1VSBA 1YDWA 2PT6A 4WNAA 1E7RA 5IUKC 1L4LA 1RQPA 2ZQZA 1T6YA 3GMIA 3H83A 1GY8A 1MRZA 3UWMA 5KDOA 3MS2A 4KIJA 1XZPA 5CLFA 3RB8A 3RU2A 5IJ0A 4RTPA 2PWAA 1PJ2A 3I8XA 4EMSA 2R8ZA 1JBQA 1QIEA 3L43A 3PTZA 1TF7A 1E9SA 1XB2A 2XUKA 4KN9S 3SBOA 3T9AA 1GUDA 3V9PA 3LMKA 2OMKA 3ON5A 1HQYE 2FR8C 3KO8A 2NU8B 3QBJA 2DULA 2A33A 3LDUA 1S9HA 3WLNA 5K09A 1IM8A 3QKIA 1HG1A 3ND7A 5H82A 5NLLA 5CLLA 1IDN1 1WW3A 3BMOA 1F8GA 3LUHA 4HWOA 3RRYA 1E2LA 3OQ1A 4YV7A 4ZEMA 3KTOA 4QBGB 4GMFA 3QJ5A 1QHHB 5JADA 5IMBA 2JIBA 3FIUA 2XEXA 3RGWS 3NHMA 1YB7A 1TXGA 4EJSB 4K1XA 1G4UR 1I2ZA 2PGDA 3IR7A 3L8FA 4JJIA 5D3QA 2KBFA 2WUEA 4HDSA 3O03A 3VUEA 4AXBA 3DAFA 3ZVRA 4EGCB 1DV1A 3CBGA 3LO5A 3N58A 5AM3A 5KQPA 5KTKA 3TEFA 1CHNA 1F60A 1P2VA 4JU9A 4OO3A 1QV9A 4L27A 4IJMA 3T5MA 4NBKA 4JROA 3WWCA 2Q29A 5AJYA 1SKUA 1HDCA 1X7ZB 3DD5A 3R4VA 4FNOA 3FIJA 3OU7A 4L08A 1QGDA 1UKZA 3K6JA 2EGUA 2PQ2A 1XFDA 3ILSA 1UXIA 4KMMA 4JHXA 1NYRA 3WHPA 5EKTA 1G3RA 2VDUE 4REOA 3I8OA 4JVOA 4WUTA 4D4HA 1NSYA 2WD8A 3TQSA 1TPZA 3GXOA 5BYJA 1U1DA 4RE5A 4ZEXA 2B2NA 2PIDA 3NDRA 1WCIA 4H6WA 4D5EA 1P1IA 4AQ7A 2XGJA 3BGIA 3F9CA 4O8CA 4B8ZA 1W5EA 3M7IA 4HMPA 4RENA 1DFGA 2QE6A 4YQZA 1T2DA 2Q4DA 4FX2A 4YJ2B 2OVBA 3I6QA 4U2BA 4YA6A 5A4KA 4ZYVA 3PWZA 1JDJA 2PFGA 1NBMA 2WDPA 4QU8A 4PAGA 5HJEA 3QHPA 1F5NA 1QC5B 2O06A 3PPVA 1SHZA 4U00A 1N7JA 3WHKA 4BFCA 2YZ7A 4EECA 5KTRA 3ND9A 1NRJB 3E5MA 3S70A 1NUSA 3PNKA 1EXDA 4O1HA 4V0KA 2X22A 2WIGA 3WK8A 4PY2A 2OMEA 4UASA 1V3VA 2AMJA 4C7KA 4FW8A 3SZLA 5CLQA 3UAVA 2ONYA 3H19A 3EPKA 4RHTA 2R48A 1EB9A 4MGKR 4AP9A 3F8SA 4QXQA 2O8VA 2O57A 2FEWB 1X9GA 4ZQBA 4XYLA 5AVYA 4TL9A 2VSFA 3BCSA 4RTRA 2VTBB 4DUZB 4FIZA 3ZDFA 4JP8A 4O2RA 3RHTA 2J5QA 2ZOSA 3V00A 4LE0A 4W8GA 2XUPA 3ZS8A 4FB5A 2AEMA 4OB6A 2FUG1 1H9BA 3WLQA 3R3VA 4BGVA 5FA6A 3O21A 2Q1YA 4GWKA 4AJPA 1TF5A 5IUJC 1KOFA 1QH1A 1JSCA 1XNHA 3R7WB 3GJQA 2YWFA 1CUAA 4LXHA 4ME6A 4P7BA 5TF0A 3RBAA 1FSSA 4EPYA 1YL6A 3CKLA 5K03A 1SVWA 1O9GA 5MN5A 4RJJA 2H5EA 2CYAA 4JZYA 3T5AA 1JG3A 4XD7A 3U1TA 3NBMA 4MV6A 4NECA 4AYXA 1O97D 2EZ9A 1KKMA 4GMDA 4L8FA 4P3OA 3MPUA 5FL7A 5A9SA 1U80A 4GLFA 3T38A 3OZDA 2G1KA 2ZSJA 3T52A 4JYMA 5JAUA 1ONBA 5DXJA 4LRXA 4F6LA 1N4AA 1QLWA 3H5VA 4X20B 4KO2S 1OAOC 3EXIA 1N6PA 2BCEA 3OQ6A 3VNSA 4R01A 5CCXA 2Z0MA 4PG8A 4AMYA 3EOZA 2WB2A 1WS6A 2J9FA 1N2EA 3PUIA 1T3HA 1R74A 1DT5A 4GXQA 1W8DA 2QVZX 3H2JA 2R0QC 4MRSA 4TS9A 5CM2Z 3EPPA 1B26A 3W90A 1NVVR 3VVBA 2P5TB 1YH3A 1P6UA 1NZDA 3FWZA 2BTOA 1JVSA 4PQYA 3H1FA 2RHGB 3G02A 2B2CA 4HQFA 3H2BA 3TR5A 1SHKA 4RACA 4B71A 4NENA 4P0TA 5EIWA 2IKSA 3DG9A 2PL5A 2QUKA 1SR8A 3BX1A 2IV3A 5CX1A 3LCMA 4MA5A 2J32A 2G7ZA 1ZOLA 5JTUA 5C4MA 1U2PA 4IGKA 4AUEA 3GVXA 5EJ9A 2WU0A 3PR2B 1O96A 1KEPA 1OYWA 4FI3F 5K8UA 4YYZA 4NNOA 1US8A 4DSAA 2C61A 2Q9CA 1BO6A 3Q6NA 4N5LA 3GARA 2WPDD 4IMRA 1DQSA 4YDHB 2O8CA 4ZN6A 5F3DA 4QJIA 3VOSA 3GCZA 1OI2A 2ZIXB 1LBIA 1Q92A 4MQMA 3ICEA 1SVLA 3VNBA 2ZRQA 5K6AA 3NBYC 2F90A 3HFSA 3ICPA 4G3XA 2JI6A 2VDJA 3FLEA 4AZ3B 4R83A 5HYVA 2PANA 4MS1A 3AUFA 1OFUA 2IW1A 5CM9C 3JQBA 3T3OA 1TYZA 2CLKB 1XDGA 3PGA1 5COQA 2C4VA 1X7GA 3A26A 5IVKA 4HTFB 5JI3E 1DHTA 1M6VA 3ZWKA 1XJ5A 2E37A 1M2FA 1S2OA 1UBMS 3O73A 1FNMA 4LVCA 3SD7A 1T0PA 4JZKA 1AC5A 3A9TA 4FWBA 2ONJA 4A0RA 1Z18A 1UBTS 2DR0A 5D1HA 4HFJA 1V6AA 2GEUA 2W83A 2P11A 2VUTA 2H57A 2GVDC 3GYGA 3KPUA 4FE4A 2HIHA 4NCJA 1FC0A 4PQRA 4QTUB 3WA6A 1TQDA 3CTPA 1H4TA 5ALYA 1M8KA 2P2YA 1Q50A 3BJZA 2ZSBA 4PGGA 4CF7A 2A9JA 2EARA 3UV6A 4ZDWA 5EWLA 5F7XA 3KSZO 3WIDA 4CCWA 5B7QA 1XC7A 3PEFA 3BJMA 3THYB 1KDYA 4DTIA 1D9ZA 5EUCA 5F2NA 1PI3A 3DFKA 2XYQA 3X3HA 4QYIB 1T3GA 4OHOA 5JAPA 3OJOA 3T54A 5JYDA 2H2IA 3ZDRA 5CBPB 2Q9BA 3TSYA 4IKPA 5ENDA 1SVMA 3LQRA 2XZTA 1DINA 2JAWA 1BKYA 4KH1A 1IEWA 4HD8A 2P9QA 3CPJB 2DBYA 3EIXA 1XRJA 3ANMA 1SELA 3O84A 4LQDA 4EF6A 3TPCA 3OZ7A 3N6RA 2FPSA 3GEEA 4YJ3B 2WAOA 1TECE 5C1PA 2MYNA 3OFSA 4EHJA 1JXQA 2Q9AA 3THRA 2H48A 4X71A 4P3KA 4EJ0A 4MYCA 4F46A 6PFKA 8ABPA 1LDGA 1KZ4A 1U0RA 2CEKA 3CUVA 1GNTA 1O5OA 4H7HA 3G9TA 5LA6F 4BJ3A 3A0RB 4A36A 1EDOA 3WB9A 2Z3WA 1K7CA 4OEHA 1U8ZA 1L6RA 1Y33E 2Y1OA 3LVFO 5C4GB 2ZTHA 3C8DA 4IXDA 2KBEA 4JOCA 5C34B 5EIEA 5HE9A 4A6PA 4N76A 4ADSG 4CU5A 5C8YF 5A4MS 1OGIA 1TFUA 1V37A 1HBJA 4UVDA 2ZM6B 4OBBA 5DPMA 1OFVA 1G7CA 1DPFA 3QTTA 5JMPA 5IC6A 5JNSA 2GCGA 3KZXA 3WFIA 3NCHA 3WKAA 4DA6A 3KETA 2OD7A 3HABA 1YZKA 3WDSA 1YQXA 2X0NA 1J8QA 2EWWA 4MI6A 3GFFA 3WMEA 2JCVA 4R0VA 2JJYA 2ZIUB 1I80A 1XMJA 2VDOB 3HEBA 4GHWA 4D4GA 4MW5A 1UWVA 2R9VA 2RAPA 2J09A 1H94A 3NDJA 5DBIA 1BSVA 3DBIA 1ADCA 4G0OA 5CHEA 2V7BA 2KYRA 3A6FA 5EXSA 4IKOA 2VZ8A 3SSNA 2C94A 4Y9UA 4MYDA 3D64A 2EJVA 1BMFA 3ZLJA 3SQWA 3H8WA 2HHLA 2P67A 5ALKA 1RXWA 1DAEA 1RAHA 1YZGA 3QYJA 3VAAA 3IPYA 4KHZA 3JY6A 4JUDX 1KMIY 3N05A 3FGZA 4E46A 1Z2AA 4L6IA 1H0KA 4WVLA 3WNQA 3HACA 2DPXA 3MJHA 4HDKA 1F38A 4DABA 1TUEA 3EARA 2XWQA 5F1OA 4HQ0A 5A0FA 3DAPA 4PHTA 1GA4A 2VDNB 3D3KA 4BLUA 1QIFA 2Z2JA 1BDIA 4QYWA 4Q12A 1W5AA 1EXWA 3B3AA 3EA4A 3EGVA 5M3BA 1O95C 5FTWA 3FYSA 2B8EA 3RASA 3K9HA 1Z0DA 5CB4B 3OOYA 2NQ8A 3B6JA 3UHAA 3PV0A 1YCHA 4NIMA 4QZVA 2NSJA 3G79A 4I9NA 2FRDC 4R16A 3DVSX 4NYMQ 4CW7A 4PZYA 2PUBA 3WGJA 3GRZA 4IS3A 3F8TA 3K1AB 3CZRA 2YZGA 2BZGA 3FHJA 1B0UA 2QENA 2GN9A 4I1IA 3UF0A 3V3TA 3HKDB 3JVVA 3ZIAA 4E22A 4OQQA 3KQOA 2HDHA 4TRJA 4KMSA 4PQGA 1R00A 3EXFA 5A02A 3ETCA 5I45A 3F3KA 4RELA 1Q16A 3QW2A 2B36A 3GWZA 3ODPA 2GO7A 4NHOA 5IT0A 3CZ9A 3AUKA 4US1R 4GI1A 4G0QA 2GQ0A 1KFBB 1KDZA 3ZY3A 1KO5A 2NUAB 3KB2A 3UBTA 1NW7A 3VSDA 4EVRA 1IG3A 2RBKA 2C83A 3RTDA 3KKQA 4ZGBA 1EK6A 1NJGA 2EHJA 3N2YA 4LJ9A 5DEOA 5GIPE 1SUDA 4FMCF 3QVMA 3CUSA 2YXPX 4N9QA 3ETGA 1SIUA 4Y6PA 3UENA 4D4MA 1TKCA 3BRQA 3EYWA 4N8EA 3WRYA 5L6LB 1PR5A 3U4QA 3I61A 1X7HA 4D42A 1PZGA 4UU1A 3FDXA 1FZTA 4X84A 3ROXA 1Z5OA 1ZJ5A 2I71A 2JH9A 2RH8A 3BMCA 4TKZA 3CVWA 3GFQA 4EO7A 3AVUA 2WKPA 3NT2A 4Z0PA 1ZJ4A 1JLSA 3GFPA 3PDIB 4JLAA 1JHUA 1TDJA 4GMGA 4RGVA 2AE1A 4P36A 1OXBB 2JIZD 3EIOA 4PIMA 1EXNA 5EJ4A 1DV2A 2IYLD 2XCSB 4JI0B 2R8EA 1GFIA 5BW8A 5FWYA 3VR5H 4E5DA 1Z33A 4DYHA 4L0QA 4IFIA 1U2SA 4MI3A 3THWB 2IXBA 3KKOA 5B2FA 1DC3A 3SYLA 2IPLA 1G98A 3ML1A 1ZVQA 4GBGA 1II9A 3BCHA 1ZRHA 2Z1MA 1AHNA 4JQZA 3C7AA 4MWCA 2CXSA 1VIDA 2XDYA 4CMEC 3VKWA 2E87A 1Q6YA 3K6SB 3ZHSA 4KJZA 2OKGA 1P5ZB 3EVGA 2IV2X 4D0SA 3N87A 1ZAKA 1WEHA 2SKCA 4M37A 5HS6A 2GNOA 1EVQA 3EVDA 2ECFA 2IZ0A 2CUKA 4X1KB 5AKGA 1D2MA 3LX6A 4P35A 1M67A 2IELA 5T4FA 1NXSA 2IVZA 3NHSA 1UWCA 2HQOA 3BTUA 2X77A 4IGFA 4YRAA 4U39A 4ZICA 5CJ2A 1BS2A 5J2UB 1C1XB 3AMVA 3KT6A 2BE9A 3DKIA 1EX6A 1U1CA 3EGIA 3L79A 3OLVA 2FPIA 4WZBE 5EHGA 1B23P 4KK3A 8GPBA 3OETA 2AJ8A 1B1CA 1CEQA 2YXNA 2GVZC 3WX0A 2MU1A 3B85A 1EU1A 2NXWA 2B94A 1WDMA 3V1YA 1XEWY 1ZD1A 1UBFA 2I67A 2VBGA 3VU0A 3ORHA 4G0ZA 4QRIA 4NZOA 2C31A 5CIWA 5EJMA 2Z6UA 3TB4A 1OLUA 5KVAA 1GZHB 3MWYW 4EF5A 3JQ9C 2G5GX 3OFNA 1F3OA 3A2NA 4F1JA 5DNVA 1ADYA 4LYAA 1Y8AA 1Z0SA 1PG2A 2RI1A 4MV0A 1CDEA 4XLZA 3Q85A 3HR8A 2PTGA 1XPJA 4YONB 2BFWA 4YRGA 3HWWA 3AYXB 3EAGA 5EZQA 5A6SA 2WV7A 2DF8A 3HJNA 1OX5A 4E31A 4DQ0A 5IWAB 1SVOA 1N6RA 3N0RA 4EG6A 4OP3A 4F4IA 3DLBA 2G1JA 1ULSA 2R96A 4NI5A 2GCOB 1MA0A 3GT4A 3COZA 3ZU3A 4MQ4A 2AFIB 2N1BA 5KX5B 4P80A 2QN3A 4JUCA 3GVCA 2FN8A 3INYA 1QVRA 1T5BA 1F12A 3ANLA 4EABA 2QMYA 2OCBA 2QL9A 2Y1WA 1JNYA 3DV2A 3ZVMA 2LE0A 5GJBA 3S2EA 3AY3A 1EDBA 1T1GA 3D6TB 1AKRA 3K4QA 4JB2A 3WLJA 3BWCA 4YRKA 3HP1A 2C2ZA 1RRKA 2H1HA 3M83A 1O87A 1K3FA 2OBBA 3LL4A 4G5GA 4D2IA 4GMKA 3EPRA 5C51B 1ZSYA 2FR8A 4C03A 3A10A 1B74A 5C2JB 4G5RA 4RVFA 4L4UA 3WRXA 5HJ5A 2NVWA 2A5GA 4WN9B 4UUMA 3QMVA 3NR2A 1P5FA 5IXYA 4DR1B 1E0SA 2EFEB 1X7YB 2ORVA 2B83A 3WBJA 3UIEA 1QU2A 2YNMC 3WS7A 2OESA 1Y80A 4AIRA 1Z3IX 1G21A 1XMQB 2P5UA 4DUYB 4WLFA 1B00A 2IUSA 5IKXA 2QUAA 2ZDHA 4HS9A 3OMXA 4JIMA 3AW8A 4KVGA 7YASA 1DX9A 3J80A 2IL1A 5ALIA 4D1YA 1P33A 2VZLA 3V7UA 2PSFA 1JJ7A 3MQFA 2W2XA 3LFTA 3TZBA 3D5EA 1YDMA 2QLJA 2HWUA 4CUJA 3MVEA 4PLHA 1I6WA 3DV0B 3AJ9A 3SJAA 2NZXA 4GSYA 3ZU2A 2AK2A 3FBGA 2YNMD 1SKYB 4R98A 4JWTA 3OIDA 5FHRA 2DPGA 3EH2A 3U3KA 3QNUA 2BGRA 4JXZA 4LOIA 1VPLA 3OT1A 1DEKA 4HRAA 2CMDA 5SZJA 3QFCA 3IP5A 4RGQA 1CZHA 2BMWA 4RZIA 4AL4A 1E3QA 2YZ2A 4G0WA 1FDTA 2F67A 1S01A 1I4DD 3HXLA 2AEFA 1FYEA 2QW8A 2QNBA 2FN3A 1RKUA 4NZ9A 3TSWA 3UAZA 2NMVA 4NCKA 4RGBA 1OVMA 4XKJA 2EQ5A 2Y1EA 4Q3EA 5K0CA 2TRSB 2ZWIA 1WM1A 1LX6A 1ZN9A 4I1VA 5TEVA 3IIIA 1G2QA 3GFOA 3QFRA 4PGAA 3DQQA 2PKXA 4GPD1 4IDFA 4YJGB 4ZMRA 5TPWA 1YS9A 4DYDA 3DT8A 5ALPA 2A1UA 2A0KA 2PN1A 1D9XA 3D2AA 5LBIA 5KSZA 1JI0A 1P91A 2RIRA 4J4BA 1LBSA 4U2FA 3QE9Y 1UBLS 4A9AA 3OP1A 2QSZA 4D46A 1PQPA 2NU7A 4KE7A 3V4FA 3B36A 4BEJA 3UMFA 4FYKA 1RJEA 4IICA 1S2MA 3WTBA 1Y3BE 2XTMA 5G4KA 1V7ZA 3SE7A 4AKEA 2VUHB 4UEKA 2V6FA 3E61A 2I87A 1AQYA 4I1SA 1T5LA 2HWYA 3FVRA 4H18A 4FINA 4DANA 1ZL2A 1EIZA 1K4KA 2QRZA 1M10A 2JI4A 1S3SA 3T7SA 1PUIA 4I8DA 4WBNF 5LP6A 4RV4A 4ZEWA 5T57A 4I3HA 1RWMA 1AKWA 3HUEA 4LN1A 2WFMA 3L7DA 1U8UA 1FFGA 4EHHA 3WA7A 1MH1A 4Y8VA 4ZOLA 2D1RA 1A9RA 4FCWA 4K26A 4ENWA 5AVXA 2QBYB 1ZUNB 2P9EA 5DLEA 3SEQA 4C04A 2B98A 1GV1A 1DQYA 3UHOA 1E2BA 1V48A 4HNGA 5CGQB 2OAGA 2IYNA 4WXYB 2OORA 4KQGA 2YDYA 1V3TA 3IAXA 3EXG2 1Y6FA 2VSQA 1CIVA 4H17A 4I8IA 4L9SA 5KJEA 3GEHA 1SKQA 2XR1A 1GRQA 3T9EA 4TYNA 2HMWA 4ENVA 4PS0A 4QVKA 2AOXA 1U2GC 4UAUA 4OXNA 4CTKA 2JCBA 1M0SA 4CV0A 5I7RA 4AI6A 3WWPA 4XCXA 4KXXA 5AVJA 2ZQYA 1ECPA 1TJNA 2PT5A 4UDYX 2ORYA 3R77A 3W1WA 3L8CA 1KI2A 5JECA 3IKMB 1KNXA 5IYZF 1J06A 4CUKA 4GP7A 1RI4A 4NVRA 2HA2A 3W2TA 2LBPA 5F5LA 2FW0A 5LL6P 3E23A 1PZXA 2WPDA 1UBUS 3ETJA 2AFIE 2Y1CA 4TLDA 1ZMXA 4DMLA 4UE6A 1IY1A 1L5VA 4N40A 1H85A 2AA3A 2BHRA 2PKRA 4FD2A 1A98A 1QK5A 4LGMA 2FSHA 2F6RA 1D7AA 4YRBA 5LBUA 3BD9A 1VCNA 2NV0A 4KVZA 1I2MA 2AWNA 3GPCA 2XCIA 3I05A 3NFYA 2EKBA 1A9TA 3PL5A 5LDGA 1CJTC 2DCMA 3V2GA 2AMLA 1B8VA 1WMFA 2IHJA 2HQSA 1HK7A 4GZMA 2E1RA 1Y8RA 5CGZA 4YO8A 1HOTA 2PSSA 4LJRA 3U60B 4LAFA 3OZAA 1VDZA 1JYEA 3AY7A 4L8VA 1K68A 1NI3A 2OYCA 5EQJB 1BDJA 4BNDA 4I6EA 4L2IA 2HC9A 4CKBA 1TU4A 1UEJA 3MMZA 4KMOA 1CJBA 4EM6A 1UKYA 4QASA 3C3MA 3JD2A 4P92A 4E3WA 2QIOA 3ITDA 1INLA 3PD7A 3W7VA 2P6MA 3TRJA 3A11A 4ML3A 3WQQA 1P29A 3U9TA 1N8SA 1T6XA 4HGQA 4IIDA 4M49A 3U4AA 5IX8A 1ZG3A 2CFOA 4JLNA 3RROA 3P2IA 1A82A 3TH5A 1W4AA 4PC2A 1JEDA 1CQJA 2XYPA 2Y77A 1H2WA 1JZQA 3C1TA 1VMKA 3KWLA 4GYWA 4HZUA 4LNUB 1FP7A 4GKAA 1SKYE 2WWGA 4MWSA 4PNHA 3RREA 4IF4A 3SICE 3W8NA 1Z6YA 3CG4A 4C4YA 3ZHUA 4K9KA 3TN7A 4N7MA 4WFJA 3ZVKA 4YMWA 1NFFA 1LPNA 1OI7A 3UWSA 3R1IA 2NUTA 2DP4E 3SPXA 4Q6BA 2QLBA 2QP3A 2QTRA 3HB5X 2OCKA 3I4CA 3NTLA 4V02A 5EE3A 4EW2A 3VR0A 1F0KA 4UTRA 4PHCA 1YJ5A 4RY9A 1WMSA 3PXDA 3GJ5A 4L28A 4QTZA 4UDOA 1DBPA 2AV6A 1M6HA 3KFXA 2FVXA 3VXKA 2ZZNA 1JJIA 5JDIC 1R6VA 3C43A 2IUEA 4M3NA 4P8RA 3DULA 3L6OO 4RIFA 3WYDA 2XUJA 2BBTA 3OZSA 1LBQA 4R7TA 1Z73A 1Q0ZA 5ALHA 3CFYA 4UVGA 2Y93A 2OBXA 5FEMA 4CL2A 2DBVO 4YK7A 4D44A 3AEKA 3OI7A 3PJDA 4QNMA 2YS7A 1EHIA 4WD3A 2DPYA 4CIBA 1RWVA 3MB5A 4KBGA 1XRPA 1T5TA 2IY7A 4QBHA 1K6JA 4ZI3A 3OEHD 4IEEA 9MHTA 3TJMA 1Q14A 5HG0A 2GD1O 2OXCA 1IMOA 4LCBA 2FFRA 4MYHA 4OB7A 3NYIA 4UHEA 4Z4FA 1E2HA 2PXXA 2WP8J 3SP1A 2H8GA 4EI9A 1G1MA 3TBFA 4UUBA 4HCJA 2VDWA 3TKYA 2R6JA 5HQ3A 4QSHA 2NVBA 1GZ6A 2A7XA 3DM5A 4KWTA 5DSTA 3O3OB 1EDDA 3JQ7B 2GRJA 4Z9BA 3W04A 1VJTA 3RSGA 4M38A 3RKRA 3FG9A 2PGAA 4LCEA 4F8JA 3IPCA 3UMVA 3V1TC 1SCJA 4LZAA 4DCGA 1FJ2A 3UFXB 3JQRA 2G4CA 4OQLA 2COKA 4MINA 2QU8A 4CKCA 2ID7A 1G17A 1ILWA 1AF4A 4N3CA 2AI2A 2PX6A 2GKSA 4EL5A 5CNIA 1BOFA 4RK7A 4HWTA 2Y1DA 2XKKA 4N82A 1XRRA 4QICA 4RK1A 1J0DA 3ONNA 2ZYHA 1J21A 1B8UA 4GVPA 3THXA 1D2GA 1VKZA 3D2LA 4JUIA 2BJWA 3EHDA 5E2BA 4RTJA 4PVDA 2G5PA 4MVYA 2FK8A 4ZA2A 3NVMB 5ERXA 2BPOA 5LNK1 5J3JA 2DWPA 4QU5A 2DFNA 5IZCC 1QQAA 5HQTA 1PQUA 1V1MA 3AM3A 4QJ5A 1ZUIA 2I2DA 3TMYA 1VFPA 1RPJA 3U7QB 3DZ8A 3PF8A 4LRQA 4UZSA 1H6CA 5JPDA 2JJQA 1D1SA 3IPLA 2H7CA 3JQ6A 1NATA 5HOEA 3I6IA 4GKJB 2QVCA 3LSTA 4H4CA 2GZSA 3LP8A 1T4GA 1JAZA 2ODEA 2XLCA 3F46A 3QKUA 4FS3A 3IR6A 3EXEA 4R7GA 5EZYA 3VC7A 4A10A 3U7RA 3SEAA 3A2KA 2V7UA 5EMLA 3W1EA 2KS6A 3CURA 3LKBA 3TGLA 1NVKA 2QN7A 4MUIA 3DO8A 3ILVA 3O9VA 4JCCA 1WUKS 1ZVMA 1MNQA 3ESRA 3H2HA 1PDWA 1XVVA 4BQPA 4LX8A 2RHDA 4YBRA 2XXAB 3DJFA 2C5GA 1JR2A 3E9RA 1E4EB 4B44A 4EA7A 4HNHA 4DFDA 1UF9A 1WPGA 2OXTA 1HLGA 1D2NA 2FZVA 2PK3A 2V4UA 4QOSA 5BSTA 3OSUA 1UFRA 3FFXA 2NT4A 3M4YA 3MHPA 3HA7A 3QKWA 1H4VB 3NORA 2YTZA 2FUCA 4NS4A 1ZGGA 3RFFA 1HMYA 5I4KA 5K0FA 5KTMA 1JHRA 3OJLA 3VDXA 3USZA 5E6UB 1BKDR 3RS7A 1N9ZA 1YZQA 4CI9A 5FOSA 4XJVA 5CB0A 5JZ9A 3U6BA 1F5SA 2Q3FA 5FNVB 3FRIA 5AVOA 1U0BB 1YD7A 3QPDA 1BOOA 1NR7A 4UUNA 3LIPA 2DSNA 3DWEX 3OKPA 4FVTA 2A86A 2QNIA 1ZIDA 5HBRA 4ZI2A 4KNWA 4RHFA 4FUTA 1F9EA 2XYGA 1IOWA 2P90A 1BXGB 4JXKA 1XU9A 2HWKA 2JIZA 3H5WA 1Q7CA 3IQFA 3L7OA 4E7OA 4AUMA 3TW4A 3UUGA 2W2VA 1GRRA 4EEXA 2WFLA 3D7RA 2Y1KA 4C7MA 1TT5A 1X3SA 4FYHA 2H5IA 3UHFA 1NVGA 2X9QA 4RSHA 5KCMA 1UZLA 2XWJI 2EDAA 4BE9A 1M2WA 1WTAA 2R6HA 1YKGA 3LXUX 4L3VA 1E66A 1X2EA 4LDNA 3T3HA 2RC5A 3VX4A 5L95A 2R1TB 3KYCB 4EG4A 1HTBA 1T8WA 1UZAA 3DXFA 2CWWA 3C41J 1Q0RA 3DMDA 1GQSA 1K6EA 4UOEA 4KR3A 1RAGA 1XNRB 4YMUA 2BHLA 3PGJA 5FTJA 2QRNA 5LUAA 2JS7A 3ZCUA 4FCTA 3L0DA 1XEXA 5ARCA 3RLIA 1XTTA 2QVLA 3Q3EA 1T4CB 2HNKA 3R5JA 4W8OA 2Q0HA 2WAXA 4BNYA 2PNFA 4L0DA 1CQWA 4BVHA 3DO6A 1X77A 4JKOA 3G85A 1X7XB 1F1BA 3BFJA 3WL3A 1M1NB 2Y92A 4DWOA 4GL4A 1BFUA 2FA9A 4R1PA 1A9SA 3L4BC 5A05A 4CMEA 2C7RA 3L6CA 1EJ6A 4H0CA 3RYIA 4CRWB 4Y9SA 5BYBA 2HA0A 5JO0A 1CX9B 5CDFE 1MX5A 4PANA 2YOHA 2I2CA 1D7OA 1XTPA 3EH1A 4MXDA 3Q40A 1W87A 3MGAA 3H7AA 2PEYA 3HVKA 4JVLA 1JAXA 1UK6A 3GN1A 4BRUA 2GZ1A 1XZEA 2O19A 1MB3A 2AF4C 3NH6A 1FDWA 1WXIA 2D7CA 1GNLA 4JJZA 1A5TA 1QGAA 3IQXA 1KY3A 2V7WA 3LOUA 4YEDA 4E11A 3EZ9A 4AF6A 5E7QA 3FB1A 1K7YA 2HHCA 1I7NA 1N57A 3IL2A 5BSFA 4KUEA 3FF1A 1YJXA 4E2FA 4BPBA 3E4CA 3DLAA 2PD6A 1KIFA 3KEGA 4TPKA 5L4SA 1ISRA 2EFHB 4MITA 2GOYA 2P6RA 4YO7A 1G8YA 4HYQA 4J8PA 2WBLC 3I1IA 3P19A 1YDHA 2BI7A 3HCOA 4TMWA 3T6KA 1HE8B 1N1EA 4M87A 1YZUA 1IHUA 3E48A 3VR1A 2EDCA 5HDBB 4EQZA 2ONCA 3WL6A 2A14A 3VJLA 4XASA 4EY3A 4BVBA 3GVHA 1Z0IA 3I0MA 4M0DA 4MJLA 1ZUHA 1H23A 1CZRA 4MP6A 4PSAA 1DUIA 1O9BA 3HYNA 5A9RA 5C81A 1DCTA 2GYUA 3FZYA 3ITKA 4G5HA 4YB8A 5A4DA 3CZ4A 4OIFA 4YT8A 1ZO8A 3RYFA 1MW8X 4C4ZA 1BN7A 2ZUDA 5F4ZA 3HSKA 5DGHA 3RQIA 2QOEA 1MUUA 5JH7A 2AOUA 2WTAA 4OX9B 4MO2A 1WD5A 2RHHA 1MIHA 1U7HA 5CB6A 4B2LA 4KAAA 4NMHA 2WTNA 5AKIA 5EP4A 5HIAA 2HA5A 3RSCA 5BW6B 1PQYA 2ZBGA 1Z74A 3T9FA 3FPCA 3LHSA 3VZPA 2WG0A 2ZR0A 3NPAA 1T3TA 2F48A 3A4YA 3IAM6 3W05A 2IBSA 1XPUA 3ES9A 1VHTA 3DGFC 4RD6A 3CLSD 3QI7A 1GZDA 4LYYA 1BD4A 3NPMA 4BJ6A 1TK9A 2R6ZA 5BVHB 3O8QA 2I34A 2H08A 5M04A 1YHYA 2FPUA 4MW0A 1ZNXA 3IB6A 1ZH0A 3QY0A 1DO8A 2AMFA 4JFRA 5J5CA 2XV1A 1MIOA 5CT9A 1UDWA 5JSYA 2EYUA 2JFGA 3ST7A 1HR0B 3AVXA 2Q0XA 1RWXA 4TKUA 4PLFA 5F2OA 5FA5A 2ZPUA 4GSLA 1QS0A 4XJTA 3Q6MA 5K0TA 3FNHA 1XMSA 2JAPA 1JKJB 2ALJA 2F4NA 4NJMA 4BZWA 3S44A 2C3MA 3VO1A 4WOKA 1YV9A 2YNMA 3CEAA 3AF0A 3FMPB 3TZ6A 1E1RD 5CFZA 1KO4A 3Q7IA 4UVIA 5CK5A 5HZGA 2D8MA 3K35A 4ZT3A 1JXMA 2Y8EA 3DFZA 3GIWA 4TYQA 3AUXA 4RV5A 3MTGA 4YROA 4A03A 2QQFA 3BD8A 4JP3A 1CUSA 3T7AA 5IVHA 3WNDA 3L0CA 4R81A 3H2SA 5IDYA 1SXIA 1G5TA 5F3WB 2VPYA 4JI5B 1USKA 2EZUA 2WKWA 3QV1A 5B12A 1DKUA 4QEZA 5J2TA 3ZZMA 4D3XA 2AQHA 3MBOA 5BT8A 2ZI7A 2XCRB 5FH9A 3IUJA 4BX8A 3GLUA 3O93A 4B76A 6ADHA 4OJNA 2ODBA 4PW0A 4GI7A 2DHQA 2OTCA 4B82A 1E64A 1C4KA 1E7QA 1JSXA 1NMZA 4HNSA 4PSKA 1M1YA 2Y1FA 5EHXA 5BV0A 1K2VN 4DBZA 1F8YA 3D3JA 5D87A 2H4JA 2Y0DA 1E5QA 2XIJA 3UM9A 4YLEA 3GLKA 1TCCA 3NAMA 1RJ9B 4CIXA 2PGOA 3FR8A 3CCCA 4PIVA 3ZIDA 1B73A 4BRZA 4G4JA 4ETNA 1OBVA 1JTVA 4JLOA 4MYSA 1TEHA 3T1QA 4A8JB 1G66A 1I32A 2J7KA 5HK9A 4IPTA 3T5PA 5H8WA 1XNQB 1EGVB 1FU7A 3AKYA 3STHA 1MABB 2MSWA 2XNSA 1NR1A 2WM3A 3NJRA 4RYLA 1MO5A 2J7PD 1FFBA 3RBXA 3OTHA 4FGWA 5EWJA 1NQUA 4DGSA 2CHEA 2PUJA 3WGNA 1B76A 1GWNA 4ZDJA 5KC9A 1BG6A 2A84A 3C4JA 1WP4A 3ZN2A 3VNVA 4X63A 4ZKDA 1SQSA 2CUZA 2VI5A 2VNJA 3S8YA 5TVGA 2WTMA 3PD0A 3NEPX 4KCGA 2VKTA 4XLTA 2GPWA 3JYPA 2O8BA 2JGNA 2YV2A 2L2QA 2Y99A 1ONOA 3CF2A 3RT7A 1TEXA 2XDWA 3E7XA 4KBYA 5BRNA 5A4AA 1I3CA 3D59A 4BQNA 5GONA 2NP7A 4ZQEA 4Q1AA 3ZJ5A 2P6NA 6YASA 3TW8A 5A62A 1FDRA 5J40A 1RFGE 2IWRA 3G2KA 2EAUA 2R7KA 4O33A 1Z63A 1BEZA 4HDRA 3UXMA 3PUVA 3G17A 1BGWA 4MUKA 1KY4A 4UTXA 2ANCA 2GXSA 4DKJA 2HM7A 2WUVA 4CKZA 3AB8A 4Q4HA 5AW5A 4WY5A 4NJEA 3QHQA 2Q1UA 3BD6A 1C29B 2I6FA 1AKMA 4PYIA 4E94A 3OPYI 2DTDA 3Q0EA 3MGKA 3SEZA 5IDWA 2YRWA 4Y2RA 3MG9A 4BMPB 2BUCA 3Q5DA 4OQEA 3DMRA 1XLTC 1ENPA 5A7GA 1ZVKA 5GZ6A 2QD2A 4PRYA 4QM7A 2YN4A 2PFSA 3GQBA 1KPHA 1PFKA 4K6HA 3NRCA 1NT4A 3TTVA 1U2GA 5JPIA 2OCLA 1A7JA 1UKVY 1E6WA 2C1ZA 1YVRA 2GR9A 1NW8A 2X4DA 3F3YA 4F92B 5KVSA 4YFYA 1QGED 5INTA 1E3JA 7REQA 3F6RA 5KYVA 1P0PA 1QWOA 1C3XA 1PZMA 4MTCA 4PWZA 3KM0A 5AVWA 3HJUA 3K1JA 4IBOA 5KYYB 1IN6A 3PX2A 4ZHQF 2CB9A 3A3PA 2DYKA 1KSHA 1LTQA 4JYAB 5CAEA 5JEDA 4I46A 1WSDA 4MWTA 4PBSA 1XJWA 1Z6GA 2XQGA 3FI0A 1VQ1A 1E2NA 4KQIA 1MQ8B 1QQ5A 1UXHA 2H51A 3LPNA 4ITUA 3SI7A 9LDTA 4HKTA 1VOTA 1ZI8A 1WPQA 2OZLB 1LNSA 3HQ4O 1YS6A 1IAQA 2I66A 4IZHA 3TRKA 3ZHOA 3CVXA 1EGQA 3OX3A 1LC0A 3DE3X 4Q9AA 3ZCVA 4TV9A 3MB8A 1GNPA 3FW1A 1T5OA 1XOIA 2ZRPA 2OL4A 2BM9A 2C4HA 1BJRE 1BCSB 1H05A 3GNLA 4D9MA 5J63A 3ZGZA 3RUIA 4EX7A 4M1TA 2BT4A 1UQUA 4NTZA 1XZQA 4AJOA 4YP0A 1P1FA 2JKVA 3JASA 3GN2A 1NI4B 1XZNA 3QGMA 1U8CB 4GXNA 5D7NA 5EXDA 3WL8A 1YQQA 4MWDA 1KZ1A 3ZLBA 4XYBA 2Q62A 2WIJA 1LV8A 2R65A 1GILA 1FFWA 1YE3A 3MCVA 1CBUA 4OL0A 3U3MA 2OA0A 3VGPA 4FBGA 4BP9A 4DV3B 3DBRB 4LRUA 4A8PA 2QUBA 3A70A 6REQB 2PKQO 4LWQA 4B73A 3RVBA 1VJ1A 1JSLA 3CF4A 2D2IA 1N5KA 1Z5ZA 2L18A 4I19A 4EKEA 1ZZGA 3UV3A 1XE3A 1XZKA 1X80B 4NESA 4WZ6A 1CZOA 2GILA 2W7TA 4JH0A 3G13A 3DMHA 2AXQA 5EHQA 4C7OA 4BB9A 2X4LA 3BIOA 4JNCA 1J6UA 3IEMA 1BA3A 3HBFA 3W0LB 5KREA 8ADHA 2NLOA 1YMVA 1PDVA 2VH1A 4GEGA 2A5JA 5T41A 2OGTA 4LNAA 2IU0A 2BP7A 5JH7B 1I13A 3C70A 5FI0B 2H63A 4H4DA 5TQJA 3WL5A 1IBLB 4HN9A 2WT4A 1W19A 2V3WA 4TT8A 2AOTB 4LOKA 3EGXA 4LF4B 3UMCA 2BM8A 2YVQA 3CLHA 1W6UA 2FMTA 5TMPA 2E4VA 3HRKA 5C7LO 1ODKA 1RJGA 5BO5A 1J2RA 3CLRC 3T7RA 4M8NE 1V4VA 3GUHA 4K6FA 5KYUB 2EP7A 3VPGA 1LQUA 3OEHA 1E2IA 1N4DA 4WV3A 4ZVMA 1I4EB 1XLVA 1Z06A 1I7LA 3IIKA 4FR2A 3EVZA 2J30A 4UPVA 4IUYA 5CYFA 1Q0HA 4YP6A 2BDTA 1SC3A 2OCXA 3N2IA 1KNQA 3TTWA 3ZY5A 5COAA 2PDAA 1LF5A 2WYVA 5E6SB 3D6UA 1H2FA 3CNBA 4BEWA 2F1IA 4DA9A 4ZO9A 4A7PA 4C4XA 3GY0A 4US2R 3CLRD 4GG1A 4ARAA 3O1JC 4XEHA 3AL0C 3L18A 3OX4A 4WSOA 3PTLA 4IP0A 4RKWA 3PUXA 3PCRB 3O8OA 4H7PA 4E1VA 3ZG6A 4DIOA 3MWFA 3BWYA 1SOAA 4M8KA 5BQFA 1FJXA 4P4TA 2PV7A 4B43A 4BMOB 2QBYA 1BXZA 2V65A 3ESAA 1JDZA 5KAPA 2J0QA 3W7BA 5IXSA 3EXHC 3N2LA 5DCWA 4K9MA 4ZYXA 5B6PA 2ZWMA 4QUJA 2FDCA 1AO3A 3K53A 4IWXA 1G18A 5JJCA 5K3EA 5KWIA 1UJ4A 1SWWA 5B1IA 2I80A 5TV2A 4LF9B 2Z4SA 4RZ2A 3ANSA 1SC6A 1RPZA 4ENRA 4RHUA 2P75A 4DLZA 5L7TA 2F64A 5C8ZA 3ZU4A 1ACJA 2ZT5A 4OAOA 4D0GA 3KAPA 5B3LA 5J5VA 4UVHA 5DHQA 5AD1A 2BSQA 1L4KA 8LDHA 1AKUA 2PUVA 4MP8A 3ICOA 1LA2A 4OHWA 4INAA 4J0EA 3V1LA 4AMGA 4HQOA