4M0UA

Crystal structure of human prs1 q133p mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
310
structure length
303
Chain Sequence
NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASPIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKEDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-phosphate pyrophosphokinase 1
publication title Crystal and EM Structures of Human Phosphoribosyl Pyrophosphate Synthase I (PRS1) Provide Novel Insights into the Disease-Associated Mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 303
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2013-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m0uA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m0uA02
4S2UA 1A3CA 1BD4A 1JLSA 3DMPA 3MBIA 4RAQA 1DQNA 3KB8A 5HKLA 1BD3A 4RHXA 1QK3A 1GPH1 5HIAA 2JKYA 2C4KA 1L1RA 4PAWA 1W30A 3LPNA 1NULA 1J7JA 1UPUA 4X44A 4OHCA 2H06A 3OZFA 2EHJA 4RV4A 4QYIB 1DKUA 5ESWA 1XZNA 1HMPA 1I5EA 1O57A 1XTVA 1HGXA 1ZN9A 1L1QA 3GGJA 4RQAA 3QW4B 5E38A 2H07A 1G2PA 1XTTA 4KN6A 1FSGA 1PZMA 1STOA 4RHYA 2DY0A 1VCHA 2E55A 2PRYA 3H83A 4P81A 2WNSA 4RAOA 1WD5A 3DAHA 3OZGA 4F8EA 3O7MA 5BSKA 1U9YA 3GGCA 1QB8A 1V9SA 2YZKA 1I0LA 1I0IA 4LYYA 1QCCA 2P1ZA 5ESXA 1P17A 1VDMA 4LZNA 4RANA 1A96A 1AO0A 4P84A 1A97A 1ECCA 1ZN7A 1QB7A 5KAPA 3ACCA 1ZN8A 4RHTA 1DKRA 3NAGA 3N2LA 1ECJA 1R3UA 4RQBA 4JITA 1MZVA 4LZAA 1UPFA 3M3HA 1ECFA 2VFAA 1XTUA 3GEPA 1OREA 3DEZA 1U9ZA 3G6WA 4IJQA 4PFQA 4M0UA 5BQOA 1JLRA 2PRZA 4M0PA 1QK4A 1Z7GA 2H08A 4QRIA 2JI4A 4WMLA 2GEBA 3LRTA 4RABA 5JV5A 1G9SA 1XZ8A 4QYIA 4WN3A 1TC1A 1P4AA 2JBHA 5EUCA 1LH0A 1BZYA 4P80A 1O5OA 1GRVA 3S5JA 2AEEA 2FXVA 2XBUA 5KAMA 4RHUA 1A95A 4X45A 1D6NA 5JSQA 1I13A 1P19A 3OHPA 1DQPA 1TC2A 4LYGA 1QCDA 2IGBA 1VSTA 1A4XA 1CJBA 1UFRA 4M0KA 3MJDA 1Y0BA 1A98A 3EFHA 4P83A 1G9TA 1OROA 1G2QA 1IBSA 4JLSA 4MB6A 4Z1OA 4FYMA 5IAOA 1OPRA 4P82A 2PS1A 4RADA 1DBRA 1I14A 2HCRA 4LZOA 5IPFA 5BRNA 1ECBA 1YFZA 1ECGA 3ACDA 3HVUA 2JKZA 1P18A 4P86A 4TWBA 1NONA 4RACA 4ZFNA 1QK5A 5BQPA 5K51A 3ACBA 4P3KA
chains in the Genus database with same CATH superfamily
1SAYA 1XK7A 5TMEA 1QFJA 1QV9A 3U16A 4UEQA 2ZRFA 4OMFG 2WSLA 3CWQA 1R6XA 1W94A 2G0TA 3W2TA 3GRRA 4CL3A 1NTRA 1XSEA 1JWLA 1QQ7A 4DYVA 2C3OA 2Q3HA 5CH5A 3D8TA 3UKDA 3V7UA 1O6BA 5K1ZA 2NZ2A 1MPTA 2HEGA 2OP1A 3GRZA 3G0CA 3HRIA 5LA6A 2Q9BA 4P4SB 4DIUA 4CV0A 4OMCA 4M83A 1PWYE 2V1XA 4N7JA 2G67A 2JVKA 2V7QD 4RGQA 1T36A 1P81A 4H4CA 3I4LA 5ABPA 1G20A 3P8ZA 2BM8A 2H31A 4DVJA 1CF4A 1PFUA 4C3OB 1I1QB 3BXHA 4J29A 2W48A 4P35A 1TUBA 3T3GA 1QOQB 4I9GA 1IE3A 2WKSA 4MVYA 1PJLA 3KZOA 3H5NA 5JNSA 2NZVG 2CBGA 1NSTA 1SUPA 1DJNA 3A6FA 3VO1A 1D0SA 3AJEA 2O2XA 1DAOA 3AEUB 3HFRA 5BN3A 1SUBA 3CH6A 2FPPA 4IVRA 4EY6A 3S44A 1I2CA 3U62A 3F96A 4R83A 2O8FB 4D3FA 3O26A 1YUBA 2B2NA 4DIMA 1J56A 4KXUA 1IEQA 4K8OA 4PLFA 5EJFA 4ASUD 2EX1A 1JSCA 2FE1A 1GZ3A 2M1XA 1LNZA 2AFIA 1V5GA 3ML1A 2DFKB 4G26A 1U5CA 1UMCA 4LIPD 4URUR 3RHTA 5IBCA 2BUBA 4HFNA 4EB0A 2R8RA 5JLJA 3M9XA 1T35A 3OTIA 1QONA 3IMFA 2NU8A 1U3DA 4EITA 1DBQA 1MX3A 4JSTA 4QPDA 1SOUA 4HBGA 2YL2A 3IBYA 4RO0A 1IOWA 1C81A 2C2HA 1NZJA 4W8HA 4DLZA 4NZYA 4AZ3A 1G3QA 3EVEA 5FUYA 5JEDA 3RVPA 5DP2A 3GJSA 4QTZA 1NVAA 1Y8RB 3E58A 2Y1FA 1TI7A 5CUQA 3UK2A 4BNDA 3JVDA 4BO8A 4KITB 1XYVA 3BXEA 4GMDA 4Q4HA 1VHLA 2NO6A 3H3JA 4M7WA 1OH5A 3GEEA 1BHJA 1J2UA 3FHCB 3ZVKA 1G8AA 2G9UA 3EXFB 2CV1A 1LGYA 2J5RA 3I42A 4O29A 2O1SA 3JVEA 2CXNA 1QRUA 1PJ2A 4FBGA 1ORHA 1JA9A 3TJZA 4NENB 4EHJA 1JJAA 4JYBA 5I9BA 4C4AA 3FPAA 2K87A 3P2EA 1KRXA 3MWEA 4ZPJA 5JSQA 2WTUA 3RVNA 1QQBA 2HMSA 2XW6A 4H3HB 1POXA 1NXOA 3WFZA 3PLAE 5SV2A 3JY6A 3DOHA 4KTTE 3WK5A 3TVTA 2HWXA 5KI6A 1TB4A 3A58B 1QX3A 1R50A 4F4IA 4OG2A 4GKBA 3U80A 3GPCA 5AK5A 2F4VB 2ZPUA 1Z4IA 1BXRA 1UT6A 4D92A 1A8IA 4RQUA 2Y1LA 4X71A 4Y2VA 4P83A 2B1QA 2FPMA 1D04A 2FPSA 3BHNA 3L6DA 2DT5A 2NAPA 2ZANA 4Y1FA 5DW3A 1NQTA 5FI5A 5TMDA 2B94A 4BKOA 5CA1F 4S35A 1A9TA 2X6TA 2JFPA 3QK7A 3LU1A 1HQYE 1MJNA 3SJCA 4S1OA 1ECGA 2YWHA 2ESRA 4HQNA 4BX0A 3A1CA 1YB4A 2OHGA 1PQWA 1TM1E 1T9AA 1VKHA 1QKJA 4KLRA 2ZB8A 2CLEB 3N0WA 3V4LA 4OLAA 4AIIA 4WIAA 1AT1A 1O5IA 2EYUA 2OZLA 1XU4A 4RLSA 2Q2OA 4C7XA 5JCOC 3L1KA 1ADGA 1ECLA 1PGOA 1T29A 3BZWA 1Y5IA 4ZDKA 1YDFA 4BVJA 1RR6A 2I67A 2HQSA 4NDAA 4BVKA 1K8ZB 3RE1A 4AX8A 4Y2RA 1RZ3A 1XQ6A 1RP1A 1RCUA 1WMBA 3EEIA 3ETHA 3RCBA 2GHQA 2I2FA 1FFXB 4DLWA 1R1DA 6LDHA 2V0NA 4C4TA 1UMBA 4L3WA 1T9GS 1XUOA 3R3UA 4ZAXA 2BM1A 4W63A 5HDBB 4PCAA 1V3UA 3FR7A 4NZPA 4HRVA 4MV9A 4PLPA 3LDFA 2OGUA 2GA8A 3CT6A 1KQOA 4MVWA 3RS3A 3H5AA 2Q0QA 2ZEJA 3QYPA 1DKUA 1KMQA 1MAHA 3AKDA 4K46A 5FTKA 3W7BA 2Z98A 1J6UA 1JQ3A 2DPHA 4IIHA 1NW7A 1G7RA 3WP0A 2X1LA 3UKJA 2IE0A 5AUOB 3BIJA 1GFWA 3KPJA 1V1JA 1H0SA 2DWOA 3EYWA 3H9CA 5CX4A 5E6UA 4UPVA 1EWRA 1Q7CA 3BTOA 2E6KA 4YMWA 1V16B 1GM5A 2BGMA 3AU9A 4UM9B 4FYHA 4B40A 5KNCH 4AC9A 1PKXA 4AUEA 5B3LA 5ALFA 6NULA 1SUEA 4A2PA 1BGVA 3E15A 4YLYA 2FPUA 4XIJA 5H81A 2FR8A 4K6FA 4AMUA 5CA0F 3ZD7A 4EEXA 1AHPA 2MSWA 3QVTA 2FDRA 3B9RA 1USIA 3QLEA 1P9WA 2Y0BA 1ZLXA 2VJNA 4Q3NA 1E9DA 1J20A 1RBZA 2Z5LA 4I55A 2ZSJA 5T4HA 5LQUA 1EHCA 1YF3A 9GPBA 2LTAA 3T3NA 2R1TB 1KK3A 1BMFD 3D8BA 4GQAA 4IHQA 4PTZA 2VQEB 1B14A 3BM5A 3N0TA 1IN8A 1NW3A 2WYHA 2Z5FA 4OHKA 5ECWA 5EUMA 2WIFA 1LDNA 3OIYA 3Q8MA 4DE5A 1SQ6A 4G63A 1Q0HA 1V35A 5AK4A 2QTLA 1RJ9B 3FTEA 4YMTA 4WSOA 3V5NA 1T0IA 1UFKA 1WUIS 3NHAA 1BO6A 1DHRA 3VU8A 4EZBA 3HCDA 1ISIA 2XQKA 1VE5A 3NKFA 3WA6A 2HADA 3RQSA 4MHOA 1A27A 3WK9A 2B0JA 1BJTA 4CLXA 2CHEA 2YMMA 4OLFA 4J0KA 2XB9A 1ZKDA 4FFPA 2YMPA 3UK0A 2YZ7A 2GZAA 2W43A 5K6RA 2J8ZA 1IN5A 4LJ4A 1V26A 1DQPA 3QEMB 3SLGA 1H1LB 5LB2A 8AT1A 2PX5A 1T24A 2O7RA 3BC1A 3AUXA 3O3OB 4ARUA 3HCNA 2FN3A 4A9AA 1BXKA 1CJBA 1LLDA 3ODGA 2YRXA 4N18A 2FW1A 4TSFD 3M4JA 1IBKB 4YMHA 4HWRA 3NWJA 3N5KA 4RLHA 3K6SB 1WBDA 3C3EA 5DCLA 3LBYA 5HIKA 3G02A 4GXNA 5CRIA 1EGVB 2ZIZA 2OCPA 4BFUA 1CUWA 4PX5A 1SVIA 2WIKA 1JEYA 2GNPA 4Q7QA 1PUIA 2B35A 2AUMA 3GAMA 2VNIA 1JHPA 1SPXA 3ROKA 3IV6A 2N9UA 2HMAA 3P9YA 1AK1A 3OKCA 4G0XA 3ZEIA 4BTVA 2ZB2A 1Y1SA 1NVDA 3GH1A 3U19A 2XNDD 2OWDA 4QM6A 4E5KA 3FYTA 2W2VA 2PT7A 2ZULA 3MWDA 1UKCA 4I50F 5H16A 5B36A 4IUCS 5AM4A 4BB5A 4ZQFA 1SB8A 1YNSA 3F1KA 3FPHA 1SVWA 4J2TA 4OVKA 1TYEB 1YE5A 4WOBA 3VH2A 2WR8A 3OZBA 2IK8A 3FKSA 1DO0A 4ZV7A 1AQLA 3IP9A 3KYCB 2HRRA 3TN7A 2IXFA 3TX6A 2HPZA 3TSWA 3W9UA 4GUDA 2BCEA 5J59A 3OETA 2Q62A 1MHTA 3HFGA 1OSNA 3LS2A 3HXLA 4CIVA 5ITWA 4Z86A 1G7TA 2ZP1A 3KEQA 4FEEA 4ZTZB 2Z8XA 2EKLA 3K16A 2MR5A 4Z49A 1LD3A 1YDHA 2E1PA 2P1RA 3DVAB 2HRZA 1BVUA 2FKAA 5IC6A 3WYFA 1IJKA 1JGTA 4BBAA 3REQA 5A2QA 1CUSA 1DL5A 2W71A 4WK6A 5CLJA 3OZRA 3JQDA 4MARA 1XO1A 2ZR9A 3ZS9A 2R0QC 3CWZA 2WQZA 3QRWA 1JFRA 2OG2A 1E1MA 5JYBA 2O5RA 4CTNA 1G0NA 3UQYS 2C04A 2O23A 3OSUA 3FLMA 5CCDA 3COJA 1EHIA 4NCIA 2PLWA 3VDNB 2PMBA 5D84A 3BJIC 1ECPA 3PGMA 4FSXA 4Q1FA 4MW4A 4Q9KA 2PL5A 3K5HA 3W79A 1Z73A 1DLJA 1I0LA 1MOQA 1C3LA 1RPJA 1YQTA 2LKCA 3KL4A 4I1PA 1VM6A 4F56A 3DW3X 3PC6A 5F5XA 4D26A 5HRUA 1VRVA 3CA8A 2BGKA 2C3YA 3VDMA 2ISSD 2WTAA 3HQ4O 4OOEA 5KYKA 4WY8A 4Z4FA 3QH4A 4FVTA 2JCBA 2GDJA 4U9HS 1SKAA 3W3ZB 3SXUB 3RAEC 4JI2B 5DH9A 4LJLA 2ZSFA 2FFHA 4CW7A 3N7TA 1A9PA 1U9ZA 2PH7A 1Z63A 1W36B 1V3QE 3FJYA 2V7PA 4AO6A 4E33A 2DH5A 3VPHA 4A6PA 2FX5A 1KK2A 2DVMA 3DMRA 1RRPA 1W36D 2ZREA 2VKTA 2C1EA 1JAIA 1EZ1A 1Y3CE 5TQ2A 2PNFA 4QNRA 2GWHA 2BFNA 1Y4ZA 4KN8A 2IIBA 5I51A 1TQ8A 1CUJA 4LJ5A 2VP3A 1RZUA 3A7EA 5AR1A 3TGLA 4G1VA 5CA1B 3O73A 3KSDO 3HY4A 2A8YA 3M4YA 4FIZA 1IXYA 2ZBUA 1L5OA 3QLVA 3EG9A 3TNYA 4GPAA 3B85A 5HKKA 4JENA 4IJMA 5CK4A 4C4ZA 2I99A 3E3MA 3TE6A 1PHRA 1CB7A 2NTNA 3HBFA 2P2ZA 2ZS7A 4ZRDA 4BP3A 2ZI4A 4WOPA 5ICGA 1P9LA 1EP3B 3FTFA 3G1UA 1L7VC 1W9HA 1Y9EA 1WTCA 4OLJA 1N6RA 4YONB 3I6MA 1I4DD 5FRDA 1LJUA 1WUKS 2CNBA 2VDPB 2QLLA 2J3QA 2H7VA 3GFGA 1R2QA 4UUQA 1KDZA 1V6AA 5KSZA 1U04A 3KM0A 1Y4AE 2CHVA 4Q01A 1Y82A 3BILA 4W5WA 5F1YA 2XMSA 4L78A 5FR2A 1A88A 1KJQA 2PLRA 3QFTA 1QTIA 3F3YA 3WI7A 2Y92A 2C9OA 4R7TA 3ONDA 5IWAB 3WZMA 1OD6A 1C8LA 2ZRBA 3DA8A 5CW1A 2YUIA 1G3MA 2V6FA 3ETDA 4IG4A 4BVHA 2IYEA 2AOVA 4TTTS 1KDPA 2IZ0A 4JXXA 3FMVA 2EWVA 3OWOA 4IHJA 4LJRA 3OPNA 1DFHA 2QYTA 3I37X 1KHHA 1RC8A 1AQYA 3CGWA 1L4NA 3UXHA 4MVJD 2ZG6A 1HE5A 2IXDA 3IKJA 2YVAA 4Y6RA 2RJ3A 5C31A 4FDLA 1DIHA 1G41A 3KR2A 4OHRA 1ZXBA 3FNQA 4BFLA 1F0PA 2W8BA 3GZ4A 3WYAA 4H7EA 1D5WA 3HJHA 3MTQA 4PSVA 1YS4A 1KQ3A 1NURA 1NN3A 2GAIA 3G8DA 2NO7A 1UJ4A 2G1UA 3ESRA 4LS3A 3DNPA 2F90A 2FLWA 4KPYA 1WXQA 1JIIA 3HO8A 4XWAA 1GADO 1Q0TA 2CYCA 5IXYA 1XHLA 1VPVA 3FCAA 4AN1A 5IEJA 3E4CA 3DDOA 1C9EA 2F9FA 2VNHA 5BMOA 2N42A 2HA5A 4MV0A 2PQ6A 4F3RA 3OE7D 1SCQA 3NDIA 1WW8A 4OF4A 1AXEA 5JASA 4ZVRA 3WA7A 2QX6A 3I1IA 4JC0A 4EABA 3M6LA 4TWAA 4EK9A 4F86A 5BSTA 2P3SA 2GN1A 1BA2A 4I2VA 3OA2A 2Z6VA 3J7TA 5G1OA 3VJLA 5HS4A 1A8HA 1SCKA 4R2JA 3SYNA 3WB0A 5ESXA 3NOOA 4KWEA 3GBVA 3KOWA 5C1DA 2FPIA 3AZPA 4I5IA 1EFKA 4J7UA 1BE1A 1E6WA 1W34A 4TTJA 1OTXA 5JHHB 4U7DA 1Z83A 4MI1A 4D9NA 4CMIA 3DBOB 2R48A 4DR3B 4ARVA 3CTMA 3V48A 2HR1A 4FYJA 3ZKWA 4YRGA 1R0SA 3OIDA 4HWGA 1TYAE 4YRIA 3D1LA 4BNYA 1YVDA 1IHOA 5T3YA 4EI7A 5JECA 3RABA 1LVGA 4XYLA 1WZ2A 1AQNA 1M8JA 5K3FB 4DB2A 1YBFA 3Q7TA 1L5HB 2RE8A 5JJBA 3A1SA 1Z17A 2XOKA 5GJWC 3U3RA 3RT7A 4NFSA 3P2MA 3CLKA 5CVUA 1KK0A 5KNDH 2OGTA 4RVSA 1G8JA 4CFYA 1QIIA 2GK7A 3T15A 2XCQA 5ULLA 4Q3DA 2G9NA 3HJTA 2PWZA 3ONEA 4M9ZA 3A6PC 1V1MA 1ZVJA 1KAHA 1ISJA 1RRMA 1TJYA 1JJIA 1W19A 3WR5A 1RJEA 4I50B 5H1YA 3I52A 4E09A 4DXHA 1C2TA 1RXYA 2P3OA 3LLUA 4QOJA 1W75A 1BMTA 1LLUA 1R0KA 1IBCA 4CLOB 3MJ4A 4D8XA 3EGXB 2XIQA 4DCCA 2R8EA 1L7XA 3HB7A 3DZIA 3EC1A 5JEEA 1T8UA 5K3EA 1E8DA 1P44A 3E9CA 2QLTA 4MV5A 1FY2A 1EIZA 2J45A 1DIGA 2Q9CA 3LGXA 1QH0A 1NNLA 1PZXA 2AKAB 2AW3A 4RPKA 2G63A 4X9XA 2HSGA 1M8FA 3OBBA 1ZA2A 4MDYA 1Q3HA 2UYYA 4YWJA 1KQNA 3DFIA 4H1VA 1CHDA 1KO4A 4JDUA 3OQ1A 4F4HA 1KOJA 1ORIA 5K51A 3G8YA 1JYSA 2EW8A 3RYIB 1WXDA 1KI3A 4CU2A 5ALEA 4FB4A 4YP0A 2W2XA 2C7VA 4PQEA 2HA6A 3DMPA 1C4XA 2ZJOA 3FYSA 3IRVA 2I1QA 4EDFA 4CQMD 3KQLA 1E2HA 4D8TA 4EB6A 4Q03A 4EMBA 2QR5A 4RJLA 4FOLA 5TGDA 3S55A 1J90A 1ULZA 3GQVA 4J07A 1TJ3A 4DA8A 4JJEA 1LW6E 4MINA 3SM9A 5FOUA 1S2DA 1SCBA 4WZBA 2WF6A 5EVCA 3TTVA 4A0HA 2OMEA 3IUSA 3D4OA 3KHSA 1EQAA 3ETEA 5JO0A 1NAHA 3DAYA 1JHXA 3L7BA 4ZIRA 3MCZA 3H4MA 1WCV1 3ZDQA 4N7MA 1X1SA 2D3WA 3P0RA 3QE2A 5FYQA 1WLYA 5CMLA 1ONSA 4ZK2A 1YUNA 3AOGA 4GPD1 1ZJ6A 1Z28A 5DIFA 3RF6A 1UKZA 5CBKA 1FXWA 4MV7A 5LZ4A 1P7CA 3HYSA 2XGOA 4LBZA 1I7QB 3LTNC 1RYEA 1QQ6A 2BFMA 4C6HA 1I24A 1OHHD 3AFOA 5I7WA 1CBUA 5F1OA 2IZ1A 5AXDA 1G59A 4KR2A 2PGOA 4JODA 1CLEA 4GMKA 4BZWA 4IIDA 4X8HA 1NQOA 4HNUA 1Q2XA 3F7OA 1N4AA 4I99A 4WERA 4KFRA 2B8NA 1FEZA 4X5OA 4EKDA 4N65A 4EKIA 1VJRA 4LDRA 4OV6B 2F3PA 3U7IA 4WA7A 3IE1A 1OXKB 2JAOA 3BB4A 5JJCA 3B6IA 1GAXA 1LBTA 3MSCA 4ZJZA 5C4MA 1U7DA 5IHXA 4ISCA 2X8BA 5BMVF 4B2YA 4D9EA 3G9XA 2HDOA 2JLBA 5EWJB 4UTZA 1JEQA 2NUPB 2P9TA 4KHZA 4RQTA 1D2HA 2BT4A 4CLEA 3GFVA 2IPOA 2A1UB 3AY3A 1F2TA 3H1BA 3KP1A 5K4GA 2IZOA 5BN5A 2ZSDA 2YYSA 5BSFA 3VNBA 4IYRA 3TSOA 2HUNA 3AVPA 1OWNA 4RJKA 2EFHB 2Y1KA 2KBEA 4IDQA 4YAJA 4DTCA 3K1AA 4DBVO 4D4GA 1F51E 4RXMA 3FUUA 5K6TA 3JWEA 2ZZKA 1FDSA 1O96B 4A16A 1LI5A 3TAUA 3ZHBA 4NE7A 3I4CA 1A9XB 3PFHA 1OKKA 5AVQA 4GI1A 3E9MA 4KXMA 4JCCA 4UCWA 1PV2A 4HNGA 1WNTA 2DULA 4NMLA 2VYVA 1UT8A 2J0UA 5LZ7A 2XGMA 3VR5H 2R6HA 4RESA 4LDQA 3IGFA 1KH2A 1UWLA 4YJKA 2AOUB 1QO7A 1WQ3A 3BKXA 1IJFA 4BFSA 3CH4B 3K8OE 5FI1B 3G5TA 3KLBA 3KFLA 2QRVA 4KSYA 4BQFA 1GTJ1 2CF5A 2MSEB 1CDOA 3LSYA 4QXRA 5BQ3A 2PGXA 2FPGB 2B1GA 1QP7A 3NS7A 3QEKA 3S2GA 1LPSA 3PEFA 3C3YA 3OH8A 3O0TA 2IUFA 2A0FA 2ZUVA 4UHJA 1Z0ZA 3LA8A 4EW6A 2OC4A 5CK5A 2YWDA 3HFSA 3NZEA 3OTGA 3ROGA 1KBQA 5JU6A 2AMYA 1TLTA 2LDBA 3DR3A 1T9DA 4JN6B 3RFUA 3ZZ1A 4EYGA 4X1KA 1P3Y1 1G8MA 4O6VA 1UZUA 1I1NA 3HA5A 2BF4A 3LUKA 2YHIB 3JYNA 4UUAA 3UAVA 3V7WA 1R74A 3AM4A 4PHHA 3PUXA 2HJVA 1KSFX 3ICPA 2QLBA 4MLCA 4EFNA 3MWLA 1A5ZA 1TYZA 3VRHA 1Y6JA 4GYYA 4EPWA 5BT8A 4MB0A 1LK7A 1GCOA 3U3ZA 2ZI9A 1XZDA 1V7QA 1IZZA 2PSEA 1C9DB 1E3TA 1YBAA 2Z9CA 3AJ9A 2QZPA 3CRVA 3I2FA 4KPUA 5K03A 3NLLA 4F21A 3I34X 3QVJA 2BSXA 3IAM6 2QE7A 1HEYA 3DG9A 3ESXA 3K6KA 3PK0A 1TGVA 4J0DA 2OB2A 5HGJA 1OPXA 1HOTA 4LHEA 4JMLA 3HB9A 5CJ2A 5LB4A 1N0IA 3K30A 1DJQA 1PGNA 2HIMA 2SHKA 3QSYA 1AGPA 1ZOIA 3INYA 1SXJE 3Q8WA 2FI1A 2P2YA 2GARA 4DQKA 3U4HA 1U7ZA 2AEMA 2PSFA 1ADCA 3I0NA 1HX7A 1LSOA 2YXNA 4LNUB 2BFBB 1VBNA 3FGNA 4X6UA 3I83A 2YN4A 5A4DA 1KAGA 3VH1A 5A1JA 2Q21A 3NWBA 2JFZA 2V6MA 3FB1A 5CJJA 2OGWA 3KJNA 5HPYB 1Z26A 1C0EA 1MAVA 1GNRA 1PTJC 4F3YA 4CM3A 3RIEA 3WGVA 1RTTA 1C29B 3THYA 4DUYB 1P17A 1SU7A 3Q11A 3WNCA 1W4AA 2VBGA 3QY9A 1S7CA 1PKEA 2I5PO 1M7HA 1T2FA 3EC7A 3SHFA 2ZSIA 5LYJF 1YFLA 4PZEA 3B3FA 3NWEA 2ADFA 2CW5A 1N5JA 2RB4A 3A06A 3KB2A 3UXYA 4E21A 5IJ0A 1LS1A 2GPJA 4KAJA 3P4YA 4Q1BA 4TYNA 5E1MA 3DO8A 3AP2A 3M3HA 1Z5VA 5IZCA 1Z5WA 2ZYGA 3C98A 4E03A 3UB4A 3TIFA 1GG5A 1CSEE 2AYZA 3PF8A 2NO9A 5CDSA 2O54A 3COZA 4P38A 4CV3A 2FK8A 1XCGB 3DO5A 3IT1A 2CD7A 1W4BA 2A86A 2HGZA 5LLDA 4L8GA 3KV1A 3M5PA 2WJ3A 3CX6A 1VPEA 3OIWA 2GJ8A 3QBEA 2GLXA 1NX6A 3FPKA 4FD2A 4W5TA 1TU3A 4OX9Y 4KQFA 3UGKA 1UBHS 3Q3JB 2YWXA 5BQ5A 3GCXA 2V97A 4YAUA 3NVKI 1P1IA 4HJRA 3B6JA 3FPCA 3UAXA 2C00A 1ZUHA 4ZXPA 4BB0A 4XOIA 1AGYA 1CY1A 4IVQA 2G5CA 4DLYA 1R6AA 2C2ZA 3H2IA 4ZV9A 2EIHA 4OLBA 4H60A 2FF7A 4L0DA 1AS0A 4NARA 2DTEA 4GC9A 3FSGD 1GYRA 2AHRA 2WMNB 3A3PA 4PFSA 4X8MA 3ANMA 4MDHA 1XKTA 4LYGA 5C80A 5JPDA 1W59A 2PXAA 1J07A 2DY1A 2Q3MA 1EE1A 5LC1A 4E2WA 2E3JA 4AJHA 2AJLI 3JAKB 1THMA 1GCIA 9MHTA 1BS2A 2NU6A 2WZDA 1ZS9A 1LPAB 1PJQA 5FTJA 4B8ZA 5IT5A 1SOAA 1TW3A 2IUYA 4UEOA 2J3MA 1G21A 1GR0A 4U2DA 2FEOA 2JEZA 1LQUA 2OQRA 3TE7A 1SXJB 2YIJA 2CNKA 1RAEA 3PNOA 3PNQA 5HFJA 3SQNA 4C21A 1JMKC 3PLNA 1KE2A 4C0LA 1E2BA 4N5HX 4NZOA 1COZA 4QUJA 1K0UA 5HKBA 1DIAA 4G0QA 4DAOA 1DEXA 2O1EA 1L4KA 4XDHA 3QJGA 3NWPA 3ZC3A 2OCBA 5FNVF 2IEDA 3H75A 5I9MA 1YVPA 1I2BA 3WGHA 4R8SA 1BWRA 5B7QA 2A3RA 4JUBA 4LYDA 5AJVB 3H2ZA 2Q8QA 3D6VA 4CG1A 5DEOA 4RETA 5CVDA 3C3BA 2CBXA 4Z8XA 1CQZA 4AZ0A 3OEEA 1SWWA 1KMMA 1UJ2A 1X8KA 2JGMA 1NDQA 2DTDA 2RHOA 1XT6A 2UVDA 4U6QA 2YASA 3WTCA 3KQOA 4MUYA 4KUEA 4LJ9A 5BMVB 4H31A 2ZM5A 3C45A 2IOFK 1EZZA 4HLUA 1HLGA 1MHPA 1WPGA 4IDHA 4QELA 4UMVA 3V34A 1H6BA 2Q6VA 2OO5A 5D3KA 2GZ3A 3DAPA 4GRDA 1V43A 3SDBA 4OXYA 2BGLA 2OORC 4RV9A 1R0YA 3VA7A 1QE3A 3ASYA 2GBCA 4OREX 4UZFA 4X20B 1J24A 5EKSA 4TLAA 3V1TC 4JC8A 3HO6A 3ZVRA 4D44A 4UAUA 3GRFA 2ZUTA 4M49A 1RXIA 5K4HA 2Y93A 1F20A 3L4BA 3NVDA 3JQGA 3C3DA 2VLIA 3H97A 1UBGA 3E81A 3PDIB 1AG9A 2R7NA 2D2EA 2X7JA 5C35A 3HP4A 2DOKA 2FQ1A 2B5WA 2WOJA 1DAGA 5BWBA 3DZFA 2DWPA 3FYCA 2H1HA 3CV3A 4D5GA 2VNSA 4U0KA 1R0ZA 4MPDA 4D2IA 1FRVA 1WHSB 3NT4A 4LI3X 1N2GA 4NWIA 4F7WA 2OFXA 5B4TA 2GTHA 2Z30A 1GILA 4NZ9A 4RK6A 1I32A 3K72B 4URWR 3WGMA 5CEFA 4L7VA 3VOTA 3HYRA 1VSBA 3OAAD 3GD7A 3IQGX 4WXEA 1Z82A 4BFVA 4P4SA 2G5GX 3EMDA 3A3NA 2XRFA 1NVVQ 5J2UF 1H2BA 2OB1A 2PG3A 1UF9A 1XQ9A 5CVJA 3V3TA 2I54A 2TRSB 3GRUA 4ER6A 3VSCA 4G0ZA 1QGUB 2Q50A 1Z45A 1BN7A 3JXEA 4E14A 3K0SA 5C3UA 3GW8A 4P36A 3CCCA 4CNQA 3OX3A 3FDIA 3GEIA 3SS8A 5IVHA 1GGEA 3HR4A 1K6JA 1Y3AA 2QSZA 3LC7O 4Y7CA 4FT4A 2YZNA 3LD9A 2J48A 3K9GA 3DDHA 2FQWA 2JANA 4F9GA 3O82A 1KY3A 4EA6A 1XZPA 2VHVA 3LA6A 1XLVA 3QI2A 5DYGA 2UV8A 2NU9A 2RB5A 1KZGB 1RW4A 3DNFA 4J3FA 4DV5B 2PXXA 2WJGA 1Z5OA 4J4TA 1M2OB 3TMYA 4JKOA 4MW1A 4CIWA 3UZUA 2XCLA 2L82A 2RHMA 3CNBA 1MABB 1LJLA 3RC7A 3E7FA 3BX1A 2C2GA 1DKOA 4EBBA 3RROA 3DPSA 2CVZA 4KBYA 4KIFA 5BVHB 5K8LA 1VLLA 1X3SA 4EY7A 2JLQA 2A9KA 3ILHA 2O5CA 1YB5A 4H4EA 5FUBA 1P75A 2F3UA 2PUHA 2PAFA 3D43A 4L16A 1T5BA 1VKNA 4RNCA 3FX2A 4HMPA 5HMMA 1Y8RA 3VYUB 1M9NA 2AKEA 2ENWA 1CFZA 1C9YA 3GEBA 4PSCA 3GMDA 1ZR2A 2Y1EA 3QUQA 3RUDA 1SBCA 2HLHA 4OK6A 3EE6A 4B09A 1A9QA 3KB8A 1AGRA 1BYIA 3WQSB 4QARA 2YFYA 4QXPA 3PJRA 3TI9A 3GT7A 1EHYA 3AUJB 5FXMA 3A37A 1KY5A 3LC0A 4NCAA 3P0HA 4XASA 5EY5B 4HNSA 3ZU4A 2ES4A 4R2XA 4NATA 1W96A 1ZSYA 5JAOA 5EZYB 3AJDA 5KDOA 5KOHB 2PZBA 4H0NA 2PKCA 4RIFA 4X44A 3AVVA 3LIIA 4O33A 4CIXA 2LDXA 2H4ZA 3QKUA 3NAZA 1VHTA 5AJXA 5TLSA 1XTRA 3NXSA 2JJ1A 2OCLA 4FC7A 5B3JA 4A8JA 1JDNA 3D3EA 1UKEA 2YJ4A 4GM4A 1KSGA 2ACEA 3PQFA 4PYRA 4CR7A 1V11A 1F38A 1JJVA 1V4BA 3A11A 2VQSA 4JUAA 1XF1A 2DE0X 2IYZA 3DXYA 5JATA 4XB6B 5AKHA 1YJXA 2PUTA 3OLQA 1DXOA 4TS1A 1JH8A 1Z4LA 4MWBA 5HEKA 3QUSA 4EY8A 5B37A 1I36A 5ISMA 1O3YA 2G9QA 2HJHA 5ARBA 3LKDA 1F60A 3VR6D 3ZK8A 2RAPA 1KKUA 3ABZA 4IAOA 3EVBA 1OX5A 5F12A 4B2PA 2BKUA 2ZJ7A 2C95A 1C0LA 2RI1A 4LI0A 5JYEA 5H0IA 3ZW8A 5ALTA 4LSZA 3FFTA 1I3CA 1QE5A 4LZAA 1DC6A 3V32A 2BD0A 3P71T 2WM9B 4M7RA 5DMHA 1L4GA 3VKFA 4PNEA 1IUOA 4YB8A 1BWSA 5E1BA 4EZIA 1FFXA 2QY9A 3FUWA 4CJXA 4HCJA 2JVIA 3HCWA 3I9V6 2ZE8A 4QRDA 1Z33A 3AZQA 1SK8A 4DQVA 4AYXA 5I48A 1X6VA 1BJRE 3E9NA 2CYAA 1KYXA 3MTDA 4RY0A 2YVLA 1J39A 1TQ2A 3MS2A 1XGKA 4WLNA 2CXRA 3CZQA 2DBQA 4DG5A 4EARA 2WWFA 3T5AA 5B58C 1LZKA 1OF1A 3QE3A 4GYWA 4YUWA 4BO1A 3VPXA 1N3LA 1PYOA 4I4CA 1VL1A 1KARA 5DGIA 1V16A 1GL7A 3PEEA 3L43A 2H17A 2AYYA 4N3BA 1TA0A 5FNVB 1FVOA 1IUPA 3BF8A 2AOXA 2VNJA 1PD1A 4NCJA 5G02A 5K3AA 3ZH9B 3A9TA 3CH7A 3SZRA 1FLDA 1SC4A 1GGKA 1IM2A 2OL4A 2UZAA 3BL8A 3GH3A 5C8YA 4XE5A 1U3GA 1TW2A 4EHIA 3GJ0A 3PVZA 4MP3A 1DUIA 1H2EA 1W4RA 1DNPA 2PD3A 2WHEA 2YY6A 3G2KA 4HDCA 1KAMA 3F9RA 3IBSA 4GI5A 1E2PA 4PE5B 3OM8A 3RFXA 3ZGZA 1ACMA 2O7QA 1URPA 1WOYA 2FH5B 5THXA 5AQEA 4W1QA 3QP9A 1S0UA 3EYAA 4CDNA 5A9SB 1KS9A 4TL7A 4RBNA 2II6A 1SIUA 4M9UA 2EFYA 4PLWA 1IK4A 2ZOSA 2HPHA 3FOWA 1AKQA 2VA8A 3EXIA 2ATEA 5DSZA 2ONCA 5EKDA 2E82A 4RPJA 1W87A 3HMKA 2O14A 4BNLA 3C6KA 4Q48A 4F9FA 1G17A 1P1BA 3D7RA 3R9IA 3SIWA 3VPSA 4B3BA 3ZHQA 4BY9E 1MX1A 1QUFA 5H70A 1QDEA 1ZO8A 1NFRA 4OJYA 1C4KA 1E9AA 1WQ4A 4OOFA 2NZJA 3R09A 2EKDA 3VNUA 1DBIA 2LNDA 3VGPA 4NOKA 1YJ5A 4WT7A 1XFDA 2BJVA 2XXAB 3QEMA 3L8DA 1GQFA 5G1NA 4ER7A 1H3EA 1I7LA 2GZDA 2EHJA 1U7PA 4AULA 1FUEA 4FFBA 2QM3A 2O2CA 3UFXB 2ZBQA 3S1LA 4YAEA 4E30A 1P31A 1B93A 1Z0KA 4HADA 1CC1S 4OY3A 5DI3B 5EMJA 1SB9A 3SE7A 5K0JA 3K6SA 4D9KA 4MMYB 1XTSA 2GHRA 1W47A 4QOGA 5JCJA 2G4VA 5J2UB 1VPWA 3B7WA 3F7TA 2JZCA 4W6QA 3H04A 2IUUA 4RCYA 4C29A 5BWOA 1VFNA 3M2TA 4YBRA 5BSWA 2AQIA 2YZKA 2Q28A 4BIMA 3G8CA 1RVDA 2DMRA 2V54A 3HUTA 3DOCA 3HUUA 5HQ3B 1U90A 3W3AD 1Q83A 4P4UA 4BKPA 5DXFA 5EIEA 3PX7A 1NMYA 4ZALA 1FBNA 2GAOA 3FVTA 3MZ0A 2P6NA 3MF4A 2P65A 3QTLA 5BVGB 3KQUA 1NSFA 3FAZA 4O4HF 1GZ6A 1BOFA 4HWTA 1IEWA 4QTUB 2PFKA 3F5FA 2Z2XA 4M1TA 2VP9A 4X63A 5BR8B 3KYCA 2Y9PB 3JZAA 2NPFA 1Z8DA 2VN8A 1XELA 3FZYA 5EZ5A 1OXUA 2BFFB 2OENG 3H5RA 4NYIR 1QHNA 3FMFA 3U2QA 3VVLA 3ZI0A 821PA 5AJTA 3RTEA 1BN6A 5DYNA 1I3NA 3F78A 3DVAA 1DS6A 1KC1A 1M1NB 3K09A 4FNGA 4US0R 5CH8A 3U31A 2FR8C 3RS8A 5DTIA 1X14A 4H08A 1F48A 4A15A 4CL0A 4KREA 4Z4GA 1WCIB 3ILVA 3L6CA 2WWTA 4LMPA 2PGLA 3W6ZA 2NO4A 2AIRA 3N39C 4DF3A 3PWSA 3STXA 2AXEA 3IPAA 4BQNA 2RHTA 3Q5GA 5JIBA 1LTQA 2G7MC 2QVYX 4Y8VA 2BMAA 1DQSA 4MKGA 1R12A 2O3QA 2PFSA 2R1UA 4JFAA 4BBPA 3THWA 4PQGA 1U0NA 3K5IA 2G71A 3BE5A 3DTVD 4QO8A 1AV6A 4AL4A 4Y67A 4IKEA 4MYSA 5DDIP 5D8DA 4B48A 4NS1A 4D96A 4ZYWA 4D74A 3DLTA 3X1ZA 5J4VA 3GROA 3JVUA 3DGEC 3EARA 3GYGA 2IU6A 1J21A 1RLMA 3HUDA 1YQUA 3W9SA 5F2NA 2V6GA 5HM8A 5B2EA 1R00A 3PTAA 2C97A 1C3XA 4UDXX 1SHJA 1KY2A 3NCTA 3WLOA 1N8TA 2CMHA 1UKBA 3DV0B 3TQCA 5B57C 5J40A 4B4UA 1Y98A 1JQAA 2FJ0A 2IEIA 3VSAA 1EM8B 1FFCA 1F2VA 1NNSA 4U02A 1FVFA 5SZHB 3RANA 4XFJA 1GZUA 1LBSA 3B7PA 3IVMA 3WIUA 4B6OA 3D2BA 3ANXA 5GMOA 2F1KA 3MWYW 2FN9A 5CA1A 3AW8A 2XMBA 3AHFA 3N0RA 1XMVA 3I62A 2QD1A 3VU9B 3NASA 3DXXA 4DV7B 5CG1A 2RK3A 3NT2A 3RLFA 2ZSHA 2FVYA 2R6DA 1GN9A 1QIEA 3ZH2A 1EYZA 3R3JA 1QKKA 4AQ7A 4JCOA 1K06A 5D3QA 3E0XA 8LDHA 2O3UA 3IUQA 3OMWA 4QYIB 5D87A 3FETA 1ZJZA 4DN6A 3I8XA 3C5EA 1ZINA 4TUYF 4ENTA 4KR6A 2IYLD 3PFWO 3I2GA 3V80A 1ZK3A 1E9BA 3LT1A 4ZVUA 1SQ5A 1Z0AA 2WJZB 3SMQA 1PZMA 3WFJA 1EVQA 3LWDA 4JIGA 2AQ8A 1YZTA 4HDAA 4KXYA 1VMIA 3KFXA 3NHBA 1D4AA 3U26A 3ENKA 3HYLA 2NVOA 4WFIA 2QMHA 1U9YA 1XDGA 5IWCA 4LZJA 2QE6A 3BB1A 5L45A 1TLFA 1J7KA 1U2EA 1Z08A 3DEYX 3IALA 5CR9A 4P84A 1ESZA 3PXXA 1H8HA 2P4UA 2WM2A 2XY4A 2OBLA 4HQLA 2QQ5A 3SWWA 2AOTB 2ZXFA 5IEBA 1OI7A 3GRKA 2HRQA 2WWRA 3URMA 3PPYA 4G86A 4HAYA 3WBJA 4IMPA 3QYFA 4KKVA 4WRRA 3KPYA 1PS8A 1PBNA 3A9WA 3UMVA 2V4UA 2ZQ5A 3JU3A 4H3KB 5AK0A 1K4MA 1ZJ5A 3JQCA 4D7AA 4E2YA 3FZQA 5A3QA 5CA0A 4M7OA 4RZUA 2R2AA 1Y7PA 1KTVA 2EZ9A 5D86A 3TD9A 4BFZA 4CCAA 4F2PA 4CL2A 3HJFA 3RG8A 4ZHQF 3RIXA 2H8GA 2Q2WA 5ELXA 4CCSA 5GV8A 2XQIA 4RZ2A 4WN3A 4OI2A 1XMXA 2AR9A 1LBQA 1PR4A 1VL2A 1WV0A 4RSMA 3H5OA 3TEFA 3TOSA 4ZHSA 3WWPA 1DEOA 1DC5A 3RWBA 3KQPA 1I3KA 3JYPA 3QU2A 3KUKA 2XWQA 3S29A 2WQ6A 4BGUA 1KI9A 1TF7A 2VJLA 4HXFB 2GEFA 4V3BA 1E60A 2BTEA 2HV9A 1JLMA 3GBPA 4TL9A 2QVBA 4X1IA 2NUAB 1T8WA 3I12A 4WN9A 1JI0A 3QA3E 1B6TA 5H9VA 2F8MA 5J5CA 1P8AA 2VAVA 2XUHA 4DR2B 2OMKA 4P2BA 1R15A 3KQQA 1ZM3A 4P3PA 3VI3B 3ZBQA 2YV4A 5C5CA 2R5NA 2IF2A 3H2HA 3RS5A 2XTZA 5I7EA 1VJ0A 2OHVA 5M34A 1Y0BA 3MHPA 2IBMA 1GA4A 2MSDB 4DIBA 3PIIA 4A2QA 4KQGA 3NBMA 3T0IA 4BU1A 1GEGA 2X0DA 1TM3E 3STTA 1MKYA 1YDGA 3Q3GE 4AG5A 4YCCA 3QLVC 4BZPA 1L7DA 4K0RA 1P1CA 3CEHA 4LHVA 2CSUA 5E95A 4BN0A 4IX9A 4IV5A 2I9KA 3IAUA 3QPVA 4Z7OB 4DUZB 1N9ZA 3RSCA 1B1AA 1Q17A 3ACBA 4HHEA 5GADl 4RZHA 2WMYA 4WX2B 1MN6A 4FZ3A 5HUQA 3NTLA 2VP0A 5ARDA 1ZDMA 5GZ1A 5JD4A 4BXOA 1ZC3A 5FCDA 3AYXB 3LXRA 1FB5A 4D99A 4EPVA 5JJIA 1GRCA 4BLSA 1QYVA 4CR6A 1M75A 5K0TA 1SEVA 2PS9A 1NN0A 5KNCA 2D2XA 2UDPA 3ME5A 3N58A 3LUBA 5DWDA 2KQUA 1W30A 5F35A 3D6UA 4UVEA 4S0ZA 3SBOA 1RJWA 1U6KA 4CKYA 1LNQA 2QZ9A 4NONA 5EIAA 3W4IA 3WLHA 3KWLA 4I50A 4BNJA 3NBYC 2HMTA 5EKTA 2OHXA 4O4HB 5JROA 4BFXA 4GX5A 4CUJA 1Z15A 3FTPA 1ZIDA 1XZNA 3LDAA 3QJYA 3BA6A 4J4BA 4XSVA 5AI4A 4EYQA 4YMVA 1ZU5A 3EGXA 4A8TA 1E66A 1N3BA 3P9KA 2LV8A 4MR7A 4U2CA 1ADFA 4C3ZA 2PQMA 2PS3A 4Q02A 2XZLA 1S2MA 3RD5A 5C5IA 1OFHA 2GBLA 2GLUA 2JGRA 3QOXA 4II3A 5FL7A 3S2ZA 4LOAA 3OZGA 4Q39A 1O89A 2EOAA 4G97A 5CCXA 4EGAA 1OV4A 2BF7A 4ZVQA 2FTKE 2WHQA 1EAMA 3O3NB 5IUNC 5AW3A 1RPZA 3NHWA 4PWZA 3ET5A 1U65A 4GX1A 3OFSA 1GG2A 3WTBA 3N9IA 4JV5B 4TV9A 2I2XB 1C0IA 5FT9A 3RYIA 2OBMA 1YO6A 2X0FA 1JP7A 1R4NB 4HDSB 5HRAA 2XB6A 3F4LA 4HAZA 4K8RB 3GLKA 2JAXA 2FW9A 3WGKA 2P6RA 1YSCA 1JHZA 2GXQA 4C43A 1MB2A 2VRNA 3HU2A 3RK1A 3QWIA 3G6WA 1ELOA 4ITVA 3H1PA 3W1WA 5CLQA 5DT9A 4ALIA 1C7ZA 4G41A 3TZQA 1PQUA 4EVRA 2QVCA 4LCBA 3TRHA 1E3MA 1MQ8B 4QJBA 4W8GA 5AHKA 3V8EA 2AQKA 3LW7A 4NVRA 4WNYA 4D9MA 1TECE 2OZEA 1I8TA 3PDWA 4QUIA 3EIHA 4YV2A 1UL1X 3HV0A 3NNDA 4WFJA 2NSDA 2HJWA 3OICA 2CNDA 4A7PA 4CWAA 4P80A 2DYKA 4QXAA 1KIFA 4XTCS 2WTMA 3TM5A 1DAPA 1KFBB 2B92A 3TR6A 3VJMA 3SBDA 4G07A 4N8DA 4M87A 5CIQA 4FNOA 1PI3A 1S3SA 3QVSA 1TIKA 3BTSA 3QX3A 5KZMB 1E98A 4N0PA 3L1JA 4KQWA 1N1DA 2F1JA 2B82A 4E0BA 2CXXA 3QFFA 3N05A 1A76A 4GOND 3V00A 4BB6A 2CMGA 3IO3A 3Q0EA 4C4YA 1JQEA 4OP3A 4ARAA 1C4OA 2G88A 1PJCA 5EWJA 3AEZA 4R9SA 1OJ7A 3O8CA 3QPDA 4N54A 2PH1A 1S5PA 2VZ8A 4H4DA 5AVYA 2HRBA 4R40A 1S3FA 1G4AE 3HVUA 2I4MA 3G6KA 1M54A 2CKDA 2JHFA 3NIBA 4HVAA 4P3NA 1RWVA 4TUYB 4C05A 3QKSB 4EBFA 4F96A 3A1UA 4FMBB 2DUUA 3UY4A 3ESAA 5ARCA 5HE9A 5BV8A 3I05A 1PUJA 1ZUD1 4MVXA 4TQ9A 8GPBA 2Q07A 3OCYA 4MJ7A 1NXQA 1VHWA 3HWSA 3QE9Y 1O96A 3RJTA 4OJMX 4FGLA 4B35A 2VNKA 1OAOA 1OI2A 2VHEA 3Q9LA 4UJ3A 4UPEA 1PT5A 4N7BA 3TLAA 2D00A 2AXQA 4WVLA 2FX3A 3ZV3A 4FHFA 1M1YA 2QBYB 1PVDA 2G17A 3T7EA 4G8DA 3T41A 1JFTA 2UUBB 1E79D 1GPYA 3BWVA 2Y71A 1W6RA 1GKIA 4LRWA 2AOUA 3OZFA 3ADOA 1QRSA 3HYCA 3KO8A 1QR6A 1JZSA 3HNPA 4KMSA 3RW9A 2HPAA 3D7LA 4D9FA 1CQJA 3GLQA 1W0CA 5LJLA 1IY1A 1MORA 4R98A 1GQOA 3EMBA 1DBVO 4ZDIA 4WGFA 1N2HA 3FZNA 1TXGA 1DAHA 4BRZA 3L5KA 4C06A 2N1BA 2CDBA 1TTQB 3ABSB 5M2QA 3F47A 5MN6A 3JWGA 1UK7A 2VDLB 3VHRA 1JR6A 3CVWA 4UPDA 2ZFUA 4OQMA 4JBWA 4XSGA 4F6RB 3ZJUA 4YIHA 3QHPA 1I5RA 3NHLA 4R01A 3TLGB 1QB7A 2DUWA 1IHYA 3ZGYA 4OUKX 5EP2A 1MTOA 1WF3A 4HGNA 3ITNA 2IUEA 4JBYA 3TTUA 3EHEA 2DQKA 3RVBA 2DUMA 1FP4A 2R7KA 3Q1KA 3K2QA 5DGDA 2BEVA 5FEMA 3B3AA 1M5TA 3E5RA 5FJIA 4J3NA 5GIOE 4DV1B 3LX5A 4IYJA 2WT9A 3WICA 4YRPA 1EVIA 2CJWB 2JIDA 1U81A 4N0QA 1ZGHA 3O4IA 4XLTA 3SG0A 3IUMA 3SY8A 2QHXA 3INGA 3KKOA 4UEWA 4U2GA 3ZG6A 1MPXA 2V74B 1X74A 2VCEA 2IZ5A 4KO1S 2EZTA 4BX8A 1NBEA 2VZLA 3HB0A 4GH5A 521PA 3H16A 1IN6A 4BO5A 4BVBA 3NHUA 1U2ZA 3HN6A 4GWKA 3HY6A 4LWQA 1NXXA 2WFMA 4JGGA 1CZNA 4UW9A 5AVSA 2ZBDA 2JH3A 2BFBA 4LNUA 3SD7A 4EG4A 1C3OA 4K26A 3L8YA 4RHUA 1HR0B 1A95A 2AVNA 1N1EA 3FMPB 3UGJA 1UQTA 2X4LA 1HEIA 4DT1B 3FOBA 2HJGA 4IDAA 3TLXA 3TSCA 3AVOA 2C78A 4RGVA 2IP2A 4X64B 5TX7A 2CNWA 3N2GB 4GOXA 2P2GA 4I9FA 4WBSA 3HKBB 1USWA 2BBSA 1YQGA 1G6HA 2QOEA 3WHPA 3L0SA 3OY2A 5HNKA 3CVYA 2X9NA 1H6AA 1T2VA 3EQ8A 2QORA 4WOCA 5JAQA 1SUWA 4R31A 3BWYA 1OBOA 1UXOA 1JHUA 4OD0A 3BOSA 2A5GA 2EARA 4HRAA 2Y05A 4K6HA 4YS6A 1W0JA 1ZK1A 1TPZA 2WNHA 3AUYA 3LHIA 2O0MA 4JWKA 1IN1A 4P32A 1Y8CA 3PHLA 1NBAA 4J1SA 2E1RA 2HHLA 2VH5R 2M1ZA 3KXDA 4ZYYA 4HB4A 4CRWB 3KWJA 1GTVA 2A5JA 3DDZX 3S40A 2M6SA 3ZLJA 3NH9A 2MSLA 3MQFA 3OM9A 3TSYA 1ST2A 5DJ5A 1IVNA 4MGKR 4NCNA 5JJLA 1UP6A 5FOSA 5CT9A 5G40A 1FNCA 1WPRA 2I4LA 3QGMA 4CGZA 1S3GA 2RG1A 1ZSVA 2TS1A 3A27A 4BV9A 3IMCA 3QTBA 3OQOA 1V45E 2R00A 1E5VA 1N2IA 4JXJA 1TKCA 3KYIB 4M1SA 1YJAA 1FS4A 3OZDA 2F62A 4LOIA 1ILWA 4ABTA 3ND9A 3PUJA 1P3DA 4FCWA 1TLLA 2EERA 4MLDA 3O8NA 1Q14A 2DJ5A 3M1IA 5AW1A 2PZEA 4TSRA 1SN7A 3PUHA 2H4WA 3FNIA 2E4XA 3FMOB 3JAKA 5JSFA 5JTTA 2OG1A 3N0XA 2I2CA 4IHKA 1NPYA 4NG4A 2M98A 2OXRA 2OYSA 1A8SA 2E4WA 2WNSA 1YU6A 3MYYA 4XGKA 3JD2A 1XP5A 3WYBA 1KDYA 2JVJA 2Q5QA 2GD6A 4DLRA 2VF8A 3TZBA 1OXBB 5CFLA 1K3UB 4P0PB 4MI9A 1C3JA 2R44A 3RARA 5KNDA 2RHBA 3JYLA 3WKCA 1HNXB 4D56A 2XLCA 1HDEA 4EW1A 1MB3A 4IWYA 5A4JA 5DOVA 4GM1A 4V38A 1ZOSA 2QJRA 3HGTA 2V4MA 3HU3A 3NAGA 4HXYA 1PWEA 4JLDA 4F12A 3R76A 1IQRA 3SGLA 3VR4H 2AZTA 1KI7A 1XWFA 1QWSA 2NQ2C 5K45A 2PZGA 1V8PA 1Z34A 1P4JA 1EUDB 1KJ9A 2FCAA 3BMNB 1KFEB 3DTTA 3MSXA 5BNFA 5T64A 4CN9A 4D4KA 2VDRB 3HC7A 4YYZA 4DCSA 5BUCA 4GRIA 3HI4A 4YQZA 3KV3O 4CV2A 1YHYA 2P7IA 5BSEA 3KVOA 3MUNA 5KPDA 3HKEA 4R8RA 4QRHA 1XZKA 1BMDA 4PGAA 1EFCA 4L8FA 2BKLA 4WE3A 2IPAB 1PFQA 3SKYA 2C20A 3E9EA 1O97C 4M22A 3N28A 5ER9A 1Q1NA 2X23A 2XODA 3IKTA 5I5GA 4EHHA 3AV3A 2GCPA 4X20A 1MQSA 4I4TF 1UH5A 4MV3A 5JWOA 3B6EA 4EYOA 3K0FB 3KEMA 3OWXA 2PUEA 4Z7JA 5IZCC 1JL3A 3L04A 1KVRA 2NXWA 1HT1E 4JJKA 3U48A 3PDIA 4N9WA 2YYYA 2Q49A 1AC5A 2A35A 5AJWA 4Z9YA 4W82A 3VPGA 3OOJA 2JIOA 2DHEA 4G85A 5EE5B 1PL8A 1E5LA 5ICFA 1BCRA 3OMXA 4F84A 2GERA 1NJ2A 2R79A 4N5LA 2DLDA 4AJ2A 4D8YA 4HNVA 3CVJA 2C61A 2WAOA 1JDBB 1ENPA 2SKCA 4P82A 1SOVA 3V1MA 4BNIA 3WGOA 5I6DA 4Q00A 2WB4A 3KT3A 3KPWA 3SPXA 3DJYA 4YLEA 1YFZA 3OPXA 2A9PA 4XQCA 1X86B 5F7JA 2C9BA 3CLVA 2Q3DA 1Y1RA 3AVQA 4F1WA 4JD5A 5CLIA 3G0HA 3EVZA 1EFUA 1TMGE 3NHRA 3AETB 1V48A 1V1RB 1YAJA 3WS7A 4BP1A 3AB3A 4JL5A 2OPBA 5CPBA 3FLAA 3PQEA 3TCXB 3RSHA 1SKBA 2EBHX 2PQ2A 2DC1A 1SWVA 3BF7A 4D02A 4PWYA 5DNYB 3HB4X 4D5EA 4DW8A 1R9NA 1YK0A 2F8SA 2GSWA 5FNZA 5T6BA 1MVOA 3V4OA 5SICE 1N0HA 2HK9A 2P7HA 1H0RA 4RS3A 3GP3A 1LV7A 4BUCA 2ZYVX 3E84A 3NV9A 3I8SA 4CTJA 2XA2A 5U4QA 3WYGA 2H2WA 5IAAA 1QPZA 2Q1TA 4M9QA 3RUFA 4KGDA 5EP4A 1CUYA 2BR3A 2H4XA 3FSJX 2GPSA 4JUCA 2QUKA 3TDMA 4DMGA 4XVRA 2QMZA 3LY9A 3INTA 1Z37A 4G23A 1MABA 1U0HC 5DHFA 4MKIA 3JZMA 1Z9BA 2FK7A 3OF2A 2WTEA 5DNEA 2E55A 4N76A 3H83A 1JBKA 1PD0A 4Y30A 2NX2A 2JKVA 3W1EA 3A32A 3W5DA 1CE8A 2ADMA 3UW3A 1LI4A 4S24A 4Y6GB 5ALLA 1USVA 2JGKA 3CYFA 4QGHA 4B3XA 4RM3A 2ODEA 2X9LA 3ZE8A 5LMCA 1Z2NX 2E4VA 1QDUA 3R40A 2QVZX 1X7HA 2OXIA 2OO5C 3ZGVA 1D7OA 3OZAA 3QXJA 4F3TA 3RB8A 3N6XA 1GXSA 4ZI7F 3VR5A 3OFVA 5DBHX 5KYNA 4EECA 2B69A 1WCWA 1FFGA 1DQYA 2G80A 3ROQA 1DE0A 1R37A 1E6KA 3B3GA 3IT0A 4J0EA 4U6SA 1FRNA 2GN9A 1P73A 3F5SA 1NJSA 2NT4A 4ZXFA 5IABA 1R0XA 5KOHA 3UNXA 1E9CA 1GTMA 4ZAYA 5LYJA 4EKEA 2HK7A 1Q3KA 3LBHA 2QPAA 3NHYA 3DKPA 5B58T 4ESHA 3W1VA 4DR5B 4A6XA 1DRJA 1F9AA 5LJIA 4NZMA 3LKBA 4D0RA 5ALRA 1N5MA 1LDGA 3EA4A 2EFCB 3TSAA 2XDQB 1UJBA 3CT4A 1EDZA 1XXHE 2X5XA 2XITA 3AF1A 4G2TA 5ENZA 2X0EA 3NCHA 3ZW9A 1UXKA 4KCGA 5ICEA 1U4NA 2NN3C 1DPFA 4KZPA 4NXMB 3WJAA 2O8DB 1E18A 2GBGA 3ZDZB 5TF0A 4XVQA 2O2YA 5TPZA 1P19A 2OV2A 3KLNA 1BU8A 4ZMRA 2UZIR 1N1MA 2XEDA 2ZAIA 1LLQA 4E7PA 1RAAA 3EMKA 4XM0A 3G0IA 1JVSA 4O08A 3BGIA 5FA6A 1L4HA 1XPRA 621PA 4QYTA 2A84A 2R7AA 2EQ5A 3C7CB 3IOYA 2DTXA 5TVKA 4I6EA 5JXHA 4FILA 2NSHA 4LYEA 3SX2A 3R6TA 4NRDA 4ZC8A 2Q5IA 3P2OA 5HA5A 3N07A 3VDQA 2ET6A 3R7WB 1F7UA 3FDFA 4QPZA 4URZR 4GOJA 1RP7A 4RMHA 2CJFA 2BEUB 1IH8A 4JP8A 1EFPB 1GV0A 5D5QA 1TEHA 3C3JA 3CLRC 5T3UA 4ESEA 4P33A 2RKOA 1R18A 4MUAA 5F2KA 4A0QA 4HGZA 4R9NA 3EWSA 4G1UC 2V6JA 3IIKA 1L5RA 2ZCVA 3NBFA 5FOXA 3UHJA 2GHIA 2PZFA 3CUWA 3K2BA 3AR4A 3ZXUB 4ND8A 2DETA 2Q45A 2YWBA 1CUAA 4GL4A 3C3PA 3KOUA 1AKMA 3CBGA 1QG0A 4CG3A 4R81A 1GPH1 3KE9A 1DEHA 3AY7A 3ITDA 1QCYA 3CR7A 3E8XA 4NBKA 3B89A 3PFBA 1JSRA 2JJ2A 5LZ5A 3SQMA 2PVSA 2VQDA 3M9LA 3TDNA 4EPRA 4LX8A 1IOLA 1J7JA 2Q4TA 3HBMA 3NC0C 2ZJFA 3MGAA 4ZQIA 1XNRB 1QR2A 2W6MA 2IDMA 1T5DX 5LBUA 5FNVA 4RA6B 1SM4A 2I6GA 2P9QA 3M6MD 2NSYA 1QFYA 3N87A 3TZCA 4TTPA 2XUAA 3UWOA 3VR0A 5TEWA 1S2IA 3GG2A 4DQLA 4WW0A 4XAQA 3AUUA 1M2HA 4KV9A 2VBCA 3UG7A 3RYCB 2Q4BA 2VUIB 1E58A 4HTFA 2OV3A 1E1RA 1S01A 1X3LA 2C4VA 4NPHA 3P97A 3Q98A 1NSYA 1TEVA 2IXAA 4PG5A 2CDNA 4F7DA 4S12A 2XVMA 3NM5A 5CM9C 2BM0A 2UYQA 3K9HA 1A5BB 1XXHB 1FLVA 5EINA 5I3CA 2VDKB 1Y6ZA 3VVCA 5JCPA 5C7IO 3RVKA 1U8YA 2BFDB 3I23A 2HO4A 1MH9A 4I4TB 1JPNA 4CM9A 1JR4A 4QX6A 1R0WA 2W93A 3GWGA 4DJ5X 3NJRA 4CGYA 3G2JA 3A9CA 4U9UA 1SUIA 3RHFA 4ZAGA 2QENA 2C0QA 5DWQA 5LZ9A 2FN8A 1KMCA 3BBPA 1ADBA 2J9XB 4YDHB 1DDGA 2V7VA 2QW0X 4I8DA 5FBKA 1J49A 2CNOA 3G2OA 1PEDA 2G8NA 4YQEA 3KB1A 5HF9A 4CDMA 1U7XA 3VKUA 4YMUA 4C6SA 3G1TA 8ADHA 1C7EA 2GPBA 4RABA 3GJ5A 2NNLD 1K4KA 1ZJYA 2G1KA 4GR4A 5TMPA 4BCBA 2A33A 3MELA 4BYMA 3C7DB 1U3UA 3IULA 3MPOA 1A7KA 3UFXA 1YCFA 3DOUA 1JIQA 3UICA 1TTTA 5DI3A 2B9VA 3QF7A 4N39A 3C7AA 2BFWA 3PICA 3QTTA 4YMIA 3M6WA 4NMHA 2I1LA 1FL9A 4MQ5A 3Q40A 5J2UA 4HUJA 3WNVA 1IBRA 3DMGA 4J0QA 4YDRA 5CD9A 4KB5A 4QEDA 1P0QA 1RLUA 1R0CA 2WD8A 2BKXA 1C1DB 4BVAA 3U3OA 3T3HA 1H8EA 1X15A 3IUPA 2Q2VA 2VTBA 3AMVA 3PLRA 3OLVA 4M1KA 2IT1A 3TYXA 3U37A 4E4RA 3OZEA 5KYWB 3REOA 1MO4A 2HA3A 1NJ6A 2QI9C 4N0DA 3OPVA 3HDQA 4PQFA 1ZH4A 3NJ8A 3CRQA 3X1MA 4JUFA 4BOYA 4E3WA 3U56A 3L0YA 1I4WA 1MJFA 4CZ2A 2O0HA 3DHNA 1YKFA 5FUQA 5TPWB 4BZXA 1PTKA 3RS7A 3AXTA 1XNJA 4Y9TA 5A4IS 4BPBA 4G0OA 2ZK7A 3C7TA 5L9AA 1OR8A 2WM3A 4Q1VA 2BFFA 4DIEA 4BLWA 4EO7A 2NM0A 1KEPA 2JIZD 1RE1A 4W1SA 4DLVA 1E7RA 2XR1A 4GSKA 2GFHA 1NJGA 3QUAA 4R84A 5K8IA 1X7DA 4CKEB 4IZIA 4RX1A 3CB4A 5JUWA 1YMQA 3GJ3A 2C5FA 3H1EA 4MPTA 4U2KA 3KQTA 1WCIA 1ZW6A 3M49A 3WG9A 3G23A 3HI6A 3Q3EA 1W0KA 2G9RA 2R8BA 4OU4A 4RL4A 3U7HB 4D9CA 3UJHA 4BNNA 2EC5A 1XMSA 3IESA 2V8BA 1Z06A 3OPYI 4JBGA 4L8YA 3BDVA 4ROTA 5K2MA 4PR0A 1IZYA 2B83A 3I5UA 2YH2A 4OQYA 2X1MA 3VZRA 3GGGA 3EVFA 5LSAA 1EKXA 4ZI7B 4U39A 1GUFA 3KBBA 4BJ6A 3MJEA 4EEZA 3PGA1 2RMKA 4OI1A 2K7FA 2GI4A 1JR3E 3GRAA 4BNKA 3VHXA 4PLYA 3AFMA 2XCUA 3A70A 2QTMA 2UZ3A 4FS3A 3C24A 4HZUA 3R75A 4EIWA 1AHHA 1PGPA 1T9BA 2H85A 5BNZA 2JLAA 3OO1A 4K40A 3H13A 3DV0A 4PHTA 4RWEA 5AVJA 5B1EA 5CM8B 4AY4A 2FEWB 1KPHA 4TS4A 5F3RA 1TM5E 1ZXXA 2R68A 4L7QA 4W5JA 4DIDA 3L6OO 1WUTA 3F49S 3GEMA 3T5DA 1XEFA 4H7PA 5LR6A 2C9MA 5JXWA 3G1WA 1MMFB 2X3FA 4ENSA 2ZI7A 1UJCA 3KZCA 3R24A 3LX6A 2DKNA 2H1LA 2C7OA 3VU9A 2WU4A 2DLNA 4EATA 1OAKA 4FHDA 1EX9A 3SJ7A 4MPPA 2OD2A 5MFZA 5HQJA 1PV4A 4Q3CA 3D0OA 3IDSA 3UCXA 1SG9A 1Z0UA 2Z8YM 2RH9B 3C74A 2ZT8A 4Z51A 1I4TD 3K71B 1QKIA 3GLVA 3ZY6A 5DN6A 3WMFA 1Z4QA 2CDCA 3HSYA 4LISA 1YONA 3DXFA 1PX2A 4QYIA 5AICA 4JI7B 4IH1A 4RPLA 3D81A 3P5BA 3HM9A 4P4GA 3QNUA 4EPTA 3EGEA 3RBZA 3U44A 1M7GA 4LY9A 4ZAVA 1P2GA 2KLBA 3WB9A 3EW9A 2IH4A 5GONF 5CB0A 1JDUA 3OURA 1MUUA 4N0MA 4HUQB 3OPQA 5GGXA 3FOFC 2VYVD 4DCMA 4ZCMA 3PJEA 4MUFA 3NBKA 4I8IA 4LRTB 1RJDA 3OFNA 1AHIA 4GQBA 2GDZA 2X13A 4JY7A 3PQ4A 4RZIA 1EGAA 1XDBA 1CZHA 1ZZEA 4XLZA 2ZKLA 2AOTA 2PXCA 2CWWA 1RVV1 2MIIA 3HJUA 4U1RA 2IS6A 1L5NA 3LWBA 4QXQA 3STVA 1E2KA 3OJCA 2PBLA 3PDCA 4DSZA 2PZMA 4H6PA 4HQFA 3ZS8A 4BB9A 2I9PA 4DSOA 3ZDBA 1P77A 3A05A 3OEWA 2F8TA 3QOWA 1H2RS 1G0OA 1DBPA 3BFPA 3D3JA 4KKXB 2YQ5A 5DTRA 5HDQA 3EVTA 3CLUC 1Z62A 4TMZA 1A2BA 3ZX4A 3FUCA 3WLFA 5C4IA 4FHGA 4IVNA 3RUEA 1L8AA 2IY8A 1WY7A 2YRWA 2X1HA 3NTQA 3NQ41 4YJ2F 4CLDA 4D9HA 1XVLA 5A4KA 4PZCA 1XCOA 5FA5A 2HCJB 3IXMA 4RORA 5DXAA 3U6BA 1B8PA 3L40A 4QD3A 4WINA 2QT1A 3RJZA 2J1LA 4NDZA 1Z16A 2H52A 1QLHA 4DZRA 4CQJA 3AWDA 4BP8A 4RF4A 3PIRA 2JL1A 2EL7A 2I78A 2MDTA 3EXHB 4K7JA 4QREA 4RGBA 4PNHA 5ENVA 4LYJA 5EJ9A 3KUUA 1JG2A 3IMKA 2WUEA 2GZ2A 1GD1O 4DV2B 1UAAA 5AKXA 1A5SB 3E18A 4KR9A 4C07A 1JV2B 3FWPA 4TLDA 3CIOA 3Q3VA 3UBMA 1AKUA 5AUPB 1W36C 3TRIA 1DTWB 3DCYA 2IKQA 2X8AA 3R6LA 4YGYA 4CEHB 2QE7D 2A59A 2KS6A 5FBHA 2WPDD 2MHCA 3W8FA 4MV8A 1R16A 4RZXA 5FFFA 5IAGA 4M3NA 3GA7A 3RAFC 1WXIA 2WYWA 3HJRA 3F5DA 5ENDA 5AKLA 3UV6A 4CCYB 2EZ4A 3B1KA 2QG9A 1U3FA 2FOXA 1DKMA 4HD8A 1IM5A 1JDSA 2XUGA 4Y2SA 2V7TA 2IIVA 4DUGD 5JCZA 1Q6YA 2VH1A 5HTKA 2QRUA 4AKTA 4F8EA 4MAAA 3EFOB 4K6KA 2WVHA 1ADYA 4QPCA 2IVFA 5K6AC 1YI1A 1LK0A 3FDJA 2Q5HA 3S2EA 4TLCA 4AZSA 2G83A 5GJVC 5IX8A 4M1QA 2I1VB 4B6RA 5AWFC 4QASA 1IIRA 4R7GA 3RPEA 4X7PA 1SPBS 3ROZA 3TB6A 2Q7OE 1FYXA 2WAMA 4BASA 4OP1A 3TPZA 1LK5A 2DHCA 1O97D 1FTYA 1XRJA 4HGOA 4A23A 1TADA 1CJVC 5B1HA 2XD4A 4BGVA 1TRKA 5CVCA 2Z8YA 2C42A 2YCLA 4C6TB 2GZMA 2OCGA 3QKIA 4HBZA 1ONBA 4XQGA 3RSGA 1CT9A 1JXQA 2GK4A 1U2SA 1II8B 2BRUC 1MDFA 2ROQA 2VJMB 1SCAA 5DZSA 3UENA 4Y2PA 3WZLA 4C0WA 5FFMA 5FOWA 2JI4A 3F73A 2ZCUA 2NP7A 3A1WA 1VL6A 1XZAA 3AFHA 4WY2A 2IEYA 5FPQA 4D8VA 3EZYA 1PJRA 4AP5A 4R0MA 3W4JA 4O4HA 2WRZA 1NNUA 4GPBA 4NIMA 4JMPA 3DHYA 3U09A 5D3ZA 3N59A 2QL9A 1EFRD 1OLXA 4LPSA 4W5HA 3UMMA 3HPQA 2GZRA 3IP5A 4RU1A 3VSEA 5K8JB 3KQHA 2BMJA 2NTJA 3DVQX 2FSPA 3GF4A 4DA9A 1FRFS 4QWWA 3ZU5A 3GUHA 4HS4A 1BQEA 4V0ME 3V55A 4DPKA 3ZDYB 1TEZA 1ZRMA 3DEKA 5IJ9A 2A0UA 2YW2A 5LBTA 4CFSA 4CKZA 5CIYA 3KBOA 1VLZA 1J5EB 4UE3S 1NP6A 1HNZB 5J9FA 2IHZA 3KEGA 3T5TA 3PQ2A 4JI8B 3T9CA 3VNRA 1II0A 3Q6NA 3GEDA 1B6RA 4G9EA 3JRWA 4ENUA 1W5AA 3AFIA 1OFUA 1RKXA 4WL0A 4RDXA 1XVIA 4CIYA 3EG5A 1W88B 4HDSA 1R4NA 4MUHA 3D5TA 1RCTE 3FVVA 5JISA 1W44A 5TB5A 1KPGA 1LLCA 2BGTA 2IZZA 1OB2A 1EVLA 1LV8A 2H16A 2DR3A 4GBMA 3HXPA 2ZR8A 3UOAB 2BKEA 1PRYA 5B64A 5FPYA 1XRQA 5AM2A 3SLKA 3RSQA 1JDJA 4DMMA 3UMRA 2IIPA 2HMWA 3U39A 1DSSG 5P8WA 4E46A 3JQ9A 1U28A 4J7XA 4PY2A 3A4VA 1CK4A 2WYIA 3Q9UA 1E3LA 3L4KA 1KVTA 5FV4A 2XIJA 1YA6A 1EUCB 1A72A 3SQOA 1SR8A 1B0PA 1UM9B 1Y7TA 2H2HA 4G1MB 2FUCA 5NULA 3DHWC 4TQUS 5I7HA 3P32A 3K0HA 1AF7A 3T1HB 1OE0A 1QZUA 4TMTA 3WLPA 3AV0B 5A5VA 4KXVA 2IHNA 3KKMA 3PT9A 1Q21A 3EDMA 5CIWA 2HBYA 5JS6A 4G5SA 1P6UA 2VDJA 2VL7A 4LJ8A 1LPOA 3AZOA 5CLHA 1RD4A 3ZVLA 1VSQA 1J8YF 1QNLA 5KWVA 1N25A 1K27A 2W6PA 3I9OA 3ABOB 3BJEA 3TLEA 2OGSA 4HTAA 1XHEA 4CETA 3NYIA 3GRCA 4L3VA 1QJ4A 2WFLB 2RC6A 2VPYA 2NGRA 5KVAA 4TLLB 5EEHA 2FZKA 3RRBA 1OZFA 2ZUSA 4TLBA 4DNFA 1CRZA 1Y4DE 4UMFA 1G2PA 1UC4B 4E07A 2H00A 2QNRA 1USKA 3PNSA 5H68A 3S2YA 3SZGA 3O4FA 4HP8A 3F0TA 1KGSA 4G09A 4JZYA 2ECQA 1ZJ4A 5HF5A 1TU0A 1XTKA 3I76A 2WG1A 5HKAA 2XUKA 1GRRA 4RMJA 1GTRA 4A6EA 3TL6A 3JASB 1D2MA 2Y6UA 3H05A 1A96A 2IYVA 2ZW9A 4UHCA 4YAWA 4RH1A 2PMWB 3MYRA 3UWSA 5JAUA 1ZK4A 3KJEA 3PNVA 4DHWA 2DXIA 2XGJA 3ER6A 3FMIA 1FP6A 2YMQA 2F4NA 1PFWA 5GONB 3TOVA 2C94A 1M74A 2O05A 2FSVA 2G70A 1R3UA 4O1IA 4YASA 1H4VB 3IP7A 3RSSA 2FUNB 1NF3A 1EXNA 3R5TA 4H17A 2QA5A 5ALIA 4HQKA 1O1YA 4CBVA 2HFJA 1O95A 2GCOB 2PRZA 4TVSA 4BWFB 2GBLC 1NYRA 1KI6B 1GGVA 4WK0B 1PZGA 3ZCTA 3PP8A 5CCBA 1NT2A 3TOCA 2FZLA 2GF9A 2QRZA 4KMMA 2IC5A 1ZVKA 2NLOA 4OU5A 5JZOA 1MTZA 4EUKA 5K20A 4IXNA 5ALZA 4QT4A 5DNVA 1LH0A 1OTYA 1CUCA 4R4JA 2B37A 3VNSA 1K6EA 4BAUA 3VPFA 3WRWA 1B6SA 1GGNA 2D1QA 3B1JA 4EG3A 1DCMA 1H4TA 1HDGO 1OYOA 2X6RA 3EIFA 2XNKA 3ADPA 3JX9A 3Q7EA 4H9GA 4PLVA 2CHQA 4V03A 4YJ2B 4YCBA 1XQXA 2Q2QA 4ZHQA 3CLRD 1UP4A 4M1YA 3S8EA 1Z5ZA 3R5SA 1F8XA 1WXGA 4FW9A 1VSTA 1VLMA 3OX1A 4L08A 5KJ6A 2XXJA 3LECA 5F77A 2QDXA 4F6RA 3NAQA 1BJKA 3P2YA 5SY6A 3UA4A 3CEPB 1KORA 4MWSA 4BQSA 3DE2X 2RIRA 4AMVA 4K03A 2CYBA 2WIAA 2QQFA 2I2BA 4AG6A 1QIMA 3QKTA 4IILA 2CFSA 3IDOA 1QVRA 1AXGA 1PFYA 3HN7A 4MJ3A 4WBXC 4BE9A 1L9KA 2UZ1B 4LYFA 3X1JA 1KGDA 1XCLA 3KQNA 5FBRB 1XN4A 3FUVA 1ODSA 4HX5A 3URKA 1QZTA 1WSAA 4EUHA 3EQ7A 4ENQA 3ROEA 1LSUA 3JQAB 2CJWA 3MJFA 5BQPA 3L0IB 3MGCA 2C7RA 3W8EA 5F4BA 3HUEA 1Q12A 4UTPA 5DTEA 2C9YA 3WOVA 5BYBA 3M9WA 1EQ2A 3ZXYA 1OI4A 5F76A 4UXIA 3FOCA 4AUNA 2NTVA 3E8SA 2QUBA 3KHKA 2OXTA 3WXBA 3IEIA 5EN4A 2A0WA 3LL7A 3T4PA 1YZUA 3BMQB 1J8DA 2ZIXA 1NTOA 4KU4A 1H6DA 4HWSA 2G4LA 3VV3A 4GR9A 4O1HA 4YP7A 3CJQA 3OKPA 1VE3A 4DDWA 1D9ZA 1ZD5A 3D3KA 1EJ0A 4OQLA 1KOFA 3DF7A 4L02A 5L6LB 1YVRA 3N2GA 1TK9A 3HKBA 721PA 3U1VA 3HEAA 1WZCA 2R5WA 4NKRA 3OA0A 1STOA 3NP7A 2RGCA 2YFHA 4N3NA 5A4MS 5I9SA 4LOHA 3RTGA 2PRYA 2J08A 3HVKA 3L4JA 3Q0IA 2BONA 2VSYA 1H9CA 1Q1GA 1I4OA 1L8OA 2FHSA 3CN9A 3NW9A 3GRVA 3OZVA 4FYWA 4MVCA 1NDHA 4ZOLF 2ALJA 3EXEB 1JIXA 4GE3A 2M6LA 4JI6B 3UQZA 3C6QA 4V2UA 5JFGA 3PITA 4H27A 3VAYA 4Z0TA 2VTEA 5IJXA 5G53C 1N3IA 2WE8A 1GU7A 2J5BA 4M6WA 3BAZA 1VMKA 3Q8LA 4TM7A 4C7OA 5FTWA 3KJGA 1TJ4A 2HNAA 5BYJA 3DB1A 1X8LA 1Q0UA 3ELDA 4MIEA 4FGJA 5KREA 2D2IA 1JMVA 2QTGA 2REQB 3WWYA 1AKWA 4BJ5A 5KKNB 2QM0A 5JZBA 1Y6GA 3MCUA 3RV4A 5LP1A 2G04A 3M3PA 1ZC4A 3SE0A 5C8VA 3BZUA 3LRXA 1SBZA 1RAGA 3DYBA 4INAA 6REQB 4ZT7A 1RADA 5ALOA 2QGZA 5A9TA 4KL8S 1FPQA 1UXJA 3A1EA 2Z9DA 3IOMA 1FS6A 1VMEA 3K4QA 3P20A 3NP9A 4FT2A 4IV0A 4YPVA 2AUTA 16PKA 4G24A 4KWCA 3O03A 3CR3C 4PC7A 1KAOA 1IM8A 1NBOA 2C2OA 2HA0A 1UBLS 2SBTA 2XWSA 3GFTA 2FQYA 1WHTB 2G0NA 3ES9A 4BUZA 5F73A 3HKCB 1IZ8A 5D85A 3QELB 3QUBA 2R7MA 2ATVA 4IS3A 3RIHA 1QV6A 3ENZA 3FROA 4JBNA 4E1AA 4MI3A 1CLUA 3QUCA 1KVQA 2ZTUA 1RRKA 4FJ2A 3FHOA 4D25A 1BCSA 2BGGA 1DJMA 3FIJA 4UM9D 3DEJA 1NVBA 1NXSA 4PR3A 2EFGA 5DX8A 3UMCA 4XYGA 3SOPA 2ZQZA 3BORA 4AQDA 3N7UA 3FRHA 4Y6OA 5P21A 1XDSA 1UDWA 3L8GA 4BDSA 5HOEA 1O54A 2P11A 3BYZA 3L18A 3D3QA 3KCNA 4JX9A 5BSUA 3ZNNA 1IAVA 4RTSA 1IG0A 1CKEA 3BMNA 1EUDA 2R6CA 2C7PA 5DLDA 2PYZA 5K3SA 2OQVA 3IQIX 1V9LA 3VX4A 2YYAA 3HKDB 5E6SB 3T9EA 4DDUA 3U61B 8ABPA 5HW0A 4B85A 1DJLA 2LBPA 3H9QA 1PFKA 1TYCA 2IYYA 4G4JA 4ND6A 5EXXA 1PJ8A 1L5KA 4OXRA 3S2IA 4W1PA 4EGFA 1FJHA 5HJEA 3TF5A 1N33B 1AJEA 5KYYA 5A2GA 1MA0A 4KNVA 1CR6A 4IXMA 4HVCA 2CLHB 1IXSB 1AXRA 3GVHA 4HFMA 4M76B 3NOXA 2HU2A 4JLNA 3T3EA 4DJJA 4D4JA 4X6YA 4PXSA 3UT0A 2IYXA 3WY9A 4W9MC 2ADOA 1PP4A 2D8AA 3L6RA 4X0EA 1VTKA 2BP7B 3R74A 3AR5A 5G41A 4YX9A 3NH6A 5L7WA 2QTHA 2HY7A 2EU8A 3CNHA 4YPOA 4N3GA 3U17A 1D07A 4CMAA 3SEZA 2P2DA 3E4DA 1L1QA 4CEJA 3L7DA 2QJFA 2NIPA 5FQOA 1TE2A 2BHNA 1PK8A 4G5YA 4OAQA 1A82A 4JSYA 2R3SA 3UKOA 4CM5A 1KSJA 4R54A 4ILKA 2A9QA 1HURA 3FRJA 4O25A 2FR0A 3UMYA 4FE7A 1A8QA 4UNPA 1EEXB 1ZNWA 2R00C 3I39X 4QVGA 4ZT3A 2AJCA 5E2AA 2V7GA 4RW0A 3RJ9A 3QVWA 4LC1A 4WBNF 4J1TA 2GCNA 2C3UA 5JRZA 1A9OA 3DL4A 1V1RA 4RM2A 3TNJA 1ZEJA 2JGDB 1O94A 2QRMA 3KJHA 4RHTA 4WASA 4G1FA 2W6IA 3NDJA 2WSMA 2D2VA 1RAHA 3E9DA 4NZZA 5B7NA 1EFTA 1X92A 4KXFB 4BRUA 1FSSA 3DD1A 2RIPA 3DZHA 1AX9A 1U80A 2XXBA 1K5HA 3EUAA 4HEA6 4PAOA 3MBKA 5DE3A 3LQRA 2XMZA 4R1OA 1U1IA 4OJTA 4UU0A 3DZBA 2ZIEA 4FUQA 3TTTA 5BPHA 1M8KA 3SCZA 2B8WA 4PG7A 2ZUDA 1PNRA 4E5PA 1OW3B 3O8QB 1DAKA 3QYAA 1WS6A 2I7CA 3B70A 2X4DA 4OGGA 2X22A 4Q9HA 3ROTA 2YOGA 3BK1A 3I6IA 2HI0A 3BWCA 1SXJC 3OEHA 3Q6MA 1IUKA 1GSHA 2FCRA 1W52X 3LFUA 4ZANA 1AQIA 1Z6QA 5CTAA 4BO0A 4XYBA 5LMNB 4ENRA 3JQ6A 1W2HA 2JAPA 2QM8A 5EUCA 1I10A 2HA7A 4BMOB 4TMFA 5IT9A 3DZGA 2X6QA 3DC2A 4WXRA 1Z2EA 4PYMA 1Z8NA 3F4BA 5AD1A 1PG2A 2OY0A 4IQ0A 2VUTA 2IZ6A 1AB6A 3GMSA 3VU0A 3GJ7A 2HWYA 5AJZA 4X8LA 3GC6A 3MGKA 1Y8QB 5EJ8A 1K7EB 4UU7A 4ZOEA 2DKOA 2PL1A 3CLUD 1NYQA 2BSQA 4QFCA 1NF8A 4D57A 1IY8A 1G20E 4BMZA 2F59A 2GXSA 5AKZA 1J2TA 1EDOA 2NU9B 5DGHA 5KTOA 3HVRA 2PRJA 4P7BA 2D0PB 3DKIA 4F9TA 1BX0A 1ZYUA 2YWGA 2IHKA 3FDXA 4A92A 1E3JA 5JQWA 5BNWA 1GVHA 2VHUA 2YFKA 5BN4A 3EA0A 1N34B 3MOSA 2VPQA 4L74A 2R8ZA 3LCMA 5K8TA 5ELLA 3PSAA 4XXHA 4IDGA 3AUAA 1I3MA 4IW3B 4MHSA 1NXTA 2G72A 3B1VA 4HYEA 1KNXA 3ANNA 3IPLA 5E3JA 1RMQA 1GQRA 1CDEA 1N75A 1T0BA 1VPTA 3CCBA 3IUBA 4L4ZA 2W83A 4LGMA 2AFIE 3ODPA 3ZQ4A 4DLXA 4IKOA 3L01A 5JR3A 1F3OA 1Y89A 1YBHA 2QD5A 4JC4A 4LNHA 5J63A 2XQGA 4B8WA 4YR9A 3NHZA 1EB9A 2PSJA 2V0CA 3LFHA 5EEGA 1XFAA 1Y1LA 2VK4A 3IAS1 3B38A 4FR2A 3RNOA 2QRHA 3BXGA 4P93A 4UNQA 3HPRA 4JT9A 4YUYA 2MMCA 1JG1A 3EXAA 2QUHA 2NTEA 4TQGA 3I6YA 5BYAA 5KYGA 2G1AA 3EIUA 1E1QA 2O8DA 2HO5A 2NSLA 4EWLA 3OQIA 3DL7A 1NC3A 4P08A 3H17A 1GCGA 1XTJA 1F14A 2X0JA 3CY6A 1NR5A 2LWIA 4ZICA 2V1UA 3HXQA 1DKLA 4NAVA 1JFLA 4RC9A 1HT0A 4AWBA 1YDMA 5LQCA 1QE0A 4OI0A 1CIVA 5JVDF 4JL8A 1IY2A 4QBHA 1CZUA 3P9QA 2WYOA 5AYVA 2ZM6B 5AMXA 2ZTLA 4L85A 3TZLA 2I80A 3AIIA 4XGQA 3BSWA 1SUDA 4Q05A 4BVLA 3KD2A 1L3CA 2BEUA 3NEPX 4ZZ0A 1M5RA 4TTVA 1EFPA 3BRWD 3C6ZA 4ZOAA 5B53A 4KSBA 1KMNA 1J00A 4NBRA 1KJWA 2GWRA 5FLYA 2LRHA 4Q4JB 3VPCA 3RG2A 4CG0A 1Q1QA 4A10A 4C03A 5IKPA 5BO5A 2WWWA 4F6LA 1N9KA 1QHEA