4M0UA

Crystal structure of human prs1 q133p mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
310
structure length
303
Chain Sequence
NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASPIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKEDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ribose-phosphate pyrophosphokinase 1
publication title Crystal and EM Structures of Human Phosphoribosyl Pyrophosphate Synthase I (PRS1) Provide Novel Insights into the Disease-Associated Mutations
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 303
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2013-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m0uA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m0uA02
3DMPA 3MBIA 3NAGA 4M0UA 1GPH1 1XTVA 2JKYA 1G2PA 1I0IA 1UFRA 3DEZA 3KB8A 1Y0BA 1OROA 1V9SA 1GRVA 3ACBA 4KN6A 5IPFA 3OZGA 2FXVA 5BRNA 4RAQA 4TWBA 1UPUA 1IBSA 1VDMA 1P4AA 1ECFA 4P81A 2IGBA 1I0LA 3LPNA 1QB8A 1VSTA 1DBRA 1A97A 1QCDA 1XZ8A 4IJQA 2P1ZA 1QK5A 4P82A 1DQPA 1U9ZA 1XZNA 1HMPA 4FYMA 4ZFNA 4RQAA 3LRTA 1R3UA 3MJDA 5IAOA 3H83A 4RADA 2H06A 3GEPA 1NONA 1QCCA 4LYYA 4WN3A 3OZFA 1MZVA 1DKRA 4RHYA 1ECBA 1DKUA 1TC2A 1O57A 1P19A 4P84A 5KAMA 1A4XA 1I14A 4X45A 2WNSA 1VCHA 1W30A 2XBUA 3DAHA 4P80A 5JV5A 4RQBA 1QK3A 5KAPA 2PS1A 1LH0A 1D6NA 1OPRA 1XTUA 1AO0A 1ZN7A 1JLRA 4RHUA 1OREA 1P18A 4LYGA 4RANA 3QW4B 4LZOA 1QK4A 1L1RA 1A96A 4PFQA 3ACCA 2EHJA 3O7MA 4RACA 1WD5A 4PAWA 1L1QA 1G9SA 1ECCA 1ECGA 5K51A 4MB6A 2GEBA 2PRYA 3GGJA 4Z1OA 4M0PA 3ACDA 4QRIA 5JSQA 1CJBA 1PZMA 4QYIA 3G6WA 2AEEA 4JLSA 5BSKA 1ECJA 1BD3A 2JKZA 5HKLA 4RHXA 4S2UA 5BQOA 5HIAA 1HGXA 1G2QA 3OHPA 4LZAA 1G9TA 4RABA 1YFZA 3S5JA 4F8EA 4LZNA 1QB7A 4M0KA 2YZKA 1I5EA 4P3KA 4X44A 1A3CA 2H08A 1UPFA 1NULA 1ZN9A 4RAOA 1Z7GA 4RV4A 1FSGA 2JBHA 3HVUA 2JI4A 1DQNA 1JLSA 3EFHA 3M3HA 2PRZA 1STOA 4QYIB 4JITA 3GGCA 5ESXA 2C4KA 5E38A 2H07A 4P86A 2HCRA 4P83A 1A98A 4OHCA 5BQPA 3N2LA 1ZN8A 1BZYA 1P17A 2VFAA 5EUCA 1U9YA 2E55A 4WMLA 1BD4A 1TC1A 1O5OA 2DY0A 1A95A 4RHTA 5ESWA 1I13A 1J7JA 1XTTA
chains in the Genus database with same CATH superfamily
2I33A 4CKXA 1DC8A 3MK31 2C82A 2MINB 5FWDA 1UFRA 3E27A 3THXA 3A6PC 2DT5A 4K6KA 3NRJA 3MTIA 3F6PA 1QYCA 3FF4A 1W7AA 3ZCPA 1V9SA 1PK8A 1WV0A 2HIAA 4OYLA 1C3EA 4CMGA 2JGNA 2VZLA 2FXVA 2UVPA 3DWGA 3B51X 1FPQA 1P6QA 1UIRA 3B3GA 1UC4B 1WCWA 2HJSA 3OI7A 4K9RA 1QV9A 4LJ4A 2BJWA 2VLBA 4X1YA 1J2JA 4OB6A 5DHAA 1OTXA 3EG9A 1EUYA 1C7ZA 3M1AA 2B3TA 4TTJA 3ELBA 2JF0A 3FLEA 1HQYE 4IIJA 2MCFA 4HWRA 5BT8A 4X91A 1EQUA 4UUNA 3HUFA 4RVCA 2AW5A 4GYJA 3VHQA 4F5WA 1M1YB 2JFNA 2QYTA 3BMCA 4R1MA 1W76A 1B8PA 2FSVA 3UAYA 3UJHA 4FYMA 1JHDA 3I76A 3ASUA 2ZI7A 4ZQCB 2RD2A 3OIDA 4MGZR 1B6TA 1P1KA 3EC7A 1NPTO 1NONA 2RB4A 4G5YA 1KY2A 3GJ8A 1XMPA 3KHUA 4XEUA 4A0SA 3NWBA 3Q7IA 4LRUA 4E08A 1G8GA 3HJTA 2XB2A 3FSEA 4QXRA 3K6SB 3T99A 5G4KB 2HA5A 1VBFA 4OFWA 1M9NA 1YJAA 2JK0A 3AVXA 1QVAA 1EE2A 1K68A 3P9PA 5PNTA 4A91A 1XDZA 2Z56A 3I2YX 1IU9A 4MR8A 1OWLA 3GFPA 2JLUA 1GSAA 3AEKB 4JYBA 4KSBA 4F2WA 3X1XA 4YASA 3A4IA 1K8XB 1PDOA 2I7XA 4DNOA 1X3LA 2XV1A 2O3RA 4Q01A 4PTYA 4BFYA 2VDUE 5A2GA 4ZARA 3QKRA 1T4CA 4G85A 2WVJA 4MCIA 2DBVO 1YGYA 4QBTA 1ND5A 1JWBB 3COWA 4Z0PA 1EDZA 3ANLA 3GXBA 1U5BB 4KMRA 4OHVA 4BMZA 4WINA 1EHYA 1U8ZA 1RSZA 1B16A 1Z5OA 1XAJA 2CKMA 3FYUC 3PKJA 1P9LA 1MU0A 1W5SA 3MC1A 3TIVA 3IQXA 4O4LF 5I7HA 4JJGA 1C0LA 4Y7CA 2P0EA 1Z4OA 4I55B 4WD3A 3OX4A 4BGVA 3PYMA 5JU6A 4B3GA 2ZT5A 1XP8A 1E2HA 4LZAA 5TIIA 2Q8NA 2HLNA 2NXWA 4RD3A 4YJHA 5TF0A 3R7WA 4I14A 1GQFA 3DBLB 3L05A 4U2GA 2FRDC 1II9A 4ZGBA 1TMYA 2E82A 2YNMA 3INNA 4NULA 3OH8A 4TLBA 2ZBUA 4M0EA 3PHCA 2B1JA 2ODTX 3MJSA 4LG1A 2FFAA 3VNRA 4BFCA 4FONA 4GI5A 5IUNC 4F2DA 4FWBA 2VBCA 1QIEA 2HQRA 4AF7A 4EVRA 1I32A 2JIDA 1IJKA 1XD9A 3KAJA 2YHAA 3NETA 13PKA 1U98A 1NVKA 3GLUA 5KYWB 4UEKA 3CLUD 3GDHA 2H9AA 3R0JA 5A4AA 5AUOB 4DV3B 1JZSA 1YQXA 1MO6A 4HDRA 4JLUA 5H59A 1NBIA 1Q19A 1TJ3A 4TKUA 4L27A 4JI5B 3A3PA 3QUAA 2Q3MA 1N5JA 1ZCZA 3LCCA 2PUAA 1EGHA 1GU0A 1PFYA 1WSBA 3QYPA 4U63A 4BNUA 4DA6A 1XWIA 2QE7D 3EZ9A 2BTQA 3CR7A 3DJYA 3EVCA 3KSRA 3KR1A 4MUYA 8LDHA 3FFAA 3CE9A 4HDSA 4JL6A 2G9QA 3CS3A 5DO9A 3WYFA 4LI3X 5LJLA 2JIZD 3KNZA 5JJ5A 1H6CA 5B3AA 2Q1TA 3A1DA 2HA0A 3EMVA 3AUFA 4PO3X 7ADHA 5HR5A 2GXAA 2H92A 3NHLA 4RZHA 1OYYA 2PYIA 1HDRA 1LPOA 1VG9B 2A9QA 3CX8A 3Q98A 4F5ZA 3NT5A 4JYAB 3A32A 2A9OA 1LKZA 3TTYA 3QOXA 3PXCX 4JLPA 4K03A 2JIPA 4X60A 3FPJA 1TO2E 3VPBA 5CCBA 4P82A 2Q27A 2CBXA 2W4MA 3JTEA 4WJLA 4ZFNA 1HLGA 5CNIA 1IQPA 4AB1A 4HAUA 1YVEI 4WJKB 4LJ9A 4JKYA 5AJZA 1NVMB 1GTJ1 1M5UA 3DE1X 1L5YA 3OD1A 3ABIA 4MUFA 5H3LA 4DR2B 1MB4A 1QCCA 3IUBA 3RBVA 3DR5A 2H17A 2JD1A 1M7HA 1YL6A 2XEXA 3E9DA 4JJ7A 4U6SA 4WZAE 9ATCA 5A4JA 1RS0A 1HSZA 3ZTYA 3CF0A 5JNLA 2HR1A 5AK0A 5L9AA 4L76A 2XOEA 4BKUA 4KFSA 5JE8A 1W6UA 2AQIA 2XTJA 2MSNA 1RJWA 2J9FA 2Y1EA 4ZO9A 4YRIA 5AVQA 1MTZA 4D25A 1P4SA 2O4UX 4QXAA 3JYLA 2FE4A 1ZN7A 2BMJA 4M1SA 5CA0F 4N0EA 3LSTA 4WLNA 1VP3A 2L82A 2R25B 4MCJA 2EYUA 3ETJA 5T3YA 2ZW9A 2V45A 3UJAA 7GPBA 3AEQA 3JY6A 1PP4A 3RNLA 4ID9A 1GPDG 3RTDA 4RMJA 1QGOA 4MVJG 1WSAA 3KB2A 1ZWKA 1FTSA 1SHTX 3HJUA 4FEGA 2EL9A 1E3TA 4LRQA 3A6FA 2BSQA 2JB9A 3OECA 2P9TA 5DN9A 2DPXA 4JLSA 4HTFB 3TQHA 4BLOA 3KIPA 3G1WA 3ZZTA 3WQQA 2P2LA 4MI9A 4BLVA 5KU7A 2ZQ5A 1E61A 4URXR 2BELA 3G2PA 4DPMA 3SBDA 2COUA 2DWUA 2HBYA 1GRNA 2HHLA 2Q5FA 2IEBA 4V0SA 4EATA 2H1OA 1NAHA 1WBJB 3JD1A 3DO8A 1I6MA 1C4OA 2B78A 1HL7A 1BYUA 2YJ6A 4U9HS 4F1WA 5E95A 1NKTA 4KQJA 2L69A 3L0ZA 5L3RA 4PGAA 2C1ZA 4I5EA 2HBQA 1FSGA 2QTTA 2W6ZA 3NFRA 3T7JA 2QTAA 2CNNA 3E3AA 4G3XA 3UJBA 2ZBDA 4RYLA 3HMQA 1UPBA 2P9QA 3HM2A 3MTBA 5AI0A 3LBNA 3NDRA 1BDHA 1U3WA 2G76A 2IPAB 4YRNA 1G8HA 2JDIA 2FE1A 2V65A 3C8UA 3TAHA 1UKYA 3GX1A 4J3NA 1IOZA 1BYIA 1QHGA 5TY0A 4KE7A 1GAJA 1M6WA 2XSZD 5BV7A 4R2JA 2GBGA 4O1MA 3LQYA 4HZIA 2VH1A 4MWDA 4FYWA 2PS0A 2R8YA 3HDQA 1J1UA 1Z29A 2NU9A 3BBLA 3ZHTA 1G16A 4NBTA 3O83A 1JIKA 2DX7A 3B5IA 1HNNA 2PLNA 3D5EA 4NEHB 4P36A 2BVNA 3KVRA 3Q12A 5LZ7A 2DQZA 4MLCA 2PL5A 4CHTA 1E2NA 1P91A 3QUSA 1T8TA 4ZMBA 1H05A 1WCIA 2I9PA 5HF8A 3UCEA 3A1EA 4LWZA 4NBNA 4JI2B 1EWVA 4ZOQI 2G70A 3SYLA 3KJIA 3BPSA 4LE1A 2C9BA 2FSSA 4BIMA 4OLHA 1A2OA 1XKLA 2APJA 1C9MA 2YYZA 3A1TA 5TE9A 4YCDA 5C32A 4IZIA 1IIBA 3I2FA 2BSXA 2DHDA 1KZ1A 2C4NA 3LVRE 1G0NA 4OKNA 2R6ZA 1URPA 3CBQA 4UUPA 3ZX5A 2JGLA 2QMUA 3VC7A 4H3VA 3ZJTA 3MJFA 2PO5A 3HDJA 1V11B 1N9KA 5LA6F 3WV5A 5I9LA 4A0GA 1L7QA 1TYEB 1G3IA 1PS0A 3OIGA 3PUJA 5DULA 4B81A 1D1PA 2QUJA 4CIDA 2AG5A 2W6PA 2WYWA 3G68A 2I7CA 2ZI6A 1DWPA 3TTTA 2ZTUA 2C77A 2ZU6A 3BMOA 2JCBA 4ZYUA 5HKBA 4N82A 3CEJA 3RKSA 1LDEA 1GAEO 3RFUA 4RKFA 2PAAA 4UHHA 3CVYA 1FPMA 1WHSA 4X45A 3DKKA 1AMOA 1V5WA 2ONYA 1ZM3A 3OE4A 4FXOA 4AUEA 4DLTA 5AOAA 3N3AC 2CGEA 4IWYA 1MT3A 2PH7A 1W2GA 3BICA 2PS1A 4CV0A 4FFLA 3FI9A 1ZUHA 4MYDA 3E15A 2FJPA 3BIFA 4K8OA 4P58A 4X3OA 3VR6D 3ITDA 1SFRA 4QREA 2Z08A 5D7NA 1OFVA 4BJ3A 3IEUA 1GUFA 3E18A 4ND8B 4DUGD 1BXRA 3UQYS 3RS8A 3MS2A 2QEQA 1RM5A 4DKJA 1IN8A 2WIDA 5BR1A 3LBAA 1IG0A 1Y3DE 1L6RA 2CVQA 3A6ZA 3C3YA 3DOCA 3USCS 1ZA2A 2ORIA 3X43A 1CJBA 1V8OA 2J9RA 3EOZA 4JSYA 2QUIA 2F67A 2JLBA 3Q0TA 4GQBA 3H87A 4RLQA 2IV3A 1VKRA 2F4NA 5BN5B 3EUFA 2Q5LA 1V47A 4U9UA 3C6BA 4C3VA 2C9YA 1X3SA 4DJJA 1ZYUA 1YR3A 2Q50A 4U02A 1T35A 3CLSC 2WJZB 5D3MB 3STXA 5JPCA 4OHFA 1SMKA 4KGVA 1JSZA 2ZI9A 2ZWAA 1PJZA 4PQYA 4WAUA 3P97A 3RHTA 3EPKA 1KOFA 4RSRA 1XEWY 5ALZA 5JZBA 4OV6B 1J0BA 5FI5A 1DKMA 2KWIA 3ZV6A 3QVVA 2Q07A 1WOYA 5IJ9B 2OD7A 1TM5E 4JI6B 1ZVVA 2XB4A 1X92A 1E59A 2ACKA 2ZBGA 3VZPA 3A4MA 3DVLA 5G4KA 5HYVA 2XZPA 2AS0A 1GEGA 1Z6YA 1YULA 4YX9A 2WJ4A 3ZDDA 4YTEA 4HN2A 4O59O 2IYFA 3CLHA 4OI4A 2XQIA 4PCAA 1U9YA 4AJOA 1OJLA 1IUKA 2IHZA 1EBUA 2VSXA 4HBGA 1KO8A 3GNQA 4R05A 1YC5A 3AM5A 3RU9A 3V8VA 3EQ8A 4IGEA 3W7BA 2WYIA 2PGIA 3I5AA 1VYVA 3AV3A 1XQWA 2G4CA 2Q6TA 1G0OA 2V7GA 3ECCA 3MBIA 3DC2A 1FNCA 2OBNA 4OXXA 1H4QA 4L28A 1TB4A 5EG5A 3TKLA 4GYYA 2V6MA 1HT2E 3PRHA 2YFYA 3ON5A 5JYEA 5K3CA 2W6QA 2YJ5A 2IA5A 1EX6A 4TWZA 1WW8A 2SBTA 2TRSB 1JRLA 2WHEA 5EESA 2NZJA 3B20A 3NDIA 3HUDA 5K03A 4HJRA 4PLVA 1KXJA 1Q7RA 3PXAA 2QQ0A 1EM6A 2YY6A 3F98A 4MIKA 4RLHA 4TGLA 4WN9A 3RRXA 4P53A 3DZ8A 4DQDA 2NW6A 2JIQA 5TQ0B 2FN3A 3GVPA 4C0HA 2FF5A 5BYJA 1AS2A 1RKQA 4P4NA 5CTJA 4KV9A 3SKVA 5B64A 1GL9B 5DHRA 1R3UA 1DPGA 5JDCA 1FZQA 1W9HA 2FMHA 1UBCA 2WEKA 2CT8A 1OLSB 1YZYA 2NTVA 2XR1A 3GEGA 3MHTA 4CMEC 1WP4A 1UMBA 1FUKA 5JT1A 3IQWA 3LLUA 1LTHR 4FYKA 4U3JB 1FIUA 4PLYA 5HTKA 1EM8A 2A92A 2BW0A 1LF0A 3Q7EA 2WZBA 5CBKA 2ORYA 5B58T 2DPHA 5LIRA 5KYWA 4L3OA 4HVCA 5SY6A 1MJHA 1RRGA 4I9FA 4HPJB 1RYMA 3C8MA 4TMZA 1KVUA 2F3UA 2QGFA 3UWMA 3K3PA 4FW8A 3DP9A 3G89A 3DE5X 1X0VA 5IJXA 2H5LA 1P7YA 2Q99A 4BB9A 1PZHA 4FGSA 5TMEA 4V0NA 5K0GA 2ZRNA 5IT0A 1N2CE 4HAIA 1B2LA 3ZNPA 1QC5B 3PIDA 3MJVA 3FRHA 1VKJA 1XA3A 1QVRA 2EF0A 2J5QA 2OVBA 4FT4A 4RPJA 5D1HA 4HOYA 3SU8A 3WYDA 4CI0B 3UAOA 5FV4A 2FR0A 4HN9A 2OC4A 4R0NA 5AXAA 3AZOA 3QQ5A 4AG5A 4EEKA 5FHRA 2R0QC 2PLFA 5NULA 1DAFA 1SWWA 3FKJA 2CYBA 3FXAA 4KXUA 4TV8F 1TVKB 3LT5A 1YA6A 2P9CA 1Q1BA 2WJVA 4IIUA 4M99A 1Z5WA 3LGSA 2BGKA 1VE1A 4L8GA 1U2TA 3NNSA 4RABA 4XVHA 4ZAFA 3S4YA 4NAUA 4GP6A 1N2SA 1QKJA 1GGVA 3G88A 3ICVA 3DV9A 2J41A 5JECA 2HZ7A 2FPMA 4BFSA 4DPKA 4ZT3A 3OJ0A 4KK3A 1POXA 2CW5A 2VZ0A 3IR6A 4XRRA 2JZNA 3B9BA 3PNQA 4MHOA 1S4QA 3I64A 2WP0A 4PCUA 5KOHB 4DHEA 1VJ5A 4QTUB 3DZHA 3O3NB 1KYIA 4V02A 4QKQA 5BWNA 1FLVA 4N6OA 1GV1A 1KTVA 1I24A 2YN2A 2EIHA 2VS1A 3KL4A 4J7XA 4X8MA 3I42A 4M8IA 4F86A 1LD3A 3WMEA 1QLWA 3MOIA 2ZCJA 3LUAA 3ENKA 3WDKA 1JG6A 1WXHA 3KEQA 2BHSA 4GSKA 4AYTA 4B43A 5F73A 4BO9A 1S2IA 1HDZA 2W43A 2ZAIA 3AHDA 4LC0A 1REQB 3LPAA 2HV9A 1SM4A 2PE5A 3U48A 1G6OA 3KZVA 1IC6A 1K5HA 2R68A 5KTYA 3N0XA 3LPMA 4MPDA 1QU3A 3ZCUA 1DUSA 3LX5A 1TCCA 1EJBA 2GO1A 3CPJB 3K16A 1WL8A 4KR7A 3LQQA 3V8NA 2K4MA 5DBHX 5FBQB 1XNJA 1B3RA 2E4UA 4ZEOA 3VPAA 4DV4B 3CRW1 3CZMA 4BKMA 4G0VA 4LF5B 1GRVA 1PS9A 1AKUA 4RNDB 4RWEA 3UENA 1TU0A 2P91A 2XNSA 4F7WA 1N8SA 1N0VC 3MAGA 3QWBA 4QU9A 3U3JA 1C9YA 3BFPA 3AR2A 4BZZA 4DXHA 1YZKA 4HDNA 4IUBS 1I7NA 2VTDA 3VAYA 1GQYA 4D43A 4QAQA 2QD1A 3K35A 3CW8X 3E7DA 4UTZA 3OEEA 4ZJUA 2BMFA 2NO5A 1VCOA 5DKFA 1JW9B 2WJGA 4RF5A 2VJAA 2ZP1A 3P9RA 3MD0A 5JS8A 1JYSA 4JI8B 4DJTA 4GYWA 4KXMA 1PLLA 4E94A 4EYOA 4WZAB 1V5FA 1AQLA 4KIWA 4MULA 4E12A 2BRUC 1YFJA 1DKPA 3EGDA 3AVUA 1HR0B 1PE0A 1JEYA 2C7VA 2GCOB 3F3KA 4OEHA 5C18A 2WT8A 1L3BA 2OOSA 4BASA 5B6PA 5K5EA 4XD2A 4IO0A 4JL5A 2UDPA 5FTKA 4I1RA 4URWR 3LQRA 3IBYA 4K2HA 2B34A 1D0IA 1OE0A 4LNUA 2JVKA 4S1PA 4X9XA 4BMDA 4YLYA 4PYQA 4AKEA 1AQYA 4IHJF 1QCZA 2R8RA 3O8BA 3PPWA 4IH9A 4JVOA 1ZH2A 4TSKA 1AXEA 2LNDA 3IURA 5EIAA 2UYGA 2RHHA 3LC7O 4E1AA 3AJAA 3RSCA 3O4GA 4RYDA 3T5PA 1SEPA 3VBEA 3D6VA 1U1CA 5GQSA 4BMOB 4YHHB 2OUKA 5KDOA 3LQ1A 3QVGB 4DDUA 3E3MA 3QVXA 3N76A 1JIIA 4JD5A 4QU0A 4RFSB 2QJOA 2IC5A 4KLRA 5HJ2A 2ZR9A 3D4IA 4ENTA 4ENQA 1HBJA 1QG6A 4BUJA 8ADHA 1CG6A 2HCTA 1G21E 1KNQA 5AI4A 1KY5A 2VYVA 2FQYA 1YCDA 2QL7A 2X8WA 1NMZA 3NPMA 2WU1A 4JHXA 3RJ9A 4WI1A 1OD6A 1MMFB 4FYPA 1YMVA 4C0AC 4A15A 4R6WA 4WFQA 5I6DA 2QJRA 3A2NA 5U4QA 1HDGO 2VLIA 1L5LA 1ADYA 2GB4A 4UBLA 1FFBA 2HA4A 5EA2A 1EFDN 1PZNA 4C03A 3WYBA 5CDFA 3C85A 1MO4A 2QMEA 1H65A 1HT0A 2FSFA 3FNBA 3VI3B 4MQUA 2CEKA 4QOIA 2J67A 4X1IA 3O93A 3SJZA 5GAJA 1G5QA 1BMFD 2E4WA 4WLVA 4F71A 1T9GS 2PWBA 2NM0A 2B0CA 2E48A 4IV0A 5KYUB 4G5QA 2ETXA 2C4UA 2O7NA 1XCJA 1N4AA 4CIWA 3CLRD 1VGRA 2CB0A 4K6OA 2XY4A 4YP6A 3W78A 4DC9A 4L73A 3STYA 2G1UA 2PRJA 2Q0QA 4E03A 1QVWA 2R66A 3EQ6A 3GLTA 3ZW9A 1E64A 4OKSA 2GJ4A 3PVSA 1JHYA 4PZZA 1QR6A 5C8YB 2XIJA 4LDZA 1K9VF 2VCYA 3CLSD 1CUHA 1A8PA 3TOSA 5JBIA 1DB3A 1JDBC 5DNDA 2A1IA 3IO5A 3NHUA 1BQ4A 3O3CA 4DAOA 1LZLA 1FW6A 1DIBA 2JIOA 5THKA 3WZ2A 5C1BA 5AKJA 2G63A 5COBA 4BJ5A 5A2QA 4M54A 4Q3KA 4KQ2A 3IESA 1XZMA 4B7CA 2WKRA 5CX1B 5HBRA 1P45A 3ZBPA 2DCUA 5CYOA 4OHOA 5EC8A 3KZCA 1ZMOA 1SUIA 1WQ3A 3PC6A 3OF2A 4G89A 3VMFA 3H1GA 1GYQA 4Y2PA 3G8AA 4DUZB 5EHIA 4ZT6A 3BB4A 3ZWCA 4B83A 2NP6A 3T34A 2WP8J 3ZH9B 3PZBA 3I9V6 1FFCA 1OYOA 1ETHA 1U1GA 2XUIA 4F04A 2EKQA 5KVCA 1Z2DA 3WAGA 5HZKA 1VL8A 3QPWA 1GG8A 5I7AA 1JVNA 5D3MA 2IS6A 1RWVA 1WQ1R 3NV9A 5JI2E 1DKOA 3M2PA 4I99A 4NJMB 3SM3A 2EBFX 1KEZA 4GX2A 2OESA 2VUTA 2QDKA 2OP0A 3QG5A 3KSAC 1A69A 3L7IA 4G5XA 3LDHA 5CFZA 2JEZA 4GOJA 3U49A 3SJCA 1R74A 1WMAA 5M5BA 3ZE8A 5IJ9A 5KNDD 4TKLA 4W5RA 1LK7A 5EJMA 2P9GA 4DLYA 2XXAB 3NHWA 3BTSA 3CNLA 4LY0A 4M3NA 4NOKA 2ISSD 2OCPA 2XWQA 4S24A 5I8WA 1T2DA 3AFGA 3ELUA 1S3GA 1M0TA 3ZNNA 3U4MA 3SXUA 3KR2A 3H2SA 3HEMA 3ZDZB 5J2TA 1QPGA 1M2VB 3SDSA 4UFPA 3H0CA 1NXVA 5AUNB 2AHRA 2RBGA 2ZWMA 3IBGA 4YO8A 3UW1A 1A9YA 3T3NA 3U81A 1ZD4A 1NVTA 5BT9A 3ZQ6A 1ILWA 2ATCA 3NM4A 1TFRA 1WMDA 3DZDA 3R3XA 4PC7A 3KT3A 5J63A 2YWJA 2WSLA 1F2DA 1V41E 4RJKA 2VUHB 1H0SA 1XALA 4Y7DA 4BRSA 2QW0X 3PXBA 1J5EB 1NW3A 1RE0A 4JOQA 2HN9A 1E3QA 1CR0A 4FKBA 1T5HX 1X7WB 1JDJA 2WICA 2D74A 3O38A 4Y9SA 4FUTA 5F4BA 5F3RA 3IBFA 4HAYA 3N8GA 3L9XA 1P62B 1MLDA 2P3QA 4XFJA 5AK3A 4YECA 3GRAA 2VDQB 2HM7A 2XMPA 2GZRA 3GJZA 2DAPA 3IQZA 4J4HA 4ZKDA 1X7XB 3IUSA 3O1LA 2P35A 4LZNA 3T5TA 2FPPB 3PTLA 3TNDA 3TW6A 4DMFA 1EX9A 4W5NA 4DWWA 1ZH8A 4MDFA 2XNDD 4MW4A 2DU8A 2WWHA 3E03A 4RV9A 4E70A 4QNRA 4TWRA 2QVXX 5I3ZA 1ETUA 3QP9A 4JROA 4KPGA 2PFSA 1OR8A 1TE2A 4RNCA 3VZRA 1EVZA 4LNHA 3NDPA 3TOVA 3ZR4B 3BQ9A 1OLSA 3HV0A 2Z1NA 3QUCA 4D6YA 1WPQA 2HDNB 4WBXC 4PZPA 1G8MA 1JQAA 2IY8A 2JC3A 1MB2A 5AHRA 2PX2A 3T61A 5KMGA 1W0JD 1JE1A 2PUHA 4GNRA 4DRZA 2YDXA 4ILEA 4MJXA 5H68A 3OOHA 1CRWG 3AI2A 3L4BA 2OZVA 1CUGA 3F1LA 5BMOA 2O3SA 2C99A 1ZHFA 3U2QA 1XKTA 5AI8A 3V1KA 3PRKE 2QMQA 4XCXA 1Q7BA 2XWSA 3I9LA 3PV0A 4KPEC 2VJMA 1ZJ4A 3LAWA 2EL7A 3C3KA 3EK2A 4ITVA 4IZOA 4UM8B 5FA6A 4ECAA 4EECA 4PRKA 3GZNB 2C9MA 2B20A 1BDMA 1E6LA 2XMRA 4O4JA 4YQEA 3ZE1B 2M6RA 2QL5A 1IWPB 3CY6A 2OCBA 4K1LA 2F17A 3R5HA 3UK2A 4A3SA 1K27A 2ONZA 2JEOA 4D92A 1OTYA 2REOA 4DT1B 3DEJA 4MW0A 3RS5A 4ZJZA 1BRMA 4IEIA 1FFAA 5LLDA 3SLGA 3AFOA 3CF6R 4EI9A 4C2TA 1IHUA 4MZDA 4IDAA 1DQPA 2QTGA 3D3WA 4DCMA 2PXAA 1TJNA 5FBZA 4F56A 3QBTA 3AKEA 4QGBA 4WCFC 3IHWA 5ESDA 1YRAA 2ODWA 1E7YA 1M0SA 1ONNA 1U2SA 1V45E 2GMWA 3UFXA 4PYKA 1S8NA 3A31A 5DWVA 5IAGA 3R9KA 3RUAA 1DARA 1QIJA 2DC1A 2UZ3A 2GPTA 1I36A 4ZOLF 4R1TA 3CSSA 5LQDA 5AM2A 1L3IA 1NSTA 3JALA 1ZOSA 4IDNA 2HDWA 3E2IA 5GGYA 3KT0A 4D2IA 3QMPA 2RH8A 2YHBA 3IYLW 4HVTA 5BXYA 2G0AA 4CNBA 2Z2XA 1L8LA 2FPUA 5DFAA 4L9RA 1FBNA 5FYDA 3BMQB 1XEAA 3PGMA 5CYFA 2D62A 5EJ5A 3E9EA 4GFDA 1E3JA 1PAUA 4PCLA 3V8EA 4R01A 5K0LA 1PGNA 4EW2A 3ZJ4A 2P6RA 1N2CB 3IIJA 4Q1BA 1FVHA 2IXFA 1REQA 2GUWA 2V7TA 1C8KA 4I3FA 1LEHA 5L3ZA 4OQDA 2XYQA 1DBVO 1U8FO 1KS9A 2NV2B 1ZCJA 1WOMA 3K0AB 1MA3A 4I08A 4RJLA 1DIGA 5PGMA 5ADWA 4GZLA 3HZHA 1JA9A 2H6EA 1E9BA 1NIJA 2R7MA 4LOAA 4PN7A 2EYQA 1H2ZA 4BV9A 1VL2A 3CUSA 2XCSB 1Q1AA 1ECGA 1K8YB 5AW6A 2GBLA 3ZDQA 2NZ2A 2Z30A 3RO7A 1BXZA 4X41A 1DAIA 2J3JA 1I01A 2OGUA 3OZIA 3PEEA 2P5UA 4PGFA 4RZSA 3WIDA 4DCUA 4YJ3A 4EUFA 5A4IS 3JWGA 3KUUA 3NJRA 2ZU0C 2ABWA 2E3JA 1C2TA 2ERYA 3R77A 5JNTA 3C74A 1MABA 1S2DA 1SVLA 2CC2A 2EG9A 3A9CA 2GYYA 2WZQA 2JAWA 2Q1WA 3D6NB 1TJYA 4R3WA 5TQJA 3H5RA 4DCNA 3DL4A 3UH0A 2B6HA 1EIWA 1VCNA 3CURA 1DXOA 1KPHA 5E4JA 4E07A 5G02A 5F33A 3U7RA 3KDPA 4L8VA 1OX5A 1WTCA 1H0HA 4HNTA 1NI5A 1YJBA 2HJGA 2MSCB 3L8ZA 3AUKA 1TF7A 3AOEA 3HXLA 5IAKA 2ADMA 3WNBA 3NIFB 3VNVA 4WZAA 3GRUA 4WA7A 2RGNA 2IOYA 4MW2A 1T3LA 2D5IA 5EE9A 2Y1DA 1GUBA 3MJ4A 1Z4PX 1S2NA 4Y6OA 4FFRA 2ZRHA 1GVNB 3AHGA 3C4JA 5FF9A 1U63A 2WYOA 4C22A 3H2BA 1MW9X 5DI9A 2C5BA 3G9XA 4RULA 2EZ8A 1E1QD 2BFAA 3WNQA 2FKNA 4E3ZA 1JDVA 1WNTA 4FCWA 1CVIA 3ZWXA 3EGOA 3JQ8B 5BVHB 4CQJA 1OQAA 2I99A 4TZKA 2WVAA 5T5QA 4CTJA 4Q82A 4EGFA 5EWMB 4JJ4A 2H54A 1I13A 1TD1A 3MYRA 2B69A 1TTHA 3OPYI 5JR3A 4EK9A 4HV4A 2OGTA 3X2EA 2XUZA 1KVTA 2O2IA 3SYRA 4YWHA 3LC2O 3SDZA 2PMFA 1EVEA 4FFDA 3LYUA 4ABTA 2D1TA 3AF4A 1KEEA 2NV0A 4RFSA 5DYGA 5A6VA 1BOOA 1MP0A 3EZFA 2OQ2A 4CCSA 5BRNA 5CFOA 3RC2A 4ZVPA 1Q16A 3DVRX 4FDVA 3RT9A 1KJIA 3E5HA 5DB4A 4YYEA 2B6NA 4XB2A 2OHGA 5KYXB 3GZ4A 5IM4A 3CKYA 4QWWA 4K9DA 4W63A 4XPZA 1VOTA 4AMZA 3RJ5A 4D3SA 5BYAA 3KQKA 4TTQA 4BP9A 3TLAA 3KB6A 3PDIB 4AUMA 4Z8YA 1U6JA 1NBEA 4ZVRA 2W48A 3VNSA 5LFAA 2PT6A 1KAGA 5IDYA 1Z0IA 4IJKA 3K31A 1R0SA 3PC2A 3JYPA 3OE1A 2P9EA 2O9JA 2KI5A 5IWAB 3VYTB 3ELWA 4S04A 5K3BA 6ADHA 1CBUA 4DCPA 1FJXA 4DRXA 1NJ6A 3U4QA 1KWGA 5GIPE 1U0FA 3FX2A 4TQ9A 5ICFA 3A36A 3IEXA 2DWQA 2C4WA 1GNSA 2KLHA 4E6PA 1RHJA 4IYRA 5AJXA 1LPAB 2C92A 2DHQA 2HSWA 4HWOA 5JV5A 5LJIA 2OO5A 3KE9A 3SC4A 2YW2A 3O4IA 1DV2A 1TKCA 3IT0A 3KTDA 2BDEA 2GTIA 3EQ9A 4RS3A 1ORWA 3W1EA 4BFVA 3LT4A 4JOCA 2O2EA 2VHCA 3E4CA 1Y1TA 2FSGA 1FDTA 4LE2A 4XYMA 5EXXA 3WRVA 5JRJA 1O1YA 1JB1A 4HUQA 4PO1A 4ZCRA 4GL2A 4MS3B 2W9XA 2YXPX 3L46A 2WKSA 3CF4G 1A27A 4JLNA 4JX8A 1G21B 5EQFA 2HYIC 4PSVA 2XCIA 4DCJA 3S7TA 1NBME 3UVEA 1DO2A 1VPVA 3TJMA 1U7UA 1K89A 4O4IB 2J6CA 5ALJA 5CX1A 1XU7A 3F4LA 3VZSA 2J1LA 3K1YA 1BQ3A 1PT9A 2Q0SA 5H3CA 5C46F 3COYA 3EE6A 1Z6AA 1YU9A 3UPTA 1BVHA 3UMYA 1CDEA 5L7WA 3OOJA 3LXXA 5LUBA 3QVLA 2DULA 4JUFA 4NBLA 4XB6B 4Y1RA 3PXUA 4RHCA 3DE7X 2QM8A 2EW8A 3JQAB 4OXKA 1JHUA 5LB2A 3AU8A 4NCAA 1A5SB 3PSHA 2RAFA 2OCKA 2MSEB 1MH9A 4PPFA 3TRHA 1UKZA 4N3AA 4KVAA 4RF4A 3PSAA 2AOXA 3RWOA 2YRXA 5BOSA 4Z54A 5K0JA 3KU4A 1NV9A 3D4BA 1F0PA 2I2DA 1GQ2A 1MO3A 3FDZA 2QLMA 1JU3A 3B1JA 2OG1A 1BH6A 4RZXA 4EHIA 3BXGA 4Z4EA 3KBBA 2Y9PB 3S2SA 1TQ4A 2DPLA 2ZE5A 4BWGA 2WAXA 3UV6A 2EW2A 4R81A 4ARAA 1R4NB 1FXWF 3RF7A 1T6ZA 1HEYA 3AR3A 3RV3A 3E05A 1GKKA 1VPWA 1TVCA 2QF7A 4CPDA 1DIHA 5HF9A 2PMDA 3ZI0A 3QXGA 4WVFA 1W36B 5E7IA 3O3OB 3SBOA 1YBMA 4EG6A 2IU4A 2Q6KA 16PKA 4JT8A 5T4FA 1BGWA 3D5TA 3SBXA 3W34A 4AYWA 4V0MA 2DH5A 3IALA 5L3QA 2JFFA 2JKYA 4ARUA 2LCFA 1DIOB 2HA6A 3IP9A 3B70A 2W2XA 4WV3A 3KEOA 4IXMA 2VO1A 2VBIA 2OC9A 2ZOSA 2D1YA 2I2FA 4XKJA 1YB6A 3WLRA 3ZDRA 1ZY2A 1JI0A 2HU5A 3ZHYA 2WOJA 3GRRA 2WTBA 3PQDA 1RD4A 3U31A 3VHRA 2XGJA 1HFKA 1L7OA 4MIOA 2EX1A 1U8AA 2OLEA 3BQMB 3RSQA 3OKPA 4E13A 1X9GA 3DZBA 4EPYA 2VT6A 2VWPA 5AHWA 4NOMA 4XB1A 2X8AA 3PICA 1NW8A 5IASA 5JD6A 1XR3A 3G5MA 1ORRA 2BPOA 3E70C 1L4YA 3KSMA 2FEAA 4ZOEA 4B3XA 4LKRA 1RC8A 3FWNA 3NWEA 2ECPA 4O2BF 1OLXB 1E89A 2FETA 2A5FA 5ALIA 3PDUA 1P9NA 3AZQA 2IYSA 4JLJA 3SOZA 2QW8A 3KL2A 1E3WB 1PTJA 3M6WA 3OJLA 3PGVA 1N2GA 2YICA 4IDPA 1H2EA 1JU4A 2WT9A 1RBYA 3ZJYA 5ICCA 4Y98A 3KX2A 4DKXA 4FHDA 4FNAA 1NG9A 4G84A 4Q24A 2OHOA 1A4XA 1Z4JA 3KEGA 1BWRA 2ETVA 4PIVA 1F7UA 4F3NA 1AQ6A 2VNKA 1SQ5A 1VPTA 2J3QA 3L7OA 4HDQB 4F8JA 2RJNA 4JMLA 4JH0A 2BCEA 4GM1A 2YHIA 1Q95A 3THWB 1ZRSA 4YH1A 5DLQC 1Z34A 5IHXA 4O2AA 1Q7CA 1S9HA 3A1WA 3H1AA 3OHSX 4RV5A 1PYGA 5IXJA 1XQXA 3ANYB 3LLMA 4EZIA 1ZVQA 1SQSA 1ZM9A 1E69A 2FW1A 2VAWA 3DHNA 3G0HA 4CUZA 2RGUA 3QE0A 1IBRA 1AKWA 3H9EO 2IH4A 4ZYVA 1NIPA 1VJTA 2YXDA 1DBSA 4OI2A 3AG6A 4QC2A 5ENZA 4ZV7A 2KW5A 1GFSA 5GV8A 4C05A 4Z1OA 4PLPA 4DV6B 4JP5A 1J4AA 4RELA 1E3EA 2M6KA 4CTOA 2IXBA 3IEPA 2CVFA 1BNCA 2R1VB 4M0MA 4KAJA 5BP7A 4B47A 3ND8A 2MYTA 4FFPA 1WMBA 3RC7A 5BN4B 5LQSA 4ZICA 3EXHB 4G5OA 4BP1A 1YVRA 4IIHA 5CVCA 2DTDA 3V4SA 3TN7A 3AV0B 4MP3A 4RAOA 3ZQKA 5AVTA 1KI9A 1KI2A 3FN4A 3QPUA 4RSMA 1GTVA 1DTWB 1ENPA 3C6QA 4JJEA 4RENA 4EF4A 1U11A 4MS4B 721PA 1KQFA 4RSHA 5FI0B 3F73A 2VH5R 1YR2A 3Q5DA 2RHDA 1X0XA 2GAJA 3HJGA 3F47A 4M8NE 4I50A 5HFJA 4N0MA 3WRWA 4OMFG 4AJIA 2RHTA 4UARA 1J0DA 3A1FA 3VYWA 4P0PB 2GK3A 3BT7A 4YA6A 1IY1A 2I0FA 4HPXB 4N03A 1DAMA 2A0KA 1TJ5A 1Z5UA 5EUCA 2UUPA 1PVDA 1Q7TA 1BS9A 3JYQA 2EQBA 4GP7A 5F78A 5M04A 2GPJA 4EG8A 1N2CA 1PJ4A 4LDQA 4TLLB 4BNKA 5I47A 5AOCA 2GCPA 1PNRA 4JP8A 5A5EA 2FSVC 3CGGA 1OIWA 1V35A 3I6YA 1VG1A 1Y5IA 3ZBUA 3SJBA 5DH9A 3ZU2A 1V9CA 2LKCA 1FLAA 1VI6A 3TRKA 2IBSA 5FLEX 1NUAA 1M2GA 3L07A 5LOVB 3EXEB 1N4DA 4WWHA 2CL0X 4BUCA 4KRGA 3OPQA 3OZGA 4P08A 5CT8A 3SLRA 4A8TA 4LYDA 1MDFA 2JI9A 2C0QA 4JB3A 1T9BA 1SOVA 4B46A 1UDAA 1ZX1A 4EJFA 1RLJA 2A58A 4GLLA 1UINA 4PHCA 1ZJWA 1SVKA 1RWQA 1RWXA 2HFKA 4BN0A 3JYHA 3L6BA 3VVBA 4HRXA 3DO6A 3MN1A 1VFNA 3OQJA 3TPFA 3E2MA 4ME6A 4QQNA 3T1OA 4KDEA 5IVIA 4CLHA 4P31A 1V7CA 4I2NA 4OVKA 2GN6A 1KJ8A 1OU0A 2C2KA 3GL9A 3DTTA 5AFSA 2JJQA 1NBHA 3REOA 2FMFA 5DV9A 3QFRA 2VPWA 1AQNA 1T25A 2C2ZA 1BE6A 2V7QD 3O4FA 4Q4CA 2FDCA 4JI7B 3GRPA 4BYMA 1US8A 4XIIA 5JFGA 4XLTA 1DX4A 4UVHA 3O26A 2C4MA 2HJ9A 1CDOA 1U94A 1NRWA 1OX4A 2QLLA 2YW9A 3DOIA 3GRVA 1R5JA 4GKAA 4M7WA 2WWGA 1T0UA 5CM2Z 5K3FA 5K0TA 3VX3A 5HXAA 2IHBA 3GLVA 1P7ZA 4YRQA 4J1QA 1L5RA 2QTVA 3TLZA 3AEYA 3Q8XB 1Y48E 3C6XA 1H6BA 4FD2A 5I9TA 1X86B 3EEFA 1DWQA 3GJ6A 2PX0A 4RVGA 4Z3KA 5BR8B 1GTG1 3HN7A 5JDIC 2WD8A 4H0CA 5L6MB 3F67A 5I9NA 4N12A 2YNMC 4WKGA 2GYVA 1HEUA 1CUIA 1EK2A 2J3HA 3B7GA 2BHRA 3G8YA 4QGAA 5FI1B 3KFXA 2LXNA 2GZAA 4DLNA 2O1SA 1OASA 1HE4A 3A4VA 3QNMA 2N9UA 2C29D 4RGQA 5KUTA 2Q8QA 2V97A 4G9GA 1OSNA 1IHXA 4NU8X 3HV2A 1D7OA 1TLLA 3D4OA 5KPDA 3F78A 5LP6C 1LX6A 1C14A 3KV3O 1BA3A 1Y3FE 3SHOA 1S96A 1J2TA 4R83A 5J1SB 2PR7A 3SF8A 2GK6A 2I7TA 3A25A 3NH9A 3OQVA 5EIHA 1CF9A 4LZPA 4GEGA 1XF1A 2F1OA 3GCZA 1AHNA 1Y6JA 1I5EA 2HEIA 3HY4A 2R8OA 3MCAA 3ND6A 2VP2A 3OJXA 4UBIA 3RBZA 2HCFA 4B17A 3LPCA 1YHNA 5K3OA 3EVZA 3SX0A 1D2MA 4CDMA 2AJTA 3CZAA 4OQQA 4F46A 3HXOA 1H3EA 3I61A 4AC9A 4KQMA 1QE5A 3N5CA 4XZ3A 5LMUB 3HH8A 3OF3A 5CPFA 1WEKA 2WV9A 1Q83A 4ALNA 1CK4A 4ZVVA 4ZIRB 5CHEA 2ZRQA 1N2HA 5JH7A 2H4HA 3Q2OA 1BVYF 1EGQA 1SUAA 4ZVKA 3I6QA 4OXRA 2XCQA 2FI1A 2KQUA 1IM2A 2F2TA 4JAVC 2Q21A 4WMLA 1JVSA 4PYJA 2C9CA 3U39A 3F9IA 4IQ0A 4DWVA 3NI2A 1Y7TA 2RONA 4EB3A 1DHTA 2FTKE 3IH5A 2CYCA 2R6DA 3NMUF 1Z5VA 5DGTA 4ZAXA 1BCRB 2ZJ8A 3HDHA 2W6OA 3NASA 3QLUA 3QZUA 4CV1A 1WETA 1RCUA 1WZUA 5DE3A 4R3NA 5KI6A 2FW9A 5H02A 3LNTA 3TNFA 2QX7A 2X15A 2B83A 4C0BA 2YWEA 5K8CA 2IYXA 5TRTA 5HGXA 2FPRA 4NG5A 2IHVA 3HYSA 2IIBA 2J6HA 3CVUA 1M34B 2HQOA 3SNKA 2QBYB 3EF0A 2QN2A 2VZEA 1UPTA 4UM9B 2OHJA 1C9DB 1KAOA 1NM5A 2NU6A 2P2YA 4QFBA 4QJ5A 5EFZA 4M1WA 4P1ZA 4IIJF 3TVDA 1NYRA 5EP2A 3H0KA 4JYZA 3PP8A 1B23P 1TF2A 5L4LA 3VSAA 1HQCA 1YB1A 4FQ7A 1NBOA 2CMGA 4GWLA 4QBKA 3JQAA 4QTTB 3PEYA 2O8DB 4X95A 4KUEA 2J59A 2WFLB 3EDMA 4ERXA 3EF3A 1BDBA 3MT7A 3UC5A 2IIVA 3EWAA 2O19A 3NTXA 4DYDA 5C7OO 3A1UA 3NANA 1F17A 3UB4A 1L5QA 3K96A 1WVMA 1NJSA 4MXDA 2ISQA 3PYXA 4JB2A 3ROXA 3THRA 1PJCA 3KTOA 3M70A 2JD0A 4QNMA 1TLTA 2B5OA 2HIHA 2F9FA 3SQMA 1XK7A 2DLNA 3B1FA 4IG9A 2OV6A 4QOFA 3P5SA 4HL6A 4UXJA 1LLCA 3G79A 3R20A 4HYQA 2Z83A 2G9RA 3K0BA 3LBFA 3TQRA 4TLCA 2ERCA 3GU3A 4W82A 4KYUA 5EJFA 1OXBB 3AY3A 3WJ7A 4NBUA 2PH3A 3NONA 3M9LA 4Z4HA 3OO0A 3EOBI 2OPHA 4E30A 1RXSA 3C7DB 3HEBA 1G20E 2AZTA 3AU9A 3CWQA 4KO3S 5TQ2A 3VOBA 3M4YA 2RI0A 2JANA 4FI3F 4DY4A 3TECE 4BNFA 2UUOA 2NU7B 2PK3A 2IPMA 3EGCA 4Q3BA 3I8OA 2BM0A 2IELA 1TO6A 1ZSYA 4GO1A 2G1JA 2OBXA 4BKQA 5DX8A 1E18A 3TAXA 5A6SA 1M73E 3UN1A 3F7MA 3IXLA 3AOGA 3GLQA 5CDYA 1ODTC 2QTMA 1QYVA 2QZPA 4MVJP 3A6LA 1QIMA 4HX5A 3BTOA 4G8JA 4QAJA 5LNK1 2QPLA 3KVNA 3AESB 3X3HA 4QTZA 4QU5A 2YN4A 3COPA 3G5UA 3FSGA 3OU2A 2NTJA 5AIBA 2Y6VA 3X44A 1MOPA 1JLSA 2BFWA 2C2YA 1KSJA 2BZSA 1VMEA 4YK7A 1T36B 5SY4A 3UHAA 3UKDA 3AIMA 4JKOA 3P94A 3FY4A 5C5CA 1NVWQ 4YV1A 3FPBA 3IPLA 1E0AA 1NJ8A 2HRDA 2O7RA 3U44A 3AKDA 3D2LA 4KB5A 2GA9A 5CLFA 2Z8YM 4FFBB 3V4VB 4TM7A 3DZJA 2QRMA 1HY3A 1ODFA 2E55A 2Q3LA 4YONB 2WT4A 1TC1A 4TTSA 1U2GA 4I46A 3THWA 5IJ0B 3ETDA 1VHJA 4E1VA 5CFMA 2QK4A 1WKBA 1YQDA 4DJFC 3EAQA 1UK7A 3B2EA 3RREA 5A4DA 1VI5A 5DSZA 3W5HA 4CQMB 3DW3X 4LV5B 4PZ0A 4WXPA 1TZBA 4QGGA 5WRFA 1KI8A 2AOTB 1Y9EA 3DOEA 2H11A 5E4TA 1JI3A 3DOJA 3KP1A 4NL4H 3EGVA 5AYVA 1E9AA 3PJEA 2NVOA 4M9CA 3WLPA 1K75A 3WYNA 1Z15A 2I2WA 2GF0A 2C2XA 3H5NA 4WK6A 9ABPA 2VJQA 2FZCA 4QODA 3W79A 3WXBA 1KDRA 4FHFA 5F1YA 2NGRA 1HURA 1QHFA 1XV5A 3VKVA 4ZI3A 3ZJVA 1CLUA 3H42B 1U3TA 2X6QA 2E5WA 4BC1A 4MV0A 5ALFA 4OHYA 4JLOA 4W1SA 3TBFA 1CPYA 1QG4A 1E2DA 4JENA 5BN4A 3BFJA 1ADCA 1KEVA 1W4CA 4H1VA 1V48A 3DPUA 2QKYA 4HZUA 4IFBA 3WK6A 2PVSA 3HKDB 1LI7A 3OM9A 3NJ8A 4DLRA 3EGEA 1DTWA 1DBPA 1KO4A 3KYIB 4O4HF 4Y9UA 4HGYA 4G5RA 5DHUA 4TRRA 4KI0A 4OJKA 5C0OE 1P0PA 3TCNA 1T8RA 4CZ2A 3VSDA 4BNDB 2H2GA 1IQ0A 1D9XA 2FSUA 1VLVA 2ZRBA 1SH7A 1ECPA 3QHAA 1DBIA 2P6OA 3OKFA 1ZL2A 2WHPB 1KARA 2IYNA 3KJHA 4BAGA 3RB8A 2EKPA 3DLPX 5BWLA 4YAUA 1T13A 1G17A 3O0TA 3EN0A 4YN3A 1D07A 1S8AA 2CDCA 2F6RA 2OCYC 2NYRA 1II0A 2SKDA 3DTVA 4FHGA 5T4BA 1X13A 1RJDA 2ACEA 3C4QA 2RI1A 1NBWB 3OCZA 4C89A 1USUA 3PHIA 3TMYA 5KHOC 3ZV7A 5F2OA 2X5JO 4MRPA 5G53C 2H9IA 4I4CA 1E6UA 1AKEA 3KT6A 2HCJB 1TUEA 5EJ4A 1X8XA 3CVOA 3O74A 3IMKA 3O9MA 3FTNA 2X4LA 2XZDA 4I4LA 1KZGB 3EXEA 1V71A 3A7DA 5FH9A 1DJPA 4Q5IA 5HKLA 3DO5A 3GLHA 3R0XA 2PZFA 1N6NA 4MLDA 4LCJA 3W9YA 2Z5LA 3N8NA 2MSLA 3KJEA 3QLJA 4EMSA 5E8RA 1Z3IX 2YNMD 4BRWA 5AHKA 1DRVA 1RYBA 2V7XA 2VAPA 4WXRA 3PRJA 4UJ5A 2NAFA 1GNPA 2XVAA 1N6IA 1JR3A 3GO4A 2YIDA 1HQDA 2VPYA 4P3OA 4V0OA 2GLXA 4N8SA 4H0FA 4WFJA 4UHBA 5FBRB 3R2JA 3EWNA 3OFNA 4I66A 4FBLA 1ZH4A 4YP0A 1PSDA 4Z2AA 2YOGA 2YXLA 3TSAA 5IRCD 1CQZA 1M6HA 3URKA 3VX4A 1QWSA 4UOEA 3FKSA 2OB1A 3O9ZA 2YZ7A 4Y1GA 4CFSA 1LVHA 1YR6A 4FS3A 2KS6A 3GYGA 1VE6A 5KYYA 1EUQA 3PK0A 1ND6A 4H6WA 3TUZC 1R6BX 3WGLA 5KQLA 3ODPA 2EGUA 3L82B 4RPKA 2WTMA 2Y6UA 4HJXA 4KV7A 3O21A 3GNLA 1IRXA 4KOEC 2VOEA 2ZB2A 2AKEA 1V1RA 2GYUA 1UT8A 5JDCC 5I8PA 1XJWA 3UKJA 4DA7A 3U4CA 1MIHA 1SR8A 1OV6A 2PZJA 3JR3A 3B7PA 1MAAA 4PG7A 4XGNA 4YWJA 5HGJA 2PHZA 2P69A 3FNHA 4NS1A 3ITNA 2GILA 1MB3A 3FSJX 3ZLBA 4EY4A 5TPZA 3OIYA 3V3KA 2NACA 4Z7NB 3RC9A 3PT9A 1C1YA 4C7KA 4EELA 1CY8A 3L7MA 2AG8A 3HCBA 3DVAB 4HF7A 5CT9A 4ZVNA 2DQSA 4CR8A 4LK3A 4FCVA 4JL8A 3EIOA 3TNYA 2R65A 2O0KA 3KV1A 1J0AA 1USIA 3TQTA 2HKIA 3GVCA 2C2BA 1Y3AA 1QAOA 2PLRA 2A57A 1HRKA 3HN2A 3EHEA 1GSOA 4WNYA 3KG2A 3QYFA 1DC4A 4YUVA 4R2HA 1PHRA 4EW6A 1WA5A 1WDLA 1W44A 1FL9A 3DS8A 1IPFA 1SBNE 3O2NA 3V7WA 2WR8A 4AY5A 5FTNA 4CKBA 4MUGA 3IP7A 4HY3A 4LJRA 1GP2A 2HC9A 4NDZA 1D1SA 1W94A 1DUVG 2AN1A 4P7BA 2CF5A 1RWPA 3PWTA 1Z0SA 3W5UA 3W6UA 4II7A 3NOQA 2DTEA 5I9BA 4ABYA 1GTRA 2BFOA 5TMDA 2FSHA 3H7AA 3KAKA 3KQMA 4IDBA 1Y8ZA 1A9OA 1WABA 3OLYA 4KXWA 4OATA 5CIYA 1P7WA 1NJ2A 3CRNA 3P0IA 4X1KA 4W5QA 4U00A 5B7NA 5C37A 4IP0A 4NTZA 3WNCA 5JSQA 5ILGA 2H63A 3KE8A 3HTXA 3OEHA 2UZ1A 3TZCA 3EAFA 5TB5A 5KSZA 3JRXA 3OF5A 2QM0A 3DFKA 4OHMA 2XJ9A 3IT1A 1ICIA 3QA3E 1P1BA 1HOXA 4POAA 5EYPA 3RF6A 2A8YA 1ST2A 1QNLA 5KQRA 2VUSA 2ID4A 5K8IA 2YFKA 5F3WB 5LIPA 1IXSB 1DXHA 3PGXA 3KXLA 5HA5A 4ENPA 1BHJA 2CZGA 4CBVA 4YDQA 5JANA 4BVBA 1KMMA 2VAMA 3GEBA 3FETA 5BNZA 1E79A 4MJ3A 4S2EA 1PJ2A 2ZUVA 1E6MA 4PX3A 3A2LA 5K3AA 3U80A 1QGUA 4QO8A 3VPXA 2BCJQ 1TA0A 2BKXA 4IIVA 5IBCA 3GGPA 3HXPA 5B7PA 3KKKA 4KLCA 4NOLA 3VSCA 4Z4FA 9LDTA 2FWJA 4DVJA 4PQRA 4NNOA 2I4NA 1NASA 2QG6A 2ZTSA 4LRSB 2Q9AA 1XQYA 3BGDA 3O2QB 2Y4NA 1OHHA 3ENVA 4LOHA 1DRUA 4KBFA 2IOQA 3V5NA 4BS9A 3RYHA 3G3EA 4K6CA 5KOYA 4OG2A 1TAUA 1KF0A 4E46A 1E92A 3BWYA 1U7TA 1K0UA 4Q37A 4YMGA 4HDCA 4U6QA 2DPYA 4F0JA 1XMXA 5JBNA 4MYUA 3RVLA 5KWSA 4R5MA 2J30A 2AZXA 4BQRA 1A1VA 3LWBA 2CJYA 3P26A 4BAUA 1TI7A 4LBVA 4Z9XA 4JQSA 1C50A 1VHDA 3QBJA 2NSLA 5BPFA 4Y30A 3LYHA 2EX4A 4EF6A 5HZMA 5CK5A 1S5PA 1E7QA 1NPYA 3UJNA 1KEUA 3GLGE 4MKZA 1UC5B 1U0GA 1XO1A 3LHDA 4RPLA 3K9LA 1SHKA 1JBKA 3SKXA 3L0YA 4X6XA 3WGVA 1I0LA 3OZUA 1QDUA 3H6HA 2GK4A 4G37A 2HLHA 4OQMA 5DK4A 3PE4A 4DILA 5K0EA 1T8UA 2I03A 2L2QA 3TLMA 2GM3A 2A7QA 4WXMA 3GUHA 5FWYB 4EL5A 2EJUA 3F6EX 3UY4A 2B1QA 2KBEA 4MUXA 4DC0A 1RZ3A 2WIAA 1UBUS 3AESA 3HWRA 2QSUA 4K87A 1JTFA 4C04A 4DW8A 1CB7A 4XLZA 2ZDGA 1UBHS 4I1PA 3FWPA 4NCNA 1YQEA 5D6OA 1CNMA 2I55A 3RUDA 3BRWA 3QX3A 2PZLA 4BEVA 4FW9A 1C30B 3CVJA 1TC2A 5K6RA 1VJCA 2Q3BA 1T36A 3Q7PA 2EATA 5BVGB 1E99A 1KAHA 4XOUA 1EUCA 1O54A 3PHLA 1GHTA 3C6YA 3WGQA 1JHRA 1FRNA 1XCMA 3DMDA 3JS5A 1ZHHA 2ZIGA 4ES6A 5BN3B 1T5SA 4AVYA 4EKNB 1QX3A 1H1LB 3WYAA 4PYLA 3NEJA 5HQ3A 4I1VA 2AD5A 4KQKA 4MWEA 5ICEA 2QN6A 1QDLB 3FRIA 3M33A 1KPIA 3ER6A 4LZOA 1DO8A 4MPRA 3T5MA 3QEKA 5IJ0A 1A96A 5F1OA 1NAIA 5KKNB 1CQIB 1EFLA 3FNGA 3UT5A 1FU4A 4CQMA 2IX3A 1T91A 3C7KA 3H1TA 3H9BA 5DDIP 2XE7A 2XDYA 3R6TA 1F2VA 1SKAA 2RK3A 3DL0A 2RGAA 3NJ4A 2YXEA 4JXXA 4X64B 3KKLA 1W85A 4AZ0A 2P5SA 1MPTA 1TRHA 4WASA 1UAAA 1DLIA 1G2QA 2WJ6A 5JS1A 2NPIA 2IYUA 2CHVA 1ZI8A 4P4SA 4IVRA 4BKOA 2XYVA 4Z5XA 4XQEA 2NT4A 2PT9A 1PJTA 2R2AA 4U0JA 3A1NA 4RL4A 4CF4A 1J2UA 3BB3A 2J3MA 4C2BA 1B8NA 4OK6A 3ZU4A 5J4HA 3OCXA 3HM9A 2GM9A 2Q49A 2C7BA 8MHTA 5REQB 3AB7A 4BJHB 4YRLA 3B3AA 1DX6A 3CT4A 3FNFA 3NRCA 3P5BA 3UMSA 2PVPA 5JCXA 1YF3A 4GZMA 3THOA 3ABSB 4BX0A 1X1DA 4FHEA 1A98A 3RUIA 1XXHA 1U8TA 1GU1A 1R8QA 4DBLE 3TZHA 3EC1A 1P2GA 1KFKB 1JMKC 1IEWA 4GR4A 1HDEA 2GEDA 2AN5A 3AB3A 3DLAA 1UXKA 1N5LA 3LC0A 4FGWA 4NU6A 4P7FA 1KYYA 4R8VA 4XGQA 4CUKA 1XA4A 4W5JA 3NEAA 1LV8A 4IDFA 3SVZA 4PO9A 4CL3A 1JIQA 3R40A 3G8DA 1R6XA 1ENZA 4NHEA 3NM6B 3OMWA 1RCFA 1DU4A 4ACBA 1I7QB 3KKMA 1JUDA 5GADl 3SQNA 3QKSB 2FPGA 2P2GA 4CLRB 4D8XA 1HETA 1D8TA 3X1MA 3FNQA 1PZGA 4OGGA 2FVYA 1RHUA 2DVMA 2ZIEA 5LNK6 2PH1A 1QOZA 1KVQA 3E3LA 2I4IA 2QT0A 4JUAA 3H4VA 2ZB7A 3G0DA 1CQWA 2HF2A 4F60A 3DD1A 4JEIA 4Q7LA 1JEDA 3REGA 1BC5A 1JJ7A 5A02A 3WHKA 4B34A 2OYCA 5KSPA 2QD4A 2B0JA 2RH5A 4MW7A 4Q03A 4R2LA 1ESCA 1NF2A 1AQIA 3ZZ0A 2RHCA 4DANA 2D4AA 3PXGA 3AT1A 2HFJA 3T0GA 4YCLA 5AQ1A 2R7AA 3CPSA 4RADA 4C0SA 5JCPA 1XQ1A 4PPGA 3LLVA 3W6PA 1F9AA 2ZYVX 2WLSA 1RXCA 3JRWA 1UDWA 4LYJA 5DTIA 4KSCA 4AJ1A 4E7PA 3IUNA 1I2CA 3REQA 3V46A 4C0XA 1FLDA 3BZBA 4KX3A 1NVFA 5AW8A 1JIXA 1P1IA 2GVDC 4L78A 4DG9A 5DYWA 4S35A 2JVIA 3SD7A 3QNWA 3DAHA 4C5AA 1QYWA 3N87A 3HI4A 3L6CA 4N0PA 2Z6UA 2PT5A 2XVYA 2K7FA 4BY9E 4D9FA 1CJMA 5F2KA 3UWPA 5IYZB 4C4PA 1YKSA 3G7UA 3ESCA 3ZI7A 3CZRA 1RDFA 1J49A 3CB2A 2CB9A 3MT0A 3GFBA 1KZHA 3VOSA 4CEJB 1THZA 2AIRA 1C3OB 2FG7C 2HJRA 3PFFA 4NENA 2D2VA 3NTLA 4PG4A 3ZY3A 1SXJA 2BGRA 2OOKA 1F7VA 3HCPA 3TSYA 2ZRAA 3OLCX 1M8KA 1CXZA 2XXBA 3BRSA 3HJRA 3HY3A 4J2TA 3PNLA 3W8DA 5IKOA 1GZDA 4C6TB 1W25A 4ZI2A 3IE1A 3TLBA 3TLCA 3ZE7A 1QF9A 1U3FA 1IZYA 2Q3EA 1QHHB 4TWIA 2C07A 4XSHA 3OC6A 3A27A 2VTEA 4P3PA 3V2GA 1GPLA 2QB5A 3CH4B 5AOVA 2HT1A 3N3BC 1J39A 3CXUA 3OBIA 3DVAA 4YP5A 4L4RA 1S2LA 3UJ7A 4HFNA 1QU2A 3IERA 3D3KA 5LB4A 4WLFA 3MELA 4E5KA 5FJJA 3UF0A 1E5XA 2O52A 2Z6AA 2OM2A 3T54A 4O4LB 1W8DA 1WXEA 2CMKA 1YB4A 3NUZA 2XD9A 1P4GA 1FTQA 3PEVA 4HNGA 3F5SA 3GAFA 1ZSNA 1IMOA 3L7AA 4L15A 3NAMA 5K8UA 2E85A 1E5DA 1VHQA 2CXOA 2F3PA 3HKEA 3ZWMA 3GUYA 1CULC 4PXSA 2O05A 1PL7A 3A11A 4G4SP 1GKYA 2OE2A 3JTMA 1BDJA 2O7SA 1Z35A 3JCZA 2DT8A 1YO6A 2QA5A 4GHWA 3WLFA 1EDEA 1PIWA 2BBWA 5EIEA 1RYEA 1XMQB 1UBKS 2HPHA 3ZDCA 4KRYA 1C9JA 1U2DA 5EQDA 4X65B 4NEGA 3P9IA 3SGLA 1QOPB 4DTIA 2VP5A 4TMYA 2AX3A 5TJ9A 2MWMA 4R41A 3CKLA 3QKTA 5YASA 2VBGA 3ZLUA 1FSFA 2FN8A 4TT3A 1TK3A 1W29A 2C04A 3QVKA 1YS4A 4H15A 2WM8A 1KYVA 2YHSA 4Z7JA 1QV6A 2B1RA 2PRKA 3DTYA 1AUVA 3JX9A 3RSLA 1YZVA 1TMKA 4AUNA 1QDEA 2G28A 2QRQA 1NVBA 1UBGA 3NWOA 4UDXX 4I9NA 1XRLA 3STHA 3CH5A 4GW3A 4GZ5A 5AQEA 1NNUA 1MGPA 2X4IA 2HPVA 4F12A 3F7NA 2KJQA 1DBRA 5CH3A 1EXWA 1CUCA 3U3MA 3IIIA 4MEBA 4BGEA 3OEED 3FYDA 4H60A 5HK9A 5ISMA 1Q3KA 1UL1X 2X2EA 2BFDA 1SVIA 1W1WA 2F59A 4X93A 3O4HA 2AMYA 2IHKA 1KK3A 4HSGA 1NC3A 3GFGA 3PNBA 4MV7A 3R7DA 2MSWA 1KQ3A 3DMFA 3S2EA 1VSQA 2D00A 3K8YA 4KL8S 2FUNB 2WM3A 4XPIB 4LJYA 3ND7A 4K28A 4BO6A 1M7GA 2JGKA 5AXDA 1UJ2A 1PJBA 2BJHA 1YKGA 1GCGA 3LO8A 2R8BA 2H59A 1AG9A 1K7FB 1PT8A 2CJFA 3TGWA 1QBGA 3CO5A 3O6VA 1ACLA 4NYMQ 4FEEA 2RHWA 1G55A 4V1CB 4C1NA 2HDOA 5JWOA 1G1MA 4EI8A 1HZZA 2MT9A 2YN0A 3H7IA 1Y8RA 2FWNA 2OXIA 2I6XA 4DDMA 1KMNA 5J2TF 3TIIA 1FXSA 1JHAA 4DOMA 3W2IA 1ISRA 3PJFA 5DGDA 1YOVB 3TTUA 3LVQE 2DFDA 3L4SO 4L6IA 4YJKA 2NU8B 1WVGA 4WK0B 2HJWA 3AO0B 4RF3A 4CTMA 6REQB 4NZZA 3B9PA 3NTQA 1CETA 1MR3F 3B12A 2QW1A 4ZVSA 3GGJA 5E0KB 3O75A 5JAOA 2YRWA 3HB7A 1A72A 1FMFA 2VYVD 1KMQA 2B7BA 2RGNC 1PG0A 1KI6B 4MA0A 2JKZA 3DMTA 1JGTA 3DE4X 3O82A 3DFZA 3DEYX 4Y6GB 5CA0B 4G9EA 1N5RA 2FLKA 1XZFA 1HE3A 4NATA 4RJIA 2EW1A 4YAOA 1RZVA 1DNPA 2JGDB 3MBKA 4KE6A 1YGPA 2ZUBA 3QW2A 2V1UA 1ZA1A 1DBQA 1NW7A 1ZM2A 1I1HA 3TQIA 1FFHA 4R9RA 5ES4B 1NULA 3D0RA 4ZEVA 5ITZB 5FDFA 1IAQA 1GZ7A 2FUEA 3BD7A 3HVUA 3R24A 2XHEA 3HPQA 4UQPA 1E2PA 2IKQA 2OXTA 3WKCA 4LC1A 4M8SA 3V2IA 4A2QA 1A4UA 3QVTA 4Q4HB 2BMAA 2E4YA 3ZXIA 2ECKA 2J9XB 4DTCA 3PQCA 4HWKA 2G1KA 3BWEA 2IUTA 3MSXA 4TTIA 1Y42X 4AF8A 5JJKA 4OHCA 1FVXA 1M2KA 1WDKA 3HB0A 2OHHA 1KDTA 4YP1A 3AYXB 5KJ1A 1FY2A 3FHTA 2AN9A 1TQDA 1H3FA 3V4PB 2DTXA 5BORA 3H84A 3WA7A 1BVRA 1CQJB 1UJMA 4YNBA 3KC2A 1ZNWA 3AR6A 1NLFA 1TT5A 3VPFA 1H1LA 3QQPA 2VHVA 1N6PA 3EXFA 1PEAA 4PEVA 1SZJG 4R51A 4GBED 5AVKA 4O8ZA 3MUNA 4O0LA 1YJ8A 5IS2A 1FMCA 1CERA 1G20A 2XVXA 4GMDA 4UE6A 2YDYA 4HXEB 5CT4A 4INZA 3V8PA 1QUFA 5IHPA 1GKIA 4UMEA 1A9RA 2IV2X 2YMPA 3VZCA 4YRBA 4ESVA 1OFIA 3BXFA 4RAQA 4O4JF 4EW1A 3I04A 3GLGB 4TWBA 3UBMA 2W98A 1QNFA 4S1VA 3AWDA 1T2VA 2FDXA 2VNAA 4FXPA 1K6XA 2V4UA 2XWPA 3C3JA 3E81A 1T9GR 2XA2A 1JZQA 2XAUA 3OPYA 3FKQA 1TKRA 2VHEA 4KIUA 2RE8A 2JAUA 1L7BA 1VL5A 3LZ6A 5DF1A 1WUHS 1NL3A 2GNPA 3AHEA 4GXQA 3WFIA 4W5OA 1QH8B 4O8CA 2FQQA 2OKGA 1SCUA 3OM8A 4UDNA 1PEKE 1PG5A 4KODA 3NHMA 1U7WA 5BPHA 1JBEA 1U8YA 4OOEA 4RD6A 4EITA 3S1SA 2CFOA 3NW9A 1GDHA 4FPXA 4IJUA 1KQNA 1GL7A 1TZJA 2NAPA 5DXAA 2UAGA 3GLRA 3ZHCA 1MV8A 5LA6B 2QLTA 2RIPA 3L5OA 3THSA 2C5FA 2VK4A 3MB5A 4IDDA 3ILVA 3KJFA 3PZRA 3V4OA 4BECA 3BERA 4CKCB 1FZTA 1JIJA 2IEIA 2BYTA 4E1BA 1EH5A 4DV1B 5CVUA 2FZEA 3FOBA 2HYDA 1C3VA 4RTKA 4IV8A 1K7XB 3GGDA 3WNDA 1ZM4A 3WICA 3WIOA 2ZATA 3TH5A 3KOUA 1DRKA 4XX0A 2PQMA 4MTLA 1DXYA 2PS3A 1KK1A 3DBVO 3N0WA 2OA0A 1Y5NA 4KN5A 3QXSA 6CHYA 3H2YA 3LV8A 3QKSA 3GIWA 1EFPA 2Z9BA 1Z2AA 4RTJA 4R8MA 3PDHA 1A9SA 1Q92A 4OLFA 4UAGA 5DHPA 4JLVA 1N78A 4PSAA 3TSOA 2PSJA 3VR5A 1I7LA 1JS1X 1OBFO 2QPOA 3BC1A 4LBYA 2GEVA 4EI7A 2CVHA 4B3DA 1E20A 1RIFA 2WPDA 4RVHA 3IV9A 3QF7A 1N6RA 1SCDA 4BLWA 2IJGX 1JLHA 1YJXA 1EB8A 1PJRA 3ZIAD 3N39C 4Q4JA 3NB0A 2XUJA 3ASYA 1UWVA 1YQQA 3IC5A 4ND2A 4QPZA 4YEDA 2O2DA 3UJCA 5BV8A 3QPVA 1YZLA 2ZJ5A 3FH0A 4TQUS 1X42A 4G1EB 1SRRA 3ZXSA 1BWQA 4XE5A 4ZEXA 2Y0CA 2BF7A 4Z9AA 2IEYA 4NLLA 3KHKA 3PXXA 1GRQA 3EPHA 3COZA 4RS4A 2J09A 4WKBA 4FWIB 1UJNA 5AJHA 5DYTA 3DYIA 4UZSA 4D81A 3DFIA 4RIFA 4D4LA 4FS8A 4QLOA 4FZRA 1T0HB 1KU6A 4WGFA 3O1IC 4NDAA 2NZUG 3A6DA 1VYTA 2BFPA 2ZIZA 3C5WP 5DLDA 5BYKA 3ZIDA 2UVDA 4K1XA 3U7FB 3UJ8A 1RLMA 1U0OC 1G5FA 2JFXA 2PZKA 4HQNA 4E2ZA 1ZGZA 2ATEA 1QQ6A 1HKHA 3SC6A 3GGOA 4XJVA 4Q7QA 1XZEA 4KPYA 2F8LA 3LQKA 2I4TA 1NF9A 4V0RA 5KX5A 5JQGA 1ZRHA 1L7PA 3R9IA 1ZGAA 3OE5A 3RVJA 2V58A 3CIOA 3I58A 3P9YA 3R41A 5TQVA 2D2EA 5EAIA 1MJ5A 3RVDA 4CEJA 1PTJC 1C3OA 1NT2A 2BI4A 2CHGA 3DGEC 3BMXA 4NMMA 1BXGA 3FHJA 2P4HX 3RAPR 3S5UA 4AJKA 3F3MA 1L4HA 1RVDA 2VOJA 3ZD6A 2JGEA 3BOSA 5HKOA 2NN3C 3EDQA 4L08A 4RA6B 5LQCA 2X0EA 1WXDA 1PGJA 5IAJA 2II6A 5KKAA 5IM4F 2EKBA 1XPOA 5E1MA 2H5EA 1Q1QA 2LUOA 4Q1DA 1XZ8A 4BCDA 3B1VA 3FMIA 1XNRB 1NLYA 1CR6A 1TLFA 2CXXA 3IELA 1XL0A 1NBAA 4B3MB 1NQOA 2VP6A 3V7YA 1WF6A 2HA2A 3MINB 3VU8A 1ORVA 3DOHA 1IM5A 2SHKA 3KOWA 4KQIA 2O59A 1W47A 3KJGA 2PWAA 4D3FA 1M1ZA 1JHPA 3GGSA 4YCCA 4UAUA 3AK4A 4CTNA 1ISHA 2I6TA 3UMFA 4YJGA 1BE0A 2VNIA 3I6MA 1W30A 2WTUA 1R2QA 1W8IA 1P3Y1 3PNYA 4RZ3A 3P4UA 3F4KA 1ZUWA 3OJFA 2OCXA 4B75A 1SBQA 1R4MB 3OQBA 4KWTA 4ROSA 1E5TA 4P35A 2VUIB 1V8BA 3V7FA 421PA 1M5RA 3HYLA 4LBZA 4I6GA 3Q40A 4ISCA 2Q0XA 5DK6A 1H5UA 4NJOA 5T3UA 3TR0A 5A1JA 3L8HA 3A6EA 5EPUA 4AIIA 5JSUA 1PVVA 4YS6A 1ZR2A 4P4GA 1WE2A 2G08A 3F74A 4XFKA 4DCVA 2H0QA 4PFQA 3WVNA 4DLKA 3Q88A 3RFXA 1S3FA 1T3SA 3BDVA 1V95A 1V6SA 1GSHA 1DT5A 1YCHA 4US2R 3BB1A 3SE7A 3DMGA 4FLMA 4MB6A 1Y80A 2QX6A 1WXXA 2ZUSA 1D2AA 5SZKB 4C4XA 2XAAA 4EBBA 4R9VA 1DJNA 3FUXA 4DN6A 3ROEA 1UFQA 1BDIA 4MI6A 1YT5A 2Z2JA 2OAP1 2Z2ZA 3F97A 3GA7A 1TQ8A 3FSRA 1K4MA 3IGFA 1IULA 6GPBA 4PZYA 4D5EA 3V1MA 1N5DA 2ZI3A 1FYDA 4EKGA 1NYLA 3NALA 3PC7A 1A3CA 1KSFX 3HJBA 5CDUA 2LV8A 4YRGA 1M76A 3C98A 5K7SA 3ESAA 1PUXA 4JT2A 4MWGA 2QXTA 4ZYYA 2VF8A 4TV8B 2GBIA 3RVBA 1Q0RA 2XKAA 5AXBA 4KHPB 2C58A 3BA6A 4NX2A 5GIOE 2RCNA 1EGAA 4XPIA 2O2GA 2YUIA 2COKA 3JAWB 3BH6A 1Z8HA 1RQ7A 1K92A 2GQ0A 2WMDA 1GVHA 3JQGB 4EB8A 4R2WA 5KYGA 4PR0A 5EKDA 4TUYF 4CL8A 4HTAA 3M89A 2YZNA 4I5FA 2QP4A 4GDMA 2VZ9A 3R7SA 4DA8A 1R66A 3MWYW 1H4TA 4GLOA 2DY0A 1H42A 2IUSA 2O0HA 2QI9C 4FU0A 4QDZA 4QYTA 1L4KA 3K1AA 1UM8A 4OJQA 4YJ2A 4AFNA 2YQ4A 2I1QA 5DGCA 3VZQA 4P3NA 3DF7A 2V5VA 4CFYA 5JVDA 1I7SB 3AHIA 5J43A 2RH9B 1HO3A 2CJWB 3FUVA 3NXKA 3UOAB 2QVGA 3JQ9A 2HNKA 2ZS9A 3FWKA 2NQ8A 2YYAA 6REQA 3T4XA 3LM8A 4J7UA 1PSWA 3ICWA 5CBPB 4MVJF 5HG0A 2PTHA 4IKPA 2OSVA 1NZJA 4XFDA 4JNKA 5ARDA 5FA5A 2VJBA 3FB1A 2CD9A 3TEMA 4DSOA 4L50A 2BDUA 4RQTA 2YRFA 2Z5FA 5ALLA 4YCSA 5KPJA 5CA0A 3CUEF 2HW8A 1G4AE 4R69A 1AHPA 1VGVA 2HMVA 2HNAA 1LVUA 3BYZA 1XZNA 3NM5A 1ULSA 4HBZA 4WZ6A 1V6AA 4TV9A 2IOFA 3LTEA 3QSGA 4MYTA 5E6RB 3DZCA 4NY1A 2HV8A 1AHIA 3FG9A 4K8RB 4XUEA 3MRVA 1ORHA 2BGJA 3VJKA 2FFHA 1RI1A 4LGCA 3X1ZA 4ER3A 5IZCA 5B55A 1SVWA 1XJ5A 2ZAMA 1JNYA 3D0KA 4NPAA 5DTMA 3E5MA 8GPBA 4G81A 3KQVA 2PAFA 3O94A 1N8KA 1PQUA 2DUMA 1XWFA 2AFIB 1WMSA 2QTHA 2ECOA 1G5PA 1NUPA 3A4LA 3BIXA 3ZWKA 4CT4B 5ALGA 4JXZA 4K88A 4WOPA 5TGDA 1ZXBA 2IZ1A 3F96A 3HE3A 2O0LA 5C1PA 3ITEA 1UDRA 2JRCA 1E2BA 3NHJA 4BX8A 3PQ4A 4NBRA 5DNAA 1KI7A 1OT5A 3JSAA 4Q19A 2NYUA 4JB0A 4PVCA 1B76A 2I71A 3QVJA 1E3SA 2G40A 2QTNA 3PQEA 4KN9S 3T7RA 5ICMA 2J6BA 3CZ4A 2JD2A 2KB0A 1P72A 1NN1A 2Y1LA 1IQRA 3ZHUA 1LNQA 3S2FA 3IBSA 5LM3A 3HFRA 5HMLA 1QG0A 4ARZA 1SCAA 1SUCA 2QORA 3BXZA 5CUQA 3BHNA 3EVAA 1YVDA 3EF1A 3EULA 2P9BA 3G6WA 1RHQA 3O1HB 4IIXA 4IHJB 4RCYA 1XZGA 4UM7A 2R8EA 4FFSA 4XM0A 3AILA 3GLGA 2XRYA 1RXUA 2B4TO 1XTJA 3U17A 2Y1OA 3WLOA 1CZHA 4CL0A 1BSVA 3D7SA 3MUOA 4FLFA 4LPKA 3WJ2A 4EM6A 1VE7A 1UXGA 1ESZA 4Z0NA 2V59A 3AF3A 3MRXA 3RK1A 4OFXA 4X54A 3NYIA 1MN6A 4K9PA 3I0NA 4B0PA 3QMWA 3IMCA 2FG5A 3CH6A 1KDYA 4OB7A 3V8BA 4AZ3B 4JWTA 5KVAA 1G64A 1ADJA 3IR5A 3OM0A 4FSDA 1CUSA 3GEHA 4KTVE 2EBUA 4XWAA 5EJGA 1E1MA 3QLUC 4D3XA 1ES9A 4P92A 1JKJA 3QI7A 4CG2A 2CNWA 4LJ7A 1EDDA 4J2OA 4FDAA 5JUWA 1Y98A 2ZCVA 4P86A 5KJ6A 3JYNA 2E5LB 2AFHE 4I50F 1LJLA 1UPCA 4NMHA 2D1RA 3RSSA 5JC8A 1LY1A 1RCTE 2JCYA 1ZD9A 1W4LA 3CRQA 4WE3A 3M4ZA 4U0KA 5LA6A 4B31A 2ZTMA 1HUQA 3ZEIA 1RXYA 3H2KA 3QTTA 3QV1A 2QUBA 4QNNA 4LQDA 3E0QA 2ERXA 3LKZA 3TG2A 1NM5C 5E9WA 3VO1A 2DB3A 5BRJA 4MYRA 4PFKA 1VL6A 4A03A 3E0XA 1GL6A 4ZQGA 4HN4B 2X77A 4J1TA 1RYHA 4H7JA 4Q9HA 5CLIA 4LVCA 4FYYA 1HEIA 3P2MA 4Q7JB 3WJAA 4UHDA 2JKVA 3ET5A 4J0EA 2HGSA 2P6NA 5LQRA 1PFGA 1UBSB 4UUOA 1LC0A 1UDBA 2QRJA 4D4JA 3FCOA 1RPJA 2JGAA 3ZZMA 4CR7A 1IBLB 3PX2A 1VHWA 3ZJUA 2QJFA 1WPRA 2VG8A 4V24A 1CRPA 4K9QA 3KSUA 4RTNA 1IN6A 2I8CA 3FJ1A 1P1JA 4Q3AA 1JDUA 4S1OA 4EMUA 4OTZA 4CE6A 5D3KA 4N6NA 2OXFA 3DNPA 5MGNA 2X8LA 4FHZA 4RD2A 5IEBA 3K05A 3LVFO 4QQ8A 4LXTA 3LWDA 4B6PA 4NE9A 3V48A 1JFFB 3MSCA 1NJFA 1SIUA 2X8JB 3PUWA 3BD8A 4P5DA 1RABA 1QMGA 4UDOA 3ZCXA 4B6OA 2C2HA 2EWWA 5JAUA 4LYYA 3VPCA 5IM5A 2LBPA 4REQB 1X80B 3IIEA 4MW1A 2ZSEA 2AW3A 3KALA 4IF6A 2ORWA 2PLAA 3P9ZA 4INJA 1ACMA 1DFGA 4J0IA 4Q18A 4Q3NA 3AXSA 5IN5A 4DMRA 2PNFA 2WNSA 1CE8A 3Q1KA 1HYGA 4G0YA 4LJ6A 4A23A 1SXGA 1XMIA 3K5HA 4L5AA 4FX5A 5A05A 3H1PA 1GZVA 2QD3A 4X6YA 5LQNA 3S28A 1TCBA 3K9QO 2PRSA 1EQ2A 4QPCA 5AW3A 2SKCA 3RT7A 1IAVA 1LDNA 3MIIA 4KDCA 4RF2A 1Z5ZA 4DQUA 3UPDA 1K97A 3UW3A 4AJHA 3B3QA 1F8UA 1QLHA 1RYYA 3KZMA 3EVBA 1NXQA 3PX7A 4NYIQ 4LHYA 4ZZIA 3HEAA 3OT1A 4YRJA 3FCCA 4GGPA 2P40A 5JEEA 1PNVA 1YMUA 4XUCA 1HLFA 4BO2A 1CUZA 4DLSA 4YAJA 3RKUA 1C8VB 3UC9A 2JZCA 3TLXA 4JX9A 1Y3CE 4A0FA 1YDWA 4ZT5A 4YLGA 1G9TA 2CMDA 2OV3A 2TYSB 3E7WA 1Y7HA 4FWTA 4CLOB 1CQPA 4RJJA 1S89A 1AKTA 2VP0A 4GMGA 3GI1A 3TBKA 5MHTA 3IEIA 4G1MB 3EPLA 4PNHA 4ARSA 2RGYA 2WJ3A 1BAPA 3ZCQA 2ZIAA 4FGLA 4MICA 4RV4A 1U2GC 3SXJA 3QXXA 4LBWA 5KZMB 5AVRA 4I8DA 1D7AA 1RRFA 2CFCA 3A28A 1DC6A 3MINA 3H1EA 1EP2B 2J5KA 1BW9A 4DAEA 2NUPA 3V42A 2JFZA 4M7OA 3V4ZA 2WMNB 5AK6A 1I80A 3V1LA 1DKNA 2IZOA 2ROQA 3Q3GE 3WGZA 1D0VA 3HYTA 2PSFA 2X9LA 5C1IA 1NW4A 2Q1YA 1DRWA 2Q4OA 3CN7A 3CRZA 3LY7A 5KWEA 2W7TA 4YI3A 4C08A 2AF3C 1VLZA 2IYAA 3A04A 3DXXA 3RLIA 4B48A 1UP6A 4TRNA 2G1PA 1R4MA 5EXEA 1GZ4A 2H2DA 1AB6A 4NH0A 2Q9BA 3KB1A 1J7JA 2C9ZA 1B0UA 1E9SA 1PJ8A 3HCNA 3QV2A 3MJCA 2I6GA 1VKHA 2ACWA 3DXZA 3LIPA 2OLKA 3IR7A 1YDEA 4B2LA 2Q8PA 2W71A 3B6EA 1MKYA 3C3BA 3LUJA 3ENZA 3CONA 5CEFA 3U7HB 4HAWA 3G5AA 3EXIA 2E18A 2O2JA 1Y37A 2QZJA 4CU5A 1ZNXA 2VPPA 3G8BA 3ORQA 4FFNA 4ZREA 3ZV5A 4NV0A 1L0BA 1GR0A 2EERA 3MAAC 1WLYA 1MC8A 2F1KA 1AGRA 4H1TA 1B00A 3W8FA 3SZ3A 5EIBC 2QMYA 3D2BA 4CF3A 5EERA 3KQPA 1JAZA 4YC7A 1LJUA 1KYXA 1OI4A 3S2ZA 1JFRA 3JVEA 1RI2A 4EARA 4Q0MA 1FMJA 1F5SA 4ZVMA 4MAAA 3ZKWA 4CIBA 3IBCA 2LRHA 1OXTA 3VAAA 1LDMA 3ZDAA 2B99A 1JJBA 2GAIA 1G4HA 3OWHA 3FPFA 5L7TA 3MILA 5JOQA 1N9GB 4JCCA 1P81A 4IRMA 3AZPA 3GH1A 4FMDF 4U2EA 3EBLA 1TRKA 3C16C 3EIUA 3OA2A 4LN1A 3E1KA 2GHRA 2WJWA 1SKBA 3BWVA 1V3VA 4RETA 4Q3LA 1MAVA 5DHTA 3WDMA 1BMDA 5CFNA 2JCXA 2ZEJA 1JDBB 3E9RA 3PR2B 3JAWA 1K88A 3KKNA 4W5WA 4EAQA 1E3MA 2C3YA 4B87A 3AF1A 5DHFA 1Q1GA 4LQCA 3ZWAA 2QRLA 4D3YA 2Z43A 3RDPA 2P2SA 4RHUA 4KPFC 2BEWA 2CXNA 1M5TA 1AGPA 2AC2A 4JUIA 3UA4A 2IH2A 3DUFB 5AHOA 1JR2A 2WSIA 2QTRA 4ZOLB 5G0VA 5HDQA 1AD2A 3GOHA 4HKTA 3WLNA 3G0OA 3LOPA