4M0UA

Crystal structure of human prs1 q133p mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
310
structure length
303
Chain Sequence
NIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASPIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKEDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribose-phosphate pyrophosphokinase 1
publication title Crystal and EM Structures of Human Phosphoribosyl Pyrophosphate Synthase I (PRS1) Provide Novel Insights into the Disease-Associated Mutations
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 303
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 2013-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m0uA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4m0uA02
2C4KA 1JLRA 3ACDA 4WN3A 1G2PA 1ZN9A 1DKUA 1ECBA 4FYMA 1MZVA 1XTTA 2H07A 3LRTA 1LH0A 1QB7A 3QW4B 2JBHA 1DQPA 1XZ8A 2H08A 5ESXA 5BRNA 4PAWA 4LYYA 4LYGA 4RAOA 1I13A 1FSGA 1Z7GA 1GRVA 1QB8A 2YZKA 4S2UA 1TC1A 2AEEA 2IGBA 3ACCA 5EUCA 3OZGA 1NULA 5K51A 5JV5A 1G2QA 1HGXA 2HCRA 2JI4A 2WNSA 4P82A 4WMLA 1VSTA 5JSQA 1NONA 2E55A 3NAGA 1L1QA 1QK5A 4Z1OA 5BSKA 4IJQA 3N2LA 3G6WA 1GPH1 1O5OA 4P86A 1XTUA 5IPFA 1VDMA 1JLSA 5BQOA 1A97A 1UPUA 1G9SA 2PRZA 1BD3A 3GEPA 4RACA 1I14A 1D6NA 4P80A 4M0PA 3ACBA 1QK3A 1XZNA 1TC2A 2VFAA 4RAQA 1P4AA 2GEBA 1ZN7A 1DQNA 2FXVA 3OHPA 4X45A 1A4XA 1J7JA 4LZOA 2H06A 1G9TA 5IAOA 4P3KA 2JKZA 1OPRA 4RANA 1A95A 1DBRA 1U9YA 1R3UA 1VCHA 4TWBA 5HIAA 2PS1A 3EFHA 5BQPA 4RABA 4KN6A 4RHUA 3MBIA 1OREA 2EHJA 5ESWA 5HKLA 1ECJA 4F8EA 5KAMA 1DKRA 3MJDA 3H83A 1ECCA 1AO0A 3GGCA 4M0KA 1A96A 4X44A 3KB8A 1A98A 4P83A 4QYIA 4PFQA 4LZNA 1XTVA 2PRYA 2JKYA 3HVUA 1L1RA 4RV4A 1IBSA 1ECGA 1BD4A 1Y0BA 1STOA 1ECFA 2XBUA 3M3HA 1QK4A 4JITA 3DEZA 4P84A 1P17A 4RQAA 4OHCA 4P81A 5KAPA 4LZAA 1CJBA 1I0LA 3OZFA 1QCCA 1BZYA 1U9ZA 3S5JA 1V9SA 1O57A 2DY0A 4RADA 5E38A 1P18A 1P19A 3DMPA 1W30A 1YFZA 4RHXA 4QYIB 4RHYA 1ZN8A 3DAHA 4MB6A 1UPFA 1WD5A 1A3CA 4ZFNA 4QRIA 1PZMA 4JLSA 1HMPA 2P1ZA 3LPNA 3O7MA 4RQBA 1UFRA 1I0IA 1I5EA 4M0UA 3GGJA 4RHTA 1QCDA 1OROA
chains in the Genus database with same CATH superfamily
4UULA 2VZEA 1VPVA 2GMWA 3BH6A 5HSGA 2VHEA 5B3JC 4NABA 2H54A 2A1TR 3F4BA 4JT4A 4Z6KA 3HCNA 4K9PA 5HQJA 3ITKA 2XMPA 2AOVA 1NWCA 4OHRA 3R9KA 3TKYA 3O92A 1ZGJA 1VGQA 1N2CE 2CLHB 4YJGA 3G59A 1HORA 1I8TA 4XLLA 1OXVA 4D3ZA 2X1MA 1PGOA 5IKOA 1W1WA 2ESRA 1KWGA 4DV5B 2OPHA 1JQJC 2RARA 3KAJA 3LUFA 3PI6A 2FMHA 1YV9A 3FCSB 1FYXA 1GDDA 3LX8A 4GMKA 4WK4B 2VWQA 2ZULA 3ZWWA 4F71A 1RT9A 3I92A 2VT6A 4QDXA 3R7AA 1Q22A 2CK3A 3SEFA 1A4RA 5HJ7A 3F2IA 2OFPA 4ER6A 1UXHA 1CXZA 1ZPDA 2H63A 3OQ6A 3OZ7A 4NVRA 3AP1A 4J6EA 3B3FA 1LI7A 2QTFA 3ORRA 1XWWA 1T8SA 3JQBC 4WGFA 1LDMA 2BDUA 3MNFA 1DQYA 1M2EA 1UADA 1ZYUA 3GEPA 2LCIA 2YNMA 4LZWA 5FO1A 4QXAA 1TQDA 4P4SB 1M72A 3JVVA 1H2BA 1F1JA 2X22A 2OFOA 3BBLA 4RKYA 1YB4A 2AQKA 3TVDA 2WKQA 4MKFA 2WBLC 3EEYA 2A5DA 3AX6A 4BX3A 4PC2A 5HUHA 1ZM4A 1ZMTA 1X1DA 2A4MA 3LQQA 1YQDA 3Q5EA 4MRNA 1XVAA 3WKAA 3TZBA 2OGUA 4YB8A 2LGJA 2XMDA 1M2WA 5ED0A 5IAOA 5LQJA 2CLLB 1P1RA 3D9QX 2P6MA 1Z5WA 3ZWXA 1XZIA 1FXWF 2KS6A 3DAOA 5JWOA 1ONNA 5DBGA 2VH5R 4XJXA 1S0UA 2J4DA 4B1FA 4CLDA 5CFNA 5KQSA 1Y4DE 1DX6A 2CVQA 4C7BA 3IQEA 4DB2A 3IVRA 3VNSA 1UL1X 1OILA 3JV7A 4D46A 2R48A 3NBMA 4OQDA 1V2HE 4DSUA 4HPWA 1GUZA 2Q1YA 5LQNA 1YVEI 4JA0A 1FDIA 1RBYA 3CURA 1BVRA 1IULA 5LQMA 3VUFA 2IIPA 3SI7A 3I05A 1P80A 1Z38A 3PJGA 4P83A 4TV9B 3STUA 4E32A 2D8AA 3ND5A 4CF5A 3RANA 1VHWA 3ECCA 1B41A 5FBRB 2W83A 4OB8A 1Z25A 3QVWA 3AESA 4Z49A 1V26A 2DJ5A 3MTQA 1MQSA 3PFWO 2BKAA 5HGXA 3G0HA 1JKIA 4PQGA 5EJ6A 3THSA 5T7BA 2O8BA 1BAPA 3QVUA 5FBVB 2X13A 1XTJA 3G82C 2C1XA 2ZJBA 1HNWB 3FXAA 4Z1MA 4DMUB 1UINA 4CN9A 3O47A 2R1UA 2JKVA 4MUEA 5CDUA 4PQYA 5DBOA 5K0SA 1ZOOA 4ITVA 3RODA 2Y1DA 4I19A 1JKXA 2O5VA 3HADA 1MF7A 2HQRA 2IYNA 2V1XA 3USES 1GGKA 4BB0A 3ML1A 1C9NA 1VL1A 4WKCA 4YRBA 1Y6FA 2A4KA 2XDWA 3H1AA 4QTXA 1A5TA 1QVVA 5CNKA 3DE7X 5HMMA 1RXVA 2PLRA 2XSZA 3KDSE 5KHAA 1Q84A 2J7KA 3LPNA 5DHUA 1MJ5A 1UBFA 3TQTA 4Q16A 3RGGA 5LZ7A 4BLWA 4EPRA 1CJMA 3ZE2B 1SBZA 1AY0A 4RXTA 3QQ5A 4HVAA 4Q9IA 2Q46A 1G2PA 4UEKA 1B0PA 3HYCA 2L17A 3KXDA 1PJ8A 3DO6A 5FPHA 3VOBA 2AXEA 1ZVMA 2IP4A 3ADKA 2UAGA 2BFDA 2FUCA 1E5XA 3BKWA 4O4HA 5GONB 1PCXA 3TYXA 4C2UA 4C4YA 4YAJA 1QB8A 1TD1A 3ROXA 4YRIA 3MJFA 3G8AA 3AUAA 4WUTA 1PL8A 1Q1EA 2AC4A 2IEIA 4LMPA 3BFPA 2OKCA 3HSSA 1RWMA 4YJKA 2F67A 4RTPA 1VPTA 1B0ZA 1M34B 2OHGA 2XE7A 1FUIA 3QF4A 1DOHA 3AM1A 3E5HA 4W5TA 4YA6A 4DNXA 1GU7A 3LDUA 4G4SO 4O63O 2C9CA 1KC3A 1YR3A 5FLKA 4AZ3B 1UPUA 1UWLA 3WSTA 3LTNC 1FZQA 3P4XA 4A5OA 1ZJZA 4MQEB 4BLRA 1DJMA 1W4BA 4EFDA 5AVRA 1AJEA 5WRFA 3DMFA 3G5LA 2XDYA 2WC1A 3FB4A 2JI7A 1DI0A 2VKTA 3ROQA 3CWZA 2NPIA 2G88A 4WKGA 4EY5A 1L4HA 4AK9A 4LFAB 1SXJA 1G6KA 5IASA 2DFLA 1Y8QA 2QGFA 1L3CA 2A1IA 5LBUA 2H1FA 5DOVA 4DV0B 5LBTA 4YCBA 3GRCA 3DEIA 2UDPA 3RJTA 2XVZA 1RQ2A 2HPAA 4LG1A 2YWRA 1KEKA 2I6FA 3K2EA 2XB2A 1YL7A 3KJFA 5BSVA 1HDYA 4YUWA 3JYQA 2X14A 3P9RA 3TUIC 1GN8A 2EL9A 4JBYA 4DDTA 5HOQA 1M6NA 1SIOA 2VTBA 2WTMA 1GZUA 3DKPA 2A7QA 2GETA 1BG6A 3DVRX 4HNTA 2ZUSA 4JGIA 1E60A 421PA 1O6FA 1NMYA 1B2RA 3T06B 2QU8A 4YRSA 1YZVA 3FLBA 1XMOB 4GVLA 2GD0A 4M1TA 1UK9A 5JZBA 5C5CA 4JEUA 5L3ZA 1P9OA 2I34A 2GSWA 2K7FA 4IYJA 5LP6C 4KRFA 4YJGB 3RV3A 5ALHA 4F85A 3RS9A 4A3SA 2QP4A 4QQ8A 2X0FA 1IK4A 2BL4A 5KHOC 3QSYA 5TR9A 4YP6A 1T2VA 1N2JA 5DHTA 2IKQA 2JEZA 4LXTA 4A92A 3W8DA 3F2VA 4ZMSA 3A32A 1OVGA 3CZCA 4DV7B 2L69A 2QN3A 2XZTA 4MDFA 3HBLA 3LPMA 4ONEA 3FG9A 3GLIE 5E0KB 3E6AA 4PONA 3PA6A 2IRWA 4R1MA 2QAGA 5E2AA 5I7SA 3SX0A 1G1MA 4G1VA 4DM3A 3QGMA 3EVTA 4A23A 5JSFA 4FD3A 4N4AA 1EFTA 1LPBB 1JRLA 3BICA 4L28A 4M1EA 5JWHA 1KH1A 5EUBA 2C2XA 2P9HA 1CZOA 3DEHA 4PHTA 1QHNA 5TMBA 4QFMA 1KI3A 3GDWA 4IDCA 3EQ6A 4DV1B 4PPQA 4LJ9A 1SWVA 2IE0A 2P1ZA 5AI6A 1DRWA 4NBKA 4WA7A 1TCVA 3KSAC 4J07A 4UBIA 1QVZA 2F59A 1JF8A 3DT9A 3MVEA 3VH4A 5F4ZA 2FI1A 3K0EA 3PKJA 3NM6B 1X86B 4XQEA 1T35A 2DFDA 4MWSA 3SX4A 4HX5A 2WUGA 5TDHA 1DQPA 4IFBA 1Y5RA 4D4HA 2B94A 5EJ7A 3HKCA 5I45A 1NSTA 2G8LA 4Q4AA 4AB1A 2WM2A 4HGQA 2DQYA 2XYQA 2CL0X 4P2BA 2ZJ1A 1W94A 1MMFB 1C8KA 2CHUA 2QBYA 1SPXA 4YDRA 1NMQA 4UEQA 3V4PB 5KWSA 5I48A 4HN4B 5C8YF 3EXFA 1W76A 4EUHA 1RC0A 3WRXA 3CZ4A 4LRQA 3ZY5A 1EUDA 1C3EA 1E58A 2WHQA 3GJ5A 3AESB 3FCOA 1O5TA 2Z9DA 2ZTUA 2ZGVA 3BQMB 3FOBA 3ZLTA 5K45A 4B2IA 2O8BB 4DJTA 5BUZA 1T6XA 3U4DA 4LMBA 4ZAGA 3FD8A 3JAWA 1NPTO 2HXGA 3B6EA 5IJ0A 4M8KA 5LZ4A 1MJNA 2NSJA 1Z73A 3QKSA 1VIAA 3RAGA 2ZI3A 2PZAA 3O8OB 1DG9A 1Y33E 2F3SA 4FFLA 3GUCA 4X91A 4ZVMA 5H70A 2GPNA 3WZMA 2YWEA 4AWBA 1OHHD 1DX4A 4BEJA 1OFHA 5KNDA 4J1TC 5ARCA 1O94C 3BGOS 3QXSA 1TMOA 2CMGA 4Q9KA 5AICA 1KI4A 1UJ6A 4D9HA 5KYWA 4R81A 1SU8A 3IKVA 1U94A 2O7QA 3OECA 3TSOA 4AJ4A 4DY4A 5SZJA 4C4OA 4BNLA 1QFZA 3BXOA 2PLAA 1T5TA 3G2LA 1J9EA 2RGCA 5E9JA 3LBAA 1ZHOA 2Q2NA 3BRSA 2JFPA 2J5XA 1V35A 2ZDQA 2QE7D 3G5MA 1EFCA 3GUYA 3K3PA 2AR0A 4IOKA 4MV1A 5ADVA 1FP7A 1E0DA 1WUJS 2BFDB 2E4YA 3LO5A 4FQ5A 4O4HB 4F96A 3OTHA 4N7BA 2FEXA 1KI2A 4A7PA 4HVLA 2C2MA 1ST2A 2PGDA 3CH5A 3RLIA 3ED5A 1ODLA 1LF0A 2CXHA 4R2MA 3K5PA 1JQBA 2BONA 2CY0A 1DC3A 3AM5A 3G2IA 4YR9A 1U7XA 4RDCA 3G49A 4XXHA 4YMIA 3WLLA 4U2CA 1WTCA 2CLSA 2N1MA 4I4NA 4UVDA 3UOAB 4KN8A 5A05A 3WOHA 2P4SA 5LD2B 1H23A 3HBNA 2PIDA 4OH1A 3L6BA 2P6NA 1P0CA 1KQ3A 1ZL2A 2FPLA 3QF4B 5FL7A 3JAMA 3O1JC 2Z6QA 4K81B 1YIAA 4NRDA 2LDBA 3WYGA 1N32B 4RZ3A 4M9CA 5KYXA 3ZDCA 5THQA 2HA3A 1UOOA 1MC1A 1E2EA 3BIJA 3WQHA 3DA8A 3E3OA 1J1IA 3NORA 2ENUA 2XTNA 2NZVG 4WY8A 4HGRA 3PEWA 2OXCA 2IOFK 2EFJA 2XZPA 3JQAD 1QX4A 4CM9A 1WMEA 3ICCA 1SXJB 3SCZA 3T9DA 2CBGA 4Z4HA 2WSSD 3K92A 3C8DA 4TV9F 2X0KA 1NF2A 1MNAA 3K9CA 3LHFA 2BHSA 2JFZA 1I0IA 4KODA 2CNWA 3CSUA 3D8UA 5KJEA 1I2CA 2HPHA 4QXRA 3R5TA 3ASYA 3HB0A 2QRHA 3G1WA 3LT5A 5EE9A 2Q8PA 4P3OA 1ZM7A 4MYCA 1AHIA 1J09A 1EFHA 5I3ZA 1BCRB 4RKFA 2IV3A 4C7MA 2VTBB 3ADPA 1GY8A 4L8LA 4XAQA 5L3RA 5KZMB 1IN8A 1ZO8A 3B5EA 4OQPA 2HC9A 4C06A 4PAWA 4DJFC 3RD5A 1DINA 1G66A 3VNRA 3K20A 4JSTA 4CF7A 1SK9A 2UXCB 3TTUA 1E4VA 1U11A 2DLNA 2E85A 3EEQA 2GESA 1SUDA 4HAZA 2IPLA 3NWEA 4JUIA 4MLZA 4MOWA 4B80A 4L51A 5FCDA 3TTSA 3ZTWA 3TIIA 1SUEA 3IAEA 4TLMB 2E4UA 1NXWA 4PZAA 1GZVA 2J6HA 1SQGA 3IMKA 1E20A 1RBQA 2NOAA 2HYDA 5I3CA 4O0LA 3GJRA 4LJAA 4LNHA 3FVWA 2CFIA 5C51B 121PA 1Z0FA 3G5UA 4ADSG 1XKLA 4LNAA 4RF2A 2CB0A 3U19A 2FZLA 2H5LA 3IC5A 2Q49A 3MXOA 1LQ2A 2QAGB 4KQ9A 3TTXA 1MJFA 4PGMA 2GD6A 1QYIA 2HZBA 4U8HA 3WC4A 3QLVA 3M6UA 4HOYA 5GZ1A 4UAVA 2ZR0A 1X9HA 1KNXA 3CE9A 1EJ0A 5GONF 3E15A 3MMPA 2CC2A 4YP0A 1G16A 4R51A 4AY4A 1VE3A 1E9SA 1GA1A 4Q3NA 2X1HA 3WV4A 1ZUNA 3ZHRA 2PL1A 3QTLA 1E7WA 5BRAA 1NR1A 2CLMB 4MJ3A 4KQXA 4ON9A 1DRJA 4GW3A 5CB6A 3HI4A 4MO9A 1Y1SA 5DXFA 2D7JA 3FHJA 1AMNA 1N3YA 3CRVA 1GQFA 1A7JA 2ZYUX 3JX9A 4L7QA 4KNVA 3ZDBA 2XVMA 1E0KA 5CFMA 3FNIA 5A4AA 2P11A 4F11A 1BDJA 4FFMA 4RK1A 5K1ZA 1C0LA 3HKCB 4FGSA 2ZAIA 4H0CA 4NCNA 3VFDA 3MWJA 4BQPA 5JFOA 1OX5A 4Q4AB 4TWIA 4TL6A 3REFA 5HZMA 1K7EB 3HQ4O 1QG4A 1T1JA 1T24A 2JLAA 1CW2B 3UJPA 4Z4FA 4JQSA 2PMBA 3KAQA 2E18A 1IZ9A 2F43A 1GNQA 3CZ9A 3KQPA 4PGFA 1A9PA 1NY5A 1P5ZB 3PYLA 4N3GA 4YO7A 4DCUA 1PYGA 3WGTA 4EYEA 1V8BA 4I4TA 1EK5A 4OLHA 3EXFB 4MP6A 1LBQA 1A7UA 4KLZA 3S2ZA 3PA8A 4GKJB 5BOVA 1EUDB 2XE4A 3OPVA 1CJBA 4EFNA 4BNMA 2HLPA 4ZVVA 1NM5A 1R6XA 1L5RA 4MMXB 4OMUA 2FU5C 1GGNA 3G2PA 3MT9A 4LIPD 4WEQA 1WQ3A 1NY6A 2GDZA 2RCYA 3JAWB 4YHBA 3FTFA 3KBOA 1YQGA 1KI1A 5IJ0B 1WU7A 3QKSB 4AZWA 3HXQA 4H7HA 4Q24A 3R5HA 2OYRA 4E2ZA 4PSKA 2JARA 3H97A 1SCUA 4ABYA 1P73A 2KX7A 1PW5A 1N2EA 4GU5A 4KYUA 3GLRA 4G0OA 1ZIXA 4D7AA 3U7RA 1FPMA 1I3CA 2A5FA 2GZ1A 4XARA 5KYWB 2IY9A 4BWYA 5SV2A 1E9RA 4N3BA 4RESA 3KKQA 4RVSA 3JRXA 1N3IA 2IUEA 3TD6A 1FIUA 1KE1A 3ESZA 3B1XA 4EI2A 1QXSA 1GR1A 4OXIA 3ZWYA 3H5AA 3CRRA 3H0EA 1N6PA 2N75A 2PTHA 3KRTA 2B1IA 3ZVRA 2CXRA 1RKVA 4FOSA 1EFPA 1PWZA 4E51A 2O7NA 1RYFA 2UYGA 4IHJA 4DMRA 4MCIA 1GRCA 1RQRA 3GEHA 1T9CA 4ARIA 1GN9A 2AN4A 1RAAA 4U2KA 2NXCA 3C15C 3WB1A 5COQA 3ROFA 1E3MA 3IBSA 2A0UA 2VNHA 2WNSA 3DNPA 4H16A 4QO8A 4E5PA 2P0EA 2VRCA 1NN0A 1TT7A 3NAGA 2QRVA 1SCNE 3BREA 3GFGA 3TZCA 4JV5B 1CHNA 1L8LA 1QQTA 3RTCA 2ZIGA 1KMMA 3E23A 2WZDA 3WA6A 3NRJA 2XXBA 1UPCA 3HG7A 5LMZA 1X15A 1R2QA 2OSBA 1SEVA 1SZJG 4R2JA 4JKOA 2DBRA 3LQRA 3RS4A 5KYXB 5DSTA 1WTAA 4TYPA 3TX2A 4AP6A 4EEZA 1AF4A 1ZAYA 2P9TA 1UT8A 3EZ7A 3CJRA 1ILEA 2VF8A 4C2TA 1ACMA 3GRPA 4HLNA 3TBFA 1R10A 3K09A 4DIUA 2DE0X 2H85A 4ZDKA 4D82A 1L5FA 2FDXA 2H2WA 4F3YA 5BSWA 3OTGA 3GN2A 1W73A 2PMFA 3IIJA 1H0RA 4NECA 2Q6OA 4NONA 1AK1A 2QUAA 4O4IA 1NX9A 1PYDA 3WQQA 2WJ4A 3CUVA 4Z4QA 5DO9A 2VXBA 4M54A 4P58A 5ESWA 1E6LA 5L8VA 3ESXA 3H5WA 1E9EA 4LRTB 1DO8A 2AYZA 4P4NA 2FR8C 4YAKA 4PANA 2YYZA 1OLUA 2ZR7A 5KJ1A 1KKUA 4DC0A 1PFVA 4ZEXA 2ZJ2A 4AF6A 3OIWA 3PZRA 2IYSA 5AKLA 2EDAA 3ZJ4A 2FVXA 3LKBA 4J7XA 4EHNA 2PRYA 4ZK2A 2QK4A 4UAJA 3T99A 4EJMA 3VVCA 3M1YA 2DULA 4Y6PA 4D9FA 2WQZA 1K97A 2J9XB 1F17A 1K89A 2IZ5A 2O07A 3BBPA 3AR5A 3EY9A 3D2LA 4Q7JB 4QFDA 3V2HA 3V34A 5JH7A 3UFXA 1QV6A 3L02A 4I5GA 3ZTTA 2MSNA 3OZFA 4QHYA 3C6QA 1T0BA 1YTLA 1TF5A 2IT1A 3KFLA 3NETA 1W581 2F9FA 3P9KA 1SR8A 3EASA 2QU7A 5SYMA 2W8BA 4L0DA 5AM5A 4YCDA 4EJSC 3DLAA 2OV1A 3M4ZA 4MVJD 1M0WA 5JC1A 3EBPA 1P5HA 3H7IA 2FX5A 3I64A 1SHKA 5JAZA 1QAQA 2BF4A 4O4HF 4KR7A 4BVAA 1R1DA 4BNUA 4NBRA 2XMSA 4L15A 5JNUA 3ZHYA 4PZEA 4B7ZA 3KWLA 3PGJA 4IIDA 1LWNA 2DH6A 3A9UA 3UT5A 1ZUNB 1EFRD 2J3EA 2X8WA 1QO0D 2ZIAA 3BWDD 4M87A 3RRXA 1NL3A 3E2IA 3U62A 5JD6A 1ZVVA 2A5JA 2BDEA 5PNTA 4REQA 2ZKIA 4URYR 5BWLA 3RG2A 3I2KA 1UZUA 5F2NA 5TQVA 2CFTA 2CYBA 4HG2A 4RJTA 4ZOLA 4L8YA 5EJ8A 4OBBA 4WOPA 4TPKA 2HQSA 4ETNA 3IAM1 4NFSA 4O33A 4Z7JA 3KQKA 3LP8A 2IZ1A 3GJTA 2V7UA 1RWOA 5E9QA 4WIAA 2B4TO 4OL0A 2A9RA 2E49A 3FR8A 1B0AA 1QE5A 1YCFA 5D6OA 4XA8A 4B7XA 4D79A 1P9RA 3KWMA 3ACCA 4ZCIA 2FPIA 3J7AC 3DGEC 2XADA 2F43B 5HG0A 1Q57A 3DOOA 2O3RA 2WVJA 4LZLA 4PSUA 4ZOBA 3RUEA 1B0UA 2OD2A 1PT5A 3FROA 2EJCA 4I4TB 4TLEA 5HM8A 4MKHA 4P9NA 4C14A 3K2QA 2CVOA 1PL7A 2NYAA 1CUDA 4FK8A 1M1XB 3WMWA 3B12A 5HCUA 3AH8A 5HE8A 1I6KA 4QDKA 1F0NA 3FNRA 3CWQA 3KWFA 4YFYA 5C7IO 4POAA 3D3KA 3UMSA 2G06A 3MQ4A 4P53A 3SVLA 4WFQA 2ECQA 3HV2A 1UAGA 2R5NA 1SCUB 4JLOA 1VLZA 3P9YA 5TPZA 1EUQA 3EVCA 3GY0A 4OOFA 2JJQA 2QYHA 2WY2D 4JUBA 3O8QA 2W6OA 3RBVA 4DQKA 1V9LA 3VVBA 1TGYA 2XY4A 3PGMA 4R1PA 1QTQA 5ALFA 3KTOA 4H17A 3LP5A 4G5SA 1VCOA 2W6MA 5AIAA 4GUAA 2RHCA 3VZSA 2D8MA 3AONB 4HYYA 4CFZA 4DIMA 2Q7DA 2GF0A 2R8PA 2VJKA 4DWJA 1QRRA 2XR1A 3JTEA 4DARA 1EEXB 4MUMA 3NKFA 5K8UA 3HY4A 4I1IA 1QZUA 5ADHA 1U2TA 5FQOA 2PLWA 2X6RA 3IEPA 3LCRA 4IG4A 5FUXA 4ZKDA 2WJPA 2FWRA 5D3MA 1EFPB 1PWEA 4AS2A 3R3HA 4XSGA 1B14A 1VIDA 1YU6A 3NASA 2E37A 3UFBA 3VR3A 4EA6A 4IHJB 2QXTA 4FUTA 3LXUX 2C61A 3KSZO 5EIAA 4JI1B 3ND7A 2PCLA 2TS1A 4HFMA 1Q7RA 5H81A 3UJ3X 4DPMA 5IJZA 4L9AA 1GLNA 1CUGA 1NJ2A 1GWNA 1J2RA 3CUEF 3MUEA 1SUWA 4LWQA 4NAUA 2QRVB 1F9EA 4MQBA 1FLNA 5I7VA 3CXUA 3H84A 4DNPA 2IFTA 3TLCA 4JODA 4IG9A 1O57A 1Q91A 3NDPA 2XAAA 3STTA 5JSKA 5CXQA 1O6ZA 1ODKA 2GHRA 3IQXA 1KPHA 1SNYA 2A84A 1A9ZA 2RHWA 2ZIWB 3NVDA 3OE7D 4YAGA 2HK6A 3L0ZA 1M8PA 3M2PA 3I5XA 3V1MA 1NVAA 1FTGA 1MPTA 4UHHA 1JHQA 2H4FA 2FMUA 3Q9SA 1FNMA 2IYZA 3DW1X 4UDOA 4D5GA 2VJNA 1WD5A 4ENWA 3TRDA 5GJBA 4RIIA 3WSVA 2BH2A 1X70A 3N76A 3KTFA 1TK3A 4XFKA 3PHHA 4CM6A 4KQ6A 1Z0KA 1U1CA 3KELA 4QX6A 3EQ2A 4N0QA 5BSMA 2GO1A 3PPIA 4O4IB 2PUHA 3O3NB 2QVBA 4Q4LA 1M0TA 5IJ9A 4AULA 2EARA 3VTAA 2G17A 3HCEA 1MOSA 4KLAA 5FQNA 1VG9B 2QUBA 5EKUA 4Z9BA 4D9EA 4DIFA 1LBSA 2HIGA 3FKSD 4LYYA 1PIWA 3OJCA 1T5HX 4TUYA 1Y6GA 3R3ZA 1WSAA 2W6IA 3D4NA 1MH9A 1OLUB 2BSQA 4QZVA 2OVBA 2EGUA 4DCNA 1YT5A 5J2TB 1JAIA 4U7GA 4I5IA 3ESAA 2QS9A 2ASEA 1X3SA 2I2FA 2YRFA 5FAKA 4IMIB 2IEDA 3R23A 1BDIA 1Y9DA 1KR5A 2M32A 4MHOA 2XCQA 2R96A 3GT3A 3VHXA 1GO2A 2ARKA 2WG1A 3IB6A 3MGKA 1DAOA 4EVSA 3UFXB 3JY6A 4BZWA 5JH7B 1QP4A 1U28A 4KYIB 4P54A 1RXEA 2FLWA 8ABPA 1Z15A 1E3TA 5JMPA 1RACA 2FHPA 2W2TA 4WBNA 1P1IA 4KWTA 2RHBA 2PLFA 3IQDB 3PVSA 1K3UB 2W8BB 5CDFA 1L9XA 4C4RA 4PY2A 2X4IA 1JPVA 4YP7A 4R7TA 1XUOA 1A69A 1B8UA 3AF5A 4YYEA 1BDMA 3PHCA 5TJ9A 5K0EA 3N9IA 3MRVA 2VRNA 4QG7A 4EB6A 3OZRA 3P0RA 3L6UA 1W5EA 5CNJA 2RGRA 1L4LA 2C96A 4FN4A 2PWZA 3KTAA 1GNSA 3R7BA 3UT5B 2VAXA 3CMCO 3OQIA 5DNCA 3ZI0A 3PX7A 4B6FA 5DGCA 1TCAA 3D59A 2G4LA 4QU5A 5CVVA 3W6ZA 9GPBA 1WRBA 1NQ5A 4REQB 1B1CA 5A3SA 1E1QD 4WADA 4QFCA 4ZOLB 3MGGA 1W36C 3PQ5A 4Q1DA 2J0SA 5CDSA 3LDFA 1FPQA 2C3UA 4ZXPA 3A7DA 3ZD8A 3IH5A 2P3OA 4LJ5A 4AS3A 5IK2D 2O2HA 3KXLA 5JZSA 4Q1CA 2GZ2A 4ZQIA 1IXRC 3HYRA 3OQNA 1LVHA 2XUFA 1ZCAA 5HCNA 5ALRA 1MAHA 5B7QA 5EIEA 2FPIB 3ANLA 1QDLB 1O95D 3NHYA 4ER7A 4CM8B 1RMTA 5DN6D 1AM4D 4EG3A 2ZBGA 1JLMA 1NQXA 2Y0PA 3EAQA 2MMGA 3AIIA 4OL9A 4P5DA 4CDGA 5GY7A 4I66A 2I4TA 3A3OA 1O1YA 5TS2A 4ANFA 5K8IA 4NOLA 2G07A 4PN3A 1SG0A 4ALLA 1IZ7A 4W9NA 3SLKA 3BA1A 1SQFA 4US2R 3LUBA 3IMEA 1GZ4A 4O4LA 1E63A 3CF0A 3HE3A 4NMHA 3EQ8A 2H92A 3FPHA 2IU0A 3CXRA 2OCGA 5LQRA 1SG9A 2BI7A 2DTEA 2PX8A 1YRYE 2KPOA 3LUPA 3OVMA 4URXR 3T3MB 3QOWA 5EA2A 2DFTA 2H11A 5AXDA 1QYDA 3O8QB 4DDHA 4RQBA 1Z83A 3E8MA 3NS7A 2R5FA 5GADl 5KBYA 2FQQA 4XGKA 3LU1A 1RXYA 3RUIA 3VHLB 3WJ1A 3WHIA 4EB0A 4FP9A 1NVXQ 1C3LA 2OILA 5FBWB 3LXRA 3PDUA 4TSFA 1HUQA 3M6WA 1PO7A 5TVGA 3H1GA 2XKJE 5A2GA 3HU2A 2R8YA 1A71A 3DPSA 4B6QA 4PHCA 1E2NA 4AWXA 5KQMA 3WAGA 3DLBA 2H1VA 1L7QA 3MOIA 4AKTA 1KJ9A 4EZBA 2JLSA 2W43A 3CW2A 5D3MB 4COKA 1P5JA 1UEXC 3DFFA 4AN4A 2NO0A 4DTIA 1V37A 3BJZA 2VP5A 3COWA 1DCTA 4IDEA 3J7TA 2BFNA 3BWBA 1TLLA 2P90A 2Q5QA 3IUNA 1SELA 3TVYA 2NTNA 2F64A 3HEBA 4MTCA 3OZTA 2I78A 2Y92A 4ZT6A 3EUWA 1PZFA 2AI3A 4OBEA 4J0GA 2AV6A 3N87A 1HR0B 3RWMB 3S1LA 5A7HA 5C2JB 2C9ZA 1VMIA 1XTRA 3F7OA 1XVVA 3JZDA 1XZAA 3BMNA 1EG2A 3BSFA 4G8CA 4GPBA 4DOMA 3C87A 1TW3A 3KFXA 3NJRA 3AOGA 2QLBA 3UMRA 3DDCA 1EXNA 3PPWA 2GO7A 2I62A 1AKQA 1PRYA 3HN7A 4KCGA 3MCWA 4D8WA 1DT5A 4L4XA 6YASA 3HVHA 3VAAA 3GLTA 3MWLA 5IZ4A 1EHCA 3WKEA 1QOZA 3AWDA 1OBCA 2FE4A 2I55A 3QKRA 3GNSA 1YDGA 1YF3A 3N59A 4IXNA 3FCEA 4Z3OA 1TPZA 3M4XA 2GJKA 1E2PA 4PLTA 4OY3A 4RF4A 4G0QA 1PAUA 1RBZA 3IDSA 5HQTA 4TROA 3FUXA 3QE3A 4I4TF 3S7ZA 2VNIA 1BJRE 2AXQA 1LK0A 5IJ9B 1I3KA 2XZOA 3NPAA 4I99A 1H2WA 2ZYVX 3UMVA 3QVSA 1UJ2A 5IF3A 1KL7A 4TUYB 1AHHA 2MDTA 3G0OA 3OSUA 5BQ3A 4ZI2A 1BJTA 3IJEB 3EAFA 1OXTA 3NJ8A 2AG8A 1YFJA 1XPUA 3QFCA 3WK8A 4AI6A 4PYLA 3NFRA 4UNNA 1PZNA 3GRVA 3O9ZA 2ERYA 4OBWA 3S2SA 1KO7A 3KB2A 3DAFA 3TL3A 1U8UA 3U3DA 3VSCA 5JCPA 3QENA 4QIHA 5ALSA 5DXJA 4QD3A 2C2OA 3H4VA 2G63A 1GR0A 1Z88A 3BE8A 1UKYA 3LCJA 4H7KA 2Q0HA 2O5EA 4YFVA 4RY0A 1WXGA 5CM8B 2WWVD 4BVJA 1V8ZA 3BC1A 3KL4A 1JR3A 2KLBA 5ENZA 3ZC3A 2X9QA 3ESDA 3C24A 1AKVA 3U3OA 4Y9RA 3UAWA 2WF6A 3FHOA 3FVVA 4WBNB 1G9XA 2LBPA 1YKGA 4QEZA 5K7SA 1KEZA 2DWPA 1Y89A 3ITDA 4OQFA 4Y7CA 4L02A 4FCTA 3DL4A 3GZ4A 1YFZA 3MINA 3GG2A 1YQWA 1D3AA 1ZHFA 2CUZA 5CUQA 3WZLA 4F97A 4TKVA 4NSNA 1DCFA 3F6SA 2VBIA 1M1YA 3IHKA 3TTVA 4M9UA 1SVKA 5EESA 4IHJF 4BUCA 1KDYA 1GGMA 2JJ2D 3HXLA 1F51E 2REQA 1S7GA 1AV7A 3HKBA 3MJSA 4GBED 3RSQA 1FTWA 2AK2A 1N92A 2RAVA 3CUTA 3KTAB 1FRVA 3NM5A 4OI2A 5MF6A 2Y6VA 1S3SA 1JZQA 2DU8A 1PX2A 2WHPA 3OQIB 4MARA 4MGKR 4F2DA 4EL5A 4A8PA 5I8PA 1SOUA 2XD4A 3IELA 1ENZA 1KK0A 4CKZA 1H8HA 4MWTA 2N47A 2FEOA 2X5NA 5IHXA 3SBEA 5ALMA 1D09A 3KX2A 3IP9A 2P2NA 4IOLA 5AW7A 3E03A 5CA1A 4CMAA 3J81A 1XROA 1C8BA 5EMMA 5KHLB 1KR2A 2QPLA 2QQFA 4GQAA 4PINA 1PV1A 4D3XA 5IKEA 1LKZA 4IDGA 2R2AA 3DLTA 3FYTA 2X4LA 1AUOA 3CBQA 4XUEA 5IMBA 4D41A 4DLVA 1L4UA 3B7WA 3GMTA 3TI9A 1EE1A 4QATA 4ZVKA 3GVCA 1OB2A 1NUTA 1LTKA 2XUJA 3FFBA 4K7JA 3WIEA 2C0CA 1KK2A 5J63A 4EITA 1ABEA 3AGPA 3GK3A 1EJ6A 3UG7A 1E5DA 1JBKA 4O4IF 3H8JA 5FI5A 4E2WA 2FW9A 2H17A 1Z08A 3TNYA 2V65A 2P7HA 4O4LB 1FL9A 5HJ5A 2AC2A 1EB9A 3JASA 4MS1A 3C3BA 4EECA 5J4HA 1DU4A 3GFOA 3L8FA 4GNRA 1JAZA 1G17A 1W59A 2WTEA 3CR8A 4AUNA 5JS1A 4PYKA 4YLYA 4BLTA 2QTNA 5DYGA 1A2OA 3O8BA 3PUVA 2WF7A 5EVJA 4V0MA 3PCXA 1ZCBA 1T2EA 2RIRA 4QEDA 5I7HA 3D3NA 4DYDA 4A6EA 5J9FA 3UUGA 1ZIYA 1C1DA 2RKBA 3C2QA 4TRJA 1V7PC 3H87A 2J8ZA 1MFZA 3ED1A 2IOYA 4Q4JA 3EZXA 3ITEA 1XDBA 2VXYA 3KOYA 3LRPA 4BLOA 1P45A 4QWMA 4C4XA 5JH7F 3AKDA 1OVMA 3ABRB 3AR6A 1FDOA 4UUMA 5FORA 1VSQA 3H83A 2OQ2A 5ALZA 4IQ8A 5HKAA 3DYIA 1J2UA 2ISCA 3CNOA 4RTRA 3QK7A 2XIQA 4H6WA 4TKUA 2IU3A 2PMKA 3OCZA 1DKQA 2ZATA 2ERCA 2JJ1D 4MH0R 1W5FA 5K3BA 4CMJA 1WZIA 4JBIA 2Q4BA 3I4LA 4UPVA 2F6RA 4P6VF 3CX6A 4B43A 3DTVA 1UJMA 3VTZA 4PRKA 1APBA 2O8CB 1WUHS 1DJLA 1U8FO 2J7PA 2JGNA 2V7PA 3AHFA 4IDAA 4R2XA 3QWFA 4KGVA 4S3MA 2RH9B 4G8JA 2A1TS 4KBGA 4QDOA 2XDQA 3FCUB 5ECGC 3DT8A 1BROA 2QG9A 5FBQB 5K05A 3ETHA 2DRIA 1X38A 4XD7D 1WPGA 5I7AA 2GA8A 1HQCA 3RT7A 1X8XA 3PXXA 3RVNA 1N3BA 1X1CA 2PSEA 2WW8A 3NTRA 1M6YA 2V6GA 2VF2A 3BMNB 3KZMA 4F3RA 4ZOLF 4TMFA 2PGXA 2XNCA 3LM8A 5D1NA 2EAUA 1KTVA 5JE8A 3U31A 4E13A 5DK4A 4B3SB 3RVDA 4ESVA 3F7MA 2C9BA 4R8RA 1BA2A 1ZIDA 5JG7A 4E1VA 1DTSA 2ODQA 5AHKA 1HYHA 4DEYA 3RW9A 3QKRB 3I9FA 3T3EA 1BXZA 3JWPA 3OPQA 3ANYB 3TCNA 2F3UA 4C0SA 2IC5A 4V0LA 2G36A 4ZZ1A 3TF5A 4KQ1A 4PLZA 3RU2A 1QF6A 4C1NA 3UYKA 2YN4A 4NE9A 3SHVA 2I71A 2AZXA 4R1OA 1U8EA 4AY3A 1ACLA 5K0NA 4G01B 2WILA 3BK7A 3ZHOA 5CCBA 3U5TA 3TIVA 2WSMA 4GZ6A 1MG0A 1QVAA 2QN7A 3BILA 3LFTA 3O2SB 1O0CA 2I3DA 1SOAA 3B9BA 1BFKA 2G80A 1IAVA 4JJ7A 3E9YA 4EBFA 5DYTA 2W4MA 2QF7A 3C5VA 4OF4A 5GJVC 2NVWA 1RCFA 2R8ZA 1E5LA 3I1JA 3PNLA 1Z26A 2GUWA 4L4UA 4KQWA 2O23A 1M66A 4B8ZA 2P9EA 3RSSA 4HL6A 3IVMA 4EHDA 4NU6A 3OLZA 4FS8A 3RVKA 4A2QA 2D1RA 4B3TB 4BIMA 2I66A 4OQQA 3FMPB 5DH9A 2RGUA 3PEUA 1QRUA 3KKPA 4Q9NA 5COAA 3DKVA 1Z8NA 2QLJA 2N42A 4J76A 3MINB 1ZD1A 3SQDA 2PX2A 4TKVB 2X42A 1VJ5A 1XZLA 3MGCA 4ZOEA 2CK3D 1N2HA 3CLSD 3D6TB 2LWIA 3DMTA 5B1HA 6ADHA 1M1YB 2BGWA 5FL3A 1J5PA 1D6JA 2HRZA 3B5JA 3BJMA 3KD3A 4N65A 1P6XA 1RLOA 1SXIA 3OT5A 2REQB 1JIVA 3EXG1 3HKBB 1WS6A 5AQ1A 5EMNA 1KE2A 2FPMA 3MOGA 2ASVA 3CUUA 4CMCA 4UUBA 2WHPB 4HO1X 4OP3A 4PWZA 4AX8A 5ICCA 4J16A 1U0LA 5H83A 4DLYA 1OYVA 2R7KA 4WLNA 4MULA 5MHTA 4DY6A 1R0SA 4YJFA 2OTCA 1I3NA 2A9KA 4JR2A 5KOHA 4ES6A 2GSDA 3LOUA 2D2XA 5B1IA 4PFQA 1DAHA 2XGOA 4RDHA 1T91A 4EGAA 4EABA 5CA1B 2IWHA 1ZD4A 4Y0VA 3BDIA 2E4ZA 3GMSA 4UOZA 1OWLA 5LJIA 1GFWA 2UZ3A 3GFPA 3BH0A 4N0PA 5DMHA 4ALMA 4CMEC 3N0RA 5GOZA 2PJZA 3R3XA 5EHQA 3CF4A 5H80A 2BMJA 3TE7A 4RMIA 5IX8A 3DM5A 1QPBA 1YUBA 2VK2A 5AVQA 2HL6A 2GOYA 3G68A 1PJRA 3RHZA 1UFOA 4P22A 1T25A 3RFVA 2BEKA 3LDGA 3ZWOA 1RKBA 1SPBS 1Z7BA 1DL5A 1G7RA 3MCUA 3P2JA 5BP7A 2QROA 5DDIP 2QAJA 1NMZA 3BZBA 3D5TA 1VL5A 4IGAA 5AHRA 5A3RA 5DEIA 4HTFA 1P18A 4BP1A 3EAGA 4BJ3A 5C81A 1YHYA 1RWBA 1BKSB 2GT1A 3DWFA 3JASB 3ORYA 4FWBA 1FP6A 4MKRA 4J3FA 4MS1B 3ZGVA 4GZMA 4YT4A 5A5VA 3HB4X 4DR7B 2NACA 3OZIA 1P9NA 1TL7C 3JQ8A 3K5WA 4KWIA 4X93A 3RSLA 2Q4DA 4S1NA 3VU8A 3C98A 3O7WA 4O1IA 3VKUA 5CDFE 3FF4A 2CV0A 1K7CA 2PNJA 4ZQGA 4UFPA 1C1DB 5M3BA 3IP3A 1QYVA 4DRXB 2BFWA 3DLHA 2QTWB 3D0RA 5FOSA 5JO9A 4Q4JB 3WRYA 3TSAA 4DMCA 4TKZA 1ZJ5A 4N47A 3H17A 4WBNF 5IG2A 4Y2XA 3PLAE 5DVZA 5AYVA 4TKUB 1P5RA 2AMFA 4Z0HO 2GWRA 2AKAB 2NVOA 1RWXA 1LK5A 3C97A 1QRSA 2CCKA 4DDUA 4EVRA 1U0TA 1WW2A 3JQQA 4AMZA 2LRHA 2TMGA 2YMMA 1JQLB 3B13B 3DTVB 5EPOA 3QEAZ 5AD1A 4KC0A 4XOIA 5E95A 4E7OA 5IDQA 3HZOA 3LQKA 3NWPA 4RVUA 5C8VA 1XALA 3ABSB 3GQVA 4QDZA 3SXUA 3R75A 3HJCA 2XDQB 4BNWA 3QELA 3N0WA 1N5KA 1WLYA 2O2ZA 5AJYA 1X7XA 2PA0A 4S1VA 4H0NA 1Y1RA 1H6AA 1WPXA 4YECA 2C7BA 1RPNA 4UXIA 4GPTA 3TOXA 5AKYA 3KCNA 3EWIA 5K09A 3GLKA 1N4DA 1KF0A 1QZXA 2RG1A 1GM5A 1BXGA 4Y9TA 4U3JA 2BELA 4BJHB 3MIZA 5E7JA 5FOWA 5CA0A 2II6A 1LRKA 5HXAA 1C2YA 4G0UA 3HXPA 3F47A 2PUVA 3B8HA 1CWUA 1NVBA 2PEZA 1FUYB 2QL9A 4NBTA 1AGYA 3ZUPA 4D74A 1L5YA 1UQTA 1MXHA 1BN6A 2I3BA 3ZXYA 2N3ZA 1J5EB 4GLFA 2VTEA 2YZ2A 1FU4A 5D86A 2I6QA 3IAUA 2FWNA 1BX1A 2I91A 1A1SA 1EPUA 5D84A 1SXJD 1EGHA 1MW8X 2H4XA 5KKAA 5A4JA 3VU3A 2C7OA 2FF7A 3PDHA 3CVXA 3MRTA 2J9RA 3KUCA 4YASA 5E4JA 3VQTA 3AJRA 2EKPA 2J5RA 2HDOA 2G9VA 2A59A 4TMVA 5BWNA 2BV3A 4XSVA 4DN6A 2CNLA 2QD4A 2C42A 2HLHA 1JR2A 4O4LF 3FIUA 1AKUA 2HK7A 4IRUB 3UAXA 4FSHA 1DEOA 1WMBA 3FPJA 3V1YA 2PGJA 2VDNB 1RM3A 4G1BA 4IMPA 3WGIA 1P17A 2OD7A 2PK3A 2PSJA 1XCBA 3IP5A 1Q5PA 5EHZA 3RV4A 3KYDA 1JE1A 2V5VA 1OU4A 4ZRMA 5B3JA 4UMEA 3T7JA 3JYNA 1EFVA 3JWHA 4MR7A 3K71B 1RZ3A 3CEPB 4F6CA 2Q9CA 1AMUA 4ZGBA 2CUKA 4ML3A 3CVWA 2IP2A 3ZH2A 3RS3A 5FI0B 2Z5GA 1J20A 2O14A 3WMRA 3Q6IA 4NHEA 1FFHA 1PT6A 1VSUA 4RHYA 3SBDA 2PKWA 4ERXA 2VHYA 3MJ4A 1NWHA 2A86A 3DWGA 4A6DA 1R15A 2MU1A 1U98A 3EF3A 1CUAA 4X6YA 1GNTA 4DKXA 4B09A 5F9HA 1RC1A 4LY0A 4OFWA 1FSFA 1HE4A 3JQBA 4OTZA 2BBSA 4NF2A 4BQSA 1JP7A 5T64A 4KXVA 1HA3A 4MZXA 5DOZA 3BFVA 3L7IA 2IUYA 3FJYA 3P2EA 5A62A 1P9WA 1BWRA 2ZRQA 4LS3A 4EKIA 4ZARA 3QY9A 2XYHA 4XWWA 3RVLA 3V4SA 4GL2A 5DSXA 3E81A 4LW8A 2AJDA 3AVXA 1COWA 2Z5VA 4H3VA 4YJFB 3GXOA 1GXSA 1NN5A 2IX9A 1BC5A 3OY2A 3PGA1 4LXHA 2AMYA 4YALA 2QVLA 2X2FA 3TGPA 3WICA 2BDTA 1NOJA 2ZXUA 2BTEA 4Z8XA 1VECA 5AJXA 4LXGA 3HCCA 3GR6A 1J56A 1W47A 2RH4A 3QLEA 3PC2A 4QUIA 1GQ2A 3F46A 1U4OA 1O6CA 2CEKA 3TEMA 1IBMB 3I73A 4L9WA 1YVUA 2O2EA 2RIPA 1M7HA 4FFRA 4MW7A 3JWGA 1X1AA 3LK7A 3VR5A 1ZRSA 4F2PA 5KQGA 3QEMA 5KNCD 1G8GA 3SSMA 3K05A 5C7LO 3COSA 2QWXA 5EWMA 3DMYA 3ADCA 1M8FA 4HTFB 4CCAA 3RCBA 1IOLA 1L3BA 4EVIA 4BASA 5HZKA 2LE0A 4MP8A 1UJ5A 2P1DA 4GXNA 1WE2A 5KWVA 2V4UA 3JQ8B 1DTEA 5B6PA 7MDHA 1NGSA 4B85A 5INTA 5BXYA 2EKZA 4QBHA 1V8OA 1WXHA 2JH9A 3WGZA 2C2KA 1E1RD 1RJDA 3F90A 1A9RA 1VJDA 1TUBA 3N1UA 4ND2A 4BATA 1JI3A 1FS5A 1M1YE 1Z34A 3MBIA 4BLQA 4DMLA 5AJHA 1V4VA 5JBIA 3SGLA 5JVDA 5HFAA 4L3VA 2XKAA 3K0SA 2XUGA 3NDJA 3ZR4B 3E53A 1A2KC 3RBXA 1X1SA 3FCCA 4IXMA 1CEQA 1SBCA 4IS3A 2W93A 4WBSA 3OIGA 5M7EA 5D3ZA 1A9SA 1UC9A 5G0TA 4DIEA 3PNQA 4LJKA 1M76A 4FW8A 2CMHA 1NQWA 3ORHA 1QG6A 2HSGA 4WXPA 1TVKA 3TM4A 4YUZA 4YRLA 4JITA 3GAMA 3SS8A 2FPXA 1D8AA 2EU8A 3H16A 3NV9A 4GZLA 1BEUB 2K5UA 3KT3A 4WFKA 3RKUA 3UB4A 5CLLA 3H2JA 3JYPA 2CB9A 4BV8A 2VOJA 3B5IA 1PQUA 3SXUB 3W8EA 3LL4A 3QELB 5T4BA 1W34A 1BA3A 2V6IA 1X7XB 3FYUC 1JFSA 3D2AA 1RP1A 1WNFA 3R5XA 3EEIA 4U1RA 5DHPA 4EGCB 4F91B 1M5UA 4JMPA 1OXBB 1VI2A 2FSVC 3KC2A 1TAGA 4MGYR 4XM1A 4ZA2A 2RI6A 1SVOA 4BBZA 5U9CA 2C77A 4GOMD 4OHVA 1BXGB 1TCCA 4U3JB 4CGZA 4YT8A 2WMOB 5CA0B 3K6JA 1H6BA 4O5AA 4RMJA 4ZPXA 4F9GA 2F1RA 4GX2A 5CA1F 1FYWA 1AS3A 4OXNA 1SU4A 4NR0A 3HACA 2GPAA 2WT4A 3C3JA 2OXRA 5DYYA 2QLNA 4QL3A 5CPFA 1J99A 1ZM2A 1N25A 3IIKA 4QSMA 2DZDA 1SKQA 1KYIA 3MTAA 4HUQA 3LZCA 1SAYA 4U0KA 4UKDA 3PFFA 1EYZA 2SICE 2WIJA 2AL7A 4L4RA 1UJ4A 4HFJA 4PIPA 2AFHA 3DWIA 1ZH2A 4RVNA 4V0ME 2PH1A 4CM9D 5H4GA 4AIIA 3VR6A 2OSVA 4TQGA 4LDRA 1FSGA 4XYLA 4OB7A 4AMBA 1VZ2A 1PGNA 1XHEA 1L1EA 2YIDA 1XMIA 4IEFB 3O4HA 4KV7A 4EKYA 5EE5B 4BVGA 4R6WA 1NVMB 2XMBA 1W1UA 3LX4A 1IVSA 4IKOA 1X9IA 3M1IA 2IYAA 2VHVA 1TIKA 3D2BA 1VZ3A 1T29A 2ZB2A 4HS4A 4PC7A 1XBTA 3H2BA 3OAAD 5H3LA 1BWQA 1G8SA 1WUIS 2GGSA 3A9VA 4M9XA 5THXA 5TQJA 4GXRA 5DWDA 2PNFA 1PSWA 5CLIA 4FYHA 3V4FA 3U9LA 2YMPA 1SU7A 1D2HA 1HG1A 2ECKA 1FJHA 1VPEA 1EE9A 3KYDB 1OF1A 1EFVB 1T2NA 2WOJA 4MR7B 5D7BA 5EIBD 3TAXA 2JA1A 3THXB 3IQFA 3GAFA 4N6NA 3K8YA 3PUHA 1IMOA 1UXOA 2VEOA 1DAIA 4TS4A 3SSNA 4C2BA 4GP9A 4EO7A 4BVKA 2ZBQA 3GGDA 3BE6A 4PLPA 1B2LA 2R8EA 1O97D 1SXPA 2CVZA 2GBIA 2Y1XA 1OY1A 4DV3B 1Z4MA 2QJWA 5D87A 1KHTA 1TM1E 1JFLA 1EX7A 2B36A 2RI0A 1T36A 1ZK3A 3N3AC 3LIIA 3DVQX 1R6VA 1V0JA 3SE7A 4V0QA 1BH6A 4CQMD 4ZHSA 3H4IA 3IKJA 1B8PA 4YUXA 4L72A 3A27A 1EGQA 3HCFA 4ALIA 1EX6A 4WFIA 3PFHA 2ZK7A 2W5UA 2MSLA 2VP9A 2XW6A 4WXHA 4OHZA 1PD1A 4O2BF 4W8OA 4D6XA 4CLRA 2D3TA 3OTOB 2PJUA 3WDKA 3PQ6A 1Q1BA 3WYEA 4NCJA 2YV2A 4F5ZA 1X0XA 2QMUA 2VAWA 1EBBA 2WHEA 2KW5A 3CNQS 4HDKA 1QKJA 2VQSA 1XRSB 5BV7A 4BOYA 4IH4A 1GYPA 2ADFA 1GXSB 3TLZA 4BMPB 1ZONA 1QO9A 3LT0A 2OYSA 5L7TA 1DXHA 2FWBA 1OE0A 3SJZA 4JT8A 3HJGA 1RTKA 3GF4A 4WV3A 3DDWA 4QYXA 5CG2A 3EVEA 3FN4A 1Y5NA 3LY7A 4HWGA 4C5AA 4UD2A 4EFKA 1I0LA 2HRQA 2OMKA 3C3KA 3E7FA 3F4LA 4FR2A 4GYJA 4U5XA 4RK5A 5A9TA 2PX6A 3QFRA 3JZAA 5K20A 4ZCRA 4B32A 2BMWA 4BP9A 4BZPA 1CIPA 1GQSA 1QGDA 2HK8A 3QEMB 5C8DA 2JNWA 2R3SA 4JYZA 2C2ZA 5EWMB 4LQDA 3ZW8A 5LIRA 4YPVA 2I4RA 3A1WA 2OAP1 3HR7A 3TGLA 1P4SA 2AA3A 3R4CA 4BVEA 9LDTA 4R71A 3Q7RA 4P0QB 3L9XA 1CR2A 4IF6A 4IL5A 4JX9A 1G18A 2GTIA 2VT3A 4EP1A 1RAGA 4WL0A 2KI5A 2GJSA 2Q2VA 3AU9A 1HDXA 4HZUA 5K6AC 3VUEA 1C3JA 4M89A 1U8TA 3CLRD 1EJ2A 5ISMA 1OYWA 1KAQA 1TUBB 2NGRA 2WE7A 3QPWA 3HJAA 3R2JA 5GQSA 3VNVA 3QUTA 4MRRA 4BO9A 1CSEE 1PEAA 1QTIA 5JVDB 4E33A 3BQNB 2XCTB 4IPTA 2FSGA 4WLFA 1QIGA 5DM70 1EG7A 1G8HA 2JD1A 4J1TA 4BDTA 1RAHA 2EQ5A 3WLKX 3QBEA 2DQSA 2XWBF 3C6KA 3WGUA 1RQPA 3P9NA 2HKIA 2CYAA 3I8OA 5JJLA 4KO2S 2R7NA 2QTRA 3UHAA 5SZHB 5HA5A 4CTOA 4XB6B 4LHZA 4ECAA 4FPXA 5CLHA 1VRVA 2LIVA 4Y9UA 2D5IA 5KYTA 3A6KA 2BM9A 4DQUA 3FOCA 2LTAA 3ZQUA 1Z4LA 1CG6A 2HDWA 3AIKA 4BNDA 1E5QA 1YZGA 2R6JA 3AJ9A 4Y0NA 3TEFA 1KMHA 3UBTA 1IHXA 2O2IA 4JCOA 1L5ZA 2JFGA 3L1KA 3ND8A 3HABA 4QECA 5FUWA 4KL8S 3LZDA 4FCWA 4NX2A 4X71A 4NV1A 1HFWA 2VOEA 1IPHA 1FXUA 3CSDA 2XUHA 3G2OA 1ZNWA 3P1JA 4PICA 3NV7A 5EMLA 2WFZA 4YPFA 3QPBA 2XEXA 2EBUA 3X1MA 2EP7A 3G0GA 3NBXX 4YAEA 3TRIA 3CISA 3EEFA 2FV8A 5EE3A 3INTA 1DPFA 1JA0A 4UDYX 2ID4A 1Q11A 5E4TA 1FLAA 1F0YA 3H9JA 4QBIA 4YPOA 4Z3KA 2C5GA 4HUQB 2BF7A 4S0ZA 1JNXX 2OCXA 1ECJA 1DWQA 4GAEA 1PKEA 2Q3JA 4KJZA 1HV8A 3SLGA 4EZIA 1Q0LA 2P8JA 1MZPA 2AFHB 4UDXX 2JW5A 4WACA 5KCZA 1HQDA 3GDGA 5H02A 4DCCA 4AO7A 2V45A 4RQTA 5LMUB 4LOHA 1MX3A 3RNLA 1Y3FE 2IITA 4KK3A 3B20A 1CQWA 4WESA 3D54D 4WE3A 1QIIA 3WMGA 1K4MA 3LY9A 5DTQA 3TE6A 7ABPA 4L1KA 2BTQB 3P4UA 2RHTA 3JTMA 4HUTA 1CR0A 1ONOA 2IYRA 4N8SA 3ZNNA 2FYTA 1W0JD 3CH7A 1I32A 1PR6A 2VZ0A 2YQ5A 4R68A 2P9QA 2IOFA 3EXG2 1GSAA 1EGAA 1SJ9A 3PDWA 3GZTB 2YHBA 4CMHA 4H6XA 1O9HA 1N36B 2ZAOA 3BGVA 5FUYA 3LA8A 1N9GA 4KP7A 721PA 4YCJA 2ODNA 4RPHA 1Z63A 4CLXA 1JHMA 4TM8A 2IVFA 3NTVA 4RSMA 3KR0A 5I7RA 1CZUA 5LP6B 2UXBB 3FWHA 3JD2A 1LU9A 3KXPA 2Q28A 3PGVA 4PVCA 4U2BA 3TRKA 5EPEA 5HILA 3DAHA 2QQGA 1CEEA 1Z37A 2F3RA 4FDMA 4JIGA 4HMPA 1ZLXA 1QAMA 4QYSA 4YRDA 4MSUA 4QOJA 1T36B 3TECE 1EFLA 1W88A 4NK5A 5KDDA 2ZJ3A 2P30A 1Q15A 4OHWA 3UXEA 2AK3A 4PNPA 1QSGA 2W2LD 2EFCB 1R37A 1RXCA 4MCJA 1LQUA 1Z16A 1PG0A 1G7TA 1LTQA 3OO1A 2AHRA 5FBLB 3PUJA 1QF9A 4MIKA 5CXXA 1Y3AA 1YRLA 2ZRMA 1N8SA 5JD4A 4CLRB 4TVBA 3RHSA 1GTJ1 1QB7A 2CZGA 4R9UC 3P4YA 4N54A 4CTJA 2YW9A 3KQHA 5JAQA 3WLJA 4IZ6A 4M53A 1HX7A 2LKCA 4MDYA 7AT1A 3UAOA 1NF8A 5HS6A 2VNSA 3CVVA 4EI9A 4NU5A 4HDKB 3DV0A 4IILA 3SSOA 5MGNA 4WA8A 4GYWA 2FWJA 1YONA 3A4LA 4FHCA 4LC9A 4W1PA 1CIVA 3A58B 5EGNA 3OWOA 4DIBA 1YJQA 2XJ9A 2C7PA 5BW5A 1BDHA 5A4KA 2NO9A 3DVSX 1OC4A 2HCRA 4FFSA 4E5KA 5I47A 1AQIA 1GQRA 1QNLA 3IUYA 4IHKA 2PWYA 1S1MA 3MJRA 1QQ5A 4BWFB 3JARA 4TL8A 1A0OA 4TWAA 4RKEA 2JH3A 1T15A 3A26A 3CCBA 3W8RA 3S8EA 2IU4A 3QVLA 4JDUA 4PHGA 3V7YA 1DG1G 4C2AA 3HJBA 3S2UA 4KPEC 1CUYA 3GL9A 1XMQB 1H5UA 1KO4A 1D6NA 2F1JA 3E1GA 5DW3A 1FQWA 2V59A 3LAWA 3WGOA 1F12A 2N1BA 3AY6A 4MKGA 4NH4A 1TC2A 1ZSYA 4LHYA 3O5AA 2HWUA 3BERA 3FSRA 3ICVA 1MORA 2RGXA 3IP8A 4NTZA 4Q37A 3RASA 5IAAA 2AWNA 1UBCA 2NAFA 2P9JA 2Z2ZA 3F4KA 2QVYX 3H8VA 2PU7A 2C3MA 3G2NA 3KEQA 1U3GA 1AZWA 1XZQA 2AFVA 2J09A 2PEYA 3HCPA 3Q2KA 4RJ2A 3O21A 2A0FA 3B36A 5TXGA 4L5BA 3V7NA 2D5LA 4BQEA 1E4EA 3OEYA 4BN4A 2OZEA 4EY8A 1FJ2A 2JJYA 4HZUB 3M5PA 5BR7A 2P8SA 2CJFA 3ZCSA 4EG5A 1PW7A 2ADMA 3ZIAD 3CRMA 3HH8A 1DWPA 1OW3B 1HT1E 2YL2A 4MS4A 4EG6A 5KAMA 4ZDJA 3UYLA 1E2KA 2W6JA 4YUYA 2PA3A 1QCYA 2C5HA 3V7WA 3WIVA 1YC5A 2QIOA 5DNDA 3WP0A 4AN1A 5KNBA 2NSHA 4MQUA 2OO3A 4NY1A 4B4VA 1S9DA 1JHAA 1G21A 2ERXA 3KD2A 1W93A 4GKAA 4GOJA 3CYFA 4NENA 2QTLA 4QUHA 3GRAA 1W4LA 4J0KA 1DOAA 3NBUA 1OI7A 2AXNA 2BW0A 3AEKA 1M8GA 1CRWG 4RFVA 2VJLA 2X19A 4D2IA 3ZHTA 1NATA 2A0WA 4UEOA 1E1YA 1R9MA 5CH8A 4KWEA 1QZTA 2BGJA 4WT7A 4BNDB 4G09A 4FDLA 1EB8A 1HURA 4JJ8A 4YTEA 4EGSA 1KMHB 4L07A 1DMRA 3WGLA 1MRZA 9MHTA 1J0EA 1Q0TA 4P93A 4OHUA 4Y98A 1NE2A 5CEJA 3VYUB 4PQRA 2ZI7A 2QT1A 3OICA 4I0WB 2QLTA 2HWXA 4B87A 3DOJA 4CM1A 1UBEA 4EELA 4YCSA 4DWWA 3A4IA 4N41A 3G0IA 4DJEC 2OCDA 3K1ZA 2OWEA 2I22A 2BGUA 4EJ2A 1GFZA 2FX2A 2ATEA 3OPNA 4HP8A 3HP7A 5CM2Z 4NZPA 2NNWB 2X8AA 3X1DA 3X1JA 3UJNA 4TMWA 5H8WA 1K7FB 3MJVA 4LAFA 3NAMA 3OTQA 3EULA 1K4KA 4G4GA 1BHJA 2XPCA 3C5EA 4IGEA 4CMKA 1C4XA 1M3SA 1TJYA 5JZOA 1R6TA 1Y1TA 1MB0A 2ORYA 1XHLA 1ZD8A 1NNUA 3WOVA 3BK2A 5A6SA 2QD3A 1L7MA 2CJWA 4EW2A 1TD9A 1PEYA 2F48A 3E5RA 3G5TA 3P2OA 2PD4A 4WESB 4JOCA 5CT6A 2XVXA 4HWRA 5KREA 1TIPA 3OTIA 1XCLA 3JVIA 3NOVA 1DTWA 1A5AB 4FFVA 4LYHA 1JNYA 4B8YA 4CMGA 3BCSA 3SVZA 4BIIA 1K9SA 1L1QA 1YDHA 1T1RA 3GBPA 3C7TA 1DAKA 2G9UA 3DG9A 1AQ6A 3IUBA 4HEQA 1OTXA 1P29A 1VDMA 1J39A 2PGLA 3UWPA 2ZBFA 3U4HA 1NR5A 1LPPA 1MBZA 4ND4A 2FR8A 4PLGA 3I3SR 3W6PA 3Q7QA 1U1EA 2D5AA 4HF7A 1N9GB 1OLXA 1Y1QA 3G23A 5CDYA 1J33A 2A9VA 3ZIDA 5FV4A 1B8NA 5JVDF 2XNDD 2AJBA 1ESDA 3FWKA 5JPDA 3MYYA 1TJ5A 2OCKA 1VE7A 4OSPA 5EJAA 5BV0A 5HFJA 5TGZA 1UAAA 3M7IA 4P3KA 1C8VB 3NVAA 4D9JA 1KP2A 5JXWA 1W88B 1T0UA 3N75A 3PVCA 2UUCB 1XTKA 2XUDA 2W8ZA 4LRYA 4D43A 2A8YA 4ZP1A 3U7QA 4BNHA 2W6QA 3W3AH 3Q6MA 2NU9A 4EJSA 2QMQA 4U4AA 4TTAA 2RHMA 1B8OA 1GSOA 3GI1A 1I6LA 3UAGA 2PLNA 5FPPA 1I4WA 2CXXA 2FA9A 2MYUA 2PN1A 2Q9AA 2W2QA 3MELA 1QG0A 3SZLA 1YZKA 3ZH9B 1RPZA 4XDZA 2R6CA 2ZBEA 3PI7A 3CPSA 3DV0B 3MERA 3U0VA 4YMGA 3UV3A 2Z3VA 2AFHE 3F0TA 1H85A 3E61A 2JLCA 3PKZA 4Q47A 5IBRA 1SUCA 2PQMA 3VX3A 3WGYA 3EPLA 4NCAA 3VC2A 4DJDC 2HQOA 1EE2A 5FUVA 3VPFA 3A11A 3E4DA 2VDPB 3JARB 4FZ5A 2VJCA 3FMGA 2L19A 5FT9A 1A4IA 1T10A 1FFWA 3QG1A 1XEWX 1TFUA 4F4UA 5DTEA 1V1RA 2FPPA 1S2NA 4GSKA 1U0OC 4RBNA 5NLLA 1FVHA 4CPDA 3U4IA 4EMTA 2PYZA 2J0EA 3QFFA 1MW9X 4A2PA 3VNBA 2J5QA 5LDGA 3AQ4A 1DKPA 2D7CA 5K01A 3PF8A 1TIBA 3SKYA 1W9MA 3VX4A 3T3NA 5LLDA 1R64A 1K92A 2E87A 1BX3A 5DX0A 1FNSA 3HRHA 3CHYA 1CLUA 3R24A 4F5DA 3OOWA 4WJLA 3QX3A 4XLZA 1XZPA 1GPAA 3HXOA 3J81k 2J45A 1E4EB 4KI7A 3T5PA 1JEYA 1QYXA 1OZHA 5DWVA 1J23A 1TNDA 1XA0A 4BQNA 2ZJ6A 3DBVO 3E9QA 1XNQB 4P4LA 5EWLA 4MS4B 5JBQA 4BVHA 2HRDA 2IXAA 2V0NA 2Z2JA 4LXQA 4MRAA 4EY3A 5CLJA 2PXAA 3GFFA 2QDKA 3DBLA 3GLVA 3EVAA 2VA8A 1N2GA 3SEAA 3TKAA 4I3HA 4AP9A 4RF3A 1G8JA 1X14A 6CHYA 5ICEA 5IC4A 4RY2A 5LL6P 2XT0A 3K4HA 3QUBA 1RPAA 3AR4A 1NLUA 5A4MS 3GT0A 4RD3A 1G21B 3QKUA 3HZHA 4NENB 5ARDA 1PEDA 4P31A 4BE9A 1H93A 3R41A 4ZOQI 1K5PA 2KQUA 3LQYA 3MAJA 3RFFA 4KSCA 1I1QB 3LY5A 4FSDA 3TN7A 5FBHA 4R1QA 1IDN1 4Z54A 3C45A 1KKLA 5FR2A 3ITNA 1DWUA 2P9GA 2QOEA 3AEKB 1X1EA 5A0VA 5AKXA 1I4EB 2GEDA 4EOGA 4ESOA 3EMVA 1L1FA 2WT8A 1FJGB 2P2YA 4QJBA 2W22A 2NO7A 1Y7TA 3WBFA 3OMLA 2B0JA 1D1QA 3K9GA 2IVZA 1KBQA 5EHGA 4AKIA 1YNOA 2V55B 2CN1A 2Q8NA 2XTJA 3EY4A 4RO0A 4W1SA 1R5BA 1DIGA 1UOPA 2HNKA 2J59A 1Z33A 3MQFA 2KWIA 4ROTA 4PX9A 3ZWVA 1IC6A 1FUKA 5D6NA 1SQ5A 2P4EA 1E6UA 1Y3BE 1WM1A 3CF2A 1PQYA 5ICMA 3RIYA 3NBAA 4JR1A 2CHVA 3WQRA 3EVBA 2QMEA 4QPPA 4UU0A 5CRIA 3WGGA 3S40A 1N2BA 2HF2A 4QDUA 1K6IA 3C48A 1CJVC 2HLDD 5CJPA 2AEFA 1C7EA 1JVSA 2OUIA 3FNEA 4FKBA 4FMCB 3BSSA 5F1YA 3NIWA 4OAOA 2GB4A 1OX6A 4D3DA 4N48A 5JCOA 4WLEA 1IBRA 3L3BA 4YRNA 3W77A 5A5FA 5DNYB 4TYNA 4BO3A 5IWAB 1AKTA 3KEOA 2J9GA 2NVUA 4PRLA 1Z9BA 4F7WA 5CFOA 3WL3A 3QM1A 2BISA 4J29A 1N2OA 1QH8A 1Z0ZA 4M0KA 4DQXA 2DETA 3IT1A 5A6SB 3GB9A 1EK6A 3DEYX 1OFIA 2WYWA 3VC7A 4QTTB 3OCYA 4PEVA 2CJWB 2DPYA 3LX6A 1Y82A 3L4SO 2R6GA 3G8YA 3TXYA 5JNRA 1YUNA 2D5CA 2R65A 2H5EA 2XBMA 1ZI6A 4JLPA 2X5XA 1DTWB 3H3FA 4C4AA 2VI5A 1SCJA 1E2IA 3PUWA 1JHXA 1SD1A 3LDHA 3HN2A 5JNLA 5FI3A 1WOYA 1B00A 2XF2A 1WHTB 2RE8A 3P71T 4Y2RA 5FWYA 3DE3X 1U4NA 2WFMA 4FW9A 4IUDS 3L43A 1ISGA 4C0BA 3VH3A 5I8WA 1NDHA 3C3PA 2B1JA 2Z2XA 5AKHA 4TKMA 4H1UA 1PJLA 4R7GA 5LKRA 1OLXB 3FHLA 4EUEA 4S0XA 1W30A 1K5GA 3FOWA 4YRRA 2OR3A 2AUTA 4H60A 5DK6A 1SBQA 1H4QA 3HPRA 3RTDA 1A3CA 2PXCA 4DEVA 4EHFA 3Q7SA 4F38A 5K0BA 3VOSA 2P75A 4ZT3A 4H7JA 5FA6A 5I5GA 2B61A 2HSEA 2XECA 3AEYA 3QLUC 4H4EA 2O7VA 4BO8A 1P61B 5CVJA 1ZJWA 2H0RA 1WL8A 2P6UA 4ZYTA 2Z2IA 3U7QB 2IEBA 4G1CA 4N3NA 1FMLA 2VS1A 3ZV7A 2NU9B 3ET4A 4EJSB 3AEZA 2BGMA 5E8RA 3C5HA 3WLRA 1DEAA 1ZGBA 2C5SA 2G0AA 1TZKA 4S24A 3ZY6A 2RHHA 3A3KA 2O2SA 1QO7A 1NRJB 4I08A 5A3VA 3GLQA 1O0BA 1C9DB 4M1WA 5BSHA 2OEPA 1K66A 3CE6A 2H9IA 1D2MA 2CLKB 3R0IA 2B6HA 4JJEA 3AEUA 2PT7A 5KTNA 4LF8B 1G2QA 2ZWPA 4OK6A 1KZ4A 3BZUA 3TJMA 3WKCA 1QTRA 4RXUA 1T5SA 5EOVA 2PZFA 3R7SA 4KE9A 4N7RA 3SYRA 5F64A 3UMMA 4AJHA 3A37A 4YWHA 4PLHA 3FWPA 5AMXA 2OGSA 2OY0A 3EF0A 3DXYA 1RM5A 4NIMA 3RFCA 2PRZA 2QRJA 3X1ZA 1SIWA 2YRWA 1ZJ6A 1CY0A 2P2DA 1IXKA 2G04A 4YRZA 1G5PA 2BI8A 3T5CA 1QK3A 2FJ0A 1V1RB 4FHEA 4RNCA 2FPPB 4BC0A 4A0HA 3OY7A 3MLAA 3ISJA 5FOQA 3OQMA 2C2GA 2PUJA 2ZRLA 5HPYB 2JLQA 3B9RA 3D6HA 2HMWA 2GK3A 3JQCA 4OQEA 4LPKA 5H3HA 4DLBA 5LDDC 2PJRA 3NOXA 5IUKC 4ZV7A 4ZU3A 1HXHA 1PS0A 4QGGA 1CF4A 2DT8A 2OPBA 4HB0A 1BYIA 1LSJA 4NMXB 4H31A 2H51A 3RS5A 4D45A 5C8ZA 1D7AA 3EVNA 4P3XA 1C30A 4QOIA 3UHOA 4AN0A 4C21A 2ILVA 3MOSA 2Q3CA 2FOIA 3BHIA 3KQTA 1QONA 3R5KA 4NFHA 2BD0A 4XSHA 3ZWPA 1J90A 1YCHA 2DPGA 3GOQA 3VO1A 4F1WA 3NIDB 5EWLB 1H8EA 2GZRA 1FP2A 3P32A 1Y4ZA 3Q8XB 3A9CA 1FMCA 3QVKA 2RHDA 5TVKA 1OZAA 1SVNA 4YMUA 3D8SA 3DBLB 4JLVA 1QFJA 3QUSA 2HT1A 5DYWA 3E9MA 3ZDYB 1H4SA 1VRCA 3BXPA 2JBAA 1YQTA 2C0QA 3DH0A 5CLGA 5DM1A 3HBFA 3TDMA 4FR0A 2QQEA 4Y2JA 5BQ5A 1Q7TA 2JDID 2P4HX 5L40A 1A9YA 5J2TF 4P81A 5B30A 2QTTA 3O8DA 3KVRA 1Y98A 3URMA 5ADWA 2O50A 4OGFA 4PZCA 3I04A 3AHGA 1I9CA 2QNBA 3VC1A 4A27A 1YS6A 1MU0A 1XWIA 4UCXA 4UM8B 1R8XA 1MJGM 2PFSA 2YXEA 3E3LA 4E70A 5IDXA 2I7XA 5K8VA 3O8LA 5EZ5A 4WCFC 2R60A 2WTBA 4C7OA 1JIKA 4A91A 1IQRA 4PPGA 5HZHA 1TKAA 2OHXA 2QUZA 3MHTA 4W82A 4H7FA 4QYIB 2IUSA 2A5YB 3EE6A 4PYMA 4ZCPA 4CKCA 2ZW9A 4MK4A 1X94A 5LYJA 1LCIA 3R8FA 4PG8A 2IEZA 1J1UA 1L5QA 2OL4A 2RONA 3H18A 4MW1A 1KDVA 3RIGA 4KPUA 2X6TA 4LDJA 1OFTA 1YJ5A 5DBIA 3FTCA 2AVNA 3ORFA 3WY9A 2HT6A 3UK2A 2TSYB 3QVJA 1X19A 3PPVA 3PR2B 4JBGA 3RAJA 2J3MA 1CZRA 3PL1A 2GXSA 4FMDB 5DNAA 5JZVA 3HYSA 1FTNA 3OE1A 3FZQA 3RDPA 3OETA 4OX9Y 1MC5A 4GMXA 1HO3A 1SBHA 3TG8A 4Q5IA 3IXLA 1Q95A 4YT2A 3PWKA 1KDZA 1J6UA 4KYVA 1W2GA 3MGAA 2NVUB 1T3GA 1HT0A 4D4IA 5MN5A 4B4OA 3BIWA 3EPRA 3OIVA 3TTYA 1QH8B 1IZ0A 2VYVD 2Z1DA 5JEDA 2QX4A 2ZWOA 3EC2A 1P7CA 2B1QA 1F8GA 1KC1A 2H7YA 2AMVA 2VUHB 2DMRA 2IEAA 4P82A 3WRXC 2QJRA 5CEEA 2XWJI 3OCXA 5JECA 1GAEO 4F5YA 3ZDDA 1U04A 2BAGA 4QDJA 3KOUA 1V1MA 3KQNA 3JALA 4UNQA 2QPTA 4ZO8A 4WOCA 2B20A 1G21E 4RJKA 1KJZA 2BE7A 2V4ZA 8MHTA 1FYEA 5FWYB 1J2EA 2QEQA 4UE6A 4BNIA 3UUEA 4KITB 3JZFA 5EUMA 4JJGA 5EHIA 2BZGA 2KMLA 3D02A 4UHJA 4A03A 1QJCA 4GYKA 4O4JA 3TLGA 4M8LA 3K2IA 4DAOA 1P4AA 4OG2A 5JXGA 2YVAA 4PPYA 2DFVA 4D42A 5CGZA 1U7WA 1N4AA 1QGYA 3I2GA 1I4OA 3JYHA 3REGA 5LB4A 3WGKA 2R6AA 1N0UA 2WICA 4PIMA 2OM2A 3GFQA 4AF7A 1JW9B 5JYBA 2H1CA 5LPNA 4UDNA 1ZNYA 4EGFA 1RC8A 3O4JA 3TQRA 4F92B 4HT3B 1CE8A 3C7KA 4FYJA 5H9VA 3OA2A 1JHRA 3ODPA 2XCUA 1ZD9A 4EGQA 5BSEA 1W49A 3FBTA 3IURA 4OJMX 1TQ8A 4U02A 2WPNA 4RGVA 4V03A 3MAGA 2AOXA 1RYYA 2WTXA 3HP4A 2VEDA 1EWVA 1W5BA 4K3VA 4KMOA 1DKRA 1ADGA 4DA0A 1POWA 3N8GA 3IEMA 3PS9A 2BTOA 4GSLA 4MEAA 1CD5A 1PK8A 4AVYA 1DZ3A 1KEWA 1RR6A 4LOIA 2C5AA 2BP7A 2IBTA 4QLBA 5M2QA 5CD9A 2QAIA 2H2HA 3GA5A 3FUWA 2WQ6A 1I7NA 2H1WA 2DB3A 2YWFA 3RTEA 5BORA 3I52A 3KQLA 5CP8A 4Y6RA 1OR8A 1STOA 2RJ3A 3IP6A 1IPEA 3AEUB 4DC9A 4CM5A 3VJLA 1I33A 1JZTA 2OV3A 3HWRA 5J43A 2JLYA 4YAIA 3UWSA 3DAPA 3QG5A 3Q15C 1F2TA 4FYKA 1K0FA 3KPVA 4LE0A 2JFOA 1RAIA 1RYMA 1EWQA 5GIOE 2GM3A 2DPHA 2IGTA 4FMCF 5THKA 1Z18A 2B8TA 1W36B 5JALA 1OAKA 2VHUA 5HW0A 2AH5A 4B3MB 4JL8A 2EWVA 3RVQA 3ZGXA 5L3QA 1CUJA 4JB8A 2B5WA 3IVAA 4IIGA 4RDXA 3RYCA 3ECSA 1TZMA 3E5NA 3KZCA 3IESA 2QKYA 1GCUA 2GVZC 3V2GA 4I6GA 2AMLA 4BTVA 4DQDA 3U44A 4UARA 2VLBA 2JRLA 2D1FA 3TIXB 3IHTA 4OM7A 3WK4A 1PZMA 3IUMA 1ES9A 1LVUA 3H2GA 2YTZA 4AJNA 4J7UA 2EEZA 2OMEA 3KKNA 3P19A 2EWWA 5FJJA 3WYNA 4RTSA 2IW1A 4B0PA 5BWCA 2VWPA 3CB4A 1L9KA 5AVUA 3MJCA 3H42B 4BVBA 2I5PO 3HGMA 2GA9A 3H6GA 1C30B 1KFCB 4YEDA 4S1WA 5KOJA 1RYBA 1NG1A 2I99A 5B12A 1CQZA 1RCUA 3GRUA 3TK1A 2GCGA 5T5QA 3U26A 3ZIUA 3QPAA 4JUFA 5K6RA 1D5WA 2JHFA 3BJRA 2IXGA 3Q8KA 3TSWA 3VPXA 1LB1B 4URUR 4KMMA 4XIGS 1KIFA 4ZAXA 3GPLA 1RRGA 1JT2A 2YMLA 1NBMD 4RGBA 5ALIA 4D9IA 3PHJA 3NC0C 2FX3A 4Q03A 4WKNA 3S5UA 2JBAB 3VDNB 4R40A 3ZEIA 4I14A 3BORA 3NDRA 4FNOA 5HP4A 4PE5B 1KMCA 2BM1A 2OCLA 1CDOA 4HEHA 4UNRA 2H6EA 2G77B 5BQOA 4P4GA 4EJ6A 3T0FA 4Z5XA 4B3XA 1E2UA 1DIBA 1T9AA 2YCBA 5LP1A 4WKOA 1E0AA 4KNYA 4C7OB 1AK2A 1HFJA 1CY4A 1ETUA 1U99A 3LVRE 4UEWA 5TPWA 4YCLA 5IH7A 3FPFA 4K5QA 3Q8WA 3FGZA 4DAEA 1MRSA 1NP7A 1H66A 3SF0A 3UHFA 4K0RA 2ZB8A 2O4UX 4X45A 3UGQA 5AM4A 4CKCB 5LYJB 1OLSA 4TVKA 2Z9BA 4L0MA 4Y18A 1DX9A 1OGIA 1U0JA 5B7PA 1IE3A 4KN9S 2Y3IA 4KPUB 5L7WA 4E4RA 3G2MA 3EOBI 3DZKA 5MDHA 2EVWX 2VR1A 2R6FA 2ZJZA 5E2IA 1GG2A 2OXEA 4L76A 1VA5A 4IOJA 4QSHA 5D1HA 4BNXA 3QOXA 5KB3A 3RS2A 2A9OA 4XVUA 2RI1A 2A5LA 4JY7A 2WJAA 1E3DA 2ZQZA 4BO2A 1VHQA 4CV1A 1JS1X 4JU8A 1Q6ZA 1XVTA 4U9IS 1GGVA 4J0JA 3H86A 5FWDA 4IIUA 2FN9A 1XR3A 4R3UC 3VZBA 1YB1A 4KE6A 2ZWVA 4DADA 3B2EA 5BV1A 4BKMA 3AVUA 1AKRA 1P72A 2JPDA 5LQCA 4JLAA 4Y6SA 4OKIA 3DS8A 1WG8A 5JJBA 4O3MA 3NP9A 4PQEA 3KZOA 3U9TA 1OYOA 1YDFA 3N2ZB 4BNFA 4F2WA 1L5NA 1W4RA 1YRWA 3OJWA 3H7AA 3DKKA 4HB2A 3C3WA 1HTWA 4M38A 4QVGA 1ZAKA 3PFIA 5IULC 1V1MB 1QUFA 3EGIA 3JALB 5JARA 1B6TA 1QVWA 4MUIA 2ANBA 4HQ0A 1SA0A 2NXJA 1G5RA 2POQX 4OP1A 2B34A 1DIRA 2PM8A 3QE0A 4JL5A 1BHQ1 4XQ9A 4D25A 3OOYA 2V3WA 4IIXA 4Q21A 2VPYA 4OGGA 3FGPA 3LGAA 5CT8A 4D9MA 3WK9A 4O4JB 3TLGB 3JCZA 3M70A 4DV4B 1R4AA 2OC4A 2QVGA 2QYTA 4LGVA 5A5DA 5JANA 5IC5A 3OZDA 4MIOA 4YCCA 3ZLJA 4CF3A 2FFJA 5LVAA 3NKVA 3U4GA 3HJFA 5P21A 3JYLA 1ECPA 1FY2A 4RY9A 1X2EA 1GPYA 1Q7EA 1VHLA 3WLHA 1Q83A 2EP5A 1CE8B 3Q85A 1KVSA 4HDQB 2R6R1 3KYJB 4KGZA 3ZNPA 1DO0A 1ZRMA 1ZKMA 3W4JA 3LO8A 3QW4B 3CB2A 3KKEA 5DPMA 1Z13A 2A9FA 1HOTA 2WWXA 2IYUA 4FE7A 2X4GA 3IPYA 4IDDA 1VSVA 2W11A 2NNLD 4GRAA 3KM0A 3N7AA 4X7RA 1S3IA 3HNRA 5TEVA 3TNFA 3WLMA 1OB5A 2IXFA 3F6CA 3OF2A 5HBGA 4BO7A 1XZGA 1GAXA 2BP7B 3A6DA 1UZNA 3ZZ0A 2CL6X 4LXYA 2VH2A 1S2DA 3H2ZA 3PG5A 2WWYA 4CMBA 3OM9A 2HF8A 5TEWA 3L7NA 4EG7A 1HE1C 1XNJA 3MPUA 1KSHA 4RVGA 1O9GA 1P5FA 1V5WA 3C6ZA 2J0UA 2ACKA 3PGKA 2XWQA 2QSJA 3S29A 1J97A 1JA9A 2GERA 4CDMA 1F2TB 3JATA 2C58A 4BPBA 1ISFA 4Q1VA 3M5WA 4C20A 2BHRA 4GMHA 3D3EA 4ZICA 3PR3A 2P9BA 3HUEA 5EZYA 1TLFA 2GRUA 2VA9A 4FMDF 4OSEA 3TR0A 2ZAGA 1PN3A 3MT0A 4TMKA 3CONA 2OOKA 4IDOA 3AF2A 3ZCQA 4IGKA 5ULLA 3WJ2A 5G1OA 4CFSA 3Q3IA 4ILEA 4ENUA 3FGNA 4Y6LA 5FOUA 3OTWA 3RYCB 4KDEA 4X92A 4RSHA 5CHEA 3HBJA 5IEBA 8LDHA 1R9NA 2REXB 2WIAA 2C07A 4CMEA 3KR1A 4INZA 3SYKA 1KAGA 1RI5A 3OZAA 1NBOA 4IIJA 2XGGA 5EZQA 1G20A 2WKRA 1JHVA 3HDHA 3NTLA 3RQIA 1ZGHA 2GN1A 4GR4A 5LXTA 3RSHA 1U9CA 2QDXA 5C7OO 1WDMA 1E3IA 2XCLA 3F8TA 3V48A 4Z7OB 1RHRA 1V7CA 2QRGA 1CDZA 3FOEC 1GOTA 2WK1A 4YHHB 2R8BA 2NT3A 3M6LA 5T41A 5I9MA 4FHGA 1Z7YA 1IVNA 2EHJA 3WBBA 2R79A 3EDOA 4G56A 3NEYA 3FVRA 5F3DA 5KOJB 5GMOA 2EXXA 1XRJA 2Y0EA 1PBTA 3F5QA 2HOQA 2O2CA 1AO0A 3GGCA 2F1OA 4ARBA 2IV7A 5IYZA 4HXEB 2IYTA 3L84A 4M0EA 4J9UE 1TU0A 4KV9A 4RD0A 1YFLA 3Q12A 3BXZA 5AK0A 3WL6A 5DHQA 2FPSA 5D01A 1Z4JA 5BN4A 1KDOA 2QV0A 2HY7A 2XB8A 4GOND 3RPEA 1ODSA 3GJ6A 4GGPA 1XQ9A 1CY8A 1GVHA 1QG2A 3GNTA 4JC4A 3SC4A 3U3ZA