4QBGB

Crystal structure of a stable adenylate kinase variant aklse4
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
217
structure length
217
Chain Sequence
MNIVLMGLPGAGKGTQAERIVAKYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSKSDCERGFLLDGFPRTVAQAEALEEILEEMGRKLEHVIHIEVRQEELMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQRADDNEETVAKRLEVNMKQMAPLLAFYDSKEVLRNVNGQQDMEKVFKDLRELLQGLAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Adenylate kinase
publication title Effectiveness and limitations of local structural entropy optimization in the thermal stabilization of mesophilic and thermophilic adenylate kinases
doi rcsb
source organism Bacillus subtilis
total genus 78
structure length 217
sequence length 217
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00406 ADK Adenylate kinase
B PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qbgB00
3I5YA 2WSSA 3GQBA 1OXXK 3NHBA 2VP0A 1M2OB 2HYDA 3B13B 4Z51A 3BAFA 3DHWC 4FINA 3DDCA 4IOJA 2EVWX 1M34E 4E22A 1E2KA 2OCPA 3RRYA 3TSZA 3LXRA 2QROA 4CYMA 5B58C 1DAKA 3SFZA 4EFMA 3BFVA 3F8TA 3Q85A 4UXJA 1GL7A 4DLYA 1ZNYA 4QHTA 2QTVB 3CBQA 1A4RA 3PUYA 5FOVA 1XU4A 1ZINA 1P2UA 2C95A 3MWKA 1OHHD 3MGCA 3F0TA 1T8TA 2G6BA 2W00A 1TAGA 2REBA 1SVSA 4BUJA 2FMXA 3GEIA 2YJTD 4BASA 4NYMR 4L5BA 4MKHA 2G1JA 2XTZA 3HU1A 4OQNA 2UVQA 2V8OA 1L4UA 4AYTA 4P4SB 2FPLA 1II0A 3TIFA 3GJ7A 1E9DA 2OM2A 4HLDA 1ZM2A 2BJVA 2ORIA 4HEJA 3BERA 3G0HA 2ZS9A 4PO1A 1Q12A 1R4AA 4LHZA 4BLSA 2V4ZA 2ZAOA 1YZTA 3FB4A 3M0EA 1XP8A 3KDSE 4M53A 1CR4A 4A9AA 3UKDA 5J5CA 1T91A 3RS2A 2OBMA 1CXZA 4Y0AA 1H8ED 2NO9A 5F9HA 1KO5A 1RIFA 2OILA 3SBEA 1SXJA 5C2JB 4XWAA 1D8TA 2ANCA 2G0TA 3CX7A 3BH6A 4JS0A 3TQFA 4BFTA 1M7HA 1DO2A 2ZJ5A 3TKLA 1G7CA 3G82C 4L8GA 2OLKA 3U61B 3PXGA 5KSOA 2FPKA 4M9ZA 2ZRNA 1G64A 2FFHA 4RSGA 1RRCA 1YU9A 2TMKA 1R5BA 1SVOA 1D9XA 1YR7A 4HAVA 4JKYA 5TV2A 2GXUA 8OHMA 3WBKA 2XEXA 4ACAA 1YR6A 2NO1A 4TMKA 1OH6A 3W8NA 2PL3A 1G3RA 1YVDA 2FSGA 2QENA 2RGEA 4QGAA 5J40A 1YHNA 1JB1A 1RRGA 3FKSA 4OKSA 1IJFA 1LF0A 5HZKA 4C9BA 1H65A 2WWXA 1N6OA 3B85A 4DCSA 2JJ2D 1E9FA 1GAJA 3ZVLA 2JIZA 4RD6A 3Q8XB 5KNBA 1KJWA 2ZI5A 2RGGA 3I8SA 1GRQA 3C41J 3IHWA 4TN1A 3GJ6A 5EP4A 5LB4A 3HYTA 4IFBA 2WAYA 1LV7A 2V1XA 3OZXA 5FL3A 1IXSB 5F3WB 4M4SA 4NMMA 4XH9B 1ZJ6A 5AJZA 4A2QA 3R9XA 2ANBA 4W7SA 4TYWA 1CF4A 2RCNA 4FMCF 2ERXA 2ZROA 1FNMA 4B3FX 2BKUA 5J4VA 2YC2C 5BW8A 1T5IA 2DB3A 2ZVPX 5BXQC 4DDVA 4BGDA 3KKQA 1W36D 3NEJA 3SQWA 1R6BX 1VKJA 4URWR 5HKKD 1IHUA 3MJHA 4D2IA 1NI3A 5ELXA 4B2PA 2ZJ2A 3UMSA 2DWPA 2ERYA 2NO7A 3NBFA 4CEHB 1NIJA 4W9MC 4NH0A 4DIEA 1H8HD 3SE0A 5FOSA 1UKVY 4HAZA 3TNFA 3HPRA 1I2MA 4CVNA 1NMZA 1ETUA 3FKQA 1QHNA 2C96A 1L8QA 1VG8A 4G5GA 2IYSA 4AKHA 1LS1A 1MABB 2BDTA 4M8NE 4MGZR 4TTQA 2VSOA 4A92A 1OXSC 4US0R 2GEVA 2CK3D 4KU4A 4LRWA 1ZP6A 3CRVA 1OB2A 2DBYA 1COWA 2B8WA 4MRPA 1S3SA 4A8JA 4Q48A 4R71A 4IEEA 2NIPA 2WOJA 3RS5A 1U98A 2ZRJA 5L3VA 4TYNA 5FTKA 4TMXA 5B2ZA 2GK7A 1VYVA 2B6HA 5FR2A 3VKHA 4NBSA 1Q1BA 2GVZC 2OXRA 3AM1A 2A5FA 2GEDA 4WOPA 5EXSA 1JBKA 2NO6A 2CLCX 821PA 2A5DA 4YMTA 2HCJB 2ZE7A 1E2JA 3X2SA 5D3MB 3CRQA 1Z0JA 2ZE5A 5J4YA 3Q9LA 4DLTA 4EFNA 2J46A 1UBCA 2F9LA 4G1UC 4DLVA 5LB2A 3LWNA 4ZO4A 2K5UA 3AKYA 3OEEA 5FR1A 1OPXA 3GFTA 1Z22A 4F7WA 1A82A 2VQSA 2ZANA 3RNLA 4EQ6B 2XOKA 2P3SA 1OT3A 1NN0A 3IPYA 2J5XA 2O8CA 1AKEA 4J0QA 1IAQA 1T4GA 1ZVQA 3AVOA 1D5CA 3GCGA 2QEQA 3M6AA 1Q1QA 2XZPA 4KBGA 1OH7A 4FMDF 2YYZA 4M21A 2QT0A 4YONB 3GLFE 2N42A 1AJEA 1CKEA 1UKZA 4KYIB 4G01B 1QHHA 1CR1A 1JQLB 3THOA 3B6EA 4EKDA 5BYKA 5F98A 1IM2A 4JVSB 2VL7A 2O8BB 2ODEA 5CIWA 1VCIA 1I4TD 3BXZA 4XWKA 2JLUA 1P6XA 1YZUA 2QMOA 1KZ7B 2GWHA 4LY6A 4B6EA 1XBTA 4ZCLA 1KSJA 4LJ8A 2ZVQX 2Q3FA 5H8WA 3AP1A 2GVDC 3GLGE 1DTSA 3W6NA 4LYHA 2GNOA 2ZUCA 4DDWA 2W6ID 1VMAA 4D81A 4AIIA 4JIMA 4MYUA 1G9XA 4X8OA 1Z2AA 1VIAA 1HT2E 3NH6A 3B1WA 4JBYA 2X2EA 5CLQA 3C8UA 1XMJA 3MLEA 2AKYA 3THYA 4MRNA 3KTAA 3U3MA 4E09A 3K0AA 1RRFA 3RS7A 4Q5IA 5FOWA 1IN8A 1VYUA 1KJZA 2EFGA 2KB0A 3PV0A 4JSYA 3GP8A 5FPYA 5JHHB 3VKWA 3DPUA 2R2AA 4V03A 3CR8A 4DXAA 5AUPB 4JSTA 4ZV4A 1JPJA 2XTMA 4KHZA 1UDWA 3B60A 2ZJ8A 2I1QA 1ONBA 1AZSC 3WRXC 2VP9A 3QIAA 1SKYB 1DG3A 3VNUA 2WM9B 3CX8A 4LYJA 3E2IA 2IHBA 1E96A 1TQ4A 3QKSB 1VDZA 3U7GA 3RABA 4WZBE 1IONA 5FTJA 1G19A 2A78A 4Q7KA 2FGJA 1US8A 5CK5A 4Q9JA 4TYYA 4RFVA 2HF8A 2FFQA 1XTQA 1MKYA 3QPVA 2VIIA 2IYWA 3DOEA 1EWQA 1ZU4A 5DN6A 1IBRA 2RMKA 2HEIA 2WSMA 1IOZA 4GT1A 4WA7A 2IYYA 5K8UA 2ZJBA 1E2LA 3QEJA 2F3RA 3TUIC 1Z6GA 1UM8A 4F4IA 5KNCA 3E70C 4NU0A 1F2TB 1XJ0A 4LV6A 4LBZA 1JEEA 1GP2A 2BCJQ 3OESA 5L3SB 3KQNA 2RB4A 3W6OA 1XPRA 5EP2A 3AF2A 2J1LA 2WKPA 2R65A 4KJZA 4B6FA 5A5GA 1VG1A 3A4NA 4PC7A 2QMHA 3ZLJA 5DLQC 4XSHA 1Z6YA 4V0MA 3SI7A 3BORA 4P32A 3N70A 2J87A 1CULC 2ZIAA 4KSCA 3U2QA 3F5FA 1NNEA 2GJSA 1Z83A 4L9SA 4XVUA 1OKKA 3HPQA 4JVLA 4RJLA 4PFSA 3EC1A 2FH5B 1KDTA 1KNXA 3AKCA 4GOKA 4IDNA 1TU3A 1HTWA 2ZRFA 4TYQA 2IK8A 1F2UA 2O52A 1PVOA 1AK2A 1VHLA 2BOVA 1N6PA 3QF4A 4AK9A 1KI1A 1DOAA 3U60B 3EPHA 1AKYA 3EX7C 1ZIOA 4PHTA 4FW9A 1QVAA 3WHLA 3H0KA 1NJGA 3QKRA 4GSYA 5FI1B 5J47A 3J81k 4LPKA 5C4GB 4C30A 4TSFA 3ZVNA 2GF9A 2EW1A 2HLDD 2QUZA 3UANA 3K70B 1D9ZA 3V00A 2G0NA 2NQ2C 1UFQA 2FFBA 4PO8A 4DSUA 2V1UA 4ZPXA 4EPTA 1OW3B 4D6PA 2Q3MA 5CLLA 3AF1A 3T1VA 4HYYA 1KSGA 4B73A 1F6BA 1X8JA 5HE8A 5DI3A 1ZUIA 4D0GA 3FWYA 3NBZC 4TLEA 1OXUA 2IYLD 4C2UA 2D06A 4C0KA 4C3ZA 1E9AA 3VHLB 3A1TA 1XTIA 1GL9B 2GZDA 2QRZA 3IO3A 3OE7D 1G291 1XMIA 1G6OA 1OHHA 1X1RA 3THWA 1U8YA 3PVSA 1ZM4A 2CE7A 3KX2A 1Q22A 3ND9A 2IXGA 3EAQA 4PAQA 1RC8A 1E2DA 2BBOA 1VECA 4C4PA 1AIPA 5CM9C 4URXR 2FDCA 3AVVA 4A36A 2D2EA 3LW8A 1QRAA 4HDCA 2KI5A 2CL7X 2GXQA 2WJHA 3JVVA 5IK2D 3CF2A 3Q7QA 3WYGA 1KI3A 3A1SA 3CF6R 4LX0A 3KQHA 3PIRA 2FZ4A 3ZVMA 3QI2A 2J0UA 2QBYB 2ZI7A 4AC9A 2AX4A 1G20E 1SGWA 5GADl 2CMKA 5DI9A 3S1AA 4B3BA 1Q3HA 5CYOA 4B47A 3LX8A 2J59A 3CRMA 1NIPA 2VHUA 3T1OA 3EIHA 3MCAA 1WP9A 2Q21A 3QENA 3SOPA 2AWOA 3BGWA 4XWOA 5EJEA 4KFUA 1UKEA 3VMFA 1S9HA 4OI4A 4LYAA 1IY2A 3IIJA 2XSZD 4S2EA 4OI0A 4NPHA 3VAAA 4QXAA 3KFVA 5SZJA 2O5VA 1E69A 1LNZA 3EASA 4LBVA 1FW6A 1GRNA 4EJSA 1T5LA 2FSIA 1J8YF 2J7PD 1AM4D 3P4XA 4FCVA 4JL8A 4DVGA 3K70C 1T8UA 3EARA 3HR7A 2CL0X 2WJYA 1QHSA 5HPYB 2W6JD 3EPLA 1KHTA 1GDDA 3LRPA 2ZRCA 4K46A 2ZR9A 1E99A 2ZRLA 4LHWA 4Q1BA 3K0FA 2WPDD 5HR5A 1NSTA 1P9RA 2ZAMA 4HZUB 3CWQA 4JL5A 2OBLA 3QVVA 1E3MA 1OJLA 4HLUC 1XPUA 1E1QA 3R8CA 3WNCA 5KPDA 4R2HA 1O3YA 4UKDA 4BFWA 3BH7A 3B1YA 2JASA 3FYHA 4Q9KA 3ND8A 1ZIPA 1TEXA 2IUTA 4GMXA 1XTJA 1SVKA 1Z0AA 2A30A 2WJIA 1KMHB 3FMPB 2ZUBA 3ZZ0A 1W1WA 2AD5A 4GRAA 4D26A 2OZEA 1F48A 2QP9X 4H1VA 3CH5A 3SJCA 2Y8EA 3FDIA 2Z4SA 4L9WA 3W5IA 1R0WA 3C5CA 2ONJA 4GFDA 4Q4JB 4ZIRA 3THXB 3FHOA 1W5SA 2JLQA 1Q57A 4RD0A 2AK3A 3RRNA 1G4UR 5CITA 3AVWA 4EPVA 4WXRA 4PQRA 5JHGB 3M1IA 1KYIA 4LWZA 2ZREA 3UATA 2ZSBA 1CR2A 2N1BA 2ZPTX 3D6TB 5DHFA 4AD8A 1PV4A 2WBLC 3PR1A 1Z6XA 4Q66C 5FBQB 4NYJQ 2CXXA 2F43B 1K5GA 2F1JA 721PA 4EPRA 2VHJA 3LD9A 2O8DB 5HKKA 4B71A 3I92A 3QKUA 1ZCBA 2IYUA 2SHKA 4TTRA 3ZQ6A 5JCZA 5JRZA 3GJ0A 4Y0VA 4NZYA 1YZKA 4AURA 1H8HA 2WJGA 3ICEA 3NHAA 4LV8B 1JAHA 1E9SA 4OHVA 4F93B 1NMYA 2ZETA 4MUBA 1BYUA 3DZDA 2XNDA 2QPAA 4K8OA 3I62A 3U5ZB 1XEFA 4PHGA 3MMPA 1G3MA 1FFHA 2GILA 1YRBA 4OBEA 1FUKA 2W0MA 4GOXA 2IL1A 4BFUA 1B23P 2DWOA 3RC3A 5L3RA 3X1XA 2C99A 2G3YA 3R7WB 4JLPA 5KTYA 2JLWA 3QXCA 4B44A 4D25A 1QVRA 1U9IC 1N2CE 3FE2A 1OFHA 1SKYE 1KI7A 3CRRA 4HUQB 4DSNA 1L4YA 5C1BA 1ZMXA 3V4RA 3DO6A 2MMCA 1DAHA 4FIDA 4M22A 2XXAB 3DKPA 3ADBA 2AL7A 3G5UA 3AV0B 5L3QA 3QPUA 5JWRA 1DELA 1T3HA 2RGNA 1E4YA 4MGIR 3CM0A 3ZVRA 1GG2A 5FBLB 3QXHA 1CJTC 3P20A 4OI1A 1RYHA 5KDDA 4X8LA 3BB3A 3VKGA 3U3KA 4X8HA 1E4VA 1RVDA 3A1UA 1U99A 4Q9LA 5GVRA 1SULA 4XD7A 2YOGA 4G3XA 1W46A 2WKQA 4RCYA 3KB1A 4QBHA 2WHXA 3D8BA 4C0JA 1NVVR 2H17A 4IW3B 5GVSA 2IC5A 2UZ3A 4NONA 4KYUA 4US1R 2IWRA 4KCGA 1DE0A 1PLJA 3ADDA 3LBNA 3LXXA 5J4KA 3CNOA 4DLZA 4RD2A 1MT0A 4Q1DA 1KGDA 4B32A 2QG6A 2RGDA 2VHQA 2QL6A 2RGXA 1P60A 5IRCD 3GLHA 1EFHA 1KO1A 1S9DA 1XCMA 5DGXA 1KOFA 3RWMB 5KDOA 2GZHA 4BQSA 5KHOC 2ZYVX 2ATVA 1MRNA 1OIXA 4CEIA 2IS2A 1E0AA 3Q3JB 3CB4A 1JPNA 3WNDA 4Q4AA 1AGRA 5B64A 4OHWA 3REGA 2XJ4A 1KDRA 4UXIA 1KY3A 1OYYA 2AHOA 3B9QA 3GLGB 1Q20A 2V6IA 2MSDB 2Q3HA 3HJNA 2ZJAA 1CJKC 1KZGB 3ZJYA 4MKIA 1Q1EA 1SXJB 4PPGA 2W2VA 1AS0A 4PSKA 1JR6A 1ZCAA 1E2PA 1II8A 4QKQA 5DO9A 5K8IA 5L8VA 2ZRIA 3SYNA 3IILA 3TQCA 4Q1FA 3PQCA 5KSPA 5C18A 2IYRA 1FUUA 2F9MA 4MQBA 2QTHA 1QHYA 4V0LA 4BEJA 121PA 2XNSA 3T12A 2V9PA 2JLVA 2NGRA 2JGNA 4WBSA 4TL8A 1W0JD 2AFHE 3AF3A 2R6GA 4KXFB 2IS4A 2C77A 4QJ4A 2NPFA 3K53A 2F6RA 2FE4A 3R9WA 1Q44A 1T0HB 4OQMA 1ZC4A 1NP6A 3JVUA 1JEDA 4QGGA 5TVKA 1EG7A 3LQQA 2XZOA 2AD1A 4CT5A 4GZMA 4O3MA 5JS8A 2WOOA 2JAQA 4JVMA 4PAOA 2VYFA 5CK4A 1CP2A 1U81A 3ZD7A 3CNLA 2ZRDA 5CIQA 1WBBA 2RH5A 2A2ZA 1FQJA 4DLSA 2C5LA 1U0HC 3A8TA 2VP2A 1P72A 4Q1CA 5FPSA 5IF9A 4TQ9A 4A6XA 2O8EA 2VRWA 2C03A 4MGKR 2D2FA 2HV8A 4O2LA 4ZI2A 1U94A 3ICQB 1WB9A 1WMSA 3KXKA 5KUTA 1GKUB 4HAXA 5DHAA 4BRUA 1AS2A 1GNPA 3PUXA 4JLNA 5TDHA 3W8RA 4LDJA 3WBJA 2R6CA 3DEFA 1VIYA 1N0VC 2DPXA 2VHCA 2OFXA 1QZXA 2OLJA 4I4LA 4LJ7A 4AKEA 3FVQA 4BFXA 1CEEA 5SZIA 3B8HA 1E1RA 2J9RA 2J0SA 1N3BA 3KUCA 3P27A 3L8YA 4QGHA 1DS6A 2ZU6A 1N0WA 5TXGA 2QN6A 1FP6A 3PENA 3R8FA 1IXRC 2W2XA 4ARZA 1RE0A 3LBIA 4KO8A 1E0JA 1YZNA 2VSXA 2YOHA 4GPTA 1JJ7A 3D3QA 3LH5A 1SXJC 4TYPA 3WRYC 4BZQA 4OQXA 2IUUA 5FBWB 1S3GA 3RS0A 5FTLA 1R7RA 2GCOA 2W0SA 4URVR 2ZYTX 4KBFA 4NYJR 2WICA 1XD8A 1WRBA 4GP6A 4N1AA 1HV8A 2HLDA 2ZRBA 1TUEA 4OL0A 1Z0KA 2GZAA 4NCNA 4D4LA 2ATXA 3PJRA 1U0JA 4DUGD 2ZE6A 1OFUX 1OB5A 4NDZA 2O0JA 2XAUA 1O87A 3KKMA 1KAGA 3LW7A 3FPAA 2E1RA 3IEVA 4MYHA 1ZYUA 4G5RA 3CKLA 5IDVA 3K70D 3CR7A 1YZGA 2WIAA 4JLKA 5CB6A 1J8MF 4ITRC 3W90A 4DT1A 1DPFA 1P73A 3Q72A 4CRWB 4PZZA 3OE7A 4XIGS 5CDFE 3GLIE 3B7GA 4OK5A 3ZQJA 4DSOA 1RJ9A 2JLSA 2O8CB 1JQJC 1G3IA 1P2SA 3OFNA 1W49A 1FZQA 2GXSA 3OIYA 1YKSA 5TB5A 3K0CA 3B1XA 1ZUNB 1J90A 2YNMA 2ZRAA 2QPOA 4I1OA 5E7MA 4DHEA 1QHHB 2IF0A 3BWDD 3L82B 4LC0A 1NY6A 1W0KD 3VX3A 1UADA 4MDEA 3QG5A 4PC3A 1W4RA 2BM0A 3FMIA 5FL7D 4DDTA 1VHTA 4IFEA 1KK3A 4RZ2A 1R5OA 5FTMA 1Y3AA 3MSXA 2BVNA 3SBDA 4XVQA 2CEAA 5AJYA 2P67A 1JR3E 4FN5A 1BH2A 2ZSAA 4DB2A 3EIEA 3LO5A 4RD3A 2H5EA 4DJTA 1XD2B 2QT1A 3OAAA 2MMGA 1KNQA 1ZRHA 1KDPA 4OJQA 4B2IA 2VH5R 3THYB 3A58B 2NO0A 2J7PA 1HUQA 3K0AB 2HXSA 3QE0A 3IBGA 4IOKA 1NSFA 3EW9A 2DCUA 3HR8A 3KFXA 1ESNA 4TMWA 2W6JA 3C14C 2WJVA 3O8BA 1TF2A 2H8KA 4QBFA 5AUNB 3IGFA 1JJVA 4FCTA 2BBTA 4PQFA 3U44A 3AKEA 4G0NA 1AQUA 1G1MA 4LC1A 1N6KA 5FBRB 3AP3A 4RCZA 4C0QC 4BRWA 3MWYW 4ZCMA 2DY1A 1MV5A 3IQWA 3MRSA 2QE7A 1CJMA 1J99A 2D62A 3K9NA 4FCWA 4ZDJA 5FBVB 1Z5ZA 1T9HA 3MAAC 3KJIA 3P32A 2GJAA 3ECCA 4HB2A 1UBEA 5KDLA 3ZYCA 3D7MA 3IHLA 3RRMA 3P1JA 4Z54A 2QORA 1XX6A 3GJ5A 3WMEA 1XMVA 3TAUA 4ASUD 1ZD8A 2AK2A 4KFRA 3RSLA 4M0LA 3WP0A 4AWXA 1NL3A 3IO5A 3TE6A 3VQTA 3WMGA 4JLMA 2A7QA 1Z06A 2FSFA 3EZ7A 1KI9A 2C9OA 4TMTA 3D31A 2B7CA 3GFPA 1E0SA 2GK6A 2QM8A 4JT4A 4KFTA 4Z1MA 3EWSA 4I81A 3B9PA 2DFTA 2OCYC 1SQ5A 4CIDA 4JT2A 5J4LA 2DFKB 1OFIA 2Z0MA 4M9SA 2ZS7A 4MRVA 4PSAA 4YC7A 4IDPA 3UPUA 4BLQA 3T34A 1IY1A 3AVPA 2IF2A 2FN4A 3KXLA 1NVXQ 2KSQA 2RKOA 4BFSA 3VU9A 2BIFA 4R2IA 2CHQA 3T06B 3N2IA 1HQYE 1Z29A 5FOXA 2OT3B 1YRAA 4QFMA 2OAQ1 2QP4A 4BLPA 1SXJE 4LV5B 5EE3A 5JRJA 4URUR 1X86B 1E2QA 1ELOA 1ZM9A 2CHVA 3O8RA 4Q1AA 3UWKA 1SVLA 1XCPA 2B21A 2YC4C 1BS1A 4PX9A 2PMDA 1GFIA 2BKEA 1QBKC 4O2RA 4RD1A 2ZSDA 3K9LA 1F2UB 4OHXA 2A3RA 3LNCA 1G17A 4D4JA 5JWOA 3KQLA 1V5WA 2ZRMA 3X1WA 2F55A 1W4AA 4KFSA 3TSWA 4XTCS 4QNRA 1ZUHA 4MITA 3T61A 4HB0A 4RZUA 2CCJA 2F1RA 2R6FA 3AUXA 2ZRGA 5HCIA 4A0GA 3GJ4A 1R2QA 4PC6A 4BZXA 4RVCA 2FF7A 4KITB 5FUYA 1GNQA 4ZCIA 1BIFA 3CZPA 1FMLA 2IX3A 5M04A 2IWHA 3UMRA 4R9UC 3LVQE 5KPJA 2DYKA 1E9BA 1PLKA 3LY5A 3RVBA 1NBMA 3C15C 1EX6A 1YR9A 2GCPA 4M1TA 1SHZA 1N5KA 3BJIC 1E2HA 2QM7A 4KLNA 1EFRD 3X1DA 3JZMA 4TL6A 3IBYA 3NBXX 4QJ3A 1NG1A 2V55B 2C9CA 1N6IA 2WSSD 1UAAA 1NKSA 1MO6A 2IYXA 4GP7A 5G3YA 2OESA 4B3XA 4LUCA 4YMVA 4OI2A 4UNSA 4RKFA 1XEWY 1XZPA 1KI4A 2WVJA 1AA9A 1XXHA 3DL0A 3Q7PA 1LVGA 1D2MA 2BCGY 3EZ6A 2RHDA 2P0EA 1E2MA 2E9SA 4TT3D 4TZ0A 1XTRA 4ZI3A 5A4JA 5SZHB 1YJ5A 1RFLA 5AJXA 4QBIA 1XJQA 2J3EA 2ZI9A 4DSTA 5JEEA 3B82A 3SYKA 2HJVA 3FMFA 3BIFA 1GL6A 3N2EA 2J0UB 1P2TA 1NLYA 3S1AB 4MDFA 5FPHA 3CO5A 4JLAA 3SEAA 3U3RA 3U3JA 4DEXA 3FOZA 1WE2A 2CCKA 1NJFA 1FMJA 1LTQA 1XWIA 2YWHA 1P4SA 1KI8A 3O47A 3VR2A 4LI0A 1J7KA 3WXMA 3FHCB 1K6MA 5IHPA 1N25A 2HUPA 4QC2A 1ZW6A 3QF7A 1S1MA 5FI0B 2QP3A 2REOA 1EGAA 2FEOA 1NVVQ 4PHHA 2VLIA 4EJSB 4RZ3A 1E98A 4DCNA 1HH4A 4M9QA 1KSFX 1QHGA 1E2GA 1I2DA 1Q3TA 4JYCA 2HF9A 1GWNA 2R6DA 2WWIA 3EXAA 5JS7A 4MH0R 4ABYA 2QMUA 4IDQA 2FSHA 1W0JA 1OLOA 1JALA 1P3JA 2FX3A 3NC1C 3QBTA 3O8DA 3OIUA 2CDNA 3K0FB 2BEJA 3C5HA 3V4FA 5E4FA 4UNRA 5B30A 3NG1A 1MR3F 2X2FA 3E5HA 4JYBA 3AQ4A 2GHIA 1EFCA 4LBWA 3X1ZA 2Z5FA 1FX0A 2J45A 1XFAA 1OFTA 1G3QA 3PFIA 4GMDA 4LJ6A 4TQAA 2B92A 3TW4A 2IYTA 4AG6A 3TJZA 4JLVA 5FPTA 3NXSA 2CJWA 1K5DA 5E7JA 5EE9A 1KAOA 4N0DA 1HQCA 4ESHA 1ZD1A 2D74A 5KO2A 3MG9A 3Q5DA 1HY3A 1X1SA 4BPBA 1NLFA 2GTPA 4P4TA 2CLDX 1LB1B 3U6KA 3AB3A 1IY0A 1MO4A 2VTKA 3I1FA 4F38A 4ZIRB 2R44A 4F91B 3BRWD 5EZ6B 5CM8B 5EXXA 2JIZD 1NG9A 1A2KC 1CBUA 1ODFA 3BOSA 4Q9HA 4QJ5A 2IEZA 1E0KA 3W34A 3HU2A 1N6LA 2HDNB 3B5JA 3LDAA 1UEIA 1FNNA 3EWAA 4PHFA 4OHZA 3X1YA 1FTNA 4DKXA 4C0HA 2WTUA 1KO7A 4ZKEA 1G8PA 1G7RA 1MRSA 1W2HA 4NE2A 1S8FA 4EIWA 3BBPA 1NLZA 5IT5A 4E03A 1KIMA 1TF5A 2D3WA 4H1UA 3BS4A 1TL7C 2AWNA 3TVTA 1G8GA 5JECA 1H8EA 2D7CA 2G83A 1AZTA 4Q4HA 4MUAA 3RS3A 3TR5A 1GIAA 2ECKA 5JMTA 2F1HA 4EJSC 4V0KA 4DLWA 4ZKDA 5DIFA 2ZSEA 4W5HA 1F3OA 1QF9A 3LLMA 5E95A 3H86A 3I72A 3TH5A 5BN4A 2PCJA 1Q21A 2GBLA 2B8TA 1HE8B 3T5GA 1ZM3A 3KJHA 4GOJA 4UXHA 2EFEB 2J0QA 3B78A 1P7CA 2GAAA 5D3QA 3TRFA 3K0SA 1UF9A 1VG9B 1G21E 3PCRB 1KTVA 1NKTA 3BD9A 1I4LD 4QM6A 1E6CA 3UG7A 3C4JA 2OFWA 5TARA 3IUYA 5L3QB 3TLXA 3AF0A 3CONA 2V6JA 4IDHA 4B3CA 2MSEB 2JJ2A 4IVQA 1UKYA 4OK3A 3KKNA 3MD0A 1N6NA 3QBVA 5JEDA 1XEXA 5HTKA 4I1VA 2VSFA 3KJEA 5KOYA 4FMCB 2Q0HA 5JBQA 4KVGA 3VFDA 4YXWD 5JZVA 5CJPA 1FPMA 1ZD9A 2CL6X 4FXPA 3ONWA 3T15A 5EUMA 3ZZUA 2V3CC 4HLUA 2W58A 3PUVA 1LS6A 4TTPA 2ZI6A 3GLIB 3KXIA 2KWIA 4QHSA 2FPMA 3OIWA 3PEVA 3WMFA 2NG1A 2A5JA 2RGAA 1NN3A 4UNPA 4V0ME 3M4YA 2ONKA 5EUQB 2Q9BA 5K8TA 2WKRA 2QNRA 2PMKA 1AN0A 1DVRA 4HUTA 5JFGA 4NCKA 2IEYA 2JJ1D 2P2LA 2EWVA 1XMSA 1QG4A 2ORVA 3GLHB 5C46F 2FEMA 3SQXA 1QDEA 1V43A 5BN5A 4TLAA 4CT4B 1PLLA 4CEIB 3KL4A 4MKFA 3A4LA 2AFIE 5EP1A 1G3UA 3WP1B 1G41A 3Q5EA 3ASZA 1RYFA 2ZXUA 2O0KA 3H1TA 2CK3A 1ZAKA 1NMXA 3RRZA 1Z63A 4IOLA 1E32A 2QMEA 1DADA 4XSGA 5JJIA 4Q02A 3NEYA 4KV9A 1KO8A 4LCBA 3CPEA 4A0HA 4ON9A 2ORWA 3U7HB 2WAXA 1CR0A 2YOFA 3AP2A 3K8YA 3KQKA 1II8B 3ZIAD 2O0HA 4FI3C 4KLZA 3WY9A 2CHGA 2EYQA 1N5LA 4JLBA 2RGNC 5JSZB 4Q19A 3UG6A 1C4OA 4URYR 2RHMA 2IYQA 2IBMA 2BBSA 3QVUA 3QJYA 4L16A 1SVWA 2QI9C 4ILEA 1U9IA 4U00A 4QRHA 3TUZC 3CRW1 2EYUA 4OYHA 3SJAA 1XPOA 4FMDB 2VEDA 3LFUA 4JL6A 1M7BA 4TL9A 4EAQA 3BC1A 2LKDA 2IYZA 3QPWA 2ZU0C 5EXTA 4R7ZA 1DAGA 2X77A 1VTKA 2A9KA 4PPFA 3HDTA 3KZ1E 2NOAA 1F60A 1M1YE 2NPIA 4HDQB 1GTVA 1NRJB 2JJ8A 1HE1C 4P0TA 1EK0A 5G40A 2H1LA 3FHTA 3REFA 2DFNA 1N5JA 4LHXA 3SZRA 2IW3A 2I1VB 2F3TA 3GJ8A 4A0FA 4QL3A 4WAUA 4A1FA 1BMFD 5C4MA 1FQKA 1GM5A 1GILA 2O8FA 3RSOA 2QSYA 3GEEA 5CYPA 2QAGA 3K09C 4BZPA 4WZ6A 4Q03A 2P6UA 4LJ4A 2P6RA 2C78A 2W6IA 4TWZA 3EZ2A 3TK1A 4C0LA 2DFLA 4MYCA 4Q9IA 1XJCA 4Q47A 4D0NA 1X8LA 2OXCA 2O8DA 2GF0A 2PLRA 2V7QD 1KI6A 3B1VA 2AKAB 1OIVA 4TL7A 4CEJA 3PEWA 2Q9CA 1EXMA 3W9YA 3O8CA 3U7FB 1M8PA 4GI7A 1NVUQ 1OYWA 3AUYA 2Z83A 1BKDR 1WA5A 2GCOB 2REXB 3UMFA 5DSZA 3LA6A 4YLGA 1Q1ZA 2CCGA 2QSZA 4F92B 3KJGA 5EE0A 1M6NA 1BOFA 4NYIR 3EZ9A 2BHRA 3I73A 4B33A 2CLSA 4LHVA 2XB2A 2FGKA 4DZZA 2XTNA 1GVNB 2XITA 4LOAA 1FTSA 3VX4A 1RZ3A 2QZ4A 2NZ8A 2FV8A 2WJJA 3EA5A 4JMPA 3DMDA 4Q4LA 1HT1E 1TUIA 3FMOB 4OHYA 2AXPA 3WNBA 4Z8XA 1KI2A 2VPPA 3IPXA 2YHSA 4CDGA 1R0YA 2F1IA 2FG5A 4TSFD 3EG5A 4TLCA 1EESA 3U6BA 2GKSA 2PZEA 3CLVA 3A1VA 2H16A 4IXMA 4DT1B 2WZQA 1G5TA 2VHTA 4PSVA 2Z43A 4QM7A 4RFSA 3NIBA 4Q18A 2J7KA 1EFUA 4C7OA 1RJ9B 2QGNA 3K0EA 521PA 4MRRA 4CF7A 5JJKA 3SC3A 1JXMA 1LY1A 3NH9A 4JBXA 3NC0C 4TT3A 4GL2A 1Y63A 5B57C 1E79D 2ZITA 2GXAA 1N5IA 3QXXA 1R10A 3UK6A 1GITA 1YE8A 3QSYA 1DARA 3I4LA 3I3SR 1VG0B 2OUKA 2GEUA 4JJKA 4BLOA 1CJVC 4YMUA 2GJKA 4OQLA 1KKLA 4BWYA 3AEZA 2VA8A 3GLFA 1XNJA 3P4YA 1W47A 4A15A 4JVNA 3NDPA 1CIPA 3SFVA 3RANA 3MJRA 1UPTA 1R8QA 4G5SA 1UJ2A 2PZGA 3CIOA 2C98A 4BFYA 3R9IA 2ZE8A 3AVXA 4MA4A 2XB4A 4A8JB 4JZKA 1XDBA 1QG2A 3GLGA 3U4QA 4ERNA 3GMTA 5EE1A 1GOTA 2BBWA 4IHQA 3LAWA 4A4DA 2FZLA 4C0SA 4B3DA 3NWJA 1Z6TA 4ESVA 4WVFA 3FFAA 3IKJA 1PUIA 3ZGXA 4M1SA 3U44B 2XZLA 3A4MA 2JA1A 1Z28A 4IJMA 3TUJC 1IQPA 5H1YA 4KI0A 1RPZA 1D2EA 2FOLA 1TEVA 2YV5A 4YMSA 2FA9A 3PEYA 2EFHB 2KBEA 4HAWA 3DMNA 2ODWA 3NKVA 3C7KA 1D6JA 1G5PA 2FJUA 3SJBA 5GJCA 4GNKA 2JLXA 1Z2CA 1NF3A 1W4CA 4NHOA 2CNWD 2JEOA 4DCTA 2IS6A 1CU1A 2D4HA 4UJ3A 4UNNA 5AUOB 4M2LA 1A1VA 1Z0FA 3SS8A 2A5GA 1OSNA 2P5SA 2EWWA 1OXTA 1I4DD 1E1QD 3K0CC 4GBMA 1GKYA 3TBKA 3UIEA 3L8ZA 2R62A 4ACBA 3H4MA 3JZAA 5AJWA 6Q21A 5IK2A 3GLHE 1HYQA 5BN3A 3OEHD 4D4KA 5JCPA 5F2EA 3AVUA 1TTTA 2KBFA 3I5XA 4US2R 2HJGA 4HDOB 2GA8A 1FP7A 2OCAA 2IT1A 1PUJA 1Z0DA 1IXZA 3OHMA 3T35A 4B35A 1TQ6A 5AJVB 2JLRA 3RS4A 4QBGB 4A2PA 4V02A 5EE5B 4PC2A 1JXOA 2WWFA 4P4SA 3WYFA 1CRQA 1SZPA 1Z6AA 221PA 4HI0E 4RZXA 3VU9B 4E5UA 4EUNA 4ZDKA 1VCMA 1E9EA 2XSZA 1RW4A 2EU8A 2OO7A 4PZYA 4DB4A 4A0RA 3FGNA 1ZNZA 3RLFA 4A8JC 2ZS8A 4D80A 1W48A 1ZM7A 1AQYA 1UDXA 1A7JA 3EIQA 3KTAB 1A5TA 3QOFA 4WXPA 2QQ0A 1C1YA 4HSEA 2JLZA 1D2NA 4L15A 3TAHA 3N5CA 1RRPA 1Z07A 2WWYA 1B0UA 1BO6A 2GJ8A 5HE9A 3BFXA 1OV4A 1U0LA 2XNDD 3PG5A 1TQ2A 2GCNA 1OH5A 2WPDA 3BH0A 2WV9A 1IN5A 4V0NA 2QU8A 2G9NA 1EFTA 2ZYUX 5GJVC 4URZR 4MKGA 4U5XA 1KSHA 2F7SA 2NZJA 2PT7A 4AYWA 3TGPA 3AGQA 2W2TA 3PUZA 1HURA 5FH9A 3A6PC 4MGYR 3W6PA 4S35A 2OE2A 4Q7LA 1JNYA 4B43A 5TMPA 2EFDB 4DLXA 2LWIA 4KSBA 3AVTA 5AK0A 1T3LA 4B74A 4Q1EA 1US8B 4XVRA 5FFMA 1XF9A 3BK7A 2BWJA 3DVLA 4BFVA 3H84A 1SVMA 2WWGA 3SDZA 4YXWA 4IVPA 2QTFA 3CX6A 4UQOA 4I1SA 4PR0A 4U7DA 2HYIC 1MH1A 1CTQA 3IIKA 4ZDWA 4IOMA 3UXMA 1X3SA 1E9CA 2JDID 2J41A 3AH8A 1XXHB 1NN5A 4N3NA 1T6NA 4D0LB 5LDDC 5DE3A 1YR8A 1A2BA 4DCUA 1DAEA 4XD7D 4YDHB 5KYKA 2JJ1A 4Q21A 3C16C 4Q7MB 2OFOA 3K9GA 1R5NA 4D4MA 3SHWA 1L7VC 3VNVA 1Z08A 2IUSA 3GJXC 4YQFA 1QHXA 1MO3A 3FTQA 1TF7A 1KMQA 3AGPA 3U3OA 4CZ2A 2G1KA 4TQUS 2AXNA 2GJ9A 1NN1A 3VR6A 4LPSA 1MOZA 3QY0A 3IEUA 3A37A 3QQ5A 4LSGA 4B75A 3RHFA 1T3SA 4CEHA 4AY2A 4QG7A 4NL4H 2R9VA 3QXSA 2BEKA 3KKPA 4IRUB 4QGFA 2Z6VA 4AKGA 4M1YA 4BECA 2ZYWX 3PITA 4JKIA 5DNYB 3CF0A 1OIWA 2OCBA 3QF4B 1U8AA 3IDQA 1IN7A 1MABA 1LFDB 4DEYA 4LJAA 2HCBA 3WHKA 3QKRB 4HZIA 1DAFA 3SNHA 3ZIAA 1XD2A 2GETA 3ZS9A 1OF1A 2CE2X 4Q00A 2BMEA 4NTZA 4JBWA 4HAYA 1JR3D 2G88A 2ZRKA 1P2VA 1SKQA 4NCIA 3RDPA 3CPJB 2GRJA 3IQXA 4PXAA 1CRPA 4BEBA 5GJWC 3EA0A 4PQYA 2RGBA 1NY5A 4IKEA 5DYGA 5D3MA 4M9XA 5DI3B 1T0JB 1GUAA 5FOUA 4A6PA 4P33A 1UBFA 3HU3A 2IXFA 1AS3A 1FX0B 4KODA 2QGZA 3I8XA 4LHYA 4N0EA 1DAIA 1E94E 2CJWB 1S0UA 4FD2A 3THWB 1RKBA 2QRNA 5KSYA 4OK6A 4EQ6A 2ZRHA 1Z8FA 2BM1A 2FU5C 2YWFA 2GDJA 4G5QA 3DM5A 3WYAA 3TMKA 1BMFA 2RGCA 2PBRA 1WCV1 2ZEJA 3HP1A 2OAP1 5BQ5A 3BE4A 3GEHA 4H9GA 3DM9B 4GDFA 4W5WA 3V9PA 1W2GA 3NBYC 4YMWA 3AVQA 3CW2A 4AG5A 2CVFA 5K8LA 2O8BA 2YWGA 1GKIA 4IDOA 1KK1A 1LW7A 3TR0A 2D7DA 3VR4A 4EPWA 1FOEB 2ZTSA 1TMKA 3OIVA 2C04A 4DRZA 3KQUA 3RC8A 4PAMA 4HB4A 1YZQA 2ZRPA 4JLJA 2NTYC 2V7QA 5E3HA 5LBIA 1E2IA 4G5OA 3W5JA 1P61B 1G7TA 2VP5A 2VP6A 3DZ8A 4C0BA 4DBLC 1Z3IX 2Q6TA 4CGZA 2ZJZA 4U02A 4Q4HB 3PEUA 1PJRA 1J2JA 5TY0A 4BE7B 5A0FA 1U2RA 1Q0UA 3SHFA 1E1RD 3SU8A 3VR3A 5FUXA 5H68A 5JI2E 2WWWA 4QOSA 4PPNA 4RD4A 5SZKB 1SHKA 3ETLA 4D82A 1W7AA 3P26A 2EFCB 3RWOA 2Q9AA 4OQFA 1XTSA 1R0ZA 2R8RA 3VR5A 1KK0A 2AN9A 3RAPR 5LD2B 3ZD6A 1SXJD 4AYXA 2FFAA 1IJEA 3DKVA 1Z47A 3CH4B 2KJQA 5JJLA 1G4AE 4WZAE 5CB8A 1S4QA 3H2YA 4LBYA 1VCNA 4XJXA 3NDBB 1N6HA 1OE0A 2XJ9A 3L2OB 4B3GA 2XGJA 4MRSA 2Z4RA 3VR1A 2IA5A 4PC1A 2JLYA 2DWQA 5DISB 5FTNA 2VBCA 2R6AA 4LZZA 4NKRA 1U8ZA 4EPXA 3QKSA 4NCJA 1ZNWA 1XEXB 3K1JA 3GPLA 4LJ5A 4QHYA 2J0VA 5HZHA 2ASEA 2IS1A 3HYRA 5JWHA 5AR1A 1SVIA 3FKSD 2P6NA 4BFZA 3LX5A 4R98A 1ZNXA 1JECA 1ZC3A 2CBZA 4YDSA 4KAXA 1E79A 1L2TA 1XRJA 2X1VA 4GZLA 4DC9A 1P75A 2V54A 1P9NA 1XB2A 2JCSA 4LK2A 2PX0A 1F2TA 5L3SA 1W36B 5AUQA 1C9KA 4LJ9A 1E2NA 4Z8YA 5BYJA 4NYIQ 5KNDA 2GAOA 2ZJYA 4JJZA 3NVAA 2ZJOA 3OFND 3QXJA 4LYFA 1VPLA 5G3ZA 3K9HA 5UKDA 4JLOA 1S1CA 1TX4B 4HATA 2H18A 1X8KA 1EX7A 5DH9A 2PH1A 5J4HA 1GNRA 4Q7JB 2UZIR 2LKCA 1HA3A 3AKDA 4JLDA 3DOFA 5JI3E 3QNUA 3W3AA 1G18A 3L0OA 1G5RA 4TLBA 3L0PA 1P9WA 2I3BA 2GBLC 3OF5A 5LD2C 3ASYA 3BFKA 3L0IB 4V0OA 1G8YA 4A2WA 4PO9A 2DR3A 1II9A 5G53C 3ZH9B 1E2FA 1NVWQ 2BMFA 3B2EA 3ZDQA 5FPKA 4A82A 3E1SA 4L4UA 1IN6A 3SYLA 2X8AA 4B34A 1K8RA 4DWJA 4NP6A 1YQTA 3VTKA 4DUGA 2PZFA 1R0XA 4P4UA 3MUFA 1R8SA 1COWD 3OAAD 2VF7A 1DAMA 1WDTA 2WMNB 2PT5A 3AF4A 5FOTA 3F3YA 1E2EA 1NBME 3GD7A 2YWEA 3QUSA 5HCNA 5EP3A 2N46A 1UBGA 5G41A 1J70A 1S2MA 2ZR7A 3EC2A 4B76A 3BB4A 3A36A 1F5NA 2PEYA 3VHXA 2P65A 1Z0IA 1TU4A 3LVRE 1DO0A 2YVUA 3CWZA 1OXVA 2WWHA 2CNWA 3I32A 4NYMQ 3EPJA 1KO4A 1W44A 2WMOB 2VF8A 4IEIA 4IXNA 2X19A 5FUWA 2QAJA 3T1QA 1XXHE 2IXEA 1XCGB 2IYVA 1VCOA 2QE7D 3QG1A 2OV2A 4C2TA 3OEED 1E9RA 2P5TB 3HWSA 2HT6A 4DLUA 4EPYA 4I99A 4WW0A 4HLQB 3A1WA 1W36C 1G16A 2OBNA 3OEHA 2PCLA 2PJRA 1G8HA 2GESA 2XOKD 2H57A 5BWMA 1TPZA 1W0KA 1CS4C 2OSBA 5EQTA 1G7SA 4P31A 3B1ZA 4UJ5A 5FL7A 3IIMA 2O8FB 4P3YA 1WQ1R 5FUVA 4DIDA 3T1TA 1XTKA 2QAGB 4TLDA 2HT1A 1VYTA 4UNQA 4XTRA 3PUWA 3W3ZB 1UEJA 4Z1MD 3UWOA 4Q4AB 3EPKA 4RY2A 2YINC 3MWLA 5GJBA 3LV8A 2YZ2A 2QBYA 4MYTA 4Q01A 4FWIB 1G8FA 2OG2A 3LQRA 1EWRA 1KI6B 1KK2A 1BYIA 3QEOA 5H70A 2LCFA 4I1UA 4CEJB 1ANKA 4M1OA 1GSIA 2ZM5A 4AKIA 3FFBA 1M74A 3QKTA 2FNAA 5JLJA 2YKGA 2BC9A 3CNNA 2ZR0A 3SJZA 4O0MA 4F4JA 4EFLA 4EDHA 3CPHA 3MFYA 1P62B 4CW7A 3KKOA 2JATA 1XEWX 4C0AC 3ADCA 3SR0A 1JI0A 1G6HA 4PANA 2ODBA 5F9FA 2OHFA 5AWFC 1WBDA 3L0SA 2ZSFA 3RYTC 1TQDA 1DBSA 4ZDIA 2ZUDA 2QQEA 1P5ZB 3CZQA 5KSZA 1MO5A 5ANRB 2CVHA 421PA 1KJYA 2AR7A 5EXPA 4AI6A 5EZ5A 4PZLA 2PJZA 4HB3A 3GJ3A 2MSCB 4ASUA 3BB1A 1ZU5A 4HZUA 1PZNA 2VP4A 1QHIA 1GZSA 4B2LA 2H7VA 4F4CA 4DCVA 2C8VA 2EQBA 4HLCA 3SN6A 1KDOA 2HXYA 3LBHA 2VO1A 1DEKA 4W5JA 5LPNA 3MWJA 1U90A 2OEPA 4PPQA 2W83A 1DG1G 1WXQA 1XD9A 1KMHA 1YZLA 5E7IA 2PX3A 4E07A 2QPTA 2JDIA 2E87A 2I4IA 4RFSB 4C7OB 4B48A 2O8EB 1NBMD 2QA5A 2BJWA 4FWTA 5DN6D 3CUEF 3NTUA 1JAIA 4Q4JA 3T5DA 1GRRA 2QAGC 3U7EB 3THXA 1LF5A 5CDFA 4DLRA 621PA 3GLIA 2DHRA 4TZ6A 3L43A 4NCHA 1W4BA 5CJ2A 2PLFA 2KE5A 2F43A 2G77B 2ZQ5A 3TW8B 1HEIA 2B7BA 4FMBB 3AVYA 1WF3A 1IN4A 4LJYA 2ODNA 3GLFB 4ARZB 1M7GA 3KUDA 4QNMA 3R20A 1AGPA 2BMDA 3KB2A 4PTLA 2UKDA 3ADKA 3ZS8A 4O25A 3K09A 5KU1A 4XOIA 4BLTA 4TMZA 1OH8A 3LLUA 1N6RA 3TVDA 3TSOA 3I61A 4LGMA 1OKKD 2QY9A 2NMVA 2PEZA 4POAA 1FL9A 2WIBA 1KKMA 4OJKA 1S96A 1TNDA 4X8MA 5DYIA 4K81B 3U4QB 3R7WA 2A5YB 1CLUA 2C2HA 3ZZTA 4IVRA 4BLRA 2FWRA 2L0XA 1ESMA 2ZI3A 1XZQA 1X6VA 2H92A 2ZI4A 3EZFA 1CJUC 1JR3A 2RAPA 2XX3A 1ZBDA 4DDUA 4KVAA 4M1KA 2IHYA 4M1WA 4TMVA 4WIAA 1TADA 2BV3A 4HUQA 4HAUA 4RKEA 4M1MA 1KY2A 2BMJA 4II7A 1W5TA 2XXAA 5P21A 1N0UA 1EFRA 3GFOA 5JSZA 2C9YA
chains in the Genus database with same CATH superfamily
1AHIA 2WSSA 3IXLA 3NHBA 3PSAA 4RTQA 1EUQA 1A4IA 4HRXA 2HYDA 2OD2A 4EI8A 3ONDA 1A97A 2IYEA 2XIJA 3T3OA 2EVWX 4FKBA 1N9ZA 1E2KA 4YQEA 3STHA 3TDNA 3LXRA 4MW9A 3D0QA 4DCCA 1OGYA 2BMAA 1DAKA 3LP6A 1LK5A 3WGOA 2UXBB 3F8TA 5M29A 1ZNYA 4N54A 3UXYA 1T0UA 2QTVB 4ZAWA 5FOVA 1QB7A 3NV9A 1U7PA 3EFOA 1Q74A 2V7WA 1O94C 3G59A 1YC2A 3EVBA 3IJRA 2TRSB 2WIDA 3I5MA 1WM1A 1NASA 1DPGA 1OHHD 5DOVA 1YIOA 5BW4A 2OUIA 3GLTA 2G6BA 3DC2A 2REBA 3BIXA 3OUZA 3WFIA 1SVSA 4RQUA 4K6FA 2WR8A 5IC5A 3EQ8A 3PXBA 4YRJA 3I9LA 4BUJA 4BY9E 2ZSJA 4MKHA 1H5NA 1UBJS 2HD4A 2XTZA 3HU1A 1QIIA 2A0XA 3IPLA 4IMRA 4RK0A 4BGEA 2HBZA 5IUNC 2ZR8A 4HDSB 4Q9NA 1WWKA 4AYTA 3OLZA 4P4SB 5IS2A 2AW5A 1H2ZA 4OHFA 3NGLA 1JEYB 5AIAA 2OM2A 1ZM2A 1E18A 3G0GA 2OGSA 4O1MA 1FUEA 4QPDA 3N39C 4TRMA 5HFAA 3BXHA 1I7QB 2O06A 2ZS9A 2XCSB 2P35A 2NYRA 5EIFA 3RWBA 3WA7A 3M0EA 3VDNB 1FU4A 2HSEA 3CLTC 3RYFB 1QUEA 4KXMA 3OOWA 1V8PA 4R7GA 3BDIA 3PPXA 3JATA 1UMBB 1H8ED 4M86A 4CJXA 1LC3A 4IV8A 4BCDA 1JE0A 2O57A 2X3UA 3D3EA 3LHFA 4N5IX 3SBEA 4YYZA 1ITZA 3K96A 2BTEA 3V8PA 3CX7A 3IX7A 3CZRA 3C3PA 4JS0A 3G8AA 1A1SA 2WE7A 2HIGA 4L4YA 4HNTA 1ODSA 2OLKA 1QCZA 3IKMB 4WEQA 5K2MA 1KVQA 2CXTA 3F6SA 2QD3A 3AY3A 3MCWA 1EXDA 4J03A 4B7XA 2FFHA 3E9DA 4N7BA 5AI9A 3DLAA 2A88A 4CWAA 4ENSA 4PPYA 1NONA 2L19A 4H7KA 4E15A 3FZYA 1WZIA 4JKYA 4X94A 5TV2A 1ZX1A 1NP3A 3WBKA 2XEXA 5F35A 1YS6A 1NDHA 2JBAB 1RQNA 2WYIA 3GYBA 4G4IA 4TMKA 1DIGA 3W8NA 1YVDA 2GD0A 3AT1A 5D7BA 2AQ8A 1JB1A 1IE3A 2YJ4A 3I8OA 3H2GA 4D42A 5L4NA 1IJFA 2CDCA 4R1UA 1N6OA 3B85A 3OKPA 2HWUA 4MQUA 1CHNA 3ZVLA 4C2AA 2JI9A 3D2BA 3L5KA 3Q8XB 4IS2A 4RF4A 5JMOA 3CEMA 1J1UA 2Q6VA 4HN9A 5K0FA 4TN1A 2AW3A 5LP6A 5EP4A 3EMKA 1CG6A 1F20A 2OYCA 3SXUB 2BZ0A 4UAUA 5DM2A 4EA8A 3STXA 5K3OA 3MUOA 4DR2B 1UZAA 5SICE 1EXNA 3O26A 4B3SB 5AJZA 1NVBA 3HZRA 1GVHA 4IGFA 1FMFA 2ANBA 2J32A 1Q91A 4W7SA 3VI4B 3BWEA 5CFRA 1PVDA 5HQ3A 4P0PB 4FMCF 4MP6A 2ERXA 4GMFA 4OL9A 2ZROA 4EG7A 1LJLA 1ZH8A 5J4VA 3BCUA 2YC2C 4R8VA 1E6MA 2FW9A 1T5IA 1KQFA 2ZVPX 4XB1A 1FS4A 4DDVA 4BGDA 4ZHQA 2O3JA 3KOUA 5FD8A 4YPVA 3IXMA 2H4XA 3OM0A 1JKJB 1VKJA 4KQMA 1FLDA 4NULA 4URWR 5DNEA 3HJFA 2FP4A 4B2PA 2ZJ2A 1LH0A 3H9JA 4QDOA 2ERYA 5LXTA 4L57A 5AM1A 3D6JA 2RG1A 3EBOA 4WFIA 2CNOA 4UM7A 3UB3A 1A9TA 4NH0A 4NNJA 5LIRA 2BFDA 3RARA 1AGXA 1UKVY 4CVNA 1G8AA 1I2MA 1NMZA 1ETUA 2FPXA 2KM1A 1QV9A 1QHNA 3FKQA 1SCQA 1VG8A 4GWLA 4HNGA 4RACA 4IUYA 4RPCA 3AC0A 4CM6A 1G20B 4KKXB 4KO3S 2D5LA 3ZHXA 2RC5A 3F9RA 3RROA 5B3KA 3FRJA 1DTEA 3TB6A 3LUDA 3DZFA 4HGRA 1C3VA 3AHFA 1DQNA 5C7YA 1OB2A 3G2IA 2ACKA 4FDAA 4MRPA 2LXNA 1S3SA 2IX9A 4Q48A 5EEHA 3MCVA 2WTAA 4RHTA 1KYYA 4TMXA 3U56A 1VYVA 2FWMX 1FFSA 2B6HA 4GDMA 5F73A 3D6HA 3IA2A 2ZYDA 4FZVA 1SHJA 3AM1A 2GEDA 1XELA 4NIMA 5EXSA 3WWOA 1JBKA 3HSYA 2DQSA 821PA 2V98A 3I1IA 3RVNA 1YHYA 3AW9A 4CU2A 5HJ7A 2HCJB 4CQMA 5CA1B 2ZE7A 2PL1A 1E2JA 3RC9A 5ES4B 5D3MB 3CRQA 1EWVA 5GIOE 3EHDA 5CXQA 4B31A 4HNUA 1XO1A 5J4YA 1RBQA 2HCRA 1KYXA 4EFNA 9LDBA 3DDWA 3L4EA 4DLVA 1E3LA 4JA2A 3GG2A 3LWNA 3NHMA 5LB2A 2VQFB 2GPBA 3AL0C 1KGSA 3GFTA 3NWOA 4F7WA 1VB5A 1YQEA 4V3CA 1DUVG 1Y4SA 5IVDA 3VO9A 4EHAA 3R77A 3RNLA 2B0JA 4HYTA 3OTHA 3PFGA 2XOKA 4WH0A 4GAEA 2QD4A 2B82A 5DBEX 1AKEA 1JDBB 3DBLA 2PD4A 2HJSA 2GBCA 1ZVQA 2XTAA 4MQEA 1EDDA 2HWYA 3H3JA 4JASB 3M6AA 4KBGA 2YYZA 1NPYA 4YONB 4CLRB 1CEXA 5C81A 5LWQA 4N5NA 1CKEA 4KYIB 1H1DA 1CR1A 2G04A 4NCXA 4PO3X 4EKDA 5JW6A 3EQZA 3QUQA 3HRKA 4JP5A 1FNCA 1QE3A 4L4ZA 2JLUA 3BMNB 3HUDA 1YZUA 5CDGA 3X3HA 5FAXA 1NBIA 1KZ7B 2GWHA 4LY6A 5EJ2A 5SY4A 3KQOA 4KIJA 4PVCA 2EGGA 3WG9A 4B6EA 3OCZA 2AR0A 5H8WA 1I7DA 3UGJA 4RKQA 1ATZA 2E55A 1SRRA 3A31A 5FV4A 1D09A 2ZUCA 2W6ID 4Q6BA 4IF6A 4EHKA 4D6YA 5BPHA 4JIMA 4MYUA 4RE5A 2MIIA 1CY4A 1MJGA 4QATA 5A62A 1JU3A 1HT2E 3B1WA 3V1LA 3OMWA 1ORRA 2NNWB 3C8UA 3HUFA 1ONPA 4IXWA 1DRJA 3MLEA 3OFVA 1USWA 4Y1EA 3THYA 1DQYA 2AE2A 4L73A 4WQMA 3SJUA 1XUOA 3KJNA 3K0AA 1RRFA 5J2UA 2H4YA 3GIDA 3PHIA 1AURA 2KB0A 1KJZA 3R3ZA 1Q0QA 5DGIA 3M3DA 5BNWA 5FPYA 1RP7A 2G06A 4LVOA 3G9TA 3PC7A 3D3KA 3DPUA 3A6ZA 3FF4A 3ZCXA 4H7PA 2C57A 1U3UA 1JDUA 2OCGA 4I9GA 3ABIA 2B61A 4HS4A 3HY4A 4TXHA 3DAOA 4ZV4A 5FUMA 2EX4A 1XTPA 5TE9A 2RBGA 2C4TA 3B60A 4QXMA 1VJ0A 3ZDBA 2I1QA 2ZJ1A 3H7IA 3NPAA 2I03A 2JIQA 2VP9A 3QIAA 1DG3A 1VHWA 2WM9B 3CX8A 4HDRB 4E21A 3L4BC 1BHJA 4J1QA 3ZE8A 4R8SA 4G97A 3E2IA 1ORWA 1ACMA 1T5OA 1Y33E 2IHBA 3AYZB 3H2BA 4XQEA 1NJ8A 1VDZA 3HGTA 4H6XA 4NCAA 3TBHA 1SO8A 1Y8AA 2CLFB 4YQZA 2CJFA 5FTJA 3Q40A 5CK5A 3E2MA 1OLSB 2GR9A 2HF8A 3IMEA 1TM1E 2EL9A 3WQBA 9ABPA 2GCIA 2C58A 1NJSA 3IIEA 3K4PA 3SLRA 4WNAB 1ZU4A 2H5IA 1IBRA 2F2TA 2PLNA 5DN6A 4CDMA 2BPOA 2WSMA 2IYYA 4G63A 2YJ6A 1IM5A 1YCHA 2ZJBA 3IBFA 3QEJA 4YHBA 3LRXA 4GLFA 2QN3A 4XOUA 1W581 4ZGGA 2PUAA 3PQ6A 3E70C 4NU0A 1XJ0A 2H2WA 2H5JA 2VJCA 3OY2A 2BCJQ 2OPHA 2JJYA 4QASA 4PNZA 3E22B 1XPRA 2QVLA 4KQEA 4Z9AA 3AF2A 2R65A 1F2DA 4J4TA 5L4LA 4GR9A 1UIRA 1DL5A 1LPPA 1W96A 1SBHA 3HUEA 1F2VA 1P5JA 4KQ9A 4Y9SA 4ZARA 1N9KA 3C3MA 4ZT7A 1E61A 4ES6A 4WX2B 1AO0A 4V0MA 1JIJA 4DVJA 5LYYA 3F71A 1O94D 2KPOA 3JWEA 2F62A 5EZYA 1EUDA 2GN9A 3RRJA 6AT1A 3ECAA 3IDZA 2FVXA 2LR0A 4GWKA 4TXMA 3HI6A 3PE6A 1L0BA 2JGJA 4GKAA 4L9SA 3EOZA 4YDQA 3QTLA 1NQTA 4PGFA 4UBOA 3IE0A 4I3GA 3PWZA 3RV4A 1SXPA 3EC1A 1N4DA 1JFRA 3GVIA 4OF4A 3SAJA 4ER7A 4DY6A 3B6ZA 2AFIA 1KDTA 1OBVA 1RM5A 2FH5B 2PSEA 3A1FA 1HTWA 1QOPB 1VJTA 1QANA 2A7XA 3HSKA 3VA7A 1XDSA 3D8UA 1PW7A 2O52A 4G8JA 4FQ5A 3ZNNA 2CGEA 3QF4A 3X1JA 4Q4CA 3LKDA 3OT1B 5DBOA 4CETA 2JGRA 3KZNA 3FCSB 1N3LA 3H0KA 1J2YA 1NJGA 3GUUA 2BEWA 3QKRA 4GSYA 2WHQA 3RIGA 3W4IA 3FLMA 4BBJA 2EARA 3JZFA 3GL9A 4X1KA 3RM3A 4HDKA 4OXRA 1PQWA 5DSTA 4CG1A 1WXWA 3CLTD 1ORDA 1UXJA 5I9TA 4CMCA 1B74A 1TM7E 4PX5A 3AG6A 1SBIA 4CFZA 3VHXB 4WK2B 4Z4FA 1N2HA 1G66A 3KKKA 4JDUA 4DSUA 1E6WA 2V1UA 1OBFO 3WLHA 4D6PA 2Q3MA 5CLLA 1SCUA 4D7AA 1G8JA 2G28A 1MMFB 1L5NA 5E1BA 4FZRA 2R2GA 1F6BA 1Z2NX 4CKCA 4DMGA 5HP4A 3DC7A 4WASA 2YBEA 3FWYA 4LF8B 1JSRA 3KC2A 1OXUA 1HEYA 1NDUA 2XMZA 1G6KA 1SIBE 2D0OB 3JQAD 3INTA 4GOMD 5FT9A 5F7OA 2PH7A 1TMYA 2Q62A 1E9AA 4Y9UA 5I5GA 1XTIA 1GL9B 2HHHB 4F71A 3OE7D 3D8NA 1YB5A 1H4QA 4KDCA 1G6OA 3ANLA 1WKCA 2CJYA 3DWGA 4D9GA 3U1BA 5BVHA 4KQWA 1ACLA 2BAGA 5JPCA 3PVSA 2JAUA 3HJHA 5DULA 2ZB2A 3OICA 3VV2A 5BYBA 1H0RA 1J24A 2BBOA 3C1TA 3P5SA 2OFFA 3RK4A 4IMPA 5CM9C 3UYLA 1PR2A 4KIWA 4A36A 1FB5A 3FKJA 2XOEA 3OO1A 3LW8A 2Q41A 1BE6A 2DY0A 4UVGA 5BN5B 3TLKA 3HN7A 2CL7X 1TCUA 1QYRA 1SZCA 5IK2D 5KJCA 2H2FA 1KQOA 3TKAA 4XYEA 1BWSA 4BGVA 3VZQA 3P2IA 2YZMA 4L9AA 3TLZA 4YR9A 3HO8A 4GRIA 2ZBQA 1QKIA 1ODCA 2IDMA 2VNIA 1O8CA 2A8YA 2CMKA 5DI9A 3UUEA 1Q3HA 1GDHA 1C1XA 3ULKA 4EI9A 2J59A 4U3JB 2ZULA 4UFNA 2XCLA 1QYXA 4P93A 3QENA 1GTMA 3TSCA 1ZMBA 1T0BA 3BGWA 4HTFB 2VNKA 3RKRA 4C4RA 4E5YA 3E9MA 4PXSA 1MAWA 2Q2WA 2O59A 1EXVA 4FCCA 4YECA 3TLMA 1EXWA 1GZ4A 1RPJA 4BB5A 4S2EA 3MJSA 1BFKA 4QXAA 3DXFA 1OGIA 1YS9A 2RGYA 3C6MA 2PIAA 2WHRA 1SCIA 2PMBA 1YUNA 2P75A 4L50A 4TWBA 4BAZA 5FV7A 2FSIA 1T35A 3P4XA 4JL8A 4DVGA 5AJUA 5HCUA 3EARA 5AHOA 5EHQA 3L01A 1QHSA 3JQ7A 4MUXA 2EP7A 3OCYA 1XQXA 3ORHA 4JENA 3QHAA 6ADHA 5F2NA 1OAAA 2ZRCA 3GEGA 5T6BA 2BDUA 2WINI 3WHIA 3LDUA 3V8BA 4FFMA 3CWQA 4BNNA 3JAWB 3PQ5A 4OH7A 2HBRA 3SP1A 1OJLA 2VR1A 4NXMB 5CH3A 4HLUC 1XPUA 5KPDA 2POCA 3A6KA 3L06A 3IV6A 3P96A 1N33B 2XLBA 3D6UA 1I9GA 1SXQA 1XTJA 3UTCA 1SVKA 4N0PA 5L53A 5BMVA 1JA1A 2FKAA 1KJJA 2QP9X 3WJ7A 3FDIA 1YBHA 2GHTA 3JQFC 3RYIB 1EM6A 2RAVA 5IXSA 4GU5A 2ONJA 4G84A 3PUIA 1QIGA 2ZUWA 3RJZA 3T6KA 4EITA 1H3NA 3L7AA 3HA2A 1U3WA 3E0QA 1YD7A 1G4UR 4M55A 4RD0A 2OQVA 1ODIA 2OQRA 2PUJA 4WXRA 1C80A 3IAM1 4DJJA 5AKGA 1K8XB 1QS0B 4QECA 2OCLA 5JHGB 3M1IA 4FYXA 2BHLA 3FIUA 2N1BA 2D3TA 2IYFA 3Q3EA 2O5RA 3UATA 2O1WA 4CM8A 3UH0A 5AVXA 3PR1A 5FBQB 2DLNA 4R01A 2F43B 3FG9A 4EPRA 2VHJA 4X71A 4RSHA 1WCYA 3ML1A 3O4RA 1MHPA 2RG7A 4B71A 4Q3OA 1DBPA 3TYXA 4Q24A 3I92A 3QKUA 2SHKA 3AFHA 2R60A 3M1YA 3ZQ6A 3EULA 3GJ0A 2QTLA 3IAHA 1JKXA 1SVNA 3EXIB 1XFDA 1EBBA 3FXAA 1JAHA 1R0LA 1LPNA 1RHJA 3VPFA 1CUUA 2DBRA 1KARA 3EUEA 4MUBA 2FZEA 1RRKA 2QPAA 2XNDA 3U09A 3CKMA 3RV3A 4D5GA 2VP3A 1TUGA 3D8SA 3LA8A 4RGQA 2GS9A 2JH3A 2YV3A 1LQTA 4Y9TA 5IDXA 4QDTA 1PG0A 2IL1A 2QQ5A 4QU0A 1IEXA 3V4VB 1KFEB 4JH0A 1QRSA 2YS7A 2PN1A 1QG6A 3ONFA 1DLJA 2R8OA 3R5TA 4QNNA 1XLWA 2ZBFA 2VSYA 4KG7A 1N2CE 3FE2A 1SKYE 4XXHA 2WK1A 2E85A 1KC3A 2FZ5A 1OZ0A 2VYCA 2V8BA 1DRUA 1JAZA 4HUQB 4X6XA 2A58A 4NEGA 1ZMXA 2J6BA 2J3IA 4YRIA 2A9JA 1DAHA 2MMCA 4MUKA 5A4MS 1XZNA 3DKPA 4H08A 5ALHA 3CV3A 2M6SA 2Q5CA 3U4AA 3G5UA 3OJEA 4C4YA 3D2LA 4FHEA 2JGKA 4L0MA 4E7PA 2BSAA 2EJUA 5JADA 4PYIA 4E5NA 1E4YA 3S81A 1U8UA 4RIIA 4MGIR 2DQ4A 3CM0A 3GQBB 4HDMB 1E58A 4JQYA 1GG2A 3HGQA 2J3JA 1LA2A 3ZVRA 1CJTC 1RYHA 5KDDA 4Z53A 3BB3A 2I1WA 5B1SA 4YP5A 4R5HA 4CCYB 2X4IA 2YIVX 1TT7A 4D43A 2XMGA 3A1UA 1YJAA 1FTYA 1SULA 4J76A 4KQJA 4XD7A 2WWVD 2DTDA 3WGUA 3COYA 2WKQA 3H8JA 4IUDS 4MUYA 2F1KA 2WHXA 3D8BA 4D8VA 2NXCA 4TM7A 2IC5A 1FXSA 2C97A 2VUUA 3RI3A 4CKYA 2ZT6A 1DEHA 1MFPA 4RJJA 4AJEA 4C6TB 2JJMA 3ADDA 3MWGA 2DZDA 1ECBA 2VQDA 2CXPA 3HXPA 2V58A 2QN2A 4RWEA 4DOMA 1J42A 2RGDA 4YFYA 2FN9A 1JDJA 1QAOA 4LMBA 3T9AA 4WFJA 5DXJA 3KZKA 3QPAA 4OXQA 5DGXA 2GZHA 3H4TA 1EVYA 2HPZA 4O4LA 3T8YA 4QWWA 3VPXA 3KEQA 4FFNA 1MRNA 3ZUGA 1OIXA 4ZGWA 1XNHA 2CC2A 4YGYA 3ZXYA 2IS2A 3M1LA 1EE1A 4DQLA 4KPYA 4PZ9A 3DCNA 5TQ2B 4OHWA 3WNVA 3RUCA 4UXIA 2F90A 1GDTA 1X14A 1IBSA 1PQPA 2NZ2A 3TE7A 1QIKA 2AHOA 3BMOB 1A7KA 1K4YA 3A2NA 3GY0A 1UT6A 1YUMA 5ED0A 1MJHA 5AW5A 4YHHB 1MD9A 3RUDA 3ZJYA 4MKIA 3GRKA 1GG9A 3L40A 5U1PA 1CVIA 1AS0A 1GZVA 3H5RA 4UVIA 2VBGA 1C7ZA 4PSKA 4N47A 3NXKA 4NZ9A 1NNUA 3T3NA 2CFCA 5THQA 3OPMA 4NMXB 3ZOKA 3DGFC 8ADHA 3B2NA 2ALJA 1Y37A 2M32A 2AJCA 2OV6A 3AR4A 1DAOA 3V1KA 5C18A 5KQGA 4MQBA 2F9MA 5B3LA 2Y0PA 3H18A 4LFBB 1QHYA 3TLBA 2YVAA 4MQFB 2HH9A 5AI8A 1I01A 3HCAA 5ALWA 5SYNA 3T4PA 3VR5D 2JGNA 1CZHA 3W8FA 1CUWA 1XLVA 2R6GA 2PU5A 2TMYA 4KXFB 4REQB 4DARA 2IS4A 2F6RA 2AMFA 2FE4A 3E84A 4M98A 3BILA 4YJDA 2BP7A 4EZBA 3R9WA 3F3SA 1P5RA 1IEWA 1Q44A 1PGNA 1RM4A 1T0HB 3QKWA 1NP6A 5FUBA 1JEDA 3S40A 2BISA 1NXPA 1X7ZB 2Q8QA 4LY0A 5IJ9A 4YO8A 3I9KA 2XZOA 3CX3A 1ZD3A 4D6XA 2ENWA 1LBIA 2W6MA 3Q87B 4QFDA 3HN6A 1HWYA 3Q7EA 1MB9A 1NP7A 3EVCA 3PNBA 3ZD7A 3CNLA 2X0KA 1SK8A 5C3MA 1C7IA 2Z1NA 2OHVA 3DG9A 3EXHB 2HTFA 4O2AB 2ZUEA 1LBHA 1VKZA 1GU7A 1U0HC 2C5LA 1PEKE 3MBIA 4C87A 3G0IA 3G0CA 4HGPA 3AOGA 2FF5A 1X0VA 5C8YF 4GX0A 1U94A 3KLMX 3OLVA 5HOQA 1WB9A 4WECA 3C3AA 1F4PA 4JJ8A 2APJA 3LL4A 3DBRB 3Q8WA 3Q88A 2BEUA 1U6IA 1AS2A 1IZ7A 1GNPA 1GG5A 2WT8A 5TDHA 1UBHS 2YICA 3SS9X 5CB4B 3LVBA 2NTVA 1AQIA 3ELYA 2VHCA 1ZGZA 2WP0A 4I46A 2OLJA 3DB1A 4N8EA 1CEEA 3JYHA 1NQXA 2WKSA 3D81A 2IY9A 2DFDA 3MSCA 5C52B 1N3BA 1XZ8A 3QYPA 4YRBA 3E6AA 1DFIA 1Y98A 3R8FA 4ARZA 2RIPA 1CSEE 4QUHA 1K3UB 1Y8RB 3A04A 2VSXA 4GPTA 2FLKA 3MB5A 1TK9A 3D3QA 3K32A 1SXJC 5K6AC 5KU7A 5IT4A 3KQSA 4L02A 4U2KA 4MVJE 3R09A 2OGWA 4EHHA 4RPKA 2GCOA 2BUCA 4ROTA 3GEBA 5EMMA 2SNIE 3G5TA 1FFAA 1UFKA 3AYXB 1PBTA 2RI0A 3L84A 1I7PA 4NYJR 4BEVA 4U2DA 1NJ2A 1WRBA 3FCAA 3DOCA 3M3PA 1X7XB 3M9WA 1JLLA 5K3DA 2WSIA 5LYJA 4QLBA 5HYVA 1ABEA 3E81A 3UHJA 1WZNA 3NMUF 1IQ0A 4D4LA 4EHFA 4Q3LA 1AK9A 1SUFA 1YACA 3KQWA 3BCSA 3K6RA 2NU6B 4F5EA 5B6IA 5IVPA 4UEKA 1EK6A 5LZ4A 4IWXA 4V38A 2P8JA 2KW5A 3M7IA 1FZTA 1KAGA 1K97A 3FPAA 3GAMA 1F6DA 2PR2A 4KMMA 4C78A 4EBBA 3ZWWA 3F7OA 5E6RB 1OLUB 3CT4A 3DEZA 3QEMA 4G5RA 3RF6A 4BTLA 5KWJA 3G2HA 3EEQA 2VJBA 1J8MF 1DIAA 4DT1A 4BNLA 1YF3A 1LU9A 1U0GA 2WVGA 2Y92A 1GGHA 1RHRA 1ZN8A 2P1DA 2YL2A 3B7GA 3PDWA 3N8NA 1B14A 3OUTA 1TA4A 3PRHA 5IZCA 3KR2A 4BKUA 5BR1A 1H2EA 4DA9A 2UZ0A 4EARA 2EX0A 1K7CA 3T99A 2V7TA 7ABPA 2H4WA 3STWA 3OIYA 4HO1X 2NLOA 4X54A 3UCEA 3A9TA 3WHPA 2WG1A 2P2GA 3GLRA 5DLEA 1J90A 3HA5A 3D54D 2QPOA 3HTXA 1RWMA 5I3ZA 3DXXA 1QHHB 2H4JA 2ODPA 3BWDD 1NWCA 2J3MA 3E3LA 3KPJA 3L82B 1L8LA 5I47A 3A32A 1NY6A 4ENQA 1W0KD 2ZW9A 4LNHA 5B4TA 4ZODA 1VE5A 3JQ9C 2JEZA 3TZ6A 1W4RA 2BM0A 3FMIA 2HBQA 1D1QA 2A1TR 3PFHA 1UZLA 2FPSA 5FL7D 4YUWA 3WKBA 7REQA 2XCRB 4IFEA 1KRHA 3OQBA 1P31A 3C87A 5FTMA 2JBWA 4G4JA 2BVNA 2OBXA 2BY4A 5G2OA 1QQ7A 2BEVB 2PX5A 2JGFA 1I8TA 3G7SA 2CLHB 4KTTE 1JR3E 4G8CA 2UU9B 3F5SA 2ZSAA 3HEBA 4GH5A 4NENB 3V46A 4DB2A 1D2AA 4J0DA 2JIDA 1WSDA 4RD3A 1XD2B 1Q84A 1Z7EA 4EB6B 3LRTA 2ZVJA 4TXJA 4FUTA 4J0EA 3FYUC 3M4NA 2GNAA 5CGQB 3IBGA 3O74A 4IOKA 3TKYA 3ZZ1A 4BATA 1ESNA 1GNTA 2W6JA 3GZNA 1UMBA 4NWIA 1Y1KE 1AXRA 5JDIA 1V11B 4M36A 5AUNB 2QTRA 4ZN6A 1Y3BE 4M9CA 1G5QA 1JAYA 1YB6A 3AKEA 1XDGA 1AQUA 3F7MA 1Y6FA 4BRWA 2W8BA 3MWYW 4MO9A 4GECA 4ZCMA 1MV5A 1Y1SA 1EB8A 2GM4A 4FCWA 2IPAB 1Z5ZA 1T9HA 1PS9A 1OTXA 1PRYA 1AQLA 1G21B 3EEIA 5KDLA 5GONB 3RRMA 1SWWA 2SKEA 2MYNA 4G8BA 1WY7A 3OJCA 3WMEA 3TAUA 1NUHA 1RMYA 3DOUA 5KYGA 3HO1A 3G68A 5HM6A 1DNPA 1O9GA 1V5EA 3ZI0A 3TINA 3WP0A 2XEDA 4AWXA 2HR1A 1FXWF 3DKIA 2I3GA 2XUGA 4MGHA 4CIVA 2WILA 3WMGA 1B2RA 4TVSA 4JLMA 3OTOB 1TVCA 3AKZA 2GK3A 4HFMA 3EZ7A 2C9OA 2EX1A 3H2HA 4UHEA 4BX9A 3V2UA 1YDHA 3P52A 1HTBA 1V8BA 3A6DA 3DUFB 2ACWA 3IBTA 1A9XB 4JT4A 4KFTA 2AEFA 2IW1A 4ENTA 5A1TA 3G13A 1EQAA 2DFTA 2FP3A 4B6PA 4CIDA 1DAPA 1N8SA 4MW1A 1CRLA 2EGUA 3T9EA 3TQQA 4DQUA 2H1OA 3EK2A 2ZS7A 4MRVA 4IDPA 1YB4A 2BGJA 1OPRA 3A9CA 1Y8CA 3AVPA 2IF2A 1ZDMA 3PPWA 5M3BA 5EJ7A 3T54A 4F1KA 2FN4A 4BUCA 3M6LA 2A84A 1Z5VA 1HNWB 2XMBA 3CNQS 3RTDA 4PFQA 5DXFA 4QQFA 2E6UX 1T2EA 1Z29A 1V3UA 3ITNA 5FOXA 3C70A 4GC5A 3KELA 4MMZB 3RBXA 2Y1XA 4QFMA 3TLAA 4BLPA 2CV1A 3EODA 3BXXA 1X7GA 4NJOA 3ZJVA 1PR9A 3DAYA 3QMVA 5JRJA 1MZPA 1SA0A 1ZM9A 3PNYA 3N0WA 2JFYA 2HIMA 2WFMA 2YC4C 4V0QA 1GFIA 4ZWNA 3MK31 3VMMA 4PYJA 5EJFA 1YQQA 4X7BA 3K9LA 1F2UB 2YXLA 2A3RA 3LNCA 4OHXA 5JWOA 2QT9A 4I8DA 3ZGLA 4DS3A 3QY9A 5HKLA 1YMQA 1UEXC 3GUZA 1YA4A 2ZRMA 2ZTUA 5U9CA 1M2FA 2O2JA 3OQNA 4D9FA 3NLLA 1Z13A 1MO2A 1HR0B 4BQOA 3SIRA 2CCJA 4GPBA 4PGMA 5HCIA 1IQUA 2W6CX 2I5PO 4PC6A 2A1UA 4GWGA 4KXQA 3DCJA 3LNTA 3CNHA 4ZVPA 2CHUA 1OT5A 1U2TA 1XDDA 2QVXX 2YN0A 5DTMA 3R24A 3CZPA 1Y3DE 4RDIA 3VAZA 1B73A 1BOOA 2QG9A 3MBKA 3UMRA 1YS4A 3L92A 3LVQE 5JO0A 2DYKA 1GPYA 4YP1A 3FBGA 4FFLA 1WL8A 4N3AA 1IVNA 2VTDA 3EEYA 1NBMA 5GY7A 1N75A 1FBTA 3L1VA 3BWXA 4CUKA 1K6EA 4KN9S 1JG4A 2Q5IA 1V3VA 3P9PA 3LUGA 2VHVA 1P1RA 1PR5A 3JZMA 4FP9A 4R05A 3NBXX 4TL6A 3FRHA 3TQRA 5LMNB 2V55B 1Z5UA 2PYZA 1NKSA 3T38A 3WGYA 4GP7A 1RWQA 1XF1A 2DQKA 2QJFA 1KEKA 5TMDA 4LUCA 2C1ZA 4I50B 3BZUA 1SBZA 2Q27A 1KI4A 2EF1A 1AA9A 2FPGB 2Q3BA 1NA5A 1OLXB 2WVJA 1DBIA 1KC1A 2R751 4Z49A 2BCGY 3DMHA 4QTTB 4D8TA 2JF0A 4QUDA 1I6KA 5LKAA 1M1YB 3CY6A 4MVWA 1ZXXA 4B4WA 3UKOA 2E9SA 4AWBA 4HVCA 1GTZA 3C48A 1FU8A 3SOZA 4RAOA 1QTNA 3BHNA 1A8IA 2H59A 3R0IA 2X1HA 2WU8A 1SQ6A 3LCJA 4GLBA 4C2BA 4DSAA 1FFYA 2VJLA 2XRMA 4CLRA 1C3JA 1YK0A 1UXGA 1VMKA 3QIVA 3ZWNA 4FT2A 5IJ0B 5KS2A 1ZAYA 1DCFA 1JMYA 4OP2A 2D0PB 2QRGA 3BIFA 1VKRA 2JK1A 4N3CA 4RESA 1R0KA 4CIWA 2C84A 3W2TA 5L7WA 4PX3A 2O54A 1NLYA 2FPPB 3S1AB 4Q3DA 1W9MA 1XCOA 3SEAA 1X2EA 1ZESA 1GGKA 2Y71A 3C98A 1R64A 5DF1A 3ILVA 4DEXA 4XFJA 4ZEWA 1FMJA 1LTQA 3L8GA 5U4QA 1P4SA 1PDVA 3O47A 4O4HB 1C9DB 1K6MA 3ZTWA 3UWMA 2HUPA 4PYOA 5FI0B 1EFAA 3BXOA 4YJ2B 3EMVA 4KAFA 2REOA 3KEMA 1S4MA 1WNTA 3GEPA 4JAVC 4PHHA 4TUYA 1EBFA 5JSFA 4MOWA 1HH4A 5DX8A 5D8DA 4DYHA 4MWZA 1I2DA 1VBKA 4GI5A 5EWJB 3VYUB 3NYQA 1FRNA 1KS9A 1R0CA 1LWOA 2K6GA 5JS7A 3ZBUA 1SBYA 2QMUA 2HA2A 1OLOA 4GX2A 3I09A 3R76A 1PNOA 2HJRA 5DOZA 4LWPA 3O8DA 1Y7PA 3OIUA 3K0FB 4OMFG 2B8NA 4Q15A 1HNNA 2FSPA 1EPUA 5E4FA 5F51A 4UNRA 3EFEA 4UDXX 2ONZA 3PKZA 1HMYA 3D3JA 4MWEA 5JI3E 1IRIA 2VBFA 1GAEO 2AFHB 2J45A 1G3QA 5AKYA 4TQAA 3F1KA 2R7LA 1Z8NA 3ZDCA 1K6IA 2VRCD 3HCFA 3MIIA 3LMKA 5FPTA 2HREA 3AJEA 3T5PA 1K3FA 2ZIVB 4IG9A 4ZVRA 2RK4A 3B1FA 3G0BA 3L3BA 3T3PB 3CUKA 2ID4A 2LIPA 3DF9A 5ALRA 5KO2A 3OLYA 1QBGA 1VLHA 1XHLA 4KLCA 2IZ5A 3EDRA 1KYTA 4HYQA 1PFQA 1NLFA 4RELA 1VB3A 4F86A 2QX6A 4WNAA 1LB1B 1IY0A 5EMNA 3I1FA 4ZIRB 3CCCA 2R44A 2P69A 2GLUA 2QLBA 2BE9A 2R85A 5CM8B 4CV0A 5JFOA 4EY5A 1MFZA 3BGSA 4K0RA 1A2KC 1ODFA 3BOSA 4Q9HA 3M6MD 4QJ5A 3RW9A 5AQ1A 5JYCA 4EJ6A 3W34A 3HU2A 4K9SA 2QR3A 3B5JA 1PNVA 2EKPA 3L6BA 2PLAA 3LDAA 1UEIA 3EWAA 2COUA 3MJ4A 3ET5A 1FTNA 1QOQB 2OO3A 3C6QA 3FGZA 1E20A 1XJWA 2Q5QA 1KPHA 1WHSB 3PSHA 4UUAA 1QNFA 1XZAA 3RHTA 1I9CA 1ENZA 2ZAIA 4LXHA 4QULA 4GXNA 2IV7A 1W2HA 2IGTA 1S8FA 1T9GR 3DEHA 5IT5A 2P8SA 1Y3FE 1EGQA 1TF5A 1OI7A 3O2NA 3S2YA 4EMUA 1R1DA 2PGAA 1AH2A 1TTPB 2D7CA 4B6RA 2IIPA 1BC5A 4RA6B 3LYHA 2WJ6A 3TR5A 2QRMA 5K0EA 1RXVA 3FZQA 4M3NA 2X86A 3WK6A 1DZIA 2GH1A 2XXJA 5B7GA 5JMTA 1Z2EA 3FWZA 4EJSC 1YNOA 3AY6A 3FUTA 4C5CA 1R0SA 5KNBH 4UE2A 2PXHA 4W5HA 2BFBA 1QF9A 3LLMA 2X8WA 2XECA 3BQMB 3QLJA 3DF7A 3TH5A 1MORA 5BN4A 5DBHX 1Q21A 5E6SB 1GQ2A 1HE8B 3CVWA 1BCRB 3LP5A 3G9XA 3AW8A 3KJHA 4GOJA 3G5LA 2GTHA 1AUPA 1RKQA 1UAGA 4HFRA 4P53A 3LSYA 4QLAA 3F6BX 1VG9B 2GN6A 3N2NA 4WCFA 4WWHA 1A8UA 3W5UA 3QSGA 3RFXA 1V37A 1CY6A 1NW4A 3KLOA 1NKTA 1F8XA 1UJCA 4EJMA 2X7HA 4MPRA 5JC8A 1LSOA 1IOWA 3I6ZA 3QE4A 2IPMA 3TX2A 1HNZB 3AF0A 3CONA 3WKEA 2VDOB 1H6BA 2OWEA 6CHYA 2VHYA 5D84A 5KKAA 3RVDA 1DKOA 2PO5A 2MSEB 4IDHA 2JJ2A 3F74A 3DTNA 2Z95A 3NDJA 3FMGA 4ZQGA 1M9NA 1WXEA 3FPCA 4BNXA 5JEDA 5HTKA 3SF8B 3EZGA 2VSFA 5JCJA 3WL6A 1DT5A 3GNQA 3KETA 4QYTA 2BKXA 1P0CA 1WU8A 4PG6A 5A4FS 1C7QA 4BLWA 5JBQA 2PDAA 4TZKA 1PJ2A 2E5WA 4YXWD 3S3TA 5JZVA 1RBMA 1K7SN 4LRTB 4KQCA 5EEGA 3RAJA 3SPXA 3VAYA 4CIAA 1UXOA 4ZOLB 4QFBA 3L6UA 2PKRA 3Q10A 3Q5GA 1T1JA 1LPOA 1LS6A 1PIWA 2FDXA 2EBHX 1M34A 1WMAA 2ZI6A 1MXHA 1XMPA 3I2JA 3KXIA 3LLCA 1BMTA 2FK8A 3PHGA 4R5MA 4AS2A 5CLHA 3HWWA 5DXAA 4UNPA 2WFLA 2I2FA 4QSMA 3AU8A 2ONKA 3M4YA 4V0ME 3UPTA 3I34X 2Q9BA 2PIDA 3NGXA 2QNRA 1AVTA 1O08A 1FRZA 1AN0A 4F8JA 2AIRA 3WWEA 5JFGA 2IEYA 2Q2QA 2P2LA 4BIMA 4ZV9A 3AIMA 2ORVA 4KQ2A 3P9SA 4LWOA 3L8FA 3CXRA 3GLHB 3NALA 2EP8A 5AM3A 2A0UA 5C46F 2VAPA 1UK9A 2DKNA 4ZAYA 5DB4A 5BN5A 4N0MA 1DRVA 2PUWA 3AETB 1POWA 2J8ZA 1XEAA 3BREA 3D0KA 1I32A 2AFIE 4DMKA </