4QBGB

Crystal structure of a stable adenylate kinase variant aklse4
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
217
structure length
217
Chain Sequence
b'MNIVLMGLPGAGKGTQAERIVAKYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSKSDCERGFLLDGFPRTVAQAEALEEILEEMGRKLEHVIHIEVRQEELMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQRADDNEETVAKRLEVNMKQMAPLLAFYDSKEVLRNVNGQQDMEKVFKDLRELLQGLAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
molecule tags Transferase
source organism Bacillus subtilis
publication title Effectiveness and limitations of local structural entropy optimization in the thermal stabilization of mesophilic and thermophilic adenylate kinases
doi rcsb
total genus 78
structure length 217
sequence length 217
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00406 ADK Adenylate kinase
B PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qbgB00
3VU9A 3K0CA 3GFOA 3CBQA 3E2IA 3GEEA 4Y0VA 4KI0A 3ZIAD 3QBTA 4JVNA 4P4UA 1R0XA 1DELA 3A6PC 2AFHE 4Z1MA 3RWMB 2R6AA 3PUWA 4FMDB 1JECA 2H18A 3FGNA 2F43B 3D3QA 2FSGA 3RS4A 4C0HA 4UNPA 4E22A 2ZROA 4N0EA 1F48A 3NC1C 4DHEA 5JHHB 4DB2A 2OUKA 1G41A 4IOKA 4HLDA 1KO8A 2FFHA 1G7CA 1NJGA 2XB2A 3QG5A 2Q9CA 4IRUB 1X8LA 1AS2A 3FPAA 1U98A 4LRWA 1ZVQA 2NPFA 3SZRA 3X1ZA 1NVVQ 2GCOB 2GJ8A 2J1LA 2ZRGA 4HB0A 1BMFA 2ZRFA 2ZSDA 3MRSA 3T34A 2SHKA 1IM2A 3TW8B 4GL2A 4DXAA 2QAGB 1GNQA 3GLHA 3X2SA 2XNDA 4IDPA 4Q02A 1RE0A 3BH0A 2NTYC 1W2HA 1GUAA 2XJ4A 2XEXA 4V0MA 1GG2A 2H92A 4LDJA 2ZJ5A 1IHUA 4PPQA 8OHMA 3AUYA 4B43A 4PXAA 2OBMA 5DNYB 2AD5A 2L0XA 4BE7B 3E5HA 1OHHD 3B60A 3GJ7A 1RW4A 1E9EA 1ZC4A 3QEJA 2GRJA 4HZUB 4ITRC 2ZJZA 4E5UA 1UADA 1GTVA 1M7BA 2P2LA 1I2MA 2VF7A 3WRYC 2CL7X 4PX9A 2QAGC 2KE5A 4HLUA 3ZVNA 3K0SA 5KO2A 3NHAA 3P1JA 3FMFA 1AS3A 1E94E 3EASA 4Q4HA 1M7HA 4P3YA 1J8YF 3CWQA 4M1TA 3KTAA 2DBYA 2GJ9A 4M9ZA 3WBKA 3E70C 4CT5A 4YXWD 3Q9LA 1UEIA 3IIJA 2VTKA 1JR6A 2G9NA 1NY5A 3A1UA 3KFXA 4W5WA 2G6BA 1NMZA 3RWOA 5EP2A 1XTRA 2JCSA 4AKEA 1QG4A 2ZI9A 3NBZC 4B3CA 1E0KA 1J70A 3K8YA 4MYCA 1T3LA 5AUQA 2C04A 5E7MA 3SYKA 4FINA 1PJRA 1G17A 1XJQA 2RKOA 3H1TA 2B21A 4RFSB 3I62A 4PR0A 4PAQA 1NJFA 5CB6A 4TYYA 1ZCAA 1KK1A 4MA4A 2C99A 5EP3A 2KBFA 2OT3B 2O8CB 2VL7A 1NL3A 2WMNB 4PPGA 3RS3A 1M7GA 2ZRIA 5HKKD 5AJZA 2YYZA 5FPTA 2F55A 3V4FA 1Z6AA 2CE7A 4FN5A 4EJSA 1ZUNB 3L8YA 4M1KA 2GJAA 2JLXA 4CEHB 2GXQA 1XBTA 2VF8A 2WJIA 4HLQB 3HU3A 4TLEA 2IYYA 4BFXA 2BCJQ 2ZE6A 3C14C 4MRRA 1Y3AA 4GP6A 2F1HA 4XWKA 1UBCA 1DO0A 3P4XA 3E1SA 1W0KD 5CJ2A 2PCJA 4EDHA 1XEWY 1E2MA 3NVAA 4LK2A 4QGGA 2GHIA 1F3OA 4F4JA 3PEVA 5L3RA 3LX5A 4Q4LA 2A78A 3RS7A 1YZGA 4P4TA 1AS0A 3LQRA 1H8HD 4X8MA 1DARA 1GP2A 4JLPA 1N0VC 3LXRA 3WP0A 2Q6TA 2HF9A 2VEDA 1U99A 4LJ9A 3B78A 2R6FA 2JLYA 3AM1A 3UKDA 1JPJA 3N2IA 3BXZA 4G5QA 3VKWA 4PAMA 4FD2A 5L3QA 1Z0DA 1OIVA 2VP2A 3H4MA 4NMMA 5HE8A 1XF9A 5A0FA 4AG5A 2YC4C 2V55B 4D0GA 2GA8A 2ODEA 4QGFA 5KSPA 3U7EB 1KY2A 1XJCA 2IUUA 2CVFA 4W5HA 1QHIA 2XXAB 3OZXA 4V03A 4KSBA 4BLRA 4W7SA 3AF0A 3SQWA 5CLQA 3WY9A 1KI6B 2ORVA 3RC8A 3B1XA 4XVRA 2GTPA 1TF2A 3I92A 5FTMA 4RCZA 1GL6A 2I1VB 4R2HA 2XZOA 1X1SA 4CW7A 3LWNA 1D2EA 4QNMA 5BW8A 2ZYUX 1TQ6A 2ODWA 4DCTA 1FMLA 2JJ8A 2ZR9A 4RVCA 4MGZR 3AB3A 3T06B 3CB4A 4O25A 5JI2E 1I4TD 3THWA 1F2UA 1XEWX 3GJ4A 3AV0B 3AH8A 4OHVA 4TQ9A 5AUPB 4O0MA 3TGPA 1BIFA 2OILA 1Q1ZA 1S9DA 1ZMXA 2DWOA 4C2TA 2B92A 2AKAB 2D2EA 4RFVA 1H8HA 1XP8A 1QHSA 1W4BA 1DAEA 2X77A 3CO5A 3L0IB 4C0AC 4D4KA 1XPUA 3DO6A 1NKSA 2A9KA 4URXR 4FW9A 4GPTA 5FOXA 2ZJAA 5D3MA 1K6MA 5K8UA 2WWIA 5IK2A 1QVAA 3BFXA 2ERYA 2P0EA 3D6TB 3I73A 3KUCA 3QQ5A 4GZLA 4OK6A 1LFDB 3U61B 3QBVA 1ZW6A 4FMBB 2C95A 1XMIA 4IKEA 4MYTA 5JSZA 2YKGA 1QHGA 1OB2A 3AVVA 4EPXA 1DAFA 1ZNWA 4P32A 4HB3A 2PX3A 1X6VA 1W4AA 5JS8A 1G64A 1KZGB 4D82A 1KO4A 3JZMA 3VMFA 3ZVLA 4BGDA 2W6JD 2ZETA 4LWZA 4NP6A 4DCVA 4UNRA 1II9A 2RGEA 5LD2B 3QEOA 4QHTA 4TMXA 1IN7A 4US1R 4N0DA 5EUMA 3UXMA 4WA7A 4NYMQ 3EG5A 2FPKA 1RRFA 1Q3HA 1Q3TA 1Q44A 2NG1A 3K9NA 5DYIA 2IYTA 4HLUC 5KU1A 2ANCA 4B33A 5A4JA 4OQLA 2QP9X 1DAKA 3WYGA 1G5PA 4DIDA 4HUTA 1OYYA 2OXCA 4UXJA 1GFIA 4BFSA 2GEDA 2ZI7A 4H1UA 4JLVA 4QJ3A 4EPTA 2YC2C 2OSBA 1FTSA 1G291 3L8ZA 4OQXA 2OE2A 1HE1C 4AYTA 2CBZA 5SZJA 3VKGA 1VG0B 2NGRA 1NVVR 3W5IA 4IDQA 1D6JA 2PH1A 1XTQA 3BERA 1KNXA 4TMZA 3KJEA 4RD6A 2OLJA 3BGWA 3TIFA 2J0SA 3CPEA 1E4YA 4OJQA 4PC7A 2WJYA 4BLQA 1P6XA 1Z0FA 4B44A 1ELOA 2H5EA 2IYVA 3LX8A 4Q47A 4A0FA 1GL7A 2CMKA 2WWGA 1XTIA 3OEED 3ZVRA 3KJIA 2D62A 4RD4A 1EFCA 2WSSD 3KJGA 2JGNA 2PZEA 3OESA 4OK5A 3THOA 1XPRA 1CULC 2GF0A 2O8CA 3IQWA 4C0KA 4TSFD 5LBIA 2WVJA 1IN8A 4B75A 4TWZA 4OHXA 1HYQA 4M1OA 4ZKDA 1JNYA 1OKKA 4JL6A 4FMDF 4CEIA 1ZM9A 3VTKA 1MT0A 4UJ5A 3QXSA 4B47A 4Q4JA 1A1VA 1N6PA 2BM1A 3SJZA 2H16A 2ZITA 3PFIA 1GWNA 2YWHA 2JEOA 1WF3A 3PUZA 1OXTA 1OPXA 3Q85A 1RRPA 4B32A 4DLSA 3CH4B 3IPYA 3X1DA 4O3MA 1W4RA 4GOKA 3GJ3A 1KOFA 1BYIA 3IIMA 1LS1A 1ZIOA 2R8RA 1BH2A 4TYWA 2OZEA 1M1YE 1KI4A 1XCPA 3L0OA 2QP4A 4B2LA 4JL8A 2QENA 3IHLA 1KSFX 4DCUA 4PZYA 5FH9A 5J5CA 2FX3A 821PA 2BHRA 4DEYA 4OKSA 5DI9A 5E95A 2XSZD 4Q9HA 1W36D 2QL6A 3T12A 1II8B 3PEYA 1QVRA 1XD8A 1SVLA 4DZZA 3A58B 2CCGA 2DCUA 5EE1A 3EPKA 3BB4A 1LW7A 3J81k 3HP1A 2OO7A 3SE0A 1IONA 4QC2A 2IYZA 1XD2B 5BYJA 4AG6A 1OFIA 2GAOA 1E0JA 1LTQA 3SU8A 2RGCA 2VSFA 2FE4A 5HPYB 1IOZA 2GF9A 4LJ4A 1KO5A 5M04A 3B13B 1VG1A 1Z2AA 2ZYVX 4MKFA 1CJKC 3VAAA 5J47A 2A30A 5AJXA 4L16A 4LHYA 2PJRA 4C7OB 4JL5A 3W3AA 1G8GA 4IEIA 4R2IA 2DB3A 1FTNA 5IK2D 2XSZA 3WHKA 3OF5A 3TUZC 1P75A 2Q3HA 2ZREA 1KIMA 2W83A 3SS8A 3NH9A 2BV3A 121PA 1BKDR 2QMOA 2NO0A 4MUBA 4NCIA 1DEKA 1R8QA 4OQMA 5FR1A 3CRW1 2LKCA 2OEPA 3W8NA 4LHWA 3O47A 3CF6R 2CEAA 4LC0A 2WV9A 4IVQA 2ZUBA 2Z0MA 1PLKA 3DVLA 3I8XA 1E3MA 3C16C 4S2EA 1IBRA 3VR1A 3PCRB 2FPLA 3GLIA 2NO6A 1PUIA 1JEDA 4IVRA 2ORIA 1NSFA 5DO9A 2C8VA 4JBYA 1F6BA 1P9WA 3GJ0A 3U3KA 2XX3A 1W48A 1GITA 3LLMA 2VIIA 2J59A 4J0QA 5JHGB 3ZJYA 3U44B 4JVMA 3AP3A 3GPLA 2FZ4A 3RSLA 3UMFA 4TL9A 2J87A 4ILEA 2AFIE 5J4VA 4KBFA 3EC1A 3M0EA 3PENA 1RYHA 1VG9B 1DVRA 1G5TA 5CITA 1NIJA 1N2CE 2C78A 2NO7A 3NEYA 3RRMA 4EAQA 3RS2A 3EIEA 3LXXA 1JQLB 5DSZA 1P7CA 1XFAA 3GEHA 5H70A 3KXLA 2WJJA 2C03A 4MGYR 3SEAA 4KFSA 4TMWA 1Q1EA 1DADA 4NPHA 3SI7A 5LPNA 3OE7D 4ZCLA 1W47A 1LF5A 2JLSA 2QUZA 3DOFA 2C96A 3KB2A 1OLOA 3K0AB 4YMVA 3VR5A 2CDNA 3EC2A 3BBPA 3GLGE 2WM9B 1W5TA 5D3QA 2XTNA 2ATXA 3IO5A 1MO4A 4A4DA 2BMJA 4O2LA 2R62A 1P62B 1KTVA 2ZRNA 1Z6XA 4HAZA 1DOAA 4R98A 1UF9A 5TDHA 5C4GB 1XTJA 1T5LA 4GDFA 4EKDA 3O8BA 5CK5A 4JYBA 4MRPA 1KYIA 1E1QA 2YWEA 5F98A 1E99A 2E87A 4IDOA 1OIWA 4JS0A 4B3FX 1EGAA 3LW8A 4GT1A 3MWJA 2GWHA 1US8A 3RVBA 1Z8FA 4KLZA 3CNLA 2QN6A 1Z6YA 2OAP1 4YDHB 1R5OA 1ZUHA 1ZINA 2GK7A 4WBSA 1KMQA 1XXHA 3T35A 4QG7A 3N2EA 4Q21A 1AGPA 2VHJA 2NZ8A 2G83A 5CYPA 5JFGA 3HJNA 2IEYA 5CJPA 2DHRA 5KDLA 1W36C 4C0QC 4ZDKA 2XZPA 2Y8EA 5E7IA 2OFOA 3CONA 4QRHA 4LBZA 3AVUA 5CDFA 3SN6A 2QY9A 3SBDA 3WRXC 1UFQA 2IHBA 2QNRA 5H8WA 1AZSC 4YQFA 1EK0A 3FDIA 3U6KA 2WAXA 1T3SA 3CX6A 4F4CA 4XD7A 3NH6A 4ASUA 4V02A 4Q5IA 5HR5A 1CLUA 2A7QA 1XEFA 2QG6A 4Q1BA 5KHOC 4GSYA 4ZDJA 3HU1A 4JMPA 3CNOA 4B3XA 1VCNA 2J7KA 1N6HA 1RZ3A 4R7ZA 5J4HA 2F6RA 4BZQA 5JBQA 3ASZA 4AK9A 4Q4HB 2QPOA 521PA 4C0SA 5EE5B 4DKXA 4KSCA 2ZR7A 4E03A 5FTLA 1X3SA 2DYKA 2GEVA 4D0NA 4LYAA 2ZRKA 1BO6A 3BS4A 3C8UA 4URWR 4BFZA 4BZPA 1G19A 3KDSE 1UBGA 4QKQA 4DLZA 3WP1B 2REBA 2AN9A 2AL7A 4MDFA 1RFLA 2HXYA 4JLDA 1AZTA 1SHZA 2PEZA 3L2OB 3KKMA 3U7FB 4XWAA 3ZH9B 1AKEA 4E07A 3K0AA 3MFYA 4A9AA 2BKEA 2H17A 5TB5A 5J4YA 4C0LA 4MH0R 1TMKA 2X8AA 4OJKA 4CEJA 3QXJA 3AUXA 5FBVB 1G5RA 3GLHB 2JLQA 3GLIE 5DN6A 4M21A 3CRMA 2Q0HA 2XZLA 1OSNA 3KX2A 4IOMA 2DWQA 4D26A 5GADl 1NMYA 4Z8XA 1OJLA 2CXXA 1G3RA 1PLLA 3PQCA 5JSZB 4LI0A 5L3SB 1OH6A 2OBNA 5K8TA 4G3XA 3A1TA 3U44A 3HPRA 3ZZ0A 3SNHA 1KI3A 2REXB 5HZHA 4F92B 1ZC3A 2F1IA 2NOAA 4LYHA 1TU4A 4XTRA 2OLKA 2QORA 2G3YA 4M22A 1CR4A 1JXOA 1RJ9A 4ACBA 5J4KA 4Z1MD 5E7JA 4TLBA 4AI6A 1VTKA 1DG3A 3VU9B 2XNSA 1S3GA 2P6RA 1X8JA 3TSZA 2V3CC 3SFVA 3VNVA 4XIGS 3EZ6A 1GNRA 4LV8B 1O3YA 4GMDA 2AR7A 1XD2A 2ATVA 2YHSA 1N6LA 1SULA 4IOLA 5KSZA 2WBLC 1SZPA 3CZPA 1JQJC 3C5CA 2ZUDA 3AGPA 4RJLA 1UKZA 5L3QB 3UMSA 4A8JA 2G77B 4KJZA 2QE7D 1NF3A 4OI0A 1KI8A 1ZNZA 2A5GA 4X8HA 5C46F 1G3QA 2J3EA 4PQYA 2KI5A 4DC9A 5L8VA 1IXRC 3DL0A 2ZSAA 3A4LA 4JKYA 4TN1A 1WBBA 3AVTA 4DSTA 1E1QD 3K09C 2QMHA 1OT3A 2RHDA 4C7OA 2ZAMA 3Q5EA 3ONWA 3N70A 4TT3A 1W0JA 4G5SA 1SKYB 3NDPA 5EUQB 2IF0A 5CYOA 3THYA 2ZYTX 4UKDA 2IUSA 1NG9A 1M8PA 4Q7KA 1E2IA 4AY2A 2AD1A 3QKUA 2IT1A 1LF0A 3QENA 5CB8A 3FFAA 1AQYA 1K5GA 1WE2A 5AJWA 3B2EA 2WICA 1II8A 4Q7LA 4QGAA 4RCYA 5P21A 3AF2A 4AC9A 1PZNA 5FPSA 3REFA 2R9VA 1D9ZA 2P65A 5CDFE 1HA3A 3IKJA 2JDID 1SVIA 1A5TA 2HUPA 2ODBA 3I3SR 2RGAA 2CE2X 2IS2A 4HEJA 3U3OA 4LZZA 2BM0A 2WKQA 1VCMA 4L5BA 4BLOA 1T0JB 4UNSA 4BLTA 4AD8A 2ZM5A 3OEHD 3R9WA 3B1VA 2GAAA 4JBXA 4Q4AB 2ZAOA 2VP9A 3ZDQA 1J7KA 3VFDA 4YLGA 1U8YA 5KUTA 3GJ6A 4KU4A 2Q3FA 1OB5A 2FSIA 4EQ6B 1L7VC 1EX6A 2V6JA 3KTAB 1J8MF 4N1AA 1YE8A 2B7BA 1HV8A 1E2NA 4PO9A 4Q9JA 1SXJA 2CLCX 4MYHA 2Z4SA 3CRQA 2HDNB 3QUSA 4FCWA 4CF7A 4LBWA 3GFPA 4OHZA 3R7WA 1CR0A 1XMSA 3K1JA 5FOTA 3BC1A 1XPOA 2IYXA 1CF4A 2BVNA 1NVXQ 1GOTA 5DIFA 1COWD 4LV5B 4YXWA 4G5RA 4M1MA 4HZUA 1G7TA 2ZSEA 1EFRA 1XMJA 3KKOA 3WNBA 1KI1A 1MKYA 3KQNA 3TVDA 2WPDD 2PT5A 1RRGA 4JKIA 2QBYB 1SVOA 4B2PA 5KSYA 4YC7A 3EZFA 1E2LA 1LY1A 2YZ2A 2BCGY 2EWWA 4OI1A 1ZIPA 3I4LA 1D9XA 2IYUA 1MH1A 3THYB 3P4YA 4HB2A 3LD9A 4L9WA 1AGRA 2Q3MA 3MMPA 2EWVA 2DWPA 4HAYA 2AHOA 1VKJA 3TAUA 5FI1B 3IPXA 1P2UA 4EUNA 4CZ2A 2GCOA 2GNOA 5FUVA 1IAQA 4C30A 5GJBA 3GJ5A 4Z51A 4R71A 1AKYA 1E32A 3FTQA 3RANA 4O2RA 1R4AA 3GQBA 1FMJA 4QBHA 3GLIB 2Q21A 3P20A 4AURA 2IEZA 1N6NA 4MQBA 3D7MA 3OIYA 4P4SA 5SZIA 2YOFA 4B2IA 3ZIAA 1N5LA 2HEIA 2KBEA 3JVVA 3V9PA 3EPHA 5B58C 1HQYE 2G1JA 2ZIAA 4PZZA 4C4PA 4DLVA 1F5NA 1MO6A 4NYIQ 2PL3A 1SQ5A 2VLIA 4G1UC 2V4ZA 3AKCA 3CKLA 3JZAA 3P32A 3W3ZB 1GM5A 1Q12A 1NVWQ 3I1FA 4A0RA 4GMXA 4ZCIA 4EJSC 4A8JC 2ORWA 2W6ID 5B64A 4TQAA 2X2EA 2ZJ8A 2XJ9A 2FSHA 3WMGA 2VRWA 2A5JA 3A4NA 2HXSA 3AF1A 3EWAA 2QRNA 3QXHA 4Q9LA 2ZJ2A 3RS0A 2QM8A 3T1VA 3I5YA 3SJAA 5J40A 1JAHA 1ZNXA 4JLBA 4TZ0A 3ZVMA 1VYVA 1G8PA 2QT1A 2VA8A 2RGXA 2JASA 4ZDWA 1KI6A 4D4JA 5C18A 4HAXA 1G6OA 2ZRMA 3DHWC 4A6PA 2OAQ1 1NNEA 1F2TB 2NQ2C 5DLQC 1UPTA 5JS7A 4A2WA 4ARZA 4C0JA 4LV6A 2GEUA 2G0NA 3OEHA 1Q22A 1E6CA 4DUGA 1PUJA 1Z06A 1Z07A 3M1IA 3B85A 3I72A 4WXRA 5TV2A 3K0CC 2DR3A 2FN4A 5ELXA 3OIUA 5F9HA 3UG6A 2UZ3A 2JJ2D 2A3RA 1E2FA 1HT2E 1SHKA 4QHYA 5KNBA 1NN1A 1YRBA 1TAGA 5EP1A 2OCYC 1AN0A 4NYIR 4MRNA 3KKQA 2XXAA 3NTUA 4KHZA 1H65A 3FVQA 4L8GA 1SVSA 4M1WA 2FGKA 4KVGA 3TJZA 2MSDB 2BJVA 5B2ZA 3WMFA 2IF2A 2GZHA 2RAPA 1RKBA 4HI0E 2XTMA 2ZE5A 4FIDA 1EFRD 4P31A 2X19A 5AR1A 4WZ6A 3VKHA 5JJKA 1W49A 1OYWA 2Q9BA 3TNFA 4POAA 2RHMA 3K70B 2BC9A 2FG5A 4TYPA 5HCNA 5FUWA 4ON9A 2WJHA 1HY3A 1ZAKA 3TR0A 2P67A 1A7JA 5DI3B 5EP4A 4Q9KA 1ZU4A 3LVQE 4ABYA 3GLFA 3I61A 1KKMA 4QFMA 3PUVA 3D31A 5EXSA 3LLUA 3QKRA 3BRWD 4DSUA 1UBFA 4N3NA 1S4QA 2BMEA 4OBEA 2WMOB 3B6EA 1LV7A 1SXJE 2ZQ5A 1BS1A 1W1WA 1VIAA 2CK3A 1S8FA 1OHHA 2GZDA 5CM8B 2OG2A 4EJSB 3OAAD 3BJIC 3LDAA 1CS4C 1ESNA 3UPUA 2NIPA 3K0FB 1OH8A 2IL1A 1L8QA 2ZXUA 2O0JA 1OFUX 1IY2A 1QZXA 2ZANA 3WHLA 1DE0A 1W7AA 5FPKA 3LNCA 4GP7A 4LBYA 4ZKEA 3SHWA 1GILA 2FFAA 1IY1A 4GRAA 2LKDA 4LHXA 4PZLA 1UKVY 4A6XA 2ZS9A 1TX4B 1NI3A 4GBMA 3TSWA 1NRJB 1E9RA 1VIYA 3F3YA 4Q18A 1NG1A 3C15C 2G1KA 1Q0UA 4B48A 4QNRA 4OQFA 5CIWA 4M9XA 4WZBE 4IFBA 1NBMD 4OI2A 1ZBDA 1E2PA 1W0JD 1KNQA 1N0UA 1Q1QA 3UMRA 3ZS9A 5JI3E 4MDEA 1XWIA 3MWLA 1RPZA 1QHNA 2WIBA 5JJIA 2OCAA 4MGKR 4JT4A 1DPFA 4HAUA 1GRRA 2O8DB 1KJZA 5TXGA 2CLDX 2VQSA 4BLSA 4TTRA 4KAXA 1Z0AA 3QKRB 4IDNA 3FYHA 4M1YA 2P3SA 5DI3A 1E2JA 1E79D 5CLLA 1OV4A 1A2BA 1Y63A 1TQ2A 3EA5A 1A4RA 3CWZA 2WKPA 1QHHA 4LPKA 1AK2A 1C4OA 3BB3A 2ZRLA 4EPVA 4A82A 2WWWA 2IS4A 3CW2A 2QTHA 1EFUA 2QPTA 4HDOB 4KLNA 1R8SA 2BDTA 3W6OA 1JR3D 3IILA 2O0HA 4U5XA 3T1TA 2JLRA 1J90A 5TMPA 3ZGXA 4NZYA 4Q7JB 1JALA 2J7PD 2QE7A 4Q1CA 4G5GA 1XRJA 2V8OA 3JVUA 1WBDA 4WXPA 4NCHA 4PPNA 5FUYA 3U3MA 1VG8A 2P6UA 4MRSA 3VR4A 2O0KA 1Z0IA 1P61B 1KI2A 3OE7A 1W36B 3LW7A 5BQ5A 1SXJC 3QPWA 2CHVA 5AWFC 3Q7PA 1CJVC 1KJWA 3H0KA 2PEYA 2UZIR 5IHPA 4PC6A 3SHFA 3T15A 3CR7A 3X1WA 2RCNA 2QEQA 2P6NA 1S1CA 1YZKA 2BOVA 2CLSA 2CJWA 3IIKA 1P60A 3S1AB 3C7KA 5E3HA 2E1RA 1RYFA 1GRNA 2CL6X 2GXUA 3B5JA 2O8EB 2JLZA 3FMPB 4OI4A 4OHWA 2FEOA 4DJTA 1EWQA 3OFND 4BPBA 2QM7A 3K9LA 2CL0X 4JBWA 3SDZA 2F7SA 4KCGA 3OFNA 4I1OA 1X86B 4S35A 2Q9AA 4A92A 1XCGB 4H9GA 5JJLA 1QRAA 2N46A 4D2IA 1CRQA 3A37A 4LHVA 1T91A 3CLVA 1KK0A 3DZDA 2FJUA 3G82C 3UATA 3MG9A 2O8FA 2KWIA 2ANBA 3ASYA 3MUFA 1LVGA 1EG7A 1HTWA 4IHQA 4ESVA 5JWRA 3SQXA 4URZR 4URUR 3NBFA 3CIOA 4Q19A 2EFEB 3LBNA 1YKSA 2E9SA 1FNNA 1WMSA 3GJ8A 3RRZA 2HYIC 4QM7A 2VYFA 1OIXA 2FDCA 4RZ3A 2R65A 2HYDA 1JPNA 2GVZC 4LJYA 421PA 1NN0A 2QQEA 3VX3A 1U9IA 1ZM7A 4AKHA 1U0HC 2IBMA 3A1WA 2DPXA 4QL3A 4HZIA 1VCIA 3UWOA 3R8FA 3FHOA 4M8NE 1MABB 2B6HA 1IQPA 2IC5A 4DLYA 1T9HA 5KPJA 4RZXA 4Z54A 2J0UA 4JZKA 3EZ7A 3KQHA 1JAIA 1QG2A 2J46A 1E79A 3FMIA 1R0ZA 1P5ZB 2GKSA 1HH4A 2A5DA 3EIHA 3PEUA 4XSHA 4B74A 4FI3C 1TPZA 2IXEA 2FZLA 2N42A 3QE0A 3B7GA 4A2QA 2KJQA 4BZXA 2GZAA 1KO1A 4B71A 2ZRBA 3QI2A 1KK2A 1TNDA 4MKIA 5K8LA 3GLFB 2DFKB 1D8TA 3GLHE 2ZI6A 3RS5A 3CPJB 4A1FA 3TUJC 3KQLA 4Q01A 4K46A 4JIMA 621PA 3WXMA 3LBIA 4UQOA 4DDUA 3CF2A 4DLUA 2RGBA 3IBGA 1NIPA 3FFBA 4QM6A 2R6GA 1MRSA 4AIIA 1GSIA 3ZD7A 1PLJA 2FFBA 4BFWA 3PEWA 4TL7A 4V0OA 4EQ6A 1TQ4A 2IS1A 1W2GA 4II7A 4L4UA 5C1BA 2EFCB 3FOZA 2F1JA 1IXSB 5K8IA 3WBJA 2VP4A 4HB4A 1H8ED 5HCIA 3R8CA 1B23P 3KUDA 4C3ZA 2Z6VA 721PA 1HEIA 1ZU5A 5FOSA 3ECCA 3WNCA 4U00A 5G3ZA 4WOPA 3SYLA 4BFVA 4JYCA 4DDWA 5FR2A 5IT5A 4AKGA 4QJ4A 4UNNA 1Q21A 4ZIRA 1S9HA 2CCJA 5JECA 4KBGA 4MUAA 2OESA 4L15A 3TSOA 5H1YA 2J0VA 3BAFA 1VYUA 3TQFA 2OCBA 3FKSA 2YNMA 1BMFD 1KJYA 4BRUA 4RKFA 2D2FA 3EXAA 4WVFA 4XSGA 2V7QA 2IHYA 1E9BA 1N5IA 4F4IA 1UM8A 1U0LA 4DRZA 4RD3A 4W5JA 3U7GA 2F3RA 5DYGA 2VHCA 4D81A 4KFTA 3TQCA 2WZQA 4MITA 1FFHA 3TMKA 5DHFA 4ZI3A 1R5NA 1WXQA 5KTYA 3CX7A 1E0AA 1CJMA 4RD2A 2QTFA 2WJVA 3AKDA 1E4VA 4GOJA 3HPQA 3K09A 3GCGA 4GOXA 2H1LA 3NEJA 1OKKD 3N5CA 2QI9C 1VHLA 2QMUA 3QOFA 1VHTA 1MR3F 1FP7A 1II0A 3B82A 3CF0A 4V0NA 2ZVPX 4DLWA 3LY5A 4X8LA 1KK3A 5CK4A 4OK3A 3L82B 1AA9A 4QBIA 1KZ7B 3B1ZA 3NWJA 3C4JA 4Q1DA 1R10A 2EFHB 4QXAA 3EWSA 1YR9A 3AF3A 4LGMA 5FUXA 2I3BA 2ZS7A 1DAHA 2DFLA 2GXSA 1R5BA 4AWXA 4JSTA 4A15A 2B8TA 5EXPA 2CCKA 4W9MC 3AVYA 3RDPA 4V0KA 3LQQA 1NN3A 3Q8XB 3DM9B 3ZYCA 1QBKC 4B3BA 3ADBA 3THWB 4DBLC 5BN4A 1LNZA 3EX7C 1N6IA 3BIFA 1G21E 1L2TA 3FHTA 4PANA 5JLJA 3ICEA 2Z83A 5KNCA 3VHLB 1GKYA 1OXSC 4UNQA 1L4UA 2C98A 3AVQA 1QF9A 3AKYA 3ND9A 4PSVA 4Q7MB 1QHYA 3HR7A 1BYUA 3EZ9A 3RABA 1VMAA 1FP6A 3OHMA 2QMEA 3DKPA 4LJAA 3QVUA 4PC1A 4ZPXA 2P5TB 2RGGA 2JJ1D 4QBGB 5EQTA 3EAQA 2ZVQX 3EPJA 2VHUA 1R2QA 1T3HA 3DDCA 1G8FA 3D8BA 2WSMA 2ZI4A 4XH9B 3KQKA 1IN6A 4E09A 4FMCB 3TUIC 2ZRPA 5C2JB 1G6HA 4DT1A 4P4SB 1S1MA 4LYFA 3VR3A 1P3JA 3CNNA 1NBMA 3CUEF 5CM9C 2R6DA 3MWYW 1AQUA 2O8BB 4MGIR 1IJFA 3B9PA 4TLAA 3PG5A 1JBKA 2IYQA 3SR0A 4QHSA 4TQUS 4PQRA 5AK0A 2YV5A 3QG1A 3M4YA 2X1VA 1SXJB 2O8DA 3U5ZB 2QPAA 3RRYA 1T8TA 3GMTA 2ZTSA 3VR6A 2NO9A 3F0TA 1XNJA 2NO1A 4RSGA 4EPRA 1Z0JA 1Z47A 1EWRA 2FH5B 2QAJA 5G40A 3BFVA 3I8SA 2WPDA 1NKTA 4TMTA 5EXXA 3MGCA 3W5JA 4CEHA 1X1RA 1ZUIA 1E2EA 4HLCA 1TU3A 3KJHA 1K5DA 1O87A 4K8OA 3GLGB 5FI0B 4NYJQ 3PUXA 3O8CA 2QSYA 1G3UA 4B76A 4CEIB 3QVVA 3EIQA 5JRZA 1I4LD 2EVWX 3Q7QA 2ZE7A 3EA0A 4RFSA 5DHAA 2D7CA 3NBXX 2D7DA 4US0R 1GAJA 4GI7A 1KO7A 1SKYE 2GCNA 2XTZA 2AWOA 2A5FA 3MJHA 4MYUA 1WQ1R 5KDOA 1IXZA 4G01B 4OQNA 4PTLA 3REGA 2ZE8A 4DEXA 4B3GA 3B1WA 1C9KA 3QY0A 4FXPA 1BOFA 2DFTA 1GL9B 2ZSFA 2PZFA 1G3IA 3M6AA 4NCNA 1CR2A 4LY6A 3DEFA 3KKPA 3PVSA 4DB4A 4PSKA 1XEXB 3FE2A 1TL7C 1I4DD 1M74A 1MO5A 2IWHA 1YR6A 5GJWC 2FPMA 3ZZUA 1NVUQ 1HT1E 4JVSB 4D4LA 2WAYA 3O8RA 2IK8A 1K8RA 2F9LA 5KPDA 1VDZA 1US8B 3AQ4A 2TMKA 4LYJA 1VECA 1W4CA 2ONJA 3T5DA 3BH6A 1FZQA 5FBQB 2LWIA 2ZPTX 4U7DA 4EFMA 2ZRAA 2YWFA 4HSEA 1WP9A 2WWFA 221PA 5JWOA 3NDBB 4M1SA 3FHCB 3EPLA 4YMWA 3A4MA 1XTKA 1YZUA 1KAGA 3KXIA 4IJMA 5SZHB 2PBRA 1JI0A 4UXHA 1KKLA 4HAWA 3T1QA 3VR2A 4G5OA 1YZQA 3PJRA 2A2ZA 2J0QA 3K70C 3L0SA 1CIPA 2GBLA 4BFYA 1N5KA 5G3YA 1G4AE 3I5XA 1U8ZA 2WKRA 1KDPA 2RMKA 2VP6A 4Y0AA 3MLEA 4BWYA 2OXRA 6Q21A 4TYNA 3R9XA 4H1VA 3EZ2A 4M9QA 1NLYA 2GILA 3NKVA 4ZI2A 5L3VA 3OAAA 3RYTC 3UG7A 1YZNA 2WHXA 5F3WB 2IYSA 2HCBA 2J41A 4TTQA 4XVUA 2ZRHA 5HE9A 2ZS8A 2D74A 4DT1B 1UBEA 2W2TA 4M0LA 1D2NA 3THXB 4L9SA 1P2VA 5KNDA 4LBVA 5EJEA 5LDDC 1XDBA 2UVQA 3OEEA 2WTUA 1U81A 4URVR 1DO2A 2WWHA 5EZ6B 1YZLA 2AXPA 4UJ3A 3T1OA 4DDVA 5BWMA 1SVKA 2IWRA 1F2TA 2ZRJA 1H8EA 1NY6A 2BBSA 5G53C 2JIZA 1JXMA 3THXA 1CJTC 2O5VA 5HKKA 1I2DA 2F1RA 3MAAC 4V0LA 2ODNA 3FMOB 4F93B 1C1YA 4XJXA 2F43A 4JLAA 2OHFA 2IXFA 2K5UA 3NC0C 5KSOA 2GCPA 1XXHE 3DOEA 2DFNA 2VH5R 1P9RA 4LCBA 3AVPA 3QKSA 4KFRA 1YU9A 4LPSA 5FBWB 1WA5A 2D06A 2FFQA 4JVLA 4NCKA 4TLDA 3RAPR 5D3MB 3NHBA 4LOAA 1X8KA 3VQTA 4TZ6A 5DH9A 4DLXA 3K9GA 1N6OA 4FCVA 4WIAA 1U94A 5BN3A 3OIWA 5LD2C 2HV8A 2BBOA 1NBME 3KXKA 3H84A 3VNUA 1R7RA 2OV2A 5IDVA 2PLFA 1YR8A 2JIZD 3G0HA 4PC3A 1D2MA 2ZI5A 4Q03A 3UANA 2W6IA 3K53A 3H2YA 4ZDIA 2C5LA 3MSXA 4HAVA 4IXNA 1RRCA 3A8TA 4DIEA 1T8UA 3VX4A 2D3WA 3SJCA 1S0UA 5FFMA 1Z08A 4TTPA 3RLFA 1NLZA 3BD9A 1E9CA 1OFHA 2FU5C 5FL7A 4I4LA 4DLRA 2GXAA 1Z83A 1ZD1A 4DWJA 2UKDA 2WJGA 5EE0A 4F38A 4XWOA 2V1XA 1ETUA 4IW3B 2Z5FA 4WZAE 2OFXA 2HJVA 4B3DA 1A2KC 2XB4A 1UDWA 1TF7A 3MD0A 3QKTA 1SGWA 1ANKA 1GIAA 2HT6A 3TE6A 1TTTA 3L0PA 1G18A 2YOHA 3PITA 2JATA 3FKSD 1NP6A 5LB2A 2XNDD 1FQKA 4PHFA 5F2EA 4LHZA 1JB1A 1ZJ6A 2GJKA 1FQJA 4F7WA 4CGZA 3IGFA 2Z43A 4YMTA 3ZLJA 5J4LA 3TR5A 1FX0A 2GVDC 3DMDA 3GJXC 2Z4RA 4HYYA 4C0BA 1E2QA 2PMDA 3KKNA 2MSCB 3R20A 4PFSA 3X1YA 3QF4A 2V1UA 1E98A 1LS6A 2ZI3A 3UK6A 1NSTA 5KOYA 4B6EA 1CR1A 5UKDA 3VHXA 3K0FA 4HUQB 1KHTA 1KDOA 1OW3B 4LUCA 4P33A 1OE0A 4KVAA 2C77A 2NPIA 3L43A 5JRJA 2QTVB 3ADCA 2CHQA 2BIFA 3NXSA 5EE9A 1OF1A 1XTSA 3ZZTA 1VPLA 1UKEA 1E0SA 1G1MA 4Q4JB 4KYIB 5FOVA 4U02A 2J0UB 2YWGA 2CNWD 4WAUA 2O8BA 1U90A 1IN4A 1Z5ZA 2BKUA 3R9IA 1TEVA 2JJ1A 4JLMA 4Q4AA 3WMEA 3IO3A 1Z3IX 3LA6A 5KYKA 2PJZA 1V5WA 4KFUA 3UIEA 3GLGA 2IA5A 1WB9A 3TH5A 1DAIA 3CPHA 4TLCA 4PO1A 1S96A 5DGXA 3ZS8A 2EW1A 3B9QA 4IXMA 2JLWA 4DUGD 5FBRB 4D6PA 1XJ0A 4ZV4A 4PQFA 1AIPA 1SXJD 2YINC 2ONKA 1ZP6A 2AK3A 2FEMA 4NYMR 3HR8A 1F60A 1S2MA 4BQSA 1W0KA 3FB4A 4WW0A 4D80A 3FKQA 1JR3A 3BFKA 1CEEA 1DG1G 3QXCA 4Q00A 1E1RD 3BORA 4NCJA 1UEJA 2ZRCA 2ZEJA 1DS6A 1DTSA 1ZRHA 1FPMA 1CP2A 1MV5A 1N3BA 3WYAA 1E2HA 4HDCA 1P2TA 2XOKD 1G4UR 1JJ7A 4RZUA 3AVOA 2W2VA 2WIAA 3EARA 4OYHA 5AUOB 4A0HA 2XAUA 1S3SA 1N6KA 3IBYA 2PMKA 1W46A 3AGQA 2V7QD 2EFGA 3B1YA 2AWNA 5L3SA 2JLUA 2O8EA 1YQTA 2HCJB 3GFTA 3TVTA 2FMXA 1W5SA 3QJYA 2WSSA 1MOZA 1UDXA 5FTKA 1VYTA 3Q3JB 4TSFA 4RKEA 2N1BA 1XZQA 3I32A 3QKSB 2ZJYA 2IUTA 4BASA 4KO8A 1A82A 1KSGA 1GNPA 4UXIA 4PC2A 1SVWA 3KZ1E 1J99A 4JT2A 3ICQB 1G8HA 3QNUA 3W9YA 2IYLD 5LB4A 3CX8A 1ESMA 1FUKA 3P27A 2QU8A 2V6IA 1OFTA 3LAWA 4B35A 5DN6D 4HDQB 3U60B 1W44A 3IEVA 4B6FA 3ADKA 1RJ9B 1E2DA 2C2HA 3DMNA 4MRVA 4NKRA 3QF7A 1Z28A 2HJGA 5H68A 4JJKA 1ZM3A 4LJ8A 5FPHA 1Z63A 3W6NA 3IDQA 2GBLC 3PIRA 2PT7A 3DKVA 1CXZA 1UJ2A 1MO3A 2ZU6A 3CRRA 1EESA 3PR1A 4M2LA 1G8YA 4NL4H 2C9OA 4NU0A 2BEJA 5JEEA 4JJZA 3Q5DA 2GESA 2HLDD 3QPUA 3MJRA 2HT1A 1ZD8A 2MMCA 5JCPA 3AVXA 2OM2A 2EYQA 3MCAA 1KI9A 4YMUA 2ZJBA 2MMGA 5BN5A 2QRZA 4OHYA 4BECA 2RH5A 4ESHA 4CEJB 3SBEA 1CU1A 1KMHB 2OFWA 3U4QB 3AP2A 1G16A 1YHNA 1M6NA 1RVDA 4IDHA 1SVMA 2XITA 2J5XA 3IQXA 4JLKA 5FOWA 3W6PA 1N0WA 1U0JA 2FF7A 2H7VA 2FGJA 3LV8A 2FV8A 1COWA 1P73A 2AX4A 1Q1BA 2OCPA 3U7HB 1JJVA 5KDDA 3QIAA 1GDDA 1E2GA 1SKQA 4XVQA 1TUIA 5FL7D 3WNDA 4JLJA 4XOIA 4BLPA 5JZVA 3TBKA 2ZYWX 4M4SA 4C9BA 2VHQA 4ERNA 1GZSA 1CRPA 2VP5A 3NBYC 1M2OB 2B8WA 5SZKB 4PHHA 3TW4A 3PV0A 1GVNB 1TEXA 3LFUA 5DE3A 4ZIRB 1FW6A 4YDSA 4C2UA 1E9FA 1EX7A 4IVPA 1KDTA 1XEXA 3T61A 2W2XA 4ACAA 3HYRA 3TRFA 4EPYA 3TAHA 2RGNC 1HURA 2BBTA 2XGJA 2JJ2A 1CBUA 1OXVA 4Q1FA 1CJUC 4PPFA 1MABA 3KFVA 1HE8B 4P0TA 4RZ2A 5FTJA 2YOGA 3ZQJA 2J45A 2BJWA 3QF4B 4TL6A 2RGNA 4FMCF 4Q48A 4TL8A 1YJ5A 1UAAA 1JEEA 4FCTA 4HUQA 5JCZA 1ZM4A 4BUJA 1DBSA 3AEZA 1MRNA 4EIWA 1J2JA 4QBFA 3LBHA 2O52A 1N25A 4KV9A 1JR3E 3EW9A 3QSYA 3HDTA 2G88A 2P5SA 2ZRDA 4YONB 3CH5A 3RSOA 2XOKA 4Z8YA 1N5JA 2C9CA 5C4MA 4NBSA 4XD7D 4ASUD 2NZJA 5EZ5A 4JLOA 4URYR 5GVRA 2BMDA 2CHGA 5FTNA 2C9YA 2AKYA 5GJVC 3IHWA 1KY3A 4I1SA 4NHOA 1Q20A 3UWKA 4YMSA 4TYQA 5JMTA 4ZCMA 3WYFA 1UKYA 4B73A 4LC1A 2ZR0A 2H57A 1OXXK 2B7CA 2BMFA 3ETLA 3SYNA 1E96A 4R9UC 4X8OA 4US2R 2WWYA 3W8RA 1XU4A 2EQBA 1GRQA 2VP0A 2V9PA 2ASEA 3AP1A 1G9XA 4RY2A 3T5GA 2R2AA 3QPVA 2I4IA 4CVNA 4DLTA 2KB0A 3W90A 2EFDB 2IW3A 4B34A 4I81A 2FA9A 4GNKA 3A1SA 3DZ8A 4I1UA 5G41A 2F3TA 1YZTA 4HATA 2A5YB 4PAOA 2IYWA 4BFTA 2YJTD 4CRWB 1G7RA 2JDIA 4LJ5A 4CIDA 1NMXA 4MKGA 2IYRA 2GJSA 1QHXA 5TARA 1FL9A 4M53A 1E9AA 1R0WA 4LJ7A 1IY0A 4BRWA 4RD1A 4M9SA 3SJBA 3LVRE 1XZPA 1KMHA 1XCMA 1CKEA 4TMKA 3NIBA 5FL3A 3U4QA 1DAMA 2QGZA 1ONBA 4NTZA 3X1XA 4D4MA 3IEUA 5HTKA 5A5GA 1ODFA 5AUNB 2W58A 3SFZA 2GK6A 2HLDA 4F91B 4LSGA 4A2PA 1E69A 3U3RA 5GVSA 1R0YA 1IJEA 5ANRB 2QP3A 2RGDA 1EXMA 1D5CA 1OH5A 2ZSBA 1KGDA 2FSFA 2QA5A 3RRNA 3GD7A 3W34A 2IS6A 1DAGA 1F2UB 1Z2CA 2BBWA 2D4HA 1FUUA 2ERXA 3IUYA 1TQDA 3C41J 1HQCA 1ZD9A 4AYWA 3CRVA 4Q1EA 3PUYA 4A36A 3A1VA 3U6BA 3BH7A 3V00A 4ARZB 1GKUB 1AJEA 1Z29A 2QROA 2W6JA 2V54A 3LRPA 4CT4B 2CJWB 3K0EA 4NYJR 1B0UA 3S1AA 4CDGA 3DM5A 2NMVA 1WDTA 1RIFA 1U9IC 1NLFA 4FWTA 4D0LB 1OXUA 1AM4D 1P2SA 1HUQA 1R6BX 5FOUA 5JEDA 2QGNA 3KQUA 2OBLA 3ZD6A 1Z6GA 4DDTA 2BWJA 3KB1A 1KAOA 5DISB 4BEJA 1PV4A 4NONA 1U2RA 1TADA 2J9RA 5TVKA 3CR8A 3ND8A 4CYMA 5BYKA 4I1VA 4RD0A 4EFNA 1T6NA 2VSXA 2QSZA 3TLXA 1V43A 1QHHB 4OL0A 4PHGA 1LB1B 2FWRA 2RB4A 3F8TA 3GEIA 5AJVB 3F5FA 4DCNA 2IX3A 3RNLA 2I1QA 1YR7A 2W0SA 3CZQA 3V4RA 1T0HB 2G0TA 3SOPA 1E9SA 1ZM2A 5TY0A 5GJCA 2PCLA 2REOA 4DSNA 1XMVA 1TUEA 3U2QA 2ZU0C 4NH0A 4V0ME 1RC8A 1P9NA 4AKIA 1EFTA 2EYUA 4DVGA 1FNMA 4JLNA 4DSOA 1TF5A 4GFDA 2VPPA 2W00A 3TKLA 3R7WB 2FNAA 2WWXA 2X2FA 2CK3D 4EFLA 1KDRA 5B30A 2QZ4A 3TK1A 2PLRA 3QXXA 3H86A 1OH7A 3BK7A 4PHTA 1P4SA 1YRAA 3AKEA 2JA1A 4I99A 1ZNYA 1Q57A 1FOEB 5BXQC 4IEEA 2VBCA 1E2KA 1N6RA 3LO5A 2KSQA 4KYUA 3NG1A 4KITB 3HYTA 1T5IA 1ZCBA 3HU2A 4Q9IA 1GKIA 2H8KA 4LX0A 4TMVA 1G3MA 1PVOA 4LJ6A 2YVUA 1ZYUA 2QBYA 2AXNA 4MKHA 3O8DA 2JLVA 1QDEA 3AVWA 3RHFA 1XXHB 4TT3D 1WCV1 3K9HA 2VHTA 2QT0A 5AJYA 3GP8A 2VO1A 4FWIB 4ZO4A 4PO8A 1Z6TA 2CNWA 1Z0KA 2FOLA 2MSEB 2VSOA 2AK2A 1FX0B 2IXGA 3FWYA 1XX6A 5EXTA 3C5HA 5FBLB 1YVDA 1U8AA 5B57C 3A36A 5IF9A 4K81B 4Q1AA 2GETA 5IRCD 4Q66C 4NDZA 4PSAA 1E9DA 4IFEA 5HZKA 3ADDA 4QJ5A 3P26A 2JAQA 1IN5A 2W0MA 1G7SA 3BOSA 2BEKA 3B8HA 2WOOA 3HWSA 5JWHA 2F9MA 1CTQA 4KXFB 2CVHA 4QOSA 4IOJA 2ZUCA 1P72A 1KSJA 2R6CA 3SC3A 1NN5A 1XB2A 3OIVA 2J7PA 4BEBA 4BFUA 1WRBA 2QAGA 5E4FA 3GLFE 1VCOA 5FPYA 3BE4A 1E1RA 2EU8A 3LH5A 2GDJA 3K70D 5F9FA 3CM0A 3PXGA 2PZGA 4EPWA 1G20E 2ECKA 3BWDD 3KL4A 2WOJA 4GZMA 3RC3A 2QQ0A 3DPUA 1T4GA 1L4YA 4XTCS 3MWKA 1EFHA 4A8JB 4JSYA 3G5UA 4D25A 2LCFA 2O8FB 4AYXA 4NE2A 1KSHA 2ZJOA 1XD9A 2PX0A 3BB1A 3Q72A 2R44A 3ZQ6A 1M34E 5CIQA 5EE3A 4G0NA 2DY1A 2HF8A 3U3JA 4QGHA 4DCSA 1Z22A 3AF4A 4KODA 4A0GA 1KI7A
chains in the Genus database with same CATH superfamily
3FTCA 3G9ZA 4QYMA 1NWCA 2WU8A 4BO0A 2JK1A 3E2IA 3GEEA 4Q4CA 4Z4IA 3PPWA 1JEJA 1PD1A 2CSUA 5JCOC 2ZTMA 4P4UA 1RADA 1IBSA 2AFHE 2X40A 3VZBA 1SD1A 2GPYA 4M88A 1G63A 1UXKA 1N5RA 2QY6A 4Z6KA 2NU6A 3RS4A 3FX2A 3UGQA 5FYDA 1J6UA 2GBFA 3S44A 4N0EA 4DHEA 3AJEA 3G5LA 5EIAA 2IIQA 1CEYA 2JI7A 1G41A 4IOKA 1QP7A 2JZOA 4YCJA 1P7ZA 5DLDA 1PEDA 3PJFA 2XB2A 3T1HB 2OVBA 3BGSA 3DOIA 4ND4A 1AKUA 5LC1A 1QH1B 2Q9CA 4MI3A 3B8EA 1AS2A 1NXXA 1WJGA 1LLFA 2AN5A 2JB9A 3OPVA 4LRWA 1JWAB 1VM6A 2B0JA 3IEIA 4HYEA 3VR0A 1LVUA 1KFCB 1NVVQ 2GCOB 2ZRGA 3PJEA 4HB0A 1OWMA 1TLTA 2II6A 1IM2A 4X61A 3DTVD 4DC1A 4GL2A 3K2EA 4FGSA 4NBWA 1F9AA 1GNQA 2XKJE 1KH1A 3GLHA 3OZ7A 2XNDA 4Q02A 3D6NB 5IFLA 2OV8A 4DTIA 3DKKA 4LOLA 2GN0A 4D46A 3TDKA 4GUDA 1GUAA 3QYAA 4MICA 1HE3A 1J2UA 3B6ZA 3OPXA 1BRMA 1R6TA 1GG2A 1GPDG 5A4DA 2B61A 1EHIA 2H92A 3ILSA 2WW8A 2ZJ5A 5MN4A 3HBLA 3AUYA 4B43A 8OHMA 2VOJA 1ORWA 1UANA 3KWFA 4DV4B 2XHZA 4EF5A 4BE7B 1KTIA 1OHHD 1Q19A 4C3VA 1RW4A 2HF2A 4BQOA 4KDRA 3AJDA 3KLNA 1ZC4A 2EP5A 2GRJA 2H65A 3ACCA 1TO1E 3DOCA 3Q41A 4HH0A 5ALLA 2CXUA 2V03A 4DMFA 3SSOA 4BEWA 3IMFA 1DKRA 1THGA 3O90A 1TZKA 1AY0A 2P2LA 1M7BA 1I2MA 4WBNF 3CNQS 4LE1A 1U3GA 1C8KA 1I0ZA 4KQXA 5TJ9A 1I9GA 1T8YA 3AJ9A 3OPNA 3PD0A 5ADHA 3NGLA 1KQPA 3F6BX 4U5QA 1XDSA 5H80A 1NHGA 3RV3A 1E94E 5I7RA 2CXQA 3WGYA 5IPFA 1GY8A 3SF8A 2CWWA 2OOKA 2VDPB 3CWQA 4IGIA 4KDEA 4YRQA 4YXWD 4M0KA 2E7ZA 1YI1A 2QV0A 1ZKMA 3U4AA 2JGLA 1FLVA 1USKA 3A1UA 4Q3OA 2Y6VA 2YIJA 4KQEA 5CLJA 3SQOA 1YR1A 4LFBB 3IDFA 2LCQA 2JIQA 2PJDA 3QFCA 2XUKA 5KNCD 3F90A 1LCIA 4MYCA 5AUQA 5IDWA 2A33A 4FINA 1XJQA 1FLAA 1Z4OA 4RFSB 3WKEA 1L7NA 3DWEX 1MXFA 3O1HB 3I62A 1QS0B 3AC0A 4PY2A 1OZAA 1Y3DE 4CF5A 1DWOA 1FK8A 3F6PA 3IHKA 3N3BC 3HJCA 3QMPA 1WSDA 1KK1A 5IG2A 1CUCA 2ZYRA 1EMDA 3T3IA 3HKEA 3FWKA 5TJHA 1T1EA 4L27A 5EP3A 4E1BA 3V46A 1L5GB 2VL7A 2CVPA 4L6AA 5BSUA 1FDUA 1FXWF 3ROXA 3RS3A 1A9PA 5HKKD 2ZRIA 1FP2A 1K68A 1RABA 2LD4A 2YYZA 3H3FA 5TSDA 4EHFA 1U2EA 4IO0A 4MJXA 1TT7A 4NPAA 3V4FA 1EA5A 1UBTS 2I6GA 1V2HE 2WKSA 3Q10A 4FN5A 1ZUNB 3E82A 4EJSA 1CJBA 1N2BA 3OTWA 4E08A 1LQUA 4MEJA 2GXQA 1XBTA 4HLQB 2EIXA 4RMJA 2XXBA 4BFXA 3W7AA 4YV7A 2BCJQ 2ZE6A 2ONZA 3C14C 1C1XB 2ZKIA 1A7UA 2F1HA 1LPBB 1UBCA 2Q1TA 1KZ1A 3CU5A 3D4NA 3M4XA 3PNLA 4I55B 1DO0A 3I2HA 3IAAA 3P4XA 4HO1X 4B5KA 1PKXA 4J6FA 1UWKA 1XEWY 4YRRA 1C9MA 4XAQA 1RXEA 4TQGA 3RSZA 3FNBA 3DFIA 4OY3A 3LX5A 3INTA 4KQ9A 1E89A 3D0OA 2LV8A 3A9VA 4C6TB 4D3XA 1YZGA 4RULA 5B4VA 1AS0A 3DULA 2F3UA 3FPJA 1IVSA 4IS2A 4YJGB 2P68A 4G65A 4X8MA 4RF3A 4I1PA 3K8ZA 4FYKA 3FUVA 3ZY3A 4AROA 1L6RA 1X74A 1Y37A 2CLLB 2R6FA 4HWPA 5FWAA 3L79A 1H42A 1HDIA 4G5QA 4LEIA 1NMEA 3VKWA 4PAMA 1DOHA 5JRDS 3DDWA 3KQSA 1SEVA 4AG5A 5LLDA 3PHIA 3FETA 2G9RA 3T7SA 4O4LF 3GPCA 4QGFA 1NQAO 3SR0A 3C5VA 2EW2A 2IYEA 1WMEA 3MB5A 2CVFA 4WOBA 1MEOA 5A4AA 3FY4A 1DHTA 4W7SA 3WO0A 4D02A 4A6DA 3M9WA 2NYRA 5CLQA 3WY9A 1JUDA 1QMGA 4AKSA 1JR4A 1LTHR 1GPLA 5KWEA 4AO6A 1X2EA 3B6IA 4PGGA 2FDRA 5FTMA 1QF7A 4C3UA 4R2HA 1A4XA 1YJCA 1AXEA 3L1HA 3EDOA 4FZRA 4G9GA 3NO4A 1PUXA 4ZTBA 3ROTA 1WXWA 4CW7A 1M6WA 2XZOA 4NCAA 3GDFA 2ZYUX 1NAHA 1CRWG 1TQ6A 3I28A 4EA8A 2AEEA 3VV2A 3W5UA 2IQ5A 1FMLA 4Y6QA 1BQ3A 2YY5A 1GV1A 3NHWA 1IZYA 3PHJA 4I8IA 4L50A 2YRWA 2C0PA 1U2DC 2Y4OA 3CB4A 1EX1A 5DCWA 5AVQA 5JI2E 1XEWX 4KN8A 5A5EA 3VZRA 3AH8A 4F2WA 4LDZA 4TQ9A 5HP4A 1PGQA 4BAUA 1JA9A 1Y1LA 4TV9A 3S0JA 3STHA 2I5PO 3MJTA 4C2TA 4PNHA 2D2EA 1NF2A 4YTEA 4CQLB 1XP8A 2X77A 3JXEA 4K9OA 5KTPA 4DLAA 2FSSA 4R83A 1XPUA 1JG2A 3BKWA 4Y6PA 2BZ0A 3RAFC 2O54A 2PBFA 3EVDA 1SG0A 3L18A 2ZJAA 3BWVA 5FOXA 2OORA 3CUTA 2FMIA 2VRNA 3PICA 2M1ZA 3R2JA 4P7FA 1GCAA 4YWJA 3ROPA 3EULA 2P4UA 4ZO6A 1JKIA 3FFWA 3IC5A 5TLSA 3U61B 3Q1KA 4GZLA 1CZUA 1LFDB 3L84A 4IFTA 3EVZA 2BH2A 3L4BA 2NUAB 1CE8A 2GO1A 2NU8B 1I0IA 4O59O 4WDRA 3MMXA 1UBHS 2C95A 2LCIA 4HTAA 4BPRA 1X80A 3IRVA 3RK0A 3B52X 3K9BA 2FPPA 4XKJA 2A0FA 2IY7A 1H3NA 1DAFA 3G8AA 4A26A 2ZBDA 5JS8A 1ZSNA 2M1XA 2OV4A 1AHIA 3UGTA 4D82A 1B4DA 1KO4A 1YJBA 3ZTYA 6CHYA 4BGDA 4MRAA 4RBNA 1BRTA 1II9A 4GU5A 4RQBA 4XDZA 1V16A 5IBRA 3SYRA 1GQSA 2A92A 5JO9A 5LQDA 1FF9A 2A6PA 3QEOA 4FJ2A 2EAUA 4TMXA 5LD2B 3HA2A 2C2MA 2WG1A 3T3HA 2WAMA 3EG5A 4BMZA 3G23A 1QZUA 1RRFA 3DT8A 1RYMA 3K0BA 3K9NA 2OC9A 3LSYA 1A2OA 3U4HA 4BLVA 4RJTA 1ADBA 3GAFA 4E32A 1DAKA 1GTL1 3K1AA 3WTCA 4UXJA 1PJTA 1LBTA 2W7TA 1QWSA 3ZKWA 4A36A 1Z7YA 2HMVA 2DPLA 4EPTA 5T5QA 4DV3B 4KQMA 2QN1A 2ON6A 3L8ZA 4OQXA 4J94A 4L7QA 1MVOA 1CUYA 2Y1KA 4AYTA 1ZJJA 2CBZA 3DBRB 5SZJA 2NGRA 2A9QA 3HN2A 1NP3A 2N1MA 3VC2A 2WJ3A 2O7RA 5ULLA 4BKMA 5K0ZA 2PKXA 1ZWKA 3DW1X 3KSDO 3PCXA 1XTQA 4JUBA 5CEFA 5ER6A 1KNXA 5FJIA 2J0SA 3TIFA 3D5TA 1LPOA 4KRGA 1KF0A 1XI2A 3ESBA 4P3XA 4BLQA 3YASA 1Z0FA 4B44A 1ELOA 4LWOA 2M2IA 1RBQA 1Z8HA 5HG0A 1VE6A 4Q47A 3WL8A 1E92A 2YWCA 1GL7A 3G8CA 4P7GA 5H83A 3ZVRA 3DCNA 2CNDA 2QUIA 2DT5A 2XGMA 3SIWA 1RXWA 2G80A 3IESA 2Q29A 1RJGA 3UM9A 1YO6A 2PZEA 1QGZA 3OESA 1XPRA 3DMYA 2GF0A 1CY2A 2W5UA 5CXXA 2OBYA 1M67A 2P9EA 3IOCA 3KB6A 4TSFD 4YJGA 4ZMSA 1VLMA 2DULA 2HSDA 2WTNA 1TUBA 3IV9A 5B1EA 2YZ7A 2WUEA 4K9MA 2YIVX 4OHXA 4R2JA 4QELA 3V4VB 1JDNA 4Q7QA 2DBZA 4ZKDA 1J2RA 3IAHA 5GGXA 2SICE 4O2AA 5HILA 3UV7A 1MT0A 2QDXA 2RJNA 4G4JA 2ZWIA 4U2BA 1WZ2A 1ODCA 3EDCA 3FPHA 4X9XA 3EQ2A 4MQ5A 2BM1A 3WICA 1Y8ZA 4DWVA 4BAGA 2WUVA 5D2CA 4LSZA 1MD9A 1ZAYA 2LVBA 1OXTA 5CDTA 4B32A 3QBDA 4YJHA 2YW9A 1QUFA 1W4RA 3Q8WA 4N8EA 1QR2A 3MTDA 3HNOA 4INOA 1ND6A 3IIMA 4XASA 1QBGA 1ZH0A 1GU0A 2OZEA 4N65A 3UJDA 2AS0A 1NFRA 1XCPA 5D5QA 3U3ZA 4JL8A 1K0FA 1JU4A 4BNFA 1DXOA 5JJBA 3AETA 4B7CA 2ILTA 821PA 4FNAA 1MV8A 5KB3A 1F6WA 3LC7O 4NABA 5KNBD 1PQ4A 3LTEA 1IBKB 5F1PA 4LECA 3ZGLA 3BPSA 5JAMA 4NULA 4KLCA 5E95A 3WV5A 4RHCA 3K7EA 3ET4A 3LHSA 1DU4A 3T12A 1W9HA 1QVRA 2EP8A 2UUPA 1SVLA 3F49S 5HF9A 4DCOA 3A58B 4U2DA 5EE1A 2OYSA 3U17A 3HP1A 1TECE 5BYJA 4QC2A 3WSTA 2QB5A 4GL4A 2X1HA 1OFIA 3FLBA 2SCUB 2J6CA 2RGCA 2VSFA 1GYPA 5HPYB 4GMGA 5G0SA 1HDYA 4OP2A 4RH1A 2RG7A 1KO5A 4R5MA 3IUMA 3G2NA 5IC5A 1EX9A 5IUKC 2GZRA 1ISIA 1Z2AA 3B13B 4MKFA 4LAFA 2ZULA 1C0IA 1WMDA 2C2XA 4FUTA 2UUOA 2HPHA 1G8GA 2P78A 2ETXA 4B31A 3HGMA 3VNSA 2TMDA 5FNVB 1NYTA 5E4YA 3PQ5A 5A3JA 4M3NA 3HB0A 4J9UE 2ZREA 3WLFA 4IEFB 2WWTA 1W94A 3NH9A 3TUZC 1P39A 1N75A 2QIPA 4YRJA 4NCIA 4IG4A 1DEKA 1K89A 2F4VB 2AXEA 4QDKA 5FO1A 2LKCA 1OX6A 3KOXA 5K8VA 4AJ2A 1U5CA 3CKYA 3DE3X 1YRWA 4RENA 5G4KB 3ZGNA 1VLJA 1E3MA 1ULSA 2YY7A 3C16C 3VR1A 4WEOA 2FPLA 1VRVA 1JPUA 1PUIA 4F7DA 2H4HA 4B3MB 1JEDA 2PNFA 4IVRA 4DLBA 1V8DA 2A7XA 2FZCA 4R2KA 3T3EA 4DV7B 3QTTA 3AI7A 3H8WA 3U3KA 4NOJA 2VIIA 3IBSA 2PBLA 2O2CA 5JHGB 4FFMA 3ZJYA 4JVMA 1EE9A 3LWZA 4RA6B 2P30A 1PFWA 1OU4A 1J0DA 3DE7X 3UJ3X 1K63A 2J87A 2OQRA 1WHSB 2XMQA 5G2OA 2VPTA 2XQFA 1FY2A 2ZTHA 1FQWA 3RQSA 1U8FO 2AFIB 4PX2A 3T5TA 2R4TA 3HKCB 2F9FA 1YONA 4Z2AA 3GK3A 1IHOA 4EX6A 1R3DA 2WVAA 2PO7A 3GEHA 4PG5A 5H70A 4HPXB 4IIYA 4I1RA 2C83A 3E7WA 3M5WA 3SEAA 2YZMA 2CD9A 1Q1EA 4UCFA 3SI7A 5LPNA 1CG6A 1XKXA 2ODQA 3F6CA 5IS2A 5FFFA 3DC7A 3BWMA 2BI8A 3KB2A 3OM0A 2Q7DA 3TTWA 4DNQA 4DLPA 4Q1VA 3EC2A 3M81A 2BI7A 2QS9A 4OXYA 3HLTA 1JKJA 2ZUFA 5D3QA 4L78A 4QTXA 2ATXA 4A4DA 4CDRA 5LKAA 3E9QA 4LRTB 2R62A 1XRQA 3LQ2A 3HCNA 3PBKA 5ALVA 4AZTA 2PTGA 1KTVA 4P93A 1H5QA 2ZRNA 5LA6F 2VUHB 4EGQA 1FEZA 3KT0A 1UF9A 4D9CA 2UU9B 1NOJA 4BBZA 4R40A 2NX2A 4OH1A 2J33A 4BNTA 4FFRA 4M0FA 3G59A 4IDOA 4GX5A 4JS0A 4B3FX 3VU8A 5BVGA 5GZ6A 4IRXA 1MJHA 4Q93A 2GWHA 2Z5GA 5CVUA 3G9XA 4RIGA 3WKAA 3RVBA 5KJEA 4HT3B 2YMPA 4OHFA 2H1FA 2UVPA 4HAOA 4EYSA 4TKVB 4MUHA 5IZ4A 5E8JA 1Y7IA 2D1SA 4CMGA 1N2ZA 1BTOA 3QYJA 4JGBA 4WBSA 1KMQA 1XXHA 1NZJA 4LRSB 4GYYA 1EXWA 1AGPA 1JSRA 2VHJA 5IDXA 2KHZA 5JFGA 4UFPA 5KDLA 4QASA 3WQHA 1JHDA 2X8BA 4FZ3A 4H31A 3DFMA 4KDCA 3CONA 4JI5B 3VNAA 4LBZA 4Y6GB 2C7PA 2ZSHA 5CDFA 2APJA 3VTFA 1YA4A 4B40A 1CS0B 3L1JA 2QY9A 3VMMA 4Z0HO 2QNRA 1EFVB 1DWQA 3U81A 1K97A 1AT1A 2HWUA 2PPVA 5BRJA 1EK0A 3FVTA 2GO7A 3KV3O 4MO2A 3E9RA 5J59A 4ECAA 3LCRA 3L7DA 4V02A 4LVUA 4ANFA 5DTEA 5FT9A 3JARB 5HR5A 2I6XA 2PYDA 3NRBA 4L8FA 5ESXA 1JT9A 2DUMA 2PU7A 1PP4A 1ADGA 3KPJA 3TGLA 1WO8A 4P0PB 1FRNA 1H05A 2QG6A 3BTSA 4X5OA 4E11A 2WC1A 1WPRA 5A0TA 1AX9A 2C4WA 2VP3A 3LT0A 3U1BA 5DP1A 2J7KA 4R3NA 2I33A 5FWYA 1EFPB 1YKFA 2F6RA 4BZQA 2ZZMA 1E61A 4DS3A 4ALKA 4Q4HB 1WCXA 3I2IA 5CW1A 521PA 4ZK2A 1RWBA 3JQFC 3L40A 4YP6A 1GGNA 5LWHA 5EQDA 1CSEE 4LHEA 4DKXA 4CODB 3ESYA 4ND6A 3C45A 3DLAA 1GFZA 3MTGA 1U0GA 1O94D 3I9JA 3MT8A 4LVOA 4P92A 4GMKA 1X3SA 2VPQA 4L22A 2C7VA 1D2CA 3ROEA 3GT0A 4LYAA 4TTVA 3ZUPA 3C8UA 3FUUA 1G19A 1UBGA 4FZJA 5FB3A 4X6LA 1HZZC 1OREA 2AN9A 2AL7A 2VYCA 3WP1B 4MDFA 1GR0A 4RTPA 1Z18A 1AUQA 1ZPDA 2HXYA 2WF8A 3DO8A 3MBOA 4Z7OB 1AZTA 4PSCA 2PEZA 3K20A 3KKMA 4RTKA 3GGJA 3K0AA 5JC1A 4A9AA 1QVWA 2BKEA 4TTIA 5E9AA 5TB5A 3TLYA 4UW9A 2SBTA 5J4YA 3VKVA 4C0LA 1E1MA 1XU7A 3LVFO 2BN4A 4AZWA 4CEJA 3O8QA 4H0FA 4UMVA 3PNMA 3CH7A 4REOA 5GIOE 1SD2A 1GGFA 5FBVB 2I2CA 3DDOA 5DN6A 1U6KA 4MS1A 4PBTA 3KX2A 5CCDA 1QYIA 3R3JA 2DWQA 1PDOA 2J09A 3GGDA 1QV7A 4X1YB 4XJVA 4D26A 2EQAA 3ONEA 1YCDA 4EJMA 1ZL2A 3EXFA 3OP1A 1IE3A 2H6EA 5GONF 3SM9A 1PLLA 1F1JA 1Z7EA 4WLUA 4G9EA 3Q3GE 1SBTA 2CB9A 4Q4DA 5L3SB 1AGXA 4F71A 1H2AS 1KI3A 2IIVA 3JQGB 1RWWA 1TZJA 3KDAA 1ADJA 4OAOA 1SOVA 2Y6UA 4XTRA 5FAXA 4XJTA 2OLKA 2PFGA 4F3CA 2VXCA 4UAVA 1SOUA 3R4VA 4AUEA 5J4KA 2QRVB 3ZTTA 3N05A 4INPA 1J4AA 5LUBA 3R9WA 2H9IA 2JIMA 2XNSA 1S3GA 3LCVB 4R9VA 5DOVA 1M83A 5ELMA 3OQMA 4NMLA 3RE1A 1CR6A 4GI5A 4ZEVA 4XQEA 3Q2OA 4RLQA 4URHA 2WJAA 4PYOA 1XGKA 3ENZA 4PBSA 5GM1A 4MW2A 5BT8A 5KSZA 3RYCB 5PNTA 1STOA 1IRXA 3NTVA 1JQJC 3C5CA 3AGPA 1UKZA 3L4JA 4E88A 2PZBA 3UMSA 3I42A 4HXFB 3K6RA 2HK9A 3OTQA 4OI0A 1BXGA 3ROQA 4NG5A 1QR6A 3QV1A 3CA8A 4QATA 4X8HA 5C8XA 1O95C 2F3PA 5HIJA 4PQYA 2KI5A 1IXRC 1OAOA 1Q2XA 2YWBA 5HK8A 1WBBA 3FYTA 1IQ0A 3T5CA 1DX6A 2PMWB 2UZ1A 3OPYA 2I7DA 5DWQA 4GWGA 4C7OA 2G04A 3W2FA 4RFLA 4XVCA 2OD7A 3GU3A 5FX2A 3ONWA 4NENA 3N70A 1GUZA 2A0XA 2WAOA 3SSNA 3AEKB 1ILEA 1SKYB 2OAEA 3M70A 1Z4LA 3NDPA 4D9HA 3LNTA 5AD1A 2YWJA 1RI1A 2L42A 4FKZA 3A3YA 4QNNA 2ZYTX 4UKDA 3TIIA 3N8DA 4GMHA 3LY9A 4O02B 4HVCA 1JLLA 1RJDA 1CJSA 2IIBA 4S1NA 4Q7KA 5DBGA 2JFFA 4RE6A 2X0KA 5F4BA 4C7MA 1EM6A 5JJ5A 5JTTA 3LQ1A 1C8VB 1QTNA 3REOA 5ES4B 1NSYA 1JEQA 3FFAA 2XYVA 4MYDA 4C4ZA 3B2EA 4EG7A 1AXGA 1WMAA 4FOOA 1LWOA 3AF2A 4ENSA 1FYDA 2IHTA 4RDHA 3SIRA 4PEVA 3RVMA 2R9VA 2P65A 4IV0A 5TPWA 1E66A 1RWXA 1Q0QA 3FH0A 3OKCA 3SKXA 3VV3A 3QNMA 3VZQA 5CDFE 2Q6VA 3HKDA 1SVIA 2HUPA 2NSLA 3P9KA 4R1MA 5D3KA 3T9BA 4C0WA 1J9ZA 1Z2OX 3L6RA 2CE2X 1WS6A 1T2VA 2PDAA 3AM3A 3G1TA 3VZPA 2IS2A 2YXLA 1XCJA 4LZZA 3U3OA 2BM0A 3H9UA 3UC9A 1NUHA 3IVGA 4B83A 4BLOA 1T0JB 5IC4A 1P9OA 3GLKA 5JD5A 5F4ZA 2A58A 5CVJA 4D6XA 3KSBC 2GAAA 5M5BA 2JD0A 2ZAOA 3DVAA 4BRSA 4BKPA 2O59A 1EU1A 5IANA 1X1DA 3GLVA 1XDWA 4I6GA 1QQAA 4BQFA 4K9DA 3W0LB 1N2HA 2XQGA 1ES9A 2X86A 1EX6A 3Q7SA 2B69A 1Y0BA 3AIMA 4BNKA 1IXYA 5F76A 3STYA 3N1UA 3C6XA 2X2PA 3CRQA 3QUSA 4FCWA 2QIOA 2X0IA 1D6MA 2JHCA 2QN9A 2RHJA 1ESDA 3AHCA 3CX3A 3A6DA 1YRHA 2RSLA 3DF9A 3IBFA 5ERGB 4IDBA 5FOTA 3ANSA 2PWPA 2IYXA 2Z9CA 2F8SA 2OG1A 1R8JA 1NVXQ 1GOTA 4FOTA 2JCBA 3VH3A 4X7BA 1CD5A 1GU1A 4HZUA 2OHGA 3KKOA 1MKYA 1DC4A 1PIWA 4GW3A 4QDUA 1K7SN 3TVDA 3WB9A 3ZE2B 4B1FA 4EW1A 5ARBA 1Z8DA 1VI5A 3PLRA 1GXSB 4R1LA 2QBYB 4CV1A 1M6VB 1VHJA 1K6IA 3EZFA 2WU1A 2ICAA 5JFTA 2BCGY 2EWWA 3I05A 1FDSA 4K6KA 4TVOA 3J7AC 4EK9A 4EH1A 3PLAE 4G1MB 3I4LA 3BZUA 1D9XA 3PTAA 2IYUA 4Y3UA 5LU9A 3NTRA 3P4YA 3W2IA 3THYB 1XJ5A 1AGRA 4GGPA 4RS4A 4DPMA 4WK4B 2EWVA 1ZY2A 1MGPA 2DWPA 2VPZA 1W25A 1X7WA 4UTOA 1FJXA 2BTQA 3VDRA 1OWLA 1ID8A 3IPXA 1UQRA 1M10A 1PSZA 3G89A 3JWHA 1LRKA 4CZ2A 3U40A 3HXTA 4FQ8A 4MJ3A 4BYGA 5CA1A 2YXPX 3FTQA 1DC3A 1K5HA 2C4NA 3ELDA 4O2RA 4X3PA 5DXAA 5A4KA 2RCYA 3P20A 2PJUA 4UU1A 5B1DA 1TJPB 2XT6A 1AZLA 1NGSA 2XMDA 4YASA 1AHNA 3I2GA 4B2IA 3HEAA 4B46A 3R1IA 2HEIA 2PV7A 3JVVA 3V9PA 1HQYE 2A5LA 3UJHA 2PZ8A 3A7DA 5JAIA 2I76A 1V3TA 3DV0A 4TV8A 1MO6A 2H63A 2DKFA 3W3ZB 4MR7B 2V4ZA 3CKLA 1V96A 3P32A 4O4LB 4ALMA 1NVWQ 1T15A 1Z35A 4A0RA 4R81A 1YS1X 4A8JC 4RK7A 3L8GA 4BIIA 4HQ6A 4X91A 3IT1A 1GU7A 3IE1A 1EWYA 2VRWA 3T6KA 2PSSA 3A4NA 3QXHA 4FNOA 5DM1A 4RIFA 1PQYA 4PFKA 1YDEA 4ZVSA 3H9GA 5JCXA 3F5DA 4B81A 1OU0A 2HSZA 2R66A 1JAHA 5J40A 4ZYLA 5FHRA 1GCOA 3MEQA 4ZQEA 1Q1NA 1JB9A 1G8PA 2J3IA 2VYQA 3DAPA 4XYBA 4ZDWA 1KI6A 1ZSYA 4CFZA 4NJMA 1QP0A 4A6PA 1M73E 2B6NA 1YJ8A 3JAKA 1DP4A 2D1RA 4LDPA 3ME5A 3PGVA 1VGVA 4M89A 3VR4H 3EYAA 1KOJA 2FZKA 5T4FA 4C0JA 4LF4B 5HRCA 3E7DA 2IYOA 4FYWA 4EABA 4I08A 5ALRA 2H3EA 2X0DA 2X0FA 1UJ4A 4DR2B 1TMYA 1Z07A 3O4RA 3MQ4A 3B85A 4EY8A 3PGLA 2WHPA 4ER6A 5TV2A 2QXUA 3HCOA 4YVFA 3GG9A 4BS9A 1E2FA 1EA7A 4QHYA 2XQKA 5KNBA 5DWVA 1YRBA 5M3BA 1WZUA 3H7AA 4S05A 1Z5VA 1SR8A 2G9UA 3OF3A 1TK2A 4WCFC 5FJJA 4Q6BA 1AV7A 1HQKA 1JQ5A 3KKQA 1QH8B 1MIOA 1H65A 3B5IA 2R8XA 3NTUA 4KHZA 1FDIA 4WWHA 5AW2A 2YVAA 1NUUA 1YHYA 4C4SA 1O0CA 2QR2A 3VAZA 2FGKA 1UZLA 4ZYYA 3ANXA 3PGMA 4QPPA 2MSDB 4HPWA 4QSMA 5COBA 1LV8A 2XRMA 1AF7A 2BJVA 3P5BA 3ZG6A 1W19A 2EF0A 2GDZA 2UYHA 4HI0E 4J7UA 5BR1A 2XTMA 4P31A 1YAHA 3VOSA 1OYVA 5KMGB 4UBIA 3O8LA 5JJKA 2XRZA 2Q9BA 4POAA 3R5HA 1O0SA 2RHMA 3TKYA 2BC9A 5FKJA 3ZHZA 4S04A 3ORFA 3AEQB 4FPXA 4TYPA 1GA4A 5ALOA 1TTHA 5D8DA 5EQFA 1DTWA 4IM7A 3H1EA 3HZHA 4WOCA 2DECA 1E7WA 1A7JA 2P67A 1Y1RA 4DWOA 2PKWA 2A67A 1ZU4A 5HDBB 4NH4A 3R0JA 4OBBA 1ZK0A 3PUVA 1SK8A 5BNFA 5A1JA 4AMBA 3JQAA 4DSUA 3HE3A 4KE9A 2AFVA 3L6UA 1D1PA 4Z99A 1G5FA 3PDJA 3Q9UA 4NSNA 3BFPA 4DDKA 5JSHA 3VPDA 1DCTA 1W1WA 1HFJA 2V74B 4RJ2A 2CK3A 3T41A 1T9GR 2OG2A 2F90A 2O06A 3OAAD 2O1WA 3JASA 3OOEA 3M4JA 4GX0A 1HQDA 4CUKA 5CXUA 1CS4C 1ESNA 3K0FB 4QQKA 1BHJA 1L8QA 2GNAA 1B8VA 2VK4A 1LJUA 3H1BA 4E1VA 4KXQA 4RY9A 1EFVA 2ZXUA 5DNDA 3NRJA 1QZXA 4LNUA 4UDOA 3KAPA 5D51S 2Q07A 3JATA 2AMYA 4B80A 4YAIA 3QU7A 1GYQA 4GP7A 4LBYA 3U9LA 1IY1A 3PFBA 4O29A 5IJXA 5TPZD 3VYSB 4MVJM 3BICA 4PZLA 1UKVY 3P0HA 2FPIB 3TBHA 1YMUA 1R4NB 4F9TA 1KY5A 3CMCO 4KE7A 4ZVRA 1P0IA 1VSBA 3EDYA 4MA0A 3VGJA 1ECJA 3MOIA 5FNZA 2QYSA 1XKTA 3LUAA 3C15C 2VN8A 4Q34A 3JQBA 2Q6OA 4I14A 4QBKA 1Q0UA 1L4HA 2FWMX 4LRXA 3UWDA 1ZLYA 1Z2PX 5BURA 3KYCB 3HGTA 1CY4A 4XGKA 3PGJA 5C8ZA 4B4VA 1ZBDA 1FYEA 1E2PA 2HDOA 4F5YA 1A7AA 3KOUA 5FUQA 2X0RA 3UMRA 3KETA 3EODA 2FPXA 3MWLA 3K9FC 3L8DA 4KVZA 1RPZA 4MDEA 4S3MA 4GNRA 2X7HA 4KXYA 1O5OA 3NU1A 4OGKA 5JJIA 4MVJG 3A1CA 3AUKA 1W59A 1V45E 5B55A 4JT4A 4HAUA 2O8DB 1KJZA 5AT1A 4H3KB 2Z56A 3JWGA 2VQSA 2JD2A 4ZT2A 3FPCA 4RJIA 3ZJVA 5LFAA 3ZCQA 4KAXA 4BN5A 1V9LA 5IHXA 3FIJA 4XPZA 2WHPB 2A9PA 1JFFA 3FYHA 2YV4A 4M1YA 3PIDA 5C3UA 1L1FA 1JFLA 1QQBA 3AYXB 3OC6A 1N2CB 3R0XA 4CLOA 1RXCA 4JUCA 4I5EA 1CHDA 3HBJA 1RXVA 1XVLA 1SHJA 1EVYA 4QVIA 3GZJA 1XMQB 3BB3A 4E4YA 3OHPA 2QTHA 4C4XA 4D43A 1DMRA 3C39A 3GEBA 2BDTA 4IIJF 1HLFA 2O57A 3PGXA 3UCEA 3WC4A 2JLRA 3D8UA 1G5HA 1K66A 4NZYA 1YS4A 4Q7JB 3UWPA 1OLXB 1A9XB 3CLSC 1YB7A 1YKGA 3I5AA 3OT4A 1K7YA 4Q1CA 2V8BA 3WLHA 5MFPA 3I04M 4HFRA 4CM9A 1DFGA 3TJMA 1WBDA 1QIHA 2HQ1A 2ILVA 2CLMB 2UZ0A 2VDJA 1RMQA 2IHJA 2OB1A 4WEQA 3ON5A 4MI1A 3VR4A 4OBWA 3TN7A 2OGUA 2L18A 1X2BA 3H04A 1W36B 3LW7A 1QIIA 5BQ5A 3KALA 2CHVA 3PQ8A 1XFDA 2EX0A 1KAQA 1V1MA 4O4LA 4KAJA 4XA8A 4V1CI 1HL3A 3ZV6A 3X1WA 5J58A 1HXHA 5JAPA 3CUVA 1MB2A 2QEQA 3BJMA 1S1CA 2OMEA 5KWSA 2OZVA 1AKQA 2WI8A 5KYYA 4L0CA 2Z3ZA 1XZHA 3P0EA 2EV9A 1ORVA 3A6HA 3PUIA 4JU9A 4XQ9A 5E3HA 5KNBH 1QE3A 4ARUA 1LKZA 1RYFA 3CVYA 4NNJA 3K1ZA 5HNKA 2CL6X 3B5JA 1U2QA 1XMOB 3PQ3A 2Q8NA 3G68A 3GGOA 2JLZA 3FMPB 2A9VA 3VH4A 4ZJPA 1PR0A 5KX5F 1G8SA 1JVSA 3G17A 4WX2B 3PT5A 1UXGA 2H3HA 2GJ4A 2QM7A 4UEQA 5FI3A 1W88B 4N48A 4ZAGA 3SDZA 1YV9A 4DL9A 4X62B 1I13A 1ARZA 2F1KA 2GUGA 1PAUA 3VR2D 1DEXA 3KJFA 3WDMA 1I14A 1XTTA 2HA7A 4XM1A 1RNLA 2OZLA 4JC0A 4KL8S 3NKLA 4YUVA 4A8HA 2QT9A 4JCCA 4BTLA 1QRAA 1D1SA 4C4RA 4ID3A 1HGXA 5K1ZA 4IDFA 3VSAA 1CRQA 3A37A 4LHVA 3I58A 4MWGA 3CLVA 3TMYA 3R5FA 3FFTA 4RKRA 4Y8VA 3PPIA 9LDBA 1COZA 3PHCA 1MG5A 3HYCA 2O8FA 1O6BA 2KWIA 2P9FA 3MUFA 3R6TA 3PKJA 5K99A 1LVGA 2O2XA 1HTWA 2QZSA 1JN0A 4XDYA 4ESVA 3P0JA 2HTEA 4URUR 1N1GA 2GM9A 1RZVA 4R9RA 5A7FA 3OQIB 4LHSA 1ORDA 4XX1A 1YFJA 3DG9A 3WE7A 3GJ8A 1EUQA 1QIDA 1H66A 3BCHA 3EBOA 4B6JA 1ZHOA 4HEHA 2EW8A 2R65A 4RZ3A 2P4EA 4CM6A 1FSSA 1KVUA 4PXYA 2QQEA 4ZVUA 421PA 2J31A 1JG3A 1U9IA 3O95A 4KKVA 5T3UA 1PJ8A 3IB6A 5CA0A 1DIAA 3L7OA 3MILA 3PL5A 4RE5A 1RYBA 1PWHA 1XDUA 3F3SA 3FPEA 3H11B 2O3RA 3P2YA 4H7JA 5IJZA 1R0SA 1N7JA 4DLYA 2IC5A 1XLVA 4M9RA 4EZEA 4RY0A 1T9HA 2Q46A 5KPJA 2E0IA 3HYNA 3DW3X 3AM5A 3PEYA 1H94A 2J0UA 3QPDA 4JJ8A 2VK2A 3RSSA 4BV3A 5KOJA 3DBHB 4DKJA 3G85A 3BDIA 4UHBA 1O8BA 5EG5A 3LO8A 3TLKA 2P9CA 2VDNB 1R0ZA 3NCHA 1RZRA 2YWDA 3CLSD 3WGMA 2H48A 5KTMA 3VJRA 2GKSA 1J8QA 2A5DA 3EIHA 3A2NA 4S1WA 4DVJA 2GNPA 3PEUA 3R7NA 3QE0A 2FPRA 2QXTA 4ENTA 3LOQA 3GVIA 4GVPA 1E8MA 2G5CA 5ALXA 5EMLA 3ZBTA 4B71A 3FLAA 3Q7EA 1DEAA 4WY8A 5K8LA 3FD8A 4P54A 1D8TA 3GLHE 4R9NA 3UMGA 4NXMB 5E9JA 3H2SA 2PXCA 4FB4A 3KQLA 3H65A 4Q01A 1X0XA 1J24A 2I8LA 2VH1A 2W37A 1AC5A 3LBIA 3AR6A 4JOQA 3JATB 1P7YA 3U4IA 1L4KA 1EQ2A 1V3VA 3ODGA 2EEPA 5HFJA 1QQ7A 6LDHA 4AY3A 3DLHA 1JLRA 2OGWA 3SAJA 1VA4A 1GSIA 3ZD7A 1PLJA 1Q17A 4BFWA 3P9SA 3PEWA 1B8OA 4JXJA 2WJ4A 3ENVA 1RD4A 1C3VA 3C8HA 2F1JA 3K2QA 3SF8B 3AEYA 3WWDA 3D1LA 3L06A 5DNEA 3UMJA 3WBJA 4DG8A 2HSEA 2VKQA 4BMSA 2CYCA 4JUDX 3S2IA 5I47A 2IH4A 1CQIA 721PA 1JIIA 3OPMA 2EFJA 3QELB 4WOPA 4XI9A 3HABA 4AKGA 1GFWA 1JJFA 2QD5A 4QJ4A 5TT0A 4D0SA 1S9HA 1V6SA 1JDSA 2CJXA 1IPHA 1OXMA 5JECA 1WETA 4IICA 1WVGA 5H1YA 1WLSA 3BAFA 3K15A 2BFEA 2OCBA 1QPBA 3RTGA 1KJYA 1K75A 4RKFA 1UQTA 5DJ5A 2FG7C 1TEHA 2WYOA 3PC4A 1Y8CA 2V7QA 4BTVA 3QVKA 5BWNA 4RKYA 3IUQA 1W93A 4MWSA 1N5IA 1W5FA 4X00A 5JSYA 4B6GA 1WUYA 2ZP1A 5DW0A 1LA2A 3OI7A 1Z12A 5DYGA 2A35A 3LC0A 4HLNA 1R8YA 5EA2A 4NI5A 1FFGA 3SX0A 3TMKA 3GRZA 2LZ0A 1AKTA 1KFKB 1O4VA 3AJAA 5CNKA 4YAFA 2WJVA 4Z9XA 1RVV1 2GN8A