4QBGB

Crystal structure of a stable adenylate kinase variant aklse4
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
217
structure length
217
Chain Sequence
MNIVLMGLPGAGKGTQAERIVAKYGIPHISTGDMFRAAMKEETPLGLEAKSYIDKGELVPDEVTIGIVRERLSKSDCERGFLLDGFPRTVAQAEALEEILEEMGRKLEHVIHIEVRQEELMERLTGRRICSVCGTTYHLVFNPPKTPGICDKDGGELYQRADDNEETVAKRLEVNMKQMAPLLAFYDSKEVLRNVNGQQDMEKVFKDLRELLQGLAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylate kinase
publication title Effectiveness and limitations of local structural entropy optimization in the thermal stabilization of mesophilic and thermophilic adenylate kinases
doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 78
structure length 217
sequence length 217
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2014-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00406 ADK Adenylate kinase
B PF05191 ADK_lid Adenylate kinase, active site lid
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qbgB00
1YJ5A 5FBVB 4DCTA 2J3EA 2ASEA 4P3YA 1W49A 1KKMA 2EFDB 3QENA 5K8UA 3GJ6A 4I1VA 2A5DA 4G1UC 4YXWA 3K9GA 3TNFA 1GKIA 5EP2A 1J99A 3CNLA 3KJHA 4A8JB 4Y0AA 3GEIA 2JA1A 3K09C 2JLXA 2IA5A 3PUVA 4EPWA 2ZI9A 2FMXA 4RCYA 1BKDR 3RRZA 4AYTA 1EWQA 2IXEA 1W5SA 2CHVA 2ZRMA 3AF4A 5FTNA 1UBEA 3N5CA 3LDAA 2O8DA 1Z0KA 4HAZA 3AVQA 5JWRA 4RD4A 3SBDA 2GJKA 1PJRA 3AVTA 1ZM3A 2ZI3A 3KB1A 4M21A 3AUXA 4FINA 4NCNA 4C0SA 4GT1A 4Q4JB 1VHLA 3KJEA 4AKEA 3SYNA 3BB1A 4OQMA 4BFWA 4XD7A 4OI4A 1XFAA 1OYWA 5L3SB 3EPLA 1RJ9A 4JLVA 3EG5A 2BHRA 4OHXA 1DEKA 2IT1A 4MITA 3I5YA 3TMKA 4GOKA 3TKLA 4LZZA 4RFSB 2V6IA 3LRPA 3LXXA 1KDOA 4D25A 3X1ZA 4HB2A 4IRUB 4WZAE 5LD2C 1SXJE 3N2EA 1O3YA 4K81B 3I62A 5LB2A 4D0NA 5DN6D 3DMDA 1U8ZA 2JLRA 3IHLA 4TZ0A 4UNRA 2GJ9A 3IGFA 4UNSA 1E79D 2BBWA 3U44B 4Q4HA 1TQ6A 2V1XA 4ZIRB 3H2YA 4PAQA 2ZU6A 1E98A 4A8JA 5CB8A 5KSOA 3C15C 3SDZA 2VHTA 2PCLA 4PPFA 2WMOB 4GOJA 4XVRA 2CMKA 1X1RA 4YDSA 3EZ6A 4KVAA 1UDWA 1R6BX 1CJUC 1XD8A 4HLCA 1Q12A 2WJGA 4M0LA 2E87A 1YKSA 1KZGB 3ZIAA 3RANA 3THOA 1MO3A 1LFDB 3W5JA 3ZZ0A 2GZHA 2O0HA 4YMWA 5FPYA 2BC9A 3L0OA 4IXNA 3CRVA 3CM0A 3MLEA 5CM9C 3VX4A 1DPFA 4XVUA 1N6PA 4U02A 2JLYA 5G53C 1W0JD 4AKGA 1ZM2A 1A1VA 3QKUA 2D7DA 2FSHA 1W47A 3GLIB 4TYWA 2ORWA 2FZLA 5LDDC 5JJLA 2W0SA 4PAMA 4Q00A 2BMDA 4DEYA 3QPUA 2I1VB 2WSMA 5JI2E 1XF9A 5L3SA 2QROA 4IDOA 1NJFA 2OCYC 2ODBA 2ODEA 3FHOA 4RFSA 2CBZA 3SJZA 3IQWA 5EXSA 1OT3A 5K8LA 1CKEA 2P3SA 1WB9A 1JAIA 1AGPA 1ZW6A 3W8NA 1NG9A 4TT3A 3ZVRA 1WCV1 1Z2CA 2IK8A 2GEVA 1D8TA 2HT1A 1HQCA 1SKYE 1CR4A 5G3YA 4Q9JA 3U44A 1P5ZB 4JLOA 3MD0A 4P32A 1E9AA 1UKYA 3I1FA 3M1IA 4YDHB 5FI1B 4ZIRA 2F55A 3CF2A 2QN6A 4QBIA 2GKSA 1HY3A 3KQUA 1OF1A 2WM9B 1OH8A 3UMFA 4P4UA 4Q4LA 3TJZA 1T8TA 2FFBA 1NJGA 3P1JA 3DMNA 4IVPA 4U7DA 1NVWQ 2REOA 1RVDA 2QSYA 4UJ5A 2XNSA 4UNNA 3TIFA 4HB4A 1E32A 5B58C 2GXSA 1D9XA 1TEVA 2A5YB 3WXMA 4IFEA 3HP1A 3IIJA 1G41A 2J59A 2W6ID 4JSYA 5DH9A 1M7HA 5L8VA 1HT2E 1Q1QA 3A4LA 4ZCIA 1SKQA 3SI7A 1MKYA 4L5BA 3VAAA 2IBMA 1QHHB 2NO6A 2QT0A 3GLIA 2CK3A 1JB1A 5CDFA 1TU4A 3EASA 1R0XA 5DO9A 4CEHB 4AWXA 3B78A 1GRRA 1WF3A 2IC5A 1CJMA 3RRMA 3CH4B 3A4MA 3DVLA 3ZGXA 3UK6A 3UPUA 4LJ9A 5HR5A 5IRCD 3MGCA 3WYGA 4XJXA 1ESNA 4UXHA 1E1RD 1S1MA 5BYJA 2VP9A 1SXJC 1JR3A 2AKYA 2VL7A 4HYYA 4MYCA 4QNMA 5C1BA 5E95A 4P31A 4QJ5A 2CCKA 4HAWA 3EARA 4US0R 2YV5A 4EFMA 4OKSA 4LYAA 3AEZA 1FZQA 4K46A 4BZPA 5EP4A 1GNQA 5FFMA 5F2EA 3O8CA 5KTYA 3WRYC 4GP7A 1US8B 1Z6YA 4JT4A 3ASYA 4KSCA 4I81A 1GL9B 3ZQJA 2Z6VA 3ZZUA 2ZRKA 1P4SA 5J4LA 2UZ3A 1OHHA 2CJWB 5HE9A 1SGWA 3KUDA 3ICEA 5H1YA 4IOJA 3UMRA 3WBJA 5UKDA 2D4HA 2XX3A 3RRYA 3UMSA 5CM8B 1X86B 1YRBA 4TYPA 3P32A 4B2PA 2JGNA 3BIFA 4DUGD 1KSHA 2H92A 1K6MA 4TLDA 4URYR 4X8OA 2SHKA 4HZUB 1T6NA 2GZDA 2J0QA 1EFCA 4O2RA 2ZI6A 3NBXX 4LC0A 2F1RA 1QHHA 4BLOA 3LFUA 2RGAA 2BEKA 3QY0A 3Q72A 3MWLA 3HU2A 4FIDA 4CEHA 2FFAA 2REBA 5TXGA 1E9SA 4CGZA 1GKUB 1S9HA 1IAQA 1DAFA 1Z83A 2C96A 5LD2B 4K8OA 3GLHB 1KO5A 4FN5A 4S35A 4XTCS 3GJXC 2W2XA 5FOWA 2CXXA 2ZYVX 3Q5DA 3UWKA 4TLEA 1HYQA 2F43B 2I3BA 4ZCLA 1WP9A 4CIDA 3SR0A 1U0LA 3CX6A 1U8YA 3ETLA 3ZD7A 4Q21A 3DKPA 4MGIR 3RC3A 3UG7A 5JEEA 1XTQA 2R2AA 2XEXA 4LPKA 1OFUX 2IS1A 1P6XA 1VTKA 3VFDA 1LV7A 3K09A 4LV8B 4GSYA 3NBFA 2D7CA 1US8A 2J45A 2YYZA 4OI1A 3CWZA 3LNCA 1FNNA 4QFMA 1XEXB 4ABYA 5F9FA 2WIAA 4NMMA 4LC1A 1G20E 3GFPA 4US1R 4J0QA 5EXTA 4DEXA 1OXTA 4LYHA 1SXJD 4IOKA 5BW8A 1PLLA 2FPKA 4KI0A 4AY2A 5CYOA 1ZNWA 3CX7A 4M1WA 3X1XA 1DARA 1QBKC 3B1YA 3CWQA 3GEEA 3T1TA 2PH1A 1XX6A 4CEIB 1JBKA 2A5FA 4HZUA 3L8ZA 2OAP1 2KBFA 3OAAD 4X8MA 4NU0A 2WWIA 3DOFA 1W7AA 1QG4A 2GWHA 4M53A 4IJMA 4O25A 1FTSA 2PX3A 4ESHA 3GLHA 5AUPB 2E9SA 3H0KA 1Z0DA 2XSZD 5AUNB 1FX0B 1P73A 3AH8A 1G5RA 1LVGA 4E09A 5JRZA 2F43A 5KHOC 1JEDA 2IYRA 1NG1A 1QHXA 4XWAA 3TK1A 3QVVA 5DE3A 1NVUQ 3RABA 3U4QB 1TMKA 4A15A 1L8QA 1P9WA 4PSAA 3IPYA 3ADDA 4IVRA 4PZLA 3CNOA 3QE0A 4HDQB 3WNCA 2R6DA 4PANA 3SZRA 4TMKA 2QA5A 1UDXA 3FKQA 4HLDA 4OHWA 5G40A 4OHVA 4C0AC 5JS7A 2GK6A 1KI8A 1XTIA 2OHFA 2VA8A 2HF8A 3KUCA 3W34A 4EPVA 1IY0A 2ERYA 1KI1A 4PSKA 4ASUA 4DSNA 1XEXA 3IEVA 2O8BB 5CK4A 3TVDA 1D9ZA 3NDBB 1RRPA 3KTAB 3GJ3A 3I61A 2P6UA 2IWHA 3A1WA 4B33A 5CLQA 1N6LA 3TQFA 4CEJB 4MUAA 4RY2A 3RYTC 1NLZA 2J46A 3AVPA 1TEXA 4P4TA 4Q5IA 3U3RA 4YLGA 4CEIA 4YONB 4R98A 2IHBA 3IBYA 2CE2X 4D4JA 4ZI2A 1G6OA 1RKBA 3CIOA 5JS8A 3Q8XB 4TSFD 1HE1C 4KCGA 1ANKA 4HZIA 4PSVA 2AK2A 1R7RA 2ZR7A 1K5DA 4RD2A 4IOMA 4OHZA 1E0KA 2FSIA 2IUTA 1XTKA 1P3JA 5FOUA 4Q7JB 3KKQA 2HDNB 1GG2A 2F1HA 1EXMA 3PIRA 1D2NA 3RWMB 4C0LA 3TAHA 1OE0A 4F93B 1PVOA 2RGCA 2XZPA 3D8BA 4O0MA 4IDHA 4POAA 4Q01A 1XJQA 3U4QA 3AKEA 1WDTA 2NO1A 3NH9A 4IXMA 3KL4A 2B8TA 3WMEA 4AIIA 4GDFA 4PHFA 3DO6A 5FI0B 1X8LA 4LSGA 3DOEA 4U00A 1Z3IX 4LBVA 3MG9A 4RKEA 4JLBA 3FHCB 4BLQA 4DLTA 2OXCA 4BGDA 1KK0A 1GFIA 4QHTA 4YMSA 3BH0A 1K5GA 3AB3A 3TRFA 1CLUA 4TWZA 3MCAA 5FOXA 3R9IA 4FMBB 3PVSA 4V0KA 5JLJA 4JLJA 1W36C 1YZGA 5KNCA 3LQQA 2QBYB 3GLIE 2WWFA 5CDFE 3R9XA 5E3HA 4EJSC 3FWYA 2IYLD 3KTAA 3LQRA 4QL3A 1U8AA 4FMCB 3SFVA 2FF7A 5JMTA 2C99A 2Z83A 2ZI4A 4CEJA 2JJ2D 5FR2A 4G5SA 2QQEA 2JIZA 1D5CA 2ATXA 4PC6A 3QSYA 2AD5A 2AX4A 1GTVA 2QTHA 3BFVA 3K0AB 1DOAA 3KXLA 4PAOA 1KZ7B 1XEWY 4LHWA 1M7GA 5H68A 1L4UA 3BS4A 5JCPA 1NBMA 4LJ4A 3QKRB 4KLZA 4A8JC 6Q21A 2ZQ5A 3IQXA 1IN4A 2PZFA 3SNHA 1G3IA 4ON9A 1UEIA 1EGAA 2IHYA 4MKIA 1E2DA 1SVIA 4KFUA 4DJTA 4RCZA 5FPHA 2JDID 1TUEA 2Q9AA 1NN0A 4G3XA 5J4YA 1IOZA 4ITRC 3WYFA 1PLKA 4RD1A 5HTKA 3CO5A 1NY5A 3SJCA 1ZC4A 3GFOA 4HB3A 1OSNA 1XTSA 3QXCA 2QGNA 2QY9A 5FPSA 5ELXA 3RVBA 4M9XA 2W6JA 4A92A 3NTUA 4OI0A 1GM5A 3K9NA 5CITA 3VHLB 1F2TB 2B8WA 2QBYA 1XMJA 2HCJB 4LBWA 4TQAA 3KQLA 4UJ3A 5B30A 2YWEA 1E1QA 3B82A 3K1JA 3S1AB 4KYIB 4R2HA 4HLQB 4DIDA 4FWIB 4DXAA 4JVMA 3I73A 2C95A 3LLUA 3OF5A 3NXSA 4Q1CA 4AG5A 1XPUA 4NE2A 3I72A 1KSFX 1CIPA 3BH6A 2IUUA 1ZINA 1E9FA 4V0LA 4LI0A 1AS2A 1Q22A 1E2EA 4M22A 3MWJA 3K0AA 2BDTA 4D81A 3EX7C 1XEFA 2OXRA 2AHOA 1AM4D 3DZ8A 4C30A 4B2IA 1W36D 3BGWA 4P4SB 1ZVQA 1UKEA 1CEEA 2UVQA 1OB5A 3SJAA 3NC1C 1TADA 3PEUA 3QKRA 3HPRA 4URWR 1S3GA 2R9VA 1ZC3A 2AN9A 1G7TA 1F3OA 2QUZA 2RGEA 3QKSB 3RNLA 4AYXA 2XOKA 4N0EA 1D2MA 4TYQA 3B7GA 1FW6A 5C18A 1R5NA 2J0SA 1QRAA 1Z6TA 3O8RA 1FP7A 3T15A 2FFQA 3HYRA 4JMPA 3ZVLA 3U7GA 2YOGA 1AN0A 5JFGA 1IN7A 4QBFA 1ZM9A 2BMEA 1QHYA 4BLSA 2DWPA 4DCNA 1GL7A 2BVNA 2OCBA 3VR5A 3OIUA 3FVQA 2GVDC 2V55B 2GJ8A 1ZNYA 4GMDA 5TB5A 2WAXA 2MSDB 2ZEJA 2QMOA 3QUSA 3VNVA 1Z8FA 2YWGA 2ZXUA 2ZSFA 3K8YA 3S1AA 1KO8A 3X1YA 2FPLA 1RYFA 4JBWA 4QJ3A 5KDOA 4QGGA 3GLHE 5EJEA 3EPHA 1I4LD 1NN3A 2NOAA 1ZUIA 4MYUA 1E94E 1TL7C 4PC2A 2QSZA 3A1UA 4RJLA 1AKYA 1C9KA 1N6HA 3DL0A 5FTKA 3TE6A 1TTTA 1ZU5A 3T5GA 4MQBA 3KXIA 3PR1A 5KDDA 5EUMA 5L3QB 3EIHA 3REFA 2ZRCA 1ZU4A 4P4SA 1DAIA 4DHEA 4WOPA 2GTPA 2VQSA 2GEDA 2QQ0A 3LO5A 2XB2A 3GJ4A 4TMXA 3QKSA 3UKDA 3U3JA 2O8CB 2RGXA 3QVUA 1OXUA 1XCMA 2F9MA 2QPAA 2Z4RA 2WJVA 3HPQA 4G5RA 3T61A 5JEDA 2HEIA 2DFLA 4B48A 5D3MB 5JI3E 3ZD6A 1E0SA 2QRZA 5DIFA 2BCJQ 3AP1A 4RZ2A 4TT3D 4JS0A 3VNUA 1G5PA 2X19A 1JNYA 1S3SA 3QOFA 5AJYA 4FXPA 1QG2A 2RMKA 1U94A 1KJWA 4XVQA 1Z5ZA 4EJSB 5HKKA 3ONWA 3O47A 4DDVA 3RS3A 1KI2A 4PO8A 1CU1A 4LHVA 4BRWA 2QP4A 2Q3MA 4URVR 3U60B 3NBYC 2PL3A 3SEAA 4PZYA 3CF6R 1OFHA 3K70B 3MFYA 4ZPXA 1BOFA 2PT5A 1L4YA 5CIWA 4JYBA 3IIKA 4LX0A 2OUKA 4D4KA 3ZZTA 1ZD1A 2NTYC 1QDEA 4WBSA 1OIVA 1MO4A 3CRW1 2R65A 3G0HA 4KITB 2O0JA 1W4BA 2VSOA 4Q9IA 1Z07A 3UWOA 1HE8B 1VG0B 3KKMA 2RHDA 5KPJA 5HCIA 2A5GA 3BB3A 2CK3D 1U99A 2RKOA 4A0HA 1BMFA 1KHTA 3AF1A 3NG1A 4LYJA 1P2TA 1CRQA 4LBYA 4S2EA 1DBSA 3FFBA 3FKSD 1A5TA 2FEMA 4EKDA 5DISB 4Q19A 3HDTA 4Z1MA 5FTMA 4JL5A 5CJPA 2CL0X 2IYTA 2NIPA 2PT7A 5SZJA 2NPFA 2GEUA 4DLVA 1XMVA 4M1YA 2O8CA 1XJCA 2ZR9A 1JR3D 4M1MA 4XOIA 5D3MA 3RAPR 1R5BA 3U6KA 3LW7A 3EIEA 1JQLB 4A0FA 1Y3AA 2MMGA 2R6FA 4G5QA 4NHOA 1KO4A 3LY5A 2J1LA 1P2UA 1NL3A 4XSHA 5IK2A 3GLGB 2FWRA 2G88A 4TMZA 1GVNB 3EXAA 1HURA 4EJSA 3OFNA 2XAUA 4MRVA 1E2MA 1U81A 3SS8A 2A30A 4IDQA 2MSEB 2OILA 1OHHD 3B2EA 3LW8A 4B6EA 5FTJA 1IXZA 1OFIA 5F3WB 2H7VA 2ZROA 2QP3A 1GIAA 4FW9A 5JECA 4W9MC 3BWDD 1E9EA 1YZLA 1Z22A 2ORVA 4ZDWA 5J5CA 1BYIA 4QC2A 2OFWA 2RGBA 4OQNA 1T0HB 2GNOA 5FUXA 1U9IA 4A9AA 2WIBA 2H57A 4B6FA 2FJUA 4LPSA 4Q9LA 3UXMA 3QXXA 1VPLA 1GWNA 4IOLA 2J7PA 4GRAA 4BFZA 4C0KA 1YZUA 3CW2A 1Q20A 4C3ZA 5KYKA 1XPOA 2ZUBA 2FH5B 3GFTA 2D06A 1DG3A 5EUQB 2UZIR 1BH2A 4PO1A 4D82A 1VKJA 3BBPA 1F5NA 3BERA 4PXAA 4C0HA 2ZSBA 1UM8A 4PHHA 5DHFA 5FTLA 3V4FA 2YHSA 1G17A 2A9KA 1IXRC 1S0UA 3VHXA 4URUR 4EQ6B 3HU3A 5B64A 5EP1A 1T5LA 1N2CE 1E4YA 3K9HA 4QBHA 5SZHB 1OXSC 2Q3HA 3A6PC 1Z29A 2HYDA 1YU9A 4MRSA 4JT2A 5FUVA 3TLXA 1NVVR 5KUTA 2RCNA 1CR0A 2HF9A 2ZRJA 3I4LA 4Q4JA 3CR7A 2O8FB 1E2NA 2IF0A 2ZETA 3A4NA 5AWFC 4EFLA 2OE2A 5HZHA 3GLGA 4JLNA 1IQPA 2W2VA 2HLDA 3KQKA 4LHXA 1J70A 1G8GA 3AVUA 1CR1A 2XTNA 2LKCA 5KSPA 1IM2A 2BJVA 4M2LA 4Q7MB 2ZE8A 4FI3C 3LXRA 4BUJA 2AWNA 1E2LA 2CL6X 4RKFA 3U3KA 3VKHA 2WBLC 1IN6A 5EE9A 3VR2A 3OEEA 4DLUA 1M1YE 1DAMA 2A78A 1VCNA 4KU4A 4KO8A 1G16A 3HJNA 3WY9A 1GITA 3THXB 2FGJA 1J7KA 1LF5A 3IILA 4A36A 1JXMA 3VR4A 2H18A 1KAGA 5KSZA 2ZJ8A 4B3DA 3FDIA 2BV3A 2ZM5A 2C5LA 4B3GA 2JCSA 3SE0A 4BASA 1ZUNB 4E03A 2O8EB 3AKYA 3QXSA 2MSCB 1ZCBA 2QMUA 2WWGA 1VCIA 121PA 4IKEA 4B32A 4EDHA 4JVSB 2OZEA 2WWHA 5B2ZA 4GZMA 4EQ6A 3T1VA 1NVVQ 4AI6A 1COWD 1NKTA 4M1TA 1I4DD 3KQNA 3GD7A 4HAYA 2ZJ5A 4NCKA 5EE5B 1PZNA 3U3OA 3J81k 1DE0A 2O52A 1DG1G 2O8FA 3JZAA 3T34A 2MMCA 2JLUA 1E99A 721PA 1G4UR 3SBEA 2R62A 3C7KA 1N6RA 2DYKA 2OV2A 3FKSA 4GI7A 5FOVA 4UQOA 3VQTA 4ASUD 1Q1ZA 2IXGA 3AQ4A 2ZRDA 2OFOA 3FFAA 2FU5C 4W7SA 3W90A 4N0DA 2Q3FA 2IS4A 4KBFA 4TYYA 1L2TA 4H1UA 3WNDA 1GNPA 3NEYA 3AVWA 1H8HD 3THWB 1C4OA 2BKUA 2QTFA 2ZRLA 1DELA 5HZKA 5DGXA 2V8OA 4E07A 1ONBA 4URZR 1JAHA 4X8HA 1S8FA 5GJWC 2GCOB 2PZGA 3LX8A 3W3ZB 2BCGY 3T06B 1G1MA 2X77A 1NSTA 1FQJA 4F91B 4B47A 1A7JA 4F7WA 1E2PA 3EWAA 1R10A 4BFXA 2C78A 3MWYW 4F92B 2ANCA 4CT5A 2QORA 2GF0A 4DWJA 2XJ4A 2IW3A 1CBUA 3D7MA 1KOFA 2GBLC 3VR3A 3IIMA 1R2QA 1M8PA 1BO6A 1N3BA 3TW8B 1IY2A 2GJSA 1M74A 1SZPA 2VF8A 1NRJB 1ZNXA 5FBLB 1TUIA 1RRGA 2QM7A 4NH0A 4EPRA 1Z08A 4ZCMA 1TNDA 4MYHA 2IUSA 3DHWC 2LWIA 3I3SR 1N5JA 2AXNA 1XDBA 2B92A 1NMYA 5DNYB 1LW7A 2HJGA 2B7CA 3CRMA 1W4AA 3CUEF 3PQCA 3QQ5A 4R71A 3THWA 2GRJA 5L3RA 3X2SA 3PCRB 5AR1A 5FH9A 1KK2A 2JIZD 4LY6A 2FE4A 2PCJA 3B9PA 1AA9A 5CK5A 2P6NA 5C4GB 2F3TA 2GCOA 1GZSA 4DC9A 1MOZA 2I1QA 4JYCA 2REXB 2YOHA 4HB0A 2X1VA 1G3QA 4HSEA 4RZ3A 2OCAA 3W6OA 2XXAB 2NMVA 821PA 1E69A 1NBMD 2CJWA 2FA9A 3TBKA 3X1DA 1QHGA 1KDTA 1KO1A 1T8UA 1DADA 1FUKA 2ZRHA 1Y63A 2IYQA 4OBEA 4BLRA 1NKSA 4BWYA 3DPUA 5G41A 4AC9A 3Q7PA 1NI3A 4UXJA 4B3CA 4Q48A 1YHNA 2OBNA 3LVQE 1QVAA 1GILA 4ACBA 3I92A 3B6EA 3UANA 2QPOA 4OQLA 2ERXA 4ZKEA 4LJYA 3CPJB 1NLFA 3K0CA 2EWWA 1P60A 2DR3A 3F0TA 1J90A 4GOXA 4BFYA 1E9CA 2QAGB 3FMPB 3Q85A 1VCMA 2C9OA 4V0MA 3CB4A 2AKAB 4W5HA 2W6JD 1MT0A 1Z06A 2KB0A 5J4HA 5J4VA 5TMPA 1LY1A 1E9DA 1Q1EA 4EFNA 1KMQA 1TAGA 2ZPTX 4NYJR 4C0JA 4R2IA 1YR6A 1XXHB 1I4TD 2W83A 1B23P 2V7QA 1MRNA 2V6JA 1E1QD 2V9PA 4A82A 4QM6A 3TUIC 3NDPA 1ZM4A 3FYHA 2D62A 2Y8EA 1YR7A 4DKXA 1COWA 3FMIA 5CLLA 3U2QA 4AKIA 1HUQA 5J40A 1E2KA 3ZVMA 2B6HA 4ZI3A 4L9SA 4RFVA 2ZRAA 1KI7A 3W8RA 2ZUDA 3EC1A 1E3MA 4JVNA 2EVWX 3N2IA 1LB1B 3OIVA 3ZH9B 4ARZB 4QBGB 2ECKA 2EFHB 1GSIA 4OJQA 5TV2A 4B3BA 1N6KA 3OIWA 2WZQA 1TU3A 4TTQA 4IHQA 3PUXA 3L0PA 1WMSA 3NHBA 3GLGE 4R9UC 1PUJA 1RZ3A 5BXQC 1H8HA 3EPKA 4XTRA 5JBQA 2XOKD 3KQHA 1OXXK 3GLFB 2C98A 4ZKDA 5E7IA 1IN5A 1XU4A 5SZIA 2ANBA 4NCIA 1SVKA 1II9A 1KIMA 1H65A 4KAXA 4V0OA 2JATA 4TQ9A 1T4GA 1S96A 1TF5A 1YR9A 3PUWA 4TYNA 3VKGA 1FPMA 2NZJA 2QAGA 3IPXA 4JZKA 1GNRA 3AVVA 1G18A 3LBHA 5IF9A 2JLQA 3G82C 4NYJQ 2H17A 1XD2B 2WKRA 2G6BA 1E9BA 2J9RA 3ZDQA 4LUCA 4UKDA 4CDGA 3VKWA 3KKPA 4YQFA 1XXHA 2OT3B 1EESA 4US2R 1OFTA 3TVTA 1FX0A 4DSOA 1OJLA 1H8ED 3V00A 5FR1A 4CZ2A 2YZ2A 5LBIA 2W00A 3ND9A 2GXAA 2F9LA 3KFVA 3KFXA 3SHWA 4Q4AB 3CX8A 1WE2A 3I32A 4Q66C 5AUQA 3RLFA 2QZ4A 1GKYA 3W6NA 4EPTA 4RD6A 3CONA 4KXFB 1FFHA 2XZOA 1KKLA 8OHMA 5JCZA 2QMHA 1KI6B 4Z51A 1G8PA 2KSQA 2GZAA 2ZR0A 3QXHA 2XB4A 4MKHA 1TF7A 4A4DA 3L82B 3RS7A 2PLFA 2QGZA 4LJAA 2KBEA 1DAHA 2RHMA 4OHYA 2O8BA 2D74A 2ZAOA 4AURA 5JSZB 3R8FA 1KO7A 3ZLJA 2H16A 4KHZA 2DFTA 3LAWA 2ZTSA 4I99A 2A3RA 4HUQB 5CYPA 4OQXA 3EZFA 1R0YA 3GLFA 2N1BA 3AF2A 4OI2A 4PZZA 3OZXA 3K70C 5GADl 2GESA 5FBWB 1YZNA 1JR3E 4MRNA 2ZRGA 621PA 4PFSA 1C1YA 4TTPA 1VDZA 1P7CA 1EK0A 2JJ8A 1E96A 1U9IC 2VBCA 1NMZA 2VIIA 2ZJYA 4Q02A 5ANRB 2P5SA 4L15A 1G19A 1N5KA 2N42A 1E2GA 4MGKR 1XD2A 2IEZA 1CULC 5HKKD 1RRFA 2C03A 2WMNB 3TUJC 1OKKD 1FP6A 1Z0JA 2P65A 4GBMA 4D6PA 3RC8A 5JWOA 3WBKA 2G77B 3U6BA 3EAQA 5LB4A 3TR0A 2FDCA 1VIYA 1KJZA 4Q4AA 3K0SA 2BMJA 4IEIA 1NNEA 2VLIA 2WJYA 4QHSA 1DAGA 4X8LA 1UBFA 4PPNA 1CF4A 1KI3A 4HLUA 1R5OA 3T5DA 2Z5FA 4GP6A 1G9XA 1KI6A 2ZJAA 4DCUA 2WSSA 2GILA 2AR7A 3GJ5A 1A82A 1BMFD 5B57C 4LJ6A 5H8WA 5JJKA 4D4MA 2J7KA 2FG5A 2OCPA 1G64A 3L0SA 5JSZA 3QIAA 1AQUA 4Z1MD 3H4MA 5E7JA 2GBLA 1MO5A 1CP2A 1ZAKA 2R6AA 3C5HA 1E0AA 4NDZA 2OFXA 4L9WA 1KSJA 2C2HA 3I8SA 4TN1A 1O87A 4WIAA 3LV8A 1X3SA 2VP6A 1N6OA 1T9HA 2JAQA 2Q6TA 1MRSA 2ZYTX 4PX9A 2FX3A 3NWJA 3THYB 3L8YA 1KDRA 4C0BA 4P0TA 4TMWA 2J41A 4YC7A 5FL7A 4Q7LA 4C2UA 4M8NE 4NYMR 4B3XA 2R6CA 3B60A 5IK2D 1ZNZA 4Q1DA 4BPBA 3MAAC 2O0KA 1M2OB 1AZTA 3OFND 1YZQA 5DHAA 2BBTA 2VPPA 5DI3B 1XD9A 3CKLA 3PJRA 4O2LA 2X2FA 2YWFA 3MUFA 3K70D 3MRSA 3EC2A 1XP8A 1NVXQ 3ZS9A 3SQXA 2GCNA 3RRNA 3F5FA 3BFXA 2YWHA 2NO7A 4G01B 4MUBA 2WJIA 1HV8A 4YMVA 1N5IA 1E2QA 4LV5B 3N70A 2EW1A 2XTZA 2J7PD 3B8HA 3L2OB 1G7RA 3DM9B 2QI9C 4M9ZA 3VTKA 4WZBE 1F2TA 3VU9B 4QGHA 2A5JA 1M6NA 3RS2A 1GRNA 2WKQA 1ZM7A 1FQKA 1H8EA 3R20A 1GUAA 4JLPA 1XB2A 1P2VA 4IVQA 1N0UA 2PMKA 2QNRA 2VP5A 2V3CC 4NCHA 2FZ4A 4OL0A 2BBSA 4TLAA 2IXFA 2B21A 1N5LA 3IO3A 3QBTA 5FUYA 3KZ1E 2QE7A 1JJVA 2XGJA 3ADCA 2PX0A 1ESMA 2NZ8A 4NYMQ 3WMFA 5JJIA 4MRPA 3AV0B 2DFKB 4DLZA 2HYIC 4QXAA 4M1SA 1BIFA 3SU8A 1CJTC 2ONJA 4FMDF 2GJAA 1GL6A 3QF7A 1EG7A 1AJEA 2NO0A 3ZVNA 2HLDD 1W0KD 2VP4A 4GFDA 3VR6A 2Z43A 2EFEB 1X8KA 2IWRA 3O8DA 2GA8A 2IX3A 1NLYA 3G5UA 3K9LA 4W5JA 1CRPA 1EFHA 2VSXA 1R8QA 3U5ZB 2GHIA 2FNAA 2G0TA 2ONKA 3K0EA 5DSZA 1R8SA 2CCJA 3QEOA 3OEED 1FTNA 3Q7QA 2CL7X 2O5VA 5EP3A 1JXOA 2FSFA 1UPTA 3A1VA 2ZSEA 4QNRA 2P67A 4B34A 4G0NA 1Z0FA 3B13B 2GXUA 5KSYA 1OKKA 1KI4A 1ZD8A 2WWWA 3H1TA 4DB4A 1YE8A 2K5UA 3TSOA 3K0FB 3QEJA 2QAJA 4DLYA 4CT4B 2KE5A 3W6PA 4Q03A 3B1XA 4G5OA 5K8IA 1Q44A 2CDNA 4TMTA 4JLKA 1LF0A 1N6NA 1KY3A 5EXPA 2BEJA 4FMCF 1XXHE 4D0LB 5TY0A 1E4VA 1N0WA 2ATVA 2JLSA 3PXGA 1G3RA 4O3MA 3RS4A 3CRQA 5JRJA 1TQ4A 3A37A 3VX3A 5L3QA 1VECA 2CNWA 4OK3A 1OB2A 5DLQC 2ZVQX 1U90A 3CR8A 4NKRA 3PUZA 2G1JA 3OEHA 4BFSA 4JLDA 2QTVB 1JECA 1D2EA 1AS3A 1W1WA 3F3YA 2PEZA 1AK2A 4PC3A 1XTRA 4Q4HB 2P5TB 1XBTA 3NKVA 1EX7A 1WA5A 1JALA 3U7HB 4WXPA 2AFHE 2UKDA 2D3WA 5P21A 2C8VA 5CJ2A 2H1LA 3GLFE 5TVKA 5IT5A 3EZ9A 4D2IA 4YMTA 5FOTA 3HU1A 2AD1A 4MDEA 2OEPA 3K0CC 2R8RA 3BAFA 3PEYA 3I8XA 4JBYA 4QOSA 2Q9CA 5FPTA 1RIFA 1E0JA 3K0FA 3EA0A 1Z28A 1WXQA 2ZVPX 5J47A 1DS6A 1ZBDA 3B5JA 4YMUA 1NBME 4PHTA 5EQTA 3T1OA 3AKDA 1K8RA 2PLRA 2WHXA 1IJFA 1HEIA 1S2MA 3UG6A 4ERNA 4HDCA 2BM0A 4KLNA 3GEHA 2OESA 4DRZA 2ZS8A 1AKEA 1G7SA 3BD9A 5AJZA 3PFIA 1W4RA 1WBDA 2YJTD 3R9WA 2EFGA 2GETA 3BC1A 5C4MA 4Q18A 4WA7A 4GNKA 4U5XA 1ZRHA 1SHZA 4PO9A 5E4FA 4ZO4A 1DO0A 2IEYA 1TPZA 4OK6A 3DDCA 2OBMA 5LPNA 4DT1B 5F9HA 1RE0A 2OO7A 3SOPA 3T35A 3QG1A 1P9RA 1G8YA 2D2EA 2RB4A 4TL8A 4LWZA 4V02A 1P61B 1OXVA 3KKOA 3MMPA 2XNDA 2ZIAA 2BWJA 2PMDA 4IDPA 1U2RA 3T1QA 2WJJA 1Z6GA 2EYQA 2JEOA 4Q1FA 3TW4A 1EFRA 1Q0UA 4HATA 2JJ1A 3A36A 4F4CA 4QHYA 1J8YF 1W48A 1GP2A 2GAOA 4M9SA 3UIEA 2TMKA 5CB6A 1YZKA 2VRWA 4JL8A 1J2JA 1XZQA 2OG2A 1ODFA 2DWQA 1CR2A 2X2EA 4DDWA 4I4LA 4BZQA 1VCOA 3GQBA 1HH4A 4DSUA 4HAVA 1W0KA 3EPJA 4ACAA 2PZEA 4B76A 4BECA 2H8KA 2IF2A 2QAGC 2ZREA 4G5GA 4LJ8A 3SN6A 2NQ2C 4B71A 5JHGB 3U61B 1N25A 1YZTA 1Z6XA 3RSOA 3BE4A 2YVUA 2WKPA 4LYFA 1AZSC 2ZRPA 2IYWA 1SHKA 1IBRA 3KXKA 4EPXA 3FMFA 4N1AA 2IYYA 3QG5A 2IYVA 2CVFA 2VHUA 1AS0A 1HT1E 1QHIA 5AUOB 4Q7KA 1KNQA 2ZRBA 2AL7A 1I2MA 3ND8A 3R8CA 4M4SA 4QKQA 4MGZR 2ZI7A 4TLBA 1WBBA 3E1SA 1YVDA 3NHAA 1A4RA 3ZS8A 5FUWA 3FHTA 1SVWA 2YNMA 1XZPA 2DY1A 3SJBA 1RW4A 5BWMA 1VYUA 1AGRA 3NIBA 1S4QA 3IBGA 4EPYA 1SVSA 2WWXA 3BK7A 4NBSA 1UJ2A 4BFUA 1ZUHA 1A2KC 4NZYA 4BLPA 4AD8A 2XZLA 2YOFA 4BQSA 4DT1A 2FN4A 4H1VA 3GJ0A 1M7BA 4Q9KA 1E2JA 4B75A 4DCVA 3FPAA 2VSFA 4B74A 4Z54A 1G7CA 1MR3F 2H5EA 2V7QD 4KODA 4LRWA 3LVRE 4TL6A 1PV4A 1FUUA 4JKYA 4TMVA 1FMJA 4OK5A 521PA 1WQ1R 4I1OA 4DLRA 4IDNA 1W4CA 4PC1A 1OV4A 4B73A 1EFUA 1EWRA 1VIAA 4LBZA 4A2WA 2FSGA 2C77A 3FGNA 1X8JA 2EWVA 2IL1A 2VHQA 3AGQA 3F8TA 4W5WA 5DYIA 1FOEB 1NSFA 1P75A 4V03A 2OLKA 3A1SA 1KK1A 1CTQA 1XWIA 2WPDA 1DAKA 3SYLA 2JLVA 4TL7A 3FB4A 3LH5A 3QXJA 4JBXA 3U3MA 5KO2A 3WHKA 3E5HA 5AK0A 4DDUA 4JKIA 5FBRB 4KYUA 4MRRA 1Z63A 1G4AE 2IYUA 5DI9A 5HCNA 3PG5A 4QG7A 3EIQA 2VP0A 2ZE7A 4OJKA 3KKNA 2NPIA 3D31A 4OQFA 2CHQA 4URXR 1ZJ6A 3B85A 2W2TA 4NL4H 1OH5A 5FPKA 1GOTA 3EW9A 2ZUCA 1P72A 1P2SA 4WVFA 3THXA 1PLJA 3RWOA 3GMTA 2BJWA 1UADA 2W0MA 3BRWD 1U0JA 3OE7D 2AXPA 2RGNA 1AIPA 1SULA 4LDJA 2VF7A 4HLUC 4HAXA 4IEEA 4PQFA 3ZYCA 2JLWA 4WXRA 4MA4A 5EE0A 2LCFA 1U98A 1SVOA 1N6IA 1W2GA 2C04A 1LS6A 3U7EB 5EZ5A 2O8EA 1ZMXA 1N0VC 2CVHA 3V4RA 1VG9B 1RFLA 1UEJA 1UKVY 3HYTA 1Q57A 3ADKA 3AVXA 1OH7A 1ETUA 2P0EA 4L8GA 1KK3A 3L0IB 4HDOB 4WAUA 2RGDA 1XPRA 1NMXA 5CIQA 4C9BA 4GMXA 1NY6A 1Z0AA 3M4YA 5JWHA 2X8AA 1DVRA 3P27A 2W58A 1M34E 3AKCA 3SYKA 1E2HA 3AF0A 3C41J 1QHNA 2IS2A 3WYAA 2HJVA 4PTLA 4NTZA 3JVVA 1W46A 1Z47A 3MJRA 4NYIR 4PPGA 3CZQA 4JLMA 1IY1A 1FL9A 1RC8A 3D3QA 4KFTA 4QGFA 4H9GA 4FWTA 3P4XA 5DN6A 4AKHA 3C4JA 1JQJC 4AYWA 1MH1A 4BFVA 2QM8A 1JJ7A 2A2ZA 3LA6A 1KGDA 2ZSAA 1JPJA 2J0VA 1E79A 1HQYE 4RSGA 5HPYB 3TAUA 2KJQA 2QPTA 3CRRA 3IDQA 3O8BA 4BZXA 3GPLA 1W44A 5EE3A 4EIWA 1V5WA 2FV8A 1TX4B 4JVLA 4CF7A 5M04A 1CS4C 3C5CA 1VHTA 2ZRIA 4NP6A 2IS6A 5AJVB 2QT1A 1IN8A 1MABB 1QVRA 1UKZA 1NIPA 1Z0IA 2J87A 2LKDA 3IHWA 4ILEA 4LV6A 5KPDA 3AGPA 4Q1AA 3B1VA 4CYMA 1U0HC 4JL6A 3ICQB 2KWIA 4JJKA 2BMFA 2R44A 2J5XA 2VTKA 2AWOA 3B1ZA 3AVOA 3C14C 2DCUA 3B1WA 1JI0A 4A6XA 4MKGA 3CH5A 1W0JA 1NN5A 4RVCA 3PEWA 2ZJ2A 3VR1A 3WP1B 2EYUA 4LGMA 2DB3A 1J8MF 4UXIA 1MV5A 4FCTA 3WMGA 4II7A 1NP6A 3TGPA 2F1JA 3IKJA 4BLTA 1Z6AA 4Y0VA 1II0A 2ZAMA 4DLXA 5IDVA 4A2PA 4NYIQ 1T0JB 2VEDA 2Z4SA 2CLCX 3X1WA 2D2FA 1ZP6A 2WOJA 1V43A 5FBQB 2DPXA 2ZRFA 2A7QA 3SFZA 4MDFA 1T3HA 4PPQA 4CW7A 2WSSD 3WRXC 4A0GA 1IJEA 4HAUA 4I1UA 1SQ5A 4GPTA 3ZJYA 4F4IA 5H70A 4DLSA 3TQCA 1DAEA 4KFRA 4M1OA 1XEWX 3OIYA 2WJHA 2FFHA 3NC0C 5A5GA 1LS1A 2F1IA 2G0NA 2ORIA 2GF9A 2BBOA 4C7OB 3WNBA 3B9QA 1LTQA 4C0QC 2V1UA 1G5TA 2B7BA 4MYTA 3M6AA 4JJZA 1Q1BA 2JASA 5JZVA 3RSLA 1G3MA 1F2UB 2F3RA 3P4YA 2ZJZA 5EZ6B 3I5XA 3NVAA 1ELOA 1SVLA 2RGGA 1JEEA 4LHZA 4B44A 1MABA 4BFTA 2GK7A 3GP8A 3NEJA 4HI0E 5FL7D 3KDSE 4AG6A 2DFNA 3OESA 2EQBA 2YINC 1HA3A 2OLJA 3ECCA 2XXAA 4M9QA 4L16A 2PJRA 2W6IA 4E22A 5EXXA 4TQUS 4V0NA 4E5UA 4KFSA 2VHCA 3FMOB 4D80A 1ZCAA 4HEJA 3WP0A 4RD0A 2GXQA 4JLAA 4QGAA 5G3ZA 1OIWA 3BFKA 3HR7A 3HR8A 2ZANA 2GAAA 5TARA 3CPHA 3IUYA 1WRBA 1BYUA 2VO1A 4C4PA 1XTJA 2GDJA 2NO9A 2WVJA 3Q9LA 1IXSB 2VP2A 4Q1BA 2HT6A 3SHFA 1ZYUA 4FD2A 3RDPA 2C9YA 1QZXA 3OE7A 2DBYA 5L3VA 1CJKC 1E1RA 1UBCA 2QP9X 2ZSDA 4IFBA 3PEVA 5E7MA 2NGRA 4WW0A 1E2FA 3W5IA 3LD9A 1G291 1II8B 2XJ9A 2ZU0C 2J0UB 3GJ7A 3Q3JB 3UATA 2Z0MA 3W9YA 3DEFA 2QU8A 1ZD9A 4DZZA 2RAPA 5A0FA 1XMIA 3R7WB 1W5TA 3MWKA 2CLSA 1TF2A 4C7OA 2XTMA 2VH5R 4FMDB 2BKEA 4BRUA 4Q1EA 4XSGA 1EX6A 1E2IA 1F2UA 5BN3A 3PITA 2QE7D 1SXJB 3LBIA 4DCSA 5J4KA 1PUIA 3DKVA 4D0GA 2BOVA 1E6CA 4F38A 4ARZA 4XWKA 4JIMA 2F7SA 4MH0R 4I1SA 5BYKA 4DUGA 3IEUA 2QEQA 3DM5A 3JZMA 1KJYA 2XITA 3EA5A 1XRJA 3NH6A 2P2LA 3BOSA 3FE2A 1FMLA 1UBGA 5BN4A 4QJ4A 5GVRA 1S1CA 1VG8A 4NCJA 3AF3A 1XMSA 3CLVA 2L0XA 4TLCA 2AFIE 3AP2A 1KI9A 5A4JA 4PR0A 1X6VA 3OHMA 3C16C 1DTSA 1KYIA 1NF3A 4N3NA 2Q0HA 3RS0A 1XNJA 2ZE6A 3BJIC 1F60A 3GJ8A 3TSWA 2ZJBA 3EZ2A 2PJZA 3KB2A 3M0EA 2ODWA 3ASZA 4LJ7A 2OSBA 1RRCA 1II8A 3RHFA 1X1SA 2R6GA 3L43A 1VYTA 3BORA 4AK9A 4LHYA 2J0UA 4IW3B 4WZ6A 3BH7A 1Q21A 1R0WA 2ZITA 1EFTA 4A1FA 4NPHA 3FOZA 3AP3A 4B3FX 4QM7A 4TL9A 2BM1A 2C9CA 3KJGA 4DLWA 1HTWA 1UFQA 3R7WA 2EFCB 1GRQA 1TQ2A 1CJVC 2Q21A 2NG1A 2KI5A 1QHSA 2ZI5A 3A58B 4LJ5A 2WWYA 1KY2A 2DWOA 2V54A 1YR8A 4ZDIA 3QPWA 1KNXA 1R4AA 2IYZA 3BXZA 4Z8YA 1SXJA 2WAYA 1OYYA 2VYFA 2QMEA 4PHGA 3FTQA 3LX5A 4DBLC 1DO2A 2CNWD 3WHLA 5GJBA 3P20A 1OW3B 1ZIPA 1SKYB 3P26A 4FCVA 3TSZA 2RH5A 5KU1A 4LOAA 4TZ6A 2WOOA 4GZLA 1T5IA 3OEHD 1XCPA 4TTRA 1IONA 2I4IA 2ZRNA 5AJWA 3OAAA 3E2IA 1QF9A 3CPEA 3SC3A 4HUQA 5C2JB 1LNZA 1P9NA 1Q3HA 5GJCA 4YXWD 1KTVA 3CNNA 2CE7A 3TR5A 1RPZA 4MGYR 4ZV4A 3EWSA 2OM2A 2QL6A 2WICA 4DVGA 5KOYA 5AJXA 1KDPA 3QBVA 1YRAA 5GJVC 2ZE5A 2YC2C 1B0UA 4Z8XA 3CF0A 2CLDX 3KJIA 4HUTA 3V9PA 4GL2A 2XSZA 2AK3A 5FL3A 4Q9HA 1OH6A 1I2DA 3AUYA 3BB4A 2OBLA 4P33A 2HXYA 1KMHB 1OLOA 3T12A 4A2QA 3TH5A 2WTUA 5GVSA 3LLMA 2F6RA 4EUNA 4F4JA 5KNBA 4M1KA 1G6HA 3A1TA 1BS1A 2GCPA 3LBNA 4PQYA 4QRHA 4B43A 1RYHA 4DSTA 3TUZC 4UNPA 5FOSA 1SVMA 3GCGA 3CZPA 4L4UA 4B35A 4XD7D 5JHHB 5BQ5A 4MKFA 4PC7A 5EE1A 1T91A 4DIEA 1F48A 1YQTA 3W3AA 2PBRA 2YKGA 4RZUA 4LCBA 3REGA 1GDDA 2WV9A 4FCWA 2HUPA 5C46F 4A0RA 4D4LA 3H84A 3NBZC 4BEBA 4V0ME 2ODNA 4D26A 421PA 4KSBA 1IHUA 5F98A 1JPNA 4KVGA 4ESVA 1Q3TA 1TQDA 1S9DA 4XH9B 4LK2A 4PQRA 2XNDD 4TSFA 1F6BA 221PA 1ZIOA 4XWOA 3IO5A 2IYXA 2VHJA 2HXSA 3QF4B 3QJYA 3PUYA 4KBGA 4B2LA 1CXZA 3KX2A 2IYSA 1OPXA 1EFRD 4EAQA 1AQYA 3THYA 2FPMA 2JJ1D 2HV8A 4CRWB 1W2HA 4BE7B 5SZKB 4ZDKA 1R0ZA 1NN1A 3ADBA 3E70C 4JSTA 2JLZA 2QENA 2ZS7A 1XCGB 4DB2A 2HCBA 3QI2A 3ZIAD 1KAOA 2CCGA 4BEJA 1UAAA 1KMHA 2BIFA 2QRNA 1VG1A 2RGNC 5DI3A 1XJ0A 2ZJOA 4KJZA 4UNQA 4C2TA 4R7ZA 5TDHA 1GAJA 2G3YA 1G8FA 2P6RA 3MJHA 2EU8A 4KV9A 1VMAA 3D6TB 1KSGA 1FNMA 3U7FB 2G9NA 2CEAA 3QNUA 2G83A 5KNDA 1VYVA 1A2BA 3C8UA 3QPVA 3SQWA 3A8TA 2FOLA 3LWNA 3VMFA 4CVNA 5HE8A 4Q47A 2OAQ1 5D3QA 2O8DB 2G1KA 5KDLA 2GVZC 3JVUA 2CHGA 2JJ2A 1G8HA 5DYGA 4ZDJA 3VU9A 3EZ7A 1G3UA 2ZYUX 4RD3A 3RS5A 3AM1A 1D6JA 2FGKA 3MSXA 3PENA 3Q5EA 2V4ZA 1OIXA 5IHPA 1W36B 3AVYA 3H86A 3CBQA 1G21E 1MO6A 2FEOA 1JR6A 2Q9BA 2PEYA 1T3SA 3QF4A 5BN5A 4NONA 4OYHA 5K8TA 4A6PA 3ZQ6A 1L7VC 1RJ9B 3HWSA 2ZYWX 3QKTA 4RZXA 2DHRA 3K53A 2YC4C 1NIJA 2E1RA 2ZS9A 1Z2AA 1E9RA 1UF9A 1P62B 2QG6A 4DDTA 2N46A 3DZDA 3PV0A 2WPDD 1T3LA 2JDIA 4XIGS
chains in the Genus database with same CATH superfamily
2SCUA 3AEUB 3OU2A 5F7JA 2F17A 1YJ5A 2ZLBA 4KE9A 1A5ZA 4DCTA 3UMJA 3UGJA 1YZHA 4HF7A 1ID1A 2ASEA 1VE3A 2J3EA 3PDUA 1W49A 2VYVD 4BO7A 2NZYA 1FE8A 1KKMA 2FZGA 2JIDA 2R5WA 1QIFA 3K32A 2OQVA 1DIGA 2A5DA 4G1UC 4YXWA 1Y80A 4IDBA 3I9V6 1B8VA 2A9QA 4HBZA 1UAGA 4E51A 2WE8A 3JX9A 1Q0RA 5DHRA 3GEIA 3GUZA 3GPDG 4J94A 4EPWA 5A0TA 1NV9A 1SBTA 4P22A 1KZYC 1UC9A 3H65A 4XD2A 1HSOA 4D02A 1BKDR 2OHIA 5FWYB 3RRZA 3COWA 2ICAA 4O1IA 3AF4A 1SQFA 5FIUA 3OX1A 3OTOB 1OBCA 2O8DA 2C00A 2QTTA 5CNKA 5DM4A 3VHXB 5TQ0B 5CEFA 2HWKA 1EBFA 2EEZA 1QCCA 4ND2A 4LI3X 2GJKA 2IZ6A 3UO8B 2ZI3A 4M21A 1USUA 4GLLA 4C0SA 1C4XA 3I52A 4GT1A 1FJXA 5BV1A 2VN8A 2G7MC 4Q4JB 5BSKA 3NV9A 3QX9A 3HCRA 4M8SA 5J3JA 3ONFA 3DTTA 3BB1A 3A6DA 3FSRA 1P39A 4WKBA 4ROSA 1R37A 4I2VA 3DAOA 3UNXA 2DFPA 2OHVA 5G2OA 3EG5A 4WLOA 3PU6A 3QMMA 3PUIA 5JUWA 2IT1A 2EGGA 3H2GA 3I5YA 1I9CA 2P41A 4GOKA 1Y8RB 4QDJA 5DLDA 4RVNA 3ROTA 3TKLA 1KDOA 4EUSA 5FT9A 3X1ZA 3DW1X 4IRUB 3A10A 1MOSA 2AF4C 2JJMA 3U19A 1K3FA 2C5EA 1SXJE 1LPNA 2CXRA 4IDEA 4DMMA 3UK2A 1DI0A 2WU1A 3AU9A 3MTAA 4MUXA 1O3YA 4K81B 4N6GA 5AH0A 5DTMA 3CEAA 3R0JA 4F8JA 2FW9A 3DMDA 1PEDA 1UZUA 1JAYA 3UH0A 1CQZA 4UNRA 1ZXBA 2MYPA 3RU3A 3VAYA 3EJ6A 4J0FA 1TQ6A 2V1XA 1AHPA 5IT9A 4FC7A 3I58A 2NP7A 5KSOA 4PZPA 2EQAA 3FSGA 2JGDA 2VHTA 2PCLA 5CDHA 1TDJA 1R6TA 3H8WA 1I6LA 3EVTA 3IODA 3DZKA 4OLHA 5DCYA 1UDWA 3VR4H 1VFNA 1CJUC 4GKKB 3K7EA 1OWLA 1WVGA 1Q12A 2D1FA 2E87A 3GGGA 4ZRNA 5GGYA 3ONEA 5CDGA 1DCKA 4UPVA 4M98A 5MN4A 1PKXA 2Q8PA 4EW6A 3U1TA 2QL9A 2GZHA 2NUTA 3DCYA 3L0OA 1YR3A 4KG7A 3CRVA 3CM0A 2M2IA 5KYWB 4MHSA 1UMDB 5CM9C 2P27A 4FYHA 4K6FA 5EPUA 4DCCA 2BF7A 2H31A 4K7JA 4U02A 2JLYA 1W0JD 2G36A 4AKGA 4Y8VA 1G8SA 1W47A 2NLOA 1NJSA 1B73A 2YHIB 4M0KA 1P18A 1QH8B 5JJCA 2AJLI 4MYRA 1H5UA 3TCXB 4KIWA 4UBKA 4Z9AA 5EJMA 2AEJA 2OCYC 1K6XA 3PXBA 2RHBA 1VM6A 5FHQA 5K0ZA 1QGED 4D9GA 2P3SA 3OPYI 4IILA 2YXNA 1JAIA 3ZY6A 5C1OA 1AGPA 3DZIA 3IOBA 3KZMA 2WTMA 2WUEA 2ZVJA 1NG9A 3D59A 3ZVRA 1FBTA 4CM9D 4QEKA 2IK8A 2J6IA 4I55B 5B1HA 1YNOA 2X1MA 2X0FA 4CPDA 2A1UB 5JYDA 5KS2A 3VM6A 1XUOA 4Z4HA 1CR4A 2H1CA 5JISA 3NYWA 1YQEA 2DWCA 2VJKA 2Q8NA 3MD0A 5KWVA 3OCUA 3M1IA 2F55A 3NO4A 4QBIA 2QN6A 2BELA 2YQ4A 1HY3A 3KL2A 1LNQA 4CIBA 1CK4A 2HA5A 3GWGA 4AQ7A 4P4UA 4P58A 1U0GA 4Q4LA 3MQFA 1AHIA 4Q15A 4YH1A 3P1JA 3Q3CA 1I0ZA 3T5BA 3DMNA 3HDVA 4WASA 3QX3A 2REOA 1P81A 5I7RA 4JY7A 3L6RA 2W2OA 2A84A 2FWBA 2XNSA 4KPUB 3DHEA 5CHEA 2OBBA 2GZ1A 5DTQA 4AZ3A 5B7GA 1D9XA 1MJFA 1U1FA 2DTXA 2YR0A 3WYBA 3WXMA 4IFEA 3P2JA 3HLTA 4BO2A 4IIHA 3IJRA 1TLTA 1G41A 1YDGA 4CMIB 1HTTA 2H4JA 3GCDA 1NZDA 3CLSC 4MICA 4W9NC 1XQYA 4ZCIA 2X5XA 2CFCA 1QV7A 4JCOA 1SKQA 2Q1SA 3KQMA 4MRMB 3SI7A 2EQ5A 4KGDA 4ZO6A 3RSQA 1X87A 3M3DA 2ZJ0A 2X8JA 4MLZA 4ZQBA 1R3DA 2QT0A 3U26A 3MTEA 2QL7A 3ZKAA 5A6VA 1JB1A 4CLOA 4X7BA 1BX0A 3EASA 2QYSA 2X4GA 3B78A 1NE7A 2IC5A 1AVTA 4XZ3A 3UOWA 4URHA 4EGFA 5EJ4A 3PX3A 1X1EA 1WW2A 5CT6A 3HCOA 4MRAA 4ALJA 5HR5A 3O5AA 1NTOA 3MGCA 3NHZA 4M8IA 3WYGA 2XIQA 3CKKA 2ZBQA 3HY4A 2EIHA 3M33A 1GUYA 1TMOA 1E1RD 5BYJA 2VNAA 1SXJC 2UDPA 3DMFA 3EHDA 3HCPA 4HYYA 5EWLA 3VZRA 4E33A 1M0SA 4UM9D 5E95A 3KJFA 4QJ5A 2CCKA 4HAWA 1O9GA 4US0R 4BCDA 5KOHA 4EFMA 4RACA 3C7TA 3LUHA 2Q50A 2WD7B 3PF8A 3Q0TA 4WEQA 4BZPA 1QC5A 3MOIA 1D6NA 1GNQA 1H9BA 1UBUS 2IPOA 3ZQUA 4EGAA 5KTYA 3WRYC 4JT4A 2H63A 5NULA 4CCSA 2J3HA 4MS1A 3PXCX 1M2KA 4I81A 1GL9B 1YB5A 4UD6A 2B98A 3IJ5A 3IT2A 2ZRKA 3RTBA 4CTKA 2X3FA 2VUHB 3RIMA 1WXXA 4DUYB 1CJCA 4L7QA 3KUDA 2I6TA 3L1JA 3ICEA 5JQGF 1XEAA 2AGVA 2YXBA 2I62A 3O8QB 4TKMA 4MI6A 4XQGA 4LFBB 2H51A 1DIBA 4ISBA 4RPCA 3EGIA 4F06A 2C9BA 2IQIA 3UMSA 4J0CA 2FPGB 3OZRA 1YRBA 5DCLA 2O6HA 3P32A 2PAAA 1X7ZB 1TLFA 2QDXA 3EYWA 1JU3A 4M9RA 2H92A 5F4ZA 4Z0TA 1POWA 1QK4A 2DU8A 4UPEA 1PWHA 3C8ZA 4RPIA 4UUOA 2SHKA 4FS3A 1ISFA 3PPXA 1V3TA 1K89A 1HRKA 2F1RA 4LC0A 2QZPA 3IUEA 4Y6OA 1Z15A 1Z5PA 3HKEB 1Z88A 2JGJA 2RGAA 3LFUA 4RPLA 2BEKA 4B1FA 1QM5A 1HYEA 1SZDA 2CFSA 3OOWA 2IVFA 1O54A 4X20B 2ZXEA 1Q0HA 5D84A 3RUDA 1LI7A 1RLIA 2XCQA 2Q3JA 1OX4A 1DRUA 5TXGA 2IXTA 4MEAA 1WOMA 2NVOA 4RQUA 1CE8A 4HPJB 2HL6A 5G0VA 3B6JA 4BVBA 2P4UA 3ASVA 3OH8A 5LD2B 4DY4A 1E92A 5B1IA 4DQXA 4FDAA 4R05A 2GERA 1TUBB 4MCHA 4XTCS 2W2XA 4R8LA 1LBTA 2R6JA 2Q2OA 3MQ4A 4EZBA 1IPEA 3QFHA 3R6LA 5JH7B 4MWSA 1XLWA 3CLSD 5TS2A 5BNZA 3ZCXA 1K0UA 2JCBA 4DR5B 5GOZA 1DIOB 3JWPA 3KK0A 3O2NA 4Q0MA 3H8VA 3I39X 3JD1A 3U31A 2G5CA 4AFNA 1VTKA 1JIJA 3KZNA 4KYVA 4ZICA 4PYJA 4HNQA 1XVAA 2FPSA 4LV8B 1MXFA 2D7CA 1OTYA 3GXBA 4PYMA 2IBTA 4OLAA 1WL8A 5LQSA 5IM4F 1CDOA 1WCIB 3W5HA 1YTLA 4QODA 2JFPA 1XLVA 2RSLA 3LNCA 3ZCRA 4G4JA 3JCZA 3IP9A 4QFMA 5I7SA 2WIAA 6YASA 1Z26A 1T2NA 4B09A 4US1R 4FMPA 4DEXA 1SXJD 5BW8A 2H4HA 3NIFB 4QVIA 5DKFA 1YMUA 2EARA 3U5TA 5K3CA 3QLTA 4KI0A 1BDHA 1A5AB 1ZNWA 3HA3A 5A4AA 3CZ9A 3VO2A 4CM9A 3ZWVA 1OAKA 4BDSA 1FP1D 1OYVA 3FCUB 1ZICA 2FW7A 4J0IA 3KHTA 2A1TS 2LIVA 3HJHA 2PHZA 3CUWA 1XC7A 3SZ3A 1I1NA 4C7BA 5A9RA 1NUUA 1U0NA 2VSQA 2W2NA 2KBFA 1STOA 3DL4A 3FD8A 4I0WB 3RV3A 3QUTA 2B4KA 3M6LA 4NU0A 4BWFB 4IVNA 1SUBA 2WWIA 2Y1KA 3HCDA 3WQRA 1MVLA 3B1FA 3DOFA 4RVHA 1W7AA 1QG4A 1K86A 3R0QA 3RTEA 4KIFA 3H7IA 4M6WB 1G5HA 4O25A 1FTSA 4KRFA 3IXLA 3UFBA 4D9FA 2PL9A 4M3NA 3MTQA 3GLHA 3BMOA 4JYAB 1RXUA 1OLUB 2OENG 5AUNB 2TMGA 3AH8A 1G5RA 1GQOA 3QPCA 1V41E 1JEDA 1OLSA 1QHXA 1ST2A 1KZ4A 2HF2A 3G2OA 5DE3A 1NVUQ 4QDKA 3U4QB 1Q0QA 1R0SA 4M0FA 3CGWA 1YJCA 3ADDA 1V4NA 3T38A 3CNOA 1RAHA 3I9OA 4EF6A 1L8OA 2R6DA 3DH0A 4M55A 4X45A 1RR6A 1FFXB 2I7CA 1PR6A 1W581 4I4TA 5EFZA 1UDXA 3FKQA 4HLDA 4ARBA 4OHVA 2GK6A 2OHFA 4GKVA 2HF8A 2AHRA 4EPVA 2I3DA 1HDGO 3W8DA 4BTVA 1KI1A 3NFYA 5C5DA 1M6EX 2O7QA 3FGZA 5LQRA 2DOKA 1JKMA 2PBFA 2ZBGA 3BDVA 4U7JA 3WLPA 1S2DA 5B1EA 1XAHA 3R44A 5KI6A 1RRPA 4J2HA 4NE9A 3D6NB 1KWGA 3W3AD 1XYYA 3U3XA 3EG9B 3K5WA 3OPYA 1CRZA 1MZVA 1ZD3A 5CLQA 3EDQA 3TQFA 1ORVA 4UDOA 4HG2A 3RYTC 5L95A 3V4OA 5LYJF 4M7PA 5IMSA 4Q5IA 2BM8A 4AXBA 3L0DA 4CEIA 3HKBA 5HGXA 2UVDA 3DLCA 4WNCA 5AM0A 4DJEC 1B42A 1P2DA 1V5FA 4YONB 4R98A 4RQAA 2IHBA 2VK4A 2CE2X 3HP4A 1WVIA 3TL3A 1B1AA 3WRVA 4ZI2A 1MB4A 4TSFD 4KCGA 4TTJA 1R4MA 2VPXA 2Q0XA 3GNLA 2AK2A 4HAOA 4PSVA 2VAXA 4RD2A 2D7DA 4KMOA 1XQ6A 2RDMA 2FSIA 2IUTA 2P6MA 1XTKA 1QG0A 5FOUA 4BAUA 4BO8A 4MIKA 1E3DA 4LZOA 1H2XA 4MB0A 2BGGA 2HDNB 3RBAA 1GG2A 4L0CA 1VSBA 4QUBA 5ADWA 4LW8A 1D2NA 4GPBA 4J0EA 3O83A 2KS6A 4JJ4A 3DJYA 3QMWA 3TVYA 2PYZA 1BU8A 2G63A 2Q5LA 2XZPA 4O0MA 1PVOA 2NO1A 4IXMA 4ZYVA 1B74A 3QVOA 1PUXA 4GLJA 5BT9A 1FDSA 1G5FA 1X8LA 2UZAA 4LC9A 5JY6A 3GUUA 3MG9A 1Q0LA 2FWIA 4RKEA 2QTMA 3FDFA 3KUUA 4MQ5A 4JSRA 5EHGA 4DLTA 2R8YA 1CYDA 1KF0A 4PLZA 1U1EA 3AYZB 1KGSA 1K7FB 3ZWYA 3BH0A 1K5GA 1QGUA 2AYXA 4WY8A 3TBHA 3TRFA 1CLUA 2CY0A 3R9IA 4OH1A 3DONA 5JLJA 4JLJA 1A9XA 2QBYB 3O8NA 1NF8A 4IDFA 3GA5A 5CDFE 3R9XA 3PKIA 1NU6A 4A27A 5E3HA 2YWJA 3JALB 3LQRA 3FSJX 4LXYA 2OHOA 2Z95A 4E08A 4EWLA 4RIIA 4XLZA 4ZGGA 3C85A 4NLLA 1NVKA 3O1HB 4G5SA 2ATXA 2VJMA 3OC0A 1UQTA 1CDEA 2AD5A 2QTHA 3A2LA 4O2AF 4TWRA 4H7JA 4RYLA 5CURA 4HVTA 5FV4A 4XYGA 3ITEA 5EQJB 4R31A 3AEKB 5KMGB 5HF8A 1DKQA 5JSKA 3HVIA 4F84A 2CYBA 1M7GA 4AU1A 4YRAA 1L4UA 5AW6A 4DR1B 2Y4OA 3WKAA 1JPUA 4HNUA 4F1KA 3DUFB 3BEDA 1SCQA 1KTIA 1K8QA 3OZFA 1C8KA 4KXWA 1M0EA 3QWAA 3VPHA 2Y99A 3D5EA 1TM1E 1VE9A 1IHPA 4NVRA 2PZFA 1JXAA 3O2JA 3SXUB 1UEIA 1EGAA 2BEWA 4MKIA 4EGJA 4YMLA 2JPDA 5C37A 4LISA 2R11A 1UPAA 3HRKA 2LTAA 1NN0A 1LD3A 1U3DA 5J4YA 4L4XA 4AECA 1TECE 3WRYA 1IOZA 3DDSA 5IN5A 4EB0A 2IHZA 4X60A 2NTVA 1B76A 4C7VA 5HTKA 5K05A 3VA7A 3CO5A 3GELA 5IF3A 4Y9TA 3SJCA 1WMDA 5A4DA 1OSNA 2PPVA 3QXCA 4LXGA 2QGNA 1LPOA 1O95A 1K2WA 5TGTA 3RVBA 5L45A 3N2GA 4JBLA 5JVDB 2P4HX 2CDCA 2YQZA 3NTUA 3ELWA 3ZWBA 4CKEB 1SG0A 4K9SA 4N7RA 3HK2A 3GFBA 1OX6A 1F2TB 2VPYA 3SF8A 3SM9A 1T29A 3S44A 1N2CA 4LBWA 3M5WA 5A1JA 4HYTA 1NQ5A 1U7ZA 4KYIB 2R7NA 3LCJA 3MJSA 4HLQB 4L57A 4R2HA 2BGMA 4XRRA 4DXAA 4BEWA 7REQA 1NVGA 4C1NA 1DEOA 4BB5A 4EMUA 3VYUB 4YCJA 4RH1A 1UKAA 3FI0A 3B2NA 1TM7E 4FZJA 4HFMA 5EPEA 3WMWA 4BYMA 1XPUA 1BMDA 1E8MA 4KO2S 3RLIA 5KAPA 1PL7A 3HYSA 4M22A 4S0ZA 4KWIA 5JC8A 1J22A 3SJUA 1EX1A 4J75A 1RHJA 2PZLA 1DX4A 3BWBA 3OTHA 3BGWA 4P4SB 4BC1A 3UTDA 3PGKA 1CEEA 3CYFA 4GC5A 4GUDA 3NC1C 1B6TA 4RUKA 1PR3A 3AW9A 3HPRA 3ND7A 2JEYA 1ZMTA 3JQEA 1Q91A 1M8FA 2AN9A 4XDYA 3RNLA 1JEYA 4PXYA 5TEVA 4FZVA 5FV7A 5JNTA 3CE6A 1TM2A 1D2MA 1FW6A 4S1NA 4N47A 4D9CA 4F0JA 2H8GA 3O8RA 5LVAA 1SEPA 3EPPA 3KPWA 2WHQA 3ZU2A 5FWXB 2HMAA 4JMPA 5DM0A 4YP5A 4E5NA 1EIWA 5JFGA 4KTVE 3DOOA 3ZHSA 5AKGA 3BSFA 3EXG2 2BEVA 3EY9A 5TQVA 4BLSA 1XTBA 1KZHA 3HXTA 3V7UA 2VCHA 3BXHA 3DMTC 1JHUA 1E5VA 4FHGA 2BVNA 4YI3A 3VR5A 1PR1A 1IG0A 1YFLA 3D81A 3FVQA 1QE3A 4H0FA 1O57A 3DLIA 4DPKA 3HJBA 2ZEJA 4YP6A 2HQBA 1JKJA 1BG6A 4LZWA 3RRBA 3RC1A 4RTLA 1I2ZA 2ZXUA 4Y2UA 3VPGA 5EIXA 3K8YA 2FWJA 2JAUA 4TROA 2DLCX 1RJDA 3X1YA 5HBRA 2B36A 1RQPA 4QYTA 1RU3A 3G0DA 3RVMA 4KNYA 2GM5A 3VOSA 2H9IA 1VE6A 4QGGA 2HNBA 2NQ8A 3MB8A 5DK4A 4MYUA 2QVCA 1XZAA 4GZ3A 5YASA 4CQLA 1KEUA 1N6HA 2OGZA 1BVUA 2D00A 3B8EA 3CGGA 1ZU5A 4DQKA 1TTTA 5AP9A 1CPYA 1EDOA 1HLFA 2Q41A 3O26A 5KDDA 4ZCTA 5EUMA 3EGWA 4FNGA 5L3QB 3EVBA 2P5YA 2ZRCA 4O4JF 4RGYA 4R54A 2XTJA 1EUDB 2RHHA 3DDZX 3ZUPA 4NATA 3KKLA 3L7AA 1EJBA 2BFCA 2VQSA 1UPXA 1I5EA 2HPAA 2IV7A 2P4SA 2AQIA 4FN4A 2WT4A 4CG1A 2O4CA 3WWPA 3HEAA 4TSRA 2XRFA 1XCMA 2Z4RA 3OM1A 4PG7A 3WADA 2XNHA 1R6XA 3WFZA 1O8CA 4B48A 5JI3E 2QRZA 1IE3A 2RK3A 3D4BA 4ZEMA 2COEA 4FEYA 4TT3D 2PMEA 4MO2A 1MC1A 2HCTA 4CM8B 3CO0S 4CE6A 3AFHA 3FDZA 2X19A 3FFWA 4YAGA 4NI5A 1FMCA 2O3UA 5AJYA 4BNWA 2NQTA 2SKCA 5CW1A 1W25A 8ABPA 3DYIA 4MVJM 3EOAI 2XWJI 4XVQA 5HKKA 2O1WA 3O47A 4GH5A 4E03A 4O8ZA 3L7YA 4DDVA 2V6GA 4UHCA 3IOYA 2E5FA 2XPCA 1PGJA 4RL6A 4OA5A 5CA0F 3JWEA 3EN0A 1IEQA 1QZTA 2PWBA 1E60A 1SOWA 2KLBA 3JW8A 3PE4A 2Q3MA 4LWOA 5HQJA 4BRWA 4URVR 3EF0A 1BD4A 1ORIA 2J6CA 4L8WB 1OFHA 2GO7A 3MFYA 5BO5A 1M34A 2JIBA 1BOFA 2PT5A 4KNWA 5CIWA 4N65A 4IMJB 4DGQA 1CUIA 4G0OA 4BVKA 1ZLYA 3FVVA 5JO9A 1ZD1A 2HF7A 2NTYC 5G4LA 4JP3A 1QDEA 2NYUA 4P35A 3CW9A 2PG3A 1MO4A 2R48A 5A62A 4RTMA 3JATB 3G0HA 2FW6A 4GZ5A 1Q92A 2BYTA 1W4BA 4Q9IA 3D6FA 2PKQO 4N5HX 1Z07A 5FI5A 3J80A 1E1NA 4LF8B 3KKMA 2VA9A 1N57A 1JA9A 5HCIA 2A5GA 3BB3A 2CK3D 1U99A 2G07A 1TIPA 2J3JA 1AXEA 1DNPA 1RWNA 3LY8A 4F12A 5AD1A 3NG1A 5K3BA 4LYJA 1CRQA 2QN8A 3E1GA 3FFBA 1A5TA 2FEMA 2IYFA 4UAGA 4G8CA 1DWQA 2FXVA 4MLPA 1JFFA 3O82A 4Q19A 3MHPA 4WJLA 2VNKA 3Q4GA 2NXWA 2XYHA 2IYTA 5A9SB 1JHOA 3AUAA 2VQ3A 3N87A 1XMVA 3OE1A 2ERCA 2XYVA 3CRZA 5HBGA 3O3OB 4XWTA 1JR3D 4LNUA 2WF5A 1JKXA 1ZY2A 1D4AA 3NP7A 1FSGA 2Y0PA 2QTAA 3OFJA 2JFNA 3B2QA 1C3OB 4A0FA 2R6FA 2ZR8A 1C7IA 2D5LA 3LY5A 2PT9A 4MR8B 4ETIA 2OKCA 4EJMA 2HJWA 5LWHA 5TT1A 4UMFA 4WCFB 1NL3A 5ER6A 4BTEA 1PJQA 2PAFA 3L8FA 5JTUA 4Y9RA 3EXAA 4JDPA 5LQUA 1EWYA 1T9DA 2BEUB 3EFOB 4IKPA 1IOVA 4IDQA 4BXOB 4CCWA 3NYIA 3L93A 1IBCA 2OILA 3ZNOA 2PMCA 4B6EA 4EOGA 1OFIA 2HN9A 4XRGA 2C94A 2ZROA 2E4ZA 3G7SA 4WLUA 5ELMA 1GIAA 4FW9A 4B9EA 1P6QA 4BMCA 3BWDD 4ZDWA 4EW1A 4QC2A 2FRVA 1UK6A 1YS6A 3T1HB 4F2DA 5BVHB 4DFDA 1EWKA 1EVJA 1T0HB 2R8ZA 3FOWA 4OQNA 5FUXA 1JHVA 2H57A 1NDUA 1UUFA 3QXXA 1VPLA 2LNDA 1NHWA 3H2SA 3RYIB 4IOLA 2J7PA 5KINB 3JAWB 3NR2A 1VI2A 3VPBA 4EZEA 5KYKA 2WWVD 1DJMA 3LOPA 5A03A 2AI3A 2VF4X 3GFTA 4MUGA 1G60A 2D06A 5EUQB 1BH2A 4QWMA 3BBPA 3Q8KA 4HL6A 3LQFA 4C0HA 2XNCA 4BMNA 3OETA 3OQNA 5FTLA 3ESQA 3PTAA 2ISCA 3QX7A 5ALTA 3A14A 3B3AA 2D0DA 4IH4A 4KUGA 3VHXA 4I3GA 1ATZA 1E6KA 2QJFA 4NXMB 2VDOB 3TG2A 2O2GA 1ODLA 2UUOA 2Q5FA 2V5AA 3AT1A 3K9HA 4KH1A 3LE8A 1MVOA 4C3OB 4EO9A 2O2CA 3WOVA 1DPGA 4HWGA 4M87A 3OA0A 1NJ8A 4ZMSA 2ZRJA 4MW1A 1ORRA 4Q4JA 3SR3A 4AT1A 1E2NA 3K96A 2XE6A 1KMMA 4CV1A 2VPIA 2GVNA 2H2WA 1YCHA 3GLGA 4A6EA 3SYMA 3HRHA 5DXFA 4MWBA 3OCYA 5ES4B 2RE8A 1Z2OX 3KQKA 4LHXA 1J70A 3AVUA 3C3MA 1QTQA 2H54A 2LKCA 1Y8RA 3IRUA 1U8EA 1NWCA 4IDDA 3QIVA 3TOSA 5BP7A 4Z0PA 4FZRA 3K2EA 5H0IA 2P75A 5A71A 3ZDAA 2FG7C 1E2LA 3BCHA 4R51A 4AF7A 3VKHA 3KTFA 1VKZA 3EQZA 3L4BA 4XJTA 1QP4A 2GM9A 2QKYA 5EE9A 4E5KA 3I1IA 3JY6A 4DLUA 1M1YE 5DBOA 3A1FA 4B3SB 1VCNA 3C3AA 1D6SA 1MDFA 1J0DA 1HGXA 3HJNA 3PKJA 2CZCA 3IIIA 1GITA 5ALLA 5AM1A 3WE7A 5CT5A 1KMNA 4GOOD 1LF5A 1MLDA 1JXMA 2WYIA 1JMKC 3VR4A 1KAGA 16PKA 2ZJ8A 3MNFA 4GPAA 4RLSA 4RJJA 4LN1A 4E14A 5KWEA 2AG0A 4AO6A 4MI3A 4YPFA 3G9QA 3G0BA 2ZBVA 2C5LA 5JW6A 4JFAA 5IC5A 1OU0A 1J56A 2JGFA 3PYMA 1JHXA 1RTTA 4NOJA 1W4LA 3AKYA 4X5OA 3SE0A 3T3DA 1X1QA 1U1IA 2MSCB 4AWBA 3EMVA 2QMUA 2YL2A 2WWGA 3EXIA 1XRRA 5TPZD 3UJ3X 1X80B 4IKEA 4J0KA 3E03A 4PNPA 3S0JA 4MWCA 2DPLA 2O9JA 4RM3A 5CA1F 5J23A 3ADOA 3OEYA 3P0JA 4L5AA 4GZMA 2X0RA 3T1VA 1OWPA 2QZ9A 4EQ6A 2Y1GA 4QTYA 1COWD 1N7HA 2NN3C 4GICA 3WBBA 1I4DD 3HV0A 3GD7A 4DDHA 2YVLA 4HAYA 4NCKA 1QRUA 1D2RA 1RLOA 2O1EA 3TD6A 1E5DA 1DE0A 4OAQA 2O52A 1LA2A 1PR4A 2D7JA 2MMCA 2JLUA 1E99A 721PA 3UK7A 3ZWXA 4A1OA 4B80A 1DDGA 2EJBA 4Y9UA 1NPTO 3ED5A 4YP0A 3OPXA 2JIRA 4DDMA 1WPRA 3FR8A 4N8DA 3AIMA 5HIAA 3E7PA 4UQOA 5I4KA 5J43A 5JXIA 1EVLA 2IXGA 1K4KA 2QWXA 3CV3A 1INLA 4U7TB 3NORA 2A57A 2YMLA 4WQMA 1KEPA 3SKXA 1VLVA 3SQMA 3WK5A 4L5JA 4N0DA 4EI9A 1Y5MA 1FP2A 4EUFA 4WLFA 3ZU4A 2BI7A 3QE3A 3PQFA 4RORA 1L2TA 4I4IA 1FUEA 3NEYA 4LWQA 1XCBA 1F9EA 1C4OA 1YO6A 2EKLA 4UM8B 1PJ2A 4C6SA 5C32A 1F8XA 1G8JA 3SHQA 4GR9A 1JAHA 4YUVA 5LWQA 2O2ZA 4HRAA 3ENNA 3ODGA 3U4IA 3BK2A 4F6RB 3EEFA 5AQEA 1G1MA 2GYUA 4PLYA 4BKPA 2B82A 1DUIA 2I1LA 3QU2A 1HFEL 4B47A 2QNBA 4F7WA 4DBZA 2QS9A 5EOVA 4EEKA 4R3UC 1KP2A 3PX2A 1R10A 5TJ9A 1XZNA 4YFYA 3CISA 3KQVA 2ANCA 1BCRB 1UC8A 1L5NA 3JWGA 4OSPA 5D3ZA 1BNCA 1H94A 2MR5A 2OL4A 1MU0A 4HR7A 3T4EA 2IW3A 4OX9Y 1NNSA 1KOFA 3VR3A 3G85A 2QXTA 1ZX1A 1EGHA 1U7HA 1BO6A 4MRMA 2AMJA 1C1XB 2GJSA 1U9CA 2XE8A 5D01A 5GIPE 5FBLB 1ZOOA 2WD8A 5J5VA 4NH0A 3VUEA 4V2IA 4EPRA 2G09A 4IZHA 4DAEA 1AGNA 3I04A 3OT1B 2YX1A 1VGQA 2E18A 4MYHA 2HLNA 1P19A 2IUSA 4QO7A 3OEWA 3CEJA 4QYSA 3HFJA 5ABPA 2IY7A 2B5WA 3I3SR 4JUBA 4ATNA 5HUHA 4G5HA 1N5JA 3PR3A 1ISHA 2PRYA 4URFA 3SMQA 2OBFA 4KE7A 3GUYA 1IWOA 4M0EA 3TSAA 3HGQA 3WLKX 2R7MA 1I6KA 2PR7A 2QB5A 5JS2A 3QQ5A 2B7CA 3CRMA 4HH4A 1SU8A 3THWA 3IXMA 2GRJA 4MR7A 4PWZA 4HAIA 4JKOA 5DM2A 5AR1A 3F3KA 3GAMA 5I9NA 4MS4B 3C5WP 2PCJA 3TRKA 1AA9A 2C84A 2Z58A 2GUWA 4KQCA 1EGQA 1ULZA 2CVOA 3KSUA 4G24A 4MW4A 1E6EA 2GCOA 4YJKA 1GZSA 5TF0A 3ZLBA 4IIFA 1U1CA 3A9UA 1O5OA 3DG9A 1WMFA 3T9DA 3O1LA 1OOEA 2OCAA 3RU9A 4FFOA 3VVMA 1M72A 1E69A 5FWNA 2JFQA 1W9MA 4KWHA 5B3AA 3L4JA 5I45A 2WTEA 4RE5A 1QHGA 5HRAA 1H42A 1KO1A 1T8UA 1E20A 2EBHX 1C0PA 5JZOA 4LF9B 4QFDA 3ZWAA 2IYQA 1C9DB 4OBEA 3L6BA 2GPNA 1R12A 2XUIA 3Q7PA 1CIJA 2AUNA 3UA4A 4NABA 1I8TA 1PX0A 1B93A 2OBNA 3AY6A 3JD4A 2RHCA 2PUGA 1VHQA 1QVAA 1U0EA 2QTNA 2QPOA 3Q88A 2RKWA 1TVKA 3KS9A 4RVFA 5C8YB 4R01A 3PIIA 2XRZA 3O73A 5DT2A 4E11A 3E27A 2VXCA 2XCRB 4KPFC 4QQ8A 2DR3A 3MEQA 3F0TA 3HKEA 4BFYA 3ZU6A 1SXIA 2O8VA 2C82A 1VCMA 4V0MA 2I34A 3QP9A 1TB4A 2GPJA 1I5RA 2AKAB 4UAVA 1Z06A 4RYDA 5TMPA 5KOJA 1LY1A 2WDZA 3VJMA 1KJ9A 4L2IA 1AOXA 4JJEA 3R76A 4C0JA 3A1NA 4O2AA 4TMYA 1E1KA 1I4TD 1SURA 1ZQ1A 5FEUA 2X8WA 1T8PA 2V7QA 3KPYA 4QM6A 1E1QD 2HLPA 2VWPA 3TQSA 3NDPA 3BXEA 5FORA 5L40A 2D62A 2JH8A 1YR7A 3AM5A 1COWA 4FBMA 3G7NA 2D5IA 2VDPB 3DAYA 2IYAA 1PS9A 1A7UA 3E61A 2CJYA 2VF5X 4ZI3A 1W85A 4RFVA 2C4KA 5H4GA 3DF9A 2CLIB 3W8RA 2ZUDA 4IUBS 4RZQA 4IIGA 1AQLA 1SBZA 3D64A 5K4AA 3T7DA 5FTWA 2I1WA 4MJ3A 3ROFA 5FOQA 2OV6A 3ZIDA 3C3YA 1ZWLA 4IJVA 4BKOA 5DM70 2BH2A 4CQMA 3ZH9B 1USVA 4QBGB 4DV1B 4E2FA 2QLLA 2EFHB 2ZIWB 4B3BA 5E6SB 5TV2A 3D3KA 3UUWA 2XB8A 2GNAA 3LECA 2A1IA 4ZT5A 3D3WB 1WMSA 5AIAA 4B0OA 2HA4A 3CSDA 1JLMA 1J0EA 4TMFA 1P77A 5BXQC 2VJQA 3LPMA 2VZLA 4IDGA 3LT5A 3T94A 2VQDA 1YJ8A 3ZE6A 1ZHFA 2OMEA 2O05A 3FBWA 1SEVA 5EIEA 4NCIA 3SIRA 1SVKA 3NW9A 1II9A 1KIMA 4D44A 3IAAA 4KAXA 4V0OA 2JATA 3FNIA 3ZLVA 5BNWA 4TYNA 1GUZA 1L6IA 5GP1A 4JEHA 1J0CA 3DQPA 1C1HA 1X7XB 1S8OA 1FYDA 4FGUA 5IP5A 3S2EA 3IPXA 4JZKA 3AVVA 1G18A 5DOZA 1FRVA 4ERXA 1UXJA 3L6EA 5CFPA 3EQ2A 2G6BA 1E9BA 3TTTA 4LUCA 1U0TA 1ESEA 5K0TA 2YWBA 1X7DA 2HSGA 3ACCA 2Q99A 4NU6A 4EA8A 4B17A 2TRSB 3KKPA 8AT1A 2IPXA 4G1EB 1Y33E 2GCEA 1XXHA 1YSCA 1OLUA 4YQFA 2GO1A 1OFTA 3EMKA 4Q3DA 4EY8A 4US2R 4HN2A 1UIMA 4G1CA 5FR1A 4I46A 2W00A 2DSNA 1JJAA 3KFVA 3H0EA 1WZNA 1TGYA 3SHWA 4RC9A 4OFXA 5AUQA 4ESOA 1Y4SA 5LQMA 2M32A 2QRHA 4FQ7A 1N2SA 3F6CA 4QOFA 1IG3A 2BUAA 1UP6A 4NZOA 5L6MB 1J1UA 4WZAB 1RABA 1FFHA 1DTWB 5IDXA 1Z16A 4BP8A 5L53A 5JCZA 2QMHA 2IP2A 2P1DA 1D2HA 5HK9A 1R00A 2KSQA 2ZR0A 2REQB 2DWUA 3ABRB 3ANSA 3L82B 4CLDA 3B1JA 3EVFA 5J2TF 1YUNA 2KBEA 3JQFA 1CRWG 2PWPA 3UAXA 1A7KA 2D74A 3PUHA 2ZAOA 1YE3A 4AURA 1V1JA 4I36A 1PK7A 1WSBA 3N8HA 3RFUA 4C4SA 2H16A 4KHZA 2YRFA 4PNEA 3EG9A 1JHAA 3JR7A 4HUQB 3WLOA 3UAVA 4YPVA 3WK7A 3LKVA 1M6WA 1Q16A 3OZTA 3OZXA 1JEAA 1PDOA 2GESA 2I2AA 4MXDA 4YV1A 4KR6A 1A9YA 4LYGA 5BWLA 3Q7TA 4G41A 4MRNA 4V3CA 3WSWA 4QU9A 1C1YA 2X58A 2PFSA 3UV3A 1ITZA 2PE5A 4RVDA 3S5UA 2VBCA 5ANRB 2IPLA 4AS3A 2FLKA 2IEZA 2QHXA 4MGKR 5DZSA 2I5PO 1ISRA 2KLHA 1J49A 5JD4A 3FFXA 3JR3A 4D8XA 1Z0JA 4LY3A 5JOQA 1CV2A 2P65A 3RC8A 3FNBA 2EHDA 4AY4A 3NJ8A 2QUHA 3AIOA 1E6UA 2XKJE 1UFRA 3GROA 3L7BA 3D7NA 1PZHA 3PSAA 3H2BA 1EXDA 1ZN2A 5I4CA 4NAVA 4NEHB 1FDOA 2ONYA 1JHPA 2BMJA 3GGJA 4NOMA 5FKJA 3HQ4O 5FQNA 4BP1A 2J6BA 3O03A 4ZVLA 2QRUA 4XGIA 5CT8A 4KQXA 4Q93A 3ON5A 3CURA 3H4VA 1ZVMA 4PPNA 5CMLA 4U3JA 2Z5FA 4GP6A 2OHXA 5T4EA 1XZCA 3IL2A 4I5DA 4DNPA 1WR8A 3GJTA 1ZCJA 5IWAB 4YRLA 5H8WA 1I0LA 4WCFC 3W9UA 3AI1A 4EYOA 2O7VA 4H7DA 5DM1A 3UUGA 4AN4A 3HABA 3IKVA 1A71A 3JALA 1Y37A 2OGTA 1PW7A 3H4MA 3IQFA 3MRVA 3BCRA 4OTZA 1MO5A 5T8KC 3TM4A 4W5TA 4NDZA 4L9WA 4RK4A 3KOMA 4BGUA 4DMFA 4QLBA 4P80A 3I8SA 1IOWA 5ALQA 4WIAA 3LV8A 5I5GA 3PZRA 5CA0A 1RXCA 4OFBA 2ZYTX 2FX3A 4OJYA 3NWJA 1BX1A 3URKA 3L8YA 2V7BA 3A05A 4JR2A 3THYB 3LL4A 4GPD1 3HGTA 4P0TA 2J41A 1N7IA 4PVCA 2LCQA 4Q7LA 1ZFNA 3LKDA 4PGFA 3ND5A 4B3XA 1DUSA 3VNQA 2R6CA 2XRYA 3COVA 1ZNZA 1E18A