1AV6A

Vaccinia methyltransferase vp39 complexed with m7g capped rna hexamer and s-adenosylhomocysteine
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
295
structure length
289
Chain Sequence
VVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*GP*AP*AP*AP*AP*A)-3')
publication title Structural basis for sequence-nonspecific recognition of 5'-capped mRNA by a cap-modifying enzyme.
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transferase/rna
total genus 96
structure length 289
sequence length 295
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 1997-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1av6A00
3OU7A 4MWZA 2WA2A 3VYWA 2R6ZA 3G2MA 3HTXA 2HNKA 2XVAA 1EJ0A 5EHIA 2ZZKA 4R8SA 2NP6A 3ELWA 3HCCA 3GGDA 1I1NA 2GAFA 2OO3A 4QVGA 3R24A 2Y1WA 1D2HA 5EQJB 5K0GA 3PVCA 2JHAA 2ZZNA 4DF3A 2CMGA 4YUVA 5K0BA 2I9KA 2PBFA 2NXNA 4FR0A 1Q0TA 5K0FA 3C0KA 1JG2A 1JQ3A 2IH2A 1P1CA 1QZZA 3I9FA 4P7JA 5BW4A 2PLWA 3LBYA 4KIFA 2I6GA 4GOND 5CVUA 3B3GA 4IWNA 2H1RA 1L1EA 1KYWA 4UOEA 1ZG3A 3UBTA 4HG2A 1L3IA 2I62A 2VDVE 2P40A 5K8VA 3ER8A 4OQDA 1M6YA 3G89A 3I5UA 3AWIA 5EEGA 1XCLA 5DWQA 4R6XA 2HR1A 1QAMA 2WA1A 5HIIA 3BWCA 4C06A 1RI4A 1ZHFA 2CMHA 4FT2A 4PYOA 3ERCA 3GDHA 2PGXA 3DXXA 2PXCA 1O54A 2R3SA 5EZSA 2Z6QA 4HTFA 4BLUA 5F2NA 1SQFA 5EMLA 3BT7A 1XDZA 4HGZA 5CM2Z 3FPJA 4MQ4A 1R6AA 4IV0A 1R18A 4E2WA 1M0EA 4P7KA 1AQIA 1NV9A 4E30A 4PYJA 1VP3A 3P9IA 4DM3A 2XYRA 2H00A 3VC1A 2NP7A 1P91A 3GRVA 2B25A 2UYQA 2VP3A 5KVAA 4RTQA 3HA3A 4RTOA 1INLA 2FK8A 2PXXA 4FZVA 5HIKA 5GIPE 2IH5A 3FTFA 1MHTA 1IY9A 3Q87B 1RI3A 4GC5A 5LSAA 3G88A 2P3LA 2VDWA 1UWVA 1KPGA 3KQPA 3NWBA 4PYLA 5EOVA 4CWAA 2IGTA 2JG3A 2Y1XA 3IV6A 3B3FA 2ZIGA 4PIMA 3EVGA 4YMHA 1TW2A 1OR8A 5EMJA 4E2XA 2GH1A 2P3QA 2ZBQA 3KPVA 4L7VA 2FRXA 2AVNA 5E8RA 5FCDA 3KKZA 3TQSA 3HVHA 3G5LA 4H0NA 1KPHA 4YUYA 2YUIA 3U81A 2QE6A 3GRZA 3FTEA 1NBHA 1X1BA 1R00A 1YZHA 1JQEA 3HA5A 2P8JA 3HCAA 3V8VA 3KPYA 1SUIA 3REOA 3H2BA 3IEIA 1ORHA 3FYDA 4FSDA 3THRA 4BLWA 4X60A 2EJTA 5LR6A 4V0QA 5C1IA 1YUBA 2UYOA 2XVMA 3MCZA 5DRTA 5FULA 3TFWA 2ZWAA 1F38A 1VPTA 4ER3A 4WVLA 5K0CA 3THSA 4ISCA 2OB1A 5DPMA 4CXMA 3JWGA 2QYOA 3KQQA 4E70A 4BY9E 2ZBPA 3DOUA 2HV9A 5EHGA 2V74B 4HGYA 1SUSA 3LCVB 2IBSA 1HMYA 4C4AA 2ZVJA 4POOA 2OZVA 2Q41A 4ZTBA 1Z3CA 2YR0A 3EGIA 4RVDA 3ME5A 2JH8A 4Y30A 2FCAA 4C07A 4E32A 3SX0A 2V7EA 3MHTA 2JHCA 5ICFA 1QAQA 1YB2A 2AR0A 3GCZA 2G72A 2GLUA 1N7IA 3OE5A 3FRHA 3GU3A 1UFKA 1O9GA 1TPYA 2IIPA 2ZBRA 4LG1A 5FWDA 5K0JA 2QM3A 3HCDA 1DL5A 4EK9A 5K0EA 2FPOA 4XCXA 3KQMA 4YUWA 4RVFA 3FPGA 4X63A 5DSTA 1N7JA 1RJGA 3LPMA 2IDJA 3TR6A 3PLAE 3EVAA 2AOWA 1F3LA 1G8SA 2KW5A 2PY6A 3LCUA 3M33A 4HRAA 1DCTA 5HZMA 1IM8A 4A6DA 2ERCA 5HEKA 3UWPA 2B78A 4XUCA 4QPPA 2PJDA 4RV9A 5HIMA 4AZVA 2ADMA 3QOWA 1VBFA 2ZSUA 1X1CA 3DR5A 3KQWA 5FQOA 5U4XA 3G8BA 4PIPA 4EMSA 2FYTA 3LKZA 3FUXA 2C7OA 2P3OA 5K09A 3DLIA 2GS9A 4YV1A 4BP1A 2UYHA 4QDKA 5E1MA 1H1DA 1BOOA 4DCMA 1G6Q1 3R9XB 3DXYA 3TPZA 1G55A 1NKVA 2IPXA 2N47A 3NVMB 3O4FA 2F8LA 3NMUF 3WSTA 1TW3A 1WY7A 1XCJA 3CBGA 3MTEA 3MAGA 4MIKA 1X1DA 4PONA 5FADA 4CKCA 3C6MA 3BKXA 4GOLD 1L3BA 1P1BA 3ID6C 3EPPA 2QRVB 3KU1A 2AN3A 3IHTA 1KP9A 3FRIA 4IKPA 4KDCA 4R6WA 5ICGA 4PGHA 5E1OA 4YUXA 4HSGA 3G2OA 2CWWA 2GB4A 3PS9A 2BR4A 3BGVA 4DQ0A 4C05A 4AUKA 3EMBA 3SSNA 1JSZA 3P71T 4PNEA 3Q7EA 1AF7A 2PT6A 3ELYA 3FPFA 3HCBA 4Z2YA 5HFJA 3R6TA 5CVEA 4C08A 4RTJA 1WZNA 4AZSA 2XYQA 2ZZMA 1VE3A 5E9QA 3QV2A 1KPIA 2OKCA 1EQAA 3S68A 3SGLA 3UJ9A 4GBED 4OBXA 1XDSA 2VS1A 4QQKA 4QTUB 2C7RA 3OFKA 1RI1A 3T0IA 2ZLBA 4M38A 1DUSA 1XXLA 3UJBA 2CL5A 1KYZA 3I53A 2OPBA 3MERA 4F86A 3NDJA 1ZGJA 3M6UA 3DXZA 1FP2A 1JTFA 8MHTA 4PYMA 4E33A 4GC9A 1R8XA 5GOZA 3T7RA 2HWKA 3K6RA 2O57A 2PKWA 3FPEA 2B9EA 1MJFA 4FT4A 4P7FA 4P7GA 2NXCA 4U7TB 2P7IA 4RX1A 3A26A 3JWIA 3UA3A 3GNLA 2HTEA 3UJAA 1V39A 5E8JA 4YMGA 5EGSA 3EVEA 1VLMA 4M36A 4DCGA 2AVDA 4M7RA 5GINE 3BZBA 4LWOA 2GPYA 3GIWA 2VDUE 3EVCA 5DT2A 5P8WA 1KXZA 5EG5A 1NW7A 5IH3A 3FPHA 5LQJA 5E9WA 5FA8A 1R74A 4C03A 1NW6A 3LHDA 4PYQA 5GWXA 1ZKDA 1UIRA 3GO4A 1RJFA 3X0DA 1PJZA 2O06A 3DULA 4DZRA 3DP7A 3R3HA 4CKEA 4ER0A 4RTSA 3EVFA 3RIEA 5KS2A 4RYLA 3MTIA 2ZIEA 4EKGA 4OA8A 5LQUA 3VC2A 2FK7A 3LSTA 3CJTA 3FTDA 2IH4A 2ZWVA 1ORIA 4HH4A 3E23A 5HILA 5BP7A 2PWPA 1FBNA 1NBIA 3P2KA 3DH0A 3SMQA 3SR4A 3SVZA 2EX4A 3EEOA 4PINA 2PX8A 3FUTA 5EIFA 5DX1A 5BW5A 3SM3A 2WK1A 4YV0A 4R8RA 3C3YA 4RTRA 4ATNA 5CUQA 2ZCJA 5T6BA 1PRYA 3KR2A 3NDIA 3O7WA 5C9ZA 2OYRA 4RVHA 4E2YA 3FYCA 2AN4A 2PVCA 3BWMA 3KPUA 3KPWA 1NE2A 2ORED 3MGGA 4B17A 1G38A 5E1BA 2CKDA 1L3CA 3B89A 3UJ7A 4X1OA 3M4XA 3A4TA 3GJYA 1VQ1A 1X1AA 4EVIA 5M5BA 1Q0SA 1G8AA 3PX2A 2AN5A 3UJ8A 2PSSA 3OU2A 5T67A 2ZFUA 4LWPA 2NXJA 1SKMA 2NNWB 2B2CA 2PWYA 3ANXA 5EKXA 4GQBA 4F84A 3FUUA 1QYRA 5EVJA 3TMAA 2B3TA 3L8DA 1NT2A 2JH9A 1NW5A 3SSMA 3DMHA 3BKWA 3CC8A 5FQNA 5CCBA 3C6KA 3HP7A 3PB3A 4MTLA 5FTWA 3OZSA 4AX8A 5K03A 3MCTA 1JG3A 3FZGA 5CVVA 5EPEA 2BM8A 10MHA 1SVUA 1XDUA 3BWBA 3EVDA 2JHPA 1BHJA 3BGDA 3OPNA 4KRGA 3T7SA 4P58A 5E1DA 2PX4A 3P9NA 2A14A 5DX0A 2AOTB 5BXYA 3EGEA 3RODA 3OZRA 1EJ6A 2K4MA 1WS6A 2AOUB 2VZ9A 4U7PB 5D1HA 4PWYA 2AOVA 5DM1A 2AS0A 1QAOA 2EFJA 3ORHA 4E31A 2IP2A 2EJUA 5DXAA 2FHPA 3BXOA 3ELDA 4LECA 4BP3A 2EG5A 4DKJA 2C7PA 2ZIFA 3BWYA 4PYKA 4YV2A 1P39A 3FUWA 5KYGA 5ICEA 4RTPA 2UZ4A 3EVBA 3HVJA 3LGAA 2XBMA 5EZQA 1AQJA 4E2ZA 3T7TA 1YF3A 1BKYA 2PX2A 5CVDA 4BLVA 4RVGA 3SSOA 4RSRA 4C04A 1SG9A 3LKDA 2QRVA 2I7CA 5LQAA 3PFHA 2IDKA 3KR0A 4R05A 4PYIA 3UA4A 1RI5A 4KDRA 9MHTA 3LL7A 1WG8A 4Y2HA 2YXLA 5EMKA 4GUAA 5GM2A 3FUVA 1G60A 3GRRA 4AZTA 5DRYA 3AY0A 2O0LA 4G56A 2IBTA 5MHTA 2UYCA 4F85A 5LQKA 3O31A 2OB2A 3P97A 5FA5A 4RTKA 4RTMA 5DTRA 1JTEA 1QANA 5KQRA 3NWEA 1EIZA 5EEHA 5HOQA 1RI2A 1EG2A 5EMMA 5GIOE 5EKUA 2P1DA 3KR9A 5ICCA 5F2OA 3GXOA 3PT9A 3AJDA 2NXEA 4ER5A 1RJDA 2XYVA 2ZW9A 2QY6A 4NECA 4CKBA 3G2PA 4WXHA 2G71A 4AZWA 3CKKA 1I4WA 1M6EX 2NYUA 4CTKA 1FP1D 4MHTA 1L9KA 4GF5A 5H02A 1YZ3A 3PTAA 2ZTHA 4XUEA 1FPQA 2BR5A 3QOXA 2H11A 3CJRA 3BGIA 3G2QA 3PFGA 4GOMD 2ONYA 3KHKA 5F2KA 5JUWA 5LQRA 3KQYA 3LX6A 5DTQA 4ER6A 3NW9A 3G7UA 3LECA 5K0LA 3LBFA 2YQZA 2Z6AA 3V97A 3DTNA 1O9HA 3TRKA 4JXJA 3OE4A 2PV0A 2HMYB 3DMFA 4HTFB 4QQNA 4ER7A 3ER9A 5EIWA 2YTZA 3OFJA 3P8ZA 2DPMA 2PX5A 3CGGA 3CCFA 1XVAA 4GEKA 4PCAA 1B42A 4A6EA 5IKMA 3KQVA 1HNNA 1JG1A 3MB5A 1WXWA 2P41A 3HCFA 2OXTA 3A27A 4GOOD 1ZGAA 2Z6UA 5FHRA 4OX9Y 3G8AA 3KQSA 2PT9A 5E2AA 5GM1A 4X41A 1KIAA 1BC5A 5D1NA 3CVOA 1WXXA 1KHHA 3E8SA 4K6MA 3KQTA 2BR3A 3P9KA 5EC8A 5E2BA 3P2IA 3CJQA 1JR4A 1Y8CA 4O29A 5T64A 5CIYA 5B1SA 3JWJA 3HNRA 5ERGB 3MQ2A 3EGVA 5HIJA 5DM0A 3A25A 1ZQ9A 3HCEA 3D2LA 2LD4A 4DA4A 1D2GA 1JG4A 2BM9A 2G8NA 4FP9A 3RW9A 1NV8A 3TKYA 2ZULA 4FS8A 3FTCA 2DULA 3B3JA 2JJQA 3A7EA 3A7DA 5FUBA 4RTNA 3HVIA 2AZTA 1FJXA 5K0NA 5CVJA 1I9GA 2E5WA 3HM2A 4OBWA 2O05A 1XJ5A 1T43A 3E05A 3I64A 3KR1A 5DM2A 3UJCA 3VSEA 1NW3A 5C0OE 2O07A 5K05A 3B5IA 3M70A 3UJ6A 1KR5A 5JR3A 1VL5A 2GA9A 4HC4A 2P35A 4FGZA 3TM5A 1SQGA 1D2CA 4QPNA 4KW7A 3IYLW 2ESRA 3AXTA 3F4KA 3P9CA 3NTVA 3UZUA 2ONZA 5KQSA 4PGGA 3LDFA 4QDJA 3EVZA 3ELUA 2YVLA 3DMGA 1YFLA 7MHTA 2OBFA 3JWHA 5GP1A 3OZTA 5DTMA 3OU6A 1YFJA 3LDUA 4KIGA 3TM4A 1NW8A 5CCXA 4KVZA 3DLCA 3R0QA 2IFTA 3M6XA 1U2ZA 3LCCA 5FWAA 4IV8A 3OCJA 3DUWA 3SXJA 5G02A 2OY0A 5CD1A 3LDGA 1R8YA 4PYNA 4EKIA 3I58A 4DMGA 3PX3A 4V0RA 3M6VA 5DX8A 1VP9A 1RJEA 4YUZA 3P2EA 2G1PA 2BH2A 3M6WA 4PCLA 3UFBA 4EQZA 2YXEA 3C3PA 4X61A 3TLJA 4M37A 3K0BA 2PXAA 2P7HA 2AOXA 3G5TA 4QVKA 2BZGA 3HEMA 3EMDA 5DLYA 5LQNA 1VIDA 3EEYA 5LQCA 2AOTA 3GWZA 4FSXA 5DXJA 1XTPA 5FHQA 5K01A 1JQDA 1IXKA 4RTLA 2AOUA 5DSXA 3AXSA 1X19A 2G70A 3E7PA 4RWZA 3HVKA 1EAMA 3NJRA 3GRUA 3NVKI 5E9JA 4CTJA 3TOSA 1JSXA 3HA7A 3KQOA 3KPJA 3BUSA 4QTTB 3TKAA 4OA5A 2C7QA 3B7PA 1N2XA 5DM4A 1AV6A 3GRYA 4KWCA 4OQEA 3UJDA 2YXDA 2YX1A 4XUDA
chains in the Genus database with same CATH superfamily
2R5NA 4RJTA 1I2BA 3NIWA 3T3GA 2I6TA 1K5HA 2JL1A 2PRZA 2VDNB 3GYBA 2HNKA 1NVVQ 2XKAA 3C7CB 5LYJA 2G83A 3X1YA 1D2EA 3X2SA 1ZFNA 1LBIA 2WJ4A 2ZZKA 3QU4A 4TKMA 4DJJA 3GJ6A 5TB5A 1JG7A 2EFGA 2ZBDA 3BDIA 1XTQA 2A0XA 1Z5PA 2P77A 3GAZA 4TQAA 4BNVA 3ZJTA 2QUKA 4DF3A 3ZXXA 5ERXA 5D87A 5TMPA 1QVZA 2GFQA 3D1JA 2QPAA 3WK5A 4NYIQ 1ULZA 2BY4A 2PKEA 3NTUA 3GN2A 3W2EA 3IKLA 1L4NA 3A3OA 1WKBA 4OGKA 3RF7A 2BCEA 3ZWWA 3EX7C 4NNJA 4IH9A 1CEXA 4CIWA 3KHTA 1H8HA 4I50F 2ZIZA 4ML3A 4MSUA 4J7XA 5EI5A 3TIIA 4B8ZA 1DRWA 3G0IA 5MN4A 3FUCA 2FWBA 1Z6AA 3OF2A 4XZ3A 1SQ5A 2FWMX 4Q4LA 1SCAA 1Y6JA 5FAKA 2IU3A 1G8FA 2ATVA 2VF4X 5IP5A 3V1TC 1WZEA 3R77A 2OC4A 1U63A 4JVSB 2B0CA 1C7EA 1DEXA 1JI3A 1K4MA 2GD6A 4TMYA 4A6XA 5JALA 2H31A 1W8DA 2WA1A 4GD3Q 4UTXA 3ZD8A 4JVNA 4DT1B 1WBDA 4BJ6A 1E7WA 4C06A 3K9HA 1CY7A 1ULAA 3IQEA 3ERCA 1P9LA 3DE7X 4YMGA 2OO5C 5IDQA 2QJRA 3PFBA 2O14A 2QAIA 5JNLA 3EBOA 3MFQA 4RIEA 5H9WA 3AVXA 1ZPDA 2NQ8A 4OFXA 4IV0A 4H7HA 1UBTS 2DOKA 2FLKA 1W0JD 2X0IA 3A1FA 4PX2A 5L95A 1NF2A 2IY9A 1Z08A 2PR7A 4ZKEA 1ZUIA 4AJOA 4COKA 2C96A 5IKEA 3RAEC 1AK1A 2CK3A 3QNWA 1F0PA 2VFAA 4YP0A 1CJKC 2WAOA 5FUQA 4UVEA 4I3FA 1SIWA 1AMNA 4Z0NA 3DTVD 2VDQB 3Q87B 2BV3A 3LPDA 3FLAA 4IIUA 4KKVA 4N5LA 2OG2A 2ZRJA 4M1WA 1W59A 3VZQA 3ZHUA 2J45A 4CWAA 1XMJA 2QN1A 5DCUA 3B3FA 3KAQA 5TMDA 2WJGA 4B71A 2GFHA 2LZ0A 4O08A 1XALA 2W2OA 5CJPA 3SS8A 1FVHA 1LW6E 3ZWNA 4UMEA 3EDOA 1Z5WA 2G06A 4IVPA 5GONF 1CE8A 1ZOLA 1VMKA 4RK7A 2MR6A 2WZBA 4FYPA 4Z1OA 2HRDA 4LY3A 2V3VA 4Z4EA 1SUIA 5JAIA 2A9JA 3SYMA 3H2BA 4B75A 1RYNA 2FV8A 2IELA 1SCNE 4JVOA 3UWSA 4U5XA 2M6KA 2D5IA 1U3GA 4KXVA 1ODJA 1NYTA 4RD6A 5CT9A 1LVGA 3Q5GA 3HDTA 1F38A 2ZAGA 4FNAA 2DRIA 4QFBA 4JASB 1ECBA 3DHWC 2PUTA 4KU4A 3S6JA 1Y5LA 4BC0A 1PF7E 1ZC4A 2WAAA 3KBBA 2C3OA 2NO1A 2D74A 3EPKA 4U9HS 3KB1A 1A4IA 3RIXA 5IAJA 1V16B 2O1WA 5B7QA 2FUEA 4Y6SA 4P86A 3CW9A 1XBTA 2FQWA 3ANNA 4POOA 3GRKA 3HY4A 4TYMA 4I0WB 2Q21A 5IH7A 4K86A 3SIWA 3EDQA 3D64A 1SOWA 1L0BA 2P9HA 5AUQA 4P81A 4XB6B 2MSKA 4IIHA 4NZMA 5DNAA 1KGDA 2GHQA 2IOFK 4IVNA 4LG1A 4RHEA 4Y2SA 5FTKA 3B1YA 5K0JA 3L6OO 1LF0A 1OXMA 1FTWA 2ZE6A 2RONA 2XMQA 3ZWDA 2YXPX 4LA4A 5I3CA 2AG0A 4JSTA 5J1SB 3U4QB 4A0GA 3HSSA 4OX9B 1JR3E 7MDHA 2K5UA 2WPNA 2J9XB 2AJTA 3WGYA 5SV2A 2O3RA 2A94A 2R8ZA 3T38A 2WYWA 4YP9A 1EGMB 2FPWA 2O8DA 1KS2A 3OQIB 4BE7B 2AF4C 3KYIB 3A1EA 3PIIA 1MQAA 3GLHE 4XUCA 4YLEA 4CI0B 1A96A 4BJ3A 4Z4CA 3DE3X 4EQ6A 3D7LA 3X1WA 1YI1A 1HE3A 2P3OA 5LB2A 1D1SA 4IV5A 1IQRA 4UPEA 2GYYA 2KBFA 1PJSA 1NYRA 3MTJA 4UFOA 5JCPA 4Q12A 3KJGA 3NVMB 4CCAA 4E5PA 2G0NA 2NZ8A 3ED5A 1TW3A 4TXNA 1RQLA 3RVLA 3WHKA 1MDBA 1RAHA 1WNFA 4M7PA 3HJHA 3V4ZA 1NC1A 3F46A 5LOVA 3QKSB 4XYGA 1BFKA 1MO5A 1N8SA 1TJ3A 2AFIA 1F1BA 2LWIA 2QJOA 3GLHB 1MC4A 1MX5A 2IQIA 2AN3A 3OPVA 1KP9A 2P79A 3GZ4A 3IVGA 4FR5A 5EAIA 1TQ8A 1RHKA 2VJYA 2ZRPA 4GYYA 1HC7A 3D7MA 3ESRA 4DQXA 2C4UA 4JENA 5AW8A 1HY3A 4ZO6A 2ZJ0A 1OMOA 3IT3A 2ZTUA 4PNEA 2OMKA 2VQEB 4N6OA 1BE1A 5DNVA 1Y8RB 1I3CA 5BQOA 2G67A 2H57A 3GELA 4P5PA 4R98A 3DGFC 5I9SA 2WKPA 3CCBA 3RRZA 2RH8A 4C08A 2I4MA 2XYQA 4KAAA 2FKNA 4OYRA 3QV2A 3ZXSA 4F92B 2PPVA 3UJ9A 3EISA 2JLZA 1VRCA 1TLFA 2PH7A 2PUFA 5D5HA 1U7OA 2WABA 3C3DA 4OLFA 4UBKA 5LMZA 2C7RA 1UT6A 4LYEA 4NABA 4WOBA 1DARA 4PG8A 4N5DA 1MO2A 2PG3A 4HDMB 4L15A 2BTOA 4PO1A 5GJCA 1ZA1A 3BCRA 5IN5A 3UJPA 3AHGA 1T1EA 2PKWA 4MWSA 1XMVA 1USGA 5ALWA 5FLKA 2FDCA 1SKAA 4J90A 2VPIA 4E5YA 2A5JA 3LUGA 3N05A 4BDTA 1I7DA 2DJ5A 4DCGA 1L5NA 2YYZA 3L40A 4G8JA 3GF4A 5ELMA 4EY4A 3IAXA 1PLKA 2JI8A 4OYYA 3CYFA 3AUUA 2WJ6A 4YJ2B 5EHXA 1KS9A 2SHKA 4JJ7A 4OP3A 2J4DA 4R9RA 2XT0A 1R0CA 2GRJA 2IPLA 2HQ1A 1FS5A 1RJFA 2ZBUA 3N76A 4Q24A 1X13A 5CIWA 3I5AA 3ZW9A 3SX2A 4CKEA 1CY6A 1KAMA 1AKQA 3GH3A 4HTAA 1E61A 1L9XA 1AK2A 2R6AA 3L93A 5IEBA 1WKVA 2E49A 3UUWA 3M1LA 4I7EA 2A84A 1VTKA 1EVKA 3KKPA 3CRVA 1Z2PX 3W5UA 5BMVF 3RUPA 2QX4A 1LDEA 3K3PA 4R9UC 1O94A 2MMGA 2ZWVA 4HH4A 4GP7A 3GIDA 1HDXA 3EGCA 3RU3A 1ZS9A 2VXYA 4M89A 4GL4A 3SVZA 2DVMA 1UT8A 4GDFA 2PX8A 4ZICA 3VUEA 4TWBA 5BWNA 2Q5QA 4MVJM 3EEFA 4PR0A 4RZQA 4XVHA 1DJMA 1A2OA 1KDYA 5K6TA 1ZXBA 3IQHX 3L7KA 3ZCVA 3GFQA 3GFPA 3DPUA 3OJWA 1FU8A 2I99A 1UZMA 3I30X 5L7TA 3T1TA 2FP4A 3JASB 2KI5A 3WAGA 2VZLA 4EKNB 1CQIB 3I1IA 1AKTA 2DPHA 2WFZA 3GD5A 2VJQA 4EM6A 1LLQA 5H3HA 3U56A 2PX0A 4NPCA 3K71B 1EVIA 1L3CA 1T5TA 4IQ0A 3NYRA 1I3MA 4ZVRA 4BO0A 2V54A 2QSJA 4MI9A 5BMVB 2IHNA 5ALKA 2PJRA 4I6JA 1QHNA 2PFSA 4PNPA 4NDAA 3ANXA 3I4LA 3L46A 1BWSA 1ZAKA 4U1RA 3B82A 1JP7A 4OK6A 1E58A 1VECA 1XZDA 1ZC3A 2JH9A 3SYLA 3INGA 4JEHA 1XPJA 3SHVA 3BFKA 3S2IA 2BKUA 3IHLA 3EH1A 1JG3A 1XRLA 3SDSA 3G9ZA 3ZE1B 5HE8A 2FE1A 4R71A 3BGDA 1KU0A 3QLUA 2A92A 3RI3A 4MO2A 2ZRAA 2GOYA 3S1SA 3E27A 1JSLA 2OVFA 2X2EA 1UKBA 1VGQA 3LUAA 3WA6A 2E82A 3C3MA 4ADSG 1KNQA 1Y42X 2FSSA 2JFQA 3FY4A 1UR5A 1OLSA 2JIPA 4D9CA 1S4MA 1Q0QA 5H5JA 3TH5A 3LFHA 4GO1A 3PR3A 1DAGA 2QXYA 3AY3A 4PC1A 3WRWA 3BSYA 4EHNA 4RKRA 5A4IS 1FZQA 1ZD3A 3MSXA 2RB4A 4QRHA 2XUIA 2Z83A 1V3TA 2CDNA 3JQDA 2BDUA 2P4QA 4C3ZA 1A4RA 1SVMA 4EB8A 1Z6GA 1CU1A 2F4NA 3GJXC 4HOYA 2I7CA 3S1AA 3B3QA 4EGCB 1E4OA 2IDKA 3HQ4O 2NT4A 1B4DA 4MYDA 4TSKA 5IMBA 3UV3A 4F7WA 3CO5A 4RQAA 4Q6WA 3IEUA 1TQ6A 2PWZA 3FSRA 4U2BA 4BXOA 1MC1A 4IUDS 1JMVA 2ZSHA 1QHHA 4OJTA 4ARUA 1SXJA 5CAEB 2W5UA 4BRWA 4PYRA 5MHTA 5EN4A 4FMCB 5DWDA 1HA3A 3AHCA 4D4LA 1LS1A 4MCHA 3R76A 2XCSB 1AX9A 2OLJA 1O4VA 5BRAA 3H2IA 3P9YA 1SU6A 1EFHA 4K9KA 3K70B 2QMZA 5P21A 3GCDA 3ND6A 5C1DA 4C2TA 4BFVA 1FPMA 1YSCA 2A8YA 2OV3A 2VN8A 3AKZA 4Q3DA 2XGJA 5HG0A 3R40A 1P2VA 1FDSA 1R9MA 5F7OA 2H0RA 2HC9A 3NASA 5HYVA 3RAFC 5G4KA 3FIUA 1MD9A 3AVOA 2C0PA 2O8EB 1U9JA 1U94A 2GETA 3CNOA 5ELLA 4GZMA 3PTAA 2I3GA 4C7KA 1GTSA 2ORIA 4UMDA 1HFWA 2ST1A 5IBCA 3U7EB 4RVUA 1E3TA 1U1EA 3QOXA 4Q4HB 1SEVA 4Z54A 4LCJA 3QFTA 3NFRA 1KE2A 1PHPA 4CLOB 1Z45A 4RCZA 4DUGD 1QYVA 5G53C 1W88B 3DTNA 4YJFB 4P83A 4Z9BA 1PJQA 1TGYA 3G59A 3ER9A 4XR9A 3NEAA 3R41A 4FQ7A 3OQVA 4GEKA 4RFSA 4MWGA 2BGLA 5BRJA 2FG7C 3QVUA 4RPJA 4REOA 3ZV7A 3AHJA 4EFNA 2Z6UA 3PJGA 3HV0A 1VJCA 5E2AA 1X8XA 1GTL1 4BMZA 4F5ZA 1FJHA 2R6DA 4POAA 1NQVA 1EFVB 1CIPA 4DNFA 1PQWA 2XMSA 1WJGA 1DIAA 2HCBA 3ZGYA 1K6XA 2BFBB 2O6LA 4B4VA 1QCYA 4CT5A 4ZJZA 2AEFA 2Q1TA 5CX1B 2FW6A 4YCAA 4U2CA 1OJLA 1R64A 4FHFA 4UE6A 3UUEA 4QBFA 1ZW1A 2AW5A 2H5EA 5EESA 2NZUG 4CMJA 5HRCA 3KE9A 4D46A 1BXGA 2CE7A 4YN3A 4YCSA 1N5MA 4UNNA 1H2ZA 1U6IA 2A67A 1USWA 5LCXA 3VC7A 1A9TA 2NTYC 1WW2A 1CVLA 2ZANA 1LGYA 4TPKA 3FFAA 4RACA 2PMEA 2EGHA 5CVCA 1P5RA 3C5HA 3PRJA 5JR3A 3NOQA 4CVNA 4D44A 4HC4A 3AVUA 5JNRA 3TM5A 2DLCX 3MVEA 3HUUA 5CB4F 1PUXA 4CCYB 3HBLA 3IOBA 1FP4B 1Y6ZA 1SA0A 4P31A 3EQ8A 4PGGA 1PJ3A 3LZDA 3MS2A 4TN1A 1L8LA 4AJ9A 3P9QA 3OPYI 3KYBA 2GEJA 4IX1A 3WIDA 4L5IA 4AY3A 7MHTA 1B0UA 2AFHA 1PR3A 3H9GA 2X0DA 4F7DA 1JNXX 1E3LA 1PWEA 2HJVA 3BHNA 3FHCB 4LV5B 4E1VA 4MRVA 3RJMA 4DR3B 3UFXB 4RH1A 2G0AA 4KVZA 5ILQA 4L78A 1O3YA 4LX8A 3IEMA 1VI5A 3FPCA 4L0QA 1CRQA 1Z8FA 3IGFA 2I1VB 4KI7A 1FYVA 1B76A 1KR2A 2HO5A 4DJDC 5C32A 3I58A 1RLJA 1I7QB 1ZCFA 4RXMA 2C61A 4AZ0A 1Q1NA 5DX8A 4Z49A 1IVYA 1C9NA 1D6JA 3M6WA 1GL7A 3VPDA 3IP8A 1A9SA 2ECOA 4QHTA 4HNTA 1GGVA 1HDEA 2ZDGA 4E1BA 4EPTA 5JYBA 4UUAA 2H85A 2D3TA 2QTZA 2PXAA 3E2MA 1SBQA 3MJHA 4DM7A 5GGYA 3G2KA 1XZBA 4DNXA 5IC5A 3SR3A 2CLMB 5CB4B 3E4CA 4YP5A 2ZRGA 3CLSD 4DMHA 4V1CA 4NDNE 4PAMA 3MCUA 3AXSA 2LP4Y 4RKYA 5IPFA 2FXVA 3WKEA 1XEXB 5FPTA 1UUFA 1CQJB 2AQIA 2HNBA 5BNFA 5A4AA 3GLFE 2GN8A 3HA7A 2IPAB 2ZYRA 3T7KA 1FFDA 1E59A 4L0DA 4ZVUA 4A36A 1U5AA 2FPIA 4YRJA 5IAKA 2YMLA 3LPCA 1YQTA 3L3BA 4B3HA 1DBVO 5SY4A 2HL6A 4GMGA 2B21A 1GDDA 1T0PA 3FZQA 4HLUC 2OBBA 4CMEA 1AV6A 3UJDA 4X7MA 3UC9A 1L5ZA 3OLQA 3OPQA 1JDNA 3HZHA 4RS4A 3TXYA 2WA2A 1M9NA 4QLOA 2E21A 4QUBA 1WAMA 3K1ZA 1B8VA 1IATA 4L28A 1R8QA 4F3YA 5I7WA 1B6RA 3D8SA 3IL2A 1DBRA 4TV8F 1BRMA 3G6WA 3G0BA 3OZIA 1C8VB 4KUGA 5L51A 3CUKA 3PFFA 4EA7A 1L4MA 1JQBA 2ES4A 3Q3HA 3T1YB 3OLZA 3OD5A 4EG1A 3CR8A 4BO6A 4MK4A 3ZWAA 2OGTA 3Q6MA 1DG9A 4YDSA 2IH2A 1PQYA 3C0KA 1PL6A 3PD7A 4F1JA 1XZIA 2IODA 3HB7A 2SKDA 4E6EA 2IXEA 3BZUA 3FETA 1QP8A 4GOND 4JDUA 4XPZA 3AETB 4BE4A 3H04A 5FBZA 3WYBA 2PZMA 3DCIA 2Q0HA 3NM6B 4F04A 5JARA 1N78A 1CF2O 2Q2QA 3L7MA 4HG2A 4ENPA 5I6DA 1W0KA 3TFOA 1Q0UA 3AKYA 2I62A 1XO1A 3H11B 3TIFA 3UHOA 1PK7A 1BQ3A 2AUTA 5T41A 1HQKA 3TNFA 4DA9A 3CTPA 5E7MA 4OQDA 3IBYA 3LI2A 3WIEA 1XTBA 1LH0A 4BFCA 1XCLA 1YFZA 4PE5B 4EY8A 4R6XA 3QF7A 1FSPA 2MTBA 1DAHA 1SJ9A 1SNYA 1UOOA 4MMYB 4R8LA 4UNPA 5JH7F 3SJZA 3EWAA 4Q1DA 4QVIA 5E7JA 1J70A 2D4AA 2WKRA 4GZ6A 1O54A 4Y6OA 2HMVA 1TI7A 5AM0A 4U2GA 3RFVA 3SSAA 1EXMA 1P2GA 2Z6QA 5EMLA 1KMIY 2BELA 4PC7A 3W77A 3HZZA 4HGZA 4Y67A 5KBYA 1JHYA 2VBIA 3DHVA 3MB8A 4Z9XA 3RARA 2Y05A 4JP8A 1GQQA 5HS6A 4PYJA 3RHZA 1EUQA 5J59A 1G41A 1QK3A 3AZPA 3JQ8B 5E38A 2GM5A 2PMKA 2RHGB 3GA5A 4GRAA 4CQMD 2C9OA 3BM5A 1VLJA 2ZXFA 3CXUA 4HUQB 4J1SA 4RULA 3GZTB 2QYHA 1AHNA 1KJJA 2QTLA 5HRUA 1EUDB 3KDPA 1YTUA 4W1RA 5FB3A 5JAPA 5FT9A 2YMQA 3HDVA 2P2SA 1DLJA 1Y98A 3E18A 3M6IA 5LSAA 3U7IA 4L3WA 2G7ZA 4HZGA 3G0HA 5JAMA 4QDTA 1EP9A 3U4IA 4QD3A 3AZQA 1DI0A 4XX1A 3WFZA 4ITVA 2G4CA 1ZISA 2FZGA 1J8FA 2G6TA 3FMIA 2ZBQA 1RKVA 2PANA 3V32A 3M4ZA 1FFEA 4D98A 4ZI2A 3F9RA 2VLIA 1CEYA 2YWXA 3UMRA 4DMUB 4BNYA 3PJFA 1MAVA 2CXXA 3ZK8A 2QY9A 2RMKA 1X7YB 3LD9A 4TQUS 2XIJA 3ZWOA 3REOA 1SHTX 3W9UA 1KSFX 4B7CA 3PC7A 4JJAA 1RAEA 5BORA 1DKQA 1W8IA 5B6PA 4Q1FA 4B3GA 1F9EA 1QIIA 1YS1X 2RK4A 1ULTA 3JALB 2W93A 2HA6A 1I24A 4FE3A 1TQ4A 2VJAA 3LY5A 4XPIB 4FFOA 2A5DA 4E70A 2O5CA 1ZQ1A 5KYXA 3A6PC 2JIZD 2X4DA 3A4NA 4RVOA 1QRTA 4Y98A 1L8QA 4OG2A 3IVAA 3RG8A 3DBOB 1LX6A 3AUJB 4ZVVA 4EB0A 1HMYA 2ZEJA 4UEWA 4RHYA 1UBNA 3RVOA 2JCXA 1HYHA 4HDKA 1YJ8A 2A0UA 3A6DA 3RGGA 1V71A 4E32A 3VR2D 3M0EA 4OK5A 3BA6A 3PVSA 2X0JA 3SX0A 3WGJA 5I8ZA 5KWIA 4J91A 1M7BA 2HGSA 2R8YA 3ZX4A 4DV1B 3HKCB 4Q9AA 3N86A 5FWDA 3IUPA 1ID8A 3ZV5A 2ZJ3A 4L5BA 3FJ1A 5I7OA 3O0DA 1BTOA 2DKOA 3QPDA 4G97A 4Z4FA 3L7DA 1XV5A 2E6KA 4HN9A 5E6SB 3AI1A 4BLTA 1L4FA 1SKBA 2BYTA 1ZM4A 3AUSA 4I81A 3G8YA 4KUHA 1CYDA 3ZBPA 4NV0A 4JP1A 3OKCA 4W5QA 4LRXA 2VK4A 5HEKA 1DDGA 1V25A 2G04A 4RANA 5KREA 4JMPA 4QOEA 2GLXA 2G9UA 1FSZA 3TXXA 3A3PA 3R5HA 4TKUB 2XYHA 3HG7A 4Y3UA 3UMGA 1SBNE 1PFUA 2WC1A 3EFEA 5CFMA 1E9BA 1T24A 1O8CA 5AK3A 1RWNA 2C1ZA 1UMBA 1M2EA 1X7ZB 3F1KA 1ZM9A 4OQZA 4DY4A 4WBNA 1N0WA 3EXFB 5B7GA 4G4IA 3ACCA 1G55A 3DD1A 3JZMA 3MJCA 2XECA 3QUQA 4F2HA 1GAJA 1PJLA 1YULA 3KUUA 2C2XA 1ANKA 1JAXA 3KYJB 4MPPA 1O5IA 2HA2A 3O83A 5FNZA 1E2IA 5B57C 4I4TB 3GLSA 3G2HA 4DJFC 3FRIA 3EPHA 1TADA 5FOWA 4RK6A 5IDVA 4YUXA 1MO4A 4MIEA 4MYTA 5B1HA 4REQB 3UPUA 4OHWA 4P93A 1B43A 2A35A 5CR9A 4C05A 2VJMA 4AUKA 3AONB 5JCOA 5TQ0A 3RRJA 2J7PD 2XNDD 3FAZA 5TGZA 1NJ5A 421PA 5JXJA 3WLKX 2H1IA 4QBGB 4QUHA 4U8GA 5H59A 4WFIA 4YAIA 3FPFA 4BU0A 3NT4A 4K6GA 5FO0A 1Y4SA 2Z58A 3JZDA 3CKMA 3IMCA 2YVQA 4KO8A 4ND4A 4H60A 3GROA 3QX9A 1WXEA 3M4JA 3IPRA 3O74A 4GBED 2ASEA 4OBXA 2AE2A 5DW3A 4MR9A 4DIEA 4QQKA 5I4CA 4G3XA 1ZMTA 1AMUA 1O95D 3WXBA 1Z68A 3HCNA 4FGSA 2BE9A 1TYZA 1Z5OA 3ABIA 4ETMA 1USKA 1EWVA 4WJLA 1EWQA 1NQWA 3DXZA 3R3ZA 4GRIA 4D81A 5EP1A 1T15A 3ZCRA 1M33A 1NYLA 5F33A 4IOJA 4R0VA 3HLTA 3BXFA 1R8XA 2R86A 4P7FA 5TQ2A 3K4PA 4NJEA 5KIAA 5L8VA 3TQFA 1FYXA 4LJYA 2P90A 3JWIA 3S5UA 3VVMA 4AF8A 4DJAA 4JLPA 1XDDA 2ZRKA 2IYEA 3EVEA 4XJSA 2O8CA 1ATZA 3HU2A 3LQRA 4N7RA 2HJGA 2I4IA 5JQGF 4CLRB 5P8WA 3RS5A 4BP8A 1KXZA 3OZGA 2ZR7A 4LI0A 5IJWA 4FX2A 4TKLA 1CUGA 5K7SA 3EG5A 2VF5X 5FA8A 4WPGA 2J3HA 2VG8A 4PZUA 5K8IA 5KU7A 1C0IA 2O0MA 2ZYVX 4IH1A 4YCBA 4JXXA 4JP2A 1IY2A 4V0OA 2O06A 2H4XA 2XNJA 4EUFA 3UKDA 2RJOA 3PXEA 1BOFA 1IPEA 2FPUA 3RO7A 5TPZA 3M7IA 3ZHQA 7GPBA 3NI2A 3IDAA 3VC2A 4MVJA 5JQWA 1MX9A 2PDAA 4L8YA 2FMTA 2M6LA 5DM70 3L07A 1ORIA 2YJGA 3LBHA 4FIZA 2JIQA 5D6OA 4Q1EA 4TLCA 1SUEA 3VH4A 3WYAA 3D2CA 4A3SA 1ZXXA 3LOUA 4W7HA 1I5OA 4TOIA 1N0IA 3SF8A 4CIBA 1M8FA 1T2CA 3ODGA 4KVFA 2XNHA 4BKUA 1OX5A 1X2EA 1W29A 1C1DA 1HO3A 3E61A 2TS1A 4B81A 3WDKA 4MWBA 1AGPA 1YBHA 3O2NA 1Q44A 1JN0A 3BAFA 4DAEA 2ZCJA 3D6AA 2UZ1B 4FOPA 4WEOA 1US8B 1EFPB 1H8HD 3CVJA 2BTEA 2LR0A 1G6KA 3NX4A 3OLYA 1HPLA 1PJCA 1WUKS 1WXHA 2WWWA 4AO8A 1YH3A 4O0LA 1RP1A 1THGA 2CXUA 1G291 3KPUA 2QDKA 3MGGA 3PT5A 4U3JB 1DPFA 1P1FA 5SICE 1O5OA 1VE9A 2R65A 4O4IA 1HLDA 1JA1A 2RKOA 3A4TA 3OIVA 4Q3NA 3V4LA 3WYEA 4JI1B 3PX2A 4MQFA 1MZVA 2LE0A 2LUOA 2RBEA 1Z38A 3C3KA 1PKXA 4AKSA 1Z4QA 2YHBA 4JJIA 2H5JA 3PC4A 5A04A 3SJAA 1Q6YA 4PZZA 5I5GA 1LSJA 1ST2A 3P52A 4A8TA 3DWEX 1ENZA 3OFSA 1Q1BA 2FMFA 4RGVA 1W4AA 2QZJA 4P33A 1RE0A 3FN4A 1WULS 5EYPA 5FTWA 1YHNA 1YUMA 3BAZA 1NTOA 3BFVA 3MCTA 2NSYA 5BQ5A 5K8LA 1ISGA 2VNHA 1Z16A 3NCTA 2PVPA 3ISVA 2XF8A 2CK3D 4O4LA 4J4HA 1V0JA 5YASA 3EXAA 1G5HA 4LW8A 1QWSA 4P2BA 1O58A 2J9FB 1Q1EA 2X40A 3IPYA 4U7PB 3U13A 4MDEA 3CVXA 3V00A 2FMIA 1G5PA 5DM1A 5KKAA 4BWYA 1KFEB 1A2BA 1GPMA 2VK2A 3HHPA 3PK0A 3HFGA 4OGFA 4KJXA 3V1LA 1XIVA 1F2DA 1IB0A 3O3CA 4H17A 2VAXA 4LFCB 2HQSA 3FGZA 1ZK4A 4J16A 1EK2A 3DGEC 2REXB 2CNWA 3ZU3A 2E0IA 2D2EA 5LJLA 4R9SA 5BSFA 3LO8A 4TV9B 1YJXA 3BZWA 5DISB 1SG9A 4HCJA 4ETNA 1Q1QA 1ZVJA 4B5LA 2EW8A 4BKRA 4CM7A 5BN4A 1WF6A 4BHTA 1G8GA 2EKDA 2LDBA 4B3TB 1U2RA 1A9XB 1KEUA 3O9ZA 1WCXA 4DBVO 1W4LA 4QYWA 3AY0A 3UQYS 3K0CA 2QR2A 2GZ2A 3O8NA 4YO7A 1K4YA 5B64A 1YT5A 3I04M 4FFBA 3I73A 4CM4A 1AKMA 3H4TA 3UK7A 5K6RA 1IXSB 1T35A 1IN5A 3AH8A 1KKLA 4MQ5A 1P72A 1ZNYA 3AV0B 4ZO7A 2WBLC 4CCWA 2HJRA 3COPA 3UV7A 1E7RA 4HYYA 5GIOE 2OM2A 3W78A 2JRLA 2B94A 5ICCA 4KWEA 4BVJA 1NVEA 5AM1A 5DI3B 3UXHA 4AZWA 1I4TD 4BNNA 5CA1F 1YASA 3IAUA 4R16A 1ADBA 3AHIA 3LW8A 2F48A 2QAGA 5DHAA 3WQHA 1ZKMA 1JQ5A 1TT5B 3ILYA 5EWMA 1Z6YA 4UBLA 2ZJFA 1QU2A 3IAHA 3A4LA 2QU8A 4QLAA 5M34A 2PL9A 2JLBA 4RL4A 1C41A 3H2JA 3ORQA 3Q3GE 4I1RA 1T5IA 5CURA 3F6PA 3RYHB 3DCYA 4B73A 4YPFA 4M0KA 3I45A 2XE6A 2K7FA 1Q15A 3HYNA 4Y1EA 4HDNB 4D9MA 1P9NA 1LPNA 4UHEA 2PX5A 1XVAA 1YBMA 1SUCA 5DLEA 1YQUA 2I80A 2QVBA 4ZV9A 3B5JA 3EGDA 4Y9RA 4E11A 1HNNA 2VUHB 2Y99A 4ENUA 4KAXA 5ALFA 3IHKA 2HF9A 4Q19A 3L1VA 4ZO8A 1Q14A 3WLPA 3KQSA 4OXKA 1H93A 5JAHA 3T5GA 2QTCA 4O25A 3VTZA 2GXAA 1M6NA 4MINA 4MGYR 3E8SA 1PEYA 3ROQA 5CTAA 3I1YA 4KYUA 4PFQA 3AERA 3FCCA 3MN1A 4KXQA 5EC8A 2PL5A 2IV2X 5CA1B 4LYHA 2QUZA 1R0BA 3MQ2A 2POQX 3ZU4A 5HIJA 1JEQB 4C78A 1FTNA 1IC6A 4Y2GA 4B33A 3TF5A 2RE8A 1UPXA 3ENWA 2I78A 3K32A 2AXEA 5HDQA 2DECA 4QXRA 1J49A 2BSXA 4C3VA 3MUNA 3CS3A 4M98A 1VHTA 2CWDA 4ZAGA 5FWXB 5A7FA 3G6KA 4I6EA 1K98A 2N75A 2E5WA 3HKEA 3QKTA 1HI9A 1WPRA 4MJXA 1FXWF 1RXYA 3E05A 1E8DA 3KJNA 3JAKA 4R9VA 3A36A 4X1YB 2X1VA 3FD8A 2XB9A 1T9BA 4O59O 3WV5A 5HKOA 4KEAA 2QW1A 4ARSA 2GA9A 4EARA 3ZGLA 4BVBA 2JKYA 1TUIA 2Y9MB 5I4KA 1EWYA 1K5PA 1WV1A 3OOHA 2WM9B 5K6AC 2FQXA 4FZJA 4NBSA 5I9TA 5B30A 5KKNB 2FETA 4YDHB 1L6IA 3EVZA 1U5BA 4OHXA 3KKNA 2PMBA 4M4SA 4N3GA 1E9RA 4RIIA 1OE0A 1E2MA 4QDZA 2O0KA 4GZ3A 4JYPA 2WDPA 4MGHA 5BQ3A 1GCUA 2J30A 3VO1A 2IIVA 2HMTA 3ANLA 2JCGA 3AEUA 3KTOA 3ZNNA 4WFQA 3ROTA 3EQ9A 1X9IA 4AS3A 1NDUA 2VP5A 3OCJA 4Y1RB 3SKYA 3CNNA 3RYFA 3WZLA 4D82A 1TAGA 4FBGA 2EFCB 4RZXA 3WYFA 1S2MA 1IVSA 3TAXA 1R8YA 4EKIA 2DR2A 4CV0A 4BWGA 2NU9A 1LI7A 4XVCA 1NM5C 5CJ2A 5BSUA 4Y9DA 6ADHA 2BFWA 1GG5A 1XRNA 1U3TA 4GGMX 4RH3A 1W49A 5LD2C 4ZCMA 1WZ2A 4NJMA 1P5JA 4P3YA 2FHSA 1REQB 2H1LA 4JA2A 4NG5A 5EJ4A 1KF0A 3JARA 4TMVA 2WICA 3U39A 1QQBA 3U7JA 3IKMB 4MI1A 3AJRA 2C4KA 3N0VA 1P3Y1 5DXJA 1JQDA 2EJWA 3W7BA 2AOUA 4WV3A 5A5GA 4L75A 2HMWA 2WU1A 3HVKA 2IOHA 4KN6A 2O7RA 4Y2PA 3A1TA 4YBZA 1ZHOA 5LUAA 4BKPA 4YB8A 1Q91A 1KMQA 3PGJA 3H2SA 3T0GA 1HYBA 4MYUA 3TKAA 1C3OA 5DM4A 1V11A 1L7PA 3EZXA 3S55A 4BZWA 3QUAA 4R84A 5KYYB 1YDFA 1O94D 4DFDA 4BNHA 3HH8A 5KYWA 3N8KA 1NWCA 3A58B 4QOGA 4QODA 4ARAA 4UUMA 2CDBA 3C41J 2IV7A 2DUWA 5K8TA 3MBIA 3FH0A 1E2LA 3NWPA 3NBUA 5JZVA 2X3UA 4IX9A 1I10A 2JVKA 2YDXA 2RGDA 2ZWOA 3I32A 2O8FA 3T3HA 1QRRA 3U3OA 1S3GA 2AWNA 5JADA 1NN3A 2LW7A 1CF9A 3DFMA 3TTYA 4D9JA 1VZ2A 1E1CB 3RWMB 3H17A 2BGKA 4JHXA 2JGJA 3QE0A 3ZE8A 1QZZA 3C6BA 5JAQA 5BOSA 1SHZA 1N33B 1TD9A 4RLSA 1LBEA 2Z09A 2QWXA 3LSYA 4I6GA 3VM6A 2H1RA 1HE8B 2NTNA 4BNKA 3EZYA 3MT0A 3DBIA 3H7AA 4RY9A 4E46A 1L3IA 2PYZA 2XSZA 1PV2A 2VHXA 1MKYA 2M9MA 4H1UA 4PZYA 1KC3A 3BEOA 3HYCA 3LXRA 1M1UA 4CCSA 2VTBA 3FLMA 2VCYA 2GKSA 5CPFA 2G7MC 3T95A 5DI9A 4CKWB 2J5RA 4JEMA 4QECA 1UWKA 2P9YA 2VDOB 4KLCA 5F7JA 3USCS 2OHGA 1LQTA 2WE8A 3ABOB 3CLUC 1BS2A 3QP9A 2WYUA 1O0CA 1UXKA 2JGDB 3MT9A 3PI7A 4P5DA 4Q7MB 5I48A 4E08A 1K1EA 3B60A 4E5KA 2C4VA 3CIFA 2ETXA 2LGJA 4CBVA 5JMTA 2ZJ1A 1O77A 2R6FA 4L2IA 3J81k 2JCVA 4DBLE 4MW7A 1NIJA 1RYMA 1QRAA 4GXTA 2HWWA 3BJIC 4TMTA 3RTDA 4L4UA 2DZDA 3NJ4A 4OBEA 1SVOA 1G63A 5CDGA 2QLFA 4BEVA 2WJYA 1OLUA 2H1WA 2X14A 2XGGA 4JR1A 4ZN6A 1HDRA 3CWZA 4PRLA 3W2FA 3K09C 3LLSA 3M3PA 3L0OA 1ZYUA 4DB4A 3G1WA 1A82A 1Z0UA 2OLEA 4H4CA 1N6OA 2O2DA 4LXYA 2Y1XA 4N8EA 4Q9KA 4YMHA 3CVWA 2XUDA 4GP6A 3NFYA 2OO5A 3KSZO 2Z8YM 3GB9A 1BXRB 2ECKA 1SZPA 4V2UA 3FSGA 3KZKA 4BLRA 1KAHA 4E14A 3KL4A 4DWWA 3PIDA 3MJRA 4RHCA 1SXJD 1JFFA 3GUZA 1VG9B 1M5RA 3PF8A 5AM4A 1YK1A 4XQ9A 4DJEC 4DSZA 1FMTA 3GGGA 2H51A 4B7AA 1XP5A 2BI4A 1AUQA 3L18A 1R5JA 5FAXA 3I9OA 2I3AA 2ENUA 2XB6A 3CURA 3G79A 4YH1A 5MN5A 1N36B 3MCZA 3BHIA 1POXA 3FCUB 5BV0A 5A3VA 1T3SA 1WP4A 1D4OA 4UQPA 2FU5C 3JWGA 2C2HA 1Q3KA 4B32A 2ZUBA 5IYZA 1XMOB 2O3QA 3P27A 5DBEX 1VKHA 3JD3A 1VCOA 3L1KA 3NYIA 4JLWA 4KE8A 3W4KA 1MB2A 3HVRA 1UJ5A 2OZVA 3B2NA 3QOFA 2IT1A 1TLTA 1I0ZA 3FDZB 3AFHA 4JBNA 5AXBA 5D7BA 5B6JA 1OZGA 2HT6A 4RPGA 3OE5A 4LN1A 4V1CI 1WCIB 2YW2A 1L5SA 3VUFA 4BLPA 3L8MA 2B2NA 1YCFA 4NCXA 4OATA 4DR4B 3NHFA 1WXIA 3FPGA 1U6KA 3O91A 2ONCA 4OK3A 1HSZA 4L8GA 4KLNA 3VGPA 5ALLA 5DCYA 3QSGA 16PKA 2JEZA 3OJEA 1DCTA 5REQA 1JKMA 2P6NA 4L7QA 5DSZA 3KX2A 2G08A 4MO9A 4R7ZA 4YLGA 2DMRA 1WDTA 3DZIA 3PPWA 1BEUB 1V3UA 3KQLA 3RSHA 5IX8A 2VHTA 3CG4A 5DO9A 4X85A 4DADA 4QDKA 5E1MA 4HH3C 1MABB 3DTVB 3A1WA 2F8LA 1QO0A 3BIXA 1ZZEA 1UPAA 2IEZA 2ZWIA 1J24A 3CBGA 3D3EA 4HH1A 1E0KA 1GZUA 4Q9LA 4B7ZA 5C81A 3QF4B 1PVVA 2AT1A 4GOLD 3QEOA 3ID6C 5JPDA 3CSDA 4LE1A 1V26A 3V8QA 1KXJA 2G1AA 3KJIA 4URYR 4DDWA 4HY3A 2EV9A 5T57A 5CA0A 1L2TA 1BCSA 1GGEA 3TI9A 4EDHA 1XD8A 2I5PO 2QUIA 4GI3A 3UW3A 2PKQP 4Q3LA 5JD3A 3N0TA 1ZD1A 1HG0A 4WK2B 2PU5A 5M7EA 1JIJA 2MT9A 5HCNA 5KSYA 1RJWA 1UKEA 1KRHA 2ZYSA 5JDCC 2FSGA 3CRRA 1QSGA 1SXHA 3CX7A 4M0EA 4XJXA 5KX5A 4IJKA 3DZHA 4EPXA 2CUNA 4LJSA 3MZ0A 3E3OA 4EMTA 1HDIA 1WABA 2ZZMA 1VIAA 3VDRA 1AGYA 1N6RA 3RBXA 3U3RA 1QV7A 1XDSA 1ND6A 3I9V1 5KOJB 2JLSA 1GQOA 2CXSA 5H0IA 3RVNA 5MF6A 2A58A 1DUSA 3UJBA 1N0VC 3PWTA 2EYQA 1KZYC 3KB8A 5KPJA 4F86A 1TCBA 1RABA 3SXUB 5A2QA 4QM6A 4WXEA 4Y2QA 4TWZA 2FW1A 3HO6A 4O4HF 5AVJA 1ZOIA 5CM9C 1JEJA 4Q9IA 4DMLA 1JNYA 3L84A 1MUUA 2XA9A 2B9EA 1X7WA 1J8MF 4GOJA 4HRVA 3CPEA 2IZZA 4FK8A 2GZHA 1UPBA 3BVPA 4M36A 4M7RA 3RREA 5DT2A 4KV7A 1DC7A 1U98A 2ZUCA 5F3WB 3B8HA 5EG5A 1NW7A 4OXNA 5LIRA 2OR3A 3FPHA 3L05A 3FE2A 4IFIA 4ZEMA 1U8AA 3BFPA 4JBXA 1ZM3A 1ZN7A 1PDOA 4G0XA 1DKPA 4HWGA 4QXOA 4TL9A 3V8MA 3WYCA 4BYGA 4R51A 4BTLA 5THKA 3DOHA 3ZWBA 3RFTA 4GBMA 1Q74A 3N2YA 3QE2A 5EQFA 3CY6A 1GZDA 1U90A 5DP1A 5JS1A 4ZQBA 1EJ2A 4QO8A 2ZJ8A 1XZPA 2X5NA 4LSGA 4WW0A 1O1YA 4N8DA 1KHTA 4RLQA 1IULA 3TIVA 3TTSA 5AI6A 5AJUA 4DLPA 1OT5A 2OMEA 2WVJA 2CJWB 1Z6PA 2DF8A 2R1TB 3MJEA 4RK5A 4E3ZA 1W35A 3EA5A 4YYZA 3H5TA 2CD7A 3E23A 2DFTA 2YIJA 3LT1A 2PWPA 4KYVA 4LXIA 1NP3A 4X1IA 2ZT8A 3N8NA 2WTEA 2Y1DA 3CUVA 1TC1A 3SN6A 1YJQA 1LQ2A 1ZN2A 3MW8A 1G6OA 4DZZA 1PR2A 3AEKA 5LVAA 3WK6A 4MS3B 4K40A 4PTYA 1XVTA 2YXBA 3KXLA 4DCPA 4RTRA 3Q3JB 2AKEA 1ZJZA 2ZIUB 3AFGA 4K7JA 3BPSA 1E66A 3PBKA 4W8HA 3Q0EA 4CUZA 3U40A 2W6PA 4B76A 4LFAB 4UDYX 3UAYA 3P0IA 3UGTA 5CH8A 1H6AA 1KDVA 1T36B 4OD0A 1KY2A 2X1LA 4S35A 1TEZA 4CW7A 1IOVA 3SE0A 1Q1ZA 2OZLA 1CC1S 2WQZA 5I5EA 1JZSA 3E4DA 1Q0SA 4LJ5A 2AGVA 4JDPA 1WD5A 2EKQA 3G13A 1HDOA 4ZU1X 1V5FA 5ARBA 5B53A 1SKMA 3B3AA 2Z98A 3W5DA 4BC1A 4GBJA 4NDZA 4K87A 1P2FA 4M87A 4AP6A 2VCEA 1YNOA 3IP7A 1DELA 4J0KA 4JGIA 4A26A 2B0JA 3NPAA 3BKWA 3RTEA 1RWPA 4XB2A 3DVRX 4Z6KA 1YB7A 3ICCA 5COQA 1P7CA 3ZS9A 1SXQA 3AF6A 3OH8A 4G81A 5EUQB 3ICWA 5K3OA 1JU4A 4JYMA 4KRGA 4M8LA 3WGKA 3WQRA 3D8UA 3GLUA 3W05A 5DX0A 2F43B 4QXPA 2AOTB 1ZGBA 4XGNA 4J07A 4EI2A 1R8SA 5EKXA 1WDKA 4PWYA 4QGSA 3HFJA 4XSHA 2CEAA 3SDBA 4QUIA 3F3YA 1QC5A 4Y1GA 3V2IA 3UK1A 3USZA 5JCXA 1OFUA 3PX7A 1N6NA 5ALZA 2EG5A 1JDBB 1KDRA 1XEWY 4KGVA 1Z0ZA 4KN5A 4I5EA 1OYOA 3KOOA 4RD0A 3KU4A 5DDIP 2XCOA 4RGQA 5HVNA 2OENG 2P2GA 2YHIB 4FTWA 4BNLA 4YIHA 4U2FA 2O7VA 2VP2A 3I04A 1OVGA 5FTNA 2EBWA 3JU3A 4Q4JB 5DBHX 3IE1A 2IF0A 2OTCA 1RBMA 4IO0A 4C4SA 1XD9A 1RI5A 1ODIA 3ZBQA 3CCCA 3S27A 1MQ8B 2AJBA 3TWOA 1GV0A 1K6MA 1U3FA 2LTAA 1YGPA 2QM7A 1G8YA 3BD9A 3HABA 4C0JA 1HNXB 3IVCA 4G56A 3GYGA 1D1QA 3HADA 4E7PA 3KYCA 5DBIA 3COJA 1KI2A 2CUKA 4KNWA 2CDAA 2VSXA 4HYTA 4HJXA 1BAPA 1VM6A 3A6FA 4KC0A 4G1BA 3WSVA 4H1TA 5F2OA 1A4UA 1UWLA 2ARKA 4DCOA 4DN6A 4EPRA 3CUEF 3ZYZA 5D51S 4AB1A 3A10A 3MGCA 3A4YA 3NHZA 4XIJA 2NYUA 4CTKA 1UL1X 1L9KA 2QRMA 1SXPA 3M9XA 4BYMA 5I01A 2H2FA 2J08A 3A9SA 4Z3OA 1S7GA 4KQJA 5IVDA 1GUYA 4DHWA 4K9OA 1Q7CA 1KK0A 4BX2A 1ISJA 5F2KA 4OHMA 3ONVA 4ZVOA 4BB0A 3QTBA 2JIMA 4N54A 1PK8A 1DAKA 3LBFA 5A02A 1J2YA 5FPSA 5KJFA 4LTNA 4XXHA 3UTDA 2HMYB 3KZOA 3B8EA 3LE8A 2QV0A 2C2BA 2Q45A 3O8QB 4E5VA 5JRZA 4AKIA 3TJMA 3OEEA 2ZI9A 1BDJA 2DPMA 2VJCA 2WDZA 3OLVA 3WLFA 3GA0A 3CZRA 1XCGB 3TLGB 4Q1VA 1F17A 1B00A 9ABPA 2NWQA 3HCFA 4KNVA 3BX1A 4D9FA 4CPDA 1I5RA 2REQA 5A9SA 5IXYA 3OQ1A 1JFRA 5D1NA 1H5UA 1U0EA 5J9FA 4RLHA 1D2NA 2LCIA 1AUPA 1DHTA 1ZDMA 2WUVA 3OZUA 3M5CA 1IUOA 4WCFC 3NHJA 4C7XA 1AGXA 2YWGA 1ZP6A 3LL4A 4I36A 4INOA 3Q72A 4NNOA 4FDVA 3SNKA 5HKBA 1RHMA 2GJ9A 2QLBA 3A4MA 3K0FA 4QSHA 5ERGB 4AJNA 3EUEA 2ORWA 1GCAA 4FP9A 2BM9A 1L5HB 1VLLA 3QA3E 4BVLA 2BM1A 2DBZA 1Y9AA 2JAQA 2Y71A 1DGQA 4RTNA 4CN9A 3TZ6A 1FJXA 1S2IA 3KTDA 4JR2A 2NMVA 3HM2A 3OOEA 4HNHA 1VHLA 1C9YA 2XKBA 4DY6A 1TB4A 2WF6A 4LBWA 3B5IA 3DEAA 3Q12A 4F93B 2KQUA 1SN7A 2GERA 1S7CA 3K0KA 1D2CA 1ZK1A 2XUKA 2DP4E 1KZGB 2ISQA 2VNSA 3AW9A 3C1OA 4JBHA 3U3DA 3CLTD 1HLGA 3HU3A 3JR3A 1AVTA 3KNZA 3PL1A 3QYAA 2QYTA 3F8TA 4JOSA 4MUXA 1N2EA 4RESA 2OGUA 5AHRA 5JAUA 2QDXA 4URVR 4TUYB 3RC1A 3WQBA 5C8YB 3EPLA 4H7FA 4DR1B 2GKOA 2H54A 3I34X 4P3XA 4DYVA 3IB3A 2PRSA 1F8YA 3LX8A 2UZ0A 3H2YA 4RY8A 5JD6A 4DPKA 3T5AA 1OAOC 5BPHA 3VR4A 3LCCA 2QTVA 1PTJA 1LQUA 1JLLA 3EG9B 1EFUA 3GD7A 4KPGA 1OFHA 2JAXA 4ZOLF 5AT1A 2OY0A 2CFCA 4LXQA 4QGHA 4AMVA 1KJYA 2QTBA 3RUFA 1Q2UA 4MVJG 4NAHA 5TMBA 5BR4A 5DW0A 1CUEA 2HJ9A 4C7MA 4L3OA 3U3MA 4LZOA 2BH2A 1MAWA 2ZYDA 4WXYB 5BOVA 1UPUA 3OO1A 6AT1A 3HLKA 1X87A 2PBZA 4J7AA 4ZDKA 3I5XA 4XDZA 3KQUA 3PPVA 2DBQA 3KJQA 5I7FA 2EBFX 3I6MA 3ZHSA 4Z0PA 4JXKA 5IHPA 4MXDA 3ER6A 1SVWA 1CJCA 2AF3C 4BECA 1IBMB 2Z95A 3FNEA 4V0ME 3E9RA 5AUNB 1XD2B 5AOVA 2DHDA 3QMMA 5LWQA 4LVUA 2V0NA 4RTLA 1UBSB 1F2UA 3R7NA 2WHPB 5C4MA 4RWZA 4LQ4A 1XKTA 1U0FA 1YL5A 5E9JA 3VKUA 4IGKA 2IVZA 1P5ZB 2CHVA 1XHFA 2QQFA 3EY9A 4P35A 5EIEA 2JLQA 1E3QA 1WU7A 1EUCB 3FNIA 2GASA 5TPZD 2GK3A 2VT2A 1PKEA 5FBRB 4MVJD 3O8CA 1N8TA 3I92A 2IYQA 2YXDA 3K35A 1YRWA 4UCFA 1JAIA 5F9MA 1VHWA 4HDRB 3M5WA 3BJRA 3UMCA 2OAP1 3EUFA 3A3YA 1E1QA 2P3SA 3U4GA 2Y0PA 4WK4B 5JNWA 1XPRA 4CKCB 4P38A 2ZSAA 1P0PA 3DZGA 4X1KA 4F71A 3PG5A 1PX0A 2Q50A 3KKQA 5F12A 5A62A 1F0YA 1BWPA 1V45E 2W4QA 3NG1A 1GPJA 4NHEA 3ZJYA 4HNUA 1UFRA 1YVDA 3PVCA 4L4ZA 1OWOA 3RIHA 1L7NA 1PEKE 2B4QA 2Q3BA 4BV9A 3FYUC 2AMVA 4MS1B 1CUBA 1EE2A 3D7RA 3CINA 3DZKA 4BB6A 2ZRHA 1SXGA 1WB5A 4KXUA 2HSGA 4GP9A 4IWYA 2XD4A 4YT2A 1IJBA 2HUPA 3LQ2A 4KRFA 2ZRBA 1AQNA 2FRDA 5CH5A 1GCGA 3V55A 1QHEA 1N5KA 2ZB2A 4INPA 4M9UA 1C50A 4S0ZA 4OUDB 2HK9A 3W7VA 2C3PA 3VSBA 3UO8B 3RYCA 3NR2A 3TBHA 1DBPA 3L77A 5B7NA 3STHA 3R4VA 4W1SA 1CR1A 3PJDA 1ZVKA 1B74A 2QSYA 1NONA 1DDIA 3GJSA 5CW2A 1J8VA 1HYEA 1W5EA 5CLQA 3UK2A 3TUZC 3KKLA 2CB9A 3ZYCA 2BMJA 4DSNA 4IYJA 5KMGA 3ITDA 2P75A 2WOJA 2PGXA 2WVHA 2YV1A 4YMSA 3Q9UA 1BFUA 1QFZA 4DBLC 3FROA 3EBLA 3NNSA 4Q4AB 5CT5A 2NVBA 4NC9A 2W98A 4S1NA 2H6EA 4FJ1A 2OZPA 4L3VA 1E99A 4OFWA 3DVQX 4OHYA 1R5OA 3P9IA 1U8XX 1W1IA 2ZXEA 1W19A 5KJ6A 3VKHA 3BEDA 1YHYA 1JW9B 1T3HA 1M54A 3B36A 1IBSA 3OBIA 3PGVA 4AMBA 3UMSA 1QYWA 5KOHA 1TO6A 2Z8YA 1J33A 5DHFA 2PUGA 2WNIA 3E15A 3AINA 4OPMA 2CHEA 2OFXA 1B73A 1RM3A 2P68A 4I50A 4Y0AA 1ZICA 5LMNB 1C0KA 1VCIA 1UDWA 2H17A 1L7QA 4FYMA 5EL0A 1KMMA 2GEFA 2XRFA 1AV7A 1P6QA 1XZLA 3W9YA 4G07A 3ENKA 1FFSA 5EJ2A 5IKMA 1VPDA 5FOVA 1UPCA 4DXDA 3TQSA 4BO7A 1GPH1 1P7WA 1ABBA 2PRKA 3WYGA 3L4SO 1RLTA 3C3WA 1JLHA 3BMNB 4OYHA 4EWLA 4PX9A 3CX6A 1YE3A 1PQPA 3JQ9C 2G4LA 4X91A 4BIIA 5LZ9A 3AGQA 1XX6A 2BTQA 2NUAB 1H9AA 4MW6A 4RAQA 4K6CA 5F78A 3HP1A 4P4LA 2X1MA 4UFPA 4FSDA 1TZJA 3ORYA 4IEIA 4C0WA 3CF0A 2GK6A 2ZVQX 3GEEA 4BEWA 2JBAB 3W1EA 4PC6A 4KYIB 5B58T 2G09A 2GN1A 4OB8A 5DYWA 1GT6A 4WVLA 3ZZTA 1VC2A 1KP3A 4DDKA 2PTGA 3AP1A 1PWHA 5LMCA 4G0QA 2SNIE 5JJIA 3O1IC 2IPOA 1QNFA 2I29A 3AVQA 4RMIA 1CB7A 4AJHA 1XZAA 3GJ7A 3OJFA 1W48A 5EZYF 5DMHA 4HEHA 2O3JA 2FUG1 3A14A 3K9LA 4G24A 4QOJA 1F06A 1FS6A 4QRDA 3R9IA 5A3RA 2JAUA 4DVJA 4BRSA 1ABFA 4B0PA 3CG0A 1G42A 1OU0A 1AA9A 3EEBA 4OTZA 1RD4A 1T4BA 2GUGA 4R2IA 5FNVB 4RA6A 3X44A 3ZHZA 1W46A 4YUWA 2F3UA 5GONA 2K7ZA 1ICIA 2EJVA 1X0VA 3PQ3A 1CD5A 4ZEVA 2XXAA 1G8PA 2CC2A 1R12A 4JC5A 3J7AC 1Q50A 1XN4A 2I4RA 3GAAA 1QZXA 1WZIA 4XWAA 3P26A 3A0RB 2E1PA 1A8HA 4EYQA 2MYPA 2B78A 5A6SA 5CA1A 2QUAA 3JVUA 4IIFA 2ADMA 2ZRMA 5JXWA 1E6WA 3UUFA 5DM60 1O03A 3DTTA 3HUEA 1F4LA 3SQNA 1Y5RA 3FCSB 1HE5A 5LXTB 1HT1E 1BKDR 1SURA 4RF3A 2REOA 1BOOA 1G6Q1 4G01B 5NULA 2LXNA 2IPXA 2H3EA 1R16A 1N2OA 2BE7A 2HF8A 3OESA 2G36A 4BASA 1KAOA 2BEJA 3BKXA 2XQFA 3TE6A 1B3RA 1DAIA 2V5VA 1M6WA 4ZMSA 3KL2A 1TK3A 2PSFA 3W4IA 2QRVB 2G88A 1N2BA 3CQ9A 4MWCA 4OF4A 1O87A 3ROPA 1HWYA 5BR8B 2Q5EA 1A88A 1AZWA 2WD9A 3OG9A 1ZD8A 2V4ZA 3WBBA 4RD2A 1I51A 4KIJA 1G4HA 4K9SA 1BU8A 3QV1A 3OZBA 4L9SA 2R44A 4ID3A 3GFBA 4ENTA 2XUHA 3L7AA 3NDBB 5HFJA 4MV9A 1TFUA 4UULA 4FJ2A 3CLRD 3EMVA 2UZ4A 2Y76A 3DM9B 1LC0A 4TS4A 4Y6RA 4Z8XA 5C52B 3PA8A 2WF9A 1Z7BA 3MRSA 1CS0B 4L8LA 4H7JA 4ZMRA 2H4FA 2QMEA 2DJIA 4QTUB 2X0EA 3C7DB 2R6CA 1A7JA 3CH4B 1YC2A 4MV8A 4JI5B 1ZUHA 1GARA 4K6KA 1CUWA 2FEOA 2ILTA 3FWPA 4KPUA 5KSPA 2FW0A 3RCBA 1W6RA 3TECE 3PEWA 2XZLA 4PXSA 4D0NA 1FP2A 1Z5UA 3AF5A 4LCEA 4ZOAA 1JILA 4NK5A 4X6LA 5LA6F 4O2BB 2FSUA 4WN3A 2GVNA 3H6KA 5CDYA 4HDMA 2FA9A 4RJLA 5FWYB 1U99A 2Q1UA 2PUWA 2A5FA 5IWAB 1TT7A 4UD2A 5CDHA 5LP6B 3UA3A 4AT1A 4LJ9A 3DAOA 5GAJA 3G2NA 1EFLA 3Q11A 1GNTA 1XDGA 5AVSA 1K7EB 3EVCA 2W6CX 4M86A 1TEXA 3LY8A 2VWPA 4HNVA 1CR6A 2BHTA 1PCXA 2Q2OA 3AKCA 1A5BB 4IP0A 3H3FA 4KR2A 2M1ZA 1LSOA 1D7OA 3TTVA 4JD5A 3GJ8A 3U4AA 5L3SA 3EVFA 3DLAA 3V1NA 2H2WA 2JRCA 5KS2A 3E70C 4R8VA 2OXCA 4X93A 4HV4A 1NJ1A 4IJ6A 4OJKA 4DLTA 4OHRA 4FCCA 1ABEA 2ZJ7A 5BN5B 2R1VA 3BK7A 3RJ9A 4EW6A 5IJZA 1VIVA 2C84A 4JS0A 3LSTA 3TZKA 2Y0BA 5KUTA 1E8NA 1A5ZA 2J07A 1ECFA 4JBGA 3EVNA 5TLSA 4BL5A 5HILA 3W5HA 3PFCA 1EP3B 1NBIA 2X0FA 4E6PA 4GT1A 2NVUB 4M0FA 4OSEA 1QQAA 4CIYA 4NU0A 2HREA 3ESAA 1UBMS 5BW5A 2W6JA 2ZBFA 3JQEA 4FFVA 1XELA 4LRSB 1GVHA 4RV4A 1USUA 1FQJA 3BMQA 4A2PA 4CUKA 2A0FA 5IK2D 4HGOA 5DFAA 2HGZA 3EFOB 3O7WA 2WTAA 3CTMA 4ZYZA 3J7TA 4XGQA 3UAXA 1T9AA 2Q1XA 1NKTA 2CLKB 2JW5A 2R8RA 5ECWA 1QG6A 5GGXA 3SHFA 1PJ4A 3TPCA 3DP9A 5E6RA 1NDHA 5IJ0A 3O1JC 1BD3A 1L7OA 3ND8A 3OQ6A 1H2HA 4H7DA 4E4YA 1UZUA 2HDHA 4HDSA 4WX2B 2FX5A 2OP1A 2Z2IA 3GJYA 1L5QA 1VQ1A 4I4LA 4KQFA 4LF6B 2GZ3A 4UZFA 2BSAA 4RVCA 3ZNOA 3UKOA 1CFZA 2O23A 2HSZA 1Y3DE 3I76A 3MGAA 1UDAA 4HS9A 3LXXA 2NNWB 2ATIA 4LVNA 5AJWA 1YE5A 5BMVA 2F1RA 3GRCA 3LXMA 1PD1A 4L02A 1N2CE 3NGMA 5K3BA 3C8ZA 4NZZA 5IBRA 3RTAA 4AZ3A 3E84A 1PT5A 4BQFA 4BN5A 3AW8A 3IODA 3RF6A 4EEKA 5LJIA 1ATIA 3O21A 3QKRB 1V1MB 3FHLA 6LDHA 1Q16A 2I3DA 4JN6B 3KETA 1U8EA 3DC2A 4DA6A 2JANA 2OILA 4HN4B 3BGOS 3D4IA 3P9NA 5CGQB 4KR0A 4PNHA 4EGAA 4O33A 5T7BA 4DNQA 4ZV7A 1P61B 2A9RA 2A9OA 4Q7LA 4W5OA 4KDFA 1N3IA 3DHEA 1ZWKA 3SHOA 3RRBA 1IM2A 2I3ZA 3COYA 1J2TA 2XQKA 4DOMA 4MP6A 4KX5A 2C00A 1WEHA 4B6PA 1FRQA 1O8BA 1P4HA 1IN1A 3BWYA 3EEQA 3BXXA 3PITA 4ILEA 4LTMA 4U0JA 3PUZA 1M6VA 4LJLA 2EWMA 3PQDA 3UM9A 1E3IA 3OLCX 1U8YA 2YZMA 3HC7A 3I0MA 1HFJA 2WPDA 2P9TA 5CLGA 3S28A 3U1VA 3M2TA 3PE6A 3FSGD 4HQRA 3UANA 2B4RO 3CW8X 4BNXA 4QJIA 5LYJB 2FSFA 4OKSA 3W06A 5G4LA 1U28C 3R9WA 3EODA 1SR8A 4HZIA 4CM9A 2PKRA 3IH5A 2GVDC 4BO1A 4PTZA 1IL0A 3B6IA 3IO5A 3CN9A 4MR7B 4YUAA 2CVHA 1GYPA 2NVWA 1KERA 4RTMA 4V24A 4WSOA 1SVSA 2GN2A 2QLJA 3GQBA 1FU7A 5DHSA 4HXEB 2J0SA 4RSHA 1Z2OX 1ZJYA 1B8OA 2P91A 1PSDA 1UQTA 4LYFA 1MH1A 2AB0A 3ND7A 2E4ZA 2IP1A 4X8MA 3AJDA 4AAYA 4ER5A 1PWZA 2QY6A 3TZQA 3D0QA 2F3SA 2NU8A 4L72A 5C3MA 2D62A 3TW0A 3UWMA 1M6EX 3VR5H 3URKA 4IUYA 3ZDQA 1J9EA 1GTRA 5J3JA 4AQDA 4RJJA 1KI1A 1IUPA 2JI4A 2YXNA 1P19A 1O5TA 2D7CA 3CEPB 3HACA 3PYXA 1ZGGA 1V95A 4MCAA 1KU6A 3ZV3A 1KVTA 4DV2B 3LKBA 5DBOA 3NC0C 4ZVKA 1V8BA 5I7AA 4Q4HA 1NSFA 1YIOA 1XTVA 1Y3HA 4C7VA 3C14C 4DLYA 4Z7OB 4WKOA 2NO5A 4QAJA 2PV0A 3S1LA 1LLUA 1GXSA 1QK4A 121PA 1UAGA 4Q01A 4P4NA 4QU5A 3H5OA 4NBTA 2YN0A 3BJZA 4YJ3F 2YN4A 4A6EA 2WZDA 4EFDA 3IC5A 4A2QA 4QGGA 2HI0A 5TEVA 1JG1A 4ECEA 3KALA 1YE8A 5F1PA 1JWAB 2PT5A 2R5FA 1N6LA 1O0SA 4MRRA 3IUQA 1XHLA 2DAPA 4EJ2A 1XTKA 3FX2A 1PGJA 1Y7HA 2I1LA 4K6MA 4B3BA 3AR4A 1DC8A 1XLWA 1Z62A 4IGFA 1Q0RA 3KHUA 4LZZA 5DZSA 5ALJA 3R5SA 4I5GA 4M0LA 2FPMA 1W6UA 1QR2A 2CDRA 3EZ6A 3L4KA 1A9ZA 1QO0D 4EY5A 2YWFA 1ID1A 3FW1A 1Y1LA 2PSJA 3WXMA 3JVDA 5MGBA 4WI1A 3RW9A 4F0JA 2H0QA 3FBGA 4FS8A 2AKAB 3A7EA 4IUBS 3DE4X 4PRZA 1JJBA 3P45A 3LC1O 5BR7A 3EIFA 2AE1A 3G7SA 1FMCA 2EATA 3WZ2A 1PR1A 4WRRA 3FCOA 3VSEA 1QZ3A 3S2ZA 1CE8B 5C0OE 2O07A 4J75A 4X44A 4NCNA 3QVWA 4UM5A 5K05A 2GNOA 4ND8A 4UHDA 6REQA 1RM4A 3I6ZA 1SQGA 4FFLA 1JF8A 2QW0X 1TO1E 4DUPA 3FNRA 2VF8A 2IHTA 5D5QA 2I2WA 4F3NA 3IE0A 3WMXA 3GRFA 2V7XA 2Z8XA 3ICQB 4B3FX 2JJMA 4UC0A 4IFBA 1ZUWA 4IQ8A 2V7GA 1ZNZA 1PS9A 2B1IA 3PQ4A 3CT6A 2OBFA 3JWHA 2I55A 3N2GB 5IKXA 1E5DA 1P77A 1NPTO 3A6ZA 3KRTA 3L0CA 2ZE5A 2PSDA 2FEKA 1VPLA 4G1UC 1H69A 5AI0A 3I2FA 1SUFA 1BS1A 2JH3A 5ES3A 4CJXA 1EP1B 2RJ3A 1J0CA 2VUTA 3H0EA 5E6RB 4FWBA 5HQ3A 2B8WA 2P2DA 5CD1A 5D7NA 3BD7A 2NZYA 1JKIA 1KEZA 1ZJ4A 1V8OA 2EHJA 1RS0A 2B37A 3PX3A 4V0RA 5F21A 3UAZA 1KEKA 3DAYA 3P2EA 4NVRA 2XE7A 2XOKA 1NUTA 1EUZA 1LJUA 3CM0A 3OUTA 3QPAA 3B6MA 1KDOA 2AI2A 4BV8A 1Q57A 3UFBA 3NHLA 3HZRA 2J41A 4TMFA 3VKVA 3RVQA 2OSVA 2J59A 1X2BA 4FYYA 5K6AA 5KNBA 2HSWA 1X9HA 3BIWA 4GM1A 4BAGA 3AM1A 1B41A 4KLAA 4WTOA 3LYHA 1P2SA 4D3XA 2JGIA 1ULSA 3WLAA 3RPEA 5I47A 2O8DB 5CB4A 5IJAA 4HJRA 1VSQA 3S4YA 4YQEA 3ZD9A 1ESZA 1K08A 2NUPB 2A78A 4XIFA 1JWLA 5DN6A 4C4XA 1TUEA 3MMPA 1U5CA 2X4GA 3GFVA 4D8TA 2X76A 4F6RB 1HQDA 4EI8A 5CB6A 4YY3B 1M2HA 2EWVA 3RTCA 1EJBA 1ZOSA 3E9NA 5FBHA 2V7PA 3P9ZA 3UMYA 2BZSA 4RJIA 4R01A 2C1EA 4XUDA 2PWAA 2R8PA 3INRA 3RROA 1JKFA 1CUZA 2V6JA 4JJFA 5A1JA 4F8YA 4KNYA 3TX6A 3CRMA 4X9XA 2PIAA 1GM5A 2KM1A 1K7CA 5LOVB 1KEEA 2IK8A 3ELWA 3OZFA 3PNMA 3VC3A 2LKDA 1NOJA 4RMHA 2AFIB 4RCYA 5B3JC 1ZAYA 4ZO4A 3TX2A 4LGYA 1T2UA 2Y1WA 5MFPA 4QPDA 4B84A 3GLFA 3OTHA 2CMGA 2QYSA 3BB3A 1TAUA 3BWEA 3H0CA 4W6QA 4CMBA 1BWRA 1JG2A 3OT1A 3REGA 1P1CA 1DOAA 1W1UA 3ZWPA 5KCMA 2YVUA 3CXRA 3LBYA 4B09A 3AR2A 4IRUB 4NARA 4L1KA 4WY5A 5CVUA 1SVLA 5JS8A 1ZH4A 2Y0DA 1ZJ6A 1VHQA 1ZG3A 2AQKA 1U9IC 1A7AA 2B7LA 4B4WA 1JDTA 4ANFA 3WK7A 1PZMA 2I76A 1Q7TA 2VDVE 3ESQA 3IUJA 4KRYA 3L02A 5GY7A 5SZHB 5B5SA 1GLNA 4IEEA 2O59A 1IJFA 3X1MA 2XRYA 4HVLA 3I5UA 3DUFA 1JJFA 1XZGA 1I0IA 2ZDQA 4F1WA 4AG3A 4TGLA 2VYQA 4JFAA 3OZCA 3GLVA 4QBKA 4C87A 1AXEA 2ZI5A 2ZWPA 1K2WA 2EFEB 2L2QA 2DQ4A 2V5AA 1SUBA 3UF0A 4G4JA 4V0KA 3BJEA 5C1OA 2HU7A 2O7NA 4BEBA 2E87A 4LXTA 2GWRA 1TCCA 3FGOA 1S02A 3VI3B 3CRW1 3NAGA 4TV8A 1FX0A 5FV4A 2VIIA 1QCZA 2WQ6A 4YRIA 2HXSA 3SJ7A 1C1XB 3CZMA 4YASA 3TVTA 2PT7A 2XYRA 4GWKA 4ZVLA 3WWDA 1RAGA 1UIMA 3SBXA 2VEOA 3U4HA 1BS9A 1I6WA 1T0BA 2IU4A 2OD2A 2Q3EA 3ZWXA 5BYAA 2WFMA 4FZVA 4JY7A 4KACA 3FTFA 2XVXA 2WKQA 3WZMA 4N6NA 5KTOA 4QOSA 3T54A 5FLXA 2Z8ZA 4P8RA 4M0DA 4CKEB 5I7VA 1U2PA 3RV4A 3BCUA 1K7XB 2O0JA 1BMQA 4C0SA 2JAOA 1Q7EA 3RIMA 4JT4A 3EVGA 3T1HB 4DIOA 3X1ZA 1NE7A 4RIGA 1X3LA 3JATA 2G07A 3KPVA 3U17A 3NBKA 3KKZA 4XH9B 4BJ1A 3HVHA 4CODB 1YZYA 4KMOA 3GBPA 3N5CA 1ZL2A 4QWMA 4M53A 4LZWA 1MFPA 1OWPA 4BV3A 4YUYA 5JH7A 3L6EA 1Z2DA 2V3WA 3R3JA 1MTOA 1S3IA 1P31A 3CKYA 1DO2A 1OXUA 1JL3A 3FR7A 3HDHA 3KPYA 4V0LA 1I6KA 2YS6A 4AFNA 4PPNA 4LSMA 4CEHA 1ECGA 2GF2A 3P4YA 2PKCA 2XVYA 2W6QA 4FJ0A 3K15A 4XYEA 3TUJC 3K09A 2R97A 3P9RA 4IJMA 2QT1A 3THSA 1RLIA 2FP4B 4RGYA 2MSNA 2DGDA 5JAOA 2JK0A 3JALA 1NRXA 2C3UA 3D6FA 3EB9A 4GU5A 4OJNA 4FIDA 5EPUA 1SKYB 2GZDA 2D7JA 3DOUA 1AURA 3I83A 1NBOA 4R0NA 2FG5A 1WCV1 1CJUC 1K4KA 1SELA 3UEOA 3PUIA 1MLDA 3H3XA 3T4PA 1CYEA 1P1IA 4PZDA 3ME5A 5DYYA 4QPJC 1BJKA 3TS1A 5K0TA 1GRCA 2G5PA 4EB6A 1N7IA 2ODWA 3MEQA 4ARBA 2OESA 3TOXA 2OAEA 1VLZA 2X8AA 2OQ2A 3DZFA 3GT7A 3NVAA 3OEED 5HA5A 1VPWA 3HN7A 1WA5A 1M72A 1ULBA 2OCYC 2DTXA 2WJAA 4HLQB 3LPMA 1KQ3A 1RKUA 4KFUA 1F3LA 1G8SA 2FSPA 2VWHA 4G0NA 4ZQHA 4XGKA 5JJBA 2FF7A 3K70C 3DFKA 4NI5A 4YPOA 2QIOA 4WY8A 3I6YA 4JBYA 5E6SA 2BZ1A 5HIMA 4KO3S 2C58A 5IZCC 4F8EA 2OO7A 5KSZA 5U4XA 3HR4A 1IEXA 3LRPA 3LKZA 5FX2A 5DV9A 3WAJA 1K92A 1RAAA 2O7QA 5KVQA 1ODTC 3E9QA