1AV6A

Vaccinia methyltransferase vp39 complexed with m7g capped rna hexamer and s-adenosylhomocysteine
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
295
structure length
289
Chain Sequence
VVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for sequence-nonspecific recognition of 5'-capped mRNA by a cap-modifying enzyme.
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transferase/rna
molecule keywords RNA (5'-R(*GP*AP*AP*AP*AP*A)-3')
total genus 96
structure length 289
sequence length 295
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 1997-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1av6A00
2ZLBA 3FUWA 4V0RA 4JXJA 4YMGA 1O54A 4DA4A 3HCCA 4CKBA 2BH2A 1JTEA 2ZBPA 4M37A 3UWPA 1G8SA 3I53A 4R8SA 4M38A 2EX4A 5DX1A 4CKEA 1ZKDA 3LBFA 1RJEA 5K0NA 5P8WA 3KKZA 3CC8A 4AZSA 4RTPA 1FJXA 5E1BA 2Y1XA 5DWQA 2IIPA 2NXNA 1WZNA 2IDJA 4PCLA 4X63A 5K09A 3E7PA 3OZSA 4DMGA 3ELYA 4MTLA 4FR0A 1DUSA 3EMDA 2IH4A 2XYRA 3AJDA 4A6EA 3V97A 2OPBA 4P58A 2Y1WA 3C6KA 1BHJA 3GWZA 3DXZA 3BZBA 2XYQA 4E32A 4KIFA 3MCZA 3SM3A 3CJTA 3FPGA 3IV6A 4IV0A 3LPMA 3UJCA 1WXXA 1NBIA 5K0CA 2AVNA 3OE5A 2NYUA 1YF3A 3R9XB 3VC2A 2FRXA 4LG1A 4QVKA 3LCCA 3KQQA 4OQDA 3GRVA 2PV0A 2G8NA 4E2XA 4ER5A 3EVFA 3TKYA 2P35A 5FADA 3FYDA 4LECA 2F8LA 2JHPA 3FRIA 5C0OE 2PX5A 2P7IA 1NT2A 5FUBA 2P3LA 2QY6A 3THSA 3CCFA 3TM5A 2GA9A 3FRHA 3BKXA 2FCAA 2ORED 2OKCA 4GC9A 3L8DA 5HOQA 4WXHA 1X19A 4U7PB 3TKAA 3IEIA 3LECA 2WA1A 1MHTA 1X1DA 2P41A 3LX6A 4PNEA 4MHTA 4OA5A 2BR5A 3PFGA 1L3CA 3KQYA 5H02A 1NW5A 2CKDA 4GC5A 3GRRA 1H1DA 3A25A 4PYQA 4C07A 2PY6A 2Z6AA 3DULA 4OX9Y 1UIRA 1SG9A 2YVLA 5LQRA 3BWBA 3GXOA 3KU1A 5KS2A 3T0IA 3RODA 3A7DA 2HV9A 4XUEA 4FS8A 5F2KA 4KDCA 3OE4A 3M6VA 5GIPE 3B89A 3LDGA 1R8YA 1F3LA 2PWPA 4RVHA 4PGHA 2H11A 4YV2A 1JG2A 2VDVE 1JR4A 3HA7A 3BXOA 3E8SA 3P2IA 3NDIA 3HCFA 2QRVA 4HTFB 2ZZKA 4PGGA 2ZFUA 4P7GA 4YV0A 1SKMA 3NMUF 4CXMA 2PXXA 1QANA 1SQFA 3GGDA 3T7SA 2R6ZA 1P1BA 2ADMA 4AZWA 2QRVB 3KQOA 3DH0A 4HTFA 3C3PA 1NBHA 7MHTA 2OXTA 5C1IA 5GIOE 4GBED 3EVZA 4M36A 4R6XA 3DTNA 1VE3A 5FWAA 3FPJA 3KQWA 1XJ5A 4CTJA 1NW7A 3G2QA 4U7TB 2XVAA 3PVCA 1EJ0A 2PLWA 5CVVA 1OR8A 4AZVA 3MHTA 3ELUA 2ZIFA 1AV6A 1FPQA 3PS9A 4RVDA 2AOUA 1EG2A 1R18A 5DTRA 2JG3A 1X1CA 2YR0A 1KYWA 1FP2A 5DM0A 2IGTA 5F2OA 5LQJA 4XCXA 2AS0A 4GEKA 1UWVA 1NW8A 3TRKA 4Y2HA 5HIIA 1VBFA 5M5BA 3UBTA 4GOND 5FA5A 4BP1A 5GM2A 3KQTA 3KR2A 3CJQA 2E5WA 4KDRA 2EJTA 3HP7A 4OQEA 3PTAA 2OBFA 1UFKA 3B3JA 3GRUA 3S68A 2I9KA 2A14A 3AWIA 1G38A 2JHCA 1IM8A 2P8JA 5E1MA 2Q41A 3PX2A 4YUYA 2O07A 1JQDA 3HA3A 3LDUA 5EGSA 2XVMA 4RV9A 5D1NA 4HRAA 4RTKA 1EAMA 5JUWA 4DQ0A 4C06A 2AOXA 1YB2A 3H2BA 4P7JA 5GWXA 2BZGA 2GLUA 2OB2A 3FUXA 3HCDA 3UJAA 1Z3CA 4RTLA 3R0QA 4ZTBA 5EHIA 5CD1A 4PIPA 5T67A 5CVEA 3UJ7A 5LQUA 1JG3A 2B78A 5FHQA 5GOZA 3EPPA 5K0BA 4EMSA 1G60A 1L3IA 3KPYA 5K01A 2O06A 1ORIA 2PT9A 4YUZA 1JQEA 3MQ2A 4DF3A 5ERGB 5HILA 4RYLA 4RVFA 1YUBA 2CWWA 3ELWA 4XUCA 5DRTA 4AZTA 5K0FA 5U4XA 1EQAA 2FK7A 3DUWA 2GAFA 3SSNA 3C6MA 5KYGA 2YTZA 3EMBA 4B17A 2P3OA 2KW5A 3M6UA 1RI2A 1RI4A 5DX8A 3JWJA 4G56A 3M6XA 4QDKA 3KHKA 5EKUA 1NE2A 2PSSA 3GU3A 4RTJA 3PLAE 1M6EX 5BP7A 1NW6A 1U2ZA 2PX2A 3U81A 3GRZA 1VL5A 2PXCA 4FGZA 4KRGA 3Q87B 5K03A 2B2CA 3GO4A 2HMYB 2XBMA 1B42A 2K4MA 3DXXA 3M4XA 1HNNA 4PWYA 2AVDA 4A6DA 5EMJA 3FUUA 5DXAA 4RTOA 3FUTA 2P3QA 2QE6A 5DT2A 4HGZA 1NW3A 3DMHA 4HH4A 4ISCA 1TPYA 5DTMA 5EZSA 2ESRA 3UA4A 3EVCA 5K0GA 5EQJB 5K8VA 2V74B 4FT4A 5BW5A 2C7OA 3E23A 3AXTA 3HCBA 1R74A 4EKIA 3LHDA 5HIKA 1YZHA 3OFJA 5EG5A 2NP6A 4C04A 5GP1A 4YV1A 3UJBA 4M7RA 1G6Q1 2B9EA 2HR1A 1YZ3A 4C05A 3MTIA 3VYWA 3TFWA 1T43A 3OZRA 3UJDA 2ZW9A 2Z6QA 3EVGA 4RX1A 3AY0A 5DM2A 3EVBA 3OU2A 1SVUA 2YXEA 2NNWB 4F85A 2AOTB 4PYLA 4BY9E 3DLIA 4QDJA 4X61A 4DM3A 4E2WA 3KQSA 5HIJA 2IFTA 2PGXA 5ICEA 5G02A 1JG4A 4R6WA 5EIFA 4X41A 2HWKA 4AX8A 3HTXA 4KWCA 3LCUA 5E1DA 2G1PA 1PJZA 5EMKA 1HMYA 4CTKA 3GRYA 3EEYA 5F2NA 3NJRA 2ZCJA 3DR5A 2P1DA 3KR0A 4P7KA 1G8AA 2AR0A 3EGIA 3G88A 4EK9A 1YFLA 2JHAA 4PINA 3B3FA 1FP1D 3P71T 4MIKA 4PONA 3T7RA 5GINE 2ZBQA 2O05A 3FUVA 2AOWA 1KPGA 3FTEA 4HC4A 2I7CA 2EFJA 4RTMA 4DCGA 1ZHFA 5B1SA 3CBGA 1VIDA 2N47A 2GH1A 1NKVA 2G71A 3LCVB 4OBWA 5FHRA 1D2CA 3NWEA 4XUDA 5CVJA 4DCMA 2BR3A 3P9CA 4LWOA 5FULA 1XCLA 3UJ9A 3V8VA 4IV8A 3LDFA 3FTFA 4OA8A 4WVLA 1RJFA 4PIMA 4YUVA 3ELDA 2QYOA 1JSZA 4PYOA 1QAMA 1RI1A 4QTTB 4CKCA 4E2ZA 1JQ3A 5EMMA 2AN5A 3KPVA 4OBXA 3NDJA 3BKWA 4KW7A 5EKXA 3RW9A 4ATNA 2UZ4A 3ME5A 3TPZA 4GUAA 5BW4A 4ER6A 3B7PA 1IY9A 4KVZA 4RVGA 2G72A 2ZIEA 4HSGA 2EG5A 3HA5A 1KPHA 3R3HA 3R24A 2I6GA 1R00A 3G2MA 1KR5A 1VLMA 3IHTA 3UFBA 1EIZA 3NW9A 4FSXA 4QQNA 2AOUB 3LKZA 1QZZA 3EGEA 2PXAA 5HIMA 2OYRA 4ER3A 3CVOA 1RJDA 3JWIA 3DP7A 5E8RA 4UOEA 2PX8A 5ICCA 3B5IA 3MB5A 4HGYA 1P1CA 3A26A 1KHHA 2ZBRA 2YX1A 2OY0A 3OU7A 4GOLD 4POOA 5LSAA 4PYIA 1L9KA 2O0LA 3VSEA 1XDUA 1KPIA 2NP7A 1RJGA 4YMHA 2PBFA 2R3SA 3G89A 4FT2A 3TMAA 1NV9A 4RTQA 4BP3A 2IP2A 2ZWAA 5FA8A 3LSTA 2OB1A 3FPEA 3GNLA 3G5TA 1M0EA 3BGVA 5E9QA 3WSTA 1TW3A 4DZRA 5FTWA 2B25A 2ZWVA 2ZTHA 3EEOA 3KQVA 1JSXA 1ORHA 2AZTA 2UYCA 2AOVA 2JJQA 5D1HA 5K05A 5KQRA 5EVJA 5KVAA 1KIAA 1M6YA 4L7VA 3FTDA 3SR4A 4K6MA 4EQZA 4BLVA 5K0JA 5FQNA 4BLUA 4QQKA 4EKGA 4DKJA 3F4KA 1MJFA 5KQSA 3HCEA 3KPJA 3RIEA 2OZVA 3O7WA 5T64A 1N2XA 1QAQA 2B3TA 3I9FA 3E05A 3PFHA 2PVCA 3QOXA 3BT7A 1L3BA 3HVKA 4YUXA 1O9GA 1WG8A 4GOOD 2ZZNA 4V0QA 4ER7A 3ANXA 3B3GA 1YFJA 2PKWA 1D2HA 5LQAA 3G8AA 4E70A 5BXYA 3D2LA 3G7UA 3SX0A 3TM4A 1VP9A 1DCTA 2DPMA 3OU6A 1DL5A 2P40A 3SVZA 4E30A 1P39A 1D2GA 2I62A 5DM4A 3EVAA 2CMHA 1R6AA 1XVAA 3GIWA 2WK1A 5E2AA 5DTQA 2BM9A 3HCAA 3HVHA 3P9IA 1FBNA 1N7JA 3HEMA 3IYLW 4C4AA 3MAGA 2BM8A 1TW2A 3VC1A 4F84A 2ZZMA 2BR4A 3SXJA 5DRYA 3TLJA 4MWZA 1WS6A 2YQZA 1O9HA 3BUSA 3QV2A 5E8JA 3SSMA 1Q0TA 5CVDA 2CMGA 1WXWA 4PCAA 2Z6UA 1I9GA 3NVKI 2UYOA 2HNKA 3OFKA 2YUIA 1L1EA 3UJ8A 5E1OA 3FZGA 5E2BA 2QM3A 3LGAA 2VP3A 2IH2A 1N7IA 4IWNA 3KQMA 4E33A 5DXJA 5DSTA 2ZSUA 3SMQA 4GOMD 1BKYA 3BWCA 5K0EA 1F38A 2VDWA 3EVEA 2VZ9A 5CCBA 2IBTA 5JR3A 3A7EA 3P8ZA 2C7QA 1XTPA 1ZG3A 3PB3A 4AUKA 1V39A 3FYCA 3P9KA 3EGVA 2FHPA 3CJRA 4RTRA 3FPHA 4C03A 8MHTA 1QYRA 1VQ1A 1QAOA 2IPXA 5E9JA 3THRA 3OPNA 4R8RA 1SUIA 2GB4A 5E9WA 2HTEA 3T7TA 3ERCA 5ICGA 3CKKA 4RWZA 1XCJA 1R8XA 3O31A 4QPNA 3KR1A 3Q7EA 3TOSA 4PYKA 3K6RA 3MTEA 3PX3A 5CIYA 1PRYA 1WY7A 2LD4A 5LQCA 2ONYA 4RTSA 2C7RA 4X1OA 3I64A 3NTVA 5EOVA 4Y30A 1JTFA 2H1RA 3G2OA 4P7FA 1Y8CA 1G55A 4PYJA 5LQKA 5HEKA 2DULA 4EVIA 3BWMA 5FWDA 1RI5A 2IDKA 2VDUE 1XXLA 5DSXA 1ZGAA 10MHA 2IH5A 3DLCA 2ERCA 3C3YA 3JWGA 2H00A 3K0BA 5MHTA 4FZVA 5IKMA 3UZUA 2O57A 3R6TA 2CL5A 1EJ6A 4GF5A 4R05A 2JH8A 3MGGA 3BGDA 3G2PA 3ORHA 5GM1A 2OO3A 5DM1A 4RTNA 3SSOA 2ONZA 3HNRA 3A27A 3GCZA 4RSRA 5IH3A 1SUSA 2UYHA 4O29A 5EMLA 4MQ4A 5DLYA 5EPEA 1IXKA 1BC5A 3P9NA 2XYVA 2NXJA 3HVIA 3KQPA 4X60A 5T6BA 5K0LA 1X1BA 5EC8A 4F86A 3LBYA 5LR6A 2C7PA 3O4FA 5EIWA 3BWYA 3REOA 1KXZA 4KIGA 3DMGA 5CM2Z 2V7EA 5CVUA 3TQSA 9MHTA 4CWAA 3FTCA 3LL7A 2ZIGA 2UYQA 5EEGA 3ER8A 1VPTA 2FK8A 3MERA 2P7HA 3BGIA 3UA3A 1XDZA 2ZULA 3DXYA 3GDHA 1RI3A 4ER0A 4FP9A 3HVJA 5LQNA 4C08A 3KPWA 4E2YA 4BLWA 3P2KA 5HZMA 2PJDA 3I58A 2AN3A 2NXEA 5C9ZA 2NXCA 4PYMA 5EZQA 3DOUA 3CGGA 1I4WA 2YXDA 3M6WA 4HG2A 1SQGA 4QVGA 5CUQA 1ZQ9A 2IBSA 2AOTA 3G8BA 3JWHA 1ZGJA 2VS1A 2YXLA 5FCDA 3G5LA 3EVDA 4PYNA 2FYTA 1KP9A 3DMFA 3KPUA 3QOWA 4FSDA 4H0NA 5CCXA 4Z2YA 3PT9A 3A4TA 2ZVJA 4NECA 1AF7A 3AXSA 3FPFA 4LWPA 4QTUB 1JG1A 1BOOA 3SGLA 2JH9A 3I5UA 2PT6A 3HM2A 3NVMB 3KR9A 5EEHA 1KYZA 4IKPA 1Q0SA 4QPPA 1INLA 5DPMA 3LKDA 1XDSA 2GPYA 3M70A 5HFJA 3UJ6A 2PWYA 5EHGA 1AQIA 3X0DA 3MCTA 2G70A 3ID6C 5FQOA 4YUWA 4GQBA 2GS9A 3P97A 3TR6A 3NWBA 1NV8A 4E31A 2EJUA 2PX4A 1I1NA 1VP3A 1X1AA 2AN4A 3OCJA 3C0KA 3OZTA 5DX0A 3ER9A 1P91A 2FPOA 3M33A 3P2EA 1AQJA 2WA2A 5ICFA 3GJYA
chains in the Genus database with same CATH superfamily
1FUUA 3DVAB 3HI6A 1Z62A 3PWSA 4ZANA 5JLAA 1ZNWA 2D5AA 2QZJA 3DEYX 1JHMA 3D0KA 3KTOA 4HEA6 4URZR 4EHAA 4X8OA 2O8CA 1RKVA 3MWDA 3QPBA 2P62A 5CYFA 4CKXA 2W4IA 3HRHA 3LPDA 4H35A 4JUAA 4Y2YA 3SEAA 2CBZA 3ZU3A 1RC8A 3C8UA 2EZUA 2GO1A 4C0XA 1FLDA 2R6HA 3H0KA 3H65A 5K09A 1YR8A 3KWJA 3E35A 2FPIA 1QIDA 4WCVA 4PLGA 2MHCA 1YMQA 2DKOA 3J81k 5JDIC 5JJCA 2WVAA 4HH1A 1IJBA 1YH3A 3TBFA 3BRSA 4DIOA 2B37A 4ETNA 1US8A 2XXJA 4BX8A 4GI2A 3E3NA 1SBZA 3AF5A 3N59A 3MCZA 1CUXA 4NENB 4Q03A 3UJHA 5AVKA 2IXGA 2C5AA 2PZMA 4Q34A 3UJCA 4N7RA 1QXSA 3DM5A 5EZYB 2FEOA 1IZ7A 3W8RA 3WGTA 1N3BA 1U11A 2FRXA 4OCZA 1XZMA 1NL3A 2GKGA 4YREA 4MYUA 3AF3A 1N9GB 1JAIA 1O6BA 1RAHA 3D1VA 1LA2A 3ZZNA 3Q1KA 1SKBA 3NHBA 4K9PA 5HKLA 3I04A 3H9CA 4ITUA 4W4TA 1WTAA 3OTGA 1CB7A 5I8ZA 4F46A 4ONEA 1ORRA 1ZMRA 4C1NA 1WZ2A 3WLTA 5ALGA 1HNWB 2AKEA 1XRRA 1P31A 2MJLA 2WJ4A 5TXGA 2XT9A 3ZCPA 4N12A 1SXPA 1A9YA 1D0IA 2OOSA 5SV2A 1IRIA 4BP8A 3LDAA 1Z39A 3PFKA 4GH5A 4BGVA 1DTSA 2ERYA 2ICAA 5FWYB 4C1BA 1G8GA 3E70C 4QNRA 4GPEA 4M98A 2BR5A 2AN9A 2LDBA 4I4TB 3QU2A 1TIKA 4ZAWA 2MINB 4CM8A 5C8YB 2PE5A 4M1KA 3AHEA 3NHZA 1LBEA 1J09A 2BGRA 2FZ4A 1OPXA 1Z4OA 2VZ8A 3ND8A 3TQHA 1NXOA 1IBLB 4XVRA 4ZD6A 1OKKA 4I1OA 2BFPA 4LF6B 1E1CA 1QRAA 1C1XB 4MPJA 3SX4A 2MU1A 4L6CA 3O8OA 1YV9A 3K72B 2EERA 1FYVA 2H0QA 2OLJA 3LCMA 1MJ5A 3RYTC 3D6AA 3T9AA 1JU9A 1YJXA 1JDNA 1QHSA 4F4DA 3ND6A 2LV8A 4K5QA 1XN4A 1SKMA 2QLNA 4KK4A 5JXJA 1H1LA 3MT0A 1T1JA 3PWZA 4LC1A 2H4WA 3O75A 1ID1A 1THMA 2W2TA 2C61A 2KQUA 3UMRA 2ZJYA 1FNNA 1C30B 3CGWA 3LP8A 2J30A 4KE7A 2O8BA 4MLCA 1NMQA 4ESEA 1LI4A 3SKXA 2ZITA 4HB2A 2OSBA 1LZKA 1LBSA 2J9FA 3U1VA 5HCNA 1CRLA 2C9ZA 3HY3A 1P74A 4G0OA 2WKWA 5ITZB 3K70D 4YLEA 2JLYA 4F60A 4FEEA 5CFMA 1GQYA 3MHTA 3IPCA 1V3UA 2CNDA 2YWCA 3ELUA 4HPJB 1FPQA 3DVLA 3ER6A 3BE5A 1VA4A 2XMSA 1V7PC 4YMLA 4HDOB 4FYWA 4UVGA 3BWDD 4RWEA 4DHWA 4EEZA 3AVWA 3WGJA 1ZJZA 1BDHA 2C7BA 3IAUA 3LU1A 3FJYA 3OEEA 2ZYDA 3EZFA 1YB5A 2WU1A 2AUTA 3KR2A 3WV4A 1SOAA 2ZIWB 4YCNA 3M1YA 1KI3A 5IKEA 2I9KA 2XGGA 2A14A 4L1KA 4CFZA 3MILA 1H3EA 1OU4A 5FFNA 4PG6A 4RV5A 2P5TB 1TQDA 1JQDA 3HA3A 2C9CA 5KOJB 1FLAA 4PHCA 5BR8B 1Y5NA 2GK3A 2XVMA 3NDPA 3GT3A 3JQ9A 4OATA 3TR5A 2XCRB 4DR5B 2O8EB 1UM9A 3ITNA 1K0UA 1E7RA 2CLEB 1RZUA 2OBBA 5KWSA 5JJKA 2EWVA 4MVXA 1N0UA 2KB0A 5CPBA 5GOZA 4HWTA 6YASA 1U8CB 4N41A 4XA8A 2D06A 3PC4A 4PG7A 3ZC3A 1SUBA 1RAIA 2PZJA 3NBXX 3LQ2A 3PJDA 3LW7A 4CMAA 2VBCA 3GQBB 4RVFA 1R6UA 2GHRA 2V7PA 3TXXA 2IEZA 3DLHA 4WOBA 3WGLA 2A3NA 1UDWA 4CZ2A 4URHA 2HMVA 4DCPA 4UVDA 3DYVA 3AWDA 3VO9A 4F7DA 3RVDA 4N7MA 3DDWA 3HMQA 1WDTA 2MSWA 5ECGC 4V1CB 3HHPA 2C3OA 2W6ZA 3OSZA 1CEYA 4M22A 4PSCA 4B3GA 1M6EX 3D8NA 3P94A 1NW6A 1G8MA 3T7AA 1USKA 4O2BF 5FORA 2D4AA 3H5VA 2W7TA 4M9ZA 2I3BA 2QU7A 1SZCA 4S24A 4FGZA 1LNZA 5LYYA 4BO3A 5JZMA 1EWQA 4OUDB 5LMUB 1Y6QA 2XMPA 2X7HA 3Q87B 2W93A 5A5GA 1JF8A 3N05A 1L8LA 5CITA 1IN8A 4IMIB 2I2FA 1KOLA 4ARBA 4DT1A 3F9RA 3SEFA 3KS9A 1I10A 4OHPA 1YL7A 3JWPA 4RGQA 1U3GA 2AC2A 2J5BA 4HH4A 4D80A 3G2KA 1F4PA 2H65A 3PLNA 4EJ6A 1YQGA 3UPDA 3H9BA 2IEYA 3GT4A 3AXTA 2KMLA 3OLCX 2BFAA 4LRQA 4YRBA 2XHEA 4ETMA 1WSDA 4MWTA 1YZHA 4JI1B 1U4NA 3K7EA 4H6PA 1I0ZA 1FL9A 4AU1A 2ZTMA 4XVUA 2HK8A 1K86A 4ID9A 3WGQA 5JH7F 4B35A 2YN2A 1NYRA 3AFIA 1LDNA 1SUPA 1Z13A 1T43A 2K7ZA 1L1QA 1XYVA 2P5SA 2ZW9A 2ET6A 4WACA 2NU8B 5HTKA 2FMUA 2I6TA 3TDMA 3TGWA 1T2DA 2NZVG 2MYPA 2YXEA 4UHBA 3WLIA 4F85A 1P4HA 1XL0A 3BEOA 4EMBA 2X5JO 5LA6A 4KOAA 5AK5A 4NBNA 2GBLA 4H3HB 5EA2A 4Z3KA 4FM9A 1H66A 2YS7A 5KDLA 4YJGB 4B40A 4UEWA 1CY0A 4DA6A 3Q7QA 3DFKA 2OV6A 4WD3A 4BV9A 1U7UA 2NSJA 2ADFA 4MUNA 4AIIA 3PK0A 5DNUA 3R5JA 2FJPA 4GKVA 5AIBA 1IUOA 1X94A 3WSVA 4TLDA 1PNOA 3MCUA 3AL2A 4B5LA 2VK1A 3W4KA 3MOIA 3AY7A 4DUGA 3OFVA 2XNSA 2GH1A 4IFTA 5IG2A 4QFMA 3BXXA 4K1XA 1CQPA 4DV4B 1SIOA 1SU8A 1MOZA 4I4LA 4JJFA 2F8MA 5LLDA 2C9BA 1EK5A 4R2HA 4KR7A 3EC2A 4WA8A 4KUGA 1M0WA 1BMFD 1UDRA 1XZCA 1Z4JA 4I55F 1WXGA 4RK1A 3WAKA 4XTRA 3AEXA 4I7EA 4P84A 4YP0A 4E88A 4GSLA 1KC3A 1U0SY 3EXIB 3LKVA 2PKCA 3M1AA 2GZSA 1ZK3A 4LE1A 2JGFA 3CXUA 2IXBA 4ZI7F 3TLKA 4O0LA 3HU5A 1R00A 1RLOA 4NIMA 2GA8A 4Z4IA 3ZZMA 2WIDA 3LKZA 3QW2A 4YV0A 5ISMA 2PXAA 1NVUQ 5ICCA 1APBA 1XVLA 3TQQA 4FI3C 2D1RA 2QUHA 2YJNA 2J3DA 5A3VA 3FWPA 2ZBRA 2QOEA 2J3IA 2EG9A 1T8UA 1U0OC 4PYIA 4UM7A 2XVZA 4D3FA 1FDTA 2FF5A 3K53A 3OJCA 4JL8A 3KDSE 3GJ8A 3UFXB 2G06A 3DJFA 2CXOA 3O8DA 1GAWA 4GX1A 4R84A 1P75A 1JHOA 1CUYA 1ZISA 1QE5A 3DC2A 1J21A 2E9SA 1W4BA 2ZB2A 4X54A 3FPEA 3QYPA 4PZ9A 1M7GA 3VDXA 3P26A 3GDWA 4AQYB 4JROA 3R0XA 1X70A 1R0ZA 3Q2KA 4XB1A 5PNTA 3BERA 3VHQA 4B8WA 1BJRE 1KORA 3P52A 4D9FA 2NGRA 1NN1A 1PZHA 1WNFA 3BRWA 2ZS9A 2VPWA 3U7EB 1IRXA 1CU1A 3ABOB 4YCSA 1MBZA 1XRPA 2ZP1A 4E7PA 1KEEB 4KX5A 4MRMB 3P9QA 4PANA 4KO2S 4R71A 1QAQA 4DCNA 3GP3A 2PVCA 1UPFA 2UVPA 3H2ZA 3H75A 5B7QA 4TWBA 4UHHA 1E3LA 2H92A 5DGXA 1QS0B 1MX3A 1JR2A 1HTBA 3DMYA 4MAAA 4PAGA 4QBHA 3RAEC 5I9MA 4BNNA 1BTOA 1IAVA 5U9CA 3LY5A 2IRWA 1QDEA 5KX5A 4Q7QA 1P7VA 3HBFA 3SX0A 1E1RD 4BNJA 3K9HA 3OFND 1IH8A 1Y33E 4QPCA 2OE2A 4K03A 1TX4B 2UZ3A 3C2QA 2RGDA 5K9ZA 3MBKA 2GPAA 4X1YB 1EP1B 4EP1A 4AMBA 3ETCA 3HKEA 4XQ9A 4WZ6A 4NY1A 4XLTA 3GFSA 3T9CA 1CY8A 3L05A 1XRMA 2WKPA 3ZGVA 5DRYA 1G66A 3FBGA 3TLJA 4BC1A 4CR6A 3VKGA 1AKQA 1WS6A 2V7WA 4BPBA 3QVXA 2WYUA 3HYSA 2PJRA 1JVBA 4IOJA 3ZNQA 3CVVA 2XUAA 3UAVA 3Q3EA 4RJTA 5KNDH 3T6KA 3WFZA 2H16A 1VIAA 3CX8A 1JHQA 2K7FA 3FZGA 4CFYA 3VR5A 3UOAB 1PT6A 3WB0A 5CT8A 1CYDA 3PA8A 5E3JA 2XB4A 4QDTA 1E20A 5K0EA 3H0EA 1R64A 1H2WA 3HSKA 2VDWA 3HFSA 2QTRA 1GKKA 3KT0A 4K86A 3RVNA 5A1JA 1XZKA 1XA3A 3FCAA 3QUSA 2JFNA 1XPUA 5EFOA 3BF8A 5ITWA 5SYMA 2NAPA 4JQCA 1YZLA 5IUKC 3WYDA 2F43A 3BIOA 2YIDA 3EODA 4CIDA 4OP2A 4UEKA 5DZSA 5CDTA 2HHLA 2IUFA 2YZ7A 3DDHA 4KLRA 3QF4A 3O31A 5JTTA 1R8JA 3FB4A 1PX2A 1I1OA 3NTOA 4MZXA 3ON5A 5AK0A 1RRGA 4KAXA 3ZXUB 1ZXBA 5AXDA 2COKA 2Q2WA 3IB6A 5GONF 1T1EA 4E46A 1UXOA 3IIJA 5EKDA 4YYZA 5IFLA 2X6RA 4RTSA 1UBTS 2P9GA 3SZUA 1RLTA 4REOA 4FEGA 5EXSA 1Z6QA 4IKEA 1VBNA 1KZGB 1ZY2A 4D8XA 5B2FA 3LPAA 3MW8A 5LQKA 1EDEA 4LJ8A 4UUQA 1W5FA 1TZJA 2VDUE 2PMKA 3ZCRA 4BFUA 1W25A 1KAGA 4IHAA 3WYBA 4D9BA 2JAXA 3U44B 10MHA 3FMFA 1KERA 1WQ3A 2YMPA 4J0DA 1P6XA 1QOPB 2LW7A 4MDFA 2JFHA 1T5OA 2ZPAA 4TVSA 1B2RA 1T91A 1G41A 3D59A 3PJEA 2QVCA 1E2IA 4CJXA 1GUDA 1VL6A 1WMEA 4DN6A 1I4DD 3ZHOA 3UHOA 3MGBA 4K8OA 1PJSA 3AERA 3BGDA 4YRMA 4YT2A 1OI4A 3ZWDA 1JU3A 2OCAA 4FI3F 3DNFA 3GMDA 4NI5A 2FG6C 3V8PA 3VPFA 4TMKA 3OX4A 1SUSA 4QSMA 2UYHA 2PRIA 3G1UA 2FPGB 5K0SA 2WLSA 5T6BA 4EDHA 1NAIA 1TVCA 4XLLA 4J3NA 2W6MA 2TMYA 4XPIA 5H4HA 2IZ6A 4V02A 3JVDA 4WV3A 2VAWA 3GZ4A 3OLVA 4TYWA 3DMGA 2PSJA 1W5AA 1XJCA 4DC1A 2GCNA 3PYLA 3CO0S 2H8GA 2SBTA 2Z2YA 4MYHA 2XCSB 4FTWA 4MICA 2X9GA 4GT1A 2H1OA 1ZC3A 3GDHA 2J3EA 1NMSA 1RI3A 1X42A 2VBGA 5AKKA 2PUCA 2AC4A 5BQ5A 3KPWA 1X86B 3O8LA 3OZUA 2IWRA 1T4DA 4CIWA 2VQEB 3TEMA 5HJ5A 1OXKB 5H3HA 1DWOA 1NXSA 4RXUA 1OX4B 3DMDA 5CUQA 1O6CA 2R62A 4UUPA 3I5MA 3QWAA 3E9EA 5EXEA 1XD9A 1W8DA 2IYRA 2NV6A 3HO6A 2FYTA 3RUFA 3MTGA 4IEEA 4A8PA 5L40A 4TS9A 1SCBA 3CUYA 1EHCA 1XUOA 4YASA 2N75A 1UDAA 3ETEA 3NVMB 3S3TA 1XRQA 4D0RA 2I66A 4NEQA 1XDSA 2IZ7A 1TF7A 3NHJA 2YKGA 1XOIA 4PQYA 5EHGA 1MO6A 1QNLA 2O5RA 3J80A 4PX2A 3NWOA 3PD1A 4WK2B 2GXSA 4GIBA 2GS9A 1G1AA 4BIMA 5D3MA 2HBRA 2PX4A 3IPXA 1I1NA 1X1AA 3N3AC 4YRRA 2RI0A 4HEQA 5IJ0A 4QOSA 5EHNA 1P7WA 1MVOA 2V4MA 3ZZ0A 1JEYB 2HYDA 5BYAA 1L5HB 4YRFA 5ICFA 2PL9A 2AR9A 3TJMA 1ZXXA 3NP9A 3OY2A 4AWBA 3GLGB 2JNWA 3PITA 4AF8A 1VYUA 4AJNA 1Z25A 4IF4A 2ZBPA 4R8SA 1LBTA 1PTJA 1E63A 3COWA 4NU0A 3SFVA 5BPHA 2EX4A 1JALA 3ROQA 3SCZA 4PG5A 2Z5VA 4CI9A 4AX4A 3INTA 5E1BA 1P5RA 3MWEA 2DCMA 2LIVA 1XDWA 4PCLA 2VHYA 1L4HA 3OZDA 4BE9A 5IASA 2IHYA 2Q3EA 1E2GA 1JH9A 1LCIA 3EMDA 2OYSA 3BFJA 3GZJA 3K35A 4XVHA 2P3SA 3U0BA 1N4DA 1ZGZA 3G9TA 3DTTA 4OJNA 1T2NA 2XIQA 2FDXA 3CSUA 1MJGM 3FW1A 3GWZA 4PNPA 5DM70 2BAGA 3W05A 4OYRA 1NUQA 3A58B 3C6BA 1WUTA 4PE5B 1FJHA 2XZOA 4BMXA 4F6CA 2FEKA 1DRVA 4HQOA 1HDIA 4WE3A 5FUYA 1NSFA 1D7AA 3WFJA 5C1BA 1D1TA 3OCZA 1DBVO 4LY9A 2RBGA 2XTJA 4OL0A 3VC2A 4HPWA 3U13A 5JAPA 3RV4A 4F92B 5JISA 1ZGCA 4D42A 2HSGA 1YB4A 2G8NA 1JAXA 2MSLA 2ID4A 4NMLA 3W5BA 1IONA 1QFSA 2DUNA 2JHPA 3FRIA 2O4UX 4NX2A 4O2RA 4NABA 2HSEA 2VRNA 2FSSA 5CXXA 1IBSA 4TRJA 1E2PA 4D81A 1MOPA 3HSSA 3R6GA 5BXQC 5A7GA 2HCBA 2OEPA 3JX9A 1P5FA 3H83A 1PDWA 1SNYA 1U90A 1DC7A 2G17A 2VT3A 2XNJA 2H2AA 4W9NA 2IX3A 1EUYA 5J2TA 2BC9A 2GJ4A 4RZXA 4GR5A 1UQTA 2PQMA 4MV0A 3SDSA 4C0BA 1E79D 4OFWA 5AOBA 4DPMA 3UJPA 1MA0A 4AY4A 1TYBE 3AR4A 4A0HA 2WKRA 3OTIA 3TLYA 3OF5A 2Z6AA 3HXKA 4BX3A 3W9UA 5IN5A 4KXMA 4RLQA 4QJ4A 2EXXA 2ONJA 6CHYA 1S3IA 4X00A 3VHXB 3BBLA 1Z6GA 2EFHB 3LGSA 4LV5B 1M8JA 5CT9A 5F2KA 4A0SA 2YRFA 5JNWA 3ZK8A 1NSTA 4TS3A 4OJKA 3AZOA 5GIPE 3OEWA 4G85A 3F97A 3TIGA 3MWYW 4OAQA 2GPJA 4P98A 1G2IA 3A6HA 4P7BA 4MS3B 4MO9A 2BJVA 1JP7A 4YJGA 1KI1A 3KCNA 3OTWA 5DOVA 4L27A 2O1WA 1ZNZA 4Q7MB 3NDIA 4QQ8A 3A11A 2B8EA 4NG5A 2XDAA 2QRVA 4OIFA 4RK6A 5GGYA 4M0DA 4XEHA 5ELLA 5ERYA 5EESA 3HUDA 3HZHA 3LXUX 3GD7A 1E6WA 4D3DA 4N5HX 1TTTA 3SVLA 1NBHA 1J9ZA 2HRDA 2BRUA 3RF7A 3HKDA 2CSUA 4U7DA 1QO0D 1R9NA 5LC1A 4B3DA 1XC7A 5J43A 4NCNA 1KU6A 1PZGA 2I4IA 4CQMB 2O7SA 3ADKA 4Z7NB 2V8BA 3I6IA 2P65A 3KKQA 4MRRA 1PI3A 3O8OB 2FPXA 3KWMA 4Z0TA 1FS6A 2PKQP 4OTZA 4DTCA 1X1RA 1EG2A 2FRDC 4X7MA 2QZ9A 1C4OA 1BWSA 1GU7A 2V98A 3EZ9A 3INNA 3KXLA 3U4MA 1BX3A 2IYUA 3A9CA 3JD0A 4XCXA 5ALFA 3L8MA 2RAPA 3IILA 4EZIA 4P4SA 1I4LD 2Y0BA 3B9RA 2HREA 5KSPA 1KZ1A 1MC5A 3KQTA 3TTYA 1U04A 1BMTA 2X8BA 4RYDA 4BRWA 2E1PA 3HJNA 2EJTA 4CDMA 5IT9A 3GPDG 1U0LA 2JHCA 3KKLA 3UT5A 3O26A 1MOSA 1S9DA 4RZHA 2B83A 2DWQA 4Q4DA 1EIWA 5EGSA 3KQLA 1ZKMA 3UWDA 2OKGA 1E4YA 2I6FA 4URFA 3IV9A 3QYFA 4KMSA 4NZ9A 4YA6A 3QI2A 4B84A 4DXDA 3AUJB 1HT1E 2Y2UA 3L7BA 5D1NA 4JI4B 1ESDA 1P77A 1YB1A 3A1VA 1PTJC 4WPGA 4BTVA 5CA0B 2OB2A 3E8MA 3N1UA 3ZDYB 1N9GA 2C2ZA 2EKPA 3NAZA 4M0EA 4OQNA 1IIRA 3DAPA 4BZWA 2BSXA 1K98A 1EVZA 1H8ED 5FHQA 5TF0A 3UMGA 4EMSA 4G1UC 1A4UA 1ZBQA 3GLKA 4LZOA 3FCXA 4FLFA 2JRLA 3P5BA 3PSAA 3I9MA 4IVPA 1L7PA 2LIPA 1ZZGA 2MMGA 3ND7A 4XX0B 1VGVA 1EFDN 2IPMA 3ZVKA 1DXQA 1OROA 1TMGE 3VC7A 2V0GA 3SSNA 2Z4RA 4GMFA 4WX2B 5CH5A 5KYGA 4B17A 1N2CB 2I99A 3HJCA 4KO8A 3SXUB 1E8DA 2GN9A 3AERB 5LYJB 1AUVA 1CR0A 1HYQA 4YAKA 4G5FA 4UDOA 3K15A 1EGHA 2V0CA 1A95A 4FN5A 4HN4B 4R5HA 3P4UA 4KE9A 1SCKA 4B3FX 4MVJI 2PX2A 2J67A 1P1HA 1G6KA 3T3DA 5IJWA 3IQDB 1XHEA 4Q93A 2A1UA 1DIGA 3OJLA 4DXHA 3ZK7A 1V71A 1CR6A 1FTSA 4QAQA 5AJXA 5EKSA 1QHYA 1JVNA 1ZM2A 3VSCA 5FOQA 5C1DA 4JMLA 4A6DA 1VJ5A 1DOZA 3MSXA 4F1WA 3JYOA 2IZ5A 2J0EA 1OC2A 1M34B 3HR4A 5A4KA 5HOEA 4DLTA 2IQ5A 4EEXA 3ANNA 3UIEA 3QELB 2MR5A 4D9HA 2D5IA 3VR6H 1AKRA 3EYWA 2VP6A 3HUUA 2QRGA 4XDHA 3WJ7A 4XYGA 4OKNA 5K8VA 1ENYA 1PL6A 3SF8B 3IALA 5L45A 3C48A 3JYHA 1NOKA 4RHYA 1GCIA 4ALMA 2HA5A 2OZPA 2YZMA 3X2SA 3U7GA 1Q92A 2HR1A 2A9KA 4GRIA 2ID8A 4B09A 2HMTA 4KSYA 3VYWA 4F06A 3IRUA 4JH0A 5CXUA 3I62A 2DPLA 2HADA 4RX1A 3HB0A 1U8AA 3QPWA 2H59A 2WVJA 4DY6A 3KETA 3ZHZA 4M86A 1BW9B 3E84A 1BJKA 1FTWA 4WY5A 1UKCA 4D9JA 2D4HA 2F4NA 4HDQB 5ICEA 4QQFA 1H8HD 2DKFA 1NBMA 1GEGA 1YGYA 4KAFA 5E1DA 4RHTA 4GEGA 2OCYC 3PV0A 3K2QA 5AQ1A 1HMYA 1RC0A 3C8DA 4FKMA 2LCFA 3O2NA 5KVSA 1UKEA 1AHNA 2A0WA 3MS2A 3II6X 4UXIA 4WXYB 3LUFA 3T9EA 3F73A 5DHUA 2OVFA 5FL7D 4DCUA 3JQRA 4ZKDA 4UUOA 2I7XA 5C80A 2OCGA 4UXJA 4MGEA 3SC2B 3B2EA 3CLRC 3D8TA 1K8XB 5E7MA 1YQWA 2HF8A 1SG0A 3PC8A 2PD6A 3PE4A 2N47A 3DWEX 4D0LB 4DLNA 2G71A 4CW7A 1G3MA 3LOQA 1WUHS 3I0NA 5T8KA 3GG2A 3RYIB 2NOAA 5L3QB 1YJ8A 1J7JA 3HGQA 5J5AA 3TOXA 3HXQA 4WVLA 2R6JA 1WO8A 2O19A 2WB2A 5KUTA 4TT8A 3TQIA 2JLSA 5BV2P 3GT0A 5FI5A 4DSZA 5REQA 3RS3A 1XROA 1ZVQA 4ES6A 2F00A 3MHPA 2JBWA 3IT3A 4G5YA 5EMNA 3HGMA 4ZO7A 3HP4A 3DT6A 5BNZA 2P6RA 1E3JA 2GCPA 3AHJA 3I9LA 1TM7E 3SIRA 3L06A 4RK4A 1FX0A 1IEVA 1EX9A 3BMNB 3TTXA 3V4ZA 2BDUA 3SICE 1BDBA 3PEFA 4NV0A 4MV8A 3HA2A 2VCEA 2WMYA 4HNSA 4KR9A 3SHFA 3ZY2A 3V5NA 2PUGA 2A0FA 2AOUB 1QZZA 2FN9A 2HH9A 2PHZA 2ZRQA 4X20A 1W46A 2IHKA 1V8ZA 5ER9A 3ZDFA 3BB4A 5L3SA 3VA7A 5HK9A 3K0FA 2C1XA 2VYCA 2AG5A 4FSHA 3UAXA 1SVNA 2Y76A 2FR8A 4DADA 1YVDA 1G0NA 3JPWA 3VYUB 1RJGA 1QF7A 4HQFA 4GGOA 4IYJA 3T1YB 3WICA 1JLHA 1NXQA 3E2MA 1G2PA 1KO4A 2FPIB 4TT3A 4KKXB 3IKMB 2PLNA 3LYHA 4IZOA 2J0QA 5K7SA 1D0VA 2ECQA 3R7FA 3TL2A 1KZ6A 2B8WA 1TTQB 1TQ2A 4X90A 3KV3O 2YL2A 4N39A 4BQRA 5IVPA 2VYNA 4B87A 3ZLJA 2POQX 2JJQA 1B8PA 3QNWA 3SJCA 4EECA 5K05A 4G0QA 4H1VA 4JJKA 4BQPA 3T3NA 2A3RA 4WKPA 3UB2A 1NBAA 4IWXA 3PUKA 4QREA 1NT4A 4QQKA 4UNSA 5GJBA 1Z5GA 3ZCTA 2G5GX 1YQQA 2FX2A 1N2XA 5EIXA 1AKYA 4LRWA 4CR7A 5J4HA 1DAIA 2F6RA 3SXPA 2ENUA 3CKLA 1W581 4MGZR 4FYVA 3DNMA 1MC8A 4KN5A 3PEYA 3RU2A 3SJ7A 1S2OA 1SBIA 1HDZA 1E6UA 1XZGA 3U5TA 5B6JA 1EYZA 1DKPA 1P2GA 2OG2A 2PMBA 1FMFA 1ZH2A 3EN0A 1DCTA 3SIXA 2A9RA 3EDRA 3AHFA 4JK3A 2W42A 3NYRA 2A5GA 1CK4A 2PUTA 4M53A 2D59A 1DBSA 2VJOA 2I34A 2CNBA 4NV3A 2PSEA 2CMHA 4OXQA 1ARZA 1F0PA 1YBVA 5JH7B 1WBDA 2WK1A 5ELXA 1R0BA 4P4SB 2G9ZA 1K2WA 5D5PA 3BL6A 3P0JA 3AIOA 5TLSA 1Z7BA 2NVBA 4NYJQ 4C4AA 2CLHB 2N1BA 4CDNA 4WNIA 2G9QA 1UFVA 3MD9A 5JYCA 4B6GA 1Y6FA 1RQRA 2ECFA 3B78A 2YQZA 3CZPA 4RD0A 4K3UA 4MW1A 1L4YA 2EJBA 4AY3A 4R8MA 2R1TB 5F1YA 1BGVA 2WD7A 3PDHA 5IBRA 2XMBA 5LP6A 2ODAA 1E8MA 1ZIXA 2SCUA 4RIHA 1C14A 1CD5A 3NHSA 4OI4A 5LXTB 1R7RA 3ZCXA 1BWRA 3DZFA 2V6BA 3Q40A 2W2KA 3A04A 2QI9C 1Z4LA 3JTEA 1G20B 4F2GA 1CVIA 1IATA 3IBSA 3WWCA 1NLUA 4DSNA 2C5BA 3SI7A 4I55A 2AQKA 3DLBA 2HN9A 3L6EA 3ENNA 1OVGA 3F3MA 1JFLA 4IUYA 4WUTA 4WFIA 1RM5A 4R2MA 1EFRA 3NFYA 2IPLA 2HA3A 3QKWA 4WLEA 1WSBA 1Y3CE 3FTNA 3O1IC 4L95C 2PVSA 3UV6A 5JO9A 3TUJC 3FIJA 4X66B 5KPJA 4RTRA 4WZBE 1NQWA 2A86A 1SBHA 3OJOA 2P4UA 4DLRA 2R1TA 1KI8A 4UMEA 3PNMA 4ERXA 3VU3A 2E18A 1X38A 2GZ1A 3OE7D 2FMTA 2HFKA 1Z0ZA 4OXXA 2G25A 4LOIA 2X5KO 3DFZA 1P1RA 2PT7A 2GZRA 2R87A 3E9RA 3KKNA 3ONVA 4LDNA 3PX3A 5F73A 5H9VA 3BILA 1N4AA 3TCXB 3EQZA 3W78A 3SG0A 1P81A 2XRMA 1MMFB 4MRNA 5EE0A 2IOFK 3NTVA 3K1ZA 2I91A 1SCNE 2X1MA 3AP1A 3D7NA 2LP4Y 3I2HA 3DCNA 1Q3TA 4ZYTA 2PFSA 3P0RA 1Y8CA 1G55A 1YE5A 1QX4A 3ZW9A 1CRZA 1JBEA 4PAOA 4ZEOA 1XTSA 2HF9A 2IDKA 4LDQA 4TZTA 4JWTA 2H9AA 3WXMA 4B4KA 4YMWA 2PRYA 4BNWA 1KEWA 3C7KA 2OFFA 1OYOA 4C4OA 3DEJA 3M5WA 3CS3A 2R96A 3CLSD 2AWNA 4NK4A 4RKWA 2H00A 5TEVA 3FLMA 1F6WA 1YI8A 2CLDX 2EP5A 3K1TA 1DAKA 3C24A 1VYHA 2Z9DA 1M6HA 1SEVA 1Y9JA 3P9YA 1FS4A 4OP1A 4UU1A 4QSHA 3VYSB 4A8JA 5CB4F 1GTMA 1RQLA 3MAAC 4KWHA 1SKYB 4NV1A 3ZVMA 1FFWA 2EWMA 1W87A 1KAOA 3FF1A 3LWZA 1Y3DE 4O29A 4RSMA 1RPTA 3FETA 5DLYA 5EPEA 2B94A 4N9WA 2NXJA 4OAPA 1MVNA 4BKMA 4BRSA 2J09A 3LBYA 4IUCS 4F3RA 4YR7A 1TF5A 1NUSA 5CDFA 3CBQA 4KPEC 2JDIA 1BGXT 1O87A 3G9XA 9MHTA 3JAWA 3IOMA 3PUZA 3FTCA 1GU0A 1HGXA 2XI4A 3ICEA 2EW8A 3GFQA 3TW8A 1R5OA 3HEBA 2W98A 4EWLA 5BN1A 3IURA 4QA9A 2W4QA 2HMWA 3KEMA 3LWBA 3P2KA 1W47A 4YLGA 2AQHA 2PJDA 3T95A 4HQRA 1NASA 5CURA 4PRLA 2IYNA 3A1DA 1Q91A 1ZPDA 2VHXA 2VJDA 3DZDA 3QHPA 1Z7WA 1ANKA 2A9JA 2R97A 2ZSEA 3DD5A 4GXRA 4HGQA 1DE0A 1DQZA 4QQRA 1E7WA 3TL3A 4BN5A 2VHCA 1SR8A 2F8SA 4HS4A 4N40A 1T35A 2Q5LA 1GZDA 1JG1A 4YGYA 2ZUUA 4MX8A 1G5IA 2HJ9A 1P3JA 4WOKA 4X7PA 1PP4A 1UBHS 1EHIA 1RQNA 2EZTA 2YV5A 3KZNA 2PWYA 3N8HA 4NHOA 1Y4AE 4PICA 5FOUA 1E9VA 3VTKA 1UMCB 4EMUA 1J25A 2Q1XA 1OLOA 1FFBA 1F2DA 3A6ZA 4MQ5A 3PJRA 1HETA 2YHBA 3BXGA 1GPH1 4G5SA 3HXMA 5I4KA 1NV8A 1WTCA 2EJUA 3G82C 2X9QA 1XFAA 3MB8A 4QD3A 5DBEX 3ZH2A 4RW0A 1RAFA 2B3DA 1FF9A 1RADA 2C4KA 4V3CA 2HHAA 3ROEA 4AD8A 1JHDA 1JHVA 2DG2A 1L0BA 3M2PA 4R2WA 4UFNA 3MT9A 2WW8A 1ADCA 1LU9A 5D84A 1GG5A 1O54A 2JGIA 3HCCA 3PGLA 3TSAA 3V8MA 4XASA 2ZWMA 4QATA 1XRJA 2ATIA 4ZYXA 5BRAA 3ET5A 3EK2A 5DULA 2NUAB 2X5OA 3RVMA 3NI2A 2O8CB 2Q9AA 1ZKDA 4FGWA 3AUUA 4DIKA 5A4JA 4WLOA 2CDBA 3VKUA 1EJ2A 3CZRA 1VSQA 1Q74A 5FO0A 1Q0ZA 1BYUA 3IT1A 3TIFA 1PN3A 4U6NA 2GASA 1K1EA 1RMTA 1RXCA 2P9BA 2ZXUA 2Y1WA 2M6RA 4EOGA 1N6LA 4ARCA 2P78A 3HR7A 3VJRA 2C9OA 2C54A 1WB6A 4CTOA 1KRWA 1M73E 1BYIA 1S1MA 3DO6A 5CB8A 2VDPB 3CZ5A 3H3XA 4PLYA 3DE4X 1K06A 2NYUA 1XTBA 3N2ZB 3TZBA 4H7HA 3DZJA 4DHEA 2HIMA 5CFQA 2B92A 3KBBA 5IF9A 1HL7A 2O3UA 4ZVOA 1GG9A 3DVRX 3TKYA 4NEHB 1OY1A 3NBUA 4LECA 4CKWA 1NT2A 2ZDQA 2RHGB 3SYNA 5I6DA 2HHJA 3K5WA 1LDGA 3OSUA 4UTZA 2GA9A 5CLIA 3TJRA 1CUBA 1MAHA 2C0QA 2I8CA 2G0NA 4LVCA 3PUYA 3WL8A 4PZUA 4I5DA 1QP7A 4EB0A 4DQXA 2FPPA 1GT91 3N2GA 2IX9A 3QVJA 1QBKC 4L07A 2WA1A 4UUNA 3AEKA 3FLAA 2FFQA 2PBLA 3QVUA 1ULZA 3WS7A 1G5TA 2E3JA 4X24A 1GUZA 4ITVA 5EE3A 1OWNA 3OMLA 4UBMA 3WK7A 4GC5A 5KOHB 2AEFA 1QG2A 4OJYA 1OH5A 1CY6A 1N2GA 3BGOS 1ZI9A 1IY1A 3CRW1 3KJEA 5DEIA 2JFBA 4HGRA 1X2EA 4ZAXA 1AN0A 1V8OA 4YRGA 4XWWA 2NZYA 3ETJA 3RODA 1HQYE 3CY6A 3GC6A 5FV4A 2OILA 3LHFA 4M8LA 1ID8A 2DBRA 5FNVA 3HCOA 2GNOA 1QCYA 3COJA 3IUSA 3MS7A 4WQMA 1XXHB 4OLAA 3COSA 4J91A 1PJCA 2H11A 1FB5A 1GSHA 1OA0A 1PQUA 4KJXA 3UV3A 5AFSA 1CUGA 5JV5A 1P60A 2XTNA 2RGGA 1ZUD1 4EG0A 4KPYA 3N70A 3MCWA 3ZWBA 5AJUA 1S1CA 1HK7A 1VE6A 1V6AA 4Q9LA 2Y4OA 4EPVA 3SE0A 1NR5A 3IP5A 2DMRA 4D6YA 4CXMA 2ZGVA 1QF9A 1SQFA 7MHTA 1J00A 2WIFA 1OX6A 1U6KA 2YIJA 4RADA 1BS9A 1VMIA 4WCFC 3ZZ1A 2QL6A 4OKIA 1NPDA 2ZBFA 4BLQA 5IJ0B 2EW2A 2R7KA 3LWNA 1DHRA 3LP5A 4U8HA 5F9FA 1Y98A 1U6IA 3C1AA 3NYQA 4RPLA 3AINA 4J0IA 5FWAA 4DC0A 1NW7A 1E5TA 3H9GA 3IEPA 1TKCA 5F1KA 1SOUA 3SVZA 4AK9A 2VHQA 4CFSA 2Q3BA 1IPHA 1ZM9A 4JEIA 2NU8A 2WDZA 4I9UA 3IQIX 5AJZA 2CVFA 4FDLA 2HDNB 1WUKS 3KHUA 2QRUA 1FP2A 3EHDA 2ZR9A 4LHWA 4PGAA 2QTBA 3L0CA 3LX8A 4GEKA 5ELMA 5AW9A 2OQIA 4DEYA 2BWJA 1E9AA 4RPHA 2DECA 2WKQA 4BP1A 3GEIA 5B4TA 1XPOA 5I01A 2RHJA 2XZPA 5J5CA 3L6RA 1PFUA 1T34A 3DFUA 2IF2A 1KS9A 1NF9A 1GARA 1P1KA 2P8JA 1CQZA 2CD9A 2W6QA 3AEQB 2IXAA 3GVCA 3RS5A 3QE9Y 3NXKA 3KXPA 5DHSA 2VYVA 1HM5A 1QGYA 2XGSA 5AKEA 3OUUA 1RCTE 3P0IA 5JUWA 5AMXA 4QO8A 4AJKA 3HJFA 5KBYA 4KZPA 2VJLA 4MI9A 2BZGA 2FEMA 2G28A 4I4TA 4CLHA 4QG7A 4BQFA 1U0BB 3H4TA 1Y48E 2HF2A 2XWJI 4EHKA 3IT2A 2Z9BA 3LIPA 3ZLUA 3PDUA 3U56A 3KU4A 2YN4A 1QMGA 4A36A 3PNPA 1VKRA 1ORIA 2M6KA 2JJ8A 1KAMA 2VR1A 1IC6A 4XE5A 2C29D 1E2BA 1DKRA 1E4VA 3BSSA 4BLRA 5MFZA 2A4MA 4U5XA 3QJ5A 1GFZA 1NP6A 3GZNA 3AJ8A 2H08A 3K20A 1UC9A 1IBRA 2H48A 4G26A 4P86A 4IOLA 4DBVO 3JZFA 3P27A 1Q7GA 4WK0B 2DC1A 3D4BA 1O0SA 1DOHA 5ALZA 1PJ3A 5J9FA 3FDIA 3NCHA 1ZCJA 4X91A 1QJCA 4W1QA 4BN0A 5EUBA 1VI2A 5KSOA 4G07A 2FW0A 1XCOA 2OORA 4E1AA 5CJ2A 2GJ9A 2WIGA 4KR2A 4IDPA 2XBMA 1CUDA 2RG1A 1XZIA 4RD3A 2H1SA 5EJ4A 1Q0LA 3R5TA 2I4TA 4G0VA 3BTOA 3CRVA 2IXTA 5GOTA 1BNCA 3AEUB 4C2TA 2RGNA 1P0CA 1KDRA 3PQ3A 1H2FA 2JZCA 1JDTA 3HUEA 3LFUA 1V5EA 4LXQA 4MA5A 3U48A 3ZD8A 2A7XA 2IYXA 2BFBB 1RYNA 4FDTA 4C5BA 4YMUA 4ZV9A 5BW5A 4US2R 5JXIA 2Y9MB 3ZU5A 5FWXB 3QKSB 1BHQ1 3DEAA 3BICA 4KU4A 1KVRA 3NX4A 5F78A 4ZEMA 4C05A 5CLHA 1TYEB 3DMTA 4J6FA 1GA4A 3LO8A 1Y89A 4J4HA 2AMVA 1FQOA 4I8DA 2MTBA 3FRJA 5DNDA 5DHAA 4C7OA 3H1PA 2X40A 4DIUA 5IDWA 5A9TA 5IF3A 5TV2A 5LMZA 4W5QA 4JYAB 3MINA 2VHWA 3NZEA 1JR3E 2GZ3A 2OGSA 4G9EA 1SXJE 4XGQA 1HZJA 1ZOPA 2Z8XA 4NONA 1IZ9A 2B1QA 3E7DA 1BHSA 1DAMA 4Q47A 1PJZA 3AL0C 2AJCA 1VE7A 3HP1A 3GRYA 3SR3A 1G64A 2P1DA 1M74A 1YR2A 4JU8A 5ALLA 1KOGA 1DJLA 3G88A 1Y81A 2XODA 4BO6A 2H07A 4RH0A 4M1SA 4F5EA 1QM5A 2EOAA 4C4YA 4FD2A 1POWA 3MT8A 3LFTA 4ZCRA 1EU1A 2BEKA 2RAVA 1OLXA 2IGBA 4UU8A 1CUSA 2WG0A 4B7UA 4DCGA 5I4IA 1GCAA 3CUUA 1TAUA 4EY4A 1B4DA 4BVHA 1KDZA 4G25A 4YAFA 5KYNA 4DG8A 3UJ9A 3GEMA 3OE7A 5TQJA 2OHFA 1TJ4A 2FY8A 2F55A 4CMJA 1N5JA 4GI5A 1LDBA 4R0VA 1DEHA 3N2YA 4PIMA 1Y1KE 3DVSX 3ZWVA 4Y2VA 1XTZA 1VHDA 3U80A 3E48A 1PDOA 1EDBA 2MYUA 4KIUA 3U9SA 3EGOA 4ODIA 4LE0A 1NVAA 3AF1A 3M6FA 3TVDA 4JC5A 5L8VA 4QDZA 4H7EA 3QKRB 5EFZA 1X7XA 3OPYB 4GRDA 1TM5E 3HA5A 4NKRA 4YMSA 3WP1B 4G81A 1VLMA 2Z1MA 2ZIXA 3VZQA 1SKAA 3NW9A 4GLLA 1EUCB 3EGEA 2YVQA 1OLSA 2A33A 5CGQB 1ORTA 5E8RA 4JBNA 3L0DA 4CQNA 3MB5A 2D0PB 1C3OA 3KJXA 1P1CA 1UK8A 3OU7A 2OY0A 5IC6A 1XJQA 4LY0A 3U3ZA 1EKXA 3MXTA 2R44A 1KPIA 1J20A 1GXSA 3WY9A 2DXIA 1SBYA 3LQ4A 3NIDB 2YYAA 3QEOA 4W1PA 5CG2A 2PPLA 2QR5A 5E2IA 2RGNC 3U09A 3P2JA 3JATA 4QXPA 1M8GA 1XXHA 3G5TA 3LTEA 1WMDA 2C78A 1QYCA 2OD7A 4ZQFA 3PP8A 1R0RE 1HDXA 3TG2A 3A0RB 2RH9B 3G68A 3EEOA 1WRBA 3A6DA 1XEXB 2I6UA 4YS6A 4BE7B 5JPCA 1Z26A 2CXPA 2IYTA 2AJBA 2R65A 3MMXA 4BLVA 1YUMA 3QG1A 4PS1A 2BZ1A 3HCEA 3C8MA 1K6XA 5B6PA 3P2OA 4RJIA 1BJTA 3GJ5A 4I1UA 1KI4A 1A9XB 4FHGA 1O95A 3PFHA 4J07A 4G1VA 4YUXA 1RQXA 3K8OE 2G0TA 4C88A 3VPDA 3GYGA 1T9ZA 4ER7A 2CCJA 1OYYA 4L08A 3OJXA 1VG8A 5B1IA 2FMFA 1ITZA 1YJAA 3A37A 5BRNA 5BXYA 1GPLA 1U02A 4V1CI 1CRPA 3EXEB 5JHHB 2Y1OA 1Z06A 3UM9A 4EJSA 1OZHA 1YRBA 3HUTA 2P6MA 4R41A 2BL4A 3FCYA 3FZEA 2XTAA 2WT4A 4HDNB 4K1LA 4G4SP 4RGYA 3T61A 1AK9A 1USUA 2BKEA 2JGRA 3FPBA 3PCTA 3WDLA 1H65A 4XD2A 1XBTA 3MBOA 5HKKA 4URWR 2GAAA 1QZTA 3TXAA 2GEUA 3IDAA 1AF4A 3I2YX 4I3GA 3CNLA 4Q05A 2PQ0A 4Z54A 5F7OA 3RQIA 2ZQZA 1QFMA 4DDHA 1Z2DA 2VJQA 2CMGA 1YONA 4IUDS 1A7KA 1NUHA 2VJMA 3PR2B 4QXRA 4CDGA 1Z0JA 2WAYA 3OFKA 5TS2A 5DCWA 4QPDA 2AYYA 5E6UB 5HKAA 1DWQA 4L7QA 5L3QA 4OVKA 1YCFA 1KEVA 4G8CA 3R5HA 1MR3F 4IWNA 1ETHA 3WHPA 5FLYA 3KKKA 1IXYA 4W5HA 3LX5A 4A10A 1KO1A 4FX5A 5T4BA 2UXCB 2BEWB 5IAGA 3DYBA 3I6MA 3VV3A 4E4RA 2BBWA 1E9DA 1IEWA 4KQ6A 4HEJA 3IRVA 4JDUA 4ZOLA 5DMXA 1LK0A 2C4VA 4IO1A 1QVRA 1J0DA 2H4FA 3JQ7B 3KVOA 3PNYA 1U0EA 4MARA 4RIIA 4UTXA 4IRXA 1C3VA 2WVHA 5LBIA 3ZXYA 1UAYA 4RKEA 3QWFA 1OAAA 2VDJA 3SKVA 1UK9A 2HTEA 3D4NA 3W5UA 3I30X 5IMSA 4OO3A 5EZ5A 1XCJA 2PSHA 2KYRA 2EC5A 1GFWA 4TRRA 1J33A 4GHWA 4KXXA 3SZ3A 3U9LA 2P9HA 4DJJA 1B6TA 3L7IA 5GY7A 2Z0MA 1CKEA 1XK6A 2G9UA 3M7IA 4DLWA 1XD2A 2JFOA 1USIA 3ZHVA 5KQLA 2IE0A 2P8SA 5CCDA 4CIBA 2O2DA 5IKOA 1T4CA 4A23A 4CM4A 1RD4A 3OZVA 2IIQA 2AH5A 3RYHB 1M72A 1YMVA 5KTSA 4BEJA 1XYGA 5AVUA 3SOPA 1S01A 2VUHB 3T06B 3UGKA 3WIVA 3JWGA 5A3JA 1CJBA 3QELA 4E1BA 2UDPA 2GN2A 1Y3IA 4BNYA 2G9RA 3CH4B 4MHSA 1E2UA 1OE0A 1SC1A 1OT5A 3EBPA 3LAWA 5D86A 1L9XA 2DZDA 4WUVA 5TPWA 1ISPA 1A3CA 1C0EA 1LZLA 1N2BA 1T2VA 2BUAA 2H1VA 2OVBA 2QTVB 2W6JD 3PTZA 5FOXA 1B76A 3L7LA 4HJXA 3G5MA 5LXTF 4FGKA 3SSOA 5CB4A 5FUWA 5HMMA 4I81A 4EI9A 2A2ZA 1Y8RB 4DKXA 1VRCA 3Q7IA 2AF4C 3I0ZA 1QYXA 4WHMA 4RY0A 4X60A 1FP7A 1GUAA 4OSOA 4R1QA 5J5VA 2C5SA 2GBFA 3G2IA 4NK5A 3NOQA 4HD8A 2GZMA 3O4FA 4TQGA 1QU2A 3FTQA 1YR3A 3TIIA 3N0XA 4ETWA 1QJ4A 4TMTA 3TQSA 2Z2IA 2ZT8A 1HEIA 3KT6A 4KHZA 1Q7BA 5AM2A 2ZSHA 3ZJUA 1IM5A 2PUVA 2H1LA 4DMCA 3O0TA 1KIMA 521PA 5LQNA 1MW9X 2W0MA 4TUYB 1JZTA 4BLWA 1VHLA 2EDAA 2NXEA 4O4HB 5ESWA 2PRKA 1DBRA 5IYZF 1R4AA 3M6WA 3FSRA 2WU4A 1LWOA 1P2SA 2VS1A 2J4DA 3C6ZA 4YQEA 4I5GA 2XBUA 3DKVA 2PKYX 3GK3A 4HY3A 1AKVA 4M0UA 4BFWA 1DAEA 1VYVA 3DO8A 5CJPA 1V3VA 2ATVA 4YXWA 4XYEA 1NJ1A 1X7GA 2IYWA 3M4JA 3N6XA 4JB3A 4TYPA 1A9TA 4OD0A 4P0TA 5EEHA 1Q0SA 4QIHA 1WHTB 1ZJYA 2C20A 1GAQA 1H42A 1NC3A 1RYZA 2GTHA 4G0YA 5CK5A 4NXNB 6PFKA 2FU5C 3KOYA 5E6SB 4GDFA 1JPVA 5EIBC 1H9BA 2BHLA 2HGSA 2J41A 2ORYA 2WNIA 2LGJA 4F11A 4N18A 3KB2A 4G3XA 4QXQA 1JEYA 5D5HA 3ZXXA 3DKPA 1O2DA 4GPD1 3I8OA 3DKIA 2P4EA 5DX0A 4LXUA 4H1WA 2WJPA 2MYTA 3AR9A 4IDNA 1NP3A 1DX4A 2HTFA 2ZUFA 3L84A 2QVGA 5D3MB 4B44A 1PT9A 2SICE 1DBQA 5I3CA 5I9IA 3E3MA 1KZHA 4JC8A 4K0RA 4N47A 3JVUA 3VAZA 3K8ZA 4L3WA 1F0KA 4OBBA 4P4LA 1DJMA 1G59A 2ZJOA 3VBCA 1PIWA 2YYSA 3E3AA 1G8SA 2I78A 3NC1C 4OKSA 1QE3A 3UWPA 3OT4A 2WTEA 3ZX4A 4CMBA 1BZYA 1SCUB 3U4AA 1RPJA 4C6TA 3KKZA 1QH8A 2ZDGA 1FNBA 3USCS 5LQCA 1OV4A 2RHMA 1ZOLA 3A4NA 3R40A 1U80A 1QYWA 3HV0A 3LYAA 1QHFA 1U65A 1EDZA 2J31A 5ERXA 4FR0A 2YC4C 5C7OO 3GUVA 3HLYA 5BSWA 4H7PA 4PRZA 1AQYA 2YMMA 2CFCA 1LD3A 1UXGA 3SQDA 5BRJA 5FPTA 1FJGB 1BE6A 4AT1A 4NZYA 4P3OA 5JCZA 5JO0A 1Z6ZA 4LCEA 3N2IA 1SEPA 5KKCA 5LOVB 3WG9A 2WPDA 3IUBA 2OLEA 2A5FA 2IZOA 5ARDA 2FEAA 1L6RA 3IR5A 4TV8A 2QV7A 4M0KA 2Q3HA 4JXZA 4OUKX 1PWZA 3QKSA 2ETXA 1O1YA 3MWGA 4KTVE 221PA 3AU9A 4R2KA 5BNFA 4WTOA 1QRSA 2F90A 5FL7A 2NW6A 2QS9A 4H4CA 1K6JA 1OI7A 1V11B 4DT1B 3Q8MA 3BDIA 1IUKA 1D6JA 1JIKA 3AEUA 2FCAA 3ED5A 5H3LA 3TLCA 5JD4A 3AQIA 1WB4A 5G0WA 4UMDA 4IBOA 4URXR 1BOFA 3HHEA 3UT0A 4NMHA 1TQHA 3ESAA 2Q0HA 5CX1A 1CZUA 3VPXA 4FIDA 5KWJA 2MMCA 3AESB 3D3EA 1A9ZA 3GD5A 1N8KA 4EG1A 1Y8ZA 2GJAA 3KVYA 5K3FB 3HZOA 1O57A 3L0YA 4G1BA 2PY6A 2EFYA 1IQUA 2ZI6A 4F9TA 4Y2SA 1M2EA 3AR7A 2DP4E 1OHHD 1QRDA 2CXNA 1EB8A 4FYYA 3H7IA 4FHCA 4R5MA 1UKAA 3E5NA 3GA0A 4OQ4A 1R4MA 4O2LA 1E2DA 3S28A 2W6PA 1CNFA 3CMCO 3D4LA 4HWGA 4BNVA 3BM5A 4B3JA 4NH4A 4PGHA 1UM8A 2ZCUA 3BE4A 3I32A 1K8ZB 1MRZA 2Q3DA 4Q00A 1B6SA 1CR1A 2JIPA 3RTEA 3X44A 4IJ5A 3U4DA 5HJEA 1UFOA 1CC1S 3QPVA 1HC7A 3BJIC 1RPZA 4S05A 5BV1A 1QVZA 4BBAA 4HMPA 1XEFA 2CL0X 2X7XA 4HTFA 4PWZA 4BKRA 1V45E 3RADC 9ABPA 3U40A 4J4TA 1V1MB 3X1MA 5JS7A 4W5RA 3TIXB 821PA 3VPAA 1QG6A 4RKQA 1TI7A 3HABA 3U3RA 3G2QA 4CTJA 4ZMSA 5C1PA 2XVAA 4GFDA 3DR3A 4FHDA 5HMLA 1XHFA 4B0PA 2XXAB 1H6DA 1IMOA 3PPIA 4PC7A 3P20A 3I6QA 1ABBA 3HN7A 1H0KA 2MSEB 1WD7A 4YO8A 2DU8A 1WU8A 1SXJD 2CVZA 5HDBB 2W90A 5TT0A 5ESXA 2R00C 4LRSB 2XE6A 3H04A 1P1JA 2VF8A 4J6EA 4LBVA 2XCOA 3A31A 4LMAA 4QHTA 2Z95A 1P9NA 2JI6A 4WKGA 3PHJA 1ML3A 4A1FA 2EZ4A 2EBUA 3AUAA 3IT0A 5CRIA 2HC9A 2ZBUA 1CQIB 4CKZA 5JU6A 3EARA 3K92A 3NXSA 1JA9A 1W1IA 3UN1A 2RSLA 2O0MA 3L4KA 3ENZA 4E5PA 5BQ3A 3UNXA 2E89A 2ID9A 3OIGA 4PLWA 1SMKA 2RGAA 4EGCB 1C41A 2SNIE 3IBYA 2GYYA 3E0QA 3BMQB 5LDDC 1PU2A 4KFTA 5AXCA 5BQPA 1YS4A 3K9FC 5B7GA 4FFNA 5HQTA 4RTLA 3L79A 4YJHA 2YNMC 1EWRA 4I46A 2I8AA 4WDQA 4WZBB 5AJTA 4ALLA 4CLRB 3TAHA 1JAHA 2BGNA 4G5QA 3E1SA 3QKIA 3ZBQA 4F38A 5A5VA 3H11A 5CW2A 3GJQA 3PNBA 4NMXB 2EF0A 2EQ5A 1XZDA 1YRHA 1E5VA 2R9VA 1I4TD 2AJ8A 2H4ZA 3VO8A 3EXHC 1VHWA 2ZYAA 5JY1A 2XUQA 1E2QA 2YTZA 5BMVB 3IAXA 1RI2A 1MGOA 4AQDA 5CMLA 2PGOA 3KAPA 3H99A 2GZAA 2P9YA 2H0AA 2HLHA 5AW8A 3ZGXA 1RP7A 3GLIA 3E2IA 4W5WA 4RTJA 4BJ3A 1Z6YA 1BXZA 1R0YA 5ALTA 1CQJA 3WGVA 7MDHA 5L4SA 1SKUA 4GMHA 2VTVA 3KDAA 3U16A 1AJEA 3L4JA 3O2JA 3FNQA 1OXXK 3NBYC 3PA6A 1NVEA 2QN2A 4PU0A 4EBBA 3JAMA 1N2HA 5A6SB 3NHRA 1QCZA 2CFTA 1OGJA 3EFOB 3CVYA 4L5AA 5DGCA 4GGPA 4OHCA 5I9SA 1GGJA 5EMJA 3AV3A 3H6HA 1OJ7A 1KRHA 3J7AC 1VFNA 1ZGGA 1V48A 3FOWA 4YP6A 1U6JA 4PGMA 5HRCA 3B1KA 1QYDA 3BPSA 3DOFA 3UA4A 3EVCA 1QH9A 3AVUA 4KMRA 1UT8A 2Z04A 3A6KA 1URPA 5CGZA 4GP9A 4ZAGA 4CI0B 1MX1A 1XZNA 2H5LA 2HX1A 4ZHQB 2BGWA 2MIIA 4L5YA 5HF9A 1N0IA 3K3PA 3ZW7A 5C53B 1Z83A 1CQJB 1G4HA 1H4QA 3QMWA 4DLVA 1XTRA 3MUFA 1NKTA 4M7RA 4R0MA 2DQSA 4KYUA 1LNSA 4FBGA 1T0BA 4Z7OB 1L7AA 4Q3CA 4EKDA 1MH1A 3FNIA 2O8VA 3TQCA 4TL8A 3W5CA 4K46A 1CVRA 5KQMA 5CLQA 1AGPA 4LJKA 4HEHA 3CZAA 4GQIA 4C5CA 4RPJA 4J29A 4C7MA 3DOEA 3VNVA 1GLGA 1NN0A 1U1DA 1VA5A 3H2SA 4LGMA 2WHRA 1NQVA 4MRSA 4RJKA 1NVGA 1PG5A 2GI4A 4RA9A 3WZMA 1E5XA 5EJAA 1Z2PX 1HT2E 4ZDIA 3K31A 1FDVA 2C0PA 4U3JB 1IFXA 1HG0A 2UYGA 3UHPA 2YYYA 4MR7A 1XQ9A 2ZB7A 4K05A 3A1SA 4J4BA 2BFDB 2ODQA 1G8AA 4P7KA 4WOPA 3TQTA 2CF5A 1UOEA 3T4EA 3ZCSA 1WXFA 1C9DB 3LRXA 4EENA 1ICEA 4H6XA 3OF2A 5AESA 1K4YA 1MA3A 2ACVA 3GROA 2I8LA 5ARBA 3KQUA 2HIHA 5AI0A 3MJCA 4YO7A 1UZUA 1CEEA 1ZOSA 1P5ZB 4KBFA 3RYIA 4CNQA 2QG4A 3EE6A 3B8HA 1VIDA 1RS0A 1XF9A 1XAHA 2VHUA 4Z3DA 4C87A 1MJGA 3A32A 2YNMA 4A0FA 3P9CA 2O2IA 1VCIA 1YVRA 5AVSA 1C8LA 4M9SA 1RJFA 4WRRA 1K8RA 3LTNC 4TQ9A 1XP5A 2QYOA 3AR5A 1ZSNA 3FDZA 1WAMA 5EMMA 1Y7LA 1V35A 1D5CA 3SBXA 3IUQA 3QY0A 1O6ZA 3DE3X 4L4UA 2REXB 1DT5A 4N54A 3CVJA 4BVBA 5HVNA 1ONPA 1YS6A 5A4MS 1ZK1A 2H2IA 1NFFA 4RY2A 4DV6B 1BKDR 2HNBA 4B3XA 1J0EA 4XPZA 1AO3A 1FMJA 2ZBGA 4D0SA 1M54A 1Y6ZA 2ZXEA 2FI1A 4LJ4A 2CHEA 4FE4A 2F8TA 4M9CA 1A04A 3CH7A 3PWTA 5JCOA 4F8JA 2OFWA 3B5IA 3KYCB 1V4NA 3ZV3A 2QG9A 4YX9A 1GPJA 1Y8QA 1KHHA 1JFTA 2JCYA 5FTJA 1I2CA 4MVJA 2XUKA 4KFCA 1DEOA 1MIOA 2Z4SA 3COZA 4MWDA 1SELA 3OT5A 4S1VA 3U3KA 3TMAA 4MP8A 1W0JA 4DNFA 4QM7A 4DE5A 1R0SA 3TBKA 1FUKA 2IP2A 3NKVA 4JJ8A 5EVCA 3PGXA 2JIOA 3GNLA 5HG0A 4B3RB 3UAZA 1LKZA 3AU8A 1FLVA 2V59A 3H4MA 4DZRA 1BMDA 1DAFA 1XL1A 1PUIA 4O4JB 2D2VA 2Y1LA 3NU1A 4AO6A 5LNK6 1XMIA 2JIDA 4KQEA 1OC4A 4YFVA 3WMRA 3E6AA 1K6EA 5C2JB 4FNMA 2JGDB 3B1ZA 1O08A 1WW8A 3FYUB 2ZRKA 2QNIA 1X3LA 121PA 1YJ5A 2B4AA 1SGWA 2Q6KA 2QYHA 3FKJA 3ADOA 1J8FA 4ND2A 4OSEA 4UJ5A 2X9LA 5CB6A 4AY6A 3WWOA 4AJ9A 3KXIA 2B3TA 3PT5A 3C3MA 1UKZA 3A2KA 4BLSA 2WSSA 2QB5A 1Z9BA 4S2EA 1WUIS 2HV8A 4B6QA 5WRFA 1GZ6A 2FSUA 1Q84A 3DV0B 3IAEA 3IVCA 4LOJA 5BWNA 5TC4A 4PTYA 4EJFA 5A6SA 3BRWD 1U1FA 5DYGA 1DFHA 1H2BA 2FSFA 2QTNA 2VHZA 3LYLA 4S1TA 1EH5A 2QX9A 3RBXA 3NIBA 4ZCLA 1XT6A 5FXMA 4TTJA 1TUGA 3IHWA 4IIDA 1GGVA 1H2YA 2P1RA 3V6LA 5M04A 1ENZA 2DHRA 1I3MA 1L4FA 3AOEA 1LPSA 2FZ5A 3AP2A 3C98A 3HVHA 4MUFA 3E58A 1ZUNB 2LKDA 2YCLA 5AM4A 2VBIA 2WLTA 3WLHA 4D57A 3SXJA 5FBZA 3OD5A 2IU0A 4R9NA 2AJLI 4IVRA 1O9HA 3EX7C 1DTWB 3SR0A 1Q77A 4YRAA 2Z6UA 3MPOA 4LHXA 4MW0A 1QGZA 3JALA 4PBTA 5EWMA 4CE6A 1T5SA 3DE2X 4FC6A 2UUOA 3L4EA 4LYYA 3DBLA 2OM6A 4QOEA 3RTGA 2JI8A 4Q1VA 2O14A 2CJPA 4EITA 1N7IA 5CNJA 2ZJZA 1FZTA 2ATCA 3RDPA 1WMSA 1BD3A 2GM9A 2YN0A 3KKMA 1E1MA 4RHFA 4WNYA 4LJ7A 5AHOA 3RE1A 3TFQA 4DZZA 4QOIA 1J97A 4KXUA 2XMQA 5HZHA 1SJ9A 1SU7A 2OZKA 3DDSA 3U3DA 4A0RA 1ONSA 2QXYA 5FBQB 3FY4A 5IDXA 1CQWA 2AMLA 5IKXA 1TKRA 1RHUA 4YRPA 2FHPA 4YDRA 3LP6A 3RCBA 4DLAA 1H9CA 1XAJA 3O94A 4W8OA 4JQYA 1ZL2A 3WGOA 4R8RA 1ZN2A 4PO3X 2ZRIA 2WJGA 1RKBA 3G13A 1Z22A 5TMBA 4C7JA 5JCOC 2BFMA 1IOLA 2PU5A 1PSZA 1T13A 1V16A 1R12A 1KSJA 3STTA 2ZWIA 3ICVA 2Z2ZA 4J0GA 1V9LA 3TOSA 4PYKA 4AMYA 5ABPA 1AT1A 3BH0A 3DZKA 1R37A 1R9JA 3K6RA 5IZ4A 1ZD4A 1WD5A 2LD4A 1QG4A 2OQ2A 4ZA2A 3BSWA 3LBAA 3HC7A 1V5GA 2ZJ8A 4RK7A 4IO0A 2O54A 1GOTA 3FHJA 3VR3A 1MKYA 3DAOA 1OZ0A 1YR9A 4O5AA 3ZDEA 2WHXA 1FDIA 4RHEA 5J4VA 4QX6A 3VR4H 2YC2C 1EMDA 2HGZA 2P0YA 4OH7A 2E21A 4HXEB 5IABA 5AO9A 1GHTA 1VJDA 2DT5A 4ZOBA 3R7SA 1M34E 3MUEA 5GV7A 5MHTA 4FZVA 1Z18A 3LT2A 2BFBA 3P9ZA 2I2AA 4FW9A 1M1YA 1RABA 2CFRA 5FLKA 5T41A 5K8IA 4ZT5A 3IPRA 1D2AA 3UC9A 4HLNA 2A0UA 5FPHA 1WA5A 3NUZA 1MNQA 3U4QB 3R44A 2ONZA 1Z73A 3A27A 4IJKA 4AKTA 4BNLA 5JC8A 3EG9B 1XTQA 3OMWA 2NG1A 2BMDA 1R66A 3P9NA 5KVVA 4BUCA 3DTVA 5ANRB 4HNVA 4MR8A 1JYEA 2FETA 3CH5A 2UV8A 4TL7A 3RSZA 4ZGBA 2OZEA 3VSDA 1M1ZA 1VLZA 5KSYA 3JAKA 4BO5A 1SHKA 2G4VA 5AKJA 3S29A 1PS0A 3EEIA 2FN8A 5A1TA 2WOJA 5CDYA 1PSDA 3TLEA 1TA9A 3RIYA 1UK7A 4Q0MA 5I4BA 2ZULA 2B35A 1LC3A 2BYTA 1P33A 1NI4A 2VJNA 3OCUA 1UANA 1Z45A 1CDDA 3ZJ4A 4WWHA 4Q1EA 2PRSA 3NYIA 4OHBA 5EZQA 1NVFA 3D3QA 4PZEA 1U98A 4MWCA 4XGRA 2IBSA 4KNYA 1EEHA 1ZQ9A 1JHXA 2AOTA 1LWNA 1ZNQO 2GR9A 2H2HA 2JLRA 4G1FA 1R0XA 3JQGB 4KIJA 2IEDA 2YFQA 4M9UA 4IIHA 2ODEA 3JVIA 1BA2A 1AF7A 1N5KA 1OREA 2QEQA 3C1TA 4LV8B 4RXMA 3UK0A 4A82A 2WB4A 4QFDA 1VYTA 2K2WA 4WOCA 5SYNA 2X4GA 3TJZA 4DUGD 1B0PA 3VO1A 3LKDA 1LXCA 3PGVA 2JCGA 4X92A 5COBA 2VP4A 4ZYZA 1E64A 3QXSA 3PPXA 3GLTA 1Q1NA 3RJMA 4RULA 1BVYF 2H2DA 4DGSA 2AFIA 3L1JA 1JHAA 1PGPA 4G65A 2DTXA 3QW4B 1ZCAA 4RZUA 5CJJA 1NONA 3T3OA 2X0EA 1SK9A 3L7KA 1QTNA 4BB6A 1ZAYA 1EUDB 5E7JA 2QP9X 3URKA 4F9GA 5BSEA 1K7EB 3VMFA 5F7JA 3TDNA 2FX3A 1ST3A 1CUFA 2GTIA 5JSYA 3BRCA 4EO7A 5EJ6A 1YXMA 3SZRA 1L5KA 4UU7A 3ASYA 1AKUA 2GN4A 4IDOA 3GY0A 3VGJA 3FR7A 2J08A 5ES3A 1P6UA 3SKYA 1C1YA 4BUZA 2XKAA 3QWIA 2ZBDA 4Y8VA 1KQPA 2NXNA 4FGLA 4M9QA 4P22A 1YBFA 2CLSA 4U9IS 4X63A 4MTLA 2FUG6 5JSHA 1KGSA 3KOXA 4J49A 4QFBA 3FA2A 1DS6A 2FQWA 1J8VA 4NXMB 2RGUA 1VDZA 3IEXA 4OHMA 3WHKA 2J07A 3KYDB 3ORQA 1HFKA 1JB9A 2G7ZA 4UHDA 1STOA 4HPXB 4ZYWA 3N6RA 2XOKD 5CR9A 4YGXB 3WYEA 2ISQA 1A69A 3FVRA 2C84A 4LQCA 2GZ2A 3LA6A 4ALKA 1Y5RA 4XD7D 421PA 3DL7A 4Z4QA 3E9QA 1E32A 3GRVA 4DV2B 1ZA2A 4MP3A 4EMTA 5EINA 1BROA 1E0SA 1P19A 3F5FA 2HA4A 3Q85A 5FD8A 4EI7A 3NH9A 2JLAA 3U7IA 2Q1TA 3TCKA 3L7MA 4MKFA 2HOQA 1YRYE 2R1VB 1J70A 3Q5DA 2VJAA 3H1AA 3BKXA 3UMSA 2QRLA 3V32A 3GUZA 1CF4A 2OKCA 3GBVA 5DF1A 3RC3A 1P2DA 4Q3NA 1Q2UA 1B6RA 3WQQA 2AG8A 3ICPA 4IMJB 3G59A 3OOEA 4DQKA 3ZNNA 2FFRA 2C99A 2P9QA 1V7ZA 1MAUA 3QMPA 2Q5IA 5JWHA 1L3CA 2C2OA 1YS7A 3KYBA 4MR7B 3I39X 5H70A 3L0BA 4OMDA 1DCKA 1WUJS 4MPRA 5JDCA 1R5JA 2YVLA 3IBTA 3RF6A 3ZV4A 1FXUA 1ZLXA 4YI5A 1RYEA 2B1RA 4LJ5A 2Y1GA 5JPIA 2WHPA 3NVAA 2VFAA 3TRDA 3GBPA 2IUSA 2JFVA 3B89A 5JDCC 3HVRA 3D3KA 1KE2A 2X0JA 1Y34E 3OOJA 4C0JA 2OXRA 3JR3A 3S44A 2GEJA 3T7KA 1D03A 2XIJA 5J2UA 4LDPA 1BCSB 1ZD2P 1AB5A 2QUZA 4H3SA 1DPFA 4P7GA 1V3QE 3VR6A 3UMCA 3BBPA 3C7CB 1XZEA 4P5EA 2R6ZA 5DB4A 4Q1CA 1UT6A 4LJSA 1LK7A 1M8KA 4KQHA 4YJ2B 16PKA 1RQGA 3RGWS 5LU8A 4Q3DA 5ADVA 4K0KB 2ZRMA 2ZVQX 3ZJTA 4PHHA 1VTKA 1QQTA 3N7UA 2C2XA 3N0RA 4NOKA 1LPOA 1OCEA 5IARA 1F9AA 2WMOB 2RC5A 3EDYA 3KJNA 3ED1A 4FYJA 2IVZA 5G0SA 3HDQA 5H68A 3ZUGA 5KOYA 1DIHA 2GYUA 4H0CA 4D97A 4R3UC 2AFIE 5C8XA 4I3HA 2BFCA 1ULBA 3EIEA 3W90A 2HA2A 4DSOA 1HFWA 2JPDA 4C7XA 2VDKB 3RSOA 5TY0A 4Y2GA 2VP2A 1VPDA 4RE5A 3DMTC 2WF8A 4NSNA 5KC9A 4GOND 4M8KA 4JWKA 2VUIB 1QHXA 4Q19A 4HB0A 1J42A 4PSAA 1KI6B 3B3JA 3DV2A 2Y93A 1N5IA 4PS0A 1P61B 4TTVA 2AE1A 1PG2A 4X8LA 2ZRFA 1I2MA 1P9OA 5HW0A 3F0TA 1T9HA 4RZ3A 4ZV7A 3RSSA 5FOTA 4NE9A 3K32A 3ODGA 5EHZA 1YA6A 2Y1FA 1CULC 5FAXA 2ZSDA 4LHEA 2C5GA 2R8BA 3D3NA 2V7VA 2VNHA 3RVBA 3UWMA 1SVMA 2FDCA 4J1TC 4X95A 5DI3B 1W5EA 2PT5A 4PPGA 2R4QA 4LEIA 1IN4A 1V4BA 5GWXA 4X6XA 3VFDA 3R0QA 1Y80A 4LY6A 5KJCA 3E22A 1E99A 4UZFA 5CVEA 3R0JA 1B23P 2D13A 4OREX 4JGGA 4B76A 2IV3A 4F9EA 1ZCBA 3Q3JB 1XXHE 3Q3IA 3VISA 3L9WA 1W0JD 4J1SA 2RI6A 4F96A 4CGZA 3KEQA 4WVFA 5LFAA 3P0FA 4PR0A 2BTQA