1AV6A

Vaccinia methyltransferase vp39 complexed with m7g capped rna hexamer and s-adenosylhomocysteine
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
295
structure length
289
Chain Sequence
VVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for sequence-nonspecific recognition of 5'-capped mRNA by a cap-modifying enzyme.
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transferase/rna
molecule keywords RNA (5'-R(*GP*AP*AP*AP*AP*A)-3')
total genus 96
structure length 289
sequence length 295
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 1997-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1av6A00
2BM9A 2FHPA 1YZHA 3THSA 4YV1A 4C04A 4OA8A 3ELDA 4L7VA 5E8JA 1L3IA 2R3SA 5ICEA 4M37A 1RI4A 2Q41A 4E30A 3X0DA 2JHAA 1D2HA 3KKZA 3JWIA 2O57A 3JWGA 4DA4A 5K0JA 3EMDA 4WXHA 3MCZA 4ER3A 3G5LA 3TKAA 4KW7A 5DRYA 3NW9A 1QZZA 1JG4A 4QDJA 2GLUA 3UA4A 1YFJA 2JG3A 4IV0A 2CMGA 1VP9A 3DXYA 3JWHA 3DXXA 3KQSA 3C0KA 3GRZA 3Q87B 5EZSA 3BUSA 2P7HA 3TQSA 3MTIA 2EJUA 2HWKA 3LDGA 3FUUA 3GNLA 4QDKA 2DPMA 3LCVB 5EMKA 1JSXA 4RVGA 1FJXA 2P3LA 2YXLA 3ANXA 3HM2A 3I53A 4BLUA 2P3OA 3KU1A 1UFKA 1KHHA 4E2ZA 3R24A 4KIFA 1QAOA 3IV6A 1QAQA 5CCBA 3BGIA 1R8YA 1FP1D 2OZVA 2ZULA 3M6UA 3H2BA 4DCGA 3DR5A 2QRVB 4P7KA 4E70A 1I1NA 2UYQA 2IBTA 2XVMA 4F85A 3U81A 2ZWVA 2XVAA 2PT6A 3FTDA 2XYQA 5DX0A 5GINE 1XDSA 1JQEA 1VBFA 5E9WA 2PGXA 3BWYA 4M7RA 3GRRA 5ERGB 3TM4A 3KPJA 2NXEA 3DOUA 3GDHA 3BWCA 3BGVA 3OCJA 4DM3A 3KQVA 2ZZKA 1KIAA 3CJRA 5FWDA 1FBNA 1ZKDA 2PWYA 3AXTA 3P9NA 1N7IA 4XUCA 2GB4A 3C6KA 3MB5A 4FSXA 5FHQA 5M5BA 5EZQA 5HEKA 1XVAA 3LDFA 3SXJA 2XYRA 3TR6A 5GIPE 1G8AA 4P58A 1TW3A 3DH0A 1XXLA 3OE4A 3RODA 4RTJA 4V0QA 3OU2A 5DX8A 3LCUA 2NXNA 5BXYA 1YFLA 1L3CA 2HNKA 3HTXA 4H0NA 3DP7A 4KDCA 4QTTB 3BXOA 2EJTA 2OO3A 2AS0A 2PBFA 2YQZA 4FSDA 4P7JA 4U7TB 2VDUE 5CVDA 3BT7A 2V74B 4E2WA 4NECA 3HA7A 4Z2YA 1YB2A 5GWXA 3KQQA 1ZHFA 3EVDA 3G2QA 3KPWA 2PY6A 5FUBA 1RI3A 5DSTA 5LQJA 2Z6AA 3GRUA 3AJDA 1SUSA 1SKMA 2ZIFA 2ZZMA 1G8SA 4QVKA 3MHTA 3ORHA 5BW4A 3G8BA 1DCTA 1F3LA 3ERCA 2NP7A 4QPNA 3RIEA 2AOVA 5DXAA 4MTLA 4QQNA 2OB2A 3I64A 3KR1A 2H00A 5DTMA 3TOSA 4PYIA 3WSTA 3I9FA 2IP2A 4CWAA 3UJ8A 2C7RA 1IY9A 2ZIGA 3PFGA 1NKVA 2AN5A 5E8RA 2ZBQA 3BKWA 1SUIA 3UA3A 3KR9A 3VC2A 2BH2A 4FP9A 3B89A 3K6RA 4DQ0A 4R6WA 1VPTA 3CCFA 2A14A 3B5IA 3KPVA 5K01A 5LQUA 5EC8A 2BZGA 5DX1A 1R8XA 4QQKA 5CIYA 2B9EA 5FTWA 1VIDA 2FK8A 4JXJA 4GBED 5KS2A 1H1DA 5KVAA 2PWPA 2ERCA 4PNEA 5FCDA 2Y1XA 2AN3A 4V0RA 5K0CA 1P1CA 4RTKA 3BZBA 3HP7A 5FULA 3M6XA 3NMUF 5DM2A 8MHTA 1Q0SA 4C08A 2AZTA 1UWVA 2AVNA 3HCFA 2NXCA 3BKXA 3E7PA 4FT4A 3LCCA 1KP9A 2IFTA 5KQRA 4PYQA 2IH5A 3ER8A 2G70A 5E2BA 5H02A 2IDJA 2ONZA 2OXTA 3SGLA 1RJGA 4CKBA 1RI5A 3HCAA 5JUWA 3HCDA 1IXKA 3UJ6A 4XUEA 5DTRA 4KVZA 4OQEA 2XBMA 4P7FA 1VLMA 3BWBA 4OA5A 4Y30A 3V8VA 3MAGA 4AUKA 4MQ4A 4PGGA 4F86A 3GWZA 4GC9A 3UJBA 5EMJA 2YUIA 1Y8CA 5EHGA 2ZTHA 1YF3A 2VS1A 4RTMA 2QY6A 2ZFUA 4CKEA 1F38A 5EEHA 3NDIA 1AQJA 2BR3A 1RI1A 3LBYA 1BC5A 4IWNA 1P39A 2FCAA 4QTUB 2QRVA 1IM8A 4R05A 3CVOA 5T64A 4EKGA 5IKMA 3A7DA 3M33A 4HC4A 4MIKA 3HVJA 4K6MA 2FK7A 2E5WA 2ZWAA 4M36A 2GPYA 1N7JA 2GH1A 3G7UA 3HVKA 2PSSA 4LWPA 3UJ7A 4E33A 3KPYA 3A26A 2QE6A 5C9ZA 4FT2A 2B78A 3FUVA 1NT2A 3HCEA 1JG3A 4ER0A 4PYOA 4U7PB 1Q0TA 2ONYA 4PGHA 3TKYA 2UYHA 3DMHA 2GAFA 3A27A 5D1NA 4RTQA 3JWJA 4XCXA 2AOTA 3MGGA 2I7CA 3O4FA 3ELWA 5GP1A 5HIIA 4RTLA 5EHIA 4DKJA 4EKIA 2I9KA 3DXZA 4RVFA 2YXEA 4E2YA 2VZ9A 4UOEA 2YR0A 3LGAA 1G55A 1RJFA 1X19A 1ZGJA 3QV2A 2P8JA 1HMYA 5E9QA 2B3TA 3B7PA 3TRKA 5DPMA 2CKDA 2CMHA 4E2XA 3PB3A 2ZBPA 1NW5A 2V7EA 3OZTA 3PLAE 3UJDA 2ZW9A 1WY7A 1X1CA 3KR2A 5ICFA 5K0NA 3MTEA 5E1OA 3THRA 5ICGA 5KYGA 1L1EA 2GA9A 4ER6A 2FYTA 4C03A 2OY0A 2EFJA 5FA8A 5K0LA 3DULA 4PYKA 4FR0A 5F2OA 3R6TA 4M38A 1KYWA 2G72A 2OYRA 1R74A 5EVJA 3G2MA 5DM4A 4YUYA 5LQKA 2O0LA 2PJDA 3EMBA 1JG2A 4RTSA 5CVJA 3P2EA 1BHJA 5EG5A 4KWCA 1EJ0A 2BR4A 2H11A 5K0GA 2UYOA 3M4XA 1NW3A 3GIWA 4A6DA 1VP3A 2P40A 5CVVA 5DTQA 1RJDA 2PT9A 1SQFA 4BY9E 3FUXA 5EKXA 2PX2A 4OX9Y 3FRIA 5CVEA 4AZTA 1NBIA 4EVIA 4C07A 4BP1A 4C4AA 2ZZNA 5LQNA 4GOOD 2UYCA 3FYDA 3SSMA 4GOLD 3BWMA 1MJFA 1RJEA 2H1RA 3A7EA 3GRYA 3I58A 3OE5A 3KPUA 4RSRA 5CM2Z 4EMSA 2C7QA 1Z3CA 1NW6A 3Q7EA 4AX8A 3LDUA 1YUBA 2I6GA 2K4MA 3G88A 3AY0A 3LECA 4MHTA 2AOUB 1WZNA 2XYVA 2JHCA 1NW7A 4RTNA 4GOND 3PX3A 2KW5A 3FUTA 3C3PA 3CJQA 3DLIA 3KQWA 5BW5A 5BP7A 3DMFA 3QOXA 2P1DA 3D2LA 5T67A 4PINA 1AV6A 4AZVA 3EVEA 4HTFA 1XDZA 2JJQA 3PT9A 3TFWA 3OU6A 5HIMA 5K05A 3FYCA 1DL5A 2IPXA 3AXSA 3PVCA 3O7WA 3PFHA 4YMHA 1VE3A 2F8LA 2O06A 4GC5A 4LG1A 3SSNA 3DUWA 3BGDA 3EVBA 3SX0A 4YUXA 3B3JA 3P9IA 3KHKA 3R0QA 1WG8A 5ICCA 3FTEA 3FTFA 5LQAA 3KR0A 4PYLA 1INLA 4FZVA 4RX1A 1RI2A 5K0EA 5FADA 2ZCJA 2ZIEA 1XCLA 1V39A 2P35A 3ME5A 4OBXA 1M6YA 2PXXA 1KPGA 4HGYA 3EGVA 4ZTBA 4GUAA 1NW8A 1KPHA 5E9JA 1JR4A 4B17A 1WXWA 1JSZA 3HCBA 2YXDA 4RWZA 4CTJA 5LR6A 2PXCA 2P3QA 3KQTA 2ESRA 3OFJA 1KR5A 5FWAA 1UIRA 5C0OE 3FPGA 2P7IA 3MQ2A 1O9GA 3UBTA 3R3HA 3GRVA 1EAMA 1PRYA 4DMGA 3HVHA 5P8WA 3OU7A 5CVUA 3NVKI 2UZ4A 3E8SA 3LX6A 3OPNA 4GQBA 4ISCA 2NNWB 3VYWA 3A4TA 3FPJA 3DMGA 2YVLA 3P9CA 3M6WA 2EG5A 3EVFA 2ZSUA 4BP3A 2OPBA 2WA2A 2VDVE 3TMAA 1FPQA 3I5UA 2NXJA 1EIZA 3KQOA 4YUVA 1XJ5A 3A25A 3GGDA 3G2PA 3SR4A 4E31A 1AF7A 4GEKA 3B3GA 2QYOA 2ZLBA 3KQPA 1X1AA 2ORED 3C3YA 3LL7A 4ER7A 5K09A 3S68A 1QAMA 4QVGA 1X1BA 2PV0A 4CTKA 3G8AA 5K8VA 4PWYA 5EIWA 1O54A 1ZQ9A 2ZVJA 2B25A 4HG2A 3HCCA 1QANA 2DULA 2OKCA 4RV9A 5EOVA 5GIOE 3SVZA 4PIPA 3CKKA 3P97A 1O9HA 2I62A 4GOMD 2P41A 5HFJA 3LSTA 2QM3A 3GU3A 3EGIA 1PJZA 4ER5A 1NV8A 5DSXA 1SG9A 2LD4A 1VL5A 4Y2HA 4AZSA 2YX1A 2IGTA 3LBFA 4HSGA 5LSAA 3LPMA 3FPHA 5E2AA 2IBSA 5B1SA 5JR3A 3OZRA 4X60A 3MERA 4RTRA 4ATNA 3VC1A 4CXMA 4RVHA 4EK9A 1D2GA 3GCZA 3NDJA 3MCTA 4F84A 3NWEA 3TM5A 1FP2A 5HOQA 4X1OA 3DTNA 3OZSA 5GM2A 4KIGA 5GM1A 9MHTA 3F4KA 1JTEA 1EQAA 2IIPA 3T7SA 3P9KA 4RYLA 1TPYA 4PONA 5DM0A 4KRGA 1WXXA 3REOA 3DLCA 2AOWA 5K03A 1DUSA 3FPEA 4E32A 3IEIA 4QPPA 3T7RA 1I9GA 4FGZA 3T7TA 2AOXA 4X61A 1AQIA 3IHTA 2C7OA 3R9XB 4PYMA 2FRXA 4IV8A 3ELYA 5E1DA 3PS9A 3FRHA 2Y1WA 4X41A 3E05A 3CGGA 4R6XA 5CCXA 4G56A 3EGEA 1QYRA 5EQJB 3TLJA 4RTOA 2PVCA 3NTVA 3UFBA 5EEGA 4DF3A 1YZ3A 2O05A 1U2ZA 2IH4A 1SQGA 4A6EA 1EJ6A 2PXAA 3G5TA 1HNNA 1JG1A 3NWBA 3LKZA 4HTFB 4MWZA 3EEYA 2PKWA 1BKYA 2FPOA 2OB1A 3EVGA 3FUWA 3GO4A 2AOTB 3O31A 5DM1A 3TPZA 4YUWA 5LQCA 2AN4A 5LQRA 3CBGA 3C6MA 5EPEA 5EKUA 3UWPA 3T0IA 4PIMA 4C06A 4FS8A 2ADMA 4LWOA 3K0BA 3AWIA 3RW9A 2JH8A 1VQ1A 4RTPA 5FA5A 3ID6C 5CUQA 1BOOA 1MHTA 1R00A 1JQ3A 2OBFA 2BM8A 3UJ9A 2CL5A 2WK1A 5E1BA 2IDKA 5F2KA 1N2XA 1T43A 2G71A 1TW2A 3P71T 1R18A 2CWWA 5F2NA 5CD1A 3PTAA 1I4WA 1KXZA 2EX4A 1G60A 2AVDA 2JHPA 2YTZA 2NYUA 1XTPA 3HEMA 4WVLA 5DXJA 5EMLA 4DCMA 4GF5A 3B3FA 1ORHA 1ZG3A 3ELUA 3GXOA 2PX5A 5EIFA 5HILA 5G02A 3EVAA 5GOZA 1M6EX 3V97A 5DRTA 3G89A 2HV9A 2ZBRA 3L8DA 2C7PA 1L9KA 4BLWA 2B2CA 4HH4A 4KDRA 5D1HA 3EPPA 2PX8A 4EQZA 1OR8A 1KPIA 1XCJA 1EG2A 5T6BA 2IH2A 3LHDA 3VSEA 1JTFA 3KQMA 3NVMB 4YV2A 2BR5A 2G8NA 3GJYA 5DWQA 3SM3A 4DZRA 1G38A 3SSOA 5IH3A 1NBHA 3HNRA 5KQSA 1JQDA 1X1DA 3EVZA 3G2OA 2R6ZA 3E23A 5FQNA 4AZWA 5C1IA 2Z6UA 2GS9A 1P1BA 1L3BA 3M70A 3UJCA 2HR1A 3P8ZA 3UZUA 2AOUA 1KYZA 1XDUA 3FZGA 3OFKA 5K0BA 3FPFA 1SVUA 4PCLA 2PLWA 2HTEA 3LKDA 3HVIA 5U4XA 4CKCA 5EGSA 1R6AA 1P91A 3KQYA 4BLVA 1M0EA 4RVDA 2VP3A 3UJAA 4XUDA 5FHRA 4OQDA 4YV0A 3CC8A 3EVCA 4PYNA 1NE2A 4O29A 5MHTA 1NV9A 4PCAA 3ER9A 3QOWA 5FQOA 10MHA 2NP6A 3IYLW 3P2KA 2VDWA 2WA1A 2AR0A 1WS6A 3EEOA 4R8RA 4YUZA 2O07A 4R8SA 5DT2A 5K0FA 2Z6QA 3SMQA 4X63A 1ZGAA 5DLYA 2N47A 4P7GA 3HA3A 3CJTA 3HA5A 4YMGA 3NJRA 4C05A 4OBWA 7MHTA 1G6Q1 1D2CA 4IKPA 1B42A 3P2IA 4LECA 4HGZA 5E1MA 2G1PA 1ORIA 5EMMA 4POOA 3PX2A 5HZMA 5HIKA 4HRAA 4PYJA 5HIJA 2JH9A 3FTCA 2PX4A 3M6VA 2HMYB
chains in the Genus database with same CATH superfamily
3N59A 4ZHQA 2O1EA 1Q17A 3P2JA 2D5AA 4GP6A 2DR2A 1AKRA 1O0CA 1SA0A 2GHTA 3VNUA 5D84A 3HHPA 4OA8A 4PZCA 1GFIA 1OFHA 4B4OA 2V7PA 1QH9A 5A4DA 4CLEA 3H1EA 3IUJA 4RM2A 5CA1B 16PKA 3G9UA 1JLLB 2V6FA 1TGYA 3A4VA 1K27A 1ST2A 4KXXA 3V32A 4BX3A 2A9QA 3OEYA 4Q93A 1JIVA 3L0BA 4HVTA 1XEFA 4LZLA 3FDFA 4WXHA 5LDGA 2PH5A 3MFYA 4GU5A 1H6BA 1L1RA 3NW9A 3H99A 4N3NA 5LBUA 4B7CA 4G4JA 4DIDA 5IG2A 4LJ7A 4NOKA 5E3JA 3SS9X 5AM5A 1DC4A 2XE8A 3K6SB 1ZJZA 2Y4NA 4L8LA 1RBQA 5B7PA 1FDIA 1NQVA 2R751 5L3QA 4MW6A 4KWTA 1QCDA 2F3QA 2GBLA 2R6AA 4I2NA 5AVXA 1K86A 4MRNA 5IDQA 4CL2A 5E95A 1POWA 4MVJD 1I1NA 1SB9A 2Y9MB 4FJ0A 4UU7A 2IBTA 2IQ5A 4C7XA 3UOGA 1K4MA 4JOSA 1SGWA 1XJQA 4IMPA 4AQYB 5JY6A 2NXEA 1HL3A 5B58C 3C70A 4JJ7A 2X1MA 1IEWA 4A0SA 3RT1A 1WD7A 3T4EA 4TS1A 1Y6FA 3M81A 2FWAA 1BWPA 4J4BA 4I81A 3ZY5A 4B9EA 5DHSA 4Z9YA 2R8BA 1TYCA 2KE5A 4HLDA 4WZAE 4ISBA 5EZQA 5JSUA 1JLMA 2WFZA 3MPUA 2OFXA 1K6XA 3N2ZB 4WH0A 3TR6A 2ECQA 2ZB2A 4M89A 3RLIA 1IN4A 1IPEA 3OPYA 4MGEA 1NYRA 2HU2A 2VYVA 1MJGM 2M1ZA 5CVDA 5IDVA 4R5HA 4ZREA 2ATIA 4Y6GB 2OP0A 1FXSA 1U0GA 4D3XA 1VJDA 4K28A 1JG7A 3V4ZA 2JASA 5KMGA 2IZOA 3KPWA 1MB3A 1FNDA 3FSJX 2QR3A 4QOSA 4XYGA 4TV8A 4QOGA 2Z6AA 1E0JA 3GRUA 5FJJA 4MQ6A 3LFHA 4ILKA 1AU9A 1ST3A 1KJYA 4H6XA 2WW8A 4QBGB 2YOHA 2UUAB 3CLUC 4QPJC 1KDYA 1XTJA 4QDTA 3LZDA 1PT7A 1O6BA 1P4HA 2BCEA 5GGXA 2BLLA 3DZ8A 4LJKA 3U49A 5EWLA 1WAMA 2G4VA 5GZ3A 2H59A 4UTOA 1NAHA 2AW3A 2WABA 1CXZA 1NMSA 3RM3A 3QFHA 1K7SN 1JFSA 1WM1A 4Z7QB 1SOMA 4G85A 1M2NA 2QRKA 2Q46A 1CF2O 1IY9A 2TMKA 3NUGA 3NIFB 1O1YA 3I04M 4PXAA 3K6JA 5MN6A 1KAQA 2FOXA 3E5RA 4YAKA 2P1ZA 4Y9RA 3WQRA 2PN1A 4R6WA 4WAUA 2FW1A 2A57A 2NV6A 2KB0A 2VDPB 4BN4A 3VI3B 4EJSA 5JJLA 1CUBA 3D0RA 3PR2B 3HEBA 4H7PA 3WGIA 2FK8A 3H6HA 5CTAA 3GPBA 2I71A 5KNBD 3URKA 3T1HB 1GPMA 1RKBA 3FOAA 2VHTA 2YHIB 4MUNA 4N6NA 4JI6B 3WOVA 4XB2A 1NRIA 1VJRA 4ZT2A 3EUFA 2Q8QA 3INGA 2G0NA 4GMKA 1NUHA 3FG9A 2P4SA 3WJ1A 1GPNA 4TTSA 2BEWB 2DQKA 4DMUB 4LHYA 3WKAA 4PHTA 3ZN2A 3BFPA 2ZU0C 4F9TA 5BUQA 5AKHA 4TYYA 1YZTA 3CRVA 2XCUA 5DGIA 4D9BA 5C7OO 1XTBA 2Q0QA 1J9GA 1LA2A 1KJQA 3UAWA 2CNKA 1IONA 1GV0A 3LXRA 1VLMA 3PWTA 4NFSA 3RAJA 5BO5A 4EQ6B 3LUGA 1S2IA 3AIKA 3MAGA 4HS4A 4RGQA 5AW2A 2BKUA 2IYSA 2R8PA 3JQGB 1P29A 1Y5RA 2X6QA 4WBXC 3T5CA 3QHPA 2ZTHA 1GLNA 5CAEA 4KE6A 3EQZA 4URFA 4DC0A 3RIXA 1V6AA 1GRRA 4LZNA 4JQCA 4DQKA 2E6UX 2XSZA 4BIMA 3VDQA 3CVOA 4JL5A 1HNZB 4Q16A 4GPBA 3M33A 1ORDA 1S4QA 3HJTA 3W8NA 3S99A 9GPBA 5AVWA 4JKIA 1BXRB 1PV2A 4TRMA 1AZWA 1GGEA 2JFZA 2WHPB 5KSYA 3OLCX 1K5GA 3HABA 5BYJA 3WDLA 2FZ4A 2HH9A 3CX7A 1GUYA 3FUVA 5ALMA 1JG3A 4HDNB 4IGKA 3HV2A 5TQJA 1YB1A 1MUUA 1QHGA 4I4TF 4KKVA 2CBGA 2ONYA 4MV3A 4P4SB 2YV2A 5AT1A 3L0OA 4I6EA 2ENUA 2J48A 3UMBA 4E5YA 2QVXX 2H3HA 2C0PA 2Q7DA 4ZZ0A 1AA6A 2LR0A 4XX0B 5ECGC 3ICWA 3HA2A 2DT8A 2QK4A 2J9FB 2P8SA 2VT2A 4WKPA 3HR7A 2NPFA 3SYTA 3WMRA 1DMRA 4FHZA 1CHDA 4EHAA 2RHWA 1T2EA 1PTJC 3WFIA 5CA0A 2Z58A 4FMDF 3BC1A 3UPTA 1IL0A 2AFRA 4F92B 2B3TA 3PQDA 5ISMA 1RKVA 1GM5A 2JJ8A 3A1SA 4MR9A 4H60A 1EVZA 4M8KA 5TPZA 1P3DA 5BQOA 3R9XA 4PPNA 1R5JA 3R74A 4DS3A 2ZW9A 3KR2A 3IPRA 4MYCA 1N5DA 3BXXA 1NNEA 1G9TA 3BSWA 4RPGA 2H4WA 5JZBA 4MGHA 3RT9A 4TLBA 3I72A 2PGNA 3MRSA 1T6ZA 5LMZA 3QVKA 5EZ5A 2OYRA 2HQBA 5IJ9A 1R74A 5EVJA 4TLMB 1WZEA 4W5QA 1BD3A 1AF4A 4KPGA 1HEYA 4MV5A 1XWFA 2BGIA 4XDHA 3SLGA 4BFSA 1IEQA 5B1EA 3T5AA 1RZRD 5FI1B 3UJHA 2PX3A 3UF0A 1T2UA 3GMTA 3QFTA 2ILTA 4HUQB 2X22A 3T95A 4BFXA 1NW4A 2YNMA 3O2JA 1DWOA 1E3EA 2NU6B 5KQSA 3NHYA 1U94A 2V0NA 3CVWA 4C1NA 2F4NA 5T41A 3LC1O 3ZBUA 4BP1A 1MDBA 3BGOS 3JQRA 2D6FA 2H1RA 2OOSA 1KKLA 3PGLA 2DEUA 1DHRA 2JA2A 1RWQA 3KPUA 5HF5A 4INOA 4M9ZA 4WFIA 1NIJA 4D4LA 1Z5PA 1YUBA 3JAWA 3TNFA 3RRNA 4EG0A 2PT7A 3WR5A 1U0BB 3ORSA 4KO2S 4RFSB 2A33A 1K92A 3IIEA 3WDSA 2IW3A 1H3EA 4WZBB 5BYBA 1IZ9A 3I2YX 2IOFK 1NFRA 3KEQA 3LYAA 3RKSA 3MMNA 1Q7CA 2VJYA 4MB6A 5KYWB 4WRRA 5EN4A 2A0KA 2O3QA 5J58A 1X8XA 2IYQA 3RUHA 4GOKA 1YJAA 3PVCA 4XDGA 1IUNA 4E13A 4I14A 4R71A 1R88A 5SY6A 2WYWA 1XQWA 1XVVA 3MTQA 4UULA 2C4UA 5DOVA 2ZATA 1AMNA 1WG8A 4HEHA 3L9XA 4Y2RA 1C1DA 4D1YA 4E4RA 1S3SA 1Q1NA 2CXXA 4MO9A 4H27A 4CM4B 1E1RA 1M0WA 4NPHA 4PYLA 1TFUA 2NZJA 2WJPA 4WMLA 4ZU1X 1NASA 2K2WA 5T8KA 4KB5A 4IZIA 3TQTA 2YV3A 4OSOA 4HGYA 2EZUA 3B5JA 1KPHA 1OY1A 3LGSA 4I4IA 4OQLA 2WVJA 5FOVA 2JVIA 1WXWA 4INJA 1VI5A 4LV6A 2EHJA 1N8TA 4WUTA 3Q7SA 3V80A 3SKXA 1SBNE 3DFKA 4E6PA 1OE0A 1R0SA 2ON6A 1OZAA 2NU7A 4WY8A 3U3ZA 4EHNA 1IOZA 1C30B 4BVJA 4TN5A 2XRMA 3SJUA 4C89A 1ZA2A 3PL5A 2L19A 3T5MA 3K1AB 2DWUA 1PDOA 2RBEA 4IL5A 4CI0B 2REOA 1GYPA 1FQJA 4HYEA 2ZPAA 4O4JA 3S1AB 4WBNF 1MC5A 3F7NA 3NHBA 4JC0A 2ILVA 1KTIA 1LW7A 2FWMX 4NJEA 2OM6A 3H5LA 3M6WA 3PA8A 4MUXA 1Q1ZA 4TWAA 4QU8A 2DFDA 2C3OA 2DKNA 2SNIE 4I1SA 1M2VA 1EIZA 2YYYA 5DNCA 3IPYA 1JEQA 1U3UA 1Z33A 2AC7A 2BFDA 2PS9A 2VAVA 3QX9A 2ZR9A 3PGA1 3KQPA 4ZV7A 3TX6A 4ER7A 1JMYA 5F3RA 4UOZA 4DC9A 5F7OA 3MJCA 4OGFA 1HUQA 2VKQA 1WE2A 4RZXA 3RK4A 2WWXA 1FYXA 4C4OA 3OKAA 4K9SA 3SY8A 1RXEA 3FMIA 1W36C 3EXG2 1QFJA 4HG2A 5J43A 4LHWA 2LUOA 4Q9KA 1LVUA 3UMYA 5I48A 1MN6A 1D5CA 1ZBQA 1QX4A 2H1IA 3MXTA 2ODAA 4YCLA 3ZZNA 3DEJA 1JSCA 3O8QB 3WYCA 4B47A 3ZHTA 1Y5LA 3DXFA 3H3JA 3EZNA 1B8NA 3X1ZA 1CZNA 2YX1A 3OLWA 2Z2XA 1AHNA 4IS3A 4K6GA 4ZO7A 2XX3A 1ZRSA 5BQ5A 1RP7A 1W29A 1KARA 2C1ZA 5B1SA 4DR6B 1BQ4A 4GP9A 3CGWA 5E0OA 3ZIAA 1F2TB 2Z56A 3OJLA 4RFLA 4B2PA 2ZTLA 3NWJA 2XNDA 3FVQA 3BCRA 4ZK2A 4RABA 5BN1A 5D01A 1YL7A 1YZNA 3IAS6 1QTNA 3LQFA 1HX7A 1OFUX 1QHIA 3JQ8A 1XRPA 3R5TA 4M0KA 1EQAA 2EL9A 4ALMA 4IVPA 3PL1A 4B73A 4HDRA 3EIFA 2GAJA 4FOLA 1FS4A 2JGLA 1QK4A 3JCZA 2IC5A 1T9KA 2W6MA 4LC9A 1ZCZA 2JHGA 1L7DA 2EW2A 5LYYA 4LPKA 3T7TA 2IXAA 3W2TA 2AOXA 2ZT6A 2JI9A 3AMVA 4C7JA 3KT8A 5HSGA 4QRDA 2J3HA 3EF0A 4GG1A 1YR1A 3JX9A 4R7ZA 3HSKA 3V6MA 4AF6A 4B48A 1E4VA 1P5JA 2WJIA 1N8NA 2Z3WA 2JVKA 1K6JA 2WF5A 4MDFA 2PS0A 2XMZA 3EVNA 1SB8A 5IKPA 3A6PC 2FQ1A 5FWXA 3T54A 5KOHB 1G4HA 3AUTA 4E5UA 1AO3A 1L5HA 3KQNA 3KWFA 1ULUA 4U8GA 1HZZC 3DBVO 4R83A 1AKEA 4MV9A 2PMKA 3HL4A 2XMGA 3FWZA 3LT0A 3EX7C 3U39A 1TUBB 1PD0A 5CUQA 4YR7A 1U7UA 3OHMA 2HDNB 4PX9A 2VTDA 4KVFA 1AJEA 1CRQA 3QKWA 4R9SA 4QYIA 1TCAA 2LZ0A 2CL5A 1N1GA 3HB9A 3NETA 2WIDA 4CEJA 4KO3S 4JENA 1ULHA 2ZWIA 4DSZA 2FHSA 3PC2A 2O52A 2WTXA 4CLDA 3PTAA 3L2OB 1BXKA 3LPNA 1ZMOA 5DXJA 2JLZA 2NTYC 2C92A 4XWGA 5B3JC 1P2VA 4HVLA 4BQSA 1XEXB 4JK3A 5JPDA 1SVIA 1JA1A 1C8BA 1CUXA 1I4LD 1VGQA 3BTUA 1MO2A 4HQLA 1CF9A 2D0PB 4UD2A 5ALLA 5GONF 4C3VA 1DWQA 5BV0A 1NBMA 2HV9A 4RLHA 4HDMB 4KDRA 4K0KB 1XCMA 1DWUA 2R6DA 3RVLA 4CG0A 2QTGA 2CK3D 3HCRA 1ESEA 1T1GA 3WNQA 2E18A 4KE9A 5FPTA 2B1GA 2QMEA 1QYDA 2NTJA 4G86A 3R77A 4ZT6A 4UTNA 4C21A 3VAYA 3L02A 1X15A 1TO6A 5DWQA 1DAFA 5FOSA 2DGDA 4KGDA 3L92A 2I3ZA 4CKBB 3FSRA 5JFGA 2MU1A 3G2OA 1KY3A 3E23A 4ENSA 1P19A 2B4TO 4R3UC 1V0JA 1UFOA 3BD6A 3Q0TA 4FYWA 4LE1A 5T57A 2EIXA 4QU5A 2G7ZA 3UJCA 3W2EA 1MRNA 5JJKA 1U9CA 1IVYA 1T0PA 3QW4B 3X44A 4A5OA 5KYVA 3HWRA 4RXMA 2LIPA 3GUYA 3EFEA 4GZLA 3UEOA 3QIAA 5EGSA 4BJ1A 1LBQA 2G8LA 2ZQYA 3QKRB 5THQA 4ZTZB 1JF8A 2WJZB 4Q9LA 2OBXA 4QXAA 4RVDA 4L4UA 1P5RA 1E69A 2Q8PA 2JD2A 4PPGA 4FFDA 2G82A 4CM7A 2NYVA 2PMBA 3QOWA 4I1VA 2C5BA 1KDOA 1KVSA 4GKBA 4CR6A 4KLAA 1Q7BA 2I2AA 3HHEA 3K0CC 4MW1A 4RMJA 2WA1A 2AR0A 3U9TA 4DT1B 3HU5A 4BO5A 3NGMA 5KQPA 2X23A 3THXA 1ZUHA 3BMCB 3LUPA 1ZGAA 2GPNA 2ZJ7A 4P7BA 3C3WA 1XEAA 4UQPA 1DOHA 3NBYC 2F1KA 1DTSA 4TMZA 5JSQA 2ZSJA 4G5QA 4IO0A 4MR8A 1UOOA 1VB5A 4CMIA 1A2OA 3RJTA 5CW2A 1Z73A 2BFCB 1Z5OA 3I76A 1FIUA 1T3SA 1OPXA 2CYAA 4PYJA 1RQ7A 2Q2NA 3ETLA 5CT5A 3VU0A 2IP1A 3TQHA 2BSAA 3EDYA 1XJ0A 2OYCA 3ST7A 3BE6A 5HVNA 2Z1DA 3BREA 4TRNA 3PDHA 1RQGA 3MJEA 4Q6WA 5E8JA 3FWNA 1BDIA 1D2AA 1IUOA 4EBBA 3IGFA 1RI4A 3MS4A 3ANYB 3OIUA 1EBBA 4RHEA 1KYTA 3FTQA 1WMFA 2VVTA 3DD5A 3N8GA 4JT4A 4BNVA 1RYDA 3ENNA 4TTPA 5FNVB 5DRYA 3SS8A 1G3IA 3ZIDA 4Y2TA 2WHRA 1SFRA 3JD3A 2OD9A 3N0TA 3C0KA 3Q87B 4OMCA 5IXYA 5CPFA 5AVJA 1V1MB 2GD6A 1K8XB 2HWKA 5EMKA 4CYMA 1XRMA 4DQUA 3D3KA 1X39A 4OOEA 5KUTA 1RWOA 4BEJA 1EX9A 2C1XA 3A14A 1KHHA 2WTNA 4DB4A 3LUBA 1IB0A 1R8YA 5JARA 5CCBA 1R3UA 4H2DA 3T12A 1FVXA 1UMBA 3QEMB 3PQFA 4RM3A 4P7KA 4E70A 4ESVA 4KPEC 4QHTA 3Q1LA 3FTDA 1M3SA 5D3MA 1JQEA 2VJMB 1WHTA 3JQAB 3K92A 3QE2A 1XTRA 4RF2A 1LC0A 4YCSA 2O1WA 4DJ5X 1ZC3A 1YZGA 4CQMB 5A4AA 1CR1A 2DUNA 2F3UA 2QMQA 1MAUA 2A30A 1ZFNA 3VX3A 1CY8A 1FB5A 4PG6A 3CZPA 4UZEA 3JVIA 3QV1A 4AKIA 5ILOA 3ZVLA 2RGAA 1UWCA 4KODA 4ZRMA 5KNBH 2NO9A 3GUZA 3K94A 1J20A 3V1KA 4V0QA 3HM9A 2O50A 3LCUA 4ASUD 3G3EA 3G82C 2H16A 5ALOA 1QQAA 4QM6A 3O3MB 4UNSA 2BDTA 4PSKA 5DZSA 2GCNA 4TL7A 2XNSA 1MU0A 3DD1A 3K0KA 4Y6LA 3KKMA 4MUMA 5IARA 4JDUA 2PGDA 3ZCRA 3EUAA 4AD8A 1SN7A 5BWOA 1CK4A 3E3OA 2A5JA 4LUCA 1ID1A 2IU6A 4JVSB 5UKDA 4D3ZA 4D6YA 5CNIA 1EVEA 3C7CB 2PKEA 3H9UA 1QO0A 4Y3UA 5FA6A 4AMGA 3HYTA 2AYYA 2QX6A 3EAFA 3RAEC 1QRTA 4YAIA 1D04A 5H80A 1FFCA 1QCZA 4LISA 2GEKA 2QLLA 3IB6A 3OJOA 4YIHA 5DW0A 3NOXA 1UZUA 4L78A 2QXTA 4FW9A 4ITUA 4RVNA 4MTLA 4MQEB 4OF4A 4X9XA 3W1WA 4BE7B 2VQDA 2Q5EA 1I3NA 5JZ9A 4KPUB 1L8OA 3FUCA 2HREA 3TOSA 2AD5A 3WSTA 1NJGA 3PUHA 1FS6A 2BGGA 3T7DA 5HJ5A 1KBZA 4PFQA 3MWYW 1FUEA 1SPBS 1T0UA 4FE4A 4U6QA 4YI3A 3T9EA 5BNIA 1MABA 2VUSA 1T1RA 4W6QA 1A9TA 3THXB 4U3JA 4ZU6X 1XFDA 2Y1KA 4GWLA 4B6EA 3K6RA 4ETMA 4Q4AB 4P38A 1WP4A 3G0IA 2FKNA 3V4RA 3U17A 4YRMA 1JDTA 2BZGA 5K0ZA 1MFPA 1IBLB 2V7WA 4M9RA 5TIIA 4RC9A 5H4GA 1ZCFA 4IBOA 3RSZA 4KITB 5KS2A 1B00A 2GN0A 5TMBA 2PXHA 3F74A 3SE0A 5LP1A 1HDGO 1U5CA 1U5BA 1XMSA 3ROXA 1I7QB 2IV2X 1ZIOA 4HDSB 2IBMA 5FPQA 1SXQA 1NQXA 1PZEA 3MQ4A 4LYJA 3TIGA 2HMSA 3LLUA 3RVKA 3MTGA 1NOKA 1N1MA 1W19A 3KELA 5TGTA 1GRCA 2IFTA 2AZMA 4UHFA 2BTOA 4F21A 6CHYA 1WCWA 1GR0A 3B9RA 1LCIA 4V3CA 3TLXA 3UHAA 1EEHA 4CKBA 2F9MA 3SJBA 4U7GA 1A1SA 3I04A 4UARA 4WLOA 3ZWAA 2H06A 3QX3A 2RGDA 3PUIA 4YT5A 3U61B 2I55A 2QTLA 4OK6A 2H5LA 1FFSA 2COUA 2OMKA 4FHGA 4QHSA 1L5YA 3SDSA 5CDUA 5JEDA 3AKZA 4FZRA 1W9HA 1E66A 2QZSA 2G88A 2Q62A 2SECE 3B1VA 2VS1A 4B8WA 2A58A 1F38A 1QG0A 4MLCA 2W6ID 3F90A 2C77A 1AKNA 2O48X 4YRRA 4PWZA 3TTYA 1L7XA 1EFKA 5F1OA 2NSDA 1KZ1A 2C9ZA 1SURA 3QU2A 4TZTA 4URHA 5IKMA 5EJEA 3JASB 3IKJA 3U9SA 1E3DA 3OOWA 1QO9A 3AESB 3HUEA 5IU6A 5TC4A 2QQ0A 1S2NA 4OGKA 1T9CA 2VYFA 2AT1A 4J4HA 3B9BA 5DBIA 4RIIA 1PTKA 2PK3A 3IELA 3K1ZA 4C6SA 4GZMA 4KAFA 2PH3A 2O0MA 2CFSA 3BE4A 4PGHA 4M7OA 4WNAA 4BGEA 2DKOA 4JLPA 4Z0HO 2QYSA 3T99A 1PX0A 3FOCA 4ED9A 4EYSA 2I2DA 3O8NA 4LRTB 3G0HA 3RRZA 3X1XA 3AG5A 2VP2A 3PJGA 2XF2A 5FI5A 4E2YA 2I33A 2XODA 1RJFA 2JAHA 3JTMA 3PDJA 3NBUA 1U3FA 1TJ3A 1Z82A 2HQOA 3CE6A 5A9RA 2VR1A 2OV2A 2ZDHA 3B7PA 3IERA 4EAQA 1KIFA 2EDAA 4HB0A 3WRYA 4N1AA 1IC6A 4Z7NB 4AFNA 3ND7A 1I10A 1VKRA 2GQ0A 5J4LA 1BVHA 4BB6A 1F4PA 4JI0B 4AKEA 4JT2A 3T4XA 3D7LA 5FO0A 2VRNA 3TFOA 1QS0B 3CRNA 2DVMA 3CIOA 1MZVA 1L0BA 3HY6A 1C9DB 3PP8A 3T15A 1RD4A 1I5RA 1MV8A 3RYFB 4WFJA 5KTPA 3STVA 4A1FA 1I6MA 1AURA 1C5KA 4IHJF 1U0SY 4DCUA 2JFOA 1I4DD 2PRSA 2QUKA 1YK0A 4RL6A 4TRJA 4BMOB 4BNXA 4BX8A 5IXSA 2WMYA 4C2BA 1FW6A 1WLYA 2V9PA 4QT4A 3VU8A 1U4OA 3OLVA 2A5DA 4IGIA 3CXUA 5HJ7A 5CVVA 4KQ6A 4LY0A 3Q9NA 3T4UA 3H11B 3NU1A 4LKRA 2J0VA 3MWDA 4BPBA 4CQJA 4AQDA 1XIVA 3A05A 3ZE6A 1KJNA 3RSCA 4LZAA 4DM7A 2I9PA 1WU8A 3H5WA 4MZDA 3X43A 4E22A 4EO4A 4P3KA 5L3RA 2ERYA 3U7GA 1CLEA 3Q7EA 4O1IA 3ONDA 5EZYB 3WADA 3TVYA 4U7WA 4D3YA 1STOA 4LZJA 1C2TA 3URMA 3ZCVA 3R3ZA 4ZXPA 3FBTA 3OFNA 1K1EA 1U4SA 3DKRA 5KHAA 3SYNA 3CF0A 4Q15A 2V4UA 1UKVY 3W05A 1YFKA 3ZLJA 1KI9A 1E9EA 1DC8A 5COAA 1ZMRA 2HU7A 4UNRA 2PZ8A 4TQUS 1Y98A 3OU6A 3W9BA 4FONA 2CXTA 3P19A 4XGQA 3LPDA 2WSSD 3T5BA 1JTVA 1J0BA 1BX1A 1EGVB 1Y6GA 4OXRA 3E0XA 4FFVA 2A9RA 3R0QA 3B6EA 4LSWA 4CKYA 2XJ4A 1C1XA 5KU1A 3T5PA 3SQXA 3HK2A 1E6WA 1INLA 1RLUA 3R3SA 4TM8A 2KLBA 2ZI3A 4AXXA 5L40A 2FU5C 4MS1B 5ALXA 2QTAA 2IV3A 4C9BA 5I7OA 3DLHA 2W6QA 4J9UE 3G6WA 1ABBA 1C7JA 2V7UA 3LWBA 1Y1LA 3IHLA 4ZPXA 4UCFA 3SQLA 3WHLA 2HV8A 4D0LB 2CL6X 1PW5A 4KVAA 3KJGA 3WB9A 3PXCX 1CC1S 2HI0A 5JHHB 4K9MA 2PQMA 1IIBA 2AYXA 3OPQA 4G1BA 4BTVA 1WVIA 4LGYA 1DJPA 4J2TA 4YFYA 2PZFA 1XO1A 3GZNA 4E5MA 3IKTA 1ZD9A 3L6OO 1U90A 3VISA 1R37A 4UPEA 2IL1A 4WXPA 5CAEB 3TB6A 1N5RA 3DE7X 5CVUA 3E8SA 4YCDA 1OLSB 2VHYA 5IZCC 3HFJA 1AV7A 4M8IA 2PDAA 3FPJA 3U5TA 2RGNC 4Z9BA 4KLZA 4LHSA 4UAJA 2H4HA 4NJMA 2X0JA 1XDGA 3V4LA 3OZCA 2RCNA 5I7SA 2HA2A 3G2PA 2PRKA 2TYSB 3Q5EA 2ZYIA 3FLMA 1DXOA 3TPFA 1IRIA 5EIHA 2Q3LA 5JS2A 4TYPA 1KEVA 5JI2E 3QUBA 1GL9B 2UYGA 1Z4MA 1Z0FA 2D4AA 2Y68A 1HQCA 3WMEA 4EYQA 3KZNA 3TQOA 2CZGA 2YZ7A 4RCVA 1UQUA 4EY8A 5TVKA 4O2AA 4US1R 3TS1A 2QM3A 1OVMA 1TZKA 2ACVA 1WCV1 1L7EA 1PSZA 4NHOA 5AVUA 1EWTA 5H8WA 1RADA 2WD9A 2PZKA 1AC5A 1VE5A 1NQTA 2QVYX 2XW6A 3OPVA 3LPMA 2V65A 1CX9B 1WRBA 3T1YB 1PUIA 3ZBTA 3S7TA 5DO9A 3RWMB 4TLAA 2H1FA 2BE9A 3OM1A 1TKRA 1DX4A 5AWFC 1SCJA 2V5AA 2MJLA 4ZOLA 4N6GA 4IZ6A 3SICE 1FYDA 2O3JA 3HPRA 3FJYA 1NP6A 1XHEA 4KIGA 1PHPA 1SCNE 1DWPA 2OHHA 1SCDA 1FTSA 2JJ2A 1M34E 4HAVA 2WJ3A 4RK5A 3B8HA 1TPYA 1QHHA 2AV6A 4PONA 3M4NA 4NWIA 1OWPA 1PSDA 4G0OA 3PNMA 4HNHA 1DUSA 1GUFA 1QWOA 4C7MA 2ZCVA 1Y89A 2HHAA 4LQ4A 2X9VA 4HWRA 3KOOA 3EISA 4CEIA 2X86A 3ZVKA 3BEOA 3H1GA 2CNDA 1O95A 3PQ3A 1W73A 2J09A 2WZQA 3RK1A 4DTCA 4N76A 4GR4A 2JK0A 4TMVA 5CFLA 4J49A 3PYXA 3PHHA 1DQSA 4D9KA 2B9VA 5CFPA 3RADC 5BQXA 1WXDA 1L7BA 2WM9B 2HC9A 3PENA 4UDNA 1N1DA 1EJ6A 1I30A 3I2KA 2GHIA 1GZ6A 1U2GC 4A6EA 1TTTA 1MRSA 1ODTC 1UC8A 2VP9A 2FFHA 2GPTA 2QRPA 3AT1A 3C7TA 3RBAA 5DM1A 3HKDB 4IIGA 3T7KA 4C88A 4CM9D 1PBTA 4YMVA 2C9YA 1E5TA 1M66A 2FWRA 1X86B 1DEKA 3QELA 5H9VA 4IJUA 2HFJA 5ALKA 2WIBA 4Q00A 5ITZB 4N12A 1WF6A 3JQCA 5T4FA 3A1WA 1WULS 1TU3A 4URZR 5KOJB 3U62A 3HFSA 2WQ7A 1J6UA 2DECA 3C1UA 3KOWA 4ND5A 1Y7HA 2OHVA 3V42A 3FDZB 3H0CA 4BVFA 3P4XA 3AVYA 4GWKA 5EJ9A 1KNQA 1W52X 3AI3A 4MS1A 5JCJD 1RM5A 3P71T 4P2BA 5EE0A 1X80B 5F2NA 3JQAA 3LYLA 5DTEA 2Q3MA 3SJZA 1LTHR 4XOIA 3Q0IA 1JLRA 4HLUC 1XTPA 4WVLA 4Y2SA 3O73A 1PNQA 2J9RA 4QRIA 1XJCA 3O91A 3I61A 2EBHX 1GKUB 3AUJB 4OUDA 3T1QA 2QV7A 1GQFA 2Q99A 4YCCA 2C78A 2WUEA 2WEKA 3HZRA 3OJCA 4L5IA 4UTVA 3TINA 1KDRA 2F90A 4D4MA 5EWJA 3FCCA 4A1OA 1IN8A 4ZVLA 3L1IA 1KEEA 1P5ZB 1U8FO 4GMFA 3KP1A 2IYLD 2IPNA 2H0QA 3KS9A 2NYRA 4PRKA 2HMVA 2G8NA 4XDYA 5AKEA 5HKBA 4LGVA 3TO5A 2JA1A 1KVRA 3DGFC 2H4JA 4F4UA 5G1OA 4Y1RB 1DT5A 2FX3A 1XZBA 1FVOA 4EW1A 5LXTA 1EESA 2GS9A 1T4GA 2O7VA 3DFFA 5FBLB 4DDTA 4W5HA 1C8LA 1NNLA 5EZYA 3V8PA 3EAGA 3OZGA 3GPLA 2PGJA 3U7RA 1X9GA 2BHLA 2IYPA 2KWIA 3SDBA 4P4GA 1EX1A 4AIIA 1AZSC 1D1QA 4RDIA 5HW0A 3MWEB 3RE1A 3NPAA 4FMCF 1F2UB 4M2LA 1I2AA 1W4CA 3EVCA 4DIFA 5MHTA 1XBTA 1YONA 1BS9A 4Z3DA 2OAGA 4LVUA 5JNWA 1XRLA 4LDRA 4GM4A 4ZCQA 5I7VA 4HGNA 4RA6A 2OP1A 5E4JA 2F48A 3PEUA 1J97A 4OIFA 4ZCRA 2XUIA 3DZIA 3HI4A 1CDOA 1NC3A 3HYNA 3MD0A 1N2HA 4K3UA 3M4ZA 4TV9A 1MT0A 3RHSA 3GLIE 3AUKA 2J3KA 2OV3A 3KWJA 1NP7A 1LLQA 5G2OA 7MHTA 4JC5A 2M6KA 3HJGA 3IS3A 2J9XB 4AICA 3P2IA 1V41E 1L7AA 1YV9A 5CXQA 1EWQA 2EU8A 2IPMA 1URPA 2QMYA 4CFSA 4KXMA 3VYSB 1B6SA 2HHLA 2OD7A 3G5AA 3LFTA 3L7YA 4HPJB 1PT8A 3BFJA 5U1PA 2NSHA 3A1VA 4LXGA 3DZGA 5CT8A 2A5YB 4G5RA 1PVVA 4C4XA 1LBIA 3TG2A 4KU4A 4TV8B 1OH8A 1JMVA 4QYMA 2Z08A 5ICEA 5KKNB 4RMHA 5HQ3A 5I9NA 2IITA 3R44A 2QU7A 2BEUB 1EXNA 4CQLA 4ALIA 4QJIA 4OBBA 3JWIA 3KLNA 2I4RA 4FD2A 4IQ4A 3RUFA 3DZHA 1E1KA 1E5XA 1R4NA 2PLNA 3F47A 4ZOEA 4XX0A 4JI3B 4UMEA 3MCZA 4ER3A 4BQFA 3TKAA 4KW7A 2GLUA 1HI9A 1SD5A 2PL5A 4NEHB 3OPYB 4RH1A 3J81k 5EZSA 2JG3A 1WW2A 4IRXA 3S5JA 4B87A 4K03A 3EMKA 1KYVA 4QDKA 4XZ3A 1R8JA 1U7WA 2AI3A 4ACAA 2H29A 2P3LA 4S2EA 3WLNA 2ANCA 1CUYA 2P3OA 2Y92A 1C7EA 4MYRA 4PPQA 3R75A 2CZCA 1H8ED 1M7BA 4HKTA 4KMRA 3VHRA 4G2NA 1EUQA 1X70A 5JC1A 1AHHA 1FP1D 5EFZA 1HE5A 1I3CA 1QVWA 4A8HA 2QRVB 3CT4A 5HFNA 3RNLA 3E3AA 4OQZA 3RU7A 3PE4A 2PT6A 1YK1A 3DTTA 3FHLA 6YASA 1LD3A 1Y1SA 3KPJA 5JXIA 4EUNA 2AE1A 3EQ7A 5JVDF 1XD2A 1P9NA 4RVUA 1ZM3A 1FYVA 2BI8A 2DTEA 1YE8A 4OGGA 4QOEA 4Q03A 1YBFA 2XH8A 1H5UA 1J2YA 1RYYA 1ZGZA 2ZJ0A 3I2JA 1G291 1C4KA 1MO4A 1UMDB 3MPOA 5L3QB 2ET6A 5EIBD 2XXAA 4IEFB 4Y6RA 1KRWA 5J5AA 4R81A 1LH0A 5FNVA 3ADPA 2ZSDA 1GGVA 4P4TA 4FNGA 3KD3A 5D2CA 3OQNA 1QFMA 2XNJA 3P9SA 2O8FB 1L3CA 3SC6A 1CF4A 4QBFA 2P9TA 3A6LA 4MUEA 3K2IA 2RI0A 4U7TB 3A6DA 1WB9A 4PO8A 4E2WA 4RY0A 1N2ZA 1I01A 1OF1A 4DYVA 4Q9IA 2NQTA 3EVDA 5E6UB 5ECWA 5KHOC 5KVSA 2VTEA 4QFBA 3TH5A 1IMJA 2XCSB 1NVFA 1N77A 4PLYA 1VPVA 2GHQA 3GLGA 1ZO8A 2BBTA 2VTVA 5BW4A 3LP8A 4MJ3A 4WOPA 1P60A 5DVZA 2G63A 2XUQA 2PO5A 1ICIA 4BVEA 3X2FA 2HBRA 1KMNA 5D5QA 3T9BA 1ECPA 3PIDA 3NHAA 5DI3B 2LXNA 2BGRA 1JECA 2IYNA 5H3LA 3ZY6A 4CG3A 3P9ZA 3DVLA 2AG6A 3KTAB 4DNXA 4CDNA 4PYIA 1NBWB 2FUEA 3AM5A 4KPUA 5JD6A 3FCAA 3R7WB 2FJ0A 3K9BA 4F4JA 1C0EA 5FUVA 4FP9A 5C7IO 5JH7F 3GK3A 2V3WA 4UUBA 1L4NA 5H68A 2DHRA 2ZOSA 2PNFA 4QQKA 4NNOA 4LF4B 1I3LA 3HG7A 4HXYA 1FFXA 1L7PA 2JCBA 4JXJA 5IAGA 4N41A 1V7PC 1FTQA 3ZE1B 2PTHA 1CBUA 2R6R1 2YDYA 2A1TS 1F17A 4EM6A 4IEIA 1EHCA 3TR5A 2CE2X 1DDOA 1LBEA 1R3DA 4GM1A 3DW3X 2GXQA 4MKXA 2FF5A 4BZXA 1ILWA 1KYIA 5BSWA 2PWBA 5DYIA 3OZDA 4QUKA 1T3GA 3BKXA 2EX1A 3FVWA 3JR7A 1GPLA 2J5KA 4HAZA 1KEEB 1XAHA 1YU9A 4X24A 2HRDA 3ASYA 1I2ZA 2FPIB 1JP7A 2O4CA 2OQIA 2PFGA 3AOEC 2ONZA 2QVZX 4WLEA 4G8DA 5BSMA 5KAPA 1BEEA 3SNKA 4BFWA 2QLJA 1T2NA 3D8TA 4K40A 1R6UA 2UVQA 3DLPX 3RCBA 2VP0A 4HDMA 3RDPA 5BNZA 3SHVA 1GSIA 3IT3A 4NS4A 4LBWA 3GWZA 1GNRA 1DLIA 3DHWC 3KTOA 1D09A 3K1AA 3G0CA 4W1QA 3NEYA 3TRJA 4JEIA 3TGPA 2H3EA 2OCBA 2E4WA 5J9FA 4FBGA 3RRYA 1UMBB 2H4FA 2ZRJA 1L5QA 3HJAA 3I1FA 5EUQB 4DTIA 3VR4D 4B0OA 5IABA 3S8YA 1YL6A 1I0IA 5T64A 2AUMA 4I1OA 1X7ZB 3H1AA 5F35A 4BNJA 1XNGA 1OGJA 3QFFA 5FAKA 1PV4A 2B69A 1SHLA 2OXEA 3A4YA 4R98A 1SXPA 1IU9A 3WWYA 2QN9A 4G5YA 1JE0A 3CF2A 3VSBA 3TAUA 1HM5A 1TVCA 2BI7A 3MHPA 4HH0A 1NT2A 2UUPA 5IK2D 2GPWA 2GZ3A 4L16A 4IWXA 2D1TA 3R7NA 4EG7A 1GPKA 1DPGA 3HDJA 2JFQA 1ADFA 3BYZA 3DDUA 3DMTA 4PX5A 3JYNA 3NC0C 3OC0A 4LHZA 4A16A 4CTMA 2YXEA 5TXGA 1OXSC 3CE9A 4RHXA 2HWWA 3GFSA 3V2GA 3RF6A 4MQMA 4YP6A 5JH7A 3N74A 4K1XA 4AB1A 5BN3B 1DJNA 3KYDB 2CDAA 4XCVA 4XFJA 1F14A 1WWKA 1ZNWA 1CPYA 4QAQA 2IZ6A 4B4VA 4AJNA 4KTTE 1NVUQ 1W581 4QQFA 2D00A 1D2MA 1ZJ4A 2GN2A 3M5CA 3SYLA 3EGCA 1FFAA 1VDMA 1OKKD 3ZDZB 4MR8B 1CUEA 1ZLYA 4K9DA 5KSZA 3DULA 1GZUA 4LZZA 1AM4D 3WMWA 2B4RO 1M10A 2DHCA 2G72A 1IEXA 3QVGA 3PDUA 4WNIA 5KNDA 3H5RA 4DRZA 3VHLB 4ARIA 3OKFA 3ZGVA 4ZVMA 2O3UA 1EZZA 1LUAA 1EM8B 3H7IA 3QWFA 3N39C 4KWCA 5IVIA 1EJ0A 3GUCA 3VH1A 4DIEA 3WK6A 5B7GA 1F2TA 1N7GA 5J5CA 2HSJA 3TNJA 4JGGA 5AICA 2DWPA 2V7VA 2PT9A 4X1KB 4TS9A 5DTQA 1IUPA 3S5UA 4B7UA 4BY9E 4E5KA 3CN9A 3DHNA 3L7NA 5CVEA 4BO7A 2OA0A 3QKRA 4DNOA 1GYQA 3AL3A 1JLHA 4LVCA 1M8GA 1Z6GA 1KJ8A 3ZE7A 1LGYA 2HLDA 3DQQA 1CP3A 4I50F 4NOLA 1IOWA 5KTMA 3PHLA 2ZSEA 1F0NA 3AV3A 4PVDA 2NT4A 4PLFA 2W71A 5FV4A 4R8KA 1QLWA 3VHXA 1DEOA 2OZLB 1XPOA 3LECA 3PXBA 5U9CA 2BMAA 1IBKB 5AXAA 5SY4A 1U9ZA 4ZJYA 1UOQA 3PICA 3QVMA 1QE3A 1I32A 2P90A 4MIYA 2B8EA 4H77A 2DYKA 1VJ1A 1LF5A 2CCKA 1V9CA 5EQDA 3ZDQA 3DS8A 1Q7GA 3QOXA 2WD7B 1NHWA 4L9SA 3UUEA 2Z8XA 1CY0A 3D6FA 2QAJA 3T52A 1C3OB 4FGKA 2W6OA 2OGSA 2IPXA 2O5RA 4ND7A 5FOTA 1JEYA 1J22A 3I2FA 1FQOA 2FDRA 1RQ2A 3M9WA 4UBMA 5DBFA 2JHFA 1YDMA 1UWLA 5GTDA 1T34A 3KHKA 1WKCA 1XEXA 2PS1A 1QHFA 1DCFA 5ES3A 1UEIA 1XMJA 4GDFA 1CS4C 1W5TA 1Q83A 1O03A 2VWPA 4HDNA 4OJKA 2Q0HA 4EBFA 1RI2A 3UCEA 4HD8A 4RFVA 4ZIRA 7ADHA 1NVEA 2ZUWA 1VJTA 1ZOSA 5IC5A 3KQKA 1WTAA 4ZTBA 4YP1A 1J8DA 4QPDA 2Q3FA 3JARA 4MXDA 5EFOA 1W0JD 3AHHA 4U6NA 5AJTA 3OKCA 2ZBVA 3WJ2A 3ZUPA 4B8YA 4TKVA 5LD2C 1JSZA 4FDLA 1PR5A 3O94A 1PP4A 1YR3A 1SUWA 4N8DA 2XE4A 4NPAA 4QELA 3NDBB 5D87A 1V7QA 1J1ZA 1NLUA 4CM4A 1H66A 4HEA1 2TMYA 3TRDA 2DZDA 2FSPA 3QVSA 3X1KA 3KSRA 1I6WA 1MNQA 4QEKA 5G02A 5IDWA 2RDMA 2YIJA 2HBQA 1EAMA 2QM8A 3I30X 3NONA 4O1HA 4XD7A 1U2TA 2JZOA 3HBNA 3O8LA 5GJCA 3IVCA 3OU7A 2IK8A 3W5IA 2O4UX 4UZSA 2UZ4A 3QNWA 3QYAA 4U2FA 1E7QA 2I4MA 3ZHQA 2FUG6 1L6RA 3HJCA 2J30A 4ZQFA 4Z51A 4RF4A 3A3KA 4TXNA 3I9MA 2AXQA 5BXYA 2F1OA 4P81A 3LWDA 3IOMA 1COWD 5LZ8A 3ZCQA 1YZVA 4YUVA 1TAHA 4RKWA 5IN5A 3MT8A 3PE6A 3KUKA 4D4JA 1UKBA 3H0EA 4ZEWA 3C3YA 4OB6A 4WA7A 4X20B 4WINA 2CHUA 2G77B 3E84A 4LNHA 4ZV9A 3OQPA 4CM8B 5CCEA 1WBDA 3DO8A 4M55A 2ZJ4A 3NATA 2J4DA 4DVGA 1FX1A 1A8QA 2ATCA 3NH9A 5DLPA 4F5ZA 5F1PA 2SCUA 3LJKA 4GKAA 4KHPB 4L07A 1PD1A 5TJ9A 1CQPA 1M1ZA 4WGFA 4UVHA 3ZW7A 2EP7A 3B3AA 3L05A 4LMBA 1N33B 5KYXB 2LTAA 4ZAXA 4DUYB 3LBFA 1TX4B 2OK7A 4LVNA 1B8VA 4ZALA 3UWOA 5AR1A 3PEWA 2HJGA 3X2SA 4EZEA 4EI9A 4ROSA 3M4YA 1PR2A 3L6DA 2B8WA 4NYJQ 2IGBA 1C50A 3KJEA 3NYIA 3TGWA 1FP2A 1IE3A 2GBCA 3PYLA 3AERB 1GZDA 2PRIA 3NHWA 4KMSA 1XJWA 1W1WA 3F96A 3F4KA 4YP5A 5IANA 3I5AA 5BQ3A 5AQ1A 2C2HA 1MV5A 1W4ZA 3IULA 3M5DA 4HX5A 2D13A 1FRVA 3EIWA 3L46A 1LC3A 1J2RA 4ZD6A 1T2DA 3SQDA 4LRUA 3NHFA 2PL3A 1ACLA 3KG2A 3WK4A 3HMQA 3IRVA 4C7OA 2PMWB 2JAQA 1RVV1 3C8UA 1N3YA 3GT7A 2ZSFA 1K98A 1CT9A 2A9VA 1T5IA 2E4XA 3KLBA 3S2GA 1UZMA 1ZD3A 4TKMA 3C6ZA 5TT1A 3Q11A 4J4TA 4RA9A 1YZKA 2X7XA 5L4LA 2GGSA 4BQPA 4G1FA 2NUBA 2PXAA 4NOMA 4Q82A 1GQQA 3LKZA 4HTFB 1Z2CA 3RT7A 5CLLA 3QBVA 3ZWPA 3AEUB 3LC7O 3PKIA 3AETB 4XOUA 4MOWA 4WK2B 2WPDD 2C54A 3T0IA 3RFFA 4ACBA 2Q6IA 1AMUA 1T8WA 5TQ0A 2ADMA 2B1RA 4KXUA 4ALJA 1BE8A 1XTTA 3OE7D 4MUAA 4JGIA 4P32A 2VHCA 3UXHA 4L6IA 3ID6C 1MHTA 1NN0A 3JVDA 4KBYA 1QDUA 1YIDA 3PA6A 2PWAA 3IH5A 4MYDA 4X91A 4Z4HA 3QVOA 3QVJA 1SR8A 1VYUA 2BTEA 1OWLA 4K87A 1TJPB 1CZRA 2YTZA 4FMDB 2JHPA 3D5EA 3JQPA 2D7JA 1P4SA 5ALTA 4FC7A 3S2UA 3UQYS 4H1HA 3ZS8A 5L95A 3D6VA 3GIDA 4ESOA 2H0AA 2H5EA 2XTAA 3TMKA 2W2XA 2PYDA 4PICA 2R5WA 3TBFA 2ORVA 1N36B 3A4NA 4RSHA 3U3JA 2FZCA 2I6XA 1CNMA 4FEEA 1N2BA 1GNQA 4I2VA 4JLBA 4N54A 1E79D 1GKKA 4PO1A 2Q6KA 3I8XA 3GLFE 4M6WA 3WOHA 1H2YA 3MINA 2B7BA 2IYEA 3ENWA 4FPXA 1N5IA 4IMIB 4DQXA 3PR1A 2CFOA 3CTMA 3GJ0A 3GJSA 2YCBA 4R8MA 1RQPA 3S2IA 5C5DA 3W5BA 2AN1A 1YUNA 4YV2A 2X9GA 5JMOA 3O75A 2RBGA 3EY4A 1M2OB 1B0AA 3B6IA 3D6UA 3HDTA 5HFAA 1SWVA 4CV2A 1I14A 5A4KA 1JQDA 3ZK7A 4CF6A 4IDBA 4RULA 4RPLA 1WETA 1XDUA 2FOIA 2ZI7A 1I7LA 3OFKA 3DEIA 5C8YA 1P2DA 5BT9A 4LWZA 1NR1A 1XNHA 2JGRA 2WKWA 821PA 4PGFA 2UVPB 4MGIR 3SHWA 3VNRA 3R5FA 1THTA 2IHYA 2XCLA 2WQ6A 5LCXA 3UJAA 5IMSA 2CCGA 2HK7A 3CC8A 4IVNA 4KR2A 1ZH8A 2LBPA 2XLCA 3GXBA 2GMWA 4K9KA 4DJAA 1PKEA 3IYLW 3UOWA 2RC6A 4D4KA 3QLTA 4R8RA 3C5EA 1OFUA 1RWNA 4CIVA 5IFLA 2DERA 4YJGA 3EEBA 4X63A 4X62B 1JKFA 4LF6B 5DLYA 1U6IA 2OO5C 2VPYA 4OXIA 3VO9A 2AJBA 2ORYA 3DCNA 1OILA 5CCDA 1EUZA 1VLZA 1NXWA 3IHWA 1DEXA 1SXIA 1A2BA 2HXSA 4MRAA 4EFNA 2AFHB 4HNSA 3TCKA 3YASA 2F17A 1JLKA 4HEQA 5HOEA 5AHKA 5HIJA 4W7SA 3V7WA 4J16C 3UXMA 4OHYA 1GTJ1 3FNFA 5CT6A 3F5DA 4R9RA 1RAIA 1TLTA 2ONJA 4EJFA 4FI3F 2G7MC 1OA0A 1Y33E 4DQDA 2ZAOA 1PN3A 4EYGA 4BNTA 1QMPA 2YVAA 4U2BA 2N46A 4W63A 2WSBA 1CEXA 4XQ9A 2I34A 4Z0NA 2O57A 5D6NA 1B76A 3I01A 2JI7A 2C00A 1W0CA 2HNAA 3AVQA 2DCUA 2I66A 4IUYA 1VP9A 1E99A 1GRVA 1WMDA 1YQXA 5AJWA 1T0JB 2OPHA 3IJPA 3PF9A 5BUSA 4ZRDA 5EZYF 1FJXA 2O8DA 2BBSA 4YJHB 3WDKA 1TKBA 1UOPA 3TTTA 4F2GA 5BWBA 1CR0A 4PQRA 4JR0A 2REQB 4P98A 2FPLA 1Q95A 1R12A 5DW3A 4RLQA 2ZROA 4CF3A 2PKRA 3BSFA 5EJGA 3D3QA 5DX0A 4ZVOA 2IX3A 3A3YA 3IXQA 4WKGA 3RC2A 3GRRA 1ZGBA 3U3KA 1QGED 3IOEA 4LXXA 4LDQA 4R0NA 4DM3A 1JN0A 1N5KA 1U04A 3LDAA 4YC7A 4L85A 3RIYA 2YRWA 3FOEC 2ZI9A 2I4TA 1EUDA 4PQGA 2GB4A 3VDNB 2YKGA 2AZXA 3R0XA 1P2FA 3VNAA 4D92A 3ROGA 4A6PA 3LHSA 1O94D 1M34B 2X8JA 3QEOA 4P0PB 5JCOA 2R6FA 4FB5A 4Z7OB 5LOVF 2NNLD 4OU5A 4P58A 5FI0B 3W04A 1AKVA 4AJEA 3OU2A 3SJ7A 1XU4A 4KV9A 3M6FA 2PGAA 4A27A 4Y1FA 1M33A 4UTPA 2QRGA 3FN4A 5HPYB 3AYXB 3RTCA 5BRJA 2O8EA 5FUBA 1XI2A 2C83A 2FE1A 2P6OA 2O8EB 1LSSA 1TEVA 1EP3B 1QHEA 3D31A 1BYIA 3VZCA 3W6NA 1UC9A 1QTQA 2O8BB 5DT9A 1YB6A 2GVDC 3BEDA 3USZA 4IH1A 4A9AA 1G8SA 3GNSA 3LQRA 2QS9A 1QVRA 1YMQA 4GBMA 4M53A 4MWDA 3P9PA 4QKQA 3O47A 4PLPA 1QQBA 3EC2A 4WV3A 4Q19A 1ZY2A 2XKBA 4IX1A 1BJKA 3DNMA 4EHLA 2XGMA 2C4HA 3L49A 3AZPA 4ZV4A 2HK9A 1NXTA 3COPA 3OA2A 2CXQA 3EG5A 4TSFA 2YRXA 4GFDA 4LHXA 3PQ6A 1EK1A 4OQMA 4MI1A 3V1NA 1LSUA 2IF2A 5E3HA 1NMZA 5FKJA 1KOJA 1PZMA 5CA0F 2C7RA 1B1CA 1LY1A 3DM5A 3A8TA 3REFA 4YK7A 1E0SA 4QQ8A 1TF2A 2LCQA 4L76A 5I8ZA 1KMHB 3QWIA 3LF2A 3LZ6A 2HO4A 4IXTA 4J94A 4YACA 1NDQA 1W5AA 3OFVA 1AS0A 3LCRA 4CU5A 5IAAA 2FLWA 2XBLA 4IP0A 4QUHA 5FTWA 2J32A 2Z2JA 2JLBA 3OSUA 2WBLC 1X6VA 4CDMA 4JAVC 3FYUC 3QXHA 2NUPB 4MQFB 1Z28A 2C2YA 2AQIA 5KVAA 1CE8A 1LF0A 5JAPA 4RW0A 4YJ3F 3TE7A 4PGMA 4YJHA 3D8SA 3NC1C 3Q7PA 3W7AA 2O8DB 3H17A 3AK4A 1ZIYA 1Q0LA 4HGQA 3CTPA 2FW8A 3BULA 3G2JA 1JFTA 4O33A 5EUCA 3AIMA 3N6RA 2FN9A 1AK9A 4TKZA 3QKUA 5DM60 3JZMA 3CLTD 4YRBA 5DWDA 4EVSA 2I78A 3G79A 1SVKA 1PSWA 3HDYA 4I3FA 4V0LA 4G5GA 5E2BA 1NVVR 3SXUA 1CRPA 3JYOA 4B71A 2K5UA 5DTRA 1OAAA 4FXPA 4G5OA 1GVHA 5BORA 3UWDA 1OQAA 3KZOA 4PGGA 1KA9H 4MIOA 4N0DA 4JP8A 2ZIVB 2QVCA 4FBMA 2Q4DA 2W90A 4YJ3B 1Q2UA 1EH5A 3OQIB 4U6SA 5CP8A 3PU6A 4Q6BA 1BA3A 4Z4EA 4RTMA 1Q7EA 3DVAA 3B1ZA 3I6IA 4IWNA 3PDIB 2GI4A 2FCAA 1JAXA 1BDMA 3IT2A 4I4CA 1P9WA 4L50A 1FP4A 2X1LA 4RVSA 3A7DA 2ZSIA 2WHXA 3OIVA 4WQMA 1ZXBA 1G63A 1EM8A 2DHQA 4NDAA 3ZIUA 1KP2A 3F8TA 2GNOA 2KSQA 2VYND 4LBZA 2JD0A 2EZ8A 2OWDA 4E4YA 4ER0A 2UV8A 3W6UA 4AROA 4BNNA 1B43A 1P9LA 1IN5A 1OWNA 1UBFA 2QZ9A 3G5UA 1SY7A 1UUFA 4OMFG 1IPFA 4G07A 4WOKA 3BRCA 3EG9A 4CR8A 1NMYA 3LOPA 4LNUB 5CLFA 3D64A 3HJFA 3LGAA 1G55A 2OAEA 2QL6A 5DHTA 1N78A 3CCCA 3K71B 4AKSA 5KJEA 1SD2A 3HRIA 5CRIA 2A88A 3BQMB 1GG2A 3IQEA 2FUKA 2CDNA 1DFGA 4EKNB 3RB8A 2BIFA 4ID9A 1A71A 4XPIA 4XQEA 1SNYA 3UJDA 1WY7A 4HNVA 3ERCA 4KK3A 1P4JA 3ICCA 1P2TA 1PAUA 1L1EA 3G7NA 4LSMA 2C42A 4HV4A 4D26A 3JQ8B 1VE1A 1S8FA 3ZE2B 1Z6PA 2XUZA 3ESYA 3KJNA 4IRMA 2HA5A 4L74A 3TQIA 3LHKA 1QQ7A 2RMKA 1N9KA 4AZ3B 1G21E 3C3CA 2BF7A 4DL9A 5LQKA 2EJVA 3GFRA 1JHXA 1V1RB 2I1LA 4BE4A 1BHJA 3SEZA 1IXYA 1B93A 1FA9A 2PUWA 5KEIA 3L0CA 1A5TA 4YMIA 4E03A 1LDEA 1G2IA 1X1EA 1YCGA 5DNEA 4EELA 1M5UA 1JFVA 3O4GA 4G84A 3DMNA 3LRXA 4Y6QA 4EB3A 2P40A 2IDMA 4J75A 4P5EA 2XD4A 1A9QA 5F73A 4BJ6A 2H31A 2PX2A 4U7FA 2YV1A 3V4VB 3RTBA 3G8CA 2ZZNA 2JAXA 3VDXA 3AUXA 5L3SB 3D0OA 4CIYA 4W6ZA 2WF7A 3O3CA 3OZXA 1D0IA 1DMSA 4ZOCA 4BZPA 1QUFA 3KUCA 2AKEA 2W9XA 3PIRA 1PLLA 3TTWA 5I5GA 1XN4A 2G06A 3TI9A 2P6UA 3AY0A 2OG1A 2PV7A 3EDQA 4MHTA 1WZNA 4TYWA 3AGPA 2D1QA 2GKSA 4BPRA 2WUWE 1V5WA 3FW1A 4ENRA 2XWSA 1LDMA 3SOZA 1Q1QA 1TC1A 1FLVA 2PKQP 3ABZA 1JZSA 2J08A 5J4YA 1PJ2A 2X4DA 3D2LA 5T67A 1XVIA 4AIRA 4AZVA 4HTFA 1G5FA 1PUJA 2GK3A 3VR5A 2HO5A 4GPZA 2FN8A 3H2GA 3U3OA 2C61A 4FXOA 1RLJA 3WBKA 5IWCA 2C2WA 4H7HA 2AWNA 1N2CA 3GEHA 1ISSA 4H7IA 3A9TA 2WYUA 2XKJE 2X0EA 5L3SA 1UBTS 1XRSB 2Y1GA 4RPCA 4Q7LA 2LDXA 1H2EA 2X1VA 3FWYA 3PBKA 2QNRA 3FSGA 2ZR7A 1YBAA 2PT5A 2ZWPA 4C6RA 5JO9A 2Y67A 5CYOA 5EXSA 2GFHA 3JW8A 3HADA 4CV1A 5K0EA 2HAEA 1Y9ZA 4IINA 2IHJA 1M6YA 3N7AA 3Q6NA 3MK31 3QTLA 3BX1A 4HDKB 3WBBA 4D0NA 4F3CA 4F6RB 1SRRA 5JDCA 1NW8A 1GYRA 2CNLA 3USES 3A6HA 5E9JA 2NO5A 3K4QA 1L7RA 1MW9X 1W44A 4YA6A 4DYHA 1IBSA 4OJQA 2QXUA 1QYCA 4LXQA 2P3QA 1UT5A 2FXIA 2R44A 2CMFA 1AIPA 3MTJA 1HDIA 1LNQA 5TLSA 2WICA 2WAAA 3ZU4A 4D9CA 3P20A 2PYZA 4HHEA 2KPOA 3WLEA 5C51B 1RP1A 1B23P 3L7JA 3WXMA 2P68A 3BXFA 1H6CA 3D43A 1F6BA 2QB5A 2XUJA 1D1PA 4J03A 3H2HA 1C4WA 2XADA 3A1EA 3CLRC 2AMFA 3QUTA 3R0IA 3LX6A 4KCGA 2B7LA 4I5FA 2WT8A 4KK4A 4MQLA 3VO8A 4TMTA 5H16A 3DE4X 1RZUA 1R0XA 1ABEA 1NUSA 2OO7A 1F2UA 1TA4A 2YFKA 3A31A 1VL0A 3KVNA 1TTHA 5K3SA 4BP3A 5L51A 4N01A 5LIPA 1A9RA 3NVDA 5LP6F 1YTLA 1XYVA 3LOUA 3GRCA 3FVRA 2PSEA 3PQ8A 1UXOA 3OVMA 1X1AA 5AXCA 5BW6B 1EFPA 1YRAA 3C16C 3KTFA 3B9PA 3HS3A 2WYVA 2VHEA 2AF4C 3KXDA 4X20A 3WMXA 4BO0A 4C7VA 5BSEA 3GLTA 1QZXA 2GD2A 5T6MA 1Y3AA 4JGBA 5EQTA 3CKKA 5HX7A 5K8UA 5BXQC 2I62A 1T9GR 1W88B 2XGOA 3FYUB 3MZ0A 4NSNA 1TK2A 4F9FA 5HKAA 3WYDA 4JB0A 4Z6KA 3EGIA 4QUAA 5ICMA 2BZ1A 4B83A 1WL8A 1IXSB 5AKYA 5CLJA 3ESZA 2OL4A 5JG7A 3PTLA 4OG2A 2FEOA 2J6CA 5AH0A 3D8BA 5KKCA 4JIMA 1UM9A 1Z18A 3RV3A 4YWJA 3TN7A 1V96A 3NDJA 4Z0TA 2G3YA 3OQIA 4RU1A 4O2BA 5K8CA 1JGTA 4D7AA 2IYZA 2B36A 1Z0UA 4WI1A 2IZ7A 4HGPA 3FVTA 4HMOA 5A0TA 2Q5JA 1YDHA 4ENPA 2VATA 4AECA 4JBIA 4RYLA 4D74A 5FWNA 5G1PA 1KYYA 5K0TA 3EZFA 3OO0A 1SUFA 3R4VA 2ZJ5A 1NATA 3SNHA 1GA4A 4QPPA 4B6QA 4KJZA 3M5PA 4DFDA 1U2DC 5JQGF 1CFZA 2GN8A 3CXRA 1G20E 3KYIB 5K4GA 1IZZA 2IEIA 1DJQA 3N2IA 4BWYA 4CMEA 3HB5X 4J7UA 3QPCA 2FRXA 2JIDA 2PU7A 1LVHA 2CJWA 2HA0A 4CIWA 1BHQ1 2YJZA 4A2CA 1R6TA 4XB6B 3BIXA 3EGEA 4MP3A 4DHEA 5AFSA 1DE0A 1WTCA 3PLRA 4P80A 3RSGA 2XKKA 3K70C 2BH9A 2OHXA 2Y9PB 3CUTA 1OW3B 5B12A 1KBOA 3U4HA 3FUWA 2IHZA 3I0ZA 4YUWA 4MWEA 2E9SA 3H5TA 2PUDA 1XZLA 4QASA 1HSOA 2P9QA 1C0IA 5IZCA 5LWQA 1GDDA 2VHVA 1JR3E 4QICA 3VVMA 1DKQA 3WFJA 3WRWA 4R1LA 2XBUA 1RXCA 3H1BA 2AQHA 4MUYA 1AKTA 1R00A 1PYGA 1T3LA 3IP9A 4GZ5A 1KU6A 4LX8A 2OBFA 5AJXA 2BM8A 3H3XA 4BV9A 4F8YA 1RM4A 2R8ZA 1MPTA 1QOQB 4WACA 5ERYA 2XTNA 3CLVA 3HP4A 2Y0DA 3R0VA 4EZIA 1CP2A 4V0SA 3O6VA 2BEJA 4WCFC 2RHLA 4CE6A 3UT5A 5BSVA 3V2HA 1AQLA 4Q1CA 5EMLA 3B3FA 3P2OA 4YDSA 1BDBA 3ELUA 3FDJA 4R1OA 5DNYB 1AQNA 2IOYA 3W8FA 1DOZA 1ICEA 4LF7B 5CR9A 1MAAA 5EMHA 2EX0A 1II9A 1NN3A 1UBLS 2VPQA 3M8KA 3QEJA 2OXIA 1ONSA 2O3RA 3IQZA 4JU8A 5DMHA 4LYFA 1SQ0A 3FKSA 4I4TA 1PU2A 4DPMA 2QQGA 3UMFA 4S2UA 3ABOB 4XXHA 3GH1A 4BVHA 4FTWA 1N0IA 2V6JA 4PC3A 3SM3A 3SSOA 3VU9B 5IH3A 4EA7A 4C43A 3A2NA 2GA8A 1YBHA 1IBMB 1KY2A 4Q1FA 2OCIA 4J0GA 2MR6A 4DUGA 1DJLA 3KAPA 2QM7A 3STWA 2J0EA 2LWIA 5C1IA 3C3MA 1JQKA 2WLTA 2XB8A 4HJRA 2JLXA 1AUOA 1E4OA 2YW2A 3AY3A 2QIPA 1Q15A 2V6BA 3O8BA 1S0UA 1UOEA 1A88A 2PL9A 1NP3A 1MAVA 5LJLA 3NI2A 2PZAA 3UO8B 4DV3B 2DH5A 3INTA 1VA4A 3H0KA 4C14A 3FVVA 5FR2A 4JP1A 2AG0A 3DL2A 1AMOA 1K08A 3O90A 1CB0A 4JLWA 3HCPA 4CMAA 3WGNA 4FR5A 5JSHA 2G9QA 1C9YA 3PGKA 5FBHA 3G9QA 3RPEA 3HLTA 4E46A 2RJ3A 3P2KA 1PFYA 3I2GA 4FCCA 4XWAA 4JS0A 1GR1A 1UIMA 2ZDQA 1CUGA 4R2LA 4R8SA 4QM7A 2IYVA 2R6GA 3NASA 4L27A 1JEOA 3Q72A 3UKOA 5CGQB 5AJUA 4CFYA 5K3EA 3ANNA 2K2QB 221PA 1G42A 4YWHA 3QY9A 4YY3B 4YO8A 5KU7A 5A1JA 4MV6A 1BZYA 5SZKB 1EWYA 2CXSA 1M75A 5HZMA 1QFXA 3QF7A 4WASA 2L42A 1ABFA 1JMKC 4HRAA 2JH9A 3VPFA 1GNLA 4GYJA 1JAYA 3P0FA 4ZICA 1E7SA 3FTCA 4YDRA 3EA5A 2XYGA 5HKKD 4AZ0B 1TZJA 2JFGA 2HPAA 4TN1A 4A4DA 1C1XB 2Z9BA 4MYSA 4I5EA 3A37A 4TWZA 3C4VA 1ONNA 4UNNA 4LFCB 4IIXA 4I3HA 1Y34E 1UCFA 2Q5IA 5C1OA 3L6CA 4FWBA 3ZD9A 1LDBA 4OP1A 4ZGGA 3SF8B 3IBFA 3GBVA 8ABPA 4WOJA 1HA3A 5A7FA 2GCOB 3JWGA 4MP6A 3Q8LA 3K0CA 1PBNA 2FPIA 2OBBA 2X77A 4BZQA 3HUFA 2VZLA 1JG6A 5FTKA 2OAP1 3UA4A 3ZNOA 4C7OB 1RHJA 4HOYA 3RHFA 3HKBA 4W5OA 3RHZA 1FOEB 2JIOA 1RYZA 3HKEA 2QE7D 4FSHA 4GPD1 4PNZA 2JJ1D 5DK4A 3UHOA 3E9MA 3L1UA 3LC2O 3QQ5A 4ZHSA 1RBZA 4DJEC 2Y1OA 3C6YA 3HXPA 1UFKA 1Z2AA 1DQPA 4GW3A 1JR3D 4ZDWA 5LMCA 1KI6B 2PBZA 2FF7A 1QAQA 3HYSA 4M22A 3W5VA 1U02A 4MI9A 2LRHA 3H2BA 3QP9A 1A5SB 3L7BA 1V7CA 2F00A 5IBPA 1ENZA 1MORA 3IAS1 3LY7A 3UBMA 2XA9A 3EYAA 2RHBA 3QX7A 4C01A 3GEEA 2FN3A 1BWSA 3NX4A 3BWYA 3WNCA 4EJ2A 5G1NA 5JMWA 1D4AA 3S1SA 4NYIQ 1KS9A 4EZBA 2CV1A 3ESQA 1REQA 3CNEA 3CEJA 4D3SA 3G9ZA 1GU0A 4JI4B 2TMGA 3MB5A 3F7OA 1H05A 1Y4AE 4Z9FA 1EZ1A 1HYHA 1Y1PA 3W5SA 2BSXA 4LPSA 5DSZA 5H0IA 4X3CA 5L7WA 4TS4A 1KSFX 2ZRAA 5GIPE 1ARZA 2VAPA 4ETNA 1CY4A 1IJBA 2R65A 1EXWA 1E20A 1TMYA 1Z8DA 2RGXA 3AJAA 3BIOA 3EHEA 3OE4A 3MELA 2NXNA 4JBXA 2OZEA 2E1RA 4ODIA 3IUYA 1PJRA 3DP7A 3HCOA 3ECCA 4CV3A 2G1AA 2PBFA 2YXNA 3G02A 2JLUA 4DA9A 3K0FB 5I9BA 1MX5A 3ETJA 4MRRA 4GXNA 3LYUA 1DJOA 2W83A 3OI7A 4NECA 4WLUA 3G2QA 3WNBA 4EPTA 4YJ2F 4YRZA 5J47A 1QTIA 1ZPDA 2ZIUB 4RZUA 1U8UA 1U9JA 4NCXA 2ZBFA 2F3SA 1SKMA 4UCQA 2YMQA 4RQTA 3EXFA 2GM4A 2DLCX 3O4RA 5I3CA 3DBOB 4G1MB 1XL0A 4EPRA 1E32A 3OTGA 4O5OA 2Z4SA 1GSOA 3RG2A 3VI4B 1V11A 1VJ0A 3TR0A 1F1JA 1YQTA 2VT7A 2VEOA 1HDYA 1FDWA 2PG3A 2PL1A 4OQYA 3UAVA 2QPTA 3OF3A 5TVGA 3NBXX 2P3SA 3AVVA 3BXEA 2QR5A 2QZJA 5I4KA 1OIXA 1Q74A 2QLTA 2IXTA 1MO5A 2QNBA 2XKAA 2QT0A 3B38A 5ABPA 5IVKA 1KI2A 4FYKA 4O8CA 2XE7A 1N9GA 2CVFA 4TLCA 2QUIA 1UBSB 1HFEL 4GHWA 4NI5A 3U0VA 2Z2ZA 3D4PA 4CMBA 1K7YA 2H08A 3AP3A 1HH4A 3KPVA 5CEJA 5EMNA 4WJKB 1A9SA 4IDDA 2HSGA 2WV9A 4WCFB 1J9ZA 1KI4A 2NTEA 4N5LA 4R01A 3AHDA 3RU9A 2O3TA 2HEGA 4BO3A 3OMXA 3KSBC 1VG1A 5LC1A 2R1UA 3T9DA 1WB6A 5BSRA 1JEYB 5B55A 3ZI7A 2NADA 4RH0A 4MAFA 1RPTA 1B2RA 3VOTA 3BZBA 4GH5A 2TS1A 2TRSB 4HQKA 4P2GA 3VKFA 1Z7BA 5KSWB 1RHMA 4M0PA 2GEDA 5AK0A 3KYBA 1E9BA 1PT6A 5TT0A 2WTUA 5E4YA 1OXMA 5KQRA 2X4GA 3IMCA 1YXMA 3FPSA 1O57A 3BHJA 3GDOA 4DAEA 2BMEA 1YRHA 1BGWA 4ZQGA 2PUAA 2GCIA 2Q5HA 1IXKA 3FYTA 3MT7A 4XUEA 2G67A 2TMDA 4S12A 4Y6SA 1H9CA 4P54A 1GADO 5LPNA 1NJ8A 4AVYA 1PGQA 1SZCA 3GDGA 4AUKA 1ZUNB 4RHUA 4UCXA 1BDHA 2WMDA 2RHCA 3LSYA 4RD6A 5BN5B 3HB1A 2O7NA 3GVHA 3KO8A 4XIYA 5C8YF 2GRUA 5EHGA 3LC0A 2PD3A 1Z06A 1IDOA 3VJLA 4C3UA 1RPZA 1KJZA 4EY6A 4I9HA 2Q7XA 4RJTA 4BE9A 1IPHA 1C7ZA 3P9YA 1GP2A 2H07A 2PLRA 3MWDB 2ZVDA 3JRWA 3QKIA 4ZT7A 1L2TA 2Q28A 1IM8A 1UZAA 1WSAA 3G2NA 5CM8B 3QNUA 3TRIA 4A10A 4JXXA 4MIKA 1CY6A 3DO6A 4KIWA 4IIJF 4DLKA 2E55A 1XCBA 1BH2A 2QYTA 4TT3A 2GH1A 3H4IA 2ABWA 1MENA 5FBVB 1DCKA 4UM8B 4A8JB 1T4MA 3M0EA 1A8PA 1LB1B 1O8BA 2H7CA 1Y9AA 4AMUA 4Z4IA 2B78A 2V5UA 3MOSA 1UM8A 3H2SA 2XV1A 3VYTB 3DFUA 4OIMA 4PNPA 1NX6A 4EI2A 4OHOA 3TKYA 4EB0A 1DC7A 1AO0A 3E7FA 1TT5A 3ZWWA 2F67A 1KEUA 3ELWA 4YRIA 3IAUA 3BMQA 4KXWA 1HGXA 2KI5A