1AV6A

Vaccinia methyltransferase vp39 complexed with m7g capped rna hexamer and s-adenosylhomocysteine
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
295
structure length
289
Chain Sequence
VVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for sequence-nonspecific recognition of 5'-capped mRNA by a cap-modifying enzyme.
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transferase/rna
molecule keywords RNA (5'-R(*GP*AP*AP*AP*AP*A)-3')
total genus 96
structure length 289
sequence length 295
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 1997-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1av6A00
4X60A 5FULA 2ERCA 2G70A 4KW7A 1OR8A 5E8JA 2ZFUA 2XYQA 4WVLA 1XXLA 5EHGA 3G8BA 4GUAA 5LSAA 1M0EA 4P7JA 1AV6A 3OE4A 3O4FA 2I62A 3UJ7A 4DQ0A 3IEIA 1BKYA 3DUWA 2FK7A 5EKUA 3SSNA 3TKAA 5LQKA 1JG2A 3K0BA 4ZTBA 2UYCA 3FPJA 2PWYA 1KYWA 4R6XA 4YV2A 3LDUA 3KQTA 2ADMA 2PKWA 5DM0A 2ZLBA 3HM2A 4X1OA 5EQJB 5K0NA 3KQSA 2ZZNA 5FA8A 1F3LA 5D1NA 3TR6A 2DPMA 1NW7A 3UJ9A 2IGTA 2OKCA 3L8DA 2PY6A 1VQ1A 3LSTA 2HMYB 3I53A 3M6VA 2JHAA 3UZUA 5LQRA 4POOA 3FRHA 3HCDA 3ORHA 2ZSUA 3LDFA 3SR4A 4CTJA 2YXLA 1NT2A 1SUSA 2OZVA 3EGEA 3GRRA 4PYOA 3OZRA 4KIFA 1IXKA 2FYTA 4GOND 4MWZA 5DTMA 1I1NA 5DM4A 2WA2A 5HIKA 3BWYA 5DT2A 4BP1A 3M6XA 1JG1A 5K03A 2YVLA 3U81A 2PLWA 2O05A 5D1HA 3K6RA 2PXAA 1EG2A 1EIZA 4RV9A 2GLUA 2JHCA 1MHTA 5KVAA 2ZWVA 4KIGA 3PFHA 3KQPA 3CKKA 2QRVB 2ZWAA 4LECA 3B3FA 4O29A 3OZTA 4QDKA 2GPYA 4X41A 4X61A 5CVJA 8MHTA 3BWCA 2E5WA 1HMYA 5HIJA 4OQDA 5EHIA 1X1BA 1X19A 3MERA 5K01A 2OB1A 3GGDA 3IV6A 3TPZA 3TM5A 3BWBA 1IY9A 2PXXA 3DLCA 2PX5A 3GJYA 1RJDA 4AZTA 4E70A 1JG4A 3NTVA 3PLAE 2NP6A 3AY0A 5CVUA 1NBIA 2A14A 2O06A 4E2WA 4EMSA 7MHTA 4PONA 3FUUA 4BY9E 2CMGA 2QE6A 2IFTA 1R8YA 3HCFA 1ORIA 2ZULA 3B3GA 5T67A 2PT6A 2IH4A 1KP9A 3G2OA 3NMUF 1YZ3A 3KQMA 3P9IA 3M33A 3UJCA 2G71A 1PRYA 5CIYA 5EIWA 1VE3A 2PSSA 2B3TA 2OXTA 4F85A 1P91A 3A27A 1EAMA 3FTDA 4AZVA 1JQDA 3BGVA 5DX0A 1FBNA 2Y1XA 2HR1A 1NBHA 2PGXA 5BW4A 5ICGA 3M6WA 4P7KA 1M6YA 3IHTA 2BZGA 3SGLA 1N7IA 3E05A 5EIFA 2IDJA 3UJBA 4YV1A 1FPQA 2YR0A 3LDGA 5M5BA 1P39A 3KPYA 2ZIGA 1ZGAA 4FSXA 4KDCA 3DLIA 3P2KA 3AXSA 3DP7A 3Q87B 3UJ8A 5FTWA 2PT9A 4H0NA 3ELWA 4PYKA 1KPIA 1WZNA 3DOUA 4FP9A 2JJQA 2V7EA 3HA5A 1RJEA 5HIIA 2OBFA 4GF5A 1YF3A 3A7EA 1D2GA 5EMLA 1X1AA 4DM3A 4YUZA 2ORED 2WA1A 4C07A 5KYGA 3KQYA 4BLUA 4FGZA 4C04A 4GC9A 3GRZA 4L7VA 3B5IA 4DMGA 2QY6A 1V39A 2JH8A 1YUBA 4QTUB 3UA4A 1X1DA 5LQUA 1ZG3A 2UYQA 4GEKA 2OY0A 4GQBA 2Q41A 5K0LA 3G7UA 1RI1A 1QAMA 4NECA 2Y1WA 3A25A 1Z3CA 4Z2YA 3T7RA 4BLVA 3DTNA 3MCZA 3DULA 1AF7A 4QTTB 2AN3A 3T7SA 1KPHA 3CBGA 3HCEA 5BW5A 2C7OA 3UFBA 3BWMA 1JQEA 1QYRA 2AOVA 3NVMB 3OU2A 4KVZA 5EEHA 2IH2A 9MHTA 4P7GA 3EMDA 3E23A 5GINE 2IDKA 5DWQA 2NXEA 1BHJA 2BR5A 3EVCA 1TW2A 5EPEA 2AR0A 4BLWA 3BGDA 3CJTA 4OQEA 5E1DA 3OCJA 2XYRA 2PBFA 3C6KA 5E1BA 5C9ZA 3KQVA 3LBYA 2AS0A 3FYCA 2VP3A 3AJDA 3P9KA 3HCCA 4YUWA 1RI5A 2I6GA 2O57A 2VDWA 1F38A 3RODA 2PVCA 5DPMA 2FHPA 3UJ6A 1G8SA 5K8VA 2CKDA 3B89A 2CMHA 3S68A 1NKVA 2ZIEA 3BUSA 5G02A 4DCGA 5E2AA 3T7TA 3JWHA 4FS8A 4A6EA 3NJRA 1RI3A 5DM1A 3SX0A 3KQOA 3ERCA 1ZQ9A 5DTQA 2UYOA 1R6AA 4UOEA 1L9KA 3EEYA 5FHRA 4JXJA 2AOWA 1I9GA 1P1CA 4PYMA 3UBTA 2C7QA 3REOA 4M36A 1WS6A 4PCAA 1BC5A 4PIMA 2F8LA 2ZBPA 2IPXA 2ZTHA 3JWJA 3V8VA 4MQ4A 3EVEA 5CVDA 3KQQA 3MQ2A 4RTMA 5MHTA 2VDVE 3SSOA 4C4AA 4M37A 2YXDA 3P2EA 1TPYA 2ZZKA 4GOMD 5DXJA 1G38A 3GRUA 2XYVA 4XUEA 3HNRA 3P71T 3PX3A 4E2ZA 2XBMA 2FCAA 3DMHA 1ZKDA 3DMGA 4PYJA 4CXMA 4LWOA 2BM9A 4DKJA 2NXNA 2GS9A 1L1EA 3NWEA 4FT2A 4V0QA 3I58A 4Y30A 1DL5A 2IIPA 4KRGA 1L3CA 2GAFA 3FYDA 4RVFA 2YX1A 1NW8A 4AZSA 5FA5A 2IBSA 3P2IA 5DM2A 4LG1A 3BGIA 1VPTA 1UWVA 3C3YA 3VSEA 1N7JA 2AOTA 2B25A 3I5UA 4RTPA 3FPEA 2Z6AA 4E32A 5CVVA 3OFKA 1XDSA 3RIEA 2G1PA 1EQAA 3HP7A 4BP3A 3G88A 3E7PA 3KR2A 3LECA 2K4MA 2P3LA 3KR1A 3OFJA 4XUCA 2VZ9A 5DX1A 3OU7A 3O31A 3CJQA 3SXJA 1YFLA 4QQNA 3KPWA 3JWGA 3CCFA 5F2OA 3SSMA 4QDJA 4DF3A 5HZMA 4QPPA 5DXAA 2HWKA 3DXYA 3NWBA 4QPNA 4PYLA 2PXCA 4YMHA 5E9WA 1R8XA 1L3BA 1R74A 1QZZA 2P40A 3FUXA 4M7RA 1X1CA 3KPVA 4Y2HA 2QRVA 3EGVA 2EJTA 4ER5A 1XDZA 1SG9A 3M4XA 3TMAA 3EPPA 3P8ZA 2IH5A 3LKZA 1TW3A 1UIRA 2GA9A 1KYZA 1QAQA 2ZVJA 2AZTA 2P3OA 5DX8A 5E1MA 3HCBA 1SKMA 2R6ZA 3KPJA 1DCTA 5LQCA 3BKWA 5EKXA 5E2BA 2NYUA 4GOLD 4RTLA 5FUBA 2AVNA 5K0CA 2PX8A 3GIWA 5CCXA 4ER3A 1AQJA 3LCVB 4GC5A 4CWAA 5FQOA 2B2CA 2I9KA 5K0JA 2H00A 4CKBA 5K0GA 5DSTA 3HVIA 2CL5A 3HVHA 3R3HA 5CM2Z 4YMGA 4CTKA 1JTEA 4HC4A 4IV0A 2GH1A 2B9EA 5K05A 3FTFA 2QYOA 2ESRA 3UJDA 4QVKA 2P1DA 1XDUA 2H11A 4C03A 1ORHA 2PV0A 3G8AA 2FPOA 2O07A 4G56A 4HGZA 4E30A 1Q0TA 4RTRA 2UZ4A 3GRVA 3NDJA 3T0IA 1T43A 1FP2A 3SVZA 4PNEA 1UFKA 3EEOA 4E33A 3SMQA 4IWNA 3FUVA 2O0LA 4EKIA 4R6WA 4ISCA 3P9CA 3M6UA 3IYLW 2EFJA 4DZRA 1RJFA 5EZQA 1WXXA 3HCAA 5FCDA 3I9FA 4XUDA 3ER8A 3DMFA 1XJ5A 2LD4A 5FWDA 5CCBA 2AN4A 5HEKA 4U7PB 2HTEA 1KPGA 3ELDA 3DXXA 3B7PA 1KHHA 3NW9A 4OBWA 4XCXA 4X63A 3PTAA 1JSZA 4PYIA 1RI2A 3DH0A 5ICCA 2EX4A 3UWPA 2EJUA 3I64A 5GP1A 1HNNA 2BR3A 2G72A 4FR0A 3EVFA 5CD1A 3MTIA 4C06A 3BZBA 2G8NA 4LWPA 5EMKA 2R3SA 2AOXA 3LKDA 2XVMA 3HTXA 2YXEA 1JR4A 3P9NA 3THSA 4E31A 3R6TA 4ER6A 1FJXA 3G2QA 3HA3A 4OA8A 4HGYA 2OYRA 5DLYA 5GIPE 2YQZA 2ZBRA 3MCTA 2DULA 1KXZA 3ELYA 1RI4A 4IV8A 2P7HA 3FZGA 1QAOA 2OB2A 4RVDA 1G55A 2AOUB 4CKCA 3LHDA 5GM1A 1D2HA 3FPGA 3ME5A 2BM8A 4HSGA 4KWCA 1WXWA 3ELUA 2BR4A 3C6MA 4DA4A 5K0EA 3VYWA 3BT7A 1KIAA 2I7CA 3O7WA 5T6BA 1VIDA 1YB2A 2C7RA 3LBFA 2NNWB 2AVDA 3TRKA 3OPNA 5E9QA 5U4XA 1O9GA 3EVDA 3TLJA 4RTKA 5EVJA 4YUXA 3KR9A 2P3QA 2XVAA 4PGHA 3G5TA 4YV0A 1JSXA 3GRYA 5JUWA 4RTNA 2PWPA 4K6MA 1RJGA 1L3IA 3LCCA 1QANA 3AWIA 4PWYA 3KKZA 3PB3A 5E9JA 3PVCA 3G2MA 3HA7A 1ZGJA 2VS1A 1VBFA 2PJDA 1SUIA 3MTEA 3QV2A 2P41A 4MIKA 2VDUE 3G5LA 4RVGA 4U7TB 5FQNA 4HTFA 3TQSA 2HV9A 5BXYA 2C7PA 4FT4A 3X0DA 3KU1A 4RX1A 3KHKA 5ERGB 3THRA 4EKGA 2FK8A 5HOQA 5KS2A 2ZZMA 4GBED 3PX2A 3B3JA 4FZVA 5K0FA 4PINA 3C0KA 3KPUA 5B1SA 1NV8A 1FP1D 2YUIA 3BKXA 1R18A 5F2KA 3MAGA 3A7DA 1H1DA 2P7IA 3C3PA 2P35A 4RYLA 4C08A 4M38A 3P97A 3R0QA 3TOSA 3VC2A 3FTEA 5CVEA 5EMJA 5GWXA 5DSXA 4OX9Y 4HG2A 4RVHA 3TKYA 3ER9A 3GXOA 2YTZA 1B42A 1M6EX 4FSDA 5FADA 4RTQA 4PIPA 4PYQA 1NW5A 3NVKI 5E8RA 2AOTB 1MJFA 1P1BA 1ZHFA 4HRAA 5H02A 1XVAA 2PX2A 4E2YA 3HEMA 4E2XA 3GNLA 4EQZA 3LGAA 3GO4A 4ER0A 3MGGA 1Y8CA 1R00A 4CKEA 3VC1A 3Q7EA 5EEGA 2NXJA 4RTOA 3SM3A 1NV9A 1WG8A 1XCJA 1JG3A 2AN5A 2ONYA 1XTPA 3FUWA 2ZIFA 3GCZA 3ID6C 2OO3A 4WXHA 5GM2A 5ICFA 5LQNA 1SVUA 3KQWA 5DRTA 5FWAA 5K0BA 1JTFA 3EVBA 3M70A 5LQAA 4MHTA 2NXCA 3LL7A 1KR5A 4QVGA 4AZWA 5CUQA 4YUYA 3CGGA 3GDHA 4P7FA 4OBXA 4F86A 1G6Q1 3RW9A 3CJRA 1NW3A 3F4KA 4OA5A 5IH3A 2KW5A 5K09A 5JR3A 3KR0A 3FRIA 2ZBQA 3AXTA 5DTRA 2BH2A 2B78A 3A4TA 10MHA 3A26A 3TM4A 1AQIA 1XCLA 3OE5A 2QM3A 4HTFB 4DCMA 2JG3A 3EGIA 5EZSA 3LCUA 1G8AA 4PCLA 2WK1A 3EMBA 2ZCJA 5KQRA 3CC8A 1Q0SA 2Z6QA 3GU3A 3D2LA 3HVKA 5ICEA 5EGSA 1BOOA 1I4WA 3NDIA 3G2PA 4P58A 1NE2A 1O9HA 3PS9A 2CWWA 1PJZA 4F84A 1EJ6A 3R9XB 2ZW9A 3UJAA 4RWZA 1SQGA 3QOXA 5EOVA 5LQJA 5GOZA 3DXZA 3FPHA 3MB5A 4IKPA 2HNKA 3HVJA 4AUKA 2JH9A 4KDRA 5P8WA 4HH4A 4QQKA 5GIOE 2IBTA 4V0RA 4RSRA 4C05A 1VLMA 3WSTA 2JHPA 1N2XA 1D2CA 5HIMA 3OU6A 1SQFA 2AOUA 2GB4A 4R8SA 3G89A 1DUSA 4B17A 3EVAA 3LPMA 4PGGA 1U2ZA 2OPBA 3JWIA 1IM8A 1YZHA 3QOWA 4RTJA 5KQSA 3FUTA 5IKMA 5FHQA 2PX4A 3H2BA 3R24A 4AX8A 1VP3A 5DRYA 4EVIA 5HFJA 2H1RA 4ER7A 1G60A 2ONZA 5EMMA 3V97A 3GWZA 2V74B 2Z6UA 3DR5A 1INLA 1WY7A 3OZSA 5EC8A 1VP9A 2FRXA 3MHTA 4A6DA 3EVZA 5HILA 3LX6A 4RTSA 3BXOA 1YFJA 5E1OA 4ATNA 5F2NA 1O54A 3FTCA 1EJ0A 3ANXA 2UYHA 2N47A 3E8SA 3PT9A 4MTLA 4R05A 5EG5A 5LR6A 3TFWA 3PFGA 3FPFA 2IP2A 2P8JA 2EG5A 3EVGA 4R8RA 5C1IA 4PYNA 4YUVA 5T64A 3UA3A 3CVOA 1VL5A 5BP7A 5C0OE 1NW6A 2NP7A 4EK9A 4GOOD 1JQ3A
chains in the Genus database with same CATH superfamily
3FGZA 1ODKA 4OPMA 5FOWA 5A1TA 3FR8A 1I3OA 2IZ7A 2R87A 1YMQA 1U8UA 1UPTA 4LK3A 4Y2TA 5CP8A 4LCEA 3FNBA 1GUDA 3J81A 4ETNA 2UYCA 3AT1A 3N75A 1XWIA 1XRSB 4B44A 1SAYA 2IYFA 4DLTA 4KL8S 3ZZNA 1M2OB 2X4GA 1X42A 3HM2A 5EQJB 1U04A 2HFKA 2OBBA 3LHSA 2JF0A 2HUPA 4UUPA 4H1TA 5JJCA 1A9SA 4JLBA 1GZVA 1NW7A 5TB5A 8LDHA 1R8QA 3EASA 1U2TA 2NUPB 3LSTA 2AI2A 2KLHA 4B5LA 3M9XA 3TUJC 2ZOSA 1IZYA 4UUAA 3JYPA 5E7MA 1GZ7A 3FI9A 1RS0A 2R7LA 2QIPA 4C3UA 1TA4A 1LA2A 2BCGY 5IDVA 4AWAA 3E27A 1EZ4A 3D6TB 4J0HA 3UHFA 3ZJ5A 3TLZA 1IBLB 3VNUA 5LNK6 4ILEA 3E53A 3TIGA 3PQFA 4DMHA 2C5AA 3RHFA 5ARCA 1JG1A 3MTBA 1PJRA 1SD5A 3BIJA 2VKTA 5ED4A 1M5TA 2O05A 4YGYA 4NXNB 2G9NA 1XX6A 3AHGA 5CBPA 4CL3A 1ZS9A 3VPHA 1VYVA 2G67A 4RV9A 4TKMA 2J4FA 3E03A 4DHWA 2K5UA 1T3HA 5K0NA 1MRNA 4CDNA 2CCKA 4D99A 1NFFA 1LPOA 4LISA 4PU0A 4XW2A 1JYSA 1E2LA 3K0EA 2C94A 3TCNA 3TWOA 5F9FA 4OFZA 2EQBA 3QENA 1SC9A 2YBDA 2R2GA 1HMYA 4ND4A 2RG1A 2R65A 2Z09A 3A3KA 3O26A 4Z7NB 3MERA 3QEAZ 1UAAA 1BGWA 5TF0A 4WQMA 4IUCS 4CKXA 1K68A 1E1LA 2G7MC 4L4XA 1UMCB 4LNUA 1TQ8A 2IW1A 1Y9AA 3ADCA 3ZWWA 2ORIA 4EHBA 1PEDA 1KSJA 5C8YA 4IDPA 1H4TA 4TQAA 1Z13A 1XAHA 3LNCA 3TE7A 1NF9A 5CH8A 5THKA 3DV0B 3FPSA 5KJ1A 4MYSA 5JD3A 4E12A 3H5NA 1EVIA 1DT3A 2RAVA 3T9BA 3JS5A 1RRFA 2F3SA 2M32A 2Q8PA 4DLNA 2C88A 1OBFO 4YP5A 1GTMA 1L1FA 3BCRA 2VO1A 2PLNA 4L76A 4LBWA 2F9FA 1OUMA 3A27A 2VQFB 1IH8A 1E69A 1K8YB 4FILA 3D1VA 3CH7A 1U1DA 1FRQA 3PQDA 3ZQKA 1X14A 5BVGA 1VKRA 2E5FA 4DLVA 4V2IA 4DYHA 2N0SA 3GLVA 1C30B 1UBGA 2VRCD 3AU8A 3NBXX 1QCDA 3MSXA 1R0WA 3BH6A 1V41E 3ZE0B 4LZLA 2I1LA 1XALA 3U60B 1OFTA 3A6GA 4QOGA 3MXOA 2JFGA 3PKJA 3AVYA 2V7TA 5C7LO 3FR7A 3BSWA 2J41A 3OSUA 4V3CA 4FC7A 5TPWB 1N1DA 2ON6A 2AN1A 1KK1A 4WEOA 4JEHA 1R4AA 4R7GA 3W2IA 4C3ZA 2JEZA 1YF3A 1D2GA 1XUOA 2XQJA 2I80A 3AR3A 3OSZA 4NPCA 3X1WA 1G8PA 4D9GA 1QG0A 3U7QA 4EABA 3G9XA 4YMSA 5BW6B 4MW7A 3GFSA 5L3QB 4RHUA 1NVBA 2P9JA 3KKOA 8ATCA 4PG5A 1QTRA 1BW9B 2GPWA 2XRMA 4MW6A 1EP3B 5HUQA 1BFUA 2UYQA 4NCAA 4YPFA 2Y1WA 4FGUA 4MHSA 4Q3DA 3IIIA 1SOMA 1PHPA 4HBZA 5BW5A 5C52B 1QK3A 1NSFA 5EEHA 5DNYB 4LYGA 1M1NA 4F3YA 2OT3B 2BFEA 3COYA 1P72A 1PWYE 3FVWA 3IMGA 1PK7A 1ND6A 1UP7A 1KVUA 1PYGA 1G98A 1SK8A 2DH5A 2IDKA 2WEKA 4INAA 4Z7OB 5ED0A 2NV2B 2R6FA 4WL0A 4Y9UA 3S0JA 3U0VA 5B1EA 2PKQP 2PSJA 1WCIB 3LQ2A 4GO1A 2HLDA 4WBNF 2YJTD 4NCXA 3P9KA 2X6RA 5KYUA 2VDWA 2WM9B 1RC1A 1MOZA 2DLDA 2D54A 1SURA 3BK2A 1LNQA 2ZUUA 3O9VA 3OPYB 2C9YA 2YVUA 3OE7D 3NNNA 3O7MA 5D01A 1RYEA 5G02A 4EJFA 1YS7A 4FGLA 5C5DA 4I4LA 3AB3A 3FNHA 1EBFA 1TQDA 3L0DA 3FLBA 3AERA 1IEQA 4UHFA 1VMEA 1JIQA 2AG5A 3INYA 1CS0B 3R7AA 1OLXB 2AOWA 1ZNYA 2Q2OA 1GQSA 4ND2A 2JK1A 5JNWA 3PE3A 2QZPA 3GZTB 4XD7A 1IYZA 3GLHA 3W9UA 2B1QA 3REOA 4XDHA 4TMKA 1U2EA 1I94B 4YX9A 3PGMA 2WB2A 1Z36A 4GT1A 1OFHA 4DC0A 2LVBA 2FJUA 4KBGA 1PT6A 3A3NA 2FMXA 5H68A 5CB4A 1CQJB 4PSAA 4EPTA 5ANRB 1JALA 2XYVA 2CXSA 4XUEA 3TTVA 4KAFA 1IVYA 2J0UB 3L0SA 3U4CA 1OB2A 3OLYA 5C1PA 4H08A 3R5KA 4ZU3A 1S7GA 4C7OB 1RLUA 1U11A 3L3BA 2P62A 4ARAA 3LT5A 2XXAA 2IIPA 4TXNA 2XWSA 4WA7A 3FPCA 1TJ3A 1ACMA 3B1ZA 1OLUA 2QQGA 3O2NA 4FYKA 1NVDA 3RBZA 3UB3A 3VJMA 3HJGA 4EEXA 1BJTA 2XNCA 3OFNA 1JHRA 3RUAA 4F2HA 3WYCA 1R0KA 5BMVB 4GSYA 2Z8ZA 2FG7C 3H9CA 3I8SA 1P4SA 1G63A 1X94A 2BE7A 1HUQA 3BGWA 3PC4A 4CQMD 2MSLA 4KQGA 4QUAA 1CZLA 1XQVA 1W5SA 2VBIA 3ESYA 2GKSA 1V96A 5AIBA 3UFXA 1ZOIA 4ROTA 2GBCA 5M3BA 4ES6A 3LLSA 4P0QB 1F2DA 2I65A 4M9RA 4UTXA 4BQOA 1VFPA 4RZHA 2JJ8A 4R8MA 5BWLA 1YA6A 4FQ8A 3PRKE 1XG5A 2NUPA 2ZRAA 1R8XA 4LZZA 4V39A 2XOKD 3BD6A 1X1CA 2PXHA 3E48A 4R69A 2IYLD 4P1ZA 1QGOA 4QOEA 2VCYA 3QVXA 4NJEA 4WFKA 3KB8A 1H0HA 3I9KA 4D3SA 3K5PA 2C2KA 2VOJA 3THWB 4KR2A 1IAVA 2CFCA 2IELA 2GA9A 2VXYA 2HQSA 5IDWA 1MLDA 2GD0A 3CVWA 1A2KC 1ZWLA 2VLIA 5EIOA 3IKTA 1Z5UA 3O0DA 2W4IA 3KPJA 4AKSA 3Q7SA 1NX6A 2RC6A 5JCXA 5EKXA 3DAPA 4OMDA 2BRUC 2XR1A 1FQKA 1L5QA 2D5CA 1H5NA 3AG5A 3WLFA 2G7ZA 3V3TA 4CKBA 4EJSC 3BK7A 3HVIA 2WIJA 1J39A 1GGMA 2OQRA 3FZEA 3H04A 4FB5A 5FYQA 3TAHA 4HFNA 3A8TA 4QVKA 4WT7A 5LLSA 4WZBE 1GDTA 3DL4A 2NO7A 4AP5A 3ABOB 3UY4A 4KPYA 3UAGA 1EB8A 1FP2A 1OVMA 2D1SA 4S35A 3SVZA 3NWPA 2FW8A 2GHIA 3MMXA 4M49A 1H8HD 2EF0A 2CXXA 2PGJA 4N3GA 1MBZA 1BE6A 3P9CA 4KFUA 4UBNA 1QB8A 3M6UA 3Q6IA 5JVDB 1QRUA 1DQSA 4FQ5A 3BXGA 1SCKA 3O8DA 1KYVA 2JS7A 4QDXA 3W6NA 3TL2A 3N0XA 1CNMA 1Y9EA 2FPPA 1C3OB 1IBSA 1C7ZA 4IX1A 3NU1A 4U4AA 1ULZA 2FFBA 3N8NA 4IXMA 4RPCA 4MQ5A 3SDBA 2GVNA 1NKTA 1CUUA 1RI2A 1XZJA 4MUKA 5MGBA 1NG9A 3G0CA 3N39C 2AF3C 4FFWA 3TFOA 3ZUPA 2G72A 1P2GA 3PNYA 1OBHA 1NY5A 4OGKA 3ODPA 5JDCC 1KL7A 2J9FA 3T3MB 1G0OA 2XB6A 2A9OA 2GRJA 3PDIB 5IMSA 3PDWA 5EMKA 1G8GA 4O25A 4K6HA 3S55A 1XOIA 1CB0A 4TRRA 1NIPA 2XH8A 2MYUA 4E31A 1QCCA 3R6TA 1L5MA 1OLSB 3PRHA 4MS4A 2WIAA 3B20A 5CDYA 4HGYA 3N8IA 1SBTA 4R51A 5LWQA 2DLCX 3RVBA 5IJ0B 4KGDA 1A8SA 2VJPA 1NA5A 4X1IA 1GY8A 1ZMRA 4WESB 3AONB 1KQOA 4HWPA 2JGLA 4MWSA 4RK7A 1IOVA 1V5WA 3CKYA 1LU9A 3C4VA 3LVBA 3TRDA 3UGKA 1W0JA 2AOUB 3M3PA 1XPUA 5FR2A 3VNAA 5FFNA 3FPGA 4PRYA 5EJ6A 1YVPA 2AFHA 1KJZA 5DGTA 3OIWA 1HRKA 3HSSA 3IPXA 3B60A 3C48A 1H6BA 3G5MA 4P36A 4HF7A 3VXKA 4EELA 5M34A 4O1MA 1ZSNA 1D09A 4HLNA 3ZWAA 4BQRA 3TRKA 1PG5A 2G04A 3V42A 1E58A 4IJ5A 2YJNA 4PPYA 5FBRB 2XVAA 1L7AA 1TZJA 1KRWA 1DSSG 1JSXA 4A15A 3AVTA 4F8JA 2PWPA 4YMTA 1NY6A 4PWYA 5IH7A 3BQ9A 1A8UA 1E2PA 1UINA 4ZQCB 5FBWB 3GRKA 4B83A 4IJUA 5GONF 4CEHB 2PZJA 1KDZA 1R88A 2FE4A 2XTMA 3RBAA 4CKEB 4DQDA 3QV2A 4C0WA 5IG2A 1H65A 3NVDA 3OLQA 5DLQC 2E4ZA 4CF4A 4CIDA 1QH8A 2JD1A 2GNOA 4XJTA 4RQUA 4Q48A 1M5RA 3VAYA 1NOJA 2GASA 1V1MB 5DP2A 2V1UA 1GPDG 1D6MA 1ULBA 2ILVA 1QGUB 1TX4B 4DDKA 1BQEA 2XDAA 2Q5CA 5EIXA 1QONA 4JJFA 2TS1A 3WLNA 5BOVA 3IVMA 4DARA 4C76A 4RYLA 2ZT8A 2OCKA 1XTSA 3GZJA 2Q1TA 5IS2A 2QKYA 5IBPA 1XEWY 1K4MA 4B76A 3B70A 1XA3A 2EP7A 3B6JA 4MAFA 2O54A 1B3RA 5AOAA 5FNVB 2YTZA 4PRKA 3SY8A 4R1QA 1V45E 4MVJG 3NVKI 4U7JA 4WESA 3WGIA 5H82A 4DJTA 4BNNA 4U02A 2RHWA 2KX7A 4B3TB 4Q93A 3CM0A 5DI3A 2R1UA 1Z2CA 2VA8A 3BWXA 2ZB7A 4N9WA 2PDAA 1FDWA 2BY4A 2V6GA 6PFKA 1C1YA 3SYKA 5HRCA 3W5AA 2QUJA 1AQ6A 3GCZA 8OHMA 3IBTA 3TGPA 5I3ZA 2Q9AA 2M6LA 4JLKA 2YZ7A 1SJ9A 5ECWA 2FUCA 2XVZA 4L3WA 2C61A 1SVWA 2YV4A 4P3XA 5ECGC 4YT4A 1HOXA 3U44B 4HLDA 3HWX1 4LK2A 1EWTA 4A6XA 1LEHA 2I66A 1N8NA 4J1QA 2A5GA 3PEEA 3A6FA 1P61B 1EE9A 2D0IA 3EFOB 3K09A 4I50A 2GZHA 5KTSA 4CTOA 1ZLYA 2Y0PA 2ZIUB 3W34A 1ODCA 1YAJA 2J33A 4L95C 4DRXA 1GAQA 3WYFA 2M6SA 1PS8A 2OCYC 1E3DA 2RHLA 1J1IA 1R0XA 2IU6A 3EMBA 4FFNA 2GBFA 4QBFA 3D2LA 5JXWA 3G2LA 2IEAA 2QN8A 1WR8A 4ZP1A 4Y6GB 3BYZA 2G08A 2RI6A 5BWBA 4OHFA 2RGEA 5B6IA 4DCJA 3F90A 1MAVA 3K8ZA 2R96A 4PYRA 1ZU5A 2FW6A 4JL5A 4CN9A 2C0CA 5D7NA 4QUGA 3OVMA 4KPGA 2R6CA 2RB4A 4ZOLF 3ZW7A 5KNDD 3NAGA 4MUXA 4YFYA 2C4KA 3BICA 2CUKA 3ZCSA 1X9HA 4OJMX 3LG2A 1VGVA 4Y2XA 4DSTA 1N2XA 4DYDA 2VT6A 5HYVA 2O20A 2GJKA 3BWEA 1N4DA 5FEUA 4OI2A 3HB5X 4ZJZA 2ISQA 3WAJA 4HNAB 3M4YA 1FXSA 5IKMA 4KJZA 1VJRA 3OETA 4LS3A 4TSRA 1YWGO 4ZZ0A 1GTL1 1PUJA 3NRCA 4IIHA 1T3LA 3DLTA 1SIWA 3VPBA 1VL2A 3ZGVA 2XW6A 4ECAA 1FFGA 4JNKA 5LZ7A 3PG5A 3MHTA 5EC8A 3JQ8B 2G9VA 3K9WA 4B3CA 1IG0A 5DCYA 3GP3A 1LW7A 3NGXA 1G3IA 4E1VA 3BXOA 3Q88A 4GKKB 1MEJA 2EW8A 3IQHX 8GPBA 1V8BA 1U3UA 3CXUA 5EE5B 1WVIA 1WNFA 1CY4A 3E8SA 3L84A 3PT9A 4PGMA 3S5JA 1Z74A 3U6BA 1TADA 5AI8A 5JRJA 4N3AA 4AT1A 3FTPA 2P8JA 3HR8A 2O2JA 4YUVA 3AYXB 4RPGA 3WWDA 3TZHA 2VQEB 1Z8NA 1O03A 4B7AA 3L7NA 2CLHB 3V1LA 3OQ1A 2JPDA 5FV7A 3LOUA 1KFJB 4Q18A 1J0EA 3QHPA 5KVQA 2VVTA 2Y77A 2AWOA 4BNGA 3LY5A 2I2WA 4F9FA 2FJ0A 2PWBA 4P7JA 3IR5A 2ATEA 1DX6A 1SKYE 2OILA 3M6MD 1D04A 621PA 1MA3A 4BXOB 1EH5A 2BGNA 1JQ5A 2FCRA 3IESA 1C41A 3Q0IA 3S3TA 4E1AA 3A9RA 3OM8A 3I9OA 2OVFA 3OMXA 3I2JA 1BVYF 4X1OA 1F3LA 2G09A 2YHAA 4JEIA 1SC6A 3EBOA 2PX6A 3IFSA 4KNYA 1CIPA 3HSYA 2GEBA 2PY6A 4R8VA 5FORA 3DD5A 4RD3A 1H3NA 2ODBA 3NHYA 4NMLA 2D8AA 4XD2A 1M1UA 4DDWA 1O1YA 3KKQA 1Z75A 4RHFA 3GPIA 3ACBA 5JE8A 3TKLA 3ZH2A 4DV0B 1VBKA 3W2HA 4TX1A 1KO1A 4I55F 2FYTA 1RLTA 4KWEA 3IBYA 2GJAA 1AA9A 1N0WA 1D1QA 1UMKA 2FMIA 2REXB 3Q7RA 4LKRA 4MS3B 2FMTA 3MS4A 4FXOA 4DRYA 1DQZA 1N2JA 4ZI5A 3JXEA 1UBNA 4AD8A 1Q6YA 1XMXA 3F6BX 5HQTA 1EG2A 3ZD7A 3K8QA 1IBMB 3QHAA 3K70C 4LWQA 3RYIB 5FOQA 2I0FA 1IIRA 3JYNA 5JQGF 1FUUA 1T1SA 3PFHA 3SMQA 2BFOA 4QWMA 2GEVA 3ND9A 4LVNA 3RC3A 5DYYA 5AK5A 4XR9A 3BD9A 5HK8A 4ASUA 3AOGA 4RA6A 5CURA 5K01A 1RZUA 3SVTA 2HV8A 2MDTA 1PHRA 2H1IA 2WP0A 1K6EA 1IQ0A 2PXXA 1EJ2A 1T6NA 3QG1A 4L8GA 3R7BA 3V1YA 1SA0A 1RJDA 3R9XA 5FIUA 4DNPA 1YB5A 1DFGA 1HI9A 3AP2A 4HDMB 4TZTA 4HGRA 1NPDA 4M1WA 1CZKA 1YK1A 3TJRA 2O0HA 1M1XB 4E2WA 4DNFA 2BFFA 2AC7A 2EKLA 3RNOA 1I2ZA 3M4NA 3OTWA 4FEYA 1GN9A 4OO3A 4DA8A 4LZJA 1KZ4A 1SU8A 4ZEMA 1WUKS 3IPAA 4P4TA 2IY8A 2DTEA 3QITA 2VF2A 4MV5A 2G5TA 1I4LD 2HYDA 3ZWQA 5KREA 4RPLA 1AV7A 2SKEA 4U63A 1YZ3A 2QU7A 3WNCA 1GKIA 2X41A 3UJCA 5DYNA 5TEVA 1P7ZA 1ZK2A 4H6PA 3K9NA 3T4PA 5ALZA 4JC0A 4MV0A 1YC5A 3Q12A 5IC5A 5LB4A 3ROQA 3ZEAA 4EBBA 1JHDA 5GPBA 3CVXA 5JXJA 4URYR 2G82A 3DO6A 4P7KA 4JI2B 1U2GC 4EAQA 4AZ0B 5IWAB 1Z4KA 4GDMA 4XRRA 1MQSA 5C32A 2YWJA 1E1RA 2FZEA 4E0BA 3EVTA 2HHHB 3PNPA 1B6GA 3DLIA 3QKRB 3O3OB 1J2UA 3UBMA 4FP9A 3C1TA 3JY6A 4LXIA 1XRLA 3N7AA 2VYNA 4EB6A 5AM1A 4DM3A 1X1AA 1NXXA 3GIDA 3W6OA 3A1WA 5JFOA 5EP3A 3IUNA 3KQYA 1DEHA 2QMYA 4PSCA 2W83A 4FEAA 5EP2A 2O5EA 4FLEA 3NH9A 3PUJA 2GBLA 3KL4A 3D7RA 3DHEA 1TD9A 2IV7A 1CUCA 1X1DA 4JU8A 4LUCA 2UXCB 3NHPA 3GUUA 2QD2A 4X7MA 2A4MA 3JQGA 2P9FA 4YK7A 1V16B 1YONA 2Y05A 4WJLA 3SZ3A 3ZV7A 3T3NA 3CBGA 3VMFA 2ZBGA 4GH5A 3ROFA 3BWMA 1RT9A 3C2QA 3LFUA 3ZV6A 4EZEA 2OCAA 2NG1A 3B1WA 4N5IX 1J24A 2WUVA 5LUAA 3EMDA 4D9HA 2JC3A 5FBHA 4S2UA 3LK7A 1P0QA 2K7ZA 2XB4A 3KVVA 5D5QA 5U1PA 2NO0A 1IVNA 2IKQA 5E1DA 1X70A 2YWCA 1C1XA 1FMCA 3O2JA 3GA5A 4UREA 2D00A 1EGMB 3FYCA 5F21A 3HEBA 2BBWA 3F5MA 1RI5A 2O57A 5IF9A 3BRCA 3AO0B 1RWKA 4FMCF 3NOQA 3CVYA 4CCYB 3N7TA 4EPRA 2NAFA 5JALA 1ADYA 1NYQA 1JRLA 3JWHA 1T1IA 3CWQA 4WY2A 3TPFA 3MBIA 3NJRA 1P3DA 1T10A 2ZSHA 3CKLA 4LA4A 4B47A 3IOEA 5DTQA 4G5XA 3UN1A 3LC2O 3DZIA 3EMVA 1NM5C 2Z3WA 4ITUA 2JCVA 1RPTA 2WIBA 3AUUA 4JXJA 2W2OA 1U6JA 4KWHA 1QS0A 4HXEB 4W8GA 1YE5A 1QKIA 4MVJP 2ZB8A 2PFKA 1NP7A 2C2YA 5JQGA 5E4TA 1N6OA 2OC4A 1QOZA 3IC5A 5CT5A 4QXMA 4UFNA 3TLYA 1PBNA 3TW0A 2AKAB 5ITWA 4RTMA 1HFJA 3VQTA 3G2JA 4LC1A 4E11A 1WSAA 3OWOA 2JFQA 1XZFA 2HMWA 2QI9C 2F1RA 2CL0X 4GOMD 2OP1A 2IYVA 4KOAA 4TPKA 2B1GA 2FMUA 4DAOA 2QLFA 5F23A 1SXGA 1G5TA 4GI1A 2B5VA 1RAAA 1C3VA 3AP1A 3BTUA 1E96A 1Y8QA 2F9LA 1HK7A 1E9BA 2F3PA 2QZ4A 1CRLA 2WMNB 3I58A 4JP3A 3U17A 4C78A 3FVRA 4WCFC 1EVLA 3UO8B 2PZMA 3C39A 3UMRA 2ETXA 2ZE6A 2IBSA 2DEUA 2N42A 4IX9A 1TVKA 4MMXB 1DNPA 4QT4A 2PVPA 4AXXA 4QO8A 2VNKA 1RHUA 3FKQA 2V45A 2D5LA 3PXCX 1EQUA 4Q66C 4XX0B 2YJZA 3WLLA 5JFTA 2Z2ZA 2GN6A 2HCRA 1SUEA 1J1ZA 4NMHA 4Q3AA 5B36A 2CDNA 2KE5A 3KUUA 1NDQA 4ZO8A 2BMVA 3RRZA 4UMEA 4Q1AA 5ILQA 4MWGA 1UFRA 4YRDA 4HI0E 4I9UA 1T2EA 5JZBA 1DO2A 2W90A 1XL1A 1SD2A 1FNMA 1ZUIA 2ZJ6A 4J0KA 3SSMA 4I9GA 3U61B 4B7CA 4QPPA 1KO8A 3DXYA 4B8ZA 5A5DA 3WADA 3LCJA 4UE6A 3W3AD 1MABB 3MTGA 4F91B 4M7RA 4BO1A 3Q4GA 4BNHA 4D80A 4ZHQF 3HJFA 2C8LA 5HRAA 2BGGA 3A4MA 2FRDC 5LIPA 4NAUA 1YBFA 2FPRA 2W2MA 4HADA 3U2QA 1PE0A 1B23P 2GVZC 1IJFA 2GWHA 4YWJA 2P3OA 3PE4A 5E1MA 2NVUB 3HJUA 4N0MA 2OESA 4CQMB 2CDRA 2BHSA 1WTAA 2O3TA 4PVCA 3L7KA 4JUIA 2N75A 4HLUA 1KDPA 4BX9A 2FSVA 3TXYA 4D81A 1XMQB 4J6FA 2I3BA 3LUKA 3OCVA 4ZOLA 1GKUB 1MX1A 1T0JB 2E49A 2PX8A 4FVTA 4TVKA 4ZYVA 1OFGA 2D2VA 3IAM1 5HGJA 4X3OA 3KHTA 5EXDA 1QLWA 1UEIA 5TR9A 3WX0A 4HTAA 2CL5A 2EJBA 1KK0A 3IDAA 2OGWA 4KOEC 4RIHA 4AS2A 1QF9A 4M9CA 3GFGA 1ZIYA 3AHIA 1W85B 4I8DA 4ZI7A 4MIOA 4EKEA 2HGZA 1ENOA 1EVZA 2PO7A 2BVNA 1XDUA 1R6UA 1XEFA 2HMVA 3AINA 4PNPA 2XMSA 2PU7A 4QX6A 5MN4A 2I22A 3DOEA 1QX3A 3PNBA 4B3SB 4IG4A 4MWOA 4PLCA 2HRCA 3R9WA 1C7QA 3GNTA 2VHZA 2PN1A 1ATIA 4IHQA 5HS6A 3UMSA 3I2KA 4AROA 4Q15A 2BGLA 3BDVA 3ADDA 1A0OA 1NT4A 4CIAA 1NQUA 1ELOA 2O4UX 3I9FA 4QELA 3OTOB 3D81A 5KNBA 1RRVA 3DEIA 4RE6A 2GF0A 3FTNA 2DSTA 5BVHA 3DXXA 1POWA 4AUMA 4GYJA 2BRUA 1H2FA 3R3ZA 5AWFC 5DLDA 3CQ9A 3SQLA 2F4VB 3QFCA 3HQ4O 1N32B 4ZHSA 2EJUA 4IIVA 3RRXA 1B7GO 5GP1A 2ZAIA 2J0EA 1ZK0A 3L6RA 3CF4G 2QQEA 4JLUA 3A1EA 4OHWA 4R41A 4HMQA 4Y6RA 5LP6A 4ECEA 3LKDA 4BL5A 3UWKA 4F8YA 3ESQA 5BMVF 3GLUA 5CH5A 4Q47A 3THSA 2D3WA 1DX4A 1JMYA 1ODFA 4W1SA 3UT5A 1H8EA 2D0DA 2X2EA 1KDRA 1Q2XA 2ZJ7A 3AJ8A 3R3UA 3VGPA 2CNBA 3C8MA 2ZT6A 5KTTA 1EUDA 3CH6A 2IPOA 3OF5A 4B85A 5LIRA 3ECSA 4EX6A 3EPRA 3MJTA 2L18A 5BWCA 4OXYA 2CY0A 4QXQA 4LXTA 3VAAA 3NLLA 2GLTA 2BM8A 1KZYC 4KMMA 1I3MA 2FN9A 5B6JA 1WXWA 3MA0A 3UB4A 3VKHA 4JN6B 2PIDA 4S0XA 3PQ3A 1K8QA 3E9RA 1DMRA 5LMCA 2G5GX 1JS1X 2J6IA 4X1KB 4ALNA 1O9GA 1QWSA 2WG2A 5FUYA 4KR9A 4J07A 1RXEA 5ICMA 1UIMA 1VYUA 3FFWA 1XEAA 1W88B 5DMHA 3WJ7A 3C7TA 4YP0A 3QLEA 5E9JA 4NG5A 4ZQFA 4A0GA 2X8LA 3SQMA 3B51X 1IN5A 1Q0LA 2Q99A 1U9YA 1U8YA 1AQNA 2P41A 4MIKA 2VDUE 1CUVA 3TB4A 3CVUA 1E3WA 2GTHA 3KHKA 4ZWNA 4TN5A 4GI2A 1CUYA 5K9ZA 2QT1A 1VL1A 2WJ6A 3OQIB 4DYVA 5B1SA 3W3ZB 2ZIAA 3GDWA 2KMLA 1JLSA 5TARA 2YHBA 1GZDA 2V65A 4L5CA 4DCOA 2OCPA 2VDKB 4HDMA 1YZQA 1YIOA 1E0KA 2PT7A 3NQ41 4K9DA 1DBVO 3VM6A 1ZD5A 3CRNA 3IOMA 4L08A 1DXOA 1T3GA 5CMLA 2FVYA 2ZSKA 1TKRA 1ZONA 4HG2A 4L78A 4GX0A 4A36A 1QX4A 3TSCA 3O03A 2XF8A 3E7DA 3P45A 2XE7A 3DCYA 5G1OA 4MW2A 4PC3A 1QIGA 4QPDA 4TTRA 5JI2E 1T0PA 1AUQA 2ZBVA 1P9WA 4DIMA 3EXFA 1W2WB 5AW7A 5KTPA 3T5AA 1I3NA 2RKBA 1TMKA 1ADJA 3COWA 3BMCB 2HQRA 2OM6A 5A9SA 2UKDA 1E2MA 3DBHA 4FDLA 5C8VA 5IASA 4FDTA 1KE1A 5ALOA 1P2UA 4QGAA 3G1UA 3TW4A 5ESXA 1OBOA 1Q22A 3R6DA 1SUBA 3MTAA 4OHZA 4F4DA 1GUAA 1C14A 4OQMA 5AYVA 1MEEA 3SLRA 2E21A 1OAOC 3O1LA 3P9QA 1I6KA 1QC5A 4U5QA 3PXEA 1ZZEA 1P0IA 1VYHA 2HIHA 1SCNE 2WUFA 3FHCB 4OH1A 3MBOA 4Z4CA 4XR4A 1A9QA 5CUQA 1L4LA 2WFZA 2ZTLA 2JFHA 4QYTA 4C0XA 5KSZA 1OGIA 2WSYB 3L1KA 1KBOA 3SFZA 2OCGA 3H9JA 1NJ5A 4QOJA 4CT4B 4XWAA 4ZI3A 3FRIA 2VXOA 4WEQA 1TM7E 2B78A 10MHA 3DUFB 2HBZA 4A7PA 2EWMA 4WLUA 3G17A 3T8YA 4L4RA 4Q03A 3ZZ0A 1CD5A 1YFKA 3ZY4A 3KYBA 2OBXA 1JNYA 3MT8A 2XMPA 5EZSA 2WPNA 3HJTA 1Y1RA 3HXKA 5CTJA 2ZCJA 5KQRA 2YDXA 5IVKA 1GYPA 3OLXA 4XH9B 2O8NA 1GU7A 1JEYB 1MN6A 2PK3A 4K9RA 5K8LA 3G2PA 4MR8B 2B2XA 3JQBA 2FZWA 1A2OA 5DBOA 4YUAA 2I7TA 3QELA 4YT2A 1AF4A 2DR0A 5JJKA 5SY9A 1W0CA 1NR1A 3ILYA 4YALA 4AUKA 5LMZA 1FSZA 3TD9A 3VI4B 4ENUA 4FFBB 4KDRA 5JW6A 1VKOA 4TV8B 1NOIA 5IWCA 4QYIB 5K7SA 1A7KA 1UT6A 3IP8A 1HLFA 4CF6A 5KSYA 5EERA 4FYJA 3JQ7A 4J2OA 3U16A 4RZIA 3DCIA 4CMBA 3UF0A 1RQRA 5C4MA 4R8SA 3ZNQA 3T7JA 1NVTA 1Y6QA 1FSFA 1Y3IA 3THXA 1GCUA 3CZRA 3AIMA 2PZFA 1IM8A 3CGWA 1A9ZA 3LC1O 1ZC4A 3QX8A 3E18A 4G0XA 4Y2PA 4QEKA 3SIXA 3U4AA 3WG9A 4DCCA 2NU6B 3PC3A 1Z33A 2LTAA 1V1RA 3H5AA 5EMMA 4DLUA 3ZXUB 1SPXA 5BUCA 2V74B 3F7TA 4EPYA 1XKLA 3FZYA 3E9EA 2J08A 5DI9A 1EE2A 1I2BA 2QZSA 3GAZA 5DCUA 3JD1A 4NV3A 3H5VA 3LT2A 4ESVA 5CYOA 2GD2A 4W5QA 4V3BA 2A8YA 3LT1A 3TE6A 1DXHA 2JGIA 3I6QA 1E2EA 1F6DA 1P7PA 2V4MA 4IIUA 1PYDA 4C30A 3SD7A 1T2AA 4YJ3A 5F64A 4IWXA 4J7XA 3Q9LA 4UQOA 5K6AC 1CUAA 3K2IA 1XHEA 3IJ5A 4R98A 5FA6A 1ISHA 1M8PA 2EP5A 4GOOD 5IDYA 2PR7A 5SY6A 4GDFA 1UXKA 3EZ9A 2G70A 2QG6A 1PYOA 1RAGA 2ZXEA 4YMIA 4A8HA 3QPWA 2RH8A 3QYPA 1UBCA 3WKCA 5M29A 4M22A 4CR7A 1HX7A 1Q1BA 3L8FA 4P35A 4N4AA 4XPZA 2J5BA 2WABA 4DG9A 2AX3A 2WG0A 2ZRMA 4JI0B 6Q21A 2YJ5A 4FFPA 3DJFA 1S3GA 2VPQA 2PWYA 1CP2A 5HA5A 5LQDA 1G5QA 4OD0A 1D1TA 4LAFA 1A76A 3X2EA 3CB2A 3QBJA 5JNTA 3HWWA 2ZZNA 3QJGA 1QE5A 1T3ZA 2QE7D 3UJ9A 1Z5PA 2FHSA 4M89A 2OR3A 3RYCB 3OESA 4HDKB 1I10A 3IB6A 5CNJA 4GMHA 5IARA 1PR5A 1X0XA 1F2TB 2HMTA 2O52A 5FPPA 3ZXSA 3WHKA 2LCQA 4NDNE 3FHTA 1NRIA 2LP4Y 4K3UA 1FMTA 1HZJA 1T13A 2BEUA 4FSHA 4IZ6A 4YJGB 3T9AA 3LQRA 4D3XA 2O2SA 5JEDA 3UGJA 5DM4A 1WXEA 3SIRA 2P4UA 8ADHA 5JOQA 1HDCA 1MRZA 2FNAA 2VNAA 3BWYA 4TL9A 2QPLA 4RGBA 4NCBA 3EEBA 3N0RA 4X5OA 1EP9A 1G64A 5INTA 3KTAB 3FCEA 4FDVA 1FC0A 2NGRA 1ISGA 3OT1B 1JT9A 5ISMA 4GKAA 1F2UA 1MC8A 4MEAA 4BQPA 3IB3A 5AM0A 3HB0A 4X41A 1CFJA 3B3FA 5D5HA 5HX7A 4ND1A 3S8YA 1JDUA 2VA9A 4F11A 4U9IS 1MABA 1SBHA 1FQJA 3N87A 4UXHA 4N76A 5AO9A 3W7VA 1YS6A 2A0KA 2I4OA 2BL4A 3I61A 5F98A 5A0VA 1TGVA 2VUHB 2R1TB 5BT8A 1YRAA 2DY1A 2HSJA 3OLVA 2ZR7A 2Q9BA 4H7JA 1MIOB 4GE0A 1H3EA 4ZCIA 3AUFA 3HGQA 3FKSA 3JCZA 4Q9DA 2ZCVA 1QR6A 3B7WA 1J2JA 1MAHA 3RUIA 5D6NA 2QTVB 3JZDA 2BC9A 4CLEA 5GV7A 1EX6A 2QIOA 5KSOA 2P6UA 4TLMB 3U5ZB 1F4PA 3ZGOA 1R3DA 1RPJA 3HY4A 1JJFA 4LC0A 1RR6A 1L6IA 2P6PA 3HFSA 4QQFA 4Z1MA 3V1MA 1RVV1 1Q1GA 1PRYA 1SIOA 3AESA 4QIHA 4D0LB 4BEBA 3GDFA 5J47A 2J30A 3KKNA 3SS8A 5G1PA 4CN8A 4CV2A 2NM0A 1C0IA 4JBWA 2HR1A 3V1NA 5ALUA 3GJZA 3SYNA 4G4SO 4ZDJA 4AY6A 3PNMA 1Z6YA 4W5TA 1KRXA 1I6MA 2RONA 3B9RA 3BMXA 1E62A 1Z4MA 5ALTA 5EQDA 4MUHA 1YI8A 4EJ6A 5M5BA 1KJIA 3KPYA 2ZIGA 4FSXA 4WKNA 1ULAA 5CB0A 3PF8A 2AG8A 3UMYA 5IDXA 1J9EA 5EZYA 5T57A 2Q45A 2X86A 2XDWA 3GLRA 3BTOA 3IJPA 5BNWA 1E9EA 4B4WA 1EM6A 1JFSA 7GPBA 3DVAB 1NMQA 4WXPA 2OUKA 4AN0A 3GEHA 4WY5A 2B61A 3RYHA 3R20A 4IIDA 1QUEA 3B5IA 3G79A 2I7DA 4PQEA 3DL7A 3CLHA 5FOVA 4BN5A 4DMGA 1V16A 1OE0A 2RGNA 3L0BA 3UA4A 4F1KA 3VZRA 4DSZA 2J3QA 4KR3A 1SG6A 3A25A 3JASA 5GVSA 1SVOA 3KCNA 1WQ1R 4GX2A 3HCEA 4HXFB 1T36B 2V6MA 3S2SA 4MARA 3UFBA 3Q3JB 4TTAA 3EZ2A 4JEUA 1AS2A 4P7GA 1LX6A 1Z5NA 1IBKB 2BBOA 5JD6A 4NK4A 3RHSA 3SX2A 2DERA 4BLWA 3EIHA 4LZWA 5CITA 1O6CA 1T4DA 3M5DA 3DYVA 3CRVA 3FSGD 3WBBA 5KU1A 3E2PA 4DTIA 2IXBA 3M1LA 2V3CC 5BQXA 1SA0B 5D2CA 1B6SA 2FW1A 2JD2A 3QVUA 4G9EA 3S8EA 2C97A 1W581 4O0LA 5HF5A 1GGFA 1A4IA 4G0NA 3RC8A 2O1XA 4Z4FA 1IZ7A 1IDOA 1PG2A 2GERA 5JISA 2FW7A 2WICA 3CRQA 3H5RA 1GIAA 3EB9A 4HQKA 3U37A 5JAZA 1KIMA 4G26A 3CFYA 1OKKD 4DMLA 2G63A 3L77A 3SJAA 3AWDA 2RE8A 2C8JA 4B8YA 3ADPA 4PHCA 5JDIC 4JIMA 1QGED 5AVSA 1T1GA 4B6JA 2GZSA 1U0FA 3V8QA 3W6ZA 1KI6B 2ORVA 3DVAA 4R71A 2P5UA 5DNWA 1RCUA 2ORWA 2IHZA 2NV0A 4IIJB 4TQ9A 1DKMA 2H1SA 2H07A 1WZIA 3KHSA 2AEJA 3EVEA 3KZXA 1EFDN 4RCYA 4KVGA 4N0EA 3THOA 4DN6A 4KR0A 4EGAA 4A16A 1XZGA 3RO7A 2A3RA 1D7AA 3EYAA 4F2WA 4UXJA 2HMAA 2NAPA 1IEWA 4JBHA 3TTXA 2MSEB 1BXGB 3OEYA 4AN4A 4YB8A 3DMTA 4BBAA 1A4XA 2WU0A 3QUTA 4AZ0A 1I1OA 1EG7A 1Y42X 3ZHRA 1S2DA 3G2HA 2VHVA 3ZGXA 1R9NA 1GG8A 3AVOA 4XFJA 2VH1A 4RA6B 1YS2X 2A0FA 3WA7A 2FPKA 3QK7A 1L3CA 3O91A 2PD6A 1A7UA 2RHDA 3FSGA 1AHNA 3AESB 2QQ5A 3C87A 1WVMA 1SXPA 1Y6JA 2WU3A 4GMXA 2ZM5A 4JOQA 3A0RB 1HE4A 1WHTA 2B25A 4I66A 1FZQA 1YJQA 2R7NA 2R4QA 3L6CA 2ORYA 1SM4A 5JZMA 1V2GA 3I1YA 4B6OA 1KEEB 3IUEA 4C7VA 3CLRC 2OG2A 3KUCA 2DGDA 4U3JB 1FFAA 1E3QA 2YDYA 1L8LA 1N5RA 5DX1A 1ISMA 2ZQYA 4CCWA 4BEJA 4U2KA 2X0NA 3NV7A 3F71A 5F2OA 4D25A 4RA9A 1Q5PA 3GT3A 2QTFA 4G5YA 2QMUA 4Q34A 1BROA 1VTKA 2OTCA 1WO8A 1OJ7A 4BNJA 2LIPA 3DC2A 5IU6A 5MDHA 1GITA 4QSMA 1I9CA 2WINI 2X8AA 3O47A 4UNNA 3MT0A 4QLBA 4YRGA 3D31A 3X1MA 1G4HA 2NO1A 2ZSEA 3UJNA 3I6IA 4YAKA 2UXDB 3F6RA 1IQUA 2PLFA 4J0JA 1QIDA 4M8SA 4B46A 1EEXB 4EHAA 2G06A 3MWEB 1QAQA 3R0VA 2BKAA 4H7KA 4GOKA 4ZVNA 4EI2A 1AKMA 1XQ6A 4PR3A 4EG6A 1SKMA 2RC5A 2UUPA 1FRFS 1VG8A 4R8LA 4ZEOA 2PA0A 1G20B 1H4SA 2JFNA 2K6GA 3DHWC 3DEZA 4EX7A 2WAMA 3FFXA 1WCIA 3D43A 6AT1A 5CB4B 2B36A 3LCVB 2HXYA 3D2AA 3Q3IA 1DQYA 2GCPA 4L16A 4MPTA 4NBKA 1GLGA 4FCTA 4REQB 4XEUA 2I9KA 4FFBA 4KIUA 5DSTA 1VCOA 3HVHA 3R3HA 5JSYA 3TPCA 3I01M 2GEDA 1JTEA 1P6UA 1EAYA 2XUQA 3D9QX 3DE5X 2IU0A 3E9NA 5IAJA 4MP8A 3JAMA 1XNRB 3UJDA 4B45A 3I12A 4WZAE 1P2DA 1ZH8A 3C7KA 2F3TA 5DGHA 1G16A 3HLYA 4RZSA 2QZZA 4HGZA 4ON9A 1BCSB 1NZJA 1E5VA 1OGYA 3IQGX 3BXHA 3FROA 1VHTA 4ZI2A 4ZYXA 1G8MA 4A4DA 2XNSA 5AW4A 2B5OA 4JUCA 2HNBA 4R9RA 1W5FA 2ZATA 3ZDDA 2WFMA 2BEWA 2VSFA 3GBVA 4HH3C 2WVGA 4FKZA 1B2LA 5DIZA 2C1EA 3TNYA 5DZSA 3SG0A 1M8GA 3B13B 3PHLA 1CUFA 2WUWE 3J80A 1SRQA 3UICA 3OZ7A 1HYQA 1QFZA 5CDHA 3RPEA 4EFNA 5THXA 4PN3A 2YNMA 1A9PA 4PYIA 4WCVA 4D4LA 4ARUA 1UMCA 1ZJYA 2O2IA 3ZDCA 4BLQA 3KFVA 1DWQA 3OIFA 4IDBA 3BSFA 2BR3A 4JXXA 3QQPA 1J22A 3HKEB 3OQJA 4MVJD 4S1WA 2YOGA 4EI9A 4I5GA 7ABPA 3O8QA 5KNCD 1H2RS 2HIGA 1FUYB 2HIMA 1PJBA 2P9GA 2QROA 4RVNA 3ET5A 4BNUA 5CFNA 1FUKA 3EZXA 3HTXA 3NNSA 2H4WA 3B38A 1AQUA 2IUYA 2P3SA 2ENUA 4OA8A 3AUKA 1YHNA 1XTJA 3EXEB 4W82A 2DWQA 3AL3A 3RTEA 2EKZA 1A88A 3OQMA 1GQYA 3CLTC 1X80A 3JQFC 4WAUA 1BXKA 4CPDA 4EG1A 2B37A 1GAEO 2YS7A 3D6UA 4XM2A 5FLYA 5GM1A 3HDQA 2J87A 4HY3A 2QX4A 1QYDA 4M0EA 1ZM3A 1Z34A 1KIAA 2I4NA 4GMDA 4M8NE 1P73A 2B35A 1JDBB 3ZS9A 2B4YA 2PTGA 1M6HA 4UCWA 1AGPA 1ODJA 2OD7A 2ZG6A 1T4GA 2QNIA 3K6KA 4KB5A 4L1KA 4GG1A 3GRYA 3DEYX 4O8CA 2QSZA 2FX5A 1GGKA 5LBUA 3QWAA 1OWOA 4XVRA 3AWIA 4FX5A 1VHQA 2JJ1D 4TTPA 4DJ5X 2WWWA 5KCZA 1KERA 4N7JA 4V0KA 5IM5A 2ACKA 4M0MA 1RPZA 3MTEA 2FN7A 5H7XA 3G5LA 4G84A 1KMHB 3OWXA 4RF2A 2HV9A 5LZ9A 1WIWA 2FB9A 3A1CA 3X0DA 2FZLA 1IPEA 1GNQA 4JVNA 5KTOA 3PD0A 2PAFA 1J99A 2WD8A 3WIVA 1A27A 1PUIA 3VBCA 2C95A 1C3LA 1FP1D 2ZXFA 3AEZA 4JP1A 4M98A 5HF9A 5BQFA 4R81A 1DV2A 4HXYA 1G6OA 1ZESA 2GKOA 3QHQA 4M38A 5DJ5A 4BV3A 2F1IA 2ZEJA 2ZYSA 1OFUX 1TLTA 1VB3A 2FEAA 2O3JA 2JIOA 5CVEA 2RJ3A 5F4ZA 1TYEB 3GLIB 1BDJA 2Y93A 3DAHA 4LHEA 3FSRA 5EL0A 5ADHA 1JIVA 3Q5EA 2GD1O 3WK5A 2HRZA 4PZ9A 3ZBTA 3DE6X 1VBNA 3GZNA 1UBUS 2FPXA 3DBHB 1I7SB 1PJ2A 1BRMA 2JBHA 3RU3A 3NHZA 2C5FA 1E9RA 1BWSA 2R6DA 4FN4A 1DLIA 4KJXA 3ZKWA 3ZNOA 2KI5A 5ALEA 4YPVA 2RGDA 1FA9A 4NNJA 1NUUA 3NEPX 2V55B 1Z6AA 3INGA 4DMUB 5EYPA 1CRPA 3AILA 5EEGA 4GMFA 1E4EB 1L4EA 3DNFA 2Q1XA 3DYIA 1WG8A 3RBVA 4CL0A 2GO7A 1V8DA 5LQNA 5SYNA 4KN8A 1V95A 2CVFA 1TCBA 2AC4A 3IH5A 1CE8A 3M70A 3C16C 5EJFA 4A0SA 4QVGA 3NBUA 4AZWA 4ZZ1A 5LYJA 3T61A 3G1WA 3OFND 5JJBA 4F86A 3MJHA 4WY8A 3F4KA 2VF7A 4OA5A 1M1NB 3PLRA 3W6UA 4HOYA 5THQA 3O8NA 1RFGE 1QUFA 2M1ZA 3N5CA 1UBTS 3NHSA 4C0AC 3QLVC 1OILA 1V1MA 1ZIOA 1AQIA 2VUUA 3OE5A 4BV8A 3AFOA 3CE6A 4GP6A 2RHGB 1L5OA 1QS0B 1W6UA 2C3YA 3GN2A 4JR1A 4LJKA 2WAXA 4OAOA 1RBYA 2P5YA 4F9TA 4JJAA 5DBFA 1X8JA 2DPXA 3Q1KA 4IJQA 3L7AA 1BOOA 2ODTX 1BIFA 1LFAA 4P3NA 4ZRNA 1T9DA 4MAAA 1O9BA 3HXTA 4HX9A 4ZO4A 3SZRA 3BEDA 2QPAA 3QOXA 4RWZA 4AJIA 4RF3A 2Z95A 4FIDA 4C5BA 1TLLA 3A3PA 3CT6A 5TQVA 1CVRA 5DP1A 1KIFA 2BUAA 1KBZA 4K87A 1JFRA 1D2CA 1PGQA 4XYMA 3UANA 1TJYA 3R44A 5L6LB 3KKKA 1TJNA 4UUNA 3RVPA 4A73A 4KQ6A 4K40A 2EHJA 4CCAA 1U2ZA 4ERNA 4EYEA 3QOWA 2KWIA 3A0UA 3C7AA 3DMDA 3A4VA 4MS1B 4DLZA 4AX8A 1AK1A 1E3IA 3W2TA 4HKTA 4DXHA 5FWNA 4EVIA 5F3DA 5LYYA 1FDTA 4L4YA 1JG7A 1KKUA 2O8CA 2NYRA 2ZJ0A 3CT4A 4P2BA 1T5HX 3DR5A 4MS1A 1H66A 2VWPA 1ZK1A 1PJTA 2QAIA 4XWTA 1VSQA 1HKHA 1AN9A 3NOVA 4EQ6B 4A6DA 1JFFA 1NQOA 1PWHA 1EFVA 2BFPA 3HHPA 2EEZA 1N5OX 1R5NA 2OCBA 3L8HA 4FBMA 4RGYA 3OG9A 3SEAA 3CG0A 4BBPA 5T8KA 4N82A 2BCJQ 1DELA 1S96A 1W87A 2JGMA 2WRZA 2V5AA 2ZYRA 2X4LA 2HDNB 2JKVA 4FZ5A 4D97A 1DJMA 3K8YA 3WK9A 3E58A 4RF5A 4EUSA 3LXUX 3S2ZA 1S02A 3FM9A 1N92A 2DT5A 1P1KA 1PDOA 2R68A 4AWXA 3ZHVA 2ERCA 4CUKA 4YJDA 2QSYA 3KZOA 5A6SA 1DWPA 4HO1X 1UBFA 2O7VA 2YIVX 1GNPA 4WVLA 5C51B 2O0MA 2E4UA 1XZPA 3BB3A 1EZ1A 5ALQA 4JSRA 4NBVA 4BVAA 3I2IA 3LDAA 5HSGA 3OM1A 2P2DA 5B12A 3K0BA 1HETA 4WOPA 1FYEA 4ARVA 1EDOA 3ANMA 2IJGX 3AW8A 4ND7A 2CV1A 1IONA 1VE6A 3DVLA 4P5PA 4D6XA 5AUQA 1WZEA 3H4TA 3QU5A 1TM2A 3PL5A 3P26A 4TYNA 1TAQA 3R23A 2G8LA 4TT3A 4EG8A 3ZWCA 3M6VA 2J9RA 1NONA 1TC2A 1VG1A 1D6NA 4Q1CA 1VG9B 1Z28A 3T4XA 3ZIAA 2NP7A 1N6PA 1FQWA 2ENWA 5IKOA 2OQVA 3MYYA 4PVDA 1W1WA 1JU4A 2VL7A 1V7QA 3GRRA 1YDWA 2BFFB 1JB1A 1COWA 3FNFA 1XE3A 4AZ3A 5JI3E 2UZAA 2Q29A 5IABA 4LBYA 2QJTA 2OVBA 2PS0A 3JD3A 3M6XA 5BQPA 1P1RA 3K9HA 1R6DA 2A35A 3WZMA 3U19A 1DBWA 1W8IA 4IEEA 2PLWA 2QGFA 4IOJA 4CFYA 4Z0TA 1WDLA 1EVQA 1E5DA 4CEIB 1JHXA 5F7XA 3KL2A 3D4LA 4B31A 5KVAA 2NACA 4KIGA 5L3RA 2HLPA 4LECA 4MWDA 4LJRA 1TDJA 3C5VA 4GR4A 4X6XA 3G9QA 2C3PA 2AV6A 1WETA 3IDFA 1G7CA 3DAYA 4LVOA 2FP4B 3IQDB 4KK3A 4P4GA 4UM9D 1XP5A 2C04A 3GGDA 5DE3A 3TPZA 4X90A 1Q77A 4KYIB 1NN3A 2F43B 3BWBA 4TL6A 5ENVA 1J00A 1Z22A 1M7HA 3GJYA 4KBYA 3ZYCA 2XUFA 1GL6A 1BCRB 2B7BA 2ZJ4A 3KEOA 2LCIA 1ZCZA 2NP6A 1CLEA 1NBIA 2EBHX 3BC1A 1M2JA 3PNOA 4MX8A 5KDLA 3VR2D 1K9SA 2CMGA 1E1MA 4IS3A 1RXWA 4FFOA 4DILA 4TYMA 2LBPA 2VJYA 4TV8F 1T0HB 1Y7PA 3Q8MA 2IH4A 4XAQA 2J3MA 2BP7B 4TUYB 2B82A 1NNUA 2GBLC 3UTDA 1Y8RA 2YMLA 3UMFA 4A6PA 2FAXA 4DC9A 2Q3BA 1KARA 4XSGA 4MKZA 2ZRBA 1P91A 2WJ4A 3ZCTA 4BO7A 1HSOA 2CL7X 3HI4A 1B8OA 5TF4A 1KFEB 3WLMA 2HM7A 3I5MA 4FINA 2BFAA 4YRCA 4B6PA 1M6YA 2OQIA 3AYZB 3I01A 4HYQA 1QRTA 2R8BA 3B6KA 2A7XA 4JR0A 4MJ3A 4Q1EA 5AW3A 3IE1A 3JQ7B 1NP6A 1NLUA 3AB8A 1F6WA 3ETGA 5J2UA 1Y4UA 1KJQA 2GFQA 3P0RA 2BJHA 4OP1A 3G0HA 3L4BC 3NV9A 1YQWA 2XSZA 3ELWA 2Q7OE 3R8XA 4WHMA 5H0IA 1I6LA 1WEKA 3KQUA 5KOIA 2HU7A 2PZLA 2YRXA 4JLAA 3C97A 4O1IA 1R4NA 7AT1A 3U3MA 1QVAA 5JNVA 1CRQA 1W44A 3RIYA 1T9GR 3GF4A 4OK6A 4RK6A 3ZX5A 2YYYA 1ESDA 2CK3D 1PF7E 2ZDQA 1IK4A 4JJEA 5ALLA 3PK0A 5FB3A 3UK7A 3WLAA 3EY4A 3ZCRA 5LP6F 4EHJA 3THWA 1S5PA 3LGSA 4IHJF 3F3MA 3H2IA 4A8TA 1SHUX 4CMIB 1F8GA 1Z3CA 4NJEB 1G4AE 3E9ZA 2ATVA 1R0BA 1W73A 3A4LA 1PEYA 4F2PA 5AXDA 1U65A 2I3ZA 3KAJA 3LW7A 4I5FA 5E7QA 4D5GA 1U2PA 2ZWPA 1JLKA 1YU9A 3H1EA 5K4HA 3N07A 1M34A 1CJUC 5DEOA 3OZGA 3JATA 1YE3A 2JI6A 2R5NA 3OICA 4BPBA 5EPEA 1PNTA 3KYDA 2NO5A 5EMNA 4DEYA 2QD1A 2B94A 4IIFA 5BSVA 2E55A 2J32A 2CHQA 5BUSA 3ZCUA 4WZ6A 1RAEA 4PAMA 5D87A 2HUNA 2JANA 2OXRA 3OJ0A 1QLJA 4FWTA 1HORA 1ZOPA 2Q2NA 1KETA 4G5GA 2ZVQX 1DKUA 3L1HA 3WGHA 3ZWYA 1ESMA 2FA9A 3E70C 3SK0A 1NZDA 1B0ZA 1NKSA 1PLLA 3ESDA 4HRVA 3ZLVA 4UOEA 1RYZA 4U2FA 2NO6A 4YYZA 3DV9A 3E61A 3RKRA 4FNGA 5LLDA 1XQ1A 1Q74A 1ZN8A 1BGXT 4G81A 2AL7A 2AFIB 3EXHB 3MD0A 2XCRB 1IBRA 2D7DA 2OV1A 3GOQA 5JD4A 5KC8A 5CK4A 4M36A 1KHTA 3GJ6A 2FWAA 2DECA 3V8VA 2MSKA 3G3EA 4P83A 5B5SA 1RRKA 3PGJA 1R4MB 4PRZA 3U7RA 3ZHUA 4QUEA 3EIQA 1A1VA 2EGHA 2IF2A 1YZFA 3V55A 3EE6A 5CA1A 1D7OA 1TPYA 2WTNA 3H1FA 4GW3A 3GLSA 4Q5IA 1OH7A 5I7WA 2WJZB 4LYAA 3U4MA 4OG2A 4DCTA 4NYIQ 5BMVA 3VPFA 3FXAA 3H87A 5JO9A 2IPLA 2NXNA 3UCEA 3PQ7A 4NYJR 1JR3A 3Q8XB 1RACA 4KXWA 3JQCA 3RU2A 2R1ZA 1WP4A 4W5RA 1H1LA 1PD1A 1WQ4A 2J9YB 2Q62A 4Z53A 1CS0A 2WJ3A 4W9NC 3VVLA 4HVAA 4X7BA 1RWMA 3JARB 4X24A 5TT0A 1C4KA 5FWXA 4X3CA 1B0UA 3EZLA 5ESDA 1UWVA 4B4VA 5JASA 3BRWD 3I5UA 1V43A 2QVZX 4ANFA 1P77A 2OFWA 3IX7A 4ZOBA 1V11A 3EDCA 1P1HA 3RIEA 5KYYA 3PQEA 1ENPA 3G88A 2PR2A 1WV1A 3FMGA 1YA4A 2XTAA 1Q7EA 3FGOA 3SJZA 3ZHQA 1TUIA 3R9XB 4QQNA 2VG8A 2FUG6 2QWXA 3G0GA 2RK3A 4KLRA 4O59O 1CETA 5E6SB 3WBKA 5L51A 3ZVKA 1PKXA 2I7VA 1YRLA 1V1JA 2WB4A 1U3CA 4PYLA 4QPNA 1TO1E 4BFUA 4EFMA 3N2GA 1I1HA 1VHDA 1YL7A 3WLQA 3EODA 4O4LB 3VHQA 4EQ6A 2WZBA 2VDRB 1L8AA 3A9TA 3G8DA 2XZOA 1E5QA 2OOSA 4FR5A 2GESA 3M3HA 4MPPA 1PGOA 2HMSA 5DYTA 2JNWA 1Y3BE 2WT9A 2IH5A 3ABZA 2FUEA 1T25A 1UUFA 1SC1A 2VCEA 1YR1A 4ZTZB 1ODTC 2HJVA 5DF1A 2OMKA 4RV4A 3WGQA 3GG9A 4FCCA 1GRCA 4DA0A 3R5TA 2OZKA 4I1OA 1W4LA 5EQTA 4KRXA 5AP9A 1UJ4A 4GPD1 3L4BA 3TL3A 4IQ0A 4EEKA 1MR3F 3EGOA 4LJ4A 2B0CA 1QYXA 2Y4OA 3QW4B 4G65A 4YCDA 5CH3A 4ZOEA 3SKVA 1JJBA 1P2SA 4IDFA 1ZJ6A 4KNVA 1E32A 4LQLA 2QR2A 3L9WA 1LPBB 4EHDA 1P8JA 2B2CA 4XVUA 3KE9A 4JSYA 2H00A 2EW2A 2P9EA 3O6VA 3AI7A 5CM2Z 4K1LA 3TVDA 4ZYYA 2SNIE 2CF5A 5TEWA 4QBKA 4ODIA 4HAVA 3JVDA 4B1FA 4XJVA 4KFCA 2BAGA 3HRKA 3UXMA 1VI5A 4PAGA 4AQDA 3WKDA 4O8ZA 4LF6B 5ALXA 5JSHA 3KZVA 3ZLBA 2VLBA 2Z2IA 3OX3A 3I9V1 3C6BA 4ZALA 3TFQA 3TZ6A 2C2MA 4B3DA 4E33A 3ICQB 3MCUA 4J4HA 5CYFA 4XE5A 5EJ7A 5L53A 2FPSA 4OHUA 4WZBA 2DUWA 3MELA 3FUVA 3GGJA 3TIVA 4IVQA 2XRZA 2C9DA 3P5BA 3EFEA 3JQQA 3OQVA 2R8EA 5ITZB 4L8FA 3WR5A 3MTJA 4ZGWA 3CB4A 3D3QA 3ZIDA 2WE7A 4R5HA 5AHKA 3PDIA 2ZR9A 3VR3A 1GM5A 4KAAA 4A0RA 4QM6A 4BC1A 5KYWB 2QHXA 5CG2A 3ZW9A 4XCXA 3AR6A 1JSZA 5DIFA 3GLGB 1IZ9A 2VDQB 1WMBA 3KYDB 2IUFA 4FMPA 4GPIB 2JJ2A 4UAGA 1JIIA 4H9GA 3VI3B 4DQLA 2EX4A 3ZU5A 4NG4A 1LBIA 1N4AA 5JCZA 3PDHA 3QU4A 4FR0A 5K4GA 3OEHD 2VEDA 3R6WA 4C06A 1QM5A 2IYZA 3CZAA 1XC7A 2CFTA 4IDNA 1RAIA 5AKHA 3RB8A 2O8EA 4PR0A 4DG8A 5EYPB 1TXGA 4RZUA 2Y8EA 3GVIA 3LRTA 1JYEA 1FYDA 5IXJA 4I50F 4XWWA 1K98A 5JMWA 4B9AA 4TN1A 1UXJA 3LQ4A 1DAGA 1GCGA 3ISJA 3PYLA 5J5CA 1MW9X 4UNRA 4KLZA 3LVFO 3MRXA 1I3KA 3I6BA 2FPIA 1WSDA 4RY8A 3CWCA 2FEXA 4W6QA 3FJYA 3H16A 3H5LA 3T7KA 1NWHA 3QVMA 4YR9A 4GUDA 4IL5A 2Q4DA 4QGGA 3V8NA 2GUGA 4Z0PA 1FJ2A 1NYLA 3S1SA 1KF0A 2QG9A 5K0EA 2I7CA 1LBSA 1RBQA 3QH4A 1S89A 1EFHA 1YB2A 3PI7A 3ZEIA 2A5YB 4DV7B 3FOCA 4ZYLA 2HC9A 3HP4A 4HLCA 4D9JA 1T4MA 2P6NA 4YTEA 1GPAA 2P27A 3B6IA 2ZITA 3G5TA 4HWSA 4D2IA 4DLAA 1NVFA 2IDMA 2N3ZA 1T0IA 4UVGA 2DB3A 2BELA 5LPNA 1CUDA 2A0UA 1NNLA 2QD4A 3E3MA 2FGJA 3L01A 3OLZA 3K6SB 3IL2A 4B4OA 1FYXA 4I4TA 3OFSA 4GLFA 3P19A 4NPHA 4C0BA 5EHNA 3N6RA 4U7TB 2WMDA 2ZJZA 3CF6R 1NJSA 2WJGA 1WUYA 3PGXA 5DBIA 1H0RA 4E5PA 2QTTA 3HY3A 3U3DA 1GPJA 2QN7A 3PX2A 1VCNA 2F90A 1FLDA 2Q3LA 2ZRQA 3AY6A 4ZAFA 3RIGA 2R0QC 5T8KC 5JH7A 1XTVA 2Q5EA 4I1RA 5EJMA 4QGSA 5AKZA 1HYEA 1UWKA 3OJEA 1G5IA 2BH9A 3FYSA 2UZ0A 3VC2A 3R5JA 4EUKA 2CW5A 1LLQA 1DIRA 1ORWA 2XKAA 3NC4A 4DEVA 4B34A 1UDCA 3WTBA 2Y71A 1B8VA 1LQTA 2AW3A 3OC0A 4AMYA 5ELXA 3KM0A 3LHKA 4ETWA 5LA6B 4LNAA 3JSAA 2H1FA 3QFRA 4AK9A 1S8AA 2H4JA 5KYTA 3M1YA 3SAJA 1IB6A 1T5IA 3DAGA 1VI6A 3QF4B 1O6GA 2GILA 5C81A 3BL5A 4FK8A 1A8QA 1U3VA 3I9JA 2NXJA 1OREA 3DJYA 3L46A 5E4YA 4YMLA 1KXJA 1QO7A 1G3RA 4M0LA 3C14C 3FUWA 4BX2A 2O2CA 2ZIFA 4XGNA 2R7MA 3JALA 3UNXA 5DRTA 4A3SA 5K0BA 1CJSA 5G40A 1YJBA 2JLCA 4S12A 3UAOA 4YCLA 1VSTA 1NXVA 5BT9A 4LFCB 4OU5A 2JI7A 4L8YA 1B6RA 3GLGA 4JC5A 3EXG1 5IH3A 1XKQA 4F4JA 1HT1E 5JR3A 4RMNA 1T0BA 4LF9B 2YZGA 5K0TA 2C4VA 3ZQ6A 4F8EA 3SC2B 4ZICA 4OGWA 3TM4A 1RXYA 2BZ0A 4ZVLA 4RDXA 2QQFA 3OPYI 4L75A 1RXUA 1Z29A 2IU4A 4E5YA 5IM4F 1NVAA 3FOEC 4PG6A 3VU9A 4PO1A 2PUVA 2XX3A 3HLKA 1G8AA 1KAOA 4WK6A 1FE8A 3D7MA 1LBQA 1XI2A 3GVPA 1ZMBA 3VNVA 1FW8A 2I34A 5ICEA 5KTRA 4AKGA 1W94A 2ZS8A 1U3WA 3R0JA 4LDQA 1VI2A 3GVCA 1TQHA 3ZVNA 5ALDA 1QRSA 2Y67A 3CU5A 3ABQB 5I7EA 1ZVMA 4G5FA 2QENA 3IR6A 5HF8A 4TZ0A 5KAMA 2CN1A 3SEFA 5GOZA 4B3MB 1KDYA 4CT0A 4IGIA 4C9BA 4B09A 2FZ4A 2IS4A 2AQHA 1XXHE 5FH9A 4HCJA 1O08A 3FETA 5HE8A 5G41A 4H16A 4F7DA 1L4BA 3LA8A 1M5UA 1FK8A 4GYYA 2NZWA 3PUXA 4HQNA 3O3MB 1KAGA 4RZQA 2D74A 3UAXA 4F5ZA 1BDIA 1LS1A 3MIIA 1IUKA 1PEKE 1Y3AA 3RS7A 3TW8A 3AP3A 4YWHA 2V8BA 4IZHA 1UKEA 3ZCVA 5KTYA 1JEOA 1ZPDA 1QH9A 1FUEA 1MC4A 1QO0A 4BRWA 4YR7A 1BE1A 5JSFA 2O8EB 3DLBA 3CRZA 3DBLA 3EWIA 4Z9FA 4MRNA 3OPXA 1WB5A 5ALRA 3ZOZA 4ZDWA 1Y1TA 3GX1A 3VYVA 4HWGA 4MVJM 4Y9SA 5DTIA 4YPOA 1O54A 4JYMA 1OZ0A 2CJFA 2GEKA 3VR0A 1LSOA 3OAAA 1K7CA 3OUTA 3UA3A 4JI8B 4BNMA 3TLXA 2XE8A 3LBNA 1R6VA 4L02A 2YZKA 3EHEA 5J59A 3WMFA 4DBLE 2C07A 3EQ2A 4YY3B 2OCXA 4BEWA 4LFBB 3PJRA 2C5LA 3PIIA 1QHFA 2BUBA 2BMFA 2INGX 3H2SA 5TQ2B 3B3AA 3FPLA 3FCUB 3FLEA 2QLJA 3CN9A 4BB6A 3PD1A 1BHSA 1H42A 1HEYA 1TLFA 2P2LA 4OQFA 1TO2E 1LI5A 2BOVA 4QXRA 4FM9A 3TKAA 1FPMA 4DJFC 3N8KA 1FJHA 3G9UA 1JXOA 2O2GA 1HF3A 3LDUA 1E7YA 4FN5A 1UPXA 5CM8B 2B1IA 2DYKA 3G68A 2H2HA 3K16A 4YMVA 2NUAB 1EVJA 1W2HA 1Z6ZA 4BKQA 3QVOA 1U8AA 3UZUA 2P9ZA 2V7UA 3I53A 3OQBA 4MH0R 4P8RA 5DASA 3RUCA 1N1MA 2OORC 3U26A 1SWWA 3WRWA 1Y7TA 3SR4A 1WLYA 4MA4A 1PZGA 4TWAA 5F9MA 2M9MA 1UQRA 2HU2A 2YXLA 2QJFA 1IXKA 1ZNQO 2W5UA 4OKSA 4JLNA 4BWFB 5AQ1A 2ZRIA 4ZODA 2IS1A 3N28A 2H8KA 3CG4A 3OZEA 1Q0QA 2WI8A 4NZMA 1MO6A 1CVLA 3DBVO 4II7A 1C9EA 4D9KA 1GTJ1 3P9XA 2NPIA 1MORA 4KRYA 3WB0A 3A4YA 4BXOA 1G21B 1ZW6A 1S8OA 3AC0A 2JASA 3D1LA 1ICEA 1VGQA 3OX1A 4O2AF 4YI5A 2GHRA 2WWRA 2ZI7A 3CKKA 3C43A 3F5DA 4ZAZA 4N5NA 5GGXA 2ECKA 1XNGA 5B37A 2NN3C 3LE8A 4WKOA 2J7PA 2JGRA 2YXPX 1U0HC 4F71A 2ONCA 5CJ2A 2BBSA 2I1VB 3CW8X 2QT0A 3RIXA 1UJCA 4MV4A 4NFLA 4RS4A 3QKTA 4KFTA 2Q3MA 2CZCA 4ENSA 5JCPA 3DLCA 1HE8B 2DWOA 4FHCA 4G0MA 2XKJE 3NC1C 3UK0A 3BERA 3R76A 3R5XA 3SC4A 1KZ7B 4NDAA 3KJGA 3GJSA 4DQKA 3FYUB 4BB5A 1UM9A 4TTIA 2DHEA 3W78A 4BY9E 4EY4A 1O6ZA 1T2CA 2JJMA 2G1AA 4HEA6 4PQRA 3CF4A 1MDBA 1ZD4A 3FSEA 3NMUF 5T3YA 4YLEA 1PAUA 3PNQA 4HNTA 1IMJA 3LA6A 3M33A 2CCJA 5JPDA 1PR3A 2BMAA 2QRJA 3ADOA 4X71A 3DTYA 3RTBA 1N36B 2RHJA 3C3KA 4OM8A 4U6QA 5A62A 1MF7A 1NFQA 3QLUC 4I3HA 1FXWA 1L7OA 2VXCA 4AYXA 1SOWA 3GFPA 1NBHA 2PGXA 4H77A 3EUFA 4JT2A 2UXBB 4KI7A 2E85A 3AJEA 3I3SR 3QXGA 2G17A 3ENVA 3BSSA 4L9AA 2Z30A 1LKZA 3MJ4A 1TK2A 4HX2A 2R11A 4IQFA 2YR0A 2JFUA 5I9BA 2E1RA 3P9YA 3A04A 4CR8A 1OA0A 2IBMA 2BGIA 2GDJA 3VNQA 5BQ5A 3WGGA 1E64A 3UJ8A 1JL3A 3FDZB 1BX0A 2GCOA 3N2EA 3F1LA 3S1AB 2Q6TA 3D3KA 2GRAA 1M54A 2V03A 3GJXC 1WZNA 3NAZA 4MV1A 4YAWA 5FOUA 3MAJA 3KKMA 3CSSA 3UCXA 2JJQA 4D8VA 5B2EA 2QLLA 1X2EA 1RMQA 5A05A 2BGMA 3X44A 3PDUA 4OY3A 4WK4B 4GF5A 1AZSC 2ORED 4M7WA 1NRWA 1O6BA 1U5BB 5GONA 1SKAA 2ZE5A 3N8GA 3ZWOA 1KEWA 1JFFB 3CURA 3RAFC 2XB8A 1TQ2A 3NHRA 4X62B 1WL8A 1NVXQ 3KZKA 3LWZA 3P2JA 2AHRA 3IUPA 3E7FA 1MT3A 2WR8A 4S1PA 1F12A 1LXCA 2AN3A 4Y1GA 1SVLA 4NNOA 5HZKA 4IO0A 4F56A 3HV2A 1YHZA 3WO1A 2XUDA 4Q3OA 2FEWB 2VDWB 1UPUA 1DKPA 1YCHA 4A1FA 3SHOA 1TW2A 3EMKA 3F9CA 3PGLA 2VHJA 3QNWA 4M88A 4WN9A 4AY4A 1ZH6A 3OCJA 1JH8A 2XYRA 4IXDA 4K28A 5C9ZA 5T41A 3LPAA 2I9PA 1R9JA 3HKBA 4QOSA 1Q21A 1FDIA 2I8CA 1KP3A 4DSOA 3L7LA 1F38A 4B2YA 4P4UA 3MJEA 4G09A 2HT1A 2CHFA 3KBOA 4RGVA 4YYEA 4BRSA 3CN7A 3HR7A 4G1FA 1W5BA 4GE3A 5JZ9A 1R7RA 3T7TA 4K9OA 2I76A 2O8BB 1QCZA 2WSMA 3TLGA 2HCBA 3V34A 3ZHCA 2AJLI 3OOEA 1Q95A 4ALLA 1QZUA 1YASA 1NBWB 3NJ4A 3JQAA 2O2EA 4ZANA 3T3EA 1NHGA 1SZPA 1WKBA 5I01A 3RVLA 1W48A 4LRSB 1IUPA 4F3KA 3ENWA 1QRRA