1G5RA

The three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
ERGIIIVFTGNGKGKTTAAFGTAARAVGHGKNVGVVQFIKGTWPNGERNLLEPHGVEFQVMATGFTWETQNREADTAACMAVWQHGKRMLADPLLDMVVLDELTYMVAYDYLPLEEVISALNARPGHQTVIITGRGCHRDILDLADTVSELRPVKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COB(I)ALAMIN ADENOSYLTRANSFERASE
publication title Three-dimensional structure of ATP:corrinoid adenosyltransferase from Salmonella typhimurium in its free state, complexed with MgATP, or complexed with hydroxycobalamin and MgATP.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 51
structure length 157
sequence length 157
ec nomenclature ec 2.5.1.17: Corrinoid adenosyltransferase.
pdb deposition date 2000-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02572 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g5rA00
3EPJA 3GJXC 2IW3A 1XX6A 3QBTA 1VG8A 1E9CA 5HTKA 3SJCA 3LLUA 1A2BA 4IDOA 4MDFA 4Q4AB 721PA 4GFDA 3TVTA 2GK7A 2NTYC 3MLEA 4B48A 2GDJA 3GFOA 2ODBA 4JL6A 1XB2A 2J7KA 2IUUA 2QM8A 4HDCA 2CLSA 3ASYA 5FL7A 1T0HB 2D06A 1YR8A 4Q9KA 3TRFA 2BC9A 1NRJB 3EWSA 1W0KD 5KSPA 2GEUA 3V4FA 5KSOA 2BJVA 2BKEA 3Q5DA 3ZZTA 2P6RA 2R2AA 3SFZA 1UKYA 5HCNA 2ODEA 5JCPA 4B6FA 1ANKA 2WVJA 4Q18A 1G19A 5J5CA 1AKYA 2GNOA 2VEDA 4A0GA 4HDQB 5SZIA 2VBCA 3TUIC 2ZREA 3DOFA 1NLYA 3LQQA 1M8PA 4BZPA 5G40A 3TGPA 1Z2AA 3OIUA 3B78A 1FOEB 2JLRA 1DAHA 1S0UA 4WIAA 1U2RA 4UNPA 1SVMA 3OIYA 1NIPA 1G5TA 1E0KA 4FCTA 4MKHA 5KYKA 2QAGB 1G3QA 5FOTA 1KZGB 1UADA 3AF4A 2ZANA 1GNPA 1Q44A 4QFMA 5AJVB 5EE5B 2ZVPX 3BB1A 2RAPA 2FFBA 1ZU4A 2GCNA 1G3IA 1W5TA 2QQ0A 5FI1B 5GVSA 1QVAA 2AL7A 2WJIA 2ZE8A 3MFYA 1P2VA 4H9GA 3HJNA 4MUBA 4Q7MB 4RCZA 5AJXA 3SR0A 4CVNA 4XWOA 2CJWA 4RD1A 2ZR9A 3TNFA 1NBMA 1QRAA 3C14C 4LC0A 4OBEA 2FSGA 5FPKA 3B1VA 5FPYA 4DWJA 1WXQA 2HLDA 1NN0A 2JIZA 3IO5A 4GZLA 1Q20A 1TU3A 1KO8A 1N6NA 1HT1E 2ECKA 5B30A 2XOKD 3BH7A 2CMKA 3BH6A 5F9HA 2HXYA 4XJXA 4U7DA 3U3MA 4Z8XA 5DYIA 4XH9B 2ASEA 4HAZA 2IEYA 1HH4A 5EXSA 2V8OA 5K8IA 2IYSA 2O0JA 2GHIA 4BLOA 2QG6A 4Q66C 2YHSA 4Z1MA 3S1AB 2EWVA 4LV6A 4M1WA 3RC8A 1YZKA 3P4YA 1OHHD 4TZ0A 1JR3A 4GRAA 2RMKA 3ZS9A 2Z5FA 1HURA 1ZNWA 3FPAA 2FF7A 3IIJA 3LV8A 4P0TA 4LSGA 4XSHA 2F3RA 1A4RA 2O8BA 3QNUA 4Q21A 4AURA 4D81A 4NCIA 2EFEB 2W83A 3M0EA 2HCJB 2IWRA 1KOFA 3SBEA 4GOKA 4KFTA 4DLRA 1R7RA 5AUPB 4EPWA 1WBDA 1QHHB 4M9ZA 5FUWA 2CLCX 1OH8A 1NKSA 3W3AA 3FHCB 2XNDA 1JXMA 3I3SR 4LHVA 1ZUNB 1C4OA 1VCMA 3JZMA 3E1SA 3VKWA 1XXHE 1KNQA 3P26A 2FH5B 3G0HA 4DDTA 2ZUBA 2W2XA 2R6DA 4NU0A 1US8B 3MSXA 2V3CC 3D6TB 2F6RA 4B3CA 2H92A 2YINC 3AV0B 3LBIA 4LJ4A 3ZQJA 5J4HA 2AHOA 5KO2A 2HYDA 2CL6X 2O8CB 3DVLA 1Z5ZA 3NDBB 1E2MA 1G7RA 2PCLA 5AJZA 4R2IA 3CR7A 4G0NA 3RRNA 3OIWA 4MRRA 5DO9A 2A5YB 3TUJC 5E3HA 4CZ2A 5EE9A 4C0AC 4C2UA 3GLFE 4Q03A 4TQUS 1GIAA 5P21A 4EQ6B 3AP2A 5KHOC 2OCPA 3ADCA 2HCBA 2DWOA 1D8TA 5CLLA 4E07A 1OT3A 1GFIA 4P4UA 4YLGA 1XCGB 1XEXB 1COWA 4DSOA 1Z6XA 1GRQA 1KJWA 4AG5A 1LV7A 5KPJA 1RIFA 2JJ8A 1M34E 1T3LA 1W4AA 4BFZA 3B9PA 3P27A 1NF3A 3CH4B 5CYOA 2VQSA 4A2WA 1XEWY 1T4GA 4NP6A 1CJTC 3A1SA 3SJAA 2CEAA 1W44A 1I2DA 2JA1A 2V4ZA 2QQEA 1XEWX 3JVVA 1GTVA 3DZ8A 2B8TA 1VYTA 1OIWA 1XEFA 4XVRA 4A4DA 1ZC4A 4LYJA 4RZXA 1EFHA 2FFHA 2PT7A 2ZI4A 4K46A 3K09A 2GTPA 1RZ3A 4V02A 4IXMA 2ZITA 4QGFA 5HKKD 3WRXC 3S1AA 4H1VA 3UWOA 4IDQA 2WTUA 1Y63A 3R8CA 2PBRA 4PAOA 5KSZA 3B5JA 4CIDA 2V55B 1XJ0A 3LBNA 4KLZA 3TUZC 1FQKA 2FEMA 1CRQA 3OIVA 2CHVA 4U02A 3BB4A 2C9YA 1G64A 3C5CA 1OYWA 2QBYA 2WKQA 3REGA 2NO0A 2PH1A 1Z6YA 2BM0A 2RH5A 2QP3A 2V7QD 2P5SA 2N42A 1Q3HA 1OF1A 3FHOA 4RY2A 4AC9A 3ZVMA 1IXSB 2J0SA 1QHHA 1EFRD 1T3SA 4KU4A 2QI9C 2P0EA 1QG2A 4MGKR 3TSWA 3HU2A 4MGYR 3U60B 1R5NA 1F2TB 4FIDA 1US8A 5CDFA 5G3ZA 4IFBA 1D2EA 3QKSB 4NMMA 2EFCB 1XTQA 3IEUA 4JMPA 4LGMA 1QHXA 5KSYA 1SXJC 2EU8A 3CF0A 1ZVQA 1NIJA 3VKGA 5EXTA 1K6MA 4UJ5A 3KKMA 1KJYA 4FCVA 2P2LA 3AKDA 2FGJA 1RVDA 2QZ4A 4A15A 1WP9A 1E3MA 2RGXA 4TTRA 1J99A 2J45A 3CNLA 1SXJA 3O8BA 5KU1A 4BPBA 1QVRA 4QM6A 3CPHA 1UBFA 4OQLA 1ZM7A 3AF2A 4E09A 1NY5A 2YOFA 2ZE5A 1NVVR 3OAAD 5AR1A 3W5JA 1E94E 1SVKA 3LVRE 2JAQA 1AZSC 2WZQA 2OE2A 3B8HA 3ZLJA 5EUQB 1W1WA 4ZDJA 1ESMA 1VPLA 4P4SA 1GL9B 2R6AA 2G77B 1D5CA 4PZZA 4L8GA 3VHXA 2AWNA 2OCAA 3Q7PA 2CCKA 4P32A 2QT1A 1NVVQ 3EZ2A 1VKJA 3U2QA 4TLCA 1A82A 1TAGA 4BEBA 1YZQA 2C98A 3A1VA 2J41A 1U0JA 4TT3D 4WXPA 1II8A 1Z0IA 5DI9A 1OB2A 4BLQA 2ANBA 3T5DA 1W47A 2KE5A 4ESHA 4RFVA 1XF9A 1OXUA 4QGGA 3CRRA 1OJLA 2F7SA 3VR1A 4GDFA 5A0FA 3GLIB 4GT1A 5D3MA 2Q3FA 3SQWA 4HI0E 4NYJQ 4D4LA 2WWYA 3R8FA 4US0R 2O5VA 3JZAA 1LS6A 5JRJA 3BFKA 4LJAA 2ZE7A 3PITA 3BB3A 4JLBA 5DYGA 2YC2C 3QSYA 5JWOA 1GKYA 2HXSA 3I92A 5CDFE 3I4LA 2R6CA 3FHTA 1NJFA 5JS8A 3EPHA 1NG1A 1GKUB 4XTCS 3PVSA 4RSGA 2WSSD 1FTSA 1G8PA 4L15A 4OHXA 3L0OA 5HR5A 2Z4RA 2CE7A 4WZBE 5KUTA 3ASZA 1TUIA 1R2QA 2FU5C 2ZJ2A 1GKIA 2MSCB 1M1YE 3FMIA 2ZI7A 3OHMA 4DLUA 4JLKA 2QM7A 4O0MA 4QNMA 1JXOA 2JLQA 4B2LA 3AKCA 1ZAKA 1DAFA 3UWKA 4I99A 1OXSC 1P73A 1XPRA 1N5KA 1F2TA 2ZR7A 5FTJA 4D4JA 4PPGA 1NLFA 1KJZA 4LRWA 3TR0A 1AM4D 5DSZA 2CHGA 1OFIA 3MAAC 5EE1A 4V0OA 5DHFA 2GXSA 3LXRA 1UFQA 3X1WA 3K1JA 3RABA 1ZNZA 2GK6A 1T5IA 1DAIA 2IXFA 1W4BA 5E7IA 1LNZA 4X8LA 2V1XA 5AUOB 4YDHB 4MRVA 4ABYA 4MDEA 4HB0A 1WB9A 2G3YA 4PPFA 3C7KA 1CP2A 1KNXA 2QPOA 2EVWX 4KXFB 2W0SA 4OHVA 3AP1A 4IOKA 4FMCF 1OYYA 1WRBA 5EZ6B 1E0AA 4B33A 3RS4A 3KQHA 1KI8A 4M0LA 3IIMA 3NTUA 4LK2A 4QNRA 4TMVA 3RRMA 1UAAA 1IJFA 3DDCA 3QG5A 1BYUA 1E6CA 4TMKA 1TADA 3RSLA 2ORIA 5CK4A 3ECCA 3GLHB 4YMVA 2R9VA 2A7QA 1U99A 4FMDB 3PUXA 4QBGB 1Z0FA 4DLSA 2VLIA 3LDAA 3AVUA 2A9KA 1E9RA 2WM9B 4PHGA 3VAAA 4Q4JA 2AKYA 2RGBA 4MYTA 4AY2A 2RCNA 4RCYA 5L3QB 5FR2A 1UM8A 3AH8A 4NCKA 3W9YA 1ZIOA 5GJWC 1E1QD 2BHRA 3RS7A 3MWKA 4DLVA 2ZRPA 1YZUA 4TMTA 2ORVA 1YU9A 3QXJA 2A5FA 2CBZA 1GP2A 4LJ7A 1FW6A 4AI6A 1DBSA 4NCHA 2B6HA 1YR7A 4ZKDA 1AGPA 2BBOA 4IOJA 3SU8A 3C41J 5JRZA 1FFHA 3HR7A 3KJHA 1LVGA 3GLIA 2PEYA 1X86B 3OEEA 4KAXA 4C0BA 4TL6A 5TXGA 3W34A 4OI2A 2GZAA 3W5IA 4I1SA 3W6OA 1LTQA 1XTKA 2OLKA 4I4LA 5M04A 3GJ3A 4G5QA 3TSOA 4DRZA 4OL0A 4ZV4A 1SKQA 4GMDA 1KIMA 4OK5A 4B44A 1G9XA 2XZOA 5AJWA 1OH5A 2FOLA 3ZD6A 1AQUA 2GJAA 4DSTA 3CLVA 3UANA 2BEJA 3KJEA 5B58C 4PC7A 1BH2A 2IYYA 3B82A 4LUCA 3TW4A 3K70B 2JLWA 4M9QA 2AD5A 1WF3A 2HV8A 5JECA 3RVBA 3AVYA 1E9DA 3CB4A 4CEIA 3C4JA 1XD2B 4JLOA 1AS2A 4TL7A 1DG1G 2X8AA 2ZJAA 1VDZA 3GEIA 2GJSA 5B57C 2UVQA 1RRFA 2F1JA 5EXXA 5IDVA 1PJRA 3T12A 2OFOA 5E7JA 5FL3A 2D7DA 1XZPA 3Q3JB 3E70C 2DFLA 3TW8B 2WWIA 1W36B 1N5LA 1HYQA 4OK3A 1UBGA 1CKEA 4ZI2A 5FI0B 2EYUA 2OM2A 4KJZA 4DCNA 4A9AA 3X1XA 2IT1A 3QBVA 3LXXA 3LD9A 4L4UA 4RKFA 2ONJA 2VTKA 3VR3A 1EFTA 2QP4A 4EAQA 2ZE6A 4PAMA 3QI2A 3AVVA 3K0CC 4PO9A 3H84A 3EAQA 5TARA 3EZ9A 1H8HD 1A2KC 1GAJA 1YZNA 2QTHA 4TL9A 4EKDA 1E99A 3KJIA 1R5BA 3T1OA 5LB2A 1SVWA 3K0CA 3DMDA 2UZIR 1CR1A 3X1YA 4F93B 3IHWA 3GLIE 1GOTA 2EFGA 4F4JA 4N1AA 1P9WA 4MRNA 2VHQA 5HE8A 1CXZA 3GLHA 2JLZA 2PZFA 4RZ2A 1U9IC 4DEYA 4XIGS 2AD1A 3W8RA 2LKCA 1UKEA 4A36A 5EJEA 3AUYA 3LVQE 3TMKA 2XB2A 1N6LA 1CR0A 2C9OA 2R44A 5EP2A 1NKTA 1HA3A 4AKEA 3V4RA 1QHGA 5AUNB 1WCV1 1U9IA 5FBQB 2DBYA 2Z0MA 3H1TA 4HB2A 5C4MA 3THYA 2J5XA 4NYIQ 5L3QA 2JJ1D 3FDIA 3N5CA 3ZS8A 4DJTA 4M22A 3IBGA 2HUPA 2VPPA 1CIPA 1ZCBA 2A78A 2BMJA 4IVQA 3TE6A 3ZDQA 2ZS8A 4Q7LA 2WWFA 4C9BA 3IDQA 4XVUA 2QA5A 1II9A 3AEZA 3IIKA 1NLZA 3OFND 3IO3A 3LH5A 4Q1AA 3F8TA 1JJVA 1P61B 1RRGA 5JWRA 2NO6A 1ETUA 1TX4B 2PMKA 3H0KA 4B6EA 3NH9A 2AKAB 4B75A 3DM5A 1BO6A 1KI7A 4RZ3A 1ZINA 2RGDA 3AF0A 1JQJC 4Q47A 3IEVA 2YNMA 4IOLA 4BRWA 3KJGA 1F60A 3ADKA 521PA 2ZETA 2W6JA 3RNLA 2WKRA 2VP5A 5EUMA 4TTPA 4G3XA 2Q6TA 1I4TD 3GQBA 1KAGA 4Z51A 1E4YA 1ZP6A 2ONKA 4PHFA 2DCUA 2BKUA 4LBYA 1U90A 2IUSA 2YYZA 3IUYA 1MO6A 2VA8A 4OHYA 4BLTA 4M9XA 4NDZA 1RYHA 3ZH9B 4FINA 1G291 2C03A 3BERA 2WHXA 1E2DA 2GXAA 2E87A 2WIBA 1KI6A 2WJJA 2JLXA 1DAGA 3MWYW 3OEHD 1ZU5A 4B3DA 4LYFA 1XBTA 2TMKA 2VP4A 3GLHE 3I32A 3KKQA 2IEZA 2JEOA 4ZDKA 2IYVA 4QBHA 4RKEA 5EXPA 2AXPA 4Q7JB 2IF0A 1W2GA 1P2SA 3B6EA 5FFMA 2FPKA 5BQ5A 2W6ID 3IILA 4BFYA 4YONB 2EWWA 1D6JA 2ZRIA 3GEHA 1FL9A 1I2MA 2DFNA 2MMCA 2GXUA 3A1TA 3KB1A 4TYWA 3HWSA 1XTRA 2ZJZA 4R98A 2HYIC 5FOXA 3KKNA 1KDPA 3T34A 2A30A 4WW0A 2IUTA 4Y0AA 3VX3A 4C3ZA 4TYNA 2I3BA 4ZCLA 2IS6A 3LW7A 4DUGD 2RGGA 3BE4A 5F3WB 4TSFA 2CCJA 1R8SA 2J7PA 1XMJA 1E2KA 2NO7A 4BFWA 1ZM2A 4QJ4A 1Z6TA 3ICEA 2D2FA 4PQRA 4DEXA 4JT2A 5C46F 2ATVA 3I8SA 4QJ3A 4CDGA 3T1TA 2P5TB 4C4PA 2Q0HA 2QROA 3K53A 2DB3A 4DB2A 1CJVC 2GAOA 1RRPA 2WMOB 5F98A 2RHMA 3UATA 3UG6A 5FBVB 2ZRKA 2B7BA 1R0XA 4OI4A 5K8LA 1XP8A 3VKHA 1JBKA 1OE0A 2GWHA 3QKRA 5C18A 4UXIA 3GPLA 1XD9A 2NZJA 2O8BB 3TVDA 2ZRNA 4A0HA 1CR4A 3AVPA 1GRNA 1OKKD 3RDPA 4NE2A 4KFSA 3VNVA 2GVZC 2H7VA 5K8UA 1PVOA 2REXB 1MOZA 2GZDA 2QGZA 2QPAA 3VTKA 2PZGA 2QE7D 3AVQA 4TLEA 1H8EA 2DYKA 4TLDA 2V1UA 4IDPA 3UKDA 2PL3A 2GJ9A 5EE3A 2VL7A 4DT1B 1N6RA 4JSTA 3H86A 4A0FA 3B9QA 4LHWA 1W0JD 1WBBA 1S9HA 3CUEF 3A8TA 4URZR 3ZVRA 4DIEA 1YZLA 1KI9A 5JJKA 3DL0A 1Q12A 3MJRA 5E95A 1EG7A 1G17A 1YRAA 2PX3A 2OG2A 2QENA 3M4YA 1GL7A 1P7CA 2OUKA 4DDUA 2JCSA 2XJ4A 3GJ0A 5C2JB 4R7ZA 4QHSA 2GRJA 1TF7A 1L8QA 4Y0VA 2NIPA 3K0EA 2XB4A 4HLUC 4R2HA 2GF0A 4IXNA 4U5XA 4BE7B 3SEAA 4BLSA 2BMFA 4PQYA 4WA7A 4A0RA 1G41A 4DVGA 2KB0A 3U3OA 1BS1A 3TH5A 4YQFA 1F3OA 4HLUA 1D2MA 2OEPA 4OKSA 2XSZA 1DARA 3QXXA 3BAFA 3BORA 4DHEA 4JZKA 4DLYA 1P6XA 4LDJA 1Z0KA 1QHSA 3L0PA 1ESNA 2PT5A 2JDID 1IXRC 2ZRLA 3KB2A 1O87A 1AIPA 2HF8A 1EGAA 1Q1EA 1XCPA 4PO1A 4C0JA 3OE7D 1KMHB 3GEEA 3QUSA 4QHYA 5H68A 3K9NA 1G3RA 4QGHA 4WVFA 4C0LA 3KXIA 3ZVLA 4CGZA 1RC8A 1MT0A 1SVLA 3C5HA 3B1XA 4H1UA 1BYIA 2WJYA 4RFSB 4GOXA 5FOSA 5IHPA 1HT2E 1C1YA 1Q3TA 4MH0R 1XMIA 4BRUA 4EPRA 3ZZ0A 4HUQB 4S2EA 4CEJB 3EIHA 1IOZA 1WQ1R 3KL4A 1OXTA 2R8RA 1FP7A 2RGNC 2NPFA 5KDOA 5IK2A 4D4MA 1E2PA 3DPUA 4KHZA 1EX6A 3FFBA 1E4VA 1SVSA 4MGIR 1DE0A 2JJ2D 3R9XA 4ASUA 4B34A 1QHIA 3PUVA 1AKEA 2RGNA 1T91A 2ZS9A 3F0TA 4TMXA 2FN4A 2QORA 3MRSA 2ZJ5A 4A82A 4HZIA 2QBYB 4NBSA 1PZNA 1SKYB 1HQYE 2CDNA 1ZUHA 1G4AE 1ZW6A 3NWJA 1QF9A 1E1RA 2WPDA 2ZRMA 3CM0A 4UXJA 1ZMXA 2H8KA 2CK3D 2V6JA 1TQ2A 4J0QA 1NVXQ 1E79A 3CKLA 4DT1A 2ANCA 2W00A 2VSXA 4XD7D 3TQCA 3B85A 3SOPA 3ZGXA 2IXGA 2CNWD 5FUXA 1Z47A 2F1IA 4OJQA 3WBJA 3K8YA 3N70A 3CBQA 3A36A 5AUQA 1HQCA 3HYTA 2BOVA 3CWQA 3EC1A 1RJ9A 2GJ8A 3EZFA 1NBME 4LBZA 5CM9C 3GP8A 3RLFA 1X8LA 4S35A 4WZ6A 4II7A 1X8JA 1CBUA 1VCNA 1SXJB 3K9GA 2AN9A 2NQ2C 1E2GA 2ZIAA 5EP3A 5IT5A 4OI0A 1K8RA 1XD8A 4F4IA 1L4UA 1YJ5A 1M7BA 2WMNB 3LX5A 2F55A 1P75A 2CVFA 3FFAA 3WMEA 1DVRA 3GLGB 4P4SB 2C9CA 5KNCA 4CEHA 3N2EA 3NEJA 1IN5A 4RD0A 4MYCA 1JR6A 4M1SA 3I61A 2GKSA 1CR2A 2CHQA 1G3UA 1JR3E 2PX0A 1T5LA 4C2TA 4DC9A 3ZVNA 5JSZB 2ODWA 1CJKC 1TQDA 1R0WA 2E1RA 1IBRA 4JLPA 3FGNA 1ZNYA 2DFKB 1KMHA 1XFAA 3SS8A 5EQTA 3A37A 4M1TA 3U44A 1II8B 2V6IA 3K0AB 1X1RA 4B2PA 3VU9B 3OF5A 3PQCA 1TF2A 5FOVA 5J4VA 2C77A 5J4YA 3QIAA 5UKDA 3SHWA 3N2IA 4RFSA 4PXAA 4MKIA 2C99A 1R5OA 5D3MB 5KDLA 3TAHA 2VH5R 2FSFA 4IRUB 5HPYB 3QJYA 3CW2A 5FUYA 4HUQA 3QVVA 1YE8A 2RGAA 4CEJA 4CF7A 2V54A 2G1JA 2ZAMA 4C30A 4EJSB 2IXEA 1R0YA 5A4JA 3KFXA 1KAOA 1W0KA 1KHTA 3O8DA 1IHUA 1Q0UA 3AF1A 5DNYB 3BBPA 2GCOB 3QG1A 1P2TA 1BMFD 3RS0A 4R71A 4ACBA 1LW7A 4URWR 1Q1ZA 4I1OA 2WJVA 2YWHA 3QXCA 4Q01A 3CNOA 3V9PA 2QEQA 1E2FA 3VX4A 2REOA 3KX2A 2YOGA 1Q1QA 1E9AA 3KQLA 3QF7A 2OV2A 5FPTA 4BFXA 1FPMA 1Z3IX 2OCYC 3QPUA 4LHXA 4ZI3A 1ODFA 1UBEA 5FBLB 2OBNA 4I1UA 2WKPA 5SZKB 1F2UA 1VG9B 4ZKEA 2QY9A 221PA 2ERYA 4HAWA 3BC1A 2ZROA 2HT6A 1M74A 3F5FA 3PR1A 1KI3A 4KV9A 1T3HA 1HEIA 1VYVA 3MD0A 1QG4A 2AXNA 2FWRA 2OLJA 4ZPXA 5KTYA 3PJRA 1H65A 1OFHA 5J4KA 4DLTA 2MSDB 2GXQA 4A8JC 2QN6A 4Z8YA 2QU8A 4EIWA 1N5JA 3I5XA 3SZRA 1YZTA 4IJMA 4A92A 1UJ2A 4C0HA 2WSMA 1KK3A 4F4CA 4OQMA 1G4UR 4I1VA 1N6HA 2H5EA 3HYRA 4A8JA 1CEEA 2XOKA 1ONBA 2A5JA 2X2EA 4FMDF 2YZ2A 4FMBB 1E2QA 2EFDB 5B64A 3GLGA 4DKXA 1NMZA 1S4QA 3Q72A 2G9NA 1VTKA 1ZD1A 3NDPA 3NHAA 5HE9A 2VHJA 4LY6A 1SVIA 3DOEA 3K9HA 3VR6A 1E2EA 2XZPA 3CPJB 3L0SA 4NYJR 4Q4JB 1KSFX 1OHHA 3DHWC 3WHKA 4EFNA 5JSZA 4AKHA 1IM2A 4D6PA 4JKYA 1EFUA 4QRHA 4V0LA 1N0WA 3NIBA 4LOAA 1FZQA 2ZI3A 4DIDA 5L3SB 3K0AA 3VU9A 4O3MA 1SKYE 1IN8A 1P9RA 3EA0A 1NSTA 2IA5A 3KXKA 5TVKA 4EJSC 5KDDA 4JLMA 4P4TA 3KDSE 4E22A 3RS3A 4Q1CA 4BFVA 4DCSA 3C15C 1IQPA 4HAUA 1KDTA 1MO3A 2ZU0C 3FYHA 3LBHA 1G20E 1MKYA 4ZIRA 2VHCA 1E69A 4JL8A 4EJSA 3QQ5A 2QPTA 3ADBA 4O2LA 2QMEA 4V0NA 4QOSA 3UXMA 5CIWA 4PANA 4QJ5A 2WBLC 4FW9A 1EX7A 3NVAA 2I4IA 3QPWA 3PEVA 4B32A 4YMTA 4DCVA 2GCOA 2I1VB 1J70A 4UNNA 4B3BA 2GF9A 2NZ8A 5E4FA 4D0NA 2IYZA 4IW3B 3TQFA 3EPKA 2P67A 3CIOA 2O8EA 4YXWD 3IPYA 3THWA 3WRYC 2YVUA 3MUFA 4V0KA 4KFRA 5JEEA 4DDWA 1KZ7B 2C2HA 1SXJE 1QDEA 4D4KA 4CEIB 4XOIA 2V9PA 2FX3A 4KBGA 3U3RA 3ZZUA 1S3GA 2H57A 3AKEA 1ZUIA 2F1RA 2D7CA 2P6UA 2O52A 2GBLC 4K81B 5IRCD 3GLGE 4GZMA 3UMFA 4FN5A 3BK7A 1Z06A 1E2IA 5L3VA 5CITA 5FTLA 1MRSA 2ZRGA 4G5OA 5CJ2A 3TAUA 4JYBA 4ZO4A 1FMLA 2BWJA 2GBLA 5JI3E 2WWGA 3GFPA 2E9SA 4M1OA 2WJGA 2VRWA 4CT5A 4MITA 1OH6A 4OI1A 2FG5A 3E2IA 1DTSA 4Q9JA 1UF9A 3EASA 2GAAA 1XPOA 5FTMA 3REFA 3A1UA 3HDTA 1YR9A 3CH5A 4MA4A 3VQTA 2Z6VA 1VHTA 2A3RA 1II0A 3Q85A 2CE2X 3SJBA 2QRNA 4Q02A 1EWRA 2C95A 4RZUA 1BIFA 1NL3A 1K5GA 4MUAA 2BVNA 2IYTA 3PEYA 1G7TA 4MGZR 4KI0A 5HKKA 4LI0A 1A7JA 3AGQA 2P65A 4AYWA 3A4MA 3DKVA 3THYB 2FFQA 4CRWB 1Z28A 2NPIA 5DN6D 1W36D 5L3SA 2EQBA 5CB8A 1HE8B 4D82A 1B0UA 2NOAA 4L9WA 1J2JA 5J40A 3PUYA 4IFEA 1PLKA 4JLJA 1TF5A 2W2TA 4FWIB 4BUJA 1GM5A 2V7QA 2AX4A 4M9SA 4IKEA 4LYHA 4NCJA 3ZIAD 1S2MA 2G1KA 1IY0A 1VIAA 4PAQA 1EFRA 2QSZA 3RWOA 3BGWA 2G0NA 5KNBA 1P4SA 4K8OA 1MO4A 2IYLD 3PENA 4WBSA 1OH7A 3UMSA 1W4RA 4POAA 2ZRHA 4B47A 1KK1A 5J47A 4HAXA 1G21E 1CF4A 1E2NA 4DCTA 1JAIA 4Q1DA 5SZJA 1TNDA 4A2PA 1NN5A 1AS0A 1FTNA 1NI3A 2JASA 1WE2A 2Q9BA 2VF8A 2J59A 2X2FA 3LY5A 5TDHA 3SC3A 3FKSD 3FTQA 2H16A 4UQOA 2C96A 4PSAA 4MKGA 3K0FB 5H8WA 2OXCA 2YOHA 5GJVC 3EC2A 4A6PA 1YZGA 1KI6B 2WWHA 4JJKA 3H2YA 3CRVA 4M4SA 1CRPA 3PUZA 3CF2A 5GADl 3BOSA 1OXVA 4TYPA 3OAAA 1ZJ6A 4EFLA 1E9SA 1G5RA 4HB3A 2BCGY 2OZEA 3I73A 1OW3B 5FH9A 4MQBA 4DDVA 2BDTA 4URXR 1GILA 2J0UA 5DI3A 2WOOA 2WICA 1SGWA 1N3BA 4PHHA 4PTLA 3HR8A 2YKGA 2ERXA 2ZRJA 3LO5A 1IY1A 1E9EA 4GP7A 3CX6A 3X1DA 4C0QC 4LJ6A 1M7HA 5FL7D 3U5ZB 3L0IB 1DOAA 2DFTA 3PG5A 4TT3A 4GOJA 1P3JA 5LDDC 3NBYC 4NYIR 3SNHA 1QHNA 3J81k 3F3YA 1XJQA 2EYQA 1AA9A 5L8VA 3QKUA 2IX3A 4TQ9A 4DLZA 3VMFA 2HT1A 4US2R 1V5WA 4BEJA 4QL3A 2KJQA 2FPLA 4U00A 4E5UA 4EPYA 3L82B 1P60A 1SVOA 1XDBA 2IYQA 4LWZA 4A6XA 1VECA 4PZLA 1E0JA 3QOFA 2PLFA 2XZLA 2WSSA 3AGPA 4KYIB 4US1R 3QKRB 2XAUA 2ZYTX 4Q00A 2JLUA 1LFDB 4JVMA 2KBFA 1F5NA 1NSFA 1W49A 4HLCA 3SBDA 3SI7A 1NJGA 4GPTA 5FBWB 3ZQ6A 2IYRA 1DPFA 2ZRFA 1Q1BA 1U0HC 2PZEA 3M6AA 1G3MA 2DWQA 3NBXX 4EPTA 4C0KA 4WZAE 4QBFA 1SHKA 1TEXA 4TTQA 4KYUA 4RJLA 1NBMD 5JWHA 1E0SA 5C4GB 3CX8A 3EX7C 3A6PC 5TV2A 3VNUA 1X6VA 5FPSA 4JYCA 3AF3A 3E5HA 2HLDD 5JZVA 2JIZD 1WDTA 2WV9A 3A4LA 3GCGA 2PJZA 1G1MA 2O8DA 3WP0A 4AK9A 3O8CA 6Q21A 1B23P 4BQSA 4DB4A 2PJRA 4TQAA 3WBKA 3RHFA 2YWEA 1G6OA 3P32A 3SDZA 2OXRA 3C8UA 2H1LA 3K0FA 4JBXA 4DLXA 4Q48A 5JJIA 4Z1MD 1GNQA 1KMQA 2HEIA 4Q9HA 4MYHA 2J0VA 4L16A 3I62A 4I81A 1NN3A 4AYXA 2ZUCA 3CO5A 1JR3D 1E2JA 3RWMB 2HF9A 121PA 2VIIA 1OLOA 4LHYA 4W5HA 1NMYA 4F7WA 2IS4A 3HPQA 4ZCMA 3ND8A 3KFVA 2YWFA 4B76A 4UJ3A 1S3SA 4NPHA 1BOFA 4TWZA 1SULA 4GSYA 3T06B 4OQFA 4BLRA 3R7WB 2ZSBA 1NY6A 3A1WA 2FA9A 2ZTSA 2DHRA 2OESA 3M1IA 3U7EB 5J4LA 1E1QA 1VHLA 3WYAA 3THXA 2GESA 5A5GA 2XNDD 3CZQA 5FTNA 2KI5A 1W48A 3U3KA 1TPZA 1ZD9A 2ZU6A 1T8TA 3LNCA 3TR5A 1E2LA 3KTAA 2P3SA 5CB6A 1UEIA 1V43A 1JJ7A 4JLAA 2KBEA 2IF2A 3BFVA 5CJPA 3NH6A 1DO0A 3RSOA 4TLBA 1SHZA 2NG1A 4M1MA 1KSJA 4HB4A 3OESA 1ZM9A 2N1BA 5DLQC 2LWIA 1E9BA 4Q4LA 4KLNA 2GCPA 5K8TA 3LLMA 1LF0A 4O2RA 4AD8A 1GVNB 3NC0C 4IDHA 1G18A 4EPXA 3CR8A 4UXHA 1T6NA 2XITA 2GZHA 3K0SA 1KGDA 2ZYVX 3D7MA 4GMXA 4X8MA 5KOYA 1COWD 2KWIA 2A5DA 4HATA 3I72A 1U8AA 1Q21A 3Q8XB 3SYKA 1OSNA 1ZM3A 1F48A 4EDHA 3WNDA 3P1JA 4KSBA 4RD6A 4FD2A 4BASA 2ZUDA 2XTZA 1TTTA 4B2IA 2L0XA 4D2IA 3UK6A 4M53A 2UZ3A 3B1ZA 5EP4A 3UPUA 2FNAA 3SYNA 3T1VA 2CL7X 4LBWA 1X1SA 4L9SA 4LC1A 2FSIA 1N6KA 2IK8A 5ANRB 2FSHA 4PFSA 2Z83A 3CRMA 4HZUB 1RJ9B 2IBMA 3VR4A 4JS0A 1DADA 3UIEA 1ZCAA 1H8HA 1KO4A 1U8YA 1XTSA 4PR0A 3CX7A 4JBWA 3VFDA 1VCOA 2XXAB 1ZD8A 4GNKA 1PLLA 4GBMA 1VIYA 2UKDA 2BV3A 2RGEA 2XJ9A 1NNEA 1XZQA 3KKPA 1ZC3A 2XTNA 4N0DA 1TQ4A 1CS4C 1HY3A 3RS2A 3MCAA 4F91B 5B2ZA 4C0SA 1X3SA 2RB4A 4CEHB 2JLYA 1E96A 4M21A 3R7WA 1ZIPA 1NVWQ 3SFVA 2JJ1A 2B8WA 4QKQA 1SZPA 5EP1A 1KO7A 1S1CA 4A2QA 1N25A 3U44B 1NMXA 5DIFA 1JQLB 1P62B 3JVUA 5LBIA 3IQXA 1XXHA 2QMHA 3OFNA 2G0TA 2FMXA 1RW4A 1KKLA 2ZQ5A 3MWLA 3VR2A 4JL5A 2AR7A 3QE0A 4TYYA 1EXMA 3RS5A 4NYMR 2ZJ8A 4IVPA 1QZXA 1IONA 1N6IA 1FMJA 3ONWA 2YJTD 3EIEA 3T5GA 3WHLA 3BJIC 2VO1A 3FMFA 2GETA 4D0LB 4Q4HA 5F9FA 1QHYA 1OIXA 2DY1A 4ILEA 5FBRB 3CRW1 1SXJD 2RHDA 3BS4A 1NN1A 4PQFA 3WP1B 3NC1C 3GLFA 2CVHA 5BXQC 3SYLA 2Z43A 4ACAA 1IY2A 4P31A 3HPRA 4NONA 4NYMQ 1YVDA 4G5SA 1KDRA 3WMGA 4HSEA 1FX0B 4CW7A 3P4XA 1T9HA 4XVQA 1XU4A 2J9RA 3U3JA 4DCUA 4Q9IA 5BYKA 3Q5EA 2QMOA 1MRNA 3U6BA 2OILA 3OEHA 3GJ7A 3R9IA 5BN3A 2IYXA 4XTRA 1DELA 1PUJA 4OQXA 1DAMA 5FR1A 4B35A 1F2UB 1G6HA 2Q3HA 4ZDWA 5JS7A 2VSFA 3IQWA 3QKTA 2PLRA 1F6BA 4BFSA 1R10A 4ARZB 1U98A 2W6IA 4HYYA 1UKVY 1TUEA 3K9LA 5HCIA 1GUAA 1P2UA 3W6PA 1G8FA 1GL6A 3NBZC 1IN7A 4Q4AA 2WWWA 4LV5B 5CLQA 3EW9A 2A2ZA 2F43B 1Z2CA 4HZUA 2AK2A 2ZR0A 3NBFA 2GJKA 4DXAA 1Z0AA 5G41A 1TMKA 3BD9A 1TEVA 4TMWA 2XXAA 4DUGA 3NG1A 2FFAA 1NG9A 4OK6A 3L2OB 4A8JB 1G8YA 3MJHA 2WJHA 1CJMA 2CL0X 4M8NE 4PSVA 2D62A 2KSQA 2HJGA 4NTZA 4BGDA 1S1MA 3IHLA 3TBKA 5BN4A 5JMTA 3W90A 3NKVA 4JIMA 3SJZA 3Q9LA 1LB1B 3DZDA 5JEDA 2ZJOA 1JB1A 2VP9A 2DR3A 3PV0A 4X8HA 5H1YA 2QAGC 1AK2A 1Z22A 1ZBDA 4FXPA 4N3NA 3HU3A 3RANA 4RVCA 1XCMA 4YDSA 1XNJA 1OIVA 1UEJA 4ESVA 4AWXA 5CYPA 2QAGA 4TN1A 1JNYA 5KNDA 4D0GA 3AVXA 1HUQA 4NL4H 1OPXA 4C7OB 4AKIA 4IOMA 1J8YF 3ND9A 4JVLA 1IN4A 1OKKA 2R62A 3DEFA 1R0ZA 3PCRB 4LCBA 1ELOA 3KKOA 2J46A 2QE7A 2RKOA 3LAWA 4ZIRB 3GJ8A 4EPVA 3LQRA 1W5SA 2BBSA 1NP6A 3Q7QA 3UG7A 2D3WA 4Q9LA 5JJLA 4HUTA 4QHTA 4GP6A 1P9NA 1AQYA 4B73A 3K09C 3DM9B 1W0JA 3O47A 1EESA 2QSYA 2GVDC 4M1KA 1AN0A 4ZCIA 1VMAA 3AM1A 3B7GA 2OBMA 2IS2A 3LA6A 2EW1A 1G8GA 2O8EB 3THWB 1XTJA 1FX0A 2FDCA 4QBIA 1L7VC 4B3FX 821PA 3FKQA 5HZHA 4QM7A 2N46A 1X8KA 1DS6A 2ZYWX 4OQNA 4QG7A 3FWYA 1KYIA 5AJYA 5DH9A 1RFLA 1E32A 3A4NA 3CNNA 3ETLA 1AJEA 2ZSEA 4HLDA 1IXZA 3RAPR 3ICQB 2J1LA 1CU1A 2ATXA 2CCGA 5DGXA 2ZRCA 4ARZA 1Z63A 4JKIA 2BIFA 1J7KA 4BLPA 1ZNXA 2F1HA 4BWYA 4MRSA 4DZZA 1G7CA 2A5GA 1TU4A 4F38A 3DO6A 3OEED 2F43A 1KI1A 3EG5A 4QXAA 3AVWA 2ZI6A 2IYUA 2QRZA 3WXMA 1N5IA 2F9MA 5CM8B 2JDIA 4D26A 3HP1A 5GJCA 4B71A 3OE7A 4CYMA 3GJ5A 1FP6A 2WAXA 3D3QA 1ZM4A 4URYR 2NO1A 3G5UA 1KO1A 2R6GA 3LRPA 3QEJA 2VHTA 4JLDA 2R65A 1N2CE 2BMEA 1BKDR 2F3TA 3MG9A 4JJZA 2G83A 1J90A 2O8CA 3WMFA 4BECA 3PEWA 5TMPA 3TLXA 3KZ1E 3EIQA 4PC6A 2K5UA 5LPNA 1PUIA 1UDWA 1Y3AA 1XPUA 2DWPA 1KDOA 4TLAA 4WXRA 2BJWA 1U94A 3T15A 1U81A 4EQ6A 1Z08A 3O8RA 3DKPA 2JGNA 3WYGA 1GWNA 2JJ2A 4MRPA 4C7OA 4PHTA 1DEKA 2OO7A 3EXAA 1OXXK 1J8MF 4KITB 1KK0A 4YMSA 5F2EA 1XEXA 2ZSAA 3CRQA 3RRYA 1GDDA 5BN5A 2IHYA 4LZZA 1W2HA 2VSOA 4DSUA 2MSEB 3SN6A 1EK0A 2MMGA 2ODNA 3SE0A 2OAP1 3L43A 4ON9A 1R4AA 1IJEA 3P20A 4XSGA 1GITA 2ZS7A 2OFWA 1Z6AA 1UKZA 2IC5A 2CK3A 1P5ZB 2AFIE 1FUKA 2WIAA 3NHBA 4R9UC 3DMNA 4B3GA 1VCIA 2C8VA 2GEVA 2W2VA 4XD7A 4JLVA 4XWKA 4V03A 1N0VC 3WYFA 2C78A 2RGCA 1UDXA 2CNWA 1Z0JA 2XGJA 3U4QB 2OFXA 3PXGA 2ORWA 1M7GA 1DO2A 2D74A 5G3YA 3AVOA 1T0JB 1GZSA 4LX0A 4WOPA 4LV8B 3B13B 1XTIA 2Q9CA 1MABB 4HLQB 5JHGB 1E98A 1LS1A 2WOJA 1DG3A 3H4MA 1Z83A 1RYFA 1R6BX 4G1UC 2BMDA 2DPXA 3V00A 3D8BA 2Q3MA 4QGAA 2J0QA 5IF9A 2FPMA 3EZ7A 4WAUA 4PO8A 2VF7A 1KI2A 3LX8A 2BEKA 2VHUA 5DE3A 4G5RA 3EZ6A 2D4HA 2XNSA 4DSNA 2J0UB 1DAKA 2VYFA 1FQJA 3GFTA 1Z07A 5DI3B 3VHLB 3VR5A 3W8NA 2G88A 3X2SA 2YWGA 2ZJYA 3I1FA 4PC2A 1MR3F 4YMUA 4AKGA 1NVUQ 1OFTA 2JLSA 4LJ9A 4UNQA 2AFHE 2ZXUA 2PCJA 3KQNA 1Z29A 2R6FA 4Q5IA 4X8OA 2W6JD 4LBVA 2C5LA 3HU1A 4NHOA 5ELXA 5AWFC 3PEUA 3QKSA 5TB5A 5LD2B 2AK3A 2H17A 2NO9A 2G6BA 2ZI5A 4A1FA 1VYUA 4KSCA 3PIRA 4JVSB 3K70D 2QGNA 1C9KA 4IDNA 2W58A 1N6OA 2HJVA 2XTMA 1RPZA 2ZJBA 2XEXA 4KFUA 4KVAA 5JHHB 2O0KA 4JVNA 3AP3A 4URVR 3I8XA 2OBLA 4Q1EA 4FWTA 4KO8A 2GILA 4TMZA 4LPKA 2BCJQ 4G5GA 1IAQA 3IPXA 5FOUA 1E9FA 1BMFA 5TY0A 3FMOB 3AQ4A 1KSGA 4FI3C 4NZYA 4OHWA 5JFGA 4P3YA 2O8FB 1LF5A 2QTVB 2LKDA 1D9ZA 3GJ6A 4IVRA 3QEOA 1CTQA 5KPDA 1I4DD 4JT4A 4ERNA 4BFTA 4DLWA 2X19A 4M2LA 1KK2A 3KXLA 1M2OB 4PC3A 1JI0A 2C04A 2PMDA 3QVUA 2F9LA 2ZI9A 1GNRA 1Z6GA 2QL6A 4BFUA 3LWNA 3B60A 4JSYA 3FOZA 3CPEA 4JLNA 3QPVA 3EWAA 4TSFD 1G8HA 4JBYA 2J7PD 4NCNA 4Z54A 3U4QA 2O8DB 3ADDA 1Q57A 3BWDD 3CF6R 2YC4C 4W9MC 1MABA 2IWHA 4XWAA 3KUCA 2ZEJA 4G01B 1N6PA 1JPJA 4W5WA 1DAEA 2IYWA 1IN6A 1D2NA 4EFMA 2QNRA 4IEEA 1EWQA 3QENA 1W46A 2X1VA 3U7HB 4B43A 5DISB 2QTFA 4YMWA 5G53C 3PFIA 1WA5A 3TSZA 2B7CA 3MMPA 2OHFA 2IS1A 3EARA 3U61B 1OFUX 3PUWA 3BFXA 1YRBA 2EFHB 3QF4B 1GSIA 1JAHA 3TJZA 1S9DA 4N0EA 4UKDA 1XMVA 3IBYA 3LW8A 1XWIA 2FZ4A 3SHFA 2BBTA 2ZSFA 1RE0A 4Q1FA 1L2TA 3AB3A 3L8ZA 2JATA 3RRZA 2SHKA 1H8ED 3OZXA 4B74A 3QXHA 2ZM5A 5LD2C 1P72A 3THXB 8OHMA 1S96A 3X1ZA 5C1BA 5FOWA 4TYQA 1XRJA 4PX9A 3U7GA 4LJYA 3ZJYA 2Z4SA 4EUNA 2QMUA 2REBA 4LJ5A 3A58B 4DBLC 4AG6A 4KCGA 3I5YA 5H70A 3KTAB 3ZD7A 621PA 1N0UA 4Q19A 1W7AA 1R8QA 1W4CA 1O3YA 1YQTA 3W3ZB 2OCBA 2OT3B 3T35A 1L4YA 3MWJA 2QUZA 3UMRA 1M6NA 2QAJA 2O0HA 2NMVA 1KY2A 3AUXA 4ITRC 2FV8A 4KODA 4FMCB 2ZAOA 3GMTA 1OV4A 4LPSA 5FPHA 1XMSA 4AIIA 2ZPTX 421PA 4D25A 4ZDIA 5DHAA 4V0MA 1FNNA 5FUVA 4B3XA 2ZVQX 4W7SA 2O8FA 4FCWA 1GG2A 1D9XA 1U0LA 4UNSA 3RC3A 4YXWA 3CWZA 2Q21A 2XSZD 3SQXA 2FE4A 3R9WA 2GA8A 3TIFA 2XX3A 4LYAA 4P33A 4URUR 5AK0A 1Z8FA 1SQ5A 3L8YA 1E2HA 1QBKC 2CLDX 1TL7C 3CONA 4PZYA 4Q1BA 1PV4A 4RD2A 1G16A 3KUDA 2B21A 4GL2A 4YC7A 3GJ4A 2FGKA 1KO5A 1MH1A 4E03A 2YV5A 4PPQA 1S8FA 2BM1A 2P6NA 1OB5A 2B92A 2CXXA 4OHZA 3IGFA 4LJ8A 1CJUC 3D31A 4QC2A 3R20A 5HZKA 1LY1A 3FVQA 5SZHB 2FZLA 3KQUA 1MO5A 5JLJA 4NH0A 1KSHA 1I4LD 2VP0A 2ZRAA 4HAYA 3T1QA 1JALA 4LHZA 5JBQA 4BZQA 1CULC 1EFCA 5IK2D 3IKJA 1FNMA 3K70C 2WWXA 4IEIA 1A1VA 4M1YA 5LB4A 3WNBA 5JI2E 2AWOA 2J3EA 3BRWD 4ASUD 3EA5A 2HDNB 1KKMA 3U6KA 3AVTA 3QF4A 2QP9X 3FE2A 4PSKA 4AYTA 3T61A 1YR6A 5CK5A 2ZSDA 3C16C 1VG1A 4MKFA 3THOA 4PC1A 1K5DA 3B1YA 3LFUA 1AGRA 4Q7KA 3WY9A 1YHNA 2Y8EA 2ZRDA 2NGRA 3W6NA 1W36C 1G7SA 2X77A 1JEEA 1XD2A 1ZRHA 3B2EA 5JCZA 3NXSA 1KY3A 4UNRA 5GVRA 4GI7A 3MGCA 1HE1C 1Q22A 2FEOA 1E1RD 2WPDD 3TK1A 4V0ME 3EPLA 4L5BA 3QY0A 5DN6A 4OJKA 5GJBA 4O25A 3BXZA 1E79D 1TQ6A 3RYTC 1GRRA 1AZTA 2OSBA 2ZYUX 2I1QA 1RKBA 4OYHA 2VP2A 4F92B 1XXHB 1JPNA 2H18A 2FJUA 1Z0DA 4KVGA 1WMSA 5L3RA 1RRCA 3BH0A 4D80A 4TL8A 3ZIAA 4KBFA 4BZXA 1A5TA 5D3QA 1HTWA 3B1WA 3QXSA 4PPNA 1CLUA 5BWMA 1UBCA 1KI4A 2CJWB 5FTKA 3GD7A 5EZ5A 1FUUA 3KQKA 4Q4HB 1VG0B 2IL1A 1ZYUA 3U7FB 4CT4B 2QT0A 3GLFB 4IHQA 4HEJA 1UPTA 5BW8A 2VP6A 4HDOB 1T8UA 3BIFA 1PLJA 2WAYA 3FMPB 4TZ6A 5CIQA 5EE0A 2LCFA 3FKSA 4NKRA 1JEDA 1JECA 3WNCA 2W0MA 1KTVA 5E7MA 2PEZA 1G5PA 2GEDA 4RD4A 3TKLA 2ZRBA 3AKYA 2D2EA 2IHBA 5BYJA 2JLVA 4MYUA 1MV5A 3CZPA 1XJCA 3ZYCA 1HV8A 2J87A 3NEYA 2BBWA 4RD3A 1U8ZA 1YKSA 1AS3A 3G82C 2OAQ1 4HAVA 3FB4A 2Q9AA 4W5JA
chains in the Genus database with same CATH superfamily
3GJXC 1XX6A 3BD8A 2I6XA 4OX9Y 1J0BA 1VG8A 4O29A 3CUWA 1XJWA 1VKNA 3DUFB 3OJEA 3H5RA 3SDSA 3BZUA 3ZWBA 1A2BA 5KQSA 3Q0IA 1N0HA 721PA 1XKLA 3TVTA 4FFVA 3KYDA 3W8FA 4D9GA 4F4HA 1M8JA 2GK7A 3BUSA 3UH1A 3WISA 1YVPA 4B48A 4AZ0A 4IF4A 1G59A 1A8UA 1H22A 2I3GA 2J7KA 2I1LA 1E89A 3F5QA 5TEWA 4ND4A 5FWXA 1NU6A 4L74A 2B7LA 4QPJC 3PBKA 1MHPA 2GGSA 2WF6A 4EF4A 3TRFA 1GTRA 1YMVA 4WN9A 4EKEA 2FI1A 4MVYA 2UYYA 1NRJB 1YB2A 4U7WA 4UM5A 4AF6A 3Q7TA 3HKEB 5KSOA 3OQMA 3DCIA 1I9CA 3IUPA 2DE0X 2EERA 2OY0A 5HIAA 5HCNA 1T9KA 2ODEA 5I8PA 3LUJA 4F11A 4FR0A 4PXYA 3UGQA 2NX2A 1G19A 1M2GA 1MT3A 5ADVA 3TMAA 4DMRA 3W7BA 2I7TA 1FYDA 2QUHA 4X90A 4Z3KA 2VBCA 3TUIC 1FQOA 2X8JA 3LQQA 5CVVA 4BZPA 2ATEA 1ENYA 4IZ6A 1F7UA 1U2DA 4O02B 1IH8A 3MTJA 2OR3A 4ZV7A 1FOEB 3ESCA 3F90A 4G0MA 3SYRA 3EQ9A 1PWZA 3OM9A 4WOJA 1DAHA 5ENDA 1NNUA 4HGQA 1K6JA 4EYOA 4PNZA 2IGTA 5DJ5A 4MKZA 5GGYA 5ALNA 1E0KA 2JHAA 2OQ2A 3LYAA 4FCTA 4MKHA 1V4VA 2IOYA 3LYHA 3TXXA 3HBMA 4DA9A 3E9QA 4MYSA 4CBVA 4FFWA 5F2KA 1SQFA 1Y6GA 3BB1A 2RAPA 5EUBA 2FFBA 1ZU4A 2GCNA 2I7CA 2G36A 3EGXB 3Q3GE 5HIMA 3URMA 4ZT5A 3EGWA 4NCXA 1IUPA 4H15A 4WOKA 4YCLA 2ORED 2R8YA 2I2FA 5FFNA 3RHSA 1E2UA 1M3SA 4YJ2F 2JGLA 4HNGA 1P2VA 3FHJA 3I8OA 4XWOA 5AJXA 4RPHA 4BP1A 3JALB 2CJWA 3N2KA 2IEIA 4MYDA 1L1QA 5JE8A 2RGYA 3K9QO 4AWBA 2ZR9A 3Q3CA 3TNFA 3AX6A 1YAJA 4XWGA 1QRAA 4LC0A 4ZFNA 4OBEA 3F1KA 4L4YA 3KHSA 2C2GA 1NF9A 1XC7A 4L08A 3PT5A 1M8GA 4GZLA 1Q20A 1PYDA 4PSUA 4EP1A 3TVYA 4FT2A 4E08A 2PKQO 3BH6A 1HFKA 5F9HA 5I3CA 4CG3A 1YONA 1XNQB 2AOXA 1EX9A 4U7DA 4IINA 4Z8XA 4RK0A 3DW3X 2ASEA 1YL7A 4HAZA 2IEYA 5G1PA 4CR6A 4BNIA 4H0CA 3L4BC 3G8DA 5K8IA 3IALA 3L1IA 3T5MA 3H65A 2QG6A 5CNMA 2ZJ4A 3S1AB 2EWVA 3NBUA 3O3MB 1V48A 1RYYA 5G0SA 3IRUA 3P4YA 2H29A 3K4HA 2PFGA 3RW9A 4GRAA 2H59A 4L0CA 3QKIA 3TTVA 2RMKA 2AJTA 3IURA 4MSUA 2CLFB 2PV0A 4ND1A 3LV8A 5DPMA 1FP4A 1QKKA 1YDEA 3KLNA 4LSGA 1SC4A 3IA7A 4YO7A 2O8BA 1AKQA 4AURA 4KX3A 2W83A 5T8KA 3W5VA 3M0EA 1CY1A 4G0VA 2IWRA 4E12A 4E5KA 3UV7A 1DKUA 1HT3A 1I0LA 1Y6RA 2Q1UA 2UV8A 2RHTA 2YRFA 3SBEA 6PFKA 4NSNA 3ANMA 3L7NA 1KVSA 2ZXEA 3JZDA 4R68A 4LHVA 4K9DA 3I3SR 4BLWA 1ZUNB 1C4OA 3MB8A 1UBJS 1WOMA 2QN8A 4P7KA 3E1SA 5FA6A 1XXHE 1KNQA 4OTZA 1DTEA 4UUOA 2GK3A 1ICIA 1YB5A 5G0UA 3VUEA 4K9OA 1E5VA 3HKEA 2W2XA 5EPOA 4AS1A 4NU0A 2I22A 4KQCA 5CX4A 4B3CA 1DPGA 2PIDA 4HGZA 2H92A 2LVBA 2PO7A 2YINC 3AETB 3LBIA 4TS1A 4TTIA 4EMUA 5J4HA 5JFOA 3FYUC 4B45A 5KO2A 2CNNA 4JJ8A 5IAJA 3KQSA 1OQAA 1DMRA 1NXTA 1Z5ZA 6CHYA 1BKYA 3RRNA 4GKVA 4G0NA 2WC1A 2FPIB 3FTCA 5DO9A 3OWXA 1SC1A 4C2UA 4EVIA 1FTYA 4Q03A 3G13A 4IDEA 1KJIA 5M3BA 4V1CB 2Z57A 1EYZA 4QDJA 2KQUA 3QPAA 3Q0EA 1S2OA 2C9ZA 3EHDA 3PQ2A 5JR3A 4EABA 3RWBA 2HCBA 5CLLA 2Y27A 3IDSA 1GFIA 3Q2KA 5AD1A 1K2VN 3Q9SA 4KG7A 4F8YA 2P75A 4P4UA 4RGBA 5BN5B 1KJWA 2IZZA 2MINB 1LV7A 4EGQA 1AMUA 2CUNA 2EJUA 2QTCA 3GA0A 2JJ8A 2HFKA 4BFZA 4OHPA 1Y4SA 1BXRB 2PG3A 3GUHA 4YRPA 3UJNA 4BVEA 3INNA 1ZD5A 4NZNA 1TUBB 3L1KA 3SF8B 3JALA 3ZV6A 1Z4KA 2WM3A 2UYQA 1N5DA 4JEHA 1AVTA 1H4TA 3L84A 4K6OA 4NESA 3SJAA 1HNNA 2CEAA 2OZLA 4N6OA 4ZAGA 1OWNA 2I0FA 1KZHA 2JA1A 3VO8A 5J3JA 4MQLA 1XEWX 3JVVA 3SZLA 2WM2A 3CVUA 4HD8A 2DERA 4RXMA 2B8TA 3ZHYA 3WLNA 1U6KA 1ZJ4A 1OIWA 1YE3A 3A10A 4XVRA 4Y9TA 1RXCA 4EB6B 4RZXA 1NHWA 1WPGA 5DSTA 1O94A 3F1LA 3PD1A 4BAZA 3V1UA 2Q1SA 1X87A 4UTRA 5KJ6A 4I9NA 3OH8A 4GI2A 4JODA 1EX1A 3H9EO 2CDAA 3S1AA 4H1VA 4DXDA 4QG3A 5LNK1 2E6KA 4L02A 2WTUA 1YRQA 2Q3BA 1J0AA 5D1HA 5B6JA 1JZQA 5KSZA 4GZ3A 1ORTA 4LRTB 3BGVA 4CIDA 3WRXA 1XJ0A 2PS9A 4OXNA 3SEFA 3LQ2A 5LQDA 2QUIA 3TOZA 3OIVA 1Q0ZA 3S3TA 2C9YA 1G64A 1RJGA 3HH8A 5TPZD 4PCAA 2QBYA 2P2ZA 1YQGA 3BIWA 1CQWA 1N8SA 1C7FA 3UT5B 4LZOA 1MVOA 3IE2A 3IERA 2JFGA 2H4HA 2IX9A 2QP3A 2C9DA 2WQ7A 3E9NA 2C7GA 1UBLS 4UDXX 4GQBA 3OZIA 2ZAGA 2X4DA 1RXSA 1Z25A 2Z9CA 2HMUA 1WB5A 2D1SA 4O4LB 4QNNA 2VJYA 3L0ZA 4MGYR 3M3DA 1F2TB 3CUTA 2ZUVA 3KHUA 1FJ2A 1J0EA 2WZDA 4XIYA 4QSHA 1Y3BE 1UWLA 4D3YA 1JHXA 4HQ0A 1FQWA 5IKOA 2VOEA 1D2EA 2IYPA 1N2ZA 3AETA 3D1VA 4IUCS 3IEUA 1RLOA 1F9AA 4TV8F 4H1TA 5KSYA 1TQ8A 5CR9A 2Q6LA 4IKOA 2GBFA 4UTNA 2ZUFA 1NIJA 2JANA 2R3SA 5CH5A 2JIQA 1K6MA 5BUSA 4TVOA 3HJFA 2X40A 3HNRA 2RJOA 3KB8A 1LZLA 1T5HX 3C1AA 4JIGA 4W1QA 3OTIA 2ZZKA 3OZBA 5BOVA 4NFLA 5HFJA 2CXTA 3HFRA 1EFAA 1BMQA 4OQLA 1ZM7A 4LXUA 1EG2A 4BVAA 2I6UA 1HLPA 3JZFA 1E94E 2AYYA 2XB6A 3BQNB 1K4KA 3PXCX 3VAYA 4DEVA 2JC3A 3LVRE 3EG9B 2OCKA 4WDRA 5JZ9A 2OE2A 5EEHA 3VR5H 4NK4A 3FWPA 3O8QA 5EMKA 5BSGA 3ZLJA 3VU0A 2MINA 4CI0B 2AS0A 4LY0A 3MYRA 1WZEA 4ZAYA 3WKCA 4LCEA 1E59A 4PZZA 3FMVA 4RMHA 4DE5A 1ORVA 2YBDA 4HH1A 3SF8A 1LRLA 4Y6LA 2P79A 1OBHA 4P32A 2QT1A 5EKTA 1E8MA 1DEXA 4URFA 2R6ZA 3NGMA 3B3AA 2D0DA 3OKCA 1U0JA 5CGQB 1MNQA 2G9VA 2W6PA 1ZXXA 2ANBA 2JIBA 2ST1A 4LRSB 1U8EA 4ESHA 1XF9A 3B48A 1MHTA 1FSSA 2PWPA 1JFRA 3FW1A 7REQA 2F7SA 3EGIA 4RQUA 5A0FA 4GDFA 3AIMA 2P7IA 4HI0E 3R8FA 1Z88A 5GONA 5AK6A 5C8ZA 1T8PA 4US0R 4BNZA 3EUEA 3L6RA 1NW4A 3ELDA 2FW7A 3D64A 2QAIA 1LD3A 3PITA 3QSYA 3RASA 3EXG1 4JP2A 2HXSA 2ZWAA 2CFCA 2OV3A 2P1ZA 3T3IA 2XDQB 4CDMA 1MG5A 1JH8A 1GKUB 3RVJA 1E2BA 3RBVA 1ARZA 4YMHA 1NXXA 1Y5LA 1G8PA 3FVTA 4N03A 4OHXA 4AS2A 4TTJA 1WXEA 4XW2A 2I5PO 2XPCA 4QZVA 1P7WA 4ESOA 4JI2B 3WKDA 3A0UA 5GY7A 3D6HA 3UT5A 1R2QA 1YJBA 4LOKA 5TQJA 3A0RB 1RWMA 2Q0SA 4ZEOA 3TF5A 5ELMA 3HXQA 2GFHA 3G2QA 3BT7A 2WSBA 4QNMA 4RF2A 2RKBA 4B2LA 1TAHA 5K45A 1ZAKA 1DAFA 2PU5A 3HJTA 1XVIA 5JNWA 2ARKA 1XPRA 1F2TA 2ZR7A 1Y7IA 3MC1A 4D4JA 2IHNA 3TR0A 5ICSA 2VSYA 1EE1A 5DSZA 1AB6A 2CHGA 3K6RA 4K6GA 2ZJ3A 4V0OA 4RPJA 2GXSA 1L7DA 1UFQA 4ITVA 2EGUA 3X1WA 4DCPA 3UK0A 2WIGA 1ZNZA 3FCAA 4FMPA 3G2JA 1CCWA 1FTWA 3PPYA 3RBXA 4MDEA 3IT3A 3LHDA 3QEMB 2VUSA 1QIGA 5BNTA 4W5TA 4P4GA 1CP2A 2WP0A 3COYA 3O2QB 4KXFB 4A6XA 4W5QA 1ZCJA 5E3IA 2V4UA 1WHSB 2B8JA 5I4BA 1FYFA 3OHPA 3RS4A 3KQHA 1KI8A 5KWVA 2HIGA 4X60A 4KIFA 5LP6C 4QNRA 3PDJA 3F98A 4R3UC 1GUDA 2WUEA 1M9NA 2JJMA 4OIMA 4TMKA 1O8CA 3FRIA 1ISJA 2ORIA 2Q2VA 1NWCA 3NYIA 3RUCA 1RPNA 3R5FA 1ZWKA 4YMVA 1E64A 2Z04A 1HXHA 1TJ3A 3WJ2A 3GF4A 5BSFA 4QBGB 1Z0FA 2JD2A 2VNSA 2WMYA 1PT6A 4IY1A 1EHCA 1U0FA 1V8PA 2A9KA 3NX4A 4EB6A 3E18A 4PHGA 4EH1A 4M36A 4S24A 2OAGA 3H97A 2RCNA 2HWUA 4RTLA 5J59A 3AH8A 1WUHS 5AI5A 5ADWA 4XUEA 2VT6A 1IJBA 1YZUA 2B2NA 2ZRPA 3LYUA 4S1WA 4D0RA 1YUBA 2A5FA 3T8YA 1QF7A 1GP2A 4EVSA 1SMKA 4BMCA 3KVYA 3Q9NA 5IS2A 4ZKDA 1QMGA 4H7PA 3ROZA 5K3EA 1QTQA 1AQNA 1PIWA 3KJHA 4U2GA 4NFYA 5IAGA 3NPAA 4RZHA 2JCBA 2XY4A 4CKXA 4DV6B 4KAXA 2FMIA 5HA5A 2BH9A 1VGVA 4FP9A 2MR5A 3E9ZA 3N8GA 3R23A 4HJXA 2ZUTA 1R0LA 3NV7A 3VZQA 3W2TA 2EX4A 4G5QA 2GKGA 2BH2A 1SKQA 4UE6A 4BNTA 4P83A 1NZDA 4OK5A 5FDFA 5JAMA 3IKTA 3LKZA 2IQ5A 4HDMB 1GGFA 4N01A 1E1KA 1K8YB 2XDQA 4MS4B 3USZA 2A5LA 2ESRA 2R7MA 3MWDB 1NDHA 2A9QA 1IPHA 2BEJA 3JQ6A 3KJEA 3UANA 4PC7A 1C7QA 1D2CA 1QRRA 4WLOA 3KZMA 5E9AA 4DM4A 3OD1A 4F5YA 1RM5A 4H35A 4EKGA 1W93A 3AK4A 1Q15A 1R00A 3F6YA 4G85A 4RMGA 4TXHA 3V7FA 1EQ2A 4AW9A 2HV8A 5JECA 4HNSA 4K9SA 4RYDA 1AXEA 5SY9A 3I9MA 3MPOA 4RWZA 3OTWA 1U2ZA 2XYRA 4FCCA 1XD2B 4OXKA 3PVZA 2X8AA 4P4NA 3LBFA 1KETA 2HSZA 1TXGA 2GJSA 2OPBA 5B57C 3I0NA 1RRFA 5EXXA 4UUAA 3T12A 1PSZA 2DFLA 3UBMA 5FNVB 2QM0A 1TZJA 1YRWA 4WZAA 1R9NA 3VNBA 4E33A 4UOEA 3WHPA 2XGMA 1YZVA 1O58A 5B1SA 5FWYB 5JDIA 3HJBA 1RXEA 1Z8DA 3HV0A 4L4UA 1OI3A 1J56A 3DUWA 4RKFA 1WZIA 3VR3A 2NNLD 1EFTA 4BX0A 4QEZA 2ZBPA 1I5RA 1Z62A 3AVVA 1VE9A 4PO9A 5G02A 3ZY3A 1GTMA 3H84A 2WVHA 1C4XA 3MSCA 1WHSA 4R1UA 3VR4D 1PR9A 1N2HA 2ZATA 1K63A 3EAQA 4Y9UA 3PYLA 3VYUB 3WWYA 2VFAA 4MULA 2IYFA 3LUFA 4EKDA 1E99A 3KJIA 2FTKE 4NABA 2CKMA 3EDRA 1SVWA 3K0CA 3DMDA 5KSWB 3ZDXB 4F93B 3ORSA 4AIRA 1GOTA 4IHAA 4D9JA 3HWRA 3ZWCA 5BV1A 4MRNA 1UL1X 4PYRA 1CXZA 4C0XA 5BMVB 2JLZA 1CF9A 2XVZA 3NGLA 4O4JA 2PXAA 1FJXA 4CHTA 5E4JA 4CKCB 4A36A 4BY9E 4QDTA 2MWMA 2Z2JA 3LVQE 3R7LA 4Z4HA 1TM7E 3I2FA 3C6MA 3QV2A 4AKEA 5EP2A 1Q1AA 3DZHA 4CPDA 4DBVO 1QHGA 5A6SA 1WCV1 5DHTA 1XV5A 8LDHA 2YUIA 3GEMA 2FKAA 5G2OA 3L6BA 2Z0MA 3H1TA 5C4MA 3M83A 4NYIQ 1QCZA 1SHJA 4YJ3F 2W2PA 2JJ1D 5CFPA 3FDIA 3N5CA 3ONDA 4Y2PA 3RYHA 3IBGA 1P4AA 1CIPA 2R8BA 2BMJA 5AOCA 3ZDQA 2DPMA 2ZS8A 4Q7LA 2WWFA 2C3OA 1BN6A 1G55A 5JNLA 4WEOA 2PUFA 1II9A 2W8BB 4R81A 4OFBA 4JI3B 2CYCA 2CD7A 1FMCA 2ZSUA 2WE8A 3N6RA 4RIEA 3VR2D 1F8GA 2IZOA 2NO6A 2XCRB 1QFMA 4E2XA 1VKOA 1MN6A 4H3VA 4B7UA 1HYHA 1QB7A 4QVGA 3T94A 3IEVA 1CZOA 1YCFA 2OG1A 4XUDA 4IOLA 4XPIB 1CZRA 4DPLA 1P77A 1QH1B 3EMDA 1NC3A 2CNBA 4HDMA 3HO1A 3RNLA 2VP5A 5JNTA 4MW7A 1WQ4A 1QGZA 3MWDA 4G3XA 5ER6A 4YRSA 3GQBA 4C6SA 4RTPA 3UZUA 4QATA 4P9NA 4S3MA 5CFLA 1EDZA 1HDOA 2GRUA 5I7HA 3IQGX 1JE1A 1U90A 4ER5A 2Z95A 2VHXA 4PIMA 5FA5A 4EI9A 1KXJA 4JLUA 1MO6A 4OHYA 2E5WA 4NDZA 4CV0A 4OF4A 3O8LA 2JI4A 3TBFA 1J9GA 1E2DA 2J5QA 1K3TA 1I7SB 4DG9A 2WJJA 4CQLA 1DAGA 4EWLA 1B42A 4MTLA 1PQUA 5FNVA 3L6OO 3WFIA 2VBIA 3K35A 2ALJA 1YJQA 4CMEA 1KYVA 1MGOA 2IYVA 2O9JA 5K5EA 5EXPA 1IQUA 1JEOA 4Q7JB 1S02A 4HN2A 2LTAA 5DCYA 5BQ5A 5I7FA 3FJYA 4NOLA 4X1KB 2OXEA 5FFMA 1ES9A 3OCVA 5K2MA 3ZHVA 3W5SA 2Y67A 4BFYA 1L8LA 3GFSA 3LHSA 4GGOA 2DBZA 1NRWA 5C8YB 3A1TA 2GXUA 1ZR2A 3MT9A 1IY9A 2ZJZA 3EVFA 4LA4A 1FFAA 1U2GC 4K1XA 4O4HB 4BDSA 4HV4A 3N6VA 3DTVD 2A30A 3VX3A 1JT9A 2CLOB 2BTOA 3NKFA 1EGMB 4ZCLA 3UOAB 4XDZA 3RAEC 3UTDA 4DUGD 1RWVA 1MMFB 1TAQA 2D2IA 2RGGA 4U0JA 2C88A 4U5QA 5F2NA 4RQAA 2I9KA 1PS9A 4H0FA 4JKOA 3G2HA 2IYAA 5BPFA 3ZKWA 4WADA 4CKCA 2VYCA 3STHA 2JFHA 3EEFA 1Z6TA 2AQKA 4ENVA 1CK4A 1ESCA 4PQRA 3W1VA 2YXLA 4JT2A 5BORA 1LLCA 2ATVA 5TS3A 3I8SA 4QJ3A 4EFDA 3PGLA 1M33A 2EDAA 2Q0HA 2Z4TA 2DB3A 1GGJA 2BUBA 4ER3A 3VPFA 1P0QA 2X5NA 3B52X 4MNTA 4XOUA 1M0SA 1U7DA 4HRYA 1CY0A 5ALVA 4FK8A 3PWKA 4A26A 3Q7SA 1RLMA 4OI4A 2P4SA 5DSXA 2FE1A 5KNDD 3LQKA 1N2XA 2GWHA 3QKRA 3VKHA 1TK2A 2C0CA 2PZMA 1LSSA 3WK8A 3BGDA 2VDJA 3QY9A 5B64A 3TQRA 5A3QA 3WOVA 4C4RA 3AVPA 3HN2A 1IQ0A 1DXQA 1GCOA 1GRNA 4QAJA 4NE2A 3VNVA 1L5ZA 5HIIA 3E7PA 2Y2VA 4KIUA 5K8UA 1PVOA 2QDXA 4G4SP 1NXOA 1FNSA 2I80A 3OP1A 1GCGA 3AVQA 4HDNB 5C34B 4B3SB 4TLDA 3VU8A 1KF0A 4IDPA 5IKXA 1QH1A 2GJ9A 4JC8A 4AO6A 2PUEA 1U8UA 4WBNA 3LJKA 1N6RA 3D59A 2I71A 3H7AA 1NF8A 3MAGA 1GT6A 4C43A 1SHUX 5DMHA 4H7DA 4O6VA 2EP5A 1TIKA 2PVPA 2YWXA 4J91A 1XWWA 4S0XA 1KI9A 1DKPA 5JJKA 1ONSA 1Q12A 1RKXA 4KNYA 1GTG1 5E95A 2NSHA 1EG7A 4NE7A 4NJMB 1QRDA 1SHTX 1TIPA 4QXQA 4MAMA 4W8OA 1DTWB 4DDUA 2Z1MA 2PVCA 1VSVA 5GZ1A 3VNQA 3LGSA 4KXLA 3AWIA 4ENSA 1SUWA 2AIRA 5TPWA 3C24A 3Q40A 1R66A 1CZHA 3TB4A 5T57A 2O4UX 3HI4A 2AEMA 3GP3A 1L4KA 1JILA 4IXNA 4U5XA 3HE3A 4BE7B 3SEAA 4BLSA 4ZI7A 4PQYA 1G41A 4DVGA 1JHRA 3D8HA 4KGDA 4X1KA 3TTTA 5BNWA 4CLOA 3PLAE 1IATA 2FHPA 4NPAA 4YQFA 4EF5A 1DJOA 3UW3A 4FZ5A 4KXWA 3V4SA 3HY6A 2VXBA 3ND5A 5C8YA 2YICA 1LK5A 1ZN7A 3ONFA 4PG5A 3UAXA 2AVNA 3NUQA 4RPKA 3SKVA 4BO7A 2PRSA 2QZZA 3O8RA 1RC1A 4EK9A 3W3AH 1PWXA 1Z0KA 3GJYA 4J29A 4N3BA 4O4HA 4HQOA 3TM5A 2RG7A 2PT5A 3KB2A 4FNAA 2BGRA 1JF8A 4WK4B 4YJHA 3ES9A 3P2EA 2Q1WA 1IM5A 3C43A 1FDVA 4A03A 3UWSA 3HXOA 2QPLA 3UK7A 4DLNA 5JSYA 3H1AA 4F4FA 1HTTA 1XDDA 2AXQA 1G3RA 3GD5A 4EUFA 4HAIA 2C58A 4QGHA 1WMAA 3A1FA 3O4RA 1P3Y1 1PTJA 4N0QA 1Z4IA 2WUDA 4U9HS 3ZVLA 4COKA 5U1PA 3JWPA 3K9CA 4JENA 2D5CA 4LC9A 1RC8A 2QJFA 4RFSB 4RQBA 2WJYA 2GLXA 3EEBA 1XRPA 3MJDA 1TJYA 1W36C 1C1YA 1Q3TA 4B80A 1CDOA 3MJFA 4BRUA 2PFSA 1FRZA 4EPRA 1TPYA 2BUAA 3QELB 1UQRA 1QX4A 4S2EA 1DXYA 3CYFA 1K4YA 3DZGA 2R8RA 4I9HA 2WLSA 2XUZA 4X7BA 5KDOA 1U0SY 4WNYA 3QRWA 1E2PA 3DPUA 4QOFA 4KHZA 1WXDA 4YR7A 3FFBA 4ECEA 2E4VA 2EBWA 3KZOA 3IT1A 4EHKA 4LVCA 3VYSB 5T4FA 4ASUA 5KU7A 2WKWA 1T24A 3MS4A 4TM8A 4IMRA 1AKEA 3F0TA 5A5VA 3LCJA 2FN4A 3MELA 3LY9A 1CNFA 2HA6A 3PP8A 2ZJ5A 5G4KB 1P5HA 2Z9BA 5EESA 3UMCA 4HZIA 3WLAA 3ZI4A 1S2GA 2INGX 2OHGA 3JQCA 1V71A 5CD1A 1YR3A 1NBWB 2Q8NA 1SKYB 2WTEA 1HQYE 3TQSA 4G1MB 1XL1A 3TLBA 1HQDA 1P6UA 1G4AE 2MYTA 5EUCA 5FA8A 3ZGOA 4YYZA 4FGKA 4O4LF 1GQQA 3AEQA 1QF9A 2DWCA 2WPDA 3CM0A 4ILKA 2C84A 4I1YA 4Q1VA 2CK3D 4JOBA 1TQ2A 3FNQA 3OX1A 4MXDA 4YWHA 4B4VA 5ES4B 3K3PA 4RZQA 4YCBA 1NVXQ 3ZE8A 3ILVA 1UC4B 1KZ4A 3CKLA 1A50B 2W00A 4Q6BA 3DCJA 4D74A 5ABPA 2W2QA 3TQCA 1GL3A 2IIPA 5LOVB 1CE8B 2CNWD 2F1IA 2OKGA 2HC9A 2IHJA 2V58A 3WBJA 1H1DA 2QYOA 3IP8A 4JB0A 3N70A 4DIMA 1GUZA 3CBQA 5AUQA 4NJMA 1HQCA 2IHZA 3DWIA 3EC1A 3L4EA 3DPSA 4PGAA 4A91A 1LJLA 4C87A 3EZFA 4LBZA 2H5JA 3I45A 5CM9C 3EMKA 1Q74A 4BB0A 2JGEA 4QYMA 1JLKA 4NC9A 4WZ6A 2IVFA 4FOLA 1B8UA 4Y2JA 1VCNA 2JZOA 2CXSA 5T4EA 3NHJA 5FB3A 3AI7A 1RHKA 1SXJB 3TDKA 1YVUA 1GAWA 1XZIA 2ZIAA 4NV3A 4MQ6A 5EP3A 4EA6A 2GRAA 1I3KA 3MQFA 1PWHA 4N40A 4UHCA 4OI0A 1KBZA 5BWNA 3Q6IA 1SCDA 1M7BA 2WMNB 4X64B 2F55A 1UK8A 2C8LA 4L5JA 2CVFA 4YMLA 5BXYA 4R3WA 1DVRA 4ADSG 3UMMA 9MHTA 5T6MA 5KNCA 1RCTE 2ZQYA 4M1SA 3ZU6A 5FOQA 2IPMA 1CR2A 2HQSA 3RTGA 3V1TC 1N2GA 1A3CA 4HG2A 3ZVNA 5JSZB 1KXZA 1QCDA 2F8SA 2E1RA 5H16A 3GPBA 5I3ZA 4CDRA 3AJEA 4YIKA 1FE8A 2G5GX 4QAQA 5FO0A 2CV1A 1RRVA 4R6WA 4EJMA 3TEJA 1OXBB 1XL0A 4MA5A 4DMMA 1WHTB 1XVVA 3OF5A 5CA1B 3E8MA 1KR2A 1OZHA 4F85A 3OPVA 3QIAA 4QUIA 5GIOE 1T5SA 1TMYA 2QV7A 4L07A 4MW6A 1L5SA 4RFSA 3OOWA 5AXAA 5D84A 1TMOA 3NVKI 1W88B 2QUBA 3CNEA 4L57A 3Q88A 1R6VA 2A0YA 2FP3A 4FSDA 2Q5IA 5JC1A 3DR5A 3E3AA 3E81A 4LZPA 4BBAA 4BO4A 1M2NA 2V54A 1ZMOA 3IPRA 2ZAMA 4GRDA 4F97A 2IXEA 3OJXA 3KFXA 2WYWA 3EXFA 4QREA 1W0KA 2CLKB 5KWJA 5ICFA 3O8DA 3IQZA 3VMMA 1DMSA 4AXBA 2J3HA 3KT6A 1R74A 2GCOB 1T9AA 2LRHA 4EW1A 1U0EA 2YQ4A 1ACLA 3QMWA 3KOUA 4B3MB 1BGVA 3EQ2A 3WLOA 2YWHA 2ZUUA 3V9PA 1WU8A 3NNDA 2HBQA 2KLBA 4J90A 5LJIA 2XYPA 2J8ZA 3DAFA 4DJJA 1E9AA 3H7IA 1HSOA 4BFXA 5BSWA 1EGVB 4WWHA 3TRDA 3PGA1 1Z3IX 1N8KA 1AKUA 1WMFA 3QHPA 4G4GA 1UBEA 2G04A 3RARA 2FEXA 3LL4A 5FBLB 2OBNA 2WE7A 2I67A 2DSTA 4I1UA 1D7OA 2CKDA 3HCRA 4JC0A 5AKLA 1EXDA 2D54A 2JI7A 3RKSA 5HIKA 4JBHA 2ZROA 4OYYA 3B36A 1TB4A 5F23A 3PR1A 4P92A 5AW0A 4DR1B 4DMUB 1CE8A 3FDFA 1DUSA 3IMKA 2EFJA 3QPDA 3NDIA 5H81A 4OFXA 1HEIA 3AZOA 4MQEA 4NMLA 1G21B 3UMVA 2WEKA 1RWBA 3MD0A 3OQHA 4BGIA 3A32A 1E7RA 1JPVA 4PG4A 4CF3A 5KTYA 1DWPA 4IIEA 4OQZA 2GXQA 2HBRA 5F51A 4K87A 4YR9A 2CDRA 1QAMA 1GCIA 1JUDA 3KKKA 4I3GA 5IJZA 3E48A 1CJSA 3Q2OA 1PGQA 4IJMA 4IWNA 1F1JA 4N65A 1KQPA 1RYBA 3GAFA 3O74A 4HH0A 2BTQB 1EFVB 4NATA 1XQVA 4QYSA 1U2TA 3I01M 4GAEA 1CEEA 1AO0A 1FDSA 3PFBA 2NZUG 3V4OA 2X2EA 4OXYA 2CMFA 2ADMA 3MK31 3OFJA 1CUYA 3DE2X 3ZEIA 3GUVA 2PGDA 4KLRA 2A3NA 1E2QA 4YP9A 4CU5A 2EFDB 1ZGJA 2YASA 5FBHA 3ZUGA 2OENG 2O48X 1S4QA 2G9NA 5ISMA 1ZD1A 3NDPA 2ZVDA 1H85A 4R4JA 2E89A 3R0IA 3UAWA 5JJBA 1UT8A 2FUG6 3DNPA 3AFOA 3PU6A 3T3OA 3DLCA 3K9HA 2IEDA 4KMSA 1E2EA 4MWBA 3AVWA 4EFNA 1QTNA 5JSZA 3WHKA 4AKHA 4D6PA 4ME6A 3ZX5A 4RTNA 3K32A 2GN2A 4N6GA 4RACA 5E9QA 5KYNA 2BDEA 1P1CA 1NPYA 1VMDA 3NWPA 4F5EA 2B4RO 3MRXA 4O2BA 4C29A 1QZUA 2WFZA 5CA1A 4KOEC 3KJFA 2FFJA 4PYNA 3UMGA 4GUDA 4B4WA 1AG9A 4PLHA 4CMCA 3EA0A 2XCIA 3O2SB 1XRNA 4RLFA 5TVKA 5F1YA 1TD9A 4EJSC 3ACBA 4C01A 3KDSE 4HFNA 4WY5A 1W88A 5AJHA 3NIDB 3ENZA 4FC7A 2K2WA 3L01A 3RIHA 4HAUA 1IQPA 3BMXA 1KDTA 2ZU0C 2GPNA 3G0BA 4G8BA 1G20E 2DRIA 2B9VA 2XQJA 1SVUA 4TKVB 4AWAA 1E69A 3B3QA 5EJ6A 3QQ5A 5IZ4A 4O2LA 4V0NA 3UXMA 5CRIA 4PANA 5CW2A 4FW9A 3NVAA 5CVCA 3EFOB 1C1XB 2H07A 3DZKA 5DYYA 3OLWA 4YGXB 1YIOA 4B32A 3ZJ5A 2GCOA 5I4IA 4TKLA 4HRXA 4BQIA 1V0JA 4PYJA 3I1IA 2IYZA 4Q7QA 3UH0A 4D3SA 1T9BA 5IWCA 4N18A 4YXWD 3WRYC 4DMCA 4HNQA 4XPZA 5B6PA 4JHLA 4DDWA 1SKMA 4D4KA 5BVGA 3RUAA 2HD4A 3L5KA 4XOIA 3ELBA 3ZZUA 2BISA 1RZRA 4J9VA 2G28A 1S3GA 4HX5A 2WF7A 1Z4OA 2ID4A 2D7CA 2DY0A 1UKAA 2P6UA 3H2JA 4ZJUA 2VQ6A 1KR5A 2C94A 2GBLC 2O52A 3BX1A 1MQSA 4K81B 3R5KA 4WGFA 5CU7A 5IRCD 4FGLA 3CVOA 4GZMA 3GLGE 4TTTS 5E6SB 3AL0C 3BK7A 3EISA 5AM1A 4O4JB 1Z06A 1E2IA 3K1AB 4Y3UA 1MRSA 4QUHA 4G5OA 4W9NA 1G21A 4JYBA 1M0EA 1FMLA 4HF7A 1JB9A 1JW9B 2UXCB 4DF3A 5LQRA 2E9SA 1IL0A 1M10A 4M1OA 3L41A 2DPLA 1ISGA 5HUHA 1DRVA 2AHRA 1VL8A 2QIOA 3FLAA 2YIDA 3AEUB 2OGUA 4YRDA 3ZNPA 2X14A 1DTSA 3OT1B 1QC5B 3A9CA 2OQVA 3CVJA 4EO4A 5EIXA 1GU1A 1V7ZA 2EP7A 3OQPA 4KMOA 4MV3A 2BTQA 5B37A 1MD9A 1S2IA 3CH5A 3P0JA 2B25A 1WOYA 5BMVF 3CX3A 2MHCA 3FJ1A 1VJ1A 2COUA 4IXDA 3T9BA 5AM3A 2P5UA 3Q85A 1PFVA 2CE2X 3C3XA 5T7BA 4UBLA 1M72A 1Q84A 3RFUA 5EZQA 3X0DA 5DLEA 4RZUA 1UDRA 2C95A 1ND5A 1Z9BA 4ENUA 1TW2A 4AX4A 2G72A 2OB2A 3JRXA 3ZDYB 4B8YA 3O4VA 2BVNA 1RHQA 1MXHA 2IPOA 3CZCA 1DDIA 4G1FA 4KI0A 3ZE2B 1OWMA 4BMNA 3FNBA 1E3WB 1KDZA 3SYTA 1PHRA 4RTKA 1BX1A 4IFTA 1BE6A 2A9RA 3AOEA 5CEJA 2FFQA 3MQ4A 4FM9A 3EPRA 1BZYA 3H4VA 2J3LA 2Z1DA 4P82A 3QLEA 1Z28A 3CURA 3B2NA 2V45A 3T3HA 3I05A 1K06A 1NJ1A 5CB8A 5JJ5A 1HE8B 3QVXA 4HMPA 2R60A 3OE4A 1B0UA 1OX4B 1XE3A 4W1SA 2V65A 5I8ZA 4IIHA 1ONPA 3EIOA 3INGA 2CHFA 3PUYA 2RAUA 3PXDA 3QU5A 4W7IA 2W2TA 4RXTA 3VBCA 3ZXUB 3KU4A 2GA9A 4MV6A 2VJKA 3WA6A 4IGAA 1KQNA 3ZIAD 2PGJA 4MPPA 1QDUA 1W6UA 4TKVA 2QSZA 4RENA 4W1PA 3PIDA 1OWPA 2G0NA 2X7JA 1P4SA 3F9CA 4M0DA 2VBFA 2WDPA 1OLSB 3F4BA 3UMSA 4XM2A 4UDYX 3IC5A 5JD4A 1J97A 5EWMA 1Q0SA 4EMTA 2G9RA 4DIBA 5SYNA 3EFOA 1ZX1A 1C1XA 2XUFA 4CCSA 4KMMA 1N2IA 2J9ZB 4UARA 4IR7A 1Q6ZA 4XM1A 3KEMA 1UXIA 4DCTA 4NZMA 5KX5B 3UJ8A 4UTVA 2AF3C 1TNDA 4R1SA 1UQTA 1JE0A 3PLRA 1PWYE 2CVZA 3DB1A 1NUHA 4MUGA 3SC3A 3LT2A 1ZH0A 2ZBDA 3FKSD 4L0MA 4DV3B 4AL4A 2VT2A 3R6WA 2JA2A 3BRCA 3WLEA 3K0FB 5DTMA 2V7PA 3DZCA 1GA6A 4E4YA 2R0QC 4ETNA 5KCMA 3O3NB 3SXJA 3SM9A 5I9SA 3TQOA 4A6PA 1KI6B 3TXAA 4JJKA 5DW0A 5K3FB 2H4FA 5JXGA 1D6MA 1EVQA 1UBSB 2PMBA 3OC0A 3LBAA 3CF2A 1IN1A 4WK2B 2ZTMA 2UYOA 2Y1DA 1OXVA 4HR7A 1IFXA 3LY8A 1E4EB 2DQSA 2HAEA 3VZBA 1R0CA 1E9SA 2FDRA 3PC8C 2QVLA 3ODPA 2BCGY 3MT8A 1P7PA 4O1MA 1NNLA 1PK7A 2DG2A 2P9CA 3LHKA 1T8SA 3M9LA 2X5OA 3GBSA 4DDVA 5C8YF 3R0ZA 1YA8A 4YFVA 1KWKA 1U1GA 3O0TA 1X0XA 1SGWA 2WICA 5DGHA 4ED9A 2PL9A 1JHYA 2X9LA 1C7IA 3HR8A 4O4HF 1QE5A 3F9IA 2PMEA 5JMWA 1IY1A 1EWYA 1MTZA 3D8UA 3ZDEA 3AEUA 4RBNA 3AUKA 3TD6A 3X1DA 5FF9A 4C0QC 1AN9A 2FRDA 4IWXA 1M7HA 3DNFA 1DRKA 1QC5A 1L0BA 1RAEA 2PMWB 2WD9A 4TT3A 3S8MA 2DC1A 2JVJA 2BFBA 2PX4A 3GA5A 3KBBA