1G5RA

The three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
ERGIIIVFTGNGKGKTTAAFGTAARAVGHGKNVGVVQFIKGTWPNGERNLLEPHGVEFQVMATGFTWETQNREADTAACMAVWQHGKRMLADPLLDMVVLDELTYMVAYDYLPLEEVISALNARPGHQTVIITGRGCHRDILDLADTVSELRPVKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of ATP:corrinoid adenosyltransferase from Salmonella typhimurium in its free state, complexed with MgATP, or complexed with hydroxycobalamin and MgATP.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
molecule keywords COB(I)ALAMIN ADENOSYLTRANSFERASE
total genus 51
structure length 157
sequence length 157
ec nomenclature ec 2.5.1.17: Corrinoid adenosyltransferase.
pdb deposition date 2000-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02572 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g5rA00
5GADl 4D26A 1A82A 1FFHA 1N0VC 2LWIA 2AKYA 1GUAA 1ZIOA 2Q3MA 1Q22A 3M0EA 3WBKA 2OFWA 3V4FA 3M6AA 1XJ0A 3W8RA 3ZS8A 3QE0A 4HB0A 3O8DA 4ZCMA 2QP3A 3H2YA 4TLBA 1QVAA 2B7CA 2IW3A 5DN6A 5J4HA 1E4VA 4W5WA 4QHYA 5FUYA 1E3MA 2REBA 2ZSDA 1DG1G 4LRWA 4D82A 1KI2A 1TF2A 3SYKA 1S1MA 1Z0FA 4MH0R 5FPTA 4RD0A 2ZSAA 4F4IA 1WB9A 2ZJOA 3NWJA 3LBHA 4IVPA 5D3QA 1XMVA 5L3VA 4ZCIA 2V8OA 2R6AA 1TX4B 1ODFA 1VG9B 4AY2A 1OYWA 3K09A 4P4SB 2KWIA 1DS6A 1XJCA 1XF9A 4JLAA 4A6XA 4DIEA 4UJ3A 1IN6A 2IYSA 4X8LA 2G6BA 4TMKA 5C18A 2NOAA 2WSMA 1XCPA 3OE7D 4TL6A 3IBGA 3WYFA 3R8FA 3FHTA 4PFSA 2JIZD 3HYRA 2GXUA 3KTAB 1Z6XA 2R8RA 1YHNA 3E5HA 1XCGB 4DC9A 1AGRA 2Z5FA 4IOLA 4UNNA 5H70A 3TR0A 1MO4A 2V54A 3GJ0A 1OFUX 1D9ZA 2JATA 2V7QA 3BB3A 3LX5A 5FTKA 1H8ED 2PCLA 3UPUA 5AJWA 2VEDA 1Z07A 2AD5A 2CCKA 3KKOA 4LSGA 4DB4A 3ASZA 3GEEA 3PUWA 221PA 1AJEA 5GVRA 4FXPA 3D3QA 1WDTA 2C99A 2NIPA 2WJHA 1E1QA 3OZXA 4FW9A 2GHIA 1YU9A 4G1UC 1KMQA 2FWRA 3VQTA 3ND9A 2QP4A 1G64A 1EWRA 1OHHA 3L2OB 3KTAA 4WZ6A 1BO6A 1VYVA 3L0SA 4U02A 3N5CA 5KDOA 1VYUA 1WA5A 3HPRA 2HT1A 3B78A 3SQXA 2FX3A 2OT3B 4NYIR 4QJ3A 2XTZA 4CRWB 1G5PA 3A37A 3OIUA 2ZJZA 1IJFA 1TTTA 1F2UB 4TL9A 4V0ME 2RGDA 3DL0A 3EAQA 4C2TA 2P2LA 1DAGA 4UQOA 3U6BA 4QG7A 2DR3A 3K0AB 3VNUA 3DPUA 2PMKA 2QSYA 3PFIA 4OHVA 3MGCA 3EASA 4LHZA 5F3WB 3CH5A 2FE4A 2QG6A 2TMKA 2ATXA 5EP1A 1GNQA 1II9A 4RSGA 4TL7A 2Z4RA 3B1ZA 3Q5EA 1GRQA 1TEXA 4QHSA 5CIWA 2JLYA 5FPKA 3Q85A 3GJ7A 4IOJA 3MAAC 1UBEA 4HB4A 1ZU5A 2O8DA 1NMXA 3H86A 1AZTA 4MUBA 2ZS7A 4R98A 1XTRA 4XWAA 4HLDA 3HU2A 3ZH9B 2BDTA 4QGGA 4CIDA 1JECA 3A58B 5CYOA 4ABYA 4BFZA 3LW7A 1XNJA 4L4UA 4PPGA 1LB1B 2WOOA 1D2NA 2FJUA 5AJVB 1N6OA 1QHYA 3GLFB 2D62A 3RS2A 1N25A 3LNCA 3A4NA 1GKYA 1U0JA 2YINC 4LV6A 4A9AA 1ZUHA 1FZQA 5LD2C 5HZHA 2DFKB 5HTKA 1W5SA 4JZKA 3SJZA 1G6OA 2XNDD 3RS5A 1ZMXA 1S1CA 2IYYA 1Z6AA 4BZXA 1E79D 3T06B 1AQUA 4NYIQ 3NBXX 3LD9A 4E22A 2HJVA 3U3OA 4D4JA 3KFXA 2ECKA 3FKSD 1SVKA 2BBSA 3EPKA 1DO0A 2EVWX 3IIJA 3LDAA 4XIGS 1VDZA 2FV8A 3AKEA 1VIYA 3U44B 4D4MA 2JEOA 5JWHA 1J99A 4URVR 3GJ3A 3VX3A 2GVDC 4EDHA 4KXFB 4TTPA 2VP9A 1NLYA 5B64A 2P65A 2OHFA 4GZMA 3U4QB 3H4MA 4YMUA 4WAUA 2WKRA 1LTQA 3KKMA 4C0AC 4D80A 2MSCB 4ESHA 1KMHA 2QZ4A 2FFAA 2G0NA 2CLCX 5FUVA 4GPTA 5B2ZA 3OFNA 1KK2A 3WP0A 1P4SA 5GJWC 2VP5A 2A5GA 2WICA 2CBZA 1IOZA 1Z08A 4L9WA 3WNDA 1P2SA 1JAHA 4C0KA 1OFIA 2Z4SA 2QENA 4A0FA 3FPAA 1LV7A 5FR1A 1GITA 4EPRA 4WVFA 4PAQA 4Q9JA 4LOAA 4XVUA 1IHUA 2GF9A 4ZCLA 5CM8B 1A4RA 2WM9B 4TQ9A 4Q02A 4DUGD 1OPXA 1W4CA 5K8UA 4MKFA 3HU1A 4GSYA 4RD4A 5DSZA 2EFDB 3AGPA 1A2BA 1C1YA 2C2HA 5H1YA 1O3YA 3NTUA 1Z0AA 3CKLA 3CRMA 4ZI2A 2VSXA 3KJEA 3VKHA 3EA0A 3K9NA 4DLWA 2ZJ2A 4WA7A 4TQUS 3SHWA 1AS2A 4QKQA 1XFAA 4LYHA 1RVDA 1FTNA 5KSOA 5JJKA 1KNXA 2BM0A 4NHOA 1DAFA 1M7HA 3QXSA 3P4XA 3QF4A 2WVJA 4IKEA 1T5IA 1CKEA 4DDVA 5LB4A 3SS8A 2PJRA 4LJ7A 2XZLA 3MJRA 3QKRA 5JHGB 2X1VA 2D7CA 4B3FX 5KNDA 3CRVA 3EPHA 3R9IA 5FOUA 4HAXA 3GEHA 3DVLA 1HY3A 4PC6A 1NL3A 2F1JA 1IONA 2CCGA 3F0TA 3IDQA 3WHKA 2I4IA 3CUEF 4TMWA 4OHYA 1OXTA 4U00A 2OXRA 4A6PA 3QNUA 3P27A 2JGNA 3KQKA 4KFUA 4HAVA 4FINA 5ELXA 3BB1A 2C04A 3JVVA 1CEEA 4KSBA 2CHQA 1SXJB 3PIRA 4OI4A 5J4VA 2J0UB 3EARA 2GAOA 3EZ2A 1Q57A 2OUKA 2PJZA 3RS4A 4C4PA 4R2IA 5CB6A 621PA 3O8RA 1MR3F 3EWSA 2FPKA 3I1FA 1BMFA 1WMSA 2QSZA 3F5FA 4BFXA 3GLIB 3IEVA 1Z28A 2QQ0A 1CBUA 1UPTA 4FIDA 4CEJB 3HR7A 5DI9A 5BW8A 4D4LA 1Q1ZA 1PUJA 4R2HA 4ARZB 4YMWA 4PHGA 2AR7A 1MO3A 5FBLB 3UMRA 4TSFD 2XSZD 3KQUA 1SVMA 2G3YA 1GAJA 2P6NA 3CWZA 3MMPA 2BIFA 4NCHA 1T8UA 3CO5A 3EG5A 2DY1A 1ZP6A 1G3MA 3EIQA 4MKGA 1XDBA 4JVMA 3TVTA 3NDPA 1TQDA 4M0LA 3LV8A 1AA9A 1GP2A 3TNFA 4A2WA 4EFMA 1MV5A 3GJ5A 1KI3A 4V02A 1F3OA 1NI3A 1COWD 2RCNA 2V6IA 2B6HA 1N6HA 1ZW6A 3C14C 3AH8A 2IF0A 1R5NA 4B3CA 2F9MA 1R2QA 3AF1A 3VNVA 2IYRA 2WJYA 1U90A 3L43A 5FOSA 4C9BA 3X1WA 2QE7A 1GL6A 3IQWA 1U8AA 4YMVA 2FGJA 2CL7X 1KDRA 4NPHA 3UWOA 2QE7D 1SGWA 4Q18A 4UNPA 3L0OA 1ZNYA 3DM5A 2WWFA 5G40A 2IS1A 4G5GA 2DWQA 3C5CA 2RHDA 1MABA 3K70C 3BXZA 1O87A 4RJLA 4KFSA 1E2IA 1MABB 2YVUA 1G5TA 4JVNA 4Q4HB 3AV0B 3Q5DA 4C0JA 5EXPA 1DEKA 4F7WA 1B0UA 3QKSA 4XD7A 4MRNA 3IBYA 5TY0A 3PITA 1QG4A 2EW1A 4M9XA 2ZSBA 1OE0A 4EJSC 5BN3A 2ZIAA 3W6PA 4H1UA 4KBGA 2IX3A 1JEEA 1E0JA 3CR7A 2ZI3A 3RRMA 4EJSA 5DGXA 4W9MC 3VU9B 3FMPB 2ZRKA 4JSTA 4D0LB 2UVQA 2ATVA 4EPWA 2OFXA 3KX2A 1Q3HA 3CF2A 3MSXA 4RCYA 3KB2A 3SJBA 3QIAA 1F2TA 1CR1A 3LWNA 4B48A 2FU5C 3QG5A 1ZNXA 3TRFA 1TAGA 4PR0A 5G41A 4MYHA 2H16A 4FCVA 3LBIA 1E2PA 3ZIAD 4DIDA 1KO7A 4OQXA 2KSQA 1SXJD 5FBVB 1XXHA 5KDLA 1T5LA 3PEYA 5EXXA 1YR7A 4IVQA 1SQ5A 1KI9A 1NLFA 2W6JA 1TNDA 4ZV4A 4DSNA 3I73A 4RCZA 1S8FA 2WV9A 2RMKA 2OBLA 3ZLJA 5BXQC 2JLVA 3VTKA 1Z2CA 3GLGB 1XPRA 1OXSC 2XOKD 3PUVA 4TQAA 1IBRA 3R8CA 4Q9LA 4P31A 3GLHA 4ERNA 2H1LA 2QT1A 3RDPA 4US2R 1KDPA 4JBYA 4ZI3A 2CL0X 2YNMA 5KU1A 3AVWA 1N3BA 2NGRA 3TR5A 1T3LA 1R6BX 1UEIA 1EFTA 2HCBA 4NYMR 1D8TA 4QBFA 2E9SA 3EZ9A 1CLUA 2NO9A 2BMJA 4ZDIA 3DOEA 5FH9A 2IHBA 4FMCB 3H1TA 3THXB 3OIYA 1ZNZA 1ZD1A 1QRAA 3QQ5A 5AUNB 4B3GA 3TW4A 3LLUA 3RABA 2BOVA 1KHTA 3EC2A 2QAGB 4QBIA 4E5UA 3OAAD 1TADA 1ZUNB 2N42A 2GZDA 4G5OA 1NVVQ 1EFRD 1VYTA 1IY0A 1II0A 1UDWA 3LY5A 3Q7QA 2IYVA 3I62A 3IPXA 1Z22A 3S1AA 3BWDD 4QJ5A 4AURA 5JSZA 1YRAA 4AYXA 4NYJR 4KLZA 2ZAOA 5F9HA 2BWJA 1HTWA 4A2QA 3LO5A 3DOFA 1N6PA 4MQBA 2IF2A 1G8YA 3AVUA 2H18A 2ZE7A 3MWYW 2O8BA 1BH2A 3AB3A 4C0HA 4OK3A 1ESMA 1Q1EA 2ZRNA 3K0FB 1UFQA 4BLQA 3B7GA 2J0SA 2EQBA 1VG1A 4BGDA 1C4OA 2XJ4A 4LBZA 2VHUA 3A1WA 3FVQA 1NMYA 3RWOA 2HLDD 2ZRMA 3R20A 3NVAA 3LVRE 4FCWA 5G3YA 3PEWA 4B6EA 5B57C 1F48A 2KBEA 2WIAA 1Q1QA 1GG2A 2GJ9A 5SZKB 3KKPA 2ZI5A 4LJ6A 2JJ1A 1DG3A 3ZDQA 3SZRA 3A4LA 4O25A 2XJ9A 4NONA 4PPNA 4OHZA 1JEDA 4JYBA 4X8HA 3AVVA 2HCJB 1NVWQ 4C0LA 1RW4A 2FEOA 1GILA 3QUSA 3RSLA 2GESA 1E0AA 2J41A 3W8NA 2PT5A 1JBKA 4HLUC 2OCBA 4MGIR 5AJXA 4M1SA 1HA3A 4Q4AA 1P2VA 4GOJA 2JJ2A 4KODA 5FUWA 3C15C 3TKLA 3D31A 1CRQA 5FL7A 3KFVA 4Q9KA 2WKQA 1JXOA 1NVVR 1ZD8A 4W5HA 2FMXA 3QI2A 1D6JA 2ZRLA 1OH8A 2VSFA 1BKDR 1DPFA 2QN6A 1I2DA 1U9IC 1P9RA 4JLBA 4EKDA 3I4LA 1R8QA 4LCBA 4R71A 1QHXA 3QF7A 1KJWA 3LX8A 4Z54A 4P33A 2IC5A 3BC1A 4URYR 3CF0A 1IAQA 5EE1A 2AN9A 3BGWA 2IXEA 1KI4A 2CCJA 3SC3A 4BE7B 1GVNB 1R0ZA 4Q7MB 1EK0A 1YZQA 4M53A 4DJTA 1OF1A 3WRXC 5FL7D 3LQQA 5KSPA 1NBMA 4P0TA 2J0QA 2WAYA 2J5XA 4JVLA 2GTPA 5BQ5A 4ON9A 3QVUA 1FX0A 4A0HA 4PHHA 4Z1MD 3U4QA 721PA 2FSHA 1W4BA 3Q3JB 2WWHA 3OEHD 2FSIA 2WIBA 5K8TA 4IDHA 2CE2X 4IVRA 4URUR 5JCZA 3I5YA 1Z5ZA 1KSJA 1XD9A 2ZETA 4OBEA 2OG2A 4IDOA 2O8FA 3CRW1 5CM9C 4JMPA 4A36A 1TL7C 3CPJB 1NG1A 4CW7A 2F43B 2O8FB 2K5UA 4CYMA 4AKIA 2AKAB 1CR0A 1P9WA 5TMPA 2HDNB 2ZSEA 2AK3A 4LJ8A 3WY9A 5JWRA 4NP6A 2VTKA 4B35A 1YZGA 2DYKA 4B6FA 3FMFA 1TU3A 2PBRA 2OLJA 3I72A 4OI2A 1NKTA 1SHKA 3CNOA 3TW8B 4BLPA 2IHYA 2WMOB 4JLOA 1IQPA 2PCJA 2RGNC 4O3MA 4RVCA 1OV4A 1W0JA 2F1HA 2WJGA 1AM4D 3B2EA 3IKJA 4A92A 4B2LA 1OHHD 2B21A 4BFUA 3VHLB 2IUTA 1AKYA 1MRNA 1OB2A 1QBKC 2D06A 1NP6A 1QVRA 3AVOA 4KBFA 3CB4A 4KU4A 5JEDA 5SZIA 2H57A 2AX4A 2DWPA 3R9WA 1Z3IX 1EFRA 3OF5A 1KSHA 3L8ZA 2JLSA 1CJKC 4V0LA 1N6KA 4DT1A 3BE4A 5FL3A 3IIKA 1P9NA 3OAAA 3K70B 4WW0A 4DSUA 4IEEA 4YDSA 1RIFA 1V43A 2Q0HA 1ZC3A 5CK5A 4LYAA 2ZUDA 2JLUA 2ZYUX 1VIAA 4TWZA 4YMTA 2GETA 3LVQE 4JS0A 4ESVA 3MJHA 3HWSA 1TF5A 2KB0A 4US0R 2VQSA 3PG5A 4E09A 4PQRA 2Q21A 5HKKA 2V3CC 4RFVA 1M74A 4CEJA 4Z8XA 4A2PA 1Y3AA 2IS4A 2EFHB 4CT5A 4AIIA 3Q9LA 3ZD7A 3CZQA 4EQ6B 4IDPA 2GCNA 2VHQA 1E9FA 3UXMA 4M1KA 1Z6TA 4N1AA 1P73A 2ZR0A 3U3MA 3X1DA 5C4MA 4JLVA 1E99A 2BMFA 4AG5A 1N5IA 2XB2A 1FMLA 2CNWA 4F92B 1YR6A 4JT4A 4Q1EA 2G77B 3QF4B 1FPMA 2ZE6A 3DZDA 4Q4JB 1TQ2A 3B13B 5TB5A 2HV8A 3FGNA 1XD8A 3ZIAA 1RRFA 2V4ZA 4Q9IA 3TE6A 3RRYA 3RVBA 1G8GA 4J0QA 1KAGA 4DWJA 2P6UA 4M21A 4ARZA 3FOZA 2O8CB 1ZD9A 5F9FA 4EFLA 4ZIRB 1GL7A 5CJ2A 1K6MA 1T4GA 2O8CA 1FNMA 3K53A 2ONKA 4LYFA 3GJ6A 1TF7A 2WTUA 1HE8B 1N6IA 2D74A 4DLRA 4DLXA 4GMDA 1GRRA 1VMAA 2IEYA 2OO7A 2GA8A 3B60A 3HR8A 1TU4A 3IHLA 4MGZR 1M7BA 4G5QA 3RNLA 4MKHA 2A9KA 5EJEA 3AP1A 4HAUA 2OE2A 4IOMA 4XD7D 2BHRA 2PEYA 2A7QA 4OK5A 3DDCA 3O8CA 2Q3HA 2OLKA 1KK1A 4X8MA 3BK7A 1ETUA 2W6ID 3NHAA 1V5WA 1XXHB 2P67A 2O0HA 4UJ5A 1EXMA 4B71A 2OZEA 2GEUA 4HUQB 2NG1A 1VTKA 3IEUA 1GRNA 2Y8EA 4JL5A 1OIXA 5FPSA 4BRWA 2JLRA 1NSFA 3W6NA 5AUOB 4DCUA 3AM1A 4C7OA 1F60A 1R0XA 1IXRC 3MG9A 1E9CA 2OFOA 1HQCA 1HT2E 2DBYA 3GLGA 2ZRHA 4PPFA 4JLMA 2VSOA 4MDFA 4DEXA 3CR8A 5TVKA 1G18A 5GVSA 4CEIA 1AS3A 4IFBA 1CR4A 4Q1FA 3DMNA 1ZIPA 2ZVPX 4DCSA 5KYKA 5L3SA 2QROA 1CF4A 1U0HC 1ZM3A 2X2EA 2ZRAA 2RKOA 1N5JA 2ZQ5A 3UK6A 4BFVA 4XTRA 1HT1E 2I1VB 5CITA 2VP0A 1H8HA 1A2KC 2CHVA 3BH7A 2W2TA 1XP8A 2AXNA 1KO1A 3C16C 4GOXA 2XSZA 5FTNA 2CVFA 1G17A 3UATA 3QPUA 1IXZA 3ZQ6A 2Q6TA 4IDQA 3EX7C 1E0KA 2FZLA 2QTFA 2BV3A 2H92A 2G1KA 5HZKA 1GIAA 1II8A 2ZR9A 2ZITA 5DNYB 3QVVA 1OIVA 4RD2A 2IK8A 4BASA 3NBYC 4PAMA 4AYTA 3GP8A 1XTQA 2BVNA 3V00A 3ZZUA 3KZ1E 3TUJC 4WXRA 4B47A 2CJWA 1E1RA 2VA8A 3QKSB 1E2KA 3PUYA 5FOWA 4S35A 2RHMA 3KJGA 3ADCA 2ZRCA 1KJYA 1RE0A 1KAOA 2QTHA 4RD1A 2JA1A 4Q00A 1EX6A 2XNSA 1SVSA 1TQ6A 4JLNA 4PPQA 4C3ZA 1PV4A 2BMEA 1Z63A 1W2GA 1U2RA 2GJ8A 1CXZA 4ILEA 4M1MA 4V0MA 4M1TA 3LH5A 3UG6A 2F1RA 1AQYA 1DAMA 1OKKD 5AR1A 2DWOA 1B23P 4EPYA 3I32A 1AGPA 3GLIA 5G53C 3UANA 2O0KA 3BH0A 2ORVA 3I8SA 1W36B 1KDTA 4TLEA 2W58A 3KKQA 4A82A 3AVQA 2WWXA 3RSOA 1RZ3A 2O5VA 3NEJA 1I4TD 3TGPA 3K9GA 4II7A 5C1BA 4XOIA 2ASEA 3A36A 2G9NA 1WP9A 4PAOA 3W34A 1EESA 3OEEA 2R44A 3BB4A 5LBIA 4BFTA 1JJVA 1P60A 4RKEA 2GWHA 2VP4A 2ZJAA 3G82C 1E32A 1G7TA 1S96A 1XJQA 3L8YA 4V03A 5EE5B 5L3QB 2VBCA 1CS4C 1CJMA 1G19A 1S3GA 4LV8B 2HYDA 3SFZA 5AUPB 5JSZB 5EXSA 3T15A 3B5JA 4KO8A 1NN1A 1L2TA 4NZYA 1WCV1 3PQCA 4TT3A 2ORWA 1M6NA 3THYA 1DO2A 3WNBA 3CIOA 1GTVA 2CHGA 1P2UA 4NE2A 2ZI4A 1NJFA 1HEIA 1QDEA 4IFEA 2VYFA 3I61A 4RFSA 3TUIC 4Q5IA 4JL6A 2F55A 4CT4B 1ZAKA 3FDIA 4Q4AB 4WOPA 3BBPA 3B9PA 1CIPA 1JJ7A 1VPLA 4KCGA 2KJQA 2B7BA 4NTZA 4JIMA 2MSDB 1QHIA 1TMKA 2A78A 2QPAA 3X2SA 4EAQA 4BLRA 1W0KA 2YHSA 4G3XA 2W0SA 3N2EA 4XJXA 3TUZC 1QHNA 3CX8A 1UBCA 5KDDA 2HXSA 4B3DA 3QJYA 1G5RA 4ZKEA 3BERA 1F2UA 2VHJA 1YJ5A 3KXLA 1JR3D 4I81A 1SXJE 3AKYA 3AF2A 3SHFA 1G9XA 4FMBB 4OJQA 4LZZA 4H9GA 4IJMA 2J7KA 4FMDB 5DYIA 4PO1A 2NMVA 2MSEB 2GILA 4ZDJA 4AG6A 4NYMQ 2W2XA 2XZPA 3H0KA 1KSFX 3C7KA 3AKDA 2P0EA 4JL8A 3NH9A 2CLSA 1XD2B 3TLXA 1DAHA 1XU4A 2AFIE 2DHRA 4LBYA 2QM8A 1EX7A 2O52A 2BCGY 1LS1A 4POAA 1GSIA 2WPDA 2H5EA 1G6HA 1FNNA 4XWKA 3VU9A 3ADBA 1GNPA 1CTQA 2ODNA 2F43A 4C30A 1Q20A 1X8LA 4LWZA 5LD2B 4LX0A 2J7PD 3E70C 5JRZA 3WYAA 4BPBA 2GK7A 2WWIA 3PUZA 5AUQA 2NPFA 4DCVA 1DAKA 1MO5A 1ZM9A 5E7JA 1N2CE 1YZNA 1Z06A 2OAQ1 3EZ7A 3THOA 3W9YA 5J4LA 2D4HA 2P5TB 2IYXA 4L9SA 3VX4A 3T35A 4B75A 3THXA 1NKSA 4IXMA 5EUMA 1SKYE 3K1JA 4HYYA 4MRVA 5FTLA 2OAP1 3IPYA 3TAHA 4JLKA 3ZQJA 1KMHB 4JLPA 3GJ8A 1G16A 3GLHB 1LW7A 2R6GA 3IGFA 1OXUA 5DIFA 2YJTD 3GLFA 1P72A 4PHTA 3GD7A 2IS2A 3SU8A 1WBDA 2A30A 1S4QA 1VCOA 3QBTA 2PT7A 2F6RA 1Z0IA 1OSNA 1NLZA 5DI3A 4DDTA 1G21E 1U81A 3TVDA 2PMDA 5CJPA 5IF9A 3UG7A 3NC1C 2REOA 2DFNA 4V0KA 3P4YA 5C2JB 1UBGA 2MMGA 2VH5R 4IOKA 5FUXA 3CNNA 4RY2A 4Q66C 4YONB 1YR8A 1Q12A 3ECCA 2CXXA 3AUXA 1M8PA 3JVUA 1N6RA 2ZUBA 3DO6A 1Z2AA 3MRSA 1ZUIA 3GEIA 4CGZA 2EYQA 2RGBA 3U3KA 1OFHA 2QQEA 1DVRA 2ODEA 3K9LA 3N2IA 3AVYA 1BOFA 1BYUA 4FD2A 3SBDA 4MYTA 1I4DD 1H8EA 3KJIA 3PVSA 1Z0DA 2V7QD 5D3MB 3AVTA 1WXQA 2OBNA 3VAAA 4C0SA 3WXMA 2QUZA 5B30A 1EGAA 2WOJA 4HAZA 2WWWA 4A4DA 1KKLA 1TPZA 4ZDWA 5L8VA 1Q1BA 3OE7A 4LBVA 5P21A 4DDUA 4B2PA 1YZUA 1XXHE 1KK3A 1X1SA 1FP6A 3FB4A 4C2UA 1OYYA 4R9UC 3OHMA 5HE9A 2IYZA 1OIWA 3OESA 4PC1A 4JLDA 1P7CA 3ZJYA 4Q21A 2ZANA 1ZBDA 3B1WA 4QJ4A 4V0OA 3B9QA 2RH5A 2GAAA 1Q44A 3GMTA 3GJ4A 1NSTA 3OEHA 4OK6A 3ZYCA 1XPUA 2J0UA 3EPJA 1GWNA 2ZRJA 4Z1MA 3VR1A 1FMJA 2ZJ5A 1PUIA 1OXXK 2IXFA 2QM7A 4AWXA 4JBXA 5L3QA 5F2EA 3MCAA 2QTVB 3PR1A 4NU0A 1NF3A 1U99A 1VKJA 2VHCA 4NCKA 4BZQA 4HLQB 4B74A 3T1TA 1AN0A 1UM8A 1NBME 2E87A 5JHHB 3U7EB 5JRJA 1VG8A 3IILA 3LQRA 5DHFA 3ASYA 1YZKA 3DM9B 2JLWA 3MFYA 3RAPR 3CH4B 2WPDD 2IS6A 4TZ6A 1NNEA 3FTQA 4GBMA 2R6FA 1NJGA 4FMDF 3RS0A 4ZPXA 2YC2C 3K8YA 4RFSB 5D3MA 5GJCA 3X1ZA 1QHHB 3HU3A 1UBFA 3FHCB 3PEVA 3QXXA 3KQLA 5ANRB 3U6KA 1OW3B 2REXB 4L5BA 3TAUA 1L7VC 1QHGA 2CEAA 2WSSA 3I8XA 1KIMA 4HATA 4WIAA 1JR6A 1GKIA 3CONA 4GRAA 4NKRA 2IXGA 1EG7A 1KO4A 1GL9B 3U61B 1ZYUA 3GFOA 2FSFA 1T0JB 2WBLC 3N70A 2C9OA 2W83A 4LPKA 2BM1A 3CNLA 2C78A 1KGDA 1JR3A 2EWVA 1YVDA 4Q7KA 2FPLA 4F91B 5E7MA 4I4LA 2LCFA 2ODBA 5KPDA 1KSGA 2ZYVX 1P2TA 3BS4A 3QG1A 2JLXA 4OYHA 3KJHA 2FFHA 3TSWA 2X2FA 4TYNA 2X77A 3PEUA 4P4SA 4BLOA 4TYWA 1W0KD 1QG2A 4HLCA 4BUJA 2XAUA 3KQNA 5C4GB 1VG0B 4BFWA 2GKSA 2JJ1D 1U9IA 1AZSC 2C03A 1GKUB 1P6XA 2ONJA 1NVXQ 1EFHA 5H68A 4F4JA 2ZXUA 1E2MA 2HLDA 1VCIA 1J70A 1NMZA 4NH0A 5DYGA 5FOTA 4FMCF 1I4LD 4KFRA 1UJ2A 1Z0JA 5C46F 2DPXA 2EFEB 5TDHA 4LPSA 3FFBA 3CPHA 3R7WA 3AVXA 1UKYA 3RANA 3UWKA 1UADA 3HPQA 2XXAB 2C8VA 2WAXA 4NYJQ 2OESA 4QGAA 2B92A 1KZ7B 4HDQB 4NL4H 2FFQA 1Z29A 1A1VA 3S1AB 4HB3A 2BJWA 3J81k 1T9HA 4UNRA 2YWFA 1RRCA 4WZBE 2P6RA 3OEED 4GNKA 3CBQA 1MO6A 2XGJA 1M7GA 3AKCA 3AEZA 5SZJA 5IRCD 2AFHE 3VFDA 3REFA 1FL9A 2WHXA 2Z6VA 2ZU6A 5IDVA 3CX7A 3ND8A 4EPXA 3P26A 2ANBA 2B8TA 1W49A 1DADA 3C4JA 2W00A 1T3SA 3W5IA 1GOTA 3A1TA 3FHOA 1MH1A 2J3EA 2CDNA 3DKPA 1IN4A 4L8GA 4A1FA 8OHMA 1P62B 1FUUA 1OKKA 1W48A 2OILA 4HAYA 3B82A 4YXWD 2UZ3A 2VP6A 3AF3A 1IXSB 4I1VA 3RS3A 3EZ6A 1X8JA 4OQFA 1UKEA 4N3NA 2L0XA 4KVGA 2A5JA 1KK0A 821PA 1XTKA 4U7DA 1ZRHA 1KI7A 1M1YE 1DTSA 2FGKA 4H1VA 3MLEA 1U8YA 3EPLA 3R9XA 2FSGA 3GJXC 4LHVA 4PQFA 2W6JD 4AK9A 4B76A 2J0VA 5FTMA 5CB8A 3EW9A 3B85A 4GT1A 4QOSA 1SXJA 5E4FA 5EP3A 1BYIA 3KB1A 4QBHA 1P5ZB 4Y0AA 1JQLB 2XITA 3C8UA 2QMOA 3EC1A 2XTNA 1JALA 5IHPA 1ZNWA 4HSEA 4D81A 5CDFA 2BC9A 3LFUA 2C96A 2BCJQ 2H8KA 1LNZA 3UMFA 1ZCBA 1XTSA 2QL6A 2VP2A 4EJSB 2NZJA 3GFTA 3ZD6A 2GCOA 3T61A 3BD9A 1ZM4A 4QRHA 2BEKA 2MMCA 2Q9BA 5IK2A 1G3IA 3QENA 4CVNA 2R2AA 3RYTC 1QHHA 1UAAA 2AHOA 3MWKA 3SJAA 4M9QA 4MRPA 2ZS8A 2A3RA 3NHBA 5HCIA 2NPIA 1KNQA 2IBMA 5FI1B 4QNRA 5CIQA 5FR2A 4MYCA 1J8YF 3QOFA 2QEQA 4XWOA 5DE3A 4FCTA 3TSZA 2WJJA 2YWHA 3EA5A 3IO3A 3OIWA 4OQMA 5CLQA 1G4UR 4UXHA 2PLFA 3QEJA 4Q03A 1PLLA 3KDSE 5JI3E 4RKFA 2OV2A 1XTIA 3HP1A 1W36C 2CK3D 2G0TA 3DKVA 4A8JA 2GJSA 3X1XA 3U2QA 2FF7A 5CLLA 3TSOA 2Z43A 4NCJA 1X8KA 4A0GA 2FDCA 4DLTA 2P5SA 4L15A 4U5XA 1F6BA 1HURA 4IW3B 3T34A 1E98A 3U3RA 2AWNA 3SN6A 4KHZA 2FH5B 3REGA 4OHXA 4PC3A 2HT6A 1OH6A 1XZPA 5JLJA 4IDNA 4TSFA 4BFYA 2R62A 1XCMA 4M1WA 2ZRPA 4DEYA 1G8PA 4FN5A 1N0WA 5DHAA 5FOVA 4TYPA 4MGKR 4A8JB 1NVUQ 2ZE5A 2BJVA 2IWHA 2D2EA 1EWQA 3KUDA 2Q9AA 4F93B 1KY2A 2ZRBA 1UEJA 3QXHA 5CK4A 1U94A 3CLVA 2A5DA 4G0NA 4PC2A 1S2MA 3IQXA 1NIPA 4I1UA 3DEFA 1JI0A 4ITRC 2QAGA 5IT5A 2C77A 2CNWD 5FPHA 2FZ4A 2ZE8A 2X19A 4OKSA 4OHWA 2ZJ8A 2A5FA 4D2IA 2B8WA 2V55B 2QMEA 4C0QC 3C41J 2YOGA 1E2EA 2ZYTX 2CVHA 2JAQA 4PX9A 5KTYA 4LDJA 2ODWA 1CRPA 2QA5A 2ZREA 2AXPA 5HKKD 4QXAA 4US1R 1R10A 3SFVA 1XX6A 1K5GA 1NY5A 1N5LA 2BKEA 2I1QA 5FBWB 5LB2A 4HDCA 1E2NA 1ANKA 4OQLA 3RC8A 3WBJA 2QT0A 4GP7A 2ZRIA 1HQYE 2V6JA 3W5JA 4JKIA 4HDOB 1W47A 1HYQA 2IYLD 3PENA 5LPNA 2QNRA 1XTJA 3T5DA 1QF9A 5JS7A 4DB2A 1ZJ6A 1VHTA 4M8NE 1Z6YA 1DE0A 2ANCA 3FMIA 3NKVA 3ZZ0A 4HI0E 3SJCA 3CPEA 4M9ZA 4BLSA 2OSBA 4TLCA 3D8BA 2EYUA 5JEEA 2ZROA 1W7AA 2OXCA 1C9KA 4CDGA 2IYUA 2J45A 4HAWA 1N6LA 1W0JD 1MKYA 1MT0A 2GK6A 4ZDKA 1HH4A 3UKDA 2EFGA 4A0RA 3ZVNA 2IA5A 3SDZA 2LKDA 3U3JA 4DUGA 2J9RA 1KI1A 3LW8A 4Q01A 2JDID 4E03A 4AI6A 5EE9A 1RJ9A 3HJNA 3SE0A 3CWQA 5JI2E 4KSCA 3ICQB 1A7JA 1YR9A 1G1MA 1XMJA 1F5NA 4G01B 4KLNA 2KBFA 4PANA 5FTJA 4TTQA 1IM2A 4QNMA 3A8TA 3PJRA 2NZ8A 1ZVQA 3SYNA 2IT1A 1SXJC 4TYQA 5TXGA 3VR5A 1KI6B 1E69A 3OFND 4M1YA 4Q1BA 4AYWA 1NN0A 3A1UA 4GOKA 2GCPA 3B1XA 4Z8YA 2F3RA 4N0EA 3ZVRA 3GQBA 4M9SA 2R65A 1EFUA 3U7HB 1IN7A 1D5CA 2ZRGA 3A1SA 3K0CC 3LXXA 2OCAA 4M22A 4DXAA 4CEHB 1U8ZA 3W3AA 1J8MF 2ERYA 3ZZTA 1LS6A 3THWB 4CEIB 5K8IA 4TZ0A 2FNAA 3EIEA 1JQJC 4KYUA 5KNBA 3U44A 1NBMD 5E7IA 4G5SA 1W5TA 2D7DA 1NN5A 4Z51A 2AK2A 1G7CA 2CMKA 3ETLA 2J59A 1G3UA 1FX0B 2D3WA 1KDOA 3FKSA 3LAWA 1EFCA 4UKDA 4AC9A 3V9PA 1E9BA 1IY2A 3KQHA 2GBLA 4PSAA 3K0EA 5FBQB 2ZI9A 4G5RA 5E3HA 3H84A 1E6CA 3FKQA 1US8B 4LY6A 3HDTA 3TMKA 2IYQA 2IUSA 1BS1A 1HE1C 2JLZA 1FP7A 4Q7LA 2NTYC 3CRRA 5DISB 3AGQA 2YKGA 1ESNA 5DLQC 5FBRB 1TUEA 4CF7A 4GFDA 2ERXA 4V0NA 2JJ2D 1S0UA 2Q3FA 2QGNA 3QY0A 2YOFA 1DOAA 1FQJA 1Z8FA 3E2IA 4WZAE 1GZSA 4D0GA 4QC2A 4DLZA 1ZC4A 4B32A 4DLSA 2W0MA 1CR2A 3RS7A 1M34E 2Z0MA 3KXKA 4I1OA 2WKPA 4HZIA 2C95A 2GDJA 1LVGA 3BIFA 3F8TA 4LK2A 4HLUA 4NBSA 3NEYA 3BFXA 2GXQA 3SYLA 2DCUA 5KOYA 2XZOA 2GRJA 3O47A 1ZCAA 1KKMA 4ACAA 2RAPA 1G3QA 3OIVA 4P3YA 4DSOA 1NY6A 4NMMA 2ZI7A 3MWJA 2G88A 4O2RA 4Q1AA 1PVOA 3LLMA 2HF9A 1E96A 3EZFA 1QZXA 5BN4A 2ZTSA 3P1JA 4W5JA 3U60B 2GNOA 3ZS9A 5K8LA 4KFTA 2HUPA 1AKEA 1ZINA 4Q47A 1OFTA 4LC1A 3LXRA 2QP9X 5EZ5A 3B1YA 3ZGXA 4DDWA 1R5BA 3PXGA 4D25A 2R9VA 4PZYA 4PHFA 3RRZA 1J90A 3AUYA 2QAJA 2RGAA 2EWWA 1YQTA 1M2OB 1JNYA 2ZPTX 4YXWA 4LBWA 1KTVA 1KJZA 4N0DA 4LUCA 1SHZA 3D6TB 2ORIA 5JMTA 3IHWA 4R7ZA 2BKUA 2XEXA 4BRUA 2V1UA 5JJLA 4PC7A 3TBKA 4AD8A 1NN3A 4RD6A 4UNQA 3BAFA 4B33A 3K09C 1XRJA 3I3SR 4WXPA 5FPYA 1KY3A 4C0BA 5J4KA 1AIPA 2ZEJA 4LYJA 2RB4A 2WZQA 4I1SA 1R8SA 3VMFA 3G0HA 2F1IA 3BOSA 4OI0A 4RZXA 1G7SA 2XTMA 1OJLA 1SULA 1KI8A 3VHXA 4KITB 3MD0A 1SZPA 4GDFA 5F98A 3QEOA 1S9HA 2FN4A 1ZU4A 2UZIR 4RZUA 3WRYC 5EE3A 2QMHA 2QU8A 1JPJA 3AQ4A 3FWYA 3T1QA 4EPTA 4LC0A 5L3RA 4RZ3A 1W2HA 3GFPA 4QFMA 4TL8A 2XOKA 3ICEA 3NDBB 4LJ9A 2OCPA 2RGNA 3PV0A 2F3TA 4QGFA 3K70D 1KYIA 1Q0UA 1SVLA 1X1RA 2FFBA 5AJZA 1OH7A 4KYIB 1XPOA 1E9RA 4Q7JB 3Q8XB 4AKEA 3K0AA 1II8B 2DB3A 5JS8A 2ZI6A 5KHOC 4E07A 3JZMA 5AK0A 4UXJA 4Q4HA 1KO5A 4BEJA 2ZM5A 1Z6GA 3QKUA 4JJZA 1P3JA 2CJWB 4HEJA 2VLIA 3VR2A 4URWR 2E1RA 1D9XA 2H7VA 6Q21A 1E2QA 1JR3E 1TUIA 4URXR 5J47A 2IWRA 4TTRA 2A5YB 4GZLA 3SR0A 4B3XA 2BBWA 2VL7A 2VF7A 4DLYA 1DBSA 5JWOA 1SVOA 2GJKA 2O8BB 4FWTA 4LV5B 3T1OA 4OI1A 3K0CA 4KVAA 1D2MA 3M4YA 1RC8A 4YLGA 2PX0A 1Q3TA 5J5CA 4EFNA 2QGZA 3W3ZB 3NG1A 1XEXB 2PZGA 4M1OA 2CE7A 1TEVA 1E9DA 2FA9A 3UMSA 4BWYA 4FI3C 1YZTA 1XBTA 1UF9A 2WSSD 3Q72A 2YYZA 2YOHA 4HUQA 2BMDA 4YQFA 2J1LA 3TJZA 1E9AA 1WF3A 4DBLC 4BFSA 2QBYA 1G7RA 1K8RA 1T8TA 1X3SA 2QPOA 3FYHA 2QAGC 4PTLA 3B8HA 1L4YA 3K0FA 3VR6A 3TQCA 1J2JA 3BFVA 4BZPA 1SVWA 1HUQA 4PO9A 2IYTA 5FOXA 5JFGA 1CJTC 4RD3A 1OLOA 4NDZA 5EP4A 4Q1DA 1G8FA 1XEWX 2EFCB 1R5OA 1AK2A 2WMNB 1AS0A 3NBFA 1COWA 1E2DA 1NIJA 2V9PA 1X86B 1T6NA 2V1XA 4Q4LA 1YE8A 1VECA 2FEMA 4IHQA 3GLFE 2NO7A 5KO2A 3ONWA 1W4RA 4I99A 4PQYA 4D4KA 1YKSA 3ADKA 1DELA 1FOEB 2ZJYA 2QRNA 4GI7A 2I3BA 4DVGA 1RPZA 4URZR 4Q1CA 1CP2A 4GL2A 3NBZC 5HE8A 1E9EA 1RRPA 4AKGA 4W7SA 1L8QA 2C9CA 5BYJA 3A4MA 5LDDC 4QHTA 2HJGA 5A0FA 5EP2A 1BIFA 4OQNA 4DCTA 4JBWA 1BMFD 3W90A 3U7GA 1W1WA 2GXAA 1R0WA 4QM7A 2HYIC 2AWOA 2ZYWX 2N46A 1E2JA 1S3SA 3THYB 2JDIA 1KZGB 1LY1A 3CRQA 3C5HA 2WJVA 4XVRA 2G1JA 4B44A 4TN1A 3LRPA 5EQTA 5H8WA 4TYYA 4TMZA 5JCPA 2GZHA 2SHKA 1VHLA 5EUQB 1OB5A 3WNCA 4WBSA 3DZ8A 4OJKA 2JASA 4JKYA 1LF0A 2XB4A 3CM0A 2NO1A 4BQSA 3QKTA 1U0LA 3D7MA 5JJIA 1PLJA 4KJZA 5KSZA 4EPVA 3TK1A 1WRBA 2ZRFA 1CJUC 1W44A 2YWGA 121PA 4MRSA 2FPMA 4NCIA 2C98A 2Q9CA 4TLDA 1NG9A 1E9SA 2ZAMA 4LJ4A 2ZS9A 3NIBA 1N5KA 3X1YA 2R6DA 5CDFE 1FW6A 1KO8A 4GMXA 3EIHA 3SI7A 1Z0KA 5FFMA 4YC7A 3SEAA 4BEBA 1RJ9B 2QI9C 3BRWD 3MUFA 2GCOB 2PL3A 3MWLA 4EIWA 2NO6A 3B6EA 4MGYR 3K0SA 1YZLA 2FOLA 4XSHA 3RHFA 3EXAA 1ONBA 2WWGA 1IN8A 3VKWA 5EE0A 1HV8A 3TQFA 1D2EA 1N6NA 1VCMA 2XX3A 2OEPA 1T0HB 2OM2A 4P4TA 1G20E 4X8OA 1CJVC 3Q7PA 4DT1B 5UKDA 4LHWA 4LJYA 1A5TA 4HB2A 4HZUA 5M04A 3JZAA 3SNHA 3BFKA 4F38A 4Q19A 3THWA 3I5XA 2H17A 2X8AA 5TV2A 4B2IA 1CU1A 2GEVA 4IEIA 4JJKA 1RKBA 2C5LA 1FUKA 3CZPA 2LKCA 4B73A 4B43A 4MKIA 3AP3A 1OH5A 4IRUB 2RGEA 3AP2A 4DRZA 1RFLA 3L82B 2J7PA 5TARA 2J46A 3HYTA 3G5UA 1XEFA 3AF4A 3UIEA 3CW2A 1T91A 4MYUA 4A8JC 1KI6A 3T12A 3WP1B 5A5GA 4GP6A 1OT3A 4PO8A 4UXIA 2WWYA 3CX6A 1KOFA 5DO9A 4YMSA 1IN5A 3W6OA 1SKYB 1J7KA 2RGCA 3KKNA 4DLUA 4Y0VA 4A15A 5J4YA 2QPTA 4K81B 2RGXA 3LA6A 2KI5A 2YZ2A 4MRRA 5CYPA 4ZO4A 3TH5A 5JBQA 4XVQA 1WQ1R 3GLHE 3FE2A 5L3SB 2JLQA 2QRZA 4JYCA 4M4SA 1GM5A 1P61B 3EWAA 1G4AE 4UNSA 4LGMA 3GLIE 2GF0A 5B58C 2CK3A 2FG5A 1DARA 2BBOA 4F4CA 2PLRA 1FQKA 4LJAA 1K5DA 4AKHA 1E79A 4ZIRA 2VRWA 4O2LA 4PXAA 1LFDB 4MUAA 4TMXA 5DI3B 3T5GA 5A4JA 1R7RA 2XNDA 3R7WB 2O8DB 3IUYA 1E0SA 1R4AA 2QMUA 2ZJBA 2VHTA 1I2MA 1XMIA 2ZVQX 1L4UA 3WMFA 2NQ2C 1PJRA 4LI0A 1XMSA 2AD1A 3P32A 4TMTA 5EZ6B 3A6PC 3SBEA 4CZ2A 2O8EA 4L16A 1E2LA 1PZNA 2OBMA 421PA 2IYWA 1FTSA 5JECA 2DFTA 2GZAA 4QGHA 1ZM7A 521PA 5IK2D 2D2FA 1W4AA 2ZRDA 1XD2A 4EUNA 1RYFA 3RC3A 4YDHB 3WYGA 4TT3D 2BBTA 2IL1A 2XXAA 1DAIA 1US8A 1Z47A 1Z83A 5JZVA 3KL4A 1G41A 4LHYA 5EXTA 1JPNA 1VCNA 4QL3A 2WJIA 4Q4JA 3AF0A 3TIFA 3I92A 4DCNA 5HR5A 2W2VA 2VIIA 5KSYA 4M2LA 4DKXA 3NXSA 1XZQA 4EQ6A 2G83A 2PX3A 2OCYC 3NC0C 2NO0A 2Z83A 5G3ZA 2JCSA 1RRGA 1SVIA 1GFIA 2YV5A 4K46A 4KI0A 1R0YA 1G3RA 1W36D 1T3HA 3L0PA 4PSKA 1MRSA 3DMDA 2EU8A 4D0NA 4CEHA 3QKRB 3QPWA 3SOPA 3KUCA 3QXJA 4TLAA 2C9YA 4DSTA 4B3BA 2HEIA 4MDEA 4DZZA 3F3YA 4ZKDA 3SQWA 1XB2A 3PUXA 4D6PA 3QXCA 4MA4A 1E1QD 2J87A 2PZFA 2BEJA 3ZVLA 1WE2A 5BN5A 5BWMA 2AL7A 4BECA 2P3SA 4DLVA 4JVSB 3QPVA 3T1VA 2QBYB 2GXSA 2ZUCA 3ZVMA 1OXVA 3BORA 2GEDA 3IIMA 5SZHB 4QBGB 4PSVA 1E2FA 1E4YA 5AJYA 4XTCS 3GLGE 4ACBA 1TQ4A 1IJEA 3U5ZB 3A1VA 5KPJA 3CF6R 4JT2A 1N0UA 1E1RD 1UKVY 4PZZA 5BYKA 1G291 1ELOA 1DAEA 2ZU0C 2JIZA 2PZEA 1JB1A 2KE5A 1Y63A 3U7FB 2GJAA 2VPPA 4HUTA 2N1BA 4JLJA 1X6VA 4B34A 3E1SA 2O8EB 1E2HA 5KNCA 5GJVC 1U98A 5E95A 4DHEA 2HXYA 2A2ZA 3VR4A 1SKQA 3FMOB 2CL6X 1Q21A 1MOZA 1XWIA 2YWEA 3M1IA 4O0MA 5AWFC 4P32A 4OL0A 5GJBA 3FFAA 4JSYA 2QORA 3WMEA 3B1VA 1XEWY 4KV9A 5HPYB 1P75A 5J40A 5FI0B 3P20A 1YRBA 3LBNA 5KUTA 1JAIA 1NRJB 3RLFA 3RWMB 2PEZA 1UDXA 4FWIB 2HF8A 4TMVA 2F9LA 3QSYA 1F2TB 1H8HD 2CLDX 2DFLA 1CULC 2UKDA 3NH6A 2YC4C 1S9DA 2GBLC 1XEXA 3AVPA 4IXNA 1WBBA 4BLTA 1GNRA 4Q48A 3VKGA 5DN6D 2IUUA 3GPLA 3GCGA 3L0IB 1W46A 1G8HA 1E94E 1ZM2A 4Q9HA 1IY1A 4C7OB 3KXIA 1QHSA 4QM6A 1JXMA 3WMGA 4HZUB 4KAXA 3K9HA 2GVZC 4K8OA 2O0JA 2PH1A 2R6CA 1GDDA 2IEZA 2ZR7A 1H65A 2ZSFA 3BJIC 3VR3A 3RRNA 4NCNA 3O8BA 1E2GA 4XH9B 3DHWC 4LJ5A 4ASUA 1LF5A 3QBVA 4PZLA 4S2EA 3IO5A 1RYHA 1PLKA 2W6IA 4MITA 1UKZA 2QY9A 3V4RA 4P4UA 2RGGA 3PCRB 3BH6A 4ASUD 2JJ8A 5DH9A 4XSGA 4RZ2A 5HCNA 4LHXA 2VO1A 2VF8A 3WHLA 2F7SA 3ADDA
chains in the Genus database with same CATH superfamily
4WLOA 4CL0A 1IN1A 4MV0A 3L4JA 1C3XA 4MR7B 3HVHA 2VA9A 2AKYA 1DC5A 1WPQA 2FLVA 3RQIA 5B2FA 1XMOB 4JI7B 2I6UA 1Z5UA 5T6BA 5EWLB 3V4FA 3M6AA 2HWKA 3B51X 4YNBA 5E6UB 4HWTA 4UTRA 3NORA 3QE0A 4HB0A 2Y71A 5JCJA 2VHVA 3EVBA 3PNQA 4TLBA 5J4HA 1Q11A 3KE8A 1KMNA 3KZNA 2PZLA 4I4IA 3IJ5A 4KMOA 3OP1A 3FW1A 2Y27A 3QBDA 4LQ4A 1CZNA 1DG1G 5KTNA 1R88A 2OO5A 4QFDA 3E2PA 4XZ3A 1GPBA 3SYKA 2FI1A 4FE3A 1L5WA 1K1EA 4DV7B 3VJKA 1RWWA 5T7BA 3Q6MA 5C5CA 3LBHA 1G66A 4F6RB 3OEWA 5U1PA 3O84A 2J6CA 2ORYA 5KTMA 4EENA 1VG9B 2FWIA 1XVUA 3MXOA 1S7GA 2I4TA 1ZJ5A 2P9CA 4FFBB 4JWTA 4ZGGA 4EAAA 1GNTA 3ZTYA 5LJIA 2XCRB 2NV6A 3ZDEA 5JC8A 1VCHA 1XF9A 3DAOA 4JLAA 5G4KA 2IKQA 2P62A 1NYRA 4OO3A 1JG4A 5LDGA 2G6BA 4TMKA 1NJSA 5A7GA 2WSMA 1XCPA 5H7XA 3R8FA 1E63A 1YE3A 2GN2A 5HK9A 4HGPA 3WHIA 2GXUA 4XUDA 2ZSUA 1N5MA 2JS7A 2HWWA 2ZWAA 3FLBA 4RM3A 5C4IA 5CDTA 3D8HA 3LDUA 1XCGB 2XW6A 4G81A 2YJ4A 4MUHA 4UNNA 3TR0A 3CZ9A 3KKZA 3BSFA 3MUOA 2V54A 4WCFA 3TINA 5LZ2A 2UYQA 1CB7A 4DUYB 1B0PA 3PYMA 2VEDA 3H83A 1K9VF 1ZOLA 2AD5A 4MAMA 4PBSA 3IDOA 2DKOA 1S2LA 1JG2A 3V8QA 4C0XA 2C99A 3ELDA 1QIMA 4JBGA 5AHRA 2WF7A 1E1QA 4DPLA 2GHIA 3G2IA 3O8QB 1X13A 1P9LA 2APJA 4MR8A 3OBIA 1SR8A 1XKTA 3ND9A 1ID8A 2GPWA 3ROKA 3L2OB 3DOCA 4K6OA 3KTAA 4WZ6A 3CQ9A 3CLTC 1WMBA 3CNEA 3L0SA 3N5CA 1VYUA 3U26A 3SQXA 1G8AA 4Y1EA 4CNQA 2BONA 2I71A 4MQMA 3RKRA 3FSRA 2XTZA 3CIFA 3OIUA 3SYMA 1D4AA 1IJFA 2ZJZA 4UC0A 4V0ME 2H2DA 3NYIA 5JVDB 4P2GA 13PKA 3FBTA 3H75A 3VNUA 1TK9A 1TGVA 1EFAA 4YV1A 3H8SA 3N53A 4K1XA 3EASA 3RK4A 4XPZA 1PEKE 2QY6A 2TMKA 4QPNA 5DRTA 3QLEA 3G6WA 5HIJA 4TL7A 1M6EX 1PZMA 3JATB 1GRQA 1A2OA 1TEXA 2HNAA 4L0QA 2QM0A 2FP4B 3GJ7A 3E4CA 3MAAC 2B5VA 4HL6A 2C88A 5LDHA 3CE6A 4DCCA 5FTWA 1FUEA 2K2QB 3C39A 5EGSA 1VLVA 4FFBA 1XTRA 2FP3A 2ZIGA 4XWAA 5LLSA 3QZUA 1UBLS 1NFRA 3HU2A 4P3XA 3PSAA 3EDQA 5CYOA 1Y9EA 2GN8A 3A3KA 4LYYA 1VJDA 1L9KA 2JIMA 5AKYA 2AOWA 2NSLA 3OLXA 3IEMA 5EI5A 2WOOA 4L78A 3F6SA 1L5OA 3DCJA 3RS2A 2IP4A 4B5KA 1GKYA 2P75A 1MAVA 1U0JA 4LV6A 5K3CA 3L0DA 2H59A 3U3XA 3WL6A 5JXWA 3D4BA 1RYNA 1TM3E 1DJPA 5LD2C 5HZHA 1W5SA 2ZYSA 4JZKA 4MQ6A 2WC1A 3WGLA 1RP7A 2O54A 2RBGA 3ZJ4A 1KPGA 2DQ4A 1REQB 2J9XB 3GLSA 3SIWA 3GIWA 2X8WA 3T0FA 2X8JB 1AQUA 1NV8A 3T3IA 1NWHA 5KYTA 1W59A 1PBNA 2OB1A 3RVRA 4YMIA 4D4JA 2ECKA 2ZWMA 3INTA 5JO0A 1BJRE 3E22A 3EPKA 5DXAA 1C4WA 1RRMA 2Y4OA 3AY3A 1V35A 2JH9A 3IIJA 3LDAA 3NAZA 1VDZA 2FV8A 3UV6A 5D84A 2OCDA 3V7FA 3EVZA 5E8RA 2AFRA 3ODPA 3UTCA 2PA0A 4MO9A 1OZ0A 4URVR 3IV7A 2QL5A 3LLVA 4JQSA 2GVDC 1ZUD1 1J22A 3ZU5A 2R6R1 1N8SA 2Y1GA 4KQJA 5AIBA 4MUMA 1NLYA 3ZNPA 2RGUA 2B99A 2WUDA 1M1YA 1LTQA 3P9XA 3OWHA 3ME5A 3QLUA 2MR6A 1UDBA 2JFGA 3QVGB 3IPLA 3TM4A 1BXRB 2ESRA 4YRAA 5JVDA 3IEVA 2FY8A 3CMCO 4TWJA 3RIGA 3CF4G 3B3FA 4JFRA 4BRSA 5IG2A 5EWMB 2XD4A 3Q87B 4L9WA 1U7OA 4J94A 3RE1A 1P2SA 1JAHA 4YCJA 4C0KA 1NONA 2Z4SA 2X8LA 3Q3EA 3SY8A 1Z7EA 3ZCVA 4EUHA 3KPVA 2A5LA 4YHBA 1GITA 5BW4A 4QXOA 4EGCB 2H9AA 4MS3A 4GQIA 3HA5A 4Q9JA 3L7DA 4MP3A 3ZY4A 1IHUA 4XVUA 3W6UA 3EVDA 4EYSA 1NDHA 2EX1A 4ZCLA 2NVUA 2R751 3F67A 2WM9B 3QRWA 3D8RA 3L1JA 1SKUA 2H08A 4EGJA 3O38A 2ET6A 4FWBA 1R8XA 5K8UA 3K6RA 1C4XA 5ARCA 4HX5A 1DX4A 1DNPA 4GSYA 5DSZA 2EFDB 4MUIA 5FADA 1C1YA 3VYTB 1K2WA 4C7VA 1ML3A 5H1YA 3A6FA 3CRMA 3S68A 1WSWA 2PH3A 3N6XA 4QUKA 5KVAA 1AGXA 1YRYE 1P1FA 1BGWA 2PXHA 5F1KA 4QDOA 4TQUS 3OJLA 2AMVA 3KZVA 4FFMA 4NENA 2XCIA 4NFYA 4QKQA 3WAJA 3M4NA 3W4JA 4DHWA 1RXUA 1KNXA 2BM0A 1H42A 4NHOA 4PW0A 1YGYA 2IP1A 2RAVA 3QXSA 4CV0A 3MVEA 1PJLA 3DZKA 1T5IA 1CKEA 2FXVA 1A9YA 1GO2A 4J03A 3VHQA 2ENUA 4LJ7A 3WLHA 2R4QA 4KDRA 1OXMA 3CC8A 4PSUA 3RBVA 2X1VA 4D3ZA 1RXIA 3R7DA 5GPBA 2EEPA 2QLLA 4QQNA 2GPYA 4R40A 1RWXA 1WP4A 4RBNA 5FOUA 3UPTA 4HAXA 1N2HA 3G1UA 3JVDA 5I47A 2VBIA 3CEPB 2H2AA 3QA9A 5IJ9B 1KOLA 2DPGA 3IDQA 1LBTA 2UZ4A 4N9QA 1BDIA 4EJMA 1DUVG 1R1DA 2CGEA 2JIDA 1OLXA 1TUGA 5BRNA 2Q0SA 1R18A 2OXRA 1U7UA 4RA9A 3LYUA 4YRJA 3QNUA 1UQUA 1LNSA 3Q3IA 5BMVB 4FINA 1RZRA 3RCBA 5KEIA 3MHTA 2CHQA 1SXJB 2COEA 1UOPA 3EARA 3EZ2A 1QHEA 1Q57A 1T5SA 1YQWA 3DBLA 4R54A 3VZBA 2PJZA 3U7IA 2IE0A 2QN3A 3VI3B 3I01M 1ZSNA 4BVLA 1P3Y1 4C4PA 2O5EA 2R4UA 4MULA 4QAJA 4XFJA 1BMFA 5ESWA 4D3SA 3GLIB 4D9GA 3EQ8A 1SXPA 4N5NA 1CBUA 2LXNA 3MSCA 3UJBA 1Q1ZA 4IG4A 2RHRA 1PUJA 2VLBA 3C3MA 2WE8A 4D8WA 2J30A 4U4AA 3IAS6 1XDZA 4XB2A 4W1RA 3V32A 1VPEA 4QULA 3I76A 2Z5VA 2AR7A 4FBGA 5FBLB 4F9TA 1SBQA 1TZBA 2C4UA 5AK5A 3UMRA 2XSZD 3FBGA 3KPYA 3DLIA 4BP9A 3P5BA 1L7MA 4IZOA 1OZFA 1T8UA 3MCWA 4NHEA 1XLTC 2CWDA 1NX9A 3V2UA 1FFEA 1TQDA 3NPAA 4FBMA 3G85A 3GUYA 1AA9A 4P7GA 3PF8A 1I14A 4M76B 2V7GA 2X4IA 4RJIA 4V02A 5FV4A 3M5WA 3K92A 4HH1A 2V6IA 3ZLTA 5CAEA 3KSAC 1K89A 5HSGA 2FZKA 1IZ8A 1O9HA 5AVJA 2BL4A 3TEFA 2RBEA 2Q6IA 4DQVA 1FCJA 2I7TA 3B6MA 3QW4B 3HA3A 2D4AA 3VNVA 4U3JA 3V97A 5IN4A 4FOTA 5FOSA 4RF2A 3LGAA 3X1WA 4K6FA 1TJPB 3IQWA 4ND8B 4JGIA 3S2ZA 2FGJA 1L0BA 2CL7X 3DV0A 4NPHA 4YRFA 1PEYA 2JF0A 1O97D 1SGWA 3UWOA 4D9MA 2I6SA 1Y8QA 2SICE 2P2SA 3C74A 4YGYA 2IS1A 5K8CA 3FGOA 1O9GA 5EZYF 1P6UA 1UFVA 3PFWO 2WYIA 3LCJA 1MXHA 1U3CA 1XF1A 1W6UA 1DDGA 2WF6A 3QH4A 4R7GA 5DNUA 5TLSA 1HT0A 4ECAA 3O4IA 4S2UA 1B0UA 4MRNA 1CG6A 4EECA 5FF9A 2EW1A 2ZSBA 3WLQA 1GPNA 2GAIA 4EJSC 2ZIAA 1K4MA 3VOTA 1X7ZA 2I1LA 2NYVA 4KBGA 1JEEA 1E0JA 4NZOA 3S1LA 3TQIA 4EITA 2IX3A 1O4VA 2Q8NA 1IJKA 4W9MC 2PRJA 2VXOA 3FMPB 3QBEA 5K6RA 2UVQA 4KHPB 4R1QA 5EERA 2BHTA 1HDYA 1ORVA 3KX2A 3MSXA 3BMOB 4RCYA 3SJBA 1ZVVA 3QIAA 4B48A 3J7TA 2WLSA 2FU5C 4EHLA 1YV9A 5G41A 1U7ZA 1I3LA 3KSBC 1PNTA 3PE4A 5CT6A 3LBIA 3CZ4A 1XTBA 4OQXA 1SXJD 5FBVB 4M0EA 2QX4A 4KLCA 4U2GA 5KDLA 3G88A 3KZXA 4A91A 1KS2A 1PYDA 3PEYA 3WWCA 5IVKA 1NLFA 4EWLA 1YAJA 4ZV4A 4EEZA 4TMYA 5LVAA 2RMKA 1SAYA 5HM6A 2IPOA 2VCYA 3TVYA 1X7ZB 1YB6A 1Y5NA 3L9XA 1WB6A 1XPRA 1X7WB 4D45A 4J3JA 5FNVA 1JEYA 1C80A 1BDMA 2COKA 4YRDA 4Q9LA 2FMIA 1WUIS 1IWOA 3OMLA 4GECA 2IXTA 4ERNA 4ENUA 2WUGA 4AP6A 5J43A 2CL0X 2YNMA 3NHZA 2XBMA 3UWPA 1L7QA 1M3SA 4ERXA 5KU1A 3TR5A 3MNFA 4UD6A 3ZWPA 3EFHA 4NYMR 3AU9A 1JLKA 3P96A 4ZQHA 3ZDDA 3T8YA 2NO9A 3UHAA 1E3SA 1I2AA 2BE7A 2ZOSA 4LXXA 4ZDIA 3NGMA 1KIAA 2QRHA 4WACA 2QR2A 3H1TA 5EXDA 5JROA 4ODIA 4G9BA 4MMZB 1SKAA 1QRAA 3F71A 4IIYA 3TW4A 2AMJA 3MUNA 4FT2A 1ULUA 2VOJA 1FNBA 3HCOA 3OAAD 5DLYA 3SQNA 3QJ5A 1ZUNB 1EP3B 4FFNA 2HPVA 1V48A 2LNDA 4QPDA 1BS2A 1SBTA 1THZA 3FHJA 1V1JA 1UJMA 2XXJA 3VYUB 2HIAA 4LF9B 4IZIA 3EH2A 3IPXA 1Z22A 2X9QA 1DOZA 1J25A 2CF5A 4AURA 4HNHA 1YRAA 1CDZA 5KI6A 4NYJR 4AS3A 4IO0A 1PNVA 3TXAA 4EFDA 4ZCTA 4YT5A 4AKSA 2BWJA 1HTWA 1VE5A 2B94A 3LO5A 5KTKA 4FFVA 4K9SA 1KDVA 1BC5A 2LE0A 1JA9A 4X1KA 2E4AA 2Y1OA 2UVDA 3O9VA 2FYTA 2O8BA 1BH2A 4H17A 4JQZA 4Y6SA 1ESMA 4M49A 4UEWA 4C0HA 5LQAA 2ZRNA 2ZVDA 5IPFA 4Z0TA 2XGSA 2YWBA 5GOZA 2EQBA 3CINA 4BGDA 1NATA 3IUBA 1QG6A 2VHUA 1XZGA 1QZ3A 1FP4B 3R20A 2I7XA 5TPZD 1KS9A 4B6EA 3ODGA 2C7OA 5ALPA 1EB9A 2KBEA 4TXHA 5SZKB 4X65B 3G8YA 5AI0A 4B5LA 4NJMA 2JJ1A 3ZDQA 5BV2P 3AETA 5ELLA 2HJHA 2I80A 4KR9A 1YWGO 3NAQA 2FKAA 1FP1D 4ZQBA 3WWYA 1KMCA 3FSGA 4PU0A 5LYJB 4PN7A 4X8HA 1SIBE 2HCJB 3AR8A 3KNZA 4C0LA 4DC0A 1RW4A 3SXPA 1QP4A 2FEOA 3RSLA 2IH2A 1DFGA 1X38A 2ORED 1I1OA 5FKJA 1JE1A 1X7WA 3IJEB 2FFRA 4TKVB 3GZNB 1VLZA 3ZZNA 1E0AA 2J41A 3C1UA 3IAFA 1LDEA 4ZT2A 4B83A 4BNLA 3N39C 2A1UB 4B4VA 4K05A 4TT8A 4DW8A 1HYEA 3MQ2A 5AJXA 5BSFA 3KQWA 4BEVA 1HA3A 1YF3A 3T94A 1BG6A 2VYVA 4E11A 3C15C 9LDTA 3D31A 4ZYTA 1CRQA 1EWYA 1MA0A 4I5DA 1WU7A 1U7PA 1JXOA 4L57A 1ZD8A 2OAGA 3T5PA 5K3OA 1D6JA 2A9JA 2W2LD 2WDPA 4K9LA 3WC4A 3TLKA 2VSFA 3AG6A 1DPFA 4X1YA 2PR2A 4J0HA 3RSSA 1P9RA 3DWIA 4KP7A 4M9UA 1AUPA 3HUEA 4AUMA 5ABPA 2C54A 1B8PA 2J5RA 4R71A 4WBNF 5A5VA 3LX8A 4XYGA 1T1EA 4OFZA 3FZEA 3PCXA 4RQBA 3BC1A 2WVHA 1OQAA 3OOYA 5C3MA 3CF0A 1IAQA 4OH7A 1G42A 3T1NA 1E7YA 2IXEA 2IHNA 4BQQA 1J6UA 2ZZKA 4AQYB 2NZVG 1EK0A 2D2IA 3ISJA 4I55F 4DJTA 1RYEA 3K9QO 1Z18A 3INYA 1V1MB 3WRXC 3WL3A 3LQQA 1NPYA 2OV4A 3KTOA 4J91A 3HDGA 3K8QA 5KNBD 4G26A 2I4LA 1BH6A 4ILKA 4MZXA 1FVXA 1JMKC 4CF4A 1C7ZA 3VPCA 3GUVA 4B84A 4ZT4A 2GEBA 4L6IA 4JI5B 1TIKA 1D2GA 2Q0QA 1S7CA 3Q3JB 4HX2A 3FXAA 1JSRA 4G5XA 2J9ZB 1GNLA 2LRHA 4URUR 3NYWA 1XU9A 3AW8A 3K4PA 4ZD6A 4KNYA 4R5MA 1M5RA 2JPDA 1KSJA 2ZETA 2HLNA 5ENVA 4IDOA 2ZYDA 1NA5A 4R9RA 1TJYA 3TTTA 3FDFA 4YAJA 4JMPA 2VK2A 1MVLA 2C7GA 1IG0A 2REQA 4PWYA 3ZQKA 1NG1A 2O8FB 2F43B 1V8PA 2K5UA 4PPYA 1MDFA 4WCFC 4CYMA 2AKAB 4IIDA 1P9WA 3OQOA 5H16A 4BJ5A 3PIIA 1X1DA 3PDWA 1IHDA 1L5FA 2BD0A 3FTNA 5DOZA 5MGBA 3U17A 3LHDA 4B8WA 4RKWA 1K3FA 1NF2A 2IV2X 4B35A 3EVNA 4QDJA 3B6ZA 3RFFA 4B6FA 3N9IA 1FP2A 3PE6A 1TMYA 2AG1A 4OBWA 4OI2A 5D7BA 3LYHA 4F0JA 2I55A 3WGQA 4BLPA 1J00A 2WMOB 3WK9A 2YY7A 4AS2A 1UOQA 2R48A 4JLOA 3UJ3X 5KMGB 4IQ8A 3EGDB 3RJ5A 4DV1B 3Q2IA 2VFAA 1XK6A 2X4GA 1ICIA 1MJGA 4JELA 4B2LA 3M70A 1OHHD 4IXWA 3UFXB 3VHLB 3O8OA 2Z1MA 3DP9A 4MTCA 3DE5X 1KEPA 1MRNA 4CHGA 1CQXA 1QBKC 2D06A 4I2VA 6REQA 5T4HA 4B3IA 4KBFA 3HJFA 2WQZA 4BC0A 2QQFA 3KVNA 3TXXA 3IURA 2DWPA 1B73A 1Z3IX 2HLPA 2ZUSA 5BN4B 4GM4A 3QELA 4M54A 1ZOOA 4V0LA 5IFLA 4MS1B 4YDSA 3HWRA 4FB4A 4MDEA 4ZC8A 4DAEA 4PZCA 1JJIA 3D6MA 1JIUA 1U3VA 2VZ9A 5CK5A 1BMDA 2HW8A 1VPDA 2POQX 3BYZA 3C3YA 4I9UA 3WK4A 4CIAA 3GUHA 2ZYUX 1VIAA 1PQPA 3H1EA 4KQEA 4YMTA 4JS0A 5JE8A 2MCFA 1TF5A 1BEEA 4US0R 4QTZA 3BQ9A 3V4VB 4L95C 3ITEA 3DEKA 1U4SA 3OZCA 3V80A 4E09A 3RTBA 1YKGA 2V3CC 4BLUA 5BVHB 2XKKA 1T4CB 3ZW9A 2HX1A 2Z2YA 2FPUA 4CEJA 4A2PA 4ZYYA 4EW2A 1Y1PA 3M9WA 4BQRA 1E1YA 4G1MB 2RC5A 3JQGA 1W6RA 4XX0A 4DCOA 1M34A 4EQ6B 1MAHA 4IDPA 4YN3A 1O0BA 2VHQA 1X70A 3Q6IA 2YUTA 4JLVA 5A5EA 2WFMA 1C8KA 2XB2A 4ITUA 1FMLA 4PYOA 3ZTWA 2H1RA 1PR9A 3LGXA 2OHOA 4A6EA 3K6JA 5G4LA 2D13A 1M73E 3UMJA 4N49A 2R6ZA 4L5IA 3ZW8A 4BCCA 3DZDA 4TTAA 2SECE 1AQJA 3KOOA 3OIGA 5BR8B 5C7OO 5TB5A 1YCGA 2HV8A 3E9YA 3FGNA 4KJXA 4OGGA 1G5IA 3GPDG 4ZYWA 1ZJ4A 3UTDA 2C5FA 4RELA 5EPUA 4TM8A 5L40A 3FYUC 2V4ZA 2GFHA 3RVBA 4J0QA 1KAGA 4QATA 1QJ4A 2P6UA 4ARZA 4M37A 3FOZA 4XWTA 2J5QA 4EX6A 5DEIA 2NVWA 2JLCA 3ETCA 1R4NA 4FLEA 5F9FA 2AEMA 4CPDA 1GL7A 1PFWA 4G65A 1T4GA 2IZ6A 3C3AA 3IQDB 3K53A 2ONKA 5CJ2A 3GJ6A 4D5EA 3IP7A 4LHEA 1U3FA 2GCIA 1H6DA 1GR0A 4DLRA 1BAPA 1GLVA 2A9PA 5C34B 3W8EA 3O83A 4AT1A 4DLXA 3DR3A 2JBAB 3MT9A 4RPLA 1ZGCA 4S24A 2A9KA 3VOSA 4D9HA 3JRNA 1YIDA 4GXQA 1ISRA 2HMAA 2VTEA 4J4BA 3GIDA 4NRDA 4NPAA 2BHRA 4IIJA 2PEYA 4YRLA 2A7QA 4LJLA 4KXQA 2LVBA 4CQNA 2OLKA 1CIJA 4LDNA 4D9CA 2W6ID 4CCWA 3NHAA 2VBFA 2P67A 4UJ5A 4IHAA 1EXMA 2O3QA 5KC9A 2OZEA 3OT5A 4YCLA 3FYDA 4ZCQA 3T3OA 1GRNA 2JCGA 2Y8EA 1DJOA 1ZCZA 5FPSA 2NYUA 1QJCA 2BP7B 3OZEA 5LP6F 3D3NA 2OGUA 4LZJA 2WVGA 5AKGA 2AUNA 2FZ5A 2XWQA 1R0XA 1IBCA 2YWXA 3MN1A 3ZHZA 5J58A 2IHUA 5A03A 4LMBA 2DBYA 4AJNA 1KYZA 2PXAA 3WMRA 1DXYA 4MTLA 1YMUA 4MDFA 1JYFA 2BFBB 2K87A 2IRWA 5TVKA 1GTRA 2OORA 4IFBA 4EUKA 1EFLA 4DWWA 4Y18A 1QCYA 4BB9A 2WZCA 1VE1A 2CDCA 3KVOA 4DCSA 4LDAA 3PHBE 2C57A 2ZAYA 1PEAA 2PMWB 1CF4A 3RFVA 2ZRAA 1U0OC 2VEOA 3ESQA 1N5JA 3RC9A 3VOAA 1DC8A 2ES4A 2EF0A 5JQGF 5CITA 2VP0A 3MS2A 4RZSA 3K8OE 3C5EA 1M72A 4JR2A 3V8MA 2J48A 3AR5A 4B1FA 4XRRA 3RYFA 4F60A 6AT1A 1KBZA 4RVDA 3ND6A 4JK3A 4LF7B 2R8BA 1XAGA 2HA2A 3R9XB 1G17A 3UATA 4AY4A 3BIWA 1SCIA 4WXMA 1Q7RA 4UPVA 3MJTA 1RR6A 2XVZA 3LPCA 3VV2A 4F21A 2XKBA 3OMWA 5AESA 5EWJA 3WS7A 3VHXB 1HKHA 4QZVA 5DNYB 1SWVA 3IUQA 1I7DA 1EVLA 2F4NA 3QVVA 1OIVA 2BFBA 4BASA 3NBYC 4EGSA 1K7YA 5A06A 4JJEA 3ZXUB 2Z1NA 5MN4A 1B15A 1XDGA 1AT1A 2FQYA 4GRIA 1PGQA 2YBDA 1J56A 4GX1A 2XVMA 3ETJA 2CJWA 4KEAA 4UQPA 3C6MA 3QX9A 1ZSVA 3QKSB 1L1FA 1RXCA 1KVSA 4A23A 2E82A 3PUYA 1WXHA 4S35A 2Q1UA 2AQ8A 3KJGA 2ZRCA 2A6PA 1RE0A 2JGRA 1QK5A 2QRJA 3WVNA 1G8MA 2IPLA 3VVCA 1E6MA 2H7CA 4KQXA 4YUZA 3ZW7A 5DNDA 1TQ6A 1U3UA 1TJ4A 1U31A 2AG8A 2D2XA 3DV0B 3R3JA 3TDMA 1Z63A 3B38A 3HR4A 5DCUA 3VVLA 4V0MA 4O8ZA 4M1TA 4R8MA 3RGWS 3UG6A 4ZOAA 3ZOZA 1JE0A 1IB0A 1AQYA 1FFXA 2XUQA 2ILTA 1H0HA 3SBOA 3OIDA 4RIGA 3LY8A 1Y48E 2WM2A 3A6JA 2HO4A 4XWYA 4J3NA 2J6HA 3JPYA 4EYGA 1F5SA 3HI6A 2VR1A 3ER9A 2O19A 1YU6A 1DKRA 2QX7A 3UANA 4MROA 5E8JA 2LIPA 2PGJA 2PU5A 3BH0A 2ORVA 3DCYA 1WXXA 2JD1A 4DBLE 1W36B 3ORSA 4MP6A 2WWXA 4R81A 5JAPA 3S29A 1RZ3A 5LZ8A 4CMKA 2WR8A 3EJ6A 1DO8A 4TKLA 1AMOA 3K9GA 1MF7A 1CZUA 1WUTA 4J0GA 4XOIA 1DQPA 1LK7A 3CLHA 3TCXB 2G9NA 3TQQA 1PVVA 3NNNA 4PAOA 3SSMA 2ZIXA 5ILQA 1KJIA 1XAJA 3BRQA 1G0NA 1IVYA 1WQ4A 1XZNA 3ZOKA 4BFTA 3H5NA 4X6LA 3RC2A 1XV5A 2YZKA 2GWHA 1EEHA 2C3PA 2JLBA 4ETIA 3K9BA 1VE6A 3L8YA 1M2JA 1NVKA 3NT4A 3O4FA 1CJMA 1PDVA 4FFOA 4G2NA 1ZQ9A 1I5EA 1D09A 2HYDA 3I5UA 1ZHFA 4IPTA 4EKNB 4YT4A 5AUPB 1L2TA 3ZY5A 1XFDA 3DTVD 4NZYA 3UJAA 4F3YA 3KLNA 3PQCA 1UAGA 2ORWA 3A25A 3E3MA 3L01A 4QUGA 4ZQGA 2B37A 2XKJE 4PRZA 4R84A 5F77A 5EJ6A 3H5LA 3TZHA 3CIOA 3X1KA 2QW0X 4NVRA 1P2UA 1NJFA 3GFRA 1QDEA 3ZN2A 3HM2A 4U9UA 3SDSA 4Q5IA 2Q27A 2Q1WA 2ZDHA 4FYYA 1NT4A 1TIPA 1Y3HA 1ZAKA 4HLNA 1FJHA 5LA6F 1ABBA 3BBPA 3TFOA 3FCSB 5C51B 1KPIA 2A94A 2D0OB 4C1BA 4KCGA 2C8LA 1Y6RA 3VJRA 4L76A 1C50A 5TJ9A 3PQ4A 4YJFA 4CTKA 1V45E 4JIMA 4L28A 2QNIA 3TLZA 1QHIA 1Y33E 1XTUA 2VAMA 2VT6A 4MWEA 1LDBA 4FPXA 4OYYA 3TW6A 5LZ5A 3ZWMA 2QLJA 2YNMC 3HZHA 1TVEA 3VMMA 5IT9A 3GPIA 1JSCA 3N2EA 1T9GS 5ALHA 4GKVA 4MXDA 1N1EA 1QP7A 1MA3A 2C3OA 2D7JA 3IE2A 4NQZA 1C5KA 1RT9A 1CS0A 3VDMA 1KH1A 1W19A 5HTOA 2O4UX 3KSDO 4C87A 2ZSJA 1R8JA 3OOWA 4I81A 5A3QA 5BSGA 5A4KA 5JDIC 4JEHA 3S2FA 5B7QA 3AF2A 3H1AA 4GI3A 2G4CA 1WX1A 4FMBB 5FNZA 4QTYA 3CGWA 4OJQA 4IJMA 1GLGA 1NC3A 2J7KA 3GWGA 3OZRA 5DYIA 2NMVA 3KRTA 4G0WA 1JKFA 2MSEB 2OKCA 4P5EA 3VPAA 4D43A 3BWMA 1GSHA 3S2YA 1VI6A 4D97A 5CVCA 1J4AA 1RQ7A 3OM1A 2UZ0A 4AG6A 4ZDJA 2RH4A 1V1RB 1KSFX 2XZPA 1VRVA 3FFTA 4CM7A 4JL8A 2CLSA 1XD2B 1DAHA 1M1XB 2QM8A 2PJDA 3IA2A 4RMNA 3RF6A 4BMVA 1NW9B 5GV7A 2BCGY 1E6LA 4PFJA 4H4EA 4Y6PA 1CY0A 3STWA 4XDHA 2GEKA 3VU9A 1GNPA 1DMRA 2W4IA 2PLNA 1OC2A 1SHTX 2OVBA 3OQMA 5G1OA 2AYXA 1SA0A 2EIXA 4U5QA 4BKUA 3ACCA 2H48A 2J7PD 3EQ6A 6REQB 4K2HA 5CA0F 5DF1A 2GK7A 1R4MB 3HXPA 1YA6A 2WWIA 1CY6A 2QZSA 3W2HA 3PUZA 1S01A 3JSXA 5JZBA 2ISQA 2EZ4A 2HOQA 2PX2A 1N2CE 3Q0IA 4O08A 2OAQ1 3H65A 4MUJA 5J4LA 3QMWA 3AF6A 1KBOA 5EJAA 2QN1A 2YMPA 3FFWA 5CDYA 1JFRA 1UZMA 1CV2A 3D6HA 1OAOC 3MTQA 1NKSA 4RVNA 4DIUA 1CF9A 4F4UA 5KZMB 1DTWA 4TKUA 1H1TA 1Z4MA 4MRVA 1LX6A 3H05A 4XJVA 4ZAZA 3TAHA 3U4HA 7REQB 3ZQJA 5LWQA 3LF2A 3KLBA 4OP1A 1F8UA 2WIDA 3GJ8A 3CKYA 3G7NA 2B34A 2BCEA 3MCZA 3JWPA 3IGFA 4OV6B 3O7WA 4G85A 1PQUA 3S81A 2Z8ZA 5E6SB 4DE5A 4KE6A 2ZRQA 4MQ5A 3GLFA 1TYAE 4TV8B 2AXEA 4JHXA 4M7PA 2P30A 5MN6A 2WSLA 3G17A 1M9NA 3CEHA 1EGVB 1VCOA 4RTQA 4X1YB 1MQ9A 1JKIA 1B7GO 2F6RA 4BNWA 1Z0IA 4XUGB 2A84A 1D6SA 1MBZA 4UE6A 5DI3A 1G21E 2PL1A 5EUBA 2C61A 4UU1A 2P9YA 4RY9A 5IF9A 1LSJA 3BGVA 3FRIA 1UBGA 1OBFO 1TM7E 2MMGA 4GPEA 3H11B 4IQ4A 4Q66C 1GUBA 2QVCA 1B8VA 3ECCA 4F9GA 3M6VA 1QFYA 3O3MB 4GHWA 5DW3A 4DM4A 1Z2AA 4GUAA 3MRSA 4EG6A 1IY8A 5CT4A 1YBVA 4K8RB 1FDIA 3Q8MA 1RPTA 3WYDA 3T3NA 3VSDA 4FGWA 3ST7A 3T38A 1FXSA 3M1AA 4FD2A 5B6JA 3TTSA 4PO3X 4GBGA 4U9IS 2HDWA 3EISA 1GFWA 3C6KA 3AVTA 2P91A 3I1IA 3GLUA 2QXUA 3IQIX 4MUXA 4QPCA 3WXMA 5AO9A 3VH2A 1J07A 2QYOA 1EGAA 2VCHA 2XT6A 1L4NA 3C3BA 1FTYA 4MVCA 4MI3A 4A4DA 1K5HA 1Q91A 1OAKA 1Q1BA 1QKJA 2GWRA 4B2PA 5BSEA 4WX2B 1GPAA 4DLPA 2FRVA 1X1SA 4MQFB 1MVNA 3FUUA 5FFFA 4CLOB 5FX2A 5AVRA 3TZ6A 5HE9A 1V96A 1MOSA 2IYZA 2XWJI 2W48A 4NI5A 4WGFA 4JLDA 4FU0A 3SC2A 3ZJYA 1H2XA 2ZANA 4DQKA 1ZBDA 2EGUA 3B1WA 4KPEC 2Z2KA 1I36A 4C1NA 3ZHSA 2X5NA 2FWJA 2RH5A 4RX1A 3WADA 3ZE0B 2BLLA 4MWZA 5KU7A 1YZYA 2FSPA 1NSTA 3V1TC 4UDNA 2SKEA 3L6OO 3ZYCA 2J0UA 5K2OA 1XPUA 2OXTA 1V9CA 1M0SA 4Q3KA 3HU5A 3VR1A 3G5LA 4GX0A 5BV8A 2ZKIA 1T9ZA 3SHQA 1LSSA 1GQYA 3TNLA 2CJXA 4U7HA 3W2GA 2QTVB 3KSUA 3X2EA 1U99A 3F5QA 4L4XA 4NCKA 3G8DA 5TPWB 3UUFA 1BCRB 2B5OA 3HB7A 2VJKA 1AN0A 2E87A 1VJCA 3R5FA 4BP1A 3L06A 3U7EB 4IFTA 5JRJA 4KRGA 4N3CA 2GPTA 4C7KA 4FE4A 4G8BA 3MFYA 5GY7A 3KOUA 2PWPA 3L3BA 1ZFNA 2IYPA 2WPDD 4P34A 3RVJA 2R6FA 3CXUA 2HSJA 1FDRA 3EXIB 5D3MA 3X1ZA 5LA6A 1UBFA 2FRXA 3QXXA 4MZDA 1OW3B 2F48A 5F3RA 4L5BA 3DBRA 4N7BA 2EJUA 5U4QA 1C8VB 1Z0UA 1L7VC 2CEAA 2XTJA 2YDXA 3E1GA 1KIMA 3ZD9A 3ZE6A 3P9NA 1ICEA 2IXGA 5KTTA 4HRAA 2V0GA 1GL9B 1S3IA 3U61B 1ZYUA 2VDLB 1MJFA 1T0JB 2PM8A 5BSKA 1KYXA 1RLUA 4QDXA 3PD1A 2HWXA 1RXEA 1H3NA 1JLSA 3BQNB 4MUEA 1C9DB 1JR3A 4NS4A 1NQXA 1T4MA 1JVNA 1YVDA 2ZBPA 3LU1A 3PZBA 4Q7KA 1PEDA 2LCFA 2ODBA 2X4DA 4R69A 1UQTA 4F3CA 3OF2A 1E6KA 3LCRA 5A4IS 1T9AA 4GKJB 5JNVA 4OYHA 1JZQA 2X2FA 2PIAA 3TOZA 1AZWA 2BH9A 4R1TA 1W0KD 3L1HA 1XMQB 5C4GB 1IDOA 2B25A 2YVQA 4NOLA 1K97A 2C03A 1KP9A 4ZVNA 3HP4A 3IQEA 2ONJA 1WMAA 1EFHA 1I9GA 1R64A 3QEMA 4BWGA 5T57A 1VJ0A 3RVLA 4EVIA 4DDTA 5FOTA 4JI2B 2BF4A 4LNAA 2PUWA 5CXUA 3BD7A 4N39A 4OIFA 2DPXA 4N0MA 4QYMA 5C46F 3AFGA 2Y1WA 4L7VA 4OU4A 1E7SA 2P6MA 5F4ZA 1NVGA 4EHAA 2W37A 3CZ5A 4YAOA 3ZI7A 1KR2A 1HK7A 1UADA 4CM9A 1JGTA 1EBFA 2QR3A 5KJEA 1P1IA 2GUWA 3QTLA 4ALMA 4P08A 4HDQB 3F7NA 4G23A 4Q9NA 3RU7A 1YRLA 4X5OA 5FB3A 5CLFA 3J81k 3FNHA 3EF0A 1T9HA 1GGKA 5KNDH 4UNRA 4F9FA 1TO1E 3GXOA 4KQ6A 4FSHA 1ZX1A 1AXRA 5B36A 2PS0A 3DFIA 1M7GA 3Q98A 3SDBA 5SZJA 1UMCA 1BD4A 4HTFB 4B45A 5JAZA 4QPZA 5JO9A 4NOMA 4YROA 3MAGA 2WHXA 5IDVA 3E23A 4N0PA 4CM8B 1MPXA 2D0DA 5DM2A 3C3CA 1IHOA 1IK6A 1RXYA 2Z09A 3P26A 3O91A 4RIFA 1AVTA 2I0FA 2BI8A 4J0IA 2OTCA 3AHJA 4XSVA 4WKNA 4G84A 3T3PB 2W00A 5EFOA 4R9VA 3ML1A 4PG5A 5IBQA 5JNLA 1W88A 3KOMA 1IN4A 4YPFA 4CKWB 8OHMA 1L5QA 1I01A 1OKKA 2GD2A 2I29A 1OXBB 3B82A 4YXWD 3D8UA 3ZDRA 1KTIA 3K9WA 2AJDA 3ZQUA 3ZWXA 1UKEA 4HNSA 4AY3A 5JQGA 5K4HA 5HA5A 4C6SA 4KVGA 2Z4TA 2I78A 3ANLA 3RD5A 4YH1A 3AFHA 3FWPA 2O8CA 4DQ0A 1DTSA 4H1VA 2VYND 3R9XA 4EI2A 4MP8A 2FSGA 2PAFA 2BGUA 1U0NA 5CHEA 3C48A 1JT9A 5NLLA 4I1IA 4LHVA 1TW2A 5AJTA 2W6JD 4AK9A 2JZOA 3L7NA 1U4OA 3FA2A 5FIUA 4EATA 5I7RA 2VSNA 4TYYA 4F6LA 5H8WA 1PAUA 4J6FA 3OKAA 1IEWA 6LDHA 1BYIA 1HM5A 3KB1A 2KS6A 4YJGB 3MTBA 4Y0AA 3MJVA 3C8UA 2XMBA 1CUEA 2QMOA 5HCUA 1JALA 4PNZA 4QU8A 2AIRA 5F51A