1G5RA

The three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
b'ERGIIIVFTGNGKGKTTAAFGTAARAVGHGKNVGVVQFIKGTWPNGERNLLEPHGVEFQVMATGFTWETQNREADTAACMAVWQHGKRMLADPLLDMVVLDELTYMVAYDYLPLEEVISALNARPGHQTVIITGRGCHRDILDLADTVSELRPVKHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COB(I)ALAMIN ADENOSYLTRANSFERASE
publication title Three-dimensional structure of ATP:corrinoid adenosyltransferase from Salmonella typhimurium in its free state, complexed with MgATP, or complexed with hydroxycobalamin and MgATP.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 51
structure length 157
sequence length 157
ec nomenclature ec 2.5.1.17: Corrinoid adenosyltransferase.
pdb deposition date 2000-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02572 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g5rA00
1AZSC 1JNYA 2IYXA 3SR0A 4FW9A 5HCNA 3ZD7A 1XD2B 2IUTA 1CU1A 1DAHA 1W5TA 2C95A 5LB2A 4Q9HA 3OF5A 3N2EA 1RYHA 2V1UA 1SXJE 4POAA 2C96A 3A4MA 4EPYA 2IT1A 3TUJC 3R20A 3RANA 1ZAKA 1T5LA 1YVDA 2V4ZA 2VHQA 5H1YA 2WWIA 1KDRA 4CT5A 2D06A 3K0AB 3KDSE 3NVAA 1ODFA 2EWWA 4S35A 5GJCA 1GKIA 1US8A 2BM1A 4HYYA 2PT7A 3U7HB 3ZGXA 4IFEA 1WMSA 4BFZA 1RIFA 2WIAA 4M53A 1JBKA 4AYTA 4BLOA 2O8FB 3NDBB 4WOPA 5CLQA 5JZVA 1E9SA 4Q1CA 5KDDA 2JLUA 3HDTA 3U6BA 3W6OA 3H2YA 3NBFA 2IWHA 3GQBA 4Q4HA 4QL3A 4XD7A 4Q00A 3QSYA 1E9AA 1Z0JA 3AVPA 2K5UA 3NBYC 4KO8A 4ESVA 4PXAA 2EFGA 2NGRA 2ZYUX 3B9PA 2R44A 1GG2A 2A5JA 1NF3A 3F3YA 4LRWA 3CNNA 1NG1A 3B7GA 4B3GA 4EPTA 5B30A 2VF8A 5FPSA 2HT6A 4F4IA 4UJ3A 2PT5A 4UXHA 5FBWB 2J0UA 1XZPA 4D0NA 5C2JB 1VG9B 2VP9A 2C9CA 2VL7A 2FFAA 1AK2A 1QHNA 4LV5B 2ZM5A 1PLJA 1X1SA 5E7JA 3K09A 1NBMD 1VHLA 1HEIA 2KSQA 3IBYA 4OKSA 4FMDB 5FFMA 2JAQA 5AUQA 1K5DA 1IQPA 1OLOA 2J5XA 3VR6A 3RS7A 3EXAA 3KB2A 2UVQA 5B2ZA 1DTSA 2V3CC 1VMAA 4CW7A 4PC6A 1W46A 1QVAA 1UKEA 1KI3A 2LWIA 2X77A 4OYHA 3Q72A 1J8YF 1UBFA 3LBNA 3U3OA 4D0LB 1CJMA 1U90A 4QJ4A 1W0KD 4AC9A 1F2TA 3RAPR 4ASUD 821PA 4L9SA 1IBRA 5FL3A 3A8TA 3NDPA 4DCSA 5IRCD 2UKDA 1KAGA 4F92B 3GLIE 2FX3A 4QXAA 4IOLA 1LF5A 3BH0A 2YINC 2IF2A 3LWNA 2CLSA 4PO8A 2NOAA 3CLVA 1R8QA 1Z08A 1TEXA 2RGNC 5G40A 4KVGA 1W36D 1GNRA 1X8JA 1OSNA 3VX4A 5GVSA 2ZRMA 2GNOA 4C0LA 3MAAC 5SZIA 4LBWA 4A92A 2JDIA 1HE8B 3HPRA 1X8LA 4G3XA 3PEUA 2JJ8A 1TF5A 5BYJA 4V0OA 1DVRA 3WY9A 3GJXC 1CLUA 4LWZA 1Q3HA 4A0FA 4A8JB 2ZS7A 2ZE6A 1MO3A 5CM9C 3TBKA 1N5IA 3W6PA 5FUYA 4HUQB 2F1JA 3EA5A 2QY9A 2VP4A 4F93B 1CEEA 1LY1A 221PA 3LBHA 3X1XA 4AWXA 3AVOA 5D3MB 3FB4A 4L16A 2JJ2A 1AGPA 2BC9A 1KMHB 3AUYA 4OHXA 2V7QA 4M8NE 2EQBA 1KI8A 1Z5ZA 1Z3IX 1BKDR 2RGEA 1KI4A 2VHJA 2OM2A 1D9XA 2O8DB 3ZLJA 2GXUA 5DGXA 2VTKA 4DVGA 1SKYB 4HLUC 3QXSA 1LV7A 2F1RA 2FMXA 4IHQA 3R7WA 5JHHB 2ZRFA 1P5ZB 1VPLA 2DYKA 3H4MA 1EXMA 4YMWA 4B35A 5DYGA 4ACAA 5E4FA 1N6IA 1YRAA 5CK4A 2JLZA 1NP6A 2GAAA 1XMIA 4JVMA 4Q9IA 3KKPA 5A5GA 1Q1BA 1SVKA 1B0UA 1G17A 3K9HA 4OHYA 4MRNA 3U6KA 3EPLA 3EZ9A 4RCZA 4FWIB 1QF9A 5J4LA 4D81A 1LW7A 3T12A 3DM5A 5FBQB 4KHZA 3BB1A 3OEHD 2R6FA 2GCOB 4Q5IA 4TWZA 3OE7A 3QG5A 1MKYA 4B74A 3QJYA 3R8FA 3K0CC 4IVPA 121PA 3HU1A 3KUCA 4ZIRB 1BIFA 1W2GA 3B1WA 3SI7A 5BN4A 5EUQB 2JA1A 1CXZA 2VPPA 4B3DA 2ODWA 5DN6D 1DAMA 3AVVA 2ZITA 3AH8A 4FI3C 2H5EA 1KSHA 3DOFA 1EFRA 5J47A 2QGZA 4QM6A 2XTNA 2VP0A 4Q1BA 4DLRA 4DXAA 1KNXA 1IJFA 3L0SA 2OE2A 2OXCA 3RVBA 3W34A 2WWFA 3DM9B 5FL7D 2W6IA 1ZM2A 5BN3A 2BCGY 4X8MA 3DMNA 3K0FA 5F9FA 1O87A 2D2EA 3VTKA 1OKKD 1J8MF 4P4SA 3FWYA 4Q03A 3CH4B 3QF4B 1FUUA 2V8OA 2TMKA 3ADBA 1QHXA 1AQUA 3AQ4A 4HLDA 4D4LA 4IDOA 3UWKA 1R5OA 3SFZA 1E0SA 3IGFA 1GVNB 2HT1A 4WXPA 1X8KA 1D2EA 3LD9A 4Q19A 3TJZA 4MKIA 1P9NA 2QE7A 4GFDA 2NIPA 3CO5A 2X1VA 3P27A 3P1JA 5DI3B 4RKEA 2GZHA 5E7MA 3ZVRA 4DBLC 1TTTA 3PUYA 5B58C 2GVZC 1QG2A 4DLUA 4RJLA 3ADDA 3WNCA 2GEVA 1W0JA 5P21A 1HE1C 3V00A 1NVUQ 1E9FA 2REBA 4GMXA 2WJVA 1HA3A 1TAGA 2GXAA 4I1UA 2E1RA 3TAHA 4EUNA 2AXNA 4B2IA 1XJCA 4TLDA 3L82B 2ZSFA 2YVUA 1CTQA 1XP8A 4ARZA 5CITA 2A2ZA 1DAFA 3I72A 5JS7A 2DR3A 4GI7A 3MSXA 4TMXA 4CDGA 5FOVA 5CJ2A 2IYWA 2Z83A 4PR0A 4XSHA 3H0KA 2WJHA 3WRYC 3C5HA 4DT1B 3NH9A 4Z8XA 1B23P 1BO6A 1NIPA 2W2XA 4KSCA 2PL3A 4W5WA 4B3XA 4RD6A 1GTVA 3AB3A 1ZP6A 3IUYA 3LQRA 3MMPA 5A4JA 4XD7D 1P60A 1U98A 4IDHA 2ZI9A 1N6RA 4B75A 4LHYA 4BRWA 1OFHA 4IOJA 4HLCA 4L15A 5A0FA 3AVYA 4JKYA 2QTVB 2ZRPA 3LX8A 1XTRA 5F9HA 3PENA 3BB4A 3CZQA 3SHWA 3BB3A 4AURA 5L3QB 2AXPA 4UNSA 5L8VA 2IA5A 2MSDB 4DJTA 4PX9A 4CEIA 2A78A 2WHXA 1L7VC 1XMVA 4EPWA 1P62B 2E87A 4KBFA 4Q7MB 2OCBA 5FBLB 1S8FA 4EFLA 1XMJA 2XTZA 3V4RA 1H8HA 3Q8XB 1XRJA 2H17A 3TSZA 4UNRA 4XWAA 1IN5A 4ZPXA 2FSHA 4LBZA 2FF7A 2ZE5A 3D3QA 5DH9A 4LDJA 2YYZA 4I99A 2ORVA 3HR8A 1SQ5A 1U2RA 2QBYA 2DCUA 1HV8A 1XCGB 2WMNB 4MYUA 4IXMA 1S9HA 5JWOA 1GAJA 4QJ5A 4RZ3A 4TMZA 1M7BA 3BBPA 2RAPA 4M1TA 4E09A 4TYPA 1AS3A 3AKCA 1NKSA 3BC1A 3RDPA 1NN3A 1ANKA 1II9A 1U8AA 2CK3A 1KSJA 3WBJA 1I4TD 3FTQA 2D3WA 1OHHA 1RJ9A 3IKJA 4JZKA 2W0MA 1FNNA 1ZD1A 2CL6X 2W83A 4JYBA 4O2RA 4BASA 3QXXA 4QNRA 5C4MA 2JLSA 1OH8A 3QE0A 3AKDA 3GLFB 2ZRGA 1G6OA 5J4HA 4GL2A 4RFSA 1MR3F 1WQ1R 3VKWA 1DAKA 2B8TA 3DL0A 4KCGA 4C2TA 3T5GA 2JDID 5KSPA 1S1MA 1VHTA 4LK2A 3WYFA 1P7CA 3TMKA 3QKSB 4ZDKA 4K46A 4D2IA 1ZUHA 5DLQC 4FMCF 4PC7A 1A1VA 4JSYA 3IPYA 5KHOC 2J87A 1D2MA 2PX0A 3RWMB 3MD0A 1QHGA 5JFGA 4ZV4A 4URXR 2FEMA 1OIXA 4L8GA 3UPUA 3IIJA 2JJ2D 1XEXB 4B43A 2H1LA 5JI3E 1SXJD 3SBEA 2V7QD 3KQUA 1HT2E 1ZU5A 5HR5A 3LLUA 4DLYA 2GHIA 3KXKA 1MT0A 1GL7A 1OYWA 1FOEB 1SZPA 3R9WA 1SVSA 4PANA 3P20A 1AS2A 2HYDA 4RCYA 1DS6A 5UKDA 1KSGA 4KFTA 4OJQA 4NP6A 421PA 1C1YA 3QQ5A 4RD0A 3PUVA 1Z8FA 2F1HA 2IUSA 2B8WA 4MGZR 3U60B 2IW3A 1BYUA 3BFVA 4Q9LA 4CYMA 1EFHA 1VG1A 1D2NA 2P65A 1II8A 4OJKA 4US0R 1AJEA 1RZ3A 1E2GA 1ZCAA 4DDUA 3SQXA 3DPUA 2WZQA 3I3SR 4ZO4A 3K9NA 2J0QA 4M9SA 4B71A 4C4PA 2I1VB 3GCGA 4AKIA 2N1BA 1GL9B 5EE5B 4JLBA 4PFSA 1OB2A 2FZ4A 1JXMA 1NN5A 1UDWA 2O0KA 2OCAA 2W2TA 4MKFA 1ZBDA 3RRNA 2VP6A 1T3LA 3EC2A 5ANRB 3KUDA 4C2UA 1TF2A 3ZZUA 3N70A 3FHCB 4DCUA 5HTKA 3Q85A 2PBRA 2WM9B 3OE7D 1ZIPA 1Z6XA 3VHXA 2NZ8A 1DAIA 3U4QA 4A9AA 1YJ5A 5GADl 5FUWA 1G7CA 4X8OA 4IW3B 3X1YA 1I4LD 1Z2CA 1KI6B 2HEIA 2IBMA 1W36C 5J5CA 4JSTA 5DSZA 4WW0A 1EFRD 1IY1A 1T4GA 4EIWA 3SBDA 4C0SA 4Q4AB 3KKMA 1KGDA 2BKUA 3EPJA 1NIJA 4NPHA 2R6DA 1U81A 4OBEA 4DSNA 2GZDA 1K5GA 2A30A 5LD2C 1Q1ZA 3L0PA 3RHFA 2J45A 2QU8A 2IEYA 3GFTA 2W6ID 1NSFA 1ZM4A 2G1JA 3FVQA 3ZQJA 4LHXA 4ESHA 5K8TA 1WBDA 1A7JA 4YMTA 4M9XA 3K8YA 4PO9A 1LTQA 4RD2A 4NYMQ 1RFLA 1CR4A 3RC8A 1G64A 3X2SA 1HURA 2WOJA 4HZIA 1XB2A 1PLKA 3LXRA 4S2EA 5C18A 2GF0A 2J59A 3WP0A 2BMJA 4MKGA 1N3BA 3BH6A 3KFXA 4D0GA 3AV0B 1TL7C 3GLFE 1RVDA 4YLGA 4DCVA 621PA 1Q3TA 5HE9A 3IEUA 1G8FA 3QEJA 5G41A 4CEJB 3CX7A 2HXSA 4G5QA 3K0EA 3LA6A 4GNKA 2O52A 4BGDA 1ESNA 2QE7D 3UG7A 2MMCA 2IK8A 2GBLA 3QPVA 4OI2A 3Q9LA 1OXTA 1N6LA 1P2VA 3PXGA 1VDZA 4G5SA 2H8KA 2Z5FA 1W0JD 3AGQA 4PHFA 5AJXA 4EKDA 1KSFX 4IRUB 1N6PA 4MYCA 3T5DA 3FDIA 1JALA 1M74A 3QKRB 4PAMA 1ZVQA 3GLHE 5FPTA 5CIQA 2FDCA 4NCJA 1G8YA 1G9XA 1N5LA 2OESA 4K81B 4TTPA 4B3CA 2VIIA 5EXXA 1RC8A 3UWOA 1FTSA 2Q3MA 1R0YA 1XXHA 2C8VA 4A0RA 2ZS9A 1IM2A 2QA5A 1TQ2A 1N0WA 4C30A 3QXCA 4F4CA 5FOTA 1YR6A 4M1OA 2B7CA 2ECKA 4JIMA 4D25A 2BBWA 1CR0A 2FSIA 4HLQB 5CYOA 3AUXA 2OBLA 1OFIA 2I3BA 4QHSA 4ZDWA 2QPAA 2CMKA 2WJIA 3TQFA 2QPOA 1F2UB 4L4UA 3N2IA 4D26A 1KKLA 2NZJA 2W0SA 3DEFA 4MA4A 4BZQA 1CR2A 2HF8A 3M0EA 2BMDA 5HZHA 1E0JA 2QT1A 3C16C 4CZ2A 2XNSA 4Q7KA 2WPDA 2ZJAA 5KOYA 2O8BB 1U8YA 1V43A 3OEEA 1UJ2A 3CPHA 5HE8A 4KFSA 3RS0A 4WA7A 3CM0A 3OHMA 1YE8A 5EE9A 3W3ZB 5B57C 1J2JA 3SNHA 3CW2A 4HZUB 2EFEB 3VKGA 3MLEA 2IS4A 3KKNA 4DLXA 4TLEA 3VNVA 3HWSA 1X6VA 4W5HA 4KYIB 5EXSA 3SE0A 3OIUA 1G7TA 1E2HA 1NMYA 3LXXA 4NCKA 1H8HD 4QHYA 3GEHA 5BWMA 4GOXA 1AKYA 1E4YA 3PR1A 3HJNA 3E5HA 2V6IA 1UADA 1JR3E 3I4LA 3I73A 2D74A 2AFHE 3PEWA 2DFLA 4AKGA 3RS4A 2ZRNA 4F38A 4B6FA 1W2HA 3VHLB 5IT5A 3GJ6A 3OIWA 1DADA 1CJKC 3QUSA 2QAGA 2ANBA 4JBXA 2IYQA 4Q7LA 1TUIA 4TL6A 4A0GA 5CB8A 1Z07A 1E0AA 4KLNA 2FGJA 4WBSA 3S1AB 1XTIA 3K0SA 1G7RA 1G3IA 1NVVQ 1SVWA 2CK3D 3EZ7A 2PZEA 3CRVA 4NCIA 4P31A 1E2JA 2OLKA 1OHHD 4PAOA 5JLJA 3WMFA 1T5IA 4LC0A 4JLAA 1U94A 1E2DA 2EFHB 3Q3JB 5TXGA 2R6GA 5EE1A 1ZNYA 2PJZA 5EE3A 3P4YA 1CJVC 2FPMA 3TLXA 3TRFA 4M2LA 3TR0A 4DCNA 1Z0FA 4L9WA 2Z43A 1W4BA 4M9ZA 1HUQA 4QGFA 1TQDA 4DZZA 4FCTA 4LPKA 4O3MA 2PLRA 1EG7A 5E95A 3V4FA 4EDHA 5TMPA 1W1WA 2BBSA 1P9WA 2XNDA 3RYTC 1P72A 5BXQC 1MV5A 3EIEA 3IQWA 1YZKA 4ZKEA 2ZJBA 2O5VA 3CRMA 2ZAMA 2CJWA 3QXJA 1NJFA 3MJRA 3RABA 5L3SB 2JLYA 1P2SA 1GRQA 4BE7B 4XTCS 1P73A 3DZDA 4E03A 4LUCA 1S3GA 2BV3A 3I92A 2F55A 4NKRA 1A2BA 2H18A 1G3MA 1FMJA 1ZUNB 1UEJA 1G1MA 4FINA 4PPFA 3SHFA 3CR7A 5FI0B 4URWR 2OAP1 2WVJA 3GLHA 3TE6A 2J1LA 1FQJA 4YQFA 3GLGE 4V03A 4E07A 1JQJC 4PQRA 2J46A 5DHFA 5JEEA 1E2PA 2FV8A 3CF0A 2ZR9A 3K09C 1GL6A 2CE7A 2OXRA 1E2NA 2C03A 1N2CE 5CLLA 3EZ2A 4G0NA 2GESA 5CDFE 2Q3FA 4DLZA 1L4YA 4I81A 3R9IA 4HDQB 3UXMA 5CK5A 2IXEA 5KNCA 2F9MA 4R71A 2F43A 2ZE8A 2DPXA 3ZDQA 3THXA 3LW8A 3RWOA 5EZ6B 4XOIA 1JAHA 4ZI3A 1MABB 3LDAA 1E99A 1TEVA 4BUJA 3T1VA 1ONBA 1RKBA 4XVQA 3WP1B 4DSOA 4AYXA 4CEIB 2D2FA 4ZDIA 3SJZA 4CVNA 1CS4C 2J9RA 4FXPA 1II0A 1P6XA 2VSOA 4GBMA 1NY6A 4MUAA 3QPUA 2AKAB 1E96A 1ZINA 3A1TA 4FIDA 3SN6A 2IS2A 3WHLA 3IPXA 4OQFA 1ZNZA 4G01B 2IYYA 2YNMA 4HB3A 4WZAE 2ZRAA 3KKOA 4TZ6A 4HAVA 1VCMA 2HJGA 4B47A 2O8CA 2BIFA 5TB5A 1UM8A 4W5JA 2GCNA 2VRWA 3D7MA 2ZRCA 1GIAA 3QKUA 1G8GA 4P3YA 1ZM3A 2RGBA 2QMOA 4KLZA 4X8HA 4JLPA 5JCPA 3PEYA 1FTNA 4B34A 1E9RA 3LW7A 5KDOA 4BEBA 1S96A 5D3QA 5JEDA 1YR7A 4G1UC 2G6BA 2QMUA 1RW4A 3BAFA 1DARA 2SHKA 1YZUA 2WIBA 1KO1A 2C98A 2H92A 3MUFA 4LCBA 2CHQA 3TUZC 3CKLA 1Q22A 3G0HA 2LCFA 4QGAA 2YWHA 2Z6VA 3LX5A 4JKIA 1A5TA 4RSGA 4LJ7A 2WSSA 2G9NA 2AD5A 2FSGA 2WWWA 4HEJA 2BBTA 5EP4A 1NMZA 2ZRJA 3RLFA 3THOA 1VCNA 3VQTA 2DB3A 3VNUA 3NEJA 2C99A 5L3RA 1R5BA 3RS3A 2OEPA 1KYIA 3LRPA 1G5TA 1SXJA 2ZU0C 3TVDA 2ZYTX 5ELXA 1YHNA 3F8TA 4V0ME 2NQ2C 4MRVA 3KTAA 4KV9A 1GNPA 3AP1A 4KBGA 4NYJR 3CR8A 4OK5A 2NO7A 4LJ4A 1N5JA 1T3SA 5FTLA 4A2QA 2ZRHA 1PV4A 5DIFA 4TQAA 1KY2A 5FBVB 4Q48A 2ZI7A 4U00A 3SDZA 3MCAA 4FN5A 3AF1A 2ZS8A 2JLRA 4IDPA 2CBZA 4MRPA 3GLGA 3GJ8A 3HYRA 2W58A 1KDTA 4NYIR 5K8UA 3F5FA 1IY2A 4AKHA 3D31A 4K8OA 3CRQA 4FCVA 3EIHA 1U9IA 1LS1A 4GP7A 2ZRIA 1UBEA 3GPLA 3GJ3A 1U8ZA 5CDFA 2J41A 1II8B 1R6BX 1E2FA 2WPDD 5FPHA 3U5ZB 2XB4A 4II7A 3ZS8A 5KSYA 1TU4A 2EU8A 3OEED 3ZVLA 2QTFA 5SZKB 5BQ5A 2IHBA 2ZQ5A 4NH0A 2XSZA 3PG5A 5TVKA 4CF7A 4QM7A 1IY0A 3ZIAA 3FPAA 3RSLA 4PHGA 3MFYA 3LFUA 4D4JA 1VG0B 2FSFA 1ZCBA 2R6AA 4ZCMA 4A15A 4HLUA 3CF2A 5FTMA 3GMTA 2ZJ8A 1IN8A 1XTKA 3U4QB 2QZ4A 3CH5A 2VYFA 1DOAA 2IXGA 2XEXA 1JI0A 4LHVA 1KK0A 4IDNA 4EQ6B 1OH7A 4GPTA 4ZI2A 4TQ9A 5H8WA 2GETA 2JLVA 3DKPA 3FFAA 3EA0A 1OV4A 4C7OB 2D7CA 1JJVA 4BFYA 3T35A 2B21A 3U44A 2IHYA 1IXZA 1OH6A 1QRAA 4HB4A 4BEJA 1G5RA 2Z0MA 2ZTSA 2IYLD 1AN0A 1EFCA 1VECA 4EJSA 3GLIA 2D62A 3SOPA 4Q47A 2VHCA 4BQSA 4AG6A 1GRNA 3ZJYA 1XPUA 4QGGA 1KO4A 3QOFA 4WXRA 2AK3A 2FNAA 5F98A 4OQNA 1W36B 4Y0AA 1G3QA 2ZJZA 1KJWA 4Z1MA 3TSWA 5JBQA 5C4GB 2PMKA 1TMKA 2J7PA 3AF2A 4FWTA 4L5BA 2JIZA 3A1UA 1CBUA 1I2DA 1N0UA 4TYQA 5LD2B 3NH6A 2FG5A 3H86A 1ZUIA 3UMSA 1E9CA 2CCGA 2ONKA 4QJ3A 1GKYA 1PUJA 3REFA 1RRPA 1M1YE 1KI7A 1XD2A 2XNDD 1MO4A 3MG9A 2MMGA 3U7EB 4LSGA 2ONJA 3VU9B 3PJRA 2L0XA 1DE0A 3MWYW 4PHHA 4DLSA 3M1IA 3ZZ0A 4R7ZA 1YR8A 4AKEA 4P4TA 4IXNA 3QI2A 4JVNA 4NU0A 4B33A 3K0AA 5EJEA 1KK2A 1SKYE 1Z6YA 2ZYVX 2YOHA 3DZ8A 4E5UA 2QQEA 1XEFA 2P3SA 1H65A 4CEHB 2VQSA 3U2QA 3EG5A 4I1SA 1OXUA 2F7SA 1FX0B 4URYR 2KB0A 1CRPA 1E98A 3OIVA 4CGZA 1XXHB 2QL6A 1NVWQ 3KJHA 3DVLA 5TARA 2PX3A 5KSZA 4F4JA 1LFDB 4TLBA 3W3AA 4LOAA 3N5CA 2DFTA 3GFOA 4PZYA 5KPJA 3FOZA 4JBYA 1R5NA 2ZSAA 4RZUA 2ZSEA 1N5KA 1E2EA 3KQHA 3RNLA 1NLZA 2QAJA 4TMKA 1WA5A 5DYIA 1KKMA 3C4JA 4KFUA 3CWQA 5JSZB 4JL6A 1Z6AA 5JS8A 2PLFA 2XITA 4LHWA 1Z0DA 2NMVA 2GEUA 5AWFC 1OPXA 4IOMA 2R6CA 3GFPA 4BFXA 3RRZA 2F3TA 1ZC3A 2IS6A 1C9KA 1OYYA 4O2LA 5IDVA 1AZTA 1KY3A 2VH5R 1S4QA 1W44A 2J7KA 4N1AA 2QM7A 4Q02A 1S1CA 3LBIA 2ORIA 1OB5A 2O0HA 4KI0A 3KKQA 1AGRA 2WWHA 1G7SA 1S9DA 1E79A 1WCV1 3CPEA 3LV8A 4HAXA 4A0HA 1FUKA 1OIVA 4JVSB 2OSBA 2ODNA 2CLCX 3I8XA 4P0TA 1M8PA 2W00A 3JVUA 4ZKDA 3K70D 5SZJA 2F3RA 4BLPA 2BBOA 4DDWA 3O47A 4FMBB 1AS0A 2KE5A 3M6AA 1NG9A 4IVRA 4PPGA 2O8EB 1J90A 4AK9A 3PVSA 3E2IA 3AVXA 4ON9A 4BZXA 3HPQA 4IVQA 4KITB 4MRRA 2GAOA 3UG6A 1T9HA 4O25A 1LF0A 5E3HA 4TSFA 4NONA 3T1TA 1G6HA 2GK6A 2QAGB 3J81k 2FE4A 4ACBA 4HSEA 4LI0A 4V0KA 2C77A 5DISB 1F60A 2VP2A 2Z4SA 2HCJB 1F48A 1VCIA 4JT4A 3O8BA 1UKVY 3IEVA 4Q1EA 3LVRE 1WDTA 4XJXA 2G1KA 1FL9A 1XEWX 2ORWA 1U0LA 2AKYA 3KQLA 2WSSD 2GTPA 1E2KA 3NWJA 1G21E 1KAOA 2ZETA 1Q1EA 2BJWA 2DWOA 4EPRA 4A8JA 1N6NA 4TN1A 4EPXA 5CB6A 4HUQA 4GT1A 1XZQA 4AD8A 1GUAA 4P32A 1E2MA 3MRSA 3TSOA 2X8AA 1YKSA 2Q9CA 5D3MA 3BWDD 1KMQA 2VA8A 1KMHA 2A5GA 3KX2A 1US8B 2ZSDA 1J99A 1COWA 2C9YA 2OT3B 4TYNA 2IS1A 1G4UR 1X1RA 4TT3A 5JECA 2ZRLA 4A4DA 2O8DA 3EAQA 1Y63A 2QP9X 2VSFA 3ZVMA 2DWPA 2QN6A 3RSOA 4OHWA 3A6PC 2GWHA 2RMKA 1N6HA 3BGWA 2ZJ5A 4Q4HB 4NHOA 4BFVA 5GJBA 3I32A 5AUPB 3LAWA 2RGGA 2YOFA 1JEEA 4BRUA 2ZREA 3FKQA 1HTWA 3KZ1E 4M4SA 2ZAOA 2DBYA 3LLMA 2WWYA 1DAEA 2FPKA 3AP2A 4HDCA 4BLRA 1UBCA 5EP1A 4LJ6A 3GJ0A 3I8SA 4PSKA 5FTKA 4TL8A 3HP1A 3DO6A 3TNFA 2J0UB 1EESA 5AJYA 2HDNB 3BS4A 1QVRA 2YJTD 4KVAA 3C7KA 2XAUA 1FMLA 3SS8A 2LKCA 2BJVA 1KNQA 4C0BA 1ZC4A 3B13B 1D6JA 3AVWA 5B64A 1E0KA 4NCHA 3T1QA 1UEIA 2XSZD 2ERYA 2NO1A 2GCOA 1G8PA 1AIPA 1QBKC 2AD1A 2VHUA 3IO5A 3T61A 3ZIAD 3CNLA 5DHAA 3SEAA 5DNYB 3WMGA 1ZD9A 2IEZA 4OQMA 4WAUA 4A6XA 2BEJA 2NPFA 4ZIRA 4QC2A 4QHTA 3NKVA 1TF7A 1C4OA 3MWLA 3BRWD 2P0EA 3BOSA 2Z4RA 2XX3A 4G5RA 1Z47A 2ZUDA 3SZRA 4PC2A 4NZYA 1R4AA 1E6CA 4BFSA 3TK1A 4Z8YA 5TV2A 4PAQA 1F2TB 3PUWA 1KO5A 5H68A 1RRGA 1XD9A 2GBLC 2WICA 3VKHA 2AWOA 4IOKA 3B5JA 2RH5A 2HYIC 2N46A 1EFUA 2QQ0A 1KK1A 4TMVA 1TQ4A 1VYVA 4ITRC 4GP6A 5EQTA 4RZXA 1W4RA 2FU5C 2IXFA 3QF4A 1NVXQ 3C14C 2MSEB 4CT4B 3O8DA 2YWFA 1XPOA 2DFKB 1GILA 5GJWC 3U3RA 1OJLA 3W90A 4C0JA 5AUNB 2FPLA 4Z1MD 2NO6A 3QNUA 1G291 1Q20A 4BFTA 1G5PA 1XCPA 2J7PD 2EVWX 2OV2A 3B9QA 2AWNA 4JJKA 2JIZD 4URUR 1XNJA 3P32A 4HATA 2JLXA 2PCJA 5FOXA 2ZEJA 5DI3A 4RZ2A 3IDQA 4AG5A 4B32A 4NE2A 2CHVA 3B6EA 3IQXA 2Q9AA 1ZJ6A 4WZBE 1FZQA 3AVQA 3RC3A 1VYTA 1Z0AA 2MSCB 4A6PA 1SXJB 2JLQA 1V5WA 2CDNA 4N0EA 1BS1A 3C8UA 1E9BA 3K9GA 1NLFA 3B78A 4J0QA 2RGCA 3SYLA 5JWRA 1TX4B 1P9RA 3DOEA 1W49A 2EFCB 5KDLA 3ADKA 2IL1A 4MRSA 1OE0A 721PA 2EYUA 4DT1A 1WXQA 3OIYA 3EIQA 4B2PA 3CZPA 2ZSBA 2BKEA 4M1KA 3R7WB 4U02A 4XWOA 4RD4A 1S0UA 5CIWA 1DO0A 1KI9A 2G77B 4XVRA 4XSGA 3ZQ6A 5AJVB 5DE3A 3TGPA 2UZIR 4H9GA 2CL7X 1OIWA 1BH2A 1GRRA 2V1XA 3P4XA 2OFWA 4URVR 2NTYC 521PA 2BHRA 5L3QA 3NG1A 1VCOA 1L4UA 3CX8A 1WE2A 3TIFA 4LV6A 1CULC 3B1ZA 4BWYA 2ZYWX 2QGNA 4LJ8A 4D80A 1CF4A 2QAGC 3L2OB 2JCSA 5FUXA 4YONB 4PSVA 2ZPTX 3BORA 4LGMA 4DHEA 2JGNA 4JLMA 2FGKA 1D9ZA 4YDSA 1SVIA 5F3WB 3QXHA 1W4AA 5M04A 4DEYA 4N0DA 3HR7A 3U7GA 1G16A 1CJUC 4I4LA 1E79D 1G18A 1YR9A 3NC1C 3VFDA 3MGCA 1JQLB 5FH9A 3MWJA 1FQKA 5KYKA 4QBFA 3ZD6A 3EASA 4Q66C 1RPZA 2OILA 3Q5DA 3IIKA 3EPHA 2ZXUA 1KIMA 5JJIA 4QNMA 1JPNA 3PEVA 2YOGA 3Q5EA 4GOKA 4XIGS 3SQWA 2PEZA 1I2MA 1OFTA 1UDXA 3K0FB 2FH5B 3CBQA 3L0IB 3WYGA 3TW4A 4P4SB 3U44B 2ZR7A 1WP9A 1JECA 4TSFD 2R2AA 4BLTA 2IX3A 1KDOA 4MDFA 3PUXA 1KJYA 2RB4A 4BLSA 3CONA 1X86B 1RYFA 1U99A 4LYHA 4V0NA 4GDFA 4TMTA 4BLQA 1XJ0A 5LPNA 1QDEA 3PFIA 4DDTA 2GK7A 2OBMA 2QENA 5K8LA 3GLFA 1G8HA 4MDEA 3CF6R 8OHMA 5FR1A 3EWSA 4M9QA 1OF1A 1P3JA 4A2PA 2WKPA 4IDQA 2BWJA 2QM8A 4OHZA 1DEKA 4URZR 5EXPA 1RRCA 3CNOA 3CUEF 2CNWA 2H57A 2CE2X 5CJPA 2C2HA 4QKQA 2AK2A 1E1QA 1MO6A 1IXSB 4PC3A 4OQLA 3UANA 2D4HA 1NRJB 2WJJA 4C3ZA 5AUOB 1Q12A 2FEOA 4JLJA 1MRNA 4AIIA 2VEDA 3A4NA 1KOFA 1TQ6A 1VTKA 2RGDA 1IAQA 3K53A 2ZU6A 1XEXA 1A4RA 3HU3A 2FZLA 3TVTA 4ARZB 4HUTA 2PJRA 2Q9BA 4HAZA 3NHAA 1COWD 1CJTC 3WHKA 3U7FB 3NXSA 1EK0A 2DFNA 2GEDA 3B8HA 4MYHA 4TT3D 1JB1A 1XU4A 3TUIC 4HAUA 3FFBA 3FKSA 4M1MA 4ILEA 4A82A 4XH9B 2QRZA 3B60A 5FUVA 4Q9JA 3L8ZA 4LBYA 3W5JA 5AJZA 2GJ9A 2PZFA 2UZ3A 1T3HA 3LNCA 3KXLA 2A3RA 1D8TA 5FOUA 3LQQA 2XXAA 4JYCA 4JL8A 1T0JB 2Q21A 3ASZA 4LZZA 3KQKA 5FR2A 4C0AC 5IF9A 2ANCA 4Q18A 4DCTA 3K70C 3H84A 2Q6TA 4AY2A 5CM8B 1UBGA 2P67A 2GRJA 1R0XA 2CHGA 3VR3A 2GJ8A 1UPTA 3I61A 4PZZA 3M4YA 3WNBA 3DMDA 4RKFA 2AFIE 1M7HA 4OHVA 3O8CA 2XTMA 4M1WA 4PC1A 1QG4A 2E9SA 4R2HA 5KPDA 3SFVA 2AR7A 1SVLA 1GITA 3NHBA 3KQNA 5EP2A 1N0VC 1PUIA 2QUZA 2W6JA 1QHYA 2OO7A 2XOKA 4JVLA 3IHLA 2QORA 5GJVC 4FMDF 1YZTA 4WIAA 2YKGA 4R9UC 4PO1A 1KI6A 1BMFA 1OXXK 2YWGA 1J70A 2ZUCA 3L43A 2O0JA 1JR3A 3QBTA 4KU4A 2QBYB 2ZUBA 2V9PA 4JL5A 4UQOA 2OG2A 2C9OA 3IILA 5E7IA 4Q4AA 1XDBA 4MH0R 4KSBA 2OFOA 1JR6A 2GJKA 2IC5A 1T8UA 3QVVA 2REXB 1KJZA 1SULA 3AP3A 3QENA 5CYPA 1WF3A 5JMTA 2CCJA 2RGAA 1L8QA 3G5UA 3NTUA 2I1QA 3QIAA 1HH4A 1NLYA 2HLDA 1NI3A 1RJ9B 1SXJC 1CKEA 2JJ1A 3U61B 1ZIOA 3QEOA 3SJAA 4XVUA 3CPJB 2ZRKA 3PUZA 4RFVA 1DPFA 3BH7A 4LY6A 2VO1A 1R10A 1PZNA 1XCMA 4YC7A 2DWQA 5TDHA 2A5YB 3PIRA 1WBBA 4RFSB 3DDCA 5KNDA 5FPKA 4CEJA 5TY0A 2ATXA 3SYKA 4UJ5A 4DWJA 3U3JA 3UKDA 4Q1FA 1YZNA 2YC4C 2FFBA 1KI1A 3KJEA 3PV0A 4QG7A 1CRQA 5EXTA 1GDDA 1ZM9A 2WAXA 2B92A 4YDHB 4KJZA 4B48A 3OZXA 4JLDA 4DLVA 1HYQA 1Z06A 3AKEA 3BIFA 1U9IC 3K9LA 3B1XA 3AVTA 2VHTA 1E1RA 4Y0VA 5KU1A 3ND8A 3QKRA 2ZJYA 5KNBA 2VSXA 3QG1A 1Z6GA 4XTRA 2H16A 2P5SA 1E3MA 1KDPA 2V6JA 2RGNA 1XWIA 1EWRA 4MGYR 3IHWA 1R7RA 1BYIA 3B1VA 4QBIA 2WWXA 5EP3A 1JEDA 1FW6A 3HU2A 3REGA 1NJGA 4GZLA 3BJIC 2IYUA 2QP4A 3AEZA 1SHZA 4JJZA 3THWA 3KB1A 1Z0IA 2J3EA 1XTSA 3SYNA 4V0LA 2ZJOA 1E2LA 2ZI5A 3JZMA 2HXYA 1UKZA 3THYA 2G83A 4JLKA 1F2UA 1MOZA 4NL4H 1XD8A 4Q1DA 3H1TA 1QZXA 3SC3A 1Q57A 4DLTA 4MGKR 1VG8A 5JCZA 3FMOB 3F0TA 4TYWA 4QOSA 4LJ9A 3TR5A 2JEOA 1UFQA 3GEIA 2G0NA 1KK3A 4P4UA 4TTQA 4UNPA 5DO9A 3I5YA 1QHHA 2PZGA 4GOJA 1T6NA 2DHRA 1ZYUA 5FBRB 1YZGA 3NC0C 4D82A 1TU3A 2O8BA 4M0LA 4PSAA 2KJQA 4DSTA 4ZDJA 2BMEA 3GJ4A 2IF0A 4I1OA 1J7KA 3EC1A 3B82A 3UATA 2XZLA 3A1WA 2EFDB 1G20E 1W48A 2EYQA 3JZAA 2HF9A 4QBHA 4US2R 2JLWA 3W5IA 4EJSC 3TH5A 4ABYA 4CRWB 4HZUA 4I1VA 4JLNA 3T06B 3T15A 5FOWA 3R9XA 5FOSA 1R8SA 1TPZA 2LKDA 1ZMXA 4C0KA 3PCRB 3C15C 4TL7A 4Q4JA 1DG1G 4BFUA 4TYYA 1IN6A 2IUUA 2ZRDA 1UF9A 1T0HB 3GEEA 1KZ7B 1OW3B 4AI6A 4FD2A 2VBCA 5SZHB 2D7DA 5H70A 1IHUA 2ZROA 5HZKA 1AQYA 1ETUA 1KZGB 1ZRHA 1P61B 4UNNA 2BCJQ 4NTZA 4MITA 1N6KA 1Z83A 4B76A 3OFNA 2FFHA 2ZI4A 1XJQA 2WJGA 4YMUA 6Q21A 2RGXA 3IBGA 2WJYA 3HYTA 1GP2A 3T34A 2Y8EA 1ZM7A 1DAGA 1KHTA 2CCKA 3B1YA 1M34E 3K0CA 3S1AA 2ODEA 4UKDA 3LVQE 5JJKA 2GDJA 4Q9KA 3Q7QA 3JVVA 5FPYA 1XMSA 4HI0E 1YRBA 1P2UA 5LDDC 1ELOA 1F5NA 3R8CA 3NIBA 2AL7A 2ODBA 1SHKA 4UXIA 2QT0A 3W8RA 3UMRA 4TLCA 2CL0X 4M21A 1E9EA 1Z29A 4HAWA 3SJBA 1KO8A 1Z63A 3AF4A 4FCWA 4U5XA 4EPVA 2VLIA 4EAQA 4LJ5A 4LPSA 4MKHA 2RKOA 2F9LA 3LY5A 4R2IA 5FTJA 1K6MA 2CNWD 1W4CA 1JJ7A 2QSYA 3ADCA 2GJSA 3BERA 1OH5A 1GZSA 2XB2A 4NYJQ 2C78A 4U7DA 2GCPA 2QTHA 1E1QD 5IK2A 3FGNA 3FMFA 4X8LA 2QMHA 2N42A 5L3SA 4V0MA 3X1WA 2ZANA 4KXFB 1A82A 3C41J 1D5CA 4RD3A 4US1R 3L0OA 2O8FA 3EX7C 5K8IA 4EFMA 2GKSA 3KL4A 4GZMA 1W7AA 3VAAA 1E2IA 4JLOA 1KO7A 4QBGB 3BFKA 5J4VA 1IOZA 3GD7A 2AHOA 2QEQA 4MQBA 4NYIQ 1IXRC 2NG1A 4Q4LA 3G82C 5JWHA 4YXWA 4JMPA 1P75A 3FKSD 3ZYCA 1GNQA 1FP6A 1NNEA 3BK7A 1GFIA 1DO2A 5HKKA 3KFVA 4JBWA 2BEKA 3RS2A 1IN4A 4PZLA 1E32A 2F1IA 3CRRA 2IYVA 5FTNA 2FWRA 3SJCA 3GP8A 1KI2A 5FI1B 4DUGA 3U3MA 3QVUA 4C0QC 2HV8A 1SVOA 4ERNA 4Q01A 1E9DA 2NO9A 3VR5A 1NKTA 2QNRA 1FP7A 2IWRA 1LNZA 2P2LA 1XEWY 4BFWA 3QF7A 2GXSA 4WVFA 1MABA 1YQTA 1NBME 4KODA 1P4SA 3PQCA 2GA8A 2OFXA 2ZR0A 1VIYA 3A37A 2ZE7A 3FHOA 4C0HA 1G41A 1TUEA 2FOLA 3L8YA 1H8EA 1NMXA 3MWKA 1NY5A 4JLVA 3IIMA 3WYAA 2A7QA 4IJMA 1Z6TA 2BMFA 2BVNA 4Z51A 2PMDA 4GRAA 1BOFA 1IONA 3WNDA 1EFTA 2W6JD 2A5FA 2OZEA 3C5CA 3FMIA 2XOKD 3KXIA 3TW8B 1QHSA 2VP5A 4Z54A 2NO0A 1VIAA 1VYUA 2YZ2A 2IYZA 2FJUA 1BMFD 2B7BA 1FNMA 3AVUA 3OAAA 1DBSA 1JR3D 2P6NA 3B2EA 1TNDA 5AR1A 4KAXA 1HT1E 3IO3A 4P33A 2G88A 3EZ6A 2FA9A 3ND9A 5EZ5A 5BN5A 1Q1QA 4TLAA 3UIEA 4A8JC 4XWKA 1DELA 2FFQA 3X1ZA 3AM1A 2WV9A 1TADA 2OUKA 3CIOA 4B6EA 1P2TA 3TQCA 3EW9A 5JRJA 2HLDD 1AM4D 1N6OA 4HAYA 3ETLA 2JJ1D 4D4KA 1Z2AA 2R62A 4B44A 2BDTA 1G4AE 4KFRA 4BECA 1K8RA 4NYMR 2OAQ1 4PPNA 4B3FX 4LV8B 2A9KA 3WMEA 2YWEA 2CLDX 4NDZA 1EX6A 4FMCB 3UMFA 1L2TA 1Z28A 4DB4A 4OI0A 3VR1A 5C46F 2VF7A 2ERXA 3QY0A 4N3NA 4LX0A 4TZ0A 3LO5A 3QPWA 1YZLA 3FMPB 1XBTA 1F3OA 4F91B 4DLWA 2OBNA 4MYTA 3Q7PA 4Q21A 3ONWA 2CJWB 3D8BA 2ZJ2A 4M1YA 1FFHA 4OL0A 5BYKA 3QBVA 1JPJA 2QI9C 4RVCA 1E1RD 3WBKA 1ESMA 4V02A 4R98A 5EE0A 3EARA 3VX3A 2WKQA 4DB2A 2GVDC 4B3BA 5G3ZA 5C1BA 1XF9A 1XXHE 2QP3A 3GLHB 3KJIA 1CR1A 2ZI6A 4HB2A 2WAYA 3AF0A 3U3KA 1MO5A 4DIDA 3NBXX 1FPMA 3FYHA 2AX4A 4EFNA 4W7SA 1EX7A 2G3YA 2G0TA 3A1VA 2XZOA 1OFUX 2I4IA 2ASEA 2PCLA 5LB4A 3RRMA 4LJAA 2F6RA 1T91A 2QG6A 2WBLC 4B73A 1Z0KA 1XTQA 3V9PA 3ICEA 2R65A 1XFAA 1GWNA 1EWQA 2DY1A 4H1VA 2XXAB 2F43B 2IYTA 3UK6A 1EGAA 4ZCLA 1JAIA 3THXB 5G53C 3SU8A 3ZVNA 3ZZTA 3W9YA 4JT2A 4A1FA 2QMEA 3D6TB 1E4VA 3A4LA 2ZIAA 1W47A 2P5TB 1AKEA 2KWIA 3E1SA 2R8RA 1UAAA 1E2QA 2AN9A 4PQYA 2QSZA 3A58B 1GOTA 1Y3AA 1XX6A 4LYJA 1YU9A 2QRNA 1CIPA 1NBMA 4GMDA 3CX6A 4OI1A 2YHSA 1T8TA 2OHFA 2PH1A 4QRHA 3WRXC 1LB1B 2QROA 2XJ9A 5F2EA 1F6BA 3FHTA 1OXSC 4TQUS 3P26A 3CWZA 1WB9A 2RHMA 1E94E 1YZQA 4B2LA 1GM5A 3K70B 1CP2A 4H1UA 2O8CB 1Q21A 3NBZC 1Q44A 3BFXA 1S2MA 4PTLA 4EQ6A 2J0VA 1XPRA 2CVFA 4BPBA 2B6HA 4M22A 4LYFA 1W0KA 2WMOB 5DI9A 4ZCIA 4ASUA 2C5LA 1OT3A 4MGIR 4C7OA 2R9VA 1UKYA 3MJHA 3OFND 1GKUB 4JS0A 3W8NA 3B85A 5HCIA 2QPTA 2X2EA 2WSMA 2OCYC 2WOOA 3I1FA 1ZD8A 5BW8A 4OQXA 2CVHA 4GSYA 4PQFA 3CB4A 1OXVA 3I5XA 3O8RA 1R0WA 2JASA 3FE2A 1NVVR 4LBVA 4UNQA 5JI2E 4G5GA 3BXZA 4IKEA 3NEYA 2V54A 3PITA 1ZNXA 2GF9A 4F7WA 4DKXA 3LH5A 2ZRBA 3K1JA 2X19A 4NBSA 1X3SA 4DC9A 3GJ7A 1RE0A 2KBEA 3A1SA 4TTRA 3DHWC 5IHPA 1A2KC 3BE4A 2V55B 2W2VA 1HY3A 3ASYA 1ZU4A 3VR4A 5LBIA 2GJAA 5EUMA 3RRYA 3TKLA 3VU9A 3VMFA 3W6NA 4DIEA 5IK2D 1IN7A 1G3RA 3KTAB 1ZNWA 2YC2C 3DKVA 1Q0UA 1G19A 1M2OB 1NL3A 3RS5A 5L3VA 2J0SA 3I62A 1KTVA 1NSTA 4M1SA 5JJLA 1R0ZA 1NN1A 3GJ5A 1GSIA 4WZ6A 3X1DA 2FN4A 3BD9A 4IEEA 4KYUA 2WWGA 2IYSA 4CEHA 4TMWA 5J4KA 4W9MC 1FX0A 3E70C 2GILA 1SGWA 4YXWD 5GVRA 3ZH9B 2RHDA 2KBFA 1M6NA 3GLGB 2H7VA 4E22A 5HKKD 4PPQA 1RRFA 1QHIA 1SKQA 4MUBA 5KUTA 1NN0A 3THWB 4OK3A 2HCBA 3OESA 2BM0A 4DSUA 1N25A 4RY2A 4DUGD 1U0HC 1PJRA 2KI5A 2BOVA 2CEAA 3THYB 1LS6A 5JSZA 2GZAA 4RD1A 2A5DA 4Q7JB 4NCNA 4G5OA 2Q0HA 2WKRA 1WRBA 2ZI3A 3AGPA 4LC1A 3EPKA 1QHHB 1U0JA 1HQYE 4LJYA 5AJWA 4YMSA 3OEHA 4DDVA 4A36A 2CXXA 4NMMA 1H8ED 2EW1A 4DEXA 2JATA 4PHTA 2X2FA 5AK0A 3ECCA 3EWAA 5KTYA 4HB0A 2PEYA 2RCNA 3A36A 4IFBA 3QKTA 4LYAA 3TAUA 3WXMA 2Q3HA 2ZVPX 4BZPA 1S3SA 5JHGB 4UXJA 4HDOB 5DN6A 3AKYA 2P6UA 3KJGA 1VKJA 4Q4JB 5JRZA 4OI4A 1HQCA 2XGJA 1DG3A 1M7GA 3OAAD 1G3UA 2C04A 4Q1AA 2EWVA 5J4YA 4D6PA 1I4DD 2O8EA 4C9BA 1MRSA 1R2QA 1O3YA 1SVMA 5FL7A 4AYWA 1E69A 1IJEA 1PLLA 4EJSB 1OKKA 4LHZA 3CRW1 1LVGA 3GLIB 1MH1A 1AA9A 4QGHA 1JXOA 5KO2A 4TL9A 4A2WA 2IYRA 1W5SA 2GXQA 4OK6A 5G3YA 3T1OA 1ZW6A 4D4MA 2P6RA 2HUPA 2HJVA 2ATVA 2OCPA 2YV5A 2ZVQX 4QFMA 2REOA 2NPIA 2XJ4A 4O0MA 3ZS9A 5J40A 3ICQB 5HPYB 2WTUA 4IEIA 4DRZA 3VR2A 1XTJA 3EZFA 3AF3A 1PVOA 3QKSA 1Z22A 2XZPA 2OLJA 4CIDA 4YMVA 5KSOA
chains in the Genus database with same CATH superfamily
1AZSC 3S81A 3GFRA 4LX8A 4R8RA 3HZZA 4Y7DA 4EP1A 1BDHA 3G2MA 2ZYHA 4FW9A 1HT3A 4CLXA 5JMPA 2HMAA 1BQEA 5FA8A 5JPCA 3OHPA 4N7MA 2C95A 5JPDA 4AJPA 4Q9HA 1JHAA 2VJPA 2F3QA 2LPMA 1UFRA 4EPYA 4B3SB 4R7GA 4TRMA 1I13A 4KQIA 2VRNA 1H2HA 3DHYA 3IVMA 1Z7BA 4YRQA 3TUJC 4WZBA 5LZ8A 1OU4A 4BXOB 5CX4A 1TCBA 2GPTA 1KDRA 1PYOA 3K0AB 3OZUA 1ODFA 2HRDA 2L42A 2DRIA 5AM3A 1US8A 4GD3Q 4LEIA 5AVUA 1ML3A 3U7HB 1Y1RA 2H7YA 4G26A 1TOAA 3ZGXA 1WMSA 3OSUA 1RIFA 2WIAA 4Z4QA 1SEVA 3T3IA 2CDAA 1JBKA 4AYTA 3DYBA 3F2VA 4LTNA 2V6MA 4WOPA 3SE7A 1AV6A 3TOZA 2P3OA 2ZVDA 3ICVA 1O95D 1ISHA 5IAKA 2XUFA 2IHKA 3NBFA 3FA2A 1SBCA 2LCIA 2RK4A 4PYMA 3TJRA 3G0CA 2JJMA 1YR2A 4Q00A 4CM3A 3RQIA 5F9MA 1R4NB 2ZCJA 4FT2A 3QSYA 2C9MA 3AXTA 4BIIA 4O6VA 2JFBA 5DBFA 3GVIA 1TLTA 2WD7A 1GEEA 1PT7A 1OX6A 3GAAA 5FLYA 1U3VA 2WG0A 1GG2A 1NF3A 3A26A 3F3YA 3TG2A 1NG1A 2RGYA 3B7GA 1T4CA 3DMHA 3SLGA 2Y1LA 3SQLA 4EPTA 1I3NA 2HT6A 3K0KA 3QEMA 1PR2A 2OMKA 1W88B 4I4TF 3ZWQA 2PT5A 3O2SB 4UXHA 5C2JB 1XZPA 2I6FA 4JELA 1SU6A 1VG9B 2PFSA 5AI5A 4RVDA 3B6KA 1P0FA 3JCZA 3TZEA 1AKQA 2YIMA 4RPCA 2FFAA 4DLXA 2ZM5A 4MJXA 3C6BA 4IJVA 3W5SA 4GPBA 3PUJA 4RSRA 2C8KA 4WJKB 5IAEA 4MWZA 3HVUA 3JWGA 4EO9A 5C1DA 3IBYA 5C8ZA 5KKAA 2YZNA 1F4LA 1U2SA 5AUQA 4DRXA 5A71A 1AUXA 1BW9A 1H6DA 3RVSA 3ASUA 1U3DA 4G56A 3ZW9A 3FNEA 1C1XA 2FUEA 4C04A 5LOVF 3KC2A 3WWPA 3KAQA 2HCFA 4E15A 5KTRA 4CW7A 3ZWMA 3H42B 2LWIA 2JFUA 5IW8A 1T8WA 1FEZA 2Z08A 3EPRA 2EQAA 1V16A 3G2KA 3IB6A 3AERA 3QWBA 2HIMA 4JASB 2HO4A 3JX9A 4XM0A 2BYTA 3U4HA 3DFIA 3RAPR 4Y6RA 3DCIA 2IE8A 2ZAYA 3LYLA 5E1OA 3DVQX 1XA3A 2WW8A 3GGDA 1DQRA 5KTPA 4DJDC 3RS9A 4CL8A 1E64A 1G66A 5CYGA 2ZUWA 2PX5A 3JD3A 5IRCD 4F92B 4RTJA 1JMKC 1VGVA 3GCXA 3S29A 4D9GA 3GLIE 4IOLA 4MIYA 3K1AA 1CETA 2P90A 3HXLA 1DJQA 3DOHA 3PFFA 2OSVA 4BB5A 3CVUA 2IF2A 2YVQA 4YP9A 2REQB 3E0XA 1BA2A 4QQFA 4CMHA 4X1KA 2QJWA 3A6JA 1TMOA 2BMVA 1Z08A 5LZ7A 1L0BA 2I2WA 3NVDA 4MV6A 4CMEA 3OLYA 4X65B 1CRWG 2RGNC 1EP1B 2IIPA 3GH3A 1W36D 4LRYA 3NM5A 2GNOA 5KJ6A 2PS3A 1FVHA 2VAXA 5FPQA 4LMAA 3U40A 5DF1A 1QF6A 5EPUA 5HQ3A 3PEUA 5FWDA 3VYRB 4C0XA 3NBMA 2FMKA 1DVRA 4I3GA 1CLUA 2ZIWB 1JP7A 3GIWA 2X0FA 2NSLA 4L8YA 3U3DA 1G5IA 2PX8A 4ZWNA 1T8RA 4DW8A 3V1UA 3LC7O 1H3EA 4H4DA 2VDWA 5FUYA 1L9XA 4PAWA 2FUG1 1U1FA 1JILA 5KCMA 2G17A 1U7XA 4XIFA 1OZGA 1QPGA 2CXTA 2FTKE 2PANA 2HF2A 1VRCA 3VYSB 4D3YA 2DX7A 1LY1A 1UXIA 4ZXPA 3LBHA 2AMFA 1XZEA 2FR0A 4K0RA 4L6CA 4NZOA 3X1XA 1N1GA 5EFZA 3FB4A 4P6VF 2Z8YA 2BC9A 1VI5A 1P1JA 2C29D 1XVTA 3HTXA 2Q1WA 1I3KA 5TGZA 1Q7EA 1HMYA 2GN8A 1Z5ZA 4X1OA 2XVZA 4JJIA 2OK7A 3DEJA 3DDUA 3SJ7A 1GPLA 1H2BA 3O93A 1KI4A 2VHJA 2OM2A 4U3JA 2JLBA 2FWMX 4QTTB 3ZLJA 4Y30A 4AMVA 3QFHA 5GOZA 1VP9A 1GZ5A 2AZXA 2CNBA 4IZIA 2X9NA 4JITA 3KHTA 3FNGA 1QV6A 1X7XA 3L1VA 4GYYA 5IBCA 3CLKA 1UODA 3IAUA 4KIWA 2ZRFA 1Q15A 4QOHA 4RC9A 4W1PA 4D43A 4HMPA 1KY5A 5IM5A 1VPLA 2DYKA 4CFSA 2AUTA 2RHRA 3I9FA 2NTNA 1E3WB 5DX0A 3QKWA 4YMWA 3DWEX 2WZCA 3UICA 2XRMA 4ACAA 1TO6A 1OGIA 2DZDA 1VPDA 4JWTA 3U1TA 4YRIA 1XMIA 4D44A 1FSGA 2W8BB 4HWSA 5A5GA 1X1BA 2GZSA 3K9HA 2J3HA 3WDLA 3U6KA 3T38A 5J4LA 5KWEA 1BE0A 3KOUA 4PYIA 3T12A 3QE9Y 3OQHA 3GEMA 4WKPA 3OEHD 2QR2A 4KDFA 3QG5A 5KYVA 4OM8A 4S1NA 3QJYA 4DMFA 4BUZA 5CDTA 5I45A 3WLSA 1GADO 2D54A 2PO7A 1C80A 1P0PA 4HY3A 2P9BA 1VKHA 3HDGA 2PMFA 4GKAA 3K2IA 3K8ZA 1M0SA 5ILGA 4FC6A 5L6MB 2QVBA 2YBDA 3GY0A 4DY6A 3E7WA 3AVVA 3PUKA 3SYMA 1K8ZB 3DOFA 1RACA 3ZDRA 4QM6A 1TYAE 2XTNA 2VP0A 1S7CA 5DRTA 2FDXA 1KNXA 2BHNA 1IJFA 5L3ZA 4DLRA 1SELA 1U6KA 4W8OA 1U7TA 2O0LA 1CP3A 4EFDA 4EQZA 3IDFA 2WWFA 4O59O 5FL7D 4QVGA 2BCGY 3PLNA 1JEOA 1P5JA 4WACA 5IT0A 1I01A 2BEWB 2V9ZA 3DMNA 3ET4A 4FONA 4X20A 5KYTA 1O87A 2OECA 3RK0A 2YMMA 5K9ZA 2IY7A 3DZBA 3G7NA 3HA5A 3OOEA 5KC9A 3D54D 2PLNA 3RKUA 1ODCA 3CH4B 1R6DA 3NALA 2OHVA 2TMKA 1QHXA 1BQ4A 2AS0A 3ADOA 1RZUA 1QHFA 4HLDA 4F84A 5I7EA 3UCFA 3P5BA 1R5OA 1FP4B 4RETA 2AXQA 1QANA 2JIMA 1GVNB 2DEUA 1P7WA 4WBNA 4REOA 4BNZA 3FPCA 2O2ZA 4RQUA 4TTSA 3VR2D 2HUNA 4PINA 3ORFA 3H3XA 4Q19A 1FXWA 3FPEA 4GFDA 1LLDA 3PWKA 5EIAA 2Q62A 3L92A 3VC7A 2VG8A 3HL0A 3BE5A 3L4KA 4JBNA 4ZVNA 4F3KA 4JBIA 4YWJA 3PUYA 5CXSA 2GVZC 3H5LA 4CKBB 1L6IA 4J0IA 5JBIA 1VJTA 1QP7A 1HE1C 1NVUQ 3EVDA 3VM6A 1EB8A 4GYJA 2XYGA 3RIMA 4GMXA 3H5VA 3BXGA 4YRFA 3ZV6A 1DQNA 4UZEA 1Z6QA 1GGJA 4F2GA 1YFJA 4EUNA 4DEVA 1WPRA 3ZWCA 1W75A 2ZWIA 4AY2A 1IUOA 4TV8B 3PFNA 1CTQA 5CITA 2C7QA 4EJ6A 3N0XA 3ESQA 3I72A 1ZIDA 2J9ZB 2O3UA 2PQMA 4OU5A 5JS7A 1D8AA 5FOVA 1E63A 4BOYA 3L7NA 1MB4A 4CTKA 1RHUA 3N2GA 1BXGA 3IUSA 3NH9A 3RHSA 1BO6A 1B23P 1YKGA 3DLPX 1EXDA 1CQZA 1USVA 5DWVA 4ZK6A 1OC2A 4OSOA 1VQ1A 3NYRA 5C3MA 3DOJA 4RDCA 2QD5A 4BKPA 5KQLA 3RF7A 2ZI9A 4O1IA 1PNOA 4B75A 4BRWA 2C3UA 2PZ8A 3H5OA 3Q3VA 4IOJA 1LQTA 4N9WA 2FE1A 3RHZA 4HOYA 4R0MA 3RH0A 1ZK4A 3EA4A 3ZBPA 4BNWA 3PENA 1QH9A 1BGXT 1C30A 1LSJA 3BB3A 3PJFA 3Q9UA 2AXPA 2ID7A 1OGYA 4WFQA 2LUOA 1DQYA 2JAOA 4AURA 1QGAA 3EOZA 2OP1A 3WC4A 4Q3EA 2XQVA 2A78A 2WHXA 2P4QA 3DDWA 2NUPB 1L7VC 3EGIA 4E3WA 5H16A 1XROA 1XMVA 2MSNA 4C43A 4B8YA 4CV1A 3PYMA 3TGLA 3COYA 3C45A 4G0MA 3DPIA 3GV0A 5E2AA 2VT2A 5A0TA 1JG6A 4KBFA 4NU8X 4GX5A 5IXJA 1DMRA 1HDGO 1XZKA 3NHJA 5FBLB 3LP6A 1GTZA 1T6XA 2XTZA 4GI1A 3DTTA 4O33A 1H8HA 2VHEA 4ALKA 5A0VA 4G89A 1ZNQO 3TSZA 3VR6D 1SCUB 1SMKA 3ESCA 3QFSA 2Y67A 2BHSA 1PS8A 2ZE5A 3JAKB 4W8GA 1YF3A 1UUFA 4G0WA 2QN8A 1E6LA 3WTBA 1ESEA 2YYZA 4DYHA 1ESDA 1Z33A 3HR8A 4L57A 1U2RA 1FTGA 1P5HA 3UJPA 2WMNB 1Z0UA 3EXHA 5FQNA 1QS0A 4MYUA 2XNJA 4MWOA 2XKJE 2R7MA 4QJ5A 2O7RA 5IAJA 1JWAB 3ZOZA 3DBLA 4HTAA 2B78A 5AK3A 4NWIA 3RVOA 3E22B 3H8WA 4N3CA 2AHRA 3WMWA 1PD1A 3AKCA 3P7MA 1Y6RA 4A8PA 1PR1A 3HVRA 1CZHA 3OOSA 1KQNA 3R7DA 1U8AA 1UMBB 3D8UA 5A5FA 4HDAA 4HZGA 3QUTA 2X4IA 1V6SA 4G4SP 4N5HX 2CZCA 5T41A 1SHLA 1MOSA 2TRSB 1ZD1A 4JI4B 2QQGA 1DHRA 1CZUA 4P84A 1R6UA 5FWXA 5FWYA 3UJAA 1J1UA 3DDZX 3RFVA 1VZ3A 3EXFB 1O1YA 4OEHA 1ECLA 1QK5A 5DNWA 4FEGA 4F8YA 5JYDA 4RULA 1P1BA 5AW4A 4F1KA 3VKWA 1GXSA 4UD2A 2KLHA 2ZDQA 4C2TA 2JDID 5KSPA 1GDTA 2PGXA 4MWTA 3G02A 5JCXA 4KXXA 1IY9A 3FM9A 3PF8A 4BC0A 4ZDKA 1TC2A 4D2IA 3FLEA 1RAGA 5DLQC 3AM4A 5FNZA 4YV2A 5E1MA 3IPYA 5CVDA 4X60A 2XCIA 3WYNA 3OU7A 4JENA 4HH4A 4HN9A 5AHXA 4UHHA 4Y8VA 2PZJA 4PV7A 3QBDA 4L0CA 3U7RA 5HWSA 1Z8HA 2HZBA 2OYSA 1UMDB 3ABIA 4IUCS 5M3BA 3UW1A 4WUVA 4K9DA 2DH6A 3EWNA 5GONF 1IG0A 1HT2E 2QUIA 1ZU5A 4JJ7A 3R3UA 3VVCA 5HR5A 4F6CA 1Z5UA 2W70A 1MT0A 3ZZ1A 4C07A 2XIJA 5FJIA 1PT9A 4EA6A 1FX1A 1SZPA 2AYYA 4MV0A 2QLBA 4LZAA 1RWBA 5DN9A 1WJGA 2NU6A 3P20A 3LQ4A 4EHJA 1DS6A 5UKDA 3HZOA 4IUYA 1I4WA 421PA 1ADJA 4REQA 1C1YA 5AKJA 2PRIA 3PUVA 1Z8FA 5DTIA 2IUSA 2B8WA 4MGZR 3SHVA 1BYUA 2HQOA 3OVMA 3JR7A 4INZA 3VOTA 4RYLA 2JIOA 1D2NA 1EQUA 2QLTA 2XXJA 3EDYA 4KKVA 4OJKA 4RKQA 4QUDA 2FSPA 4YJGB 4TPKA 3SQXA 3R0XA 2J6HA 4RZSA 2ZJ6A 2F9FA 2J0QA 4GPEA 4M9SA 3T0IA 4TTTS 2I1VB 4JXKA 4AKIA 2WNHA 2N1BA 4BS9A 5B3JC 5IJ0A 3OJOA 5IM4A 1YJAA 4Q3AA 3U80A 2W2TA 4MKFA 3HEBA 5F35A 3QXGA 4MHSA 3PGVA 1OJ7A 2BEVB 1TYBE 2I6SA 3JPWA 4TS4A 5ALJA 3AR4A 3WQHA 1DEOA 5BP7A 5AYVA 3N70A 2F1OA 3VAYA 3O7WA 2G25A 4PCUA 1ZIPA 2X2PA 3F49S 1QYIA 3HB5X 4QXQA 3VHXA 4AY5A 1RXSA 5CFQA 2BW0A 2NZ8A 3G23A 1CF9A 1JYEA 1Q0ZA 3OZSA 3FKJA 3PGXA 5FUWA 3VO1A 4AUEA 3EY9A 2JGJA 2Y0BA 4IW3B 4ZVKA 3JRWA 3S2YA 1U04A 3MJTA 3VR6H 3X1YA 4D9JA 1A8IA 5T6MA 2PGLA 3X1KA 3DLCA 2A14A 5AKIA 4UE2A 5FLKA 4JSTA 5DSZA 5J5CA 1BXRA 1Z5NA 4NBVA 4YT5A 5A9SA 4K1LA 2AA3A 3KXDA 4KO3S 1LJ8A 3KKMA 3L7JA 4Q4AB 1NRIA 2R6DA 3L8GA 2QIPA 3ZX4A 1Q1ZA 3QNWA 3RHFA 3F5QA 4MCIA 1TCUA 1T1RA 2D5IA 2C5HA 3GFTA 3LCCA 4PXSA 1SUSA 2W6ID 1NSFA 2Q4DA 1Y82A 4LSZA 1DIOB 1QG6A 4I3HA 2J4FA 2PFGA 2KM1A 3QLVA 4H3KB 4AZVA 3RYCA 4QUEA 5K3FB 2V6FA 4NYMQ 2RARA 3FTEA 3NT2A 3KWMA 3RC8A 3X2SA 2EARA 4DJ5X 1Q92A 1A7KA 3PDIA 4FCCA 4ME6A 5C18A 2GF0A 1J7JA 2HMUA 4QQ8A 2ZUSA 1DI0A 3K1AB 3OQIA 2BMJA 3LUJA 3OE1A 3BH6A 4IJ6A 4L8FA 3NC4A 4MKGA 3TEFA 1UZUA 1MO2A 1TL7C 4NENB 4JI5B 1AO0A 5LYJA 2CMGA 621PA 3A0RB 1G8FA 1I8TA 1LW6E 3E05A 4CEJB 4K2HA 1VMEA 2HADA 4CQLB 6ADHA 3KEFA 1K9SA 2O52A 3HRIA 4TUYF 1ESNA 4BGDA 1FU7A 3T1QA 3ZHOA 1QRUA 2PH5A 2HSEA 2IK8A 2GBLA 4WESB 2CW5A 3ZWOA 2VK4A 3L7MA 3FHLA 3ILVA 4HDMB 4BE9A 2GYVA 3WWYA 1QRTA 3A1FA 5TS2A 4CF6A 1DFGA 1VDZA 5CDGA 2H8KA 4MS3B 4JR2A 4Z4EA 3PXAA 1DCKA 1JALA 2H1IA 3FHJA 4U9UA 5IBQA 2PVPA 3EXG2 3QWFA 4RBNA 5FPTA 4HNVA 1DJMA 2FDCA 3QSGA 4HWTA 4KRGA 4EHFA 4K81B 4ER7A 4NBNA 3I5UA 1BDBA 4B3CA 4GKJB 1JHOA 4X54A 3B89A 2C8VA 1XXHA 2GPBA 1DP4A 1LBHA 2ZS9A 4A0RA 3PX7A 1IM2A 1DX4A 1JG4A 3JTMA 1QP8A 1SOWA 2V9CA 2IYPA 3E7DA 1GT6A 1N0WA 1W59A 2Q0QA 3OA2A 4F4CA 5JH7F 1CEXA 2B7CA 2I4TA 1LGYA 2O2GA 2CHEA 1PNTA 2BBWA 1CR0A 3LDHA 3N0VA 1H1LB 4JIMA 1DJPA 3R6DA 1XVVA 3AUXA 4DIUA 1BS9A 2OBLA 1AN9A 4TXJA 3CA8A 1KMMA 3T0FA 2WJIA 4UEOA 1KVUA 3TQFA 2WMDA 5EJMA 2QPOA 3MF4A 1QLHA 1X7XB 1HWYA 1HLDA 1NQTA 1XZIA 1YR3A 3KZMA 2TS1A 2B98A 2VAMA 3DTVA 3N2IA 1ORTA 2NZJA 4NAVA 3E9CA 1MBZA 4TKUB 2YJ3A 5DOVA 3OC6A 4EUEA 3NAMA 2BMDA 3AJ8A 4UTZA 4CL3A 3WHIA 2W2QA 4CZ2A 4BVAA 3QELB 2XMGA 2ZJAA 4PG6A 5AT1A 4BVGA 4TMYA 4EX7A 1EX1A 5HE8A 4WOKA 1X7WB 3UMYA 1RXIA 4MWDA 3N8IA 4D9HA 1UT8A 3C3YA 1NYQA 3CM0A 4FTWA 3HFRA 4FR0A 1MAWA 1YE8A 1X7DA 2JHGA 1DBIA 3ZHYA 3W3ZB 3S70A 3SNHA 3CW2A 4HZUB 3EGOA 3R9XB 2R8EA 3EIXA 2RD2A 4EYSA 2CB9A 3KKNA 3Q87B 4FFBB 1KJ8A 2Y6VA 2D3TA 3AY3A 2I2XB 4IS2A 4KQKA 4KYIB 4M8LA 5BYBA 2PKRA 1NMYA 1Y9JA 2HRQA 4GNRA 1V1MA 3IA7A 4S1TA 5EHZA 3PQ3A 5JFOA 4F3TA 1VPWA 2W90A 5KNLA 1QQBA 3TW8A 1AKYA 3PR1A 3OOWA 5EWJB 5K51A 5DCYA 8ATCA 3NJ4A 3OOHA 4JLWA 3OZFA 3ROZA 1FE8A 2DFLA 2G67A 3CNQS 1ZAYA 1XV5A 3VHLB 4PG8A 4IIBA 2X14A 3GWGA 2UVPB 4KR6A 4XGRA 4DXAA 4HQ6A 3V7NA 4JBXA 2Q5FA 4Q7LA 1QAOA 3H4IA 2SCUB 3PPIA 3H19A 4A0GA 1Z07A 2YHUA 3AJEA 4BWFB 1MVLA 3DXZA 3RWBA 5KQRA 2CK3D 5B1EA 1P2GA 3V8BA 2PZEA 2BFCB 2ILVA 4PAOA 1V6CA 2OLKA 3DT9A 3I3OA 5HMMA 1L5KA 1EG2A 3WMFA 1NJ1A 4C7BA 5BRJA 2ZUVA 4LC0A 2EHJA 3LI2A 1U94A 2WSIA 1I1OA 2C9BA 2VUHB 3PX3A 4HH0A 2C88A 5I8WA 3RYFB 2FKNA 3Q3JB 9GPBA 4G5HA 3V1NA 5TXGA 1PX2A 4BMXA 1ZOOA 1ZXLA 4C3OB 5DX8A 4OQDA 4I8DA 3TRFA 3VZRA 4M2LA 1AKUA 1JU9A 2JIQA 3ZNNA 4CBVA 3C7TA 3IE0A 1W4BA 1X8XA 2GAFA 3B1KA 3ICPA 2PXXA 5I51A 2Y1CA 2EOAA 1HUQA 1NNSA 1YR1A 4YRCA 4EY5A 4AZ3B 1U2GC 4R2MA 1PKEA 1F12A 5HIIA 4DZZA 4O3MA 3OTGA 3IEPA 2Y1OA 2NZVG 5HS6A 3J80A 2Q4BA 1IHYA 1HDCA 1QUEA 2FXVA 2XNDA 4GLBA 2R47A 4DCCA 4BO8A 3V4OA 4K9RA 4ZKEA 3RC1A 4BDSA 2ZJBA 1V96A 3DAOA 2ZAMA 2CJWA 1A5ZA 3ENVA 3F98A 3MJRA 3RABA 3UHPA 4D9EA 1KS2A 1VOTA 3LL7A 3LUBA 1Y5IA 5PGMA 3ZLUA 2A0UA 3QMPA 2CF6A 1IM8A 2CLKB 4KGZA 3MMNA 4YUYA 5E4JA 1RLMA 1G3MA 1WY5A 1ZUNB 4QUHA 3TIGA 4DDKA 2HWXA 4ETNA 3WNCA 1LZLA 3SHFA 4BNDA 3CR7A 1WM1A 3CNEA 3O0TA 5FI0B 1HNNA 1O8BA 3JQ8A 4QXMA 3C0KA 3W1VA 3TQIA 4BP9A 5K0GA 1J5EB 1DDGA 1SY7A 1UZNA 2H29A 4IV8A 4U1RA 2GLXA 1DMSA 2ZWPA 5DHFA 3SM3A 4N39A 1E2PA 3EG9A 4XUEA 3HUTA 5IXYA 2W6PA 2OXRA 4JI7B 2W48A 5IP5A 3FSRA 3DSRA 5DYWA 1RPJA 3G0OA 3EZ2A 3KAJA 5E3IA 4G0NA 2B1QA 2B94A 1N1EA 1SCBA 5JD3A 3WG9A 4FD3A 1L4YA 5HIMA 3ZE6A 3R9IA 4X9XA 4XDGA 1HDZA 2FPIB 2J67A 1NSYA 4Z4CA 2H3EA 2F43A 3QA3E 3HCBA 4HR7A 3BWYA 3THXA 3LW8A 1F1BA 2HQRA 1XJ5A 4XOIA 1JAHA 1T8SA 1P81A 3MVEA 4Z9FA 5EG5A 1TEVA 1U1IA 1K3FA 1EUDA 1ONBA 3ADPA 4DSOA 5CNIA 1RXYA 1RR6A 4QOIA 1OI4A 3H5TA 2D2FA 1PTKA 2NM0A 2X8JB 1W5AA 1WMAA 3FFXA 3JARB 1DBWA 1TC1A 3TZQA 2I55A 3NM6B 3MYYA 2G28A 1NRXA 1TCAA 4WUTA 2EW2A 4GBMA 3L5KA 3VYWA 2AKAB 4FZRA 3RV4A 4CKWA 3IPXA 1ZJYA 1NQOA 2R5WA 3K5WA 4GICA 5JO0A 3F6SA 5G1OA 5KQGA 3PZBA 2BFDB 3GN1A 2B25A 4TZ6A 1H1DA 2OK8A 2P4HX 1OPRA 1K92A 1TPYA 2ADOA 4UHBA 2HJGA 3U48A 2O8CA 1WV0A 1U9ZA 1PVDA 1U7UA 4IXTA 2EDAA 3DBHA 3QKUA 1IIBA 1G8GA 5EWLB 4QYTA 2DU8A 4KLZA 1AF7A 1AB5A 1XU9A 2CHUA 4ZJPA 2H4YA 3UB2A 3PEYA 3I0NA 4DA8A 1D4ZA 1CNMA 4L02A 5HJ7A 1QS0B 4BEBA 2IUFA 5D3QA 2YXNA 3OCVA 1JYSA 4O2AB 2NU9B 5IVPA 5EGNA 1QAMA 1N2XA 5HW0A 1YZUA 3MUFA 1LDGA 1C9EA 2WJWA 1PR3A 3CHYA 2CF5A 3ZEAA 4BU0A 2CHQA 4P4NA 3D6NB 4I3FA 3VKVA 3NP7A 4CR6A 3CKLA 1Q22A 1NP3A 3UPTA 1JDBC 4GP9A 1K66A 1NDUA 3HSKA 4XPIA 4BHTA 5FWXB 3WL4A 5FWYB 4UQLA 2I71A 3DNMA 1LPMA 4HGPA 1UJ4A 2WSSA 3U37A 5B7QA 1QRDA 1SXGA 2Y27A 3TJMA 2BBTA 1A7UA 1UBMS 5EP4A 1L7XA 1NYTA 1GXSB 1N2OA 1GPDG 4JU8A 1TM5E 4WN9B 3AFOA 1VCNA 3NANA 3DZCA 3T1HB 2OGWA 3N0RA 2VPIA 4IG9A 2DB3A 4W1QA 5EKTA 3VJLA 4Y9SA 2Q50A 3DAPA 1KYIA 1N8TA 2OR3A 3BTVA 1I33A 1SXJA 1CG6A 1QKJA 2ZYTX 4YJ2F 1YHNA 2J09A 3EVFA 3PXXA 4NFHA 1JHXA 1QFXA 4FOLA 2GBCA 2H4XA 2R8BA 4BB6A 2PBZA 2Q8QA 4KXNA 4OK5A 4ZI7F 4IBOA 4MW9A 3VPDA 1XZMA 1V7QA 2C5BA 1IVYA 5F7ZA 4YT4A 2FPGA 3D59A 1GYPA 2ZRHA 1PS9A 1PV4A 2ST1A 5DIFA 4DQLA 1JHRA 2DSTA 2WNIA 5JJCA 4U00A 4G5YA 3D1JA 3PDHA 4FU0A 3DE3X 3QWIA 2DOKA 4UCQA 1SA0A 4MRPA 2WJ4A 1JLLA 2MDTA 3GJ8A 2UZ1A 5KYUB 2W58A 4NYIR 5K8UA 1ZD2P 1T0UA 2QL5A 5KQPA 2B8NA 3G0GA 2H9IA 3GJSA 4G41A 1BC5A 3FUCA 3I8OA 1P1FA 1AUPA 4DANA 2QTTA 3RJ9A 3EDMA 3I53A 1FY2A 2AE1A 5CVUA 5CDSA 1N2CA 1EJBA 1TJ4A 4S1VA 1FP2A 4CCWA 1L1QA 4WCVA 3ZWDA 4XE5A 2J41A 3SBOA 5DLYA 4UE6A 1E2FA 1ONSA 5FPHA 4HVTA 4Q9NA 3T5BA 1JBEA 3ZS8A 4B3MB 2UXBB 3A2LA 1TU4A 2EU8A 3FWPA 5DW3A 2QS9A 5A06A 2QTFA 5SZKB 2JIRA 1I80A 1MLDA 2ZJ0A 2FMHA 4Q82A 4ZYXA 3LYAA 3PNPA 5IC5A 4NH0A 3STXA 4E31A 1JVBA 1IBSA 1YVUA 2AZDA 2ZBEA 3RADC 3DB1A 3I5XA 1YB1A 3UMBA 5C7IO 8ADHA 2PA0A 3MFYA 4J43A 1NVEA 4DR4B 3DPSA 2R6AA 1UKCA 3MPOA 1QC5A 4MQEA 4QUKA 1GA6A 5FTMA 2G40A 1AK1A 2ADMA 1DC7A 4MYRA 1IN8A 4CUJA 1UOQA 1XTKA 3E6AA 2FEPA 3FAZA 4QAJA 4BL5A 1OXKB 5E8JA 1YFLA 2PT6A 1DOAA 2XEXA 4B81A 1E6EA 1EFAA 1VLZA 1KK0A 2Q0XA 3KFLA 4S12A 4WKCA 2HO5A 1JQ3A 4GPTA 2P4UA 2WABA 4DYVA 4JJEA 3ZUPA 4ZI2A 3HVIA 1XK6A 3TX2A 4E1BA 2GETA 1LBQA 2AN3A 4I66A 4NDNE 5CA0B 3IVXA 3EA0A 3LUPA 4C05A 5C8VA 4C7OB 2EF0A 2IE0A 1J21A 3BK2A 1IXZA 4HD8A 4UBLA 4IIEA 1OH6A 2AC7A 3DO5A 3KZKA 3Q2OA 1L7QA 3HO8A 3DFMA 1Z7GA 1MB2A 1XN4A 4OQQA 4EA7A 3RYCB 4BQSA 3PCTA 1GRNA 1LRJA 1LLFA 1ZI6A 2QTWB 1ULHA 2AF3C 1IOWA 4CMIB 3O38A 2IGBA 2QL9A 4W1SA 3Q3EA 3QOFA 4WXRA 4UTNA 3QE3A 2QR5A 4Y9DA 5BSMA 4P8RA 3WB1A 3DVAA 1KTIA 4JEHA 2VHYA 4Y0AA 3V1MA 2ZQYA 5C4GB 4I4NA 4EHDA 1ST3A 1TMKA 4KW7A 1UXJA 4MS4B 3JVDA 1I14A 3HBMA 1PEAA 3G0DA 1U3UA 3R6TA 5D2CA 4N8SA 3MLAA 1I2DA 1N0UA 1L4NA 4GGMX 3O4FA 4ARBA 2FG5A 2D0DA 4ZHQB 5JDCC 1DZ3A 1S7GA 4YCNA 4ES6A 3ZU3A 2ONKA 2YDYA 1PUJA 1TZ2A 1R64A 4YAOA 3TS1A 2R8ZA 1X7GA 1XD2A 4C7KA 1YCFA 1LPPA 3GT3A 1MO4A 3MG9A 2MMGA 4INOA 3PJRA 1V71A 3FCOA 3G1TA 1DE0A 1B76A 5CD9A 4N3AA 3ZK9A 4AKEA 3LCUA 1HT0A 4HEQA 3TSCA 2MYPA 3LUCA 4RW0A 1M5RA 5KHAA 4TXMA 5EJEA 1YQGA 3ABSB 4EEZA 1Z6YA 1SIOA 2V98A 1YB4A 4MVWA 1FDTA 1JEQB 3BL5A 2HIAA 5A2QA 1B1AA 1YIDA 2P3SA 5CHEA 2H11A 3TI9A 1Q19A 2VQSA 3H65A 4NC9A 4UBKA 3U16A 1OXUA 2A3NA 1FX0B 2VF5X 3C1AA 1CJBA 4IDBA 4URYR 3MGGA 3ZXIA 1ZK3A 1CRPA 3HBFA 5JADA 1FFGA 1SB8A 1XXHB 5LJIA 3UJDA 3T1NA 2GCEA 4F4JA 3A1NA 1C41A 4LOAA 1KQPA 1XA0A 4Z4FA 1O8CA 1LI7A 1CY8A 1R5NA 2J6BA 2ZSAA 5HBRA 5K3DA 1T10A 4J4BA 1RCUA 5AI9A 1EVZA 1J2UA 2ZIUB 2WR8A 1JYFA 4AMZA 3AR3A 3P96A 1WA5A 5K8JB 1KKMA 2YJ4A 3AONB 2HU2A 3L07A 3VPAA 2NU8A 2XIQA 1RZRA 1IQUA 2DAPA 2FOIA 3MW8A 2YICA 2GEUA 3IPRA 5AWFC 1OPXA 2DLDA 4FKMA 4EMUA 3COWA 4F85A 5IZ4A 4BFXA 2DMRA 4R2KA 4BJ6A 2HW8A 2RE8A 2F3TA 4IIJA 4ALNA 2IS6A 1OYYA 2JFXA 3B1JA 4Z7OB 3TD2A 3K6SA 3X0DA 1D09A 4BJ5A 1KY3A 4LF6B 3G5TA 3HCAA 2QX6A 3I83A 4EY4A 5A04A 5ARDA 3RJTA 3WTCA 4E88A 1S1CA 3BT7A 3OTIA 4BE7B 1AGRA 4V1CB 5DHTA 2G06A 2HTEA 3V3TA 4QZVA 3ME5A 1G7SA 1S9DA 2INGX 2YNMD 4HAXA 3V6MA 3DJFA 3E4CA 3IR5A 4AJKA 1USIA 2GCIA 2OSBA 2BGKA 1PJ4A 2XCTB 1M8PA 2W00A 2VKTA 3JVUA 2WU0A 4Z53A 4DDWA 3NBAA 2KE5A 3PT9A 2WF8A 1LNSA 3F9CA 2W43A 3NYIA 1RJGA 3FBGA 4PYRA 3W7VA 3MUOA 5EYPB 1T34A 1DRUA 2B1IA 4AK9A 5MHTA 3PVSA 1OROA 3VPSA 3HY4A 3NEAA 1QIIA 1D6SA 1IDOA 1MX9A 1Q1GA 1C29B 4R8VA 3HPQA 5DNVA 1ID1A 4ZVUA 3CLHA 3T9CA 2IEDA 3UG6A 4H3SA 1LF0A 4TSFA 4NONA 4ZPJA 5LLDA 3J81k 4R2WA 3N76A 1QO7A 3CS3A 3IP7A 4RPLA 5A05A 1HDXA 2YZMA 4ACBA 3TRKA 4LI0A 2VDMB 4KZKA 4V0KA 4Z7QB 3VU1A 3DVRX 3SEFA 1FU4A 2VP2A 3CLUC 4O08A 2AXEA 5TX7A 4F0JA 1ULUA 5E9AA 1F48A 4F5EA 3K71B 4GC9A 5DBGA 3RTEA 4QX6A 1J20A 1WDTA 1H2RS 5FQOA 2ZJ3A 3H1FA 2C58A 2E4ZA 1U28A 1YQQA 2I6QA 4D9IA 1ATIA 1P31A 3KLBA 3I42A 3DW1X 3NWJA 4MUNA 4LF8B 2I87A 2P1DA 1NPYA 1N2JA 2BJWA 2DWOA 2J9GA 2RAFA 3JASA 3O1JC 4YIKA 1QVWA 3ST7A 1N6NA 3T4PA 1FVXA 4A8JA 2W2MA 3H4TA 3MQ4A 3I4FA 1FDWA 2B34A 1S2NA 2Q2VA 1AHNA 1RT9A 1YULA 2YV2A 1M0WA 4HUQA 4GT1A 4AD8A 1GUAA 3PQ4A 1Q14A 4U4AA 1RWXA 3D0OA 1UC9A 4LZLA 3PFGA 1PQPA 3MRSA 4DV0B 3TSOA 1VHQA 1WMFA 2RHCA 4FW8A 3KT8A 3BWDD 3TPFA 4LCEA 5KHLB 1KMQA 2VA8A 3M4NA 1P18A 2FZ5A 3MHTA 1JR4A 2C0QA 3UB3A 3BJZA 5I7AA 3ETNA 3IPAA 2ZT7A 4X00A 3OJCA 1X1RA 1X14A 4KB5A 3SYTA 2H1WA 3ORSA 1O9GA 2MTBA 4CV0A 1AHIA 3ZCPA 1K5PA 4IJUA 5AVRA 1ZUWA 2Y1XA 2Z2YA 5COBA 2I2BA 2IHVA 4G8BA 2QTLA 4QSHA 1MA3A 2QP9X 3KHUA 4WWHA 4QEKA 1KMCA 2Z1MA 2B7LA 4PFQA 3GQBB 1N6HA 4Q4HB 5KMGB 5LIPA 3QBJA 4NHOA 3RFUA 2OA0A 1Z8DA 4BRUA 3NT5A 1ZN2A 1E8MA 1FUEA 2NUTB 1HDIA 2BPOA 1HTWA 3D1VA 3F71A 4YREA 4Z4HA 1A71A 2DBYA 3OKFA 5BV1A 1RAIA 4JI8B 4Q3KA 3PXEA 2JC3A 1DAEA 1T9CA 1R88A 2C7BA 3AP2A 3A6ZA 4KDEA 5HGJA 3DO8A 4KE9A 4PSKA 3GJ0A 3I8SA 1COZA 4LNAA 4R8KA 4FR5A 4WCFC 5FTKA 1RQ7A 2R4QA 3DO6A 3SQMA 1CK4A 2J0UB 3DFZA 3TNFA 4G8CA 5IKXA 3WGLA 3IAS6 4MUIA 2QLNA 3HDJA 2D0PB 1GN9A 2GWRA 4RH3A 2A92A 1FMFA 2R6R1 1TKAA 4C0BA 2B0JA 2ZT8A 1D6JA 1FSZA 5CAEA 1WCIA 4YLYA 1QXSA 1E0KA 1FS6A 2VJMA 1S02A 3PTLA 1B6TA 1TCVA 1UEIA 2ERYA 2GCOA 3DULA 2PRZA 2VHUA 3L8DA 2QZPA 4XZ3A 5HFAA 4CM8A 3SEAA 1ACJA 5K6AA 3QGMA 2ID9A 3IP5A 2C0PA 3NI2A 2QTBA 1I7LA 1BKSB 1V9LA 3NNSA 2WF5A 1HR0B 1EB9A 5DX1A 3Q98A 3ZDDA 4E4RA 1Q0PA 4YA6A 3ND5A 1N5OX 1NATA 5TC4A 4M86A 1NOJA 1KEUA 1P4HA 1ZRNA 1ZZGA 1T13A 2HNAA 2P7IA 2ZUDA 4FWBA 4PC2A 4ZOBA 2FR8A 1G9SA 4P7BA 5AOCA 5TV2A 4XRRA 5KJCA 3CVVA 4LXHA 4PAQA 4G5FA 2VKQA 3T7EA 4H59A 5JCOA 1M6VB 1XD9A 3KVVA 2AWOA 1T36A 3ES9A