1G5RA

The three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
ERGIIIVFTGNGKGKTTAAFGTAARAVGHGKNVGVVQFIKGTWPNGERNLLEPHGVEFQVMATGFTWETQNREADTAACMAVWQHGKRMLADPLLDMVVLDELTYMVAYDYLPLEEVISALNARPGHQTVIITGRGCHRDILDLADTVSELRPVKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of ATP:corrinoid adenosyltransferase from Salmonella typhimurium in its free state, complexed with MgATP, or complexed with hydroxycobalamin and MgATP.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
molecule keywords COB(I)ALAMIN ADENOSYLTRANSFERASE
total genus 51
structure length 157
sequence length 157
ec nomenclature ec 2.5.1.17: Corrinoid adenosyltransferase.
pdb deposition date 2000-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02572 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g5rA00
3ECCA 1N5IA 2OEPA 1XTKA 1D8TA 3AGQA 2GK7A 5F9HA 3QKSB 4C7OB 2CLDX 2RGXA 4G3XA 3QXXA 4J0QA 1TQ6A 3NWJA 3KQHA 2F9MA 4LI0A 5BN5A 3QEOA 1CLUA 2VH5R 4NYJR 1E9AA 3VFDA 1EFRA 1W5SA 4O0MA 4W9MC 4B6EA 1KZ7B 1KZGB 2O8BB 2FZLA 3CX7A 3SBDA 1YKSA 1GKIA 1DAIA 4G1UC 4LJ6A 5JHHB 4MH0R 4B44A 1FNMA 4YQFA 5DGXA 2V7QA 2GCPA 2VP2A 5LB2A 2NO1A 2O0JA 2IA5A 1DO0A 1N6RA 1IJEA 1GFIA 3GEHA 4X8HA 3DDCA 521PA 4M9SA 3THWB 2NQ2C 1DPFA 2AFHE 3Q85A 5L8VA 4NHOA 4M53A 1KY3A 3L0PA 4IXMA 3R8CA 2H57A 4G01B 1WF3A 4YDHB 3CRVA 5DYGA 2KBEA 4E09A 1NSFA 1ZBDA 3TMKA 3UKDA 1D2EA 3TAUA 5JWOA 5DHFA 4NDZA 4A36A 1XD8A 4Q7KA 3RS2A 1AA9A 1IXZA 2PH1A 3I5XA 1E2KA 1Z0IA 5FOSA 4DKXA 2AD1A 1JPJA 4Q03A 2FZ4A 4EKDA 1CR4A 2VF8A 5B30A 4GOXA 1KTVA 4FXPA 3ICQB 1NBMA 2ANCA 1N6HA 4DCVA 3BH6A 2R62A 2YWFA 4TMKA 4E22A 1P62B 2WJVA 2JLQA 3NH9A 4IFEA 1I2MA 5CYOA 4F92B 3WRYC 3THXB 1W2HA 3PQCA 1UEIA 4RZUA 1G3UA 3I8SA 4QBHA 4TQ9A 5FBQB 4BRWA 4CDGA 1G1MA 3I61A 1TEVA 2D3WA 3W8RA 2PJZA 1KJYA 5KNBA 1TTTA 2FF7A 1VCMA 2WMOB 4ZDJA 4JT2A 2F3TA 3VU9B 4JJKA 2NO6A 3EC1A 4Q01A 3SN6A 3PVSA 3R7WA 3T12A 5LD2C 4AKGA 1P4SA 4ESVA 5L3VA 1MO5A 4LY6A 3GCGA 2JEOA 1NIPA 3GJ4A 3TW4A 1G20E 2Z4SA 4LUCA 2HEIA 2EFEB 4G5QA 3BBPA 3ASZA 2PZGA 1DBSA 821PA 1NI3A 2W58A 2J0SA 3MJHA 1N6IA 4EPVA 1P9WA 1E1QA 3EASA 3QKRB 3U3KA 4RKFA 1W44A 1QDEA 4QXAA 4UNPA 4BFSA 5DYIA 1KI1A 2IF0A 5E7IA 1G7SA 2GXQA 3EWSA 3HR7A 1JAHA 4AYTA 2N46A 1IY1A 3BE4A 3DZDA 1VYTA 4DUGA 4IDNA 1US8A 4EPTA 3HJNA 4URZR 3AF0A 121PA 1J70A 2MSEB 3H84A 1LS6A 1XP8A 3SS8A 4TYYA 1GG2A 2XTNA 4LJ9A 4F4JA 3SI7A 3KQKA 3F5FA 4LV6A 5FTKA 3REFA 4Q4AB 1CEEA 4CEHA 3CF6R 2IXGA 1PZNA 4WVFA 3U5ZB 4Q21A 1VHLA 5E7JA 3VAAA 2ZSBA 3T06B 5DN6A 1G5PA 1Q1BA 3CRMA 3GFTA 3VKWA 1NBMD 1PV4A 3BFVA 1DEKA 1SKYE 4B3DA 1KNXA 4CZ2A 2NPIA 4BFWA 4A6PA 1Q3HA 1G19A 2I4IA 2W2VA 1S3GA 1E2HA 2ERYA 4UJ3A 4UNQA 1E2PA 1DAMA 4Q1FA 1SXJB 4NCKA 1J8MF 1UKZA 5EZ5A 2BBTA 1XXHB 1MKYA 3A4MA 3FKQA 1DOAA 4UXJA 1GKYA 1QVRA 1XMJA 3LVQE 4PPFA 4KLZA 1ZW6A 2IUUA 4D25A 1XTQA 1F2UA 1KDTA 2OO7A 3A58B 4LOAA 5FPTA 5KSOA 3AKYA 3VTKA 1GRRA 2TMKA 4E5UA 3AKCA 5JRZA 3PFIA 1AGPA 2BM0A 3KFXA 5E7MA 2EVWX 2I1VB 1C1YA 3MUFA 4NYIR 3MWYW 2CNWD 3CH5A 2IS6A 2J0UB 4P33A 1K8RA 4I1UA 5EP4A 3ZDQA 2Z83A 5C2JB 4FD2A 4B48A 4EPYA 2FSHA 4M9XA 2PCLA 3I73A 4BFYA 1OB2A 1Z29A 5JCZA 2RAPA 4NCNA 4IOKA 1G291 2BMEA 2G83A 2ZIAA 2CMKA 3U6BA 2C9OA 1NVWQ 4QL3A 4Q02A 4C2UA 4P4UA 5AJWA 5J47A 1XD2B 1N6NA 4DSUA 4U02A 3SYLA 3KTAA 3B1YA 1GUAA 2WIBA 2AWOA 4G0NA 3UWKA 3AVUA 4NU0A 2ZJOA 4BLPA 3CPEA 2IYRA 2N1BA 1YR9A 3THOA 4KFUA 4XJXA 4URWR 1TPZA 4JLPA 5EP2A 1VIAA 5J4VA 4DB4A 1ZD8A 2WWYA 4TLEA 2JLYA 1RPZA 1NG9A 4V0KA 4IW3B 1A7JA 1EFTA 1T5LA 2BMFA 3NDPA 3ZVNA 5HKKA 5LDDC 1CJTC 2EFCB 3HP1A 1KO4A 3CBQA 3VR2A 2Z4RA 3GFPA 1Q0UA 2CXXA 4GOKA 4JVSB 3U3JA 2OUKA 4HEJA 2W6JD 2CJWB 3WNDA 1CRQA 4A4DA 5FI0B 1ZC3A 4G5RA 1W2GA 1P73A 2BKEA 1F3OA 3K0AB 3PG5A 2AR7A 1QHXA 3BRWD 4P4SB 1F2TA 4XVUA 2QBYB 4Q18A 3AV0B 3S1AA 4RCZA 4TT3D 4OHYA 4POAA 2CVFA 3HPRA 4U00A 1Z0FA 2CHVA 4ZDKA 2P0EA 3QBTA 2QMHA 3BH0A 1L4UA 1HE1C 2B6HA 1D2NA 1T3HA 4IVPA 1S3SA 3RS5A 2PBRA 3SDZA 3VKGA 1N25A 2F1RA 4RFVA 1AKYA 1EESA 2FPMA 1UBCA 3GJXC 3N5CA 2VIIA 5TVKA 2HCBA 1QHHB 2ZRDA 1ZUIA 1R0ZA 4ZCIA 3QKTA 2R6AA 2G6BA 3TSOA 4V0MA 2UKDA 4RD4A 4LSGA 1R5NA 3MWJA 1HT2E 4FMBB 2F1HA 2UZ3A 1JECA 3AF2A 2WAYA 1M34E 1E0JA 4BLOA 1OXSC 2YZ2A 3SHWA 5IF9A 4QHYA 2JGNA 1Z6AA 3F3YA 1KI9A 2QGNA 4BQSA 1XFAA 1RYHA 4LHXA 2E9SA 4LYJA 3A36A 3FMFA 4KI0A 5GJWC 1OJLA 2ODNA 2QI9C 4PSKA 1I2DA 2CNWA 4AYXA 1WCV1 4WXRA 1Z47A 1GM5A 4C0LA 1QHSA 1Y3AA 3L0OA 3LRPA 4G5OA 4GPTA 1G9XA 5EP3A 5SZHB 3HDTA 2P5TB 5K8LA 1QHIA 2PT7A 5JSZB 3SQXA 3RABA 2ZREA 2NMVA 1JB1A 2RGBA 1ZNZA 4NONA 3BJIC 5DLQC 3SOPA 3KUCA 3E5HA 1LTQA 2FGJA 5KU1A 1YVDA 4QM7A 2J46A 3U4QA 2EYQA 2VSXA 5DISB 1PUIA 2REOA 4OHWA 1R5OA 4RD6A 4AI6A 2ZRPA 5CIWA 2NGRA 1XPRA 1YJ5A 1FQJA 2BDTA 3CNOA 4TLBA 1OHHD 2GXUA 3M1IA 4LHZA 4M1WA 1DVRA 4NCHA 1RE0A 1WBDA 4AY2A 1U0LA 2VSFA 2CEAA 5DH9A 1OXTA 2J0QA 3DMNA 1OH5A 1OXVA 1Z2AA 5LPNA 3RC8A 3A4LA 3OAAD 2WWXA 3K9HA 4I81A 1E79A 3LXRA 3UIEA 2PEYA 1MO3A 1G8PA 1A2KC 4C0SA 1A1VA 1HYQA 4Q1BA 1OPXA 3KXKA 2QT0A 1F6BA 2GHIA 5FBRB 2BIFA 3AF1A 2F3RA 3QUSA 2A5FA 3OIVA 2O8DA 3KDSE 3P26A 3FVQA 3W6PA 2XSZA 4UQOA 1KOFA 3SHFA 1XTIA 3A4NA 4TSFA 4XWOA 4HAXA 4E07A 1VMAA 1Z08A 2ZRHA 1YQTA 2P6RA 1KI8A 3GLHA 2WOOA 3NEJA 3T5GA 2OCBA 2B21A 3SZRA 1HUQA 2QU8A 1XEXB 3CPJB 4O3MA 4PPQA 1D9XA 1O3YA 2HF8A 3G82C 3U7HB 1VDZA 1KJZA 2XEXA 3KJHA 3WRXC 4HDOB 4M1YA 2WKQA 2GJSA 3M0EA 2ZI9A 3PEUA 3GJ5A 3SBEA 3TAHA 1BKDR 1ZRHA 4RZXA 4CIDA 1KO7A 1YZQA 4ZCMA 4XTRA 5K8UA 3KXIA 5HR5A 5KOYA 4OQXA 1D5CA 2D2FA 1J99A 2XZLA 3K0FA 2Q3MA 3LBHA 1VCIA 2PEZA 2WVJA 2IWRA 1G3MA 4ZO4A 4DLSA 1PJRA 2RGNA 1PLKA 1ZD9A 3B5JA 1G7CA 2NTYC 3IBGA 4LJ5A 4Q66C 2ZJAA 4IEEA 4NYJQ 4KBGA 3GLHE 1WE2A 1XEXA 1KMHA 2H5EA 2HCJB 1E9FA 1R2QA 1AK2A 1W49A 2GCNA 3LW8A 4HB4A 4JLNA 4DLWA 2J7PA 1TF7A 2OXCA 3LXXA 4IRUB 4L8GA 4RVCA 1HURA 1XXHE 2N42A 2FU5C 4V0ME 4C9BA 4B32A 4G5GA 3X1ZA 4DDTA 2J87A 1M2OB 2XNDA 1B0UA 3PV0A 2F6RA 4PC2A 2DWOA 4EQ6B 4Q4JA 1OIXA 2Q3HA 1PUJA 1JR3E 2BEJA 4UJ5A 4MYHA 1EWRA 2C5LA 1RW4A 2E87A 2ZS8A 3B1XA 3L82B 3QXHA 3AGPA 2CE2X 5C18A 2RGNC 2YYZA 1G21E 4Q7LA 5TV2A 2VA8A 1KMQA 1EK0A 1IQPA 2JATA 1NN3A 4KO8A 4CGZA 2FOLA 2OAP1 3ZQJA 5E4FA 1G3QA 2XXAB 4KBFA 3TKLA 3ZYCA 4GP7A 3K9GA 4TL6A 5ANRB 2ZRAA 2GVZC 1L4YA 5TXGA 2G3YA 4ZI3A 2R6CA 3DO6A 4DIDA 1IN4A 1NSTA 3ZVMA 3P32A 2QRNA 2RGCA 2JIZA 4BE7B 2V1XA 2RH5A 2GNOA 1E4VA 4HLUA 4GOJA 1LF0A 1SXJA 1RJ9A 1W36B 4EAQA 2HF9A 3CB4A 4UNNA 4ZDWA 1T0HB 3B9QA 2J59A 4MRVA 1GZSA 4HB3A 2EWWA 4DVGA 1ESMA 3FMOB 2ZRKA 2KB0A 2C96A 4JSYA 4XOIA 2OV2A 5CJPA 1LF5A 5HE8A 5GJCA 2ODBA 4BPBA 3AM1A 1DAFA 1RFLA 2QAGC 1KGDA 3LA6A 1NLZA 2G0TA 2VF7A 1Q1EA 2Q0HA 5AJVB 2WTUA 4PZYA 4MRSA 4HZIA 4LPKA 3TQCA 3TE6A 1AS2A 3A1WA 2JJ8A 4D81A 4HLUC 5L3SB 2BVNA 4ABYA 1KIMA 3QXCA 4DEXA 4QM6A 2VHJA 5DI3B 2XOKA 3M4YA 2Q9AA 4DLZA 2KE5A 2IYLD 2YNMA 1NVVR 2A2ZA 3D6TB 1KJWA 2X1VA 1SXJE 1P2VA 3WHLA 3CPHA 2AKAB 2ZEJA 1SZPA 1GIAA 3SR0A 1Z06A 2ZR7A 2ONJA 3V00A 3AVVA 4LC0A 4JL8A 4QHTA 4PC7A 3DOEA 3D3QA 4YMVA 1E9RA 1E79D 2ZSFA 4XVRA 2HT6A 3PUZA 3AKDA 2JAQA 4M1MA 1KY2A 2GESA 3CR8A 3THWA 4H1UA 2X77A 1XD9A 2A78A 3U7GA 2W2TA 1SKYB 5KSYA 4Y0VA 3FFAA 4Q5IA 3NBYC 1YZLA 3RDPA 1FL9A 3V4RA 2O8CA 2CHQA 3TUIC 2FV8A 4RD3A 4KITB 3BK7A 3ZGXA 1IN8A 2J45A 4QJ4A 4DLUA 3BGWA 2FSGA 3FMPB 4UNSA 3EPJA 1E2LA 1CJMA 1N5KA 3W9YA 2Q21A 1HV8A 2EU8A 1JNYA 3FYHA 1GTVA 5HE9A 2QE7A 4ACBA 3B1WA 1E2EA 1ZJ6A 1Z2CA 4LJ4A 5J4LA 5KDOA 4MGYR 2OBNA 3BC1A 3GJ8A 1ZM4A 2BOVA 3SEAA 4V02A 2HUPA 4AK9A 1NIJA 1SVMA 4DLRA 1EG7A 4LYAA 2JLUA 1KDOA 4A9AA 1TAGA 1M7HA 1ZU5A 2JLSA 3NBXX 1U81A 3B9PA 4PHFA 4DDVA 4N0DA 3GJ0A 2ZI4A 2IHBA 1Z6XA 5SZIA 3TSZA 5C46F 4OJKA 1ESNA 3U6KA 3K0SA 2V1UA 2XGJA 2ZE8A 3ZS8A 1VCOA 2QSZA 1ZP6A 1HE8B 3UXMA 2BM1A 4BLSA 2GEUA 3BB3A 4HB2A 2BBSA 1YR6A 4Q4LA 4D0GA 1G7TA 1TX4B 3Q9LA 4Q4HB 4DRZA 3OZXA 4C0AC 1JI0A 4JLAA 3TR5A 2HLDA 3NHAA 3F8TA 2CDNA 3UMRA 1QG4A 4QG7A 3AVYA 1LNZA 3QKSA 4P4TA 3PUWA 1CTQA 3WYGA 1Z0DA 2AXPA 2VBCA 1N5LA 1OLOA 3AQ4A 3IHLA 1UDXA 3R20A 4PO8A 4Z54A 5B58C 1TF5A 5LB4A 1P75A 4DLXA 1SKQA 1A2BA 1UF9A 1XTJA 2EFDB 4EFLA 3GD7A 1FMLA 3WMGA 3MWLA 3HWSA 5TY0A 2FFQA 2ANBA 1J8YF 8OHMA 2IS1A 1G7RA 4DSTA 4U7DA 5JCPA 2FG5A 2QEQA 1NN1A 2OCYC 4MA4A 2YINC 3BD9A 4Q9LA 3L43A 2G0NA 4MYCA 3A1VA 2AKYA 3LDAA 5CYPA 5FFMA 4Z51A 1KO1A 4B73A 4QBIA 4HATA 2QPAA 4G5SA 1KI6B 2JLRA 5DI3A 5G3ZA 2H16A 3GPLA 4II7A 2AL7A 1FQKA 5JBQA 1ZUNB 4PC6A 5J4HA 1CJUC 1CXZA 3B1ZA 3CR7A 2H17A 1XMIA 2VO1A 1XJQA 3AF3A 4XH9B 3BOSA 3FHOA 3MCAA 2A7QA 1P2SA 4AG5A 3A37A 2R6GA 5CM9C 2Z5FA 4A2QA 1E94E 4D4JA 5JS8A 1NVUQ 3TRFA 2IYZA 3PEVA 4XD7A 4OJQA 4C30A 3CIOA 3ADBA 3E70C 1LFDB 3NC1C 2YOGA 4BUJA 3EPLA 1DE0A 4B3FX 3ADKA 3KB2A 1S96A 4RD2A 1DAHA 3PUXA 1KAOA 2OFOA 1R5BA 3NC0C 4W5WA 1Q21A 4NCJA 3UMFA 3ICEA 4QBFA 2ZSEA 3W34A 2ZE7A 2YC4C 2ERXA 4B47A 3H0KA 3SFVA 1D9ZA 4KSBA 3KFVA 2DCUA 3U61B 2RHDA 4PR0A 2PMKA 1FPMA 1JR6A 2RGEA 3CX6A 4TMTA 3IIKA 1YRBA 1E6CA 1KSHA 4KSCA 2ZRIA 3KKNA 1W4CA 3IPYA 2DYKA 3U3OA 4CRWB 3PUYA 4DSOA 2IYTA 2ZJ8A 2ZAOA 3QF4A 1OKKA 5KPJA 2ZI7A 4JLBA 1O87A 3QEJA 1RJ9B 3QE0A 1W36D 1E2NA 3KX2A 2XOKD 4EDHA 3AP2A 4LBVA 1QVAA 3L0IB 2R65A 2Z6VA 2O52A 4LYHA 2ZRLA 4DDUA 4QJ5A 4FCVA 1W0JD 3GLGB 3P27A 1H8ED 3KKMA 2XX3A 4QGGA 2D7CA 2QAGA 3AVTA 2XITA 4AD8A 5AJYA 5IK2A 1RRCA 1BH2A 1OIVA 4AIIA 1NMXA 2BJWA 3QKUA 1TL7C 5JRJA 5F9FA 1G4AE 4AKHA 1RC8A 4K8OA 3LAWA 1KO5A 5H68A 4S35A 5JLJA 2CLSA 1CKEA 2VHQA 3QBVA 3EA0A 2CCGA 1DADA 2D62A 5G40A 2NOAA 2QENA 4XWKA 4FMDF 1XJCA 4V0NA 3S1AB 1VG9B 4PANA 4XD7D 3LNCA 2XZPA 1J7KA 1JBKA 4TMZA 4DUGD 2ZM5A 4A0HA 2IBMA 1XCPA 4H9GA 4Z8YA 4PQFA 1OF1A 1GNPA 2QROA 3I5YA 2V55B 4PZZA 4ITRC 3WNCA 4TTPA 4NCIA 5FUVA 3RRZA 4KAXA 1ZINA 1XCGB 3I92A 4I1OA 3H1TA 3UWOA 5FOUA 2ZPTX 3OFND 2QP9X 4GMXA 5GJVC 3MMPA 3PENA 1II0A 5LD2B 2AK3A 2I3BA 1R7RA 4LK2A 1KDPA 1BMFD 1IHUA 2AFIE 4CT5A 2QTVB 3B7GA 4MKGA 2YKGA 1Z0KA 3CRQA 2GK6A 5TB5A 2O8DB 2QM8A 3OESA 3BFKA 3QQ5A 2VHUA 3EC2A 1P3JA 1AZTA 1II8A 3QXSA 1RRGA 4GMDA 4BGDA 2WSMA 2HYIC 4JS0A 4YMTA 4B43A 1TQ2A 1DAEA 4ASUA 2JASA 1ZM2A 4EPWA 1T0JB 1X3SA 2QT1A 5TARA 1W36C 3GLHB 5TMPA 5FOVA 3DPUA 3Q5EA 2UZIR 4UXIA 2GBLA 4KYIB 1R0XA 1I4TD 2F1JA 2OCPA 5FUYA 3T1OA 4B2IA 4ARZB 3A1SA 2ZS7A 1Z28A 4Q1AA 4MRPA 2QP3A 2R2AA 4LZZA 4OYHA 3GFOA 3QG1A 4F93B 3LX5A 1YZKA 3ADDA 5FR1A 2OSBA 2AX4A 4Z8XA 3U3RA 1T6NA 1MOZA 4LBYA 3CNLA 2W6ID 3RS0A 3PEYA 1YRAA 4JL5A 4BASA 3QG5A 2QMEA 4KU4A 2ZQ5A 4LJ7A 5FUWA 4BECA 4X8MA 2ZI6A 3EZ6A 3P1JA 1FP6A 4C4PA 3C7KA 2D74A 2GRJA 3BXZA 3A1TA 1HY3A 2P2LA 3K0AA 3MGCA 2ZSAA 3KXLA 3EZ2A 2C95A 4R7ZA 5E95A 3I62A 2CJWA 2OFXA 1U8YA 4M2LA 3RANA 2ZTSA 4D2IA 1OSNA 1OFHA 2GZAA 3ETLA 4P3YA 1KK0A 1SXJC 1ZM3A 4TSFD 4FWTA 3GP8A 4HAVA 3VR6A 1AS3A 2XTZA 2GJKA 1MH1A 2HT1A 3WXMA 3CO5A 3MAAC 4WXPA 3EIEA 1RIFA 3DM9B 4M1OA 2ZAMA 3LX8A 3K8YA 4C0QC 3QXJA 3EIQA 1P9NA 3PUVA 4YMSA 2ECKA 3O8RA 2WV9A 4MRNA 4KCGA 4IHQA 2JJ2A 1XTSA 4OI0A 4I4LA 4B2LA 4LC1A 2IX3A 5LBIA 2GAOA 3IEUA 4DCNA 3DVLA 4IDHA 4C0HA 2ZUCA 2GILA 1ZM9A 1JAIA 4JBXA 2ZRJA 4MDFA 3T5DA 1KSJA 1EX6A 1QHGA 2WJJA 1G3RA 3P20A 4XWAA 4BLQA 4MUBA 4MUAA 4CF7A 3KKOA 3WYFA 4HLCA 4HI0E 2GJ9A 3BFXA 1G17A 5GVSA 4ZDIA 1CP2A 4JZKA 3ZZUA 3L8ZA 3C41J 3W5JA 4XVQA 4I1VA 2KJQA 1ZYUA 2FEMA 2ZUBA 2FFAA 5CK4A 4QRHA 2JJ2D 2PLRA 1IM2A 1SVIA 3ZVRA 4C0BA 1G6HA 1U8ZA 1C4OA 3K0CA 1KI3A 3IPXA 6Q21A 5CLLA 1YZNA 2QL6A 4IVRA 1CJVC 1GNRA 4YXWD 5BW8A 2NZJA 2AK2A 1UKEA 1ZIPA 1ZVQA 1ZC4A 3I72A 3HU1A 3NVAA 3LLMA 4TN1A 1JEEA 4PPGA 2FPKA 4TTRA 1T3SA 3Q3JB 1HT1E 1JJ7A 2ZRBA 4KLNA 2D4HA 1F60A 3IHWA 2OZEA 2XB4A 1W48A 3FKSD 3WBJA 1Q3TA 3FOZA 3IEVA 2WAXA 5B2ZA 2NIPA 1P2UA 2ZI5A 3QVVA 3TW8B 3NHBA 1WQ1R 4LBZA 1XWIA 4IVQA 1YR8A 2JIZD 3DMDA 2JLZA 4IOMA 1TF2A 4M21A 1CULC 1JJVA 1AIPA 1YR7A 5DSZA 3LW7A 4HLDA 3CW2A 4C3ZA 2W6IA 3DHWC 2AHOA 1NP6A 4US0R 1E98A 2IS4A 4URVR 4O2RA 3SNHA 5A4JA 1XMSA 3A6PC 1NY5A 2DFLA 3THXA 2C03A 3MD0A 4TT3A 2PX3A 2CK3A 1ZMXA 4IDOA 4LDJA 3EPKA 4DT1B 2GZDA 3ND8A 1ZNWA 4FI3C 2QAJA 2RGGA 1WA5A 3VU9A 2GXSA 1DS6A 2EYUA 5HZKA 1E4YA 1GRNA 4BFZA 1XEWY 4F7WA 1S9DA 1Q57A 1W4RA 4P0TA 3TJZA 4RFSB 2CL6X 1G8FA 3AF4A 3DZ8A 4KYUA 2R6DA 4HSEA 4TMXA 1KNQA 2QSYA 1CRPA 2J1LA 4O25A 4EFMA 1M74A 3G0HA 5HPYB 3U44B 1PVOA 1FUKA 2YC2C 1W1WA 5KTYA 5C1BA 5GVRA 4Z1MD 4YDSA 3BERA 4LJYA 5EE1A 1WB9A 2ZRMA 1E2JA 621PA 4IJMA 1BYIA 1KYIA 3B82A 3RYTC 1VG0B 5FPSA 2QZ4A 2J5XA 5F3WB 1Q20A 4A92A 4IXNA 2H18A 5DIFA 1US8B 4ZIRB 1KMHB 2P67A 2A9KA 2GETA 4GFDA 1BMFA 1J90A 4HAWA 2PZFA 4TMWA 2CCJA 4MKIA 1Q22A 3BORA 3LVRE 3WNBA 1GNQA 3BIFA 4JLDA 4JVLA 2MMCA 1GWNA 3KB1A 3CF0A 3T61A 1KK3A 4URYR 1U8AA 2PX0A 3T15A 4F38A 2J7KA 4CEHB 1UPTA 1VTKA 3N2IA 3SE0A 2GKSA 3OIYA 4IEIA 1QG2A 1H8HA 4GT1A 2A3RA 2ONKA 4EIWA 1SHKA 4PHGA 4RD0A 3CKLA 1TU4A 3QJYA 4YXWA 1Z5ZA 3TK1A 3T1VA 2VQSA 2ODEA 4L4UA 5BYKA 3VR4A 4HZUB 1KSFX 4AKEA 4B3XA 4JIMA 3EXAA 1H8EA 2GAAA 4RY2A 3TIFA 3B85A 1GKUB 4A0GA 1E0AA 4M9ZA 1IAQA 2ZJYA 3J81k 3BAFA 3VX4A 3GLGE 1T3LA 2XB2A 1G64A 4KODA 1A82A 3QKRA 2LCFA 2ZE6A 3O8CA 4E03A 4B75A 2W0SA 3OAAA 1AQUA 2OLJA 2IWHA 2XJ4A 3HYRA 3EX7C 4NE2A 3B1VA 2V8OA 1SQ5A 1U2RA 5JHGB 4ZIRA 1Z6TA 3EPHA 1W0JA 3R9XA 2WKRA 4DLTA 5GADl 2HV8A 3KQNA 4JLJA 3RC3A 4PHTA 1KKLA 5EXTA 1AGRA 1DO2A 2C04A 1KAGA 2ODWA 5AUNB 4GRAA 1W47A 2B7CA 3I4LA 3QY0A 4NL4H 1RKBA 5CLQA 4ZV4A 2ZXUA 2FX3A 5JEDA 4D4MA 3IBYA 4I1SA 2G9NA 1GOTA 1U90A 1M6NA 3K70C 3ZD7A 1OHHA 4ILEA 4ON9A 5B57C 1XMVA 3JZAA 3EW9A 4A2WA 1S1CA 5L3QB 4MYUA 4Q1CA 1P72A 1V5WA 1OYWA 2NZ8A 4ZKDA 3W3AA 3X1YA 5BN3A 3FHCB 2RB4A 3E2IA 5HCIA 5FBVB 4AKIA 2WJHA 4HAUA 1JQJC 1FX0A 1P9RA 4N0EA 2ZU6A 1Y63A 2CVHA 2ZR0A 3AVPA 2QUZA 2WWWA 1KI6A 2VSOA 4UKDA 3HPQA 5H1YA 1U99A 4LWZA 3ZZTA 3REGA 1W0KD 3WP1B 3SC3A 2OAQ1 4DCSA 2VEDA 2X2FA 1IN5A 2P5SA 3C8UA 4FCWA 1SHZA 4DLVA 2BC9A 1Z0JA 3IQXA 3K1JA 4JSTA 2KBFA 4A8JB 1ZAKA 3EA5A 3KKPA 2GJ8A 3TH5A 2MSCB 3PIRA 1K6MA 4YONB 2VHTA 1KI7A 3ONWA 5SZKB 2Q3FA 2ORIA 3EIHA 1M7GA 3D7MA 3THYA 1N5JA 2H7VA 4X8LA 4B71A 3ZD6A 1SULA 4QOSA 5SZJA 3TNFA 1Z8FA 2LKDA 2GZHA 4F4IA 5B64A 3OHMA 1EWQA 5JS7A 1KHTA 2JDIA 2F1IA 2F9LA 1E9DA 4S2EA 2A5YB 3SQWA 5FTJA 2HLDD 1M1YE 1NNEA 3LV8A 2BMDA 3WBKA 4WIAA 4AYWA 4C0JA 4OQLA 3Q7QA 3GLFA 4IKEA 1X86B 2DPXA 1BOFA 2FE4A 3RVBA 1CJKC 1XDBA 3P4XA 4RSGA 1GL7A 3CRW1 3UMSA 4CEJB 3WP0A 4TQAA 1TUEA 5C4GB 1MABB 1KI4A 1NLYA 1S4QA 3AH8A 4K81B 4Q1EA 1L7VC 2VPPA 4JL6A 2WIAA 1EFCA 1ZNXA 2ZETA 3JZMA 1G8HA 1MT0A 2FH5B 5H70A 1X8JA 1B23P 1VKJA 2BKUA 4U5XA 4A1FA 3B60A 5CB6A 3EZ7A 5M04A 4PPNA 3MLEA 3C5HA 3LY5A 2GCOA 3LQRA 2A5GA 3MWKA 1X1RA 5KDDA 3RWOA 4PFSA 2NPFA 2PT5A 2ZI3A 2O8EA 3U4QB 4GL2A 3AP3A 1F48A 1EFRD 3B2EA 1NMYA 4X8OA 5JWRA 3UATA 1OFUX 3R9WA 1N3BA 1CS4C 4XSGA 1S8FA 1BIFA 1VYVA 5L3RA 4CEJA 3HU2A 1D6JA 1X8LA 1KKMA 1JR3D 1I4DD 2OXRA 3PR1A 5K8IA 4LHVA 5AUOB 1UBGA 3VR3A 2IYWA 4KFSA 1XZQA 1G8GA 1Q12A 2IYUA 3TGPA 2G77B 2DFNA 4ARZA 4KJZA 4LCBA 2OBLA 1K5DA 1F2UB 5FTLA 4WW0A 2B8WA 1DARA 4AWXA 3Q8XB 2VP6A 3K70B 1MRSA 2CLCX 4OHVA 4GI7A 1UAAA 4URUR 5IK2D 4BFUA 1R10A 4BZQA 4NP6A 4HB0A 3TSWA 4RFSA 3X2SA 4IDPA 4TMVA 3VX3A 4FINA 2VYFA 4TYWA 2SHKA 2IYSA 3CNNA 4EFNA 1T4GA 2QN6A 1G3IA 1NVXQ 3T1TA 2CL7X 2VRWA 5AJZA 5JZVA 1UKYA 1J2JA 3RSLA 3VQTA 2FDCA 1G5RA 3VHLB 2EQBA 1T8TA 1XNJA 2QPOA 3D31A 3T1QA 1VECA 5BN4A 5JSZA 1VG1A 3N70A 3ZIAD 3ZIAA 1Q1ZA 5JFGA 3JVUA 1AKEA 4PQRA 1E2MA 1E1RD 2WM9B 2R9VA 1UBFA 1W46A 2OM2A 2X8AA 1MR3F 3IDQA 3NKVA 5AWFC 1CIPA 4XSHA 4R2IA 1CF4A 4WZ6A 1IONA 5JJKA 3FMIA 4I99A 4M22A 2ZYUX 3VNVA 1DELA 2PLFA 1XB2A 1II8B 2YWEA 4LRWA 2EFHB 3O8BA 3TVDA 3NTUA 4TTQA 2W00A 5K8TA 4HZUA 1W4AA 2BBWA 1XJ0A 2LWIA 3DKPA 3U7EB 3TUZC 5EQTA 1XCMA 2DFTA 1LV7A 3SJBA 1FFHA 1KDRA 3AEZA 4WBSA 3U44A 1HA3A 2YOHA 3LH5A 2FFHA 1LW7A 3GEIA 3G5UA 3QI2A 4RJLA 5HCNA 4TZ6A 4P32A 4A0FA 1SXJD 1MV5A 1WXQA 3CRRA 3OE7A 2KSQA 4Q00A 3QOFA 2P6UA 2J3EA 4RZ2A 3T34A 1N6KA 3W90A 1E3MA 3D8BA 3CWQA 2BV3A 4V0LA 5KYKA 4GZMA 3LBNA 4DWJA 4M1KA 2Z0MA 4HLQB 3L0SA 4Q4JB 4D4KA 3ADCA 3C16C 2KI5A 4ACAA 2H92A 1ZM7A 4NMMA 4B3GA 3FWYA 4PZLA 1OV4A 4TL9A 2D06A 2C9CA 4QFMA 2IT1A 3W8NA 4GP6A 2ZANA 4DXAA 1T9HA 1X8KA 5KPDA 5JJIA 4BFVA 4MQBA 1OYYA 3FE2A 4Q47A 1NY6A 2QGZA 4Q48A 4Y0AA 5DE3A 5KHOC 3V4FA 4JKIA 5KSPA 2IUTA 1SVKA 4PO9A 4QKQA 3A1UA 2QA5A 1MO6A 3ND9A 1CR2A 5FOTA 2G88A 2F43A 3A8TA 4LHWA 5JI3E 1XPOA 3IILA 1D2MA 3RS4A 4FCTA 3LFUA 3U7FB 4A0RA 1OE0A 1SGWA 2VP4A 4DCTA 1XD2A 3OIWA 5KDLA 1QBKC 1JXOA 3R9IA 2P3SA 2QM7A 4N3NA 3CLVA 1ANKA 1DTSA 4HUQB 4O2LA 2JDID 2RKOA 4OI1A 1WBBA 2CCKA 1LS1A 1ONBA 1JEDA 2XTMA 1GDDA 1NKSA 4PAQA 4OK6A 1YU9A 1P2TA 3TUJC 5IT5A 3B13B 2B92A 2FSFA 2E1RA 3UG7A 1VYUA 4XTCS 1JXMA 1NKTA 3P4YA 2RMKA 4JJZA 2QPTA 1Z0AA 3VMFA 2I1QA 5CITA 4D26A 4OL0A 1ETUA 4JMPA 2GVDC 2P65A 2CE7A 1FNNA 2PZEA 1R0YA 2RCNA 4EQ6A 2DHRA 3OIUA 1CR0A 2AD5A 2ZYTX 3AVOA 4KVAA 1TU3A 2W0MA 4Q4HA 3PJRA 3QF4B 2VP9A 2REXB 2GJAA 3OFNA 2WWGA 4Q4AA 4JLVA 5A5GA 4NYMQ 4GSYA 3K09A 4NYIQ 5EUQB 3WMEA 4P31A 4KV9A 2HYDA 2ZS9A 1RZ3A 1YZGA 4F91B 4CEIB 4LX0A 2JLXA 4A8JA 2V6IA 3B8HA 1G16A 4OBEA 4PXAA 2GF0A 4C0KA 2V4ZA 2HXYA 2C78A 1ZCBA 5FI1B 5BXQC 1NJGA 3ZH9B 2EWVA 1XEFA 4ZCLA 1JALA 1UEJA 4TL7A 3IUYA 2RGAA 2W2XA 5JMTA 3LBIA 5GJBA 1Z07A 4URXR 1R0WA 1P60A 1T8UA 4MGKR 4YMWA 2ZITA 5FTNA 4JVNA 3CX8A 2DBYA 1ZD1A 3CZPA 1QHNA 2D2EA 4MKHA 4NYMR 2CBZA 3L8YA 1G6OA 4L9SA 1E99A 4ESHA 1XXHA 3KJIA 1W7AA 2PMDA 1AJEA 2QTHA 1U9IC 2C9YA 4TLDA 5CK5A 4OK5A 4M9QA 5KNDA 1YE8A 3I1FA 2V6JA 4L16A 2DR3A 1E2QA 3GQBA 2FEOA 4OQNA 2IF2A 1VHTA 2YWHA 2ZRNA 1OFTA 2NO9A 4R9UC 4A8JC 2FNAA 4BEBA 4ZI2A 4C2TA 1G18A 2FFBA 3KJGA 1MABA 2AXNA 2F55A 4BFXA 2IW3A 3K09C 1RVDA 5J40A 1FX0B 1G41A 2IUSA 2WZQA 2P6NA 2WJIA 3ZVLA 2DFKB 1G4UR 4A2PA 5DN6D 3RHFA 2ZSDA 2X2EA 2CL0X 2FWRA 3WYAA 4IFBA 1QHYA 3UG6A 3M6AA 2HDNB 2A5JA 1M7BA 3LLUA 4MRRA 4BZXA 1U9IA 4US2R 4PC3A 2O8EB 2ZJBA 4DZZA 1MRNA 4JYCA 1VPLA 1W4BA 1DG3A 2ZJZA 3B6EA 5EZ6B 2IYYA 1FZQA 1N0VC 5KUTA 1IXSB 1VIYA 3L2OB 3KJEA 5FH9A 1L8QA 3SU8A 2PCJA 1AS0A 4D0NA 2NG1A 3MJRA 3NBFA 2VHCA 4V03A 3C5CA 2XAUA 2OESA 4JT4A 4LPSA 4M0LA 3VHXA 4EUNA 4CVNA 3ZS9A 3OE7D 1IXRC 1S2MA 1RRPA 1H8HD 1E9EA 1UKVY 4DSNA 1N6LA 3SJZA 4DHEA 2OG2A 1A4RA 4M1TA 5AK0A 4CYMA 2XJ9A 1E9CA 4TWZA 5DHAA 2ATVA 4CW7A 5FPKA 3GLFB 2XXAA 3RRYA 2L0XA 5J4YA 2PJRA 4FMDB 4FW9A 2K5UA 1WP9A 2IYXA 1W5TA 3WY9A 3RS7A 2QAGB 4BRUA 4QNRA 1OB5A 1E69A 3QSYA 4XIGS 2BHRA 4NBSA 4AG6A 3IGFA 2X19A 2YHSA 3SJAA 3VR1A 1F5NA 4JKYA 3I32A 3IO5A 5JEEA 1S9HA 3KKQA 3OF5A 4LBWA 2HXSA 5EE9A 4EJSC 3NXSA 3KQLA 1TEXA 1Q1QA 1E1RA 2QORA 2MSDB 5FBLB 221PA 3FB4A 3DOFA 4Q7JB 3MRSA 3RLFA 1OT3A 4IDQA 3RWMB 1TNDA 4TLCA 5G41A 2Y8EA 2AN9A 2XNDD 3BWDD 4PSVA 4LYFA 2LKCA 1XEWX 2EW1A 4QHSA 4R98A 3OEED 4Q9IA 4GDFA 2AWNA 1G8YA 3BS4A 3UK6A 3KZ1E 4HUTA 5EXPA 2Q9CA 1KI2A 1I4LD 2JJ1D 1AN0A 3RS3A 2ZYVX 5FPYA 5JWHA 5CB8A 5DI9A 4HYYA 4TZ0A 1FTSA 3GJ7A 2B7BA 2REBA 2ZE5A 2CK3D 2BMJA 2FJUA 4MITA 3ZZ0A 2XZOA 2OCAA 3EAQA 4JLMA 4A82A 3LD9A 4Q9HA 4OHXA 3GLIB 3QIAA 1F2TB 2QBYA 1ZUHA 5DO9A 2FA9A 5BQ5A 4BZPA 4PC1A 4RCYA 1GITA 3EZFA 1HEIA 4M1SA 4WOPA 2V3CC 3GEEA 3LWNA 1II9A 1QRAA 2IK8A 3WHKA 3Q7PA 4OKSA 1E32A 4R2HA 1E9BA 2XNSA 4DBLC 3THYB 3KUDA 2GTPA 2A30A 4FMCB 1R6BX 2OT3B 2KWIA 5CIQA 4IOJA 1QHHA 2WPDA 2WSSA 1E96A 1KSGA 1XPUA 2UVQA 4HDCA 3U60B 1BS1A 2JCSA 3UPUA 1FW6A 4JBWA 4YC7A 4D82A 3GMTA 4EPXA 3CH4B 4JLOA 2ZVPX 2ORWA 3AB3A 4FMCF 4PAOA 1XBTA 5EE5B 3O8DA 4DJTA 4MGIR 2XSZD 4OK3A 5D3MA 2WICA 2CHGA 3R7WB 4B33A 1WDTA 2A5DA 3QPVA 2IHYA 2QRZA 2JLVA 3FHTA 1FMJA 3H2YA 3ZJYA 1N6OA 2WJGA 1TMKA 1TUIA 3VR5A 4ERNA 1XU4A 1P5ZB 4WZBE 5IDVA 3QPWA 2IEZA 2IYQA 4Z1MA 1TADA 3AUXA 3FGNA 3ASYA 3FTQA 2GBLC 4R71A 1AZSC 4B6FA 5FL7A 2ASEA 4RD1A 4TL8A 4KVGA 4BLTA 1N0WA 3H86A 4BWYA 3LQQA 4GBMA 2EFGA 4K46A 3T35A 4PO1A 1IY2A 3FDIA 4MGZR 5FTMA 1YZUA 3PITA 2IYVA 2WBLC 3SFZA 5D3QA 2C8VA 4H1VA 2J7PD 3W3ZB 4HDQB 1SVWA 2ZR9A 4PX9A 3BB1A 1X6VA 3TR0A 1KK1A 1COWD 2VL7A 2BBOA 3TBKA 4NPHA 5FBWB 5L3SA 4LJ8A 2J0VA 2OFWA 2J9RA 3SJCA 1E2FA 4DC9A 1NN5A 3RAPR 3QPUA 1IOZA 1LVGA 4LGMA 4CEIA 4TYNA 4NTZA 4TYPA 4HUQA 2VTKA 1OIWA 2QG6A 2YJTD 4LJAA 1GL6A 4LV8B 4Q19A 1OFIA 3CUEF 5DNYB 1FUUA 2G1JA 2WJYA 2ZJ2A 5AUQA 2QNRA 1TQ4A 2OILA 1U94A 4TQUS 5HTKA 3VKHA 5EXSA 1NLFA 1IN6A 1Z6YA 3AP1A 4Q9JA 1Q44A 1EFHA 3TQFA 1OH7A 1GVNB 3NEYA 4W7SA 1FP7A 3CWZA 2D7DA 5KO2A 1HH4A 2ZJ5A 2C2HA 2DWQA 2ZRFA 3CZQA 5JECA 1DAGA 3QF7A 1E1QD 2ZRCA 2WWFA 4Q7MB 2WMNB 4W5HA 1UBEA 4MKFA 5JI2E 4B3BA 1ZU4A 3CM0A 1IN7A 3EG5A 5FR2A 5AJXA 5CDFA 5BYJA 2HJGA 1N0UA 4RKEA 4C7OA 1COWA 3NIBA 1NBME 4PSAA 1AQYA 3GJ6A 2F7SA 2QQEA 421PA 4JLKA 1UJ2A 5FOWA 2NO0A 1T91A 3AKEA 1R8SA 1SVOA 4A6XA 5F98A 1NMZA 2O0KA 1VG8A 1C9KA 3EWAA 4D80A 5EE3A 2O8BA 4QGHA 4QJ3A 1VCNA 3I8XA 1NVVQ 2W83A 5EUMA 3IKJA 3NBZC 2JA1A 2Z43A 2ZYWX 4JVMA 1K5GA 1E2IA 1PLJA 4OHZA 3IQWA 4TLAA 3KL4A 1RYFA 3PEWA 1Z22A 4B74A 4D6PA 4ASUD 1DG1G 1LB1B 2OE2A 3CONA 3X1XA 5L3QA 3SYNA 5HKKD 2O5VA 4AC9A 4KXFB 1X1SA 4Q1DA 2V7QD 2J41A 3C15C 5CJ2A 4NH0A 1NF3A 2DWPA 4KFRA 3H4MA 5BWMA 1KO8A 4PQYA 1QF9A 3ZLJA 2R6FA 2RGDA 4QC2A 4EJSA 2GWHA 5IRCD 3C4JA 1OW3B 2H1LA 1ZIOA 1KK2A 2YWGA 1QZXA 1R8QA 4Q9KA 2FGKA 1U0JA 5P21A 2QMOA 5E3HA 5TDHA 2NO7A 4L9WA 4RZ3A 3PXGA 4DT1A 4ZPXA 1Z3IX 1JR3A 3RRMA 3K9NA 5J5CA 1E0KA 2WWIA 1NG1A 3GLGA 1DAKA 1FTNA 2F43B 2R8RA 4HAYA 1IY0A 1SVLA 1E0SA 3U3MA 3RSOA 3R8FA 2FSIA 4PTLA 3X1DA 2VP5A 1CBUA 4A15A 5KSZA 1M8PA 1R4AA 1NN0A 3C14C 3GJ3A 5JJLA 2YOFA 2ATXA 2DB3A 2GXAA 2BCGY 3MSXA 1UADA 2ZU0C 2WPDD 2WSSD 4B34A 1GILA 4KFTA 4N1AA 3AUYA 1CR1A 4EJSB 1AM4D 1IBRA 3PCRB 1E9SA 5EP1A 2GCOB 3RRNA 1G5TA 2VP0A 2OHFA 4LV5B 2ORVA 4FIDA 2HJVA 3WMFA 5AUPB 4OQMA 3I3SR 4QGAA 1V43A 4DIEA 1HTWA 2IL1A 1N2CE 1RRFA 3KQUA 2G1KA 3V9PA 2JJ1A 4V0OA 3NG1A 1UM8A 3IIMA 4OI4A 4WAUA 2GF9A 5HZHA 4GZLA 1EXMA 1GRQA 3QNUA 3GLIE 4BEJA 4DEYA 2GDJA 1GP2A 3MFYA 3TLXA 1IJFA 3E1SA 1S0UA 3HU3A 2BEKA 4PHHA 1EFUA 4TYQA 4M4SA 2IEYA 3W6NA 1OKKD 1PLLA 1XRJA 3AVXA 1SVSA 2RHMA 4B2PA 3FFBA 2WHXA 4MDEA 1E2DA 4PAMA 3VNUA 1L2TA 5C4MA 1YZTA 2QQ0A 4MYTA 2V54A 5A0FA 3B78A 3OEEA 4KHZA 2QY9A 2ZROA 4UNRA 1EX7A 2WKPA 4QGFA 1XZPA 4JYBA 3Q72A 3UANA 3RNLA 4YLGA 1ODFA 2VLIA 4CT4B 3DL0A 3X1WA 4B76A 3GLFE 1LY1A 4QBGB 4FN5A 1WMSA 3NDBB 2WWHA 2BWJA 1HQYE 3ZQ6A 3K0FB 2GEDA 3K0CC 5F2EA 5CDFE 3K9LA 1XX6A 4HAZA 5FL3A 4WZAE 2IC5A 1TQDA 1W0KA 4GNKA 1N6PA 3W6OA 3K53A 2Q6TA 1Z83A 2ZUDA 2IXFA 3N2EA 3Q5DA 2GEVA 3DM5A 5KNCA 1E2GA 3FPAA 3EARA 1HQCA 4UXHA 1WRBA 1MO4A 5FOXA 1JPNA 5J4KA 3O47A 3OEHD 2DY1A 3OEHA 4DLYA 1XF9A 5G53C 2QE7D 2O0HA 2YV5A 2V9PA 5G3YA 3IIJA 1EGAA 1U98A 5H8WA 5CM8B 3JVVA 1GL9B 2J0UA 1OXXK 1GSIA 2OLKA 1ZCAA 2ZVQX 3DEFA 3FKSA 3QENA 3AVWA 1CU1A 2C98A 4LHYA 3K70D 1YHNA 2QMUA 5UKDA 2OBMA 1ZNYA 2QP4A 2IXEA 3U2QA 3GLIA 2O8CB 4B3CA 2MMGA 2O8FB 5AR1A 3EZ9A 4IOLA 4BFTA 4JBYA 3BH7A 2GA8A 3MG9A 3KTAB 4FWIB 5EE0A 4DDWA 1OH8A 1GAJA 1OH6A 3BB4A 2ZRGA 3LO5A 3F0TA 1XTRA 1A5TA 4D4LA 1ELOA 3IO3A 4OI2A 5FUXA 5ELXA 5D3MB 2BCJQ 2PL3A 2B8TA 1BO6A 2WOJA 1P6XA 4M8NE 3TVTA 1P7CA 2C99A 2C77A 721PA 1NJFA 5EXXA 1NL3A 5FL7D 1FOEB 2BJVA 2FN4A 4OQFA 1T5IA 2W6JA 2R44A 1P61B 4WA7A 4YMUA 2Q9BA 4NKRA 5FPHA 2O8FA 4QNMA 4W5JA 1BYUA 1H65A 4EPRA 5IHPA 4L15A 4DCUA 1S1MA 2H8KA 4B35A 1JQLB 3CF2A 2JLWA 2YVUA 3HYTA 4AURA 5EJEA 3HR8A 3W5IA 4NZYA 1Z63A 4F4CA 1NRJB 2FPLA 3NH6A 1OXUA 3QVUA 1UDWA 3K0EA 4P4SA 3SYKA 3AVQA 4D0LB 4DB2A 2IS2A 3DKVA 2QTFA 1U0HC 1UFQA 4US1R 4L5BA 2FMXA 4BLRA 1Z6GA 4ZKEA
chains in the Genus database with same CATH superfamily
3ECCA 1D8TA 2JI7A 4KDCA 5F9HA 2YBEA 4LXYA 1BSVA 3PF9A 2RGXA 4C7OB 4J0QA 4W4TA 3OZBA 3A6EA 1PJ4A 4B79A 3KQHA 1MC1A 2ZT5A 3OTQA 3EVBA 1CLUA 1FCJA 4C4XA 2LVBA 1EFRA 1K6IA 3OZTA 4X1KB 3GAAA 1KZGB 2FMTA 1B8UA 3DEKA 2FZLA 4OJNA 3CX7A 4OHRA 1EM6A 1YKSA 1GKIA 2FSSA 5JHHB 1UZUA 1JPVA 3LY8A 2EEPA 5FWYA 1F6DA 5DGXA 2V7QA 3WB9A 2EDCA 2NO1A 4QODA 1IUPA 4N82A 2WE8A 1GFIA 1T6BY 4CL2A 3F3SA 2GZ2A 2QTAA 4M9SA 4A27A 1ADJA 2NTJA 3MJCA 4Z9BA 3VO8A 4F6RA 4MP6A 1CYEA 3VNBA 1LSOA 1CUXA 1ENZA 2FK8A 2WFLB 3L0PA 2ZT7A 3TI9A 4YDHB 5DYGA 3LL4A 4LDNA 1DQPA 2R7NA 3UKDA 1D2EA 2PKCA 4D98A 5JWOA 2VH1A 1IWOA 1VRCA 2XW6A 3CSUA 4NDZA 4Q7KA 3RS2A 1L5GB 3UAGA 2Q5IA 5ECWA 5FOSA 3AFNA 3E0XA 2O5RA 3K32A 2HHLA 2HGSA 2XCUA 1J0CA 2Q9UA 3OJXA 2FZ4A 5BSGA 2IY7A 4N7BA 5B30A 4FW8A 1N6HA 4DCVA 2AQKA 3R3VA 4C6TA 4D8WA 2WJVA 1I2MA 1P7ZA 1EB9A 2GHQA 2X6TA 2X9LA 2YNMD 3MJTA 1W2HA 3TNJA 1UEIA 1SQSA 4QBHA 2IEBA 4CDGA 2FW6A 5FBQB 2GERA 3QGMA 1C3XA 3KBBA 2G71A 1ZMOA 4MIEA 3W8RA 5K0TA 3KCQA 3U7QB 5KNBA 3G5MA 4GZ3A 4O2AB 3OC0A 4TXNA 4CXMA 2XUJA 2P6PA 1Y9AA 4INOA 2JIDA 3A05A 3OZFA 4MI3A 1K66A 2GYWA 3FH0A 4Q01A 4DY6A 2PQMA 3SN6A 3PVSA 3T12A 3Q40A 1YCFA 1YS4A 3WDKA 2XECA 2VZ8A 3SZGA 4AKGA 4A1OA 3PXDA 2OP1A 4KUHA 4M46A 1TYZA 2PGLA 3DO8A 4DJDC 4ETIA 3FZQA 4GM0A 2JEOA 3PLRA 4M1ZA 5T8KC 2D5AA 2Z4SA 2ZW9A 4LUCA 5F3DA 3TW4A 4G5QA 2OO3A 5FTWA 1PZFA 3ASZA 3IV6A 2K4MA 3V3KA 1NI3A 4ERXA 2J0SA 1T5BA 3KSRA 4MVJD 2WZCA 3C70A 3U0VA 1MX1A 3HY3A 4I55A 4Q3OA 4RKFA 3CLTC 2ES4A 3QELB 3Q2OA 3RYIA 4N8EA 4QXAA 4Y67A 1TZ2A 1V1RA 4MQMA 1R3DA 5DYIA 1KI1A 4NE9A 4RPIA 2BFOA 2IF0A 4RMNA 4X0EA 3DE4X 3EWSA 2L69A 4F5EA 4MB0A 3T52A 5LQUA 2EG9A 1ZHFA 5KQGA 3CRZA 3BE4A 1CFJA 1HLPA 3K6RA 1V48A 3R6GA 3DZDA 4X7PA 3HXOA 2UXDB 1D6NA 2GAFA 3PDUA 1X3LA 4IDNA 1US8A 5LVAA 4PYJA 5KS2A 4LYGA 4R1QA 2FUKA 2JHCA 5D00A 1WX1A 1O95D 1BHJA 1YCGA 3EIWA 4PRYA 3II6X 2MSEB 3F4LA 4GSLA 3TLCA 1XP8A 4B9EA 1XRSB 1JKMA 2XTNA 4FILA 4Q9NA 3SXUB 1ZMRA 3B1JA 3SI7A 3PQ3A 4DCOA 7MDHA 3ECSA 4LAFA 1NASA 4Q4AB 5CDYA 1TUGA 1RP1A 1NQOA 3D4OA 4GX2A 1EAYA 2BEWA 4PLPA 3ENQA 3ROQA 3DQPA 1ZLXA 2JFZA 3VI4B 4X6YA 4D9HA 2ZCJA 3QLTA 1YS6A 1VHLA 1PGNA 2B8NA 1YQGA 2II6A 2JFGA 3CLSC 1SU7A 1RXUA 2QLJA 3BZBA 1Q1BA 3D8HA 2E6UX 1Y5NA 3H87A 1PBNA 1UDCA 3GFTA 1DQYA 1ONNA 1QAMA 3M2TA 4OQQA 5J5VA 2R87A 3VKWA 4Y9DA 4CCYB 1YULA 4D9EA 3FPGA 1AZWA 2FPIA 2W11A 5AI6A 2NP7A 1WR8A 5C81A 4Z6KA 4BFWA 4X94A 3A04A 2CMFA 4ASUD 4CETA 3OA2A 4NBRA 1L5RA 1IZZA 1S3GA 2W93A 3N2KB 1CERA 2ERYA 1Q7BA 1C5KA 1HDEA 1DAMA 1HG0A 2XV1A 3A26A 4TWIA 1W85A 2IE8A 3KB6A 1AVTA 4GPZA 1J8MF 1R6UA 1U5BB 2I7XA 1XXHB 1MKYA 1J2RA 2WJ6A 3A4MA 1DOAA 3EXEA 1QVRA 3B6MA 1C8VB 1BX0A 3JYOA 1T6ZA 4M87A 4E6EA 1XCOA 1F8FA 4LISA 5DHSA 1WCXA 5JCOA 1ZW6A 3SY8A 2H6EA 1F2UA 2FPSA 2HWXA 3A58B 4LOAA 3TZLA 1PR9A 1AUXA 2TMKA 5CNMA 2Z9CA 3E61A 3Q3CA 1LDYA 2HREA 3OKPA 4MQ5A 2J67A 3KFXA 4RESA 4G0YA 2CUZA 4I5DA 1A8SA 2PZJA 3ABIA 3EGCA 4OM7A 2CNWD 4RNDB 2AUTA 3NUZA 4I1UA 1PIWA 5EP4A 4ZT4A 3PWZA 1P0FA 1PJZA 4B48A 4EPYA 4J7XA 4GR5A 4E4YA 3UOGA 1OB2A 5JCZA 3R6WA 1I2BA 4IOKA 4F3YA 2CMKA 2D5CA 1CK4A 4UHKA 1ZOLA 1NVWQ 2ABWA 2HR1A 1NSYA 5J47A 5AI8A 4GBJA 1N6NA 1CEQA 3OLXA 1HDXA 4NMHA 4I9NA 1BTOA 4BXOB 2WIBA 3VYVA 3GGJA 4BYMA 4FTWA 4BLPA 3BSWA 4CG2A 5ADHA 1A9PA 2AZ4A 1Q7EA 5F2OA 3THOA 4XJXA 3V97A 4F9GA 5B7QA 1HPLA 4KQ1A 4F4FA 2H1SA 1RYNA 1NR7A 5EP2A 2NSYA 3TD9A 4CLEA 5C32A 3W5DA 4TLEA 2JLYA 1H5NA 4MGEA 3ONDA 1E61A 1TT5B 2KX7A 3PHJA 4IW3B 4F86A 6REQB 5KX5F 1PEYA 4BB9A 3NDPA 4EA9A 2IJGX 2P9FA 5C5DA 5HKKA 5LDDC 4LHEA 5IAGA 2WHQA 4OEHA 2IYAA 2EJVA 5IMSA 3K1TA 4LCEA 5T4EA 2Z4RA 3GFPA 1Q0UA 2CXXA 3H11A 4K6CA 1E6KA 4PZ0A 1CRQA 3D1LA 3ESXA 1U1GA 4DV6B 4JLUA 4GYYA 1TW3A 3FGZA 4P4SB 3K0AB 3PR3A 4AJEA 1TOAA 4XVUA 1H3EA 1UXJA 2GPSA 1U9ZA 1G0OA 4RCZA 2JGDA 4TT3D 4B7CA 1DXQA 1M8KA 1YL6A 5T4BA 2CVFA 1F20A 1GUFA 2CLOB 1DCMA 4DTIA 1Y3HA 3ZQ4A 3H5RA 4U00A 4L4SA 3QE9Y 5AD1A 1N0IA 5L7TA 1R8JA 1DJNA 2GBCA 2P0EA 2YS7A 4TSKA 4MJXA 5DFAA 5GWXA 3F1LA 3GNSA 3MPOA 3MINA 3AWDA 5KVQA 5EIAA 1O77A 2ECQA 3HBFA 3DW3X 2GCIA 3SDZA 1ZSVA 2NSJA 4RFVA 4H15A 3HDJA 4B6QA 2FUEA 1G2PA 2V7XA 1WNFA 2J8ZA 3GJXC 4DXDA 2EKZA 5DBEX 4CLOA 4UVIA 2FPXA 3JAKB 4I9UA 3R7LA 1ZUIA 3HWRA 1SOAA 2J5RA 1R0ZA 3JW8A 4DLPA 3MHTA 3TSOA 1P5JA 4V0MA 1JRLA 2UKDA 2AZTA 3STHA 2OO5A 1VGVA 1JECA 3CEPB 2LXNA 5C8XA 4RVNA 3EAGA 1ZRSA 1G9SA 3HDVA 5EJ5A 5IZ4A 2R86A 4K6KA 4MQEA 4X1IA 4D41A 1P44A 1H2ZA 1OXSC 1UK8A 5IF9A 4ZZIA 4M9RA 4EMSA 1JEQA 4FS8A 4EQZA 2WSIA 3OQBA 2CC2A 2OD2A 3NANA 3GD5A 4EKYA 3A36A 4PN3A 3FMFA 1PRYA 5BORA 5IXYA 2E7ZA 3EF0A 1SBZA 3C7AA 3MTEA 1QHSA 2ZWMA 1U7DA 4G5OA 4TTJA 2JPDA 3HDTA 4YACA 1XTZA 3KKLA 2D8MA 4U39A 2NMVA 1JB1A 5DLPA 1ZNZA 3C48A 2WYOA 5KOJB 3DWFA 3IUMA 2B4YA 1PWHA 2QRJA 1L5OA 3IT0A 5DLQC 4CQLA 2E55A 2PWYA 3A1NA 1LTQA 1NBHA 2Z58A 1KXJA 5KU1A 3BF8A 3E7DA 2Q7OE 1P1JA 1TCUA 3A3YA 1GYQA 5EJGA 1JHPA 2FAXA 1E7SA 4MYSA 3VVLA 4CF4A 5LOVB 1IEXA 1XZKA 1FDIA 5DX0A 1QSGA 5CIWA 1TJ3A 2NGRA 1Z75A 2R5FA 4QG7A 4ZAWA 3VV3A 1XPRA 1QRTA 4U2DA 3ZHBA 4ZT5A 1OHHD 5IYZA 2QJOA 2WYHA 5EXEA 1WBDA 4K05A 4WE3A 3K4PA 1MF7A 2GPBA 2XLBA 3GNQA 5LZ8A 2MR6A 1OXTA 1IZYA 3DMNA 4QZVA 1CUDA 1OXVA 2NUAB 3VMMA 4M54A 1Y42X 1H2WA 1VSQA 4JEHA 3GXOA 1ZD5A 5AVWA 1CB7A 4MR8A 2Z1DA 3OAAD 2WWXA 2LP4Y 3K9HA 1E79A 1L7NA 3LXRA 3OQIB 4E2ZA 3ZY4A 4Z0PA 1OPXA 3GFSA 5FWXB 2GKGA 4R9SA 5FBRB 4UBMA 2JH8A 2YMLA 2IPNA 3M89A 5DEIA 4B4WA 5B4UA 2PMWB 2C42A 5KYTA 3OIVA 4PSCA 4UASA 3ZIUA 3TKYA 3HY6A 5DX8A 2HJSA 5ITSA 1KYQA 1YAJA 3I9FA 4RJTA 4JFRA 5DK6A 3W6PA 4Q34A 3H7AA 4OXKA 1KOFA 3SBOA 3SHFA 3BTVA 4BNLA 1GCIA 4XWOA 5AW6A 4M9CA 3GRUA 1U8CB 3PD7A 4G8CA 4HDNB 4MJ3A 1Z08A 2BHSA 3THRA 1CUAA 2ZRHA 1YQTA 3USCS 2P6RA 4C7BA 2WOOA 2AJBA 5EINA 1ZWKA 3LKDA 4GKJB 4CN8A 1K7EB 2PPLA 4HQ0A 5DTQA 1XEXB 1PL8A 3CPJB 4Q6BA 4X1YA 3UB3A 3MGBA 1SQFA 3U7HB 1PBTA 1ZGGA 3W79A 1M0SA 3A4YA 3R2JA 1EG2A 1GZUA 3OZIA 1RM5A 3N8DA 2WKQA 4MP8A 3UUWA 5KTKA 1MVLA 3SBEA 1O5TA 3GJ5A 5KYWB 3LUAA 3V7FA 3HKCB 3OJCA 4P35A 3DZFA 2FPIB 2YRWA 4EVSA 2W42A 3LBFA 1H42A 4LWPA 4XTRA 2AMYA 3KAPA 2YHAA 5EWLA 2JS7A 4RTKA 3NHLA 3EZNA 2A9JA 1G5QA 3AEQB 4KPYA 2PGAA 1XHFA 2XPCA 3EQ7A 1L5YA 3LBHA 5LQRA 2WVJA 1IQ0A 3NX4A 1G3MA 1WZIA 5ALWA 5E0OA 3ZLVA 1Y1QA 1ZR4A 1PLKA 3C8HA 4BLVA 4ZMRA 2W22A 4LJ5A 4YASA 3H7IA 3P0EA 4G0XA 4L07A 4TKVB 1HORA 2P9HA 4H7EA 1KMHA 3LDHA 1T4DA 4II3A 3AX6A 1YFZA 4PEVA 1PFVA 2D1YA 3LXXA 1HURA 1XXHE 5K2OA 3X1ZA 4DDTA 3M6MD 4YO8A 1GPMA 4AW9A 1EAMA 2CF6A 3IXLA 3PV0A 2F6RA 4Q4JA 1OIXA 3H8SA 4BNHA 1JR3E 2BEJA 1Z33A 5AI9A 4BKPA 1YDHA 1PGOA 2ZBFA 5LLDA 2RBKA 2C5LA 4W6QA 5B1EA 3QXHA 3B36A 2DCMA 2XB8A 1OOEA 3ORYA 3Q6IA 3QUBA 5C18A 4OLAA 2RGNC 2YYZA 4KRFA 2A1TR 2YW9A 5TV2A 2RCYA 2VA8A 1PE0A 2OZLB 1MIOA 3ZQJA 4B7XA 2G04A 3CA8A 5E4FA 1G3QA 4I08A 2Q4BA 4GP9A 1TEHA 3OD5A 4KBFA 3ZYCA 3DVSX 5ANRB 3RGGA 1HTBA 4R1UA 4CDRA 1NVAA 2ZUFA 2H51A 2JI9A 5LJLA 1V39A 1U7PA 4ZI3A 4XDGA 3DO6A 4J2HA 3BL5A 5BSKA 1OAOA 4FQ7A 3AU8A 2A1IA 3IOMA 1UWVA 2B1RA 4FGUA 1J2EA 2VDRB 2YWCA 3DBIA 1Z7EA 3R3HA 5ALEA 5WRFA 3TLKA 3T3MB 4BE7B 1O6GA 2RH5A 4RV4A 4E15A 1DC7A 1KP9A 3DDUA 5KQRA 1E4VA 1LDGA 4HLUA 4GOJA 4ZQFA 5HF5A 1V47A 2PR7A 4HBGA 4GXQA 3PUHA 4K40A 1EGQA 4XEUA 1A2QA 4Z9XA 4DVGA 5IU6A 1ESMA 1O5OA 1G8JA 3F6PA 3B12A 3N6RA 3F4KA 1Q0HA 5FXMA 2G67A 3DTVD 4GYKA 5D1NA 2X5OA 1K3FA 3GK3A 2E1PA 5CXUA 1DAFA 4NU6A 3ENNA 4KR2A 1RLIA 3MCUA 1KGDA 2B3DA 2Q99A 3E5NA 3DBOB 4KVZA 4HS9A 4FLEA 5EGSA 2CJFA 3O4RA 4F4UA 2WTBA 4Y6LA 1AS2A 3TE6A 2JJ8A 1JSRA 4Y9RA 3A2KA 1C8BA 1I6MA 4FFNA 1KIMA 3WC4A 2EW2A 4QM6A 2VBFA 2VHJA 1UOEA 4KNYA 3M4YA 4IRMA 2KE5A 1ORHA 2IYLD 1NULA 2BZ0A 1VFPA 4MCAA 4NS1A 5IP5A 1KEEB 1VPTA 1IG3A 1UIRA 3HVHA 1QGUB 2W6CX 3CPHA 4WFKA 3WHLA 2AKAB 4BKRA 4IZIA 4KXUA 1SZPA 4E5KA 3AILA 3JSAA 3FVWA 3BUSA 4TQGA 1WOYA 2HSGA 1N2IA 3OLWA 4KZPA 3P0RA 4A8TA 1K08A 5DNAA 4QHTA 1DX9A 3VJLA 3GFRA 5KTMA 1FP2A 2OCKA 4TS4A 2FEXA 3U4IA 1OZGA 1PU2A 3BYZA 1E79D 2A4KA 4GGPA 2X76A 1NU6A 1UBMS 4N5HX 1SZDA 4RWEA 5EWJA 4WBNA 2JLVA 1UBNA 2QYSA 3U09A 4X7RA 3T4EA 3OOWA 4G1BA 2JAQA 5AW9A 2Y76A 1THTA 3CR8A 4FYWA 1XTUA 2IV3A 4F3CA 4FLMA 3UH1A 4ALNA 1NAIA 3U7GA 1RKQA 4M7WA 5KSYA 4Y0VA 1JKFA 3FFAA 3N2YA 1SB9A 3NBYC 4P83A 3RVNA 5K03A 2DWUA 1JEJA 1EM8B 2HA2A 4RD3A 3S28A 3EEBA 3P5BA 4ZI7A 5TT0A 1SR8A 2IP4A 4EYEA 2J45A 2I3DA 2XDWA 4DLUA 4N6NA 4W5QA 3P2MA 3FMPB 4UNSA 4XYEA 1ADGA 4JK3A 4WEQA 1E2LA 1CJMA 1HV8A 5CGQB 1JNYA 2IPMA 1P4RA 3FYHA 3HSYA 3ICOA 3DMRA 3H0EA 4PW0A 1E2EA 4UEJA 2GYVA 4ACBA 1J24A 3V42A 1NW6A 1VJ5A 4YRRA 2DE0X 3NXKA 1FS4A 1D6SA 1BD4A 4G0WA 3WKDA 5CAEB 4K1XA 5F12A 3M33A 4V02A 1IHPA 2HUPA 4KR0A 1S2NA 1GTRA 4M7PA 4LYAA 3X1KA 5AHWA 1TD9A 1BQ4A 1Z0SA 4NV1A 3D4LA 4A9AA 1TAGA 1ZU5A 1C81A 1C30B 4PHFA 3V9AA 4DDVA 1T3ZA 2C3UA 3GJ0A 1JN0A 4G67A 1GV1A 1RQXA 1Y9ZA 3TSZA 1NJ5A 2REQB 5C46F 3UBMA 3R7SA 3K0SA 3HBMA 4YQEA 2OXFA 4JQZA 2QSZA 1ZP6A 3DTNA 1IYZA 1HE8B 2EGGA 4BLSA 1WKCA 1CQJA 4FFLA 4ZI5A 3FPCA 4GMGA 4HK4A 5IWCA 1LPOA 1OPRA 4HB2A 1CQPA 3PWSA 5EGNA 2IQ5A 3CJTA 1BC5A 1LD3A 1G7TA 1MU0A 1Z5NA 2PYZA 3Q9LA 4PBSA 3BDIA 4X41A 2YJ4A 3HB5X 1OXBB 2YFQA 4U7PB 1W2WB 1SG0A 2HLDA 2Z8YA 1L5SA 1BWSA 1N2XA 1N2OA 2RKBA 1ES9A 1YR3A 1P5FA 1GGKA 2P0AA 4N01A 4NNPA 1NYRA 3OTWA 1NRWA 1G0NA 1POXA 4PLVA 1U6IA 1N5LA 3OPNA 2JK0A 1UDXA 4KE7A 2F8SA 2WINI 2D2XA 1U1FA 3H5NA 1UF9A 5LB4A 4RHXA 3WKBA 4EBFA 1GLNA 2IYNA 3CGGA 3WMGA 4LOLA 3MWLA 1RPTA 4DG5A 1XQVA 3UHAA 4QWWA 1J8YF 4EY7A 8OHMA 1X7GA 2JBHA 4DSTA 1G55A 4Q0MA 5A05A 4HNAB 4ZQIA 2RHHA 2V7BA 2E82A 2OCYC 2R66A 4MA4A 3FSGD 2G0NA 3OO0A 3QEBZ 3GJRA 3DV0B 1Z5VA 1N77A 1YVPA 2VHEA 4FN4A 1AE1A 4PCVA 4RIFA 1C8LA 3RG2A 3ZG6A 4B73A 4Z51A 3TDNA 4KHPB 3PNSA 1KKUA 1F38A 4G5SA 5G3ZA 3TOSA 1UBRS 2H16A 4QDXA 3MJFA 3UZUA 1THMA 2YUIA 1TM4E 1VCHA 1PTJA 3DT8A 2QXUA 5CVJA 4PC6A 4KIJA 1T2CA 1V41E 1CJUC 2TS1A 3L6UA 1TZBA 2FE1A 5ER9A 1WUTA 2QL9A 3RT9A 3CR7A 1A8QA 2H17A 3UMVA 4TRMA 1C7IA 2PZ8A 3O6VA 4F5ZA 1W6RA 4DMHA 5BWCA 3H05A 1P2FA 2I7TA 2JGLA 2OQRA 1FRFS 4PZAA 3MCAA 1N4AA 4AJLA 1QIEA 1TCVA 3F5SA 1YJQA 1E1NA 1RZRD 1EE9A 4ZALA 3E1GA 4TTIA 2Z5FA 4AWBA 4A2QA 2IUEA 3NIFB 2Z09A 3M1YA 4DQ0A 5HK9A 2RGRA 1WSDA 3E2MA 2AZXA 5AJTA 2I4MA 2QX6A 3AT1A 1NDHA 3TRFA 4BMCA 4BQIA 3R1IA 1ZKMA 4OJQA 3JQGA 2GNPA 3CIOA 4C30A 3RTBA 3COWA 1JB9A 1I33A 4CN9A 3N2GA 4BUJA 4B3FX 1IATA 1LJUA 3ADKA 2LBPA 3OQIA 1EK1A 3TEMA 6NULA 2PKQP 2CBGA 3NC0C 2A35A 1CWUA 2Q4EA 5G2OA 4U2GA 4QBFA 1T2AA 1Q0TA 3W34A 2FSVC 1JL3A 1X1CA 1QB8A 2I4RA 3DOCA 3H2IA 5M3BA 1CZOA 1KJIA 2LR0A 3OM0A 2PUWA 5AM2A 5JXWA 3F73A 4O1HA 2PWAA 3KFVA 3U61B 2NSHA 2V98A 1KTIA 5I9TA 2VZ9A 3RRJA 5AKEA 4I6GA 2G9UA 3W2IA 1K4YA 3HUEA 3ZY6A 3EJWA 1A8IA 1FPMA 3WX0A 3VU3A 2J6CA 5FYQA 3R9KA 3IA7A 2RDMA 3S2ZA 1GTSA 5IANA 1YRBA 5DWQA 5A3JA 1U3DA 1KSHA 3BE5A 1ADFA 1U8EA 2WG0A 3KKNA 1B0PA 5D1HA 1W4CA 2HMUA 3OJLA 4KXMA 4WY8A 4BGEA 4EVRA 3ZBPA 2DPYA 2V45A 5KYYB 2B1JA 3QF4A 5KPJA 4JLBA 1O87A 4LHSA 1JVSA 3K5IA 2PWBA 2QV0A 1E2NA 3KX2A 4ZWNA 1NW5A 2OHXA 3DBRA 4EDHA 1XEAA 1L4NA 2GK3A 1QVAA 1MOSA 1Y5IA 1KAQA 1M2WA 1UFOA 2R65A 1SUSA 2Z6VA 3B1KA 3KZKA 3MJSA 5GONF 5B1YA 5IN4A 2ZRLA 2DQYA 3OPYB 4R3UC 1UBHS 4AX4A 1ODSA 5ITZA 2IODA 4QGGA 3O4GA 2FK7A 5A9TA 1LPMA 2WIGA 3UN1A 4OLJA 3PXCX 4CM4A 3BGOS 4RYDA 4WFJA 2CKDA 5GZ3A 1Y3IA 5AJYA 1N5OX 1GPNA 1EVQA 4FC6A 3RC7A 1NM5A 1NMXA 2BJWA 2PA3A 1TL7C 3MCWA 3QKUA 5JRJA 1EJ2A 4KL8S 3SM3A 4KTTE 4BVBA 1KO5A 2Z30A 4D6YA 1ZPDA 2EW8A 2PT6A 5K0SA 1C7JA 1E3DA 1JKJB 3EA0A 5G40A 4BX9A 4RVHA 4F7DA 2G07A 1EQ2A 1M1NB 1VG9B 4BNKA 2DHCA 3T8YA 4KOAA 3ZE2B 2BI7A 4OA5A 1DJOA 2G9ZA 4XD7D 3LNCA 3ZDXB 4KIWA 4TMZA 3F90A 1JBKA 4DUZB 1SN7A 1YQXA 3ACBA 1PSWA 2O2EA 3PX2A 4ZD6A 4DUGD 4A0HA 2IBMA 4EGAA 4YS6A 3MZ0A 4GI3A 1NXTA 2YVKA 4YQZA 3I5YA 1Z0ZA 4JX8A 4PZZA 4ITRC 4PLCA 3HXQA 3EDMA 3MCVA 5FUVA 2IYOA 3I2IA 3ILVA 1RQLA 2B35A 2BFMA 4KAXA 4XR4A 5EEHA 4F3RA 1XCGB 3DFIA 1S4MA 2HAEA 3P71T 4OXXA 1JDUA 4GHWA 5IX8A 4EG3A 1OY1A 4BN0A 4W5TA 1J97A 2ZPTX 3C3MA 2G5TA 2P2ZA 2QP9X 3KKZA 2EP8A 3OFND 4IDEA 1JHYA 4JI1B 1HYEA 2AK3A 3RU7A 1TO6A 2B99A 2CNLA 2HX1A 1EINA 1POWA 3B5IA 4J0IA 3TFQA 4EENA 4O59O 5I7WA 1C3OA 1KDPA 1UKCA 2C29D 5DLYA 3U26A 5L4LA 1EM8A 2AFIE 3AERB 1GUZA 4MB2A 1HSZA 2YKGA 5G1OA 3JD1A 5T3YA 2Q0XA 2D5LA 5FNVF 4F2DA 5B36A 5TB5A 2R7KA 2ZJ3A 3OESA 3NC4A 2IOHA 3ACDA 1TAHA 3DFZA 3MGAA 2NVOA 2ZBUA 1D07A 4XUCA 2YWDA 1X9HA 2EQ5A 3GT0A 1TQ2A 4MEJA 4ZOBA 4B43A 4YAOA 2L17A 4EHBA 1ZM2A 4JI7B 1GO2A 1RM3A 2JCXA 3GLHB 4Q9DA 1QGED 2P78A 3FCAA 1LC3A 1QDUA 2ZSIA 1I4TD 3A1SA 5AH0A 1V8BA 1Z28A 5E9QA 5EIOA 5EY5B 4MRPA 4BO0A 2R2AA 2PSJA 4QXMA 5FF9A 1WOMA 4OYHA 5LM3A 1N2ZA 3GFOA 3VR2D 3DDSA 1SD1A 1MOQA 2H1CA 2E4AA 3ADDA 3BKXA 1T6NA 2O7NA 1KAMA 5M7EA 5TLSA 3PEYA 1MC4A 4FJ2A 4HN9A 1YRAA 4RHUA 4P81A 1QU3A 1D2RA 3QG5A 2QMEA 3HCPA 3JRWA 1J4AA 4X45A 1B16A 1D03A 2HU5A 3JALB 5FUWA 4UUNA 3TNYA 3TFOA 1FP6A 2BE9A 3KPUA 2D74A 3V4VB 4PWYA 2LCIA 3GUZA 1SUBA 4MR8B 3MGCA 1I7SB 3EXG1 3M5PA 1NRXA 1HKUA 4MPDA 5FKJA 5F7XA 2ROQA 3FVTA 3G8BA 3LLCA 1K4KA 3ZY2A 3WLQA 4FYJA 1ISSA 1DNPA 5I8WA 3UMMA 4AY5A 4YUWA 4P3YA 3RQIA 3QPCA 4JAVC 2C8LA 5A3SA 3K1YA 1RLJA 2W98A 3BDVA 4AZ0B 3K2BA 4K6GA 4FWTA 3AUAA 2ID4A 3PNQA 2P62A 3VR6A 3WJ1A 4JI2B 1KARA 4PGGA 4JA0A 2M9MA 5CCXA 3V6MA 4IIVA 1DRJA 1SHTX 2P2DA 1YO6A 2GWRA 3MAAC 4L5AA 2XYPA 1WXHA 5C0OE 1RIFA 3DM9B 3UW1A 5A7FA 4MV1A 1X7YB 3K8YA 3HP7A 3QXJA 4W63A 4DV0B 3RTCA 4P92A 2A8YA 1P1KA 4NNOA 3QA3E 2HK9A 4IHQA 1R37A 2DBRA 1PJAA 3GLKA 5HA5A 1UJ5A 1UC8A 3FUVA 4ND8A 5LBIA 4UC0A 1NYQA 5TRTA 4EMBA 4NG4A 2FETA 4GOMD 1J20A 4OP1A 4QQRA 1JSXA 3C3YA 4MUAA 3OCYA 1C2TA 5C7OO 3RFCA 1CSEE 4CF7A 1VP9A 3KWMA 2OK8A 2GJ9A 3BFXA 5GVSA 1IUNA 3UMCA 4ZDIA 4GKKB 5CG1A 2PXAA 4GW3A 4YCDA 1QYWA 1JZQA 3IAEA 4JZKA 1L9XA 3EVEA 5CT5A 3MJEA 4CDNA 1RWWA 4BNDA 1R00A 1HWYA 4EWLA 1O6CA 2FFAA 3ER6A 3JQGB 4MUHA 1E5XA 4QRHA 2OBXA 5C4IA 5JH7F 3L4BA 4S05A 2BM8A 3TS1A 3VNSA 4BNTA 3L7JA 5KWJA 4BLUA 1U8ZA 1C0EA 1C4OA 3EB9A 1S6YA 3Q12A 2R48A 4QU8A 1X7DA 2G4CA 1YQQA 4RQUA 3K0CA 4RPCA 4E12A 3W8EA 4AIRA 1T1SA 1EA7A 5BUSA 2QYTA 4EA7A 6Q21A 5FP0A 2QL6A 2IH2A 1GNRA 3L7YA 5BW8A 2OL4A 2QNBA 2GPYA 1EI9A 3I72A 1ZC4A 4HVAA 5ADUS 3DLCA 4G4SP 1YRLA 5AW8A 5FNVA 4OVKA 2JKVA 5GZ1A 1HT1E 2WAMA 1IBMB 2ZRBA 4KLNA 4YRBA 4F9EA 3IHWA 3QUQA 2AOUB 2PSSA 3R3ZA 2Y67A 1W48A 3C6KA 1TVKB 1Q3TA 2YYAA 1ZIDA 4MQUA 5G0UA 1DLJA 4CLRA 4YYEA 2QD3A 2BTEA 3NHBA 4JGBA 3JQRA 4HFRA 2PFSA 4A73A 2GNAA 4IVQA 1ETHA 1QR6A 1XQWA 1GL3A 1GUYA 4CTOA 5J43A 2JLZA 4BQPA 5JC1A 4ZEWA 1QC5B 1CULC 5KX5B 4C7VA 5IJWA 2NAPA 1DIGA 3LW7A 4IKPA 1COZA 2FRDC 2A33A 3DHWC 1OGJA 5LLSA 2WAOA 1NP6A 1ZK3A 3FJOA 1EUCB 1P9OA 2PIDA 4BJ1A 2ZJ0A 1GZDA 3HBJA 5A4JA 4B7ZA 4JD5A 4ZQEA 1XNQB 1SM4A 3H9UA 2IBTA 3VA7A 4PG4A 3H4IA 5KKAA 3EVCA 4IDOA 3KKKA 2OKGA 4F56A 1SXPA 2IHVA 1T3TA 1LK7A 2BGJA 1L8AA 4OAOA 2QAJA 1EKXA 4DV3B 4BBAA 4GQIA 4PRLA 1WA5A 3VU9A 1OAKA 4F46A 3O38A 2EYUA 3H3XA 2IEAA 2LE0A 4BFZA 1ODTC 4TLMB 1JWAB 1S9DA 4QULA 1J8QA 1W4RA 1W5FA 2AQHA 2AYYA 2O7QA 1WZ2A 3MBIA 1CV2A 3DZ8A 3UJPA 3UWSA 2ZTHA 1Y4DE 3QHAA 4I3FA 5BSFA 1R88A 4UE3S 3V8BA 4AZ3B 2X1MA 4FOSA 5IXSA 5AOCA 1CRPA 4EFMA 1F2VA 1HL3A 4M55A 3CNBA 3IYLW 3V46A 2QU7A 1SURA 1NQVA 1W1WA 2YC2C 4PQGA 4UMDA 1WUJS 4JP1A 3IDSA 3BERA 4WCFB 1TTQB 5KC9A 1L5MA 1R8XA 2X0FA 1ZN9A 4IJMA 4KNWA 3O7MA 1BYIA 1C7RA 3B82A 3HJAA 5CLFA 3T41A 3QLEA 5JNUA 3LTNC 4JENA 1TKBA 1PR0A 1VG0B 1K3UB 4WT7A 4W1QA 1AF7A 3L18A 2J5XA 4MEBA 4RY8A 4ZCSA 2ISSD 2B30A 2XUQA 3UM9A 1U6JA 3FPEA 3IP3A 3O9ZA 2O59A 2I1LA 2JGMA 2A9KA 1RQPA 2GETA 4GFDA 1BMFA 1AXGA 3CR3C 4HAWA 4QOFA 4DGQA 3IE2A 2AUMA 1V37A 4IJVA 3BORA 3PE3A 4P3PA 3PDCA 2XUFA 4FYMA 1ZL2A 2W8BB 3J80A 2QX4A 3WNBA 3T3DA 2I87A 1GNQA 2YX1A 3N3BC 4HRXA 2MMCA 4DYDA 3CF0A 4EG1A 3O84A 1JMVA 4URYR 4K9KA 3PHLA 4CEHB 1VTKA 1RM0A 3N2IA 1FDVA 3SE0A 1TKCA 4GLFA 3VYTB 3I2YX 1YK0A 4RW0A 3WADA 1FS6A 3UAWA 1HT3A 5CD9A 3RFTA 3T5MA 1AB6A 4EIWA 5BN4B 1V35A 1SHKA 1BQ3A 3I9V6 2BN4A 3G5AA 2J4FA 1UPXA 4P6VF 4LIPD 5JAIA 2VRBA 4DBVO 3C45A 1VJ0A 3T9DA 3T1VA 3PFWO 2IYPA 4B3MB 2MDTA 4HZUB 3ZQKA 3R5XA 1YRQA 1EVYA 3D81A 1Y8QA 3PNLA 4A3SA 1GKUB 4A0GA 1PG2A 4OXYA 2DZDA 3S7TA 4RSRA 1FVXA 4HNGA 4A23A 1IAQA 2Y1WA 1YDFA 4XPZA 1T3LA 4KODA 5EKTA 1Y4ZA 4I55B 2LCFA 3H8JA 4E03A 1QP0A 2PWZA 3OAAA 4NIMA 3GCWA 3ZE7A 3NUGA 3UJ6A 2FEAA 3EX7C 2VH2A 3EDCA 2P2SA 3VR0A 3FIUA 3F2IA 4PZCA 3DE7X 3DVAB 3SBXA 2V4MA 2RAVA 1SQ5A 3TZEA 1KVSA 4BKMA 4IYJA 1RCTE 7ABPA 2FW0A 2WKRA 4NOJA 4RLFA 4WLFA 2YJ5A 5ERGB 2P4HX 3G0CA 5JNWA 2XBMA 4JLJA 1H6DA 3RC3A 1RWBA 3EVTA 3UWPA 3ZN2A 4F5WA 2XA2A 5EXTA 1UIMA 1LI4A 4N8DA 3GROA 3NHRA 4O63O 5JO9A 4O8ZA 1LU9A 5BSWA 3BMQB 2C04A 1GQQA 2Q5LA 2ODWA 4JWKA 3JTMA 4GRAA 4RANA 4YV1A 3C1UA 3SXUA 4OLBA 3A1EA 4NL4H 5CVEA 1RKBA 5CLQA 1FFDA 3GW8A 3C4QA 4GLOA 4PNZA 1LLQA 4ZV4A 5JEDA 3WQHA 3CVUA 3E84A 1U90A 1F0YA 3NYQA 1QVVA 3FCUB 4G23A 4JJGA 1OHHA 2HIGA 5HVNA 5B57C 1VKNA 1XMVA 3JZAA 3EW9A 4I1PA 1XRQA 1ZFNA 3F6RA 4A2WA 3WWYA 5GIOE 2CDAA 3FNRA 3KR1A 4TV8F 4MYUA 3HH8A 1P72A 4Q1CA 4F84A 5L3QB 1K0UA 1KRHA 2WU3A 3UYKA 4ZKDA 3VR4H 4YUZA 4BCCA 1V1MB 2VDQB 3IMKA 5CUQA 3TO5A 1OBOA 4KVFA 5FBVB 4AKIA 2J3MA 1PT5A 2WJHA 3FWPA 1P9RA 4X64B 2Q62A 3WJ7A 2ZR0A 1O96A 3FZGA 1A7KA 2CYBA 2FLKA 5DCLA 2VSOA 3KHUA 4RPJA 4TV9A 1H23A 5FBKA 5AXBA 1MQ8B 3KOXA 3SMQA 4LWZA 1FLVA 2OYSA 3ZZTA 3HCEA 1BMDA 3MM4A 1A69A 5AQ1A 2PZLA 1WV1A 5FYDA 1Y7TA 1Z4JA 2WUGA 3GUYA 2BHNA 2OBYA 3CE6A 3KZXA 4ND1A 3OQMA 3ZI7A 1Y48E 2DP4E 1K7SN 3PNOA 3HHPA 1MORA 1KP3A 1GPDG 3ILXA 2FRXA 4DLVA 2WUFA 5IFLA 3FRHA 4AZWA 1JAYA 4RJIA 1XALA 4EHNA 4A8JB 3GRRA 1XKTA 3EODA 4XJSA 2MSCB 2SBTA 1P1BA 1M34B 3EPRA 4JQOA 4MDYA 2OOSA 3LFHA 4MROA 4RH3A 4YAFA 2Q3FA 1KPGA 3ZV4A 3C74A 3HCFA 1N75A 4QOSA 5SZJA 3IQGX 1X7XA 2VDNB 2JL1A 1FMFA 1DRWA 2GZHA 4JJ6A 4U5QA 2I6XA 4K9SA 4JC0A 5G4LA 2F1IA 2F9LA 4TRNA 2OSVA 2NZ2A 5IJXA 3UK7A 4ZOCA 3L0YA 1RBYA 3D6HA 3STVA 1M1YE 3I04A 3LV8A 4RS3A 1B1CA 5AI4A 3WBKA 4MR9B 4MDFA 2XUOA 3WBFA 3D59A 1R18A