1G5RA

The three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
ERGIIIVFTGNGKGKTTAAFGTAARAVGHGKNVGVVQFIKGTWPNGERNLLEPHGVEFQVMATGFTWETQNREADTAACMAVWQHGKRMLADPLLDMVVLDELTYMVAYDYLPLEEVISALNARPGHQTVIITGRGCHRDILDLADTVSELRPVKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords COB(I)ALAMIN ADENOSYLTRANSFERASE
publication title Three-dimensional structure of ATP:corrinoid adenosyltransferase from Salmonella typhimurium in its free state, complexed with MgATP, or complexed with hydroxycobalamin and MgATP.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 51
structure length 157
sequence length 157
ec nomenclature ec 2.5.1.17: Corrinoid adenosyltransferase.
pdb deposition date 2000-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02572 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g5rA00
1IXZA 2YJTD 1JEEA 1TQ4A 1Z6XA 3SZRA 1AA9A 2ZIAA 1XMIA 3QIAA 1GRQA 1T3LA 5EXXA 4E07A 2ZXUA 1CP2A 5DYGA 4EJSC 3MUFA 4MQBA 1DO0A 1QBKC 2EFGA 3WBJA 2QE7A 1D2NA 2ZVPX 4B3DA 2O8BB 4LJ6A 5CLQA 1E2JA 4YDHB 1MO6A 4R98A 3GFTA 5EZ6B 4MGIR 1COWA 1GITA 1G41A 3NVAA 4LJ4A 3TNFA 3QPUA 1SKQA 3Q7PA 1P72A 3THXB 2Z6VA 2IHBA 3LX8A 2V4ZA 3IQWA 4WXPA 2P0EA 2B7CA 4DWJA 4P4SB 1T8UA 1KJZA 4Q9LA 4G01B 1KIMA 4DSOA 1RVDA 3CNNA 2P6UA 4KFSA 4M1WA 4DLRA 1U8ZA 4IDNA 2GZHA 4HAXA 2DR3A 1ONBA 3AP2A 4M21A 3P27A 4Q47A 4XTCS 5AJYA 4CEHA 3IDQA 1KSHA 2W83A 3VR2A 4OKSA 4B73A 2O8DB 1KYIA 3DPUA 3DMNA 5FOSA 4PSAA 2F9MA 1U99A 2GHIA 2PZGA 1WRBA 1L4YA 1R8SA 3ICQB 4HLUC 5BQ5A 1E2LA 1TF5A 4B44A 2R44A 1KK3A 2ATXA 3FFBA 5HKKA 3PFIA 1OFTA 4GMXA 4H1VA 4YXWD 2IYYA 2G88A 1Z2AA 4RZ2A 2V1UA 4K8OA 4PSKA 4ACAA 5HZHA 2VPPA 3GJ6A 2VP4A 1Q21A 4MRRA 1NG1A 4OHZA 3GFOA 2ZITA 2ORIA 1F2UB 2E87A 4HZUA 1OH8A 1XPOA 4Z1MD 1FX0A 1PLKA 2QPAA 1VHTA 2ZE8A 2HF9A 3K0SA 4PQYA 4TL8A 2AK3A 3NBFA 5FR2A 2XXAA 2O8CB 3K0CA 1M7BA 4KITB 1PUIA 3M1IA 4Q18A 1GL6A 1MR3F 1OXXK 1GKIA 1W47A 3RSLA 1Z28A 2ZRHA 3RS7A 2ZRMA 5CLLA 4V0OA 2YKGA 3TAUA 4KU4A 1P2VA 1JAIA 4ZV4A 4FMCB 1NN1A 4KLNA 3RS2A 1UADA 5G3ZA 2J3EA 3RRYA 3EZ6A 1NN3A 1MRSA 4PHGA 3SBDA 5KOYA 1ZVQA 3BAFA 1TADA 4P0TA 4C0AC 4LHYA 2KE5A 2I1VB 1UKVY 1OFIA 4ON9A 5CITA 2XNDA 2WKRA 1XF9A 1IONA 4GZLA 3IQXA 2ODNA 4US1R 1ZC3A 5TARA 1G21E 3BS4A 3SJAA 1W0KD 3U5ZB 2VHJA 1CR4A 5D3QA 1XCGB 4DC9A 3IIJA 4X8MA 4TSFD 1QF9A 3CM0A 3NTUA 4DLWA 5KSPA 2GILA 4DLTA 4D26A 1GL7A 1ZNXA 3K0EA 1S9DA 3X1XA 3A4NA 3BB4A 2OESA 1KZ7B 3KUCA 1RFLA 2ZUBA 4D4JA 3OESA 1A1VA 2JATA 3B85A 4DCTA 2B92A 1KI8A 1XD2B 3K1JA 1VYVA 2PCLA 4ZCMA 5EUQB 4PZZA 3Q72A 4M2LA 1P73A 2ZUDA 4MYCA 1ZD1A 1HUQA 1W36D 1FL9A 1UKYA 3C16C 2XJ4A 1W46A 1Z0FA 5E7IA 2J87A 2AXPA 1II8B 1U90A 4UJ5A 1XCPA 5KO2A 5B64A 1I2MA 3CIOA 3I5XA 2O8FB 2F3TA 3B13B 3GP8A 4MKHA 4OK6A 4NCIA 4URXR 1TX4B 3PUWA 4DEYA 3K8YA 4TMKA 5FOUA 4RFSB 3TUIC 1ZYUA 2G9NA 3U7FB 1G5TA 1Z6AA 2WJHA 3W5IA 2O8BA 1M1YE 1SVOA 4EPVA 2YVUA 2E1RA 2VLIA 3LAWA 2RGDA 1SVWA 2NQ2C 3L0IB 3THXA 5JS7A 4Q4AB 2ZE6A 2QU8A 5KUTA 4A4DA 4TYWA 4PPQA 5FOVA 1K5GA 3G82C 4JIMA 4P4SA 1SVKA 2WWHA 3DVLA 1PJRA 1XU4A 4PC7A 1CF4A 1OFUX 4OK5A 1KKLA 3OE7A 1Z8FA 2V3CC 1G19A 4ZI3A 3TK1A 3UATA 1U0LA 5BW8A 4HUQB 4QBFA 5DNYB 4XTRA 2BHRA 2GJ9A 2O8DA 2RGGA 1KNQA 2CL7X 5FPKA 1TU3A 1CJVC 1S8FA 2LKCA 1ZIOA 2WM9B 2K5UA 1DAGA 1X1SA 8OHMA 4BZPA 4U02A 1KMHB 4FD2A 3RS5A 4MYTA 4B71A 3AVWA 3PXGA 2CHQA 3LWNA 4QJ4A 1JAHA 1E9BA 1WBBA 2PLFA 3KXKA 4B34A 1F5NA 4N3NA 5J5CA 2MSEB 5E4FA 3A4MA 2PZEA 2G0NA 1OYWA 2ZREA 5KPJA 2WJGA 4HSEA 2IYSA 1NIPA 4B2IA 2FNAA 1F2UA 2FA9A 2PBRA 3O47A 4B6FA 1XNJA 3IIMA 3QXXA 2AX4A 1KY3A 1WMSA 4TLAA 1TUEA 4Q9JA 2X1VA 2DBYA 5AK0A 1YZQA 2UKDA 5C4GB 1LB1B 4LDJA 3GPLA 5GJBA 3VAAA 1XBTA 3K9NA 2CLCX 2O8CA 1Z47A 1SQ5A 1QVAA 5JJKA 4M1YA 4LJYA 3PEVA 4QGGA 4AIIA 2FGKA 4DRZA 5CDFA 5KNDA 2CHGA 3NG1A 4B47A 3GEHA 3WHLA 2JLWA 1W36B 3O8BA 3SHFA 4NONA 2H7VA 3L0OA 2Z4RA 2J1LA 2NIPA 1H8HD 1P75A 1JQJC 3M6AA 4GNKA 5KDOA 1SVSA 2QMHA 1BS1A 5KSYA 1XZQA 4PHHA 4OHWA 1X8KA 4QBIA 4NCNA 3NC0C 3UK6A 2E9SA 1R5OA 3PUYA 2OFOA 3AVOA 4BZQA 2EQBA 3FVQA 3VMFA 1HT1E 4PZYA 1VPLA 1RRGA 4DLXA 2QORA 1R0YA 2ZRAA 2YOHA 4IFBA 4F92B 1P2SA 5FH9A 3HU3A 4D81A 1OXTA 3U3JA 4XWOA 3W8RA 5D3MB 4AKHA 4GPTA 1ANKA 1R4AA 4LJ9A 1OFHA 4BLRA 3PEUA 1XD2A 3LLMA 3ZZUA 3QXJA 1E0KA 4MKIA 1UDXA 2JLRA 3K09A 3AF1A 4XSGA 2GXSA 3IBGA 2IHYA 1TUIA 3ZD6A 4LJ5A 2GKSA 1A4RA 2IYRA 2ZS9A 2GAAA 1II8A 5H8WA 3C4JA 1TQ6A 1T5LA 3MWLA 2IXFA 1KDTA 2XTMA 2O8FA 2J0UA 4TYPA 4BRUA 2QRNA 2WJJA 2DFNA 2ZRGA 1EFRD 621PA 2BCJQ 3C7KA 1IJFA 3TSZA 2XGJA 2IBMA 2DYKA 3UMRA 1E1RD 1LS1A 2GZDA 3L43A 1YU9A 1C9KA 2ZTSA 3CPJB 4OQLA 1J8YF 2CHVA 3CB4A 5H70A 4AI6A 4RFSA 3A1VA 2J59A 5DHAA 3QKUA 2EWWA 1CIPA 1W7AA 4YXWA 3H4MA 4Q9IA 2O5VA 3HR8A 1J2JA 3DM5A 4V0KA 4E09A 5CB8A 2IL1A 4V0MA 1YVDA 4L4UA 3T12A 1OT3A 4Q4AA 3AVVA 4A0HA 2N1BA 4Z1MA 2J45A 1MOZA 1ZD9A 4IRUB 3FHCB 1IXSB 1N0UA 4M53A 4NYIR 4B75A 3MWKA 5AUPB 4LV5B 4BFYA 5CDFE 3TQFA 3Q5EA 2IS6A 3A8TA 3AM1A 1OB2A 1C1YA 5J47A 1P5ZB 4HUQA 1QHGA 4ZO4A 1NY5A 4TZ6A 4Q1AA 2JA1A 4WZ6A 3SN6A 1XWIA 4UJ3A 3FGNA 5FR1A 5AUOB 2O8EB 1NY6A 1CTQA 1G3MA 4EPYA 3B60A 2KJQA 3Q85A 4XH9B 5SZJA 3T06B 2A5FA 4FMDB 2RGNC 1P9NA 1S96A 4LV6A 5FUYA 3RRZA 1DAIA 1XMVA 2ERXA 2IF0A 2WJYA 4LYFA 4A2PA 4UQOA 4D82A 3IO3A 4BFVA 2HT6A 1SXJD 1DAKA 1KHTA 4Q02A 3ONWA 4QBGB 1YR7A 4BECA 1PZNA 3SDZA 3U4QB 1UKEA 3FMOB 2GJKA 2NTYC 4U5XA 1GNPA 3A58B 2QG6A 5ANRB 2XZLA 3CO5A 4R71A 3FDIA 3I5YA 2OLKA 4JMPA 2OBLA 2RH5A 3A36A 3SR0A 1NMXA 2Z5FA 4TSFA 1P9RA 2AL7A 4UXHA 1G1MA 4C0LA 3SJCA 2JLQA 1IN4A 4WVFA 1EXMA 5KHOC 4OL0A 1KAOA 4CVNA 1CJKC 5EE5B 4US2R 3AP1A 2H1LA 3QBTA 3WHKA 1EGAA 4LI0A 5BYKA 1GG2A 1E2FA 1G8HA 3GEIA 3RS4A 4NHOA 2AWNA 3E1SA 1OJLA 1N6RA 1ZNYA 2SHKA 1X1RA 2OFWA 4C30A 2DWOA 1PLLA 1DAMA 3CUEF 2W0MA 1UEJA 1G4AE 3LRPA 2BCGY 2Q0HA 4QNRA 3ZVLA 4TLBA 1Q22A 3I8SA 3MD0A 4B74A 3UANA 3K70C 2O0HA 4F7WA 4HUTA 2VYFA 3J81k 2C77A 4W5WA 1KO7A 3K0FB 1H8ED 4CT4B 121PA 5C1BA 4Q1BA 2OG2A 3MFYA 4M22A 4V0ME 1OKKD 4G5RA 4UXIA 1C4OA 4DUGD 2GVZC 1OV4A 2ZSBA 3CR7A 3EIHA 1N3BA 4RY2A 5KPDA 1NL3A 4URWR 5JWHA 5EQTA 5BN4A 4AD8A 1LY1A 3RRNA 4JLOA 2P5SA 5F9FA 2FG5A 4GRAA 4A36A 3C5CA 4URZR 1YZNA 1NJFA 3DL0A 1S9HA 5TXGA 4BEBA 5B57C 3W6NA 2FMXA 3AF3A 1W4CA 3FB4A 3SE0A 4G3XA 4BFUA 1KDPA 3KJGA 2YWGA 3BIFA 3SYLA 1CULC 1G3IA 1Z07A 2AD1A 5L3VA 1WCV1 2C95A 1QHSA 2ORWA 1BMFD 3KKPA 5K8LA 3F8TA 1T4GA 1ZM9A 1ZRHA 2VHCA 1I4LD 2EYUA 2BV3A 3VKGA 1YKSA 1CJTC 1IN6A 1JJ7A 1G4UR 4C0JA 1N6KA 4MDFA 3HU2A 2YC2C 3DEFA 4YLGA 2ZU6A 2H18A 1KSGA 1HE1C 1QG2A 2JGNA 2VSOA 2WIAA 1SXJB 1ZM7A 3BXZA 4KODA 4DHEA 2WBLC 1VKJA 5EP4A 5DSZA 3VX3A 2BWJA 1G17A 2WTUA 3IKJA 2VRWA 5FPHA 4ZDKA 5CM8B 4GL2A 1E79D 3U3MA 3GLIB 3AKYA 1YRAA 4BASA 2R6AA 4BLPA 1MH1A 2WAXA 3BWDD 4MGZR 1P4SA 3H84A 4BGDA 2QTHA 1S2MA 4WXRA 1ETUA 1KI4A 1KNXA 4N1AA 3TVTA 3AKCA 1OYYA 1KDOA 4DBLC 3I1FA 2RKOA 3PQCA 3UG7A 3SJZA 4Q21A 2VP0A 1RRFA 1VG9B 2BIFA 3GJXC 3WNCA 3HJNA 4KVAA 2O8EA 3VHLB 2CCJA 4A2QA 3K0CC 1ZU5A 5KYKA 4Q9KA 5HR5A 2RGCA 2HCBA 2VL7A 3CW2A 3KL4A 4IKEA 2IUUA 1WBDA 1WA5A 1KI1A 1ZUIA 3T1VA 1QHHB 5DN6A 4KXFB 1YZLA 1H8HA 4M1SA 2WWWA 1SKYB 1SVMA 1MT0A 4NH0A 5CYPA 3JZMA 1CR0A 3VFDA 4NL4H 4TMZA 1R5NA 3I73A 4OYHA 1Z6GA 3U4QA 3ECCA 3KQLA 4KYUA 3GJ4A 4A82A 3DKPA 5FPTA 4IOKA 1ZAKA 2CCGA 2FFAA 4NYMR 2C78A 5KTYA 3ZH9B 5JS8A 3BH7A 3BJIC 2QQEA 4XVRA 4NKRA 3TR5A 2ZSEA 3TBKA 3KFVA 4B3CA 2PMDA 4ZDJA 1G9XA 2OILA 4IOJA 1TMKA 1TPZA 5K8TA 2ZRFA 3KTAA 3A1UA 3E2IA 3NBXX 1QDEA 1YZUA 1E1QD 2QAGB 2R6CA 1AQYA 1G3QA 3NWJA 3FHOA 4NYIQ 3C14C 5IK2D 5B58C 1FW6A 2ZRBA 3LFUA 1MO4A 3T35A 4QNMA 3VR1A 2CL0X 4EIWA 1GRRA 1KO4A 3V00A 4NYJR 3VKHA 3WY9A 5DHFA 3GCGA 2PEYA 3ZVRA 1AS3A 2V7QD 4DDWA 5FL7D 1E1RA 4JLJA 3TUZC 1OF1A 1NKSA 2NO6A 1IOZA 1NMZA 2WZQA 3K0FA 4QGFA 4G5GA 3BBPA 1JQLB 3LW7A 4JLPA 1VHLA 4YDSA 1F48A 1A2BA 4IW3B 4A0GA 1OB5A 2VSFA 1P7CA 5DO9A 1CJMA 3SJBA 1FNMA 3SC3A 3U7HB 3VR6A 2FFBA 1OXUA 2HV8A 2JIZD 5BXQC 3A1WA 1KDRA 1FQJA 1XXHB 2OAQ1 4ERNA 2RGXA 2OCYC 2J41A 2WWFA 1NP6A 4XVUA 1CRQA 1R2QA 3FE2A 5FBLB 1DAEA 5HE8A 4F38A 3CX6A 1E2GA 3GD7A 5L3QB 5IDVA 1FFHA 1IN8A 1XMSA 2QNRA 4Z8XA 2VF7A 3THWB 1E4YA 1VCOA 2IEYA 1JB1A 3EAQA 5EE0A 2GCNA 4TMVA 3UKDA 4BLQA 1HH4A 1WF3A 2JJ1D 2R65A 2PT7A 3HR7A 1TAGA 1EFCA 4FINA 3MAAC 4PX9A 5JWOA 4HATA 1VIYA 1W4AA 2XX3A 2NPIA 2ZI9A 1G291 4YMUA 2OO7A 3KUDA 3TE6A 4JBYA 1HA3A 1KAGA 2PMKA 1AN0A 4QXAA 1E2HA 3R9IA 3TUJC 1XEWX 1SXJA 1UJ2A 1YZTA 1DARA 1RYHA 2IYUA 2CEAA 1KGDA 4Q48A 4RZXA 4PHFA 5TV2A 5EE1A 3H0KA 4IDHA 2JLSA 3ASYA 1NSTA 1GRNA 1D6JA 2G6BA 3NKVA 4PAQA 3M4YA 3QI2A 2WSSD 3ND8A 4L15A 3GLIA 4HYYA 1G3UA 1IN7A 2ONKA 4IEIA 2GRJA 4TL6A 3LQQA 4DLSA 1I4TD 1OIWA 1Y63A 4EUNA 1T5IA 1TEXA 2B8WA 2WOJA 1JR3D 4PPNA 1YZKA 3QXCA 3PIRA 3CRMA 4Q7JB 3B78A 2A5DA 3NBYC 2FGJA 4LBZA 4AKEA 2QM7A 3QY0A 1LV7A 1DEKA 2Q21A 4X8LA 2NO0A 1AZTA 3U60B 2ZVQX 1Z5ZA 2OM2A 1NN5A 3PUZA 3T5GA 4RCZA 1Z3IX 1XEXA 4HDCA 2IYVA 4K81B 1E9RA 4FI3C 3ZGXA 1T91A 1QHHA 1D9ZA 4QKQA 3RLFA 4R9UC 3RANA 4HAZA 1M8PA 1S3SA 2P65A 3IILA 3P20A 3VNUA 4V03A 1ZNZA 3D7MA 3U6BA 1G5PA 1XMJA 221PA 1TF2A 4TT3A 2VP6A 3X1YA 2ZYUX 2ZRLA 5J40A 4LHXA 1E9DA 3I8XA 4NCKA 4Q66C 4ZDWA 3TRFA 4B6EA 4ZDIA 3I61A 2TMKA 4PFSA 2REXB 3AGPA 1N6NA 4DUGA 5KDDA 4FCTA 2IYQA 3AEZA 4GOXA 5FOXA 4OQFA 3PENA 3N2IA 3CRVA 3ZLJA 4TTQA 2CE2X 5DI3B 1QHNA 2HXYA 3CF0A 1NI3A 3KZ1E 3ADCA 4LYHA 4CIDA 1RJ9B 4PO8A 3EA0A 2VSXA 4DDVA 1E2IA 3IGFA 4RKEA 2Q6TA 4LPSA 2EWVA 2HDNB 1U8AA 3HPRA 1X8JA 2BDTA 1ZCBA 3OIWA 3LBNA 3QG1A 3PJRA 1GNRA 1A82A 1NVVR 1OHHA 2DFTA 5KU1A 2DCUA 3K09C 3FWYA 2YWFA 4HLQB 5H68A 1XB2A 1CU1A 1N0VC 1U0HC 4OQXA 3B2EA 4U00A 4EFMA 1ZP6A 2PH1A 4JYCA 5GJCA 4RD2A 1BMFA 3RC3A 1GTVA 2G3YA 2P67A 1Q44A 1SXJE 3QVUA 2GETA 4TTPA 5BWMA 3G5UA 3W3AA 4IDOA 4B48A 3U2QA 1AQUA 3WYFA 2Z4SA 1J8MF 5HTKA 1VDZA 4A1FA 3GQBA 2OT3B 2CDNA 2ODWA 3CR8A 4OQMA 2ZM5A 1KOFA 3C5HA 3CRQA 4DSUA 3LNCA 3UMSA 4DXAA 5JRJA 3GLIE 3CPHA 2A7QA 3OZXA 2GEUA 1DBSA 3MLEA 3CONA 4CEIB 1XXHA 4HB0A 5LB2A 4Y0VA 1RRPA 2PL3A 1E79A 3T34A 2XJ9A 1UBEA 4JSTA 4MA4A 4Q7MB 1FMJA 5JJIA 4J0QA 4QL3A 4US0R 4JBXA 1GSIA 1S0UA 2YYZA 3LQRA 1T9HA 4GZMA 4NYMQ 5L3QA 2GXQA 1JBKA 3AGQA 3GLHB 3P4YA 3O8CA 2IA5A 4JLDA 1JR6A 4BUJA 1L7VC 1G16A 2ORVA 4JL8A 2ZRJA 2OAP1 2IW3A 2CXXA 1R0WA 2ZRKA 5A4JA 2KB0A 3QEJA 1SKYE 2PZFA 4LHWA 3QKTA 2X77A 3W34A 2OEPA 4YONB 4DVGA 2PCJA 4TYQA 5HCNA 5J4VA 4KFUA 2QL6A 2C5LA 1JXMA 5EXTA 5G53C 2QENA 3CRW1 2OLJA 4PTLA 1ODFA 1Q0UA 3KX2A 3NBZC 4LPKA 2OBNA 3ZQ6A 4DLVA 3TVDA 1T8TA 1Z29A 2QSYA 3PV0A 1FTSA 2W2XA 3OIUA 4JLAA 1ZNWA 3GLFB 3AH8A 421PA 3KB1A 4PPFA 2ZI6A 4XD7D 2C9CA 1E98A 4RZ3A 2WWXA 4XSHA 3CZPA 4AG6A 4BLSA 1SVLA 2FN4A 1Q3HA 3QENA 2JLUA 2ZUCA 4ABYA 2FPMA 2QTVB 3AKDA 4PC2A 4YQFA 1OIVA 2BMDA 3VX4A 3RNLA 4DLZA 2AN9A 1CBUA 3K9LA 4B2PA 4QRHA 2PLRA 4I81A 4BQSA 1VYTA 1OH7A 3WMGA 4KBGA 3ZIAD 5CK5A 3AVUA 1S4QA 1P2TA 1E1QA 1PLJA 2FEOA 3VU9B 2W2TA 3ETLA 1R6BX 1E4VA 5IK2A 1N6HA 2NZ8A 1O87A 3EA5A 5P21A 4CDGA 4Z51A 2N42A 1G64A 4EPRA 2XSZD 2GAOA 3FKSD 4LYJA 4FWIB 3EPHA 1DOAA 2PJZA 2ZI3A 1W36C 2QY9A 4B32A 5IHPA 2ZJYA 3LBHA 4KSBA 4C7OB 4F4CA 4WAUA 4BRWA 1CRPA 2GBLA 3OEED 4C0SA 3QOFA 3OEHD 5FL7A 3EZ7A 5DYIA 4HLUA 5G41A 3U3KA 4TL9A 3HDTA 4D2IA 4UNSA 2ZETA 3NH6A 1NVUQ 5DISB 1AZSC 2QP9X 1LVGA 4P4TA 1GZSA 1N6OA 1XXHE 1HE8B 4EPWA 4IJMA 4OHVA 1MO3A 4Q1FA 4O25A 4D25A 3NHAA 4PQFA 3B8HA 4URYR 2QGNA 2F1HA 2ZI5A 1ZUNB 2JIZA 3AVYA 3IEUA 3BFXA 5DI3A 4ZI2A 1Q20A 4O2RA 5G3YA 4C0HA 2DWPA 2GNOA 1RJ9A 1YQTA 2G83A 2IEZA 4NBSA 2XAUA 1M6NA 1L2TA 2ZQ5A 1G8YA 4OHYA 3WNBA 4ITRC 3U7EB 4IDPA 4NZYA 3VKWA 2RCNA 2CJWB 4MYUA 2D2FA 1EG7A 4B2LA 1EESA 2FX3A 3IPXA 1D2EA 4P33A 4QM6A 3KXLA 3B9PA 2JJ1A 1CR1A 2ODBA 2R2AA 5SZIA 3CH5A 5DGXA 4I4LA 1E2KA 3IEVA 1II9A 2KBEA 2H8KA 2WJVA 3CNOA 3GLGB 1OIXA 1E0SA 1P3JA 2QAJA 3LBIA 2HCJB 3PG5A 4QJ3A 1N5IA 1F2TB 1OH5A 3QBVA 4BFSA 5HZKA 4QM7A 5FTLA 4NPHA 2EVWX 4A8JB 2AD5A 4IHQA 5FI1B 1T6NA 1AKYA 2QP3A 3NH9A 4JJKA 2ZSAA 4OI2A 2C99A 1PVOA 2ERYA 1U0JA 4GT1A 4KFTA 1IJEA 1P61B 1US8B 4CEIA 2D7DA 3ZD7A 2FZ4A 1XTQA 2Q3MA 4V02A 4P32A 1KO1A 5FTJA 2ZJOA 1E99A 1Z08A 3W9YA 2JLYA 1ESNA 1E96A 4ARZB 3MCAA 1XTSA 1XTKA 1FMLA 2IF2A 3CF6R 3GLHA 1JR3A 2GEDA 1HV8A 4H9GA 5CK4A 2F55A 1DG1G 1P6XA 2ZYTX 1WP9A 4YMWA 3P26A 2Q9CA 4QOSA 1KSJA 1ZCAA 4RZUA 3U61B 2F3RA 2C04A 4W7SA 1Z63A 4ZCLA 4FMDF 1IBRA 3CNLA 1KJWA 2OXCA 5JZVA 2D62A 2DHRA 5A0FA 3RC8A 4I1OA 4QGAA 1H65A 1X86B 2ZU0C 1D2MA 2JAQA 1NVVQ 2J9RA 3ND9A 2QMEA 3I4LA 3KQKA 1HYQA 5KSZA 4TQAA 1P9WA 3KKMA 1WB9A 2C8VA 4FCVA 2LWIA 2IUSA 2R6GA 4Q1EA 1DVRA 5EXPA 1EWQA 3REFA 4TLEA 3GLFA 1W5SA 4JL5A 3B5JA 3U7GA 1QHYA 3UXMA 3T1TA 3FKQA 4PR0A 1G7TA 3LY5A 2AWOA 4TLDA 3R9WA 1KK0A 3QG5A 2V8OA 3HYRA 1UDWA 2YZ2A 1KMHA 4MGKR 1DO2A 2JLZA 2ASEA 2F7SA 3B1ZA 3TIFA 1LF0A 2WV9A 4KO8A 6Q21A 4G5QA 2QE7D 5CM9C 1V5WA 3I62A 2BBSA 1G3RA 3VTKA 1B23P 5AJWA 5DLQC 3NDPA 3IO5A 4QHSA 2AXNA 5TDHA 4GMDA 3L8YA 3VU9A 1UM8A 3IUYA 3K53A 1KO5A 2BMEA 2J46A 1W0KA 3C8UA 3EWSA 4PPGA 2DFLA 2OSBA 2GEVA 2F1IA 2MSDB 4L5BA 1UAAA 4Z54A 3NIBA 5F9HA 4GOKA 1ELOA 3H2YA 4PO1A 3GJ5A 1FOEB 2BJWA 1ZM4A 4C7OA 2BBOA 4UNNA 3GJ3A 3REGA 3PR1A 4IVRA 1P60A 2GF9A 1XTIA 3GJ7A 3FHTA 2FSIA 4HAWA 2D06A 4DEXA 3EPKA 4RD0A 4NMMA 4LZZA 5CIWA 1N25A 1Z2CA 1W49A 3EASA 2B7BA 4BFWA 3L2OB 5GJWC 4I1SA 1E2DA 4LK2A 5BN5A 2WWGA 2YWHA 3TH5A 2R8RA 4XWKA 2YOFA 4Q4HB 1CS4C 4TYNA 4G0NA 4JLNA 3GLHE 1JR3E 1KSFX 3UIEA 4NTZA 4PO9A 1VCNA 2WJIA 3KKOA 4KJZA 4DJTA 4LBWA 4PC3A 2ZSDA 1E0AA 1KY2A 5FL3A 1E69A 5C4MA 2ZANA 5IRCD 1XEFA 4JYBA 4YMTA 3SHWA 4UNPA 3QJYA 2IS1A 1UBFA 2CJWA 2NO9A 4B3XA 4G5OA 4Q00A 2O0JA 3LD9A 5D3MA 1SGWA 1P2UA 2A9KA 3HP1A 4AYWA 2GXUA 3ZQJA 5FBVB 2BKEA 1BYIA 2QSZA 3FFAA 4NDZA 4QC2A 4AWXA 1NBMD 1IAQA 3NDBB 4Q7LA 3GLGA 4TMWA 4M9XA 2YV5A 3RSOA 4AYXA 4P4UA 4R2HA 1LW7A 3TSOA 1F2TA 2QMUA 3O8DA 2ZJ5A 3TKLA 3GLFE 4JLKA 5B2ZA 4A8JA 1CJUC 2ZRIA 4YMVA 3DZ8A 2HUPA 2ZAMA 3E5HA 2H16A 1OXVA 2YINC 3LXRA 5JECA 1NSFA 4OI0A 3RDPA 1US8A 4CT5A 4E22A 4IEEA 5LD2C 2GZAA 1SXJC 2QT0A 2ZI4A 4DIEA 1D9XA 2RAPA 2ONJA 3H86A 3QE0A 1QHIA 2D74A 1U81A 4XD7A 2VQSA 2ZROA 4JBWA 4DZZA 5J4HA 4A0RA 1WE2A 2QMOA 4ARZA 1Q12A 2WVJA 3B7GA 4OBEA 2Y8EA 1DTSA 1Q57A 4IVPA 3QKSB 5C46F 3PEWA 3TAHA 2YNMA 3B1WA 2GK7A 1NRJB 1SHKA 1HT2E 2OBMA 2QT1A 3KB2A 2CVHA 3ZIAA 1KO8A 1W2HA 2V6IA 2X2FA 3AUYA 4LC1A 4CZ2A 3QNUA 2QP4A 1CXZA 5LB4A 4II7A 4BEJA 4HZIA 1U9IA 1VG8A 2XSZA 2B21A 3FKSA 3PVSA 4HB3A 1DG3A 3C41J 3SU8A 2BJVA 2CLSA 4BFTA 4JL6A 1PUJA 4MITA 4GI7A 4AYTA 4LJAA 5EJEA 3AVPA 3OEHA 1XD9A 2FPLA 1CLUA 2HYDA 3RWOA 4DDTA 1IY2A 1O3YA 3H1TA 3VR3A 2W58A 1J90A 5AJVB 4FMBB 5L3SB 1HTWA 5JJLA 4AKIA 4O3MA 5AJZA 3LX5A 5JCPA 1NN0A 4B3GA 1E9SA 2HJVA 4A6PA 3CWZA 3BGWA 4HI0E 3I32A 4HDOB 4ZPXA 4UNQA 2P3SA 3D8BA 2ZRPA 2BKUA 1VYUA 3JVVA 4DLYA 2FSGA 3PUXA 4RD1A 4IDQA 1LTQA 3EG5A 1XRJA 4LUCA 1AS0A 5BYJA 5L8VA 2VP2A 5L3RA 1VIAA 2OCAA 3KFXA 1Q1ZA 4KI0A 1OLOA 2GXAA 4AY2A 4IVQA 2IS4A 4QBHA 2CCKA 3W5JA 4A6XA 3P1JA 1KI2A 2XB4A 2FDCA 1E3MA 1BOFA 2ZJZA 1RC8A 4DCNA 3GLGE 3DOFA 4WW0A 4TYYA 4FXPA 3R20A 5AR1A 1NVXQ 4LC0A 5KNBA 4LOAA 4TMTA 4DSNA 2QTFA 4F4JA 1GWNA 2ODEA 4Q4JB 2VHTA 2R62A 3AVXA 3D31A 4A2WA 2FSHA 4PC1A 2OE2A 3BC1A 2XOKD 3VR4A 1G18A 2VEDA 5FTNA 1XJ0A 4KCGA 1KJYA 4OJKA 1IQPA 1EFTA 4K46A 2OCPA 5CJPA 1RPZA 3L0SA 3B1XA 4RFVA 2QRZA 4MDEA 4JKYA 2FPKA 2WAYA 2A5JA 1W44A 2IYZA 3L0PA 4C0BA 3TSWA 5AJXA 4B33A 1EFRA 3AB3A 3ZZ0A 1TNDA 1UPTA 2C9OA 4W5HA 1NF3A 4HAYA 3WRXC 2GCOB 5FOWA 2XITA 1U98A 5KSOA 3VNVA 2IYTA 1S1MA 4M9ZA 4WZAE 2IUTA 3EC2A 4AKGA 1JECA 4MRNA 3UMFA 2P6RA 2QEQA 5FTMA 2RGEA 4D0GA 3P4XA 4AURA 3FOZA 2NMVA 4XWAA 3S1AB 1ZBDA 4TN1A 2V55B 5JHHB 1IM2A 3SNHA 4E5UA 5K8UA 5JCZA 1JEDA 2QPTA 1N5JA 3AF2A 3CLVA 4LSGA 5KDLA 1G8GA 3UWKA 3ZS9A 4P31A 5EUMA 2VH5R 3TW4A 3B6EA 4DB2A 5EP2A 3B82A 5EXSA 4X8HA 4Y0AA 3EZ9A 3C15C 4YMSA 1JPJA 4GBMA 4PAMA 2JLVA 1G8PA 1OE0A 4ESVA 1DELA 2J0VA 1NIJA 3QKRB 5GVRA 2ANBA 2R6DA 2J7PD 1LF5A 1QVRA 1IXRC 1SULA 1G6HA 4C0KA 3LW8A 3RYTC 2V54A 2D4HA 3B1VA 4B43A 1FTNA 2ZRDA 3BFKA 3WP1B 4CYMA 5BN3A 4Z8YA 2GTPA 2IK8A 4W9MC 2EYQA 3EXAA 4A15A 4C4PA 2AR7A 2ZR0A 3GJ0A 2J0SA 4A92A 3A37A 3EPJA 3AV0B 1XEWY 4L9WA 3OIYA 5J4YA 1JPNA 3QKSA 2HLDD 4EQ6B 2Z0MA 2WPDD 3AUXA 1ZM3A 4ASUD 2RGAA 2PX0A 2IWRA 4IFEA 2JLXA 3QF7A 3RS3A 3RS0A 4EJSB 2P6NA 3MG9A 1NLFA 2I1QA 3R9XA 3MWJA 1K6MA 3DO6A 4JVLA 2FFHA 2Q9BA 4KFRA 4NU0A 5KNCA 5FUXA 3PEYA 1RZ3A 1Z6TA 3L82B 2GCPA 2UZ3A 3NEYA 4BFZA 5JEEA 1Z06A 1OSNA 4LRWA 1R8QA 4F93B 3BRWD 1FP7A 2JDID 4NE2A 1JNYA 1RYFA 2HYIC 2A3RA 1V43A 1W0JD 4EFLA 4FMCF 1N6PA 3ZVNA 4R2IA 1NVWQ 4L16A 2GVDC 4GOJA 2GBLC 4V0NA 1WXQA 3SYNA 3DOEA 3X1WA 1ZINA 3TR0A 5L3SA 2C2HA 3OHMA 2H5EA 1F60A 4Q1DA 1A7JA 4JSYA 1GKYA 1NLZA 1E2EA 4C2UA 2X19A 2FJUA 2ZS8A 2XZOA 4Q9HA 2RB4A 2FOLA 3OAAD 4QHTA 2XZPA 1AJEA 1UKZA 1ZW6A 1N5LA 1XD8A 4M0LA 5B30A 2IXEA 2C9YA 5JI3E 1Z6YA 3DKVA 2EU8A 3AVTA 1H8EA 2Z43A 3R7WB 2R9VA 3JVUA 4RD3A 5FI0B 1OKKA 2O0KA 1YR6A 4LV8B 1E2PA 2HF8A 4F4IA 1TQ2A 2AFHE 4I1VA 2UZIR 3AF0A 3WXMA 3TGPA 2GWHA 1LNZA 1KTVA 2VBCA 1KI9A 2KBFA 2QQ0A 3AP3A 3QUSA 1NBMA 4RCYA 4Q4JA 1KK1A 4HB4A 4E03A 2QAGA 4JVNA 4MUBA 1CEEA 2QUZA 3K0AB 2ZJ2A 1ZD8A 3NXSA 2ZI7A 4WOPA 4NCJA 4B35A 1YR8A 4BFXA 4AG5A 4DCVA 2PT5A 1M7GA 4HLDA 2QGZA 4ACBA 2ZE5A 5FPYA 1IN5A 2OV2A 4LBYA 2MSCB 1SVIA 1MV5A 3CRRA 3BERA 2GCOA 2FFQA 1S1CA 1HURA 2ZAOA 4CEJB 4PHTA 2HJGA 4G5SA 5C18A 1NKTA 4A0FA 2Q3HA 1FQKA 2I3BA 4HAVA 4OI1A 1WQ1R 1D8TA 1AS2A 1GAJA 2BC9A 3SOPA 1T0JB 3ZYCA 4OQNA 5TMPA 2NO1A 2BBWA 1E6CA 3Q5DA 3D3QA 3RWMB 3S1AA 1GP2A 1T3HA 2FWRA 4JVSB 5GJVC 1BO6A 1BYUA 4Q7KA 3THYB 4Q03A 4MKGA 4Q01A 3WRYC 2H92A 3PITA 2RGBA 3EARA 2AK2A 3F3YA 1FP6A 5JRZA 1OH6A 1ZM2A 4O2LA 5HCIA 1ZC4A 2D2EA 3THWA 3LVQE 2CVFA 4LHVA 2Q9AA 3U6KA 3QKRA 2GJAA 2BM0A 4EFNA 3VHXA 3U3OA 1IHUA 1QZXA 2JJ8A 2ZYVX 3OIVA 4ZKEA 2J0UB 4IXNA 4AC9A 1PV4A 3IHLA 3BH0A 3RVBA 4H1UA 2ZRCA 1UFQA 4W5JA 2KWIA 4PAOA 3EW9A 2ZR9A 1E9AA 1RW4A 3EWAA 1SZPA 3N5CA 1DS6A 3QXHA 3MRSA 4CRWB 5JWRA 2XTNA 3NHBA 4BLOA 2ZJAA 1B0UA 3CF2A 2REBA 4LY6A 4EQ6A 1EFUA 2ECKA 4NYJQ 3SS8A 5F3WB 2FEMA 2YOGA 3K9HA 4S35A 3ZJYA 4LJ7A 5JEDA 4MUAA 4D4KA 2DY1A 5E7MA 1L4UA 4C2TA 4EJSA 3TW8B 2WOOA 2YC4C 1N0WA 1E9EA 4FW9A 3FMIA 5SZKB 5DIFA 3IIKA 5FTKA 4RKFA 3QVVA 4JVMA 4WIAA 1L8QA 1NBME 1Z0AA 4MRPA 4LBVA 1Q1EA 3OF5A 3EPLA 1A2KC 3LXXA 4UXJA 1Q3TA 5LPNA 3Q8XB 3VQTA 1GUAA 2C96A 3ADBA 3EIQA 2CE7A 3I3SR 5GVSA 2GJSA 4TQ9A 2HXSA 1VTKA 5JFGA 2A5GA 2QN6A 3B9QA 1J99A 2GESA 2B8TA 5JLJA 2XOKA 3KJEA 4NP6A 5JHGB 2IXGA 1ESMA 4D4MA 1NNEA 4EDHA 4RD6A 3ZDQA 1F6BA 1Q1QA 4N0EA 2NOAA 3OFND 2NO7A 4BZXA 1KI7A 2CMKA 1AM4D 1M7HA 3X2SA 4D0NA 2PEZA 1CKEA 1EK0A 4QG7A 1WDTA 2BEKA 3SQWA 4GP6A 1G8FA 2V7QA 4KBFA 3UG6A 2VIIA 3GMTA 2BEJA 2GDJA 2ZEJA 3CX8A 3ZZTA 2NPFA 2DPXA 2G0TA 4Q5IA 5HE9A 3R7WA 4GDFA 5FBQB 4OJQA 2ZSFA 4CGZA 2WIBA 4L8GA 1G6OA 4M1MA 4JT4A 1XJCA 4G1UC 2CK3D 3IBYA 1G7RA 1QRAA 2ZE7A 5TY0A 3W3ZB 5J4LA 4LHZA 4LJ8A 2QA5A 1QG4A 3BD9A 4KYIB 3N70A 5IF9A 3DHWC 1MKYA 1GDDA 1XP8A 5E7JA 4AK9A 2JJ2D 4DCUA 5J4KA 1NG9A 5EE3A 2WWIA 1FUKA 4POAA 1DE0A 3SEAA 3HYTA 3K0AA 4C3ZA 4FCWA 4KAXA 2FE4A 5FPSA 3QF4B 3HU1A 4HAUA 5TVKA 5AUQA 5DN6D 1TEVA 2F9LA 2QPOA 4UKDA 5G40A 5FBRB 2A30A 4B3FX 1XTRA 2AKAB 1E2NA 3CH4B 2J7PA 4TQUS 5DE3A 1AGPA 4A8JC 5HPYB 1E32A 3CBQA 1Z0KA 3BORA 1X8LA 4DB4A 2D3WA 5LDDC 4ZCIA 3FTQA 2MMGA 3K9GA 1GM5A 2FF7A 4URVR 4GP7A 4CEJA 4QFMA 3KQNA 3WNDA 2W00A 5JBQA 2IYLD 2IX3A 3O8RA 2UVQA 4LYAA 2HLDA 1M34E 1XCMA 2QZ4A 4QJ5A 1UBCA 2WPDA 4ASUA 4EPTA 4OK3A 2IS2A 2G1JA 4Q1CA 5FUWA 3MJHA 1QHXA 2JCSA 4X8OA 2W6ID 4KVGA 1W2GA 3THYA 4M9SA 1VCIA 2LCFA 2W6JD 2WSSA 1DPFA 3V9PA 4OI4A 4BPBA 4PQRA 4QGHA 1JJVA 1KMQA 2N46A 1J70A 1D5CA 4WA7A 5EE9A 3DZDA 3KKNA 3TJZA 3CPEA 4KSCA 1NLYA 1YRBA 2JDIA 5DI9A 1U9IC 4PANA 2VHUA 1XJQA 1W0JA 1J7KA 1GNQA 2CNWD 1R0ZA 4LX0A 2OUKA 1YJ5A 4ZIRB 2EFEB 4ESHA 3SFVA 4LGMA 1YHNA 1VCMA 2X8AA 3BE4A 1R10A 2VHQA 1BH2A 4DKXA 4KV9A 1OXSC 3A4LA 3WMEA 4MRSA 2DB3A 3LVRE 1GILA 4D6PA 3OAAA 2NG1A 5JI2E 1E9CA 1MABB 1Z22A 2O52A 4LWZA 2VP9A 5JSZB 3K70D 3R8FA 1TTTA 2OZEA 4D80A 4D4LA 1M2OB 1JI0A 1VG0B 2CL6X 2X2EA 3FYHA 4XOIA 4PC6A 4M1TA 4L9SA 1ZU4A 2VF8A 2WICA 4XIGS 1W4BA 4TLCA 1XDBA 4DT1B 2RHDA 3EZ2A 1I2DA 4P3YA 2A5YB 1E2QA 4EKDA 4TZ0A 1YE8A 1Q1BA 1FNNA 1ZMXA 4V0LA 5LBIA 3AKEA 4YC7A 4JLBA 4Q4LA 1K8RA 3ADDA 3KJIA 1CR2A 4I1UA 2V6JA 2IC5A 1COWD 2QBYB 3W90A 2IT1A 3QXSA 1IY0A 1KI6B 5EP3A 1FPMA 2BBTA 4XVQA 2Z83A 4BE7B 3M0EA 3MWYW 4BLTA 1T0HB 4PZLA 2WHXA 1GFIA 1OPXA 1RRCA 4M1OA 3W6OA 4M8NE 3F5FA 1OW3B 5UKDA 1KKMA 3LLUA 3A6PC 3AF4A 2H17A 2WMNB 2R6FA 1G7CA 3HWSA 3QPWA 3E70C 3EX7C 3RAPR 3QSYA 3V4FA 4A9AA 1E9FA 3VR5A 4C0QC 3G0HA 3MSXA 2JASA 4ILEA 5E3HA 2JEOA 2VO1A 1HQCA 2OFXA 1VG1A 3X1ZA 2YWEA 4DLUA 4F91B 1G20E 5HKKD 2BMJA 2WKPA 2WSMA 2ZR7A 1UEIA 1NMYA 3SBEA 3SYKA 1I4DD 4KHZA 4TWZA 1W1WA 1BIFA 3T61A 2NGRA 3CX7A 2CBZA 4IOLA 1G7SA 2EW1A 4JT2A 3T1OA 3LV8A 5K8IA 3U44B 2DFKB 2REOA 1R0XA 3KTAB 2G77B 2F43B 5A5GA 3DM9B 4Q19A 1ZUHA 3PUVA 2H57A 3QF4A 3AQ4A 3ASZA 4PXAA 3SI7A 4RD4A 2F1JA 2XEXA 4RSGA 5SZHB 3QQ5A 2C98A 3EZFA 3DDCA 1NJGA 1E0JA 1GVNB 3AVQA 3LO5A 1DADA 3TMKA 2EFDB 5TB5A 3KJHA 4WBSA 3UWOA 3TLXA 4LCBA 2QI9C 3FMPB 4TT3D 4D0LB 1XPRA 1KK2A 3BFVA 3ZS8A 5CYOA 1TU4A 2PJRA 3KDSE 3LA6A 3A1SA 4O0MA 2A78A 1F3OA 3MJRA 1TL7C 1U2RA 1S3GA 3Q9LA 2HEIA 1LFDB 2ATVA 2QM8A 1Y3AA 3LH5A 4JJZA 4TTRA 2VA8A 4DDUA 5IT5A 3K70B 2BMFA 3MMPA 2XNSA 4HDQB 2MMCA 4RJLA 4MGYR 2XNDD 5DH9A 3U3RA 3T15A 5EZ5A 2XB2A 4HB2A 4URUR 2FV8A 2LKDA 3KXIA 1IY1A 3QPVA 5ELXA 3THOA 5FBWB 4PSVA 2QROA 1HQYE 2Q3FA 2B6HA 5H1YA 1GL9B 1EWRA 3P32A 4N0DA 1U94A 3WP0A 4IXMA 3D6TB 1RE0A 1N5KA 1GOTA 3F0TA 1OHHD 4FWTA 1GKUB 1R5BA 2F1RA 721PA 1Z0DA 1RKBA 5CB6A 2DWQA 3N2EA 2IWHA 1AKEA 2KI5A 4WZBE 1II0A 2BOVA 4FN5A 4ZIRA 2ZPTX 2VP5A 3GFPA 3BH6A 3RHFA 1W4RA 5E95A 1T3SA 1M74A 4EAQA 1KZGB 3BK7A 3HPQA 4GSYA 4JLVA 2AKYA 1A5TA 2CLDX 2BM1A 3OFNA 5EP1A 5AWFC 4KLZA 5F98A 2WKQA 3EIEA 1FUUA 3CZQA 4BWYA 2YHSA 5LD2B 3OEEA 1MABA 2WMOB 3JZAA 5JSZA 3IHWA 3L8ZA 2IYWA 4HLCA 1X6VA 2FH5B 4CEHB 2RHMA 3FMFA 2GJ8A 4B76A 3W6PA 4MH0R 2OHFA 1KI3A 5CJ2A 3KQHA 4DT1A 2L0XA 3IPYA 2BVNA 1RIFA 3BB3A 2CK3A 1MRNA 1XZPA 3RABA 1E94E 1Z0JA 1EX7A 2NZJA 1P62B 3WYAA 2GF0A 4CF7A 1UBGA 2J5XA 2G1KA 3V4RA 3I92A 4U7DA 2ANCA 2QBYA 1GIAA 3TQCA 5M04A 2JJ2A 4FIDA 1KI6A 3EC1A 3MGCA 1AIPA 1XX6A 1W48A 1MO5A 2J7KA 4HZUB 2AFIE 2EFHB 4XJXA 1BKDR 2P2LA 2PX3A 1XEXB 1FX0B 4JLMA 1Z0IA 1DAFA 2ZYWX 3BB1A 3RRMA 3ICEA 3R8CA 2WWYA 821PA 2W2VA 2OCBA 2QAGC 3CKLA 4DCSA 1YR9A 4DSTA 3NC1C 2V1XA 2AHOA 3OE7D 2XXAB 1AK2A 1LS6A 5C2JB 1N6LA 2FZLA 2XTZA 1VMAA 5FOTA 3DMDA 4M9QA 2A2ZA 3WMFA 4I99A 2FSFA 2RGNA 2KSQA 1U8YA 2J0QA 1ZIPA 4UNRA 2C03A 1XPUA 5GADl 1VECA 4JS0A 3GEEA 1TF7A 3WBKA 4S2EA 2OXRA 4IOMA 4B3BA 1R7RA 1JXOA 2FU5C 2P5TB 4C9BA 1UF9A 3T1QA 5AUNB 5CIQA 4Q4HA 1ZJ6A 2EFCB 2HT1A 3B1YA 2ZS7A 1EFHA 2W6IA 3WYGA 1DAHA 1HY3A 4MRVA 1E2MA 5JMTA 4R7ZA 2W6JA 4TMXA 4EPXA 3U44A 4M4SA 1XTJA 2RMKA 3PCRB 1N2CE 2ZRNA 3NEJA 4ZKDA 1X3SA 1Z83A 1XFAA 2F43A 4HEJA 4MYHA 1FZQA 2GA8A 3T5DA 1JALA 1TQDA 3SQXA 4GFDA 1YZGA 3FPAA 521PA 3W8NA 5FFMA 2D7CA 4CW7A 2CNWA 1AGRA 3I72A 4JKIA 3X1DA 1SHZA 4TL7A 3KQUA 3GJ8A 4RVCA 4QHYA 4M1KA 3Q7QA 1G5RA 2VTKA 2ZJ8A 3ZVMA 2ZJBA 5F2EA 3KKQA 5FUVA 2V9PA 1EX6A 1N6IA 4OHXA 2W0SA 3A1TA 3BOSA 2I4IA 1HEIA 2GK6A 3CWQA 3LDAA 4JZKA 3ADKA 3UPUA 4MKFA 3SFZA 4NCHA 1K5DA 1W5TA 3Q3JB 4DIDA 3QEOA 2IYXA 2F6RA
chains in the Genus database with same CATH superfamily
3AERB 1MAWA 1IXZA 2GBPA 2VTVA 5DT2A 4CDNA 2E7ZA 4E4RA 1IHDA 1I4OA 2IP1A 1VLQA 3ROEA 2PA0A 4OHFA 2XYHA 3WLIA 2R1TA 1T3LA 2G07A 1TUGA 3KB8A 3TVYA 3TLZA 5CNIA 3KYJB 4EJSC 3OE5A 2QM0A 4MQBA 5DYWA 1W88B 1QBKC 2EFGA 2QE7A 3GD5A 5KYYA 1YCGA 2I9PA 3HCOA 1FK8A 3JVDA 4LJ6A 5CLQA 1E2JA 4R98A 3GFTA 5EZ6B 1FEZA 4MGIR 1GITA 1DRJA 4JYAB 5G0WA 1X92A 3ZWVA 1IHOA 3AI3A 2HNBA 4OLFA 3C39A 3ISJA 4OBWA 3Q1KA 4KQMA 3JQPA 3WTCA 3LT1A 1GA4A 1T8UA 1QYDA 3O4HA 3CW9A 2D5LA 1KJZA 2WR8A 4P4SB 2V0CA 4NNJA 1K8QA 2H9AA 2Q49A 3I01A 5CFZA 3OETA 1Q6YA 2WC1A 3ZJ4A 1BVUA 1XT6A 4DSOA 4N47A 2C54A 4UM7A 4BNVA 5HMMA 5HDBB 1V1MB 1ONBA 4M21A 3H18A 1JN0A 1TU0A 3P27A 1JLMA 2JLBA 4FGSA 5CMLA 1DX4A 4JEMA 1KSHA 4ZQGA 3ZTWA 2VC2B 3TD6A 1WDKA 1ZESA 3DPUA 5FOSA 2QN2A 3VXKA 1GGJA 4LVCA 4DR5B 2BZGA 2GHIA 3ODGA 3OKPA 3R74A 1L4YA 1R8SA 1RYMA 2OAGA 2VYND 1E8DA 2WIGA 3GN2A 4JQZA 5BQ5A 4JV5B 3K8QA 4P9NA 1E2LA 4GBED 1L4NA 3MCZA 4B44A 1B2LA 3KJQA 1KK3A 2AG6A 5B1IA 3Q9NA 5KYNA 1PR2A 1Q77A 4GMXA 1QF6A 1U8UA 3C7AA 2IYOA 1YNSA 4JJ8A 1GNSA 4RZ2A 5DCUA 5J5AA 4PSKA 3DZFA 2XLBA 3H17A 1PFWA 5HZHA 1X1AA 3W7VA 2GM3A 3W78A 2XBUA 4EZIA 4XEHA 1TZMA 1E4OA 1U28A 3CUYA 1I3OA 2ORIA 2XV1A 3N2LA 3UGTA 3VPHA 4BQRA 3JQFC 2H85A 1OH8A 2XVXA 3P2MA 2VYCA 2GBFA 4Y2RA 5CCDA 2JI6A 4DIUA 3DQQA 4ZVNA 4RTMA 4C4RA 2XODA 3QY9A 4WCFB 5THXA 2D1TA 4PQYA 3ETDA 1M1NB 3ME5A 2Z8YA 4LW8A 4H7JA 2I6XA 4B4VA 1KBQA 2WVGA 2P8JA 1ZH4A 4Q18A 4NU8X 4CF6A 3EVTA 2H2IA 2I0FA 3EVAA 1GKIA 3HJHA 2RK6A 3RNOA 2YKGA 2BFEB 3WI7A 3B12A 3AY7A 1P2VA 2ZIEA 4LRSB 1GAEO 2CBGA 2PKEA 1OLSA 4KLNA 1UADA 2J3EA 1JHDA 3DXFA 3RRYA 1MRSA 3SBDA 3WK8A 1SK8A 1PK7A 3AESB 1Y4DE 3BAFA 4E2ZA 4G9BA 1IDN1 1V16B 1H94A 4F6RB 4UMDA 5ISMA 1YTUA 4P0TA 4J3FA 3VDXA 2HZ7A 1WX1A 3AM4A 3V1YA 4P86A 1T1EA 2KE5A 3LRXA 3NHZA 4LHYA 1RXSA 3RYHA 5BV1A 5FX2A 4R6WA 3C97A 5IAKA 1U2TA 2HMTA 2Z3ZA 3ZW8A 4B4OA 4JI8B 4MUMA 4R5HA 2XUHA 1NUPA 2BLLA 1Z56C 3HUDA 5ENVA 3U5ZB 3G7NA 1CR4A 2QTTA 2HJRA 4DC9A 2PZMA 3ZE1B 2VJPA 3SKYA 3H8SA 1QGUA 5H83A 4JC4A 1EE9A 4MUNA 5A1TA 1CDEA 3HA3A 5KSPA 1CV2A 5JR3A 4DLTA 5LP6C 1TIPA 3PC3A 5ALPA 1J5PA 4KE9A 3K0EA 3HO6A 4NK5A 4R1NA 3BB4A 2R1ZA 1I7LA 2BHNA 2ZUBA 3NWEA 2UVPB 4HFRA 1JIXA 3N2KA 1XNQB 4ETMA 4NBLA 4WA8A 2HPZA 4ZCMA 2DOKA 3RTEA 3UUFA 3ZXUB 2OCKA 1XKLA 3UC5A 2XCLA 1I13A 1KEPA 4MYCA 3JQ7A 4YAJA 1L4HA 1UKYA 1ZOIA 3CVJA 1JWLA 1E4EA 4GXNA 4ZVUA 1II8B 2HBYA 1XKTA 4IF4A 5AO9A 1WY5A 1XCPA 4PG8A 2I99A 5DGHA 1ZGCA 3DT8A 4YVFA 5A5DA 4HH3C 2BFDB 2FX2A 3A6HA 3CV3A 2UV8A 4QPJC 1V7PC 3OJLA 5HEKA 3WK9A 3EIFA 4D3ZA 2W2LA 1PQ4A 1D0SA 5EWMB 3VUEA 3B13B 4HP8A 1T2VA 4ONEA 5FAKA 1ZUWA 2I6FA 3DUFA 3OCZA 2Z30A 3U19A 4C14A 1GU0A 1TX4B 5CFOA 4U39A 4YAOA 3K8YA 2BZ0A 4PCUA 4RFSB 4TMKA 5CX1A 4UHDA 1ZYUA 4FQ7A 5FOUA 5E4JA 3U7FB 1Y6GA 1G5TA 3NTXA 4CIAA 1Z6AA 3UH0A 3ICVA 1LGYA 1SCUA 4C5CA 4EARA 2MR6A 1JIUA 3K0KA 4OXNA 4P0PB 2YVUA 3AHHA 4WLFA 4RV9A 2FCAA 2JZNA 2VLIA 4IG9A 2GF2A 4GWGA 1MC8A 1B8UA 4N40A 4DBLE 2P2CA 2RFLA 4Z0TA 4B4UA 3DE5X 2NO4A 4IUCS 1MD9A 1SVWA 2GZMA 3EGIA 3HYSA 3L0IB 4I3FA 4QFDA 1QWSA 4WXHA 4ZYZA 3TOXA 4EVSA 4Q4AB 5JS7A 2ZE6A 1WMBA 5JQGF 2QMQA 1RC1A 3V8BA 1L5OA 2VK2A 3HY4A 4JIMA 2QR2A 4FDUA 4LXIA 2WWHA 5SICE 4DQKA 3OZWA 1E66A 4KUHA 1MB2A 1WZEA 4PC7A 4X93A 1CF4A 1ENOA 4CMAA 4ETIA 3KRTA 1KKLA 4UTOA 1JFTA 1NDQA 1ZZGA 2AW3A 3AW8A 1H42A 3N8GA 4XTRA 2B1IA 4FEAA 2F3UA 2GJ9A 4NOJA 3BMNB 1ULTA 1AD2A 1J8QA 5YASA 1DG9A 3HJUA 5L4NA 2OCIA 2O8DA 3KE8A 2CL7X 2AYXA 4G0ZA 3C7CB 5CFMA 3IMKA 2VQFB 3V2UA 2WM9B 3IVXA 1UXOA 1DAGA 3MTDA 5KJ6A 1NP7A 3OPMA 4BZPA 4B71A 4FD2A 2O2EA 3KPYA 1W94A 2BSXA 3LWNA 4NFSA 4ENWA 2O3QA 5DX1A 3C3JA 4UVDA 2JFQA 2VPIA 3QHPA 5IEBA 4B34A 3LY7A 5J5CA 1X19A 1AQJA 2XCSB 1OYWA 2XWJI 3DEZA 4HSEA 2IYSA 4JI7B 3BXFA 3PR2B 1F2UA 2J3HA 1O95D 2PBRA 3IBSA 3E9EA 3O47A 4P34A 5FI5A 4BVFA 3L8HA 1QPZA 3W4KA 1PNOA 2H1OA 2JGJA 4ZAVA 1BWPA 2X1VA 4TWIA 4X65B 4IJKA 2FSUA 1PI3A 3BL8A 1TD1A 4HF7A 4FUQA 2XMZA 2FKNA 3L8EA 2VPZA 3K4QA 5C4GB 4A7PA 4B3GA 3GPLA 3K9NA 4NOMA 3WIOA 1RLUA 2IE8A 1SQ5A 4GXQA 4S1PA 1Y8RB 2ZZNA 3PC8A 4M1YA 4QBTA 3TLMA 4Z4FA 3NMUF 2IU4A 4AIIA 2FGKA 3WLHA 3OJFA 5CP8A 3AWIA 3HSYA 3F3KA 3GEHA 3ESXA 1J23A 4LXXA 2PUJA 2XUQA 2VDNB 4ND3A 4NONA 4EEXA 1EJ2A 3C24A 1TI7A 3DB1A 3BXPA 1BEUB 5I4KA 4DJJA 2RGUA 5EQJB 1Q7CA 3M6AA 4GNKA 1FVOA 1NKVA 2QMHA 4EF4A 1KEKA 4Z53A 3DEYX 5KSYA 1FDTA 1SUFA 1YL5A 2O50A 4PHHA 3PXXA 4QBIA 1YR1A 1D2RA 2CLLB 2VWQA 4NCNA 1GPMA 2HA3A 3BICA 2PYZA 3FY4A 3LUCA 2UZ1B 2WKWA 2B3TA 2E9SA 1UBTS 1R5OA 2C0CA 3PUYA 1E7WA 4GYYA 3QPDA 4DTIA 2EQBA 3FVQA 3TKAA 3P9CA 1BXKA 1IPEA 1NFRA 1VPLA 4D6XA 3QVKA 4IO0A 2OXTA 1TK9A 2ZKIA 5TQJA 1ADJA 1P2SA 2UXBB 3PJDA 4F3TA 5A4IS 2VXCA 3R6DA 4RL4A 4EY6A 2HQ1A 2A86A 4YRTA 4DBVO 1A76A 1OXTA 3U3JA 2XA1A 4AKHA 1NATA 4FJ0A 5ALOA 4O2AB 2FQ1A 4WLUA 3DQPA 1ONOA 2FPRA 2OO5A 3L05A 1EXVA 4AKSA 3QRWA 3R3SA 1UPUA 2OTCA 3AYZB 3GWGA 5DSTA 1KVUA 2XQVA 3AF1A 5KJFA 3ZD6A 4IVNA 1TUIA 1B93A 4LJ5A 3KZCA 1QIFA 3A6JA 4MVWA 3DJFA 1QMGA 1HNXB 1IBSA 1YI8A 1YJQA 2ZS9A 1A1SA 2GAAA 4NEGA 3QPBA 1P6QA 4M54A 1R6AA 2FZEA 3SZ3A 4N3AA 2PXAA 2PGNA 1PTJA 3KR2A 3WLJA 2XTMA 4G1FA 1P1HA 1YIDA 1FUIA 1RHKA 4KPFC 1QIKA 1EFRD 3UB3A 1WPXA 3C7KA 4JELA 1HZZC 2XGJA 1E1RD 1ILEA 3L43A 4BO8A 4HXGA 4KXVA 5H70A 1J8YF 1L3CA 1TZJA 3HRIA 3A1VA 3I1IA 4FYIA 4E13A 2VDOB 1GXSB 2J59A 2P9JA 3CG4A 1DKUA 5DHAA 2PGXA 3FH0A 4YXWA 2Q45A 5DJ5A 3CYFA 3I5XA 3H4MA 3ZBUA 2VDJA 3VYVA 1JFFB 1E1DA 1NVMB 1XA3A 1J2JA 2J5QA 1YBVA 2YWDA 4V0KA 1ZJZA 1U9YA 2Q5EA 4EJ2A 1U0TA 1L7EA 3EK2A 2DQZA 4K88A 3X2FA 1OT3A 4YPVA 4R41A 3QIVA 4A0HA 2OHGA 4Z1MA 1PFQA 3HUUA 5EESA 3HJCA 1WMAA 4IRUB 4M53A 3V5NA 3FPGA 2R7NA 5AW5A 1ZO8A 1Q0QA 3KLNA 3P71T 1SD5A 1XF1A 4RJ2A 2QD4A 3C5WP 3QUTA 5JJBA 4LF5B 5F3DA 3F7NA 4DDHA 4A8PA 4BFYA 1B74A 1DRVA 2D3TA 1QAQA 5JW6A 1OB2A 1GA6A 3MUEA 1I30A 3ICWA 2Q4EA 5ALKA 4U9IS 3CXUA 5J47A 3BG5A 3G5MA 1QHGA 3MCWA 4HUQA 1DNPA 4WZ6A 4B17A 4XCQA 3ZCQA 5LQJA 5CB4F 1BRMA 1XWIA 2MSWA 3DO5A 2O8EB 1NRXA 4L74A 5AK3A 3OA0A 4O4LF 3KWJA 1Z4QA 1H5UA 1A88A 4EPYA 3SOZA 4QUJA 3JQCA 4GOOD 3ZI7A 3IJRA 1TJPB 4NY1A 2A5FA 4FMDB 1SZCA 2PKQP 2AMYA 3U4DA 2Q8PA 3R3JA 4UFOA 1CVIA 2XGOA 1GA1A 2B94A 4CIYA 1N3IA 3KTDA 3ZTYA 1SXJD 4BFVA 4QA9A 2V7TA 4MPTA 4Q02A 3ONWA 4JDUA 4TS3A 5HYVA 1WABA 4NF2A 2PPVA 3L1HA 1RP7A 3SDZA 4J03A 1OY1A 1CIJA 4GE0A 4U5XA 5EIBD 2W6OA 3STTA 3VTFA 4EI8A 3EHEA 2H4WA 1H05A 1QYVA 4I19A 5I4BA 2DWUA 4PGGA 4JY7A 1BU8A 1AURA 3A36A 2C57A 4TSFA 1P9RA 2V3WA 1YOBA 4K26A 3MBIA 4C0LA 3ML1A 1CUJA 1FP4A 1DRUA 1EXMA 2DCMA 1HRKA 3M4ZA 5EE5B 1KIFA 5LXTB 4X66B 3IKTA 4LI0A 5JAOA 1GCUA 1G8HA 2DU8A 1UQRA 1UZMA 3E1SA 4YHHB 2QLTA 4EYKA 2A5LA 5CXUA 3I6BA 4XGRA 3B52X 4QQRA 2XKJE 4E5KA 5D5HA 2DHDA 3FIJA 3RVJA 1IAVA 2QTMA 1S01A 1OAOA 1V1RA 1XTBA 3PDIB 5JSYA 4DMHA 4ZGWA 1DAMA 2CNLA 1MB4A 3CUEF 3PSAA 3U49A 1MIHA 1T36B 3DLIA 5AJHA 2JG3A 3LRPA 2Q0HA 4GYKA 4Z9BA 3ZVLA 4F12A 4XIIA 1M5UA 2BHSA 3OQBA 4X90A 5DTIA 4B74A 3TOVA 1O96A 5KVQA 1PIWA 4BE4A 3OZSA 1M0SA 3WRWA 1MO2A 2JI7A 3A6FA 4TWBA 4BX8A 4DJEC 4HUTA 3J81k 2C77A 1H8ED 4RAQA 4CT4B 4X1IB 121PA 3G5AA 4AZ3A 2WD9A 3ZE8A 4BUZA 1CYDA 3EXHB 4UU7A 3Q87B 3EH1A 4M9CA 5A5EA 1JUDA 1KZ4A 3OM9A 3SPXA 4OBBA 5LZ5A 3WK5A 1TJ5A 1OV4A 1QH1B 3DDHA 3DONA 4WX2B 1U5BA 1E58A 1RJFA 2ZTHA 4MP3A 3TQTA 1NR1A 4GRDA 4WY2A 4DQDA 5K5EA 5KPDA 4F6LA 3TR6A 5EQTA 4Y1RB 4HADA 4AG3A 5BV8A 2O5EA 2OK8A 1I51A 3GQVA 5L53A 2J9YB 4RELA 1V26A 2FG5A 3NNNA 3N8IA 4ER7A 4A36A 1U6KA 5HF9A 2C58A 1DCMA 1DKQA 4URZR 4G9EA 2IV3A 2Z3WA 3K96A 2FMXA 1IH8A 3AF3A 3NIWA 3QVLA 3W6NA 3IELA 4G3XA 4C3VA 3DXXA 3KJGA 2DUNA 3K92A 4AZTA 5C3UA 3EIXA 1OWPA 1U7DA 5FJJA 3PDHA 1JQ5A 4YQZA 1SUDA 1JE0A 3QVGA 1T35A 2AD1A 1V4NA 2F17A 3KHTA 3RROA 1NPDA 4YCJA 1MHTA 1JGTA 1QHSA 2C95A 2ORWA 3I42A 1YDMA 4K6OA 4AQYB 1T4GA 2FY8A 4YIKA 2VHCA 4HY3A 4FFSA 2EYUA 1XUOA 1NJ6A 2GPAA 3WQBA 4M9UA 3VKGA 1VM6A 2PS3A 3AUUA 1IN6A 2I6QA 4C0JA 1N6KA 4MULA 3K1AB 2H5JA 5EHNA 5K7SA 2YC2C 3AR3A 3DEFA 1KFJB 3L7OA 7REQB 3M2PA 2EKBA 5H9WA 4HN9A 1KSGA 3RB8A 3JQDA 3WX0A 4LF7B 2R4QA 2JGNA 3JATB 4M0CA 4ZHQA 1SXJB 4Z7QB 4PEVA 5E1BA 2P78A 3OOJA 4KTTE 5DSZA 1BJRE 3VX3A 3VVBA 3RAGA 2OKGA 2ZJ0A 2JJQA 2AFRA 1EVEA 3DHYA 4GEKA 4IXDA 5E6SA 5CM8B 5HUJA 2WTUA 4JGGA 3D3JA 3HC7A 3GLIB 4EJ6A 1YRAA 1GAXA 5FWYA 2DBQA 5K8JB 3BWDD 2J3DA 2C59A 3H84A 3HCPA 5FLKA 2PSHA 4R5MA 1R6TA 3UMCA 4XDZA 1KNXA 3B5IA 4N1AA 3HKBB 2OVBA 4H7HA 2IBTA 1H4SA 1OYYA 1U3CA 2VG8A 2AOTA 4DBLC 2C2WA 4OAQA 2RKOA 3UG7A 3WIVA 1ULZA 1YIOA 5CVUA 4Q21A 2HX1A 1U1GA 2DM6A 2VP0A 1PT6A 1RRFA 1VG9B 2WI8A 1UWVA 3D5QA 3L40A 3CX4A 3IE2A 5DGDA 4K0KB 2CCJA 1ZU5A 3OIDA 6NULA 1CYEA 4IH1A 2MWMA 4TRNA 3C1AA 1I4WA 1PT7A 1RTKA 4U6SA 1JDPA 1KI1A 1WA5A 2IUUA 3SCZA 4YYZA 4XYGA 1SXQA 4D3YA 3QU2A 5C1DA 3I6YA 1QHHB 3KJFA 3SVZA 1H8HA 3LUKA 3WKEA 4B6SA 1SKYB 3W05A 1DAOA 1SC1A 3EGDA 5FNVB 4NH0A 1O94A 1N7JA 4H7FA 4L2IA 4RIHA 1CR0A 1JYEA 3ACDA 4C6TA 1EHCA 4YUAA 3L8CA 1LX6A 1RBZA 2AEMA 3QFSA 2R7LA 3DBIA 2JVIA 3ONVA 3UGQA 3TTYA 4K03A 3CSSA 4HD8A 1H2YA 1U1IA 1YE5A 3GDHA 2CDRA 2FFAA 1V7QA 3JQAD 4EB6A 2QWXA 4IDBA 3ZH9B 3BJIC 4XVRA 5IKEA 2WDZA 4AAYA 3O93A 2BUCA 5EQFA 5KVSA 3JYOA 1G9XA 1TMKA 3CEMA 3L49A 5EMHA 3QA9A 4ROSA 4YJGB 2W2OA 3A1UA 4Z7OB 4D97A 1KFCB 1GDHA 3OLVA 2P2GA 2Q7DA 5LU8A 4NZ9A 3WBBA 4H27A 3L7DA 2ZB4A 3I76A 3JRNA 3FHOA 1I0IA 1QG6A 4JH0A 1VGVA 4KTVE 3LUAA 3E05A 5C7OO 3FSEA 2GK3A 4E31A 5JYEA 1J6UA 3R4VA 1X42A 1U0OC 3FN4A 4QNMA 2CL0X 5FP0A 3SF0A 4OQPA 5IP5A 2FKAA 1Y4UA 3WQQA 1CEYA 1PGQA 1Y1KE 3WY9A 2COEA 5I5EA 5JQWA 1GZVA 1YBFA 4UUQA 4HN4B 1JMYA 1NAHA 2P1DA 1W76A 2V7QD 4KRGA 2IGTA 2R6ZA 4R3UC 4PVCA 5TS2A 4DDWA 1CQJB 1GCGA 1DKOA 4KNWA 1KVSA 4PY2A 3K0FA 2WZQA 2UYGA 1QSGA 5JVDB 5E6UB 1CY6A 1DIRA 1GZUA 3GQBB 2NN3C 5E4YA 1SUIA 1K2VN 4D92A 4PRKA 1FNMA 3SC3A 3U7HB 2I2DA 2Y71A 2FRDC 2OBYA 1G9SA 1OXUA 4BXOA 5K0FA 2YZMA 1JV2B 4HDRB 3PRJA 4AKTA 4X3OA 2OZVA 3FG9A 3DBRB 5HIIA 3RW9A 3L3BA 4BVAA 2WWFA 2ID4A 3NAMA 4FYPA 4MWTA 4RY0A 1V45E 2QU7A 3H13A 3L4KA 3D59A 4NS4A 1EINA 2DE0X 3M1AA 2ECQA 3RLIA 5L3QB 4DR3B 3RT7A 1S8OA 4DEVA 5I9IA 3AHIA 3THWB 4P22A 3PYLA 2O1EA 1FB5A 1I80A 1P8JA 2IEYA 2V0NA 3AIIA 3GB9A 3KQVA 3M9LA 3D3EA 3OJCA 5D1HA 3FDZA 4NQZA 2IHKA 3IAS1 3WYBA 1HH4A 2JJ1D 3OZAA 1ATZA 5T67A 1TAGA 1EZZA 4BNYA 1EFCA 1TEHA 4PX9A 1FFBA 2EAUA 4HATA 2OGWA 1JG1A 4NECA 2A1TR 3WAJA 2ISSD 4UHEA 4MS1B 1G291 1FFWA 1G60A 1XK6A 4YMUA 1V96A 2ZYGA 3OJOA 2X58A 5GMOA 1KAGA 2PMKA 3T9EA 1E2HA 3UV6A 4CMHA 1UJ2A 1YZTA 4UPVA 1MJGA 1D4OA 4IQFA 4Q48A 5JYBA 3CNBA 4PHFA 2AH5A 5TV2A 1X7XA 2PMFA 1MAAA 4X54A 4RPIA 1IZ7A 4PAQA 5EPEA 4I46A 3MQFA 1GLVA 2FLWA 3M4YA 4HEA6 4JP3A 3BXEA 4LSMA 4MPDA 3QI2A 5FIUA 5K01A 3ND8A 4L15A 4NX2A 1MFPA 3GT4A 3LA8A 4Y0NA 4IEIA 1IN7A 2ONKA 1HOXA 2AYZA 2FCRA 2GRJA 3DAYA 4FFMA 4KAFA 3JQAB 1Y63A 5C31A 1BE1A 2EBHX 3R41A 3K8ZA 3W7BA 1T5IA 2B8WA 2EOAA 2WOJA 1LKZA 1JR3D 4ZOQI 1YZKA 2YWRA 2GN1A 2HTFA 1YQQA 2OYRA 3VNRA 3CRMA 4Q7JB 3RFXA 2G67A 2FGJA 4BIIA 1LV7A 4FFLA 4YR9A 1K7CA 2ZVQX 3R0IA 2E82A 2YZNA 1NN5A 2XRFA 2XCUA 1Z3IX 4RCZA 4UUPA 1WXGA 3WJAA 1QWOA 1XDGA 4X60A 5I8ZA 2YR0A 3HBJA 1T10A 3N8KA 4FI3C 1NVKA 4MICA 1G6KA 1NUAA 3FF4A 3RS9A 5BV0A 1ULAA 5K8CA 3B6JA 1PW5A 3RLFA 1GSHA 1NYQA 1M8PA 3C6BA 4LE2A 1YU6A 2WFLB 4V03A 1GPYA 3U6BA 1UWKA 3HNPA 5HHTA 5KTSA 1IY8A 1BXRA 1AUXA 1QP8A 2GASA 3WGQA 3WSWA 4J76A 3R3VA 4JB8A 4Y2XA 4Y9RA 4YRAA 3K4PA 4I66A 3IDFA 4B6EA 1SIOA 2BUAA 4E2FA 4ZDIA 1R4ZA 4GUDA 1Y8QB 1BS9A 2HOQA 1B4DA 4R2XA 4XB2A 3WZMA 3CE9A 1N6NA 4A23A 5JCJA 3ANYB 3PLRA 4H1WA 1ODTC 3PENA 3CNEA 1Y6QA 3ZLJA 2H1CA 2CE2X 4KQFA 2CYBA 3CF0A 4ALMA 4XRRA 2H07A 1NJSA 1O5OA 3GU3A 4LYHA 3V4PB 4C21A 4CIDA 1QM5A 1U3TA 2ADOA 3I2GA 3HB7A 4JD5A 4PNHA 1JWAB 2ABWA 3EA0A 2EG5A 3VYRB 1MDFA 3D6HA 3OOYA 4DA7A 4LPSA 1NVDA 2DPYA 5HQJA 1U8AA 4D43A 2FPGA 4EHBA 3RUFA 2RK3A 3PJRA 3QG1A 4HJXA 1GNRA 1A82A 1NVVR 1WF6A 3TF5A 3L6CA 2DCUA 4LZPA 1XAIA 3C3YA 1N0VC 2Q3BA 2XDQA 3B2EA 3IQFA 4UATA 1U8FO 4YP6A 1ZI6A 5A7FA 4RK7A 4DZRA 3H2SA 3FKJA 3OQJA 4JYCA 4RD2A 5AHWA 8ADHA 1VKOA 1BMFA 3KQPA 2PX6A 1L6IA 2HMAA 5HQ3B 2XUDA 4C7MA 2G3YA 1PJ2A 2MHCA 4G2NA 1SXJE 3AFHA 1W25A 4UMVA 2Q27A 3L9XA 3U2QA 5B4UA 1A8IA 5I7WA 4QLBA 1BVHA 2IZ1A 1FDSA 2OHXA 2RH8A 4J3JA 4A1FA 4F4FA 3FWKA 3S8EA 3ER9A 2ODWA 3CR8A 2BEVA 2P79A 3INGA 5AH0A 2ZM5A 4AF6A 2VAVA 1MB9A 1XTZA 1ZMBA 2PSFA 3E84A 2FK8A 3DTVD 4UVIA 2AN1A 4DSUA 3GLIE 4BS9A 1ZNQO 3OZXA 2G63A 3ND7A 2GHQA 2GEUA 1DBSA 1KE1A 3WRXA 4WT7A 5AW0A 5BT8A 5HKAA 4S0ZA 1RSZA 4GZ5A 4HB0A 1JLRA 1U7ZA 3KEOA 4QO7A 2WP0A 4MQ5A 3EY9A 3G59A 4JSTA 1P2FA 2VVTA 1NASA 3F46A 3WV4A 3BRQA 1GSIA 1S0UA 2I4LA 3CZAA 2YXPX 3SY8A 2Z2XA 2H9IA 3CO0S 2ONYA 3PQ8A 2Q4RA 4HDAA 3RC1A 2Y93A 3VZRA 3P4YA 4QOIA 3HKEB 2CYCA 5B1HA 3O8CA 1W6UA 1EK1A 2IA5A 2IZZA 4JX8A 4MPJA 4Q3AA 1YB4A 1DIBA 4JLDA 4BUJA 1L7VC 1YE3A 2AG8A 3VVLA 2OAP1 2ZRKA 3Q88A 1QNLA 4IH9A 1SKYE 3ZCPA 3PPIA 1GU1A 3ZCTA 2R7MA 1ES9A 1OPRA 1CRLA 4NNOA 5FULA 3KEFA 4RENA 1V47A 2P9YA 4YONB 2X7JA 3GJZA 4TQGA 1UFOA 5DYNA 5AOCA 2JH9A 4URFA 2OOSA 4X7PA 1M2VA 2DFVA 1T9GR 2C29D 2QL6A 3ETJA 2O2XA 4LZWA 1JXMA 3VM6A 1ORRA 3EPPA 3CRW1 4GPD1 1LCIA 2C5AA 3D3WA 4QXOA 2JEZA 1ODFA 3KX2A 2PZBA 4JB2A 4V3BA 1J9EA 1MNAA 1W93A 3H5OA 2QSYA 1Z29A 3AR5A 4JLAA 4YP7A 3UJPA 2IKQA 4ENUA 1YONA 3M7IA 3OUTA 4UM8B 5F1YA 3GLFB 5GM2A 4MLDA 4OATA 1UMKA 2ZI6A 4M1ZA 4XD7D 4FNGA 5CDYA 3HEBA 1EHIA 4CMGA 1FSSA 1UJCA 4AG6A 2NTJA 3QENA 2PNJA 5JIBA 2JLUA 1CUUA 1AUOA 1BEZA 1E7MA 1UBSB 4IJWA 3AKDA 4RJTA 4YR7A 4YQFA 3UB4A 3OC6A 5JJCA 4J8PA 1I1HA 3UHJA 3VX4A 4BY9E 1S2OA 4H17A 3U1VA 1DPGA 5B58T 3FVVA 4ZVSA 2CFRA 1CQIB 2J07A 4PHCA 5K0EA 1WXEA 1KOGA 1LSUA 3KFLA 5TQ0B 1OH7A 1HDGO 3W8EA 2QTZA 3E61A 3S68A 1W87A 1Z4OA 3AVUA 5AVUA 1M75A 4IHKA 3H5VA 4LJLA 3FGOA 4MQ4A 5JSHA 2BRUA 3ETLA 1JHQA 5I5GA 1EVZA 2NZ8A 5COAA 1MORA 1O87A 1J0AA 4JI1B 1JDNA 3Q3IA 4C3UA 5TT0A 4MYDA 4PNZA 5EJ9A 1I0LA 2X8JA 3FKSD 3IDOA 4IZIA 4WCFA 4AP5A 3AL0C 4L8WB 5ICGA 4LNHA 3ETHA 5ECDA 2QAIA 2WABA 3HCNA 4BQEA 1Y37A 1DLIA 2O3SA 2ZJYA 1C50A 3LBHA 3V1LA 4BEWA 4B09A 2PSDA 4WAUA 1KE2A 4EY7A 4G07A 2VK8A 4M86A 2GBLA 1CVLA 3OEED 4I3HA 2C2ZA 5KTMA 3QOFA 4KNVA 4XPIA 1P9LA 1UZUA 3V8NA 3LVBA 2VQDA 3CF4G 2BJHA 2R6R1 4JQOA 3TSCA 3PTAA 1U4SA 3NTQA 4RKQA 3O9VA 4UNSA 5I7HA 2QP9X 5FA8A 4P4TA 3RIYA 3HKDA 3ZLBA 1WXWA 1TYCA 2GCEA 3D4PA 3T7EA 4CFSA 2VHYA 3QNWA 4EPWA 1U6IA 5F1OA 1M8FA 3AESA 1BX3A 1MO3A 3DTVB 3HRHA 3FTPA 4Q1FA 4O25A 4QVGA 4GO1A 1ZJWA 4D25A 3H05A 4GL4A 4PQFA 2HI0A 2J9GA 2ZULA 4KGXA 4BIMA 1ZUNB 3B6KA 4BBPA 2HF7A 5DBOA 2JKYA 2WZCA 2W11A 5FI3A 1MZVA 2DRIA 2JRLA 4R3NA 2C7OA 2X6RA 4GLOA 4O2RA 3H1FA 4OGWA 4C0HA 4Z9FA 1RJ9A 4D96A 2BFBA 3B3JA 2G83A 2XB8A 3JQ9A 4L5IA 2VH1A 3BMCA 1JEQB 2HRBA 3ESBA 3NR2A 3VNSA 4OHYA 4ITRC 3SAJA 1BHQ1 1RT9A 2JAWA 4GZ3A 4M99A 5SYNA 3T7DA 4ZJYA 1AA6A 4NZYA 3VKWA 2XKAA 2CUNA 3K6SA 1ZK2A 2ZSJA 2D2FA 4TLLB 2CDAA 3WNVA 2DP4E 5IYZA 5LIRA 3JTMA 3IPXA 2ERCA 4QM6A 4AN1A 3B9PA 3AU8A 5IH7A 1F1JA 4YAUA 3PCTA 5CX4A 2R66A 4DABA 5DGXA 2NAPA 5JSQA 5KB3A 4MEAA 4UTRA 1YJBA 1II9A 3K94A 4GOLD 2OV8A 3IFSA 2WJVA 4KQXA 1K7YA 3Q7TA 1OIXA 2HU2A 1YF3A 4R8MA 2WHQA 5FD8A 4ZHQF 4KPGA 4IDGA 4QUIA 3ZK7A 1N5IA 1XU9A 1RABA 2HR1A 4MR7A 2AD5A 5FI1B 5K3FB 4JJKA 3DE0X 4OXXA 1H0KA 5FT9A 1GO2A 1T2UA 1TYAE 1NP3A 4P5PA 3TBFA 1WHTB 3RRBA 3B3QA 3NWPA 2C2BA 1VJRA 4KFTA 4MTCA 3IV6A 4CEIA 4RXMA 1PGJA 1BN6A 1R12A 1ZH0A 2Q3MA 1W85B 1XCLA 5LZ4A 2H4FA 3WKBA 2D13A 3ZU2A 3DMRA 1BCRB 1E99A 1QGDA 3FFTA 3FOBA 3BE8A 4P7GA 3KAQA 1CB7A 1CFJA 4RETA 4MCIA 1ESNA 1E96A 3RSHA 4NESA 4UDYX 2GEDA 5CK4A 4B85A 1MV8A 1V3VA 1MGOA 3DMTA 1E7SA 2G4VA 4U2DA 3P26A 4QOSA 5E9AA 4W7SA 2C04A 3QLJA 2VXBA 1Z63A 3QPCA 4P3XA 3CNLA 1KJWA 3E6AA 4FBMA 4TRJA 1ZD5A 2SBTA 3RIHA 1H2ZA 2OCDA 4ZAYA 3I30X 2E4XA 1Z39A 1KQGA 2Y92A 8LDHA 1V6CA 1LDEA 3BK1A 3RC8A 1SUBA 3TCKA 4MARA 2ZWIA 4LWPA 1H65A 1SCDA 3RUHA 1QLWA 2ZU0C 3KQKA 2P69A 3ND9A 1F9AA 5TSDA 1KXZA 3UENA 3CVXA 4ZOEA 2B4KA 1HYQA 4PLFA 4BMYA 3N53A 4B3HA 2FRXA 4TQAA 3WWYA 5KSZA 4MO2A 2J32A 5IT0A 1WB9A 4PYKA 1YZHA 1EWQA 1ECLA 1T3ZA 3SSAA 5HK8A 3OQOA 4BCCA 4JL5A 3B5JA 3KVNA 4Z4QA 3UXMA 1JQEA 1QOQB 3MJDA 4GI5A 4EYQA 4PR0A 2WD7B 3LY5A 2AWOA 3T5BA 4EG4A 1E61A 2H08A 5HQTA 5FQOA 3QG5A 2Q7OE 5D85A 2FHPA 1H0RA 4XGKA 3MAGA 3N6VA 3MRTA 1X74A 3OFJA 1VGRA 2ZATA 3B1ZA 3C3PA 2WV9A 3TIFA 4G5QA 2NYVA 4IHJB 3WJ2A 1EFVB 1LFAA 3CLTD 1VCHA 3HVIA 3N74A 7ABPA 4LMAA 1QGAA 1Z12A 3TTVA 2DWCA 3E7PA 3NDPA 1Z4JA 4BRZA 5KSWB 1PVDA 3GX1A 3L8YA 1QK3A 3IUYA 3LM8A 4LNUB 3K53A 4Q24A 5DM2A 2PRJA 3C6QA 4AQ7A 2OSBA 4L5BA 2GEVA 3BZUA 4DC0A 4EKIA 2Y1FA 2ATIA 3DVAA 3V7WA 1RADA 2OGUA 4INPA 3M4NA 3G13A 4A1OA 5F9HA 1J21A 1OXKB 4PO1A 2DT8A 1H69A 1GGKA 4YRFA 3GJ5A 1C3XA 2ZUTA 1ZM4A 5A06A 3LY8A 4JWTA 1B6GA 1GARA 3K6RA 4JUAA 3UGKA 3PR1A 4MA5A 5HGJA 3WL3A 1P60A 4EZBA 1XTIA 2V7PA 1Z25A 5L40A 4HAWA 3F98A 1X38A 2EX0A 3E3AA 4JT8A 1NPTO 1CUGA 4LZZA 2C2XA 2CVPA 1N25A 2FRVA 1W49A 1XHLA 2AX3A 5ES4B 2B7BA 4FX5A 4OGKA 2GO7A 2J85A 2BFWA 5BN5A 1LI7A 2QYTA 3TH5A 4E5YA 3EXHC 2VDMB 4O1MA 4ZT2A 2PQ0A 4XWKA 1K98A 1MN6A 2LCIA 5ICCA 5IXSA 4YAKA 4M6WB 4L5CA 2HFKA 1IQUA 3EVNA 4FE3A 2JLAA 1JR3E 3EUWA 4KVFA 4PO9A 3UIEA 3ZDBA 1KORA 1FC0A 1JU9A 3OICA 3V1TC 3S0JA 5MF6A 3L6RA 3K6KA 4QJIA 4MI6A 3CH7A 1WDWB 1XZIA 4RA9A 1YHYA 2YV3A 5CLHA 1DBIA 2DGDA 3HHEA 3QJYA 4UNPA 1L5SA 1SCKA 2WZBA 5CFQA 4NHEA 4OYRA 2XUPA 4B3XA 3JAKA 2O0JA 1W2WB 1GEGA 1N9KA 1L8XA 3OCUA 2G5GX 2HNAA 3GEGA 4FDMA 4KO3S 2R8EA 5FBVB 3F6CA 2FP3A 1XDUA 2HA2A 3F3MA 4P3OA 1NBMD 1NVBA 5IT4A 4RTKA 3NDBB 5IS2A 1LLQA 4GX2A 4QBKA 3GLGA 2RAFA 2ZYIA 4R3WA 3WWEA 4Z5XA 1FPQA 3RSOA 3V2GA 2COUA 5AW4A 1DQNA 1LW7A 2HLNA 1NXWA 3L02A 3O8DA 4WY5A 1MQAA 5HS6A 3EZNA 1ZJ4A 1DXOA 4JLKA 4IWNA 4CV2A 2FSVC 4JU8A 5J2TB 3GLFE 4CLHA 1FP1D 3DZ8A 4Y7CA 3QX8A 3N6RA 3BDIA 2BZSA 4H3HB 1HYEA 4BN4A 4ALNA 2G8NA 4HAIA 4IFIA 4UVHA 4BX3A 1SXJC 2AVNA 2V7UA 1J22A 4DIEA 4U2CA 2RAPA 3GUHA 4DY6A 2VWHA 1QHIA 5BN3B 3QBDA 4ISBA 1Y1QA 4B84A 1WE2A 4V0SA 5EIBC 4MW1A