1G5RA

The three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
157
structure length
157
Chain Sequence
ERGIIIVFTGNGKGKTTAAFGTAARAVGHGKNVGVVQFIKGTWPNGERNLLEPHGVEFQVMATGFTWETQNREADTAACMAVWQHGKRMLADPLLDMVVLDELTYMVAYDYLPLEEVISALNARPGHQTVIITGRGCHRDILDLADTVSELRPVKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COB(I)ALAMIN ADENOSYLTRANSFERASE
publication title Three-dimensional structure of ATP:corrinoid adenosyltransferase from Salmonella typhimurium in its free state, complexed with MgATP, or complexed with hydroxycobalamin and MgATP.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 51
structure length 157
sequence length 157
ec nomenclature ec 2.5.1.17: Corrinoid adenosyltransferase.
pdb deposition date 2000-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02572 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g5rA00
4OI4A 4OQNA 3MGCA 2BMJA 3U44A 1Z07A 4OKSA 2G1KA 2F55A 2QAGC 1IONA 2BEKA 1SKYE 3CPEA 2JLYA 4LSGA 2ZS8A 2DCUA 3BFVA 1SKYB 3L43A 5EUMA 3FMPB 1PJRA 3FE2A 3R20A 1VCNA 3RC3A 5JHGB 1G19A 2FF7A 3MAAC 2V7QA 1KZ7B 3BGWA 5SZIA 3OFND 3QF4B 2R6CA 2D06A 4A0GA 3CRW1 1TF5A 2RHMA 1M7GA 1JXMA 3K9HA 1Z6YA 3TW4A 5FUXA 3GD7A 3ZH9B 3U7FB 5E3HA 2GILA 4PSVA 3GJXC 1KTVA 3FWYA 1Z63A 3PEWA 2J0UA 1DAEA 5KPDA 2O8FA 4KHZA 2GWHA 1NNEA 3T5GA 2O8BA 3AKCA 3B6EA 5KSZA 3GLIA 4KI0A 1KK2A 2J0QA 4V03A 2VSOA 1E96A 5E4FA 4II7A 3RWOA 1IAQA 1U81A 4B3CA 1OXSC 3G5UA 1W2HA 4ZCMA 4OHZA 2ZJBA 3M0EA 1W49A 1COWA 4JL6A 2QM7A 3UKDA 4A8JB 2QE7A 1NVWQ 2FE4A 1D5CA 4C0JA 2P2LA 4YMWA 2UZIR 1XCPA 3RRMA 3O8BA 2R44A 3CWZA 5DO9A 2NO1A 3B8HA 3RRZA 1G4AE 3VHLB 1E9SA 4Q4AB 4GNKA 4ESHA 5JMTA 2RGBA 1KO8A 1A82A 2JLXA 5E7IA 2RGGA 4PXAA 1VTKA 3GFOA 4U00A 3EPHA 2YOHA 3OEHD 2VRWA 5DI9A 4QNRA 2VA8A 3B60A 3MWKA 4D4KA 3HYRA 1Q1QA 4D4MA 1KSGA 2XX3A 4AK9A 3BH0A 5EE0A 1M1YE 2X19A 3QPUA 5H1YA 3VR2A 2BV3A 3PR1A 4P4UA 3VFDA 2QQEA 3A1UA 1W7AA 4FI3C 3NKVA 4DSUA 4A0HA 1WA5A 5HCNA 2VQSA 1U0LA 3MD0A 1C1YA 4UJ5A 2XNSA 4CEIA 3S1AB 5KDDA 4CDGA 4FMCB 5DI3B 5DN6A 2OFOA 1VPLA 1ZJ6A 1NSFA 4NU0A 4C2UA 2ZI4A 1R8SA 4XSGA 3LAWA 3KJGA 1X8JA 4HDCA 3BORA 3SFZA 1GZSA 2F7SA 1CS4C 2D2FA 1VYVA 3TQCA 1NSTA 2IYTA 3NHAA 2G0TA 1WB9A 2PLRA 4GMDA 4XD7D 2PZFA 4L15A 3P27A 4CIDA 1XEFA 1MV5A 4C0QC 3BE4A 3H0KA 3PITA 4LHYA 221PA 1YR7A 4DZZA 1G3IA 3K53A 2VP4A 1MR3F 3SBDA 1ZM2A 2XTZA 1NMZA 2AR7A 2ZR0A 1GDDA 4BFTA 3I8SA 4D81A 1OLOA 1CRQA 4NCHA 2H1LA 2QT0A 1U99A 1XXHE 2EYQA 4K46A 1WCV1 4I81A 2GRJA 1XXHB 1QG2A 3A1SA 4XWAA 4XIGS 4Q4JB 2C8VA 1WBDA 2QPOA 2BBWA 2C5LA 1JNYA 3SJBA 1GSIA 3PV0A 4HLUC 4B71A 3U7GA 4GFDA 3ZVMA 1P73A 1G7RA 4RFVA 4XH9B 4D6PA 2NMVA 2FDCA 3C5CA 4NCNA 5EE3A 3LV8A 3A1WA 4Q19A 2H18A 4A2PA 2I3BA 2KBEA 3FHTA 1VCMA 3HU2A 5C2JB 3AF4A 5CITA 4M9XA 3QI2A 4TMVA 1SXJC 1NVVR 1CR0A 3TGPA 3I8XA 4B3GA 4MH0R 1Z83A 4QGGA 3WY9A 2YWFA 3K0SA 2P6NA 2AFHE 2IS4A 4OHWA 3NVAA 4PPNA 4A2QA 3RABA 4ZDJA 4D80A 2XOKA 2CK3D 4M1TA 1DOAA 3GJ6A 4MRPA 4LYHA 1KJZA 4CEHA 4KCGA 3Q5DA 2IUSA 2ZRJA 5EZ6B 2G1JA 4TTPA 5FUYA 4C0SA 1G5RA 4RFSA 4L8GA 1ZM9A 3IDQA 4WZAE 4XVRA 3DMNA 3ZS9A 1A4RA 3BIFA 3GEIA 3VR5A 3TQFA 3U44B 1XMIA 5BQ5A 4NYMQ 1KAGA 3VAAA 1X6VA 2NO7A 3QVUA 1G20E 4ZCLA 4Q7JB 1X8LA 2VP2A 3THWA 4LY6A 2DYKA 5FFMA 1AN0A 1X1SA 1HY3A 5A0FA 2P67A 1JQLB 2XZPA 3AVPA 2VHTA 2GA8A 1JI0A 2C98A 3I1FA 5EE9A 3X1YA 3H86A 1K5GA 2WBLC 3NDBB 3V00A 3DPUA 1ZM4A 3VR3A 2V3CC 1KY2A 3SJCA 1GUAA 2JJ8A 3UANA 5DNYB 1FX0A 2H7VA 2GJSA 2O52A 1SZPA 5KNCA 2ZUBA 1N25A 4FWIB 4AURA 1NKTA 2J0UB 2ZU0C 4G01B 4M1SA 2MMGA 3TSWA 2G9NA 3UMRA 1YZGA 3LW8A 2O8FB 5CB6A 5GJCA 2O8BB 3GLIB 4JLMA 3GPLA 4GI7A 2WM9B 3PUYA 3AP2A 4IDPA 3FPAA 3SZRA 2PMDA 1R5OA 2GZAA 4B2IA 1MABB 3N70A 4BLOA 2GHIA 1J90A 1T9HA 2DPXA 3QOFA 4I1SA 5C4GB 1NVUQ 1QHIA 3WP0A 2EVWX 1ZIPA 4EPWA 4GMXA 4B76A 3C41J 3KJHA 4AYXA 1TTTA 2Q3FA 2C78A 3PEVA 1QRAA 3EIHA 5BWMA 2JIZA 4LJ6A 3THOA 1WBBA 5JSZB 3RHFA 5FUVA 1ZCBA 2D3WA 2Z43A 4QOSA 5DH9A 4RZXA 3UATA 2JASA 4XOIA 3WRXC 4Z54A 4WXRA 5J4KA 2YWGA 4MQBA 4KYUA 1F6BA 5CDFE 3I5XA 3QKTA 4IDNA 3KKNA 4UNQA 1W0KD 2ZYVX 4OBEA 3FHCB 1W36B 1EK0A 3EASA 3SR0A 5FL7A 5LD2C 1HQCA 1HT1E 2J3EA 3L0IB 4FMDB 1LNZA 2Q9BA 1CR1A 2EFDB 4WZ6A 4RD0A 1VCIA 3IEUA 1YKSA 5DE3A 4DT1B 3B5JA 2ZRPA 5JFGA 4JLBA 1UDWA 4JL5A 3KTAB 4H9GA 5IK2D 4CEIB 4LPKA 2IUTA 1KSJA 1GNPA 1UBEA 2OFWA 4W5WA 3ZZ0A 4PZZA 5EXSA 1K6MA 3AM1A 5UKDA 3WXMA 1GL9B 3CLVA 3MMPA 1YZNA 2GXSA 1G6OA 2QGNA 3CW2A 1IHUA 2Z4SA 4A0FA 4JJZA 3LWNA 4P31A 5FBVB 2VO1A 4DIDA 2CJWA 3QEJA 5E7JA 3VR6A 4BASA 1MRNA 5TDHA 1JJ7A 4GBMA 4DCUA 3AGQA 3HPQA 4P3YA 2PLFA 5HE8A 4A6XA 1AS3A 2C77A 1N5IA 1GITA 2E87A 3LNCA 4EFLA 2IX3A 2FSFA 3H2YA 3KB2A 4LJ9A 2ZE6A 1AZTA 1M2OB 2ZPTX 4TL9A 4R71A 2FV8A 1RRPA 2PEZA 1Z22A 2QP3A 3IBYA 2GF0A 2CLSA 1E1QA 2F9MA 2W6JD 2Q0HA 4C0HA 1AKYA 4DLYA 4DDVA 1OB5A 4YDHB 2X77A 5FPKA 2YWEA 4KFSA 1NY5A 1Q44A 4BZQA 3P4YA 4EDHA 2WPDA 1Z2AA 3TUZC 2IYQA 5J4LA 5HZKA 3AF0A 3ADBA 3IQWA 1G8HA 4W7SA 1S3SA 2W83A 4DCVA 1XTRA 5CB8A 2ZE5A 3R9WA 2QRNA 3LH5A 2GF9A 2K5UA 5AUPB 1Z47A 1NRJB 1Z6XA 2ZYTX 2VP9A 1FW6A 3Q85A 4FD2A 2N42A 5B64A 2DFLA 1UFQA 1KDRA 4A1FA 4DEYA 3WMFA 4ABYA 3X1XA 1H8HD 1RYFA 1KK1A 2IWHA 5GADl 3W90A 4L9SA 4O3MA 4QBFA 1G9XA 2AWNA 4ZO4A 4ZDKA 1ZU5A 3FDIA 4IOJA 4PQFA 1CJVC 1XP8A 2QENA 4B73A 3IIJA 2NOAA 1L7VC 4O25A 2QMOA 2ZYWX 2P0EA 1J8MF 3NBYC 1G41A 821PA 4L5BA 4Y0VA 1FNMA 2H5EA 3NG1A 1W4BA 3MUFA 4D0GA 5J5CA 3TBKA 4D25A 1XEXA 2XEXA 1SXJE 3EC1A 3QG1A 4I99A 3MSXA 2DHRA 3BH6A 1NN5A 4CEHB 2FSIA 1LS1A 4YC7A 1D9XA 1ZNXA 2OT3B 3AF3A 4RFSB 3K0FA 1NJFA 5C18A 1DARA 1T5LA 4V0OA 5HE9A 3TAUA 3BC1A 1QHHA 2OILA 1HT2E 2VSFA 2B8TA 4C2TA 4MKHA 1NL3A 5EE5B 3QPWA 3C16C 2ZRKA 1XD8A 1JR6A 2WVJA 2OEPA 4EKDA 4IXNA 3AF2A 3F5FA 4FCWA 4F93B 2OBMA 1X86B 3LBIA 2ZR7A 1NI3A 2ZJZA 1E2DA 4MGIR 3C5HA 5EE1A 1RRFA 1VECA 3VKWA 4GT1A 1DEKA 3U2QA 5JI2E 4DLUA 1B23P 4CT4B 1OFIA 2QGZA 2FNAA 1EXMA 3UMFA 4Q18A 1QHGA 2CNWD 3DEFA 3AP1A 1E9RA 3AH8A 5HTKA 1KI7A 1AM4D 1TX4B 1FZQA 2GAAA 3LLMA 5IF9A 1IY0A 3U7HB 4PHGA 1D2NA 521PA 1WF3A 1E9CA 3SI7A 4DHEA 2RGNA 3THYA 5CLQA 2GJAA 1T0JB 1U9IC 5B58C 4JSTA 1NJGA 4TMZA 2QP9X 5EP2A 1E2LA 2Q3MA 621PA 4AY2A 1ZM7A 4Q00A 2ZI5A 4TN1A 4Z51A 1ZINA 4QFMA 5K8LA 2C9OA 3E1SA 2XJ9A 4YMSA 1II0A 1MH1A 2FEMA 3U3MA 1CBUA 4Q1CA 2GEDA 3IIMA 3T06B 2ZRNA 5FTJA 4PO8A 3WMEA 8OHMA 2GTPA 1GNRA 4GSYA 4ZDWA 4L4UA 2QRZA 3K9LA 2W0SA 5KDLA 3I61A 4BFSA 4I4LA 4F38A 4US1R 1WMSA 1OKKA 2JDIA 4GOKA 1KZGB 3JVVA 1WRBA 2W2XA 4URUR 2ANCA 1UF9A 4A8JC 2R6GA 2MSDB 5L3RA 1H8EA 4JVMA 2ZE7A 5IHPA 1ZD9A 5DISB 2WOOA 3CX8A 3NH6A 2VHJA 4M1KA 3THXB 5FPYA 3AKEA 5FL3A 3SE0A 1JXOA 1US8A 2HEIA 2FFAA 5H8WA 4ZV4A 3CH5A 3WYGA 1DBSA 2Q9CA 4P33A 1JR3E 1DPFA 1E2NA 1KAOA 4QBGB 5DHFA 4AD8A 2IYSA 5BN5A 4U7DA 3T61A 5L3VA 2O8CA 4ZKDA 1JECA 1P61B 1GVNB 4G0NA 1N0UA 2QU8A 2NIPA 3B2EA 2N46A 1DELA 3EX7C 2ORVA 4DLZA 3PEYA 2WWYA 2EU8A 2GBLC 1VIYA 4A15A 3K1JA 1KKMA 3KB1A 3NEYA 2HV8A 1KO7A 1E9AA 1G17A 1GNQA 3ZGXA 5AJYA 3K09C 3L0SA 4NYJQ 4XVUA 2ZVQX 5FH9A 4CEJB 4B34A 1LV7A 1XRJA 3I92A 4CRWB 1BOFA 2IEZA 1N6IA 3ZS8A 3OFNA 5KSOA 3ZJYA 1CF4A 3A37A 3K0CA 4POAA 4NHOA 2FSHA 3VU9A 2ZRLA 1F5NA 4RKEA 2HF9A 5AUNB 5EJEA 1P6XA 2ZQ5A 2NZJA 4LYAA 2YC2C 4NKRA 4QL3A 1IN6A 5DIFA 1Q22A 4QHTA 2OESA 2FJUA 4WAUA 4Z8XA 1SVWA 2TMKA 4M9ZA 4Q1AA 3DL0A 1M7BA 2WSMA 5FR1A 3CR8A 4H1VA 4LYJA 5JEEA 5JS8A 3U61B 1CEEA 2WAYA 2ZJ8A 4Q21A 4A9AA 2P6RA 3CPJB 4ZI2A 1P2TA 1MO5A 1OHHD 5AR1A 4BFYA 2DBYA 4FXPA 2GAOA 4W5HA 2CL7X 1FOEB 4KAXA 3ZIAD 3GMTA 121PA 1VG0B 2FA9A 2FPLA 2R9VA 3L0PA 4R7ZA 3TRFA 5KOYA 2IF0A 3QF7A 1IN7A 4GZLA 3R7WA 1PUIA 2WICA 4Q66C 2GJ8A 1XEXB 2JLSA 5G3YA 2REOA 1GRNA 1O87A 5FOWA 4HEJA 2JJ1D 4PPGA 1XCGB 2J9RA 3CUEF 2A2ZA 4DLSA 4JVSB 4BUJA 5HR5A 3EPLA 2V54A 4EQ6A 3K0FB 1YRAA 2ZXUA 2J1LA 4OYHA 4V0ME 5JS7A 2KJQA 4MYTA 2D7DA 3PUZA 5A5GA 1QHHB 2DR3A 1G291 2AFIE 1U90A 4ACBA 2HJGA 1RVDA 4TZ0A 4PAQA 2QBYB 3WYAA 2OSBA 3KKPA 2AD1A 4GOJA 3TAHA 4PO9A 2JCSA 3T1TA 4EPRA 2FMXA 2J59A 1FQJA 2Q9AA 2ODWA 4GRAA 2RB4A 1TEVA 2QTVB 3QUSA 5EQTA 5C1BA 3I32A 1EFUA 3W5JA 1KDPA 3HP1A 1CJKC 2XB2A 5KTYA 3F8TA 1DG3A 4C30A 4FW9A 1TADA 1XTKA 2NO6A 2QORA 3CZQA 4XD7A 3TIFA 4BLSA 4DCNA 4NBSA 3RC8A 1G8PA 3IPXA 2V6IA 1DAIA 1XD2A 1MRSA 4AKEA 1KOFA 4TYQA 1ESMA 3QXSA 3AVUA 3THYB 3MJHA 4NYIR 4YMUA 3LX5A 2ZANA 4QJ4A 3AVQA 4LZZA 3P20A 3RRNA 1YR8A 2QSZA 3VKHA 2ZI6A 4C7OA 1YZQA 4BRUA 2ZI7A 2BBSA 2H16A 5ANRB 1KSHA 2B7BA 4RD1A 2YNMA 2UKDA 4TLDA 1FUKA 3MWJA 5BYJA 1VYUA 1ZNWA 3M6AA 1Z28A 2WWGA 5EXPA 4EPYA 1UJ2A 1N6LA 4JS0A 1NKSA 1EWRA 5TV2A 1Q12A 3IEVA 4AKHA 4A92A 3EWAA 2HCJB 3KUCA 4G5SA 4LX0A 3U3KA 3NTUA 2SHKA 5G40A 4PFSA 4B3XA 1FNNA 1T8TA 3GFTA 4DUGA 4TQUS 1Z06A 1ZP6A 2QMHA 2REXB 2O0HA 1EFRD 3QVVA 3KJIA 5KPJA 4OK3A 2AXPA 3AQ4A 3IBGA 1Q3HA 3B1ZA 3AV0B 2PH1A 2NO0A 1W47A 3ADDA 4QC2A 2NO9A 1KGDA 4XTCS 2VF7A 5KYKA 1G4UR 2ZREA 3HPRA 3TE6A 1US8B 4QGFA 3B1XA 3JVUA 1X3SA 2HDNB 2PCLA 1VIAA 4IHQA 5CLLA 3WHLA 2JLVA 4OQXA 2X2FA 4XVQA 2Y8EA 2VH5R 4LI0A 2YV5A 1G21E 4ARZA 4YXWA 2H8KA 3I5YA 2WIAA 2EFCB 4MRRA 2HLDA 1UEJA 1W36C 3EIQA 1XPOA 3REGA 1QVAA 3Q7QA 4Q03A 4QM7A 1ELOA 4Q1FA 1R0YA 2V1XA 4RD3A 1KK0A 4M21A 1U8AA 3GJ7A 5JWOA 1KO1A 2Z4RA 4HB3A 1AS2A 2CMKA 2VP0A 3KZ1E 1IJEA 1GTVA 5TY0A 3SYKA 3REFA 3VMFA 2NGRA 2ZETA 5CK4A 3RYTC 3SS8A 2XAUA 4O2RA 2R2AA 4AI6A 4R9UC 3QQ5A 1PLKA 1VG1A 3I3SR 3VU9B 3IKJA 2IC5A 2CHVA 5J4HA 1TUIA 5GVSA 4RD6A 5B57C 4WOPA 2VSXA 3VR4A 4QKQA 4Q9HA 2FX3A 1CR4A 4HAUA 1ANKA 4IOMA 5JJIA 1L8QA 2HCBA 3IILA 1MOZA 3GLFA 3K70D 3AGPA 2WWFA 1G16A 3NC1C 3GP8A 5DYGA 3BB4A 1U2RA 3OIUA 3MFYA 3QIAA 5KUTA 1AGRA 2F9LA 3UXMA 4LHVA 3RS2A 2F1IA 2P3SA 4BFVA 2PJZA 4IXMA 1NMXA 1VG9B 4HUTA 3R8CA 2ZS7A 4QXAA 5IDVA 3K0AA 1Q57A 4HATA 3RSOA 4BQSA 1Z29A 2KWIA 3BXZA 3TK1A 1KI9A 5JEDA 3AKDA 4D26A 1E4YA 3AVXA 1OXUA 1ZD1A 1WXQA 2QNRA 4KSBA 1NBMA 1L2TA 2P65A 5SZHB 2YINC 5AJZA 4Z1MA 1OH5A 5KDOA 1Q0UA 4EQ6B 1JQJC 1KDTA 2QM8A 5L8VA 3P1JA 4G5GA 3WBKA 2RKOA 4WBSA 1W0JD 4IEEA 2GK6A 2G3YA 1K5DA 3OIYA 4PTLA 4HI0E 1OFUX 5IK2A 2EWVA 5B30A 3RS3A 4XWOA 2V7QD 1XFAA 2IBMA 1A5TA 3OIWA 1RJ9A 2CHGA 1DG1G 3UWKA 2NQ2C 1ESNA 1Z0IA 3IGFA 2BOVA 3GEEA 2ORWA 1XPUA 3GLHA 1OIWA 1CIPA 4G1UC 3SJAA 4F7WA 1NIJA 4R2HA 3SFVA 721PA 2IS6A 2ZYUX 1HEIA 2BCJQ 2F6RA 1DAFA 4DLWA 1P4SA 1UBFA 2QMEA 3IPYA 1QHXA 2BC9A 4HLUA 1RRGA 1XD2B 2JGNA 4JJKA 1ZIOA 4M0LA 4XWKA 4F92B 3PIRA 4FN5A 4A82A 1YU9A 3HU3A 4JIMA 4BLQA 4DRZA 3B85A 1EG7A 2QE7D 2ZJOA 1IY1A 1SKQA 2CCKA 3PEUA 4UNRA 5K8TA 2OXRA 1KKLA 2X1VA 2XNDA 3KX2A 4FINA 3VX3A 4C7OB 3C15C 2V9PA 4BLTA 5A4JA 3L0OA 3WBJA 1Z6TA 4FWTA 4E07A 4ZPXA 4M1WA 4ZDIA 4JBXA 3E5HA 5KU1A 2WHXA 2HJVA 2BHRA 1I2MA 5TARA 4HLDA 1E3MA 3FMIA 2R6AA 2OBLA 2ONKA 1E2KA 1ZRHA 1RW4A 3UMSA 5EP1A 1N0WA 3ZZTA 3CO5A 1M8PA 1PLLA 2EFGA 2GJKA 1MT0A 3TJZA 4CW7A 1KHTA 1IN4A 4BPBA 4CF7A 3DOFA 1KNQA 3PVSA 3GLIE 3V9PA 1H8HA 1FP7A 1O3YA 1J99A 4PQYA 1XU4A 4AG5A 2YWHA 1OIVA 2IYRA 4EIWA 1E98A 3FMFA 3NHBA 4K81B 2ZSFA 4PAOA 3Q9LA 2IYWA 4CVNA 4WA7A 4RJLA 1W2GA 2ZS9A 1CXZA 3RDPA 3PUXA 3TH5A 3VX4A 4Q7LA 5DN6D 1KI1A 2F43A 5AWFC 4DC9A 3A8TA 2GEVA 2RCNA 2ZR9A 3QE0A 4ARZB 4US2R 1P9RA 3N5CA 4IDQA 5KNBA 4A36A 3P32A 2FGKA 4IW3B 1OYYA 4Q9LA 3HR7A 1VMAA 2OHFA 2EWWA 1V43A 4PC7A 1R2QA 2AXNA 2QG6A 3EC2A 1RIFA 5FR2A 4EJSA 4OI1A 4LC0A 2J7KA 3LXXA 2GXUA 2REBA 2GESA 1ZUNB 2WWWA 3L8YA 2NZ8A 1E0JA 4LGMA 2H57A 4W5JA 1AQYA 2OFXA 1MO4A 1J2JA 1T4GA 5AJWA 3LO5A 4WIAA 6Q21A 2DB3A 1IXSB 1BMFD 4C0BA 5CJ2A 2BJVA 3FMOB 3SQXA 4RKFA 4RY2A 1KI6A 2G0NA 4NYMR 2WTUA 3KFXA 4KSCA 3ZZUA 1LB1B 2CNWA 2A3RA 2CLDX 2QN6A 2OV2A 3W9YA 2QAJA 5D3MA 3K9NA 3LVQE 3AEZA 3W8RA 4DLVA 1P3JA 4TL6A 1JEEA 3UWOA 1GM5A 2ZSDA 1T91A 4B32A 1ZAKA 3BRWD 4HB2A 4YDSA 4HAWA 4JLDA 2ONJA 4B3BA 3R9XA 1ZVQA 3GLFE 5FOTA 3GLFB 4QBHA 1E4VA 5FTNA 4BECA 3CKLA 1JAHA 2OO7A 4BFUA 2IYZA 1FPMA 1W48A 4JLVA 4Q9KA 2F3TA 1TPZA 4LJAA 4QNMA 1NN3A 3QKUA 1OH8A 3UG7A 4PQRA 4JZKA 5JI3E 3LBHA 1G3MA 3DM5A 4TLBA 4E09A 3BH7A 4OI0A 1R0WA 2QTFA 1W1WA 1ZNYA 421PA 5FTLA 3UK6A 4BFXA 4LV5B 1SXJD 2V8OA 2D4HA 1OF1A 1G64A 5CM9C 2JEOA 1NBME 2A30A 2LKCA 2BMDA 2YOGA 5L3QA 2YZ2A 2BM0A 4YLGA 2PT7A 4IVPA 4B48A 1U8ZA 4MYHA 2FPMA 2XZOA 2C96A 1ZD8A 5DHAA 2WWXA 1Z0AA 1TF7A 5JJLA 3GLGA 3RANA 3NBFA 4S2EA 1E1RD 2UZ3A 1G5TA 4QGAA 3BB3A 2WSSA 4US0R 3RVBA 2KI5A 1G3QA 1TUEA 1OE0A 1AS0A 1OV4A 4P4TA 2I4IA 2XTMA 3JZMA 3DZ8A 3A4LA 1RJ9B 4WXPA 2JLUA 1JJVA 3LW7A 2JLWA 2VPPA 1HH4A 1NY6A 4LRWA 1Q20A 2WMNB 1KNXA 4OQMA 3RS5A 2ZRBA 3EZ2A 1LW7A 4H1UA 4HZUA 5AK0A 3QXXA 4X8LA 4M4SA 1E2MA 5J4YA 3H1TA 1LF0A 1E79D 3FFBA 4TT3D 1IOZA 1CTQA 1XF9A 4OJQA 4PR0A 2JJ2A 1LVGA 5FTMA 2BMEA 1HA3A 3HR8A 5HKKA 2QT1A 1XTQA 4FCTA 4ESVA 2BM1A 5GVRA 4KLZA 4D82A 2GK7A 1XBTA 5KSYA 3E70C 1E2PA 4AYWA 3THWB 4NCJA 4JYCA 5GJBA 5F2EA 5CK5A 4Q7MB 5LDDC 2FGJA 4EAQA 3ZYCA 1GKUB 4FMBB 4V0LA 1UBCA 2A5GA 1NIPA 3W5IA 4TL8A 2F1RA 3HJNA 1MO3A 1T8UA 1C9KA 2CE7A 1G5PA 3KKMA 1FX0B 3OEEA 3PCRB 1QBKC 5EP4A 1XX6A 2Q21A 2RGNC 3BAFA 4Q1DA 3TSZA 2RGDA 3EZ9A 3VR1A 3WYFA 4D4LA 2B92A 4LOAA 2ZI3A 1HTWA 2VIIA 1NLZA 4JLPA 4DKXA 2GCPA 3C4JA 4KBFA 5FL7D 2VHCA 1YJ5A 1OHHA 3DKVA 2B8WA 3WMGA 2ZU6A 1AIPA 3AKYA 4PC3A 4FMCF 3IO5A 3QXCA 3ZVRA 1II9A 1QVRA 2FFQA 4UNSA 1TU3A 3ASYA 3U6KA 2C9CA 3EARA 1PVOA 3GJ5A 4BLRA 2RMKA 2HXYA 3LVRE 3P4XA 1XPRA 4OHYA 4RZ3A 2QL6A 4B3DA 2V1UA 2F43B 1JR3D 3KQLA 1AJEA 1S9HA 4BRWA 1DE0A 1U8YA 3H84A 1R0XA 5EP3A 2ZE8A 4DLTA 1YRBA 2ZSEA 5H70A 4KBGA 1AQUA 1TEXA 4Q4HA 4XJXA 1WDTA 5HCIA 2AX4A 4B75A 1JBKA 4EPXA 3BB1A 1CKEA 4U02A 5H68A 3T34A 4EJSB 2XGJA 2IYXA 1NN0A 1GG2A 4NONA 1ZNZA 1S2MA 1XJQA 4URZR 2QI9C 4PHFA 5FOXA 5FOUA 3EW9A 4ZCIA 4HLQB 4TSFD 3X1DA 2W0MA 3CH4B 4IJMA 3U6BA 3B7GA 1OFHA 1XD9A 4RSGA 4G5QA 4Q5IA 1U9IA 3OE7D 3N2EA 4NMMA 4UKDA 2AK2A 1E1QD 1EFCA 1KI6B 1LY1A 4RD2A 5CYOA 3QF4A 3TMKA 1EWQA 1BH2A 2FFHA 1OSNA 1Z0FA 4KXFB 1I4LD 1ZC3A 4R2IA 1V5WA 3FGNA 3KQNA 5KO2A 4B44A 1XTSA 3TLXA 4BZPA 4U5XA 4GDFA 1UKVY 3AUYA 4BE7B 2LWIA 2L0XA 2ZUDA 1HURA 2ODNA 4MYUA 4PSAA 5DYIA 1UKEA 2CJWB 3DOEA 4M1YA 1RC8A 1QHYA 5LBIA 4UQOA 1FL9A 3PXGA 2IHBA 2ECKA 4JL8A 2J5XA 3X1WA 4DDWA 3EXAA 2ZSBA 3GQBA 4TYWA 1II8A 5ELXA 4LK2A 1KJYA 4A6PA 2Z0MA 3ZQJA 3K0CC 2NPIA 2RGAA 2WJJA 4JLJA 1D2EA 2W2TA 4F91B 1KI2A 2VHUA 2H17A 3OF5A 4URYR 4Q4AA 1OT3A 1SGWA 4M53A 3CX7A 2F1HA 3QJYA 1QG4A 3SEAA 2BBOA 2DFNA 3KJEA 1ZC4A 2AD5A 2GVZC 1HYQA 4V02A 3SYNA 3EWSA 3A1VA 5L3QB 1RYHA 1A2KC 1J8YF 1G3UA 4Y0AA 2ERXA 1LF5A 2EYUA 4Q48A 3W34A 3ICQB 5TVKA 2WWIA 4C4PA 1A1VA 3PUVA 4DIEA 1AK2A 1SVKA 3U3RA 5KSPA 1PUJA 2CL6X 4TMTA 4EPVA 4IOKA 1S96A 2IEYA 3EIEA 1R4AA 3QNUA 5J47A 2XXAA 3IUYA 2GBLA 5C4MA 2FPKA 1IN5A 2XZLA 3T1VA 4DSNA 3ND8A 4J0QA 3UPUA 4FIDA 3SC3A 4HDOB 1P72A 1FTNA 4RCZA 1D6JA 1FMJA 2YHSA 1G8GA 1S8FA 3KQHA 4LHXA 1MKYA 4ASUD 1OXVA 1F2UA 5CM8B 1ONBA 1S3GA 2BIFA 2XSZD 4A2WA 3X1ZA 1Z6AA 2V55B 2CL0X 2BWJA 3QY0A 1IBRA 4LHWA 5JWRA 3LFUA 2ZRCA 1E99A 1NLFA 1Z6GA 3DO6A 4CGZA 4M1MA 1R6BX 2D7CA 3KXLA 3OEHA 3ZVLA 2C04A 1E6CA 1L4UA 3AVTA 1KI4A 2ZM5A 2Q3HA 4WW0A 1MO6A 5SZKB 2D2EA 4G5OA 1Q21A 4HAVA 5L3SA 3KFVA 4RZUA 4X8HA 1T3HA 2QP4A 4NZYA 3W6PA 3VNVA 4ERNA 4TYNA 3QXHA 1QF9A 1YR9A 1QHSA 4HDQB 2FH5B 1NG1A 2JLQA 5IRCD 4XTRA 2HF8A 4MGKR 1N6PA 1U0HC 3FTQA 4LJ8A 2QA5A 2QEQA 4NYJR 1CRPA 4TLEA 2BVNA 4O0MA 4KLNA 1DAGA 2ZRFA 2ZEJA 3SNHA 1GWNA 4WZBE 1GRQA 3SYLA 3NIBA 3CX6A 1E94E 3Q8XB 3TNFA 5K8UA 2DWPA 2GCNA 2YKGA 3O8DA 1Q3TA 3X2SA 2I1VB 2OLJA 2OAQ1 2BKUA 2QPAA 4FMDF 3MG9A 3U3OA 1U94A 1OKKD 3O8RA 1F48A 1IJFA 2JDID 4BEBA 4CT5A 3U4QA 2BCGY 5M04A 2CVHA 4LPSA 2FSGA 5JJKA 4AKGA 1H8ED 3FKSD 4HZIA 3D8BA 3EZ6A 4N0DA 4PHTA 4LBYA 3VQTA 4QHYA 4B47A 2UVQA 4LWZA 2WJVA 4G5RA 1G1MA 4F4CA 3QENA 1G7CA 5AJVB 4TLCA 1UBGA 2OCYC 2OBNA 2A5FA 1FP6A 1VCOA 1SVOA 1R8QA 1RE0A 2DFKB 1WE2A 3BJIC 4L9WA 1VG8A 4CZ2A 1G3RA 2E1RA 4BWYA 4LV8B 1OJLA 1HQYE 5CYPA 1GKYA 4BZXA 4C0AC 3BOSA 2G77B 2OUKA 1OXTA 4N0EA 4BLPA 4MDFA 2IS2A 2W6ID 3I4LA 4Q4HB 3T1QA 4TL7A 3GJ3A 3B13B 3ADCA 2JLZA 3W6OA 5EXTA 2AN9A 4AC9A 5HPYB 1W0JA 3K0EA 4QJ3A 4AWXA 1OH6A 2CDNA 3RRYA 1S0UA 4KV9A 3ONWA 4UXIA 3NXSA 2IXFA 3BWDD 4LJ5A 1S4QA 1XZQA 1S1CA 1GL7A 1UADA 2CCJA 4UXJA 3TUIC 1M6NA 2BBTA 4B3FX 2QAGA 3LLUA 2QROA 1XTIA 2ZJ2A 1RRCA 2EQBA 4KYIB 4KFTA 1YZKA 4ACAA 3ZLJA 3F0TA 1X1RA 2CK3A 5FUWA 1KMHA 1BS1A 2OAP1 4X8OA 1QZXA 3AP3A 2O8DA 2IT1A 2FEOA 3FHOA 2A5JA 1WQ1R 2O8CB 3O8CA 2R65A 4QRHA 3SJZA 2IUUA 4JT2A 1RKBA 3HU1A 2OE2A 2PEYA 1ZUHA 2YOFA 1MABA 4LBZA 2ATVA 5TB5A 1SHKA 3OHMA 4JLOA 3SN6A 1T0HB 2HYDA 2WWHA 3PUWA 2J7PD 1P2VA 1W4AA 1JPJA 1N5JA 2G83A 4Z8YA 1II8B 4JVNA 4PC6A 2GNOA 1OFTA 3B9PA 1KIMA 1N6HA 2ATXA 1CP2A 3OAAD 4PZLA 1ZYUA 3QBVA 2C95A 5JSZA 3JZAA 4Q1EA 1ZM3A 3CNOA 2WKRA 4LC1A 1YE8A 3TUJC 1F2TA 3PFIA 2C99A 4HAZA 5FOSA 4I1VA 2WJGA 4IRUB 4ZIRA 2WJIA 2J0VA 5JRZA 1I2DA 5P21A 2VBCA 4HYYA 5CDFA 4M9SA 3ETLA 1QHNA 1JALA 1GFIA 4TMWA 3KXIA 4PANA 2NPFA 4YONB 2BKEA 2Z83A 3CR7A 1E32A 2H92A 5JLJA 4LBWA 3FVQA 2PT5A 1NVVQ 1A2BA 1LS6A 4HAYA 1TQ6A 2XXAB 2B21A 4DT1A 2XTNA 3ICEA 1HV8A 5BW8A 4R98A 3KQKA 1CR2A 3QPVA 4AYTA 4L16A 4JLNA 1P9NA 3KTAA 2QZ4A 1RZ3A 3CM0A 4Q9JA 5FPSA 4DWJA 4JKIA 4QM6A 2ZROA 1BKDR 4JBYA 4B6FA 4YQFA 1Y3AA 3GJ4A 4TQ9A 3FFAA 3HDTA 2EFEB 1P62B 3IHWA 3GEHA 1YZTA 1F2UB 1IXRC 2PMKA 2GXAA 2KSQA 3R7WB 2P5SA 2WOJA 2ZVPX 2ZRMA 3TVDA 4EUNA 4JVLA 4B2PA 4C0KA 1P75A 4KVAA 4M1OA 2DWQA 3NH9A 1TL7C 3RWMB 5C46F 4GP6A 4PPFA 1IN8A 1W4CA 5GJWC 1W0KA 3KKOA 3D3QA 3CBQA 4FCVA 1BMFA 1KSFX 1P2UA 2AK3A 2C03A 3D6TB 3T1OA 4NH0A 5L3SB 2OLKA 2PZEA 3ZVNA 1NP6A 1G18A 4MUAA 1XCMA 4PHHA 4E5UA 1DS6A 1N5LA 3CF2A 3FOZA 2CXXA 2OCAA 4DCTA 3CNLA 4Q01A 1YQTA 1KO4A 4KU4A 4QBIA 4BFZA 5F9FA 5HZHA 4IDOA 4TZ6A 4EPTA 1KO5A 1RPZA 2ZRIA 2ZSAA 4B43A 3BFKA 4MRSA 1Q1BA 2EW1A 3ZDQA 1E9FA 3ADKA 1FQKA 4DXAA 1TQDA 2AKYA 2G6BA 2ODBA 4EFNA 3U4QB 3K70B 2VHQA 4DUGD 2F1JA 2OG2A 4PPQA 4OI2A 4DEXA 1J7KA 1E0SA 3Q7PA 1W4RA 1XJ0A 4DSOA 4MDEA 3IQXA 3VNUA 4TWZA 3ZD7A 4ON9A 5LB4A 4MKFA 1COWD 2GCOA 1SVLA 3LX8A 1OIXA 3T35A 3A36A 2R6DA 3G0HA 1JB1A 3WHKA 2ZRGA 4OQFA 2W6JA 2ZJAA 2IXGA 3DKPA 4MRNA 2V4ZA 4IOLA 3DDCA 2OZEA 3BFXA 2HUPA 3B1YA 1Z08A 4IFEA 1SXJA 1DVRA 3B78A 4P4SA 2V6JA 1M7HA 1VKJA 4LJ7A 4YXWD 2W58A 5IT5A 1G7TA 2HLDD 3Q5EA 1SQ5A 1AGPA 3AVYA 5AUQA 1G6HA 2HT1A 1I4TD 4OJKA 4LJYA 3ND9A 3UG6A 2LCFA 2GDJA 3AF1A 1CULC 3A1TA 3EZFA 4KFRA 3LQRA 5TXGA 1QDEA 3OIVA 4MKGA 1E1RA 3CZPA 3ZQ6A 3H4MA 3A58B 3CRVA 5JRJA 1W36D 2WZQA 1R7RA 2KBFA 1E9EA 1TQ4A 3RNLA 2C2HA 1Z8FA 3A4MA 2IW3A 1EX7A 4IVRA 4KODA 3UIEA 3U3JA 2IYUA 4LUCA 4Q47A 4W9MC 3Q3JB 2HXSA 3DMDA 5B2ZA 2QAGB 4PC1A 2VF8A 3U5ZB 4UJ3A 3NEJA 2O8EA 4CYMA 3EA5A 2Z5FA 4EJSC 1KMHB 3RS4A 1E2GA 2O8DB 4IVQA 1L4YA 3AB3A 1KMQA 4IFBA 4JBWA 4MGZR 4XSHA 1Y63A 2YC4C 2ZAMA 3R9IA 1E79A 2JA1A 2W00A 4TT3A 5BYKA 1K8RA 1BIFA 1LFDB 2FG5A 1XMJA 3QXJA 3M4YA 3RS0A 5CJPA 4DCSA 2DFTA 4ILEA 3LY5A 1M34E 1ZMXA 1E2IA 1E0KA 1E69A 1N6OA 2ODEA 1Z0JA 3SU8A 3QKRA 2B7CA 2GZHA 3SDZA 3CWQA 3QKSA 3BS4A 1EFHA 3C14C 3W3ZB 4NL4H 1TQ2A 3VHXA 1E2EA 1PLJA 2ZIAA 3LD9A 3KXKA 3FB4A 1ZUIA 5FI1B 1F2TB 3L8ZA 2P5TB 2PZGA 1R10A 2GZDA 5SZJA 1KJWA 4M9QA 3VTKA 4ZIRB 2FZLA 3A4NA 1E2JA 1P2SA 1NBMD 1T6NA 3B1VA 3MWLA 1AA9A 4N3NA 4TYPA 4Z1MD 2RH5A 1CJMA 2G88A 1G7SA 1BYUA 1W46A 3LXRA 4RD4A 4HB4A 4URWR 2WKQA 5K8IA 3B1WA 3AVWA 3I72A 2J45A 5F98A 3THXA 2O0JA 4QG7A 1N6RA 3SQWA 3LBNA 1I4DD 1RFLA 4Q1BA 1W5SA 1ZU4A 1IXZA 5BN4A 4E03A 3BBPA 3TVTA 1XJCA 3CB4A 1Z5ZA 3U7EB 1NMYA 1JR3A 3R8FA 5FPHA 2PCJA 4C0LA 3B9QA 2ZI9A 2ZUCA 1E2FA 5F3WB 1NVXQ 1XDBA 5TMPA 3K0AB 2XOKD 3HWSA 3W3AA 1OYWA 1T5IA 4PC2A 4HB0A 4BFWA 1UKYA 2CE2X 2FFBA 4YMVA 2QQ0A 3AVOA 2IA5A 3LRPA 3TKLA 1FTSA 3CONA 1P60A 1XEWY 4TMXA 3V4FA 2IHYA 2QSYA 4TSFA 3ECCA 1XTJA 4HAXA 2YJTD 3N2IA 4CEJA 1GAJA 4PAMA 4P0TA 2OCBA 5BXQC 1ETUA 3OE7A 2PL3A 2CCGA 4QHSA 2QY9A 2QMUA 2W2VA 2F3RA 2XNDD 3QBTA 3GFPA 4IEIA 4DBLC 4F4JA 3A6PC 2OCPA 1AZSC 3OZXA 1UM8A 1N2CE 1OW3B 1P7CA 1SVSA 1XEWX 2ZRDA 3L82B 2A9KA 1BO6A 4K8OA 1R5BA 1IQPA 4D0NA 2VEDA 2BMFA 4KVGA 4DB4A 1A7JA 4C9BA 2PJRA 1F60A 2B6HA 3EA0A 3K8YA 1YZLA 1E2HA 4D0LB 4NPHA 3GLHE 2MSEB 3GJ0A 1UKZA 3GLHB 1UDXA 5J40A 1OB2A 4M2LA 3C7KA 1NG9A 4B35A 4B74A 5JBQA 4DSTA 5FBRB 4HSEA 3D31A 2OXCA 4MITA 4YMTA 4PX9A 3FYHA 1CU1A 5DSZA 4ZKEA 4Q4LA 3NC0C 2FN4A 5FBWB 3B82A 4A4DA 4B33A 5DLQC 1JPNA 2DWOA 2GCOB 3MRSA 1NN1A 4GP7A 3CF6R 3PG5A 4OQLA 1OXXK 1EX6A 2IK8A 4RCYA 2VP5A 2PX0A 1UPTA 4B2LA 1Q1EA 3BERA 4MGYR 2J87A 1SXJB 1XWIA 2A7QA 4P4SB 1PV4A 2QUZA 4GL2A 2JIZD 5JCPA 3V4RA 5JCZA 4BEJA 3MJRA 1F3OA 2Z6VA 2AHOA 1GILA 4P32A 2AL7A 4DB2A 4UNPA 1UAAA 4NP6A 3K9GA 3IHLA 4V0MA 3TR0A 2ANBA 2D62A 4NDZA 3HYTA 2D74A 2CLCX 2MSCB 3WNBA 2QBYA 2X8AA 1YHNA 2GETA 1EGAA 1SHZA 1W5TA 1VDZA 1AKEA 2RGEA 3I62A 2A78A 2OM2A 4LHZA 1IY2A 4UNNA 2VL7A 2KE5A 2PBRA 4N1AA 2LKDA 3AUXA 3CPHA 1YR6A 1S9DA 2EFHB 3PQCA 3ZIAA 2J41A 4PSKA 1R5NA 4ASUA 1PZNA 4DDUA 3LQQA 1GKIA 2IL1A 2XSZA 4WVFA 2IS1A 4KITB 2RHDA 4JYBA 1E2QA 4ITRC 2O8EB 1GOTA 5GJVC 4DLRA 5JECA 1ZBDA 4OK5A 3MCAA 1X8KA 4HUQA 5E95A 2JJ1A 3DZDA 2BDTA 5CIWA 3IIKA 5JHHB 4MA4A 4MKIA 4Q7KA 1N0VC 5EXXA 1UEIA 2WJYA 1VYTA 2AWOA 2QTHA 3NBZC 3VKGA 3E2IA 4O2LA 1HUQA 1KDOA 5FI0B 1LTQA 2WJHA 2GJ9A 1XZPA 2J46A 2PX3A 1M74A 3CIOA 4LCBA 4V0KA 1TNDA 4JLAA 4DLXA 4BGDA 4D4JA 1JEDA 1KYIA 1TF2A 1FUUA 3QKRB 2RGCA 3J81k 3M1IA 3QKSB 4GOXA 4LYFA 1FMLA 1CJUC 3CRMA 1U98A 4MRVA 1E9DA 4TTQA 4PZYA 1N6KA 1U0JA 1YVDA 2DY1A 2NG1A 4A0RA 1W44A 1KI3A 3DHWC 4F4IA 5KHOC 3C8UA 3F3YA 3W8NA 2WPDD 1OPXA 1HE1C 3EPKA 1Z0DA 1NLYA 5D3MB 2IF2A 4HLCA 4LV6A 1N6NA 3T15A 4RZ2A 1NF3A 1FFHA 4LJ4A 3FKSA 2A5YB 2CHQA 2YVUA 3CF0A 4KO8A 1JAIA 4GPTA 4OL0A 4S35A 2ERYA 3EG5A 1GRRA 5FPTA 1P9WA 1SULA 1Q1ZA 2BEJA 1YZUA 2WSSD 4A8JA 2YYZA 3W6NA 2VP6A 4C3ZA 3GJ8A 2CEAA 1TU4A 2E9SA 2XITA 1ZW6A 4KJZA 5LD2B 3QEOA 5G53C 4Q02A 5FBLB 5DGXA 2O0KA 4PO1A 2FWRA 3CRRA 4TLAA 2IXEA 2P6UA 1DADA 2VLIA 3D7MA 2ZRAA 2XB4A 4E22A 1E9BA 3BD9A 4X8MA 2R8RA 2RAPA 3EAQA 2GEUA 2W6IA 2C9YA 5AJXA 3DVLA 4JSYA 3SHWA 1S1MA 1DAHA 4I1OA 4DVGA 1GIAA 2RGXA 2KB0A 2IYVA 2XJ4A 1SVIA 4AG6A 2R6FA 4LDJA 3P26A 1E0AA 3CNNA 3LA6A 4LBVA 4OK6A 5FBQB 3SOPA 2I1QA 1KK3A 1R0ZA 4NCKA 4NTZA 1EFRA 2JJ2D 3GLGE 5HKKD 3RSLA 4V0NA 3GLGB 3AVVA 2WAXA 4TMKA 3IO3A 1XB2A 3CRQA 1N5KA 1ODFA 2WKPA 2BJWA 3FKQA 4TTRA 5JWHA 2ZRHA 4EFMA 1SVMA 3Q72A 4ZI3A 1CLUA 4DJTA 3S1AA 1DAMA 3K09A 4URXR 5DI3A 1VHTA 3L2OB 2HYIC 4AIIA 3KQUA 1B0UA 2JAQA 4AKIA 2ZTSA 4URVR 3U60B 2QPTA 3OEED 1WP9A 3EPJA 1C4OA 1GL6A 2A5DA 4QGHA 4HZUB 2R62A 3KL4A 4NYIQ 5LPNA 2JLRA 3I73A 2GVDC 3WP1B 4B6EA 2N1BA 5G3ZA 2FU5C 5EZ5A 3T12A 2J7PA 2VTKA 3PENA 4JT4A 3T5DA 1G8FA 3MWYW 2IYLD 1XMSA 1G8YA 2GXQA 2HT6A 1OH7A 1BYIA 1TAGA 1XMVA 2MMCA 1Z2CA 2J0SA 2IYYA 1N3BA 2FOLA 3OAAA 1IM2A 1H65A 1GP2A 1VHLA 3GCGA 5BN3A 2ZJ5A 4IKEA 4TQAA 4NCIA 4GZMA 4QJ5A 2CBZA 4OHXA 5D3QA 4KFUA 4DDTA 3SBEA 3TR5A 4OHVA 4Q9IA 3KDSE 1XXHA 3K70C 1DO2A 3DM9B 1DO0A 4Q4JA 1Z0KA 3BK7A 4TYYA 2ZJYA 4RVCA 1TMKA 1KY3A 3RLFA 3KKQA 2VYFA 5J4VA 4MYCA 2X2EA 5CIQA 2ASEA 3NDPA 1D2MA 2WMOB 4D2IA 1CJTC 5E7MA 3NBXX 3OESA 1KI8A 5AUOB 5FOVA 1EFTA 2WIBA 2CVFA 3TSOA 2ZAOA 2O5VA 4I1UA 1HE8B 2NTYC 4NE2A 5F9HA 1Z3IX 3ASZA 1XNJA 2ZITA 1D9ZA 4UXHA 1J70A 4M22A 2FZ4A 3PJRA 1ZCAA 3KUDA 3LDAA 5KNDA 3SHFA 3WRYC 4MUBA 3MLEA 2AKAB 5G41A 1EESA 3QG5A 3RAPR 5JZVA 3WNCA 1T3LA 3EZ7A 4G3XA 3G82C 3ZD6A 4JKYA 2Q6TA 3NWJA 4M8NE 1P5ZB 5FTKA 2JATA 3TW8B 2IWRA 1T3SA 2WV9A 3O47A 4HUQB 5EUQB 3WNDA 4JMPA 3QSYA 2GKSA 5LB2A 2ORIA 1DTSA 1D8TA 1DAKA 3RS7A 4IDHA 4JLKA
chains in the Genus database with same CATH superfamily
3SLRA 2GI4A 1GR0A 1Z2NX 3AV3A 2HF2A 3WGYA 1MZPA 1Z6ZA 2C7VA 3TLGB 1Z07A 4M98A 2DXIA 2G1KA 2F55A 4IIXA 2CLOB 3KQYA 3NT4A 4H7FA 1T26A 3U4CA 4YRDA 5EUMA 1SKYB 3KEQA 2EWMA 2F62A 4L5JA 4I4IA 1VCNA 3RC3A 4FFRA 4OU4A 4OG2A 2YRXA 2I2WA 2PO5A 3IP3A 1N75A 2GS9A 3N8HA 3ET4A 3IUNA 3QLEA 4WKCA 2UZ0A 3OFND 4F2DA 2R6CA 3H9CA 4NV0A 2FWPA 5FT9A 3CRW1 3QU7A 2RHMA 1M7GA 3TW4A 2H2HA 1U3DA 3FCUB 4IIDA 3EFEA 3EZGA 5FUXA 3ZH9B 4M1EA 4XYEA 3O5AA 4F5EA 1JT9A 4NFYA 4PYNA 1ZMRA 2O8FA 2W2KB 2ZAIA 3V8EA 2BDEA 2GWHA 2P2DA 3G0BA 4H59A 4B3MB 3M8KA 1S8AA 4GW3A 2VSOA 1E96A 1IBKB 3WL5A 4B3CA 1IAQA 3SQLA 5FNVA 1W2HA 4ZCMA 2O3JA 3MD9A 3DOIA 2OKCA 1P6UA 1V3UA 1U8XX 1XK7A 2HREA 4UUNA 2B5VA 2QE7A 4A8JB 3HZOA 1GGKA 6CHYA 3BL8A 4GXRA 1PNTA 3CUYA 3N2KA 3RRMA 3O8BA 3TZCA 4RA6A 5DO9A 4B7CA 1MA0A 2N9UA 3DE2X 3RRZA 5TQ0A 4FYIA 4OB6A 1FP4A 3RVKA 3MT8A 4QODA 4Q4AB 5COBA 4YRFA 3RSSA 1KOGA 5DRTA 3KWMA 3K9QO 2NO4A 4DWWA 1KO8A 1P45A 5AHOA 1V11A 1X1DA 1WCXA 3Q15C 4BX3A 1TA9A 1WNTA 5B4TA 4Y6GB 1W5BA 4MHTA 1QNFA 2FEAA 1O8CA 5MGNA 1TRHA 2HZBA 4RKYA 3ZDYB 4GKBA 4L57A 3EDRA 5DI9A 4QNRA 2VA8A 3UAWA 3URKA 4G97A 4B3IA 4Q3EA 4D4MA 3OQOA 1NUUA 2BM9A 2JFXA 3DZJA 2IYAA 3PA6A 4LYGA 4PTZA 5DSTA 5E2AA 3VAYA 3KQSA 1O6FA 3U1BA 4F7DA 2PA0A 3PSHA 3ISVA 4YRLA 4TRNA 1YUMA 2V7PA 3K05A 2O57A 1OBHA 2AFRA 1ZWLA 2WIKA 4BMDA 3HN6A 2H4JA 3NKVA 2OV8A 3OD5A 4A0HA 4DSUA 1WA5A 3VVBA 2EJVA 1WW8A 2GNAA 3K73O 1HFWA 1U0LA 3BL6A 1LJLA 2HIMA 2OK7A 3E8SA 3GRZA 3MD0A 4HWOA 5ITVA 4UJ5A 4NCBA 4CEIA 4E1BA 2IPLA 3MTBA 3SZOA 4WA7A 5CURA 3ZHBA 3ANSA 2OFOA 1AC5A 3G8YA 3SQNA 3P9RA 5KZMB 4C7XA 2Z30A 1G5IA 2Y66A 3BXXA 4GGMX 4MQUA 1X8JA 4HDCA 4DQUA 4R2WA 2UZ1B 2F7SA 4FHCA 1CS4C 1JHYA 1QQ7A 3EOBI 4OREX 1IRXA 5CH3A 4FGSA 4BO9A 3EGXB 2JAXA 1MHPA 4XJSA 4ZRDA 4EAAA 4HY3A 4IDDA 1P1IA 3FYUC 4KR0A 2FZCA 3WO0A 2XEDA 1XRSB 2E4WA 2XQVA 4XB1A 1XEFA 3IKMB 3O4JA 2Q3JA 3WLSA 1SZCA 1YULA 2JFWA 3VPHA 3V46A 4C0QC 3O84A 3MS4A 5GOTA 1PNQA 5BR4A 1CPYA 221PA 5GM2A 3HVRA 4JP1A 1W6RA 5GZ6A 2CSUA 3KXDA 1CDDA 3HNRA 4HHEA 1ZM2A 3MCTA 4OB8A 4RPGA 1NMZA 4UBNA 3RTBA 3ZBUA 3I8SA 2PMBA 1PCXA 3OT4A 2Q28A 3QTBA 2H1LA 3VHRA 2V97A 4MQFA 4PCUA 1EE1A 2FX2A 5EMKA 4BV2A 3HBNA 3L7NA 4XWAA 2X5KO 1FQWA 5C7YA 2Q3EA 4F71A 4ISBA 1H2ZA 5AICA 3SJBA 5G1NA 3OX1A 2GTHA 4HLUC 4B71A 1DU4A 4TOIA 3U7GA 2BGGA 2VPYA 4CBVA 1P73A 1V96A 1QMPA 2R00C 2X14A 4RFVA 2NMVA 1YHYA 3VYVA 2FDCA 5EE3A 3A1WA 4Z99A 2CFSA 2KBEA 1JEQA 1P2DA 2W6ZA 5AOCA 3HU2A 2Y6VA 3DBLA 3A6JA 4RENA 5A06A 3QI2A 2V4UA 3IFSA 4QPNA 1FIUA 4HVLA 3L04A 3DZHA 2RI1A 1L6IA 1A69A 1C9JA 1OI3A 3A3KA 3CLSC 3FJ1A 1HYHA 2MYUA 2YXDA 5H3HA 3K0SA 4QGGA 1ZFNA 5DN9A 2YWFA 3EEYA 2Q4BA 1BX3A 1Y1LA 3JASB 3VNBA 3WVNA 2JIOA 3C87A 1OZFA 1T8SA 4C29A 3ZY6A 3NVAA 4X1IA 4D9NA 5CA0F 4OKIA 1GQQA 4ZOLA 3SWWA 1EVKA 2XOKA 4L0CA 5AP9A 3KOXA 2XDQA 4P81A 2QJOA 2W6MA 3AO0B 4P4LA 4PZAA 4I1YA 4Z6KA 1YK0A 3Q5DA 2C4KA 1XQ6A 4F04A 2G1JA 5C5DA 2A59A 1TM4E 2HMUA 3B7WA 5CLGA 4MWEA 1G5RA 3STXA 4C0SA 1Y6GA 1ZM9A 4EHLA 3IDQA 3BQ9A 3F2IA 3HY3A 3DMNA 4MHOA 4XGQA 2F2TA 3OECA 2WQZA 1UOEA 3LECA 3ZS9A 5P8WA 1BNCA 1K08A 1F8YA 2R8YA 4R2XA 2WUEA 2DJ5A 2H0QA 3QZUA 1GT91 2WM3A 3EF0A 1R9JA 3GOHA 3TQFA 1X6VA 1YKGA 5EUBA 3H1BA 3K0KA 4JLSA 3NNNA 4Q7JB 3QVGA 1ACLA 5EIBC 4A26A 3THWA 4I55F 5FFMA 2VH2A 1AN0A 2VCEA 3JQ6A 1C9YA 1RSZA 1VJCA 3D6AA 1JQLB 4HPJB 5HSGA 2GA8A 4LE0A 4QU9A 4MSUA 3NDBB 2JIQA 1KYZA 3DPUA 4P4NA 1N36B 3VR3A 1DFHA 3SJCA 1A9PA 1GUAA 1FDOA 1GPAA 4RHCA 1KEUA 1HG0A 1FVFA 4HMOA 2PLWA 3KU1A 3KSMA 4EQZA 2GJSA 5JO9A 2W11A 4FYMA 1CUBA 2ZUVA 2H3HA 4B5LA 2QBYB 1E6WA 3A6HA 3FOCA 4N18A 1F8FA 3AEXA 4KW7A 1NKTA 4EYGA 2ZU0C 4GOOD 1BEUB 2MMGA 4B83A 3JD0A 4KE9A 2O8FB 4MV8A 4PLVA 1I6WA 4RXTA 3DBHA 3JQGB 3GPLA 1E4OA 4GI7A 3TQTA 3PJDA 4IDPA 4UAVA 1OBOA 4WOBA 3DCNA 2Q7XA 2EARA 2PMDA 1I0ZA 2GZAA 3K1AA 3WK4A 4BLOA 2GHIA 1T9HA 1WIWA 2DPXA 2VPTA 3IXMA 4EGQA 5GONA 3VSCA 4CQLA 2X42A 1EM8B 3ZUGA 1B0AA 1FNDA 5FTWA 1UC9A 4EPWA 1M5RA 2R60A 3L3BA 4GMXA 3N2KB 4B76A 1JAYA 2OWDA 4KDCA 3RRJA 2JGRA 1JDPA 1UBLS 1PAUA 1DIRA 2PJUA 4RWZA 4RY0A 5BRAA 5TQ0B 1ADCA 3VJMA 1JIJA 1FP4B 4V39A 3AILA 3CISA 3U9LA 3WB1A 2JIZA 5E4JA 2AYXA 5B1YA 4NICA 4YP1A 1HYGA 1ZJYA 1BXRA 5C3MA 3IBSA 1V11B 4HMPA 4QOSA 5DH9A 1ISIA 3UATA 2JASA 3WRXC 5T64A 2HLNA 5KWIA 2YWGA 1KFEB 3TXAA 3IPCA 1F6BA 3NYWA 5JCOA 3QKTA 1KARA 3C97A 3HL0A 4BIMA 1TMOA 3JQAA 2PL1A 5DLYA 2ZYVX 4ND8B 1W36B 4DG5A 3DUFA 3KSAC 1Z25A 5FV7A 5LD2C 1HQCA 1P1BA 1Y1RA 1ES9A 3WFIA 2C3MA 1E61A 1ULHA 4WZ6A 3T9EA 1VCIA 3WOVA 1UBJS 1YKSA 1FFYA 1SUBA 3B5JA 1QNLA 1R6DA 2ZRPA 4ZU6X 4DLLA 5EQJB 5JFGA 3D2CA 1UDWA 4JLBA 4JL5A 2UU9B 5IK2D 4CEIB 1RXSA 1UBEA 2QUKA 2OFWA 2J3MA 1SFRA 4IUYA 4B8YA 3OQ6A 1ISMA 3KWLA 4V0RA 1ZN7A 3AM1A 4I4TA 2WNHA 2P79A 4OEHA 4CN9A 3MMPA 5ALLA 3HO1A 2C3YA 1YB7A 2VQDA 3QVTA 1GGEA 2QGNA 3CW2A 5ER9A 4E33A 2OZKA 1YMUA 3UCFA 1AQNA 3OZSA 3A9RA 2HHCA 1I3MA 1E64A 4EA6A 2CGEA 3LWNA 2J9FA 4U7GA 4BO0A 2SKCA 5E7JA 3VR6A 3LIPA 4BASA 1UFOA 5I8WA 4C4XA 5TDHA 4JJAA 3TLZA 1M9NA 2GM3A 4DCUA 9LDTA 3HACA 4UQLA 3HPQA 4P3YA 5EJ9A 2O3RA 3QELA 1WBJB 1U7DA 3ODPA 2C77A 3UTDA 4B3JA 4WH0A 3KKZA 1GITA 1Y4UA 1ZISA 5C1OA 4MLPA 2I62A 3OH8A 1FFSA 4C01A 4EFLA 4F3RA 2F8TA 3P9ZA 4JJ6A 1AZTA 3Q2IA 1MAHA 1XU9A 3OURA 3ST7A 2PEZA 3INGA 2QP3A 4H31A 2ABWA 2H7XA 4UUAA 5ITZB 1E1QA 5F5LA 5EFOA 2Q0HA 3GJZA 3DYIA 4RS4A 1HT3A 3ZN2A 2PSJA 4DBVO 1JN0A 3HV2A 2L82A 1NY5A 4EUHA 4MQFB 3BMOB 2O8NA 4EDHA 4HH3C 2WPDA 5DVZA 2NN3C 1Z2AA 2Q2QA 1U5BA 2FLKA 1TVCA 2G7MC 3EODA 2BPOA 3ITDA 3R40A 4RTRA 3UHAA 5HZKA 3AF0A 4D5EA 5JAZA 5KC8A 4P35A 2FMTA 1GXSB 3PQ4A 2O3TA 1RABA 3IQWA 4Z4GA 5HM8A 1Z5GA 2W83A 2ZPAA 3C4QA 2X4GA 3FDZA 5JRDS 5EG5A 1XA0A 2K5UA 3ICCA 4G41A 4MR9A 3VC7A 3NX4A 7REQA 1FW6A 3VO9A 2N42A 2IE0A 1VGRA 2DFLA 3QWHA 1JPVA 3WGMA 3IBTA 3WQSB 2RONA 4A1FA 3WMFA 3SBOA 5BWLA 1H8HD 1RYFA 1JEQB 2WMDA 4MA5A 1UJCA 3W90A 1A95A 4QBFA 2AWNA 3DBLB 3E3NA 1X1TA 4ZDKA 5CVEA 3T7EA 2HEGA 1UWCA 3TQRA 5B6PA 2Z9DA 1DC4A 1CJVC 3JR7A 5EIEA 4BTLA 4KWIA 4B73A 2NOAA 4CMJA 5BR1A 2E6UX 5C52B 1VBMA 3KSZO 3OSUA 3IMCA 3OCYA 4Y0VA 4DQVA 1FYEA 3G8AA 1W4BA 4F3CA 4X1IB 5C31A 5J5CA 1CF9A 1PGPA 1PW5A 2VUIB 3TX2A 1R4NA 2HPHA 3QG1A 2XDQB 4HVAA 3NNDA 4D92A 1Z26A 5ALOA 4GKJB 3IS3A 4KH1A 4EW6A 4O4IB 3VZSA 1ZNXA 3B53X 4RHYA 3BZBA 4FIZA 3KVVA 2F3PA 5C18A 1G8JA 1U8TA 2NYVA 4V0OA 2YS7A 1BJKA 3F6RA 3QOXA 3T3HA 4ENWA 3E9NA 1Y7TA 2VSFA 2B8TA 4G07A 1PR9A 4EOGA 4KRGA 4QQRA 1XD8A 3RVPA 5FYDA 1JR6A 1LJ8A 3ZWKA 5FWXA 2VT3A 3TEMA 4EKDA 3ZJ5A 2I33A 5CYGA 4OGKA 3AEKA 4AO7A 4GT1A 5B37A 3BCHA 5CX4A 3U2QA 1OFIA 5CD9A 1QHGA 3BF7A 2B3TA 3DEFA 2H8GA 3EPRA 1U31A 3LG2A 3O94A 4EGAA 3MS7A 4HNHA 5FEMA 4Q3OA 1MJ5A 4ZYUA 3R7BA 4KQFA 1QV9A 3H16A 3N7TA 5EPUA 3IC5A 2C5HA 2PKQO 4DC0A 2QN1A 1GJRA 2A86A 3ZCSA 2QTRA 2GAAA 1WKVA 3AB7A 1IY0A 4PHGA 1D2NA 3WQRA 1QDUA 3LS2A 1DPGA 1TLFA 1VSTA 3PQFA 3ZK7A 3DBHB 1P91A 3F78A 4V38A 1OASA 1KYVA 2Y27A 4LJRA 2Z2JA 2D0IA 1LTHR 3EEQA 4H7IA 4I8IA 3EGOA 3H2SA 3K1AB 4YT2A 2GJAA 2OO5C 5CG2A 1OJ7A 1U9IC 2IZ6A 4FFBA 5I4KA 1TD9A 3O83A 3JQFC 5CXXA 5GONB 4WBXC 2Q3MA 4BNIA 5DW0A 4CQLB 2X8LA 3CCFA 621PA 1QGOA 2RD2A 4TN1A 1DJMA 3WMXA 4QFMA 1QK5A 1I3KA 5MFPA 3E1SA 3VO8A 2XJ9A 4YMSA 2EJWA 2BGRA 2A1TR 1KAMA 2Q6KA 1BROA 3U3MA 4ZTZB 3SK0A 3KOOA 3OOSA 3C7DB 3GFFA 3IIMA 3WWDA 3CTMA 2PU7A 4OFWA 4NS4A 1Z75A 4JEUA 4PO8A 2AI2A 4HGZA 1Q7EA 3UT5A 2P0AA 1BGWA 1NBEA 1XVTA 5BV1A 1BXRB 1UBMS 2ZJFA 1B0ZA 3W8EA 2QRZA 4AW9A 1Y6FA 1F14A 5TQVA 2KMLA 5I5EA 5ULLA 3OWXA 3JAWB 3MTJA 3CIFA 1Z39A 1VJTA 1GKKA 1V0JA 4XPIA 3LWDA 1CIVA 4WESA 3RVQA 3T3MB 2JDIA 2CL5A 1D0VA 4GOKA 1YUNA 3VGJA 3JQAB 2NNLD 1FXUA 4A8JC 2R6GA 2CNNA 2MSDB 3L6BA 4N9QA 2QVZX 4WCVA 3DUFB 3JD1A 4TXMA 1U6KA 4TVOA 5DISB 5IHPA 2WDPA 1X7ZA 5KVSA 1QAQA 2WOOA 1WB5A 3FBWA 4FUQA 3EFHA 1V8FA 4ENVA 1AKQA 2ZIXA 3AUAA 1JB9A 3AKEA 2QZZA 3RYIA 3SE0A 3D5EA 2DPMA 4CTNA 4KVZA 3HB0A 3LY9A 4R2MA 3FTFA 1CUCA 2P40A 3L0YA 1WEHA 5LBUA 2ZCVA 1DBSA 1PNRA 2Q9CA 3LPLA 4P33A 4YJDA 3F6BX 3BKXA 4U7DA 4GX2A 3SXPA 4HFRA 2XYVA 3RUIA 3T61A 4DABA 4BV9A 3GPIA 2O8CA 1DQYA 2GUWA 1Q0LA 3K20A 5ALHA 4HXYA 5TQJA 4UE6A 2NZXA 1GVNB 3M2TA 1RQRA 4QUBA 2RGRA 1EBUA 2N46A 1ZJ4A 4BNGA 3WE7A 4RS3A 4I66A 1AQLA 5BV0A 5FFNA 5I51A 1ZUD1 1OWNA 2GBLC 5LDGA 4A15A 3K1JA 4P7FA 3NEYA 5DTEA 3P2JA 3WO1A 1KO7A 4J91A 1D7OA 1Q0PA 1ZRSA 3D4PA 1HR0B 3K09C 3L0SA 3MJVA 3QUQA 2ZVQX 4XR9A 4XVUA 5JXWA 4CEJB 1JJIA 1T6BY 2BEWA 1CZOA 5U4QA 4AQDA 4JJGA 1GUFA 1DXYA 2PUFA 1BOFA 2IEZA 1N6IA 1VL0A 2G25A 4J2TA 4MW0A 4RESA 4BNYA 4PSDA 3CQ9A 4N6NA 1TK9A 4YV7A 5E1MA 3ZJYA 1U0RA 5KSOA 3ELWA 1K7EB 2HADA 2LGJA 3A37A 2JAPA 3K0CA 4PAGA 3GG9A 3KD3A 3VU9A 2G09A 2D5LA 3O21A 5KX5A 1F5NA 4RKEA 1U5BB 3FA2A 4Y1FA 3DAHA 2O5CA 3KAKA 2RHGB 4ZEMA 1BDHA 3AIOA 1SD1A 2W2NA 2JH3A 5ED0A 3F73A 3AHCA 3DTYA 1G2OA 4QL3A 2CXOA 4E5NA 1IN6A 1Q22A 2O2ZA 3OTOB 3PDWA 4QHTA 2OESA 2ALJA 3A9TA 2I7TA 2R11A 3R3ZA 1JMKC 4MR9B 2PNFA 3DL0A 4Q0MA 3WK7A 5FR1A 7REQB 4H1VA 2G71A 3R7NA 5JEEA 5JVDA 1CEEA 1K68A 4A9AA 1BJRE 4TVKA 5E6RA 1MO5A 2AC2A 3H3XA 1OHHD 2BFEA 2LRHA 1NXQA 1Z45A 3AZOA 2JH8A 2DBYA 3PDIA 2IFTA 2OKGA 5AR1A 5IJ0B 4GZ3A 5LUAA 2VSNA 4CF6A 1O6GA 5EGSA 2NZ2A 2NSHA 3GMTA 3WYCA 1YS7A 5FF9A 4AMYA 5C5EA 2P9TA 3L0PA 1U7PA 2I71A 2WAAA 3COVA 5DM70 2FHPA 4GZLA 3AZPA 2C20A 1HT0A 1X7DA 2WICA 4N0PA 2Z6UA 3P9YA 5JNRA 2GJ8A 4RW0A 3CEJA 1T35A 1Y8AA 1UP6A 5TGDA 1ZD4A 4PPGA 1UBHS 1XCGB 3FBGA 3CUEF 4P2BA 5KI6A 1PO7A 2P9ZA 2A2ZA 4JVSB 1K1EA 4Y2PA 5TS2A 4BUJA 1G42A 1FVHA 1SCIA 4O4LF 3GB9A 1GUZA 3KELA 3E1KA 4QUAA 4UM7A 2DLCX 2J1LA 1VJGA 5THKA 2KJQA 3PXCX 2WILA 5A5GA 1LPBB 1WU8A 3ORHA 1G291 1PEYA 1RVDA 4FFDA 4N01A 2MU1A 5GGYA 2PM8A 3TEJA 4B46A 5FWXB 2QQFA 1DWOA 1UP4A 5DM0A 4HYTA 3WWZA 4KQJA 2JCSA 3AM4A 1RI1A 3IUEA 3T1TA 1QE3A 2J59A 1FQJA 2Q9AA 2ODWA 3AEKB 2IP1A 3C45A 3PC6A 4GEGA 2RB4A 5JJBA 1TEVA 2CKDA 3P2OA 2BHLA 1H0HA 1P9LA 5K51A 3AFHA 3E5MA 5M3BA 3S8MA 4GX1A 3O8CA 3S1LA 3NP7A 1P39A 3HP1A 4IGKA 4TWRA 3F8TA 3KVNA 2V5UA 3C70A 2GASA 1A9TA 3MTIA 3QNWA 3T54A 1PFWA 4JU8A 4QUIA 1BKYA 4A0SA 1EVLA 4FW9A 3BRSA 2QORA 2WB2A 1VBNA 4PINA 3IAFA 4NBSA 3RC8A 2JGEA 3IPXA 4MV6A 2R8OA 2DOKA 4TN5A 3NWOA 3QMVA 4FX2A 2JRCA 3AVUA 4UASA 1TOAA 2P8SA 1G59A 3GJQA 2PX5A 3GUVA 3QWAA 2JI9A 4YMUA 3H4VA 5F23A 2J3QA 3LX5A 2XUOA 4LZZA 5HQTA 2AFVA 2QSZA 4YQYA 1DO8A 2JKVA 4PO3X 4NMWA 1KVQA 1YZQA 4BRUA 2BBSA 5J2TF 5H3LA 2B7BA 4RD1A 4PQGA 2VBGA 2GZ2A 4GDMA 5U9CA 4ZEWA 5AM5A 3F1KA 3MWJA 1ZLXA 4MKZA 4AZWA 1QGZA 3UT5B 2WWGA 4B4WA 3GLVA 1YNSA 1XWWA 1A50B 2WRZA 2Z8XA 2A4MA 4J3NA 5CFLA 5IFKA 4JS0A 3HU5A 5TV2A 5LQJA 4QE3A 1QIDA 1G8SA 4L9AA 5JATA 4G5SA 2PANA 3MWDA 3U3KA 2QVGA 2SHKA 3FZQA 4XPIB 4WESB 1C80A 4UE2A 1FNNA 3RROA 2XZDA 1T8TA 3GFTA 4TQUS 1UWKA 5A4AA 1ZP6A 3QVVA 1SUCA 2F8MA 3KJIA 1X7ZB 3P2MA 4KLAA 3C6YA 1JGTA 3ZGNA 2R5NA 3OIDA 3A1DA 2IYNA 3LYAA 2RBKA 3OZWA 3JWEA 2ZIXB 2O0MA 4FZVA 1SURA 4MB0A 4QC2A 5IAKA 1GU7A 4MVJI 1KGDA 3RYIB 4C7MA 5EAIA 5KYKA 1G4UR 4O29A 3LK6A 8ADHA 4LWPA 1YIDA 4HRVA 3B1XA 4IY1A 2HDNB 2JLVA 1OYOA 4HDNA 5DBGA 3VXKA 2G70A 1H6AA 4RAQA 2BI7A 2X2FA 2I9PA 1K9VF 2R6HA 3GRYA 4KYTA 1T15A 4R8SA 5SY4A 3UTCA 5AM3A 2HJRA 4TVSA 3FW1A 4B4DA 3LOPA 1M0SA 2BEVA 2WIAA 5CPBA 2ZWOA 2EFCB 3BD6A 2XBUA 1Z4KA 4XYBA 1W36C 3UQYS 3LL4A 2C8KA 1OLUA 4NMLA 1YL6A 5SZIA 4BB5A 5KVAA 1XPOA 1NVBA 1QVAA 1SUIA 1JWLA 5AHXA 4JX8A 1ELOA 1NSYA 4JJFA 1JMVA 3OZFA 1ZUNA 3EBPA 5DCWA 4XOUA 2VYCA 1J42A 1FX1A 1NA5A 4M21A 3DPSA 3LCJA 3SEZA 1PR6A 3GJ7A 2PX4A 1R66A 3U0BA 3RAJA 4QSMA 3PFNA 3DC7A 4ZGBA 2NO5A 1IZ9A 4IRXA 1AS2A 2CMKA 1U04A 1E3EA 3NHZA 5IEBA 1NNSA 1BXGA 4J0EA 3X44A 2BEWB 1MFPA 2CNLA 2VHXA 4PR3A 3SYKA 2QD1A 3ESRA 4H18A 3VMFA 1ZVVA 4RLHA 5CK4A 1WW3A 3SS8A 1PR3A 5IFLA 1WAMA 4O2RA 2FN3A 2R2AA 2EHDA 4HDAA 3EIUA 4XDZA 3QQ5A 1V47A 1VG1A 4P84A 2GN9A 3VU9B 1PZGA 3YASA 5KX5B 4RVGA 2YWXA 3IKJA 2RC6A 4BBJA 2WG0A 5AKXA 2IC5A 3VPSA 1BX0A 2JKZA 4RD6A 2D8AA 4WOPA 2VSXA 3ELUA 5JG7A 4Q9HA 4QKQA 3BCRA 1CR4A 3GBPA 2DUNA 5KYYA 4N41A 4IOMA 5JJIA 2ZW9A 1L8QA 1YDHA 4MAMA 2HCBA 1C0IA 4YS6A 4RK5A 1H9AA 2GDZA 4QGBA 5JVDB 5TIIA 2NYRA 5ERXA 1ZSNA 3DWEX 5JYDA 5E6RB 5KUTA 2BFEB 1AGRA 3VAZA 3PDIB 3IJPA 1MOSA 1CG6A 1ST3A 3IVCA 2AC4A 2HRRA 4BV3A 3D6FA 4BFVA 4RJ2A 5IAEA 4IXMA 2WUVA 1LBSA 1RWXA 3M1AA 5DNAA 4UOEA 3JWGA 5HGXA 2ZS7A 5ICFA 5CDUA 1UBKS 4G4SP 4LGCA 3L4EA 3LY8A 4IF4A 4M7OA 3ISTA 1DRJA 3IEMA 1G9SA 4HNRA 3AKDA 4PRZA 4D26A 2DT5A 1RRMA 1QOZA 3EFOA 4PZ9A 2GN6A 4X3CA 1WXQA 2FW8A 5E2BA 4JC0A 1B73A 1X70A 4W5OA 2YINC 4Y6RA 2QAIA 4INZA 4MQ6A 5AJZA 3MF4A 3UCEA 4CHGA 1V16A 1KDTA 4R1NA 3A9CA 4Y9SA 3WBKA 2QRKA 3S2SA 3CZ4A 2GK6A 1LPMA 3O1JC 1U1CA 1SBNE 2G3YA 3EG9A 3N28A 1J7JA 4QPJC 4KXMA 5JASA 2YZ7A 5COAA 1JJFA 1MXFA 1AURA 1N2CA 1WB6A 4HI0E 2DETA 1JDUA 5B30A 2BRUA 3DEJA 1LVHA 1EM6A 3ZZMA 2IBMA 2I3ZA 1A5TA 4P54A 3NVDA 4R83A 4TKMA 3UWKA 5BSKA 4W7IA 1VHWA 5JISA 4JNCA 3U16A 1YCDA 3QMWA 4DR6B 1BE6A 2C2WA 1Z0IA 3GT3A 3IGFA 2JZNA 2NVOA 3IPLA 4EYOA 4G0MA 4BMSA 3SJAA 1CIPA 4K05A 4F7WA 1XPUA 3OBBA 1SUAA 3KLNA 2XXJA 2KW5A 4RXMA 3EEOA 2G40A 1HEIA 2HZ7A 3IJEB 1XAHA 1Z9BA 1JFFA 2BCJQ 3TLYA 1WPGA 2PS0A 4BCBA 3VNQA 3SKVA 1ZCJA 5H83A 3TMAA 3R0VA 3WX0A 3UJHA 3WQHA 3IPYA 1ZCZA 1U2ZA 2MR5A 4QVIA 2B34A 2ZWMA 2BGLA 4FT4A 4MQEA 5CU7A 4TYWA 3LUKA 4DLNA 4XWKA 3P0JA 4M0LA 4F92B 2R66A 2FWBA 5LKRA 3PIRA 1GG8A 5JE8A 3S2YA 2WT9A 4BLQA 4D3ZA 3ZX5A 2QE7D 4BQPA 1QQ6A 2CCKA 3PEUA 3RC9A 2X1VA 2XDWA 3DE5X 3KX2A 4I55A 4O1HA 3SM3A 5CFRA 2MSWA 3NM6B 4FINA 4GECA 4BMNA 1JW9B 2CD7A 5T3UA 2OBBA 3L0OA 3OJWA 3F47A 1Z6TA 4RIEA 4QXRA 2YTZA 2WP8J 4JBXA 4KBYA 3ND6A 4OHRA 1E7QA 2P91A 1I2MA 1L3IA 4Y9RA 3FMIA 4TZKA 2ONKA 1TZJA 2ZCUA 5AXAA 2WTEA 1N0WA 2FN9A 2HAEA 2P2CA 3ED5A 4CLEA 2RHJA 2HQ1A 3NJ8A 3ZZTA 1PTJA 1PLLA 4I0WB 1MT0A 5B1SA 1IEVA 2EV9A 3ED1A 1R8XA 3P0FA 1FP7A 1O3YA 1C9DB 1J99A 4PQYA 4JK3A 4L74A 4HBGA 2I4NA 4KE8A 3VJLA 2YWHA 1JR2A 1OIVA 3TW6A 5C35A 1HMYA 3RIEA 2IXDA 2JFPA 2ADFA 4F3YA 3HNOA 5E9AA 1E7YA 1EGHA 4K81B 1EBBA 2ZSFA 4BC1A 2FDRA 5DCLA 4DDHA 1N5MA 3Q3HA 1SXIA 4KN6A 3FZNA 1W2GA 2R79A 2ZS9A 4QUJA 2Q4DA 4HDNB 3EQ7A 4RJLA 3VX4A 1Q91A 4BKQA 4ZK6A 1KI1A 1NLUA 2BMAA 2F43A 2JEZA 4RVNA 4V24A 4Z2YA 3VU8A 4DC9A 4EITA 1NI5A 2A1IA 1QORA 5GIPE 1F3LA 2RCNA 5ALWA 3AR2A 1P9RA 2BEVB 3DP9A 5JCOC 3EXHB 5LQDA 2BL4A 5KNBA 1UBRS 1TIKA 3D3EA 1TCVA 4MV3A 4OA8A 1OYYA 2QRQA 2ZCJA 3FCSB 3SX4A 1VMAA 3ZDAA 1RI3A 1V43A 4HEQA 3SZLA 1N77A 1GQ2A 3EC2A 2I6TA 5FR2A 4DYVA 5FA5A 1QQTA 3WLNA 1EXDA 1GTSA 2J7KA 2HLHA 1CY8A 1ZUNB 2VNJA 2H57A 1QZ3A 1AQYA 1MO4A 1KMCA 3BUSA 4KGVA 1T4GA 3WL3A 3VDRA 4WIAA 4UPVA 1BMFD 1BVRA 2GSWA 1YZVA 3ZG6A 4UU1A 5CJ2A 2XWJI 4GO1A 3M81A 2O14A 4ZMSA 2BJVA 1BXGB 3FDFA 3BTSA 3GGSA 2X2PA 5ELLA 1R3DA 3G2OA 1N2ZA 4KSCA 2YUIA 1ETHA 2A3RA 3M9LA 1NBHA 5IW8A 4D98A 2AZXA 4UUQA 1CEYA 1QXSA 1E7WA 5EJ5A 2FP4A 5AVOA 4DJDC 2XRZA 3KTFA 2B36A 3GVCA 3LVQE 3WB0A 3HCDA 4MVYA 5THXA 2WTBA 3AR4A 4C21A 2L17A 3I2HA 4H16A 4TL6A 4IQ0A 1V8DA 3UWOA 3OKCA 3WYEA 3ZJ4A 4G1EB 3EIWA 3FZYA 1J5XA 1T6YA 1UANA 4B3BA 3D8TA 4JLDA 5KYYB 5KAMA 1NBIA 2XUDA 2DKFA 4E32A 2CV0A 2X40A 3AR9A 4JDPA 4QBHA 1OFGA 1YJCA 1ZD3A 3BWEA 4KDRA 5FTNA 3RJTA 1JAHA 1X7XA 4IJUA 5A3SA 5K09A 1L4NA 2IY9A 2PGDA 2ZBUA 1YR1A 3Q3EA 2F3TA 4NFSA 4LJAA 2EIXA 3LC2O 2RAUA 3VOSA 4YRBA 1ZIYA 2VT2A 4DTCA 4CLOA 3PFFA 3ZV7A 1LSUA 2PK3A 2C4VA 3A70A 3LBHA 4UHFA 4V2UA 3ZK8A 4WQMA 4XPZA 5A3QA 1CB0A 4OI0A 3E9DA 2QTFA 3EA4A 4F5ZA 3W4JA 3JR3A 2XT6A 1COZA 7ABPA 1Y89A 2Q8NA 5DHSA 3OE5A 4F4DA 5KC9A 3WGGA 2YOGA 3VO1A 3EFOB 2BMDA 1AGNA 3TZ6A 3ZQKA 5K0ZA 4MMZB 2YZ2A 5L3QA 4Y2QA 4UVHA 3CLHA 4C22A 1FNBA 1NWCA 2PT7A 4RVHA 1KJ9A 2LIVA 5ED4A 3FD8A 4MYHA 2FPMA 3G2NA 1IULA 4Z53A 2DFDA 4S2UA 1XZMA 3UWMA 3B7PA 2C92A 3K6RA 3B1JA 3LQ1A 3RANA 2WIDA 3NBFA 1BMQA 1P0MA 4IICA 4O2BA 2P4SA 1QO0D 3UGQA 3UO8B 2Y0EA 3BB3A 2V0NA 1WF6A 3TRKA 2GBFA 3C39A 2WSSA 3VH4A 1N2CB 1JTFA 1P17A 1TUEA 3MB8A 3AJEA 5BSMA 4KVFA 1L1FA 3LT5A 3UXEA 4RTQA 4P4TA 2I4IA 2XTMA 2WZCA 3AWIA 4V3BA 1KDVA 4XCVA 3I42A 3VR3D 3WWCA 4LOJA 3E7PA 1JJVA 3JYQA 2EQ5A 3LW7A 4HMQA 3S5JA 4KXQA 2VPPA 3AHIA 4DJFC 1NY6A 4B79A 5HKBA 1AF7A 2VYQA 1Q20A 3PGJA 4INPA 3ZKAA 2G72A 3M82A 5CVJA 4UU0A 2WLTA 4FPXA 4HZUA 5AK0A 2OGUA 1JFFB 3DEYX 3FI0A 4X8LA 3SF8A 1UPUA 1E2MA 1F0NA 3L9XA 4HPXB 4P7GA 4DM4A 5JQGA 2ET6A 2W5UA 2X13A 2JVIA 1E79D 3FFBA 4MQEB 3J7AC 5BWBA 2G07A 2YBDA 1XF9A 4HQRA 3RQIA 4K26A 3AFOA 1LVGA 3DV0A 4PX2A 3HR8A 5EYPB 4A2CA 1I1HA 4QTYA 5HKKA 2AEFA 2QT1A 5LM3A 2OAGA 4UDYX 4AP5A 3WV5A 4FCTA 3WMWA 4ESVA 5FRDA 4I55B 1QLHA 1XZLA 4D82A 2YHUA 4PYJA 5LWHA 1QRTA 2GK7A 5KSYA 1TA0A 1MD9A 4DQXA 1E1LA 2XE7A 2I34A 3L0DA 2EBWA 4AX4A 2GPAA 5FBHA 4MPPA 3D2BA 4Q7MB 3HBMA 3TJMA 4Q7QA 1CYDA 2QS9A 2QXTA 2Z9BA 3D6JA 2PTGA 5F77A 4OHOA 1GQOA 3LC1O 4H4CA 3D6VA 1MO3A 1T8UA 3TG2A 2HSZA 1MG5A 5D6OA 4L6CA 3PT5A 3E9YA 2QM3A 4QVKA 4TM7A 3E3MA 1NJ5A 2QD3A 4DSOA 4EKYA 4ZT2A 3WYFA 3VR1A 2JCYA 2QTLA 2B92A 3O73A 2ZI3A 2IDZA 4DQLA 4JLPA 3C4JA 4KBFA 2VHCA 1YJ5A 4PFQA 4NBTA 3ZWYA 4BAZA 2QTGA 4K40A 4YYZA 4PC3A 3E61A 3ZHSA 2H31A 3HKDA 1QVRA 3WDMA 3ASYA 3U6KA 4EUKA 3EARA 5AW3A 4JITA 4FNAA 5IZCA 3UGTA 1FFBA 4UM9B 2JI6A 3LVRE 1XPRA 5BUCA 2VAVA 2V1UA 2F43B 1APBA 4PHCA 1RQ2A 1JL3A 1R0XA 2FY8A 4ICIA 1IM8A 1XA4A 1O0SA 3UJ8A 4DMHA 1XTTA 4MRAA 2X3FA 4F6CA 4KBGA 8ATCA 1D04A 1KGSA 1NXSA 3TS1A 4L51A 4Q4HA 5KQPA 5HCIA 1JBKA 4F2GA 1Z12A 4FOPA 3BB1A 4MW9A 2XGJA 1H1TA 4KPGA 1GG2A 1UFKA 3H2BA 3UB3A 4BXOA 4URZR 5E2IA 3ZXYA 1LBHA 2X0FA 3ZHQA 3C1TA 1XCOA 2V6BA 1GNVA 2ZIUB 4GWKA 3WK9A 4X84A 4EB6A 4XDYA 3DE1X 1JG3A 3AIKA 2X0RA 3MGBA 4P38A 2QVXX 4IJMA 3RC2A 3B7GA 1KEVA 4F5DA 1GY8A 1PT6A 1R1DA 4G5QA 3DTVA 4IF6A 4LMBA 4Q5IA 3OA2A 2Q1UA 3OE7D 3DEZA 5HRAA 1UK8A 5JPCA 1E1QD 1LY1A 3TMKA 5ILQA 1BH2A 1E5LA 5A3JA 1J0XO 5ALVA 3W5VA 1QLJA 3G5LA 1OSNA 2PV7A 4KUGA 1V8ZA 2OVFA 1I4LD 4R2IA 4E46A 2ZWPA 3FGNA 3UK0A 3E6AA 2I2XB 3EVGA 4CMHA 3A10A 3T06B 1EB8A 3F46A 1RYZA 3KR1A 3TLXA 4EG4A 2CDBA 3CMCO 4BZPA 4GDFA 3WHPA 4BLVA 4DKJA 2LWIA 2L0XA 3DWFA