4EPVA

Discovery of small molecules that bind to k-ras and inhibit sos-mediated activation
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTPase KRas
publication title Discovery of Small Molecules that Bind to K-Ras and Inhibit Sos-Mediated Activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 170
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4epvA00
2HT1A 1EG7A 2R9VA 1E9FA 4PQYA 4XH9B 3ZVMA 4P4TA 4AIIA 5HCNA 1KO1A 1T0HB 4HAXA 1SKYE 1ZIPA 3AF0A 3AVTA 1QHXA 5KDLA 3DOEA 4JLKA 2IUUA 2OILA 2P5TB 2YOHA 1NIPA 2GJ8A 1E9SA 1KNQA 5F2EA 1XPOA 4R9UC 1NI3A 3FB4A 2F55A 1L4UA 1JECA 5CLQA 5B58C 4RY2A 4CW7A 4QM6A 4UNRA 3GP8A 2FPMA 1KAOA 3LBIA 5K8IA 2J41A 1IN4A 2QEQA 3PR1A 5GVSA 3SZRA 5G53C 4A2WA 2C98A 3C5HA 4G5SA 1N6IA 4IOKA 2EFEB 4DCVA 2WTUA 1NKSA 2XNSA 3CRW1 2V1XA 2UVQA 3QPVA 4A2QA 1Z6TA 1OXVA 4NZYA 4TMKA 1W46A 3BORA 4JJZA 4E09A 521PA 3X1DA 2O8BB 1E9DA 3ZIAD 5A5GA 3AM1A 2IW3A 3B5JA 3TUIC 3FHOA 5FBQB 4C2UA 3R9WA 2V4ZA 4MGZR 4NCJA 1NLZA 1W48A 3VR2A 2WJGA 2IL1A 1KAGA 2IXGA 4GMXA 3IQWA 4MUAA 1XX6A 2QGZA 3PEUA 1ZM4A 1G18A 2Q3FA 4MGIR 2GKSA 4BFYA 4ERNA 1G8GA 4TQ9A 5IRCD 3AVVA 2FFAA 1RRPA 4NONA 3REFA 5BN4A 4NPHA 2IEYA 1GP2A 2EFDB 3A1SA 5GJBA 4JT4A 4IDOA 3CH4B 3OAAD 2ZI5A 4IEIA 3KKNA 1U98A 2C96A 4JVMA 1K6MA 4YMWA 1G5TA 4C0BA 5BN5A 3KTAB 1KO4A 4OI0A 1E4YA 1AS0A 3IBYA 3BOSA 1EFCA 3CLVA 1N5IA 4URXR 2J0VA 3B82A 2VP9A 3FPAA 4BFUA 1KDRA 4L8GA 1NY5A 1AZTA 1CRQA 3C7KA 3S1AB 3LD9A 3AVWA 2JLQA 1IOZA 1GAJA 3IDQA 2CLSA 3E5HA 4JLBA 1ZCAA 4Q9LA 2ZJZA 5EP1A 2FFHA 3NBXX 1Z3IX 2V7QA 2QQ0A 1V5WA 1DO2A 3QBVA 3R7WA 1T5IA 1RJ9B 4LHWA 3RABA 1DAIA 1AZSC 3PFIA 3V9PA 2WIAA 1UADA 1RKBA 4MA4A 2QMUA 2XZPA 1UEJA 1FUUA 4ZPXA 1VECA 1W0KD 5KSPA 4C9BA 2OFOA 1XD2B 2ZJ2A 1Z6AA 1E4VA 3GLIB 2F3RA 2DB3A 1W49A 1TEXA 1G5PA 1J99A 3EARA 1MRSA 2YV5A 3BH0A 1R5OA 4URVR 4JKIA 4KHZA 5JWOA 4WW0A 3P20A 4DCSA 3DKVA 1FW6A 1NVXQ 2CL6X 1VG8A 4B32A 2QP3A 3TRFA 1GNQA 3IHLA 4E03A 4LWZA 2G0NA 2GZDA 1WCV1 3AVOA 1E2MA 2ODNA 1GDDA 1TMKA 2RGDA 4DLWA 1MRNA 4JVLA 1QRAA 3VKWA 2ZSFA 2RGNA 3UXMA 1S1CA 1I2MA 2A5GA 3KUDA 2WSMA 1G17A 5JJKA 2CE2X 1GL6A 1SKQA 1LS1A 4TL9A 5FPSA 4QRHA 2E87A 5C1BA 1IN8A 5EJEA 1A4RA 3NC1C 1E2LA 3LY5A 2RCNA 2P6RA 1L8QA 2FMXA 5EXXA 4ABYA 2IWRA 4GP7A 4EPRA 3B60A 3I1FA 2YOFA 2XSZD 4UJ3A 4IOLA 1X86B 3U7EB 4HLQB 1VG9B 4LHYA 1JEDA 4BEJA 5J5CA 5EP3A 4UXJA 1NVVQ 4D2IA 1Q44A 3BFVA 5GADl 1R8QA 1VIAA 2D7CA 3FDIA 4EFLA 1XF9A 4B3GA 3TSWA 1F3OA 1YZNA 2ODBA 3HP1A 3KL4A 5D3QA 5B57C 621PA 3NHAA 4MQBA 1N0VC 5L3QB 4TYNA 3K8YA 2BJWA 1E94E 4OQFA 1G8HA 1ZU4A 2MMGA 2P65A 3P4YA 3TK1A 4BFTA 4B75A 1R0ZA 2PEZA 1TUIA 1SVKA 1FOEB 1N6LA 3AB3A 3KQLA 1E2DA 3HR8A 1IY2A 2BOVA 3CRVA 3A58B 5C4MA 1MT0A 1XEXA 1RRGA 4ASUA 2YVUA 4L5BA 2QPTA 3K0CC 1E0KA 2HT6A 1N6PA 3D6TB 3LLMA 1DS6A 4Z54A 3MFYA 4GBMA 1QHNA 1K8RA 2GCPA 1PLJA 1R6BX 3NH6A 3PXGA 4PSKA 1XEWX 3FHTA 2D74A 1OT3A 4M9QA 2IYRA 1LB1B 1FNMA 4MGYR 4FD2A 4GDFA 4B3XA 1XXHE 1CULC 1DVRA 4BRWA 1M6NA 4IOJA 2XTZA 1W5TA 5TY0A 2ORIA 5EZ5A 4M4SA 2WSSA 3GJXC 3AUYA 4NYJR 3RWMB 4F38A 2EWWA 5CM9C 4JL6A 1GILA 4MRPA 1JNYA 3FMPB 1NN3A 2ZRGA 3SJCA 3RYTC 5KYKA 5L8VA 2OFWA 4Q19A 2ODWA 3QF7A 4YXWA 3W8NA 4ZDJA 1CU1A 2AFIE 1ELOA 1QHSA 2G83A 2YINC 2ECKA 4PHGA 2BMEA 1LY1A 2W2TA 4QGFA 2HF9A 2CXXA 4FINA 4DHEA 2OUKA 2QQEA 2ZE7A 2D2FA 5EE9A 1OHHD 2ZR0A 3WHLA 1II0A 4CEJB 1XCMA 3I3SR 4WVFA 1JBKA 1X1SA 1W7AA 2F6RA 2AXPA 2DFTA 4A8JB 1ZUHA 1Z6XA 2K5UA 4KJZA 1LVGA 3UWKA 5J4HA 1CR0A 3GLHE 2NO7A 3GFTA 4G0NA 2WWHA 1P2VA 1ZC3A 1YR8A 4CZ2A 1UKYA 1JAHA 4JLMA 1UKVY 5M04A 1CR1A 3OEHA 3AVQA 1W4CA 2EW1A 2ERYA 5HR5A 1CR4A 4FMDF 2I3BA 4BLTA 3WP1B 5FOSA 3ZJYA 3CRRA 5CIQA 1R7RA 3HJNA 3ZGXA 3VKGA 4AKEA 3KJGA 2JLVA 2ZROA 1Z06A 3EG5A 2VP6A 2ZSAA 4PZLA 4TT3A 1OXSC 4Z51A 3A1WA 2FV8A 1K5DA 2ZRCA 4C0HA 4BFXA 5JZVA 1W36B 2WWWA 3Q3JB 4ZIRA 3FFAA 2X77A 1M34E 1O3YA 4JLJA 1DARA 1NIJA 3K0AA 3R9XA 2G77B 3U44A 2DWQA 2Q9AA 1G4UR 1TF2A 4LZZA 1W44A 2HV8A 2IK8A 5A4JA 4V02A 4UNQA 3L0IB 3FHCB 5FOTA 2AWNA 2OG2A 3T12A 3ADKA 3IIJA 4OJKA 3B1WA 2FA9A 1NLYA 5C2JB 4EUNA 2OBLA 1F2TB 1KI9A 1GNRA 3M1IA 4NKRA 1KKLA 4KBGA 4F92B 1Q21A 2GXSA 1II8B 3AKYA 3EC1A 5CYOA 5DHAA 1CP2A 2R8RA 1E9BA 2EVWX 3ND9A 2W6ID 1G6HA 1D2EA 1N5KA 4GNKA 3W5JA 3LWNA 2NPIA 5AWFC 3EA0A 5TV2A 1BOFA 4OHYA 4HLDA 2GAOA 4POAA 1E79D 3GLFB 1V43A 1M8PA 2FDCA 2OBNA 4JJKA 3SC3A 3O8CA 1ZU5A 4YMUA 1KMHA 2MMCA 2BM1A 2ZUDA 1W1WA 1WE2A 1U81A 1Z29A 2BDTA 5JRZA 2IS2A 2BC9A 1D2MA 1E2JA 3W34A 3BWDD 1FL9A 1RC8A 1XMVA 4WBSA 4KO8A 5DGXA 4B33A 4RZXA 2GXQA 3LW7A 4Q1DA 2ONJA 1CTQA 2N1BA 4JIMA 4NCHA 3RRMA 4C0KA 4HZUB 4ZI2A 3LVRE 2P67A 3OFND 1Z0KA 1XCPA 1GRNA 1E2FA 1CJMA 1CJVC 2BBWA 1NMZA 3I73A 2W58A 4HUQB 5FOXA 5C46F 2KBEA 1BYIA 1MO5A 1M7GA 1HH4A 1IXSB 2CVHA 2PCLA 3TUJC 3ASZA 3HYRA 2ZREA 3SBDA 4CDGA 1ZMXA 3QXJA 5F3WB 2ATVA 4M1TA 2QMOA 1UBGA 5LDDC 4XD7A 4M22A 5FI0B 4MUBA 5FTLA 4F4CA 1VHTA 2UZIR 1GKIA 5F9HA 1Z0JA 3DEFA 3Q72A 1ZBDA 2OLKA 2RGXA 4Q1AA 1JJ7A 1L4YA 4A1FA 1KJWA 3LRPA 4IVQA 1KSGA 4B2LA 4D82A 1Q22A 4DLZA 3NBFA 3SDZA 2D4HA 2RAPA 4RCZA 5K8LA 5CJ2A 3LX8A 4P0TA 4KFUA 3CF2A 5TMPA 2H8KA 3LFUA 1RYHA 1R2QA 2XB4A 3SQWA 1AS2A 4BFZA 1KK3A 1IXRC 1NBMA 2IUTA 4V0OA 1TF7A 4YQFA 4EDHA 2PMKA 2BIFA 1J70A 4HAUA 3BAFA 1KNXA 4ZIRB 4HAVA 4TN1A 3CWQA 3AVXA 1NJFA 1J90A 1I4DD 3K0AB 4HI0E 4ZDWA 3THXA 1KSHA 3U44B 2GCNA 2IEZA 1SVOA 1XTQA 2L0XA 2B6HA 2VHCA 3LLUA 1U0JA 4DEYA 1Q57A 2GBLA 4OHZA 1GRRA 2VF8A 1CLUA 2YC2C 1R10A 2W2XA 2FSHA 4LJAA 1ZIOA 3SYLA 1YVDA 4PC6A 1SXJC 1T3HA 3T1QA 1RIFA 2IYTA 4WA7A 4C4PA 5LBIA 4X8LA 1F5NA 1SVLA 1W47A 2BWJA 3U61B 2VP0A 5AUNB 1D2NA 2VBCA 3QXCA 5FBLB 5TARA 2XXAA 3AP2A 3BC1A 4V0NA 4EPTA 3KJHA 3Q8XB 1D9XA 1Z0FA 3ZIAA 3NDBB 3L0PA 3I5XA 1G21E 3EC2A 4QGHA 2ZE5A 4NYJQ 2AKAB 1US8B 4KYIB 1FZQA 4PC3A 1D6JA 3FMFA 1XD9A 1LW7A 5GJVC 4HB0A 2OCPA 5CITA 4LYHA 4M1SA 2IHBA 3QG1A 1XD8A 5AK0A 1KDPA 1KIMA 2AHOA 5EXSA 1W4AA 5IDVA 1KY2A 2HEIA 3OF5A 1T6NA 1FPMA 1KMHB 1IN7A 4HLCA 3RC8A 4OHXA 4A4DA 2QGNA 3ONWA 3WP0A 3DM9B 1YR6A 2H1LA 4GL2A 2OFXA 2ZJYA 1T8TA 4D4KA 2VF7A 5FOVA 2ZR9A 1SQ5A 3P1JA 3SI7A 4QBGB 3NDPA 3TH5A 1YZUA 3CWZA 4PSVA 4MYTA 2QM8A 1P9WA 1FTNA 3BRWD 3KFXA 5FPYA 5HPYB 4O25A 3JZMA 1WP9A 1ETUA 2ZR7A 4AKGA 2V6IA 5AJVB 2ZI6A 4TTRA 4JVSB 2NO9A 3CNLA 2AKYA 5CDFE 1A5TA 5KDDA 2HF8A 1N3BA 3Q5EA 4CT4B 2REBA 3PUYA 1H8HD 1N5JA 3I92A 4NYIQ 3CPJB 4S2EA 1KY3A 1UKZA 3FGNA 2CLCX 4YMSA 3TKLA 1S9DA 3NC0C 4ACBA 2GF0A 3VKHA 3VNVA 1HE1C 4XTRA 2PT5A 2ZSDA 2QUZA 4M2LA 2NZJA 1DAEA 4X8HA 1KKMA 5H8WA 3KB1A 3U60B 1OKKD 1LFDB 2Z0MA 1SKYB 1T91A 3TBKA 5KOYA 1TTTA 3HR7A 4HDCA 1AKYA 1E1QA 3MWYW 2QN6A 5F9FA 4O2LA 4OHWA 4LHXA 3A8TA 4C0AC 2F43A 3AV0B 1Z8FA 2ZI9A 2F9LA 4K81B 3EX7C 1VYVA 3LBHA 2F9MA 3SEAA 4GPTA 3PUZA 4AYTA 4AURA 4Q1BA 5FBVB 1GG2A 3CPHA 2RGAA 2FG5A 5J4VA 3VHXA 3KJIA 3ADCA 1OSNA 5G41A 3MWJA 1IAQA 2DWPA 3PEWA 3I72A 3SE0A 3QKTA 1P2SA 5FL3A 1G3RA 1Q1EA 3QXXA 1TQDA 5LB2A 2IYZA 2OHFA 3AKDA 4JKYA 4FCVA 3RS4A 2NGRA 1JI0A 4HAYA 2O0HA 1OFIA 1N6KA 2GESA 2NTYC 3BIFA 2OCBA 2GZHA 1BO6A 1WF3A 3QNUA 4UQOA 2XSZA 1G5RA 2HUPA 4HATA 1UBCA 3KTAA 2JGNA 1EFRD 2CBZA 4DJTA 1G20E 2WV9A 3FMIA 2QTFA 2A5YB 3NHBA 2QPAA 2RHMA 1GVNB 1AM4D 2ANCA 1DG3A 4II7A 4JBYA 4Q4AA 3S1AA 5JI3E 4MYUA 4AKIA 5BYKA 2FSIA 4CEHB 2ZQ5A 2Q9CA 1ZM9A 2W83A 4RD0A 4DSUA 5GVRA 4NCKA 1X1RA 1ODFA 2W00A 4L4UA 3I5YA 3IO5A 2GWHA 4LPSA 3ZVLA 3U6KA 2W0SA 4JLNA 4W5WA 1Z83A 4WZAE 4A0GA 1E9AA 1W4RA 3FYHA 2KE5A 5EXPA 1X8LA 4DXAA 4W7SA 1KK1A 1P4SA 2OT3B 1Q1ZA 1LTQA 2NIPA 2VYFA 2XZOA 4O2RA 1X8KA 2C9YA 2WJHA 3VX3A 4AI6A 3D3QA 4C30A 2FGKA 1GTVA 2OEPA 3TE6A 2CCJA 2NO1A 4NCNA 1XD2A 3GLIA 2ZUBA 1LF5A 1XXHA 2Q0HA 3W3ZB 4C7OA 1ZD8A 3I32A 4FN5A 3BB3A 4N1AA 2GF9A 4WXPA 4B6FA 121PA 2ZAMA 4WOPA 4A0RA 3HU3A 2ZS9A 1P9RA 1CJUC 4QGGA 4LC0A 4D80A 3RHFA 1M1YE 2QZ4A 1P9NA 1LS6A 2VA8A 3PUWA 5FR1A 1QZXA 4HYYA 4GP6A 1EX7A 3C41J 4B48A 5DSZA 4ILEA 2JEOA 1KJZA 3QI2A 3F5FA 4BEBA 5BXQC 2MSDB 4B3FX 4Y0AA 1N6NA 1QBKC 2FJUA 1E9EA 3CUEF 3CR7A 1UM8A 3MG9A 3T1OA 3GEHA 1FX0A 3G5UA 2VP5A 4JLDA 2QI9C 2BEKA 4DLSA 3ASYA 1IY0A 1P62B 1X8JA 1S3SA 3PVSA 1P61B 2CK3D 2FH5B 4B43A 1FUKA 2YKGA 4PHTA 1G7RA 2PLRA 1AJEA 2QRZA 2Q3HA 3NTUA 4C0SA 2BMJA 1ZP6A 4DDUA 2H5EA 1G8FA 2GEVA 3MLEA 1TAGA 3GLHA 3K0SA 4BLRA 2F43B 3KJEA 4MKIA 4YDSA 3T06B 4MYHA 1VTKA 1OHHA 1GKYA 2WKRA 3U3KA 5AUPB 1GM5A 2GJSA 2ZYTX 4I1OA 1U8ZA 2BVNA 4HB4A 2HJGA 5FPTA 2W0MA 3HU1A 4GOXA 2C03A 5L3QA 3GJ5A 4RJLA 3NKVA 2ZIAA 4JYCA 3VAAA 2C5LA 2G9NA 3AKCA 4M9SA 2ANBA 3FOZA 1GL7A 4TLEA 1GUAA 2ZI4A 1F48A 5J4LA 3CX7A 4PPFA 1I4TD 3MRSA 4Q4LA 5DLQC 3TGPA 4CVNA 5IK2D 1B0UA 4OQXA 3VR3A 2KWIA 1QDEA 2X19A 5CK4A 1Q3TA 3GEEA 3AF2A 3C5CA 2LKCA 3SR0A 1FMLA 2R62A 2XNDA 4BGDA 1IXZA 4LYAA 1ZM3A 2OZEA 3ZYCA 3CB4A 3BH7A 2QMEA 3SJZA 4LRWA 1XU4A 2H7VA 3JVVA 3VMFA 2GTPA 4NDZA 3VTKA 1E6CA 4I1SA 2VSFA 2XB2A 3TUZC 1UF9A 4D26A 4Q4AB 2CL7X 3OESA 1IJEA 4P33A 2MSEB 4MITA 1QVRA 2J87A 3TAUA 3UPUA 3N2IA 2EFHB 1YZQA 4PR0A 1EFTA 4ARZB 3SFZA 3EZFA 2NO6A 4Q01A 3EPKA 3OEEA 2GXUA 3CX8A 4TMVA 3KZ1E 2PLFA 3B1VA 3EZ9A 1E1QD 4A2PA 3TR0A 2JJ2D 1G8YA 4XSHA 2YC4C 3F0TA 4Q47A 1XXHB 4Q02A 1RZ3A 4BLPA 4C7OB 5JSZA 3LAWA 2O8CB 4U00A 4JVNA 1ZUNB 3GJ4A 3KXLA 4CEJA 4TYWA 3WRXC 4PTLA 1T3LA 3QPUA 3QF4B 1EGAA 2J0SA 2ZRDA 2AFHE 5KU1A 4A8JA 1QG4A 2ZAOA 1NRJB 2ZYVX 3T34A 2A5FA 3GMTA 4A36A 1OPXA 4LHZA 1DAFA 2QM7A 1TQ6A 3CF0A 5B30A 3BB4A 2W6IA 1TF5A 4HUTA 2W2VA 3JVUA 1G8PA 3BBPA 4ZV4A 1HUQA 3SJBA 2PJRA 5ANRB 5KTYA 3KKPA 5BQ5A 1UBEA 2WOJA 3B85A 1JR6A 4BWYA 1E79A 1O87A 3L2OB 4LV8B 2YWGA 4RKEA 3PG5A 3TMKA 3T5GA 2C95A 5JBQA 1NN5A 3TR5A 2CNWD 4TMTA 1FX0B 2LCFA 5EZ6B 3A1TA 4Z1MD 4EJSA 2A5JA 1Z6YA 2CDNA 2QAGB 2QU8A 5H70A 1JR3E 2QENA 5HE9A 2GJ9A 4ZI3A 3CX6A 1AGRA 1LNZA 3UATA 4A6PA 1MO3A 4NE2A 2Q6TA 1Z2AA 3A36A 2YWEA 2CCKA 2TMKA 3AKEA 3LNCA 1KI3A 2DYKA 3GLHB 4FMDB 4LJ8A 3RLFA 4X8MA 1CXZA 4F4JA 4EFNA 3ICEA 4GMDA 4A8JC 3OFNA 3F8TA 4LHVA 2O52A 3H1TA 2QPOA 2WMOB 3C15C 2G88A 5JJIA 3I62A 3AVUA 2P3SA 2RGCA 1A2BA 2ZS8A 2RGNC 4DKXA 2WJIA 4JT2A 2F3TA 5EE5B 1A2KC 1G1MA 3AF3A 5C4GB 3ADBA 4L9WA 4C3ZA 2VTKA 3B1ZA 4LK2A 3GJ3A 4OYHA 4HSEA 1TPZA 1L2TA 5DI3A 1XMIA 4URZR 4DEXA 1NKTA 4Q9HA 1J7KA 1EXMA 1NG9A 3NWJA 4AK9A 1KDTA 1JQLB 1F2TA 4QKQA 2ZTSA 4PFSA 4YDHB 4B73A 1TQ2A 2OE2A 2IXEA 2LKDA 2NQ2C 5DI9A 3MD0A 1F6BA 4IVRA 2ZI3A 4B74A 4LJYA 1II8A 4RD1A 3TAHA 1W36C 3K1JA 2X8AA 4DLUA 2AK3A 4KI0A 4RZ3A 3U3OA 2X2FA 4UXHA 3OIUA 4Q4HA 2XZLA 3AP3A 2X2EA 2ZSEA 1CR2A 1N0UA 1E2IA 3BJIC 4A92A 2PH1A 4AG6A 1U8YA 4NYMR 2WICA 2G6BA 3GLFA 1RRFA 1U0LA 4FW9A 4ZKEA 1X6VA 2KB0A 5KNCA 5C18A 4JZKA 3GCGA 2AR7A 3ZD7A 5HCIA 4DLTA 1FQKA 4P4SB 2VEDA 4DLRA 3A4NA 2NOAA 5SZKB 4CEIA 5FUWA 1E1RA 1ZM2A 721PA 5DNYB 3A6PC 1WB9A 2HXSA 4TZ0A 2GHIA 2IUSA 4HZUA 3GFPA 2HXYA 1E2PA 4M1OA 5EP4A 2Q9BA 4FWIB 3THOA 5AUOB 4B35A 5JSZB 2ZRLA 3LX5A 4HUQA 3RS0A 3BH6A 3OE7D 5DISB 1U2RA 1N25A 1DAGA 1H65A 1DEKA 1NLFA 1IM2A 4QBFA 3U4QA 5HE8A 1NN0A 3U3RA 4K46A 2PBRA 3PQCA 3QIAA 3RNLA 1MR3F 3WHKA 1BYUA 4LX0A 5DN6D 1KHTA 5A0FA 2QA5A 4DT1B 1J8MF 4PSAA 1G7SA 4OK5A 4B71A 3EXAA 4M53A 2RGGA 3VU9B 1E2EA 3AGPA 5AJWA 3SJAA 1AN0A 3X2SA 4I81A 1ZNWA 4TSFD 1QHIA 4LYFA 4QFMA 2WIBA 4UNPA 4DDWA 4EJSB 1ESMA 1TUEA 2JLXA 1KOFA 2XNDD 1Z6GA 4GSYA 4GOKA 1OFHA 2PX3A 4M0LA 2Z4SA 5KSYA 5CDFA 4OI1A 5L3SA 1A82A 2GCOA 1KO8A 4DCTA 1BH2A 3Q9LA 3GPLA 3B1YA 3LV8A 4EPYA 1P5ZB 3B13B 2O8FB 3WBJA 4B3BA 1JEEA 2FGJA 3AGQA 1BIFA 3O8DA 1P72A 2J9RA 3Q85A 1T0JB 1SVMA 2FN4A 1GNPA 2IYVA 3HWSA 4KFRA 4O0MA 1UEIA 3P32A 4R2HA 1IQPA 2I1QA 2KJQA 3OEED 4ON9A 2J59A 5E4FA 1OH7A 1H8HA 1ZNZA 2FPLA 2J3EA 3NBZC 4M1MA 2GA8A 4XVQA 5FBWB 1AS3A 3N70A 3PUVA 5DI3B 2J7PD 2ZRKA 4URUR 4PAQA 2YNMA 5DH9A 4MKFA 3VX4A 2G3YA 1WQ1R 1OF1A 2GJAA 2NG1A 3P4XA 2VRWA 4HEJA 3GLGE 3EIEA 3W90A 1OKKA 2ZPTX 4GZMA 1HEIA 1TEVA 2REXB 5CK5A 2P6UA 2VQSA 1UJ2A 4PC7A 2CL0X 1II9A 2WWIA 3W6NA 5D3MB 3ZZUA 3V4RA 4HLUA 2VLIA 3EA5A 4IOMA 3FWYA 4URYR 1DAKA 3AP1A 4M9XA 2O0JA 4DCUA 3E2IA 4TYPA 3KQHA 3ICQB 2JA1A 2BBTA 1YJ5A 3U6BA 1US8A 1YRAA 4FCWA 4Q4HB 3VR5A 3R8FA 1ZC4A 3TW4A 1U90A 4JS0A 2BCGY 2VO1A 3QKUA 4GRAA 821PA 4W5JA 3UG6A 4B76A 2H16A 2ZI7A 3ETLA 4NTZA 1WBBA 5ELXA 4R7ZA 1E0AA 2FU5C 5CJPA 2A9KA 3WRYC 2OLJA 4MGKR 2WM9B 3K70B 3OIYA 5L3VA 2RGEA 2GRJA 1K5GA 3PENA 1BMFD 1Q12A 4C2TA 5EE1A 4DSNA 1ZINA 1OIWA 2R65A 1GZSA 5EE3A 3LDAA 4BE7B 5P21A 2GAAA 2QBYB 1IONA 4HLUC 4TYQA 4V03A 5H68A 2ZANA 3PUXA 2FZLA 2Z4RA 4TQAA 2N46A 4TL8A 3LA6A 5J40A 2RMKA 1OIXA 5IT5A 4PO1A 1KGDA 1EFRA 3U4QB 3P27A 3QG5A 4WZ6A 4KSBA 2GZAA 1HA3A 1N0WA 4MYCA 3LXRA 2XOKD 3CNOA 5G40A 5EP2A 3MCAA 5FTNA 2JIZD 2ZRAA 2IYWA 2ZXUA 2ZEJA 3FKQA 3BB1A 4Q18A 2I4IA 3K9LA 5L3RA 4B6EA 2HDNB 3BERA 2P5SA 2ZUCA 2I1VB 3B9QA 1PZNA 3J81k 2FF7A 3SU8A 5FTJA 2J46A 3AEZA 3HU2A 1SHKA 3RC3A 3X1XA 4OHVA 1DG1G 4TWZA 1XTJA 3EIQA 4PQFA 1XJCA 3UK6A 1DBSA 5L3SB 4KITB 2GCOB 2ZM5A 3BGWA 5CIWA 5K8TA 3H0KA 2R6FA 3KQKA 4Q00A 1WXQA 2ZJBA 1TADA 4E22A 4OI2A 5FUXA 5LB4A 4DVGA 4BLOA 1GKUB 3Q7QA 4XOIA 2C8VA 2JLRA 3L8YA 1KO5A 1G19A 1E9CA 2PCJA 4L16A 5UKDA 1P2UA 2JCSA 3R20A 4BZPA 1SVSA 3EAQA 1MKYA 3U7FB 4I1UA 1Z47A 1XJQA 2Q21A 3AVYA 3UWOA 2ZVQX 3BFKA 3K70D 4DB2A 3MMPA 4R98A 4DWJA 4QBHA 5JJLA 4KV9A 1C4OA 1EWRA 4QXAA 3B6EA 1E1RD 4RVCA 3JZAA 4PPQA 1DTSA 2QRNA 1YR9A 3NEJA 2J0UA 3NIBA 4D0GA 4WAUA 1HE8B 3LQRA 2BMFA 4KXFB 1JXMA 2CK3A 1XTRA 1IN5A 3B8HA 5KHOC 4LSGA 3RS2A 3ZQ6A 4PPGA 1DELA 2JJ1D 3Q7PA 1T9HA 3ZH9B 3WMGA 4DIDA 3FE2A 1G3IA 3I4LA 3H4MA 4CEHA 3D31A 4OL0A 3AF1A 4G5GA 1KI2A 2ZE8A 4A9AA 1OFTA 1OV4A 1R5BA 2GBLC 3WYAA 2OM2A 2AN9A 3TLXA 5JHGB 2OXRA 1KTVA 2G0TA 1NVWQ 3B78A 1S1MA 3ZVNA 2QSZA 4TLCA 1AGPA 1S2MA 2IYQA 4LJ9A 5JMTA 1IN6A 3LH5A 4F7WA 4MKGA 4G5OA 4I99A 4KFSA 1XWIA 3T1VA 5SZIA 1CJTC 3TSZA 4M9ZA 5IK2A 3VR6A 4TTPA 3CRMA 2QMHA 3E1SA 2DWOA 4H9GA 4HDOB 3FVQA 2IS4A 1CEEA 1IBRA 1YZGA 1TU4A 3DM5A 3QKSA 2OCYC 3RRZA 4UNNA 5GJCA 1NJGA 1N2CE 4RFVA 1JALA 1FFHA 4JSYA 3NXSA 2R6DA 3TVDA 3DKPA 2YWFA 4PHHA 5J4YA 4Q66C 1PVOA 1F2UA 2RGBA 2BMDA 5EE0A 4B44A 1XPRA 1B23P 1VYTA 4FXPA 2WWFA 4LV6A 1JB1A 4NHOA 3HDTA 3UMRA 4D4MA 1KYIA 4URWR 4PAMA 2FZ4A 4TMWA 4YLGA 3VQTA 1S0UA 3UMSA 1KZ7B 4P4UA 1VYUA 1EESA 2F1HA 2VP2A 4AYWA 3D7MA 2G1KA 4GI7A 2PJZA 1OFUX 5B2ZA 4W9MC 2XTNA 4PPNA 5CYPA 5SZJA 4BECA 2HCJB 1CS4C 1GRQA 3ZDQA 4R71A 1OJLA 3U3MA 4N3NA 1AQUA 1VDZA 4MH0R 2J45A 5BN3A 1CBUA 2JJ2A 5JECA 1U9IA 2GXAA 3IUYA 1RE0A 4ZO4A 1MO4A 4MKHA 4PQRA 3VFDA 2B7BA 2J1LA 5KPJA 5FUVA 4QHSA 4PHFA 1HT2E 3H86A 4U7DA 2DFKB 5DYGA 3GD7A 3CO5A 2WVJA 1N6OA 1PLLA 1UFQA 5IHPA 4Q21A 3ECCA 2BKUA 3C16C 4WZBE 3SQXA 3T61A 1QHHB 4CEIB 1XZPA 1G9XA 2EFCB 1E0SA 4IDNA 2A5DA 2ATXA 3CIOA 5BYJA 4IRUB 3M0EA 3K0EA 4KSCA 5DYIA 4Q1CA 2A3RA 3W9YA 5EUQB 5FPKA 1XEWY 2CNWA 2VIIA 2H18A 1E2KA 4Z1MA 4CIDA 2J0UB 2UZ3A 1NVVR 4FMCF 4CF7A 4LPKA 5LD2B 1Y63A 4IXNA 4LUCA 2ZRPA 2VSOA 1PV4A 2B21A 2DFLA 1KMQA 3EZ2A 3LXXA 2IBMA 2NZ8A 2HLDD 3TVTA 1P60A 2JJ8A 4AYXA 1VCIA 2GVDC 1U8AA 4D0NA 3MAAC 2WWGA 3RS5A 3K09A 1TQ4A 2WWXA 4JMPA 2JAQA 2QORA 2J7KA 1XDBA 3CZPA 3O47A 4Q1FA 3QVVA 5FOUA 3B1XA 4UJ5A 4ARZA 2ZU0C 1D5CA 2DHRA 1KK0A 1OXUA 1GIAA 4LJ4A 3KXKA 2F1RA 3K0FB 2ZRIA 4LV5B 1YRBA 3E70C 4QNRA 1P6XA 4LBVA 1I2DA 4KLZA 4V0KA 3WNCA 1MOZA 1NP6A 2A2ZA 4I1VA 2QE7A 2V54A 2O8CA 3UG7A 5JWHA 4G01B 3QKSB 4TMZA 1XZQA 1COWD 421PA 4AG5A 1KI8A 1CKEA 4US0R 3K9HA 4QBIA 1OLOA 1E2GA 1RVDA 3QF4A 2VHTA 2CMKA 2ONKA 1G6OA 1NY6A 2EYQA 1F2UB 1UDXA 2BM0A 2RHDA 2FPKA 1SXJD 1OB2A 2OO7A 1KDOA 3RS7A 1JJVA 1AK2A 3GJ7A 4JLVA 1E2QA 3UMFA 4H1VA 2WHXA 1Q20A 1KI4A 2ORVA 2ZETA 3I61A 1FQJA 2IYYA 1H8ED 5JEEA 4LBYA 2V6JA 1MABA 2CJWB 4EQ6B 2IX3A 2QAGA 1IJFA 4DCNA 4A15A 3O8BA 5J47A 2D7DA 2D62A 1SXJE 2IF2A 3DMDA 1E9RA 2CE7A 2GDJA 3PV0A 3KDSE 2GVZC 1Z5ZA 3N2EA 2EYUA 5E3HA 3DVLA 2XJ9A 4Q9JA 1VPLA 2R6CA 4H1UA 1NBME 3FMOB 1OH5A 2Q3MA 2WPDD 3OE7A 2GETA 5EQTA 3REGA 4ZDIA 3CONA 4JLOA 1F60A 1Q0UA 2B7CA 4LBZA 2QTVB 3FKSD 1G7TA 2F7SA 3WNDA 4YONB 1Z22A 2FEOA 3DO6A 1E69A 1KI7A 1WDTA 4HDQB 3W5IA 3PITA 5DN6A 4KYUA 1XTKA 5JWRA 4XSGA 3MJRA 4BFVA 2QROA 2QAGC 4JBXA 2IWHA 1OH6A 4NBSA 3LO5A 3QOFA 1G3QA 1T4GA 2OAQ1 3M6AA 1R4AA 2JDID 3KKMA 2XX3A 3EPHA 4TSFA 2YJTD 3SNHA 3U2QA 1S8FA 3CW2A 3SOPA 3KQUA 4ZKDA 2C04A 2Z83A 4J0QA 1G64A 3EZ7A 3ZZTA 3OIWA 4G1UC 4US1R 1NL3A 3U5ZB 1XFAA 1OW3B 3QENA 2XJ4A 2ZS7A 4D6PA 5G3ZA 2WOOA 1PLKA 3QJYA 2WAYA 1HV8A 1Q3HA 4IEEA 3V4FA 3DZDA 4V0ME 5E7JA 4FCTA 2VHJA 3IPXA 1GL9B 3NG1A 4OI4A 4Q1EA 3T5DA 3GLGA 1KI1A 3PCRB 4LYJA 1Y3AA 5AJZA 2EWVA 3X1YA 1FTSA 1RW4A 1N5LA 2B92A 2ZJAA 3P26A 3QBTA 2IYXA 2E1RA 2OAP1 4LJ5A 4RD3A 2BBOA 3EPLA 4P4SA 2AD1A 2SHKA 2J7PA 2KBFA 2RH5A 3IBGA 3RWOA 2KSQA 3RRYA 4A0HA 3SBEA 3UIEA 4D4LA 4TQUS 3F3YA 3L0SA 3NVAA 2FSGA 3WYGA 4Z8XA 4LDJA 3ZD6A 4Q7JB 3B9PA 2IYSA 3MUFA 3IIKA 5TVKA 2V1UA 3SS8A 2R2AA 1J2JA 1JR3D 1XEFA 2AK2A 4JSTA 4KBFA 5KUTA 2O8DB 4Q9IA 3QVUA 1ZJ6A 2C78A 3PEYA 4DB4A 3FTQA 2IS6A 4DT1A 4PZZA 2A7QA 2C77A 4OQNA 1ZNYA 4JLAA 4RD6A 3VU9A 3W6OA 3TIFA 4EPWA 4DUGD 4DSTA 1QHGA 2ZJ8A 1VKJA 2W6JD 2HYDA 1MABB 1LV7A 2RB4A 2FFQA 1HT1E 1W2HA 1KZGB 1MV5A 2ODEA 5JI2E 1YQTA 3BD9A 1YU9A 5JLJA 1U99A 4GOJA 4XIGS 1BMFA 5HKKD 3B2EA 4Y0VA 5KDOA 5H1YA 5FL7D 4LY6A 4Q7MB 2O8FA 2NMVA 4X8OA 3ND8A 3N5CA 3IPYA 2ZYWX 2EFGA 3A4LA 2IF0A 5JRJA 2WKQA 2GJKA 3KXIA 3W6PA 1C9KA 2C9OA 4DLYA 5HZHA 3IGFA 2WMNB 1BS1A 3L82B 1ZW6A 2XOKA 6Q21A 2JIZA 3TNFA 2QP4A 2FEMA 4PC2A 1EX6A 1YZLA 3K0CA 3SN6A 4OQLA 2WJJA 3U3JA 4Q03A 4EJSC 2ZYUX 4RZUA 5JCZA 4HAWA 4TYYA 2VP4A 4BLSA 4KLNA 4KU4A 1E32A 4PANA 3U7GA 3RS3A 1YE8A 3DZ8A 2QE7D 4I4LA 4HZIA 4XWKA 1VG0B 5EUMA 4OBEA 1G7CA 5D3MA 4NL4H 1L7VC 1I4LD 2BEJA 5KSZA 5FUYA 1D8TA 5JS7A 1HYQA 3SHFA 3ZZ0A 4C0LA 2H57A 4AC9A 1KSFX 4D25A 4RKFA 4BRUA 2BBSA 4CRWB 1Q1QA 4EPVA 2C2HA 5BW8A 5JHHB 4BQSA 1E3MA 1JXOA 3K9NA 3GLGB 3T15A 4IFBA 3TQCA 1WBDA 1KK2A 3BXZA 4G5RA 3AF4A 4EAQA 4OQMA 1VMAA 3SYKA 3ZS9A 3NH9A 5KSOA 3LVQE 4LJ7A 2F1IA 3HPRA 3CRQA 4L9SA 1JPNA 3EWSA 3MWKA 3IKJA 3WNBA 4QJ4A 1SVWA 4N0EA 1PJRA 5TB5A 1Z0AA 4F4IA 5AR1A 5SZHB 5DO9A 3KFVA 2YYZA 4QJ5A 1T3SA 4M1YA 3GLIE 2QBYA 3AVPA 4MRRA 4TLDA 1Z0DA 4PXAA 1CIPA 2CEAA 4RFSA 4XWAA 2CVFA 4OK6A 1QF9A 4GT1A 1YHNA 1G16A 2PEYA 2V9PA 3IQXA 4DIEA 3R7WB 2CLDX 4TL6A 1DOAA 4A0FA 4QNMA 3CPEA 3K53A 1IY1A 4AWXA 2AL7A 3RSLA 2JJ1A 3QXHA 3H84A 4RZ2A 3UANA 1OYWA 3AUXA 2JLYA 4PAOA 1ZD9A 2BJVA 2JLUA 1NNEA 2CHQA 3IILA 4QG7A 4TLAA 2QT0A 2R44A 3ADDA 1YZTA 2LWIA 3OZXA 3DOFA 3QQ5A 3EPJA 3K70C 3THWA 2P2LA 3ZLJA 4LCBA 4P3YA 1Q1BA 4TZ6A 1U0HC 2VHQA 4BPBA 1OE0A 3OHMA 4N0DA 2ZE6A 1KSJA 2FFBA 2O5VA 3GQBA 3QKRA 2WJYA 4W5HA 2JLSA 2MSCB 4QC2A 1R0XA 2IHYA 1XTIA 3IHWA 3WMFA 3DHWC 4EFMA 2ZRFA 1AIPA 1ZUIA 2R6AA 5BWMA 4IXMA 4DSOA 1MH1A 4TLBA 2N42A 2A78A 4FI3C 4RD4A 4Q7LA 5FH9A 1XB2A 2BV3A 3AQ4A 3X1ZA 3EASA 1S96A 1VCMA 4K8OA 4NYIR 3GFOA 4LOAA 1JPJA 1NF3A 4ZCLA 4IVPA 1M74A 1SGWA 3MSXA 4BZQA 1ZRHA 4M1WA 3X1WA 2JLWA 1ZCBA 4PO8A 1XBTA 5AJYA 5TXGA 3QY0A 5JCPA 2FSFA 1A7JA 2DPXA 2XITA 1ONBA 3BFXA 3QXSA 4XTCS 4GZLA 1M7HA 4IDHA 2IYUA 4KCGA 3WYFA 2GEUA 3PEVA 2B8WA 5FR2A 3CNNA 2QL6A 4DDVA 3I8SA 4ESVA 3QPWA 4XVUA 1QHYA 2V3CC 4PZYA 5KNBA 4XJXA 2Z43A 2V7QD 3A1VA 3QEJA 2ORWA 3G0HA 4B3CA 2C99A 2OCAA 2FOLA 2AWOA 1R5NA 2QT1A 3IEUA 5DHFA 4P31A 1MO6A 2QAJA 3PJRA 3LW8A 5FBRB 4CT5A 1GSIA 2HYIC 3BE4A 5CB6A 1VG1A 4QHTA 4DBLC 4EKDA 4V0LA 1XEXB 3TJZA 3VR4A 1W0JA 3A4MA 3HYTA 2QP9X 2V8OA 3H2YA 4OK3A 4JL5A 1SZPA 1T8UA 3GJ8A 4CYMA 2G1JA 4MRSA 2YOGA 3QUSA 3T1TA 3THYA 2FE4A 1DE0A 1ZAKA 1JAIA 3L43A 4C0QC 1Z2CA 1S4QA 4U5XA 1FP6A 4YC7A 4BUJA 1W5SA 3R8CA 3KX2A 4DLXA 4ZDKA 1PUJA 2VSXA 3A1UA 3MJHA 3QSYA 4L15A 5JS8A 4RFSB 2NO0A 2FNAA 4EPXA 1G4AE 2E9SA 4TL7A 1NMXA 2ZRHA 2ZRNA 4DC9A 4KFTA 4PO9A 2R6GA 3GJ0A 4LBWA 2D3WA 2HLDA 3SYNA 2C9CA 1XNJA 4NH0A 1UAAA 5G3YA 1FMJA 2YWHA 3A37A 2ZRJA 1J8YF 1VHLA 1KJYA 1P75A 3CF6R 5HTKA 2ZITA 3RDPA 2VL7A 4ITRC 2XGJA 4AY2A 1NN1A 3WY9A 4Q9KA 1W2GA 1SHZA 1W36D 4M21A 2GK6A 1UDWA 2GK7A 3THWB 4E5UA 2ASEA 2GILA 3KKQA 4MDFA 3HPQA 5FTMA 4DZZA 3QKRB 4M1KA 3CM0A 5E7MA 3ZS8A 1NSFA 4PC1A 1GFIA 2ZJ5A 2OSBA 5E95A 2B8TA 1DO0A 1UKEA 3DPUA 4WIAA 4B34A 5HZKA 1R0YA 2QTHA 1E2HA 3KB2A 3R9IA 2J5XA 3Q5DA 4B47A 1VIYA 2H92A 3WXMA 2XAUA 1GWNA 2BCJQ 1E0JA 1COWA 1OYYA 3DL0A 4B2IA 4LC1A 3TQFA 3WMEA 4KODA 4Q4JA 5DIFA 3QEOA 4OKSA 4ASUD 4TMXA 1RRCA 5FI1B 4Q7KA 1CF4A 5KNDA 3D8BA 1X3SA 1SXJA 1XRJA 4QGAA 1QHHA 3UKDA 3RVBA 1RFLA 2OV2A 1YR7A 2AXNA 1QG2A 1EK0A 2PZEA 1G3MA 1IHUA 2P6NA 4QM7A 4FWTA 1YZKA 2DBYA 1UBFA 2PZGA 4JL8A 4UXIA 4B3DA 2O0KA 2PZFA 2OBMA 5AJXA 1OB5A 1WA5A 1H8EA 1NMYA 1OIVA 1ZNXA 4Q5IA 1KI6A 2ZSBA 2ZRMA 4QOSA 2J0QA 2A30A 2YHSA 1OXTA 2WAXA 2WSSD 2CCGA 3EZ6A 3OIVA 4GFDA 4NP6A 1RPZA 3EW9A 1N6RA 3BS4A 4Q48A 4US2R 4NYMQ 3T35A 2O8EA 1HY3A 4LGMA 4ZCMA 4CGZA 2WBLC 3W8RA 2XTMA 5FPHA 4NCIA 3ZQJA 4YXWD 4FMCB 2RKOA 3CKLA 2DY1A 3B7GA 5FOWA 4AD8A 4IDQA 1PUIA 4KVAA 1G41A 5JEDA 2WPDA 4IJMA 1YKSA 1DPFA 5J4KA 3GLFE 1Z07A 1TX4B 1E96A 1KO7A 1UPTA 3FKSA 4M8NE 5TDHA 4KVGA 4HB2A 3MWLA 221PA 1R8SA 4ZCIA 4BZXA 2WJVA 3TSOA 1W4BA 4F93B 3K0FA 3THYB 1R0WA 2QY9A 1HQYE 1SULA 1Z63A 1VCNA 1HURA 4F91B 4IDPA 4JYBA 5LD2C 4V0MA 1XP8A 3TW8B 2DFNA 1EFHA 3KUCA 3NEYA 2JDIA 3IIMA 4JBWA 2P0EA 3DDCA 5CLLA 4ESHA 2H17A 4NU0A 1P2TA 3DMNA 3OEHD 2ZRBA 4UKDA 2V55B 1Z28A 1CJKC 3C4JA 4U02A 4UNSA 1AKEA 4BLQA 4EIWA 5K8UA 2CHGA 1JQJC 2ERXA 2QSYA 4DLVA 5FTKA 4E07A 2IYLD 2XEXA 4QL3A 1XMSA 4TT3D 5JFGA 1N6HA 2GNOA 1EFUA 1LF0A 2GEDA 3OAAA 5EXTA 3QE0A 3C8UA 3SFVA 3VNUA 3I8XA 5KO2A 1DADA 2CJWA 2OXCA 2DR3A 2ZVPX 4EQ6A 1ZYUA 1M2OB 1P3JA 1C1YA 3NBYC 1U94A 2Y8EA 1ZM7A 3L8ZA 1EWQA 5CB8A 1TL7C 2Z5FA 4KAXA 1G291 1QVAA 1D9ZA 4XVRA 1S3GA 1E2NA 3ZVRA 2D06A 2BHRA 4QHYA 2IC5A 3C14C 4AKHA 1A1VA 2EQBA 2F1JA 4IHQA 1P7CA 5AUQA 1CRPA 5GJWC 3CZQA 4YMTA 4A82A 1T5LA 1VCOA 4Q4JB 2YZ2A 3EWAA 1XPUA 1W0JD 2PL3A 5F98A 2HJVA 4IKEA 1JR3A 4B2PA 3O8RA 4S35A 3WBKA 1Z0IA 5B64A 1RYFA 2WWYA 2QNRA 1NVUQ 1SXJB 1ZD1A 2WKPA 1SVIA 1S9HA 1DAMA 1W0KA 3IEVA 2O8BA 1Z08A 2VHUA 1ESNA 1M7BA 1P73A 3K9GA 4RSGA 4LI0A 2FX3A 2UKDA 2AX4A 3KKOA 4DUGA 5IF9A 3RSOA 2W6JA 4O3MA 3EIHA 2FWRA 1KI6B 5DE3A 2QG6A 3LQQA 1ANKA 3FFBA 4FIDA 4D4JA 2IT1A 1U9IC 2IS1A 1FNNA 1E99A 3THXB 1G3UA 4WXRA 1AQYA 3CH5A 4LJ6A 4IFEA 4ACAA 4D0LB 4PX9A 1AA9A 5E7IA 5HKKA 1NG1A 2O8EB 1TNDA 3CR8A 3GJ6A 3IO3A 3PIRA 4DDTA 5FL7A 3W3AA 2PT7A 4BASA 2VH5R 2JLZA 1E98A 2PMDA 2IXFA 1WRBA 4NMMA 3U7HB 2VPPA 4RD2A 1HQCA 3SHWA 2ZU6A 1XJ0A 1GOTA 2DCUA 3LBNA 4D81A 1DAHA 4QJ3A 4XWOA 4TTQA 2NPFA 3AH8A 4JLPA 3RRNA 4HAZA 2CHVA 3KQNA 1OH8A 5LPNA 4FMBB 2XXAB 4P32A 4YMVA 1HTWA 2JATA 8OHMA 4G5QA 5FFMA 1FP7A 1GITA 4OJQA 4A6XA 2X1VA 3G82C 2EU8A 2BKEA 5CM8B 2ZJOA 2HCBA 4IW3B 4Z8YA 1XMJA 2Z6VA 1NSTA 3BK7A 4XD7D 3RAPR 1ZVQA 1XTSA 2WZQA 1OXXK 3MGCA 2PX0A 4C0JA 3K09C 4G3XA 1RJ9A 5KPDA 3VHLB 3CBQA 3GEIA 1TU3A 3M4YA 4BFWA 2O8DA 2REOA 2KI5A 2OESA 4MRNA 3V00A 2AD5A 4R2IA 3L0OA 4HB3A 4DRZA 1WMSA 2IA5A 3VR1A 4MRVA 4BFSA 1BKDR 4RCYA 2D2EA 2JASA 3RANA 1XCGB 1NBMD 4MDEA
chains in the Genus database with same CATH superfamily
3D9QX 4BAUA 1LDGA 5AM4A 2BFPA 4XH9B 3UBTA 2W2NA 4OX9Y 4P4TA 3E9RA 4XR4A 2BGTA 4R7GA 3ZI7A 4AIIA 1T0HB 1W19A 1L1EA 2MIIA 4HAXA 3O9ZA 3ER9A 5LSAA 2ISSD 4DLPA 3CVOA 2OXEA 2Q7OE 4EI7A 3DOEA 4JLKA 2OILA 2P5TB 2PH3A 1Y5NA 1J24A 2GJ8A 2PRZA 2X9VA 4ZCPA 1E7YA 3OSUA 5F2EA 1XPOA 3I0NA 4R9UC 1NI3A 4ZODA 2F55A 2UUBB 3OM1A 1L5MA 1KVUA 4WOCA 4MVJE 2GUGA 2DUWA 1FJXA 1JSXA 2L19A 3BA1A 2QWXA 5FB3A 3GP8A 4NARA 4PONA 4P2BA 1L3CA 4XUEA 3VH3A 3ITKA 2QEQA 4QGBA 3KOYA 3ZWCA 1W75A 5GVSA 4A2WA 4RK0A 4DCVA 1T34A 3D1VA 2CNLA 4YBRA 1YJBA 1QGYA 3T1HB 1C9YA 3DBHA 2V1XA 3AETA 3IA7A 3SC2A 4JT9A 3QPVA 3DV0B 3TNDA 2W8BB 1SOWA 4OHFA 4TMKA 2ZBFA 1OV6A 3BORA 4ZT7A 5HS6A 3SLGA 4E09A 4K7JA 4C4OA 3DPSA 5HF8A 2PMEA 3X1DA 4MEJA 1JG7A 1NPTO 3VTZA 5A5GA 1J1ZA 2R6HA 3VJMA 2ZIXA 1HNNA 3FHOA 3DTVB 4MCIA 3CTPA 4HQLA 5TQ2A 4W5QA 1K98A 3QBDA 4MGZR 4PYNA 2OCDA 3RYFB 2G25A 1UWVA 3PGVA 3SJUA 5JR3A 1MF7A 1OWMA 4DIOA 2V74B 4YX9A 3U31A 1PGQA 1XX6A 1F9EA 4GS5A 5EWLB 2Q3FA 2I4OA 1H94A 4YRAA 2GKSA 4G67A 1G8SA 2WU1A 3WKEA 1GTMA 4G0MA 2P4QA 1TM1E 1JT2A 1W5BA 2FFAA 3KPWA 2IKSA 2HREA 4YCAA 2G36A 4CCYA 5JH7A 2AJCA 2EDAA 4ZVPA 1O5OA 4UULA 2EFDB 3HRIA 3WLPA 3JQ9A 2LNDA 1HRKA 4TZTA 5IN4A 3IDAA 2W4IA 1GPNA 3V2UA 4LKRA 3HABA 3CH4B 3OAAD 4MWEA 3C3DA 4PSUA 3V1KA 4B4OA 3X2EA 2ZB2A 1OPRA 1FS4A 1T0UA 4QVGA 3RFTA 3CV3A 3DEKA 1IMJA 2KW5A 1G5TA 3CW9A 3LPCA 4YMWA 4EYSA 3HEAA 3KTAB 1BCSA 1E4YA 1QE3A 2XQJA 1EFCA 3N0VA 3UC9A 5GZ1A 2QN8A 2NZYA 4DJAA 5DWVA 3IALA 3MJCA 1JKMA 1KDRA 2OORC 3DE1X 3L05A 4ERXA 5AESA 1J0AA 4I8IA 4MWCA 1CRQA 2WG1A 4OKNA 3C7KA 3NHRA 3GVCA 1JLRA 1QH1A 3LD9A 4W6ZA 5FA6A 5G1PA 5JALA 3AVWA 1IOZA 1LC3A 2DFPA 2O2GA 1Q1GA 1ZCAA 3KD2A 2ZJZA 3KSRA 5EP1A 1AC5A 3RO7A 3G2LA 4EHFA 5JY6A 4QJBA 1IUOA 2H1SA 3NBXX 4I4NA 5ERGB 3C6MA 2V7QA 3A9TA 3Q7IA 4C21A 2O0MA 3QBVA 4X20A 3R7WA 4QOGA 1O89A 2CVOA 4LOHA 3IUMA 4CUZA 3JQ9C 1CY2A 2RHHA 1DAIA 2PUAA 3WNVA 3PFIA 2WE8A 4P3PA 4J1TA 2PR7A 5TR9A 5CB4A 3N28A 5LQAA 4D6YA 2CSXA 3TTSA 3EBLA 4JI8B 2HRCA 1ZN2A 2F3RA 1V35A 2DB3A 4A73A 1G5PA 4Q3CA 4YT5A 1J99A 4CKWB 2VK4A 3MINB 4EY5A 3E9NA 1D8AA 4KO4S 3BH0A 3CUKA 4C6TA 4DRYA 3EN0A 3P20A 4EGSA 4P5EA 1UINA 1OXKB 2RK4A 3FPKA 3PRKE 4KLRA 4B5LA 5IUNC 4PXYA 4EATA 4ZCSA 4E03A 5C5DA 3SDSA 4QICA 4LWZA 2CZQA 4F1KA 2G0NA 4IDCA 1AHHA 2X7XA 4X93A 2ODNA 1GDDA 2EHDA 4BNKA 1MRNA 3ENVA 2H1VA 4G2NA 2RGNA 3UXMA 5HMLA 1I2MA 2A5GA 3BTSA 4R16A 3EVBA 3DA8A 2WSMA 3ZE9A 1YQEA 2HDWA 3SXJA 5M7EA 2CE2X 1SKQA 5C1BA 1LS1A 3SDBA 3AJEA 5AOBA 5EJEA 3F73A 4R3WA 5CU7A 4GI2A 3UHOA 3NC1C 3JVEA 4LHSA 1E2LA 4GVXA 1IE3A 1L8QA 4D41A 3GFGA 4ABYA 4BQNA 2IWRA 3DBHB 3AETB 3SC2B 2IPMA 1R50A 1N8NA 3ORSA 2IEIA 4XDYA 2XSZD 1A5SB 3W9UA 1OBHA 3U7EB 1WQ3A 1KHHA 2X1LA 4EYGA 1G5QA 4OJNA 4UXJA 1NVVQ 1IBMB 1U04A 4BP1A 4UU1A 4B31A 4D2IA 1CUYA 2HIGA 2ZIXB 1Z0UA 1DC5A 1R8QA 3GBSA 2C9ZA 3D6UA 4M83A 4H0FA 2B1RA 3Q10A 1LLCA 3P9SA 3DHVA 5IZCA 4QVIA 1N5MA 3HO1A 3CJQA 1F3OA 4B3GA 1XCOA 5TGZA 4QT4A 1SFRA 3HP1A 3N6RA 4WE3A 3CF4A 3MCVA 5B58T 1ZICA 3H75A 4NCAA 4I50A 4MQBA 1O6CA 4ZALA 1RYNA 1U7HA 2DG2A 2P65A 1ZU4A 3LP8A 4OQFA 4QYIA 5KNBH 5FO0A 2GCGA 1P0PA 1R0ZA 1K88A 1RRVA 2DULA 1S89A 2X2PA 4CCYB 1SVKA 5DBHX 2H8GA 2JB9A 1N6LA 1E6EA 3AB3A 1CUVA 5ALXA 1JJIA 2PD6A 2BOVA 4PBSA 5LNK1 3HUUA 4KXWA 3ZHOA 2GT1A 3C45A 5C4MA 4MA5A 2YWDA 8AT1A 1RRGA 4ASUA 1JSZA 1PBNA 2GK3A 4L5BA 3C48A 4U7WA 5B6JA 1E0KA 1N6PA 3MILA 1Z4QA 3ZHCA 1KR5A 3STHA 3LLMA 3WGVA 1DRKA 4MKZA 4QUEA 1QHFA 4Z54A 2I33A 3GA0A 3G7SA 2EKZA 4GBMA 1LRJA 3K9FC 3EF0A 3QZUA 1K8RA 2Q41A 2GCPA 1R6BX 1T0BA 4EYOA 5IZCC 1Y7HA 3NH6A 4DR4B 1JA1A 1L7AA 5KCMA 1KQFA 1J2YA 2XBUA 4EEKA 3JQAA 2MINA 1I36A 4MGYR 2CL5A 1QH1B 4F5EA 4OX9B 3PDHA 1CULC 4G5XA 1VBKA 4IOJA 5TY0A 1T4CA 2QZ9A 4OA5A 4UHCA 1RQRA 2OXTA 4F38A 4ZJZA 3AHCA 1T3TA 1SUEA 1J8DA 4JL6A 2QUAA 4DAEA 1GILA 1WO8A 4MRPA 5AICA 4Y2SA 1P6UA 5LQUA 3BYZA 3LBYA 5ENZA 3LOUA 1ST3A 2IEBA 2OFWA 3U4AA 2FHSA 4HRYA 4FOLA 2D4AA 3QF7A 3VVBA 1DX4A 1PQPA 1MVLA 2KPOA 2WF8A 3RS9A 5KQGA 3HQ4O 1LPMA 2G83A 4MICA 2ECKA 4XLLA 3RRBA 2BMEA 2F67A 2WF7A 1BXRB 3M6UA 4MGHA 2CXXA 3R75A 2GAIA 2QQEA 2VBIA 3A25A 2GPJA 1XYYA 5EE9A 4C6TB 1OHHD 3HB1A 3U9TA 4CEJB 3UMGA 1ORHA 3LT0A 4XUDA 2FW8A 1JBKA 1HE2A 4KREA 1X1SA 4OFWA 5AKEA 3ZU3A 2IU3A 3R6WA 4OHMA 5IS2A 1ZUHA 4OKIA 2YUTA 2K5UA 4JWKA 4KJZA 1NQ5A 1WMAA 3SVTA 3ZK9A 3K1TA 1UQUA 1Y4ZA 4W7IA 2C9BA 2WRZA 4ENSA 1I94B 1J21A 1YDFA 2QNIA 1M3SA 2BFCB 4Y2TA 4CZ2A 4DNFA 5GM2A 4PFQA 4DMHA 3BXFA 3DAYA 2EZ4A 1L1QA 2XD4A 1VRVA 3AVQA 1W4CA 1W2WB 2EW1A 2C4MA 3KOXA 1CR4A 3B52X 4CQJA 1SBCA 3CLTD 3DEAA 2ZWIA 4DCCA 4CQMA 3ZJYA 3R23A 5I4CA 3TTUA 1U8UA 2NLOA 3L7BA 4G6ZA 4HN9A 3KJGA 2JIRA 2ZROA 3F49S 3EQ9A 2JLVA 4KI7A 2I2AA 1HKHA 4JI2B 2QHXA 2CKMA 3ZY4A 3WAKA 5KTRA 3QLVA 3EPRA 4HXFB 2HMUA 5K1ZA 3MT7A 4C0HA 1EGVB 2X5NA 1Y81A 4HGOA 5KNLA 4DV0B 2YBEA 3KKZA 1VSQA 3ZLBA 2V96A 2WWWA 5MN5A 3FFAA 3RASA 4O4JA 4F4FA 2PUBA 2YMMA 3GEBA 4ETNA 1L5YA 2BGWA 3JR7A 5C7IO 4ABTA 2GBIA 4WOBA 5T3YA 3GNTA 5B55A 2CV2A 1FU8A 1W6RA 5AMXA 3HA5A 5TEVA 2NV0A 1TCUA 2WNHA 4KO3S 3O21A 5LLSA 1UK9A 2CWDA 3NETA 4E51A 1KA9H 2HV8A 2VOEA 5G0VA 2G09A 2X8WA 3FHCB 2AWNA 3UOGA 3H4IA 3WL6A 2BEVA 3RVSA 3A6ZA 3FPHA 2OFPA 2Q6IA 2IYNA 3IIJA 4QRDA 5DFAA 4QREA 4O6VA 1DQZA 2B8JA 2O1XA 5DSTA 3FSEA 4DTCA 1GNRA 3IMEA 1PN3A 2FQWA 3DAFA 2XMGA 3OX3A 3ZNNA 1KKLA 4QLBA 3ZNQA 4YROA 3OPQA 4J49A 2GN9A 1II8B 2WA2A 3AKYA 3KZXA 3LC1O 5CYOA 2HQ1A 5DHAA 2WSYB 3FNIA 3ZLUA 1CVRA 2HMVA 2NYAA 3IX7A 2OD9A 4AZ0B 3DWEX 5M29A 4K03A 3UW1A 3ND9A 3JQAB 2W6ID 3TW8A 5E1OA 3JZFA 2QL7A 3JX9A 4RLSA 3HDQA 4BDTA 4XFKA 3NRJA 5AWFC 3EA0A 3IT2A 4JC0A 4KK4A 5B4VA 1M9NA 1WCIB 4HLDA 3DSRA 3NKLA 3GLFB 3PZBA 1XLTA 1P8AA 1T4CB 1YL5A 1L3IA 4HVAA 4TROA 3PQDA 5L4LA 3UFXB 2EXXA 3G5AA 4ZQBA 2BM1A 3M5PA 4D9KA 1W1WA 1WE2A 1Z29A 2ZAGA 2ZYGA 3LT2A 3GEGA 5JAQA 4B0PA 4R0MA 5JRZA 4EAAA 2BC9A 2MT9A 1FL9A 4WBSA 1LH0A 3FNEA 4RZXA 4C78A 1W29A 2PH5A 2XWJI 4K9PA 4ZVOA 2G40A 3HNPA 3FW1A 1KOGA 1CTQA 4NCHA 1ZBQA 2AMLA 1CCWA 2OK8A 4HZUB 4JIMA 3NX4A 3WYCA 3C24A 1M2VA 2BEUA 5B1YA 4KPFC 3CINA 1BGWA 3ECAA 5IASA 2NTVA 2CLMB 3K5PA 3TX2A 1I3NA 3TTTA 2C58A 4FC7A 3ZHZA 4P83A 3EXEB 2GBCA 2PCLA 4TWRA 3ASZA 1R15A 5JATA 2ZREA 2HWUA 2IV2X 3OJ0A 3JWGA 4F2PA 1XLTC 3D8HA 4NV0A 3QXJA 1USKA 1FF9A 2BHSA 1UUFA 1AA6A 4RLFA 2ATVA 5EMJA 1PUXA 2K87A 3L1HA 4F4CA 1JA0A 1SZDA 5TQVA 3LY8A 4P4NA 1JFFB 4YIHA 3DEFA 3EDCA 3V4VB 3Q72A 2OLKA 3MELA 4Q1AA 4S24A 5U9CA 4J94A 1GQ2A 2ZYSA 3LOPA 4R9SA 3LRPA 3LXMA 3N0WA 4K3VA 4D82A 5LWHA 1WUKS 2XVYA 1Q22A 2Q1TA 4DLZA 4C20A 3NBFA 5I9SA 1Q95A 2RAPA 4RCZA 5CJ2A 1OLSA 3O1IC 1S2IA 3FYTA 4H6XA 4KFUA 1ML3A 2AE2A 4FZ3A 4RJ2A 1IG3A 4BO4A 3TOXA 7YASA 5TMPA 4CLXA 2KQUA 3TYXA 1V2GA 4CCWA 3EULA 1JHQA 1RYHA 3GRUA 4IX9A 2C7OA 1IBLB 1JBEA 2IVFA 3GN2A 1ADBA 1NBMA 4V0OA 2IUTA 1V5FA 3A3KA 3F9IA 2BIFA 3IP9A 4HAUA 3BAFA 1IVSA 2A4MA 3TCKA 1J90A 4O4JB 2EG5A 3HJFA 1TFRA 3VYTB 1L5SA 4EVQA 2JFPA 1KSHA 1FE8A 1MB0A 1O7JA 3OO0A 3UHJA 3VU3A 3CUTA 1B15A 1QFMA 1YHZA 2HO4A 2JJQA 3NHKA 2Y05A 3B6ZA 3AXSA 4MPPA 1B00A 4DEYA 4QOHA 1UOQA 4M0FA 1DKOA 4P6VF 5J5AA 1AMOA 1I7SB 5ALEA 1F20A 2DZDA 3FF4A 3JS5A 2JGIA 1U8EA 1DBIA 3HGMA 1EBUA 1ZIOA 2RH9B 1V7PC 3O93A 2WMDA 3QX8A 3DL2A 3R44A 4FU0A 4H08A 4JQSA 4UU0A 4UPEA 3U39A 1M83A 2IYTA 1TM4E 4MVXA 4WA7A 4FFVA 3R7SA 1F5NA 1JS1X 2YUIA 3M8KA 3ENNA 3PGKA 3NRCA 2CLOB 2VP0A 5TARA 1PEKE 1J39A 4FR2A 2H06A 3BC1A 4MW2A 3GT4A 5LBTA 4F3KA 1Z0FA 3ZIAA 3NDBB 3GUUA 3COVA 4NVRA 4K9MA 1R18A 4YCLA 3EC2A 1WB5A 5EQFA 4DSZA 5ICGA 4H3SA 1F2DA 2V7PA 2AKAB 3ZDXB 1US8B 1CG6A 4PC3A 1Y8RA 2R8OA 1D6JA 3IEKA 3ONVA 1TM5E 4X9XA 1QK5A 3VJLA 7REQA 4LF6B 2SCUA 4NC9A 2J6BA 3DOIA 3QG1A 1M1NA 3C7DB 1W4AA 1IUNA 1L5RA 1Y3DE 3DAHA 1MPTA 3OF5A 4LIPD 5CGQB 4RIHA 3ZDCA 1QIDA 2P75A 3ZBUA 4B7XA 2QGNA 2O2SA 2F3UA 1VI5A 4CCSA 1G20B 3NIFB 2XCQA 4GL2A 2BLNA 3GZ4A 1PJ2A 1TCVA 3QWFA 4L78A 4F9TA 2VF7A 5EGSA 1Q15A 3R5SA 4DV7B 3P1JA 3V8EA 1OAAA 4R2JA 4Q6WA 2R8PA 1WDLA 2H11A 1RJDA 3ZE0B 1YZUA 4B46A 5K0LA 2ONZA 2W7TA 3M6VA 1FTNA 3WLRA 1NW5A 5FPYA 4EKYA 1F8XA 3RVRA 1KRHA 3NAMA 5ALNA 4O25A 4AJPA 4CHGA 5BV0A 2AOVA 3CXRA 1J5EB 1ETUA 2LV8A 3S5UA 2V6IA 2O7QA 1IJKA 1QGUA 3F78A 3ZDZB 4UU7A 1DXOA 1YBHA 2PQMA 13PKA 4GWKA 1YVEI 2VRCD 2R751 1XVTA 3ZX5A 3IEPA 2HF8A 4H7EA 3Q5EA 4XGIA 2REBA 2Y77A 3KYIB 1TW3A 4BV8A 4C22A 1H8HD 2EKDA 4ARIA 3IXMA 4KIGA 1P45A 1UKZA 2XWSA 1DOHA 4XM2A 5KJEA 4JP2A 3NC0C 5IULC 3ZDBA 2YNMD 1DQYA 1EGHA 1GR0A 1SC3A 2PT5A 2GYVA 1IBSA 1PNTA 3LRXA 2NZJA 2I76A 1XZGA 3LQYA 4X8HA 3WAGA 2G17A 3KB1A 4WBXC 3HM9A 1W35A 2HF7A 1OFVA 5ALRA 3JRWA 5IFKA 2DPMA 3TBKA 1NW4A 2YR0A 1TTTA 2Q29A 3HR7A 1UPFA 2VXBA 4GWGA 1AKYA 2WLTA 1OLSB 3RGGA 4MUHA 4REMA 5F9FA 1QIKA 1P3DA 2B4QA 4PG7A 1HEUA 4OHWA 3UW3A 4LHXA 2C84A 4RBNA 4UTNA 1GPJA 1NVAA 5HM8A 2ZI9A 2F9MA 3WGIA 4BE9A 1YRWA 3PUZA 4AURA 1V8BA 5FBVB 4PYKA 5BW5A 3AKZA 3I9NA 2IU0A 5TSDA 1USIA 1RWPA 5DLEA 4B4KA 4W5NA 3OPXA 4QPCA 1DKUA 1OSNA 3IEIA 3MWJA 4H7KA 3GCXA 4B17A 4BXOA 1LZLA 2BISA 4KQ2A 4CI9A 1H2ZA 3B1JA 2JIQA 4IGAA 3REOA 3QKTA 4GAEA 4YRBA 1U1GA 3KHUA 4FDUA 3UWDA 1JRLA 1TT7A 3QXXA 2IZOA 5BW6B 1B41A 1JWBB 1DUSA 1M66A 3GYBA 4DV3B 3E4DA 2OHFA 1GPLA 5LUBA 3RS4A 1JI0A 1H6AA 1EPUA 2BCEA 3OPYI 2O0HA 1XE3A 5DX8A 4WEOA 3GVIA 3LC0A 4FGWA 5IC5A 3V3KA 4ND5A 5F5LA 5JUWA 2FFJA 1O5IA 1WF3A 5AI9A 2II6A 3C6KA 5K45A 2JFQA 2HUPA 1UBCA 4HRVA 2CJYA 2CBZA 3IR5A 1X2BA 2G08A 2O07A 1LRLA 1UM9A 4ENVA 3GAAA 4WCVA 2P2NA 1MJ5A 1CUGA 5EKXA 4JBYA 2QM3A 3HVJA 4Y9UA 1ZXLA 3S1AA 5I7OA 4MYUA 1NYLA 5D5HA 2YS7A 5BYKA 1QK4A 3SOZA 1PJSA 2ZQ5A 2Q9CA 4KVZA 5EQDA 1I8TA 1ZM9A 1WW8A 2G7MC 2SCUB 1I3LA 1KH2A 1CUJA 4QQKA 5GVRA 2XHEA 3VUFA 4HJRA 4L4UA 4WLVA 2ZB4A 2R66A 1ULAA 3IO5A 4LPSA 2VTVA 4J0HA 4Y2GA 2W0SA 3U6KA 1YZYA 1TJ3A 3JASA 2C42A 4WZAE 4A0GA 3EIWA 3RBVA 1LPNA 2KE5A 4IIYA 4DRXA 3ZJ5A 2VWPA 4U2BA 3SHTA 3V6LA 4MHTA 2WJHA 1LQ2A 2C9YA 3MBIA 1O9GA 4CL3A 3SKYA 3GLIA 4JYZA 4FC6A 4MVJD 2ZR8A 1XXHA 4KQKA 5AVKA 3TZBA 3W3ZB 3I32A 4FN5A 4H18A 3BB3A 1W5FA 1P9OA 4B6FA 4H6VA 1XAJA 1ZUNA 3HLKA 3LNTA 4G0VA 4QUBA 1JI3A 3ZX4A 1EE2A 4RY8A 1F0NA 4G4SO 2VAPA 2ZS9A 4UZSA 3H1PA 1CJUC 3EJ6A 3KOWA 2XCTB 2A8YA 3CA8A 4LC0A 4D80A 3RHFA 5J58A 2QZ4A 3LUAA 1RM5A 1ZMOA 3WIVA 1RI2A 2AQ8A 3ZI4A 1E20A 4D3XA 3G23A 5T7BA 1EX7A 3B5EA 4MWTA 4B48A 3DO8A 1SOVA 1RWOA 3WK9A 2Y1FA 1N0HA 1RAAA 3BGSA 4M37A 2Z95A 2ETXA 1CP3A 5H5JA 3R0IA 4BEBA 1RU3A 2AOUA 3HKEB 2YXBA 4B3FX 2LDBA 3T7DA 2FJUA 5D1HA 1ZH8A 4DN6A 3OJEA 3FPBA 3NB0A 3OJOA 4PNEA 2Z04A 2PGAA 5IVDA 5BWNA 4FNOA 1WV1A 3GJTA 3TNJA 1PR1A 4DLSA 3ASYA 1IY0A 1P62B 1X8JA 4MR9A 4BUZA 1VJRA 3D4IA 5CGZA 2JFZA 2Q7DA 1WEKA 1ZO8A 4B43A 1FUKA 1HZJA 1VMIA 2YKGA 1G7RA 4D42A 5EZYB 1AJEA 3IMCA 3CMMA 1NQTA 3ANMA 2BH9A 2HWYA 3OJLA 3NIGB 3KBOA 1FVHA 1IBKB 1Q92A 3AX6A 4AUKA 1I33A 5C5CA 2QN7A 2XGOA 4E7OA 1BKSB 4MDYA 1GA4A 3I9V1 1VTKA 3IQDB 2CSUA 3OT1A 3RUFA 2RGYA 1DGQA 4AF6A 2R86A 3CZ9A 4U4AA 1GM5A 2Z6AA 1U8ZA 1VYHA 4GOXA 5L3QA 2GI4A 2C03A 3MYRA 1A97A 4RJLA 3KYDB 5F77A 1G2QA 3VAAA 4WH0A 5DM4A 2HA3A 2Y0BA 2ANBA 2GQ0A 1QAMA 2KMLA 1AUOA 4TLEA 4D3SA 4ENPA 4BXOB 3KQYA 3MWEB 1ABBA 5J4LA 1JHDA 4IMRA 1CNMA 4MV3A 4G1BA 1I4TD 2PA3A 4EF6A 5CFNA 5IBRA 1A8SA 3ZWXA 1B0UA 3VR6D 5HZMA 2CLKB 1L7DA 4PXSA 3WK8A 3IQFA 3Q3CA 2B0JA 4RZQA 5CK4A 3GEEA 1M34A 2X0KA 3HA2A 3CVXA 1YACA 1FMLA 5DGDA 1IXZA 1LQUA 4RWEA 2O7SA 3KZNA 1Y9ZA 3CB4A 3O4JA 4K8RB 1DT5A 3BH7A 4UE3S 4UEWA 2Q6VA 4TWBA 4K0RA 2H7XA 1P39A 3A2NA 4F1JA 2PPLA 3QFFA 1TGVA 3GGCA 4G41A 5ECGC 3SIWA 5EKDA 4LDNA 4ZOLF 4ATNA 1QVRA 2J87A 5HKAA 3N2IA 2EFHB 5IVKA 3GB9A 4URHA 2FPGA 3MOGA 4PR0A 1AO0A 1FRQA 1YB6A 4ND6A 4ITVA 3OU7A 5ENVA 4PG5A 2H54A 2NO6A 4D3ZA 5C5EA 1VCHA 2PGDA 2R7AA 2BGRA 2UUCB 3M33A 3OEEA 3CX8A 2NTEA 3FNBA 3KZ1E 3L40A 3OE1A 3TQIA 1U3CA 3OOSA 3EZ9A 1E1QD 3HXOA 5CHYA 1DTWA 3TR0A 2NZWA 3EY9A 1VMDA 1MC5A 3BZBA 2QW0X 4JLWA 1KS2A 3RYCA 3P0FA 2AJTA 2EP7A 1XXHB 4G85A 1VLVA 5FHRA 4UM5A 4UUNA 3F3MA 3BMXA 2EZ9A 1YIOA 3LAWA 4KDEA 4RMGA 4ZA2A 2OWDA 1ZUNB 1JDUA 3KXLA 1QOZA 2PLNA 1T3LA 1E1MA 3QPUA 4UAJA 3ZNPA 3UCFA 1EGAA 3W7AA 2J0SA 3AHFA 3G8DA 1RXCA 2EW2A 4CDRA 1NRJB 5B2EA 3T34A 3GMTA 3CRNA 2YCBA 1D04A 1P8JA 4LECA 4LHZA 1DAFA 1U0RA 3CF0A 5B30A 2WP0A 2LXNA 3BB4A 1TF5A 4ZV4A 1HUQA 4YCJA 5I8PA 5JBNA 3DDHA 2WOJA 1JR6A 4XB1A 2AOUB 1KAHA 1O87A 4RKEA 4B9AA 5B36A 3I2HA 2IDZA 4LOJA 1SCKA 1RMQA 5JBQA 4X61A 2GZRA 2CNWD 4OQZA 2NYVA 3FIJA 2FZGA 4DCJA 1U7TA 2A5JA 2OVBA 3MJTA 3OQBA 4EJSA 2QAGB 3PICA 4BTLA 5H70A 1JR3E 4PVDA 2QENA 3X1MA 1A9SA 1T1GA 3CX6A 3RF7A 1NX6A 1QPBA 3RK0A 3E0XA 1YQXA 1CF2O 5CT6A 3LCVB 5KKAA 3RWOA 3MN1A 2CCKA 2ZXFA 2DYKA 4LJ8A 5CA1F 1YQUA 3MWFA 2XQKA 2VATA 1FFGA 4EZBA 1ND6A 4GMDA 2ZJ7A 1NDQA 3OFNA 5K3FA 3F8TA 3DLPX 3NO4A 3QVMA 1Q6ZA 5IH3A 3RS8A 3C15C 4M99A 2P91A 1I6KA 5JJIA 3AVUA 1ZOOA 1A2BA 4BNUA 1DCMA 2HB6A 4K05A 4JT2A 2F3TA 2IODA 3HBNA 5K7SA 4UTRA 1DP4A 1R4MA 2ADMA 3AF3A 1CZOA 3R5KA 2RI1A 1TO1E 3P0RA 4KWCA 1B73A 1QGAA 2I3DA 1SD2A 3C8ZA 2C07A 4HSEA 3QTLA 3RUIA 1XROA 2IHJA 1LD3A 4MV0A 4MVWA 3G6KA 1XMIA 4LZNA 1YNSA 4E12A 1TM3E 1NKTA 4Q9HA 2BD0A 5CDSA 1NG9A 2VYVD 4AK9A 1ZUD1 2Y99A 4J3NA 1KDTA 4S1PA 3T6KA 4E3WA 1M34B 5A04A 4PFSA 4B73A 5ICFA 1TQ2A 2OE2A 1JFSA 2IXEA 1SIBE 3ISJA 2NQ2C 2ZYHA 2IH5A 1F6BA 3VYRB 5LR6A 8LDHA 4HFRA 3TAHA 1VJDA 1T8SA 5BUSA 2RGRA 5A05A 2X8AA 4DLUA 5JVDB 3STTA 3U3OA 2ZIUB 4IIJF 3RBXA 3VRHA 4DR5B 3OIUA 2Y4NA 5DM60 3FF1A 1GTG1 2PZMA 2WWRA 2E7ZA 5KMGA 1CR2A 3IVMA 4KV7A 3UHAA 4R8MA 1T26A 2G28A 4A92A 2EX0A 1EUQA 3Q4GA 2YZ7A 4NYMR 3B1FA 2G6BA 2IBTA 3ILHA 1DFGA 2EERA 2FPGB 1AKTA 2MTBA 2FETA 4TKVA 2V4MA 1ENOA 1X6VA 2WUGA 5C18A 3KL2A 4MUJA 2RARA 2AR7A 1XFDA 1QYVA 2EX4A 1ACLA 3BDVA 2ESRA 3LDGA 4HC4A 4E31A 1S02A 1VKNA 5KINB 4EG1A 5FDFA 1E3EA 2NOAA 3G13A 4XYLA 5F9MA 4CEIA 1DTWB 2R1TA 4RCVA 2BGGA 2FKNA 5DLDA 1SVUA 4P0QB 2VAMA 1WB9A 3V42A 2DHDA 3E84A 5AUOB 3K2BA 1E2PA 1XIVA 2Y93A 3NONA 2RK3A 3TZEA 4AMVA 4JWTA 1BW9A 3I2JA 3LX5A 3L8GA 4O1IA 1N25A 3QV2A 1DAGA 1NLFA 2R6JA 3RSZA 1IM2A 1FZTA 1CY8A 3S44A 4ENRA 1NN0A 1PJAA 2ODPA 4OEHA 5HBGA 2HSDA 3RNLA 1E3SA 2VC2B 1MR3F 2HI0A 1BYUA 1YGPA 2P9ZA 4LX0A 5FO1A 5JQWA 4RQBA 5DN6D 1V4NA 3MJVA 5A0FA 3AR6A 3H1GA 3GDFA 1QKJA 3LFTA 4B71A 3THRA 4L0CA 4YRLA 3WE7A 1AXEA 3TB6A 1XV5A 1OTHA 5GONA 4NFSA 4ZT4A 4I81A 1ZNWA 1KEWA 3DEZA 3HVRA 3R3UA 4DIFA 2VDRB 4QFMA 2PYDA 2XKAA 4EJSB 1ESMA 1EFAA 2Z5LA 1KOFA 4JR1A 4PV7A 1Z6GA 5ALQA 3WQSB 3BCHA 4KUGA 1OFHA 2PX3A 1V5IA 1PR6A 3FDXA 2I62A 4F85A 3EVNA 2J30A 5L3SA 1Y42X 3NOOA 1FFCA 1HNXB 1T2AA 3MIZA 4XEUA 5CW1A 3H2IA 4B79A 1KRXA 3GPLA 1TIPA 2MDTA 4EPYA 4R31A 3IPCA 1KFEB 1MNAA 3WBJA 1JEEA 2NACA 1BD3A 1HDYA 2GSDA 1BIFA 2PZLA 1NURA 1VSUA 5K3FB 3UGJA 3T9AA 3O8DA 1P72A 2B83A 1T6YA 2J9RA 4YO8A 3D4PA 1LLDA 2HSWA 5ALIA 1GNPA 3FGPA 2QUBA 3F4KA 3I09A 4IHJF 3HWSA 5C34B 3UMMA 3COPA 3IVAA 1GPUA 4DYHA 5C3UA 3P32A 2XMRA 1R4MB 4ND2A 2P9TA 4U7FA 4N0PA 1RIIA 5HGJA 1J56A 4M1MA 1ZESA 5FBWB 5GOTA 1WVMA 2AZTA 3DD5A 1QU3A 1XPUA 4URUR 4PAQA 3HC7A 4MW5A 3PRHA 4QT0A 3VX4A 1PR2A 2AI2A 1IZZA 4N39A 3SC4A 1OF1A 1JDBB 2QJFA 2GJAA 2Q2QA 5BR8B 3NGLA 3MAJA 3W06A 4BJ6A 4OBBA 2FAXA 3NWBA 2C3PA 2UYHA 1JLKA 3OMWA 5CK5A 5JH7F 3AEUA 2AYZA 4LQCA 4FX2A 3KYJB 1II9A 2ATEA 2WWIA 2Y1GA 3TD9A 3AR8A 1FTWA 1TE2A 3MGGA 2VLIA 1LFAA 4AROA 1RPTA 3AZPA 2NU7A 5BSRA 1TGYA 1K92A 3E2IA 1NBOA 1QTIA 3PTZA 4GP9A 3R6LA 1T5BA 5A7HA 3OF2A 3UAYA 4R1TA 2VBGA 4KOEC 5EHZA 3ILSA 4OXNA 5KMGB 4JS0A 3FWZA 4LJRA 3QKUA 1RAEA 1JUDA 1IUKA 2XUQA 2WFAA 5C81A 821PA 5GOZA 1JYSA 2PE5A 1XCLA 3M1YA 2VYNA 2X76A 3OLCX 4MV5A 2O14A 1I1NA 2OHOA 1Q5PA 2V7GA 3T9DA 4WLOA 3KRTA 3V6MA 1UC9A 2WM9B 2NNLD 3OIYA 5KTSA 3ESCA 3OKAA 1BMFD 2R1TB 1QB7A 2C29D 5EE1A 1ZINA 1OIWA 5JDIC 1GZSA 4FW8A 3LDAA 3X2FA 1MENA 3ZE2B 3JPWA 2C3UA 3MYYA 4JBGA 4AM8A 1LBHA 2JZNA 3PUXA 2D5IA 4TQAA 2CWWA 1SH7A 2N46A 2NSLA 3D02A 2YYSA 4B9EA 4BZWA 1PL0A 1XZNA 1YTLA 2QAIA 3E1GA 4TL8A 5J40A 4NS1A 2OGTA 1JDZA 3MA0A 5E1DA 5DKFA 2DT8A 5DP2A 5TIIA 1N0WA 5G40A 1ZQ1A 3BMCA 4HFJA 5JCJA 3U19A 2DTDA 4P7FA 2JIZD 3AY0A 2W70A 1DXQA 4RKQA 5KYTA 3D2AA 1EA7A 4RYDA 1NRXA 1RM3A 4LFBB 1E7MA 1BRMA 2O50A 1OI2A 3E3AA 1P7WA 1B93A 4PFKA 4RX1A 1QIIA 1X87A 5L3RA 3LUJA 2HDNB 3BERA 2P5SA 1OQAA 2I1VB 4PICA 4G65A 2ODQA 1UBSB 5FTJA 1RQLA 1X2EA 3NHZA 3WGUA 4DV4B 1EWYA 2BHLA 3HRKA 2WIJA 3AEZA 3WL5A 4B84A 5ITZB 3CR3C 3GAMA 1VJ1A 1SHKA 2PFKA 3SYTA 3ABRB 4OHVA 3UMJA 5AVQA 1DG1G 3DT8A 4TWZA 2JI4A 3K92A 1M1YA 2IZ1A 1LTHR 2VDMB 4PQFA 4KR2A 5ALVA 4HLNA 4UEQA 5L3SB 4IV5A 2ZB3A 3RT7A 3V8MA 4ZANA 7ABPA 2C83A 1GU0A 3M4JA 1JQ3A 3KEFA 4Q00A 1L5KA 3DVSX 4ER6A 5L9AA 5A4FS 2VDOB 1YUMA 4NBLA 4E22A 3N59A 3ED1A 4W1QA 5LB4A 4DVGA 1N2SA 3DZFA 2JFGA 4P4LA 3LU1A 4XOIA 2C8VA 1LNSA 2AJLI 3CS3A 3L8YA 4BVBA 1QG6A 1G19A 4EW1A 4MV1A 4JX8A 2RHRA 4QRIA 5F73A 3I9FA 4WD3A 4BZPA 3R20A 2O06A 3ZVKA 2ACVA 1SVSA 3EAQA 3LHFA 3OE5A 5LQJA 4TSKA 4FYKA 4EO9A 3BFKA 4DB2A 4DWJA 4WEQA 4QBHA 4QIHA 3A0RB 3PC2A 4I50F 3T5CA 3M4ZA 2Z4TA 3TL3A 4GM0A 1G38A 2PX8A 2QRNA 1TW2A 3IJEB 4MQ5A 1JBQA 1NT2A 1V9SA 3LT4A 5JPIA 4B8YA 4EEZA 5H81A 3NIBA 1GG5A 3KM0A 3KWJA 4WAUA 2AYYA 2A0XA 3OCXA 4D0GA 3AL3A 1W93A 2E2WA 3AEUB 2Q28A 5IVIA 1JXMA 4XYMA 1SOUA 1F38A 3O1JC 4ND8A 3V7YA 3ZYZA 2WPNA 4MSUA 3T3OA 1Z75A 3ZXUB 4IKPA 4LSGA 2HRRA 4LI3X 3HWWA 3ORRA 2G9RA 3RE1A 2JJ1D 3CZRA 4RVHA 2DWUA 5E8RA 2GCEA 4DIDA 1GAWA 3ZDRA 3NP9A 1G3IA 2YV2A 2E1PA 1CUFA 1MP0A 4UD2A 3AF1A 5AFSA 1RXVA 2ZBVA 2DAPA 3NAQA 1K2VN 1P7YA 3AIKA 1DIRA 5JV5A 3HJTA 4JP3A 1R5BA 4AJNA 2AN9A 2WABA 3D81A 4YP0A 2ACKA 2V6BA 4A23A 1N9GA 5BVHA 2IEAA 4Z4QA 2J33A 1AGPA 3AEXA 1WMEA 2IYQA 1CERA 5ENDA 5JMTA 2HIMA 4TS1A 4G5OA 5FULA 1SM4A 4V38A 3T1VA 5SZIA 4B8ZA 4EB3A 1L5QA 3PHBE 4OU4A 4PVCA 3I76A 1MFZA 4ZI5A 1LK5A 1GPBA 2LDXA 1ZONA 2PKXA 3E1SA 4B3MB 2GH1A 5J23A 1CEEA 3O0TA 1IBRA 1TU4A 4YCCA 3EY4A 4WGFA 5ITWA 1LC0A 1IYZA 4UNNA 3E5MA 3KLNA 4RFVA 1U3FA 1YJ8A 2JRCA 3EVGA 4I2NA 3NXSA 5ALJA 2R6DA 3AUKA 3ETJA 3I42A 4BE4A 4IIUA 2YWFA 1DU4A 1R8XA 4FILA 4PGGA 4MV8A 2RGBA