4EPVA

Discovery of small molecules that bind to k-ras and inhibit sos-mediated activation
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title Discovery of Small Molecules that Bind to K-Ras and Inhibit Sos-Mediated Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 64
structure length 170
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4epvA00
4MDFA 1PUJA 1QHNA 3WMEA 3M4YA 1KJYA 3Q7PA 3QNUA 5BN4A 3TUZC 3I4LA 2GNOA 3OIUA 1N5KA 2GRJA 4FW9A 2VHQA 2QSZA 3EIHA 4B74A 1HA3A 4QHSA 1QHIA 3TH5A 2QE7D 2VBCA 2JLVA 4Q4AA 5GJVC 5CIWA 1JQLB 3BH7A 4BLQA 2BCJQ 2C77A 4C3ZA 2GTPA 3A6PC 1PJRA 2QAGB 4KFTA 2QSYA 2ERXA 4LHVA 5G3YA 5DSZA 3OEEA 1SKQA 2Z6VA 3NHBA 4CZ2A 3UXMA 4Q18A 3AF2A 3RNLA 2AFIE 2SHKA 1N3BA 4E5UA 4MYCA 1NBMA 3X1YA 2FPKA 2FU5C 2ZI3A 1P2TA 2HXYA 2PLRA 2ONJA 2G77B 3Q72A 4P0TA 3AVVA 1YR6A 2JLYA 2YINC 2EFGA 1G7SA 2OHFA 1WF3A 2V9PA 4P4SB 5CB6A 4AYXA 3AUXA 5FTKA 3PVSA 4NBSA 4WZBE 1TL7C 1X8KA 2WVJA 1IN6A 1T5IA 4XD7D 1T9HA 3QOFA 2CK3D 2UZ3A 1XX6A 2PT7A 5BW8A 3VHLB 2W6ID 4WBSA 4R71A 2IBMA 5FPSA 4LJ8A 1F6BA 5B64A 2IHYA 2WOOA 1M2OB 1RRCA 1ZNXA 4ZDKA 1VIYA 1R8SA 3MLEA 2ZANA 4TL6A 3ZS9A 4PTLA 5EXPA 3GQBA 3LVRE 3KQHA 4ESVA 521PA 4GMDA 3R7WB 2BMFA 2XNDD 3VTKA 3FPAA 2VPPA 1YVDA 1E96A 4FXPA 3RS7A 3TK1A 3LNCA 3UMRA 1IN5A 1QHHB 5L3SA 1ZM9A 4R98A 3UANA 4C0BA 1E9BA 1P62B 4TZ6A 2ZTSA 3A37A 3U60B 1NN1A 4A6XA 4FCVA 2BOVA 2HT1A 2XJ9A 4L4UA 1D8TA 4RFVA 2RCNA 4EFLA 5CIQA 2O8BB 5EE5B 4E22A 1SVIA 4EJSC 2C04A 4WOPA 3GPLA 4YDSA 2FJUA 4Q9JA 4RFSA 2BWJA 3F5FA 5IF9A 1OFHA 4AG5A 1CRPA 4BLTA 5KSZA 1OXUA 4OHWA 1DE0A 1JR6A 1BH2A 1RJ9B 3KL4A 1JAHA 1E0SA 1ZNWA 4IEIA 5A0FA 5BN5A 4HDCA 4Q48A 5EP2A 2IL1A 3RC8A 1XNJA 5F3WB 1CR2A 4HUQB 1OKKD 2WWHA 2OV2A 3QKTA 1A82A 5KDLA 3O8RA 1NLFA 3UG7A 1KI9A 5CK5A 5GVRA 2ZRJA 3CF6R 2QAGA 3OIWA 1IQPA 3CUEF 2YOGA 4DLZA 2ORWA 5FPKA 1XFAA 5H68A 4HB0A 1TUEA 4MGKR 3MD0A 4PQFA 3EARA 1DAGA 2JASA 3GJ8A 2GBLC 1QVAA 1P2UA 2AK3A 4RZUA 5HE8A 3EPKA 5DN6D 1G291 1W2GA 3PCRB 2IYRA 4URUR 1NL3A 3IO5A 1OHHD 4L9SA 1TF2A 1EK0A 1S8FA 2AXNA 4EFNA 2Q6TA 4MA4A 1X8JA 1IN8A 4QGGA 3RHFA 3KQUA 2XZLA 1KMQA 1W0JA 1N0WA 3KJEA 4WA7A 4AIIA 3TSOA 1PLJA 4PX9A 1JR3E 1XMVA 2VSXA 3W5IA 1SZPA 2FFQA 1HV8A 4URWR 3P4YA 2IS2A 1BMFD 4XVRA 1Q12A 4FMCF 3X1DA 4D6PA 4LCBA 1GZSA 3QXHA 4I1OA 2DFLA 4QKQA 3GLGB 2RGDA 3PQCA 3KJIA 2CDNA 2GILA 4PSAA 2ZROA 2GXQA 5CJPA 1FQKA 3BFVA 2R8RA 2FGKA 4RD6A 3TJZA 4D4KA 4EJSB 2XGJA 3GEHA 3BB4A 1M7GA 2O0JA 5HCNA 3VFDA 1HT2E 5EP3A 2ZITA 3PFIA 2L0XA 1EWQA 3AB3A 3CNLA 5KSOA 1E2NA 1QHHA 1ZD1A 1OPXA 5EZ5A 2FSFA 1G21E 4W9MC 4FCWA 4TLAA 2J5XA 2QMHA 4Q9LA 3ECCA 5JI2E 5TY0A 1CR0A 4JVSB 4PQYA 3WNBA 1TTTA 5J47A 1PLLA 3U6BA 2ERYA 4RJLA 1G20E 1G5PA 2WJHA 4JLVA 1OB2A 1NP6A 1EGAA 2PCJA 1G17A 3AVXA 1G4UR 2O8BA 1HY3A 1G8HA 1G7TA 1G64A 3UG6A 1Z3IX 5EP4A 3IBYA 2NQ2C 3RS0A 1GP2A 3SI7A 4KFRA 1XCMA 2ZU6A 3B85A 3VR2A 1W0KA 1VCIA 1ZIPA 5FTLA 5FH9A 4DRZA 1QHXA 1T0HB 1KKMA 2VF8A 3QG5A 2A7QA 2ZRFA 4DLYA 1JQJC 2ODEA 4QBHA 1LVGA 2WWXA 4HUQA 2JLXA 3RC3A 1R5BA 1DEKA 1KMHA 1VTKA 4AI6A 3LBNA 3NXSA 1S4QA 2ZI9A 3NEJA 1G3QA 1MO4A 2A5GA 3K9NA 1FNNA 1RE0A 1E4VA 2J7PD 3Q5DA 2J46A 4LZZA 5FL3A 2V54A 5KHOC 2VHTA 2PH1A 2QNRA 4P4TA 2G1JA 4QGFA 3X1XA 4A1FA 4HDOB 3QBVA 1E98A 4A0FA 1TU4A 3KQKA 5DE3A 4KFSA 1S9DA 1VDZA 1KI1A 1X3SA 2VQSA 1Q1EA 4IDOA 1HH4A 3B82A 3SN6A 4YXWD 1KK1A 2VP9A 3K8YA 1XJQA 2BMEA 4RSGA 3P26A 4FMDF 4PPGA 2RB4A 3IHLA 2FG5A 3VKWA 4O3MA 1U99A 3ZYCA 4UQOA 5DIFA 3KZ1E 2YOHA 3K0CA 2QTFA 4DSOA 2FSHA 1GUAA 5JEDA 1W36D 2B92A 2HLDA 1Z83A 2IF2A 5IK2D 3VHXA 1GFIA 3BRWD 2JCSA 4PR0A 2A5DA 1ZUHA 2PBRA 3CH5A 4NH0A 5AUNB 1FOEB 5CYOA 2OLKA 4Z54A 2ORIA 3MWJA 2X2FA 1M6NA 2VIIA 3K09A 1MO6A 3GLGA 3I5XA 2A2ZA 2H1LA 2G0NA 5E4FA 2W6JA 2ECKA 5CK4A 5F98A 2DR3A 4FI3C 4PQRA 4DC9A 3LLUA 4QHYA 2QT1A 4ACAA 5GJBA 1E2GA 2WJYA 3EAQA 4LC0A 1R8QA 4BFWA 1CIPA 2IYZA 4TMXA 4HSEA 4OKSA 3AQ4A 5DNYB 2QORA 1W4RA 3LXXA 3HU1A 3NBZC 4OI4A 4EDHA 1E2MA 1UKVY 3BWDD 4JLBA 3IBGA 4OI1A 1Z0KA 3TUJC 3X1WA 2CCGA 3AUYA 1G3UA 1W5SA 1UBFA 2ZRHA 1YZGA 3CNNA 3LAWA 3T5DA 4ABYA 2WSMA 4M1OA 3I32A 1Z07A 3FYHA 4QFMA 3NVAA 4BQSA 3TRFA 1NVXQ 1XTJA 3V9PA 4BRWA 3A1UA 5FBLB 1KNQA 1RRGA 2G83A 2N46A 3BB3A 3UPUA 3TMKA 2B21A 4GPTA 4G5RA 4IXNA 2XB2A 2O5VA 1VIAA 2Q21A 4MGIR 4P4UA 4D82A 2ZE7A 4LI0A 1E94E 3K70C 4Q1FA 4KITB 3AV0B 1Q21A 1NMXA 3GFPA 1DVRA 1PZNA 3I8SA 2A78A 2ZI5A 3ASZA 3FVQA 1SXJD 4HUTA 3MUFA 5DISB 1XEWY 5HTKA 1KSFX 4Q03A 2CEAA 1KIMA 4OHVA 4U00A 5JCZA 1N5IA 4H9GA 1E1RD 5FUXA 2W58A 1I4LD 4TQAA 4ZKEA 3OAAA 4TT3D 1JB1A 3WRYC 2WAYA 5E95A 5D3MA 4AD8A 1P9WA 2HUPA 1EFRA 4ZV4A 1T8UA 1T6NA 1VECA 3THYA 1N6LA 2QG6A 1COWA 3ONWA 1GKYA 1TF5A 1KY3A 1NVVR 4KCGA 4IOLA 1AKYA 5J4YA 4RD3A 4JT2A 4PPFA 1L7VC 1YQTA 1FFHA 2H16A 4G5SA 4NYIR 4TYPA 3X1ZA 1G18A 2GF0A 1KTVA 2IC5A 1Q44A 3AKYA 3FTQA 4G5GA 4HI0E 2R6FA 4BFVA 5B2ZA 1SVOA 1AK2A 1WRBA 4LYAA 4XD7A 2ZAOA 1ZVQA 3N70A 3MG9A 3V00A 2YOFA 2PZGA 1J7KA 3SS8A 3Q5EA 4Q1AA 3U4QA 1AKEA 4QBFA 4DLTA 4G1UC 1WXQA 2Z4RA 1R0YA 1WP9A 2JLRA 2PMKA 4CYMA 2RGAA 1P2SA 1A5TA 3O8BA 4HAYA 2OBLA 3ETLA 1BS1A 2JDID 2VP5A 2H5EA 4HZUB 4D81A 1FUKA 2XZOA 2ZJBA 1G16A 4H1UA 3FKSD 2BMJA 1XMJA 3THXA 4QGHA 1DAEA 1J99A 2XTNA 2WAXA 3JVVA 3PV0A 2BC9A 3QI2A 2D7DA 1NMYA 2C03A 2W83A 2QY9A 2XXAB 2XZPA 2QL6A 5DLQC 1MR3F 1FTNA 3VR1A 3OHMA 3NH9A 5M04A 4IDPA 1E9EA 1W4CA 3K0EA 4NE2A 1OH8A 4Q9IA 5HCIA 5FUYA 5J5CA 3C5CA 2J0UB 4KXFB 3D8BA 4KODA 621PA 2WPDA 4LJ9A 5DHFA 5JLJA 2BM1A 1N5LA 3GFOA 3KJHA 4DDTA 4X8MA 1XJ0A 4B75A 4A6PA 2P3SA 2IYVA 3MMPA 4LHWA 5H1YA 5K8TA 1MO5A 1WCV1 4WZAE 4LJ6A 3N2EA 4JMPA 1WMSA 2EU8A 3GJ6A 4QXAA 2OBNA 1G5RA 4AWXA 4UNRA 5KPJA 3AP1A 1GL6A 4US1R 4E03A 4IDHA 3CBQA 3OEHD 3B13B 3FKQA 4OK6A 4DUGA 2JLUA 4LYJA 4WXRA 3I92A 3HR8A 4B3XA 5C46F 4LBZA 2C5LA 3W5JA 3ICEA 2XSZD 2FFAA 3REFA 1H8HD 3CNOA 4OYHA 2HXSA 4P3YA 1CF4A 5SZJA 3PIRA 3NTUA 1UADA 4BLSA 5FOVA 1KO7A 5CYPA 1ZJ6A 1NLYA 3UKDA 2AL7A 4AC9A 4IEEA 3KFXA 2QENA 2IYSA 4D4MA 1QDEA 2NIPA 1XXHB 4AKGA 4V02A 1UEJA 4M1WA 3QEOA 1E0KA 4V0OA 5TVKA 5FBVB 5KNDA 1KK2A 2IYWA 1KOFA 3CWQA 1SKYE 1W4AA 4GMXA 4TTRA 1KKLA 1XTIA 2A3RA 2JJ1A 2R6GA 4LJYA 3CW2A 3SYKA 4PHFA 1CR4A 1E9CA 1LW7A 2PEZA 5LDDC 2QM7A 3H4MA 5G40A 1G3IA 2CNWA 1Q1BA 3VX3A 1F2TB 2BKEA 2GCOB 5EUMA 1B0UA 2O8CA 4DB4A 3QG1A 2EFCB 2ZJ8A 1OLOA 1QBKC 4V0ME 4BLOA 4XSGA 4I1UA 3I3SR 5AJXA 5BQ5A 5DI3B 2IXEA 3RS2A 2D7CA 4HATA 4MRRA 3NC0C 4HZUA 1ZP6A 2GAAA 4OI2A 4Q7MB 4Q7JB 4D0LB 3FFBA 4NHOA 3D6TB 1YZUA 4X8LA 1P73A 4GP7A 3SYNA 3L0IB 1ZBDA 2BDTA 2HF9A 4NYIQ 5AK0A 4C7OB 3MJHA 3K0SA 4TQUS 2B8WA 4TSFA 1IJFA 1W7AA 4JIMA 4C30A 2LKDA 2ZVQX 2ZU0C 1OH5A 1NVWQ 1ZMXA 1E2EA 3EG5A 2QMUA 4W5WA 4HZIA 3VAAA 1Z2AA 2B7BA 2AWNA 3IPYA 5TARA 4TL9A 3WP0A 3K9GA 1NKSA 4GOJA 4HAWA 4M9SA 2QEQA 4Q4LA 5HR5A 2ATXA 5JECA 1E0AA 4UNQA 2CE7A 2ZYUX 2IUTA 4JYBA 3RS3A 4EPTA 2JAQA 4W5HA 8OHMA 4LJ4A 2BJVA 4Q9HA 4YLGA 2RGCA 4URZR 1EESA 3DM9B 5FR2A 1D9XA 5FI1B 1OW3B 5KO2A 5B57C 2PMDA 3EIEA 3AM1A 4AY2A 1XZQA 2IS1A 1NY6A 5CM8B 2NG1A 3FMPB 4ZCMA 1JBKA 3W6OA 2ZUBA 2FEMA 4XIGS 2ZYTX 2ZRBA 3VX4A 1IY0A 5KOYA 4DWJA 3SBDA 1NRJB 4TYWA 2JIZD 1XDBA 4L9WA 4M4SA 1A2BA 4FN5A 5E7MA 1L2TA 2GCNA 3GEIA 2RGEA 5UKDA 5KSYA 5DGXA 2PZEA 4EQ6B 4URVR 4N0DA 3BH6A 5IHPA 1DBSA 1EFHA 3BAFA 2ZIAA 4DCSA 2ZSFA 2ZUDA 4TQ9A 4E07A 1E2HA 3A1VA 3L2OB 4H1VA 3GLFA 2QAGC 4XVUA 2JJ2D 4LJ7A 221PA 2EFDB 3W9YA 5G53C 2V6IA 4MUAA 1TQ2A 5AUQA 2BCGY 1ZC4A 1Q3TA 1U8AA 1SGWA 3LA6A 4G5OA 3AF4A 1QHYA 2GCOA 2VRWA 3RLFA 2D62A 4HAVA 3GLIE 3H0KA 3ADCA 1IXSB 3Q7QA 2H17A 2ORVA 3GLHE 4PO9A 3TR0A 3JZMA 4EPWA 4M1SA 1MKYA 5FFMA 2KBEA 2ASEA 2Q9BA 4ZO4A 3C15C 3VKGA 5L3SB 1W46A 3NWJA 2QMEA 4JLPA 2QUZA 3U5ZB 4NPHA 4XJXA 1GNPA 3HJNA 3TLXA 3W8RA 4JJZA 4C7OA 1Z29A 5FUVA 1TADA 1G7CA 5CDFA 1S1MA 2IUUA 1G3MA 4U5XA 2CL7X 5CLQA 5EE0A 4BEBA 3CR7A 3RANA 4Z8XA 1GM5A 3TAHA 1UM8A 5GADl 3LV8A 2H92A 3CM0A 4AKEA 2C8VA 1DS6A 4BECA 4RFSB 4A0RA 2CBZA 2QA5A 3G82C 1P75A 3BH0A 4IKEA 2CMKA 1P5ZB 4GT1A 2IYYA 4TL7A 1PV4A 4A2WA 5H70A 1VMAA 1OT3A 1MV5A 4XWOA 3QEJA 2AD5A 4L8GA 2KI5A 3LWNA 3RRZA 1M7HA 1KDPA 1E1QD 4KO8A 4GSYA 2V4ZA 3AVPA 3K9HA 1UKEA 3EW9A 2HJGA 2VSFA 3QKSB 4YMSA 1ELOA 3WYAA 3HP1A 4L15A 1SXJE 1ZCAA 1EG7A 4JL8A 1N6IA 1OXTA 2QTVB 4JJKA 1YZTA 2CHGA 2DYKA 3SE0A 1W44A 3L8YA 4CW7A 4MRNA 1SVSA 3PUYA 4TLBA 2QP9X 5JBQA 3CO5A 4IDQA 4TT3A 1XTKA 1P6XA 3TE6A 4HAUA 2EVWX 4JVNA 3KKQA 2BM0A 3KXIA 2REOA 1E79D 4EQ6A 2AR7A 5KPDA 2IS6A 2DHRA 4IJMA 1G6HA 1DAHA 5LB4A 4NDZA 4TN1A 1AS0A 4HB2A 1N0VC 2NPFA 1W49A 3MSXA 3R20A 4TLDA 2QBYB 2PX0A 1FUUA 1H65A 1P60A 2IXGA 3PG5A 1G4AE 2RGBA 2FOLA 2IXFA 2OT3B 1J2JA 1DTSA 4Q7LA 3LX5A 2BV3A 2WWFA 3VQTA 2WMOB 3A36A 3CKLA 4PHGA 4NU0A 2FWRA 4M21A 2YV5A 3SU8A 4B6FA 2HYDA 2ATVA 3SOPA 3TKLA 2RHMA 1T3HA 2C95A 4BFTA 1S0UA 5JWRA 1E69A 3ZLJA 2A9KA 1AQYA 2DFTA 1XWIA 3KXLA 3REGA 2PJRA 5JS7A 4R2IA 1U0JA 2OAP1 3HWSA 4FINA 3FMFA 1N6NA 4EAQA 2WICA 1XD8A 3A8TA 1VG1A 5FL7A 3K0CC 3FKSA 1TQ6A 1ZYUA 2ZRAA 3A4LA 3FWYA 4LWZA 2V8OA 5ANRB 4PSKA 4LV5B 2G9NA 1GWNA 3HR7A 1DAIA 2ZREA 4II7A 2HCBA 4ILEA 1R5OA 4LBWA 3OE7A 3WXMA 1NLZA 3K09C 3MWLA 5EUQB 2XTMA 4V0KA 3KKOA 2ZS7A 4M9QA 5HZHA 3QXJA 3SBEA 2VEDA 3QIAA 4FCTA 3AP2A 1US8B 1N6HA 2IF0A 2J59A 4PC6A 1D2MA 2WOJA 2OZEA 2QGNA 5BXQC 1W1WA 4B2PA 1OF1A 4X8OA 3QPVA 1KNXA 2DFNA 3KUCA 4M0LA 3DVLA 3ZDQA 3GJ5A 1W5TA 3AGQA 4DIDA 1PVOA 1HURA 3GJ4A 4B3FX 1Q57A 3P1JA 4F7WA 1CLUA 1U81A 1TQ4A 2P65A 2OLJA 3E5HA 1LFDB 4MKHA 2WM9B 3VU9A 2ZRKA 5EP1A 4A8JC 1E9RA 1SQ5A 5FOSA 3LVQE 2LCFA 1R4AA 3QKSA 1E2FA 4ZCLA 1KMHB 4KAXA 2R6AA 4RVCA 4FIDA 4JLDA 4D4LA 1KK3A 3ZJYA 3LBHA 4NCNA 2IT1A 1NN0A 1XTRA 3ZS8A 1XJCA 3UWKA 4BPBA 2GZAA 1KI2A 3B7GA 3QE0A 5A4JA 3R9WA 3CR8A 3U7HB 1GIAA 1HYQA 1OYWA 2VYFA 1LY1A 2C99A 3NHAA 2JLQA 1N6OA 1R0ZA 4PZYA 2V7QA 3B8HA 2GXUA 5C1BA 1F5NA 2REBA 2QBYA 4F4CA 3MWYW 1KDOA 2WJVA 4Q4JB 4C0HA 1EFUA 1TMKA 2ZRMA 3OFNA 1JR3A 2AHOA 4PAMA 5J40A 3B1WA 3SHWA 1MRNA 2ZR7A 4JSTA 3GMTA 5EZ6B 4J0QA 4C4PA 2FPLA 3ZH9B 2ZRNA 3SJZA 2EWVA 2H57A 3UATA 2ZVPX 1II9A 2F9LA 1DO2A 2AKYA 2GHIA 3SZRA 2CJWA 3TUIC 3PENA 4DJTA 2FZ4A 1OFUX 4LC1A 5HKKD 3TQFA 3W8NA 2OILA 4EPYA 1E3MA 3IDQA 3RABA 1P72A 1YRBA 4JBXA 1XPRA 3TW4A 3T15A 2OSBA 1U90A 1HE1C 1R5NA 2YWFA 1OH6A 2RGNA 1CS4C 3SEAA 1OE0A 4UJ3A 4DZZA 4PC1A 4ON9A 2JA1A 3FB4A 4IDNA 2O8DB 4LUCA 4QGAA 1US8A 4BLPA 1I4TD 1Q0UA 4A8JB 4EPVA 2Z83A 3DO6A 4NYJQ 3AEZA 4TMTA 3SFVA 3X2SA 4ZDWA 2GKSA 3ZVLA 3IIJA 2VHJA 5KYKA 1AJEA 4MKGA 4TYNA 1CJUC 1TEVA 2ZJ2A 4KVGA 2XOKA 3QPUA 1YE8A 1ANKA 1ZW6A 4TMWA 1NKTA 3VR4A 1F2UB 2Z5FA 3C7KA 3EZ6A 4DHEA 4F91B 4DLUA 4EFMA 5JS8A 3KJGA 1V5WA 1FX0B 3K70D 1CJTC 2ZRDA 1E32A 3GP8A 1WDTA 4KYIB 4AKIA 2A5JA 5J4HA 3NG1A 5C2JB 1QHGA 3RWMB 4V03A 5AWFC 4KU4A 4IVPA 2HEIA 3U3KA 5LPNA 2ZJAA 1KO8A 5D3MB 3HU2A 1FTSA 1KHTA 3KKNA 1P9RA 3THYB 2W2VA 4AK9A 4NKRA 4Z8YA 2IYQA 2FH5B 3VR5A 3FE2A 2F6RA 3OIYA 5FTJA 3B78A 2ZM5A 1OFTA 1LTQA 4TMVA 2QU8A 2ZE5A 2F3RA 1I4DD 2EWWA 5KSPA 3W34A 1E2LA 3RRNA 3EPHA 3LBIA 5EE9A 3H86A 3L82B 4Q4JA 4B48A 3U6KA 4OK3A 2MMGA 3U4QB 2C2HA 2WIBA 1U9IA 3TAUA 4CRWB 1ONBA 2DWQA 5FPTA 5AJZA 2GA8A 2R6DA 1ZNYA 3GFTA 2QROA 1XZPA 4B44A 2HDNB 4O25A 1MH1A 5KTYA 1NG1A 3KKMA 1CTQA 2D2EA 5FOWA 1RYFA 2OFOA 3R9IA 2ODNA 4DB2A 3THXB 1G19A 4MRPA 1GRNA 3LLMA 3PEYA 1GOTA 1XD2B 2O0KA 2ZSBA 3B1ZA 3TW8B 4EKDA 2GK7A 3T1VA 2BEJA 3QSYA 3RVBA 1BIFA 2WKPA 4CEHB 2CCJA 4OL0A 4PANA 4WXPA 1UKYA 4LSGA 1F3OA 4GOXA 3WBJA 2QZ4A 2WSSD 4LV8B 3NDPA 1JECA 4KYUA 4OHXA 2VO1A 4ITRC 5IRCD 1Z06A 2IYXA 5JSZB 2ZJ5A 3SDZA 2X77A 3GLGE 2O8DA 5EJEA 5C18A 3IQWA 4E09A 2VLIA 4OJKA 4A8JA 1YZQA 4JKIA 1WB9A 2YWGA 2WTUA 3KFVA 2JLSA 4JLAA 3NBXX 4QJ3A 1N2CE 3CLVA 4PZZA 3CWZA 1GRQA 3QY0A 4XTRA 1DOAA 2AK2A 2QMOA 5KUTA 1CJMA 4GL2A 4FD2A 1AGRA 2CHQA 6Q21A 5SZHB 1GILA 2HV8A 1Z0AA 2WWIA 4M1KA 4TMZA 1F2UA 2DWOA 2FE4A 1K6MA 1H8ED 2ZJZA 1Z63A 121PA 2ZJOA 4RD1A 3SJBA 4Z1MD 1E1QA 3WHKA 1FX0A 4N1AA 5C4GB 3CRQA 2WHXA 1L4UA 2QE7A 1C1YA 1YZNA 4GP6A 4KVAA 3N5CA 4UXJA 5AJWA 5FBRB 4YDHB 4L5BA 3RS4A 2ONKA 3IO3A 1SVWA 1RIFA 4MYUA 4PPNA 4HLDA 5DHAA 2YC2C 2FGJA 2IWHA 4TWZA 3DEFA 4PAQA 2G3YA 1TNDA 4IRUB 2FSGA 4C2UA 2X1VA 3ND9A 1E79A 2GCPA 2Z4SA 2OCYC 4FMCB 4Q1BA 3RYTC 3OZXA 1CULC 4JVLA 4MKFA 2R44A 1CP2A 1KAOA 3QKUA 3AF1A 5P21A 1LS6A 1ZD8A 3BORA 5J4KA 5L3QB 1AM4D 2YNMA 1Q1QA 2J45A 3EWSA 4BZQA 3T61A 1JI0A 3OEED 2RGXA 3B9PA 2CK3A 4K46A 3TVDA 4BGDA 2QPOA 1Z6AA 4IOJA 2KJQA 1NBMD 3EIQA 3FFAA 2O8CB 3CX6A 2W6IA 2I3BA 4HEJA 1R0XA 3AH8A 4S35A 3EWAA 4C9BA 2O8FB 2OFXA 1CU1A 5CB8A 5HPYB 2OFWA 1CBUA 3W3AA 4LJAA 5K8UA 1Q22A 1UF9A 3UK6A 1XEFA 3CRVA 2DBYA 1WBBA 3UMSA 3OIVA 5EE1A 1CJKC 3HYTA 3ZD6A 2QP3A 3IQXA 1UAAA 1XD2A 2XNDA 4KSBA 4OI0A 3KQNA 3F0TA 1OIXA 1KYIA 2VHUA 3DOFA 4PPQA 4CEHA 4QNMA 2C9OA 4RKFA 1OJLA 2V1XA 5LD2B 3PR1A 2WJGA 1D2NA 1FMLA 2F7SA 1VG0B 3CPJB 4A2PA 1D6JA 3RSOA 5FR1A 3WNCA 3DZ8A 3CF2A 1PLKA 1P2VA 5JSZA 1JNYA 2R65A 1HEIA 3TR5A 3L0OA 4OJQA 4IOMA 1WQ1R 3BGWA 1VCOA 4CEJB 2WWGA 3GCGA 1MABB 5JJLA 4NYMR 4MGYR 1UFQA 1M34E 2JGNA 4QC2A 2DPXA 2XB4A 5AUPB 1W47A 4M9ZA 4UXHA 1XCPA 2Z0MA 3G0HA 4BE7B 4NONA 2Q3MA 1E2QA 3CX7A 3PEWA 3CF0A 2R2AA 3C4JA 3KX2A 3TVTA 3B1VA 4GFDA 4QG7A 2EW1A 1BYUA 1YKSA 2OXRA 1TUIA 4Q9KA 5JJIA 3BXZA 1TEXA 2PJZA 3T34A 4DCVA 1OKKA 3NBYC 1JJVA 1TX4B 1A7JA 5AUOB 4M22A 2CL6X 3SHFA 3RRYA 4OQNA 1SVMA 1E2KA 4B73A 3ZD7A 1J90A 3EA5A 4NCIA 2DFKB 1IY2A 4FMDB 4DIEA 1DO0A 3MJRA 3H1TA 4ARZB 5ELXA 3DOEA 3BBPA 3N2IA 5DN6A 4TLCA 1NIJA 4A15A 1OHHA 4EIWA 1KI4A 4DSUA 3GLFB 1GDDA 5L3QA 4M1YA 4JLKA 3BC1A 4KLZA 2AFHE 4QBIA 1J8YF 4WZ6A 1W36B 1E99A 2GDJA 1FL9A 1QZXA 2WV9A 3WRXC 4DXAA 1X86B 1NMZA 4KFUA 5JFGA 1BMFA 3BS4A 1QG2A 3ZGXA 4I4LA 2I1QA 5FOUA 1SVLA 4LHZA 3WMGA 1Z8FA 4PC2A 4V0MA 4ZDJA 3GJ7A 2WMNB 4QJ4A 5F9HA 3E70C 2O8FA 4NMMA 2GEVA 1W2HA 2VP4A 2VF7A 4JL5A 1W0JD 1KDTA 4KBGA 5TV2A 4D0NA 3I5YA 3I8XA 1DARA 1E0JA 4O0MA 4C0QC 3U7FB 4B3DA 4DT1A 4UJ5A 3DKVA 3WBKA 2ZS8A 1KAGA 2CVFA 1GVNB 4L16A 1G41A 4KLNA 2C96A 4A0GA 2ANBA 3DKPA 3W90A 2JJ8A 2ZRLA 3MFYA 3U3JA 1T4GA 2ZYVX 5KNCA 2ZSEA 4JT4A 3IILA 3ZZ0A 2FNAA 1FQJA 4Q7KA 5TXGA 5KU1A 1KSJA 4DDUA 3LX8A 2ANCA 4BUJA 5BWMA 4CEJA 4KJZA 2QN6A 1MABA 1M8PA 1G8FA 2JATA 2WIAA 3J81k 2VTKA 2NMVA 1M1YE 1DADA 2VSOA 4RZXA 1Q3HA 3SQXA 1VYUA 1RZ3A 1RRPA 4OHYA 1NIPA 5KDDA 3LO5A 2P0EA 4YMWA 2ZI6A 3IIMA 2QQ0A 1UBCA 3IUYA 2XAUA 4QRHA 3W6NA 1IHUA 2ZPTX 3D7MA 3K0AB 4TTQA 1AZSC 2OCAA 2W0SA 2I1VB 3CPHA 2B7CA 2J0QA 5K8LA 2GJKA 2ZSDA 1P61B 3LFUA 1GITA 4JS0A 3ZZUA 2QP4A 1C9KA 1IN7A 4NYMQ 2J7PA 3T1QA 4ESHA 1IXRC 1NN5A 4MUBA 4DKXA 3W3ZB 5FTMA 4RZ3A 4B32A 1TQDA 3BFKA 2ZE6A 1YRAA 1R7RA 2R9VA 4EPRA 4ARZA 1NI3A 3BIFA 3K9LA 2IX3A 1GL7A 1TPZA 2QAJA 3QXCA 4LRWA 1CEEA 2UVQA 4YXWA 2A5YB 1G7RA 1AS3A 4BLRA 4U7DA 2ZQ5A 3GJ3A 3PITA 4ZPXA 1PUIA 1Z6TA 1F48A 2ZS9A 1XCGB 2QM8A 3CH4B 4URXR 1ETUA 1YR7A 4LYFA 5JWOA 3LH5A 4NL4H 3T12A 3TNFA 1W48A 4JL6A 5IK2A 4DCTA 4TL8A 1XXHE 3CONA 1KI3A 4GNKA 4DCUA 3VMFA 1I2DA 5AJVB 1N5JA 3A1TA 3CIOA 4C0KA 3I61A 2O0HA 1SHZA 4MKIA 3AVQA 4Q1CA 2BBWA 4MDEA 4KBFA 4D80A 1VHTA 3U3RA 3LY5A 2HLDD 4JVMA 5G3ZA 2DY1A 1C4OA 4DLWA 4ERNA 1NG9A 2EQBA 3U7GA 2BEKA 2HF8A 1KZ7B 3ND8A 4B3BA 3JVUA 2FPMA 5FOXA 3IEUA 5DH9A 2CE2X 1FP6A 3AVTA 1MRSA 3QF4B 4MRSA 3BK7A 1II8B 1XRJA 4RCYA 3TIFA 1ZU4A 3QXSA 2O52A 3SNHA 3KB2A 2YHSA 3Q85A 2F1RA 2YKGA 5E7JA 4GOKA 5EE3A 3DDCA 1O3YA 4NZYA 1LNZA 3UWOA 2LWIA 2RGNC 3ZVMA 4TYQA 3KQLA 1T0JB 2B6HA 3HYRA 421PA 3MRSA 3VU9B 4BFYA 4F38A 2NTYC 4C2TA 1R10A 2ZI7A 3PUWA 2GZHA 1E9FA 5FI0B 2C9CA 1EX6A 3BERA 4HAXA 2ZJYA 2WKQA 3QVUA 2QRNA 2IUSA 1SXJA 4CVNA 5BN3A 3K0AA 1XEXB 1G8GA 1OB5A 2XJ4A 4CF7A 4XWKA 4JLJA 4B76A 3EZ2A 2D3WA 2HYIC 1E1RA 3ASYA 3ZIAD 4Z51A 3FDIA 4DLVA 2GZDA 1XBTA 5TB5A 2ZXUA 2HCJB 3VNUA 2OE2A 4A0HA 5GVSA 2RH5A 1T8TA 2OEPA 3PEUA 3QVVA 3TBKA 4LDJA 2V1UA 3CZPA 1RC8A 1E9DA 5EXSA 3WY9A 2W0MA 1IY1A 1KI6B 4M2LA 4CGZA 3OAAD 1U8ZA 2YVUA 3KXKA 4MH0R 2IA5A 2ZRIA 5F9FA 5C4MA 3RWOA 4URYR 2RGGA 1EFRD 2QT0A 1KGDA 4M8NE 1COWD 2PL3A 2Q9AA 1CRQA 3F3YA 1NBME 4IVRA 2QGZA 4OQFA 4D26A 2FV8A 4NYJR 4N0EA 1FP7A 3CPEA 4PHTA 1CJVC 1Z0JA 1X6VA 2JDIA 2CJWB 4G01B 4F93B 1ESNA 1R0WA 1A4RA 1X1SA 2BJWA 1YR9A 2ZI4A 1Z0IA 3AKCA 4MRVA 4R7ZA 5DYIA 3AVUA 4D4JA 1U9IC 3BE4A 2P2LA 3SR0A 4V0LA 2KE5A 4FWTA 2GF9A 2BIFA 4OQXA 3EPJA 4GBMA 1CR1A 4JSYA 2NO0A 1G1MA 1R2QA 1N6KA 2IYLD 1IXZA 2RHDA 1I2MA 3UIEA 3ZZTA 2NZ8A 4LBYA 2MSDB 2PT5A 2K5UA 1YHNA 4Q66C 1X8LA 3QF4A 2YJTD 4DLRA 4DLSA 1II8A 1U0HC 1E2PA 4OQMA 1BOFA 1OV4A 5KDOA 1QRAA 2BBOA 1LF5A 4Q1EA 4DDWA 4B43A 2G88A 3U3OA 1QF9A 4A9AA 4JLMA 2V3CC 2H18A 2NO9A 3TQCA 4CT4B 1DG1G 3I73A 2V55B 3T06B 3DL0A 5JHGB 1FPMA 1UPTA 4CEIB 3A4NA 4BFUA 2FSIA 1BO6A 5K8IA 3OEHA 2G0TA 2GETA 5JRZA 3U44B 3DM5A 4C0JA 2WPDD 1XTSA 1K5GA 1G8YA 1E9SA 1Q1ZA 4P31A 4Q02A 1UDWA 2IS4A 3T1OA 2FX3A 2J41A 3B1YA 2XSZA 1XEXA 2EFEB 2Q3HA 1H8HA 4EUNA 4LGMA 4UXIA 3B2EA 3S1AB 1YZKA 2QRZA 1YU9A 2F1JA 2F43B 3Q3JB 1EXMA 3DZDA 4HLCA 4WIAA 4KHZA 1LV7A 1ZUIA 3WYFA 3BB1A 5EXXA 2IWRA 3WP1B 2DWPA 4DUGD 4BZPA 2VA8A 1A2KC 2VL7A 3JZAA 2P5SA 2FA9A 1HTWA 1JEDA 2OM2A 4ASUD 1T91A 3QKRB 3QBTA 4NCJA 2FFHA 2H7VA 1KO1A 2ZR9A 2ZYWX 3ADKA 3KDSE 3CB4A 5JRJA 1KI6A 3PUVA 4DVGA 1WA5A 2D06A 3NEYA 1KSHA 3L8ZA 4F4IA 1SHKA 1W4BA 4RKEA 2JLZA 3NC1C 2FF7A 2ODBA 2P67A 4DLXA 4ZDIA 1F60A 2PLFA 2JJ1D 2KBFA 1E2IA 4CDGA 2ZRPA 2A30A 3SC3A 3QUSA 2R62A 3BJIC 1SULA 4HLQB 4P4SA 3NBFA 4DEYA 3IIKA 1EX7A 2CNWD 4ZIRB 2NPIA 721PA 4GI7A 3TSWA 1GAJA 3PEVA 2OUKA 4PO8A 4POAA 3FGNA 5E3HA 1UKZA 3D31A 4HB4A 3LRPA 4US0R 2BMDA 1IAQA 1HQCA 5JMTA 3C41J 2G6BA 4Q21A 4Y0VA 1N6RA 1GSIA 1KJZA 4BEJA 5JEEA 3I1FA 2EYUA 4TLEA 4LPKA 2IHBA 5J4VA 2GJ9A 4NTZA 5A5GA 5L3RA 3R7WA 4XSHA 2NO1A 2AD1A 4UNSA 1S1CA 2H8KA 1Z6YA 2GJAA 3U61B 4NP6A 4QJ5A 1JALA 2FDCA 1ZC3A 5FUWA 1E4YA 4TSFD 3TGPA 1NNEA 1TU3A 1IONA 2ZRGA 1D5CA 4JYCA 4LV6A 4CEIA 1DAFA 5SZIA 2J87A 3LQQA 4A2QA 1MT0A 1X1RA 4QNRA 2EFHB 4IVQA 5FTNA 3U44A 3K0FB 4BRUA 3H84A 4I1SA 1A1VA 4YMUA 1Y63A 4FMBB 1QG4A 2WJIA 4BFSA 1J70A 3RSLA 4MQBA 2X2EA 4JLOA 3S1AA 1OYYA 2IYTA 3Q9LA 3VNVA 2NGRA 2F43A 5IT5A 2JIZA 1RVDA 2F1IA 1RJ9A 3DMNA 3DHWC 4UKDA 4YQFA 4M9XA 2J1LA 2MSCB 2G1KA 4N3NA 1JPJA 1ODFA 3QJYA 3VR3A 2YWHA 4CT5A 1KSGA 1RFLA 4WVFA 4I81A 3M0EA 1RPZA 3AGPA 3QKRA 1ZNZA 2PCLA 3GD7A 1P7CA 2JJ2A 3ZQ6A 1KO5A 2C9YA 4YMVA 2VH5R 5DYGA 4JZKA 2AN9A 3EZ7A 2F1HA 1XU4A 4PZLA 4KSCA 1BKDR 2N42A 1Z0FA 1UEIA 1VYTA 3FHTA 1G3RA 1IOZA 1JXMA 4M1TA 1KY2A 3H2YA 3SFZA 4XWAA 2F9MA 4DBLC 3FOZA 1U0LA 3LW7A 3R9XA 3KUDA 1JXOA 2GXAA 4IHQA 4TMKA 2CL0X 2GVZC 2PEYA 2RKOA 4WW0A 2P6UA 2J3EA 3NKVA 3IGFA 4ZIRA 3OF5A 2CHVA 3C16C 1S96A 3GJ0A 3B60A 1HT1E 4JKYA 3ZVRA 3QPWA 3KKPA 4US2R 1UDXA 4MYHA 2ZETA 3AVYA 1OIVA 4MGZR 4QL3A 4AG6A 1T5LA 3C8UA 3B5JA 4LBVA 4JBYA 4PHHA 2Q0HA 1NJGA 3Q8XB 4D0GA 1NSTA 2CXXA 2NO7A 1EFTA 2FEOA 1CKEA 3P4XA 4U02A 4YC7A 1XPOA 3AVWA 2ODWA 2VP0A 1GKIA 4XTCS 4EJSA 3NH6A 4AURA 1AIPA 4ZCIA 4DCNA 4DEXA 2P5TB 1Z6XA 1JPNA 5LD2C 4AKHA 1OXSC 2IK8A 4QM6A 2TMKA 4A4DA 2QPAA 1JJ7A 4D25A 2MSEB 3R8FA 3L0SA 4RD4A 4UNPA 3T5GA 3VR6A 1G9XA 1SVKA 3RRMA 1EWRA 2BBTA 5F2EA 5L8VA 3PJRA 2DB3A 5DO9A 2C98A 2QQEA 1E6CA 2ZAMA 2P6RA 2IW3A 3K0FA 4LK2A 2CVHA 1UJ2A 3O8CA 3SQWA 4P32A 5IDVA 1T3SA 1GNRA 1GTVA 2ZUCA 3I72A 5KNBA 1UBGA 5EXTA 2XEXA 4LOAA 3L43A 2D74A 3ZIAA 1OFIA 3OESA 5CM9C 3EA0A 1Z0DA 3FMOB 4RD0A 1Z08A 2D2FA 3WMFA 4AYWA 2AXPA 1SKYB 1Z6GA 3E1SA 2GBLA 2XTZA 1YR8A 3LW8A 1XMIA 3RDPA 2WJJA 2GEDA 4Q01A 4M1MA 2OCBA 2YWEA 2E87A 1DG3A 1XB2A 1XP8A 1BYIA 2X19A 3TSZA 2ZR0A 1LB1B 1HQYE 3T35A 4QM7A 2BHRA 4NCHA 821PA 4C0SA 3A58B 4BASA 1NVUQ 5SZKB 1NSFA 1ZAKA 4KI0A 4LYHA 1KI7A 3K1JA 2FMXA 4DSNA 1HUQA 1KI8A 2OXCA 2WWWA 3KTAB 1S2MA 1AGPA 3A1SA 4I1VA 1TAGA 4BFXA 4JLNA 5JJKA 3C14C 4C0LA 3EASA 4YONB 1AS2A 1VG9B 2OO7A 3MGCA 4UNNA 4Q47A 1W36C 3QQ5A 1FW6A 3SJAA 2REXB 3WHLA 3CRW1 3G5UA 2QTHA 2F55A 4DT1B 5AJYA 2CLDX 1S3SA 2NOAA 3M1IA 4W5JA 3PXGA 1ZD9A 1OXXK 1UBEA 5LB2A 2GESA 3C5HA 3EC1A 1ZINA 1RKBA 4LPSA 2ZE8A 1Z22A 4OQLA 4F4JA 1LS1A 5FPYA 3DMDA 2GVDC 3B6EA 5FL7D 1LF0A 2AKAB 2W00A 4K81B 3U3MA 3EX7C 2QPTA 1GL9B 1YJ5A 3CRMA 3HPQA 3BOSA 4TZ0A 2EYQA 2I4IA 5JZVA 1XEWX 1VCMA 1T3LA 1RRFA 1CXZA 2UKDA 1ZM2A 2XX3A 4MITA 5FBWB 4C0AC 3THWB 1IM2A 3PUZA 3OE7D 2E9SA 2FFBA 5E7IA 1U98A 5HE9A 1MOZA 1E2JA 2YYZA 1AZTA 4HLUC 1QVRA 4PC3A 4B71A 1ESMA 4PFSA 2RAPA 4TYYA 1VYVA 1AN0A 4V0NA 1KJWA 4DDVA 4BFZA 2VP6A 3K70B 2GEUA 2JLWA 4XVQA 5HZKA 2Y8EA 3HPRA 4GZMA 2WZQA 2PX3A 1VKJA 3GEEA 2QI9C 3SYLA 2BBSA 3B1XA 2OAQ1 1G6OA 1N25A 2KB0A 4A92A 4B2IA 4ZI3A 4X8HA 2RMKA 5GJWC 5JHHB 1E2DA 3P27A 4DSTA 2OCPA 2VHCA 1MO3A 5AR1A 1XPUA 1ZRHA 1KDRA 4B33A 5TMPA 1AA9A 1SXJC 3AKDA 3IHWA 2OBMA 1K5DA 1XTQA 3SJCA 1RW4A 4OHZA 1P4SA 3WYGA 2ZSAA 4ASUA 4A36A 1L8QA 4O2LA 3EXAA 4B3CA 3A1WA 3EZFA 1IN4A 4QOSA 1IJEA 3AVOA 1D2EA 4IFBA 1U94A 1TF7A 1JEEA 5FPHA 2AWOA 3KB1A 3HU3A 5JCPA 4Q19A 1VG8A 4LX0A 4Q00A 4Q4HB 5D3QA 1S9HA 4AYTA 3P32A 2V7QD 3GLIB 4OBEA 1M7BA 1WE2A 2Q3FA 1GNQA 5G41A 3WNDA 4A82A 3GLHB 4PC7A 2O8EB 3KTAA 3IKJA 1EFCA 3MWKA 2BKUA 2JEOA 4RY2A 4EPXA 3OFND 1JR3D 2NO6A 4B35A 4B2LA 2V6JA 3FHOA 4NCKA 3D3QA 5HKKA 1E9AA 2WBLC 4IW3B 3LDAA 1S3GA 5FOTA 4HDQB 3V4FA 1KO4A 1YZLA 3LD9A 2WKRA 1Z2CA 4PSVA 3M6AA 2J0VA 4LHYA 4OK5A 2FN4A 1FMJA 3HDTA 1Q20A 1Z5ZA 5CJ2A 5FBQB 5J4LA 3THOA 1NVVQ 2IEYA 4IXMA 1OH7A 1KZGB 2GXSA 2IYUA 4Q5IA 3RS5A 4CIDA 4O2RA 1P9NA 4R9UC 4ACBA 5CITA 2GJ8A 2IEZA 1VHLA 2W2TA 4TTPA 3AKEA 3THWA 3GJXC 1ZM3A 4G0NA 2MMCA 2WWYA 4B6EA 1K8RA 1DPFA 5EQTA 4M53A 3ADBA 2XXAA 3IPXA 4JBWA 1GG2A 5JWHA 4GRAA 3MAAC 3DPUA 3ZQJA 2AX4A 2ZRCA 3RAPR 2ZEJA 2KWIA 2LKCA 2NZJA 4BWYA 3O8DA 1VPLA 5BYKA 2YZ2A 1D9ZA 1SXJB 2J0UA 2XNSA 4Q1DA 5TDHA 2XITA 1ZU5A 5CLLA 3R8CA 2X8AA 3ADDA 5L3VA 3QF7A 3CRRA 2FZLA 4F92B 2HJVA 2R6CA 1W0KD 4HAZA 3FHCB 1N0UA 1G8PA 1M74A 1XD9A 2XOKD 4B34A 3CX8A 5H8WA 4PO1A 3E2IA 1IBRA 1XMSA 3IEVA 1FZQA 1Z28A 2C78A 4W7SA 1RYHA 2B8TA 3CZQA 2P6NA 1U8YA 2CLSA 1AQUA 2VP2A 2F3TA 4ZI2A 1VCNA 2GJSA 4IOKA 4BZXA 4FWIB 1ZM7A 4HYYA 4Q4AB 3UMFA 3P20A 4GDFA 1NN3A 1O87A 3W6PA 4LJ5A 1NJFA 4QBGB 4LY6A 1QHSA 5B58C 1ZCBA 3NIBA 2W2XA 1DAKA 3LQRA 3LXRA 1Z47A 3MCAA 1V43A 4QHTA 1KK0A 3ZVNA 1P3JA 1FNMA 1XXHA 2HT6A 4Q4HA 1NF3A 3QXXA 4GZLA 5JI3E 3F8TA 3BFXA 3GLIA 4P33A 4ZKDA 2Z43A 3I62A 4K8OA 1II0A 3GLHA 3NDBB 1OSNA 3V4RA 1XF9A 4RD2A 2O8EA 1J8MF 4S2EA 4XH9B 4RCZA 3PUXA 3B9QA 4MYTA 2DCUA 4R2HA 3GLFE 4YMTA 2J9RA 4IFEA 4LHXA 4KV9A 3EPLA 4Y0AA 5GJCA 1ZUNB 4RZ2A 1N6PA 3FMIA 1F2TA 1OIWA 3EZ9A 1Y3AA 3QENA 1U2RA 1R6BX 2BVNA 4G3XA 3U7EB 2OG2A 2Q9CA 2WSSA 1DAMA 1NY5A 2A5FA 1B23P 4HLUA 5B30A 4XOIA 1GRRA 4I99A 5DI3A 2GK6A 2W6JD 2YC4C 3L0PA 4B3GA 2J7KA 5DI9A 3T1TA 3U2QA 2GAOA 3ICQB 1ZIOA 4G5QA 2OESA 5BYJA 1JAIA 1GKUB 2D4HA 4WAUA 2J0SA 4D2IA 2CCKA 2KSQA 1DELA 2N1BA 3EC2A 4PAOA 5CDFE 2GWHA 1ZM4A 2CLCX 3AF0A 3BD9A 4HB3A 3K53A 3AF3A 1H8EA 4Z1MA 1WBDA 3VKHA 4B47A 3A4MA 4PXAA 2PZFA 3O47A 3AP3A 1OXVA 2UZIR 1L4YA 5LBIA 1G5TA 2E1RA 1HE8B
chains in the Genus database with same CATH superfamily
4ROTA 3EVTA 5L53A 3H04A 4HMOA 1CUJA 2QTAA 3ZWBA 3M4YA 5CA1B 1DBVO 1T9GS 4I3HA 3CUTA 5K1ZA 3TUZC 1A9QA 4ETMA 3OJCA 4Q93A 1T5TA 4A91A 1MC8A 1OGYA 5J2TB 1PYDA 1UJ6A 1DKMA 4F3KA 3QWIA 1AGNA 1K8XB 3EIHA 2QL5A 2WTNA 3GUCA 4QHSA 5LQDA 3TH5A 4BNUA 1P5JA 2JLVA 1EUCA 5GJVC 4N12A 5CIWA 1V4NA 1JQLB 5IUKC 1MXFA 3DZKA 5KTSA 4OX9Y 3PE3A 2ERXA 2KQUA 5DSZA 4KOAA 1XA4A 2IE0A 4A1OA 1Q0PA 4U4AA 2WF7A 2Z6VA 3NHBA 4AMBA 3UXMA 3AF2A 3RNLA 3QOWA 4KE7A 1R74A 2SHKA 3PDJA 2D5LA 5EZYA 3M82A 3T7IA 3TIVA 1COZA 1U7TA 1F12A 3KOXA 5H3LA 2FU5C 3O84A 4ZAXA 1P2TA 4RHTA 4UNIA 2HXYA 2WQ6A 1BFKA 1YMVA 4TVBA 2JFUA 3PRHA 5JQGF 2YINC 1HT0A 3UB2A 1LUAA 2VUTA 1Y4UA 2Q1TA 3SQDA 4JUBA 3CVUA 1XRPA 3AUXA 5FTKA 3QPDA 1TL7C 4A6DA 1DAPA 3UT0A 5C53B 4JJ8A 4XD7D 3PF8A 3QOFA 1WMFA 5B7QA 4S0XA 1UP4A 1XX6A 1JQ3A 1J0XO 2PT7A 4Q3BA 1XQXA 3UEOA 4MJ3A 2RONA 3WXBA 5KJ1A 3FCUB 1BDHA 2VRBA 1RLUA 4WACA 4BTEA 4R71A 4LDRA 5FPSA 4RK1A 1WQ3A 3O31A 4LJ8A 1TFUA 2WAAA 1G8AA 5B64A 5EINA 2OOKA 2WOOA 4RMIA 3S44A 3G9QA 1ZNXA 2QGFA 4DXHA 1V4VA 1VIYA 1R8SA 1Q7BA 3MLEA 4GVPA 4R16A 4ZC8A 4FLFA 4JI6B 3ZQKA 3QYAA 3N7TA 4QXQA 3I64A 4LOJA 2X40A 4DMUB 2YXBA 4B0PA 3NDJA 4LX8A 5SYAA 3ZR4B 3ZX4A 5EEHA 2EZ9A 3KEOA 2PBFA 2KYRA 2AYXA 4QO8A 2BMFA 3R7WB 4BJ3A 3FPAA 2VPPA 1DRKA 3RS7A 3UMRA 3V1KA 3UMCA 3WQBA 4BB6A 5JPCA 4MLZA 4YYEA 5KX5A 1IN5A 4G97A 1QHHB 2GSDA 3INRA 5CM2Z 3REOA 2PL9A 1LSJA 4ARVA 2A9PA 4RJIA 3TKAA 4IJQA 2ILVA 1ZM9A 4HX9A 4B87A 2BFFA 4GICA 1O94C 2X42A 2I76A 2ZTSA 1FDVA 1NN1A 1SU6A 4DIBA 4FCVA 3M3DA 3RBZA 1MPXA 2OORA 2RCNA 4EFLA 2IQIA 5CIQA 2GLXA 4KXNA 4R8KA 4Y7DA 1EMDA 1FMTA 1SVIA 3L0DA 3JQ8A 3NNSA 4E22A 3VZRA 4EJSC 2XYRA 4ZCSA 16PKA 5JNVA 2HI0A 1SH7A 2RG1A 4RFSA 2BWJA 5IF9A 1OFHA 1IPHA 3ZJUA 4F3CA 1WCWA 1QRTA 3BULA 4RU1A 3WJAA 1IBKB 4OHWA 4WKPA 2ATEA 5HA5A 4Y6LA 1MFZA 1XE3A 1XN1A 5F12A 3CKKA 4WY5A 1O77A 1SCKA 3TQOA 2ZAIA 3GJZA 3W79A 4FCCA 1AO0A 2BZ0A 4CTKA 1XNJA 4OMCA 5B4VA 1CT9A 1HE5A 3K5HA 3QOYA 3O9MA 5BPFA 3EUEA 3P9KA 3AZQA 3W5AA 2L18A 4EKGA 1E5QA 1NLFA 4UASA 2IZ1A 3MXTA 5CA0F 4ZJUA 4RVFA 4G56A 4R5HA 2ZRJA 2DE0X 2QAGA 3CF6R 2C5SA 4D8TA 5FRDA 5FO1A 2YOGA 3U40A 1L7AA 4IGEA 4XLTA 5ALHA 4WD3A 1RDFA 4WKNA 3C1TA 4F4UA 4IGIA 1UK9A 3GJ8A 5EKDA 3MJ4A 2AK3A 3S5JA 4B40A 3OCCA 2BE9A 3WL5A 4DYVA 3ZXXA 4OIFA 1W2GA 3S40A 2XODA 3NASA 4TTVA 4G09A 4ZQEA 4L9SA 1TF2A 1S8FA 2AXNA 1VA5A 3E82A 4P35A 4J1QA 2YS6A 5SY6A 3ZZNA 5JAPA 3UCEA 4E21A 3RHFA 3E5NA 3KQUA 1GQYA 1KMQA 1SZDA 1PLJA 3FWNA 3NWOA 4TKVB 3V5NA 1M8GA 1XMVA 2VSXA 3WLIA 5AVOA 1K4MA 1NGSA 2WTEA 4EEXA 5HQJA 3ZDEA 3AHJA 4Y6PA 1WAMA 5I7VA 1Q12A 3D3EA 1VMIA 1KFKB 1PHRA 2P4SA 3NM4A 1M2WA 4JAVC 5FBHA 3V34A 4PLWA 3UHAA 4I1OA 1T5DX 1RQXA 4YI5A 1PEDA 3PQCA 3S2EA 3FPHA 4N8SA 3HSSA 2ZROA 3N28A 4GW3A 2GXQA 2O2YA 2OHOA 1FQKA 3CQ9A 5IKPA 5K20A 1JQBA 5TPWA 5BRAA 5JZOA 3ER9A 3TFWA 2FGKA 4D4KA 4D98A 3G68A 3OMLA 1M7GA 5AQ1A 3G89A 3PFIA 3FNQA 2L0XA 4JJIA 3SMQA 2PNJA 3P9NA 1E2NA 1Z4NA 1JPUA 1QHEA 5EJ9A 3UK7A 4OLHA 1HMYA 4PX3A 3OZWA 3BMQA 2HIGA 4RY8A 2XYHA 4TLAA 3DBHB 4LOHA 1V37A 5HMMA 1QQBA 1YBVA 3A27A 1HX7A 1TTTA 3RRJA 2MYUA 1DCFA 1JTEA 3U6BA 2ERYA 1EK1A 3FYUA 1GQQA 1DKLA 4BMYA 4EHAA 3AM5A 3KT6A 1OB2A 3AVXA 2O8BA 1O5IA 4PBSA 3KKZA 1HY3A 1G8HA 1RLJA 4LXYA 2GZ3A 4MWEA 5AXDA 3ABOB 2OGZA 5ECGC 3SC4A 3EFOA 3KV3O 3LX4A 1Z3IX 2W4QA 4PCAA 3GT0A 3CG0A 3IELA 5A3VA 4CKEA 3IBYA 4RIFA 4Z1OA 2NQ2C 2R2GA 3RS0A 5BT8A 3B85A 5AW5A 1ZHOA 4IYJA 2PKCA 3PNQA 3JS5A 1ZGAA 3TTTA 1QG6A 1VCIA 1ZIPA 4P84A 1MXHA 4RHEA 4NPCA 3QEAZ 3MD9A 1NUSA 5K6TA 3VOBA 1NLMA 2ZB3A 1ZUD1 5ESWA 3U49A 1DBWA 3D6VA 1DKQA 1T0HB 4S1WA 5IAKA 3MTDA 2ZRFA 3OZAA 4KGXA 4ZC1A 5HFJA 3T94A 1N1DA 4FP9A 1LVGA 4RDCA 1DJPA 2AH5A 2WWXA 3B5EA 4PE5B 5K3SA 3WDKA 4IUYA 4E1BA 1VTKA 3C8ZA 1SJ9A 3LBNA 3CR3C 3NDRA 4JBHA 4IIGA 4LVOA 5LA6B 1S4QA 3W9SA 4XR4A 3K9NA 1GQFA 3PNKA 4LQDA 1FNNA 3W1WA 3B20A 5KTTA 2VWPA 1ZCFA 3Q5DA 4O4IF 4PHCA 2C8KA 3AU9A 3NOVA 4DBZA 5CDSA 3PD0A 1GZUA 3IEXA 2QNRA 3PJDA 4A1FA 1TAUA 4M76B 5DM60 3FPCA 1TU4A 2C97A 4Q3OA 5DE3A 4KFSA 1VDZA 4BQIA 1KI1A 1X3SA 4NMXB 1LX6A 3UMBA 1TVEA 2CB9A 1Q1EA 4YUXA 1KK1A 1LPNA 2VP9A 1CUFA 4ZXFA 3RUIA 4Q3EA 2HCFA 4RSGA 3S8MA 5FFNA 5E0OA 4PPGA 1ODJA 4DREA 3LT4A 4L5AA 1ZEJA 4FYYA 3ST7A 1M5UA 3VKWA 2FZGA 4LTDA 3K0CA 2QTFA 4IUBS 1LRLA 1M2HA 5IXSA 3IIEA 4PAGA 1Z83A 3SVTA 1LSSA 3ZW8A 1YVRA 2IYEA 3CMCO 2JCSA 2A5DA 1HZJA 2JFXA 1ZUHA 1NSYA 2PBRA 1YR2A 1ULBA 3DOJA 3FI0A 2FSUA 2V0CA 1VLZA 4MYDA 2X0FA 4F2PA 2QE6A 4ARCA 2FDRA 1HTBA 2Y1KA 2VIIA 3K09A 1H22A 1MO6A 1WXWA 1N36B 3I5XA 3IOYA 3GN1A 1GSOA 1Z2NX 4YIHA 1GG9A 1WDKA 3LLSA 1HDIA 1ZMTA 5E4FA 5EWMA 1XCOA 1WXFA 2ECKA 3NZEA 4QIHA 5CK4A 4NOKA 2DR3A 1RSZA 1DLJA 1GGKA 2LGJA 4MEAA 3STUA 2GHTA 2QT1A 4U2KA 4ACAA 5GJBA 2ON6A 1ZD3A 3L18A 3DULA 2FJPA 3GGDA 3SIXA 4PO3X 3LIPA 1L5HB 5J2UB 3UZUA 1PJTA 3FSRA 3JYNA 3KVYA 1T25A 5ETJA 4RM3A 4KUEA 4TMXA 4OKSA 3TTYA 1T29A 2I6TA 5A4AA 5ED4A 4P81A 2BFEB 4RXMA 4CFYA 1BX0A 2C59A 1E2MA 1JSXA 1Q14A 3G6KA 3KDAA 3OUZA 4KR0A 4QDKA 4RK4A 1ZSNA 5J23A 1Z0KA 3M6IA 2AYZA 5G4KB 3V1LA 4DA9A 3AB7A 3HJUA 3NHKA 4FHGA 2RK6A 5AI4A 2YQ5A 1UBFA 3A4IA 3EXEA 3O3OB 3R6DA 3T5DA 5BORA 4ABYA 5T8KC 2WSMA 2BGRA 3WGQA 1SCUB 3GROA 2HJRA 3I32A 4QFMA 5KINB 3MOSA 3ZBQA 3KOYA 1XTJA 4BRWA 3FWKA 1KNQA 1ATIA 3OT1A 3UPUA 5CHEA 3TMKA 2EF0A 4GPTA 4OQDA 2XB2A 1CNMA 2ZT7A 3NEPX 1UJBA 2ZE7A 4P4UA 3HZZA 1EPUA 4YQYA 5C0OE 1E94E 4FYXA 4C4YA 4KITB 5A4KA 1Q21A 3GFPA 3K70C 1PZNA 3I8SA 4DMGA 2L2QA 3QJGA 3ASZA 4OMDA 4K1LA 4PCLA 4WLEA 4CWAA 4YCNA 2I5PO 2FN3A 3OCJA 2BGTA 1G0OA 1FDUA 1HEUA 1KSFX 2EIXA 4R69A 3D4LA 4OHVA 4A27A 3NT4A 1ZBQA 4H9GA 1FX1A 1KZYC 1RM3A 2W58A 2WTAA 3JU3A 1W1IA 3LQ4A 3SEZA 4TQAA 3VM6A 5JQGA 2QYSA 3OAAA 2IHZA 1X3LA 3JD3A 3PX2A 4NAHA 1JB1A 4NZOA 3LHSA 1TJNA 2YH2A 3IE2A 3L7AA 4G63A 5JVDA 2OL4A 4EVRA 2HUPA 2FPIB 1T8UA 5DEIA 1T6NA 1NZDA 1VECA 2QG6A 5B7NA 5ES4B 1COWA 3THYA 4LF5B 3GDHA 4N76A 5FA6A 2X8JB 5F77A 4F3NA 1JVNA 4KCGA 2AOUB 1U8FO 1RKQA 1F4VA 4YP9A 1BMDA 4FLMA 1KPGA 3DR3A 1BCSA 4G5SA 4O4JF 4FHZA 1KOLA 3ZGLA 3AI2A 2IC5A 3H4IA 1SCIA 3FTQA 1SEVA 4G5GA 4PAWA 1A9YA 1F38A 5HJ2A 3QTLA 3DE0X 4F46A 3LBAA 2ZAOA 2C2KA 2ZK7A 5IKMA 5A5VA 4AMUA 1JIKA 3U4QA 3OHPA 2C4VA 3G17A 5FT9A 4QBFA 4QYIA 2NLOA 3G5TA 4G1UC 3DVAB 4UMEA 1W88B 1WXQA 3DV2A 1R0YA 4CYMA 4FBMA 4D3FA 3NHFA 1GQSA 2OBLA 3PD1A 4I7EA 2FX2A 2JDID 3VGJA 3TOCA 2NXNA 1FXWA 3QITA 4GG1A 4RXTA 4CBVA 4HVCA 4D0SA 5KYXB 4X1IA 1U3DA 3FKSD 1TT5B 4IDGA 4MVYA 1G6KA 1RT9A 4RTOA 1XMJA 4I5GA 1J99A 2RHGB 3NGLA 2C1XA 2O23A 4FD3A 5TGDA 3EF0A 3QI2A 4HFJA 3K4QA 2D7DA 2QBYB 2C03A 4I14A 4CV2A 2QY9A 4OX9B 2XUIA 1V71A 4CTNA 2NSJA 2QRGA 5AQEA 1R4NB 3JASB 2XQKA 3F49S 2QL6A 1JB9A 5DLQC 3GRYA 2Z3WA 4CMBA 1FTNA 2RH4A 3RUCA 2YMLA 3X1KA 3VR1A 1KEEB 5DXFA 3OHMA 1C8LA 4AZVA 2ORED 2ENWA 4JEUA 4ZJZA 1V1RB 4DIFA 5J5CA 3KVVA 4RTMA 3KV1A 3TRJA 1WPXA 3GFOA 2DWUA 3KJHA 1P7VA 1U6IA 1XMOB 1XAIA 2WUFA 2GYYA 3R0JA 1U0BB 3QUCA 2P3SA 2IYVA 2JBAA 2JGLA 2VUIB 4KDRA 2C9ZA 3GVHA 1B42A 2CD9A 2RJOA 3EZGA 4JMPA 4QOGA 1M1XB 1MJGA 2L69A 5BWOA 4Q6BA 5JCOC 1E2BA 4PBTA 4UNRA 5KPJA 2C0QA 4O8CA 3AP1A 1F51E 1VOTA 4KAJA 2BFPA 4US1R 2OPHA 2G8LA 3UXEA 3B13B 4ZAZA 3W7BA 5HOQA 4RIEA 5B4UA 4HNQA 4OK6A 4RJ2A 4DUGA 3OJWA 2AC4A 2JFGA 2JLUA 3JQAB 3MWDA 4H27A 1PZXA 4XRGA 2GEJA 2H63A 5A6SB 5C46F 4LBZA 2C5LA 4G0MA 3STTA 1E8NA 1W4ZA 2C42A 2XSZD 4NR0A 5FIUA 3REFA 4KB5A 4BO4A 4EARA 4FM9A 4B45A 2WJWA 4P3YA 3WGTA 5SZJA 1O5OA 2X0IA 3PIRA 4KDCA 1CF4A 5DGIA 1KO7A 5I9SA 1WCXA 3QMWA 2X76A 1NLYA 3BSWA 4KK3A 2XMBA 3IA7A 1GTG1 2XA2A 2Q3JA 3KFXA 3R3SA 3TB6A 1CQXA 2NIPA 2W7TA 3OF2A 4V02A 2GD1O 4QT4A 2FPGB 4INPA 4IZIA 4OL9A 3QEOA 5TVKA 4QXPA 2M6LA 3RH0A 1X38A 4YRGA 2HMSA 3T99A 1KK2A 2IYWA 3TRDA 4R6WA 1L1QA 2ZYRA 1QONA 4OYYA 1SKYE 2Q4TA 4H08A 4TTRA 2CXUA 1PR4A 3GOQA 1GCAA 3HDVA 1V11A 1XTIA 2A3RA 2DSTA 2R6GA 2QG4A 3K32A 4LJYA 3CW2A 3SYKA 1U28A 4PHFA 2SCUA 1KERA 2HJWA 1CR4A 1Z16A 2Q99A 4N3BA 4PYRA 3C98A 2XUHA 2PEZA 3TJMA 4G25A 2J0EA 3QX7A 5BW6B 4KWIA 3GU3A 1F2TB 1ZGZA 4BVLA 4EUFA 3AR9A 3E0XA 1A7AA 1K1EA 2ZBFA 5BQXA 1EAMA 9GPBA 1NJ2A 5EUMA 2V59A 2LP4Y 1GLVA 3P9ZA 2ZJ8A 4OKIA 4R84A 4AZ3A 4FDUA 2VSNA 4N01A 3RI3A 2DHCA 4UREA 5BQ5A 4PQGA 2D7CA 1JQKA 3H6HA 4COKA 3FFBA 4X8LA 1XKLA 1P73A 3G0GA 1SMKA 3FNHA 3CURA 4CNQA 2WFZA 5AK0A 4CKZA 4JENA 4DLBA 4C7OB 5I3CA 3MJHA 4EG8A 2J31A 1QZTA 4TQUS 4C6TA 2B8WA 2R60A 2UUOA 4FGSA 3I58A 2ACWA 3AR7A 2ZU0C 1AKUA 1E2EA 3EG5A 3EODA 4YJFA 1QH8A 3G6WA 1U2DC 5I7HA 3JQ9C 2ZFUA 3IPYA 1PZGA 5TARA 1VIVA 5IH3A 5LFAA 4HVLA 2PXCA 3WP0A 3K9GA 1BQ4A 1MNAA 3DE2X 4M9SA 3NCTA 2BYTA 2I2XB 1E0AA 4JLUA 4UNQA 4PLGA 2Y77A 4JN6B 4CXMA 1HYHA 1NV8A 2IUTA 1BVYF 1SR8A 2HO5A 1TZJA 5CUQA 4G86A 4DVJA 4W5HA 8OHMA 3O3NB 3R0XA 2XVMA 1WVMA 2RGCA 3H7AA 4FYKA 5K0BA 1YGPA 1Q16A 3I6IA 2X9QA 3K31A 2N1MA 3OPYA 3ZUGA 4MTCA 1JZTA 4QWMA 2XUQA 5TPZD 1GZDA 3HEBA 5F51A 5K09A 2JJMA 3C3KA 1WUKS 2CVZA 2VNKA 2PUCA 3HJFA 2PY6A 4IQ8A 3F6RA 2ZVDA 4ZVMA 1JBKA 3W6OA 2ZUBA 3SC2B 1XNGA 3CX4A 4N3AA 3VX4A 1IY0A 4HDRB 4HFNA 1NF2A 2NU6A 1Y7IA 2PQ0A 5IT9A 4ZOQI 4EGSA 4M4SA 1DC8A 4QGBA 1L2TA 4F4FA 1O1YA 4JVOA 2WMYA 3JWEA 4JBIA 5KSYA 2CV2A 1P2DA 1QP8A 2B9EA 4PZCA 2ZSHA 4UM8B 2DUNA 2JD1A 3G8BA 3QUQA 2Y1LA 5HKLA 2HMAA 1M5TA 1PS8A 1U1IA 4OUKX 1EFHA 1MENA 1P0MA 4P58A 1J1UA 3BAFA 3QWFA 2ST1A 2ZSFA 2ZUDA 3GLQA 1KAEA 5THQA 2F8SA 4E07A 4H1VA 2C58A 3L2OB 1QP7A 2POCA 3OPQA 3PXDA 2QLLA 3A26A 1TMOA 3V1YA 4XVUA 2H7CA 3D3WB 5ENDA 5EYPB 1PCXA 1XRLA 1ZD2P 1QNLA 4HLNA 1JGTA 4LYYA 4W9RA 5INTA 5F76A 2V6IA 5EQFA 3P0FA 5AUQA 2BCGY 4W7HA 3T9AA 3COYA 1RYNA 4XJTA 2R8PA 5GQSA 3MIIA 2XXBA 5IVKA 5ADWA 1R50A 3RLFA 1L7EA 3H0KA 5LJIA 1IXSB 1YR1A 3Q7QA 2D13A 1WHSB 5JSFA 1JKIA 1QO0D 3KL2A 3NPMA 5DW0A 3UC9A 4CKWB 1RI3A 2AN1A 2Q9BA 2WHYA 2OXIA 4U5QA 3OSUA 4IXWA 4PLHA 1A8UA 1LDNA 3LT2A 1C81A 3AF5A 3HSKA 2P0AA 1BJKA 3BWMA 4K6KA 3PZBA 4KW7A 4JLPA 3U5ZB 3G2LA 3ZCSA 3D6UA 3TLXA 2CNDA 3W8RA 4JJZA 1UPCA 4UCWA 1TADA 1P45A 2HZBA 5H4HA 3S2GA 5CIYA 1S1MA 4B82A 3HNRA 1TLTA 1VKRA 1JKJB 3DWFA 5EE0A 5FUBA 4BEBA 2HCTA 4YJGA 3RANA 4Z8XA 1GQ2A 4GUDA 1EVYA 3TAHA 3JQDA 3LV8A 3UWDA 4Q34A 2HJSA 3VUFA 5B58T 4EW3A 1DS6A 1X0VA 4XASA 5HOEA 2K6GA 2CBZA 2QA5A 3NP7A 1JDSA 5K0SA 3G82C 1P75A 3RBVA 4E2WA 4EHKA 1BNCA 2Z2ZA 5JBNA 5KWSA 1VXRA 2XF2A 3EJ6A 3WQSB 2C7VA 5LQMA 2A0XA 5DLPA 1SEPA 2GBIA 4TL7A 3SMVA 5H70A 5EIEA 1PV4A 4XWOA 3QEJA 1J97A 2LVBA 1GZ6A 5BN5B 4XCVA 4OGKA 3ZU6A 1USUA 5EUCA 4TUYF 4HDNB 3PSHA 3OCYA 4RTKA 4F56A 1XKXA 1OXMA 2G67A 2I6SA 3TMYA 3N7UA 3UW3A 4K88A 3K9HA 5B1IA 3EXFB 1Y6ZA 1UKEA 4YMSA 2HJGA 3AI1A 5ESXA 5K0EA 4E1AA 3WYAA 4L15A 4EO4A 1DZ3A 1RHMA 4B6QA 2PKRA 4KNWA 1N6IA 3LL7A 4ENTA 1F7UA 1OXTA 1Q0LA 3A1EA 5KNBD 2I87A 4JJKA 2ZW9A 2VJOA 2W8ZA 2X4LA 4L85A 2CHGA 3QHPA 1W44A 3L8YA 4WKBA 4CW7A 1A71A 2VEOA 3LA8A 3LVFO 3HDHA 5JBQA 3CO5A 4TT3A 1SUDA 3DE4X 4QYWA 1UBHS 2B0JA 3TE6A 1L7QA 2XGGA 3HGTA 2BM0A 3EXHA 1DQPA 5DT9A 5BT9A 2C1EA 1E79D 3KR0A 1XTVA 4BV9A 4DG5A 4RL6A 1G6HA 2MT9A 1DAHA 1DUIA 2FMKA 4L2IA 2NPFA 4CUKA 4CQMB 1CRWG 1A4UA 1XWWA 4GGMX 1OTYA 2NQTA 3PGKA 3DXZA 4IDBA 3S55A 5BR8B 3F7MA 2IXFA 2PUFA 5IBCA 1QIKA 2J9FA 2BTOA 3IUNA 3O95A 3PBKA 4Q7LA 4IMPA 1JH8A 2BV3A 1NUUA 3KRTA 3VQTA 5IM4A 1IXYA 4UBIA 2FWRA 1FTWA 4DV4B 5IAGA 5EHGA 3RBAA 2ZYSA 4R01A 2ATVA 1T15A 1JQEA 4M7RA 3LP6A 4I0WB 4YRAA 4ARAA 4BFTA 4F9TA 1HL3A 3ICWA 5EMNA 3CXRA 2DFTA 1N2HA 2A1UB 2JS7A 2UZ1A 1RYBA 3ZLJA 3SICE 3CSSA 2LBPA 5JS7A 3N8KA 3JAKA 2I91A 5EVCA 1U0JA 4WXMA 1E4EA 3HWSA 3I9OA 3OE1A 4XB2A 3HV2A 1CVRA 1EK6A 1WCIA 3FMFA 4UBMA 4EAQA 3IJ5A 3UENA 1PQUA 1XD8A 3MGGA 4J4TA 4UPVA 4COOA 3RYCB 1TQ6A 1R4MB 1ZYUA 2B0CA 2ZRAA 3BE5A 3BM5A 3NANA 5EY5B 5A1TA 3QE4A 3VISA 4NFYA 3U80A 3ZE9A 5IWAB 5A4MS 2NUAB 2ZREA 1XVAA 1QKJA 2OC4A 3I0ZA 2HCBA 2PLWA 2QN3A 2E89A 4GPAA 2X9LA 3L6UA 1T8SA 3HQ4O 3QQPA 4RA9A 4WL0A 3MWLA 2CLLB 3W4KA 4DV5B 3KKOA 3OLVA 4UDYX 3MFQA 3SBEA 2XUPA 4ZALA 3QIAA 3PA8A 1EKXA 1PG0A 3NIFB 2BFBA 3H9BA 4O2AB 4TPKA 2J9XB 1HC7A 1ZK3A 2QGNA 2WOJA 2CXTA 5BXQC 3T5AA 4B2PA 3EEOA 5JNLA 2P4HX 1KNXA 1YJBA 3PI6A 3KUCA 2EXXA 2IZZA 3OU2A 5JDIA 4YP5A 1K2VN 3MAJA 4DSZA 3I0MA 1W5TA 3AGQA 2J67A 2P11A 1HURA 5DV9A 1PVOA 1HFJA 3AF6A 2OLJA 2F4VB 1ISFA 2R5NA 3VDXA 4CL8A 4GIBA 1QR2A 4MKHA 3VU9A 1BA2A 3CLUC 4DV3B 5DXJA 3OOYA 1IM5A 5EP1A 2Q7XA 5IPFA 1ZL0A 3GFGA 1E9RA 1SQ5A 1H42A 3LVQE 4G67A 4Z3DA 5AVQA 2LCFA 4BMDA 1GAEO 2O59A 3SOZA 1U02A 4RVCA 5IULC 4FIDA 5AKLA 3DE3X 3E18A 5GIOE 1MHTA 4BPBA 1XTRA 4L3VA 3Q3EA 1PW7A 2GZAA 3QE0A 1KFBB 3KZNA 3H5RA 3CR8A 1GIAA 6ABPA 1A04A 1W5BA 4V0RA 2C99A 2F1OA 3O75A 5AJUA 3IX7A 1FFWA 2RBEA 2VK8A 3VKUA 1YJAA 2OXTA 4IFTA 3R9KA 1XVLA 2DY0A 4IJ6A 2GXUA 2AUTA 4LY9A 4MUGA 2QXYA 3BIOA 4QYMA 4O8ZA 4AUEA 1JHAA 1MA3A 5LC1A 3UOWA 1GJRA 3MWYW 5H9WA 3JRNA 5G0WA 3L79A 4DPMA 1TMKA 3M7IA 3ELYA 5BSGA 3KHTA 2QW0X 1P3DA 4XGIA 3I04A 3IULA 1Z5OA 1B0AA 3ETNA 4NOLA 2EF1A 2ZR7A 1QVZA 2F48A 3GMTA 4RK7A 2ZTHA 5E2BA 4E5VA 2OZKA 2FPLA 3ZH9B 1TEHA 3SJZA 2VS1A 4YQEA 2EWVA 3NORA 3QU9A 2P40A 4HQFA 2CXOA 3JQGA 3JYPA 4UU1A 2I2WA 1MOPA 2H9AA 5EPUA 2F9LA 4QPJC 1NBAA 3TUIC 2CZCA 2JJQA 2JRLA 3CZ4A 4I8XA 4Y1GA 3U0VA 2FZ4A 3RIGA 4CM9A 2FZKA 1PK7A 5CXXA 3UMJA 4Z4EA 5HKKD 1LLFA 1YCDA 4EPYA 5IC5A 5BNIA 1N77A 1Y3BE 3IDQA 1YTUA 1QLJA 1Y1RA 3TCKA 1UMDB 4X90A 4GKBA 1XPRA 3M4XA 4LECA 4MROA 2OSBA 1U90A 4ZJYA 2BCEA 5A02A 3IV7A 4B4OA 4CN8A 4DARA 5B1EA 5BWBA 5D3ZA 5BMOA 2HRBA 1JHVA 5NLLA 1IZ9A 2VQDA 9LDTA 4ZZ1A 1OJ7A 1RWKA 1S89A 3T9CA 4BLPA 3CN7A 1I4TD 1Q0UA 3UQYS 3EULA 4UU0A 3I76A 4TMTA 3SFVA 3QVWA 2I2CA 4GR5A 4ZDWA 3JW8A 5KYKA 3EIOA 3C7CB 1FU4A 3AO0B 2IP4A 3KVRA 1GU1A 1NVAA 3JPYA 5IKOA 2V8BA 2ZJ2A 4TYNA 1ESEA 4A73A 3VPAA 4Y1FA 3TDKA 2WJAA 3MQFA 3QPUA 4JJEA 1VHWA 4ND2A 2RHLA 4FZVA 4LHSA 5AO9A 2R5WA 4F91B 4RDHA 4DHEA 1V39A 2J3MA 1RPNA 1XQ6A 1RCFA 1JI3A 3ZWMA 2GF2A 5BW5A 3OZGA 3K70D 3VPBA 1XYVA 3BXXA 2VXCA 1HO3A 2IBTA 3ONNA 3R0QA 1CPYA 1QHGA 4V03A 4YJ2B 5AWFC 1L4EA 3DHNA 3V8MA 2E6KA 4NENA 2HEIA 1CY8A 1N2BA 4ZV9A 1Y8ZA 2ARKA 4XPIB 1KO8A 1L9KA 1Y1PA 5D3MB 3V9AA 1C14A 1FTSA 1KHTA 5JO0A 2B4TO 5D51S 3COPA 4ZOLF 2Y9PB 4JEHA 2BSQA 4JI7B 2NZUG 4NKRA 4HAIA 4ZVKA 3BWVA 3LBFA 3FE2A 4R1LA 1QQTA 3OIYA 4UAVA 4L6IA 2R8YA 1KR2A 5LXTA 2JI8A 2WVGA 3BK2A 1SC3A 1C3VA 1VBFA 2O2GA 2F3RA 2QMZA 1JT9A 2CLKB 3BJEA 4GSLA 5FWXA 1UFVA 2CNBA 3RRNA 4BFLA 2WUDA 4Z0TA 1F1JA 3A6JA 3LBIA 3I01M 3EPHA 4R6XA 4L78A 1ABEA 1HDXA 3L82B 5JCXA 5ALEA 4JMLA 2FI1A 5BOSB 2FOXA 2TMYA 3FVWA 3KAPA 4OK3A 3P2MA 2FG7C 2MMGA 2C2HA 1M2GA 1RAHA 2ZBVA 5FPTA 2KPOA 4TM8A 2GA8A 3G2JA 2NZ2A 4HDSA 2R6DA 4IAOA 4NCXA 4U0KA 3S3TA 2QROA 3BDIA 3BMNA 8ABPA 5F64A 2O3UA 2DP4E 4B44A 5A3JA 1QBGA 4MIEA 1UWCA 2JFZA 1PGQA 5KTYA 2CXSA 2PAAA 2CGEA 4B5KA 2WIJA 5HHTA 2ODNA 1YUMA 1XA3A 2I6XA 4XARA 3QW4B 3T9DA 5LLTA 4DB2A 1T4CB 4MRPA 1EINA 1PL6A 3LLMA 5SV2A 2O0KA 2LW7A 1PUXA 2RC5A 4IJVA 5A9SB 3B1ZA 5I9LA 3QTTA 2BEJA 4DCPA 3L7LA 1L5RA 3SM9A 3W2TA 4HMPA 4OREX 4BVKA 2Q3EA 4LSGA 1SKAA 3C8MA 3OM1A 4LZNA 5KYUA 3F2VA 3TS1A 1O89A 1ZH8A 3EUAA 2I7XA 1T9DA 2AS0A 4LV8B 1PR9A 5G4LA 2Q6VA 1Y89A 1QNFA 3FXAA 5JO9A 4BNIA 1A72A 4ITRC 5IRCD 4EX7A 2OV1A 2FWPA 3IS3A 2XBLA 1KH1A 3SDZA 4ZEXA 5JSZB 3GLGE 5LL6P 2MYTA 5EJEA 3HO8A 3R7LA 3FETA 4DGQA 4X65B 1I94B 2V6GA 5C1OA 2VDQB 2H5JA 4JKIA 3PYMA 1TA0A 4NG5A 3K6JA 4QUEA 2JFPA 1EG2A 1KP2A 5KYVA 4WZAB 4PZZA 3ESCA 1UMBB 3CWZA 3DE5X 3F9CA 1Q2UA 2QMOA 2AK2A 4CFSA 4H17A 4FD2A 2CHQA 1QH9A 1BXKA 2PL1A 3DE6X 3HO6A 1TKRA 1ZD5A 3KVOA 4WXEA 2DTEA 1QP4A 2XQVA 2B7LA 2W48A 3HBMA 1UPFA 4ND6A 1OVGA 1F2UA 2QTMA 3HY3A 3NTOA 4LC9A 1MD9A 2ZJZA 2GAIA 2I80A 5F3DA 4Z1MD 1BKSB 4JWTA 1P18A 3UUEA 1E1QA 3TM4A 4WEQA 1RYZA 5K0CA 1YL7A 1H69A 1GTL1 3DLCA 4KNVA 3W5DA 4X60A 1C1YA 2RHWA 1KYYA 1SNYA 2ZB4A 2C92A 5ULLA 3RAJA 1PJBA 4J0CA 4HF7A 5F1PA 4EBFA 2BGJA 2Y1DA 3K6SA 2WD7A 4NU8X 3TVYA 2FN8A 4HWGA 1IZ7A 1SVWA 5DK6A 2C29D 5AESA 4F3RA 3EGIA 1YZYA 4HLDA 3ZD8A 2G9UA 2NSHA 2NYVA 3DTVB 1MDFA 1XEAA 2I71A 3H05A 3LP8A 2FSGA 1I5EA 5COQA 3RIXA 1WS6A 2X1VA 5K4AA 2IXDA 3G2KA 3LCUA 2ZPUA 2WIKA 1VA4A 4MKFA 4U7GA 4OGWA 1EFAA 1LS6A 2ZBRA 3T7TA 2UZ0A 5CT9A 1RFGE 2J45A 1L4LA 3P71T 4QYTA 3R6GA 4EKYA 3QHAA 2GTHA 3S29A 2I4MA 2R97A 3PRJA 9LDBA 2XWBF 3H1GA 3K3PA 5KKAA 3FG9A 4H2DA 4B4VA 3WL4A 4D97A 3F8SA 4WNAA 2VRCD 1LPPA 2Y1XA 3STYA 1K7SN 1V1MB 1NBMD 3FFAA 4KRFA 3Q9UA 2GPNA 3MRTA 1MZVA 3GGJA 2UYGA 3T1HB 4KQEA 2I78A 1R0XA 3AH8A 4HH3C 4KR7A 1I2AA 1O96A 1H1LB 2FK8A 3LOUA 5K2OA 4GLFA 4AKTA 2VNAA 5EZSA 2I55A 4KVFA 2BF7A 2BFDA 1ITZA 1C29B 2LUOA 1JAXA 2DBYA 2P1DA 2Z8YA 3G2PA 3OIVA 4JDUA 3TD2A 2FR8A 5AXAA 3UMSA 2QP3A 2OKCA 3VUEA 3VU1A 4YRBA 3NATA 5E3IA 5LQNA 5A7FA 1OIXA 3KHUA 3DOFA 1SWVA 1Q1AA 4RKFA 4W8GA 3II6X 1JTFA 2G6TA 4DA0A 3ZKAA 4UQLA 5DIZA 4I4NA 3BZWA 1M2FA 1D2NA 4IIUA 3WV4A 4A2PA 1MVOA 1RM5A 3HUEA 5CYFA 4YT2A 4EJ2A 1BSVA 2W11A 2C4WA 3WNCA 2CLOB 5I47A 4F3TA 1T36A 2B37A 4AICA 1KYXA 3EVBA 1JNYA 3A6GA 4IL5A 3C24A 3L0OA 4F3YA 5AI9A 3FTPA 4BCBA 3BGWA 1JG7A 4CEJB 1MABB 1AGYA 3OLWA 4OSPA 5LP6C 2DPXA 2XDQA 2XOXA 4EZEA 3H5NA 2GZRA 4UXHA 3TG8A 4GYJA 2HQRA 4W8OA 3WKAA 1JEOA 2NX2A 4NONA 2TECE 1WBBA 4ARUA 3EXIB 4IILA 4UHHA 2QKYA 4YFYA 3TGWA 3N0XA 4Z4QA 3KX2A 4GFDA 4X91A 1X7XB 1ZZGA 4H18A 3PRKE 3H8SA 3QTBA 5CX1A 4Q7QA 5K3EA 2J5BA 4MUKA 1SKMA 4I4TB 3FWZA 1Y7TA 2AJTA 2OXRA 2JKVA 4L7VA 4S2UA 4XDZA 5MHTA 4UTVA 1BC5A 1FLVA 1CUYA 1CQZA 5JJIA 1OCEA 1TEXA 2PJZA 5IW8A 3ZH2A 2FRDC 4DCVA 1YF3A 3ZE1B 1TX4B 1T2AA 2NP7A 1E6WA 3UAZA 3CSDA 4E6EA 4CFZA 3SZ3A 4ZT3A 4RTQA 3RRYA 2YW2A 4E08A 1E2KA 4UBKA 4B73A 3GO4A 2OAGA 1QE3A 4NCIA 2DFKB 2HU2A 3GLRA 4LVNA 5AD1A 2OZVA 3IODA 5D5PA 3C7TA 4ARZB 3DL4A 2EQ5A 3PNVA 1R6TA 1Q6ZA 1I14A 1E5DA 1D2AA 1I51A 4LRUA 3GLUA 3BBPA 2GI4A 2X7JA 3HS3A 4GL4A 4UVIA 4BMVA 3RG2A 4YUYA 4TLCA 1NIJA 4HEQA 5I5GA 4RMJA 4ZAWA 3VVCA 3OQOA 1Q95A 3GLFB 4DSUA 3FMGA 4M36A 2QL9A 1SG6A 4PYJA 1Y48E 1ZWLA 4KLZA 2AFHE 2XVZA 3IT1A 2Z2XA 4WZ6A 4R9VA 2NUTB 2EKBA 4WBNB 2ZUVA 2GDJA 2WV9A 1N2XA 1RPJA 3N3AC 5FADA 1ABFA 4KFUA 1V41E 3GP3A