4C1BA

Esterase domain of the zfl2-1 orf1 protein from the zebrafish zfl2-1 retrotransposon
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
171
structure length
171
Chain Sequence
GPAMDVAIIGDSIVRHVRAASSKGNKVRTFCFPGARVKNISTQIPTILGAAESPGAVVLHVGTNDTGLRQSEILKKDFRSLIETVRRTSPATQIIVSGPLPTYRRGNERFSRLLALNEWLITWCKEQKLLFANNWNLFWERPRLFRPDGLHPSRAGAELLSDNISRLLRTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ORF1-ENCODED PROTEIN
publication title Structure and Properties of the Esterase from Non-Ltr Retrotransposons Suggest a Role for Lipids in Retrotransposition.
pubmed doi rcsb
source organism Danio rerio
total genus 54
structure length 171
sequence length 171
chains with identical sequence B, C
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12690 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c1bA01
3.40.50.12700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c1bA02
4C1BA
chains in the Genus database with same CATH superfamily
1NAHA 1WB4A 1OQAA 3DXZA 2VRWA 5DP2A 1QRTA 4A8TA 1UBCA 5EVCA 2BR4A 5L3SA 2CSXA 2DUUA 2QLTA 1KYTA 2JEYA 1L9XA 4GZ5A 3HXOA 3BFJA 4HV4A 2I2WA 4V38A 3TVDA 4G0OA 3IKVA 3UMGA 5DM60 4EEXA 1GPKA 4KR7A 3I28A 2O8CB 1QP8A 1IMJA 5ES4B 1EP9A 3AOGA 3WKEA 1LPBB 3MGKA 2W7TA 3EFOB 3L0IB 1TPZA 3MJDA 1DJNA 1ODJA 2ZRQA 4EL0A 1DG3A 1NQOA 4D57A 3DW3X 3WAJA 5EHIA 5F52A 3EPJA 2FG7C 1LVGA 3FHLA 5TARA 2J59A 1PG5A 1C7QA 1E2UA 1Z16A 2FPIA 2I6XA 2Y93A 3KQQA 4OUDB 4F84A 4OA5A 2I3AA 5CFZA 2P6RA 1KYYA 1TK2A 1KSJA 3ANMA 1KOJA 3G6WA 5G0VA 4Q7QA 5EJ8A 1BRMA 1NMEA 4EPRA 3QEJA 4OXKA 2P3OA 5HR5A 4TXMA 4C0SA 3LBAA 2P9HA 3UMFA 2AE2A 3OZAA 3KAKA 3G2JA 3BAZA 3PL1A 3GAZA 2A9PA 4UNRA 5AUPB 3ZLBA 3GVHA 1FOEB 3VTKA 3BF7A 2C83A 3C15C 3P5BA 1IJBA 3I9V6 4Q4LA 3L8FA 1QTNA 2VSNA 2W37A 2W11A 1GKIA 3AUKA 3BIXA 4HUQB 4MQ6A 5I4KA 1E4YA 3PPVA 1GAXA 1C0PA 3B6EA 9ABPA 4DB2A 2PZ8A 2VOJA 3BJRA 3IVCA 3JQEA 4GLFA 1IQRA 3IBFA 4O4LA 4OMCA 3RTCA 1FJ2A 3B2QA 1JLLA 3BJMA 2JI7A 4AKHA 4ID3A 2BFDB 2EZUA 3OJLA 1CUJA 4TOIA 5JSFA 1LLQA 2FR0A 5H5JA 3MJFA 3VPXA 3LA8A 1W75A 1KJ8A 4L3VA 1B0AA 1U0GA 2MSLA 2EX4A 4XRRA 2Z04A 3NNNA 3DBVO 2ICAA 2QUZA 1AGNA 3IHKA 1NBAA 5EIBC 3G2QA 3WKDA 4YAEA 5KKNB 3SJ7A 4MW7A 1A9OA 2P35A 3OJWA 3HWX1 3CINA 4ICIA 3CEAA 3HKDB 3JWGA 4KO4S 4QU5A 1VMIA 2I3DA 5EE1A 1D1TA 3INTA 2OY0A 4AG3A 4EUEA 3BS4A 4WV3A 4KI0A 3PA6A 4RKYA 3GMTA 4BLPA 3WAGA 2OQIA 2WF7A 2W83A 4R54A 4GNKA 5BSGA 3MCAA 1BWSA 1NNEA 4MSUA 5CA0A 4BGEA 5C35A 1IFXA 1MJGA 1TO6A 4IKPA 3S2ZA 5B6IA 1U7OA 2AC2A 1JDPA 4C4SA 2ZXFA 2ZS8A 3MCUA 2I66A 2QRHA 3C3AA 1B23P 1ZLYA 1M0WA 5AXBA 4X3OA 3JRNA 4FYWA 3OQOA 3A4YA 3OZVA 4NAVA 5BMVA 3I04M 3LDFA 3HXMA 1KQGA 1M1YB 1S8AA 3EXAA 4L02A 1ZMBA 1RSZA 1CX9B 4LOAA 3TZKA 2H8KA 4PZPA 5IXYA 2F6RA 4HH4A 4DA6A 3BUSA 2UZ1B 4QBIA 5ED4A 3DZGA 5KVSA 1AQLA 1EEXB 1EHIA 2WB4A 3D43A 4M7RA 2F00A 5AM5A 3ZY6A 4GDFA 2IDJA 2JFYA 2F3SA 2NU6A 4ZAGA 4FFNA 5A5FA 2GPSA 1SUIA 1ZIYA 4KLRA 4LS3A 1EUDA 1HE1C 2GPJA 5B1SA 4CTMA 5LOVB 2ONKA 3QLJA 4LBYA 1OV4A 3QFCA 1NNLA 4GP9A 1VPEA 1SHJA 2PYIA 2J09A 2IXGA 3EIWA 1W9HA 2Y92A 3KSRA 4RIGA 4A92A 4LV5B 2WQZA 1TM1E 1F0YA 2RKBA 3ZIDA 1Y7IA 4DDHA 4DN6A 4DMMA 4ZI7B 1W0JD 5JS8A 2QTCA 1G55A 2GK3A 3H19A 3WMRA 2WTMA 3G2NA 3HJAA 2HJRA 4QQ8A 1T0UA 1Q1AA 1CWUA 3GLVA 1Y8CA 4W8HA 1KPIA 1OZGA 4Y0NA 3WYAA 2N47A 1VXRA 3NO4A 4GW3A 2A67A 2POCA 4PQGA 4RESA 5IEBA 3BKXA 3U3KA 3H83A 4E6PA 4W8OA 4FW8A 4RV9A 3UYLA 4LX8A 4JJ7A 1VCNA 1XNHA 1YDEA 4WK2B 2Q3CA 1R8SA 1OZ0A 4QFDA 4XD2A 2QPAA 1UWCA 2VDWB 1JEAA 1F0NA 4QEDA 5KHAA 3D7RA 3C3CA 4YT4A 5EG5A 2PUAA 4PQEA 4Y2RA 4F93B 4UU7A 1N3IA 4ETMA 2ERXA 4GQAA 4TKVB 4BUCA 5I7HA 5FTKA 1M9NA 2YR0A 3PUIA 4HVCA 1B26A 4KFTA 4P38A 1Q20A 1O95A 1U0RA 3RWMB 3I52A 3ZHYA 4A2PA 4UFPA 1NP6A 3P9KA 2VO1A 4CG1A 2WAYA 2AS0A 1QF7A 1J33A 1CY8A 3TL2A 4PXSA 3T3GA 1K5PA 4HYQA 1YKGA 4I9HA 3VH4A 4PGAA 1YHNA 4YYZA 3OWOA 1KQOA 1OFUX 2XD9A 3SIRA 3UPDA 1JPUA 3LXRA 3G6KA 4PWYA 1Q0RA 2HIHA 2FXVA 4XI9A 1YI0A 1VE1A 1P9NA 1DEXA 1R5BA 1RLIA 2JGMA 4QO7A 3TLGA 4KYTA 3VI3B 1NBME 1NL3A 1L5RA 3GFBA 4IHJB 3UWOA 1JAZA 3WL8A 9MHTA 2INGX 5KUTA 4I19A 1XLTA 3EF0A 3V8PA 2WDZA 3TJMA 2OQVA 1NU6A 4R9NA 1HE4A 1QR2A 2Q5LA 1TTTA 3EUEA 3QV1A 2HO4A 2VDQB 4HATA 4YGXB 5CB4A 1W2HA 1TM2A 1PD0A 1CJMA 1RAIA 2AN1A 2BGJA 3P9XA 3V1UA 4J75A 2W8ZA 3VGJA 4BRWA 2AOXA 4HWKA 1PNVA 2NU7A 1NXSA 5K20A 1VJTA 3ANNA 3BM5A 3ID6C 4KXXA 3H11B 4OGGA 5EUCA 4QPDA 5J2UA 1KYZA 1RZRA 2HW8A 3GJXC 3TXYA 3B7PA 4EG6A 1XKXA 1OWLA 5IVHA 1HNNA 1W2WB 3HB1A 4LVUA 4GX1A 1J09A 4AO7A 2H52A 3R3JA 3GLKA 5DV9A 3L43A 1MOZA 1OVGA 1Y4DE 2YV3A 3CNEA 4HJXA 2O54A 3D7SA 2CVHA 2QLMA 3NDRA 1DJOA 4M55A 4NMWA 5L3SB 3C3DA 3PT9A 2P5SA 3NP9A 3UMVA 4L4XA 1XZAA 5FD8A 3SKVA 4HNAA 4ZT3A 1Y6ZA 3WLTA 4C2AA 5B1HA 1O9BA 1QO9A 1U0LA 4Z8XA 3PNKA 4LRYA 3NASA 5FDFA 1EI9A 5JD5A 1JG1A 2HF8A 2R96A 2DBZA 4DSUA 2DKNA 2C8LA 2AEEA 3BHNA 3ZHQA 2DWUA 1DBPA 2Z98A 1WXEA 4N3AA 1JKJB 4M1QA 1PLLA 3IA2A 2X3UA 2Y76A 4P7FA 4XDGA 4WZAA 1YASA 4ZTUB 1FF9A 5F78A 4TTAA 1M67A 4YJKA 2OSBA 3BGIA 3H1FA 1PYOA 2OXRA 3HDHA 3SFZA 1NVEA 4COKA 3V34A 3EVTA 2E49A 1CP3A 1D1PA 3BVPA 2FLWA 4D4JA 1VGQA 3MAAC 4R40A 2I62A 2IP2A 5KYTA 1ZGHA 2D59A 4XZ3A 2IUUA 1LX6A 4Z4IA 3FVTA 1SCUA 4KE9A 5TC4A 1JVNA 4EF5A 1Q7TA 3TCKA 4CMIB 3WQHA 4QUHA 4G5QA 2DUWA 3C7DB 1KDZA 3L8MA 3EPLA 1FFGA 1EBFA 3MSXA 3NI2A 2Z56A 3HJFA 1D7AA 1UINA 4EW2A 1X9IA 2WMYA 5T3YA 4WJZA 1QMPA 4NHEA 3ANXA 3SQNA 3BL6A 1N6RA 2BY4A 2HJVA 4MW4A 3BIOA 3RKRA 3RUIA 3R8FA 1PNQA 1NQTA 1ST2A 1JLLB 3EIQA 4CU2A 1WBBA 3UUWA 4JBHA 4DPMA 1O0CA 2VTEA 2ZE8A 3JSAA 1CFZA 4QNRA 1G5QA 1XTSA 3I01M 4PLHA 3WGUA 2I29A 3F2IA 2WK1A 1C1XB 2IIQA 3AW8A 4PZ0A 3FOCA 1A0OA 2J3HA 1LLFA 1RAAA 2E4AA 2PU7A 1AQJA 3E81A 3ANSA 2YICA 4JXJA 4C22A 8OHMA 2B36A 5IDVA 1YJ8A 1YCDA 3OD5A 4QOSA 2C96A 1XRLA 5FUXA 4EJFA 2P77A 3VDQA 2GNOA 1LEHA 4B0PA 1JSCA 1KOFA 2NGRA 3I6IA 2KWIA 2FPWA 4CKYA 5KC9A 3OFSA 4F3YA 4IG9A 1U1FA 4ZCQA 3TBFA 1K6MA 2GEDA 5MFZA 2WF6A 4PS1A 1OH5A 4IUYA 1N36B 2D7DA 2WG2A 1I7PA 3ELDA 4L78A 4OXRA 3P94A 2RK6A 2WJGA 3NIWA 5DHTA 1MTOA 3HWWA 5EMJA 4YRCA 3RT1A 1X74A 4XIFA 2AEJA 1GNPA 4D8TA 3A6EA 4R8MA 4BN4A 1R88A 3QUBA 4INPA 3JV7A 4K03A 2D4HA 4WIAA 5C8YA 1C3EA 1XAHA 2VJNA 2Y0BA 4QX6A 2FH5B 3C87A 4DMFA 2ETVA 5K4GA 3ZHZA 2CYBA 1A5AB 1QZTA 3SHWA 1YBFA 2O2ZA 1H4VB 1IXRC 2GN6A 3FF1A 4O4HB 1M10A 3QA3E 4BVFA 1O97D 1UT5A 4EX6A 4YUWA 2X5OA 1VM6A 4WNAA 5DTJA 2XAUA 5KPJA 3C1AA 3DW1X 2EQ5A 3LUCA 5KYXA 2EF1A 1UBHS 2JLUA 1A4XA 1KH1A 2DY0A 3RJMA 1KR2A 1GVNB 3PIIA 2NU6B 5A3QA 3EQZA 3F9RA 1BCRA 2JCSA 4K6CA 1FYDA 2J08A 1B43A 4MGHA 2RBGA 3QY0A 5ALQA 5DWQA 2G1JA 2C4TA 3ASUA 3E22A 4MYSA 1VYVA 3PFIA 2I1LA 5CH8A 5AJUA 3RC1A 1QP0A 3AFOA 2XUJA 1U28C 5IS2A 3W7AA 1GGFA 1MO3A 2SKCA 1RU3A 1G0NA 3EC2A 3LUGA 4FYHA 1RHQA 3D3EA 3T7DA 4BKMA 4DLXA 1GGMA 1N1GA 2F64A 1TA0A 3HDTA 3IH5A 1JIQA 2OZKA 1THGA 4TTVA 5FOUA 2R7MA 4LC9A 2AOUB 2AJDA 2WA2A 2GYVA 1RXCA 2BEJA 5HCNA 5IXJA 3FCCA 3AIOA 1OIXA 4BFWA 4LDJA 3QLEA 2P9BA 3RUCA 3OZXA 1JA1A 5BORA 4H7EA 1M34A 2XGOA 5KTYA 4MWEA 2VAPA 2ZYUX 3PQ3A 4RQAA 4HGQA 3AJAA 1XRMA 4HN4B 1NVVQ 1MG0A 3ON5A 4KPYA 4UXHA 1P80A 1Y0BA 4XYEA 3TIFA 2RGRA 1UWVA 1JG3A 1A3CA 1RPNA 5HTKA 4EUSA 3VR4D 1VFNA 5JCXA 3A32A 1J0BA 3G8YA 3AJRA 4YIKA 1NUTA 4ZCMA 1RYHA 1HOXA 1LPNA 1UMCA 5AW6A 2BRUA 4QA9A 3PA8A 1T10A 4KITB 1OXBB 4YH1A 1CS0A 3KB1A 3LKZA 3T3EA 2AG6A 3G3EA 2CNLA 3COVA 4F96A 2VF7A 4YAOA 2QJWA 3A10A 1D4OA 2YV4A 3WXMA 1I2DA 2WWWA 1F51E 5B7GA 4R7ZA 1T8PA 1U11A 5K0BA 5EFOA 5KQPA 5B2FA 2VQEB 2VVTA 4DQVA 1VHTA 3SSAA 5DH9A 3X1MA 3F4BA 4IHKA 1R5JA 4OA8A 3EZ6A 4ND6A 2YFQA 4N3CA 3RSFA 1K8YB 3B3FA 2OV1A 1NWHA 1H0KA 4LCJA 1FP2A 2ZB2A 5JI3E 1UFRA 1NURA 2JEZA 3OFKA 1CG6A 1NVAA 4JCCA 4QOEA 1I4TD 1UKCA 1NBMD 1MQ8B 1SRQA 2B5WA 3FPAA 3M9XA 4JR1A 3ZNOA 4IWYA 3T38A 1NM5C 3CISA 1Z06A 2V7TA 3LGSA 5JLJA 2BYTA 4EMUA 5CB4B 1XT6A 2V6MA 2ESRA 3RPEA 3KFLA 4OFXA 5FNVA 1M6YA 2J67A 3QI7A 2B1RA 1OLUA 5EWMB 5KWJA 4EVIA 2NU7B 1ODTC 3OKAA 5I7FA 1CC1S 2Q9BA 4W6ZA 3MUFA 5J2UB 5FUMA 4PBTA 3ENKA 5DX0A 1JR2A 3SC2B 1B41A 2ZIEA 2HWWA 1GA6A 3BHMA 3RODA 1XPUA 4R9VA 4KQEA 5G02A 3ICEA 4ZQFA 1C8VB 2OORC 2XCLA 3DTYA 4US1R 5A04A 1ITZA 5A1JA 3TLKA 4OSPA 1V8BA 1E9EA 3KJFA 4UNPA 4BU0A 5IZCA 5AVUA 1A1SA 3OJCA 3TSOA 1FNBA 3GJ0A 4V2UA 4C6SA 4GDMA 1I7DA 1GNRA 4RMJA 2JJMA 2UKDA 3KHUA 3M6FA 1NVDA 2G9RA 2D1TA 4U7PB 5TPWA 3S5JA 1G8SA 5B6JA 1Y1RA 1RJ9B 2O2CA 4RQUA 3T61A 1XI2A 4L72A 3W05A 3B13B 4GC9A 3K70B 2AFHE 5FWDA 5ER9A 1RIFA 1SPBS 1XCOA 2H5EA 4LZAA 5JDCC 3QUCA 4Q4CA 1IEWA 4WZAB 1UPAA 4LQLA 2HTFA 3RUFA 4BNGA 4MV9A 5KVQA 2FFAA 3CCBA 2Q0SA 1Z7WA 1WXIA 2C3PA 2OFFA 3HGTA 4LJ9A 4N0DA 3W7BA 1P1JA 1QGUA 2QTBA 3JQCA 4L3WA 4Q7JB 3RCBA 3T9BA 3HUDA 4OSOA 3A6HA 3G79A 2R6CA 3S1SA 5JRJA 2VSYA 5ESXA 2C4WA 3DE1X 3N2YA 3EIUA 1NVGA 3MMPA 1DKNA 2XCIA 4Y7CA 4Q66C 4XWGA 1QIMA 1H5QA 2CL0X 3T1VA 4BNZA 4NBNA 1LPPA 5SZKB 2Q3JA 2IEZA 2QTLA 4A10A 4LBVA 4XUGB 1U2GC 4UCWA 3MM4A 4UPEA 2KJQA 1CQJA 5IJXA 2O0JA 4Q9JA 1IM8A 2COEA 1Y8RB 3FWZA 2NQ8A 3GDOA 1SHZA 3Q40A 4L5JA 1VBFA 1JFTA 3E8SA 1VC2A 2GZ3A 1KY4A 1RBYA 3B82A 4JLUA 5D1NA 3VDMA 3U56A 3GQBB 4BX3A 4UBKA 3MQFA 1UC9A 4IX9A 3I9MA 3NDJA 4AJEA 5CNKA 1LDEA 2YWDA 4HNSA 4MKHA 4TVOA 2E4XA 2WIGA 3FNHA 2XB4A 3IEIA 3OZCA 4FJ2A 3M6WA 4QLOA 4DCCA 1GV1A 1PD1A 2VDNB 1TADA 3ZWMA 1Z4OA 4HWTA 4RL6A 4MULA 1LDMA 3BMQB 2A59A 1MD9A 4P7BA 2H4FA 2BBWA 3EUWA 2YXEA 3PCXA 4RY9A 1LFDB 3ACBA 3E3MA 4TMVA 1JHYA 1T6BY 4OO3A 4OVKA 5FPPA 3USES 5CDYA 5DBEX 4UOEA 1W8IA 3FH0A 4RK4A 5CW1A 5A9SA 1A8SA 2OFPA 1E6MA 1R6BX 4N5DA 1J5XA 3HK2A 1DOAA 3PEUA 2ZOSA 2HR1A 2CJWB 4PZDA 2OB1A 1GJRA 2PH7A 4IV0A 3LAWA 5FR1A 1Z4MA 4WINA 3EBLA 1T35A 1RJDA 4R1TA 1K68A 3A4IA 5DIFA 2DFVA 2OCPA 5TT1A 2PKEA 3VJMA 3KE8A 4KFSA 3TUZC 2UZ0A 1NOJA 2WWHA 4D82A 4M21A 2O1SA 2CFCA 3PFBA 4IFIA 1NBWB 3NXKA 4K1LA 3N2GB 2PZFA 3V5NA 3KJGA 3WLHA 1N1DA 5KU7A 2C7PA 1WA5A 3M6LA 1ESEA 2XIQA 5JXHA 3A2NA 4I4NA 3H7AA 1JW9B 2RHDA 3ED5A 4RELA 3DMHA 4UOZA 5B12A 2PLNA 3REQA 3DP9A 3K1ZA 4E15A 4X3PA 2LCFA 3ZNPA 2PKYX 2VP9A 2XPCA 4I8DA 5P21A 2F9FA 4TTJA 1USWA 2WVHA 2Q28A 3E22B 4GI7A 2VYNA 2AXEA 3FB1A 2QUAA 2VJMA 2Q9CA 3BRWA 2B83A 3NWBA 5CX1A 1HA3A 2ZE6A 1Z0UA 3C39A 3LWZA 5LZ8A 4G1MB 1RXWA 1PFYA 1PL7A 4UVDA 1YMUA 1E3SA 5LA6F 3U4AA 4DANA 5EHGA 4DBLE 4LTDA 2LZ0A 3HP4A 4ZEMA 4OHMA 3FTDA 3K71B 3LWDA 4XWOA 4R3UC 3BERA 4XSVA 4MDFA 1RAHA 1YO6A 2QRZA 4ZYTA 3VBEA 4NRDA 2W2KB 1KDRA 5JMOA 3NAGA 1ZGJA 2OHJA 1IUOA 4CETA 2GF2A 4FOLA 3ROTA 1BHSA 1PQWA 1M6NA 4EG8A 1D0IA 1E7WA 4LJAA 3QG1A 2M6SA 2X8BA 5K6RA 2AUNA 4OQDA 4XLTA 3TVTA 2BEVA 2Z1MA 2YJ6A 1FA9A 4MS1A 2ZRHA 5CHYA 1R0BA 2QMQA 3KP1A 1RJEA 3MNFA 2XSZA 4KQ2A 5EFZA 3X1KA 4D0SA 2XF8A 4BNIA 2FX5A 1UMCB 3DB2A 5AXAA 1Q7EA 5H8WA 1RC8A 4AY3A 1CS0B 5ALEA 1HG1A 3VTFA 1SUWA 5D5QA 1HDEA 2V9ZA 3INRA 4HGPA 3GD5A 5FPQA 1DBIA 4MMYB 1KVUA 3U81A 4D45A 2CCKA 1U1IA 2A3NA 3LWBA 4KEAA 5BR7A 4FFMA 4UVGA 4IP0A 4CM4A 1F0PA 4DQXA 1QF6A 1VBKA 4TV9A 3FSRA 1PJ3A 3AYZB 4B4WA 3FHTA 1I5EA 1NUPA 4M54A 3TPCA 1WETA 4NJOA 1BQEA 5A3VA 1SHKA 4G5SA 2BFEA 2B82A 3LT2A 4R2KA 5JMPA 3ORFA 1QVRA 1KHTA 4DNQA 3SBOA 2NSHA 4OATA 4NKRA 3WGYA 3DVQX 2GD2A 3QGMA 3LC7O 1DFGA 1OBFO 3NORA 1GUYA 4A5OA 3JD1A 3PPIA 1DQYA 4O1MA 1GV0A 1OLUB 1IY8A 1HDXA 4MPTA 2WHYA 3FAKA 1J90A 2YZNA 3G8BA 2F7SA 5CDTA 4QQFA 3VXKA 1AHNA 1JQBA 2W4MA 1J24A 2WM9B 1GT91 4N49A 3TI7A 4F8EA 3CRVA 4HPJB 1VGVA 4HOYA 3HSSA 4CR7A 2Z5LA 4FHCA 1R0WA 3AX6A 3D6NB 5CB6A 2L42A 4GHWA 1ZD3A 4JX9A 5C18A 5TDHA 2GS9A 3OUTA 1ZOLA 1P2GA 1YK0A 3DCNA 4OQXA 3G0DA 1V96A 5BVGA 3ZDRA 3SZGA 5TVKA 5BSEA 1UDRA 1F60A 2EKPA 2H9IA 3DYVA 1QHYA 2XTZA 4P3XA 3W4IA 2VDRB 4J76A 1WUJS 1E94E 4BQPA 4KAXA 5KTPA 1TXGA 4WKNA 1ORIA 3IT0A 4ALJA 4Q7EA 5K0TA 1SCKA 1NASA 4TS4A 1NKTA 2QLLA 4D9EA 1FS5A 5JYDA 3RT7A 3RS3A 4HNQA 5AK6A 4YPFA 4UQOA 1R64A 4D8XA 1NN0A 2CNNA 5D84A 3R6DA 3W8DA 4N8SA 4WOCA 1F2UB 3FTPA 4LPKA 2VPXA 2FOIA 1SJ9A 2C8JA 2E18A 4WADA 2G4CA 3CWZA 3OESA 4U00A 5DNYB 2BFOA 1V11B 1EFPB 2DLDA 2CFIA 2VQDA 1LA2A 1L5ZA 2ACVA 5DHSA 1ZJ4A 1BYUA 5HKOA 3KLPX 5BWMA 1P0CA 1XWIA 4O4IA 2W6JA 1TT7A 4NYIR 3AF0A 3RF7A 1ZI9A 3RS4A 2IV2X 1FS4A 3UXHA 4DMRA 1N2CE 1W87A 1JQDA 1JXOA 1T6YA 1YZUA 4TMXA 2IT1A 3GU3A 3KTDA 3URKA 1ADGA 4WNYA 3RUDA 2Y6VA 1KTVA 4G89A 1TVKA 2FSPA 3TTSA 1C2YA 2FDXA 3RVQA 4XQCA 1Q7BA 1TRHA 3FROA 4EAAA 4DJEC 3H2JA 1ULUA 4YP7A 4KQ6A 4D0LB 4LY9A 3L7OA 4U9HS 2Q7XA 2WSIA 3R40A 5ALLA 1JV2B 3B8EA 3T35A 1PT6A 1MF7A 4OP2A 4O2RA 1JE1A 1WHSB 2OB2A 3NTXA 4H4EA 4LFBB 3R4VA 3ZYZA 4WUTA 3UMBA 4DPLA 2O5EA 3OECA 5TGTA 4AO8A 5F2KA 4Z7JA 2F3UA 1H2HA 1EB9A 1FXWA 2B2XA 2QT1A 1ZW6A 1M2FA 1Y1SA 4NMLA 4OBEA 3EFHA 2CHGA 1VYTA 1C3LA 4M9RA 4QSMA 5DBOA 2B3TA 3M6AA 5FV7A 3RS9A 3UMSA 1DCTA 1W4BA 2CY0A 3CH5A 5HM6A 1FVHA 1SCDA 5A9SB 4PNHA 1J07A 1GZ4A 2QT9A 1Z4KA 2R6GA 3FI9A 5FB3A 5HK8A 1FUIA 3WADA 4BQNA 1FYXA 2WIBA 3L4BC 3W7VA 3F1KA 4B3TB 1RLUA 2HA7A 2QRNA 1CF4A 4DOMA 4HQKA 1P3JA 1QRDA 4BJ5A 1PX2A 4B46A 1K9SA 1WABA 4I3FA 1DO0A 2EBFX 4UHFA 1IY0A 2NUBA 3NVAA 1XIVA 3ADBA 5EMNA 1EDDA 2E37A 3WWPA 4U5XA 3K9FC 5ECWA 4M22A 3QSGA 5LDHA 1TOAA 1F8GA 5ICEA 4EHHA 3ZXUB 5A1TA 4FHZA 1PGQA 2LGJA 5LQUA 3G7SA 2A58A 3FNQA 2GJ8A 1Y5MA 1KEVA 2XMZA 2J4FA 2XGMA 3F7OA 4GH5A 4I4TB 4MVWA 4NMXB 4PLVA 5LP6F 5BVHB 1ELOA 3LCVB 3DEIA 5DT2A 4AP9A 3W8FA 1N8TA 1WMEA 2IZOA 3UEOA 3RGWS 5DM70 5HCUA 3A27A 4AO6A 2FZ5A 2Z5GA 3TYXA 2R2AA 1PG2A 5D7BA 3KB8A 1BXGB 4GWLA 4IIUA 2OILA 1QSGA 3FLBA 3OBBA 1HEIA 2VJMB 2D2EA 3X44A 3H1GA 4DEYA 3C6BA 2EW8A 3KQTA 4ZP1A 1FP4B 4F6CA 5BV1A 2PVCA 2ACEA 1E7YA 4BXOB 4RA6A 4IXTA 3WOVA 2BTQB 2Q8PA 1WVGA 4ND8A 1JTVA 1UQUA 5BSVA 3VTAA 1J2RA 3IQXA 2IIBA 1C1YA 2PAFA 3NG1A 4J0JA 3C6MA 4J3FA 1FJGB 3CJRA 1DTWB 1ZOSA 1P5FA 1JWBB 1T5HX 2E5WA 2OKCA 3Q9NA 3H9BA 1H4SA 3DMYA 4FYIA 1ZY2A 1R6TA 1O6GA 1KY5A 4EVQA 3ZDBA 4XB6B 2P6MA 4A0GA 2I7CA 3G9ZA 3THSA 1UPFA 4S1PA 1SXQA 2Y1WA 4AJLA 2EAUA 3E15A 3LCCA 3OZFA 4EL5A 2WI8A 5C4IA 3P2YA 3ZZUA 3O92A 5CT8A 1N5OX 5INTA 2PH5A 3IKJA 3WLOA 1HGXA 3VNRA 5KQMA 2Q8QA 3ICCA 2W2MA 1F48A 2XUIA 1GHTA 4JI1B 5JECA 1S4QA 1Z68A 1T6XA 1DC8A 1X0XA 4R5HA 4XGQA 3IP9A 3ISTA 3MPUA 4YFYA 4QUDA 5BT9A 2HLNA 4NJEB 3SM9A 2BGMA 4JP5A 2ZJ8A 3TQFA 4Y6QA 5IJ9A 2UVQA 4B8WA 1B74A 4RF2A 3GFVA 5BWCA 5FTJA 5IM4A 3ZS9A 2EJUA 4EI9A 1M1YE 2PQ2A 1N4AA 1PZGA 1Y63A 4F45A 4L7VA 1ENOA 4U39A 4ZVMA 3CEJA 4CM4B 3ZK7A 2A9RA 4KQWA 3PIDA 4IDAA 4TV9B 2ET6A 4ZO7A 4EZBA 1FTNA 4V1CI 3QA9A 5K01A 2AG5A 3E3LA 1IJFA 4BCDA 1CEEA 1M66A 3Q0EA 4U6NA 4AI6A 1QTQA 2JA1A 2ZSUA 2R84A 521PA 5LNK6 5GONF 4MO2A 3A4NA 4K88A 4I55A 2B2NA 2HRDA 2YNMC 4GMFA 1KTIA 2GESA 1RWPA 1XCJA 2QLBA 2AYYA 2W6OA 4E4TA 1Z2CA 4NDNE 3WVNA 4LYFA 1QOQB 5EEGA 4V1CA 1QKJA 2G40A 2DHRA 3HL4A 1OAOC 2FQXA 2TMKA 3Q6IA 4POAA 3ZWYA 5KNCH 4X1OA 3WK5A 5HNKA 4Q4JA 5HSGA 3WK8A 1PWZA 1WR8A 4BX9A 3VU9A 2AEMA 1OHHA 1YVEI 3L7KA 4IHAA 2H5IA 4NNOA 4ZAZA 5FL7A 5F9HA 1ODKA 1HLFA 3CCFA 3DDHA 3PP8A 2C2MA 2NO9A 4QUAA 3FIUA 2IYEA 3I5AA 4FJ1A 1DUIA 4X41A 1F8XA 3MRSA 4CQJA 5IWAB 3IDSA 3QU5A 2WKSA 1SVIA 1NKVA 4RAOA 4TS9A 2DHQA 3HY6A 2JDID 1PL8A 1X8LA 3TTTA 3U9TA 3NIBA 2XE7A 4Q21A 2H2WA 1XDBA 2LD4A 3L79A 5SY4A 5IZ4A 1RRMA 3KUDA 3WIUA 2QTVB 3I6QA 3K2EA 4MV3A 4Y2TA 4ZYYA 1ICEA 1H1DA 8ATCA 3S81A 1C7JA 2VHCA 5FPSA 1SHLA 3O8RA 2H48A 3KQKA 1DAEA 1DQZA 1E4EA 1G5TA 2GDJA 4BC0A 2JGNA 5DNUA 1PUIA 2UYYA 4RD6A 1ZA1A 2VF5X 1MIHA 2ZCJA 1VG0B 3BCUA 3CWQA 3H2ZA 1SXGA 3UJBA 4HNTA 2FMTA 2XBMA 4FS3A 1OXXK 1E0AA 1V16A 5ALRA 2O57A 3MCVA 3MT7A 3QKWA 3UAZA 1SN7A 1BDBA 2I6FA 2N75A 3ZD8A 3EZYA 2Z8ZA 3OPYB 4B7AA 2AK3A 3T9FA 4DG8A 3ZX4A 2JLWA 4JQOA 5EYPA 1JNXX 4QNMA 4IR7A 2AJTA 4MQFB 3UG7A 4FCVA 1SIOA 2YHBA 3LHDA 1OKKA 5LP6A 4YQYA 4Q19A 3ZY4A 3EQ6A 1NATA 1NE2A 2R5NA 4YRZA 4O4IB 3LUJA 1YRYE 4GYJA 4Z4GA 1T4DA 2DECA 2PGXA 4B3JA 4XFDA 1UP4A 3CH4B 4U0JA 1NM5A 3CKMA 4IIJF 4TKUB 3GLFB 2P30A 1P2FA 5IJ0A 4K86A 3EGDB 1TVKB 4DILA 1GTVA 1MV8A 3HMQA 1H1LA 3E0QA 3VR6A 1Y1TA 4ZHQA 3R3WA 1WNFA 4EMBA 2WW8A 5K2MA 1E62A 3WQBA 3LY8A 4CIBA 2QPLA 1XA4A 4TYYA 1Q1GA 3GUYA 4CG2A 1FY2A 1OR8A 1ABEA 1ZWLA 1NN3A 4MAFA 2QUJA 4CRWB 5H3LA 2UZ4A 1IN4A 3WJ2A 1RRVA 4YRDA 1PGJA 1JDTA 2OORA 2BLNA 4D6XA 5CEFA 2NADA 1Q0QA 2Y0EA 3TW8A 4US2R 2BFWA 4PG5A 3W3AD 4XCVA 4B81A 3UK1A 4WXRA 4E07A 1EB8A 3GCZA 1QOZA 3RRZA 3SKXA 5JFOA 2MSWA 2AZTA 1X42A 2PRZA 4DCPA 5EP3A 4DUPA 3P2EA 3U09A 3PQ4A 4OD0A 1R2QA 1AQUA 2WYOA 4G0ZA 4M9CA 1PUJA 1EG2A 1I3NA 2YZGA 3BULA 4G56A 2AMFA 3C5HA 4LGVA 2I71A 4UHJA 2PV7A 1H6DA 4DC1A 4Y67A 3WS7A 4MI1A 5CFRA 3EWIA 3CN7A 3K7EA 1F1JA 3RU2A 1RWMA 5JDCA 4CQLA 1EVYA 1RT9A 2X1HA 3FKSA 3RS7A 4F86A 2JZCA 3U39A 2JGJA 2MWMA 1JXAA 2D3WA 4P53A 1G6HA 4NH4A 4DIOA 4KLZA 4JGIA 2AYZA 3DT6A 4RTJA 1GILA 1NSTA 1J06A 1RM4A 1TYAE 1Q77A 1BWQA 1YR9A 1HDYA 1ZFNA 2FWBA 3IBSA 3SLGA 5L53A 4YJ2A 2B1GA 3K0FA 1U2EA 4Q9HA 3WYEA 4E46A 5EWJA 5LWHA 3JYHA 3D2LA 4YAGA 1ZUHA 3OSUA 4MMXB 3WLLA 4ALMA 2BZGA 3L7CA 3QLVC 4QRIA 4WQMA 3SR0A 2CSUA 3ZW9A 1ACMA 2X7HA 3KQMA 3PHBE 3N0TA 4MPJA 1NUAA 1ESMA 1GG8A 1DPGA 3K35A 1II8A 3A7DA 1TRKA 1Z34A 1NJFA 3GLHA 5T4BA 3RVKA 1YR8A 2ACKA 2EQBA 1MTZA 4OHFA 5B36A 4AS1A 4LYYA 2PUDA 5E7JA 1NNI1 1JA0A 1GZ5A 3TPZA 1L7PA 2ANCA 3KTFA 1LJUA 4QATA 3TX2A 3SC4A 4ZC8A 4PSVA 4IH9A 5DF1A 3RS8A 4CIAA 5K6TA 1OLOA 3A6GA 3HSYA 4F7WA 4QASA 1S2GA 1CQXA 2O8NA 2WT9A 1RLOA 1TVCA 1BFUA 4I6EA 3M1YA 3BREA 4IEEA 2BCJQ 1CHDA 3LYUA 3VC3A 5DGTA 1W1IA 4L4ZA 4OSEA 1E0DA 1G9SA 1GADO 2HM7A 3ELWA 2P3LA 5ELLA 1O94C 2YYYA 4EFMA 3WYNA 1H0RA 2E87A 5EXDA 2Q1YA 1ADYA 1R16A 2IIVA 2VG8A 2CXUA 2AW5A 1CR4A 2C5HA 3V3TA 3WHKA 1I33A 3NFYA 2XRYA 4IGFA 3PYXA 4QT4A 3B7GA 2C7GA 1BCSB 2IOQA 2Y99A 1TFUA 3QVSA 2EP8A 2QRMA 4NG4A 4C4RA 1C2TA 1N6KA 1WTCA 2AT1A 3BWYA 3FYCA 4P32A 4PR0A 5JU6A 1N1EA 4XSGA 2OFOA 2P8SA 3N8DA 4RS3A 1VHJA 1XZNA 3OCUA 3F5QA 5DNWA 3GIWA 1U63A 4G0WA 4XDYA 1A9XB 2CLOB 1EBBA 4RVGA 2V55B 3ZV4A 1WZ2A 3KOOA 2XXJA 3ND8A 5IJ9B 1MOQA 4P0TA 4EHAA 3NT5A 3F47A 5AVJA 3U7FB 4P4SA 1HG0A 2XLCA 3JSXA 1XF9A 3CONA 3HP1A 2QG6A 1D2EA 3ZHSA 5C2JB 3WNBA 1M7HA 1B76A 2Q3DA 1N0IA 2WKWA 1Y3DE 3L8EA 1KKUA 1PT5A 1YRLA 4E30A 5CB8A 2XOKD 5KTOA 2C2WA 2H85A 3VKWA 1DBWA 2ZR9A 1IHXA 3NHAA 2H4YA 2XQFA 2NTNA 5UKDA 2NU9B 3AIMA 4REQA 4BMPB 1IQ0A 3ECAA 2ZAMA 4C6TA 2O2XA 3GEMA 4B1FA 1JFSA 2RGWA 2JFWA 3KSBC 1MW8X 1TCAA 3UAVA 3IAEA 4I55B 1CY4A 3K1AA 3MWEA 5D3MA 2GM9A 1QCDA 2D7JA 2JGAA 3FN4A 4RUKA 4CW7A 4DXDA 3CVYA 1XHEA 1G4AE 2R1VA 3FMPB 5A06A 5AD1A 3CUSA 5K3EA 2ZYTX 1GPMA 5JT1A 3JTEA 3JZAA 1Z56C 3KPVA 3CKYA 3BJZA 3ZWAA 2WD8A 1ZZEA 3OCCA 1XL1A 3D6MA 1KYVA 3E35A 1P81A 1IBLB 1SC9A 2P1DA 4HH0A 1UF9A 2C2OA 2PBFA 3PC4A 2ZUTA 4CGYA 4YHBA 2W8BB 4C2BA 2YV2A 5JSUA 1W44A 4URUR 2C0CA 1TCCA 4TX1A 1GCGA 3D4BA 4OBWA 4MDYA 2X41A 3Q7TA 4D02A 5CDSA 3LIIA 3P9SA 4RVDA 4D0RA 4BO6A 1BS1A 1V6AA 2VLBA 4A91A 5BWLA 4X6LA 4XA8A 4EARA 1T0HB 3P9RA 1GG9A 4ERNA 2HF2A 2I5PO 2P69A 3IVGA 4KLAA 4Q7MB 3WSVA 721PA 3N0VA 1U7WA 5DHUA 4J9VA 2M1XA 5TIIA 2A30A 5HXAA 1LV7A 2HQOA 1FRVA 3G2PA 2NUTB 3AY7A 4FT2A 2OENG 2OXEA 4JASB 4UUPA 4ETWA 3GJ7A 1H4QA 1E3MA 3HVHA 2FZ4A 1EQUA 1XU9A 1GFIA 2X6TA 1MJHA 2ZTLA 3B53X 4RVSA 4YQZA 5CBKA 5HJEA 2JLBA 1AXRA 2AQ8A 5K3DA 4MKZA 3G89A 1JHUA 2X0FA 2ZB3A 3HQ4O 3PJEA 4GX2A 3O0DA 1QLHA 5EYPB 4FFWA 2NSJA 4QQKA 3VHQA 1SCAA 1AQYA 2EG9A 5FUBA 3HHEA 3PUXA 4ZVUA 4MKIA 4RX1A 1R3DA 2HXYA 2FPKA 5GV8A 1TI7A 2VJLA 2WFLA 2CLKB 3HABA 2OM2A 4R8SA 5BMVB 3JWIA 5K99A 5COBA 3ZWKA 2E3JA 3UV6A 1UOPA 4IUCS 1CZHA 1XTVA 2KS6A 1FIUA 4LJ6A 3TS1A 5ELXA 1RXVA 4JI7B 1VECA 2QN3A 3GJSA 1ZS9A 2YFYA 4GZMA 4WESA 2D6FA 1OGJA 4BFYA 3MEQA 4PYRA 1TT5A 2Z09A 4ZHQB 2IZ0A 1SY7A 4G41A 3IAM1 2WWGA 1L4HA 2IPLA 3W5AA 1BFKA 1EK2A 1IEVA 4HXYA 2BBSA 8ABPA 1AKNA 5JYEA 1FVXA 2H08A 4BRSA 2SCUA 3TINA 1V5IA 4UC0A 3UT0A 4WK4B 3SP1A 5CFOA 4EB8A 1N77A 5FOQA 3U26A 1HY3A 2ZDGA 4GC5A 5HBRA 1GA1A 2PGIA 1XJQA 5JHHB 2YFHA 3N39C 3WIVA 1AKWA 4BQOA 4TL6A 5KQGA 3VZBA 1BEZA 3AF3A 3QEBZ 1T1RA 1WO8A 3NAZA 4MUHA 2QRKA 3FWYA 3GVPA 2OR3A 4B32A 3CO0S 1KS2A 3T15A 1KI3A 1M54A 5AFSA 4K05A 5F5LA 4UE3S 5FP0A 4KKXB 5J43A 3Q41A 1Y3FE 2J5BA 2QIOA 4JGBA 1PR3A 3C3YA 1XQXA 2ZR7A 4WZAE 4ZOAA 2BMWA 2YMLA 3CX4A 3ZZ1A 2JK1A 3ELUA 3AOEC 4NULA 4RDCA 5JPIA 3NM4A 5I9NA 2HT1A 3BFKA 1CRZA 3EDYA 2EX1A 2PX3A 1V3TA 2ANBA 1FFSA 3HFGA 1Z8FA 1IB0A 3GAMA 1PZHA 4LJ7A 3BH6A 2DB3A 3WHPA 4DQ0A 2VK4A 2X42A 1KYQA 4ARZA 4G0YA 2WWTA 4YJ2B 5AVOA 1B15A 2WTXA 2XHZA 1SZJG 1T36A 1CIPA 3ESCA 3LOUA 3VHXB 1USVA 1KY3A 2QXTA 4PAMA 1T6ZA 4XGIA 1EEHA 3AB3A 1I9GA 2ADMA 1ZM2A 1M8GA 4FLFA 5LXTA 1J0CA 2BELA 2D2XA 3VX4A 4UTOA 3SC3A 4Y9TA 5CLLA 4TL8A 1E3JA 1KP3A 1F14A 1FFDA 4O0MA 3WLRA 1E6EA 3NPAA 3GUCA 3NEYA 3RWOA 1VG9B 3LQKA 4L8WB 5DTEA 1P2TA 4QWMA 4UU0A 4KHZA 4YUVA 2NTVA 1U0FA 2V7UA 4TLCA 4TT3A 4X66B 1M1NA 1QIKA 2Z58A 1SD1A 1XF1A 2ZUWA 3TJRA 1E8MA 4YLYA 4O08A 4OB8A 3KBBA 1NMSA 4KPGA 4CIXA 1QBKC 1CUCA 1Q1EA 2ADOA 2WIDA 3BYZA 4ENWA 4JUBA 1FRQA 4HWRA 4KE6A 5D01A 4ZANA 5CCXA 3N07A 1MXHA 5TPZA 3FPEA 4LZNA 4I46A 3IHWA 2PDAA 3O7WA 3IBGA 2Q7DA 2DBVO 1ICIA 3K2BA 4YCAA 3H5WA 5AR1A 9ATCA 3NTQA 3M7IA 2GZDA 4JC5A 1UBJS 2EFHB 3T3OA 3F97A 3RSOA 1Z5VA 4DR6B 4NCJA 1L5KA 3C4QA 5IC5A 3OCVA 1N32B 3DYIA 1OWOA 1YC5A 2RFLA 4XDHA 3NKVA 1JH9A 3MRXA 5K9ZA 2P65A 2JD2A 4V0LA 2B20A 4MPDA 2FFJA 2O3QA 4RZ2A 2OD7A 4BBPA 4A36A 2XZLA 4IZIA 3U4CA 4JROA 2X0IA 2X9GA 3L0BA 3S29A 1NVVR 2QAIA 3A6PC 2ZJ4A 4J94A 1PS0A 4F4FA 4N3NA 4Z3OA 1XTJA 3CNBA 1Q2UA 5DI9A 3UGTA 3H04A 5JZVA 2KMLA 4HLNA 1Y1KE 4HSEA 2GTPA 3HLYA 4LVNA 1OBHA 3W5VA 1JILA 1JAYA 2X8JB 3AEKA 1XDWA 2GJKA 1ZGAA 4REQB 3ZWNA 2HSJA 1QHSA 5SY6A 4F38A 1ZN8A 2WRZA 2XUPA 4C6TB 3F73A 5F7JA 3LCJA 4MIOA 4G2NA 4W5TA 5ER6A 1Z37A 5EXEA 3NPMA 4KQHA 4FYMA 1U3VA 1FSFA 4IMIB 5J4HA 4ZIRA 1OILA 3MWEB 3W0LB 3BC1A 3M89A 2C4VA 1POXA 4L4RA 1Z18A 4DJ5X 1X7WA 2R6ZA 1HEYA 1G16A 1G8FA 1PQ4A 2IWHA 1IWBB 2XYQA 1H9BA 1V1MA 3ENWA 3UT5A 3M83A 4O02B 5JD6A 2C2GA 1QF9A 3GRUA 3N6RA 2AHRA 5FCDA 1U2RA 2BGLA 2R6FA 4UUAA 3AGQA 3OF2A 5E2AA 2A3RA 2Q99A 4LHEA 3BH0A 2P2SA 4X90A 1M34E 4AYXA 5L7YA 2CHQA 4Y1GA 3WL5A 3R5TA 2MMCA 4RKFA 1NJ1A 3IDFA 5DHPA 4AKIA 3ASYA 4OLFA 4CKBA 1QXSA 2DF8A 2JFHA 3KWFA 1U02A 1T8RA 3LUKA 4MPPA 3WGLA 5JPCA 4RTPA 4UNIA 3C0KA 4ZVOA 3TW4A 1YJ5A 3BRCA 5IPFA 4UU8A 4ZJUA 1PL6A 1RWVA 1Q0TA 5JQWA 2A0YA 1QHGA 1VCOA 3DUFA 3ENNA 4RJJA 3MK31 5JAQA 4TLBA 5D5PA 4BBAA 2ORWA 4WSOA 4QGSA 1VL2A 5I7WA 4ZTZB 1R5NA 1Z0DA 5JNTA 2XEXA 2FOXA 1O95D 3JVIA 5KWEA 4Z7QB 3DLHA 4DIMA 5CAEB 3ZVMA 2NTEA 4RF4A 2VEOA 3VSEA 2C59A 1F4VA 3R2JA 2B1IA 2XZPA 3LG2A 2HMAA 2GZSA 2NVWA 3QEKA 4KXVA 4EJSC 1JI0A 4UHHA 1Z45A 2V5AA 4U63A 1P4GA 4OHUA 4D4HA 1G5FA 1IN8A 4EGQA 5FEUA 3K92A 4NCAA 2FPUA 5CFLA 2HDHA 4JJAA 1AUVA 4LMRA 4C07A 1VYHA 3D8BA 1PW7A 4OLBA 1Z47A 1G1AA 4ZYVA 1PUXA 3LT4A 5TLSA 1I13A 4KUGA 2W90A 1OH6A 2EHJA 4WZZA 1C29B 2XCUA 3PDWA 1L5HB 2V7XA 4JBNA 4R2XA 4AJNA 4Z49A 4WOJA 1MOSA 3BBLA 1EQ2A 1YCFA 2XB2A 4FFBA 4M3NA 4HAYA 1Z75A 3KSUA 3RS2A 1JDBC 1FFAA 3ESXA 1FLDA 3BXOA 4COOA 2PFKA 4XGNA 4P2BA 2H06A 3YASA 3O93A 4ZFNA 3W8RA 2E7ZA 1W5FA 3H1TA 1E2PA 5F2NA 4GXTA 5K3SA 1FMTA 1OAOA 3O1IC 4IUBS 1RZRD 1TT5B 3QHQA 4ESHA 2WAOA 1R8JA 3O90A 1O8BA 3NHZA 5EJ2A 2OECA 6LDHA 5IF3A 2O8BA 2XV1A 4JYAB 2QUBA 1NJGA 1LI7A 4NBUA 3KNZA 4I4LA 3VJKA 4KX5A 4RHYA 4UCQA 1W7AA 3QU4A 4EOGA 3NGLA 3K16A 4GP7A 4E1AA 1EFLA 1LJ8A 5FWNA 1EUYA 1EK0A 1H6BA 1A9ZA 1JJFA 1Y5NA 3B51X 4B3SB 3FPLA 8GPBA 2C9ZA 1ESCA 2BFFA 3EYWA 2BEUA 2YJ3A 2F2TA 1R5OA 3NKLA 3ML1A 3N8IA 3K70D 3KHSA 2DWOA 5I7EA 5E4YA 3GCWA 4UQLA 1YZYA 4W9NA 2J0UA 1TJ3A 4B40A 3VC2A 1YSCA 1HYHA 1QB8A 4PAGA 3CE9A 5FJIA 3AERA 5ALKA 2V54A 3KEGA 3KYJB 1M2JA 1CY7A 5EMLA 2HK7A 3RSSA 5TMPA 2Y1FA 1TQHA 5JJBA 1U2SA 3TGPA 4FHEA 4QTTB 1W4LA 1JEYA 2OQ2A 4PSUA 1YS2X 3N5CA 4EHBA 2B4QA 4LSGA 4ARZB 1EFDN 3QY9A 4JL5A 2NIPA 1NV8A 1EA7A 4CKEB 3W9UA 1CEQA 1T36B 2ATVA 3M81A 4Y3UA 2FZLA 3CLVA 5DSXA 3UUGA 1U9CA 4BMDA 1BVHA 4WK0B 2X77A 1EA5A 2P1ZA 4E0BA 3ZV7A 4C76A 4L9RA 2OGSA 1YL6A 3ZCTA 1LVHA 3C2QA 4KODA 4BIMA 4YAUA 5J1SB 4DUZB 1P4SA 4A9AA 1TGVA 2CE7A 2ZAYA 3PI6A 2CNWA 1FP6A 1KJZA 4TXHA 3E7DA 5B64A 2GSDA 3VMMA 1PR9A 1B6TA 2PWYA 3EQ9A 5JYBA 3T7SA 3JWHA 2Q2OA 1OROA 5DWVA 5AVZA 4LMAA 3UJ7A 4D56A 5L40A 1XP8A 2C04A 2NVOA 1K08A 1N7GA 2FW0A 1KYWA 3ZJ4A 5IAGA 2QP4A 2EFGA 1NJ5A 1UKEA 1JDZA 4Y0AA 2A57A 3U4GA 3ZLTA 1NF9A 3LP8A 3Q6NA 1DIGA 3D0OA 1QYRA 4Q3LA 3P26A 1FDUA 2MSDB 3GMDA 3O8DA 3AVVA 2YIDA 5FO0A 4O59O 4ER5A 3RC2A 3TSAA 3PLRA 1U5BB 4HLDA 3QELA 1X8KA 2G82A 3U62A 2PYZA 1MJNA 2GNPA 3FSJX 3ZE8A 1TKCA 4PZCA 2GEJA 4YAFA 3JYOA 4R5MA 1XDDA 3SZMA 3DE3X 3WGNA 3S8MA 3IEMA 4RVOA 3FOAA 4KV7A 2J3QA 4MAAA 5JDIC 1C3JA 1XD2B 2YVQA 5H02A 2RK4A 4B33A 5AK3A 2BR5A 2QF7A 1N6OA 3OA0A 5B2ZA 1NQWA 4KN9S 4LUCA 1R0CA 4BRUA 3B2NA 3OPQA 2FZGA 1IBSA 1UKBA 3IXQA 2B92A 2DHEA 3MGAA 5DX8A 4DTCA 1JWLA 1KIFA 5CPBA 2ONJA 2G77B 1FL9A 4C1NA 4MQ5A 1BKSB 1MT0A 4KDEA 4ZEOA 2EEZA 4ARAA 2QMYA 4IV5A 5THQA 1BS9A 4KCGA 1AK1A 1ISPA 2VDMB 2ZCUA 1ZQ1A 4GBGA 1JEJA 1H3FA 3DHNA 1PJRA 4TWRA 1VKRA 1ZNQO 2HO5A 3JQ6A 4LSMA 4J0FA 4RLSA 4TLAA 3P1JA 3EA5A 2WICA 4DVGA 2FW7A 4MCJA 3C6KA 3EY4A 3NB0A 2IU4A 3VVMA 4Q9LA 4YONB 3RFTA 1S2MA 1YUBA 4Q3NA 1W4RA 1Y4AE 2AJ8A 4RL4A 3L0PA 1YS6A 3RB8A 1ZJZA 3EXHA 5AYVA 1BH6A 4P82A 1YDGA 4YAWA 1PJZA 4CEIA 1V1MB 1BDJA 1DX9A 3CGWA 3O73A 4QVIA 3WDKA 3PWTA 4ZMBA 3H4MA 4L22A 4ZQEA 3LW8A 1H93A 4ZVRA 5JMTA 1KETA 2O2IA 2R00A 3UA3A 5ICFA 3O2QB 3L7NA 2GTHA 4FGJA 3I5UA 4ZOBA 1O94A 1DX4A 3FPSA 3L2OB 4BVKA 4CMKA 3RYCB 3O0TA 1E98A 4Y2SA 1EM8A 1X80A 1NWCA 5AI4A 3WDLA 4ZD6A 3O9MA 2F62A 2D4AA 4G2TA 4G8BA 4CQMA 4D6YA 2ZSHA 4YJ3B 1CE8B 1X3SA 4TXNA 1I3LA 3ZDXB 1J97A 1H85A 1JUDA 3GA0A 3V97A 5EMKA 4KVFA 3I9NA 1RABA 5ALDA 3JAMA 5L4SA 1Z88A 2I9KA 3CIFA 5KYUB 3RAPR 1IK4A 3DUFB 3CG4A 1T24A 2H18A 2N42A 4EFLA 2FR8C 3AESA 4HLUA 2GR9A 2RAFA 4RWZA 1MKYA 3KOUA 1PGNA 1EINA 3DEKA 3UHJA 1CJCA 4RE5A 4H3VA 4PLWA 4U0KA 4YAKA 5LKAA 4FFDA 1JTEA 3NW9A 4D8VA 1ZUNA 5B37A 3IUQA 1QU2A 1DIAA 3DKKA 1AQIA 2GT1A 4F12A 1XEAA 5CW2A 3WLFA 3AI1A 3QVOA 3LECA 5F7XA 2VNKA 3TQCA 1FUUA 2F3TA 4QNNA 3RASA 4B2LA 3A2LA 1G3IA 3TB6A 5BT8A 2YYAA 3KUXA 4BLTA 3BEOA 3TLCA 5JUWA 2XWQA 1V7CA 3EZGA 1QHHB 4I1VA 4OFZA 3AR5A 3DUWA 4FFBB 5JY6A 3BB3A 1Q50A 3A9WA 1I24A 2IHYA 1C3OA 3LLMA 4U3JA 1RKVA 2XZTA 2C99A 3VOBA 1YR2A 2NV0A 3PXBA 4WXYB 2NVUA 3OT5A 1JQEA 3CLUC 3O8NA 5E95A 1EJ0A 3E05A 2BKLA 3CT4A 4JSRA 4MUEA 5TVGA 3HC7A 4RQBA 2JI6A 2O8BB 4JBGA 5CXQA 2PFSA 3BMNB 2Y1GA 4E6EA 1U7DA 3GLGB 3MT8A 4D6PA 2J9RA 5LUAA 2IS6A 4A8JA 1JN0A 1XK6A 4ZI7F 3HY3A 4KGXA 2E5FA 2ZIXB 4EENA 1P5RA 1XZKA 3TOXA 4NV1A 4OIFA 4B84A 3IVAA 8AT1A 1XKTA 1Y37A 4BNKA 4PHCA 4D9IA 1OXTA 5HJ5A 5IRCD 2XZDA 2FCRA 2BEUB 3T5GA 2DJ5A 5DHRA 4EKEA 2BTOA 5I6DA 5EIOA 4DG9A 4IV8A 1JS1X 3SSMA 4UEKA 1CUFA 1DQRA 1XZDA 4KWTA 4BDTA 3SR3A 3AZQA 4IS3A 5I8WA 1MRNA 3DDWA 5H4HA 3KDSE 2DUNA 1AZLA 1Z2AA 2I55A 2NSDA 3PPYA 2XQJA 1MABA 2R47A 4QBGB 5A05A 3LBHA 3BXPA 3V48A 1XPOA 4TVKA 1C0KA 1HC7A 2C5LA 2J85A 3M4YA 4MRPA 4WASA 4B4UA 4PC6A 3C14C 1MVNA 4U2KA 3UK0A 3WGMA 1WS6A 3UT6A 1GRQA 1TZCA 2JLRA 2YJZA 1I0LA 1Z22A 4O2AA 1FYEA 1LZKA 1UC4B 2PGAA 4L6IA 4R1UA 5TGZA 3WWOA 4QXQA 1I7SB 1SU4A 2QX6A 1E2MA 3EDCA 4H7IA 4HI0E 2XR1A 3IQHX 1VDMA 4MW9A 1F0KA 4LHVA 2HU5A 4FNAA 2I7VA 1H94A 4U7HA 4XIGS 4EM6A 5K0JA 3ROFA 4AZ3A 1QO7A 3Q2IA 5AXDA 2C8VA 2F48A 4PSAA 4W7IA 3GLFE 2ODBA 3QZUA 4TL9A 5BR8B 5BSFA 1AKEA 1EFVA 2G5TA 2JI9A 2RH4A 1DI0A 3EUFA 1R8QA 3WIEA 2BM1A 1LDYA 1P8JA 2VA9A 3ESRA 1RJFA 3FFBA 1QLJA 4J1NA 1V8PA 1FXUA 4R0VA 3LVQE 5CBPB 3H3XA 3ZCVA 3OOJA 4B47A 4P2GA 2J6IA 6NULA 1IN1A 2O8VA 1CYEA 2Z6UA 3NTVA 4QGAA 1NQAO 4DV1B 2OGTA 2Y3IA 4MWBA 3JQQA 1EXNA 1QFSA 1NF3A 2QRLA 2GF0A 4NBKA 4QJ5A 5IYZA 1KC3A 3DE4X 4M1EA 1DQPA 3SYKA 1S8NA 3F6BX 5DW0A 1PDWA 3PRJA 2VDJA 3IJRA 4IXDA 1TJYA 5SZHB 2W2LA 5DOZA 1BRTA 1N75A 3QELB 4V0SA 4JLDA 3BWMA 3ZH9B 2ZUDA 3A37A 2WPDD 4H7KA 3NUGA 1YT5A 2FSHA 1ML4A 5T8KC 2YHAA 3COYA 3AI3A 3FY4A 4FYKA 4BNXA 4KMRA 4DSTA 4YCMA 2W2OA 5KQLA 5LWQA 1VOTA 2HYDA 2R86A 3CYFA 1V4NA 3H1BA 3L40A 1RM0A 3I05A 4YRFA 4BLSA 1PU2A 2FJUA 4IEIA 1ZINA 2KM1A 4PHFA 4ZGGA 4Y2HA 2KPOA 1SIBE 1SVOA 1UP6A 3EGWA 1P0FA 1G9TA 2VA8A 1ODCA 4UEOA 1CULC 5E9AA 5EHQA 3EOBI 4IMRA 2BHLA 5G0SA 3VHRA 2CUNA 4LYEA 4KGZA 4B09A 1Q0HA 4WOKA 1LKZA 4QOGA 3TOVA 5JOQA 1VLZA 5ADWA 5ABPA 1OYOA 1UPBA 3HDJA 3OURA 1ZOOA 2Q4RA 3K4HA 3CVVA 3EQ7A 2GCEA 4BLQA 4NBVA 3Q3HA 1F20A 3B9BA 5DHQA 1BWPA 5HX7A 2VYND 3GJTA 5B1YA 1WUIS 2NSLA 3CZMA 1KFKB 3BRWD 4HLQB 4I81A 3WMGA 4TSFA 2I4TA 4GL2A 1HXHA 3R3UA 3L5OA 3U60B 1NOIA 1VIDA 2ODPA 2R8XA 1R10A 5CTJA 5AHRA 3N53A 1Q0UA 2I2BA 4K9RA 3HCPA 4O4LF 3VU1A 5DEOA 1NZDA 5IG2A 2HMTA 2IYZA 3I9KA 3BD8A 3U9SA 5MGBA 5EUQB 1QK3A 2XA9A 1Y6RA 2G5GX 5EIBD 5SYNA 1PWHA 3ZE1B 4JNCA 5FKJA 4RO0A 2QQEA 1XZPA 4IVNA 4QU8A 2FZCA 3NTOA 4EA6A 2NZVG 2PJDA 4EW1A 1I2MA 2IRWA 2HY7A 3ABIA 3FTNA 3RFCA 1EM8B 1NQVA 4H08A 4N5NA 4Y7DA 2G09A 3IGFA 4Q3OA 4PRKA 5LFAA 5DJ5A 2QSUA 1PFQA 5HF5A 4CQMB 4EB3A 5KSPA 2XB8A 3MAGA 3WGQA 4QXRA 1FDWA 4C4YA 3EIHA 1W88A 2MSEB 3BQMB 3FOWA 3DOJA 1Y8ZA 5E0KB 3KK0A 2AW3A 4M1MA 3ZK8A 1JAHA 3K6KA 1TLLA 2J7PA 3ESAA 1PTJC 4JB2A 1GTJ1 3UMYA 4NHOA 3GLIA 3AESB 2ZSAA 1KEKA 1W59A 5I01A 5ITVA 3JVDA 1UBTS 1Z08A 1N6LA 1P17A 1P7VA 3MBKA 2J9YB 1ISRA 1JKMA 1RAGA 4FEEA 1RTTA 4LJLA 4PU0A 5CA0F 3UJNA 3SJAA 3KDPA 1E18A 1P33A 1KRHA 2EL9A 4HWPA 3RYFA 2AG0A 2BJHA 1IY9A 1DLJA 3UMRA 4LHYA 1G19A 1WCIA 4CM9D 1ZAYA 2A4KA 1ZUNB 3Q9SA 2AMVA 2G1AA 1DKLA 2P11A 2ZPUA 2ZU6A 2J6CA 5GZ3A 3DLBA 1QMGA 1WL8A 5BMVF 2Z6AA 1ZAKA 2HPHA 4GOLD 1GOTA 1R0YA 5C5EA 3GJ3A 2O8FA 3N8GA 1GL9B 3D8HA 1E0JA 3SN6A 3K6SB 4N6GA 1FRFS 1Y3HA 3OH8A 2JRLA 1VL8A 5IWCA 4NXMB 3WG9A 1HQYE 3DZ8A 1KKMA 4HYEA 1LNQA 4PTYA 1Y5RA 1MGOA 7YASA 4N3BA 2DFTA 4BIIA 1C3OB 3F6YA 3IFSA 1OFIA 5FTNA 4F2WA 3HXLA 3AVOA 2NX2A 1U8CB 3F3SA 4QLAA 3UAXA 3HU3A 4K81B 4UUMA 3TTWA 5IX8A 5IEJA 3KR9A 4HTFB 4Q3BA 2VPIA 1WX1A 4ENQA 9GPBA 2PD6A 1NJ2A 5HKLA 2QY6A 4HPWA 4RTSA 1GQYA 1HE8B 2VAXA 1R4MA 4G4SO 2IYUA 4TWAA 4WEQA 2LW7A 2X4DA 3U19A 3IERA 3HU5A 2H07A 1Z13A 4H9GA 4JMLA 4Q9IA 1UH5A 1T9ZA 4EY7A 5KNCA 3W90A 1G3QA 4AN1A 2NVBA 3FRIA 3ZJUA 3H0CA 4TMTA 3EODA 1WZUA 5CDFE 2V7QD 1WJGA 1DE0A 2P0EA 1QIEA 1ZHHA 2XXBA 4U2EA 4DJAA 4GLJA 1AY0A 4Q24A 3CPJB 5AVTA 2GZAA 4UNQA 3NTLA 1FDSA 1EBUA 2WIAA 3QYAA 4B5KA 1YKFA 1B8NA 3PKJA 5AQEA 5DLPA 3KLNA 2NTYC 3AY3A 4W9RA 3SJBA 2QXYA 4PGFA 2OO7A 4NFLA 4EYQA 1L7RA 4GOKA 5E1MA 1AV6A 3RTAA 4B3BA 4K26A 1I7NA 5EJIA 1FMLA 1GRCA 1MABB 1EVLA 2E82A 3L3BA 2GD0A 1CRWG 2YFKA 3DE0X 4ZJPA 4DARA 2PZMA 3PC8C 2J9XB 5CNIA 1D03A 1RD4A 1LTQA 3E0XA 4IS2A 3H2IA 4OV6B 4Q37A 5DLQC 5LBTA 2QI9F 4MJLA 4NV3A 4MDHA 1TYDE 2FEPA 2R97A 3VDXA 4KP7A 4JLPA 4BO4A 4V3CA 3OF5A 2P67A 4DA7A 4CTNA 2VDUE 3LF2A 4RHFA 1C4KA 3VO1A 2NNWB 4J03A 4KIWA 3N2ZB 1IONA 4ZYWA 2C9YA 4J43A 2FWIA 2P6PA 1QYIA 4RF5A 4MEAA 3I1FA 2B7LA 5IUKC 3VOSA 3QVJA 4WA7A 1MRSA 1RJGA 2LDBA 1JI3A 3E9YA 1A4RA 2ZGVA 5CB4F 2GKOA 3JS5A 4ZMRA 3G2HA 3ZHTA 1UMDA 2CHVA 2VT7A 4HRVA 4ER7A 5K8TA 1Q0PA 2VC2B 3QPUA 3BAFA 2CXTA 4CKWA 3GAFA 3C3JA 4I5GA 2BHSA 3M2TA 2LV8A 1RYEA 3HBFA 1TJNA 3SIPA 5J2UF 1JLHA 1YV9A 3WJAA 4NTZA 2P4HX 3SWWA 1I4LD 2XH8A 4CF5A 5GZ1A 3NTUA 3VYTB 2OCXA 5JXIA 1CZNA 4JS0A 2QW1A 2JHAA 1O0SA 1ZVJA 2XA1A 4R05A 3LTEA 4RY8A 3T5BA 1U7PA 3FYUC 4ND1A 5D3KA 3IO5A 3R7DA 2IKSA 1KL7A 3PHIA 4R9RA 1F8UA 4ALIA 3DGEC 1NUSA 2NPIA 5L9AA 4L5IA 4IO1A 4W1SA 3RW9A 1J42A 5AHXA 3TI9A 1UKAA 3LP6A 5IUJC 2HNAA 4L4UA 5HMLA 1AMOA 4TZ0A 4U8HA 3IIIA 1S7GA 4JH0A 3DJFA 4ZRNA 4BYGA 1G8YA 2EC5A 1HURA 3RBZA 2Q1WA 1AVTA 5KKCA 1YONA 3K9HA 4DNOA 1TZKA 4DY4A 4UDOA 4M9UA 4GOOD 2WTUA 1ZIOA 1WXHA 4KOEC 3SXUA 1T8WA 1XTBA 2I99A 3O2NA 1FFCA 3N0WA 5JAOA 3CCCA 3RK1A 4GI3A 4ENTA 2PSHA 1YQQA 3VJLA 3W2TA 2JFBA 1OIVA 2ZI3A 4PS0A 3OZWA 1J0XO 4L73A 5AJTA 1CJVC 2C9BA 2X9LA 2F8LA 3DVAA 3I1JA 3DD1A 4HH3C 4HO1X 4QGHA 2B21A 2VP2A 3C6XA 1KXZA 4MIKA 2PKQO 3DV9A 5CCEA 1C9MA 1FLAA 4LWPA 4P92A 3HP7A 5J4YA 1P44A 1PNTA 3C98A 2C1ZA 5KQRA 4JJ4A 2Q4EA 3SK0A 2R8OA 4ZU6X 2G6TA 1YHZA 3TQRA 1TX4B 1HE3A 4KLCA 2J7KA 2A5DA 3DBRB 4ZK6A 3AU9A 2V96A 5LQKA 3MS2A 1MC4A 2JI4A 1E1RA 5JBIA 2ZIVB 4KXMA 3N7UA 3VZQA 5L95A 2C7OA 1GCIA 3OOYA 3R6TA 1FUKA 4J91A 1UJNA 2ZJ1A 3EXIA 3IMFA 4NPHA 2DY1A 4YCCA 3PU6A 4XM2A 3IIKA 5L4LA 1Z6TA 2HLDA 5ENDA 5GP1A 4HEQA 1UFVA 2JBHA 4P4GA 2A35A 5FADA 2HSDA 2PH3A 4CKZA 1GNTA 5EJ5A 3K0SA 3T12A 3A6FA 1K6EA 4NV0A 4DLWA 1H22A 3WFIA 1KORA 2K7ZA 2QQ5A 4D25A 3I92A 5F64A 1PR6A 3V3KA 1KF0A 4RTRA 1R4NA 3I9V1 1PQPA 1RRFA 2I76A 2B4KA 1R9MA 2B98A 4EI7A 2Q0HA 1VG8A 2BE9A 1UM8A 1XHFA 1Q0LA 5B4TA 4RH3A 1B0PA 4JL6A 1UAGA 3HCEA 5JDIA 3AHEA 3BORA 1VCHA 3SEFA 5B7NA 5F1PA 4OH1A 1CUGA 2BKXA 4K28A 4X8HA 1XJ5A 2QRPA 5DOVA 5DN9A 3I8OA 5L7TA 1P6XA 4MS4A 2F59A 1H9AA 1HQCA 2GN0A 3O4IA 4HVLA 2EGUA 5C8YF 1OXVA 2HMSA 5AHOA 1M6WA 2NO6A 3IJPA 1KP2A 5EWLA 2KBEA 2JH9A 1CNFA 4JHLA 4YRJA 7GPBA 4TMKA 5KJEA 1VGRA 3O6VA 3QUTA 2XTJA 4L50A 5A7GA 4HWOA 2XBLA 3Q8MA 3VX3A 3LT1A 1XD9A 3OCZA 2J48A 3OJXA 3ILYA 4FZ3A 1OXSC 1YUNA 4RIEA 1QS0B 2GILA 1PWYE 2O8FB 1JHQA 3PUKA 4JY7A 1FSZA 4GLOA 4K1XA 5DHFA 5AXCA 1R8YA 3FTQA 5I9SA 3CVUA 4PEVA 1XEXA 3N6XA 1RCFA 3DV0A 2I2CA 3KOXA 5ITWA 1SKYB 1NLYA 5FAKA 5C53B 1JIVA 2YMPA 5JZMA 4QDZA 5DN6A 2P0AA 5A4IS 1NXTA 1T9HA 1C9EA 2ZIGA 3ILHA 4WLVA 4R8KA 4LZPA 3GNTA 5FL7D 3UAWA 1D2RA 2AD5A 4M8SA 2VS1A 3E18A 5FLYA 4MWDA 1NZJA 4JP2A 1RYBA 1BGXT 3GB9A 1YCGA 4JOSA 1R4MB 1T3GA 1E3DA 2ZJFA 4LOHA 5EUMA 3BSSA 3OZIA 3VZRA 1O03A 3PLNA 3DR5A 3MD9A 2CEKA 4ZOEA 5HIKA 1B6GA 4HUJA 5F1OA 4UE6A 3FMGA 3Q10A 4RD4A 5K03A 2M32A 3DF9A 5CIYA 3HGQA 3SX0A 4B7CA 2IY8A 3J81k 2QVBA 4YAIA 5DGHA 1YRWA 1DC4A 1DXQA 1ESZA 1MX1A 1B3BA 2DBRA 1OPXA 3AM4A 3MC1A 4OI2A 1JJBA 3UTCA 5GVRA 5MFPA 2RCYA 2O3JA 2YWBA 1E1CA 2LXNA 3BMXA 4ZVQA 4EW6A 3FZNA 3F8TA 1KI2A 4ARSA 1EIWA 3W9SA 1HO3A 4E13A 5BSKA 3OPMA 3GRRA 4LMPA 4R1SA 4RKRA 3UTDA 4DYHA 2X5KO 3ZDFA 4PFSA 1GARA 1BO6A 4MZDA 3TLEA 4G65A 3I72A 2A1TR 2FR8A 4MROA 4LYHA 4X00A 2Y4OA 3B5JA 1ZK1A 2JLQA 3MCZA 1TAHA 3NQ41 2XVYA 2XT6A 2J4DA 5AKJA 4DDTA 2TECE 1S1CA 1DBVO 2QN2A 4KO1S 4A7PA 2Q2NA 3RV3A 3OZEA 4KPFC 2X4IA 2JHGA 4QJIA 4EJSB 3KSAC 3PIRA 2WD9A 4K6OA 3AL3A 3R9XA 3T7TA 4C0AC 3O95A 4ESEA 2EATA 1V47A 1OKKD 3OZBA 4PC3A 3QE9Y 2HBQA 5IN4A 3RK4A 3PKZA 4V24A 5JXGA 3OCXA 3WFZA 1HOTA 1IEQA 2GJSA 2CKMA 3C6QA 1YS9A 3TJZA 2JAWA 4CF7A 3FOEC 5CJPA 4Q03A 5DNEA 4NFYA 4PYKA 1ZW1A 3PGA1 3I5YA 3AEXA 4ITUA 1D6JA 1LBEA 1V95A 2V58A 3C24A 3K30A 1E5QA 3FVVA 3SF0A 4YCDA 2DPGA 3UZUA 1P4AA 1JDBB 2GCOA 2A9FA 2FX2A 1I4WA 3AGPA 3L7DA 4KR3A 1UMBA 3VR6D 3MERA 3HKBB 1U9JA 1E2QA 5FI1B 3WFJA 4Q02A 1DT3A 4B82A 4W5OA 5JROA 4Y2PA 1CUXA 3V1NA 3WWDA 5FNVF 1QR6A 4DA8A 1L3CA 3N5KA 3H8SA 4CKWB 1BDIA 3EVCA 3MGCA 2GD6A 3H84A 2WWRA 5TGDA 1E3QA 3F6CA 3II6X 5BY2A 5K8VA 3OP4A 4HDAA 4XASA 4BNTA 2IYYA 1GT6A 1LNZA 3QU9A 1CZRA 2VR1A 4QECA 1EGAA 1GRVA 1UJCA 5DM4A 2ZTSA 1X3LA 4I2VA 2C2KA 4UATA 2I8CA 4C1BA 1JR3A 2P7IA 2PWZA 1J99A 1N2IA 1QK4A 2AG1A 2O06A 2PSDA 2D8MA 3ISVA 3MTJA 1SAYA 2L2QA 4E32A 3BXHA 2A5FA 2EBHX 1C9KA 1DUVG 3AIIA 4G4JA 5DHAA 2D5CA 3C1OA 3HFSA 4UASA 4C0HA 4AMUA 2BUBA 3MTQA 1DKOA 1L1RA 4PCUA 1U80A 5F3RA 3KM0A 4X71A 1JIJA 1NYLA 1E3IA 2O0KA 3JQ7A 4YJHB 2X5JO 4RHEA 1R66A 3FMIA 1X38A 1ZHFA 5DM0A 3MILA 5ARCA 1YRHA 3NRBA 3HDYA 4JXKA 4KPUB 3TD2A 2GLUA 4X63A 5KVVA 3D3QA 2QX9A 5TXGA 1JKXA 2IPXA 3IKLA 2H7XA 4DM3A 3BOSA 4NENA 3TOSA 5JRZA 1KI1A 5JISA 1HSZA 5CVTA 1E4VA 1E7RA 2ZUUA 5B3JC 3CLKA 2Q21A 4HC4A 5EIWA 2BCEA 5EIXA 1X7YA 3QTLA 4N6OA 4I1IA 4X84A 1I6LA 4PICA 5ADHA 3A04A 3K8ZA 2AFVA 3ADCA 5CFQA 2Q5EA 1SBCA 4LFAB 5B2EA 4XYMA 1EFCA 4C4PA 3TMYA 2HCRA 3EG9A 3AJ8A 2VAVA 3CRNA 4BFSA 1HT0A 1W5TA 4XOIA 3N3BC 5KNBA 1WXDA 1F9EA 4JI8B 3SZOA 4LXXA 4PSCA 5JS2A 3T5PA 1YCHA 3GZNA 4DKXA 2ZRKA 1HZZC 3EAQA 2IV3A 3IAUA 1KSHA 4BWYA 3CUYA 1T4CB 2P9QA 3EGCA 4NOMA 4LGMA 4LDRA 3ZEIA 4CTKA 4BX8A 3D5TA 1HRKA 1S9HA 3WL7A 2EXXA 2YZ7A 3VPSA 4H35A 2QZPA 5BXQC 2KBFA 3E7WA 1O4WA 3Q2KA 4E14A 1ZXBA 1SNYA 2ZJ5A 2DR0A 1TL7C 3WB0A 1JYFA 4IXWA 2WQ7A 1MG5A 2W6CX 3NIDB 2IJGX 1AHHA 1ZMTA 3RVSA 3K6SA 3QKIA 5JO0A 3PDCA 4HAWA 3SYTA 4DR5B 3U7GA 4MUKA 1V5EA 2CVPA 3E58A 2PNJA 1NFQA 4PBSA 3W5IA 2V0NA 1E0KA 1UC8A 2DZDA 3LKBA 4ZPXA 5DISB 3VSBA 4BNDB 4MRNA 1ODLA 3G2OA 4YEDA 4PFJA 2C4HA 4RCZA 3STUA 3Q98A 2GVDC 4DYDA 2FZKA 2WJIA 3F96A 1N6PA 1YOBA 4MS4B 3OKPA 1QIIA 3N74A 1ZRSA 5KTTA 2G36A 3BA1A 1DJMA 4UEWA 4IKEA 4QUEA 3FX2A 2QV7A 2IL1A 4N5HX 5IFKA 4JLWA 4G36A 1TO2E 3EXFA 1PJ4A 4I1RA 1OASA 3UK7A 1RADA 2OP1A 3RYCA 4IILA 1J7KA 2WZBA 3M33A 3MUEA 2GA9A 1ISSA 2VK2A 3R3SA 3PG5A 4E21A 3D3NA 4I9GA 2L0XA 3IT2A 2WAAA 4R69A 4DV0B 1WKBA 4OJKA 5DTRA 4HR7A 4Q1FA 1E92A 4LE1A 2BUCA 5LU9A 4B6PA 1EGHA 1R4AA 2HNBA 3QE0A 3TRJA 4R8VA 1C5KA 1Z25A 4OJQA 3BIFA 1EM6A 4IPTA 3TQOA 4BNMA 4XYLA 1ZONA 5JZBA 3GIDA 3JRWA 1SBHA 4WW0A 1NRXA 1M1UA 5CYOA 5AM2A 4A1FA 1Q3HA 5A6SA 4ZU3A 1FLNA 1CZUA 2EIHA 3L0YA 2PQMA 1OD6A 4Z1OA 2QMZA 1FVOA 3MQ4A 3IQZA 5BYKA 4NNPA 4C5AA 2IHBA 1PRYA 1L5VA 1UEXC 4J16C 1IL0A 4W99A 1P73A 2KHZA 2RHTA 3UWSA 5TMBA 2H16A 3BSWA 1WUTA 2V3CC 4Y8VA 1QYDA 4PLPA 3LQFA 1AT1A 5KOIA 1PSZA 5ALJA 2IZ7A 1JALA 2VNAA 4GYKA 4RVCA 4UBNA 2RIPA 3CRMA 1JHPA 5BWNA 1COWA 1ZK0A 2FWPA 5KIAA 1Q95A 2Q46A 1GAQA 4AZSA 2PZAA 1AGXA 3LWNA 3DVRX 3UV3A 2CLIB 3DLTA 4MRRA 3TFWA 2RHGB 1KZ1A 3FGOA 3ZS8A 2AKYA 1JJ7A 1UK7A 3O8OA 1OI3A 1QNLA 2GB4A 4RLHA 3ZJTA 1KZ6A 1XCMA 4HDOB 2VI5A 3A3OA 3LQ1A 4W5NA 2CFTA 3KYIB 2J1LA 4UARA 3AI2A 1P4JA 2BH9A 3ZV5A 4CYMA 4NZYA 4DIDA 2ZDHA 2J9FB 1FSPA 2GAOA 4RIHA 2H2HA 3ZDAA 1IY1A 1V9LA 5ESRA 1RPTA 3GW8A 4IFEA 4HTAA 3PQ5A 4BE4A 5IVKA 3KXDA 3V2GA 5JATA 3PEYA 3FSEA 3G9UA 4IJ5A 1SKUA 1IRXA 4Q3EA 1J4AA 2QTTA 1K7SN 1KRWA 1ZJYA 3X1ZA 4B6QA 2BGUA 2SKDA 3BMOA 1RBMA 8LDHA 2Q6LA 4X1KA 4TV9F 5HF6A 2PE5A 4RZHA 2FFRA 4BE9A 2F55A 1DHTA 1NA5A 1ORWA 4JLMA 5DYNA 3QLUA 4MVYA 3D1VA 5IVIA 3WHIA 4JI2B 1PYGA 4YNBA 1ISGA 4BVGA 4LOLA 1CQWA 1JAIA 5FH9A 2VT2A 2LKDA 3KOMA 1AO3A 3AEUB 3OHMA 2R1ZA 3HR8A 4IINA 4MTLA 5KSOA 5I4IA 4L0QA 5GIPE 1XRQA 3ER9A 1O54A 1E5VA 1ETHA 5LA6B 2ZJ6A 3IB6A 1PFWA 2EFYA 3WB2A 4CMJA 3NVMB 2CUZA 5FWAA 4QLBA 3TZEA 1FVFA 4G97A 3B2EA 3GLGE 5K3BA 3GRVA 4YLEA 3KQPA 4B6FA 1DEKA 5KX5A 3UY4A 2E21A 2CT8A 3U80A 3ZW7A 4EWLA 1LY1A 4P3PA 1J1ZA 3MLAA 1UZMA 4JKOA 5EQDA 4I50A 4LRXA 1UFOA 2PT7A 3HI6A 4R98A 1ZXXA 4HX9A 5EC8A 1UMKA 4H3KB 4I1UA 5AW5A 2JFUA 5LL6P 4CDGA 3MW8A 3TZCA 4QG3A 4MRSA 3W2HA 3OETA 5K3FA 5HZHA 3WZLA 1TMOA 2ONZA 1XZBA 5G1NA 4C0WA 1OB5A 1PR1A 1H2BA 1Z0AA 4KV9A 1UPXA 4LHZA 1L1EA 2ZYIA 4N4AA 4MQUA 4U6SA 4G5RA 2FN9A 2GEBA 5EOVA 4CBVA 1OX6A 5L4NA 3P52A 4MQ4A 4EG1A 1QLWA 3H05A 1XCBA 3U61B 2OXCA 4WERA 3OM9A 2GCGA 4BP3A 1ECCA 1K1EA 2ZQ5A 4U7GA 4AMBA 1S1MA 1WULS 2I3GA 4P7GA 4WDRA 3ZV3A 3PC8A 4LJ5A 3FMVA 1XFDA 3SICE 3FUVA 3U7EB 5BOSB 1C81A 4TUYA 5TNXA 2PCLA 2XWJI 3IP5A 4K9DA 5FOVA 2PUBA 3ODGA 3A6ZA 3PXDA 1EX7A 5JXWA 3K5HA 3E48A 3MS4A 3QKSB 1N2HA 3PXAA 1JFFA 4HDNA 1L6RA 2DCUA 2CXQA 1X7YB 2ZWPA 3QU2A 2PZJA 1DEOA 2R66A 3AF2A 4FHDA 2A33A 4WXPA 4L9WA 4CF4A 4CLOB 2VP4A 2TYSB 2J87A 4BP1A 4O4IF 1WV1A 5JFGA 3H7IA 1THMA 3KB6A 3EG9B 4OGKA 3KBOA 2ZWAA 3ZBQA 4BATA 3OX1A 5HKBA 1JKFA 2G07A 5LZ4A 4U7WA 2YIVX 2VYQA 1T9GS 5BMOA 3D02A 3DBOB 3U31A 4NIMA 4TT3D 1KJYA 2CMFA 4M7PA 5G2OA 2ODNA 1PJCA 1WB9A 1B8PA 4C3VA 1RYZA 1S2IA 2EOAA 2KSQA 2QMEA 2QP9X 2AD1A 2WUGA 3RFXA 4EPXA 3D6TB 3DJYA 4XJXA 1HMYA 1VG1A 3L6EA 1KK3A 3FNGA 2GBLA 1GPDG 4Q4HA 1EWQA 4ZDKA 1BEUB 3O4HA 4DZRA 2XD4A 3WKCA 2QSZA 4PGMA 3HB7A 3MIZA 2F43B 5TPZD 1K6IA 4PN3A 2GXAA 5CH3A 2AXQA 2AJBA 3B48A 5JNSA 4JSTA 2O6HA 4IWXA 2XF2A 1FW8A 2FMFA 2IITA 2ZJOA 3CG0A 4MV6A 1HYEA 2AV6A 3FYUA 3M0EA 4KN5A 1AK9A 1FXWF 2O2GA 3IAXA 4IVPA 3RNOA 2E9SA 4OM7A 4C0XA 1M2VA 1ZIPA 1MH1A 2EIXA 4RYDA 4WKPA 2G7ZA 1GYPA 3IULA 4KQGA 1VI6A 3ZGLA 4B0OA 4X62B 2Z95A 1GR1A 2FQ1A 3A1CA 3CSUA 4O2LA 4JJFA 2WG1A 4YCNA 3KKQA 4I99A 5CCBA 4JUAA 5LMZA 4UHBA 3SE7A 2CJPA 4F21A 2R8RA 1C7RA 4OUKX 1KKLA 5AJYA 1IXYA 4FGWA 1E2GA 2O05A 2I65A 1R27A 3OLWA 1YDFA 3TQIA 4YQFA 2GM3A 5F51A 4Q0MA 3ESBA 5DYYA 2A0WA 1C8KA 3RIYA 5TQ2A 4MUGA 1I94B 2QE6A 1BN7A 3K72B 2FTKE 4LTMA 3VPDA 2I03A 3L0ZA 4H31A 3G0CA 1UEJA 5JAZA 3AF4A 1PV4A 1ZM4A 2PBRA 5FLEX 3ROQA 5A4FS 1IRIA 4KG7A 4FKZA 1TVEA 4RORA 3S44A 4NY1A 3OM1A 1YB1A 4X24A 2PX4A 1VZ2A 4IDQA 4C06A 1XEWY 4F91B 5A6SB 1MEJA 2W2TA 1PNRA 1X7ZB 5ALXA 5TX7A 3BMCB 1HNZB 1L8AA 1E89A 4PNZA 2Q3BA 3UATA 1FX0A 1ZU5A 3RREA 2RI0A 3AR3A 1A82A 1LFAA 2ODAA 1Q92A 2VT3A 4G07A 2AVDA 4P4UA 3PX7A 2IHZA 1XCGB 2HCFA 3G8AA 4KAJA 4NNJA 3S8EA 3IAS6 3AUYA 1YQEA 3B5IA 3GF4A 3SM3A 1KEWA 2P5UA 1QH1A 5E7IA 4ANFA 2ZRBA 2P91A 4HEJA 3FMFA 4URXR 4YJGA 1RI3A 1LF5A 4J0HA 5C8ZA 5C1PA 2EWVA 3H18A 2WT8A 3Q15C 4XR4A 2SNIE 1PWXA 2VNSA 1U1DA 4B7ZA 1KDPA 4J4HA 4KR9A 1YRBA 4Q34A 5IJAA 1XZCA 2Y77A 1ZNYA 2CHUA 2R25B 4RSGA 4X5OA 3ERCA 1VB3A 2OVFA 4RVUA 1K92A 5E2BA 5EHZA 1RWKA 1B16A 1HSOA 1U1CA 3ROMA 1XU4A 4EB6A 1LBIA 3D4NA 3LNCA 1QH0A 1E9VA 3MQ2A 3QP9A 5C34B 2X0DA 3RRJA 2W6MA 1GPYA 1RBQA 2WU4A 3ICVA 3MGBA 4YLGA 2FG6C 3BHJA 4YAJA 5FWXA 5J2TA 3C7CB 1Y1LA 1ZUIA 2XMBA 4GG1A 3WP1B 1HE2A 2DCMA 3OOEA 2XOEA 1N5KA 1S89A 4RJTA 4ABYA 5IM4F 3CPSA 4RHCA 3G68A 5C1OA 1H6AA 1X1CA 3HUFA 5HKKD 4DIBA 4OFWA 5LP6B 4BFTA 4HJRA 2IGBA 3EXEA 2AJCA 2A1UA 3P2JA 4CT4B 1NF8A 4NAHA 2YNMD 2ZBUA 1CT9A 4LC0A 3PICA 4ON9A 3K9QO 4GVXA 5IMBA 5JSKA 5DFAA 1C7EA 2WHPA 3JWPA 1JEOA 3QQPA 3LO5A 4KQJA 2RGNC 4MMZB 3TLBA 2YDXA 3QOFA 3VOTA 3TL3A 5LLDA 2X3FA 3IALA 2NYUA 4I55F 3EPRA 2X8WA 2YN4A 2CF5A 5CX4A 1G3UA 3ETCA 4YJFB 4LZJA 1QJCA 1EZZA 5DLEA