4C1BA

Esterase domain of the zfl2-1 orf1 protein from the zebrafish zfl2-1 retrotransposon
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
171
structure length
171
Chain Sequence
GPAMDVAIIGDSIVRHVRAASSKGNKVRTFCFPGARVKNISTQIPTILGAAESPGAVVLHVGTNDTGLRQSEILKKDFRSLIETVRRTSPATQIIVSGPLPTYRRGNERFSRLLALNEWLITWCKEQKLLFANNWNLFWERPRLFRPDGLHPSRAGAELLSDNISRLLRTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF1-ENCODED PROTEIN
publication title Structure and Properties of the Esterase from Non-Ltr Retrotransposons Suggest a Role for Lipids in Retrotransposition.
pubmed doi rcsb
source organism Danio rerio
molecule tags Hydrolase
total genus 54
structure length 171
sequence length 171
chains with identical sequence B, C
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12690 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c1bA01
3.40.50.12700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c1bA02
4C1BA
chains in the Genus database with same CATH superfamily
3DZIA 3H87A 1ISPA 1BCSB 1HE2A 2PTHA 2V8BA 4B40A 4CTNA 1JF8A 3NC0C 2QRUA 4YYEA 5SZJA 5M2QA 1IG3A 4RJJA 3HM9A 3IV7A 4C5BA 2GSWA 4AN0A 5C8YA 4A0HA 4NYJR 5HOQA 3LQQA 2IZ1A 4F86A 2GPTA 5I5GA 5LBTA 3R7SA 3DTNA 2ZRAA 2X1MA 5DBGA 3UNXA 4NOLA 1NUQA 1FC0A 3RQIA 1W5AA 3DUFB 4EGQA 3VX4A 1ZVQA 5HF6A 4BN4A 2Z08A 4DAEA 1UAAA 2OO5A 1VDMA 3E5NA 3GFSA 4HP8A 1HDIA 3SN6A 3OY2A 4ZZ3A 2YQ5A 1QANA 4ATNA 3G9UA 1M10A 1O95A 1X80A 2CSUA 2GYUA 3I2YX 4QXMA 1D4FA 1K3TA 1M67A 1AK1A 1TJYA 2XOKD 5F1KA 3PEYA 1LBQA 1OU4A 4C4XA 5IDXA 1U11A 5KDDA 1HKUA 5KOJB 3T7CA 3AYXB 3OZUA 3QITA 1SUCA 1E2KA 4M1WA 3PXUA 3PGMA 2NMVA 1URPA 3A1VA 3LUFA 4IVQA 4LJYA 4CG0A 4DWVA 5AW2A 3Q4GA 1AF4A 2ZXFA 2FJ0A 5THXA 1FVHA 4DMUB 2K4MA 1KSFX 1WF3A 4S0XA 4N49A 4WACA 3WKDA 3K2EA 3IAS1 3MHTA 1KFBB 1ADFA 5CW1A 1COWA 4ZCIA 3FUUA 1A96A 2PD6A 3LHDA 2A14A 4Q3DA 1IBRA 2FW6A 3U44A 3AKEA 2H4XA 2Q0XA 4NNJA 1I32A 1OX4A 1RWVA 3KU4A 5DNUA 3L1VA 4NKRA 1IPHA 4X8HA 5GGYA 2CLFB 4DY6A 2OV2A 4DXDA 4W8GA 2XXAA 4QUJA 1H6DA 1ZM4A 3GJ8A 1C0LA 1L6RA 3NDRA 3QVGA 3KHKA 4KWIA 3TD6A 5BORA 5T6BA 4D99A 2DBZA 2WJPA 2EKDA 3V6LA 2R1VA 3WHLA 4BX0A 4G5YA 4LS3A 2JRLA 5E7JA 3OAAA 1R9MA 3T0FA 2VCYA 1QUFA 2LDBA 1WUIS 3E7PA 2XUJA 3HVJA 1XCLA 3RROA 4ZRNA 2HFKA 3MJTA 2YHIA 4B3IA 1A8PA 4PLPA 3OQJA 2VTBB 5D01A 1R0XA 2O2CA 3QVOA 3LUAA 2AMJA 3AJAA 2XGSA 3ZPXA 3LDGA 1OIWA 4JEIA 1TTPB 3TEMA 4MQFA 2BELA 3MWEB 3TR0A 2VRBA 3D2AA 3ROQA 3QEAZ 5JRZA 2P2NA 3R7NA 1ZITA 4FNMA 3JALA 4S1WA 2AOTB 3VR3D 4KFCA 3D8NA 3O82A 5FYQA 3FZQA 1MC8A 2IXFA 3OU2A 3KDAA 4BO3A 1WG8A 3ADCA 2WWXA 1K5DA 1GZ5A 5EZYA 1DOHA 4QFCA 3H5IA 2Q7XA 2A5LA 3FYCA 4QBHA 5KSYA 3QU4A 4MUBA 4ENUA 1KARA 3MUFA 3H16A 4RVOA 5I6DA 3LTNC 4YMWA 3K6KA 3TRIA 4TYYA 3IVAA 3ONFA 2AC7A 2YZNA 1TA0A 4AP6A 1EUZA 1TW2A 5JFOA 5C5CA 1CF4A 3AVVA 3NHMA 1SEPA 2F3PA 1X7HA 2JFGA 3EQ2A 3QM1A 5I7AA 6ABPA 4GICA 4M9SA 1ZH2A 4N3AA 4JI2B 4FBLA 3MUOA 2FXIA 1T2EA 3OJLA 3PC4A 2D2VA 1P2DA 1NLZA 3ZHYA 1PGQA 1V8BA 2D2IA 2DFPA 3NBFA 2IS1A 3FMFA 3VI3B 3I39X 3H99A 2C83A 1AQIA 1XELA 3AR6A 5LA6F 4CKEA 3OMLA 4RGBA 3RAJA 1CJBA 3HCCA 1FP4A 3G2IA 3ZS9A 5FLEX 5LOVA 1DXHA 3DEZA 5T4HA 1YTLA 2P9JA 2RI1A 2VSFA 5DO9A 1QHFA 5LA6B 1LW6E 3EG9A 3OFSA 1XNRB 3AI3A 3A36A 4KPEC 1DQSA 2C2OA 3QWBA 3VAAA 1MC4A 3DC2A 1NXQA 4HH3C 5D00A 5IT5A 1KJWA 2YMQA 1K6JA 3E35A 4INAA 3QUCA 3LUHA 1KQFA 3C1OA 4B1FA 5DASA 1V11A 1XLUA 1NJGA 1RC0A 2F9LA 1FP7A 3QVSA 4RBNA 5CVEA 1ZKDA 3G89A 3L8CA 3ZDYB 3H9UA 4DUGA 2BYTA 2WZBA 3OZCA 3S1AB 2GCOB 1VYVA 3WZ2A 5CVTA 3E05A 2ZYVX 4QOIA 3PEFA 4MV4A 3PGXA 1RAAA 2FNAA 3K71B 2GESA 3SGLA 1KY3A 3N7AA 3THXA 2G4LA 3ESCA 1IXZA 1RAHA 1EFDN 2WTBA 1QWOA 4K28A 4LUCA 3U2QA 5DBEX 4F4FA 1KQGA 3DA8A 3E03A 3OU6A 4AX4A 1L4GA 1MB3A 4N5HX 3EYAA 4CPDA 1R6DA 1DEHA 5ILQA 2ZB8A 4I1RA 3SC4A 3BN3A 4XFDA 4IRUB 1X7WB 3FVTA 3L92A 1CUFA 1I1OA 1NBME 2GF2A 3JU3A 4R41A 3TNLA 1GN9A 1CP3A 3NU1A 4QLAA 1U9IC 5FR1A 2VYND 3CIOA 5CEEA 1X3SA 1MNAA 3OQVA 1J8MF 4PLGA 2J9FB 2ERCA 2QMZA 3FNIA 2Z58A 4P3NA 1U1DA 3HYNA 3OE5A 4RIHA 5BN5A 3EDOA 5HMMA 5LZ7A 1E4EA 3JVDA 2IYWA 3FNGA 1NXXA 2HSDA 5AIAA 2R3SA 3HHPA 2IX9A 3PNQA 3DKKA 3K31A 3MRSA 4JA0A 3SSOA 1FNBA 1W4LA 1Q21A 4KIGA 3HLYA 3I37X 4GC9A 4LFCB 4F21A 1TYBE 5GONA 3UJCA 1L7PA 1V9CA 4FINA 1L5LA 1UKYA 2ZRKA 1T2VA 2ZBPA 3QV2A 3TOXA 1ABBA 2Q29A 1EVIA 3BRCA 4NHEA 1FFDA 1U0LA 2A30A 4C5AA 3V8EA 5CA0F 4L8VA 2D54A 1RYMA 5KYWB 1WMSA 2ECPA 2J9GA 2O2JA 1JFLA 3QFHA 1FMJA 4JVOA 4RKFA 5LR6A 4OLFA 4NXNB 5BWMA 2YVUA 1I4DD 2PN1A 4XM2A 2O1XA 5HBRA 3WIBA 4J3NA 3BDVA 5FL3A 5FPPA 1KJNA 2FEAA 4AKTA 1Y4SA 2CXHA 2DJ5A 2AQ8A 3GJZA 3BAFA 5BURA 5HHTA 5M34A 2XR1A 3ABRB 3QPBA 1CR6A 2W6JA 4GPEA 5LJIA 3AH8A 3WZLA 4ZODA 1OB2A 2VK4A 3WLIA 4L02A 4I50F 3TJZA 3K9FC 2HLDD 3IAFA 1N6KA 2VRNA 1G8GA 1ZW1A 1DO2A 3IFSA 3LE8A 3RLIA 1TZCA 1UM8A 3S3TA 1JQ5A 2XUKA 1MDFA 3KQPA 3EE6A 3JY6A 4Y6LA 2BKVA 5EXTA 3F6EX 3LBNA 1TT5A 4I50B 2YXLA 2QBYA 1A2BA 2GM4A 1NUSA 1L3CA 1Y80A 4RTSA 2PZFA 4B80A 3K9NA 1X8KA 5D5PA 4YUYA 4D44A 4FC7A 4GOND 4IUBS 4QE3A 5IN5A 3WNBA 3JPWA 3QLVC 3MINB 3H8JA 3R0VA 4D2IA 2IYSA 4DR6B 5EMJA 5K4AA 1DPGA 1JH8A 2OZVA 2R5FA 2WU4A 5CG1A 2GK6A 3EGEA 3DHWC 4AS2A 4PLCA 2AMFA 4C0HA 1ZOPA 1MABA 2VDUE 3JQ8A 1KOJA 1PZNA 1CJVC 2GJAA 2OAQ1 3IL2A 2OC4A 2CL7X 3CSSA 4FLEA 4RDCA 4BLWA 4IH1A 3W3AD 1N2CA 4ARUA 2Q4TA 5BXQC 2XB2A 1CS4C 3DTVA 2ARKA 2YL2A 3CZ5A 2PQ6A 3PC2A 3EIOA 2I6XA 2RFLA 4HFMA 1BGVA 3R9XB 1LVGA 4PYOA 5HE9A 1PF7E 1DWOA 1CHDA 2PGIA 3IE0A 4TV8F 4AMYA 1QNFA 4KV9A 2G7MC 5KIAA 4G2NA 4O4IF 2CDBA 4RSRA 5BNIA 3T1HB 3C7AA 1ACMA 2XMSA 4TV8B 3UC9A 3BEOA 3HO1A 1E5XA 2E4UA 2OXCA 4Z4HA 3BB3A 4EG3A 1FLDA 1ISIA 4YRKA 1PT6A 2ST1A 1W25A 1VBNA 2YJGA 1IY8A 4M38A 3IBGA 1RLJA 1B0PA 5H02A 2JIQA 2G9QA 4PAOA 3SZLA 1E1QD 1RE1A 1BYIA 3Q7EA 4I9NA 3WYGA 4MAMA 3UCFA 1DRUA 5F4BA 3KJNA 1U04A 4FCCA 4RSGA 4GFDA 5DTRA 4KQJA 4WESB 2O3JA 1I13A 2QUZA 1QZZA 1CF9A 1RIIA 4LHWA 2WMDA 2F8LA 4TSFA 3JZDA 3SHFA 3B2EA 3ZCTA 4ZMBA 2IWHA 3RADC 2R00C 1QP7A 3BIOA 3BJMA 3HI6A 4F1KA 1KH1A 3BMCB 2AFRA 2ZVDA 2C0PA 3KETA 3RSZA 3T7TA 2IBTA 4OLBA 2QW8A 4JDUA 4XIIA 1PJCA 8GPBA 3WRYC 3PS9A 3GL9A 2JGFA 3PWTA 4AB1A 4HAWA 2GM9A 3RV4A 4NBNA 2H1IA 4HUQB 2HCRA 4L9RA 3VU1A 4JWKA 4N5IX 5EE5B 2C07A 2O8DA 1SC9A 1ISFA 3CWCA 5K6TA 1H1LA 1KK1A 4CQMB 3AY6A 2H7YA 3RRBA 2I8LA 1YRAA 1QYXA 3GZTB 3VKVA 1T0BA 4H08A 4ICIA 4BBAA 4CDNA 3CEHA 2DR3A 4WJLA 3FSGA 3BFPA 3HZRA 5EJFA 1WZCA 5ICEA 3U80A 4B4WA 3TR6A 1GKUB 4I4LA 2I2AA 5AVWA 4M0KA 3WWCA 3NX4A 2MWMA 3M5CA 2G08A 4HS4A 1ZOIA 2AZDA 3MJVA 1E61A 3M8KA 4QGSA 3RU3A 5GIPE 2F43B 3Q87B 1GKLA 4OVKA 3VNAA 1PYGA 1MTZA 1ZSVA 3O8QA 1SVIA 4KX5A 3HSSA 3C7KA 4KXNA 3C0KA 2J8ZA 2LP4Y 4UEWA 3FOEC 5TMDA 1JNXX 1KRHA 2W5UA 2CW5A 3SXPA 1G2OA 2HV8A 4ZHQA 2OO3A 1A04A 1G8FA 1E0AA 3S6JA 2JLVA 1YR7A 1DV1A 4MIYA 1U8UA 2PJDA 4BX2A 1ENYA 1MKYA 1W93A 1BROA 3MN1A 2O2YA 2DPHA 3OIFA 3KRTA 2J08A 4MHSA 2VKQA 4D5GA 1KZ6A 2JCSA 1MX9A 2X8LA 4GKBA 5FA6A 1M9NA 3D59A 4DUYB 1WMFA 4YRQA 4MJLA 2HT6A 2YTZA 4IR7A 3VDNB 2ZT5A 1FFBA 3IQIX 1LK5A 2XVXA 3OJOA 4ID9A 1RMYA 2HSJA 3AKZA 1KEPA 2IS2A 4FHFA 5E2AA 3CHYA 1R4AA 4Y6RA 1CV2A 4XRGA 4YCJA 1A9QA 5HK8A 1QKJA 2OCIA 1KWKA 1M1ZA 2WI8A 3TLYA 1EE1A 4FGLA 3BT7A 2HF8A 4KBYA 5HCIA 1ANKA 1ZXXA 3EVAA 3R0IA 4L7QA 5JSZB 3QLVA 4ZCRA 3HCOA 2WAAA 4P4LA 4OLAA 2BE7A 1BCSA 3GLFB 1W4RA 2RGXA 3WK5A 4I5DA 3RS5A 4PR3A 3JQ9C 2H08A 5F2OA 1LKZA 4BN0A 5DCYA 3O03A 1ZDMA 3TBKA 5ERYA 3X1ZA 1QBKC 1CX9B 1T3GA 2G70A 4XLLA 4DREA 1QF7A 4LJRA 9LDTA 4O2AF 2PHZA 1DKUA 3DUFA 1KVTA 2VH2A 4Y3UA 3VYUB 1DBVO 1VE6A 2QTAA 3KPUA 2R6CA 4IV8A 1ULUA 4TXMA 3WGQA 1SC4A 4O2AB 1ZW6A 2XB4A 1RCFA 3DZCA 4DN6A 1UH5A 2E37A 2GSDA 4PSDA 1LEHA 1NW9B 4CGYA 2AFIE 3PX3A 3LIIA 5H9VA 5IDVA 2GZ2A 1E2EA 3S4YA 4E33A 4DIFA 3I9KA 4MA4A 1UKZA 1NVGA 4ZREA 1G3RA 1X13A 5AVTA 5E4FA 1T36A 1YV9A 4GVXA 1E9BA 1Y7PA 3K1AB 1HI9A 4OQEA 4DQDA 4PZCA 4L4YA 3GR6A 1FTWA 2COUA 2VNIA 1U3DA 5EJ2A 3H86A 3TTTA 3LQRA 5ED0A 421PA 4BVBA 4B84A 2BCJQ 3RVLA 3NBZC 4PSUA 5BOSB 3FKSA 4WAUA 2JAUA 3LH5A 2XF8A 3E3AA 1Z73A 4CQNA 2F62A 4KK4A 1DS6A 1W19A 1YQDA 1Z26A 1V2HE 1YC5A 2HNBA 3AQ4A 3LX6A 4Q3KA 4WXEA 5HJ7A 3VJRA 1GHTA 3KOZA 4KXLA 2W0SA 1ZXLA 4BZXA 3WGIA 1TUBB 4IJQA 2B6HA 4W9RA 4BCDA 1ICEA 2EJCA 3TLJA 4ZYVA 2ISSD 3A7EA 2X1VA 3CRMA 1YRLA 1SJ9A 3WJAA 3ND5A 2GLXA 3EODA 1HYGA 1NVUQ 2OLEA 3ID6C 3LVRE 3RFFA 1NVVQ 2BEUB 2DFKB 2W11A 1MG5A 4KBFA 4X54A 1EDDA 4V0OA 2PYIA 1VYTA 4YN3A 1O97D 1QIIA 1S8AA 4FNAA 5KQRA 4COKA 3VPFA 1ZJWA 3DBIA 3VJLA 1DFGA 3A4LA 4EAQA 1IZ0A 3PXEA 2X0FA 1L4YA 3BFJA 2BHNA 3OKCA 2CZQA 2A7XA 3E27A 1VLZA 1N5DA 4MW4A 3QEBZ 3MWEA 2GFQA 4HZIA 4F93B 4G41A 2FMKA 2W2PA 1MRSA 2XB8A 3NHUA 4Y6SA 4F60A 2QTGA 1ODIA 4IIDA 2HIAA 4L78A 3JTMA 4H3KB 4LZAA 1E1YA 5DRYA 3UKJA 4JBXA 5EKTA 1KVRA 2X23A 3KB2A 5CURA 3V4OA 1RYHA 1QVVA 2CXRA 2DKNA 4WNIA 4G81A 1UZNA 1BMDA 2P6MA 1Z2CA 3W4IA 2H00A 2P3OA 5CCXA 3KPVA 5EY5B 5ERGB 5LP1A 1O03A 2BR5A 4U39A 5FPKA 5JALA 1R3UA 4Q6BA 5FIUA 2UZ1B 2DJIA 3NONA 4QOFA 1WMBA 3ZQ4A 1E9CA 3IX7A 4WLVA 3BRQA 3GRPA 4H7DA 4FPXA 4AMVA 5JROA 2FA9A 3T1OA 3W6OA 1QHHB 3RE1A 1GGJA 3ND7A 3OEWA 1AUQA 1Q20A 4H7PA 4BWVA 3OT4A 1E9AA 4ND7A 1HEYA 5KPDA 3HB1A 4C07A 4BU1A 3G68A 3TIXB 5AD1A 4XZ3A 3WJ7A 1I7DA 2XUFA 4FYVA 3V7YA 1UQTA 3CX6A 2HU7A 4FEGA 4P54A 5FA5A 3WKBA 1XDBA 3LD9A 4HDQB 2ZROA 2NACA 1CR4A 3G59A 1Q6YA 4NHOA 1LCIA 4HDAA 4R9NA 4DWWA 3AIMA 1TLTA 2Q1XA 2WIFA 4P36A 1WTCA 1KIAA 2Z8YM 1GVNB 1I80A 2GB4A 3CLTC 4X1IB 1W2WB 3DLIA 1JXMA 3ZHCA 2P62A 2OG2A 1GL3A 1RWXA 1Z3CA 2NO7A 4O0MA 5LA6A 5HIKA 2V6JA 4NICA 1U8AA 2OCKA 1SKQA 2B7CA 1WNTA 4JXXA 2W83A 3RAEC 1VPEA 2ZSDA 3AOEA 3BMXA 1DC4A 1U8TA 2NNLD 5BR7A 5E7MA 5UKDA 3OJ0A 3O8CA 3FSRA 3OH8A 2KPOA 2AB0A 3Q3EA 5TB5A 5KYXB 2XNSA 4TKMA 3AB7A 1JBKA 3QPAA 2MYPA 5JLAA 2CXNA 4D4LA 2H63A 4A0FA 4CTOA 4ERNA 1OILA 4MV6A 3UVEA 2F55A 3EXG1 4TM8A 4D9JA 1E62A 1PR6A 1V3UA 2I8AA 4BAGA 4GP6A 1A2OA 3K94A 4LJSA 5EUMA 5GJBA 2OPHA 4LV8B 4PFJA 4U7HA 4YJHB 5SYMA 3ZGXA 4BHTA 5AVZA 1JR3E 3IURA 1VKOA 2P91A 3BWVA 4R0VA 3W8NA 4ARAA 4XIFA 4KR9A 5HK9A 1XTIA 1ZFNA 1XCMA 4L27A 4TYWA 3DV0B 4XFKA 4Y9DA 3RUPA 3TTVA 2H2DA 5JJ5A 5LDHA 1WEKA 1CYEA 4UKDA 1CIJA 2WF7A 3Q3JB 2FMHA 3UCEA 3SD7A 1W8IA 4RF3A 1ABFA 4R16A 3ZX4A 1OTXA 2FZ4A 2REBA 3WSTA 1G3IA 5K3CA 5IXYA 2IOYA 3U7EB 1D8TA 2AI1A 3VO8A 2AZXA 3H5NA 4ZFNA 2JFBA 4I1VA 1OX6A 3AI7A 4QXRA 5ES4B 2XIQA 3BRWD 3QOYA 4B45A 4OLJA 5E38A 1FVOA 3INTA 2Y2UA 2VHTA 2QRVA 1TVCA 3GH1A 4RIEA 4WK4B 1LPOA 4GW3A 2BI7A 2QNBA 4Z9YA 1UOPA 5D3KA 3PI6A 5TARA 3HBAA 3OSUA 1IBCA 4KR2A 1WCV1 4H7IA 3PWKA 4Y0AA 1ZN8A 2B1IA 4YT5A 2D62A 2ZSUA 3WGOA 1Q7TA 2REOA 1XGKA 2YJ3A 4W5WA 3FOWA 2IXDA 4PANA 2WD8A 5CFMA 4B3MB 3UM9A 2BZ0A 3K35A 3GELA 1O87A 4ZTUB 5CLJA 1E1DA 3FWNA 1E2FA 1SOAA 2OMEA 1LPAB 1RBMA 3O4VA 1KJJA 1Z4LA 4UHHA 2W43A 5KYWA 4MTLA 5J4KA 3B9BA 3EISA 2ISQA 1KU0A 2JK0A 4DGSA 3VTFA 3M5PA 5M29A 3GZNB 3D6NB 3FOFC 2DLCX 4UMVA 4JYAB 3RYFB 1XMVA 3QUTA 1IJEA 1ECBA 1PGNA 1QSGA 2EJBA 3DFUA 3H5RA 2JBWA 2PLRA 2O2GA 1T2UA 4WCDA 4MS3A 4MR9A 3LQ2A 5LDGA 3H9JA 4J7AA 4IZ6A 3DNMA 4BLTA 5DNDA 1E99A 4UCFA 4WA7A 2PUDA 2QX9A 4I2VA 1QV7A 4N0PA 2ASEA 5A3SA 1KRWA 3P2IA 4YRTA 3I72A 1VCOA 2YWRA 3RTDA 4XLTA 4BC1A 3VOBA 4QTXA 1X1EA 1JVSA 2PQ0A 2WUEA 1MVLA 2H4WA 4I50A 4K7JA 2IFTA 3BXOA 1T34A 3OFKA 1J7JA 2H9AA 3KJEA 4LK3A 5B7GA 4ITVA 4Q48A 5K2MA 4GYKA 4KLRA 3Q88A 3MAJA 2HY7A 3RSFA 5FLXA 2UZ4A 4BTEA 1SXGA 1OFUA 3D3NA 1EE2A 4C88A 2FPLA 2UUOA 3MFQA 4S1NA 4OSPA 4PCLA 3H9GA 2YV5A 1NDHA 4N0MA 4NH4A 1V5GA 3VO9A 1XAIA 4BQRA 1J5PA 4XD7D 4U7TB 1JLHA 4MS1B 2JS7A 3QNMA 4Q3LA 5K3DA 3N8DA 4F84A 2BEWA 1W59A 2GILA 1AN9A 4PY2A 4QODA 3OLCX 5ILGA 4CI9A 5A4MS 5AXAA 4RY0A 2DC1A 4FEYA 2KI5A 3BZUA 4M88A 4KH0A 4OYYA 3ZDDA 1B2RA 5EIFA 1F2TB 2ATEA 1ODJA 4M0FA 4XM0A 4XVHA 3AUXA 1LU9A 1VIAA 4J6EA 5A02A 2Q28A 2C7OA 1OCEA 1E9FA 2EHJA 4JI0B 1SIWA 1QFMA 3C70A 2E85A 4TV8A 5FQNA 1Z56C 5BWLA 5LLTA 1GJRA 1FFSA 4MA0A 4MI9A 5IZCC 5JSUA 1O94A 1Q1AA 4O4IA 4JLVA 2YWDA 3NAZA 3TLBA 4CMIA 1S3SA 3PP8A 2F1JA 1QQBA 2XA9A 3VZPA 1XZIA 1NMQA 3DDSA 4OHWA 3PE3A 4EKNB 1NV8A 2EGGA 2R6DA 1CIPA 2RGDA 3GMTA 4RQTA 4IIFA 2CL6X 3B9QA 4BFWA 4WESA 5AFSA 1GPBA 4EGSA 5K3AA 3UMCA 4CLRA 4GX0A 3ERCA 1UP6A 3WGZA 4MRRA 2XGGA 5K0GA 4JROA 2D2EA 2OHJA 4ZJUA 2PE5A 1CQJB 1H2BA 4KOAA 1NN1A 4BRSA 2ZSBA 1G66A 1PBTA 2AJLI 3BMCA 4RH1A 4U6NA 3FSEA 2IY9A 4OKIA 1S3GA 2OD7A 4XAQA 4AG3A 1U8FO 5C52B 1SVSA 3B8EA 3DW3X 3JQGA 3T0GA 2KQUA 1JLRA 3E53A 2XYPA 3VHLB 2PUBA 3UMBA 1KAHA 2GBIA 3QEMA 3BFKA 3KKZA 4K6CA 3SM3A 2HV9A 2PUHA 5DNAA 1NSTA 4MPTA 3S5UA 4PW0A 2L2QA 4TYMA 4AMUA 3UJDA 3I3SR 4EATA 3CRNA 3OPVA 5TGTA 4CL2A 1HT0A 3CX7A 4OV6B 5I48A 5H0IA 4FSDA 3FHCB 1NUUA 3FOZA 3WRXC 1VCIA 3QUSA 4DMLA 2OM6A 4DGQA 5A4JA 4C6TB 3A10A 3GJRA 5BUCA 2VXCA 2ICAA 4AYXA 3VQTA 2HBRA 4GKAA 4G65A 4FDAA 4G1UC 4BQOA 1P5FA 4D3SA 5DGHA 4YLEA 1SMKA 3RC9A 5F76A 2ZZNA 1D2CA 4KACA 1DEXA 2F43A 2Y4OA 1M3SA 1K4KA 3QRWA 4K9RA 5FTNA 5IT0A 2RGEA 1DCMA 3G5MA 2AKAB 1QHYA 1SXJA 4ZVQA 5JAQA 3CW2A 2A7QA 1W48A 1S2DA 2C9BA 2ESRA 3DE5X 2IVZA 2JGNA 3B3QA 3N2KB 2GD0A 2IDJA 1Z0UA 2POCA 3NT2A 4MVXA 1U0SY 2RDMA 4QOGA 1MH9A 3FLAA 1EHIA 1KS2A 4D3XA 3HBFA 1SA0B 2JF0A 1HKHA 2VPZA 2PUFA 3T1NA 1INLA 2HWUA 3AEQB 2ZBRA 3A2LA 1CEEA 1N3BA 1ZA1A 1E8DA 3A32A 4H7EA 5K51A 4MHOA 1L5QA 2ZPTX 4Q4LA 1H3NA 1ORVA 1PSDA 2CUZA 2N1MA 2VP3A 1U0TA 1F3OA 1PDWA 3LK6A 2P7IA 4AZVA 5FL7D 3A0RB 2RH8A 1V4VA 3INYA 4EG7A 1YRWA 3QTLA 2ADFA 5JG7A 3G0BA 2BGMA 1UC8A 1MQSA 3AGQA 3GC6A 4TYPA 5CXXA 5E0OA 5CDFA 3T99A 4AF6A 3JYPA 4QZVA 4OPMA 1KI3A 4JNKA 4WKGA 5CFNA 5ICMA 3OT1B 2EZ9A 1NVXQ 5A4KA 4RHTA 5CFQA 5JSZA 4B6JA 5B55A 5I5EA 3ZE9A 1XMXA 1X74A 2DUNA 5EZSA 3TWOA 4XWOA 1I7SB 3GLFA 4KNVA 1J2TA 1LF0A 1BNCA 4GWLA 4KQ2A 2B35A 4L57A 5AP9A 5TJHA 4F2HA 1NF9A 1PZHA 1QGUA 1Y37A 4QJ4A 5K0LA 4PCAA 3DLHA 4CIAA 3TZBA 1VSVA 2XJ9A 3GLGB 3M1YA 5EHNA 2E2WA 4AZ0A 1NBAA 2JKVA 4A27A 4FYYA 3RJ5A 4C2AA 4C6RA 2VHQA 1M75A 2RGUA 3UW3A 1RP1A 4HWOA 2OAEA 3CX3A 1H85A 2QTWB 1FP1D 1H2HA 3LBFA 3PFHA 5THKA 1HO3A 4O2AA 5FTWA 3WNVA 1GRQA 3DMDA 1QG2A 4DLUA 3TQTA 4FMDF 2OWEA 1E89A 4KXFB 4KLNA 1EG2A 4OQPA 4XARA 5DX0A 3R74A 2UXCB 3G6KA 3KB8A 4EKIA 2QQGA 2O05A 4OSEA 4A6EA 2XMCA 5DM60 2FLVA 2O8VA 1O6CA 1V5WA 4GH5A 4QUBA 3VPCA 5CNMA 1JFVA 2MIIA 3ZLJA 4YJGB 2ZJ1A 3RSOA 5GIOE 2CN1A 2IPMA 3FNRA 3LFHA 2Q3HA 3IP8A 3MLEA 1NXTA 4BWYA 1EAMA 1TA9A 5BOSA 2JH9A 2PXXA 4PO9A 4KN8A 1EUQA 4ZO8A 2XNKA 1KETA 2R11A 1IUPA 2O2XA 1FYFA 4UHKA 4RSMA 3K4PA 3LUJA 4K6OA 4X44A 4X7BA 5CT8A 4DLZA 4DSUA 4HV4A 2QRQA 2XUOA 2NSJA 3LP5A 3F71A 1LSSA 3T7KA 3REFA 1TUBA 2AQHA 2CJPA 3GO4A 4K9DA 4KYIB 4L3VA 3ZGNA 1B3RA 5C1DA 2WKRA 4RZ2A 3PL1A 1SR8A 2WSYB 3H4IA 3Q85A 4B5KA 2ZPAA 1BEEA 4N8EA 4TQGA 3VPHA 4BQIA 1W1WA 4LBYA 2GEFA 2OP1A 1OLOA 2HQBA 3ZHQA 4NU6A 4RJKA 3UF0A 3HDVA 1N36B 1NURA 1GQOA 2D7CA 5AVVA 3FTFA 1ZRHA 2O4CA 4YRFA 5IKOA 3UAWA 4EHDA 4I1IA 4AF8A 5IU6A 2QLBA 2UUAB 1QYCA 4QPPA 1KO1A 4AZ3A 3U4MA 3D0OA 4AK9A 2P4QA 1L7DA 1N5MA 2OE2A 3DZFA 4K9NA 1CNEA 1ODSA 3EFBA 3BJZA 4G86A 3WHPA 4ETNA 1Z6AA 1S9DA 4AURA 2APJA 1HTWA 2RGBA 1FYWA 3FHLA 3QF7A 2BDUA 2PPLA 3DEIA 3H5VA 1M66A 1RS0A 3HY4A 3TG8A 2A92A 4ND1A 5JBQA 2WZDA 3ZWBA 1FFHA 2LZ0A 1O4WA 2W2TA 1UP4A 2WE7A 2G4CA 4GS5A 4HLDA 3OKFA 1WU8A 1VL5A 2A6PA 2GJ9A 4KI0A 4P3KA 3DQQA 2RJ3A 1NVFA 4QOEA 2VBFA 4RXMA 2C7VA 1R15A 1YZHA 3OO0A 4DDTA 1RWQA 1EGAA 4KMSA 5IK2A 4MIEA 3RBAA 3TOVA 2I66A 1D0SA 4ZRMA 4CEHB 5CP8A 1LC3A 1QHHA 2PJZA 3AHCA 1E6EA 3G9ZA 3X43A 5HIAA 5JCJD 4CEIB 3CPEA 1UXGA 4KX3A 5FJJA 1KAMA 3WL3A 1E3JA 2AW5A 5WRFA 3CR3C 1YQWA 3D9QX 3ZLBA 4LGVA 3RHTA 1FDTA 3E4DA 1Z2DA 1N6IA 3NHBA 4XPIB 3AIIA 1MA0A 1POXA 4YP1A 4BMZA 2ZDGA 4L9AA 2VSQA 4RYDA 2ZIEA 3GPCA 3W05A 3EEYA 2GYVA 5HM6A 3FTQA 3GGJA 2IXBA 1U7PA 3KKEA 4KQKA 4X1IA 1OWLA 2I2BA 5C8VA 3QXXA 1SXIA 4PQEA 4CKBB 5ITWA 1M6EX 1PG2A 2PRSA 4A0GA 4PWZA 3LRPA 3PFGA 4JUIA 4H4CA 3EFOB 1FU8A 1XFAA 3UH0A 1M72A 3UUWA 2PSFA 3IJRA 4BL5A 1YBMA 4Q4DA 4E07A 4V0QA 5IWCA 2DCUA 2BBOA 4L9SA 3C87A 3CWQA 1JE0A 1JDZA 3WWOA 1RD4A 3EMDA 4NZ9A 1RI1A 2QORA 1Q12A 4BJ6A 1CDZA 1UZLA 2BPOA 3E2IA 1OBFO 3WVNA 1RZRA 2O7VA 5C9ZA 4GPTA 2V9PA 2IGBA 3GT3A 3L07A 4YJHA 5F5NA 4FYXA 1GN8A 2CMKA 3HR8A 3HXKA 3K6JA 1KYXA 4K40A 2B37A 2ONKA 4HRAA 1O96A 4MVWA 3DD5A 3GFFA 3BX1A 1K68A 3ELBA 2PKCA 2O2IA 3KLBA 3DAOA 2J6CA 1GA1A 3LP8A 4M22A 3TR5A 3SICE 3WAGA 2F64A 2WJYA 3L7BA 4GIBA 4NCJA 4ZI2A 1XMJA 2QRGA 2VDWA 3AUTA 3P0IA 3I5MA 4EW1A 4IWXA 4RY8A 3V7NA 1B00A 4X0EA 1SVOA 3JXEA 3KC2A 3U3RA 4WHMA 1Z0SA 2XOEA 4GXNA 4N76A 3J7TA 2FG7C 3ETEA 2BZSA 3P9YA 1G7TA 1Y89A 2VS1A 1TYAE 4R8SA 3SZGA 2WKQA 5B6IA 5IFKA 3L02A 3VRHA 5B7NA 2IEDA 1GFWA 2EARA 1LDBA 4A73A 2UYYA 4WUTA 4RPJA 5MF6A 5KREA 3CRRA 1PNQA 1R4MB 4ZI3A 1ZD3A 3QLEA 3R0ZA 2JARA 5DEIA 3UH1A 5KNDH 3K8QA 1VMEA 4LV5B 3AONB 1F8YA 2FMIA 4I99A 3V1KA 3T4UA 4AMGA 5FLYA 4J7UA 3FNHA 3ELYA 1EBFA 1ZGHA 3QG5A 3TTSA 5KDLA 1GG2A 1US8A 3U7GA 2QPLA 5F7XA 2B99A 3PT9A 5ABPA 2C29D 4PAMA 4K87A 3OD5A 1XPUA 2C9OA 2ZIZA 3DKVA 2V7PA 3HA5A 4TVOA 2AZ4A 4B9AA 1WO8A 4FZRA 4ZVKA 1KYWA 2VQ3A 1R0WA 1M33A 1YC2A 3PXXA 4TWAA 3MJFA 5HCUA 3QVTA 1JR4A 3R09A 4FXPA 1RYDA 1UKCA 4IQ0A 5EIEA 2PIAA 3NATA 1NM5C 3P96A 3I5UA 1W36D 3UUGA 1GZSA 5BY2A 2A9OA 1P7YA 1Q57A 4G1FA 3DW1X 4IG9A 4YTEA 4EOGA 3QE9Y 5FUMA 5DBFA 3AVQA 3PDCA 1BS9A 1TK2A 2DG2A 3ELDA 4E1VA 3X1KA 3CR7A 4MQ4A 1JR6A 3IUEA 5F35A 1JSRA 4DV4B 1L5OA 4DNOA 1I5EA 4NF2A 3AL3A 1JGTA 1T15A 4GMDA 1M6YA 2QL6A 2H5JA 4C6HA 4RMIA 1PV4A 2X42A 4OQDA 3KNZA 2GBGA 2ZYSA 3IT3A 5CNJA 4MPRA 3IVCA 3EZFA 4IFTA 5D86A 4LI0A 3H5AA 2WK1A 1YIOA 4MS1A 2MYUA 4UW9A 1A98A 2ZM5A 4E31A 1ZGCA 1XZAA 3LC0A 4QEZA 7REQB 2AN9A 2X8JB 2FPRA 1JG1A 3L3BA 1QR2A 3T9CA 2BFDB 1FPQA 2WIDA 4ZQCB 2EOAA 4P7GA 3ZI4A 4LZNA 1F2TA 4YAKA 1CUEA 4J94A 4CLEA 4G0ZA 4D9BA 5JBIA 1L7EA 3LW8A 4MYCA 1TEZA 2P9QA 1J4AA 2ANBA 4FQ7A 1H42A 1S7CA 2FLKA 3LC2O 3GQVA 4DCCA 4DSZA 2W71A 1QQ5A 4L3OA 1XCJA 1PR0A 3JX9A 4IOMA 3IKVA 3P2JA 5L9AA 2KX7A 2CLMB 2O1EA 2ZULA 3K9QO 2FEPA 2HMSA 2TSYB 3JQBC 2REXB 3T61A 2N0SA 5HFAA 2F6RA 5DHFA 3PDJA 3VKWA 2CNLA 3U3ZA 1N2CE 3D43A 4RABA 2BKUA 3VNVA 1Y7HA 5IVHA 1QH1A 3DV2A 3PPYA 1YNSA 5EKXA 2B82A 1G5FA 3MT9A 1IHPA 4M54A 3AL2A 4ZANA 3G13A 1WUJS 1Z7EA 1OVGA 3HDTA 1NQTA 3TGLA 1XRJA 3UT5B 1H6CA 1Z8DA 4C4PA 1N2HA 4V1CA 3AEUB 3PBKA 3R1IA 4FDVA 4JIMA 2G36A 1Z6ZA 2C78A 5IVKA 2WA2A 2R7AA 3ICEA 3R6DA 2QG4A 3MTDA 3WMXA 3VHQA 4DV5B 3UAVA 3S28A 3WLHA 3N75A 4FW8A 5B57C 5JH7F 4LOIA 3KOYA 2RE8A 2DPYA 2ZS9A 1JKFA 3FB1A 1DPFA 3MSCA 4ZMRA 3TPCA 1B73A 1U0JA 1LVHA 1EEXB 2ZRNA 4MZXA 4E5VA 5JH7B 4X6XA 1U0BB 1EVQA 3GCXA 3TBHA 3V97A 1BCRA 1I33A 3OURA 4TMVA 3SBEA 4QJBA 4RK0A 3OG9A 5B5SA 1OC2A 2G28A 3KO8A 3HVHA 2FX5A 1LDEA 4EB0A 4YPVA 5HQ3A 3JYLA 4EK9A 3F78A 1QGZA 3FWZA 1R8JA 4GUAA 3QBTA 4UMFA 4O4JF 1GAWA 1SVWA 3CKLA 4XM1A 2O8EB 1GPUA 3M5DA 5JTUA 2M32A 1MO4A 4NMMA 3EJWA 4C3VA 2FN7A 3TUJC 1K88A 1WEHA 2GN9A 4PRZA 2YW9A 3PNLA 4JWTA 3UENA 1THTA 2XGJA 3ON5A 4YP9A 1Y7IA 3EGIA 3RJTA 4YJDA 3V8BA 2VJKA 4YQZA 4CM9A 5AHXA 4KGVA 3QE0A 1SHZA 4M8SA 3SYKA 4B5LA 3BF7A 4Z1MA 4DPLA 4ZZ1A 2OHIA 4K9MA 4KQ9A 2F8SA 2QTCA 1SA0A 2FFAA 3SS7X 3NTOA 2PGXA 4TLAA 4Y9RA 1FL9A 3OM9A 1Y4ZA 2PUVA 3P4YA 5ALSA 5EQFA 3TQCA 4AJLA 4KV7A 5KSOA 1YB2A 1Z5ZA 1NM5A 4WJKB 5HS6A 1NPYA 3PQ8A 4KN6A 3T7EA 4B32A 4BZQA 1O8CA 1WB5A 4I5IA 2QNIA 3LT2A 3ODPA 1OI4A 2HDOA 3KKQA 2V5VA 5JEEA 3O2SB 3OTIA 2GPSA 5EERA 5HZMA 5DTIA 2YYSA 3Q1LA 1XQ6A 1W4CA 2PO7A 2Z57A 1NBEA 5ESWA 4ZK2A 2HREA 2GHQA 5F9FA 1XEXB 4XUEA 4LOLA 4DRYA 3E9MA 4ZPJA 4Y2QA 1M1YA 1JHPA 2DFVA 3MWYW 3OT1A 1IVNA 3DFFA 2YNMD 3Q7RA 3QYFA 2FK7A 2XA1A 1K7XB 2YCLA 1DRJA 3BL6A 3DDHA 4HADA 4NEQA 4DANA 4HMQA 1BDJA 3V2IA 4LECA 3V48A 1T5DX 4H18A 3P2YA 2Z2YA 3F7OA 4NMXB 1Q1ZA 3LDHA 5CH3A 1M5TA 1QIGA 3FUCA 2ADOA 1VJ1A 1GGNA 2Y92A 3P32A 4URXR 1W1UA 3BS4A 3KWLA 1QB7A 4JXKA 1EG7A 1NQAO 1T1IA 3HJUA 2V7TA 2ZTHA 4D9IA 5KQPA 1EFUA 5H9WA 2PZ8A 2V98A 4MYRA 2ZREA 1OHHA 2G0NA 4EKEA 1H0SA 3VNRA 1P9WA 3WKCA 1D6SA 2JD1A 2QYSA 4KN5A 4ZAGA 3L1HA 3NHAA 4GI3A 4BE4A 1U99A 4Z49A 5JLJA 1H93A 3SHVA 1GSIA 3IVRA 2HRQA 5HCNA 3UMSA 5KPJA 1U3VA 1W85A 2IIBA 4F8EA 1E96A 3E4CA 3CUYA 3V1NA 4A36A 1P1CA 1X70A 3CISA 4M76B 3DDNA 2OK7A 4R40A 5LBUA 3GRCA 3QKUA 3JQBA 4DCUA 5KEIA 1T9BA 5LJLA 2QGNA 1IONA 3D3KA 4IRMA 3TLKA 3IVMA 5CYFA 2OBMA 4E2WA 3OECA 3ZE6A 2UYCA 1FUUA 4P80A 3MTGA 5LYYA 1W4BA 3TLEA 4NFYA 2HU2A 2P0AA 3HCFA 4YCNA 1DLJA 2O3UA 4CEJA 1WD5A 4EPWA 3GUVA 3O74A 3ZHSA 4CM3A 1U8YA 4TKUB 3AT1A 3BDIA 3ZG6A 4EHFA 1S9HA 2C61A 3EEQA 3MPOA 3BJRA 5IUJC 4FGJA 2AKYA 4NBVA 1U65A 5TPZA 1HR0B 5HEKA 2KBEA 3B78A 3MIIA 4G5SA 2L19A 1WUKS 2IYAA 2ZRQA 2AXPA 1Z34A 3IVGA 3SJZA 3VPAA 3WDSA 4DMMA 4UBNA 4R0MA 4OHXA 3TW4A 2HJWA 5TY0A 3JS5A 5JPCA 3I9NA 1M1XB 5G1PA 1AT1A 2BV3A 1GUYA 2X9GA 3GFGA 3QPWA 1DKNA 1I36A 1EB8A 2W90A 2OZKA 5KOHB 2IODA 1FLAA 4DJDC 5KB3A 5C3MA 5KYYB 4B33A 5F2KA 4F5WA 4PZLA 1NOJA 2OOSA 4OI1A 4B35A 3D02A 4E12A 4MPPA 2O1SA 2YFQA 4P2BA 4EUFA 3S5JA 5U9CA 1DKOA 1IK4A 2BEJA 4HWPA 3H75A 3RHZA 4X7RA 5FI0B 2BFBB 2DWPA 3OZDA 1QPZA 4XUDA 1LLDA 3B1XA 3ILYA 8ADHA 1YR9A 2LW7A 2XAAA 3I9V6 2OXTA 5DM2A 1XZQA 1S2LA 1R5OA 1T91A 3TM4A 5JS7A 5HKKD 2NPIA 3SLKA 4YRZA 1NX9A 2V54A 3FDFA 4PNHA 1U1FA 7ABPA 2D6FA 3R6GA 2VF8A 4NK5A 3SQDA 1E9DA 2IYZA 3HL0A 3UG6A 4Y1FA 3IXLA 1ABEA 4PQRA 2EBWA 3F8TA 1LK7A 3ZGLA 2PLNA 4BMNA 4CEHA 1JDJA 3ZI7A 2QT1A 3ESRA 4NDNE 1J0BA 2QG9A 2HDHA 4CEIA 5J2TB 1XNJA 4HSGA 3M3DA 3GP3A 1MV5A 3VV3A 4L6CA 3KKPA 5I51A 5TT1A 3HDGA 4LQLA 1DRKA 3IV9A 3ME5A 2IYYA 4M0UA 3NBAA 3KS9A 3BFXA 2PMEA 4LY9A 4J75A 4MHTA 4TV9B 2YINC 1SQ5A 1U90A 4QBTA 2ZANA 4B7CA 1E2BA 5JJIA 4AKHA 3C5WP 1N7HA 2B0CA 3BTVA 5ADVA 3O26A 3MS2A 3KVNA 4CKBA 3F3YA 3W5BA 3A1EA 2BL4A 4ZYUA 1ZNZA 3Q8WA 3UA4A 3NVKI 2I2WA 2QJWA 3EFOA 1MAWA 4MW6A 4YXWD 1YF3A 4J9VA 2IUEA 2J07A 1LPMA 3ONWA 4L6AA 5FTLA 1U2RA 2WNIA 5LZ5A 1ZH6A 3R40A 2GXAA 3H3FA 3DFMA 3WGTA 3IEIA 4X65B 2QE7D 2Z9DA 4MRVA 5AJUA 3OBBA 3N1UA 2FFHA 3OA2A 1OXSC 3L6DA 1VB5A 5CK5A 3CNBA 3EB9A 5DNYB 3QYJA 1QZTA 2NZYA 2CJWB 4TZKA 2J5KA 5JE8A 4A8JA 4DA7A 5IYZB 4FWIB 3L4JA 1GUDA 4MJXA 2GGSA 3A25A 3C4VA 1IWOA 4PU0A 3FROA 4YMUA 1DELA 1YL5A 3CO0S 2QYTA 3IUBA 1CK4A 2PS3A 4WKNA 4OHMA 3PKJA 3JQ7B 3WLMA 2JGAA 4MIOA 1QP8A 3ZDEA 3IJEB 3OWXA 2REQB 5CEFA 3BM5A 4BNGA 4QUDA 3QHAA 2OC9A 5HRAA 1XTTA 4Q1EA 4BYGA 2D06A 2R2AA 3EIWA 1O54A 5ALYA 5EAIA 4UD6A 1V5IA 1NVVR 3O3CA 1M2VB 5A9SB 1AUXA 4UHBA 3LCRA 1ES9A 5CPFA 1RKUA 2TECE 5ECYA 2PXAA 4XW2A 3MOIA 3UMJA 3KVOA 3U3KA 1I3LA 4HH0A 2W6IA 3DGEC 3A6EA 3U5TA 2NWQA 3OT5A 4JLUA 4P81A 3QUBA 3WBFA 4EW3A 2JFFA 1ZBQA 4LMRA 2W2KB 4B82A 1CY0A 3AU8A 2H2WA 3OM1A 3G2KA 2AIRA 1LF5A 4UE6A 2CHQA 4HNQA 3DEJA 2ZUEA 3DVRX 3B1ZA 3OFND 1JDVA 1G8JA 2SHKA 4EF6A 3V8VA 3FAZA 1OREA 1NF2A 4JC5A 2YIVX 3RNLA 1P31A 4EYKA 2EP7A 1NSFA 4RFSA 2R66A 3MWFA 3W3ZB 3LBHA 2V7VA 1ISJA 2DQ4A 4GSKA 5AJXA 3THOA 3OQNA 1EP1B 2G80A 3F73A 2EL7A 3EVFA 4K0KB 5H59A 4ALMA 5A3QA 3TO5A 4G84A 4IIEA 4C04A 2JLRA 1AUPA 4OSOA 3IDZA 3P0RA 4I81A 4WBNF 4TSKA 3Q1KA 2NO9A 4K9PA 3K1YA 4F1WA 1YCDA 4R1LA 3TMYA 4I8IA 2OR3A 3PITA 3T3OA 4IX1A 4WBNB 5A2QA 4CF7A 2VZ8A 4XQ9A 5C4IA 1EPUA 5ALXA 2R86A 2VLBA 1CJTC 3CO5A 1T6ZA 1SKBA 2ZRFA 4KFTA 4OQ4A 1ISGA 1ZHHA 5AM0A 1RC8A 1UMBB 2BAGA 2IGTA 4NFHA 3T5MA 1THGA 1XALA 2BOVA 3A1WA 5FTKA 2XDAA 3SOPA 3CEAA 1GPYA 4AMZA 1JHYA 4N8SA 4PPNA 4CLHA 4DCOA 2AF3C 1DQRA 1TIKA 3AM3A 3L5KA 2C42A 2VT3A 3U4CA 3HCRA 4J1SA 3OOYA 4NYIR 1G16A 5TJ9A 1D9XA 3ET4A 5TQVA 2ORVA 5B1HA 1OAOC 5ARBA 2XZPA 3HABA 2WWVD 1UJ4A 2WIBA 4XCXA 5A71A 3WK7A 7REQA 2UYHA 2J5XA 2C7PA 2YFYA 3PC8A 4Q15A 1E94E 3JD0A 4A5SA 4LJ8A 2X7XA 3EXIB 4OMFG 1AZWA 3N5KA 4CI0B 5K3EA 3VKFA 3N2GB 4MA5A 3TZQA 3DV9A 1NXSA 4M7RA 4C7OA 3PCTA 4UDXX 4LRQA 1U1IA 2Q3JA 1T8SA 3TLZA 1XNGA 3ZCVA 1U2SA 3TVYA 1G8YA 2Y1CA 4NIMA 2WIGA 4FDUA 4UHDA 2EIXA 4H17A 1KI8A 3VPXA 4BQQA 2M1XA 2B83A 3WNDA 3WLOA 1A5BB 4UTXA 3MQFA 3KFVA 1IY0A 1F0YA 3HU3A 1DJQA 5COQA 5AUOB 1R0BA 3HWSA 1L9XA 2Z8ZA 4E4RA 4M7OA 1BQEA 2HJGA 3GX1A 1QP4A 2VO1A 1DAPA 4KTTE 2I33A 2H17A 2QPOA 4FBGA 1KI4A 3U13A 2O3RA 3D2BA 3L46A 4RVDA 3DULA 4GLLA 1NVWQ 3KTAB 1Y7TA 3SKXA 4D9NA 4ND8B 3VR2D 2E4WA 1JHVA 3FRJA 1YUMA 3H2KA 3LKDA 4ZGGA 3ER8A 2CNOA 1M0WA 1L4KA 2B25A 3K1ZA 1P8JA 4MINA 1QGED 2UZIR 2V1XA 5EIOA 4AY6A 1DKMA 1E1RD 1NJ5A 3H7IA 1E32A 3Q0EA 4KSBA 4R8KA 3SF0A 4AL4A 1H8HD 1JDSA 1WB9A 6GPBA 2ID8A 4BO4A 1Y4DE 2A0FA 2PVPA 4G8CA 4EX6A 1TQ2A 2G1JA 4FYWA 1CXZA 2PL9A 3D2LA 3PR3A 4PTZA 5AKGA 3SEQA 2P4UA 3OE1A 4FFWA 4X8OA 1CB7A 4EG6A 4EUSA 2QUAA 5FOUA 5C7LO 5KNCA 3VNQA 1JIQA 3FR8A 1W29A 3D4NA 3LLSA 5F3RA 3UK0A 3NALA 1Q1GA 2E89A 3LCCA 2VEDA 4HQNA 2X2PA 3FZNA 9LDBA 2XXJA 2V4ZA 1EA7A 3WLQA 1GYRA 4REMA 3GXOA 3EQZA 1HZZA 2G40A 4M9ZA 3C41J 5JH7A 3WMEA 4HJXA 2FRDC 3E2PA 3PZRA 3WADA 1KSGA 4DR3B 1RXWA 3F46A 4JZYA 1RYBA 2XAUA 5F2EA 1ZNQO 2PSDA 3HNOA 2HMYB 1K8ZB 4CKWB 2GZDA 1JU3A 1X1BA 2EDAA 3NJ8A 4KQFA 2G5GX 4MV3A 2A5FA 1NY6A 3HP7A 3ETJA 2WQZA 4EHJA 1QG6A 3BE4A 2WAYA 1FRVA 2IE8A 3BMQB 4LF7B 2CDAA 2B5VA 3O1LA 1EZ1A 1RW4A 5HQJA 3BD9A 4O4JA 3V42A 1KR2A 1B15A 1WXDA 2CEKA 4QUEA 4DHEA 3ANSA 5AKZA 3BERA 3LDAA 1K6XA 3IYLW 3TLMA 4FVTA 5AJZA 3GCGA 1BE6A 1CY8A 1TUGA 1JU4A 4ZAFA 1EIWA 1F38A 1R8SA 2HW8A 2IL1A 3USES 3PHJA 4Y6PA 3VPSA 1KTVA 1TB4A 1X1CA 2I6FA 2VG8A 4HNGA 2JA2A 2Q5EA 1G7SA 4RA9B 5CAEB 2FCRA 3KXKA 4FFOA 2IZ0A 3ZBTA 4Y30A 1CQZA 4CM7A 3I5YA 4H59A 4ZHSA 3Q8KA 2BMDA 4LCJA 4RTJA 3VH3A 1KMIY 3SFTA 1O95D 2PGJA 3TZ6A 3D8RA 1U3UA 1KO7A 2TMDA 2HF2A 3FZGA 721PA 4TLBA 1Z4MA 4OH1A 4GYWA 3P9RA 3PFFA 2ZCVA 3USCS 1M6HA 4DSAA 1EXDA 1WPXA 5E9QA 2IEYA 5D6NA 5TGZA 3BGSA 1XEXA 1SXJE 3SZOA 4C87A 2WD9A 1ZO8A 4JUFA 4L4ZA 4C30A 3WR5A 4KFSA 2EZTA 2Y4NA 3HKBA 1VCNA 3ZQJA 1S8FA 2H4FA 3DVQX 1EUCA 1J42A 1E6UA 1YACA 1ZIPA 2VK1A 1X92A 2MMCA 1HOXA 1YDWA 3BWBA 1Y3DE 4ZT7A 4WLUA 4DVGA 5DFAA 2NO1A 3H9CA 4FMBB 4UULA 1RJGA 4PZZA 1XXLA 1OAOA 1PUJA 1TC2A 1XZLA 1OI3A 2GN8A 2NQ2C 2IZ6A 3BORA 4IJVA 3NKLA 4UBJA 1IB0A 3T7DA 4BZPA 3HA3A 3PL5A 4NYMQ 5DX8A 4YYZA 3M6VA 4X91A 2W9XA 2QX7A 1YIDA 3KYIB 2C20A 3AV3A 1YMUA 2W22A 3DBVO 4HL6A 4PPYA 4PQGA 3T1QA 3U26A 4ZCMA 1VGQA 1M1NB 1K97A 2JKYA 1RHJA 2XYVA 3NM4A 2R5NA 3OWOA 2YWFA 4KH1A 4EJFA 5EL0A 4EMSA 5CDFE 2GZHA 3OAAD 1N8TA 1IEWA 4G5HA 1A4UA 2XMPA 5I7HA 3K72B 3Q41A 4AJEA 5FORA 3THRA 5E6SB 4MRMB 3LS2A 4P9NA 3GLFE 3RRZA 1QH9A 4D97A 1RYFA 2JFPA 2O2HA 4RK5A 4DOMA 3KPJA 1XP8A 2O8NA 2OQ2A 1CVRA 3QNWA 1P8AA 4GX1A 4LSGA 3SSNA 1X7XB 3OIGA 3JWGA 3NRCA 5P21A 2W70A 2VP2A 3H5LA 4B6FA 3QPUA 4D42A 1H66A 4TTVA 3KXLA 2Z1MA 1G19A 4NCHA 2HF9A 4J03A 1ZI8A 3KG2A 4JODA 4LPKA 4WERA 4X24A 4EMUA 4G0WA 1MF7A 1JQ3A 2WJWA 3CKMA 3ONNA 1DIGA 2B4QA 2Y76A 3Q7SA 4IILA 4BUCA 1DX4A 2HDNB 2IYOA 4XGQA 2FWMX 1ESDA 1VIMA 5L3QB 3LKZA 2ZT7A 1VLHA 1UXHA 2D1YA 1D7AA 1DC5A 3FR7A 4ZVSA 3WLEA 4Q47A 1S8NA 5HIIA 5KWVA 3EIUA 1G3MA 4PLHA 3U9LA 2VUHB 1DJOA 5EXEA 3GXBA 2EFYA 2RGYA 4HX5A 3L7AA 4C05A 3DVAA 1SCUB 1PJAA 4RKRA 3CT6A 1ZHOA 2PBLA 2ZIXB 1JSXA 4X8MA 2BGTA 3ZDXB 4BXOA 1U7WA 1VKHA 1G8KA 1U2TA 2ZATA 3C98A 4G85A 1RMTA 1LI4A 2ZVPX 4Z9AA 1XTUA 5KYYA 3NASA 2ZXUA 2GJ4A 3VR5D 1VP9A 2OLKA 1Q91A 5LPNA 1Y1KE 1CUWA 4BMVA 5K8JB 1RPZA 1JUDA 2WMNB 1P1KA 2BFBA 3IT0A 4P4GA 2FKNA 3Q72A 3BBPA 4TTQA 1N0HA 5DM0A 1QK3A 4OHZA 2IWRA 1QRDA 4HGOA 4D80A 3NUZA 1GR1A 4E5KA 1IN7A 4ML3A 5EP1A 1JPUA 4PXSA 5FPSA 5EIAA 1ZD2P 3QF4A 4GWKA 4RTMA 3DYVA 5CT4A 4C7KA 2AEMA 3IIIA 4FKMA 1FIUA 3EZYA 1WPRA 5DHTA 3ZV5A 1X1TA 3I12A 5DOZA 1H05A 3FA2A 2BFMA 4H1UA 4Q9NA 5FXMA 2WLTA 4ZCQA 2XKJE 3NEYA 3M82A 4NCNA 2FMTA 1YS9A 5K7SA 5DPMA 2ZWVA 1L5KA 3AJRA 3VH2A 4CQJA 2YN2A 1AQNA 4FDTA 4TTSA 1QVRA 2G9RA 4E2ZA 2OESA 1JXOA 4EW2A 4JP5A 4DDHA 3IIJA 1BYUA 4G67A 4A9AA 5DHPA 3EHDA 1GGFA 1HY3A 1IEQA 2AR9A 4JEUA 4WADA 4BGVA 2PX5A 4C4AA 5DNCA 1WDWB 5A0VA 3CEJA 3EN0A 4XVRA 3V4RA 2R5WA 1ESZA 5EYPA 1C1XA 4ZTZB 3JASA 3HV2A 4G1BA 5TPWB 4TWZA 1G8SA 1UODA 3BWCA 3HKDA 3E9DA 3PNKA 2EBUA 4RNDB 4BV3A 3UWOA 4D3FA 1KZ7B 1N92A 5K0JA 3VPGA 2EU8A 3NS7A 2GM5A 2Y6UA 1B2LA 3F97A 3I58A 3PU6A 3SYRA 2WU8A 3S2UA 1SVUA 2O6LA 1LJUA 1XRSB 2PDAA 4Y9UA 2R8OA 3O4RA 4V3CA 5CYOA 4A23A 3EZGA 4OXRA 1T6NA 3V1YA 1I10A 2GNPA 2XYHA 1E7QA 1AHPA 4JYPA 4RMHA 1WCIB 2JIDA 1M6WA 1NL3A 3A3NA 1V26A 1Z6TA 2IEIA 4LY3A 5EWMB 1A27A 1O6GA 3MCTA 2ZUWA 3QNUA 3KJXA 2FEMA 4FKZA 2C94A 2ZJBA 3RIEA 2AN4A 4LNHA 2W4QA 3K9WA 1XB2A 1ILEA 3CUWA 4M9UA 5JD4A 1QCZA 1I2BA 3PLRA 4AYTA 4E3WA 3NHWA 4DZTA 1I0LA 1F8UA 3M9XA 2CUTA 4YUXA 3ADBA 1V9SA 1QH0A 5AI6A 4MUGA 2B30A 2R1TB 5J63A 2W6JD 5DTQA 3K2QA 3TPFA 4LXXA 1IMOA 1E1MA 2R6JA 5DRTA 3NAGA 2VF4X 4MR8B 5AUPB 3VKHA 1IZZA 3IPRA 1ZHFA 2TRSB 4B47A 1PIWA 3MXOA 4CT0A 4R1QA 4E2FA 3PUXA 1DJPA 2WD7B 2GCIA 3AESB 4H7JA 1FTSA 3ACDA 4D82A 1QV6A 1TDJA 2EFGA 2W2KA 1UBKS 3LCUA 4B8WA 3CZ9A 2J0UB 2QL7A 4EUHA 2A94A 3ZXXA 3WB2A 5EVJA 4GNKA 2B0JA 2XTJA 4AJKA 2PV0A 1BTOA 4R2HA 1NLYA 1YQQA 4PYJA 4N6NA 4WOPA 2P1ZA 2OVBA 4IDPA 3W7AA 5A3RA 1Z63A 2WF5A 4RACA 5TS3A 3S68A 3DMRA 3Q5GA 4FN4A 3C1UA 4GZLA 1I1HA 4Z99A 3DTVD 2IH5A 2XHZA 3KV3O 2NUPA 2PFGA 3B7GA 1W4AA 3HYLA 5CFLA 3ZGZA 4BO6A 1S7GA 3ZDQA 5JYBA 3B1FA 2DFNA 1PS8A 5DHSA 1TZBA 1QCCA 4AXBA 2JFOA 1FF9A 2PT9A 3QHPA 1WETA 4EYSA 1PFUA 2VNKA 4MUEA 4F9FA 4N3NA 1GU7A 1HYQA 4PCUA 4WBNA 3M6IA 3D0KA 4L8GA 1WQ1R 1RFGE 4KIFA 3T3NA 4OHUA 4TRNA 4N4AA 5K45A 3VVCA 2CJXA 5EMHA 4GR4A 4P3PA 4ISCA 3ABSB 4IGAA 2HYIC 2CFIA 3CNOA 3OUTA 3KV1A 2X19A 1N7JA 1O5OA 4N7BA 2GEBA 4IGIA 3CY6A 4M1QA 2W37A 1BQ4A 3CNQS 4IFBA 1OASA 1QIJA 4JJEA 2JD0A 1R8XA 2UYQA 4CM8A 1FS4A 4MYSA 4C21A 1JLSA 4F96A 4JYMA 3H2HA 3TZHA 4KGZA 4YMHA 2NAPA 3F5DA 3BHNA 2EZ8A 3FYSA 1BDBA 1RT9A 2H6EA 3I9OA 2Z9BA 4JN6B 3IAUA 1DZ3A 3G9XA 3L5OA 4PICA 1J49A 2VP0A 3WOHA 3LHKA 2AKEA 2AFVA 2JD2A 5KQGA 1GYQA 4MW0A 4Q3EA 5C4MA 4NNPA 2EKZA 2CV1A 1DRVA 1YONA 4LEIA 1LH0A 3L8YA 4B3FX 5FBVB 3I45A 2CCGA 2A9KA 2QK4A 3CN7A 1VGVA 4OIMA 1U6KA 3WL6A 4KR7A 3L7YA 4BX8A 1KBZA 3HR7A 2Q0SA 2O0LA 2C4UA 2QENA 2LIPA 4BX3A 1X0XA 3NVAA 5KKAA 1KVQA 1KZ1A 2XCQA 3KZNA 4LX8A 3SYLA 2VQSA 5LVAA 4DR7B 4QGFA 4ABYA 3MUEA 3DM9B 1M2HA 4DG8A 1UIMA 3OCJA 5KYTA 4NAVA 2VTKA 3FSGD 3L9XA 3O9MA 4LXIA 3EUFA 3K8OE 4ND8A 1DIRA 1WD7A 4RJLA 3H0EA 2ZOSA 4U1RA 4ENPA 1WMAA 4LC0A 3MF4A 4DIKA 5A7FA 3LQFA 4KB5A 2FSVC 3GLHB 1EFVB 3V7WA 4ZT6A 2XUIA 3UTCA 4Q66C 4JC0A 3KQLA 2O52A 3PIRA 4YCBA 7AT1A 5C81A 2EQAA 1XXHB 4ZQBA 1PWZA 4R1PA 5JMPA 2O4UX 3KTFA 4RMJA 2PWBA 3D54D 3SDBA 4LWQA 2KJQA 2Q99A 4LHZA 4HNAB 2WRZA 1QF6A 4LPSA 2CUKA 1I5RA 4U8GA 4YP5A 3EW7A 3MOGA 1JFFB 4N01A 3VR3A 2JCBA 1F9AA 4HDKB 3H4TA 3MT8A 3NHPA 2YS7A 4G4JA 5K09A 4ARZB 4PV7A 2HGZA 3OVMA 1ZD9A 3QJYA 2QXYA 1YZNA 3AF3A 2GRUA 1A8HA 1MW9X 4RD4A 2QT0A 2ZJ8A 1AS3A 3VU9B 3R76A 3M34A 1AA6A 4RX1A 3R3VA 3C6YA 5J5CA 4LF8B 4RHCA 1YRYE 3I34X 2DU8A 4CKWA 3VH4A 1ST2A 4GE0A 3O7WA 3KQNA 3U9SA 4OMCA 1Z9BA 3LW7A 4Z7OB 3ITKA 2RGAA 4UFOA 3VNBA 4MWGA 1WKVA 5AOAA 2SECE 3RS0A 1GD1O 3BMQA 4BFUA 4QD3A 2W6QA 2COKA 4I6JA 1GY8A 4E11A 3ETLA 1MJ5A 1WB6A 4GR5A 1ZOLA 3RBVA 1MGOA 3QKSB 3L7KA 1HOTA 4TVBA 2YXNA 1U1GA 4Q0MA 3VR4A 5JAMA 3KIPA 1T6XA 2YVAA 3NNDA 3LZDA 2JI7A 1EWRA 3DPIA 2HJHA 3EFEA 1YD7A 4KDFA 1YB6A 1ZOSA 2WKWA 5ECWA 1PQUA 2WHRA 2XZDA 3AVPA 3JVIA 3LYLA 4G89A 4I46A 2B92A 4K6GA 1E1CB 3VHXB 1D8AA 1X8XA 2IU4A 4Q21A 4ZT5A 3BB4A 1FFXB 2PSSA 3ZXUB 4BFCA 2O5EA 4C7MA 4LDAA 4Z0NA 4BLVA 1ORIA 1FQKA 2IZZA 1E9RA 2NPOA 4FZ5A 1WX1A 3ZW8A 2W7TA 1JZSA 2NUTB 2QD3A 3PUHA 2YZGA 3V8QA 5BUSA 2EFCB 1WXHA 2PUJA 2Q21A 1C4WA 1DBQA 4JP8A 1EX6A 4EPYA 2K87A 3ZTYA 5CA1B 4P3OA 3I2GA 4NL4H 3QLTA 2XDWA 3UJ3X 5LQDA 4AKSA 1BVRA 5E1MA 2O06A 4HATA 3FKSD 3B51X 3KBOA 4G4GA 2R97A 4PRKA 1P4GA 3PX7A 1RCUA 1L4HA 2ZDQA 2MJLA 2FU5C 4LAFA 2OBXA 1NVBA 2YRXA 4MS4B 3NOXA 4O29A 4D1YA 3ZDAA 5D85A 3NOQA 1G8MA 5AVYA 3WK9A 2VYNA 3ABQB 3WLTA 3ULKA 3RRFA 2ZLBA 1BH6A 1EVYA 2P41A 1IH8A 2V7QA 3L77A 3BTSA 1HUQA 2O8DB 1C7RA 1RAFA 2BUBA 2G77B 3AEYA 3NMUF 1AKVA 1BHJA 1L5HB 1M1NA 3ESZA 3LXRA 1ST3A 3MT7A 3OLXA 4FDLA 4PO8A 4WNAB 4NZYA 2R4QA 4MGYR 1GTJ1 3L8FA 4DV1B 2XQFA 3GU3A 3R4VA 4MW9A 5DP2A 1OU0A 2ONCA 5FPQA 1M1YE 1CUHA 3URMA 2FWBA 5KWJA 3MIZA 3U09A 4JUDX 3R8FA 3DL4A 1C1YA 5E6SA 4MRMA 1I4LD 1IBSA 3DS8A 3CNHA 3FYUB 3ROZA 2ZUDA 3Q0IA 1L5MA 4LHVA 3O94A 3TXXA 1X7XA 5DIFA 2Q46A 3BAZA 4EY8A 1Z0DA 2A58A 3CX4A 3T7SA 2HT1A 2MR6A 2N9UA 1IY1A 3HHEA 3AFNA 1J56A 2VUUA 1KMCA 2EF1A 2FSVA 3QQ5A 4LYAA 4XWWA 1HE1C 1PJSA 3BC1A 4DIBA 5LWQA 4MV7A 4B4VA 4LFAB 4CV0A 4MB6A 3W6UA 1GGVA 2H1SA 1CWUA 3DKIA 3O5AA 2GN0A 1J07A 3D81A 3T5TA 1P1JA 4F71A 2QV0A 5AVOA 3KALA 5L3QA 3NHLA 4I1OA 2VPYA 5G4KB 5BT8A 1WOMA 5BNZA 3QELB 1XF1A 3JW8A 3I8OA 2QU7A 4W1SA 5LCXA 5EJ7A 1YFZA 2E4ZA 2HSZA 5T8KC 3QMVA 2NW6A 4JLNA 4N18A 3TIFA 3WV4A 3QH4A 1J0AA 2ZDHA 3B8HA 3O1HB 2W2VA 1E0JA 4JKOA 4LDZA 4MR7B 2QR2A 2GMWA 2NXWA 3VR1A 3R3WA 3LT5A 1NOKA 2IP4A 3QLUC 4TWJA 4CIDA 1N0WA 4JYCA 2OSVA 4UXJA 5IHPA 5LZ8A 2K2QB 1MT0A 3ZGOA 3EW9A 2C9YA 4KE7A 2ZUVA 2IHJA 5DJ5A 2I0FA 2QU8A 5LQSA 4P08A 4BC0A 3UAOA 4E1AA 2UXDB 3DXXA 4U4AA 4HFNA 5MN5A 1UFOA 1XRQA 1Z4KA 2A1TS 4BVKA 4E70A 5LD2B 1GDDA 1CW2B 1SK9A 3E8MA 4UOEA 3WGNA 3ADPA 3BEDA 3GYGA 1N34B 3PRKE 3DO8A 5CHEA 4F38A 2WVAA 4MX8A 4A2PA 2XUHA 4I0WB 1BVYF 5LQKA 3RODA 1EFHA 5T64A 2JVJA 2BHTA 3L4SO 4CCYA 4A91A 4Y2XA 1K0FA 2NYAA 2YH2A 3GCDA 3RIYA 4Z4CA 2ZYUX 3BIJA 5KU1A 3C16C 4G26A 1YL6A 1LTHR 2J0VA 2H18A 1KK2A 3EDMA 3IOBA 1U28A 3NIFB 4PG6A 4WZBB 4Y2TA 1V37A 2QL9A 3CNNA 4O3MA 2P6NA 1QO7A 2VDPB 3O4IA 1P77A 1JKMA 2RI6A 2FW7A 3C3EA 3ELWA 4O2BF 4B76A 3CLUD 4QO8A 1MXHA 5G0TA 3BA6A 4BB9A 1UADA 1TECE 5DLPA 2IDMA 1Z38A 1T9DA 3PQ3A 4O2BB 3ZWQA 1FX0B 4R3NA 3T38A 4PLVA 2CVPA 3NNSA 1V7CA 5AW8A 3OO1A 4HH1A 2ES4A 4FOPA 2EYQA 5K4GA 1QIHA 2VEOA 5FPHA 4YNBA 5FBQB 5H1YA 3MCUA 4BNVA 3IHKA 2JDID 2M6KA 4R31A 3OTWA 1KMHB 5JUWA 1PJZA 3IUPA 4J6FA 3U6KA 2EKPA 1E7RA 3UO8B 2X4IA 2BM8A 2PXHA 1P80A 4ARIA 3B60A 3HFGA 1TVKB 2QTFA 3OOJA 2BJHA 2NUAA 3BD8A 3EDRA 4A0RA 3U3DA 4HYEA 2FFJA 1QJ4A 1SUFA 1PFGA 5K3FA 1XG5A 4JJZA 3R5TA 3FBWA 3ILSA 4KNYA 2PZAA 1A9YA 1XVTA 1ZIDA 4KGDA 1TT7A 5D6OA 5LXTF 4D46A 3U4QA 2HCTA 3EXHB 5E4YA 3RVDA 1QIEA 1YHZA 1GADO 3A4IA 2GK3A 4M2LA 1WCIA 4MROA 1C8LA 4NJOA 3A2KA 1Q74A 4Z0PA 2W2QA 1PTKA 4M60A 2PUCA 2IDKA 2XRFA 3CGWA 1THZA 1K7SN 1VJ0A 2PA3A 4GT1A 4HX2A 1WUTA 4NEGA 4WA8A 4DR4B 1MB9A 2IC5A 4EW6A 4LQ4A 4YDRA 3TECE 3WTBA 2NAFA 3IAHA 4EAAA 4I5GA 1SIBE 4JP2A 4C4RA 2XADA 2OAP1 1QOZA 1W0JA 1VYHA 1P75A 4OH7A 4PZUA 1MFZA 5JR3A 2BISA 2R1TA 4RWEA 3CVUA 1IM5A 4FXOA 2GR9A 5ALGA 2I34A 5NULA 4XX0B 3ZIAD 3ODGA 1XDZA 1A72A 2MINB 4B6PA 1OY1A 1PE0A 1TKCA 1PKXA 4C29A 2IDZA 5H70A 3UN1A 4TQ9A 3OTOB 1QLJA 1V6CA 4UQPA 4CODB 1ZMRA 3CF0A 3G2PA 4H7KA 4A8TA 2Q3FA 3AGPA 4J91A 2WD7A 1NMYA 3CUVA 3HEBA 1GVHA 4XUCA 1QAMA 1SO8A 2C2GA 1E3DA 2X4GA 4F6LA 1RLUA 2IHZA 2BWJA 2J0UA 1J0DA 2BR3A 3O8LA 3OOEA 4JB2A 5DNVA 5T8KA 1VRWA 3DOUA 4J3FA 5KAMA 1T9AA 2C59A 1X42A 3FUTA 2EYUA 2MCFA 1R2QA 3AFGA 5IAOA 2HFJA 2Q1YA 4H15A 2GLTA 4RFVA 3KPYA 1YFJA 1UUFA 2C1ZA 2CYCA 5IM4F 1TKRA 2ZBFA 2JAWA 3ZHTA 2ASVA 2Z83A 2H1RA 3AM4A 5L6MB 2O2ZA 3U9TA 3ZXYA 3WV5A 1BFDA 3GDFA 4NV0A 1IN1A 3T5BA 4DIOA 3CLTD 2FSIA 2C8JA 5ALHA 3VDRA 3CB4A 1PFYA 4GOJA 4PXAA 3W4KA 4UXHA 4O8ZA 5IS2A 1V7PC 5EHIA 4BTLA 1NQOA 3GGDA 4MQUA 1P29A 1TAGA 2VATA 4I9FA 4WTOA 1HFWA 2C31A 4KVFA 5I8ZA 1D6MA 1N6HA 4HFRA 1AKYA 4B4KA 4M7WA 5ILOA 3R0JA 2J3DA 4Q24A 4MRAA 2VJLA 4IO1A 1OUMA 3W04A 4ER0A 2NO4A 4C4SA 1UFKA 3FPAA 2A1TR 5CNIA 4R84A 2AA3A 2JHFA 1W0KD 5AXBA 1W30A 3V00A 3ZHRA 5A1TA 2NADA 3G1WA 3R8CA 3NHFA 2C1XA 1ZIXA 4F4UA 3F9IA 3PVCA 3GVXA 4UUNA 1YQ9A 2Q0QA 3AF1A 1RLIA 1M7HA 2NG1A 3B3FA 2JA1A 5EUCA 3OU7A 1U7OA 1YRHA 2VJMA 1IN4A 1G1MA 1C1DB 4GVLA 4PSCA 1FJXA 1PRYA 3LX4A 1TA4A 4TL8A 1PO7A 1PHPA 1Y1LA 2PR2A 3GJ3A 3WE7A 5B7PA 2GCNA 3P97A 4OD0A 1IRXA 3Q3IA 4AKGA 4FHCA 5KDOA 5HX7A 2VA8A 4FYJA 4CF4A 4A1FA 3KSRA 2VPPA 3E7WA 4IMPA 3RSQA 2C95A 2ZIVB 1N75A 4MQMA 1VP3A 2XQGA 3HSKA 3ZWWA 2NZUG 3WGKA 4WWHA 4DBZA 5JYEA 1L7VC 4YB8A 3FVRA 4BNZA 3TXAA 4BU0A 3QTTA 1SCIA 1GR0A 4P98A 9GPBA 3MD0A 2DWCA 2ZUUA 1SHLA 4KWHA 3GWGA 1ORHA 3FYUC 4BFTA 1J1IA 4CQMD 3HVRA 3KUCA 2HRRA 4KRYA 3QWHA 5AJHA 4BO5A 3U3JA 5ALUA 2PJRA 2CE2X 1DBPA 5I7UA 1BWPA 3L79A 2E4VA 4MV9A 5EQTA 1QRAA 1CUXA 3HDJA 3IS3A 4PYRA 5GWXA 3T7RA 5BRJA 2I1QA 1L7QA 1AIPA 3DNFA 3HGQA 1DO8A 3N5CA 2GERA 5LP6F 1DG3A 4MKFA 3CH7A 3OD1A 5JC1A 1FU7A 1XXHA 2HMVA 2QF7A 5E1DA 4ZVRA 1XVIA 3TSOA 2G04A 1XQ9A 3L0BA 3IBFA 4I9UA 4LHXA 2GO1A 3ABIA 1V2GA 3HVUA 4HVAA 4KO4S 2Z5VA 4NBSA 4HNAA 5LP6B 1JJAA 3IEUA 4YCLA 1LS6A 2VYQA 4BO9A 1HL7A 5KYVA 3H0CA 4MCAA 4HDKA 1BJRE 4KO3S 5KNBH 1L4MA 1CETA 3HJCA 4KZKA 4CUZA 3C6MA 4J0KA 3W1WA 1U1CA 4TXLA 4AECA 1ZJ5A 2CMGA 4NI5A 2QXTA 3UMGA 4BJHB 1YHNA 2PJUA 3OLWA 1T1SA 2R79A 5D2CA 3T12A 3VU9A 1XQ1A 1YRBA 2BZGA 5I4IA 4NE9A 2GLUA 4MSUA 4ZZ0A 1CTQA 3A05A 2WNHA 1RWMA 1PJ2A 3ETDA 1BFUA 4FLFA 4I4CA 5A9TA 4TS3A 4I4IA 5FBHA 4AY2A 4W63A 2VFAA 2G09A 4OHPA 4RPHA 5B3JC 1JEQB 4HNHA 4M0LA 4F06A 3TIGA 1Q3HA 2IV3A 5EINA 3OZFA 3D1LA 3T7IA 2ODTX 2GJ8A 3AF0A 3FPGA 4ZVLA 2V6BA 4HRYA 1W88B 4WMLA 2PS9A 1PJTA 3RSCA 3THWA 3GCZA 4ND2A 2R6HA 5HILA 1VM6A 3U4IA 1PX0A 3HRKA 3ILVA 4TN1A 1CP2A 2PMWB 3DMPA 3I0MA 5AO9A 2J9YB 1IXKA 3RFXA 3NWEA 1KAOA 2X0RA 3WP1B 4H35A 1D2NA 4HEJA 2GYWA 5GV7A 3E8XA 2ZI6A 2WSLA 3H8SA 3HU2A 1AXEA 2PKQO 3VHXA 2YC2C 1R10A 3OQHA 3PGLA 4IJMA 1BAPA 5A6VA 3GJ6A 3MJEA 2K6GA 4FCWA 4PBSA 2P9TA 3ANTA 4KOEC 4DCJA 4TTRA 5H16A 5BN1A 3G1UA 3TAHA 5JXGA 5I47A 2NP6A 3SBXA 4R6WA 3C3YA 2HA2A 3JVEA 1KYTA 3DVSX 4MLDA 1NZFA 1T13A 2FRVA 2X9LA 3QXHA 4IOJA 4MNTA 2GRAA 2A9VA 3DOEA 3FWPA 4ON9A 3PICA 2V3WA 4JVMA 4YECA 4DAOA 5HTOA 1CQXA 2WR8A 3OOWA 2IX3A 4NNOA 3G2HA 4J4BA 1S6YA 1N4AA 1BHO1 2W98A 1OZ0A 3H4VA 3HUTA 1BS2A 2RHRA 1ZWKA 4YV2A 1AMUA 3Q5DA 2R8EA 3WZMA 4OJQA 1SQSA 2Z95A 5DGXA 5TS2A 3A6ZA 5GMOA 3WMGA 1P0FA 2Q8QA 3IP7A 1QP0A 2NN3C 1C14A 4K5QA 3EGWA 1SD2A 1XK7A 4O2LA 4V24A 5A6SB 1JA1A 3ORFA 4JL5A 3U37A 1Q3KA 3Q5EA 4FOSA 4MS4A 1R5BA 1GCUA 1O6BA 1VJDA 2JIOA 2WFMA 3QUAA 4O6VA 1VDZA 4JBYA 3NORA 1ACJA 3VSCA 1KH2A 3O4HA 4ZEVA 4LSWA 5SY4A 4CMEC 4LDPA 3PXGA 3T4EA 4WZZA 4EX7A 4KTVE 1OGYA 1XPRA 1GAJA 1L5HA 4WNAA 2EWMA 3EXEB 3AQIA 3EXHC 3IJPA 1YR2A 6REQB 1BD4A 3WKAA 4UOQA 4DV3B 3JQRA 3BK7A 3KHUA 5BV0A 5GINE 3GVPA 2ZBQA 3NHKA 4E88A 5JCXA 2QIOA 1FFYA 2W48A 4Y1RB 1H3FA 3EVNA 2VP9A 4FEEA 1CY6A 3CJTA 2I71A 1CZUA 3NH9A 1NP3A 5LYJB 2BMAA 1VE3A 3ZVMA 1IDN1 4LTDA 2ZRHA 3SIPA 3PFIA 4JOBA 3ZCUA 2EJTA 3IBYA 3MWLA 4BNUA 2ZE8A 3C3JA 1Y4AE 3OJCA 4REQB 5HQTA 3WLJA 5BV7A 1U8XX 2FUCA 2IPLA 2PCJA 3OFJA 3SHWA 2R8RA 2A9FA 3NBKA 1NRXA 3CSUA 4RULA 1YA8A 1TLLA 4DDKA 4J0IA 4EJSB 4MEAA 3T94A 3R7FA 4KFUA 3GWZA 5HFJA 3G0CA 3J80A 1ZX1A 3D8BA 4NABA 2BTEA 2W2MA 3T3PB 3M70A 2G9VA 5KQSA 3NKVA 5G4KA 3ADOA 1YCHA 5FP0A 1TFUA 2HA6A 5CIQA 1QO0A 3KYDB 2FPWA 5AK0A 3PNVA 1II8B 2FZVA 5ECDA 2ILVA 5H82A 2O0HA 2PPVA 2Q27A 1HE5A 4MI3A 2D5LA 4CFZA 1KZYC 1EWYA 1HDRA 3EVCA 1RU3A 1BWSA 4K1LA 4MR7A 2GJKA 2R7KA 2VZ9A 4YI3A 3CH4B 4ECEA 4RYLA 2HRBA 3B3AA 2NVOA 4TQAA 4C7VA 4YX9A 1NXOA 3NVMB 2OCDA 3R6LA 3RC7A 1E3WB 2ECOA 1S89A 1E7WA 2ODAA 4OU5A 4N40A 1VECA 4JA2A 5B3JA 4FX5A 2GASA 2C4HA 1JZQA 2B1QA 4QYSA 4XD7A 4LHEA 3SQLA 3WXBA 5C32A 3OWHA 4B3RB 5BR4A 1BX0A 4YRAA 4W6ZA 2JPDA 4QNRA 2JNWA 3HB5X 3ZY5A 5CJPA 3BCHA 3K1JA 3ZU6A 2VBCA 2ZK7A 1TF5A 2EC5A 1U7UA 1XF9A 2HR1A 2NQ8A 1JTVA 1KJIA 3ECCA 1ORWA 3WMFA 1D1PA 4EHBA 1EJ0A 4K88A 4OHFA 2Q0HA 4GOLD 2X5KO 4JBIA 4UJ3A 4D98A 3O21A 4NE2A 3BYZA 4C2UA 1DO0A 1FDWA 1USGA 3AR4A 3VVMA 3KT3A 1L0BA 4CKCB 3L7LA 4H0FA 2QD5A 1IHXA 1XE3A 1DAGA 3LAWA 3RDPA 1ECLA 3LRXA 3GW8A 4LDJA 1M74A 1MJGM 1S1CA 2JIBA 3FFWA 1E79D 4JJGA 1WXGA 2NZJA 1MBZA 2R60A 1ODTC 1WHSB 3GLRA 2J32A 3UWPA 2X5NA 2IH4A 1XP5A 4PINA 3U48A 4O2BA 4JT4A 4I3GA 1FSFA 2VH1A 2JANA 4LNUB 2XCOA 2QJOA 3KYCB 3BF8A 1HWYA 3BIWA 5H5JA 2JIZA 3WO0A 4WFKA 2J59A 3TVTA 1S96A 1RM5A 2OGUA 3BICA 5AKXA 3JD4A 4DLTA 1YK1A 1K0UA 3FKJA 2PFSA 4EYQA 1QZUA 3A9RA 4F5EA 1AY0A 1USKA 1TVKA 1J20A 1GNPA 2I4OA 4L2IB 4MGZR 2J6IA 4Q6WA 4JIGA 1UXKA 1G5HA 1UBJS 4G37A 4CMEA 3QWFA 1L7OA 3FSJX 3ST7A 5JD5A 1Q7RA 1D1QA 1Y6GA 5F5LA 3PC7A 1IN8A 4DZRA 4N3CA 1GQFA 4MP3A 4RGQA 2JAXA 1RKQA 1SBCA 2ACKA 3W9UA 3MJRA 4QVGA 4ZU3A 1B43A 3CEMA 5LXTA 5KS2A 3HQ4O 3RF7A 4JI4B 2P6RA 3A0UA 4KYUA 2FSGA 5LP6C 1FSGA 3EVTA 4QUGA 1AKEA 2WU0A 3EBPA 1EGQA 4HZGA 2GKSA 1GRRA 1GGHA 3T1TA 5BV2P 3FMVA 3FHTA 1RRGA 2YWXA 4WLEA 3K92A 3R9WA 5CK4A 4Q9JA 5CDGA 3VNUA 3QKIA 4V0NA 1RWNA 2P1DA 3JYOA 1ZGGA 1GZDA 3UJNA 4Y18A 1USVA 4XX0A 4F5ZA 1ZK0A 4IHKA 1Z5GA 5TDHA 1E5QA 1U0NA 5ED4A 4JU8A 2XX3A 4QUHA 1HQDA 4JLSA 5HKOA 1OH5A 2GN1A 3DHNA 3NWOA 3RT7A 1DVRA 2Q4RA 2GBFA 2KWIA 3I30X 3I8SA 3LOUA 4ILKA 4LXTA 3QLJA 4JYBA 3L6RA 4OP1A 1W5TA 4QM7A 4QHSA 4OTZA 1F4VA 4HNVA 5E7IA 1N1EA 2V7WA 2OHFA 4Y2HA 4DPKA 4YWHA 4B3BA 5ITZB 1OGIA 1N57A 2CE7A 1XRLA 2HJSA 3DL7A 3K2BA 1VJCA 2NVUB 4Q7KA 5FL7A 1B1AA 1GILA 1ZN7A 2D1TA 5T4FA 4EBFA 3A1NA 4I14A 1C30B 3OETA 2Z6AA 5BSTA 2EW2A 1LLQA 1Q2UA 3C5CA 4L5AA 4Q7EA 5EIBC 4LWPA 2YJ6A 1HYBA 4QYIB 5E3IA 3DB1A 3DKRA 3X0DA 3BJIC 3WS7A 4X00A 1KY5A 3HE3A 1YU6A 3IOEA 5IM4A 3F47A 5CRIA 3SDSA 5T5QA 2VYCA 4A03A 2DOKA 5DTMA 5DCLA 1XTQA 2QRLA 3L0DA 3QXCA 2CNNA 3O7MA 1GNVA 4QBIA 2NU8A 3VI4B 2Q4EA 3WIOA 3TUIC 2F90A 1B0UA 3MRVA 1H94A 4XJSA 3AI1A 3D8TA 3ZN2A 2ZUFA 3UOGA 3NHYA 3HU5A 1VIVA 2BTQA 1NZDA 1IHUA 5LQCA 4FSXA 1FS6A 2DR2A 3EGDB 1ZUNA 3KSZO 1UC4B 3FUWA 4PBTA 1KMQA 1RWKA 2WUFA 2BFFB 4Z3DA 4PCVA 1I3NA 4WD3A 1AQLA 4AJ2A 1FLVA 1KXJA 4IH9A 3EY4A 3C8DA 3E5HA 3OE7A 1YS7A 1C1DA 1ND6A 2V7GA