4C1BA

Esterase domain of the zfl2-1 orf1 protein from the zebrafish zfl2-1 retrotransposon
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
171
structure length
171
Chain Sequence
GPAMDVAIIGDSIVRHVRAASSKGNKVRTFCFPGARVKNISTQIPTILGAAESPGAVVLHVGTNDTGLRQSEILKKDFRSLIETVRRTSPATQIIVSGPLPTYRRGNERFSRLLALNEWLITWCKEQKLLFANNWNLFWERPRLFRPDGLHPSRAGAELLSDNISRLLRTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Properties of the Esterase from Non-Ltr Retrotransposons Suggest a Role for Lipids in Retrotransposition.
pubmed doi rcsb
source organism Danio rerio
molecule tags Hydrolase
molecule keywords ORF1-ENCODED PROTEIN
total genus 54
structure length 171
sequence length 171
chains with identical sequence B, C
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12690 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c1bA01
3.40.50.12700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c1bA02
4C1BA
chains in the Genus database with same CATH superfamily
4F86A 1TVKB 1AQJA 4X7PA 2CHQA 2FW0A 3AX6A 1AUPA 1JMVA 3IQIX 5K0GA 2X2EA 4YCMA 1QF6A 3WBJA 3P0EA 3WC4A 1QG6A 2QE7D 3PDIA 1ZK4A 3WGMA 3RUAA 4TUYB 5E4YA 1ZGCA 4FJ0A 1R5OA 4TTSA 2AZDA 4WY8A 3C3CA 1EGMB 4NZYA 3C3YA 5FUYA 3O03A 2QUKA 3CNHA 3WIBA 4C5BA 4XTRA 3HCPA 5I3ZA 3NAMA 1AN0A 5TARA 2DY0A 4UU1A 2CDCA 4G67A 4KCGA 4D0SA 3AFIA 3PPYA 2QDXA 4DV4B 3RHTA 3BMCB 2PX6A 4D6YA 4GMKA 4EYOA 5D5PA 1XRRA 4DV3B 2GPWA 5KNBD 4PS1A 1ACJA 4DNFA 1X6VA 3COVA 1L9KA 2XLCA 4HY3A 3AUXA 2YCLA 2YFHA 4ZOEA 3AR7A 2W2LD 1QOZA 1E9DA 5K51A 2MOKA 3CNLA 1UR5A 3EXAA 1QQAA 3BGOS 1DKPA 1I3MA 2WC1A 2O19A 3RIYA 4LC9A 5JRJA 3SKXA 4FMCF 4CI9A 2FZEA 1KZHA 4HS9A 3S2ZA 3IBCA 3S70A 1H6DA 2O0MA 2Y2UA 4L7VA 4OAQA 1K0FA 1A9ZA 3SIRA 2IXDA 3ZV3A 4UTNA 1YAJA 3K0BA 4KN6A 1A69A 3I3SR 1FFCA 4C30A 3OJEA 4PZ9A 1WMEA 1YMUA 2OO7A 3FOFC 3ICWA 5HF5A 2XITA 4FYMA 3ZHSA 4F3RA 2RGBA 3R40A 3AIIA 2VDKB 1NNUA 3B9QA 3FUCA 1YACA 4IIXA 1KDZA 4BVAA 5CU7A 4G9EA 3PEWA 2BUCA 3EXHB 1W93A 4Y9UA 2G76A 1L7OA 2I66A 4PZAA 2J5QA 4GD3Q 1TC2A 5M2QA 4OHBA 3FGPA 3QVSA 3D5TA 2W11A 3CKYA 4BNKA 3DV0B 4YMLA 4W5QA 3DD5A 4HQ6A 2Q27A 1M8PA 1FVXA 4HZUA 1VC2A 3E5HA 3GV0A 1WW3A 2FI1A 5G0VA 4A2CA 3N2LA 2I3DA 1M7HA 2PSHA 1BGWA 3NIBA 2R6HA 3WK7A 2BTQA 1Q0SA 4A1FA 4ECEA 1GEGA 1BEUB 1ZICA 3A9SA 3GJYA 1D07A 4WLFA 1NTOA 4LHEA 3T3EA 3COJA 1MOZA 1OZAA 3PJFA 1L7DA 2HRQA 5A4DA 1XLUA 3M1IA 1UBHS 2GH1A 1N0VC 4EEKA 2RAVA 1I7PA 1NURA 1QK5A 1JXOA 2B6HA 1K9VF 2PCLA 1A5TA 3U9TA 3OFJA 4M0KA 5C4IA 3DT9A 1E1NA 1WPQA 3OMLA 4X1KB 5AKLA 4ARZA 4LJAA 3LPLA 4O4IB 2Y05A 4ZAVA 4DSNA 2EV9A 3G7UA 4I5FA 5DHAA 2HDHA 2H11A 4E0BA 1E99A 2YYZA 3AKEA 3OTHA 3IHWA 1EGQA 3IDZA 1OX5A 3R5FA 3TVYA 4P5PA 3A9RA 5TPZA 221PA 2WSSA 4PG8A 1N78A 3JV7A 4ZP1A 4D56A 1KJ8A 2A9PA 1WUYA 4F04A 2I91A 4MI1A 1L5RA 1X8LA 3GLIA 2ERCA 4U00A 2FQYA 4C78A 1EUZA 2NX2A 1N92A 2HM7A 4ZK6A 2FUEA 1JKMA 2WIBA 3QY0A 1EIWA 1J23A 3M5DA 2WFAA 1QDEA 1XDWA 1Z13A 2AYYA 4W6QA 4WL0A 1WUHS 3RRFA 1FXWF 1QFJA 2W6MA 2Y1EA 1NUPA 2NSDA 1F51E 3IAM1 5LP6A 4NEGA 5EYPA 1NNLA 4KH0A 4IZ6A 4DLKA 1YQUA 3FVVA 3NKVA 4NBWA 3KC2A 3MQ2A 3IIJA 4G4SP 1AIPA 4UCXA 2I34A 1Z2NX 1SQGA 3M7IA 1J39A 3OX4A 4CQMD 3ZVKA 5LB2A 4FWBA 3VR4A 4CMCA 4J7AA 5TNXA 2JFBA 1PD1A 3DNPA 4QRHA 3RSQA 4K8RB 2ZFUA 4MCIA 1WXWA 5HWSA 4L15A 5G0WA 2AX4A 4CDRA 1HE8B 2VQFB 1O2DA 2RHCA 1G0NA 5E6SA 3F49S 2B34A 4OA8A 4RS4A 1NJ6A 1VL6A 3KJIA 2SBTA 4XVRA 5JMTA 4M37A 4X1IB 3H3JA 4EJSB 3ZVMA 3VGPA 4FJ1A 4GQAA 1Y98A 4MOWA 3NZEA 4B75A 3D8RA 3CT4A 2ZVPX 1SHUX 3KT3A 1A5AB 3ID6C 4TLMB 2FX5A 3D2BA 1Y6FA 2ZE5A 1CUAA 4MV1A 2OXRA 2ZUBA 3VV2A 3DOIA 5KS2A 4J49A 5EJ2A 4C07A 4C4YA 1YJ8A 1C9NA 1NV8A 3ESBA 3PZBA 2YWEA 5D51S 4ZCQA 3L6BA 1DJMA 1W4RA 3HJAA 1TQDA 2GJAA 3H8SA 4R3UC 1WOMA 3PDUA 4QWWA 4RMNA 4XDYA 5JO9A 5LZ5A 2R9VA 2IV7A 4HLDA 5HM8A 5GIPE 1WG8A 2IOHA 1W48A 3KS9A 1NA5A 3WHPA 1HL7A 1NXQA 2VIIA 4NKRA 3REGA 4U0KA 4B3RB 1KEEA 2YIVX 1UWLA 5GY7A 2XAAA 4GGOA 1EEXB 4WNAA 1A9YA 3NIWA 3PENA 2YXDA 3TD2A 1L5YA 2ZITA 1W6RA 3HDVA 2PH1A 4MI9A 1YZKA 2IF2A 1VOTA 4KQ2A 3HPRA 2ZRBA 3AQIA 1M74A 3PX3A 3AYXB 3UFXB 3USCS 2XVXA 1DIHA 3KYIB 1NW6A 1D6SA 2HXYA 2ZRAA 3IUNA 3PFIA 4ZQFA 5AVRA 4EB6B 1TJ3A 1FDUA 1OF1A 5CVDA 4U2FA 4Z99A 1L7EA 3RQSA 5BR4A 4ZRDA 4DR7B 1JG6A 3D3KA 3QE4A 4LMAA 2F00A 1E6CA 1Q1QA 4CKWA 2RSLA 5KNLA 1P1BA 1DIRA 4HX2A 3PDHA 3SBEA 4HAXA 4A2QA 4Y7CA 4QNNA 2VDVE 2O3RA 3WIDA 2LGJA 1S7CA 1QV9A 1U7WA 1SEPA 2ODTX 3LUFA 1RZVA 3W9SA 2G82A 1ISPA 1RXSA 1HL3A 2ZQYA 1I13A 5JTTA 2GUWA 1E79A 1WQ4A 4ZXPA 2P9ZA 3FPGA 3MGCA 2VP3A 3STVA 5B3LA 3WQQA 1C3LA 3OX2A 1H9BA 3G0DA 2QQFA 3KYCA 3TQOA 4B71A 4GPEA 4AG5A 5KBYA 1VBKA 5DX8A 4IVNA 5TDHA 3K0SA 3KQNA 1KQPA 1PFUA 1YB6A 1ZMBA 4FGSA 4U39A 1V0JA 4HBGA 1M2HA 2G8NA 3IVXA 1W25A 4AG6A 5FBKA 1XAHA 2PKQO 2C78A 4RY2A 4UHBA 2XNDD 4V24A 4PV7A 3ZCVA 5BMOA 1WDMA 4ND2A 2QAGB 5AW9A 3R9WA 1DTSA 1CC1S 2WF7A 1W5SA 1U0SY 1YRHA 3I2IA 2QR5A 4KV9A 3O91A 1I7LA 1QLWA 1QUFA 4YONB 2C94A 2QG9A 2HCTA 2QWXA 2ZR7A 2XD4A 2C5FA 1NXOA 4H35A 3DMYA 3BFJA 4LJ6A 1PQPA 5FQNA 4BWYA 4C87A 4F4HA 2C0PA 2GN6A 4G56A 5KWSA 4TXMA 3N6RA 3FSGD 3IA7A 2X9QA 3LUPA 5UKDA 2X15A 4GLLA 4LIPD 3LM8A 1XNHA 4YMTA 4M8IA 3E2PA 1PGJA 2IU0A 3MIIA 3VDRA 3L7MA 2Z2XA 3ER8A 1YB5A 4HUQA 2CVOA 3V4LA 1GTJ1 1H8HA 1BTOA 3GARA 5AKKA 3WDSA 2A5JA 1JSRA 3I9NA 3GVCA 3KDAA 1VCIA 2EFDB 2ZK7A 5AXDA 5B55A 2QT1A 5C1IA 3VNRA 3SXUB 1KO5A 5IJ9B 5JI2E 2F9LA 1U31A 1RE1A 3LPNA 2Q6IA 5A0FA 4EGSA 1V71A 3ICEA 1N25A 3MRTA 1JUDA 5ALRA 3AR2A 3AL0C 1L5FA 4WESA 4RK4A 3HU5A 2HTFA 1CZLA 3KD3A 2PIDA 2I80A 4BNLA 4UNRA 3QKTA 4QNRA 2P35A 4D8TA 1DEKA 1J8QA 1ZYUA 2GB4A 3WP0A 1N2XA 3ODPA 1U8EA 2AKAB 2JHGA 3AKDA 5LYYA 1PZNA 4U8HA 1JQKA 5FUVA 3VR6H 4QU0A 4QUEA 3IUYA 4Q4JA 1ZNQO 1ID1A 1CVIA 4CV2A 2O54A 3IPYA 2ODNA 1H6AA 2W8BA 4OB7A 3HYNA 2GPNA 3ASYA 1L6IA 2P9HA 3P0RA 4AMBA 2ST1A 2LV8A 4IIJF 4OP3A 3R9IA 2Q3FA 4J1TA 3CLRD 1ZRNA 4OBXA 4HI0E 3IDSA 1DJPA 1GHTA 4MINA 3DDWA 3L0ZA 3AVUA 5F9FA 3DR5A 3EXG2 4O4LF 2QRMA 4O2AB 1KDRA 4W5OA 1PJZA 4MB0A 5G3ZA 1BS1A 2F1IA 3L18A 2XPCA 4F0JA 3DLHA 1WO8A 1I0IA 5I5GA 3U3RA 1P1CA 3D6FA 2C8KA 3O7WA 4ZT4A 3VBEA 5MN6A 3CF4G 4HWKA 1R9NA 4MMXB 2LUOA 2X9VA 3E0QA 1JFSA 3CGWA 3SS7X 2WFLA 1X7GA 4BFSA 4AYXA 2FE1A 3TIFA 1WB5A 2J5BA 2QZJA 2P9QA 1BHO1 1SB9A 2JFYA 3UXYA 2GM5A 4C1BA 1SNYA 2AOUA 1LS6A 1EUDA 1MO4A 3ZD6A 3B1KA 3ZG6A 2BV3A 5EPOA 5C9ZA 3BSYA 1WQ1R 3QFHA 4FFVA 3LE8A 3ZK7A 2OLKA 1RC1A 1XZIA 1YJAA 5C81A 5JXGA 4IDHA 4N6OA 2QA5A 1FDTA 2EX1A 4CKEA 2Y1XA 4B3MB 2PH3A 721PA 1JDNA 3PCXA 2G9VA 3D54D 4KDRA 5FHRA 1S2IA 1MOQA 1SN7A 1PFVA 4TYNA 3NDBB 1EB8A 1WVMA 4RX1A 4P7JA 5TLSA 3OF2A 3UK1A 2ZYAA 1KQGA 1M1NA 2EKQA 1EZZA 2C96A 2P5UA 1U1FA 1OB5A 2BHRA 5ED0A 3JQFA 3DDCA 4L5AA 1WPGA 2YN4A 4C14A 2XMDA 1X8KA 1EWYA 2QQEA 5A4JA 4M0UA 2NGRA 5B1YA 1XXHE 5EXTA 4RXMA 1R6DA 3JQFC 4LBZA 5SZIA 3R6DA 1RJWA 3JZDA 3JW8A 4DR4B 2D1FA 4RQBA 5K8UA 1XTVA 3ZHVA 2CFIA 4AMZA 2BKVA 1GPLA 4JIGA 2PZFA 3TRFA 2AQHA 4CCYB 1I2CA 4RWZA 5C7OO 1HKHA 2B21A 5F4ZA 3A3KA 1CUSA 3QBJA 2JLAA 5TEWA 1BW9B 1KK1A 3HCCA 2D0DA 3Q15C 3NBQA 3LXXA 1JWAB 1KMQA 1DPFA 2KSQA 1XCJA 1C81A 3GA7A 3W4KA 4F12A 1DQPA 4Q1FA 2ZIAA 3VPDA 2D5LA 5EKDA 1UKBA 1UXGA 1VL5A 4L3OA 4JBWA 4X8OA 5J1SB 3KZXA 2WKPA 3IUBA 2FN3A 2WG2A 3UUEA 1BCSA 4TMTA 1ETHA 2BFCB 1K08A 2FEAA 3IUJA 3OPNA 4GOOD 1ST2A 5ULLA 5K8TA 4AWXA 3ZJTA 1PNVA 1F8YA 4LDAA 4PRYA 5B7NA 3MB8A 3GGGA 3S4YA 1Z6YA 2PD4A 1J97A 4DCMA 5I7RA 3V1NA 2Y0BA 3RRJA 3Q2OA 3LG2A 2FWNA 4DGQA 3NJRA 2HREA 2PO5A 1U94A 4WN9B 1N3IA 2J9YB 4BQSA 5BMVB 2QM3A 5IKEA 1OBOA 2WHPB 3I9LA 2GRUA 4QFMA 2QMOA 4CIYA 3P2JA 4E13A 1PJ2A 4LJ7A 5CTAA 2WMOB 3D6VA 1VSVA 2FFAA 3NEYA 1NY5A 3O92A 3DWIA 4TKZA 4W8OA 521PA 4E4RA 2N47A 2IWHA 2BM0A 3V9AA 3NOQA 4DLBA 121PA 1JVSA 4ZARA 2DR0A 3QPUA 1NVKA 4G0ZA 4WERA 4B7AA 1V3QE 4Q7QA 3U4DA 2R60A 1QHXA 1BHQ1 1FFSA 1KSHA 1W0CA 4KZKA 4F56A 2V7TA 2YJ4A 3UCEA 2QPLA 3ROZA 1ZC4A 2XUDA 3RGGA 4YRBA 4RDCA 4BWGA 4DYDA 1ZKDA 2FUNB 3H2KA 4Z9BA 3TL3A 2AMLA 4E1AA 4RYLA 3MTBA 2G07A 3IURA 4PWYA 1TOAA 4I7EA 5LYJB 3FJYA 1EA7A 1X1DA 3AP1A 1VKJA 3LC2O 3KT0A 5DM4A 1RRMA 3FBTA 1WY5A 1NZFA 4L0QA 1QG2A 5SV2A 4GBGA 1LLFA 3C3JA 3QFFA 4O2BF 2DGDA 3ZWWA 1G6KA 3F4KA 1JR3A 3LKDA 3F5SA 1R5JA 1GUAA 4QUBA 3SI7A 4CDGA 5K8LA 1DT3A 1N9ZA 2F43B 1L7MA 4O4JA 4YO7A 2FPSA 1R6VA 2XDWA 1TA4A 3FTQA 3QI2A 5CXXA 4AMGA 1OASA 3ASVA 3NPAA 2PTHA 4DLPA 1HFWA 2WILA 1P4SA 2OCYC 5LXTF 4FFSA 1NV9A 1QAQA 2YV4A 4E4TA 3K2QA 3ERCA 1PCXA 2B4AA 4JLAA 3PGXA 3TOZA 3CLSD 4EHIA 4XR4A 3E7XA 4F7DA 3E3NA 4CM5A 3FTDA 1GP2A 3M1AA 3L79A 4M6WA 4UVHA 4PG6A 4GR4A 2Z6QA 4MGIR 3PWSA 1ZA2A 1IMJA 2JF0A 3TE7A 3G82C 3SF0A 5JQGA 1UODA 3O0DA 3B6JA 5DBGA 1Q7BA 2VDWA 3JX9A 3ZV4A 4AURA 4EQZA 3EPKA 1SC6A 2KX7A 4K0RA 1GAXA 4M49A 3R7BA 2QK4A 2HBQA 1IXSB 1MC5A 5B7QA 4NJEA 5J4KA 2GARA 3VVBA 4AS3A 3ANTA 2O05A 4F3CA 3GW8A 1CQZA 2DPMA 2ZT5A 2Z2YA 5CX4A 3LTNC 3PBKA 1KP2A 3FXAA 4XWAA 3LZ6A 1HOTA 1WSAA 4HDCA 1O0SA 2V6IA 1NBME 2A9QA 2QMQA 1E9BA 5C51B 1MX5A 1QONA 1NQXA 3QY9A 3Q1LA 2HHLA 2XSZD 1ZFNA 4FZJA 1ZD1A 3WLRA 4TQUS 5DTRA 2OP0A 4FFMA 1EFPB 4DBVO 1J9GA 3EWIA 3WGTA 3OF5A 1WSDA 4HWTA 1QRRA 1Y4SA 3NT4A 1W4ZA 1ESZA 1NMXA 2DOKA 5DSTA 1Y3FE 2EZTA 4YAOA 5FTJA 2GGSA 3LMKA 2YHBA 3GX1A 1GR1A 1KETA 4OO3A 1X0VA 1XWFA 2R79A 2ODEA 4QOIA 5ELMA 1JDBC 3C8ZA 5FWXA 5C5IA 2EP7A 3L8CA 3EZYA 1N3YA 2M9MA 4TL8A 1HFJA 3VQTA 4HJRA 1IAVA 1XCOA 2ASEA 4NNPA 3MWEA 3RIMA 1RP1A 4LK3A 1JPNA 1ZIDA 2HDWA 3EMDA 4FR5A 4OVKA 4E6PA 3ED1A 4ZVVA 4Y7DA 2IGTA 3PHJA 1JKIA 5JMOA 4GM0A 1NXXA 4NFLA 3U44B 4QLAA 1QFXA 1VIYA 4TT8A 5LZ7A 4ZHQB 4ETNA 3PGKA 1QYDA 4RE5A 4IGFA 3PE6A 5FWYA 1GGMA 3T3OA 4R5MA 3L0YA 2M2IA 3CLUD 4ZO7A 5LYJA 4OQNA 2BBTA 2YWJA 1D2AA 1RACA 1IOWA 2V7QD 3HHPA 3KKQA 4QG7A 4OGWA 3OJLA 3SSMA 2O5EA 2ZSBA 5HKOA 2FK7A 3ESAA 1QTIA 4UJ3A 4D43A 6LDHA 5JSHA 2O8BB 3JQCA 2ZRQA 1JXAA 5C8ZA 1AKYA 1KL7A 1T8RA 2Z58A 3H0CA 2JHAA 1B15A 3MWFA 5EMNA 1SCQA 5LQUA 1GZ5A 1NSFA 3R7SA 2FHSA 5DN6A 4WK0B 1KFJB 3V4SA 4GQBA 5BSVA 1PUJA 2P2LA 3QELA 2JD2A 4BNNA 1KQ3A 2BZSA 1P3JA 5HCNA 4M83A 1DAFA 2A58A 3LHDA 4BXOB 3R74A 2BSXA 1MTOA 4QBIA 1IC6A 3HCFA 2CMDA 4IINA 2LW7A 1LDEA 3I1IA 1BRMA 4M0LA 3SSAA 2HQOA 3B1VA 3E9EA 5L40A 4O25A 4EFDA 3FOAA 2AOXA 2C3UA 4S04A 2NZUG 1RRGA 4S1OA 2A35A 2QUZA 3X44A 1RAHA 1KYQA 1QRUA 2AOVA 4CPDA 3L9XA 5JZSA 1GIAA 5AM1A 1JB9A 1K4MA 1W88A 4DSOA 1NFQA 1PG5A 2ZIGA 3GJSA 1CZKA 2JGDB 1YR3A 1SOVA 4O2LA 5AW4A 1YR9A 5ALTA 2OESA 3U37A 4RK7A 5HJEA 3DVLA 2JLBA 1C0KA 2B4TO 2J33A 1T3HA 1AUXA 5I4KA 3AVWA 4TXHA 2NYVA 3B6MA 4NCHA 2H9AA 4OHYA 4YGYA 4OOFA 5C46F 2JAHA 2EW2A 2E2WA 1IJEA 1T13A 4MVXA 3VU1A 1ZHHA 1E5DA 4IJMA 1S3GA 4QO8A 1QRTA 3RVMA 2FUCA 2FPPA 4KLCA 5FNVA 4IFBA 3FDZB 3SD7A 2Y1WA 4D98A 4EHHA 2BGGA 4PX2A 4JQSA 4AM8A 3BMXA 5FWNA 5HBRA 4KO8A 4OG2A 4CNBA 2QLNA 1UQRA 3R0JA 1ZM3A 3WL8A 3WVNA 5FUQA 3QF7A 4CLDA 3U7JA 1E64A 1ZSYA 2O7RA 3HRKA 4XYLA 3OCJA 3HZRA 4L4RA 4M9QA 4DXHA 1NUUA 5KDLA 3O1JC 3ZJUA 4BLVA 1X94A 4UQLA 3BE8A 1GWNA 1QJCA 4BMOB 4MEBA 5KQPA 3Q7SA 1Q1GA 2OO3A 4WXPA 2F1HA 2XQVA 3QEOA 1NPYA 2H3EA 5TF0A 3DTNA 1GNVA 1RIIA 2XDQA 3SYKA 3GBVA 5BNZA 5CDTA 2ZJFA 4RXTA 3R6GA 3F3MA 1PQWA 1R4MA 4C7KA 1B3BA 2DTEA 4Q3KA 5L7WA 4WOCA 3AR5A 3HK2A 2RCNA 4Q01A 1JJBA 2PUVA 4EVQA 4DC9A 3OZWA 2CL6X 2NXEA 2MYTA 1EDEA 4PXAA 1HE3A 1O5TA 1E2PA 1KVTA 1M3SA 2IP1A 2DM6A 1X7YB 2QMZA 4HPXB 4XUGB 5DHUA 3T5CA 2Z5FA 3PQ3A 1H2XA 3ZXYA 4B6PA 1VPLA 5KQLA 3UJ6A 4YT2A 4UUQA 2VTDA 1DC3A 1DVRA 3D8TA 3DCNA 2AG8A 3EQ8A 3IKMB 5TPZD 4BMCA 3I73A 2ZS7A 2RGEA 1JEEA 4PQRA 1F9EA 3U19A 1Y8RA 4H15A 3IRVA 3SX2A 3QXSA 2PZMA 2R5WA 2IYTA 4S1TA 2Q3MA 1HGXA 2CNLA 3AONB 3M9WA 1YJQA 1AMNA 2YXBA 4WV3A 4MWCA 5CDFA 4BYGA 4JYZA 3CEAA 2IYXA 3U4CA 2R8YA 1OGIA 1R3UA 4MV5A 4YGXB 1CUVA 3EXHA 4Z4EA 1L8LA 3BQNB 2IYWA 1XTPA 2VPIA 4PCAA 3OLYA 3D31A 4FLFA 3JQPA 1O94A 1TRKA 1ECJA 2P9TA 2Y76A 3ITDA 4Q02A 4RL6A 3QLJA 2W8BB 4D5GA 1U2ZA 1E89A 3QU5A 2PX2A 1JMYA 1YRAA 4P82A 1ITZA 1IHPA 4L8WB 5LUBA 4Z53A 3UWDA 2Y3IA 3MTQA 2TRSB 3OZIA 2V6JA 5FFNA 4YRIA 2PWPA 1QQ5A 2X2PA 4M88A 4IS2A 3ER6A 3IVMA 1ECPA 3FYHA 1RQXA 3UAWA 2OORA 5J43A 4YCLA 3JSAA 3RS9A 1W9MA 3SK0A 1RZRD 1PYGA 4DDMA 4WKOA 2VPPA 4LWZA 4MVJG 1SB8A 4RK1A 2HBYA 2WMYA 2A4MA 3GEGA 3R3WA 5EJFA 4BC1A 2C8JA 2GDJA 2DFTA 5EMMA 4BB5A 3JZAA 4CHTA 3FHTA 3K92A 3S55A 3ZHUA 1A4RA 1Q44A 4RELA 4KJXA 4QPJC 3GAMA 1QDUA 3D5EA 1T4CA 4ZI7A 1G20E 3LQYA 2HO4A 1BJKA 3QWBA 1Z4QA 4G5XA 4KN5A 3LYUA 1MD9A 3FMIA 4F45A 2EERA 1RJ9A 4F91B 1W5EA 3OJXA 3T15A 3T3MB 5A1JA 4N5NA 5BV8A 3M9LA 2V7BA 3AGPA 3HXLA 3O31A 3VO1A 3MINB 3MTIA 3PUIA 3HKEA 5LA6B 5K3EA 2FMHA 2OO5A 4I9GA 4S0ZA 1TD1A 2R25B 4NBUA 3MNFA 3ONEA 4G2TA 1CDDA 1EXNA 4IIBA 3NC0C 3QJGA 4MWTA 2GHRA 4LJKA 2XTMA 1T2UA 5JVDA 4US1R 3RC8A 3OG9A 5BW5A 1E18A 1V26A 1B8NA 1E0KA 1VZ2A 3IRUA 2FSVC 4B46A 4EO9A 4YRAA 4UDOA 2VTBB 1B76A 1RM4A 3IMKA 3TDKA 1W19A 3GPCA 2VVTA 5EKTA 2OZPA 3ACCA 3NDPA 1N5LA 4C2AA 1J90A 4PAMA 2PRZA 4OY3A 4JC0A 4Y1GA 1ZR2A 1QKIA 2WZDA 1GL9B 2IHUA 2WWHA 4J1TC 1PT6A 4MKZA 1GARA 1PW7A 1W76A 3CR8A 4QKQA 1Z56C 2ZRHA 1GN8A 1HH4A 1OI7A 3L0PA 3P9IA 4JJ6A 3KFVA 2BTEA 3CUKA 1A2OA 1X3LA 5FYQA 2GEFA 5JLAA 2ZJ6A 3N2YA 3I2YX 1SRQA 1SZCA 1RWVA 2LVBA 4HS4A 5KNBA 1FP2A 4QNMA 1EPUA 4AUKA 3M1YA 4P0QB 1U80A 3SP1A 4X5OA 4OQQA 1JGTA 2WJYA 1RJEA 3O6VA 5ALYA 5IARA 4BVJA 4YXWD 4HNVA 3MRSA 3Q5GA 4M8LA 3SWWA 1TUIA 4QYMA 3GLFE 1Z3IX 1PQ4A 1ULHA 4HDMA 4Q3OA 3I6IA 3VPSA 5K4GA 2C77A 1NWCA 2V59A 2PMBA 5I7WA 1BNCA 2GN8A 4GM1A 1IHXA 2OZLA 3MWJA 2F62A 2QW8A 3OJFA 4MIEA 2ZZMA 4Y2RA 5I7OA 1BDHA 1LNZA 2CL5A 1YMVA 3SDBA 4A27A 1BHJA 4CTKA 1Y63A 4JR2A 2O1EA 5B6JA 4RY0A 1N4AA 1RVV1 2OG2A 1XVAA 1ZESA 4S1PA 3RK1A 5ECGC 5B64A 3GMDA 3T0IA 1T5DX 4LJ8A 4C89A 2OD9A 5A05A 2QLMA 1DRVA 5BR7A 1NRWA 2N46A 3WK9A 3ER9A 2B2CA 4DBLC 2IUSA 3KSBC 1CW2B 3K8ZA 2PJDA 1Z5VA 1CT9A 1E9EA 1Q0HA 1QYVA 1WCIB 4KXQA 2LKDA 5HZMA 2Q9UA 3L7DA 3MJDA 1YI0A 5MGNA 4O8CA 1A8UA 3CLVA 4NJMB 5G0UA 3N0RA 2FNAA 1SOWA 1Z5UA 4EY4A 4ZD6A 4R40A 4MYDA 5TGDA 3HFGA 2E82A 4XX0B 5AOBA 2IH2A 3M6VA 3H0EA 3HJRA 3QU7A 4FDMA 5EFZA 1VZ3A 3FHCB 4CLRB 1WTAA 5WRFA 4DR6B 2ODWA 4F5EA 1LPMA 2IPXA 5HW0A 1LK5A 3BZWA 2AXPA 4BZQA 2X9LA 1B2RA 2PVSA 1TM1E 4HMOA 2Z3VA 3QPAA 4QHTA 2QMYA 4A8JA 1XR3A 1NP6A 1XFAA 3FMOB 2WFMA 1A7UA 1QYXA 3T5TA 1Z35A 1V2GA 1J2TA 4Q9NA 5KNDD 3SVZA 2WT8A 3USZA 3L02A 5FI3A 4NS4A 1Z73A 4EKGA 1FSSA 2SCUB 4NP6A 1N5MA 4RPGA 5F9MA 3GH3A 3QX3A 2VP4A 2XCTB 2MYUA 4PBSA 1QTQA 1S4QA 4B5KA 4IJWA 5DK4A 3FYDA 3AEQA 2HKIA 3CBGA 4N7BA 2RBEA 2Y0DA 1YTLA 2DAPA 2XNHA 5IDVA 5AK5A 2AHRA 4MH0R 3U62A 3L77A 4K6OA 4HDKB 4DVGA 3EXEA 1N34B 5AKHA 3ML1A 2PYIA 4JL8A 4KE9A 3C7KA 1WV1A 4FGUA 4KBGA 4JBHA 4EF4A 3SICE 3ZR4B 1CSEE 4E33A 5B7PA 1EVZA 3B5JA 3T4EA 3OJCA 3HWRA 1KZ7B 4CTMA 3I9FA 1II8A 4PNHA 1GZVA 1BZYA 2XQJA 2Z9CA 3BERA 3H3XA 1G9TA 4XQGA 3W1EA 4AK9A 4BECA 1OI2A 1NULA 5HMMA 3OKPA 3IPXA 4B4OA 1ZN8A 3E6AA 3M4XA 1C8BA 1Q14A 4C6TB 2FMUA 4IHJB 1AKTA 2D2VA 2OWEA 4L73A 5AM2A 5JCOC 1ONPA 5GM1A 2ATCA 2G7ZA 4K9SA 3K0KA 5LQSA 3IVGA 3SXJA 1IBRA 3O47A 2O8EB 2M6RA 1KHHA 2JGFA 4HEQA 4X1KA 5F51A 3T7RA 5A5FA 4GT1A 4FNOA 5KOYA 2FKAA 1OYOA 3CZRA 2EF1A 2CXNA 5IHXA 2RK3A 4U02A 1ADBA 1HTBA 5EY5B 5JAZA 1YS4A 2GD2A 3ODGA 4CQNA 2PA3A 2GTPA 5K0CA 3QLTA 4H0FA 1JEAA 2X7XA 1ZZEA 1S2OA 4BVGA 3MTEA 2VRBA 3DTVB 4J1NA 3AF1A 2BMDA 3I52A 3PYLA 1CBUA 5FP0A 2CB0A 1GQSA 3UEOA 4UE6A 4AT1A 3BTVA 1VHTA 5CURA 4JI5B 3VRHA 1OFTA 1D4ZA 2ZSHA 3R20A 1UPTA 2DVMA 2H0RA 2FCAA 2BDEA 2YYSA 3EFEA 2DQ4A 3KAQA 4UM9B 1PBTA 3EYWA 3IFSA 2NPFA 3M89A 2HL6A 3H9QA 3II6X 2WZBA 3A3OA 3FJOA 2F4VB 3ESDA 3DLCA 4ZT6A 2A88A 5GQSA 1ZRSA 4HNAA 4M9XA 1T9KA 3WLQA 2DKNA 1JH8A 1MW8X 1WE2A 2GQ0A 5K0JA 4TS3A 2YMMA 5BWMA 3K73O 5ITWA 3RS0A 3Q8WA 4H7JA 3S3TA 4J0IA 3LJKA 4NENB 4DWJA 4R41A 3A1DA 1L4MA 1QTRA 2VK1A 3MC1A 3G17A 1XCPA 2J3DA 1HYBA 2JHPA 3BMQB 4ZAZA 5JTUA 2GJSA 4FOOA 2DPXA 2A3NA 4FI3F 2Q7OE 5KPJA 2IYEA 1PR2A 5M3BA 1JPUA 2YZMA 1U1EA 3Q40A 4OH7A 4BNTA 3PT9A 4U5XA 3KEOA 1KSJA 2C97A 4KRXA 3IXLA 1P73A 2FZWA 3OF3A 4GR9A 5B6PA 1WULS 1DKUA 3MBIA 3CSSA 3NBFA 4XOIA 3SJUA 3G8CA 5B2FA 1SVLA 4OI4A 5BV7A 1I4DD 4YUZA 4EP1A 3E3LA 2NSLA 4AKIA 1OFGA 2JA1A 2J9XB 2XXJA 3T9BA 1NW8A 1D3AA 1IEWA 4UXIA 2FSUA 1GO2A 4F97A 3A6ZA 4TYYA 3JWJA 2FLKA 1NONA 4QUDA 3EJ6A 4TMXA 5BVHB 1UKZA 2E21A 2SHKA 5GWXA 1I3CA 1QHGA 3DF7A 2AW5A 3D8UA 4X93A 4C4SA 4K88A 4ENVA 3AO0B 3FZNA 3Q7TA 2UVPB 2HEGA 5JDCC 5FULA 1MA0A 2XB8A 4LWOA 4IDFA 4NCAA 1H3EA 1AGYA 4EOGA 3HL0A 3OMWA 4POAA 4D92A 4GOND 3I1YA 3OICA 3QWFA 1JG2A 4CLEA 2NVBA 3OHMA 3RUPA 2AZMA 1OUMA 1MDFA 1QMPA 1Z47A 2QX6A 2P77A 3F5MA 4P2BA 5FA6A 5FOWA 4R9VA 3QMMA 2RBGA 2X1MA 4E5PA 3MWKA 3LU1A 1IWOA 1NN0A 2DCMA 5CDUA 1BH6A 2TMGA 2VN8A 3VKUA 1DQNA 2R6FA 4TTPA 2XKKA 1KOGA 2V4ZA 4RPJA 1GOTA 1LK7A 1NBIA 4Z4GA 4WCFA 1GRVA 4RD3A 4WXYB 1RRPA 3PV0A 3NJ4A 4L22A 1T2CA 2FZ5A 1JKJA 1QUEA 2PKQP 4M1OA 2A1TR 1KP3A 4XLZA 2WRZA 3RIXA 3VU8A 2V98A 4IXMA 2HT1A 5KTOA 1CQJA 5JRDS 2KLHA 3O3NB 3UJBA 1NR5A 1DOHA 3QVGA 4GG1A 3W2HA 2Q4EA 3ZHCA 4DAOA 1XNQB 4OV6B 2JBWA 3E2MA 4L16A 5CHEA 2MU1A 1NVDA 1VG0B 2GBPA 2F3PA 1L1EA 3RFVA 3LOQA 3AH8A 4ZZ0A 2UXCB 4DHWA 3FROA 3B48A 1CLUA 4BGIA 4MYSA 3DMHA 4OOEA 2JJYA 1A8IA 1JAYA 2WSLA 6NULA 1HT1E 1PGQA 1CQXA 1X80B 2C4MA 1F3OA 2IKQA 3UPDA 2W2KA 2H2WA 6ADHA 1E1YA 1GLNA 1EI9A 2QXUA 3KCNA 1OAOC 3FYTA 5K0TA 4GPIB 2OC4A 5DP1A 1OTHA 5A03A 4A73A 4HC4A 5DIZA 4ZI5A 1H2YA 1KZ1A 3LS2A 3R5XA 2PQ0A 3DM9B 2WYWA 1AS3A 1Z12A 1CNFA 3EVNA 4NBVA 3ZIAD 4TWZA 2COUA 1JEQA 1RHQA 1TLFA 4UBMA 4XCVA 1I4LD 3ZWOA 1C7FA 3LY5A 4M1MA 1NDQA 1IMOA 4HQFA 4LY6A 4MLPA 1DV1A 5FYDA 3WNBA 3ZBTA 2I54A 1SBHA 4X7RA 1PLKA 3PQ5A 4P3XA 4NULA 3LRXA 4QDUA 2I3GA 3BKXA 3HCWA 1IH8A 4PYNA 1J7KA 2ZB2A 4YC7A 3T52A 4KFCA 3L7NA 2YTZA 3LXMA 4GVLA 5E9JA 3LQ1A 1KGDA 2JAQA 1EK0A 3RIHA 2PBFA 2FDXA 4MUYA 4RQUA 4EG6A 4F5ZA 3TI7A 1YUNA 3CMMA 4FIZA 3DWEX 3OX3A 4JP1A 1EGHA 1W0JA 3EGCA 3PUZA 1T91A 2D2IA 5E6UB 1KORA 3SS8A 3WZMA 5KYKA 3BWXA 2C2GA 1T24A 3AJDA 1KH3A 2P67A 3DAGA 1YCFA 2OFFA 3B9PA 4H4DA 4D3DA 1TADA 2OBNA 3PUKA 3X1WA 5IWCA 4QAQA 1UDWA 1T2FA 3LV8A 4JMLA 4CEHB 2X22A 1L5WA 1W75A 1CWUA 2RH4A 2VPYA 4JLSA 3PL1A 2X8BA 1LWOA 3VUFA 2GEJA 2H18A 2CNOA 2RHRA 1R50A 3RANA 2A4KA 2GK3A 3QX7A 4MHTA 2OHXA 1WMAA 2QUAA 3DUFB 5HKLA 3V2GA 3VO2A 5CBPA 2C9CA 1KY2A 4URUR 5FEMA 3WNQA 4ITRC 2C7RA 1CR0A 1ZJJA 4RF4A 2EARA 1UWVA 4Y6RA 1KZGB 4OJNA 1AA6A 2WQZA 3H9BA 3FBWA 4P8RA 3TSYA 4AZWA 3AWIA 4L8YA 2GCPA 4WNYA 3QUQA 4NBKA 4X85A 4LS3A 4YROA 2LDBA 1I4EB 4Y3UA 3IP3A 3QPBA 3FM9A 1X7DA 3D1LA 3T1VA 2TMKA 1OX6A 4LJ4A 2JH8A 3EFBA 3KYJB 3PQCA 3P9SA 1Y1QA 4K46A 3N70A 3N8DA 1STOA 3AHCA 4I50B 2WSBA 3OT5A 3CRMA 4RMHA 5C1PA 5JD6A 1M2EA 3M5CA 1S4MA 2YWGA 4FHDA 2ANCA 4C4OA 3P2MA 3W6NA 1JQ5A 3LDFA 1R0RE 3QE3A 1RT9A 3QVLA 1Z2CA 4NYIQ 3RR2A 5J2UF 4RENA 1RI5A 3E48A 4RAOA 4XWYA 4E1BA 1OI4A 2C95A 5JAQA 1KJIA 1E3QA 3G2MA 4YYZA 4MS1B 3ORRA 5FTNA 4CG2A 2NUAA 3KOUA 1M2OB 2CF6A 3TLZA 4KHZA 1E6KA 3ROXA 1Y5MA 1Z82A 2PK3A 2VTKA 2C5GA 3FNBA 3MFYA 1ELOA 4H1UA 4Z8YA 2X4GA 1M66A 4JVOA 2OB1A 2ORVA 1LV8A 4HRXA 1XNGA 5LU8A 1XAGA 1Q7EA 1ZD8A 5CIWA 5B6IA 2ZYIA 3V6MA 4D6XA 1FVFA 2KBEA 4FB4A 3EXFA 2DG2A 4ZA2A 4I4TA 3U5ZB 4TTJA 2LCFA 2W6NA 3D3QA 2W2PA 4ZYXA 4DLUA 3ENVA 2C4VA 2VJBA 1ZWKA 1Y48E 3TE6A 4WACA 3ZZNA 3NOVA 5TMPA 3T3GA 2PZEA 3AP2A 4X20B 4B4UA 2GHTA 5EJ4A 1E2EA 4HB2A 2Y27A 4MSUA 4O2RA 4R68A 3ICCA 5AJVB 1KSGA 5IVKA 3GEHA 4FB5A 4OATA 2E49A 2VC2B 3WFIA 3NUGA 1K7YA 3F0TA 4D74A 4DMGA 5EZYA 4EG1A 1UBMS 4QOFA 4U6QA 2HI0A 1XELA 2YR0A 3H87A 3KWMA 4NC9A 4ZAXA 4B43A 4PN3A 4ZCTA 3P9NA 3PWZA 2JVJA 4MUAA 3WRXA 2G1PA 4F11A 1N6RA 2ATEA 5IU6A 2YDYA 4JJEA 4N8SA 1O03A 2P8SA 3MLBA 1TK3A 3HU2A 4JVNA 3IKJA 3TRJA 2IDJA 4RH0A 5JC8A 1GYPA 4HSEA 3ROPA 5BSRA 4PANA 3C6MA 2GUGA 2IUEA 4LDQA 4MS3B 5AUOB 2IX3A 1QJ4A 1R0KA 2QY6A 3GLHB 2AUMA 1W52X 4MVYA 1SG6A 3EODA 1ESNA 3PJEA 5FLYA 2GWHA 1N8NA 3OQJA 1V8PA 4KOAA 4XW2A 2AK2A 3HVIA 2IODA 1PGNA 3TJZA 1ORDA 3ANSA 1JECA 1ZK0A 2WKWA 4M86A 3SYTA 4L4UA 4XWGA 5T67A 1UINA 1GA1A 3K6SB 1CR6A 4PBTA 4PPQA 4ZODA 1P61B 4YACA 4EK9A 1C0PA 3DF9A 3EIXA 3WGLA 3FOBA 1X1CA 1DKLA 2BMFA 3OFNA 4HWOA 2R6AA 3HYRA 3PXUA 3RYHB 2JLVA 2EZ9A 3AKZA 3VPBA 4B6SA 3WRYC 5EXPA 2P9CA 3WMRA 4EYSA 1D6JA 5L3VA 3EFOB 4FCTA 3HZHA 1J5XA 4BMXA 1SCDA 2VJNA 5FTWA 1XYGA 3D5QA 4CIAA 1L8QA 4JI6B 1SY7A 2AG1A 2Q4RA 4UUOA 2VDOB 2XE6A 3V8RA 1CCWA 2MINA 2JGEA 3FMGA 2GAOA 3KTAB 5LQCA 1AKNA 1E1DA 1I01A 1XIVA 4B6GA 2GM4A 3C0KA 3L40A 4UM5A 4X7MA 4WCFC 2FSVA 4OUDA 4XGRA 1C41A 3C4JA 3BQ9A 1V1JA 1Z4MA 1Q3KA 1KMHB 2FPIB 4EABA 3CH5A 4DCUA 4MPPA 1VKNA 3GQBB 3EDYA 4A3SA 2BEWB 2QOEA 4Q4DA 4UM9D 3X3HA 3ND9A 1U5AA 1KRWA 1W1UA 5TR9A 1V7ZA 3DYIA 1P0CA 2B2NA 4ZI7F 3SMQA 2AEFA 5CXQA 1YKGA 3CF4A 4CM3A 4CLOA 1EK1A 2I4LA 4HTAA 4JXKA 3ZD8A 1EDOA 1TZMA 3IP6A 5EHXA 1IBSA 1UH5A 2NO7A 2NO1A 1U8CB 2IEGA 4EB6A 1N5JA 1NJGA 4Y6PA 2L2QA 5FPHA 4GNRA 3F4BA 3ADPA 3PHBE 4L3VA 1ZEJA 1X7WB 1Z7YA 4Z9XA 1YDWA 4BNIA 1ESCA 4EHAA 2F6RA 4HUTA 3FIUA 3QJ5A 3MJCA 5HMLA 1JDZA 1Y0BA 2H92A 1A27A 3BMQA 4BCBA 2FE4A 3GF4A 3PNVA 1GZ6A 4DEXA 4DSUA 3FTNA 2ZSDA 1ZUNB 4MK4A 1YKFA 3LX5A 3RS8A 3OEEA 3TI9A 3W7VA 3CWQA 1FFDA 3EBPA 2I9KA 1DHRA 5K2OA 3HCOA 1IY8A 2XTJA 3ZU6A 2J7PA 2H4WA 2V1XA 4B8ZA 3TFWA 1Z5OA 4BKMA 1U0EA 1YDMA 1BXZA 2AFHA 3RAGA 4WJZA 4TV8B 3IAXA 4FQ7A 4G0MA 1AU9A 1N2SA 1D03A 1EBFA 3ORHA 3O1LA 2WG0A 4HRAA 3CXUA 2FX2A 4H59A 4CM4B 1GUFA 4F21A 3QZUA 4MZXA 1NW5A 2W70A 5K45A 2W6JA 5ELXA 2X23A 1DEAA 2O1SA 2XQKA 2YFQA 3DEIA 2V45A 4HDRA 4PAGA 4S1WA 4OBEA 1TIPA 3ZCSA 4NK4A 1FSZA 2WYVA 3L7BA 4BN0A 5BQXA 1YU6A 2ERXA 2PU7A 4PBRA 4RVFA 3OZ7A 3UH1A 5KYXA 1X1RA 2NZ2A 3N7UA 4HQLA 4KFSA 4DA0A 4H16A 1W44A 4RZXA 4L1KA 5EC8A 2JDIA 2XDYA 4KR0A 5I7HA 3OEHD 3IPAA 4LHWA 1CZOA 1THMA 2X1LA 1R6UA 3O21A 4MVWA 1FPQA 1OFIA 3DAPA 4ZRNA 2WF8A 3CKKA 4TL9A 5CFOA 5PNTA 3HR4A 4HH4A 2VBFA 3DM5A 3K72B 4TRRA 1GQYA 4AJ1A 4NHOA 3OUTA 2PYDA 5DI3B 3EEQA 4TUYF 4XIYA 3CUTA 2VZLA 2C2WA 1FQJA 3N0TA 5LJIA 1XD2B 4HNHA 3LPCA 4F93B 5HRCA 4HWRA 3BCSA 1IDN1 3DQPA 4L2IA 2JIQA 4GBED 4IDCA 4TS4A 3FOWA 1XRQA 5AO9A 2WA1A 4D2IA 4YT5A 4MKFA 3U4GA 3J81k 3VKGA 1FW6A 2IZ6A 3DYBA 4L95C 1OB2A 5B37A 1X7XB 4QM7A 1I7DA 1ZMOA 1CIVA 2JJ2D 1VRWA 3LQQA 2YUTA 4NSNA 1INLA 3GNSA 3L1KA 3NO4A 4LDZA 4L0CA 4JSTA 2I2WA 1RM0A 1U0LA 2IA5A 3W5VA 3H17A 1DUVG 4MWEA 4ML3A 1U65A 4GDMA 2ZKLA 1VHWA 4HDKA 4NYMR 3GLIB 2Y68A 1TO6A 2ZBGA 3SKVA 3ZD7A 3HNRA 3FCSB 4IUDS 2JG3A 1V35A 5T64A 2OD7A 5JADA 3NHAA 4IIHA 4Z9YA 2W83A 4AL4A 3UT6A 3RJTA 2QENA 2J9GA 3E1SA 3TKAA 4A4DA 1T3LA 1KJZA 1UKCA 5LA6F 2NVWA 1PX2A 3U0VA 2GCIA 3UWSA 4GWLA 1XPUA 1O57A 5BSUA 1IM5A 1TMOA 1OH7A 1QOPB 5CYPA 3AVXA 4OHMA 1ZNYA 3C2QA 3QU4A 2HLHA 4HYTA 1W4CA 3R0ZA 4YP6A 5THKA 3VR6D 2JA2A 3AWDA 4NYJR 4Y6QA 5B7GA 3J7AC 1EXVA 3S2YA 5HQTA 4ZDKA 1Z9BA 3OFKA 3I6MA 2XIJA 5KNDA 5KNCA 2AUTA 3UJPA 4QLBA 1L7NA 1Z0ZA 2OTCA 3N7AA 4S1NA 4PG4A 1AX9A 2OHVA 3U4QA 2Y1LA 1B42A 3WIUA 1HLGA 2ZQZA 1Q2UA 5IH7A 1C8VB 2EJWA 3MG9A 4LVCA 2ECKA 1QB8A 1X70A 1OLXB 4IEEA 1JFTA 1ZD9A 4WUTA 1N7HA 3H05A 3MERA 4C0SA 1M1YE 3D81A 1VI6A 4FW8A 3H2GA 3M83A 3MLAA 3V8EA 5KMGB 3EDQA 4PSUA 2R5FA 2FRDA 2SKCA 4GLFA 3JD4A 3MFQA 4K6CA 4R8KA 4PU0A 1FJGB 1Y6JA 1V2HE 3PNBA 4BFYA 3U6BA 4MI6A 4XPIA 7REQB 3T1TA 3HU3A 2CYAA 4YQZA 3T6KA 1XT6A 2CVZA 4KO3S 3EZ9A 4O29A 5EWLB 1QXSA 2G06A 1ULAA 4W8GA 2VAXA 3WK4A 3C3XA 3R1IA 3ND8A 2C7BA 4RV9A 5D84A 3EF0A 2GK7A 2V0NA 3WJAA 1YGYA 2OGSA 2DTXA 1GL7A 2H06A 4OP2A 1E1QD 4UVGA 1DUIA 4PLWA 3WAJA 1GFZA 3RNLA 5ES3A 1RBZA 1MJGM 2ZYUX 2JH3A 2P65A 4YMVA 1BVUA 4BFLA 1JEJA 4IIYA 1PKEA 4CIBA 4GC5A 3GDWA 3H13A 3DAOA 4LZNA 1L5GB 4ZZ3A 2IHJA 4Y67A 5C4MA 1TIKA 1G5FA 4J0FA 3HUEA 3BXPA 3Q3VA 3ZXUB 3AI2A 2UZIR 3HEBA 5HIAA 4U6SA 2CXQA 5LPNA 1DSSG 2WTNA 2PWAA 4M53A 3N3AC 5DHSA 3BHMA 4R8RA 1SVOA 5FR1A 5LDHA 1CEQA 3HJFA 1CEEA 1E1RA 5EIEA 4HF7A 3QMVA 4OJKA 5DXJA 2DUMA 1SBCA 4JJAA 5DGDA 4ZOAA 1E5QA 1U2TA 4CEJA 3V1UA 3Q7PA 1M7BA 2Q9CA 2OQ2A 3D4PA 4R6WA 5K6AA 4RSHA 1C7JA 1MORA 1RLOA 1XZDA 1YS6A 1UFVA 2QYSA 2XAUA 3AR4A 4XD2A 5DZSA 3AF0A 1IN7A 4IKEA 1IONA 1GPWB 4QVGA 3KZMA 3VHXA 5BN4A 5LZ2A 4OFWA 2JBAA 4Q3CA 1YDGA 2BD0A 1CVLA 3RF7A 3PC4A 1B1CA 1CV2A 4N7JA 5IH3A 1DV2A 4NCXA 4R0VA 4UCWA 3VHXB 2WFZA 3QU2A 5CXUA 5J47A 1HI9A 3MBOA 1GITA 2QBYA 4V0LA 4KXUA 4NY1A 4LXIA 2O2ZA 1YBFA 2W5UA 1P62B 3VU0A 1M2GA 4DGSA 4IIGA 2VK8A 3ZLTA 4TGLA 3KTOA 3DLPX 2ETXA 4B3CA 2IH5A 2ABWA 4CEJB 2GOYA 3EGXB 4MR9B 3S1LA 5K3FA 1UC9A 1NF2A 3I4FA 2OAGA 1H6BA 2Q45A 4YV7A 1QSGA 3H9GA 4HFMA 2P11A 4N5HX 2BFFB 5AI0A 3LX6A 1KQNA 1Z5WA 3GWZA 1TJ5A 5CA1F 1L4KA 2A14A 3TL2A 1CJTC 1M0EA 3AIOA 2R84A 2XCSB 5DCUA 5L3QB 4YALA 4HL6A 1OJ7A 3TW8B 4ZJUA 4J3FA 1KU0A 2FGJA 4HV4A 1ODTC 1B26A 1P4JA 3BF8A 4CM8A 4QT4A 4HRVA 3DTVD 3AY3A 3IOEA 3KZCA 1ZQ9A 3IOYA 4ZALA 1E6WA 4IHJF 4FCVA 4F4JA 2I0FA 1VTKA 3CW9A 1VCNA 3IESA 4N0MA 3MWDB 1KK2A 4INPA 3MIZA 2AR0A 1Q91A 4X00A 2GVZC 5EP2A 4D8WA 2Z30A 2VYFA 1TTQB 2IXFA 5G1NA 4CV1A 5JOQA 3EARA 3G2JA 2FK8A 4QWMA 2F1RA 4UMFA 2O0JA 2IZ0A 4BRWA 1IWBB 3C8DA 2VWQA 4ND1A 1FLNA 3RTBA 4EJ2A 3KKOA 5JLJA 1JG3A 3CO0S 4C0KA 2IPMA 4JBIA 2GN1A 3OVMA 5NULA 5F2KA 2AFIB 2EFHB 2GTIA 1G8PA 5FJIA 4DG5A 1M8FA 2FXVA 2WM8A 4IDAA 2WIDA 5G1PA 1P18A 4JP2A 2CJFA 3IT1A 2VDMB 3ZYCA 4B74A 4BV9A 4DLTA 2NXWA 4FFNA 4W82A 3EQ2A 5K7SA 3N2GB 1C1DA 3BAZA 2JI7A 3R3UA 2GEBA 3UHPA 3R9KA 1LD3A 1JHQA 1KPGA 4IF6A 1K1EA 3E23A 5DGXA 3DH0A 3WKEA 1TF7A 4PLGA 1HDEA 2RKBA 1AQ6A 3REOA 4C5CA 4UCQA 2V54A 4JN6B 1CR4A 1SUSA 1YE8A 1IY9A 3IEVA 4L02A 4N5MA 2TMDA 3JATA 1C1HA 1NYRA 3KELA 1BG6A 1T3GA 3AVQA 3NT2A 3C3PA 3FSRA 4IIVA 5CDFE 2OVFA 2VH2A 5IAJA 4YPFA 2QN1A 2BPOA 1IL0A 5LZ8A 4BX3A 2X0DA 2R7MA 4XDHA 4HWGA 2BH2A 1BQ3A 3N3BC 3DFFA 3NALA 1SUBA 1CERA 1B73A 2OT3B 3GIDA 1RLIA 4HDNA 2B1IA 3EE6A 3RYTC 8AT1A 3QITA 2VYVD 3BCHA 2GK4A 4QBGB 2G7MC 2BKXA 2WF9A 3G8AA 4LHVA 3F6CA 5DNCA 5ED4A 1IPHA 5CFQA 3C7AA 3INTA 4TYPA 1BXRA 2CLIB 2ONKA 3RU9A 1QZXA 1YRWA 3GXBA 5HK9A 1Z7EA 1R0LA 1ABEA 1DXHA 3R3JA 5DM70 4X6UA 2FR8A 4X8MA 1FOEB 1VP3A 1QFYA 2QLJA 5GMOA 4D4HA 5REQB 1JSXA 4DA6A 5BSMA 1PJBA 4CBVA 4DRXA 1CJCA 2X0RA 3L46A 4HLNA 3WR5A 1TZBA 3AJ9A 4DIDA 1V3TA 3SZLA 1X14A 2XD9A 3A6HA 1MRNA 3HXPA 1E7RA 2PZJA 3AM5A 3BEOA 3G79A 2ESRA 3P4YA 3P0IA 4W5HA 3TW6A 1FP1D 2YOFA 1BSVA 3JQAD 2HZ7A 5L53A 4P08A 4MRPA 3KQHA 5JBIA 1WP9A 1NI4A 4BMYA 1BQEA 1WXEA 2H0AA 2J08A 4GZ5A 2PRYA 2ZS9A 1JSCA 1BMDA 2D7DA 4Y2XA 3T9FA 1XFDA 4F5YA 1DINA 1FDSA 2R48A 5FOQA 1MAHA 1KYXA 4A8PA 1YZ3A 3K2EA 1ZCBA 4EHLA 1QGUB 3HDTA 3QXJA 2PUGA 1BE1A 2HIMA 2IOFK 1QVVA 1AGXA 4YHBA 4F5WA 1EFRA 2RG7A 2REQB 2EW8A 2X8JB 5IKPA 2G0NA 4OJQA 3M6AA 1ECGA 1R6XA 1JZTA 4ZU6X 5A7FA 5IF3A 1XHLA 3HCRA 3HKCA 1TAQA 2GJKA 4F85A 4P7FA 4DEYA 4FGWA 4PPYA 3K4PA 5TVKA 5FADA 1FA9A 5ALIA 3TLGA 4U2KA 3ZHZA 3O82A 3O94A 1KEUA 3JVUA 1MN6A 5SICE 4JLOA 3C74A 2DSNA 4FKZA 2Q3LA 2GDZA 3HLYA 4RW0A 1G5RA 3OE7A 3I8XA 1VPEA 2RG1A 4OIMA 3FMFA 4K86A 5F23A 1NE7A 4J0KA 3UZUA 5A9RA 1LPOA 1YR7A 3GPIA 1UJ2A 4B7UA 2AFHB 4D3YA 5IT4A 1XU7A 4NE7A 2XEDA 2XW6A 3NS7A 2XEXA 2ID4A 4P31A 3WOHA 4FK8A 3EPJA 2QUBA 5U4QA 1A8PA 4FMCB 3SIPA 4XUCA 4AFNA 1G1MA 1ZI6A 3KVVA 3SOZA 1OVMA 3EG5A 3VUEA 1BKDR 4KWCA 4JHLA 3T4PA 3ZGNA 3ZXXA 1ZVQA 4ZHQA 2EZ8A 4PF1A 1MHTA 3LAWA 1XXHB 1SD5A 1ZCJA 3IUSA 2DQSA 2R00A 4M0DA 3WIVA 1BGVA 2QTMA 1B4DA 1LY1A 4CTJA 4EUHA 2XXBA 4M1QA 2VSQA 4MVJP 2MYNA 1VL8A 1NXVA 3QUSA 4NMHA 3EN0A 1TVMA 4OQEA 3ZY2A 2RB4A 4N0QA 1Y8AA 3QFTA 2JD0A 1VMKA 4BNVA 2J5XA 4C22A 2AXEA 4FNAA 4AX4A 4B2IA 4P80A 1RSZA 4FZRA 1U5CA 2Q49A 1J0XO 2OK7A 3CF6R 1HX7A 2G88A 3BXOA 2JNWA 1I3NA 4KV7A 3DFUA 4LYHA 5FL7D 4J0JA 1CRPA 3IDOA 1SPBS 2VHVA 3PC8A 4V03A 4J03A 3N53A 2IIBA 4YLGA 1IY1A 1P7PA 3OCCA 3GQBA 3ED5A 4HFJA 2WW8A 1SAYA 4I1UA 1JYEA 3UYKA 4LK2A 3ZLBA 1O95A 5LR6A 1FX0B 2CDNA 1LX6A 1SUWA 4M0FA 4TYMA 3UUWA 3B6IA 3DCJA 3DXXA 1YDFA 2PH5A 2WKSA 1PZMA 2PS9A 1PVVA 4G5HA 4JUDX 3UJ7A 5HG0A 4FSHA 1A8QA 2POCA 4HH1A 2FHPA 1YCDA 2OBYA 5DSXA 2HRCA 2OUIA 4V39A 2ZSAA 3BHJA 3RTGA 4KWIA 3Q41A 2HRDA 1C1YA 3P0JA 4QASA 1U1IA 3A37A 5AKGA 1PR4A 3G5LA 5LBIA 1DG3A 4G65A 4HZGA 2ATVA 1VJ5A 3JQEA 1XVUA 3QLEA 4BX0A 5CLJA 3SQNA 5E0OA 1PN3A 3I5XA 2CUNA 1CYDA 3B3FA 2J59A 1U5BA 2QQ0A 3LKBA 5IVDA 5LLSA 1XOIA 2LE0A 3SAJA 4AROA 1LV7A 1K8YB 1VGQA 2XA1A 3GG2A 1DIGA 3K0AB 1DG9A 4G0OA 4OAPA 4YRRA 2BFOA 5LLTA 4BMDA 3GELA 3L4SO 5L51A 1GFSA 1I1NA 3R0VA 1BMTA 4M6WB 1RKXA 4Q39A 2TECE 4WFIA 5FBZA 3T95A 4KO1S 3EEOA 5BO5A 2QNBA 3P4XA 4OXYA 1ANKA 1IM8A 1G8SA 5FT9A 1BS9A 2BHTA 1K89A 1RYHA 4BO5A 3NJ8A 2ZBPA 3IMEA 3JY6A 4JQYA 4UM7A 3ADCA 4PZ0A 4BO8A 1JV2B 1VE5A 1GUBA 4MW0A 2XB2A 1MAUA 2YV3A 4QPCA 5G4LA 5LYJF 3RC3A 4N6NA 2NTVA 2QL6A 3T1QA 1IXKA 3WO0A 2E55A 4C1NA 1AY0A 1E3SA 3EZXA 2VF7A 3R24A 1R4AA 2OLEA 2P3QA 4O2BB 5DGTA 1KFEB 1TD9A 1O3YA 3D6MA 4YBZA 3BF7A 1G20A 1RKUA 1UIMA 3C5HA 3TPCA 4ABYA 5E9AA 1AO0A 5IC5A 3R8FA 4RJTA 1EWQA 1P2BA 1N77A 3Q0IA 1VE1A 4CF7A 3CCFA 2HV9A 4CKBA 1R0CA 2BGNA 2UDPA 3GU3A 1A4UA 1QAMA 1WKVA 4P98A 2P90A 2W0SA 2CL7X 4PHTA 3CZ9A 3MGGA 4YP0A 3E22A 1GDTA 1H5UA 4I1VA 4KGXA 2NO9A 3PSHA 5KHOC 1TKCA 5IM5A 4MV4A 3FCCA 1EGAA 3H97A 2C00A 2DE0X 1EX1A 3SQLA 1UAGA 2OO5C 4E88A 4DR1B 1Z8HA 4BASA 1HNZB 1JIQA 2ASVA 3GMTA 4QFDA 4YCDA 5JCZA 4DC0A 1H4QA 4LCJA 3PTAA 1YONA 2VNHA 3CQ9A 3PK0A 5HKKD 1UK6A 3WQSB 3O8QA 5ICSA 1Z2PX 4MQFB 1OCEA 4R7ZA 2GFHA 2SNIE 5AD1A 2X5JO 2YBDA 3I45A 1EZ4A 2EIHA 1E92A 2BW0A 1SPXA 3JAMA 1QX4A 1SA0A 2HU7A 5JAHA 2JI9A 5CD9A 1U0RA 1M2OA 2XMBA 3LC1O 1Q0ZA 3VJMA 5K20A 2PVPA 1EVKA 2DWCA 3FYUA 4DMUB 1C8KA 1BE8A 5EJMA 4F1WA 1BFUA 4XDZA 1Y4UA 1HDRA 3FTPA 4LJLA 4WADA 1P7VA 3GFVA 3H2SA 4W1SA 4RKFA 5I8ZA 1QK3A 1JTFA 1O5IA 3CFYA 1R88A 2B0JA 3U7RA 3NIDB 4BU0A 1MEEA 2J87A 4I50A 1F1JA 1PZEA 2SECE 5KSOA 4TKVB 2A92A 4L0MA 4AICA 2AYZA 3DKPA 3ZU4A 2QJTA 2WIKA 1OZ0A 1XRLA 2I3AA 4HHEA 5ENVA 1L5VA 1JXMA 1B8OA 1CS0B 1MAWA 2R68A 5BSKA 4XJXA 2Z5LA 2NZ8A 2WJVA 3TZHA 4QVKA 3TCNA 3L0IB 4YB8A 2GJ4A 2YVQA 1CXZA 1T1JA 3DYVA 3E82A 3IX7A 4G1VA 4UPVA 3M0EA 4BAGA 4R1MA 1P0MA 3U4MA 3ELWA 3K35A 1CDZA 2GBLA 4FFOA 3BT7A 3OPQA 3WL3A 1E0SA 3T7AA 1O8CA 4QBTA 3WQBA 1UBGA 3GOQA 1KAMA 3I2GA 1N2EA 1X7ZA 4I1SA 5FBQB 4IX1A 3ZWAA 1VCHA 2WD8A 3FWYA 3RYIA 3BRWA 1Z0UA 3HCAA 1T3SA 2Q2NA 5FAXA 2IXEA 5TJHA 4FYJA 3ZE9A 4AJNA 4DR2B 3D7LA 4AJJA 3HKBB 3ORSA 4RD4A 1P0QA 3RTAA 2GXQA 3N5CA 3DQQA 4M1KA 5H0IA 3P9QA 3DL7A 3A2MA 1N5RA 2A5DA 3WLFA 3VO8A 4C7VA 4EYQA 3GROA 1O97D 3GDFA 4QOHA 2FCRA 3STWA 1YO6A 2VWHA 4CE6A 5DGIA 2EDAA 2AQ8A 3L0DA 2A0UA 4HAVA 4D8YA 4KPEC 1FX0A 3E9NA 3EOBI 4IXNA 621PA 3O8BA 2VXYA 3NFYA 4TRNA 3CO5A 2I87A 1L4UA 1WZEA 4LHXA 3TJMA 5JJ5A 2G09A 1K68A 5J59A 1TL7C 1CHDA 5FUMA 1FBNA 4Q24A 3WLAA 3KCQA 1IOLA 4XGIA 1YULA 2IIVA 3EJWA 4FZVA 3TO5A 1NQAO 3CLTC 3QUBA 2QZ9A 4MUNA 3E03A 1GFWA 2UZ4A 1B74A 3V3TA 3GC6A 3H2BA 3H99A 3OIFA 3A10A 5IZ4A 2BFNA 2I3BA 5ICEA 1JKXA 3FJ1A 3RYCB 3EVDA 2JRCA 3NDIA 3STYA 5KCZA 1C9YA 5KYUA 5C32A 5HSGA 1R0BA 1VHDA 3GRYA 1S9DA 3N0WA 4LDPA 4R2IA 5AVXA 1N0HA 1NQUA 2IU4A 4UBJA 5IJXA 3NHMA 3LLMA 4FYVA 3UJ3X 2A0WA 2HFJA 3OUZA 2C99A 2D0IA 1K86A 1E20A 3WGOA 1N6NA 2R6GA 5EZYF 1QP8A 2B20A 2BHLA 2R47A 3C7CB 4MTCA 4RJIA 3C7TA 2HA2A 5C31A 4AN4A 4YAUA 1IY2A 1TYCA 4CIWA 1UDAA 1EBBA 1G8HA 1TM7E 2QVXX 4O3FA 5GZ6A 1F2DA 2IVFA 5J2TB 3LUKA 1NLUA 3OEWA 2EGUA 2VTVA 4DWVA 2DULA 3AKYA 2G1KA 1KO4A 2H0QA 5CT4A 2EFEB 1O6ZA 3WBKA 2PBZA 3HGTA 3NNNA 4M89A 4K1XA 1WXIA 4CM1A 5BSFA 1TPYA 2C7GA 4RKEA 5KSZA 4I6GA 5C8XA 3T4XA 3WXMA 3HXTA 2VAWA 3D2AA 4I8IA 5JW6A 4OX9B 3FUWA 4R7GA 2QV7A 3C39A 3K9GA 5B53A 2FR0A 4ZEMA 1CQWA 4Z3DA 1G3IA 3R0IA 4RDXA 1T35A 4WN3A 4HPWA 2IYQA 1YQ9A 2YVLA 2GEUA 1WX1A 1A2KC 3ZDBA 2PV7A 3GK3A 2QLLA 3I8OA 1JHXA 2BFWA 3CC8A 5T57A 1YCGA 2W6OA 4L8FA 1RD4A 1J07A 3IAFA 3Q85A 3QEKA 4G5FA 1IOVA 2PKRA 2AJTA 2O8NA 3QXHA 2BMAA 1N4DA 4UFPA 2HSWA 2WUWE 3KHKA 4CKXA 2GJ9A 5E7MA 3N6VA 1XN4A 5KTKA 1KO1A 4PQEA 1YD7A 2DWUA 1UDBA 1IVSA 1T6ZA 4PS0A 4B31A 2DFVA 2N9UA 3H04A 3T3HA 1ICEA 4QEKA 4H1HA 1XZPA 1X92A 2I62A 4QPZA 5CT8A 1UMCB 3QYPA 3G5MA 4WNCA 1THGA 4HNTA 2BY4A 5HOEA 2NXCA 3JR7A 3IQFA 4U9UA 2VQDA 3STUA 3U3MA 3WWDA 3PXGA 4YUXA 4ZCPA 4D3ZA 1QO9A 1W8IA 1Q0QA 2PMFA 4NCNA 4TL6A 3V00A 2PFGA 3GEMA 1I5RA 2QN2A 1T6XA 4HGQA 1PQYA 4KIFA 4PO8A 4IIJA 3AJAA 4BMSA 4S35A 2XZOA 3DQZA 6GPBA 1FDWA 3P0FA 4MPJA 4FMDB 4HDNB 2F7SA 5M5BA 2WWIA 1P0IA 1P19A 3GEIA 2FZGA 4HLUA 1FMFA 1YHZA 3MS7A 2OCPA 4GX2A 2AVNA 1CR2A 1TMGE 3RKUA 4EB8A 3LDHA 4WNAB 4EUEA 1RVDA 2DC1A 2PXXA 5CFZA 2C4NA 3CT6A 3H9CA 1ZNXA 4NENA 5AJYA 1R7RA 4GPZA 3SLRA 1UBOS 1PR0A 2ZLBA 3LP5A 4W9MC 1QFMA 5ALXA 5JNLA 5A7GA 4MWBA 5B12A 3FPEA 5LL6P 2TMYA 4EX6A 1K3UB 1COWA 1FEZA 2QNRA 3HB7A 4IO0A 4ZQIA 4A0GA 2H1LA 3L0OA 4BNYA 4HNAB 1ENYA 2V97A 1YR1A 3HPQA 2AEMA 4FYXA 2V6GA 1Y9JA 1GTMA 2I7TA 5I9MA 4I1OA 3IUPA 4FJ2A 4NE2A 3KKZA 1HNNA 1MDBA 1URPA 4LNAA 1UC8A 4J0CA 1XCMA 1T5IA 3BJEA 1C1DB 1U99A 3SYNA 2J0QA 5I9BA 1NSYA 3CKMA 4MNTA 1I0LA 2RKWA 2ZI3A 3IDFA 5CH5A 5D5HA 4DUPA 1W85B 3UTDA 3EQ9A 4DWOA 2R6ZA 1Z6TA 3W8DA 3N58A 3NG1A 5JXJA 4HEA1 1XTSA 3U1BA 1OIXA 2ORYA 3GFPA 1E2UA 2HMWA 1F5SA 3C1TA 3WJ7A 4BNJA 3MTGA 4MUGA 4ND8A 1GZ4A 1MUUA 1PI3A 1D6NA 1T9BA 2QTCA 4S2UA 4BRZA 2KWIA 3BK7A 3C6XA 3BCRA 1KBZA 1DAGA 2OD2A 3NB0A 4CQMA 4ZKEA 2MMGA 5J3JA 2I4MA 4QGBA 3TQSA 4NCJA 3RQIA 4NDAA 3CWZA 5A06A 3UAZA 4IKOA 1DS6A 1PJ3A 1OZFA 1OV6A 3DG9A 2ILTA 4V1CB 1K6IA 1NM5C 2I65A 1U2GA 2MTBA 1TZCA 4IIFA 4XSHA 3UB3A 3VC2A 4DQ0A 5JY1A 2ZJ4A 2G0AA 5ECDA 2HEIA 2VDPB 1XTKA 4IILA 2E4WA 4PNZA 1PR3A 3KKLA 5EEGA 4DNQA 2F9FA 3B6KA 1POWA 3G85A 3H2ZA 4OSPA 3LUHA 3RWOA 4EY3A 1I36A 5LXTB 2UYGA 3IJPA 2YC4C 5CRIA 2VO1A 3ESZA 5K3BA 9MHTA 1UFQA 5JH7B 1LVUA 4GI7A 1A77A 4LGVA 5G41A 4C0WA 4NV1A 4GPD1 3N28A 4S12A 1T9ZA 1P31A 1U9CA 3GRFA 1MAVA 3NXKA 3RSLA 1KI1A 3BXEA 1X19A 2NIPA 4FYHA 4WK4B 1MU0A 5J63A 4EB0A 3F5DA 4GX5A 2V7VA 3FNFA 2JFOA 1MEOA 2G71A 1GCGA 2HNAA 3IHLA 3SC6A 3BRSA 1UIRA 4BVEA 2JFVA 1KWKA 3NC1C 4N18A 1KPIA 1QIEA 3D2CA 3L3BA 1E2LA 1KC3A 2P75A 2ZRKA 3GVPA 2X4DA 1RCFA 1PR6A 2H8KA 2P4UA 4KPGA 4MP3A 3W7BA 3ZWYA 4FYWA 1SHJA 3GJ8A 4B83A 3X1XA 1QK4A 1ZHFA 5FR2A 1N33B 3ISTA 4LQDA 4NU0A 4RZUA 4CDMA 3WL5A 4LY9A 1D04A 1H1DA 3A2LA 1IDOA 1T43A 1KC1A 3KZNA 4NICA 3IJRA 3A6DA 4M1WA 3AUTA 4Q7EA 4XYEA 4A8JB 4RTQA 4LY0A 4LZAA 1OXUA 2H65A 1QF9A 1RKQA 1XRNA 2OL4A 1DLJA 1Y3CE 3FIJA 2HU2A 4TKUA 1IPFA 1FFXB 2FLVA 3GGPA 3DOHA 4Q6BA 5BW4A 1NATA 2R4TA 1U7HA 3Q11A 1J42A 1EXMA 4Y6LA 4G84A 3TF5A 2BZ0A 1UOQA 4JDPA 3U7EB 4DLZA 4B40A 3PB3A 3JQRA 3H5RA 5I9LA 2VTEA 4F4DA 3E1KA 5IUNC 4LF5B 3BD9A 3UA4A 2HHHB 3CJQA 3M34A 1UP4A 2QN8A 2WY2D 3RD5A 4D80A 1VHQA 2PQ6A 4C3ZA 5C1DA 2PL5A 5TPWA 2Z8ZA 1UKVY 4ATNA 5C80A 2PLNA 5JSFA 2HMVA 4F9GA 4H7KA 1XZHA 4WZ6A 3TJRA 1P33A 5LOVA 1TTPB 3RAJA 3D3EA 4ENSA 1XAIA 3QEMA 3HR8A 1WW2A 5B3JC 1Y4AE 1KTIA 2C9ZA 2YX1A 1QRSA 1H2FA 2VS1A 3B8EA 1R10A 2HDNB 3W2FA 1H8ED 3U81A 2HUPA 1U6JA 2D1TA 3CRRA 1XC7A 3NKLA 4LX0A 4XIIA 2G9ZA 4BJ1A 1U0HC 2AMVA 4NYJQ 4E5VA 5L4SA 3C1OA 4RNCA 4NXMB 4F1KA 2FG5A 3GZJA 4E1VA 4EKNB 5J4YA 4NMXB 2Z2IA 1RR6A 3FPKA 4BV3A 4ZHQF 1AUOA 1GLVA 1PLLA 3N86A 4PLHA 4PSDA 5HUJA 1T8PA 2EZUA 4MYUA 1G21A 4PVCA 4BTVA 1U8TA 4RY8A 2X5OA 3MJRA 2NTJA 4G0YA 4QQRA 2JLWA 2WB2A 3OURA 5IHPA 3Q3CA 4NU6A 1KSFX 3ZU2A 1B2LA 3KKKA 3U9SA 2LR0A 1XTJA 4M1EA 4P4GA 1ESDA 3RSHA 5LBTA 1KIAA 5EJIA 2NT4A 3F3YA 3OP1A 1L3CA 4C05A 3WAGA 3ZV5A 1B6GA 2JFPA 3SOPA 1II0A 1W4AA 5DMXA 1PYOA 4PM4A 3C3EA 1E5LA 4ZEXA 2PUBA 3UPTA 3UNXA 1GZDA 1ZGZA 3M4YA 4CKZA 3RVSA 4DARA 4ICIA 2HJHA 4EKIA 1TCAA 3W5CA 1Z0FA 4U2GA 4FC7A 4DEVA 1PZHA 2VSFA 1TGYA 2PE5A 3DO5A 3UMMA 1ILEA 4OBBA 4B0PA 1VLZA 4DJ5X 1E98A 1IHUA 1FNSA 2JI6A 4RIHA 2EG5A 4UUNA 5KKNB 4GKKB 1PNRA 3DMDA 4HAOA 3IC5A 3PEUA 2IV2X 1SKQA 2ZI5A 3PPXA 3OPVA 4B8YA 3A4MA 1SJ9A 2XUAA 2YXLA 1KY5A 1TNDA 4PZZA 3WWEA 1YR8A 2OCLA 4L8GA 3PC6A 4KX3A 1IQRA 3PPVA 2XXAB 4DY4A 2HY7A 4TWRA 1SXJD 5T41A 2XA2A 2D3TA 4B3JA 2VHCA 3M70A 1O58A 1C2TA 1V9CA 2M98A 4IDOA 4Y2GA 4YDHB 2Q3HA 3F7OA 3MYYA 3R7FA 3ELDA 5A9SA 1K3FA 3LK7A 1J0DA 2D2XA 4G0XA 2JCXA 2CLFB 1DT5A 3PLRA 4N1AA 5DWQA 3RHSA 5DPMA 1F2VA 4QDXA 4PIMA 4JT2A 2QD5A 5M29A 2X3YA 1JQAA 4FNGA 4H7IA 4RHCA 2LWIA 3I42A 3AK4A 1W87A 3D64A 3NTLA 4Z86A 5BQPA 1A8SA 4LRXA 1PK8A 2VWPA 3FNHA 3AJEA 3IB3A 5KQRA 3BDIA 2QTWB 1NVFA 1Z7WA 3EG9A 1HR0B 3LFHA 1DU4A 1USKA 1XP5A 2QI9F 3D7MA 3A25A 4L2IB 4UQOA 2RGXA 2Y1GA 3OOWA 3JZMA 1OPXA 4C7OB 2C8LA 4JMPA 3AUSA 3HA5A 3BDVA 2A84A 2BSAA 5I6DA 4B32A 2P9JA 4HG2A 3S1AA 3ZYZA 3L7AA 1DQSA 1US8A 4GEKA 2Q1TA 3IE2A 4O4HB 3BJIC 4V1CA 5KU7A 2GILA 2JFGA 2YNMC 3QBDA 2VHZA 1HRKA 5FPKA 1WHSB 4TMWA 3GLGB 4LXYA 4Y8VA 3CHYA 3HBAA 5JSYA 4C9BA 5BNFA 1RYYA 1RXYA 1JNYA 3LLVA 4WNIA 3W2IA 3C98A 3QE9Y 1MH1A 3D2LA 4AF6A 2RBKA 1WR8A 3N07A 5K9ZA 2V6MA 3L1HA 3H1BA 4DT1B 1ISGA 3FVRA 2VJCA 4B85A 4F2PA 1KBOA 1P8AA 3D0OA 4C7MA 3GFTA 3QFSA 4ZO6A 4C6HA 4JKIA 5HOQA 5JRZA 3THWA 1SELA 2QLFA 1H0KA 3ZOKA 4UHFA 4HDRB 3ZE7A 4C29A 3SJCA 4GHWA 4P86A 2WVAA 1YZHA 3HBMA 4UEOA 1RQ7A 4RAQA 2WVGA 4C08A 4BQNA 2JRLA 3AM4A 4EFNA 4GP9A 3GPLA 1TDJA 2O3TA 2WF5A 4V0QA 1QBKC 1VJGA 3LI2A 3L8MA 2CV0A 1ORVA 5KWVA 4OHPA 2CKDA 3AJ8A 3X0DA 5B4UA 4OI0A 1NVXQ 4RGVA 4EFMA 1XDDA 4K1LA 1O77A 4P0PB 1Y5IA 4MUEA 2WU1A 1XYVA 2WAOA 5JCXA 2P6MA 1H05A 3PYMA 2M1XA 2FOIA 3PVZA 3OY2A 4KACA 4Z54A 4DV1B 2I76A 3EGWA 2OCXA 2IEDA 5F9HA 4XKJA 2ZYTX 1NTRA 3R3YA 4JEIA 4OJTA 4RSRA 2YRFA 3OCUA 1YNSA 1JFFA 3IUQA 4MULA 5JT1A 1X1TA 2WTMA 4YJ3A 3ZKWA 6REQA 3C8HA 4BNZA 1NHWA 4BAZA 4D0RA 1NM5A 1YHNA 2P79A 4OHRA 3WYGA 4MGZR 1OH6A 1L5SA 2A78A 2JBHA 1E1RD 1HWYA 2ZJZA 1QKJA 2B9EA 3BFKA 4RO0A 5I45A 1XU4A 5K01A 3H16A 4A5OA 5LLDA 4UVIA 1NBWB 2E37A 2P5TB 2VBIA 5GGYA 1WBDA 2RIRA 5E4TA 5HE9A 4TRJA 3ZUPA 1JLSA 2V03A 1PO7A 1QHHA 2QTHA 2R8BA 3PRKE 1LW6E 4MQ4A 5EZ5A 5D7BA 2D7CA 2Z5VA 3VH1A 1U3CA 4OHZA 1PF7E 2AC7A 3UOGA 1U0TA 3QBTA 1KYWA 3CF0A 4QICA 2DR3A 3K09C 1YBVA 3UHOA 2IPLA 5JYBA 1X42A 3EUAA 1RRKA 1DBSA 3BGVA 2ZIZA 4DCVA 4URYR 1UMKA 5CT6A 3IB6A 1OMOA 4PICA 2R86A 4R69A 3R4VA 3KTAA 4Y0VA 3NM6B 4RV4A 2XGOA 1W88B 4RHYA 4RGBA 2VHWA 2FEWB 2XKBA 4IIUA 4M9ZA 1EH5A 1XTIA 3QBVA 3KQKA 2PR7A 3E1GA 1HXHA 4Y9DA 1OY1A 4KNVA 3PTLA 2XDAA 3TR0A 4YJFB 1V11A 5EKUA 3V33A 3VAYA 4XQEA 4CMBA 1NVBA 3P32A 4ZHSA 4G0UA 5FHQA 1NOJA 3UANA 3HJUA 3IEXA 4QQNA 3DHYA 2FJ0A 4K26A 4KMMA 1NXPA 2DKOA 3DLIA 1YNOA 3A6KA 1TF2A 5IT9A 1EWTA 3H42B 2I6GA 2PZLA 4RVOA 4JASB 1RI3A 4PSKA 3UKOA 1BE6A 2MWMA 1SCIA 2ZUWA 3OIDA 4R2HA 4Z7JA 4PPFA 2CHEA 4MA5A 3VNQA 4AJLA 2J4FA 2PD3A 3TLJA 1MBZA 1SBNE 1R0XA 1NKSA 2OENG 1QIGA 2M6LA 2OXIA 3K0FB 1ADYA 1P9OA 1RBQA 2BGJA 1Q19A 2PRIA 3C5EA 3EHEA 3KYDA 2XE7A 3FWHA 3S44A 4NEHB 2H1IA 1KTVA 1XG5A 3DL2A 1W35A 1O9GA 2H7VA 3W8FA 3W04A 1E9RA 1PFWA 2P0EA 4IDGA 4Z1OA 4S24A 4PGHA 1YL6A 2HT6A 1QGZA 2R44A 3CNOA 1THZA 1P2UA 1Q84A 5GV8A 1W36B 2PAAA 3UGTA 4HWPA 5B3KA 4RSGA 2Y9MB 5KINB 3OT1A 1Q95A 3GD7A 5DNEA 5KYUB 1DXYA 1FRVA 3OLWA 2WD7A 2GX6A 1L4HA 1GYRA 1W73A 4ZCMA 2RGNA 1V96A 1OX4B 2HQBA 5CVEA 3WGIA 5CGZA 2OORC 7YASA 3L4KA 3BREA 4AY6A 1N5DA 3HH8A 3V8PA 5ALNA 5IVPA 2DUWA 4DTIA 4LF4B 1J24A 4KAJA 1DC4A 4LNHA 1MJFA 3U7FB 4A6XA 3NU1A 2R66A 4IYJA 4QSMA 3UPUA 4JUAA 4JLPA 1GTZA 4I4TB 5EHIA 3EXFB 1EFPA 3FZGA 4YUWA 5DYWA 4YMUA 3HP7A 1GT91 1L7XA 4H6WA 5DF1A 1GPDG 3Q72A 4MUFA 4ZV9A 1LTHR 4G26A 4S0XA 5F4BA 1KH1A 3ZGLA 4YQYA 5KOHB 1E4YA 3HYCA 2H57A 4HSGA 5C8YA 3NTUA 4E09A 2PGNA 4WIAA 4S05A 5ER9A 2BF4A 4IGKA 1P5JA 1U7PA 4US0R 4B6OA 4AYWA 1FIUA 2EBUA 3ANMA 2JEOA 3BIJA 1CUFA 3KL4A 3DONA 1PVOA 2YUIA 1JE0A 5LIRA 2NU6A 3W6UA 2RI0A 2RGAA 2DHQA 2HK7A 2P41A 5CW2A 3ZDEA 1Z8FA 2XRYA 4ETIA 3ZIUA 3QH4A 4EQ6A 1M5TA 1LWNA 1E2FA 1QZZA 2XVYA 1TQ4A 3UJ9A 4OLAA 2IYZA 3FCXA 821PA 1IZ9A 1E2GA 3I76A 4MR8A 4N5LA 1KKLA 2FYTA 1CDEA 4XFKA 2XOXA 1C3OA 5LQDA 4MJ3A 1DGQA 3ASUA 1PV4A 5JQGB 2Q6OA 2Z08A 2ANBA 3GL9A 3FFTA 3QV2A 3EZGA 3WB0A 2WIGA 2CWWA 1R4NB 2BUBA 4HMQA 3SGLA 3ZCXA 1JYSA 3SC2B 3SEFA 2WYOA 4UPEA 3HVRA 5TQ0B 1DG1G 1HT3A 2IY7A 2C4WA 2C2XA 2O14A 1T8YA 3DKKA 3WQHA 4BEBA 4FDVA 3TTSA 1DQYA 3HV0A 4WI1A 3ZE1B 3UG6A 5AVZA 3NC4A 1C9KA 5MN4A 1VLQA 4OKSA 1IE3A 4PQGA 1G8YA 1YQGA 2PIAA 2XY4A 3G0OA 3H1TA 4HRYA 4PX9A 3NHZA 1A9SA 4B3IA 4GECA 4DMHA 4LNUA 1JR4A 3GT7A 1Q74A 4IUBS 3RH0A 1F60A 3K53A 5H83A 3WOVA 4FN5A 4WECA 4BUCA 3DL4A 1RYFA 3DPUA 2FMFA 3QBEA 4N8DA 1WBBA 3IEPA 4WVLA 3QQPA 1GRQA 4LDRA 4EECA 3FGOA 2INGX 4WA8A 2UZ0A 1Z8NA 5F52A 4BZWA 1TGVA 4GOLD 4URHA 3KQQA 4FP9A 3OT4A 5ALOA 1I2MA 1QE5A 1FRFS 4FD3A 5IYZF 3V34A 3G2KA 3PITA 4J90A 4NNJA 1LBEA 3BGIA 1N2IA 3DFIA 1EDDA 4N0EA 3I1FA 4DM7A 4FWTA 4Z7OB 1S1MA 1OKKA 2PAFA 1N2GA 3K1AA 1J6UA 1XJQA 2A9VA 4LZOA 4N41A 1IB0A 1IZ7A 4RH1A 2QJRA 2IOQA 1IG3A 1JR3D 4J2HA 2Y1DA 3UKDA 5HKAA 3EGOA 3ITNA 3KB8A 4TSRA 3DZDA 3HO1A 1BWRA 3GGCA 4HGOA 4L9SA 3EPLA 1LDMA 2KQUA 1PV2A 1TE2A 1I1HA 2OG1A 1W36D 5CLQA 5D87A 4KQGA 1OT5A 3TSCA 4BQRA 1IN8A 5IN5A 1C2YA 2VF2A 4TXNA 1ADJA 3LLCA 4I81A 1QGYA 3UWPA 1XBTA 4E2WA 3U56A 3CEPB 4I36A 4YLYA 4K9NA 5IRCD 5EE3A 1JEQB 4UEQA 1WUJS 5LD2C 4INAA 2O7VA 1Q15A 4P3NA 1RJDA 1SIWA 2GERA 3MXOA 2J5KA 3QPDA 5E2BA 3P8ZA 1EXWA 4TKLA 5EQDA 5FD8A 5BYAA 1NBAA 1WKCA 3FX2A 1I6KA 1ISRA 1M8KA 1RRFA 2WU8A 3G9QA 3OJOA 3SM3A 1P3DA 3QVUA 1RWBA 4B79A 1NRJB 3CSUA 3KJXA 5DN9A 2X13A 3TLYA 5DT2A 4YY3B 1OTXA 3TYXA 3ZNNA 3HDYA 2E1PA 1GSIA 4QIHA 1ZBQA 5DYGA 3RUFA 5JD4A 3BA1A 2Z56A 1YS9A 2I4OA 4R1PA 4BLWA 4DNXA 3QLUC 4B7XA 4AZTA 1DBVO 2COKA 3FW1A 2PLFA 4HFRA 3MPUA 5J2TF 3SLGA 1L7PA 1KOFA 5JFGA 3QENA 2BF7A 3IT3A 3NBKA 2DLCX 4ZICA 4FYKA 1HM5A 2H1WA 1J2JA 3OQPA 4GI2A 5KX5A