3CWCA

Crystal structure of putative glycerate kinase 2 from salmonella typhimurium lt2
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
381
structure length
369
Chain Sequence
AMKIVIAPDSYKESLSALEVATAIEQGFREIWPDADYLKLPLADGGEGTVEAMVEATAGRIVHVEVTGPLGHRVNAFYGLSGDARSAFIEMAAASGLEQVPPAQRDPLKTTSWGTGELIRHALDAGVEHIIIGIGGSATNDGGAGMVQALGARLRDAQGNDIAQGGIGLETLASIDISGLDKRLSACHIEVACDVTNPLTGKEGASAVFGPQKGATPEMIERLDTALTRYAHLIARDLHVDVLDLAGGGAAGGMGAALYAFCGAQLRRGIEIVTDALHLEACLADADLVITGEGRIDSGKVPIGVANIAKRYNKPVIGIAGSLTHGLDAVFSVIYTICTLEDALKNASENVRMTARNVAATLKAGQQLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative glycerate kinase 2
publication title X-ray crystal structure of putative glycerate kinase 2 from Salmonella typhimurium LT2.
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium str. lt2
total genus 110
structure length 369
sequence length 381
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02595 Gly_kinase Glycerate kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10350 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycerate kinase; domain 1 3cwcA01
3.90.1510.10 Alpha Beta Alpha-Beta Complex Glycerate kinase, domain 2 Glycerate kinase, domain 2 3cwcA02
3CWCA 1TO6A
chains in the Genus database with same CATH superfamily
3RC3A 2ZSEA 4EJSB 1IM8A 3ITNA 4U7WA 1ISMA 1J0CA 2G9ZA 5EIHA 5F2NA 4QPCA 5HUJA 4JSRA 4ER7A 2BMWA 2HCJB 2IEDA 5AW9A 1DKOA 1M2HA 4ITUA 2XGJA 3ZW9A 3RU7A 1FYEA 1H6CA 1J2YA 1GPJA 2CYAA 1E0SA 5DHTA 3WICA 2ZB7A 3LQRA 4KQXA 3IBSA 4BAZA 2F1HA 1GHTA 3T3GA 3FYDA 2DHRA 4DHWA 4EPYA 3CNNA 4PN7A 4Y8VA 1CY0A 3JALA 1ZUNB 4YT4A 4YUVA 1SCUB 1XNJA 2OC4A 4FZJA 3Q8MA 4I6JA 2VF4X 1Q83A 4XB2A 4AMGA 1AZLA 2IP1A 1ZD4A 4WLVA 1VPTA 3UJ7A 1K7XB 4GBGA 5KEIA 2P3OA 2JJYA 2ZSDA 5EE0A 4LV5B 3CSSA 2R4QA 1L7EA 1PK9A 1UOEA 4QECA 2XWJI 3E8XA 4GPAA 3U4MA 2WILA 3L7NA 4B2YA 4HWRA 4JP2A 1QVRA 4LTDA 2WF5A 4ALMA 4EEXA 2ECFA 3P9KA 5E8JA 5BOVA 5AKGA 2MYPA 4H3KB 4JFAA 3FA2A 2VNHA 4X90A 1YDHA 3AY7A 1KYQA 3G2IA 5K0GA 3F5MA 1DC3A 3O7MA 4C6RA 3STWA 3I2GA 1ZUD1 1ST2A 4E11A 3A58B 1NMQA 1GAXA 1KDRA 1KZ9A 1GU0A 4LOLA 2AFVA 4UPEA 3RFTA 3QK7A 5FI0B 4HP8A 1PL0A 3PDIB 4CF7A 4K28A 2AG6A 2CHUA 2ECKA 2I6TA 3L04A 4JN6B 5CRIA 5FWNA 2G7ZA 3ABSB 1G6KA 3BMCB 2BI7A 3T3DA 2I91A 3QE4A 3L0PA 4FMDB 5K0NA 4GAEA 1H5NA 2H52A 2PG3A 2X0IA 3G1UA 1M2EA 4KIWA 4Q9IA 1TLTA 5BSUA 1KI9A 3ELBA 4UNIA 1L5SA 4BBZA 1KEEA 1W29A 1P61B 4Q1CA 2GBLC 4HI0E 2OPBA 3SHOA 3E9RA 2MYNA 1WF6A 2IXFA 2W48A 1S2DA 2B6HA 2QU8A 3IERA 1OUMA 2JFNA 5E7QA 3ZIAD 1YTUA 2GLUA 2OVFA 4E03A 1FP2A 1OX5A 1GILA 1ZBDA 5AD1A 4PAQA 1RQNA 3MQ4A 4YUAA 3VAAA 1RD4A 5E1BA 4F2DA 2Z3VA 5BN4A 1IPFA 3VVLA 1CUCA 5KO2A 4YHBA 4QQFA 2F9LA 4X7RA 1YZUA 1W35A 4GMHA 1SH7A 3WGNA 4ROSA 2WYOA 3LGAA 5EKTA 3KKZA 3TSCA 1OV6A 3NYRA 2YWFA 4NG5A 1G4HA 2CK3A 4B4VA 4MJ3A 4PPNA 4HMQA 4MR7A 2D00A 1E3IA 1VA4A 1IEXA 5C7OO 2A3RA 3BB4A 5FWYB 4JI3B 2WYUA 1ML4A 1PQ4A 4KACA 3EC1A 3RS9A 2D2IA 1N8NA 3OFKA 5I51A 3SWWA 1FJGB 4JQCA 4LJYA 3LD9A 3CVWA 2Z2KA 4ESVA 1Z3CA 2PSFA 1O6BA 2YX1A 1PGOA 3BORA 3EVFA 1H0KA 1WXFA 4TSFA 2G70A 3RTEA 3SOPA 2PR7A 4R8RA 3UT5A 5HRAA 1G59A 1A3CA 3ZK8A 3E3AA 3KKNA 2Y8EA 2JI6A 3V2IA 1EUCA 2RHTA 2RH5A 2HWXA 1EHCA 2V6GA 3JS5A 3WYCA 4C4SA 3ROQA 3JV7A 3SE7A 4EHDA 5AW3A 4DM3A 5EHNA 2I54A 3VNRA 3WQHA 2IU6A 1RM5A 4H4CA 4CW7A 1IZZA 4FGJA 3FPSA 3IAFA 4CMIB 1PYDA 2OVBA 5C53B 1WZIA 2BKAA 4NICA 2I4TA 3ZZ0A 2PVPA 4DSOA 2HRBA 3BJMA 3MJ4A 1QOZA 4K6FA 3M89A 5FJIA 2XHEA 3L1VA 1T2VA 4MH0R 3ML1A 1QORA 3VNUA 2AF3C 3W1EA 2V4ZA 1FTGA 4NYIQ 3N3AC 4CODB 2ID4A 5ENDA 3SJCA 4TL9A 2EFDB 4CKCA 4EG7A 2YW2A 3CYFA 4NP6A 3MCAA 4BFLA 3NHAA 4DJFC 3OJEA 1QH1A 2VNAA 1SKYE 1HE2A 5IYZF 3AW8A 3HVJA 3OPXA 1H5UA 3UH1A 1U8ZA 5GAJA 1NOJA 2R0QC 4G1FA 4J91A 3TDNA 2PZFA 1T5BA 2P68A 1L1QA 1DXHA 4QQNA 1WCV1 1UKBA 1GP2A 4C1NA 3AONB 1EFVA 3HCBA 2WVGA 1K08A 3GBVA 2L17A 2OUKA 3D2CA 1Y1KE 1QV9A 1GQOA 1S02A 3AV0B 4OBWA 4CMGA 5JSKA 5C5CA 5EZSA 4N47A 3Q8KA 1NYLA 1VG8A 4W5OA 3DDWA 2R8ZA 1L3CA 1P3DA 1HT2E 4GYWA 4CGZA 4KFCA 5HDQA 1H66A 1HORA 3DW1X 1SZCA 3CH5A 1E7YA 3JQRA 3GFRA 5EXTA 1IOZA 3NFYA 4ID3A 5IU6A 1N2ZA 1TUGA 2HA4A 3BMQA 4X8OA 2CEKA 2Z4RA 1P7CA 3IP7A 4J0DA 4NE7A 1TA0A 4HF7A 2GTHA 3IB3A 5E8RA 1G1MA 2CXQA 2PAAA 2YJGA 1P72A 4L4ZA 1R6TA 1UIMA 2IVZA 1VYTA 4PGMA 4M1MA 1PWZA 3BMOB 1C7FA 1L4NA 3O4HA 2VTBA 2YWEA 3QKRB 4L85A 1JE0A 4BRWA 1OU4A 1R4MB 3ZUPA 2ORED 3R23A 5BN5B 2QROA 2BLLA 3AM4A 2P9ZA 4RZ3A 1BJRE 4CCWA 1XCPA 4QWMA 4F12A 4TKZA 2Q6OA 3II6X 4BMYA 2GGSA 3EODA 3P52A 4M37A 1JEYB 1OXTA 2QNIA 4UJ3A 4E22A 5BQXA 3RUIA 5IVPA 3BDIA 3T1YB 1MIOA 1S2OA 3PVSA 1R0XA 4BB6A 3KB8A 1EDBA 2R7NA 2NUTA 3ZCRA 4ZDJA 1HRKA 1B7GO 2ZIZA 4KSBA 3X43A 4MZDA 4C7OB 4WHMA 1WPQA 5I4BA 4A6PA 3B53X 4EW2A 3W9UA 3ZGVA 2KLHA 3SD7A 4EIWA 3O21A 3LHSA 2OHFA 5DLPA 1TUBA 1Y8QA 2DULA 2JI9A 3DEYX 3KSUA 4RQTA 1JDBB 4FEYA 4RZ2A 3RVJA 1GAQA 5C3MA 4G26A 1QIHA 2Q3EA 2HCFA 1H4TA 1EFRD 1J6UA 1E2FA 2DPLA 2HHCA 4PAWA 4UW9A 2VRBA 5ALGA 3VO2A 3VUEA 6AT1A 4W9MC 4LJLA 1RPAA 3OMXA 5F1KA 2JAQA 4C3OB 2J7PD 4C6HA 5M5BA 3VJLA 4MV6A 3R0VA 5T4BA 1YR1A 3I2FA 3IRVA 3KPVA 1D7AA 2QMEA 2I2BA 4U2CA 2RBEA 4TXHA 2O8FA 2FWBA 1JXOA 2IELA 5SZKB 4F3RA 4JI0B 1PTKA 2I22A 2Q2QA 1TQ4A 1SC1A 4JUAA 4DMLA 2Y0PA 4RA9A 5EYPA 1ZL0A 3ENZA 1TQ6A 1RCUA 1U1CA 4YIHA 1N36B 1B8PA 4O5OA 3ASYA 5EFZA 4KCGA 1OI2A 1RMYA 2FLKA 2RBKA 4QYSA 5EJ8A 5B7GA 1H4SA 3OAAD 2D5CA 2VAXA 3K6RA 3PSHA 3N53A 4EFMA 4EY6A 2Q1XA 1A9OA 2V8OA 4TKVA 2CUZA 4U63A 3MS4A 2PRKA 3DL0A 4DY6A 1MF7A 5JU6A 1ECJA 5K3OA 3GWZA 5JC8A 3PFKA 1EP2B 2WG1A 1J22A 1EFPA 4D3YA 3GRZA 4NV1A 3JARB 3EFHA 1XHFA 3SBDA 1FYXA 2VSYA 3D31A 5K0EA 1DZ3A 5LZ9A 3T3OA 1J8DA 3CBQA 1V41E 1NF8A 1O6ZA 1Z4MA 2BOVA 2GBLA 3PE4A 2TYSB 3DULA 3P9SA 5F3WB 1Y6FA 2ZI5A 1W87A 2E21A 2COEA 1J00A 1M10A 2J3DA 3CMMA 4GVLA 4TYPA 3UMCA 3QLVC 2ZUSA 5HBGA 4RIGA 2FPPA 3DQPA 1XEWX 3BL5A 4KIJA 5EWJB 4F5WA 2DEUA 4CV3A 4KNYA 3F9RA 3B5JA 3P0FA 5IVIA 4CL8A 1THMA 1VKNA 4DIKA 1QUEA 1ECLA 1XZAA 4IRMA 1LRKA 1RHUA 4BFWA 5IS2A 1YHYA 4BE9A 2NIPA 3VDXA 4DF3A 3G9XA 2QZPA 4U9IS 4IIEA 8ADHA 1SD1A 2ZZKA 3B3JA 3KOYA 3LC0A 4KIGA 1JNYA 1P3JA 3VSAA 3WKCA 3GEDA 3AVQA 3EDMA 1GU1A 2QVXX 5C1IA 1EDDA 2CCJA 1FU4A 1P4RA 2JD0A 2I6XA 4DBZA 2YBEA 4HNAA 4DV2B 4GSLA 2Z5FA 2OY0A 4HVAA 4U6NA 3DOCA 5ESRA 1YT5A 5IN5A 3T4EA 4BTEA 3CLUC 4L0CA 5DT2A 2UZAA 4BMDA 1HZJA 3X0DA 3ZXXA 4DBLC 5JS6A 4CXMA 5E6RA 5KVSA 3O91A 2XBUA 1DLIA 4HDMB 5AI8A 1KXJA 2XMQA 4CIVA 1OU0A 2WT8A 4IV0A 3HYNA 4PFJA 1IN8A 2R85A 4A1FA 3H8VA 4AB1A 4BRSA 5FBZA 5AUNB 5LNK6 4NEQA 3RU3A 5CEFA 3M1LA 4D6YA 1KQFA 1QVAA 3IP8A 4QOHA 5K0LA 1I0LA 4WJLA 3U9TA 1ACMA 2QUIA 1NWHA 2AMYA 1M6VB 3QBVA 4I4TF 3IEMA 3FSJX 3HUUA 1IHYA 4OOEA 3KO8A 2BHLA 2WAXA 4RJLA 1ACJA 1VIMA 2WFLB 3N28A 2ACEA 3JAKB 3H5OA 2C97A 2HN9A 2KWIA 4XWYA 5TQ2B 4EI2A 4JGBA 1C3JA 5B4VA 4N0DA 2HA2A 3HDYA 4BVLA 3SX0A 2OLKA 4ETNA 2GNPA 1MVNA 1Y6QA 4LVCA 1CY6A 4DBLE 1OX4B 2C99A 3KX2A 1VHDA 4B8WA 1V26A 1ZPDA 2A94A 1U0GA 4WZBB 3WXMA 4M1SA 4BN4A 4C29A 3FYUA 1MX9A 3M9XA 3PBKA 4TUYB 1SOUA 1XDWA 4LY6A 4JI8B 2OHOA 2EJCA 3LC2O 2FA9A 3LPLA 2B92A 2X9GA 3DEIA 3NCTA 4WBNA 3DM5A 4MEBA 1LCIA 2ACWA 3BSWA 5ALRA 1E6UA 4IJMA 1DAGA 3PNQA 4ARSA 1U4NA 1MC8A 2N46A 1G66A 1W5FA 1WB4A 2JFXA 2W2MA 3FRJA 3MTBA 4Y6SA 1PKEA 2DQSA 3DZBA 1PZMA 3JQEA 1LBEA 2K4MA 5CGZA 5IJAA 4N6NA 3VFDA 2HMTA 2WABA 3A4TA 1TM1E 3KP1A 4A0FA 2HJRA 2WINI 1Y3DE 2HJWA 2CL5A 1PR5A 1DO2A 2BMFA 2GT1A 4LDAA 2AFIE 4CR7A 3IQIX 4GRDA 4IVPA 3U5TA 4CT4B 3R0JA 1RE1A 1NVXQ 1I8TA 4LV8B 4RK1A 3AL0C 2IIBA 4NNPA 4XARA 3ZCQA 1IU9A 4A5SA 3L6RA 2AQKA 1YR2A 3OM8A 3OOWA 2FY8A 4MINA 2V8BA 1RHRA 1QPGA 3I6IA 3NWEA 5B4UA 1G38A 1U99A 4ANFA 1UJ2A 3O2NA 1VMEA 1WDTA 3ND7A 5CNJA 3T3MB 4CIXA 4EKDA 3T5PA 1J70A 5KDLA 4C0XA 5EINA 5DWQA 1JHAA 2ODNA 3T52A 3G59A 2HBQA 1UMCB 3VMFA 5BVGA 1XNQB 1EFTA 5HIMA 3GIWA 2Z2IA 3UATA 1L6IA 2XH8A 3COZA 3NQ41 4ASUA 1F06A 4EW6A 3P5BA 1UT8A 2AI3A 4I5IA 1QRTA 3G6WA 3L93A 4MV9A 2Q5JA 4UEWA 2CUNA 4C5BA 5JO0A 1E2GA 3QSGA 5HE8A 3IR6A 1L1RA 1P29A 4CU2A 4MEJA 2OTCA 5AKHA 4DMMA 4Q24A 4DOMA 2GPNA 3JTEA 1L5WA 4GR5A 2FK8A 4NAHA 2QR5A 3JD0A 4QGBA 4BMNA 2DUMA 1QRAA 2LZ0A 4U2BA 4J1TC 3W77A 4CI9A 3SVTA 3IBFA 1I3NA 3LU1A 2RDMA 2CV0A 4LJ7A 2IPLA 4M36A 5C8YA 3WQSB 3WYFA 2D5AA 2NUPA 4C14A 4KE9A 1ZVKA 3H11B 3OVMA 5I9TA 3H9CA 5LIPA 1QK5A 5DMXA 2NSJA 5EHXA 1QZXA 3T1HB 3DAGA 3GVHA 2Y4NA 4EJMA 2VI5A 2ZRHA 4RH0A 1T4MA 5CDTA 4NYJQ 4WY5A 3MD0A 3GRFA 2X8WA 4FBGA 4FT4A 1VOTA 2FDCA 3EAFA 3SGLA 3CONA 3QBTA 1EXMA 4R0NA 5EGNA 3ED5A 2YMPA 4EVSA 3HLYA 3EJWA 3BHMA 4LECA 2P4HX 4M6WB 3KT6A 3KLNA 5H3CA 1GFSA 4HVCA 4KG7A 1EFDN 2XGOA 2CWWA 3T7EA 4RLHA 1T0UA 2JGKA 4PHHA 4MVJP 3BE8A 3MT0A 2I0FA 2OO5C 3QLVA 3L02A 1F14A 1KU6A 3EG5A 3PE6A 2Q50A 4UHKA 1OBHA 2B83A 1M75A 1RWVA 4WECA 5KAPA 4MVJD 1E32A 1UDBA 3F71A 3F5FA 2HJHA 4LE0A 5IC5A 4B40A 3ECSA 5ABPA 1YH3A 1MT0A 3IQGX 5EQJB 1YDMA 4N65A 4CMJA 1ZHFA 4D8WA 4UOZA 1Z7EA 4MS1B 2AUTA 1PJCA 4L8LA 5GY7A 1EQUA 1CRZA 4N54A 4EA9A 2UYOA 2WF8A 4HPJB 4J6FA 4HAZA 3GB9A 5FORA 3ZK9A 4OQNA 2C3PA 2WD7A 3C3BA 4YR9A 1ZIXA 3WIOA 3QVGB 5EZYA 1JAXA 1PS0A 1EVIA 3QY9A 1QP4A 3O8OB 3RB8A 3DOEA 1GL9B 2QRGA 4RNCA 4BRUA 1OB2A 5JJBA 3LGXA 3GY0A 2WOOA 4YI3A 3RBZA 2PZEA 3UT6A 1SXQA 2NYRA 3FYCA 3FRIA 4D4KA 4GLFA 2KSQA 5DGIA 3DOUA 3G3EA 1XRJA 3WWOA 1CUHA 2F2TA 1ZH0A 3WJ1A 4ZTBA 1VJDA 2CNKA 3E35A 1O6FA 5FUYA 4KR9A 2V7QA 4XTCS 2CL7X 1M8GA 5F4BA 2BAGA 3GJ3A 3CF4G 5EE1A 1EU1A 1YMQA 4OU4A 1LLQA 2PUJA 4KQ9A 4F6RB 4PG6A 1AQNA 2G1KA 2IW3A 4CIDA 2AE2A 4GOLD 3ON5A 4B73A 2PV7A 3OT1A 4YX9A 2BP7A 2UYGA 1FQJA 1PV2A 1KO4A 4LNAA 4RNDB 1ZMXA 1A9YA 4ARUA 3NBFA 1MJGA 2OWEA 1XTBA 4MSUA 1GGVA 3OEHD 5B57C 3BN3A 1HPLA 1JQJC 1QMGA 3Q0IA 2X8LA 1VLVA 1TJPB 3NHWA 1RYYA 4JQSA 3KRTA 3GAAA 1UBLS 5AI9A 4XVUA 3OP1A 4RC9A 1ZGHA 2Q5CA 4HDKB 4IW3B 1X0XA 2J0QA 521PA 2Q5QA 2X3FA 4NJMB 2YZMA 3ZS8A 2HZ7A 1E3JA 3Q2OA 3PGMA 4YALA 4G07A 4EUNA 3DOJA 3MAGA 3D7SA 2YVAA 3KLMX 2YHBA 3LX4A 2DR3A 2K5UA 3BEDA 2EWWA 3CGGA 1ZRMA 1NG1A 4O1MA 1U2ZA 5EXXA 5J40A 5C1PA 5CAEA 3AO0B 3KQLA 3EX7C 1VPVA 1ZCAA 2ORWA 4JYBA 3R3UA 3BUSA 3ZJ5A 1C9YA 2FOXA 3BICA 4CIYA 3BK1A 2LPMA 4LY9A 4FW9A 1UDCA 1NQTA 1NULA 1WDMA 2YY6A 3BFPA 3EULA 4OPMA 1E2EA 4ZYZA 5KQMA 4FN5A 2GKSA 2ZJOA 3VNQA 2G9NA 1II8B 2GN0A 1YZVA 1LS1A 4IF4A 3TOZA 1M0EA 1H9AA 3UMJA 3Q6MA 4LFBB 2XLBA 4F2GA 3GJTA 3H9GA 5CM8B 4KYIB 3ET5A 4E46A 4ZKDA 3WK7A 4BO5A 2R65A 3ZBPA 4XPZA 2QZ9A 4OFZA 5A0TA 3UN1A 2GCPA 3DEZA 1E20A 5E4TA 2WDPA 1GPAA 3BL6A 4U0KA 1PGPA 2Z5GA 5LUAA 5L53A 2F17A 1P9LA 4YJ2A 2QX8A 1EIWA 1NZFA 3O1IC 2P6NA 3JD4A 1FP4B 3V8EA 1CDEA 1QIEA 2VPIA 2CNNA 3HPQA 5HS6A 5A9SB 2O4CA 1KEVA 5KTKA 2ZUUA 4HAOA 2I1WA 1GUYA 3JQ8A 1DGQA 2H3EA 4LGCA 1OFVA 1WNFA 4RPKA 3MTEA 3PXEA 4DIEA 4ED9A 2C5BA 4DV1B 2FB9A 4B9EA 1HURA 4H6VA 1IVSA 2GZAA 2WMNB 4DIDA 2JCVA 3Q7RA 4X1YA 4DZZA 2CDCA 1KJZA 4KQ2A 5BW8A 1SG9A 2QD1A 3F1KA 4PFQA 1RQLA 4KPFC 5AW8A 4K1XA 2V6MA 4J7AA 1SCIA 1M1YE 4U9UA 3TUJC 2H2IA 3DLPX 3DPUA 4CLHA 4R2HA 1RLOA 2RGNC 2R8OA 3F74A 5FULA 3VGJA 3K1YA 4DQUA 5JISA 1AF4A 1SA0A 4URWR 4J0JA 3HB1A 3PPYA 1CB7A 1DTWA 1U0TA 4KQJA 1H1TA 2JGLA 5BNZA 3CU5A 1KYXA 5DEOA 5BXYA 5ALXA 3GT4A 1P1BA 2HRDA 2QN6A 5JMPA 1QRDA 1A8IA 4MDEA 4YAGA 2E4XA 2GKOA 4QWWA 1PU2A 1ZHHA 2Z3WA 2QAGC 3KZCA 3OE5A 1EEXB 3P2IA 4WGFA 3W5JA 4UUNA 5A6SA 4OBXA 1QHYA 4LV6A 1D1QA 2P8JA 3AFOA 4X3PA 2MT9A 4I4NA 3GUYA 5BT9A 3AVUA 1TU4A 4PX2A 4D6PA 4F84A 3ONDA 3QYJA 5LD2C 4FD2A 4HWKA 4GPIB 5KPJA 1GD1O 1KOFA 3AEUA 1J07A 1F8GA 2HAEA 1IEWA 2R751 2X1MA 1GVNB 3HRIA 2H48A 3WX0A 4D02A 4CEIB 5JZBA 1OXMA 3ZE2B 3HSYA 2OO5A 1RVDA 1ZKMA 4H17A 3KXLA 5SY9A 3O4JA 4GC5A 3AEQB 4ND7A 3CKYA 3TB6A 1B6TA 3ZHUA 4G1EB 4RTQA 1ZOOA 3QFCA 1F6BA 3FBTA 1PG2A 1WCYA 2Z4TA 4NQZA 4EB8A 1P0MA 2JFWA 1OI7A 1V8PA 3GRVA 2AVNA 1OLXA 3VNSA 2IXTA 4RD6A 2WF6A 2N42A 3FYHA 2V98A 4PQYA 4B6JA 3AWIA 1T2NA 3OZTA 4NFYA 4Z7OB 4CHGA 1WETA 3G9QA 3FETA 2G3YA 4KQCA 3S2GA 6NULA 3ESZA 3UGQA 1UINA 2QNRA 3W3ZB 5HW0A 4LDQA 1OV4A 4L5AA 2QTCA 4MKIA 4B4UA 1NRXA 1KR2A 2WJHA 4JX9A 3X3HA 4P0PB 4WDRA 3L7KA 3E18A 2QMZA 4R2KA 2LBPA 4YCSA 4K6OA 1JMYA 1QG4A 5CLJA 1RHKA 3LQ1A 1Z2DA 2F59A 5CB8A 3DF9A 1U7XA 4FLEA 3UANA 3UCFA 1B2LA 3HU3A 4H60A 2ZB3A 3T5BA 4LF5B 4OI4A 1P74A 2HY7A 5KQGA 5CW2A 4FHEA 4W5WA 5A03A 5DLQC 4NE9A 2O3RA 2I80A 4U1RA 2AQIA 5B6JA 4PR0A 1GQSA 3ANLA 1PW5A 2CMFA 4IIBA 4LE1A 2AFRA 3IUNA 4M1ZA 4NZYA 1F3LA 3UXEA 4KQWA 1VKRA 2QTWB 2AQHA 4AG6A 1O5TA 4YWJA 2J6CA 4UTPA 2N1BA 4DBVO 3IO5A 2D0OB 3NBUA 4P58A 2W6MA 4MO2A 2QRQA 1GPDG 2QTMA 1KA9H 1QS0A 3JQ7B 1G2IA 1ZZGA 2Q6IA 4HPXB 4IZOA 5DWDA 2PSEA 3U16A 1LTKA 1TM5E 2WZBA 1O08A 4I6GA 1MVLA 5K3EA 2NX2A 2Q45A 2GM9A 2ZS7A 1LBQA 1VMKA 5A4KA 2H31A 2ST1A 4YRCA 2VQFB 4UEOA 4LG1A 2IHKA 4L3VA 3NBQA 3HZRA 3ZPXA 1A5ZA 4Y1GA 4IO1A 2Y6UA 1UFOA 5DV9A 2XDQB 3ME5A 3TZLA 5KQSA 4TTSA 4R9SA 5D5QA 3I4CA 3VBEA 4D3DA 2H9IA 5AW7A 2V7BA 3TX2A 3QYAA 5AQ1A 2GCNA 2AXQA 1XD8A 2CVFA 2JZNA 2QEQA 3ER6A 3F97A 2YV2A 2VRWA 4L76A 1KJJA 1HWYA 5G3YA 4OQMA 4OU5A 2JARA 3CEPB 4KPGA 4NBRA 4UUOA 4WN9A 1R64A 3IRUA 1NVMB 3VH2A 4ME6A 1UMDB 5EE5B 3ZDQA 4HRXA 1EP1B 1JIIA 4N01A 1PFGA 1VA5A 1TF5A 2PGDA 5HBRA 5JS1A 3L06A 3L05A 1ZG3A 4ZKEA 1ZOIA 2VTEA 4WKPA 1BMQA 2V5AA 3N8GA 4N3CA 3ZZMA 4QFCA 1GPBA 4PVCA 4M0DA 1FTNA 4FJ1A 3ECCA 3KZMA 2G4LA 3BXOA 4CN9A 3ETJA 4FONA 3DXFA 3WNBA 2BGGA 2GFIA 5JT1A 3AI3A 1CYDA 1G5IA 1BFDA 1NX9A 3QFFA 3EH1A 5TMDA 1D8TA 2QBYB 4Z4GA 1D0SA 1BH6A 2RGDA 3ACCA 3KSMA 3CLSD 5EJAA 2OA0A 4D9HA 5SZHB 4KOEC 3U4CA 1UK7A 1ZX1A 1I4OA 5TJ9A 3V5NA 4Z4IA 3HGQA 4MB0A 5TPWB 4F91B 4Q39A 2XEXA 4DLBA 1X8KA 1KAOA 5ESXA 3QVJA 3WYGA 2VTKA 3SPXA 1OHHD 1NRJB 2LE0A 3HKCA 5BSGA 1C3OA 3X1WA 1MQ8B 3C8DA 4R68A 3AG5A 4MHOA 3R76A 1Y9DA 3RHFA 1Q84A 2BRUC 3GRUA 4BCCA 4XX0A 1O57A 1TRHA 3HY6A 1C0LA 1T35A 5AP9A 4CR6A 1T6XA 4G9BA 1P5FA 4HSGA 4NMLA 4NBWA 3T99A 1PAUA 2HA3A 1Y1RA 2JD1A 3BWMA 4HG2A 5ECYA 2YTZA 1R5NA 4EY3A 1USUA 2WDZA 3F90A 1IZ8A 1D4OA 3VX4A 2B2CA 4BZWA 1CP2A 3DMRA 3EH2A 1U2DC 1XZDA 1C14A 2A67A 2O3JA 2A5LA 1QUFA 1JLMA 4FZVA 1BMTA 4BMOB 4GL4A 3GT7A 1YRYE 3KDSE 1U8FO 3DS8A 1I7PA 4OSPA 4D8YA 5BV8A 3M6IA 4QG3A 2AZMA 3QIVA 2DUUA 3IP6A 2QPTA 2ZKLA 2PX6A 1TMYA 4MAMA 4ER0A 3Q7IA 4TUYF 4EABA 1IBLB 1MXHA 3B2QA 5JY6A 1T36A 3W6UA 4O4JA 1W6UA 2QY9A 2RG1A 3U1VA 2QAGA 2ODBA 2PGOA 1C2TA 2VSOA 3TLGA 1FP7A 3U3RA 5ALZA 3ZDFA 2C1EA 1ABEA 2VDQB 1DMSA 1JKIA 4HNQA 3IHWA 1T9KA 2BIFA 3LDAA 4CM8A 5D3MB 4MYCA 4HT3B 4MUAA 4RCVA 4MS3A 4Z99A 1YFZA 1F2UA 2QOEA 5KKAA 1ZJ5A 3ADBA 3ZE1B 2I3ZA 1QRSA 1ZCZA 4PTYA 4D9GA 2RCYA 4G0MA 1DKMA 2CW5A 2YY7A 4WXMA 3H1EA 4BN0A 5ADWA 3T1NA 3SYTA 5JEEA 5KJCA 1UXOA 2BPOA 4Q4DA 4YAEA 3WBFA 2WJGA 2QNBA 3LWDA 4YRNA 2IL1A 5LA6F 5JS2A 5F2EA 3RUCA 3W6NA 3WP0A 4DCSA 1XKLA 5DN6D 1QB7A 2R9VA 2Q1SA 3IT3A 4LSZA 3RF7A 4RDXA 3IIJA 1C3XA 4OGWA 2WFMA 4Q0MA 3PXBA 2V7GA 2XCIA 2XQKA 3DFIA 4TV9F 1PW7A 1W0KD 3P9QA 5HOQA 4DXDA 1YA4A 1TE2A 2AEJA 4CI0B 4FQ7A 1FX0B 3PRHA 4GXTA 4QVKA 4ARAA 2FSIA 2FMUA 2OHXA 3O8QA 2QTGA 3EPJA 2QI9F 5LQMA 1O03A 3BD8A 1JI0A 1BXRA 1KRHA 3OEEA 1D2GA 2GFQA 3PIRA 3QVXA 3SF8A 5L6LB 3ETNA 1PEYA 3EHEA 3FE2A 3O2JA 3OKAA 1SURA 3B48A 1QC5A 3JQPA 4GX5A 4JLVA 3HDTA 5ER6A 4CLOA 4NFHA 4XIJA 2I3BA 3KKEA 4OUDB 5E7MA 4JYCA 1OW3B 5EKUA 3U2QA 3QWBA 3C14C 2PSDA 3D1LA 2VT3A 4MQEA 4OAOA 5IT0A 3LPNA 1U2RA 3VBCA 3IEPA 2I34A 1JNXX 2PZ8A 1E79A 4FYWA 1Z4JA 2PGXA 4HXYA 4XXHA 2G9QA 2L0XA 3NI2A 3CZCA 4TRJA 4EVRA 3BZBA 3UJAA 3IPXA 3I8XA 3ZU3A 1PFKA 4EVIA 1ZN7A 3RV4A 4OAPA 4HGQA 4IIFA 3OO0A 2HSEA 1OWOA 3NRCA 2X7XA 1E3LA 1K8QA 7YASA 5BNTA 1HNZB 2IXBA 4N5LA 2X2OA 3W2FA 1SK9A 4RULA 4YJHB 4QBHA 5ITZB 3R9XA 4MV5A 4FKBA 3U80A 3PXXA 4UMDA 1H0HA 4RENA 3N0TA 4I46A 3RIXA 1X94A 1YDFA 3UMYA 1MO6A 1WU8A 2XGSA 3CRRA 1CY4A 1BX1A 1XQ1A 3AOEA 3K6KA 4XAQA 2YZKA 3DZHA 3I6QA 1OFIA 5EMNA 1UFVA 4B75A 3VNVA 4LJRA 1TUEA 1DU4A 1TJNA 3MTJA 1JDZA 1L7OA 4MRRA 3AEXA 4QPPA 4Y2GA 3VOSA 5ULLA 4LOHA 3A0UA 1YRLA 2RJ3A 4GHWA 4HUJA 4BQOA 2VRCD 4JDUA 1WW8A 1R0LA 3KYDB 3K0KA 4BYGA 1JAHA 3TBHA 3FLBA 3R7SA 1IEQA 2FEWB 5B36A 3S2UA 4CETA 1W1WA 3BVPA 1RP1A 4IEEA 3K8QA 2UKDA 4NZZA 1KYZA 5UKDA 3AUXA 4PX3A 4DEYA 1USWA 1ZL2A 3MWDB 3SR0A 3ZUGA 1C7ZA 2ENWA 3C6BA 4LQCA 4DDTA 3BIOA 1I1HA 1E4OA 3AHEA 3EVTA 3FUCA 1BD3A 3NP9A 4HNSA 1Z5VA 1JIVA 2WNSA 1WTAA 4HB2A 4P2GA 5IKPA 3K1AA 1T6BY 1LVHA 1U1EA 3EMVA 1R7RA 3X44A 3UKOA 4YPOA 2Q5FA 5JMOA 1AZSC 4AQYB 4E5SA 2DBZA 3ZWAA 1KH2A 3VH3A 3R3WA 4EHBA 1ILEA 3FF4A 3TLBA 1RADA 1KYIA 2WJYA 3I0ZA 2BF4A 5A02A 1Z6TA 3LV8A 1UQTA 5BQFA 1Q0SA 3ETCA 1GNTA 3KKQA 4UHEA 4X24A 2MHCA 2D2VA 2W6ZA 3I6YA 2JAUA 4JU8A 1NXXA 4PZDA 1AV7A 4I4CA 4EDFA 1IN7A 1Z0ZA 3JZDA 2GJSA 1AQYA 1LX7A 3PICA 4XJSA 5ERGB 1IWOA 2X0NA 3VOAA 3FMGA 3LT2A 4OHZA 1H69A 3ZWCA 4TN5A 1QRUA 1G21B 2HK9A 4HADA 4G5RA 4OK6A 1H22A 3MMPA 4IIJA 1GZ6A 5DULA 2ZE8A 1XCMA 3OOHA 4ZHQF 5K20A 1E2IA 2WYWA 3L7LA 2GETA 3PQ8A 4GZ3A 3LO5A 3SP1A 3H2ZA 1IVYA 1YCGA 2JD2A 5KJEA 4PLGA 5L4NA 3G9UA 1NW5A 3F5DA 3GFGA 2BEUA 3L6UA 4NK4A 3WBKA 4LMAA 1AA9A 4C04A 3TSAA 1BCSA 4QJIA 1YC2A 3P4XA 3PTAA 1L4GA 4Q3NA 5SYAA 2CDAA 1GGJA 2IHBA 2PZAA 1FP6A 1KYTA 2WLTA 2PUWA 1L4BA 3M5CA 2W6NA 4IDEA 3H6HA 4WFIA 4Y1FA 2EIXA 2EX4A 2J67A 3HCCA 4G5SA 1VE9A 2X0EA 1EA5A 3EPHA 3S1AB 2IEBA 4NCHA 3T35A 2DTDA 3B7WA 3OKPA 4CG1A 2CVPA 2E85A 3N2KB 1W25A 4RV9A 3QZUA 1QO0D 4II7A 2F48A 4M0PA 2AN9A 4D4IA 5KOJB 4JLOA 3T15A 4M0KA 3TL3A 1K4MA 3OQ1A 4ESOA 1C0PA 4RHCA 2IEGA 4G2TA 2QTHA 4GKVA 3GOHA 4YP9A 1ADJA 5AMXA 1QDLB 4C6TA 2VWGA 4J0QA 5DNUA 2REQB 4FSXA 3IKJA 1IAVA 3COYA 3HUTA 1W0CA 4Z5XA 1Q7TA 1ZO8A 2GARA 1MO3A 2N75A 4Q1DA 5LP6B 1NVKA 2GD1O 2YZ2A 3HNOA 4JI6B 4EUEA 3U48A 3OC0A 4NZ9A 1QYIA 1IB6A 1Z2NX 3I9OA 4MQ5A 4X60A 3O90A 3SM9A 2EQBA 1V4VA 3B13B 1WOMA 1JSCA 2R6JA 3KB1A 3MLEA 2F9MA 4GPBA 4EL0A 5EPEA 2YN0A 2HLPA 5T6BA 1Z0KA 3SHFA 3HMQA 5FRDA 3REQA 3V97A 4M8NE 1SUSA 3LVRE 2ERYA 4ZAWA 3KC2A 5FP0A 2IXDA 5AVOA 1BGVA 4BOYA 2Q7OE 3TBKA 1E9EA 2ZAMA 2JHGA 2J3LA 1MDFA 1VHLA 2D7JA 5H8WA 1JUDA 5FUQA 2OZEA 4DLYA 1RKQA 2Z1MA 5JJIA 2QTVA 3W6PA 2YDYA 3K73O 4G0XA 3RC1A 3WV5A 1TOAA 2PVCA 2F3QA 1UJBA 2F00A 2AX4A 1R0WA 4UM5A 4UHDA 1K98A 1R16A 4JBGA 4MI9A 2VL7A 1P80A 3HFGA 4FFWA 4GE0A 4PQGA 4YAIA 5TMPA 4EKIA 1I6LA 1Y6RA 4FE4A 4KPUA 3NTXA 3WDSA 2QTZA 2XSZA 4QLBA 5BUQA 2OEPA 4ZRMA 5I48A 5JTUA 5LQJA 2H57A 1V1JA 1L7RA 2FW1A 2QVYX 3LPDA 4IUDS 4J16A 5DM1A 2PWBA 1CYEA 3I1YA 1W75A 1F7VA 3EXHC 2WTBA 4BS9A 2AFHB 4M9ZA 4BQPA 4KR2A 1ESNA 4KBFA 1K27A 5L8VA 4JXJA 3K94A 3AHCA 2VDWB 2PEZA 3OZAA 1U7HA 1QU3A 4FHGA 3AI2A 1LQTA 1Q1NA 1PV4A 5TGTA 4MIKA 2OV1A 1YZQA 4M87A 1MO5A 1GITA 3LC1O 1PNVA 1RNLA 1UQUA 4QHSA 4UDOA 1JWLA 4KV7A 1U3UA 1Z7BA 3HEMA 1JT9A 4QFBA 3HKEB 5F98A 5L4LA 2E0IA 3ZXYA 4FNGA 3IEIA 3OMLA 3E03A 1EVQA 4JJAA 2PIDA 4G84A 2DWUA 2FDRA 3MGCA 4RK0A 1QGZA 3H8JA 4NCJA 1FVHA 1RXWA 3IVGA 4FR2A 4KVAA 3GV0A 4J9VA 3G0BA 3RG8A 4YH1A 1QAOA 1F3OA 1OBOA 1QHEA 4Z4QA 3N76A 2FW6A 1K75A 4C6SA 1MABB 4DNXA 3FF1A 3L0OA 3VU8A 2FRDA 5LDHA 1VE5A 2OCBA 4LYFA 2R2AA 4XX1A 1HYQA 3NNDA 3T8YA 2ZB4A 4JUDX 4KAFA 2C7VA 2JB9A 1E1QD 3HVHA 1PD1A 4MUXA 3A9RA 4E3ZA 1B0AA 2I66A 4K81B 4UHJA 4XGQA 1T5LA 2E89A 2WVJA 1E9RA 4A03A 2ZIWB 3CEAA 2WYVA 1PLLA 3LUHA 3W4JA 5EWLB 4U7GA 2HA5A 2HDWA 2PMEA 2VWQA 3NHUA 1QDUA 3GJZA 3RO7A 3G13A 3HP4A 3DXZA 2YWXA 5AT1A 2C8LA 1CUJA 1UMKA 1KJ9A 1JPJA 3PLRA 2G6BA 3PQDA 3W7AA 1QVZA 5LOVB 2AS0A 4FHCA 5EIBD 4DGSA 3VJKA 1VFPA 4AKHA 4PEVA 2WUEA 4WLOA 3FSGD 5EY5B 4UJ5A 4N4AA 3F7TA 4K8OA 4AY6A 4F9GA 1EDZA 1T4GA 1GPLA 2FN8A 4LHEA 2O7NA 5DYYA 4QVGA 3DTTA 4BFYA 3EXIA 1ZMBA 3PHBE 3AIOA 3V4FA 3O3OB 2GAIA 4EBBA 2BCGY 2BFCA 2CLMB 2XNSA 3DFMA 1TCVA 1J90A 1Q77A 3NFRA 5ELXA 4IIDA 2C42A 4DCGA 3IO3A 4D3ZA 4X7PA 1KZYC 3EXFA 2A14A 2DCMA 3PC3A 3WRYC 4KQEA 3LHIA 4CRWB 3HDGA 3OQNA 3EW9A 3FOWA 3SQOA 3OQOA 5CFQA 3R4CA 1H9CA 2H3HA 4RLFA 1XCGB 3KKKA 1G98A 1K8RA 3SS8A 2XPCA 3DOHA 3BH7A 4PLFA 2G0AA 2IPOA 2VF8A 2Y1XA 3HGTA 3SICE 3DZCA 5JLAA 1V5WA 2PIAA 2WJZB 3LFUA 7ABPA 4HEQA 5AJWA 3PDHA 4ZYWA 4LF9B 4AJPA 4AULA 2XUZA 3OLZA 2Q8PA 5KTSA 2DBQA 3R3XA 4POOA 1BS9A 4A26A 3NIFB 2YV4A 3ICCA 2YIMA 1S3FA 3TZBA 4EOGA 2VTVA 2E82A 2X7HA 3ZHSA 4WOBA 2CSXA 1K5PA 4LXIA 3A6ZA 4J0IA 4XWGA 2L42A 3A3KA 4AJ4A 2J4CA 4BKMA 5JE8A 3OJFA 4J2TA 2Q5LA 2ZAIA 1NE7A 4CTKA 4EFDA 1U3WA 2CVOA 1SVMA 2X0JA 4QJ4A 2C96A 3B1ZA 4OQEA 2BGWA 4EEKA 2FPLA 1VJCA 2Z1NA 3DC2A 5CFNA 4IPTA 4L51A 4MX8A 5DHPA 1EP3B 1K0FA 2IHZA 3QPAA 4ECAA 5FNVF 2L18A 4DDHA 5FX2A 4KHZA 5FLXA 4ZAFA 1AS3A 3F6RA 2PANA 2NU8A 1R0KA 4XW2A 1BE6A 2BKUA 2ZW9A 4GMFA 2QN3A 2QGZA 1HTWA 4BJ5A 3V55A 4IYJA 3NYWA 1BIFA 2ZYSA 5KVQA 2OPHA 3DJFA 4DQKA 1FY2A 4JL8A 1E5TA 1HQCA 3KAKA 4EWLA 2G36A 4WY8A 4DEXA 3A4NA 2AA3A 4PQFA 3K8ZA 3JVDA 2VDOB 3NKVA 2VG8A 3OJLA 3OIWA 3WOVA 2OBNA 2VSNA 3WLOA 3ZY3A 3ZY5A 1WXEA 3EZXA 1A2BA 3KUKA 2QIOA 5KNBD 3ROMA 5DNYB 3DOIA 1ISFA 2H1CA 4IDGA 4IVNA 2C78A 2VF5X 1RYHA 1HGXA 2CJFA 2OG1A 1RR6A 2WR8A 5F77A 3SN6A 2BGIA 2QRNA 1MB3A 1OVMA 2P27A 4HO1X 1V11B 4GMXA 1KGDA 2PL9A 1JDTA 4IF6A 3RT7A 1YIAA 4F71A 1EBUA 1N2OA 2YWBA 1IY8A 4IX1A 4PHGA 4URXR 4OOFA 1UPCA 3AR5A 2XB6A 1N8TA 3HEAA 4OH7A 4CTNA 4ZIRB 1DB3A 2IA5A 1C29B 1V4NA 1P31A 4IH9A 4OFXA 1VDZA 3TEFA 1OKKA 2NZWA 3W7BA 3GFTA 2GN9A 2JLBA 3I3SR 3R1IA 3IOYA 1VYVA 4KH0A 1GUZA 1XFAA 4PANA 2ETXA 5CNKA 2XCLA 1RI5A 2QMYA 3NNNA 1ID8A 1KJWA 4WLEA 4UE2A 4ZWNA 3AF0A 4TMVA 1QZZA 3SQDA 3OC6A 1FUKA 1EYZA 4G89A 2P78A 3DM9B 2WZDA 4N3NA 1ECPA 4OK3A 2H1VA 5D7NA 2H4YA 3DWEX 3UGJA 1JF8A 1LTHR 1Q14A 4C76A 2JGDB 4EM6A 2CSUA 3BJRA 3G0HA 1XU7A 2NADA 1G2PA 2Q5IA 3K5HA 4IDAA 2XB4A 4UDYX 4HEJA 1J2RA 1N6HA 4QJ5A 4B3GA 3K71B 3I2IA 2ZTSA 4QSHA 5NULA 4B17A 5A5EA 1XZ8A 1QZTA 4HK4A 5LP1A 4Z4FA 3DBHB 1KP9A 1R8XA 1RYZA 1L0BA 1AMUA 4XOUA 2XDWA 2HDHA 1ZI6A 1N32B 2R25B 2AOWA 4C5CA 3JQAA 1EVEA 3PQ7A 1I0IA 4KX5A 2R8RA 1YK0A 4BO1A 3U4QB 3D7MA 1HXHA 1PT6A 3CW9A 3T3EA 2PMKA 4V2UA 3SK0A 4YECA 1NY5A 1AKTA 3QX3A 3O94A 4M1YA 4R2LA 2BSAA 2V55B 2X5JO 3Q10A 1ICEA 3S2ZA 4CM4B 4QRDA 4WINA 4E08A 1BMDA 4H7JA 4ZI7B 3GGDA 1MV8A 2AOUB 1OGIA 3SJUA 3P0RA 2QY6A 2YHSA 4CM3A 3AMVA 2XMBA 2VNKA 4K0RA 4RF2A 2VHVA 4XPIB 1QHXA 1L7MA 3KPJA 3EVNA 3BCUA 1WB9A 1MB2A 2XYGA 3IP3A 2I03A 3GF4A 3GRKA 4TZKA 5DHUA 5H80A 4XM0A 5HSGA 5KTMA 3BTUA 2HCBA 4Q9DA 4OEHA 3DKVA 4G9EA 3WL7A 1DHRA 3B12A 4YAFA 2VXBA 1ADCA 1HYBA 1TVKA 2ARKA 2R87A 3H1GA 3OIYA 2NZVG 1KP3A 3G02A 3LE8A 4YJKA 4INOA 2NU6A 3PHJA 3QOYA 3GBPA 5T8KC 4HQKA 2X6TA 4REOA 4Y67A 4DMHA 2A59A 1QYCA 1E9CA 1MDBA 1H05A 1NP6A 1U7TA 1WXWA 2R6CA 4UXIA 3SC4A 4DVGA 4DFDA 1C81A 1EVLA 1N4AA 2C95A 4LKOA 2FPIA 3EGCA 3PLAE 5JAZA 4GYKA 5TMBA 4EJSA 1TM7E 4JP8A 4IMPA 2GN4A 4DLWA 1IHOA 4AI6A 4BGEA 2N1MA 2XZPA 3HFJA 4HQFA 3T9FA 1EJBA 1F8YA 2KYRA 2OCAA 4IHKA 3DKRA 5K09A 3KXDA 2O5EA 5KSPA 3OZIA 2CK3D 3NS7A 2VJNA 3IC5A 3PE3A 1Z75A 3DBVO 3WRYA 4WEQA 1IZ9A 3L1HA 1ZICA 4X1IA 4NE2A 3DSRA 1N8SA 4TT3A 4EATA 2G04A 1KAGA 3ABRB 3RUFA 1JA1A 1ZUNA 2ERXA 3K15A 1JJ7A 1FDVA 3O3NB 1U9CA 1SCUA 3UJCA 1GRQA 2RKBA 4WNAB 4JP1A 1TVCA 4AX4A 1T8UA 3AHJA 1K88A 1M34E 3RODA 2ODEA 5L3VA 3IUSA 1A9TA 5C1DA 9ATCA 1P1CA 1JDBC 1OGJA 3FRHA 1UPUA 1A5SB 4D8TA 1HNNA 1Z6ZA 2JGNA 1BXGB 2D8AA 3ADPA 3C6ZA 4URYR 2W70A 4C0QC 4F04A 1YKSA 4PS0A 4NZOA 1GZUA 1DG3A 3BGWA 3FWZA 3KR0A 2O8NA 4KN9S 2EJBA 3FKQA 1EA7A 1MAHA 3KTFA 1KQNA 2P2SA 2UUCB 3BB3A 5K8IA 1AKRA 3GJXC 4ZEVA 4S0ZA 2CMHA 4JJZA 4M49A 3WK8A 4CL2A 1Y82A 3OP4A 4TMZA 3EQ9A 1EX7A 4NOJA 2NYVA 5EHQA 4TTJA 2C7BA 1AU9A 4W7IA 3TOCA 1F6DA 3IURA 4KAJA 1V96A 2XJ4A 5C4IA 2C58A 2FOIA 3LK7A 3G7SA 3MUNA 3PDIA 3N0RA 5FHQA 2XYPA 3B1WA 3E2MA 1TK3A 3BMCA 4DC1A 5FOQA 4W7SA 4E2YA 4N8DA 2ZSFA 4EPRA 4YRJA 2RI6A 5JWRA 1G8PA 4WKNA 4JI5B 2G28A 2VDVE 2XTMA 1KEUA 4Q21A 1P8AA 4A82A 3T34A 1LF0A 2Z98A 4WBSA 1B43A 3R5TA 1UBJS 3G68A 3T1OA 1E5VA 4YS6A 1ZGBA 2NPOA 5GZ3A 1X7WB 1DC4A 5ALKA 3IPYA 3VDNB 1DV1A 2Q5HA 2BZSA 5D7BA 5BUSA 2HA7A 3C7TA 2ES4A 4QG7A 1E96A 5I3CA 2A35A 5F4ZA 4WK6A 2VBCA 3TM4A 1P7VA 1JBEA 3H4IA 4HNUA 2ZVDA 3N6RA 3ZHOA 3GNSA 3GLSA 1V39A 3Q3JB 1E8DA 4K9KA 2VP3A 3A9SA 1KOLA 1WM1A 5LU9A 4AMVA 1F6WA 3WGZA 3HYRA 1J25A 3M6MD 4JI1B 4DRYA 2RAVA 2HQBA 3RHTA 3AI7A 3SSAA 4BEJA 4OXXA 1FXSA 2WWHA 4RZQA 4CUZA 5BYKA 3X1ZA 1GCIA 2MMCA 3LZ6A 3DT6A 1QGDA 4ZRNA 4EI8A 1DCTA 5FWYA 2XAUA 1CUSA 2BCJQ 2V7WA 3H04A 4JIGA 2R6GA 5DGDA 4WW0A 2P9JA 1PVOA 1YO6A 3HSKA 5K45A 1PSDA 1R6VA 4CG3A 4L8GA 3KHTA 3ITKA 3RLIA 4ZQFA 3TYXA 2IDMA 4AYXA 1UXJA 4TRNA 2FXIA 5E1OA 3R7FA 2BJHA 3HR4A 4JBLA 2ZEJA 3QLJA 4KOAA 4QBKA 1SVSA 1IE3A 2XDYA 3I5XA 4KLRA 1E3QA 3O4GA 1C3EA 5KQRA 5CD1A 3JQFC 4O2AF 3TR5A 2QT9A 2R8BA 2CY0A 2D0PB 4A8JC 4ZYLA 4Y2VA 1OAOA 4W6ZA 2JLXA 1W0JA 4CMIA 4JQYA 1KVUA 1CETA 4PYIA 2CBGA 2SECE 1DJNA 1Q0QA 3DMYA 3H9QA 4ARVA 3GL9A 4CKXA 1L7XA 2CUTA 5DLEA 5L3QB 3VHXB 1R5OA 3I09A 4MQBA 4O8CA 1D03A 2R84A 4AIRA 4NPCA 3ZWQA 3WGLA 4QUEA 4DANA 3TZ6A 2QJWA 1SUFA 1JHQA 2IPMA 4L6AA 3O8LA 1AUVA 1FRFS 3EPRA 4UQOA 2Y05A 3RVQA 1HNXB 1FTWA 3NDIA 2FZ5A 1KKUA 4BPBA 1YJQA 4CUJA 4IXWA 3RS3A 3ZLUA 4X00A 5G41A 1A2OA 1Y9EA 3C3CA 3HA3A 3HABA 4O29A 5DYTA 4BZQA 4CG0A 5H4GA 5K0SA 3EQ8A 4PG7A 5CBKA 3L8EA 1WNTA 1A97A 3HYCA 2H11A 3GLKA 3LG2A 4A9AA 1NXTA 3KZ1E 3B60A 3KZNA 3OZWA 4QGGA 4DCMA 1VLJA 1TTTA 4CLXA 1L5RA 4NABA 3HHPA 1N0IA 2Y1WA 3EZGA 1NZDA 2EBUA 4EZBA 4M7WA 3ER9A 3PA8A 1KZ7B 1Z16A 1N9GB 3UG6A 1G5QA 4UBNA 2D1YA 3AWDA 3ZIDA 1OXUA 1RZVA 5ALTA 1QCYA 3DE2X 3LT5A 3JPWA 3X2EA 4AZVA 4GIBA 3AL3A 1N5DA 2FWMX 5LYJB 2A84A 4K9DA 1BWPA 1EDEA 1SCDA 2WF7A 3GJ5A 5T8KA 1UJ4A 3P2YA 2E1PA 2JFPA 4WAUA 4FKMA 4D44A 1XPUA 4AL4A 2BFOA 3ADCA 1SQFA 4JC0A 5JBIA 1AGRA 1Z8DA 2ESRA 4H77A 4PXYA 3TLXA 5CLLA 1UBFA 4AKTA 4X71A 1FQWA 3V4PB 4QLAA 3BGDA 1T1RA 3QKRA 2ORYA 4K46A 3DZDA 3WJ7A 4MYSA 4M7PA 3ZVRA 1R4MA 4FX5A 4QZVA 1IMJA 1A72A 3H2JA 5BN5A 5KOIA 3CJTA 2K2WA 4NV3A 1U81A 4CDNA 2K87A 4RIEA 3ETEA 2VP5A 5LFAA 4WN3A 2JK1A 3AP2A 1JEYA 2B5WA 4QPJC 1NLMA 2OQRA 3OPMA 3NALA 4D56A 4EO7A 1BYIA 3KM0A 1MH9A 1FZQA 2I55A 2V7XA 3VV2A 3W90A 2REOA 4CMAA 3THSA 1ZUWA 4F21A 4EY8A 4OJMX 3KOOA 4C7OA 1Q3HA 3QITA 3WLTA 3IMGA 4N39A 3U4HA 1TVEA 3ZWPA 3MTGA 3I9V1 4KXLA 4BAUA 4DZRA 2AOTB 2YASA 5CB6A 3NTUA 1NV8A 1SD2A 1NP3A 4QXQA 3K20A 3R40A 2OBYA 2H92A 1YA6A 2OFXA 1DBQA 3N8DA 4CFZA 4E51A 1HZZC 2R00A 3FBWA 2IVFA 3I04M 3OZFA 1HL7A 3JYLA 1U7UA 1J20A 3PC4A 4N76A 1KFBB 5C7LO 1M1UA 3RQSA 4D92A 2JGIA 4EW3A 1EBFA 4JLKA 1ZAYA 3SEAA 3R8FA 1RZRA 3ABQB 4IJ5A 3QHPA 3PKJA 3RVBA 2X2EA 5LQUA 3GPDG 2X58A 3RUAA 1CQPA 1EK5A 4JA2A 2AJ8A 5EWMB 3AUKA 2CF6A 4C03A 1H2HA 4EZIA 4FB5A 4MXDA 2AC7A 1R27A 3R7NA 3M6FA 1FE8A 1N2GA 3WFIA 2HXGA 3HGMA 4ETWA 2QORA 4OA5A 4M8IA 4ITRC 1IJEA 3G9ZA 4MVJF 2VK1A 2X1HA 4B6GA 1KQGA 2WY2D 3WY9A 1EVYA 1HFWA 1ZP6A 2ADOA 2VP0A 1FA9A 2A9JA 2V7UA 2VK8A 2J31A 3LFHA 3ZWNA 3S81A 2QN2A 3T5CA 2Y0CA 5CHYA 5EA2A 5KWSA 3UF0A 4H7PA 3RK0A 2D74A 1IONA 2C9MA 3GAZA 2HF9A 3JARA 5DXFA 3SSOA 5E1MA 3LBFA 1A5BB 1I51A 2XMGA 3AM5A 3D3JA 4HDNA 4AS2A 4BO6A 3E5HA 5LOVF 3A6JA 1XT6A 1PX0A 1UBKS 1PEKE 2DFTA 3L84A 3SR4A 4MJ7A 4S05A 1ADYA 4ENWA 4PGHA 3J81k 5C52B 3UVEA 2E37A 5EWJA 4D4JA 3WGYA 2EHDA 3C70A 1XC7A 1GEGA 1K6IA 1ZKDA 2OZLA 3LUJA 4QATA 1NASA 4XFJA 3BWEA 2W2XA 5JCJD 4G37A 4DQDA 4RTMA 5KYXB 5KB3A 3JQBC 4P38A 2P1DA 1GR1A 1NVVR 4BVBA 1WPGA 4R0VA 2VJKA 5DRTA 3UMGA 1JI3A 1VJ1A 4FFRA 4WL0A 2ZJ0A 3QUTA 1DX9A 2ZBVA 1KY3A 5ISMA 3NANA 4BGVA 3ZV7A 2DPYA 1GTL1 3RKUA 1WP4A 1ZISA 2CC2A 2FN7A 4U6SA 4JZKA 1UP6A 3I5MA 4X6YA 2OBBA 2K6GA 1Q16A 1ZOSA 1J5PA 5ENVA 3UPDA 4NCNA 3QTTA 1KJYA 3U0VA 4H7KA 1BX0A 1HE4A 4HDMA 1BJTA 4N1AA 3UCXA 4J9UE 4G24A 4ASUD 2C4WA 1IC6A 1FYDA 1TM3E 2Q4DA 1EP9A 3AL2A 5DISB 3AY0A 2Q8NA 5D5HA 3FDFA 4TVKA 2B82A 1NBME 1LSJA 1ORWA 1KK1A 1TQ8A 2H2GA 5JNTA 1M6VA 3HCDA 2IWHA 3ZKWB 2JAWA 4ZFNA 3V4ZA 3IODA 1I9CA 1GSIA 4MWDA 3K53A 4P5PA 4QBTA 1QX4A 3BHNA 3MFYA 3SI7A 3VQTA 3QMVA 3RGWS 2WFLA 3LXMA 1SJ9A 3JAKA 1YB5A 3HADA 4MPRA 3W9BA 3S8EA 3H8WA 5CCBA 5TQ2A 2FQ1A 2B3TA 4ZVRA 2XX3A 4HFRA 1JDJA 1I6KA 2DYKA 4G25A 2JIMA 5CH3A 1XRRA 2LVBA 1OX4A 1BU8A 5DO9A 4RMNA 2EFHB 5F7ZA 3UGTA 4ZOEA 1W47A 1R8QA 2R8EA 3AR8A 3GZTB 1LRLA 2G9VA 2H7XA 3I72A 4WZBA 1TW2A 3EGDB 1T8WA 1U3VA 1IULA 4TUYA 3F6SA 4G5FA 1M2NA 4WNCA 2W6OA 3I4FA 3LL4A 2JS7A 4CEJB 4EHIA 3NDRA 1K6XA 1OMOA 1CY1A 3MTAA 5E9JA 4P4GA 5EJIA 1Z2OX 1CUIA 3GMIA 4KX3A 1OXBB 2EP7A 5C8DA 4I08A 2A9QA 4KWCA 3GAMA 2X4IA 4KFUA 4MITA 1L4KA 1JXQA 4I7EA 3MOGA 4R83A 3ULKA 1BA2A 1UADA 3FMOB 2YFYA 2H1WA 2WWIA 3AUJB 4ZPXA 2P1RA 1TIBA 2HRZA 3P9PA 4OQPA 2C0PA 2UUBB 1E7MA 5BSMA 1KZGB 4DTIA 1TECE 1OD6A 4QU5A 4BNYA 3MGGA 4JOCA 3U56A 1L9KA 1FC0A 3DLHA 1VL0A 2A9OA 2KM1A 1CRLA 3VZRA 1PNRA 4DC0A 1GRRA 3OCYA 3GW8A 4M1TA 3A2LA 1CFZA 1C4WA 1T2CA 2RJOA 2C4TA 4H1WA 3A2KA 3IEXA 5FA8A 3IBCA 1TAHA 1Z8NA 3CX7A 3DPSA 1ZN8A 3HZHA 2J9ZB 4NJOA 3H5TA 3RUHA 4M0LA 1ISJA 4EYEA 5TLSA 1E3SA 1KVSA 3PUXA 2CCKA 2QD3A 3AT1A 1T43A 4DTCA 4Y2QA 5AR1A 3H42B 2JASA 1PWHA 3PEUA 4K3VA 2HGSA 3EWNA 4E13A 1UMCA 2GZDA 3H2KA 2C31A 1A8UA 2WWFA 2QRPA 3CLUD 2Z56A 4R41A 3INYA 2A0WA 2WTEA 2O2DA 3D4LA 5D1NA 3VTFA 3A9CA 2D54A 1KVRA 4B46A 4R98A 1J33A 4N7BA 4FYJA 4NZMA 3TNFA 4XM1A 4G1UC 1O7JA 4MV0A 4QX6A 1P1RA 3K2EA 3RVMA 3AR7A 5H5JA 4YRAA 4NS4A 3LA8A 3QXSA 2I3DA 2JKYA 2V7QD 4HB3A 4MWSA 5E1DA 1EBBA 1MQ9A 3PEYA 5KJ1A 3EIOA 4GYJA 3G1TA 3NWJA 4V0RA 4A6XA 1HZZA 2PX2A 3HJNA 4G5QA 3HL4A 4XE5A 5EJ5A 5IFKA 3OKFA 1L8XA 1H65A 3QPCA 4BV2A 1B3BA 3N2GB 2YYYA 4PZ0A 4DMUB 5BV0A 3H11A 2CNOA 1JHXA 3S2YA 1I7QB 1B41A 1TT5A 3OY2A 2GB4A 5FYDA 2MR5A 4IKOA 1J1IA 4P53A 1M6YA 2HPVA 2ZUWA 1PDWA 4F56A 1XZIA 3O38A 3B51X 5C5DA 3UAXA 1AGPA 1CC1S 1WB5A 1N77A 7AT1A 3VR4H 1VSBA 5AOCA 5TRTA 3G2KA 3NHRA 3KFVA 4TXJA 2QIPA 1GDTA 4KN8A 3PKIA 4LGYA 4OF4A 2CNBA 5E95A 1FJXA 2O7VA 1GDDA 2JH9A 3CLVA 1R0ZA 4JEHA 3CSDA 4RVUA 4HATA 2BMDA 3KE8A 1DQPA 3NHPA 4M6WA 5LQNA 3VR2A 2XB2A 1BWSA 3WLIA 1WABA 4B0PA 3QU5A 2TMDA 4P7GA 1W4RA 4TKMA 1D4FA 1MUUA 2G5PA 5CNIA 3QWFA 1V5EA 1PJ8A 3NOOA 4H6WA 2WPDA 1TZCA 2J59A 4ER6A 4HWGA 3JQBA 3C7DB 1Z26A 2BGJA 4MS1A 3WLHA 4ZOLF 5IHPA 4FZRA 1GA1A 2DU8A 4GZ5A 4RDHA 5SICE 2V97A 3R5SA 1ZNYA 1JKFA 2XQJA 3VR4D 4DPLA 2O6LA 5JD6A 3BTVA 3ZJTA 3U7QB 4LWZA 3LQFA 3R9KA 1H0SA 3MT8A 1DFGA 3QVGA 1ND6A 3OOJA 2DUNA 4UMEA 5IARA 3O8OA 4O4HB 3VC2A 2QXYA 1FF9A 2WP0A 1KL7A 3AF2A 2PBZA 5CTAA 3VR6A 4EG6A 4ENQA 1EVJA 3UM9A 3PGKA 2ATCA 3A05A 5THQA 4B4OA 2VUTA 5JADA 3UV6A 3T7KA 5B12A 4OLBA 5H70A 1V9LA 2CNLA 4RGVA 3Q11A 5D85A 5DYWA 1V8DA 2G7MC 3HLTA 2ZRNA 3SQWA 3VSEA 1FXWF 1CY7A 1QV6A 5JSZB 3I61A 1YDGA 3NBAA 4W63A 5DTMA 5I7SA 1U8UA 3SZRA 3PUJA 1CRPA 2FKAA 2IGBA 3THWB 2I4RA 4W82A 2E2WA 2XHZA 2DBYA 4F6RA 4MICA 4RZXA 3H9BA 2ZULA 1P7ZA 2C5HA 2HCTA 5L7WA 3MJRA 1UZUA 2H00A 4EI9A 5IC4A 2B8JA 2XXBA 3LTNC 1SG6A 5A5DA 3TO5A 3MD9A 3ZWOA 3LP8A 2GA8A 3LRPA 2FHSA 2I76A 4V03A 5LCXA 3QP9A 4U0JA 1I7LA 1IMOA 1TA4A 1VG1A 4NOLA 3KLPX 4Y9DA 3G88A 1F2DA 1NAHA 3VZQA 3WGTA 3NEJA 2HA0A 4XQCA 3C6QA 1JU4A 5TY0A 3SC2B 3UYKA 2Y99A 5AJYA 2LCIA 4HDKA 4HX9A 4WUVA 1ECCA 4U2GA 4NJMA 2I99A 2PQ2A 1PVDA 4IM7A 3D59A 4LBVA 3SIXA 4A4DA 2GEUA 2H9AA 1QDEA 2J9FB 2YQ5A 2P79A 1NOKA 3WGIA 1Y9JA 3H3JA 1C9EA 3LHFA 2H6EA 3HXPA 2YIVX 4HHEA 3V1YA 1YZNA 4CNBA 5BMVF 5HR5A 3MS7A 1RHMA 4KK3A 3OIGA 4D80A 3EARA 5L51A 3GLIE 2CXPA 4JJ6A 3EY9A 4NC9A 3TKLA 4OFWA 2ZWVA 3FMFA 4J4HA 2QVBA 3H2YA 1GOTA 1P2UA 2I8CA 2OM6A 4YFVA 4ZEOA 4EY7A 1II8A 1LNSA 3UV3A 3UZUA 1TAGA 4MRMB 4ZK2A 3RROA 5I45A 3PS9A 3A11A 1RZ3A 4D9MA 5YASA 5JASA 1GJRA 1F5NA 2WU0A 1DTEA 1GRNA 1WP9A 1ULSA 1WVIA 5CEJA 1EQAA 1RACA 1WSAA 3BHJA 3JALB 1ACLA 4EHFA 2ZI3A 1WMBA 4TQGA 4YT5A 5JNLA 3GEPA 2WUGA 3CCCA 5J59A 1YFLA 1T29A 1WY5A 4BNDB 3H83A 4JVSB 4Y2RA 4ZV4A 1VLMA 2WW8A 1QFZA 3ZHXA 1HMYA 3WIBA 5IZCC 2IZ1A 1BG6A 2JEOA 2G67A 1H94A 4D9EA 4DLAA 1HKHA 3U6BA 1O4VA 3BF7A 4UU7A 1C3LA 4JJFA 1FP4A 1ZXLA 3EIXA 2MR6A 1QIDA 2PQ0A 2C07A 5A9SA 3CUTA 1Z33A 2FSVA 2IH4A 3O4RA 4PLWA 3V1NA 3KSDO 4L9SA 1JW9B 1H2YA 1LPBB 3BWDD 1IQ0A 1CDDA 2DJIA 2KBFA 1JFTA 4GBED 4F0JA 1N3YA 1WUTA 4DLSA 1M7GA 5CDGA 3LKDA 4D46A 4YUYA 3JW8A 4AUEA 5KJ6A 1NYRA 2P2ZA 4HEA1 4LZPA 4NMHA 4B0OA 3FVRA 1QFSA 2LUOA 1A0OA 3C3MA 3ETDA 5FADA 5JH7B 5HFJA 3STXA 4MUMA 2IE8A 1BNCA 3D02A 4DXAA 5KOHB 2HQ1A 2JFQA 1ARZA 2JHCA 2NV6A 2ZSHA 1CBUA 4PLPA 3E0QA 4Q3LA 1YBHA 2IWRA 3SC6A 1B00A 1UWVA 4WEOA 4IIVA 5EKSA 4OX9B 1CUFA 1WDWB 4PXSA 4UOEA 2HPZA 1DI0A 3ESAA 3GIDA 1DC7A 3PEEA 4YNBA 3URKA 4FBMA 2IUSA 1GKLA 3IT1A 4YP7A 3AKEA 4RUKA 1QXSA 4BGDA 4G5YA 3KQHA 1XK6A 2WSYB 3I2JA 1M2JA 2CN1A 4IOMA 1WDKA 3QVKA 3AFGA 2VH5R 4LC9A 2YVLA 2WVHA 5JZOA 5A5VA 2F1RA 1WMSA 5FFNA 1ZD1A 3IL2A 2ZSAA 2E9SA 3CFYA 4QT4A 2PPVA 1L7AA 3GRPA 2RKWA 5LLSA 1JH9A 4LY0A 1CUGA 2HK6A 1ECFA 4V24A 2D59A 4BLPA 5JNVA 5HX7A 3B1KA 3TR0A 3A3NA 3CPJB 2ZTLA 3HKDB 5CR9A 5JLJA 4CEIA 2WEKA 5DXJA 2J0EA 5IJWA 3SQMA 3T1TA 5ED4A 1X38A 2W2PA 3RYHB 4UUPA 5HYVA 5HRCA 3JQ6A 1COWD 4MLDA 2W37A 3KOWA 3PXUA 1HQKA 1G8MA 1GTVA 3AEQA 2JVJA 3H84A 1I24A 2ZQ5A 2J09A 3HI4A 4GOOD 3E9MA 4CMEA 3G0GA 5H7XA 3SOZA 2G08A 1ZVQA 3H86A 5E2IA 2W6ID 2LIVA 2D4AA 1YOBA 4ND1A 3KQSA 1MHPA 2H4JA 3RI3A 1QYVA 2YDXA 5DNEA 3HTXA 1DQZA 3K05A 2INGX 2ASEA 1TQDA 4IMIB 3C4QA 1LDYA 3EDQA 3AVWA 2BFPA 3AVOA 4BX9A 2X9QA 4JB2A 4D0NA 1Q0PA 1R9MA 1SIWA 5SV2A 3Q9NA 2IYAA 2Q8QA 2VYQA 3B3AA 4MW2A 3V6LA 5HIKA 2H5LA 4RJJA 2A5DA 2IHTA 2AUMA 4WK2B 4G5OA 2CLLB 3N8KA 1F4PA 4MDYA 4FFLA 1O0BA 1W4ZA 4MLPA 4U39A 1L4YA 4XR9A 3TQRA 3YASA 5AKLA 3R6LA 4KLZA 1U0JA 5EMLA 2QW8A 1GM5A 2AR9A 4P5EA 1B0UA 1M74A 4INAA 4AY4A 2XVMA 1DKPA 3GJSA 3LPCA 4WKCA 3ZTWA 1SFRA 5AIAA 3VVBA 3S2IA 5EVJA 2FR8C 2P9GA 4D9FA 4MYDA 13PKA 3R20A 1JQ5A 5J2TF 4QL3A 2P3QA 1DTSA 4ARBA 2BEVB 4ZOAA 4M88A 3N6VA 4MRAA 1Y48E 3OCVA 5F21A 2YJ3A 1K0UA 4UTOA 2XUFA 1RFLA 2XR1A 3TTYA 1UOOA 5CLHA 1H93A 2X2PA 3FW1A 4QRHA 4DREA 1JFFB 3HEBA 3JQ7A 4NXMB 5FL7A 4ZV7A 5CB0A 1DJOA 1XU9A 3GEBA 3DTYA 1XAJA 3QFTA 1ORDA 2B6NA 2IY7A 3DOFA 4MIEA 3UB4A 5IABA 2A0XA 5CURA 3ZIAA 2QLTA 1JHVA 4UM8B 1I80A 3P0HA 2HLNA 4CNQA 5AW0A 1AO3A 4A2PA 4BNJA 1Y81A 4YRSA 2XDQA 2QP3A 3EZ9A 1YE3A 5HILA 1Z4NA 2O8VA 3T5DA 3ZE9A 1FQOA 1FX1A 4TS4A 4OLFA 4FYIA 2PH1A 4PHFA 5FUBA 2NT3A 2GZ1A 4DLVA 3BRCA 3C1TA 1YIOA 3C8ZA 3RSSA 1VI2A 3TTWA 1NE2A 1WBJB 4DMGA 6REQB 3GT3A 3U7GA 3SU8A 3E9YA 3ESRA 4XLTA 1FNBA 1UMDA 1B76A 2OQ2A 3DDNA 3A31A 3FKJA 3OQPA 3T12A 2YXNA 3BRWD 1Y9ZA 2A0FA 1V95A 4Q4JB 1Y5IA 1AXEA 3G9TA 1CUXA 1WKBA 5DU2A 4MHSA 1LWNA 2OBMA 3T61A 4RVOA 4KE6A 1H8HA 1XJ5A 5CFOA 1FNDA 2OXCA 2QJFA 3Q87B 1WZCA 2NSHA 1U9JA 5CB4F 5I8WA 1V8ZA 4QBGB 1THTA 3IR7A 3WWYA 2QBYA 1D2HA 4BEVA 1MJNA 4LYAA 3MLAA 2YHAA 1DARA 1XF9A 3TIIA 5BY2A 3R3VA 1RM3A 2RGWA 4JLNA 3OEED 5D3KA 3WBJA 3QVWA 5IZCA 1YQTA 2FYTA 4JAVC 3QEJA 2O59A 3UWOA 1PBTA 5IJXA 4TMXA 2XUQA 5TPWA 3W0LB 1NJ2A 4U7TB 4X62B 3A4YA 4I19A 1WD7A 2V7VA 4UTVA 3IGFA 3F4LA 3E7XA 2CBZA 4A7PA 4LTNA 5ITSA 1A7JA 4MB6A 3PGA1 2MYTA 1B8UA 2I1VB 3E9EA 1T0HB 4X66B 4NI5A 3SBEA 5LMUB 1E79D 3Q40A 5IKOA 1C4XA 1TXGA 1AQLA 1F1BA 2P4QA 5EG5A 1TD9A 2IF2A 2WZQA 3MWEB 2GAAA 1CVRA 4ZJYA 4NX2A 3B1VA 4RADA 3HSSA 1VCMA 3ABZA 4A0HA 3CLTC 3ADOA 4LHVA 5ANRB 4QNRA 2EHJA 3HCAA 1AN9A 1OTXA 5FKJA 1D5WA 1MQAA 1T6NA 1XTKA 3QXHA 4QQ8A 4YDRA 4ZREA 4BLTA 2RH8A 2P6UA 4LRTB 4EUHA 3DHYA 3DO5A 3ETLA 2BFFB 4DUPA 1H2ZA 1PQUA 1ZJ6A 1GPMA 4AF8A 2ZUEA 3RC2A 4GQIA 4DIUA 4FNMA 5ER9A 3A1NA 1X1AA 1Y4DE 2IS6A 2GAOA 1DKNA 1KVQA 2BM0A 4NHOA 5AVKA 5DIZA 2HV9A 1D6SA 3DTVB 4QGHA 2J85A 3G2LA 5LLDA 4ECEA 1KDTA 4Y9TA 2R7LA 1KGSA 5DW3A 4AS3A 5LJIA 4G1BA 2B8EA 3FHOA 5BYAA 1CUWA 5LP6C 1XWIA 4WNIA 4YTEA 5D3MA 1RZUA 3ZKAA 4C1BA 2PMFA 5EAIA 2H2FA 2OCIA 4RHFA 4NS1A 3W34A 3R3JA 3FPBA 2RH4A 4IMRA 4CMKA 5HTOA 3K0AB 3TXAA 1BOOA 3I1FA 2YFQA 1ECGA 4IHQA 2WSLA 3LLSA 4BNZA 1JVBA 5LWQA 1GQ2A 2C5LA 3K30A 1YQWA 3BX1A 1YJCA 4NQRA 3SLGA 4CKEB 2EKZA 1N7GA 2ZUVA 2QHXA 3LW7A 2W11A 1MC1A 3HRHA 1V4BA 3CF0A 1TVMA 5BSRA 3SVLA 3KZKA 4MI1A 1PSZA 1L7PA 1JTFA 1SC9A 2WKQA 4DCJA 3CR3C 4LJKA 3HBAA 5E7IA 4H0CA 4UARA 1FX0A 5LKAA 3OM0A 3OX1A 3ZJYA 1N2HA 2C2BA 4YRRA 3O5AA 4WV3A 4RKQA 2C2WA 3E58A 4L8VA 3MCUA 3UQYS 1RQ2A 1EFRA 5KU1A 1A4UA 2CGEA 3F9IA 3KKPA 4OUDA 4AXXA 3NDJA 2PO5A 4G1VA 1SCQA 2OHJA 3P97A 2R3SA 2UV8A 3MZ0A 4YYZA 5K05A 4PZZA 3V7FA 5BSKA 3MB5A 1SWWA 5E2BA 1AM4D 2EJTA 4P35A 2XZDA 1SHJA 2DECA 3VU0A 4AT1A 1NR1A 2IP2A 2V6IA 1UZLA 5CK4A 4QODA 1D2NA 1XD9A 1YQQA 1C2YA 3BD6A 3DPIA 3KSZO 2H5IA 3CH4B 2F1OA 2HFKA 3R3SA 4EHNA 2HM7A 4H7EA 3WE7A 10MHA 3O9ZA 1MP0A 4AECA 3KT3A 2ZYGA 2PUBA 4H3SA 2V3VA 4KI7A 3DHNA 1J23A 4Q47A 4TQUS 2H5EA 4YJHA 4RTLA 3L43A 4Q4AB 1SELA 2G07A 4FE3A 5ITZA 3KXIA 4ZXPA 1W94A 1I4DD 3QVTA 2W98A 1NX6A 3AR2A 3KELA 5CDHA 4L8YA 2BZGA 3KKLA 2FEAA 2QX4A 5CA0B 1IN1A 2FW7A 1A7AA 2WKSA 3CY6A 2BLNA 4DNOA 4UATA 3EZ2A 1P1KA 3MHTA 1XSEA 5KQPA 3M0EA 3QUQA 1APBA 1UAGA 2I1QA 2EKQA 3H13A 3NB0A 2O06A 2IZ0A 2VJYA 3KYDA 1KRXA 2RK3A 3SM3A 2IYFA 4IDBA 1UDRA 1WOYA 2BSQA 1BGWA 2YHIB 1MA0A 3EGWA 4GI3A 421PA 3RS7A 4WLNA 1TU3A 1SHTX 3E4CA 3H5IA 4JB3A 2BISA 1T1GA 4R1QA 1R18A 2JNWA 1TYCA 3MWDA 3NC1C 1Y6JA 4J7UA 2GD6A 5EE3A 1EEHA 4ILEA 2FMFA 4DCPA 2RGBA 1JEDA 1YQXA 5MFZA 3SZOA 1X6VA 4AU1A 3WL8A 2XVYA 4KTVE 1NMYA 2VRNA 4U8HA 1MENA 1MEOA 3LPMA 3NAZA 5LMZA 1DLJA 2GK6A 2WC1A 1JA0A 3T9CA 2AKEA 1M72A 1XVAA 2PQMA 3CZ4A 3KYJB 1IJFA 4OXRA 5E3HA 4OYHA 4ADSG 5GWXA 2OCDA 4R3NA 2VF2A 2BGTA 2O20A 2Z83A 3M4XA 2HOQA 5FI5A 2AF4C 2CYBA 1N2CE 4YT2A 3EQ2A 1K8XB 3CNQS 4L07A 4ARIA 4GOXA 1D5CA 2JJ2A 3BTSA 5LMCA 2C9OA 2VYVD 2XF8A 3D4BA 1ISPA 4FS3A 3IS3A 3UKDA 4O8ZA 1KWGA 5DRYA 3WDLA 3GCXA 5ILOA 1G19A 1XDDA 1NFRA 2XGMA 4O4HF 3TCKA 1V3UA 4NWIA 1JEQB 4HJRA 2RSLA 3FNQA 3G85A 5CX4A 2JGRA 4M0CA 5H3LA 1PJZA 3SZMA 1VSQA 3E0XA 4JJKA 3VSCA 4KLAA 2FV8A 4F96A 1G21A 1LTQA 4UUQA 1NPTO 5KNDD 3WWCA 1JR4A 1KS9A 2JAPA 2XSZD 1OYWA 3E1SA 1WLSA 3KU1A 3WJ2A 1M8FA 2W2TA 2R4TA 4UBOA 4ACBA 3FR8A 4V02A 1U0SY 4D5GA 1B8OA 3NV7A 3ENKA 1BKSB 1KERA 1ZU5A 2EOAA 1MOQA 1WW2A 2NMVA 1E7RA 1S9HA 4GF5A 2EL7A 3H75A 3O7WA 2X15A 3M81A 3GGCA 1T5IA 1DOAA 2QT1A 3NVMB 1L5ZA 5G0UA 1SUWA 4A0RA 3COPA 4EYKA 4NBUA 1PFVA 4LMRA 4UQLA 3PQCA 2VJCA 1ECBA 4E32A 2EIHA 4OKSA 4P4UA 1AKNA 3NP7A 2RC5A 3ZQKA 4AKGA 3N6XA 4JNCA 2B34A 1AJEA 4KITB 2VDNB 1AKWA 1EJ6A 3ZE6A 5K6TA 4GBJA 4GXRA 3NBZC 4N8SA 3F49S 3GEGA 3S1AA 3D9QX 4ESHA 2J46A 2FMIA 1Q0HA 4V0NA 1O58A 4JROA 2GK4A 4MVJG 2VXCA 3N2KA 4F4IA 5FOTA 5ALVA 3IDOA 1T1SA 2M1XA 4DNPA 4EA7A 4B6EA 3IEVA 2JLSA 2Q41A 3IBGA 4QDUA 1XF1A 4RH3A 4XLLA 4ZODA 5KOJA 3S5UA 2O5RA 2JLZA 3KQMA 1ITZA 2DJ5A 3M70A 3CPEA 2O7RA 3KYCB 1HE8B 1M6WA 2WKPA 1FRQA 3DGEC 3PCXA 4X9XA 2REQA 1ZK3A 4KQKA 4E5VA 1XMVA 4US1R 1EAMA 1JHZA 1WJGA 3M49A 5EIOA 3UK1A 3VZSA 4B43A 3EPLA 1QF9A 5DCUA 5F35A 3EW7A 2FKNA 1Q3KA 2JZCA 4UNQA 2A1TS 1Z18A 4W5HA 3AR9A 2I7DA 3OCXA 1Q7EA 3SEZA 4E12A 4QTZA 3IAHA 1NVEA 2C5EA 4KIFA 3FPKA 3HDQA 1QO7A 3C3KA 3HKBA 4ZVOA 3U4IA 5KYVA 1W34A 3SJBA 2ZWPA 1XFDA 4TGLA 3ZE0B 3HJFA 1GU7A 2Q6VA 5A04A 1SY7A 4I50B 4IZIA 5HQ3A 4PAMA 4FZ5A 3D4NA 1U2QA 4RQUA 2NNWB 3VAYA 1HNWB 1PL7A 2XT6A 3EA0A 4R8MA 2XY4A 1RAFA 2RHLA 3T7JA 4W5QA 4NV0A 3WA6A 1NPYA 1X7ZB 1YQDA 4E6EA 2R86A 1MX5A 3F78A 4WCDA 3I32A 2JLVA 1N25A 3D3EA 1UF9A 3TVDA 2X41A 5L7TA 4KPYA 1T1EA 2NTYC 1V47A 4UVIA 1QOPB 1UEJA 2C20A 1NDHA 3O92A 3N7TA 1N6IA 5HOEA 2X40A 5K0BA 1GL3A 4P98A 5I7RA 5JFOA 1P75A 4KXVA 2Z08A 1YGPA 4XWTA 3KETA 2QTRA 1UKAA 2JFUA 3OIDA 1PWEA 4MMZB 2Q6LA 1ODSA 4O2BB 3N8HA 3NHMA 2HKIA 2AFHA 4A27A 3GDHA 3QEOA 3DH0A 4OHBA 4C7XA 1A8SA 1P1FA 4D42A 2EZ9A 1G8KA 1QYDA 2AFIB 2VDWA 4DPMA 4Z7NB 1AQ6A 4Q02A 2CV1A 1FJHA 2F8TA 2HMYB 2P40A 2N9UA 3PVZA 3PDUA 2XWQA 1T2UA 1E62A 4NJEB 4J0GA 1B6GA 5JH7F 2GUGA 3AUYA 3JRWA 3HKEA 3NNSA 1E9DA 4JLAA 3IMCA 4FINA 2CLKB 5AESA 2C77A 1AB5A 4RPJA 2BGUA 4PSVA 4F5EA 2C0QA 1Y6GA 4Z53A 2O14A 3UCEA 1YL6A 4DRZA 4YV1A 2HSWA 4G8CA 1TMOA 5T57A 1C1DB 4HN9A 2O07A 5DSZA 2GAJA 1P6QA 4IQ8A 1I7SB 1T5OA 1RTTA 3NMUF 4K9QA 2BI8A 1MABA 4D9NA 1GR0A 4AZ3B 2P9BA 2XBLA 4FDVA 4L5CA 1PEAA 1XZMA 1YBMA 5FEMA 5J43A 2FG5A 4QU8A 5JEDA 3ZVMA 1Z4OA 4P1ZA 2EGGA 1UANA 4FDAA 1B6SA 1CULC 1F0KA 1Q6YA 1EWQA 3BJZA 1A27A 2NVWA 3N2EA 4ZYTA 1OILA 2JIPA 3FY4A 2C7PA 1UXKA 3RJTA 1QQBA 1BHO1 2EJVA 2EU8A 2OESA 3AXTA 2UYHA 4LDNA 5EWLA 3RE1A 4FMCB 1J8VA 2OLJA 4M0FA 5HZHA 3V8QA 3T0FA 4B2LA 3PC8A 3KSRA 1C7EA 2HIGA 1J5XA 2VS1A 3TPZA 2GCOB 2YV1A 5JOQA 1Y8RB 2W6CX 1D6JA 2Z6VA 3EGIA 3WWEA 5LOVA 3TNLA 4YRFA 2Y67A 4Q3AA 3MQFA 2FEXA 2WRZA 3RU9A 2J41A 3NT5A 4JXZA 1TQ2A 4RF4A 4MTCA 5K2MA 4K9LA 4C89A 4ZCIA 1ZQ1A 3WL3A 1NI4B 5D5PA 2XT9A 4J2HA 2JFZA 1BDIA 4ZEWA 3CWQA 4R16A 4DCVA 3HVRA 4EA6A 5BQPA 1FVFA 1R3DA 3L40A 1NU6A 3H1TA 3PK0A 2W2NA 3CCFA 3AHFA 5F9HA 2AK3A 2AN3A 2PE5A 1DRUA 4DR5B 1AY0A 3QUBA 4FKZA 4MR8B 2FLVA 4ZJPA 2QRZA 2WWRA 3L82B 2WIKA 5DI9A 1L8OA 1ELOA 6ABPA 4FQ8A 4ZO9A 3UAOA 1A69A 2NNLD 5EHGA 1PJ4A 3CVYA 5CLFA 5JALA 4XI9A 1T5SA 1XRQA 2YL2A 2M98A 4JBXA 2R66A 5KHOC 1OKKD 1U2GA 2I33A 5CYPA 4QOFA 2VP9A 3U7IA 1LQUA 3HHEA 4FYVA 1AIPA 5IDWA 2OYSA 3EWSA 3D2AA 4X1YB 1P91A 4TS1A 4GLOA 1WXXA 2A5GA 4GBMA 2ZRIA 1FDRA 2EBWA 3H97A 1G17A 5DP2A 3A1UA 3F67A 5IT9A 3L41A 5DMHA 2J7KA 5G40A 3OEHA 2XYVA 1OZFA 2JA2A 2FSGA 4V0OA 5JJLA 1Z07A 3PRKE 1X1EA 4CVNA 2J9YB 2BTQB 2A4MA 2BUBA 3PA6A 1WKCA 4FW8A 2FQYA 1MB9A 2NVBA 4R4JA 4UKDA 4CF4A 4E5KA 3LC7O 1B4DA 4JT2A 4AM8A 2XXAB 4O63O 1Q50A 3UMSA 4D6XA 1CS0B 3EEFA 4GOKA 3UJBA 1LV7A 3AU9A 1B93A 1D4AA 1JHMA 2QTAA 2QX9A 1QK3A 5EN4A 4R1OA 1E9SA 3IUPA 4HGPA 2ZUFA 3T3NA 3PL5A 5CT5A 5AXCA 1DZIA 1E5QA 1ZUIA 1SHLA 1Q11A 4XZ3A 3JQAD 1YOVB 4B31A 2DERA 1XKXA 2I9KA 2G5GX 3S8YA 4ISBA 4X84A 3C5HA 1A9PA 2W2VA 2HPHA 1TD1A 1X87A 2XMCA 2YV5A 3FMPB 1BCRB 3KT0A 4OQYA 5H02A 4E7OA 3OZ7A 1MXFA 3QENA 4XLZA 2D0DA 2HO5A 2VPZA 3H0EA 1UWCA 4RHYA 5EJMA 1VP9A 3EMDA 4FYHA 4XUEA 3NJ4A 4NVRA 3TIGA 4BFSA 1XZPA 1UKVY 2DRIA 1CD5A 3K09A 2PXXA 1EQ2A 3M4YA 3PUVA 2QX6A 4HY3A 4RD2A 1PWYE 2GILA 1CF9A 1WZNA 1BE0A 1NUPA 1FSFA