2O8NA

Crystal structure of mouse apolipoprotein a-i binding protein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
233
Chain Sequence
AVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Characterization of Apolipoprotein A-I Binding Protein, a Novel Phosphoprotein with a Potential Role in Sperm Capacitation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords ApoA-I binding protein
total genus 75
structure length 233
sequence length 233
ec nomenclature ec 5.1.99.6: NAD(P)H-hydrate epimerase.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 2o8nA00
3RS8A 3RO7A 3ROGA 3RRJA 3RS9A 3D3KA 2O8NA 3RSQA 3RT9A 3RTDA 2DG2A 1JZTA 2AX3A 3RU3A 3RSFA 3RTBA 3RRBA 3K5WA 3RSSA 3RRFA 3RTEA 3ROZA 3RTGA 3RU2A 3RREA 3RTAA 3RSGA 3RNOA 3RT7A 3ROEA 3ROXA 3D3JA 3RTCA
chains in the Genus database with same CATH superfamily
1VKRA 3WGGA 1C2YA 2I66A 2IWRA 5IXSA 4RE6A 2VP2A 4AF8A 3A1CA 3UGJA 4ZICA 5DU2A 4P0TA 3E5MA 3ZDQA 3VI4B 1PKXA 1KO8A 3GP3A 1W1UA 3IT3A 3TNJA 5BORA 2QTGA 3D5EA 2P9QA 3BCUA 2NU9A 4NBSA 4UUQA 5H1YA 1ZD5A 5B37A 4LW8A 5TJHA 1DAHA 4HDQB 4ND7A 2G9RA 4DRXA 2B0JA 2QN3A 4L51A 3ACCA 4O2RA 1LBTA 4X6UA 1LFDB 5JI2E 2VATA 3HV0A 4QOIA 4A0SA 2KWIA 3NTLA 1LDYA 1I01A 5LQRA 4NIMA 4PYNA 5JZOA 1Y37A 1WCXA 1W0JA 2ZWOA 3K6JA 1LLCA 5HG0A 4ZYYA 2V8OA 1J8MF 3OZCA 3ESZA 4HQ6A 1IXYA 4FHGA 3OCYA 5I5GA 1YOBA 3RSZA 1E89A 1N2JA 2IOFA 3ZCPA 1M9NA 4ALNA 1C8VB 5JEDA 3BRCA 5AM3A 4H6PA 1ONPA 1V95A 1SK9A 2ZZKA 4HQFA 3UPTA 4FNAA 3N7UA 3OWOA 2HIAA 4Z9XA 3REQB 4LFCB 3EOAI 2ZI9A 1MAUA 4J0HA 2PL1A 3B9RA 1OXVA 4BX3A 2AJCA 1JDJA 4WOJA 3GX1A 5KWVA 2ZXUA 4QOSA 1I6LA 1U7PA 4FE3A 3RABA 2VP9A 1U31A 4L8FA 2HCJB 2ZI3A 1KL7A 5DN6A 4GSYA 3ZIDA 1JG2A 4CU5A 5IFLA 3EGXA 3TQTA 3DVLA 1IULA 3DE2X 1Q15A 1KETA 2HK8A 1Z36A 4JENA 2X23A 4XZ3A 1TEVA 1T6ZA 5BV7A 2OA0A 4MEAA 5AJVB 5DIFA 3DDZX 3M33A 4KXMA 3P0FA 4RVDA 5KKNB 1I1NA 1NBEA 1H65A 1XZBA 4B87A 4O8ZA 4OAQA 1I5RA 2Z9DA 4F9TA 1KK1A 2MYNA 1GNRA 2G9VA 3E48A 4LXHA 1DXHA 4RPKA 2PJUA 1E94E 1WVIA 5KYTA 3GL9A 1SNYA 5B2ZA 3DOJA 2ZCJA 3ESYA 1WL8A 3AF2A 4WBXC 3T54A 5LWQA 5HR5A 3SBOA 3JQ9A 3CKYA 2F8TA 4TKUA 3B52X 2OBFA 4J1SA 3RFCA 2WSLA 2IYZA 2IHNA 4Q1AA 4BVKA 4QT4A 1WTCA 3I2IA 3TZKA 2DYKA 3EJWA 4X7RA 5JFOA 3G2MA 1WIWA 1YQEA 4R8LA 2VF8A 3SP1A 4H7FA 1FUIA 4EYOA 3QLUC 2D8AA 3H9BA 3ETDA 1WPGA 4HNVA 3OA0A 3ORHA 5L7WA 2JI4A 2B9EA 3DONA 3TZEA 1N9GB 2ZTHA 5AJTA 3CQ9A 2VNSA 2QTVA 1Q84A 3DOEA 2GB4A 3GFPA 5DGCA 1Y4DE 3OAAA 5CCEA 1Z2CA 1LDBA 4KO8A 4WBNA 5CFMA 1N6LA 4B3FX 3STYA 5D5HA 1TDJA 3RLIA 4E5MA 5J4LA 2FR8C 3HBJA 1S3FA 4Q01A 3REOA 2QG9A 1RC1A 5K20A 1R0BA 4ZAFA 3VPAA 4CCYB 3PJGA 4PLVA 1BIFA 3QMVA 3GW8A 3QJ5A 4QPPA 1CLEA 5EHGA 3ZHBA 5GJBA 1M6VB 3KZXA 1RM4A 5GAJA 3AJDA 2E9SA 4L5JA 3ED5A 3WL7A 1RACA 1YGYA 3QNWA 4CF3A 1Z0ZA 4F3KA 1WQ1R 1XMOB 5JFTA 1WUHS 1G8FA 1EWVA 4C21A 3T3IA 3FTNA 3PPVA 4PO8A 3T5PA 4I2VA 2W98A 2O8BA 2XF2A 3OM9A 2I2AA 3K1ZA 5BQXA 3VZCA 1DKNA 1DBIA 4Q1FA 5M7EA 4I3GA 2G1JA 3FOEC 1VJ1A 4ZTUB 5H59A 2Y9MB 4ISBA 4MQFA 1HE2A 2VNJA 2PJDA 2IPXA 2E2WA 1QH9A 1VXRA 2Y6VA 3JQGB 1V4VA 3HJNA 4QYSA 3E22A 2FXIA 4FD2A 1WW3A 4PHCA 4OI1A 2OWEA 1O6FA 1V8PA 2OXTA 1TM2A 1WTAA 4J7XA 5CBPB 2AKEA 1V11B 4D9EA 3S27A 3MOSA 5REQB 3U9TA 3CWZA 3VVLA 4N40A 1XKLA 5KTRA 5HVNA 5HK8A 1KRXA 2V8BA 4H1TA 1JT2A 2ZRNA 4G41A 2D2IA 4L50A 4N5DA 1O94A 4C29A 2BGGA 2G1KA 3WP0A 3JYPA 4R2HA 3RC8A 2J0SA 4P7KA 2B83A 1B1CA 2XDYA 1LV7A 4ENQA 2IHZA 3QKUA 1OTXA 1UXIA 3FCSB 1USVA 3C3YA 4HAYA 1R88A 4LWZA 1P1FA 3ZYZA 4DHWA 3FJ1A 9ATCA 5DWQA 3A7DA 3NUGA 4DMHA 4E15A 1L5YA 5TMBA 1HV8A 4AMYA 2EV9A 3QU5A 5JS7A 3OJEA 5CDFA 5CYOA 5TF4A 1G4AE 1WF6A 4Q3BA 3RRNA 4TTJA 1MW8X 2EFDB 1S02A 2XVAA 4AQ7A 2ILVA 3PIDA 4PICA 4GP7A 4YMHA 5AW7A 3RS9A 4EKDA 3NAMA 1ZXBA 1ZEJA 4DOMA 3PPWA 3R77A 4MUJA 5DP1A 1LS1A 2YUTA 3E82A 4E14A 4EP1A 4IDPA 5F5NA 3CRW1 1NHGA 2IDJA 4YP1A 3U39A 4UNRA 5ICCA 4RIHA 3HWSA 2IYXA 1PN3A 3BGVA 3A32A 3EA5A 2BOVA 1A9RA 1FLDA 5FB3A 3RGGA 2KYRA 3RJZA 5D8DA 3THXB 1N3IA 2XQVA 2NSDA 3UWMA 1Q1GA 3HCCA 2Y2VA 4M1QA 3VQTA 4MMYB 1DDIA 1V4BA 1PR9A 1SCQA 3CLUC 1CERA 4DLVA 1Q44A 3HCAA 1JLLB 5DT9A 1PNTA 4BO5A 5CLJA 1Z25A 4FTWA 4UM9D 1XAHA 3MT8A 2NVWA 2RJNA 5CXSA 1LW6E 4ZODA 5BYBA 2PWZA 4H7JA 3ESDA 1YK0A 1PT6A 3NEYA 1W25A 2P0AA 4KUGA 1LDMA 2V3CC 3K96A 1BNCA 2CYAA 2PNFA 4ZQFA 5AVSA 6Q21A 5ILOA 1TL7C 3IFSA 5BN1A 2AG0A 3EIQA 2NVOA 4OKNA 1WXIA 5AOVA 2NPFA 1UFVA 3ETJA 5CHEA 4CUZA 1C41A 4DREA 2J30A 2P77A 3UUEA 2QVCA 2JLUA 4RFSB 2C5GA 3H1AA 1KI1A 3H2GA 3AEYA 3USZA 1E9CA 2QN7A 1JVSA 3G8AA 1DLIA 5B1EA 5IAAA 3A9RA 3K0EA 4PANA 2IOFK 2Q7OE 5IXJA 1G66A 1A2QA 1J09A 1E59A 1QC5A 2VQ3A 3BERA 4IDCA 4XOUA 3UJ3X 2QWXA 2PSHA 4I36A 2WD9A 3FSEA 4HN2A 4OU5A 4YAWA 1NOKA 2Q5FA 2YYSA 3E18A 1QH1B 2R7LA 1NUQA 2ZDQA 3DVSX 4PZYA 4KN5A 4YC7A 3SVTA 1R6XA 3O8QB 5K2MA 4CMJA 2MCFA 3SSOA 3ZJYA 2R8XA 1CQPA 1Y3AA 2CJYA 3BFVA 3DR3A 3IX7A 4I1SA 3TIVA 4B7XA 5IPFA 5T5QA 2I4IA 4BZZA 5EGSA 1XJCA 2RAUA 2WKRA 1ZCBA 1PNQA 1Y3FE 4C5AA 4LQLA 2R7MA 5LJIA 2XE6A 2ZVQX 4EHJA 1SBIA 1J0EA 1NQWA 1DMRA 1XRSB 3K92A 4HWOA 4B48A 1PDOA 3AESB 1E0KA 5F4BA 4EUEA 2EG9A 4IIYA 4KR0A 5K0SA 1WB5A 3RARA 1UMDB 1Z15A 1VJTA 1BRMA 2HQOA 2J9FA 3A9SA 3GV0A 4FLFA 5HDBB 1ONBA 4M3NA 1TZCA 4G0ZA 1BTOA 3ZXUB 2TSYB 3D6MA 1QB8A 3QV2A 3B89A 3MCVA 3PF9A 1CEEA 4PAGA 4RHEA 5JWRA 4FSHA 2HMVA 3HFSA 4RSHA 3D7MA 4V0NA 4ZCLA 1PNRA 1SCDA 3B1XA 1N7HA 3H0KA 4L0DA 2EAUA 3L40A 4EELA 3T7IA 2MOKA 2QTCA 4NONA 2P90A 2BFCA 2WHQA 4JQZA 3GEIA 3EHDA 5I45A 5CTJA 4MPTA 4L6CA 4RPGA 3O8NA 1ZK1A 4LYYA 4DR7B 3HCOA 3SD7A 3PRJA 3F1KA 3HO1A 3K1JA 4RS4A 3UWDA 3OPVA 1IM2A 1WPQA 2HH9A 4TMXA 1EX9A 2CZCA 4LJ4A 3VR5H 2JEZA 4NU5A 2PL9A 3ZY6A 3HDQA 1DV2A 2JCBA 5DBHX 5EJAA 2O8VA 2FB9A 1Z6AA 4XDYA 2B2CA 2XIQA 3KG2A 3PCRB 3FDZA 2H1HA 3P9ZA 1USGA 1R5JA 1UKYA 3DLCA 2VHTA 4BC1A 4BN5A 1UL1X 1DOHA 5CFNA 1B0AA 3RVQA 1AC5A 1W19A 3H42B 3UWPA 5EIEA 3WFZA 3EDCA 1JJ7A 3A6HA 2FEMA 1O9HA 1Y1RA 3WYAA 3IQZA 1TZ2A 1GTG1 3KSZO 5BOSB 1FL9A 4JVSB 1Z16A 4IY1A 2NZ8A 4MVJF 4RH1A 1GQRA 2UZ1A 4FR5A 4JQCA 3SVZA 7REQA 1IN5A 1QB7A 4KEAA 5ELMA 1E9FA 1S4QA 3SFZA 3K0FA 2JVIA 2Q5LA 3EDOA 3SC4A 3VNAA 3ZGOA 3BGDA 3NZEA 1RC8A 1DBWA 4GPAA 1MIOB 4YRLA 3KHTA 3V2UA 4E0BA 1CPYA 1DUIA 1RLJA 1WBBA 2V1UA 2D1YA 2J67A 3OLQA 4AIRA 4I5DA 2GPTA 4R1TA 2QW8A 2MT9A 4P32A 3HJTA 5H81A 3OZXA 4CLOA 1W1WA 1ENYA 2GRJA 1UP4A 1Z5NA 3IUBA 3TLYA 3CA8A 4KFTA 4RD1A 2EVWX 4BS9A 2OCBA 4W7SA 5LB4A 4F85A 4NOMA 4NCIA 2C7GA 2W71A 1EFUA 3MINA 1P2GA 2WDPA 5TMDA 4O4IF 3NDJA 2VN8A 4B74A 2GAFA 4K86A 4D97A 4DJEC 1E4EB 1PDVA 2O7RA 1E2LA 2JFQA 4LXGA 4N7BA 4OIFA 1AQUA 4PZDA 5KTPA 2C2YA 3IEPA 2PX6A 1NNLA 1JG4A 3VH1A 2C5AA 2BTQB 4K40A 1VL0A 4BNKA 4B09A 1NAHA 3KVVA 1WKVA 2VAWA 4UZFA 1KNXA 4MV0A 4OL0A 2D7JA 1PJLA 3VDRA 1D1SA 3I6IA 2DQKA 3O1HB 4LIPD 4LWOA 4EA9A 3MB8A 3R3ZA 4PVDA 3LBAA 1I32A 4Z4QA 3E3NA 2G04A 5MGBA 1IB6A 3WDSA 5J3JA 1ULSA 3S4YA 2YTZA 4Y6RA 2G5CA 1BGXT 1FDUA 2A0FA 3GELA 3TRIA 2PFSA 4J43A 3ZG6A 1JRLA 4IV5A 1R10A 3CKMA 3FYDA 3L79A 2V54A 1E7SA 2G63A 2CYBA 2D5IA 2R6DA 3BMOA 3L8FA 4I9NA 2WU8A 2WU0A 4KLCA 4PZEA 1VRCA 1T91A 4RK1A 1DFGA 2OHHA 4FNOA 4FCCA 4ZOBA 3IOBA 2IHJA 4ZO9A 3N2KA 1S0UA 1GUFA 4WKGA 5IVHA 1YQQA 4M55A 2JBHA 4A7PA 1RZ3A 4LCBA 6CHYA 3FR8A 3ILVA 3ONNA 3WLHA 2JAXA 1WUKS 1RKUA 3KXLA 1X13A 4JUDX 4PTYA 4YREA 3SZMA 4H9GA 3GUUA 3V2HA 1XNQB 3K9QO 4PGGA 3V8QA 5A3VA 3JR3A 4QO8A 3PXXA 4D9BA 1JW9B 3KEQA 3O26A 3KQSA 3CG4A 2AXQA 4AKSA 3EOZA 2VDWB 4IQ8A 1G2PA 3QMMA 1R8QA 3AX6A 1AKQA 2ZB2A 3S6JA 1SUIA 1I2DA 2J9XB 2VK8A 3SQMA 3AHDA 1MABB 2BTQA 1XVUA 3TSOA 4QAJA 3WMRA 4KQMA 4D8VA 4GR9A 1T4BA 2BCGY 4DV3B 5AK4A 3ZEAA 4AZVA 1YA6A 3UUFA 3N2ZB 2J3LA 2IYWA 3CISA 4CMAA 1MRZA 5L8VA 2C9BA 2O1WA 2X22A 4FCTA 3RSLA 1HNWB 2ZUCA 3ONEA 2X2PA 2EZ4A 2NYUA 3V4LA 2J0QA 5JECA 3EMVA 1NA5A 3OU6A 2FN9A 1SUBA 4WOBA 3KT8A 2E1PA 3STWA 5MF6A 3VMMA 2JB9A 4GX0A 2N9UA 4PFQA 4Y6QA 4TYWA 1ZUWA 4INPA 2V6IA 2XBUA 4E11A 4DG5A 5EWMA 4R40A 3HXKA 3RSGA 4X97A 3RC2A 5TIIA 4Q7QA 1W5AA 1VP9A 5IWCA 3M9XA 4U4AA 1VPVA 1X8JA 3JQ7A 4BFSA 5L6MB 2QNRA 3RWBA 5J2UB 2DHQA 3L4JA 3WP1B 1JKJA 1NBME 3VPGA 1E6UA 1V7PC 2JI8A 1PQ4A 5CK4A 3AY6A 4CF7A 1Z08A 1X94A 4NFYA 1ZH8A 2PU5A 4D8UA 1JDBB 1U63A 2YW2A 1UP7A 3RTBA 2P27A 3DHVA 3LBHA 1UWKA 3IPXA 3M9LA 1ZA1A 1DWOA 4EY4A 2J9YB 1JJFA 2JLAA 3Q1LA 2QZ4A 2PIAA 1IXKA 1NWCA 2O2XA 2OYCA 4CE6A 3RREA 1D1PA 3FPEA 5T3UA 5FAKA 1TJ3A 3TQOA 1Y7HA 1JSCA 3ILHA 4OFXA 3BXXA 4DUPA 3PR1A 3GLFA 4LRUA 3C16C 1TYEB 2CFRA 3LF2A 4YX9A 1BXRB 3H5OA 4A6DA 1GAJA 1GTZA 1NFQA 5IWAB 3JVEA 2V7EA 3OZVA 2GJ8A 5FYQA 5EINA 3UANA 3VKFA 1AB6A 3AHIA 5EJ9A 1TVEA 4MQBA 2G17A 1JFLA 1OA1A 1K86A 1QYIA 2ISCA 1ISRA 2XUIA 1P0FA 2Q3CA 3DOIA 4J3FA 4KAXA 2J09A 5JS1A 4G1CA 1ECPA 1R8SA 4KQFA 5P8WA 3MJVA 4HQRA 4KAFA 3LOQA 5ALZA 3GRUA 2EFCB 1UMCA 1P1HA 1EVIA 1M1NB 5CFLA 2H5EA 1RRGA 2EBFX 1EX1A 2QTVB 3I8XA 2DQZA 3MA0A 3HA2A 3OM0A 4K9LA 1KZHA 1RRPA 3PPIA 3T12A 3GGGA 4B73A 3GZNA 4MWZA 2X8LA 1JSXA 4DMCA 2N47A 2B6NA 4JT2A 2JFNA 2AOXA 3FNQA 1L3IA 2VP5A 3A1FA 4NMHA 3TGWA 1MEOA 1XA3A 2OECA 2NU7A 1T5SA 2VCYA 1RS0A 3EVDA 3Q7PA 4ZVTA 4KHPB 2VAPA 3PFCA 4O0MA 2HCFA 3QTTA 3BL8A 1ZK4A 2X1LA 1X7GA 2IH4A 3KWMA 2DUWA 1KXJA 1OI7A 2C1ZA 2C3YA 3JYNA 3QA3E 5FUWA 4EBFA 1IY2A 2PUBA 1X0XA 2PUGA 2I87A 4HQOA 4R5MA 4F3RA 4R7TA 4K46A 4L8WB 1KE2A 5JAPA 5T7BA 2WAAA 4W5QA 1HETA 1EVJA 1Z68A 3MS4A 5EKSA 2P3OA 3F5SA 3FVVA 1CUHA 5I8ZA 2NACA 5JS8A 2IPOA 3OA2A 2J3MA 3ZU3A 2EDAA 2GZDA 2OB2A 2BGWA 4RQUA 4KL8S 3UO8B 4WNAA 3DG9A 2OYSA 2OGZA 4ACBA 6GPBA 3JD2A 2VDUE 1NVWQ 2R8EA 3GQBA 5LIPA 2F59A 1PS8A 2B4RO 1E3WB 5EZYB 2FR0A 2WSMA 2VJMB 2ZR8A 3QYJA 4RSRA 4DIFA 1NURA 2EW2A 4V0SA 4W9MC 1JE1A 2O2CA 3CH5A 4ZCSA 4ZYWA 2Q46A 1XNGA 3UYLA 3DWIA 5ALWA 4WVFA 1V11A 3TS1A 4K88A 3ZBUA 3DEHA 4E07A 2A5FA 4C0HA 3F6YA 1X9HA 1CTQA 2P9EA 3HUDA 3LF1A 3BS4A 4BFUA 4N82A 1GSOA 3CSSA 5EVJA 4I9UA 2O3SA 4G5HA 1N2CB 2OG2A 3VYWA 3KYIB 3ZCTA 4HXGA 2C58A 2BHLA 2WUWE 3FF4A 4MUKA 4CWAA 1JEYA 3GNQA 5MFZA 4WDRA 2WTEA 1NVKA 3COPA 2C29D 3IS3A 2IUUA 4I7EA 3SIWA 2XR1A 3NEAA 4U9HS 4HOYA 2CLOB 3EAQA 2NUAA 4EL5A 4AY6A 3HCPA 3BZBA 1N6NA 2BI4A 4BUZA 2W43A 3JZMA 4GPTA 4U2KA 4YDRA 2MMGA 3RT9A 3W79A 2CFCA 1PLKA 3JYLA 5KS2A 3PI6A 3GLIA 2IYFA 2W2LD 2V7QD 2HQRA 4ZJYA 2Y1DA 3LCJA 2G40A 2W22A 3EDRA 5EG5A 1JB1A 1VSTA 1W4BA 3CZ5A 3S81A 2FRDA 2QE7D 3NG1A 2P2CA 4YVFA 1CQZA 5JJIA 2FX5A 3DE0X 3HYTA 4URZR 1C9YA 5LLSA 2W4MA 1M5TA 3G2LA 5EHNA 4YT5A 3TJRA 1NP7A 1XKQA 4KW7A 2WMDA 1KARA 1P45A 3THSA 1A77A 2ZRJA 4GQBA 1QF7A 1IIRA 2CDNA 3NTXA 1ZISA 3ST7A 1CZRA 2ZIUB 5ALFA 3T9AA 5DTJA 1AY0A 2ZT6A 4ZEWA 1K98A 2F9MA 2YASA 1RYZA 1T5OA 4HY3A 4S3MA 4U5XA 1WD5A 2O8CA 1JDZA 2W58A 3C3KA 5CLQA 5ITZB 1X3LA 1FFHA 3LC2O 3FTEA 1MB9A 4YV7A 3NHBA 1MB4A 4W6ZA 3DBLA 1J22A 1WNFA 3LDGA 3OHSX 4G89A 2RHCA 2X3YA 4OKIA 3AJAA 4RABA 3ZCQA 1NKTA 4LWQA 1LDGA 1G3UA 3BDVA 2D7CA 3A3KA 4W7HA 4W1RA 4TXMA 2RGAA 4KN6A 1H4VB 1PS9A 3C24A 3OZ7A 3PX2A 3T1TA 2ZBDA 4MUGA 2JGIA 1QGOA 5TV2A 4C6TA 1ZL0A 3OPQA 1G21A 4URYR 3MRTA 3PJRA 5ITSA 3EPKA 4C7MA 4D79A 2I2CA 2GLXA 2O19A 2MU1A 1V8DA 5AW9A 2PXXA 3HN6A 1HYBA 1VB3A 1IQUA 1QHHB 4UUAA 5T64A 3RIHA 3ROTA 4MGKR 4UJ5A 3S5JA 4O63O 3ROMA 3HVKA 1AURA 1SVWA 3D3KA 3DLAA 3MRSA 3UB3A 5KYNA 1MRNA 4GZ3A 4LV6A 4MA5A 5EP4A 2I1LA 2AZDA 5JPDA 1CZLA 2JFOA 4ZMBA 2VRCA 3HO6A 4N3NA 2JLSA 4RZIA 5EZ5A 3SXJA 2LTAA 1M7GA 3I6ZA 4FFVA 1LJ8A 2DWOA 4I14A 5DGIA 3EPRA 1EBUA 4UHEA 1TUBB 2ZIFA 1L3BA 3JZDA 4LF9B 2PZBA 1PU2A 1W9MA 4P36A 1G38A 4AZSA 2RK3A 4Q7MB 4AJIA 3CURA 2IV2X 4LOLA 5JRJA 2YWFA 3E84A 2YRFA 1DQYA 4RBNA 1CY6A 5AHWA 4HX5A 4AROA 1W6UA 2G4LA 3R40A 1ML4A 5FI5A 3U3OA 3Q88A 1YB7A 5T41A 4ZT7A 2J48A 1L5LA 2XAUA 2D06A 3O8RA 5F51A 1P3DA 3UK7A 2FEOA 2PAFA 3GOQA 4KRFA 2KMLA 4IZIA 1KI6A 1TO2E 2QRQA 5A3QA 1B00A 5LQNA 1N36B 1YZ3A 2OEPA 4MR7B 5CT9A 3F9IA 2XWQA 4YPFA 1SKYE 5ED0A 1FBTA 3ZWCA 2H4HA 4G23A 3D4PA 4U8GA 2IEBA 5DNWA 4WSOA 3CZRA 2VZ8A 3P0RA 1M73E 1PZFA 4X1IB 3LQ4A 2C4HA 2UVPA 1A9XA 1IHPA 4XA8A 4RQTA 2GM9A 3LT2A 3RBXA 4D9CA 4DZRA 1PBNA 1UC8A 3L8EA 5A1TA 3JQBC 3AWIA 3MC1A 3WNCA 3OI7A 2FW1A 4LBVA 2TMKA 2Q1XA 1XMJA 3U7FB 2J46A 4QEZA 4CR6A 4L72A 4OVKA 1EXMA 3MPOA 2XBMA 3WZLA 2DSTA 1LXCA 3MWLA 4DDWA 3OCVA 2DBRA 4OYHA 4O08A 1QXSA 2P1ZA 3AI1A 3D8NA 3ZQ4A 3CLTC 1XLVA 1ZP6A 3GA5A 4IJKA 3GEDA 2V5AA 1XDSA 1EFPA 4ERNA 1MMFB 1WJGA 1YZVA 2FQ1A 4KVGA 4L7QA 3W8EA 4Z6KA 5I8WA 2A9JA 3B3FA 1RHUA 2HDOA 3PXCX 3UK6A 1W96A 3P9RA 4HDRB 1YKSA 2ZR0A 1P6UA 1XEAA 2OGSA 2ZR9A 3U19A 2W2XA 3B13B 1ZSVA 1C2TA 1XFDA 2VWHA 1KI6B 2Z6UA 3C7CB 4MV6A 3S40A 4LFAB 1PEAA 3WISA 3HXTA 4CJXA 2VRBA 1T2FA 2ERXA 2O7QA 2VA8A 3NASA 3EEBA 4IX1A 3T5CA 4D8XA 1U5BA 4HGOA 1QE3A 1J8YF 3Q9LA 4C0BA 1L4UA 1ZAYA 1H2FA 1QRUA 3KQPA 4JLVA 4M9ZA 4A92A 3IAS1 3SKXA 4PZ9A 3IKTA 3WJ1A 2WK1A 4LF6B 3GYGA 2QD4A 4KH1A 1MAAA 3TIFA 1SXGA 2JAWA 4NESA 1IXZA 1H8HA 2B8JA 2E4AA 3E81A 2OK8A 4BQOA 4EYEA 1GU7A 4KPUB 4NBVA 1XNJA 3IPRA 5FF9A 4NBUA 5B64A 4KIFA 4PR3A 1PO7A 3TTSA 3PT9A 3WWYA 2JLWA 2GXQA 2WP8J 2BT4A 3B9PA 5JQGF 5JDIA 4CM6A 3GBPA 4QARA 1HDXA 3SYLA 3WMEA 3HVRA 1E2EA 1FZTA 1BXKA 1HSOA 4HDSB 3DGEC 1RPAA 4GUDA 4BNLA 1HDRA 4YP7A 1N2IA 1ZONA 4X3PA 4DDUA 3OP1A 4UDNA 2PR7A 5HNKA 2QX7A 3FW1A 2ZB8A 1PW7A 3AUJB 2F3QA 2YHAA 3L4SO 1F7UA 2D0OB 4RTRA 5EJ7A 4MRAA 1CJTC 5GPBA 4FR2A 1U3VA 4HAXA 4HWGA 4YB8A 1K27A 2RGNA 2X4DA 4RH0A 1ISFA 4HWTA 3PNSA 1ODKA 3K9HA 4GKKB 3GRPA 1RKVA 1T5TA 5GJCA 5CG1A 4QJ4A 4R1PA 3NYQA 4BVFA 3K5WA 2N3ZA 2NXJA 2HDNB 2YHBA 5SYNA 4ZALA 5IUNC 1UZLA 3MJEA 3BDIA 3EA4A 3C5CA 3HQ4O 2ZYAA 3VJKA 2RHDA 3GFTA 4K6MA 1QZ3A 1RJFA 1NVVQ 2YY5A 1QNFA 3A1EA 2CMDA 4CHTA 4X20A 1E3JA 3FDIA 3KXDA 5EKXA 4EDHA 1HL3A 4HKTA 3B5IA 4LZLA 4PX5A 1P9NA 1W4ZA 2WJVA 1WHTB 2ZRQA 2W2OA 3MJSA 4PX3A 2JGDA 1EZ1A 2ANCA 3GRRA 3RRJA 2X5OA 2X41A 2R8BA 4H7HA 4F5WA 4C4OA 5AXDA 3FUWA 1ZCZA 4L15A 2GGSA 4Z7OB 1C7JA 1D4FA 1LH0A 2UVQA 1IG0A 1GFSA 3IBTA 3CZAA 4LUCA 1WXDA 3RV4A 1NX9A 2H9YA 4DEVA 4FB4A 3ANXA 1R50A 3OEYA 4C05A 4MPJA 4EFKA 1PSZA 3TM5A 1KO1A 3K6KA 4FI3C 1HZJA 1Y8AA 3PDUA 1OWOA 1IQRA 1R0RE 2LVBA 4J07A 2CL0X 2PEYA 2J4CA 2QYTA 2HRCA 3LOUA 1MOPA 5DZSA 1E6CA 2WICA 5DTIA 1KYIA 1SOAA 1EQUA 4YONB 4JWTA 1UJCA 3V4PB 4EPYA 1M72A 1A2OA 1J1ZA 1E3MA 1BDJA 2X8JA 1K5GA 4GPIB 3ULKA 3MGAA 4LGCA 2IYOA 2E3JA 5K3OA 5KSOA 1U8CB 1VKNA 3OCJA 2G6BA 1D9XA 1JL3A 1YZFA 1Q0ZA 1J25A 3ZHXA 1K7CA 4E70A 4RF3A 2AN1A 4EB8A 3LHKA 1PFUA 3QF4A 4OAPA 4U9IS 1EK2A 2HU8A 3WG9A 4FMCF 3ZS8A 5BSKA 3CFYA 1E20A 1W47A 1N2EA 2GM4A 1N78A 3AR6A 4TZ6A 4ZXPA 1K3UB 3PNYA 1VA5A 3K5PA 3VHLB 4X66B 1HDZA 1M6WA 4YNBA 2WNSA 1W581 3CLRD 3HJHA 3AR5A 4HGRA 5EEHA 3T95A 3WGMA 3ZW7A 1AO0A 1T26A 1WE2A 4Z99A 1SY7A 2H0AA 2PA3A 2CHUA 3NDRA 5C81A 1YI1A 2XGSA 1N32B 3BL5A 4JT4A 4ZKEA 3D0RA 4AZ3A 2XWJI 3MJ4A 2IS4A 2MMCA 1LX6A 3IDSA 1Z8NA 1E66A 2C61A 3DP7A 4FDVA 3T1QA 1N2CE 1JEEA 1IHUA 2XTJA 2ZAOA 4QXPA 4KBYA 1PQPA 2B7BA 4BWGA 3AW9A 1KORA 1RP1A 1G6KA 1TJYA 3ZKWA 5H9WA 1NIJA 4D74A 1KIAA 2X9QA 4Q18A 1OXXK 1IN4A 4CM8A 3HPQA 3E5HA 2D5AA 1X1RA 3OY2A 1H2BA 1GKIA 1VLHA 2Y3IA 4KYTA 5I9SA 5IJ9B 4KE7A 2OTCA 4HAZA 2QAGB 3BTUA 5CAEA 1T34A 2UYGA 3KL4A 5J47A 1TAUA 5A3SA 2M2IA 4WXHA 3WZ2A 1A69A 2C78A 4MKRA 2HSDA 1DARA 3QY9A 2I7XA 3ZV4A 4CW7A 4N5MA 1MP0A 5EJ2A 3TE6A 1WB9A 3PYMA 4IF6A 1FLVA 1LY1A 4KPUA 4MKHA 3WKDA 3TLZA 1C0IA 2I3ZA 3HGQA 4PSKA 5MN6A 3ZVNA 3BD7A 3QFRA 1H2AS 2V6BA 4AG5A 1OZGA 2GSWA 1YB6A 3HK2A 4BFZA 3RUEA 3P9KA 1XQVA 3P96A 4ENTA 4BBAA 1E6KA 5JG7A 1TC1A 1HURA 1OX6A 2FOXA 2NUBA 2FUEA 2PV7A 2X6RA 1PL0A 3B6KA 4LSWA 4R8KA 4NSNA 3AIIA 3L7JA 4FE7A 5LL6P 4EK9A 1O57A 2P4HX 2JAPA 4DCGA 2B99A 1CP2A 5A71A 1JAIA 4R9UC 4YCDA 3LK7A 3TB6A 1CUZA 4LX8A 5JSKA 4BLTA 5ALTA 4TXLA 2H16A 3PQFA 1CZOA 2RFLA 3KOWA 3PJFA 1AZSC 2XDWA 2BH2A 2MSEB 2F48A 2VJMA 3DKRA 2YZGA 4GBMA 4HYQA 4JHLA 1RCUA 1OH6A 4BBZA 4B71A 1XRMA 2GD6A 2ZZNA 4FT4A 4PU0A 2D1TA 5I7RA 3LIPA 1RQXA 2ZSJA 2SHKA 3BM5A 2OD9A 3LZDA 2DOKA 4B8YA 1YE8A 3GJYA 4WD3A 2AD5A 3HB0A 4Q15A 4MVJD 1O96B 3V3TA 3UQYS 1M8PA 4J0EA 4KXQA 4C14A 1PK7A 1GN9A 2FFQA 1SQGA 1E1RD 2YJTD 3FKQA 4OB6A 1DO2A 4RGYA 4YWJA 3W5HA 1KVUA 4GF5A 2I22A 4JYBA 4NEQA 4W63A 3TNDA 4L3VA 1GEEA 1XD8A 4EPTA 1XLWA 5A2QA 1GKYA 3TNLA 4ZQEA 5BSTA 3GBSA 3GZ4A 4LNHA 4M6WA 4EJ6A 2NTYC 1A82A 1XALA 2IXDA 2OMKA 1GZ7A 1NVUQ 1OKKA 1SKQA 2XUKA 1V96A 3L6RA 3UJBA 2HIGA 3AEZA 3OUTA 4NENA 2MSKA 2RONA 4NABA 3C3CA 5EERA 2BAGA 4R41A 4OOFA 1XPRA 1HDYA 1Y4SA 4JUCA 5HEKA 3EEIA 1JQKA 2WJIA 1H23A 1QVZA 1TYDE 1LF0A 4QBFA 3KNZA 3OMLA 4RA6A 4URHA 3TLEA 4JI5B 4DMUB 5LU9A 4E08A 2V1XA 2XOKA 3SIRA 1U80A 1ZH0A 5ECYA 2OV4A 3Q98A 4HSGA 2EBUA 4MHOA 4R1UA 3D8RA 4RADA 4G1UC 3VAAA 3NM4A 3VR2A 3FI0A 4P82A 1B2RA 4GXTA 2QJOA 2VH2A 3NUQA 4J8PA 4RJTA 2ID4A 3BDAA 1EJBA 1GNSA 4R9SA 4EAQA 1GKLA 1HK7A 4QDXA 4RPIA 2Q21A 4MKGA 4KCGA 4P80A 4N5IX 1WW8A 4BU0A 3MXOA 4FOSA 3T9DA 1N5JA 2PLNA 4X3OA 1E1CA 3R4VA 1IOLA 3B1VA 1TT5B 3QEJA 2WFLB 2RGCA 4KQGA 4RK4A 3M5WA 1ANKA 3Q5GA 4WK2B 2HCTA 1MORA 2W6PA 3Q0EA 5FNZA 1NP6A 5JXWA 2V6FA 3ZX4A 1P9OA 2CVPA 4JI0B 3MG9A 4ZI2A 3PS9A 5DMXA 5KC9A 1E2QA 3EVEA 5DRTA 1TUEA 3SZ3A 3X0DA 4A8TA 1NU8A 3QOYA 1QHHA 3KKPA 2HJ9A 4Q3OA 2C9DA 3BFPA 1DOZA 2E18A 4HQKA 4LTMA 3EF3A 3BMXA 3Q1KA 4QQRA 4F7DA 4CXMA 3KXPA 1UOEA 4JFAA 1RRCA 4YHBA 1FFXB 2W9XA 1B8OA 1YHYA 1UCFA 3H86A 5JW6A 1B1AA 4ON9A 4UHKA 1EAMA 1ZOLA 4BNFA 3MFQA 1NJ5A 1W8DA 4Z4FA 2AWOA 3J7AC 3LW8A 4MWGA 5HW0A 1KJNA 1YE5A 3AKDA 4DIEA 2ZYGA 3K1AA 3KOXA 1EWKA 3P2OA 1HEUA 4YRZA 3U3KA 3GLKA 3M6LA 2OHVA 4ND4A 2BGJA 5TEVA 5HKBA 3IURA 1FY2A 1KP9A 1Y89A 3Q3GE 3U80A 4MB2A 4OH1A 1ZK0A 1GQ2A 4QQFA 2O8BB 4LY6A 5CM2Z 3EC1A 5ESWA 2CMGA 3IMFA 4UBNA 2FSUA 2JFXA 1XNHA 1J6UA 4ZHSA 1GFIA 1CUGA 3BSYA 3TKAA 5L3VA 2IPMA 3GMTA 2DPXA 2O2GA 1FXSA 4MWOA 4G0NA 4J91A 1OGJA 2GI4A 1UMBB 4UBJA 5C3MA 5KOJA 2JJ2D 3WGKA 4MYRA 2QVBA 2F3TA 5DCWA 4UCQA 4ZCRA 5E4YA 4B3CA 1H9AA 5DN6D 3CZMA 5K6AC 1NW7A 1F0KA 2QLTA 3IBGA 4MB0A 3DT9A 4J1TC 4H4CA 4W8GA 3COJA 3A1TA 4JIGA 4PPYA 2RGDA 5FKJA 1ZBDA 4WJLA 3MGGA 4RKQA 1L7EA 2V65A 3IB3A 5AJYA 4UUPA 2FF5A 3QELB 3IAAA 4RU1A 3IMGA 5HCIA 1GHTA 2R1ZA 1H0RA 4ED9A 1OUMA 1L3CA 1KO5A 2IK8A 3EG5A 1FDRA 4X00A 2WVAA 1XJQA 2QRLA 3WLJA 2D6FA 3GVXA 1U3FA 4LSZA 2WTNA 521PA 3DKVA 5IG2A 3MWJA 2L19A 4BNXA 3HL4A 4H08A 1EQ2A 1GPBA 1QYRA 2C5HA 2QP9X 3N76A 1UH5A 4JJGA 4XPIA 3WJ2A 1E6MA 1LNZA 4DIBA 2GK3A 2ZXFA 2XHEA 2X40A 1JT9A 4IAOA 4QQ8A 5GVSA 2PX4A 1PVDA 2J5XA 1RQNA 4O5OA 3KTAB 5KBYA 2DUUA 5AW5A 2NOAA 4RHXA 2FWPA 4ZVLA 1MV8A 1RW4A 3DBRB 3B48A 5MN5A 3M6WA 4AICA 1JZQA 1CP3A 1E99A 1NVEA 5ES4B 5KNBA 4NFLA 2FPGA 1L5ZA 1A5ZA 3TX2A 1U2GA 3NHWA 4X1KB 1LTQA 2C94A 2RGNC 1JLLA 3I04A 1XU4A 1MG5A 1NYTA 3N9IA 3F4LA 4IVRA 1GNVA 4WNCA 5AICA 4JP5A 2BM9A 1IATA 1SC4A 4P08A 3HB4X 3ROXA 4E5SA 1ONOA 2W90A 1QNLA 4MWEA 1I7LA 1JAHA 2YJGA 4A6PA 2GYWA 2B8NA 3LYAA 1AO3A 5FWDA 5EHXA 3LPCA 1UDRA 2FSVA 3KD2A 2GVNA 3JWEA 4QQNA 4YASA 3TQSA 5IAGA 5IABA 4IFBA 1R6DA 4FILA 1RAHA 4RWZA 3G2HA 3DR5A 5IF3A 2Q1WA 4I4TB 1C7ZA 2PBFA 3QBTA 1ZGGA 2JKVA 2PLAA 4AJLA 3RYFB 4QL3A 1Y3HA 2WJZB 4U6QA 5FHQA 1UAYA 4A1OA 2BRUA 4DBZA 1FRVA 2XA2A 1UT8A 3EIEA 3F5DA 3K8YA 4IOLA 5KC8A 2RGRA 4XEUA 1A8PA 4HYTA 3G59A 3I3OA 4Q24A 2II6A 2ZUEA 3FFAA 3A04A 3P4YA 5MN4A 1RIFA 4K0RA 3KJEA 3RYTC 2P91A 2OPHA 3W90A 5BSHA 4DIOA 2G8LA 1WMBA 2Q4RA 4KO2S 4KP7A 4ZPXA 4G4SP 4BNJA 3I61A 5L3SB 3V4VB 2D0DA 2YIJA 4PLHA 4BKRA 4N41A 5CW2A 1QGUA 1RWBA 5HJ5A 1WABA 4HNAB 5ELLA 1W36D 3IPCA 2UXBB 4KWCA 2YJ3A 2H63A 2PA0A 2XT9A 3VNVA 2GPBA 5CIYA 3VSEA 1FNNA 1TT5A 1UDBA 2OO5A 2Q1TA 3NPMA 5FBZA 3T3MB 2GK7A 5JALA 2QLMA 2G4CA 3AEUB 3U61B 2NSLA 3GT0A 3VR6D 4ZYUA 4C03A 3EIFA 1EWRA 2K2WA 3DV0A 4XPZA 5EJ5A 5HQ3B 3GLFB 4GRAA 3WLQA 3LUJA 2D2EA 3DMNA 3WB1A 2FMHA 2Q4OA 2FQWA 2A9FA 4E1VA 4OK3A 3F97A 3E0XA 1T4GA 4N01A 4C3ZA 2NYAA 1PGOA 2EJWA 3ER9A 4ARUA 3X2FA 4GBJA 1LWNA 3ZI0A 2BTOA 4JBGA 1I6MA 1WUYA 4X95A 5B57C 4UDOA 1IMOA 4MQEB 3DWEX 4W1QA 3LPNA 4V3BA 1AS2A 1E9AA 3HLTA 3OZDA 3DPSA 5JD5A 2HSEA 7MHTA 2ZTSA 4BNDB 3AERA 4KWTA 5J4KA 3HJFA 2GTIA 3DGFC 3PC3A 5BN3A 5DNDA 4RMHA 2Y93A 4HLCA 3U3JA 2JF0A 3SCZA 1GZHB 1U6IA 2CXHA 3E5NA 3VKUA 4LJYA 1BMFD 1ESCA 2RI1A 1ZEMA 2AFHB 1NJ8A 1Q7CA 2BF7A 4NZZA 5KI6A 2FUNB 4HP8A 1S7CA 4DCCA 1CCWA 4PNEA 5JXGA 1KOLA 1O5IA 3TK1A 1RFGE 4TLBA 4RDIA 4ND5A 1NBIA 1WSDA 1CY1A 1N1EA 1NVFA 1VOTA 1CEXA 1HLGA 4NBTA 3VR3A 5EJ6A 1DBQA 1NMZA 3I42A 1NC3A 1DEKA 2RKBA 2ZWIA 3OC6A 3RYIB 3CVYA 1KS2A 2VUUA 2WM2A 1E0JA 2R5WA 2YFHA 4BEWA 1JQAA 3Q2KA 2R85A 1XZAA 1O0BA 4L57A 5F52A 1JLSA 1NXVA 2NT3A 4TSFA 5SYMA 3SJZA 1X87A 3LUHA 3QFCA 5ANRB 2BGLA 5BPFA 1P3Y1 4ARSA 1JEOA 1PUIA 2RC5A 2XUJA 3BFXA 3CKLA 1P2TA 2Z2IA 1L6RA 4R2JA 2E4UA 4G0WA 1JTEA 5A4DA 1W34A 1RWNA 1Q91A 4PTZA 2G9QA 4M9RA 5J2UF 2O20A 4LDQA 3JD3A 4MQFB 1NY6A 5IUKC 4DBVO 2AOWA 3ZE8A 1EDEA 2BPOA 3VR6A 4S0ZA 4MW1A 4D9FA 1TEZA 3PXUA 4AJHA 2FE1A 1MRSA 4N5LA 2H7XA 3WQHA 4PVCA 2KLBA 5F7OA 4YAEA 2NW6A 4MGZR 3RUCA 2OXEA 3DMDA 3V7YA 1XO1A 1NQ5A 4IPTA 5CUQA 2ICAA 3ZLUA 3TIGA 5KYXA 4KOAA 1EBFA 4OP2A 1PR5A 2B4QA 2QVGA 2ACEA 1OFIA 3DZGA 1BW9A 1G20E 2IODA 3QVSA 4HWKA 4KR3A 1L8QA 4MJ3A 4P22A 4EHIA 3K5HA 1PSDA 1VYUA 5BWMA 3MINB 3I2HA 4QSMA 3EIXA 3FLMA 3U60B 2Z2JA 3ETCA 1AQLA 3MLBA 2RK6A 3OESA 2OXIA 3JAMA 3PHLA 3Q3CA 2BGIA 3KQQA 4BTEA 4DARA 5KDOA 3PTAA 4NY1A 3M5CA 4EKGA 2PUEA 1J24A 2GVDC 4CM8B 1SMKA 4P4LA 4Q7LA 2J6CA 3RFXA 4DA8A 3K35A 1A9OA 2C95A 4PIMA 2O7SA 5EJFA 1G8PA 5GONA 2FN4A 4Z7QB 5DK4A 3UF0A 3UK1A 4H59A 1QLJA 5BMVA 4EG7A 1FSPA 2IZZA 1QHNA 1RQLA 2HRRA 2ZDGA 2YR0A 3R09A 3PWSA 4ILKA 5E7IA 5IZCA 3G1WA 4LXYA 1YB4A 3KQLA 2GKOA 2JIZA 3M1AA 4KYVA 1XQ1A 3GDOA 1JYEA 3DVRX 2ASEA 3MILA 2QGFA 4FFRA 1YHNA 3WY9A 5HHTA 5EIBD 1H05A 3U3XA 2QQEA 3ND6A 2HLNA 5J4YA 4WPGA 3DLIA 1MX9A 4Y9UA 4FFPA 4HDCA 5E3IA 2XMBA 2PZKA 1TK3A 2WWVD 3F47A 4L5BA 3KJZA 2QVXX 5D1NA 2V7BA 1I5EA 3K9LA 1H8EA 2AZTA 1Y8RB 5HF8A 3PC7A 1FCJA 2NU8B 5AW4A 2V7UA 2ZAIA 3EZFA 1TYBE 2AX4A 1QHIA 3D5QA 2GN9A 3KWJA 3QBDA 3FZEA 5BUQA 1DXOA 3AEUA 1YAJA 2VF5X 2C7QA 1Q95A 1H93A 3G8BA 1T9KA 1XAIA 3A4MA 2D0PB 1ZNXA 1YIAA 1DADA 3S2GA 3QUAA 4TLAA 3CRZA 3PPYA 3GAZA 3R6TA 4R84A 3LYHA 2IHBA 5DXAA 4ARBA 5CXQA 5KUTA 3MQ2A 2GCOB 3A1WA 2PIDA 3MMPA 2EBWA 4TWAA 2XYQA 5H7XA 2XGJA 2WWHA 4NMMA 2WJGA 4JITA 4MVJH 1ISSA 1F2VA 3KOMA 3OEWA 4O4JF 2C31A 1S1CA 1Z5PA 3PHJA 1BFKA 4DC0A 5JT1A 2PGDA 3PJDA 1NXPA 4WA7A 5CX1B 5HF9A 1KGSA 1PGJA 4C4ZA 3G82C 3ESAA 1XU9A 2CL6X 1IG3A 4D8TA 3DT8A 3R4CA 1H3EA 2W93A 2BP7B 3O8DA 2IDZA 1VJGA 3PNQA 3EIUA 5CYPA 4GEKA 5CYGA 2ZPUA 1SQSA 3CZCA 4FHZA 4IXNA 3TH5A 2CJWB 3T8YA 1M5RA 4RAQA 2B4YA 1V7ZA 5ADWA 4MK4A 3BGOS 3AR9A 4V2UA 3CZ9A 1WQ4A 3DBLB 2PMBA 2AW3A 1B4DA 4Q02A 2JJ1A 5BQPA 5FOQA 3RQSA 2XITA 3AESA 3NANA 2W5UA 4QX6A 1KY4A 3RODA 2QF7A 2R87A 3GUCA 1X2EA 4DLBA 4ZK2A 5A06A 2Q7XA 5B7NA 5C5EA 2QLNA 2ESRA 4C3OB 2B8EA 3PNMA 4R2MA 4F5DA 3UK2A 4J2TA 3HHPA 3OZEA 4K9SA 1QJ4A 4M22A 4UHBA 2WF5A 4DM7A 2WY2D 2BHNA 2WYOA 3PFIA 4DCPA 1N8TA 1TF5A 2OFXA 4F8JA 2X9NA 3L4EA 1Y3CE 5FLYA 5AI0A 2VPXA 2YXPX 2O2SA 3GP8A 1D0IA 3B53X 1KIMA 4D6PA 3AINA 3QOXA 2NLOA 5HE9A 1K06A 1JLRA 3GIDA 1IRXA 4U2CA 5FPPA 5I7UA 1PR6A 4MQLA 1PK9A 1RHMA 3DQQA 3KYBA 3QPUA 1DBSA 1RQGA 5HRCA 3T1YB 1E5DA 1IOZA 3JV7A 3O31A 3OPXA 5C8ZA 2AJDA 2H2FA 3W8DA 4CG0A 4ZI7A 4E51A 1ESZA 3G0IA 4J9UE 4J4BA 4REOA 1G7CA 2OC9A 4M54A 5DGDA 1R4MA 4K8OA 2NO0A 3UAXA 2GAOA 2X1MA 1AVTA 3ODGA 3OF2A 3CVUA 2QLLA 2EWMA 3QKRA 1VE7A 4MQ6A 2DH6A 4WFIA 2IXTA 3RRYA 3WGJA 2E6UX 4YUXA 1T1RA 4A0HA 4PV7A 1H42A 1SXJD 2CCGA 4KI7A 5HZMA 1QQ6A 1VHTA 2HGZA 2Q3BA 3F6CA 1X2BA 2Q2WA 1U1EA 2ODBA 3SIPA 3JZIA 4NYJR 5KQGA 3C8UA 3HPRA 2DJIA 2ZJ7A 3HKBA 1K2WA 1ZW1A 2J6IA 1LZKA 2ATXA 3IIKA 4Q3KA 4OFWA 2CY0A 4BN4A 1FQOA 1NF8A 5HSGA 3GH1A 4MI1A 4NPAA 2VSFA 3BREA 4BQSA 2I0FA 5CVUA 1TTQB 2EFJA 1J2JA 3P2KA 2QXUA 3IBFA 4RJIA 1RAIA 4Y2YA 3ZE0B 4KITB 3QI2A 2FWNA 3T06B 2CEKA 2YWEA 4EEKA 3H1FA 4YTEA 5KNDA 2EBHX 1RHQA 4IQGA 3RHTA 1ZM2A 3IAS6 4GL4A 4QBKA 2RKWA 1O5OA 2AJLI 4UHHA 5E8JA 1PGQA 5F78A 3EQ2A 4RS3A 3TSCA 4KDCA 4X92A 2COEA 4WV3A 1LRLA 1A7AA 3W2IA 3ZU6A 4UTRA 2EF0A 1Q14A 5DTRA 1FB5A 2WP0A 3WNVA 1SZDA 2ROQA 1CW2B 3PQ4A 1X19A 3RPEA 1Z7BA 2DPYA 2OC4A 1YRAA 1T0BA 1KY5A 5AJWA 4H3HB 5JTTA 1YR8A 2B5VA 3DDNA 2A9VA 1TVMA 2PQ0A 3B70A 1OX5A 1UMBA 4R6WA 4F86A 1IJKA 1GPYA 2C4TA 3ESBA 4JLDA 5JDCA 1FLAA 1H6BA 2HLDD 1SEPA 1SRRA 4MWSA 1YJCA 2OCGA 1PZEA 2ZRHA 4XEHA 1P9WA 4CKBB 3BWXA 1GPKA 1XFAA 3JAKA 2WU1A 5L3ZA 3OOJA 4ZEVA 1VKOA 3G17A 2KJQA 3CT4A 4IEFB 2AGVA 3TTTA 3LL7A 5LYJF 4GKBA 3VSDA 3I6MA 3C4JA 4JLBA 1G5QA 1N6KA 2VHZA 3AUAA 3SEFA 3SZRA 4Z0HO 2Z3WA 1C0PA 1UDWA 2PSJA 1N8NA 2YWXA 2TECE 1ZJ5A 2B1IA 2XT6A 3DVAA 4ABTA 1HA3A 4YUVA 4DZZA 4HDRA 5DM0A 4ALIA 1CQIB 4JU8A 3KLNA 5ER6A 4I4LA 1L5HB 1JYFA 1AN0A 2IE8A 3HMKA 1FSGA 1YQ9A 4K03A 3PEWA 1QQAA 4CMHA 3IOCA 2A9QA 4IDEA 4K28A 5GJVC 5DISB 1YB2A 3EH1A 4Q7JB 1UK8A 2XUFA 1MO3A 1VZ3A 3G3EA 1NN5A 2AZMA 2GHQA 1P17A 2BFMA 3ZOZA 3LHIA 1CIVA 4XR4A 3CYFA 3ZQKA 2EKZA 3ONFA 1L4KA 3FNIA 4IRUB 4II2A 4DEXA 2RH4A 4AN0A 1NJGA 3I64A 2NUPA 1SWWA 3V7WA 1TQ2A 3STVA 2RGBA 3DMTC 1I4TD 2QPLA 3EF0A 4A2QA 5JBIA 4BJ6A 4G0OA 4EG5A 3WLLA 2D00A 2XUQA 1E4YA 4A2PA 1ZGCA 4Z9BA 3VA7A 1W36C 4J49A 1JNYA 2CFSA 1XQYA 1BH2A 1EGMB 4GHWA 4KSBA 3TAHA 2DM6A 4FWTA 1XKXA 3F4BA 1TA4A 5CM9C 4ZOLB 2CCKA 1O97D 3OZUA 4FDAA 3W5IA 4BAGA 1LI5A 4DPKA 1K6MA 3D4OA 3U6KA 1WMSA 2YIMA 1JHAA 4E94A 2YQ5A 2DE0X 4OKSA 4U9UA 5J2TA 3U7GA 3T9CA 3G89A 3MIIA 5EGNA 3QE9Y 2IU3A 2WQZA 4QYIA 3HYRA 1SA0B 4WCVA 3KPVA 3JQAB 1IWOA 1JFFB 3LA6A 4CIXA 2VYND 1KHTA 3G9QA 3GLFE 2FMKA 2KSQA 3B1YA 3PG5A 4YS6A 1Y4UA 2HM7A 2VYFA 3KZNA 3C3WA 4JS0A 3F8TA 3FPFA 2VBGA 4FT2A 1RXUA 2BM8A 3G8DA 1KZ1A 3Q3HA 3N2GA 4EY7A 2GKGA 3TD2A 2Z1NA 4N7RA 1HE8B 2WSYB 1XXLA 1UC5B 2IEYA 2QL7A 2Y1WA 1KC1A 1RADA 4DDMA 2UZ1B 5ALIA 2ONJA 2HJHA 2J5KA 3WTBA 4F1KA 3DOOA 1XX6A 5D51S 3JQEA 5H8WA 4MKIA 3EVBA 1OLXA 5BNIA 1Y5NA 1ZRSA 1P6QA 1AXEA 1D6MA 3N0VA 2OBYA 3WZMA 5WRFA 3RNLA 1HC7A 1YIDA 3QKWA 1FFGA 3URKA 4FYXA 4CM1A 2ZBGA 5CEJA 3I9MA 3QWIA 3R7NA 1RAEA 5C1DA 2R9VA 3MWGA 3UKJA 4N8SA 3LY9A 2ZBFA 4C5CA 2HU2A 3N8GA 1UPBA 3D5TA 1OHHA 3NVMB 2K2QB 4KQ2A 3RS8A 1UODA 2YC4C 3KSDO 3U7JA 4EUHA 1LTKA 1XDGA 4REQA 4UHFA 3TSWA 2F00A 5AM4A 5C7IO 4GG1A 3ICCA 4Q34A 1GXSA 1REQB 4D4HA 3OFSA 4HNRA 2GS9A 1I5OA 4JR1A 3F96A 3MRVA 2VKTA 3H4TA 1E6EA 4KZPA 4CM4B 1L5FA 2BKEA 2FVXA 1GQFA 1W0KA 2GYUA 4CT5A 4EF5A 3W5CA 1AK1A 5IJ9A 3LCVB 1FFSA 5KSPA 1G8SA 3DE5X 2CL7X 3LTEA 3O3NB 1EFRD 1A9XB 1IC6A 2ECFA 2Y1OA 4LV5B 1FX1A 4LYEA 1BWQA 1N8KA 3C0KA 3CR3C 1ESNA 3VBCA 1AV6A 1EKXA 4RPJA 5HIKA 3BFJA 3G2JA 2HMWA 4XX0B 2QSZA 4R3NA 4W5WA 5AK5A 5IAKA 3UAOA 4CT0A 4M21A 4HCJA 4I5GA 5IVPA 1R0XA 4GI7A 5C7YA 2OFPA 2XUGA 3EZXA 4XLZA 3T0FA 2Z0MA 3VR1A 4DDVA 2ZTLA 2BFBB 3WWCA 3IIJA 4M9QA 4JSRA 3Q9SA 4YMUA 3VC2A 1T8TA 3FSRA 4RVCA 3UM9A 4HNTA 2YJ5A 5I7OA 4GP9A 1VJRA 3AEXA 3W9BA 1W1IA 4AWAA 2FG5A 2VTEA 4G0QA 3RH0A 2ZS9A 3ZGNA 2FDRA 2ZKIA 5CURA 1K6JA 3OCWA 2BM1A 3PXGA 2OHJA 2Z6QA 1XZIA 1WD7A 2WE7A 1JLMA 1VFNA 4Y2XA 1AUOA 4YPOA 1T2EA 1Q19A 2B9VA 4TS4A 1TE2A 3R3JA 4LY9A 1L9XA 2JANA 3GU3A 1G5RA 3KE9A 4O2AF 3WE7A 3J81k 2RHRA 2EC5A 1XTBA 1WXWA 2VRNA 2NG1A 4YRSA 5EYPB 2C77A 2GEVA 2ONYA 2R751 5D87A 2EKDA 5HILA 4CUKA 3OZSA 2I99A 3IMCA 1BMQA 2GJSA 4MVJG 3I39X 2J7KA 4KBGA 5BNWA 1QP7A 4QUHA 4GKJB 1ZSNA 3I4FA 4GX2A 2Y1XA 3O9VA 3B2QA 4IDOA 5BVHB 1DX6A 2VDNB 4ECEA 4HYYA 4OQFA 4PONA 2JI6A 1CD5A 3VR4H 1YZLA 1C3OB 4IVQA 3TJMA 4E2YA 2Z6VA 3L6DA 1YB5A 4WE3A 4XFJA 4X7MA 3ZOKA 5JLAA 3UT0A 1EA7A 3CEJA 2R00A 3EXFA 4NVRA 3RYHA 3L82B 5FO0A 1YS9A 1CWUA 1EE2A 1F6BA 2PWPA 3C5HA 3GFBA 2EG5A 3CSDA 3O2NA 5D86A 4DW8A 1ILEA 4YUWA 5K0GA 2AK2A 3GWGA 4TVOA 2QZ9A 4MIEA 3M1YA 2QENA 4TLLB 2Q1YA 3ZK9A 4AMVA 4HZUA 5EJ8A 1DAMA 2GEFA 2NZJA 1BN7A 2PZLA 3CLUD 3D3NA 3ENKA 4QYMA 2ETVA 2JC3A 3DAOA 2EHDA 2WV7A 4B4OA 1SKMA 3CE9A 3PDCA 3RR2A 4ZZ3A 1P4SA 1XZFA 1J99A 2IUEA 3DDSA 3IVGA 2OCYC 4G5YA 2HD4A 4FM9A 4KJZA 2WEKA 5K3FB 1PLLA 1C0KA 3UCFA 4YUYA 3E7XA 3ZDZB 2FW9A 2F8SA 4HLUA 4IH9A 2R66A 4N3BA 1J5XA 1WP9A 3DQZA 4LXXA 1F0YA 4XFKA 3ZCSA 1COWA 4G97A 3B6IA 4LBWA 2VHVA 4LOKA 1M66A 2ZJ4A 4MS4A 1FFWA 2QX8A 2Y4OA 3FCEA 5TGDA 4OHYA 2MR5A 4JY7A 4WNYA 3SF0A 1JEAA 3B5JA 2HK9A 4QRDA 4V03A 1G60A 1X7YA 2JFZA 1PFWA 3P0EA 2GFHA 1XZGA 3PV0A 4HAUA 3I01A 2VF7A 2HB6A 2GM5A 2E6KA 5AKLA 1B93A 1E32A 3KQWA 3MTBA 4KMRA 2PQMA 1N5RA 2QMOA 3L7DA 4DCNA 3EXFB 1MO2A 1XRJA 3GXOA 1Z4KA 1AKNA 2I4TA 2NZ2A 2QK4A 2HA4A 2QKYA 4OSPA 4ZOLF 4LPSA 1OB2A 4OXXA 1YVEI 3CNEA 1VHQA 2WHPB 4EY8A 2DF8A 5DNAA 2I33A 4EMTA 1YRLA 3WSVA 1HQKA 2QSUA 1J23A 4PG6A 4PEVA 3WHKA 4TZKA 3PQ7A 4DCJA 4AUEA 2Q0SA 3JPWA 1UKAA 5FI0B 5K3AA 3ZHYA 5DYYA 4P81A 4UHJA 1KQNA 3C3JA 1XAGA 3CF4A 2RCNA 4HO1X 5K0JA 3L4BA 2J8ZA 3WL3A 3EGDB 3GCDA 1TD1A 3ESQA 2ABWA 3S44A 4N3GA 1QKJA 5F7JA 1W49A 2IYYA 4G6ZA 4Y0AA 4TTVA 4NNPA 3A25A 1VLQA 3OQOA 1RCTE 2PZMA 4OFBA 1G7SA 1JAZA 2CNWD 2OCLA 3JQRA 4W4TA 3UUGA 5K3BA 1MAHA 1RLUA 4NFSA 1I4LD 4DWWA 4HN9A 1SUDA 2XGGA 3QBVA 1CRWG 1X70A 3JWIA 1IAVA 1PI3A 2AMYA 3FMFA 3MW8A 1BXZA 1RHRA 1E1DA 2R6ZA 5KHOC 1JHPA 2Q6KA 1GT91 3QLJA 4IGIA 3FCCA 4JLOA 3K2BA 4CQMA 5LU8A 4ZQHA 4PZZA 1M5UA 2HBRA 5L3QB 1RQ2A 3F4KA 3P26A 2NVUA 2JARA 1SIWA 4HBZA 1OLUB 4F45A 3B1ZA 4AY2A 3ZDEA 5JMTA 1VHWA 5HDQA 2TMYA 3EWNA 4KR6A 1UIMA 2WLTA 3EGIA 4FMBB 4JMPA 3PKJA 4JLUA 4LK3A 2GF0A 3V7FA 4XVUA 5K8TA 1UINA 3W1EA 3GO4A 5KQMA 1Z34A 3DAHA 4OYRA 5T6BA 1OILA 5JAUA 3KPYA 3IC5A 3FRJA 1SXHA 4MYUA 1T10A 4D0SA 3HXPA 4RTMA 1GGMA 3ZKWB 4UTZA 4JLWA 1EUCB 2YJ4A 1J21A 3IAFA 1B0UA 4ALMA 5JYCA 3ZVKA 2WLSA 4OXRA 3S1LA 3B8HA 1XQXA 3ON5A 3WI7A 4QBGB 4KQCA 4BL5A 4S04A 1XUOA 2UYYA 3LLCA 2X4LA 3ZUGA 3CX7A 2VK4A 5BV2P 1MUUA 2AFIA 1MB3A 5BXYA 2ATVA 2BEUA 1Q7TA 3UMJA 3PNBA 5FOUA 4PC2A 4PBTA 1Y63A 3HR7A 1Z7GA 4FGZA 4AURA 3GJ0A 3C3XA 5A7GA 4DV7B 2Z4SA 4IHJA 1CB7A 1E1KA 2IUTA 2OSVA 3BMOB 3GUZA 5ALXA 1VSUA 1VECA 1OTHA 3RW9A 1XYYA 2C2OA 2Y0EA 1JHYA 4FZVA 4BX8A 1KMHA 4M0LA 1L4GA 1D0SA 1KP2A 3RF6A 1QWOA 4PCVA 2ANBA 3HH8A 3GNTA 3ML1A 1NZDA 1VSVA 3U4HA 2FK7A 5T57A 4ZYVA 1W75A 4HEQA 4RVOA 3DEZA 3MWFA 1KEPA 3BH0A 1E5QA 1R15A 1WY5A 4M53A 5B3AA 2AN5A 3VV2A 4C07A 4CTJA 4DSAA 3H11B 2QZJA 1FSFA 4BGVA 5INTA 1ZVJA 2W2QA 2PGJA 4RELA 1Z62A 2CNNA 4R6XA 2JNWA 1E3EA 1PF7E 2CLHB 2JK1A 5ADVA 1CR1A 3IQHX 2FMUA 1LSOA 2OCAA 1CQJB 2V96A 1JQ3A 3AF0A 4TMZA 4FHEA 4QATA 5FTWA 4HL6A 3ZGXA 4N0EA 3ZNOA 3CF4G 4EB0A 3DJYA 1GTL1 1JXQA 1ND5A 2AD1A 1QOPB 2HEIA 3V1YA 3V8BA 4D9MA 1JWLA 2YZNA 3DLHA 1IEQA 1U0EA 2VXYA 2ZRKA 5E4TA 4YFYA 1JR6A 1L8LA 1HE3A 3AV3A 5IM5A 4TLMB 1USWA 2ORWA 1T5HX 2W2LA 4QDKA 1KQ3A 1XKTA 1Z6YA 3KALA 4UU8A 4EFDA 3FBTA 1Q1ZA 2AV6A 3CKKA 3MOGA 3VGJA 3I1YA 4I2NA 1HZZA 5H02A 5LXTA 3U26A 3O38A 4IHJB 5AYVA 2AYZA 3ZTWA 1SCBA 3C1TA 4CFYA 1ZQ9A 3F67A 4YAIA 3K71B 3OQMA 1Z88A 3L6OO 3OLWA 1ZD9A 2E49A 3D54D 3F7NA 5SV2A 1LS6A 2GFQA 3D59A 4JDPA 3DZDA 1D9ZA 1DQSA 4YRPA 4Z9FA 1P44A 2PRIA 2YOHA 1D1QA 1HT0A 1SHTX 3CLSC 2FPPA 4JYZA 3L01A 4EY6A 3R5XA 3TIIA 4KREA 2VHUA 3AM1A 1GDDA 3IBSA 1NUAA 3QJYA 4UOZA 1JWAB 3TRKA 1KZ6A 1BG6A 1CIJA 4XWTA 4QTZA 4YRQA 4UZSA 1WU8A 2VHYA 2GK6A 1Z35A 3MYRA 4GQAA 2YZ2A 4Y9SA 1FXWF 1C7RA 4CBVA 4RF4A 1RXEA 2B25A 2R7AA 4OGWA 1XHEA 4BWYA 4H0NA 1LNSA 3VBEA 1EX7A 4DCVA 5K0CA 1QTQA 1B73A 4KFRA 4D3ZA 1QRSA 2R6HA 1A5BB 3BOSA 3L0YA 3MRXA 4KQEA 4ZQIA 5KB3A 1DIGA 2XVXA 4LJRA 2UKDA 1P72A 1M10A 4WFKA 5AH0A 2UYCA 3KQHA 4E5YA 5A04A 1NDHA 2QD2A 2ZTVA 4S1VA 3FNEA 1SG0A 4M0PA 2B1JA 1UOQA 5CT5A 5TS3A 4GICA 3LFTA 4HGZA 5DCLA 4FKBA 2HK6A 2O3UA 1AGYA 1ODTC 1SHJA 1LLFA 4TV9B 3T0IA 2CNDA 3E9YA 1S3SA 4BFYA 5IRCD 3NHYA 4JP2A 2XNCA 4L08A 1TJPB 4U1RA 4D98A 1T4MA 1U7HA 2PJZA 5ARCA 2FGJA 3WRYC 4NPCA 4IXMA 2Q3HA 4RK7A 4NL4H 5CB4A 2BDUA 2VF4X 1NMYA 3U4IA 5C8YA 3CT6A 2XGMA 4OHKA 4O33A 3HDYA 1VPLA 3UENA 2QVLA 2RGGA 5E7MA 2PE5A 8MHTA 5C1PA 4IJMA 1U8AA 3RVRA 4EJSA 4LOHA 2GDZA 2HWKA 2V55B 4AYXA 5CB6A 3EIWA 3RCBA 3TLBA 3W5BA 5IFKA 3QU9A 2WWGA 2VJYA 4KC0A 2Z57A 3ITEA 5ITWA 1NVTA 3M9WA 1E0DA 4UM8B 1Z0IA 4JFRA 4WX2B 5DLPA 1I14A 3KDAA 2WRZA 3GDHA 4BCCA 1ABBA 2BGNA 1PEYA 3UIEA 2KM1A 2JFFA 3NBXX 3TM4A 4KMMA 1NP3A 4LHZA 1QO0D 2DECA 5D00A 1PT9A 4G37A 3EZNA 2BISA 4J90A 2FG7C 2FW6A 1D4ZA 2FSVC 5DGHA 4BBJA 1QC5B 1PIWA 1TM7E 4JJ6A 4D4KA 4EJMA 2F3SA 1P1BA 4W8OA 5HBRA 1GT6A 2HN9A 2JIOA 2LP4Y 2ZAYA 3LPDA 1ZCAA 2EXXA 4CVNA 5I3ZA 3DNPA 4P0PB 2P68A 4RAOA 1J1IA 1I4WA 2PSDA 4MP8A 5KOHA 1JIUA 1DDOA 3CVOA 3W05A 4ZJUA 3AL2A 2NO4A 1KERA 2X76A 4LQDA 3UGKA 5JSFA 2PGOA 3WLEA 1HG0A 3QLVC 1P2VA 2LR0A 2ORVA 2XDQB 4FCWA 2OZKA 4LVCA 2VTBA 1Z73A 2CL5A 3HUEA 3EN0A 3I2KA 2WT8A 3ITNA 3P4XA 4LMPA 5ILQA 2I9KA 4HAOA 4JHXA 3R7WB 5LYJB 1ISHA 1IAQA 2V7PA 4BIIA 2XQFA 4TMVA 1KQFA 3O94A 4HNSA 3BB3A 4DLPA 2IZ6A 4PLGA 1XG5A 2HMAA 4FE4A 1KJZA 2AN3A 1UJ4A 5DP2A 3UEOA 4AZ0B 1R9JA 1PBTA 5AJXA 4Q3NA 2AC7A 2AJTA 2FSSA 2V5UA 4V2IA 1RM0A 4QFMA 3FRHA 4PQGA 1IYZA 1LI4A 5EN4A 2C5FA 2R8OA 1K6XA 2F3PA 1NC1A 2JH8A 4XWAA 1T3SA 4HLQB 1EUYA 1U99A 2R00C 4UAUA 1DAIA 1DTSA 3D2AA 1GL6A 4WCDA 1R8JA 2X0KA 3QVLA 3BWEA 1U2GC 3DKPA 1EZ4A 1NF3A 4H60A 4NX2A 4BX2A 1XWIA 2HMUA 2B3DA 1MCZA 3AIOA 5CAEB 2ZULA 5A4KA 5EXTA 2WF9A 1ZU5A 1UAGA 1KF0A 1HFEL 1QTNA 4BV2A 4FYIA 3GAMA 4J75A 4IUYA 4J2HA 4XIGS 2B2NA 4Q9IA 4GKVA 4AJ1A 2PMCA 3GAFA 1XTTA 2I4OA 4M9SA 3G5LA 4L22A 1D4AA 1SBZA 1U7WA 2EJVA 4WWHA 1NFRA 2QS9A 3D2CA 1J90A 1VE9A 4EGAA 2G7MC 2HWXA 3MWKA 3OT4A 4DILA 4B6RA 2FPOA 4C7KA 3GFSA 1Q17A 4DAOA 4QPJC 2QPTA 1PR3A 2XPCA 5FWAA 5E3HA 5BW8A 1WHTA 3ZWNA 3B8EA 3ZEIA 5BVGB 3OT1A 1IM8A 2AXEA 4ENSA 2LE0A 4MUIA 4B0OA 4ZQGA 1JG6A 3QLUA 5LWHA 4A16A 1P7WA 1OWLA 2NAFA 5CVJA 2UUOA 3T7CA 3AMVA 4BGIA 3ENWA 5AKEA 4X71A 2DT5A 5G1PA 4PYQA 1QYXA 4JT9A 1QOZA 4DS3A 1OT3A 4J0FA 5JH7B 2Y1FA 3KTFA 1RJ9B 1V47A 4C7BA 3G5MA 3EXHA 1EFLA 4BTVA 4ZZ0A 1TCVA 1G3QA 1HYEA 3FUUA 3NC4A 5AJZA 3ZV3A 4YR7A 1W0CA 1IXRC 1UJ6A 4HZIA 3L7CA 3PI7A 5CLIA 5KKCA 4MV7A 1N7IA 1DEHA 4R16A 2BFPA 3T1NA 1I30A 3WRXC 1NF9A 3EOBI 2HQ1A 2R6GA 4MLDA 4Q05A 3PFBA 3MJFA 1NOIA 2IHKA 5GM1A 2JW5A 1ID1A 4BP9A 3GYBA 5IC4A 2PGNA 3BL6A 1PQWA 4HRVA 3R7LA 1F5SA 5BR4A 4UNSA 2E82A 3O2JA 2CV2A 1NBMA 3QU4A 2VT2A 3E3OA 3TTXA 4F6LA 4ENWA 4PG7A 4I3HA 1KDOA 4CM3A 2VZ0A 3O8BA 4QTYA 3ASYA 4TLDA 3PVZA 4MITA 1R5NA 3ZWDA 3B51X 3OIYA 1T9ZA 4KPFC 5A02A 2O6HA 2Q3EA 2Z8ZA 2WWRA 2W6ZA 3AR8A 4QZVA 3TOCA 2JKZA 3T3DA 2D8MA 2C04A 4ZCQA 5JSZB 5GTDA 3FVTA 4YAGA 4PZ0A 4TMTA 1JQJC 4ESVA 1NN3A 5CDUA 1WHSA 4INAA 1L1FA 5FUMA 3H18A 5IDWA 4MV5A 2XA1A 3JYQA 4PPNA 3P9YA 5D6OA 1AIPA 2ASVA 3QHAA 4NOLA 3CZPA 3G79A 4D9HA 1R6UA 4M83A 1FRNA 4IO1A 1ADFA 4XLLA 3OJFA 3I83A 3NTRA 2X3FA 3I9JA 3E35A 4I9HA 5G3ZA 3UT6A 1NG1A 3ZHUA 4RVFA 1KBOA 3DMPA 4LMBA 4R8RA 3CINA 4PLWA 5EYPA 3ILYA 3ZN2A 5LZ9A 1R37A 5HX7A 1JA0A 1OYVA 2JGJA 4QPDA 2AN4A 2V6MA 3QVGB 3IIEA 4AB1A 4QUIA 1KZ4A 1U3GA 4UULA 4D0GA 4ZI7B 5C5IA 4JYAB 5H68A 1I1HA 2Y71A 1T3TA 2FAXA 4BPBA 3SJCA 2QX9A 2AFVA 3DBRA 4Q1DA 4EEZA 3BEDA 3E9QA 4B2LA 1Q16A 4DRZA 2NNLD 4C87A 2QUJA 2PS1A 2C2HA 2AB0A 4EFNA 1RLTA 4HAVA 5EZ6B 1J9ZA 1YK1A 3G88A 4R1QA 1XCBA 3L04A 4FYMA 2OAQ1 3FY4A 4I50F 2BY4A 4RVHA 4KUEA 1K6EA 1XZCA 1Y0BA 3Q9UA 3R5KA 4L5IA 3IR5A 1E9VA 4JYPA 1DAFA 4CDMA 4ESHA 2HT1A 2NXWA 3I45A 4ETNA 5AD1A 3PUYA 5BP7A 5CXUA 1S2MA 7YASA 3KQVA 1Y9JA 1QG6A 2LXNA 4EOGA 3NMUF 2YXEA 3D8HA 3DFKA 3H83A 2JRCA 4TTQA 1OJ7A 5BWLA 1WKCA 2C20A 3PYXA 2R8ZA 4WGFA 2H1RA 2YVLA 3K7EA 1H5QA 2ZQYA 2J5QA 3RYIA 1A1VA 2KX7A 1TPZA 2Q50A 2FFJA 2DP4E 3GZJA 2DQ4A 2CXOA 3FMVA 3ZBTA 1Q74A 3DL7A 4V0RA 3KYJB 1A4IA 4MLZA 4YLEA 4QVKA 7ABPA 4NE2A 1HNZB 4HLNA 4R1LA 5K3CA 1CUYA 5HJ2A 3CLTD 2C9ZA 1X1CA 1AHIA 2Z2XA 4Z2AA 1KSJA 4CETA 3OSZA 4RXUA 4Q9LA 5HF6A 2AOUB 4KIUA 4NK4A 2O07A 3W8RA 1NMSA 2WQ7A 3DOCA 4JKYA 3JD0A 3CXRA 4H1HA 5KSZA 5FIUA 1OW3B 4BCDA 4EHKA 3QUQA 3ICOA 2I1VB 1NPDA 2AOTB 1FTNA 2D5BA 4TS9A 3HDGA 4XKJA 5CMLA 4UEOA 2GZ1A 2XJ9A 3NW9A 4JLMA 3SZOA 5CFQA 5JJBA 1XRPA 3ZUPA 2V6GA 3AKCA 4RORA 2F9LA 2GFIA 3QBEA 3CPEA 2JVKA 4NCAA 3FZYA 1FS4A 3C8MA 2OGUA 3CU5A 2NU6B 2NMVA 5GZ3A 1U0JA 2GBPA 3BE5A 4H1VA 1M0EA 4Q4JA 4HS4A 2ETXA 3IAUA 3CONA 2REOA 3NWEA 4Y1EA 1NTRA 5DM70 3CVVA 2OGTA 3KBBA 1HDCA 3G2IA 1X1DA 3HCEA 5E9WA 2OBLA 2PQ2A 2QTMA 3HB9A 4AT1A 2F1KA 3ITKA 4N18A 5EWLA 3HSKA 1IHDA 4MO9A 2BHTA 4YMLA 5IZCC 3ZY2A 5LQMA 4YCNA 2Z9CA 1F20A 4PXAA 1W2WB 3HR4A 5DXJA 3EYWA 5JCOA 4DCUA 4EPXA 3D0KA 1QCCA 3I0ZA 5JANA 1E1NA 1RJ9A 3ZWYA 1OHHD 1YS2X 4GU5A 4RKYA 2Q0QA 4XM2A 3TXYA 3INTA 1Q7GA 4YQYA 4ARIA 3BAZA 3ZHZA 1QTIA 3AV0B 5KNDH 1RKBA 5GGYA 2R68A 5E1MA 3PE3A 2C59A 4IGKA 4MCIA 4DY6A 5BWNA 3V1TC 2DQSA 1KO4A 4H0FA 4L8VA 3ROFA 5LOVA 1VPDA 5G1NA 3AGQA 3LVQE 1VTKA 9GPBA 4KR2A 3SI7A 3NTVA 1SVSA 3A2KA 3NBAA 2NTNA 1O95C 5J40A 4GNRA 4QTTB 1HYQA 1F4LA 3W7VA 4L9SA 1G5TA 1E1CB 3DZ8A 3QVUA 4PG5A 1QCZA 5B2EA 1UPTA 1AGPA 3LG2A 2H8KA 1O9GA 2EF1A 5GGXA 2Z09A 1JIQA 1RWQA 1IBCA 4UW9A 2VPPA 2GILA 3BILA 5I47A 3REFA 3W78A 1Z5WA 1UDXA 1IBLB 3KYDB 4U3JA 1OOEA 3ZV6A 4J4HA 1YL7A 2EYQA 4F6RB 3VKVA 5DOZA 3IP8A 4WKOA 1U7TA 3DOHA 4K6KA 4YJ3B 1DB3A 2D74A 3T61A 5BSEA 2EZUA 1ZHOA 4D9JA 1WBJB 2DWCA 4IIJA 1VBMA 3RS5A 2QTWB 1RLIA 4P3KA 2CXSA 3R7DA 5KVQA 3GMSA 1TK2A 1Q3HA 4WZAA 2M6RA 3FDZB 2VCHA 4MUXA 3BIWA 1GG9A 3GDGA 5IJ0B 3D6JA 1ATZA 1DAEA 3EX7C 3VPBA 3JAWB 4C30A 3BQNB 1NQOA 3EY4A 3KEFA 4X1OA 3RIEA 1L6IA 3BSWA 1OLXB 1OT5A 5I51A 2Z98A 4HFMA 3SHOA 1K8ZB 4L9AA 1SBYA 3OEHA 1GZDA 2BN4A 2PZJA 2TYSB 4RZQA 5B1DA 3SVLA 1P2DA 4JC0A 1TZKA 2CUNA 2DHEA 4N03A 2CWDA 3KCQA 1YD7A 2X5JO 1R74A 2RIPA 2WILA 2ZKLA 3I1JA 5CX1A 3KHKA 5IEBA 1CE8A 4IG4A 4WY5A 2WHPA 2CYCA 4YAJA 1RWOA 1SBCA 1A9TA 3QKSB 2Z1MA 4MAAA 1R9NA 2CHEA 3E2PA 3IHLA 2B3TA 4GWGA 3WMXA 1I3NA 3TVTA 1P91A 4YRAA 3DD1A 2QL6A 5B2FA 4YJGB 5C9ZA 1BCRA 1A96A 4LAFA 3T35A 3CUSA 1UPCA 2GETA 4PWYA 4S1TA 4JX9A 2P3LA 3T3NA 1KJIA 2OBBA 3Q8WA 1K8RA 1ZL2A 3KEGA 4Q1EA 2JIDA 4LE2A 1EUDB 1YSCA 2WKWA 3IXMA 1Y1TA 4UBLA 3I5UA 3SK0A 5D2CA 5IAOA 4YJ3F 1SA0A 2VTDA 1BQ3A 3JQAA 3N2YA 2CMFA 4HK4A 3E9NA 1VGQA 4PYLA 4NMWA 1SCNE 4TM8A 2X14A 3X2SA 4YJDA 4UFPA 1H2WA 1RBZA 3PGXA 1Z29A 1JHUA 1AN9A 3BTSA 5DBOA 1R6AA 1AK9A 2GN1A 2GZAA 2JRLA 5KJFA 3ES9A 2FKNA 1GV1A 5G4KA 3L1KA 3H04A 1TAHA 4KG7A 3BKWA 3UJ6A 1M8GA 1V0JA 5G2OA 1LDEA 4B7CA 3LY7A 4BNMA 1RJGA 2F8LA 2NO6A 3BK7A 3HKCA 1OU0A 4MZDA 1UJNA 4O4LB 4OX9B 1MV5A 1HRKA 2GNOA 4UVIA 1B7GO 1QIIA 3N2NA 2JFUA 3NRCA 2MSDB 3E03A 5GV7A 3UWKA 3L7AA 1ZESA 4JXJA 2WPDA 4ONEA 4EQ6B 1JI0A 1YV9A 1BQEA 1S2GA 2H65A 1JU9A 4X3CA 1ZMOA 1A04A 1FPMA 2M6SA 5HOQA 2A57A 1ST3A 4PSVA 4F3CA 3INGA 2FPPB 1KKUA 4RZSA 4B35A 3WLNA 4RF5A 1CT9A 2R4QA 4ZV7A 2XZPA 1FX0A 3ICWA 3T7TA 1F7VA 4WKCA 4MRMA 3E6AA 4AMUA 4E12A 2P1RA 1L7MA 2PH7A 4JVMA 4YRFA 1JEDA 3IELA 3F1LA 5EMJA 5DYTA 2AFIB 4RWEA 4U7PB 5DE3A 3WIVA 1SG6A 3V6LA 1A97A 3G5UA 4XGIA 2J4FA 3Q0TA 1Q92A 2YY6A 1YMUA 3GEEA 4E6EA 4QHYA 4YK7A 1TAGA 1E1QD 3AQ4A 3EZ6A 3GR6A 1G17A 3H84A 3PQ2A 1MT0A 1Z3CA 3IR6A 1GR0A 5KCMA 1TGYA 1U4SA 1A0OA 2C4UA 1KJYA 3LY5A 3QFTA 1HE4A 3GAAA 3QYAA 3GC6A 4M7RA 4R9VA 1FP1D 4JDUA 4UFNA 4MVJE 1Z9BA 2GNAA 1SK8A 2PBRA 4Q1BA 2ECKA 4BX9A 4LF7B 1JR3E 1ZLXA 2YVAA 2VJQA 3FCUB 1GPNA 3PHBE 4JGBA 3A27A 3T7EA 5HUJA 3OQBA 4TV9A 3PX7A 2PCJA 4B83A 4IFIA 2ZFUA 3P5BA 5DBFA 1DG9A 4QICA 4GOKA 4TUYF 5EY5B 3DJFA 2ODTX 2QG6A 3S99A 3WLMA 5KVAA 5KO2A 2WTMA 3ZBQA 2BFBA 3FXAA 2RJ3A 1LI7A 3HBAA 2X2OA 4QRIA 4UMVA 4NZMA 4PGFA 3OTOB 1NVDA 1ISGA 2GPNA 2CW5A 3I5AA 3MS2A 3JZFA 4G9GA 5CLHA 3V32A 2XCSB 1STOA 4OSOA 5EA2A 4BAZA 1EQAA 3TZLA 2GO1A 1J4AA 3OFND 4MW0A 3IGFA 3ZHQA 1O54A 4TSRA 1XRQA 4Y2GA 2VNKA 2I29A 3BIOA 2J9GA 4CI0B 3K70D 3W6OA 1CEYA 2H7VA 4FDMA 2LIVA 4KQHA 2H11A 1QIEA 2I6FA 5IKOA 1GGNA 1L7BA 4QULA 3K30A 3LBNA 3W7BA 4HT3B 4DPLA 4M0DA 1GNLA 2Y4NA 1BE1A 2PGXA 1RTKA 2VS1A 4ZOEA 3T52A 1BVRA 3NWBA 2IS2A 4D92A 3JX9A 2FQYA 1ZJZA 1UBJS 1D2CA 3DMGA 2O3RA 1Y6ZA 2PD3A 2NQ8A 1KPGA 1TW3A 3CGGA 4K8RB 4QXQA 1E58A 4GXQA 1OI3A 2VJNA 1HT2E 1KY2A 3FJYA 4ZU3A 2A0XA 4JEUA 4L75A 4GXRA 3O21A 3OHMA 1X42A 2AFHE 5K03A 2EFEB 1M6NA 1UC9A 2WYVA 2NV0A 3O0DA 5JV5A 1N0IA 2EIXA 3VJRA 2GF2A 3QHQA 2W6CX 4FFSA 4NKRA 2IOYA 4GI5A 5LUAA 4DG8A 2ZS7A 1WXXA 1ZIOA 1QTRA 4FIZA 4JJ8A 5G0UA 4IIBA 3MELA 4YP6A 2AMLA 3HNRA 1CBUA 2C9OA 5C4MA 1F5NA 3DBHA 1NV9A 2BI8A 1NT2A 1QFYA 2VSXA 3O83A 2I7DA 4NG4A 1KAEA 2A1TS 5DKFA 4CKWB 4DKXA 1DC3A 4WUTA 1V26A 3QFSA 1A8IA 2BFEB 4JL5A 4Z1OA 1F8FA 1ABEA 3BBPA 4UTOA 4R54A 5JAOA 1DTWA 1Y5RA 3BMCB 3TTWA 4OHVA 2G1UA 2NAPA 4NAVA 3JSXA 4Q9DA 5ABPA 2DXIA 2QXTA 3IP3A 4ZA2A 3L6EA 4CQMB 1A4XA 4DA0A 1WCYA 4EEXA 4CTMA 4P0QB 2VHEA 1EUDA 1CS4C 3UT5B 3IILA 3PE4A 2ACWA 2R84A 3QY0A 3NVAA 5EZYF 1TLLA 4AKGA 1YA8A 3AHHA 5IVIA 1PV4A 2ZUTA 5A9SA 4WY8A 5AVVA 1AGRA 2C4VA 2Z3VA 4GX5A 2AF3C 3IDFA 3TLJA 2W48A 2JLXA 1YR3A 3BJMA 1JH8A 5DTEA 2JFGA 1GO2A 1Z0FA 3NORA 5L4LA 4D1YA 1FYWA 4BO7A 4FC6A 3Q3VA 4BLOA 3AVYA 4G09A 2IYQA 2FEXA 1D2HA 2QD5A 3D9QX 5G4KB 2ZIGA 3FYTA 1GTJ1 1JR3A 2QE6A 5FNVF 3S7ZA 2NQTA 3AIMA 5AKZA 3IA7A 3NX4A 1Q1QA 2QXYA 1XEXA 1A5AB 1SUCA 2JEOA 3BSFA 1UXJA 3FJOA 3O75A 2FFBA 2LDBA 2XCIA 4MGIR 3QEAZ 1L8AA 1XAJA 4YRRA 4KIWA 4YCMA 1YCHA 2F3RA 3VO2A 3PDWA 5D7BA 1IJFA 1Q7RA 1N2CA 5CNIA 2ST1A 4DG9A 2Z4RA 4REQB 2C5SA 2J0VA 2VHXA 2XUDA 2YKGA 3DHEA 4IIXA 2WIGA 2OZVA 4WZAE 2ZI4A 4MI3A 3FWKA