2O8NA

Crystal structure of mouse apolipoprotein a-i binding protein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
233
Chain Sequence
AVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Characterization of Apolipoprotein A-I Binding Protein, a Novel Phosphoprotein with a Potential Role in Sperm Capacitation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords ApoA-I binding protein
total genus 75
structure length 233
sequence length 233
ec nomenclature ec 5.1.99.6: NAD(P)H-hydrate epimerase.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 2o8nA00
3RRFA 3RRJA 3RTEA 3RU2A 2O8NA 3RO7A 3RNOA 3RSSA 3RRBA 3RS8A 3RU3A 3RTBA 2AX3A 3D3KA 1JZTA 3RTGA 3ROEA 3ROGA 3RT9A 3RREA 3RTDA 3D3JA 3RTCA 3RSFA 3RTAA 3K5WA 3RS9A 2DG2A 3RSGA 3ROXA 3ROZA 3RT7A 3RSQA
chains in the Genus database with same CATH superfamily
4PLWA 4B6QA 2V7PA 2PRSA 1PR6A 3DZHA 2Q1UA 3REQA 2B2NA 2WJGA 2E48A 1AKRA 1VMDA 2GAAA 1NVMB 4LDQA 3OOYA 4D7AA 1NDHA 3BF7A 3QKRA 5IT5A 5MGBA 2PEZA 4TWIA 1AY0A 4XCXA 1RBYA 1TMOA 1IG3A 1KFEB 4KXWA 4L4XA 1NIJA 2HU5A 2OHXA 1WOYA 2QRJA 3NYIA 5ABPA 1JPJA 3OPXA 1NKSA 3ZZUA 3VNRA 2C82A 1HFKA 5INTA 1NJGA 2DMRA 4HDNA 4CV0A 1O0CA 1J2RA 4CMGA 1NW6A 3MJTA 5DT9A 1RRKA 4AZ0A 4BRUA 1F14A 1XHEA 6REQA 2WTBA 2YR0A 2DTXA 1DU4A 1KI7A 1KXZA 1XKTA 3C85A 4K9KA 2NW6A 1GPMA 4XEUA 3UUWA 4R3WA 1DKOA 1Z5PA 3HP1A 2ICAA 2QN8A 3AC0A 1EHIA 1ZESA 3CLRD 2FZGA 4M38A 3STWA 4PLGA 4C87A 1ZNYA 2QXUA 3LIIA 4II2A 1NF2A 2I66A 4JCOA 5TB5A 1B0PA 1YE3A 3PCRB 4R6XA 1ICEA 1FDIA 2H2GA 5J2UF 1UC4B 3VZDA 3HJUA 1E6CA 4B2IA 3K2IA 3PLNA 5SICE 1F6BA 1RACA 4XIYA 4HD8A 4KX3A 3F3KA 3NASA 3C5HA 3U40A 3KSMA 4AF6A 2XOKD 1H8HA 4B3IA 2F3QA 2WZDA 5JXJA 4W9RA 4BVHA 1W44A 1JEAA 2PGAA 3R74A 2PZEA 1JNXX 2AX4A 3FRJA 3PC7A 3VAYA 3IAUA 4ETMA 4JBGA 5EVCA 2D5BA 1Y34E 3S81A 3HYSA 1FRNA 5GMOA 4FGKA 2FK7A 2IHJA 2PFSA 4KO8A 2VDQB 3WFIA 4IKEA 2WDPA 4BNJA 4OXKA 3OQJA 3D3KA 5CYFA 1XRRA 3IAM1 4CDNA 3EFBA 4EFNA 4DMGA 4G07A 4C0JA 5K3AA 3U7HB 2PYDA 4KXQA 3WGHA 2II6A 2V8BA 3DYIA 4KR7A 2QN9A 3AR4A 2B1IA 4M6WA 3DVSX 2R68A 5C35A 5KX5A 2QL5A 2AFHE 4GOLD 3VX4A 1X38A 5EINA 1WEHA 2O0JA 2NO1A 2VZ0A 3CKMA 2ZYTX 3R5FA 4GZ6A 2GZMA 3LVBA 4IXTA 3ZVRA 2DBVO 1PNRA 4C6TA 3PCXA 2NUBA 1E2PA 4IJMA 4Q9LA 4CM9D 2FMXA 3H4MA 4PLFA 4QTYA 2ZWAA 2ZI5A 3RO7A 4EG1A 4ZK6A 3CWZA 1MOSA 3QUCA 3W78A 1QF7A 4YIHA 1CDEA 1MFZA 3MRTA 4QQKA 4CQLA 4ESOA 1XTJA 1NM5A 3AY6A 3H1FA 3S1AA 3UUGA 1H5UA 2A1TS 1CU1A 2XIQA 1DKPA 2PZ8A 1X7XA 1YULA 1AHIA 3D7RA 3JQQA 2VK2A 2C61A 3E7WA 5D1HA 1KE1A 1MDFA 1NBOA 3SX0A 2CDCA 4XGKA 3IJEB 3QWBA 2B98A 1U9CA 3U4CA 1WDKA 1I5EA 2PBZA 3V2HA 5L8VA 2EJTA 4RCVA 2EIHA 2G1UA 3Q9UA 1YIOA 3HXQA 4K87A 2G4VA 4GI3A 1ZVKA 3NC0C 3VTFA 4C20A 1CJCA 3BFJA 5A3VA 3EXFA 4D99A 5NULA 2PS3A 4I4NA 3TIVA 1Q7BA 1JEEA 5CT6A 1Y7TA 3CSDA 1C7JA 3OD5A 4G6ZA 5G3YA 4MGKR 3V4SA 4F84A 2ACVA 1SY7A 2FFJA 2I2XB 3C3DA 2EBWA 1G4UR 3EIEA 1BN7A 3CRQA 3PFNA 4P4SB 5A0FA 3UKJA 3MTQA 4FNGA 3S5JA 2XOXA 4R01A 3SPXA 5C46F 1Z37A 2OHFA 3OQHA 4DSOA 5CCDA 2VCHA 3FCAA 2NOAA 1HT1E 1IN1A 2XQGA 3P26A 3D0KA 3M6XA 1SU8A 1ID8A 1H6AA 4TMKA 5I9BA 2G08A 2Q41A 2WINI 1YUNA 2XRYA 3N8IA 2HA5A 3BH6A 2N9UA 1OXUA 1ND6A 2XOKA 1KHHA 3K6SB 1T8TA 1X86B 1NQTA 2VCEA 3COYA 3D5TA 2C9DA 4QXAA 3CR3C 3CY6A 2AFIE 4EW6A 3N28A 1YE5A 4ZK2A 4BPBA 4F7WA 1ZR2A 2DFVA 5THQA 1YWGO 2Q5JA 5KDOA 1BS1A 1RRGA 1FZQA 1SCIA 1GKIA 2ZFUA 3UQYS 2R7MA 1BDBA 2WUWE 5EMNA 2D2FA 2D1TA 3C7KA 1KS2A 1S02A 1UKAA 3OPQA 1C7RA 2IHZA 3D6TB 2XB8A 1CY1A 2WV7A 1FVFA 3H04A 2HV9A 4DXHA 2J0QA 3WGNA 4WMLA 2WICA 1L5NA 3UK0A 2WAYA 3I2JA 1Y6GA 1PTKA 2YOFA 4PSVA 1APBA 1R0XA 4ZQIA 1A4IA 2X9NA 3UJDA 1L4UA 4S0XA 2W2QA 4DMUB 1KQGA 1ORVA 1UAYA 2V54A 5AJVB 4DLVA 4RFLA 2VHYA 1VHWA 2P35A 3LCRA 2NPIA 1PTJC 4NAHA 1T0JB 1ZC3A 4NNOA 1E1NA 2G72A 2Y99A 3E3AA 1AA9A 2D2XA 3ZDBA 3H5NA 4D8TA 1W5AA 3N5KA 3WYGA 4DIKA 4MZXA 3DE0X 1ISRA 3DMDA 4N65A 2B4TO 3U48A 5F3DA 3W5SA 5KSWB 5FT9A 4NBRA 5T8KA 2YWCA 3Q7IA 2WIDA 4JZYA 5A9RA 4UEQA 5B3JA 1T1IA 1BHQ1 1MJGA 1O95A 1CRQA 3Q9NA 3PVCA 4ZVPA 5TVGA 3T5AA 4DFDA 3GC6A 3G8DA 4UDYX 5DNUA 3JQGB 2RCYA 4IZ6A 2J0VA 3GCGA 1XYGA 4WLEA 2C7OA 2VK4A 4K1LA 3CZQA 3BFPA 3U1BA 3GR6A 4YMHA 1MG5A 2OBBA 2RFLA 3GGOA 3IA7A 1XD2A 3KEGA 4MCHA 3NDIA 3R6TA 4WLVA 4Z9FA 4ZCSA 4EHLA 1NG9A 3K9HA 4YN3A 2QQEA 4KXLA 2F3TA 1BKDR 3AX6A 3IRVA 3QKSB 5JDIA 2AOUA 1PEAA 3HKBA 1E9FA 3DFFA 1PVVA 3GJ0A 3H2HA 4UD2A 2WTXA 4ND8A 3WIDA 3X1XA 4E4YA 4EZIA 5ICGA 2IU6A 2QVXX 2NNWB 1EUDB 4BNXA 2GBFA 2HA4A 2IIQA 2BI4A 1LC0A 3JQRA 1LVHA 4EZEA 4FC7A 3T7AA 2RGDA 3JZMA 4CFYA 2QUZA 4JQYA 3TQFA 1CIPA 1E6LA 1A9RA 3UMVA 3EF1A 5ALYA 3ZWAA 2HU8A 1Z7YA 3N2ZB 3HCEA 1NPYA 1NN5A 4RV9A 2VJLA 1PX0A 1YCGA 2Q6OA 3IBFA 4PG4A 1TTHA 1SPBS 2IUFA 2IXFA 5KYYB 4L8VA 4OCZA 1FBTA 1QHSA 1OAOC 4QOSA 4EGAA 3V42A 4PNEA 5ALZA 3I37X 2BGIA 2C5GA 3HN7A 4QXRA 1UJ4A 1S9HA 1QZ3A 3P0HA 1PTJA 4BFXA 3JQEA 1GTZA 4MJLA 1KU0A 3HV2A 2QLFA 4RVOA 4KE7A 2RGNC 1AG9A 4JB2A 5LZ4A 4LDRA 1T8YA 1NZDA 2QP4A 3V8QA 2GBLA 3ETGA 4G84A 4UOEA 4EHJA 4XVUA 2IHNA 2V5UA 4XUCA 5D7NA 4EG8A 4BNHA 4NFLA 1I32A 2PMCA 1G64A 4E51A 5KNBH 16PKA 1HTBA 2A14A 4QO7A 1Z5ZA 5F2KA 3LXUX 1HLPA 2HU2A 1QHHB 2AI2A 2X6RA 4D57A 4NWIA 2BGKA 3ESBA 3LGAA 4A2PA 2GZHA 1JHRA 1I2ZA 3LS2A 1T1SA 1XDZA 3D59A 1KAOA 3N2LA 3AJRA 3OX3A 4G4JA 1VLHA 5I01A 1L5GB 3LA8A 4UM5A 3VA7A 3DXYA 2IPAB 2Q6VA 1TVKA 2HJHA 4ZT6A 2DM6A 2CK3D 3C1AA 3CTPA 3GP3A 4DJJA 4EHBA 1CLEA 1A8UA 3K8QA 2GYUA 3GJTA 3BF8A 4EJSB 3QKIA 2ATEA 1S2DA 4HAVA 4ERNA 1JIKA 1Y5LA 3AETB 3GOHA 4PS1A 1FFGA 5DTMA 1MNQA 5FOXA 4EX6A 1C0LA 4NR0A 1HDEA 1GYRA 3V4FA 3O8RA 4U7FA 4JUDX 4Y1EA 1DUVG 1H3EA 2R25B 4EH1A 3HBFA 3PUIA 2V98A 5T5QA 3UT5B 1AVTA 3UA3A 3CHYA 1YBMA 1M6YA 4KL8S 4LEIA 3C6ZA 3KKKA 3LJKA 1LA2A 2PX6A 3BJIC 1T4CB 2Y9PB 3OCVA 2CYCA 3PE3A 1RWQA 4OSEA 1KEUA 3HKCA 3ZJ5A 2ZULA 2WAOA 4OXQA 2OAEA 4NRDA 5KNDH 5L4SA 1WY7A 2KSQA 3MZ0A 3U44A 1SBIA 4IDDA 2QVGA 4UMVA 3MLBA 5D6OA 5JS1A 1RFGE 2IYWA 3GGDA 5E0KB 4FFMA 4RDHA 2ZREA 2C7RA 3E81A 1GG9A 4YNBA 4BECA 2IE8A 4QVIA 3RS4A 2FCAA 1JLLA 4GOJA 2ZRGA 2FF7A 4L02A 1TU0A 4CLRB 2EKBA 2X8WA 2ZE8A 3DEIA 3F67A 1DQSA 4HYQA 3STVA 3KB6A 2V97A 1V71A 4E5NA 3N5CA 3GZ4A 2B37A 1CRZA 3IVMA 1B6TA 4GX2A 5KAPA 4GMGA 3PFCA 4QGSA 1X7DA 1EBBA 3DZGA 1YZHA 4P54A 1X13A 2FN9A 4BO3A 5I7HA 1Y5IA 4GL2A 4IKOA 3ER6A 3GVCA 1YFJA 2WMDA 4MV8A 3OIDA 4RYDA 4IPTA 3QVTA 4TV9F 3SYRA 4HGYA 1RADA 4KIFA 3IC5A 3EZNA 2J0SA 1MIOA 1EXVA 1GRCA 3NHZA 3EBOA 3RS0A 4YYZA 3W6PA 3GRAA 1YT5A 2V7GA 1P19A 4LZPA 4RTQA 3P8ZA 4FQ5A 4REMA 4EMBA 2O8BB 5FUBA 1I4LD 4QDTA 2IUTA 2JIZA 1CZKA 1EBUA 4RSMA 3V4VB 3W8EA 4C0QC 2WJWA 4OP3A 4EGSA 1RC8A 1QIDA 2O05A 4Y6LA 2GM4A 2Y0BA 3V1YA 2W83A 2XTAA 1U02A 2IYOA 2ORED 2I8AA 4OHOA 3F9IA 2O0LA 1S3SA 4KO2S 4WK6A 4EABA 3T38A 3FCEA 1G98A 2YWGA 4LJ5A 3TL3A 4PN3A 5JNRA 1CZUA 4TZTA 1MLDA 4FXPA 4Z4FA 5JY6A 3AKCA 1TIBA 4RMIA 5F52A 1W36D 4RAQA 3DTYA 2OVBA 1UQRA 3VOBA 3WX0A 1QR2A 2PSFA 4TOIA 5DISB 1JHVA 1VPVA 4BFSA 3OE4A 3UK6A 3ZDAA 3J7AC 1LZKA 4AIRA 1ZP6A 3C7CB 3CR8A 2XF8A 1OLXB 2P40A 1XEWY 4ASUA 2BEWB 2BBTA 3AEKA 1NTOA 3Q72A 2RMKA 3TOVA 2W2KA 1OREA 2Q1TA 1H1DA 2VHQA 3DVAB 3O91A 2VPWA 4B4WA 4YMTA 2EF0A 2YOGA 2IZ6A 2C9MA 2XT9A 1ZRNA 3MQFA 3DW3X 1YKGA 1WUTA 3KDPA 4D4LA 2RHMA 3F4BA 5EQTA 2RGGA 4KK3A 1R5BA 4RS3A 5G2OA 3QOXA 5TPWA 2C2YA 3RAPR 4CLOB 3D8TA 3B51X 2AI3A 3FLAA 4PYIA 3L4KA 2XJ4A 4ZVMA 4C2BA 3DMTC 5JJIA 1DPFA 1JYEA 1M76A 4AMBA 1U7UA 3N8DA 2I4RA 1G6KA 2NQ8A 5CPBA 5FOSA 1TEZA 1OAKA 4GYYA 3W5JA 2IU0A 1DJPA 4B4DA 1EI9A 2N47A 4UBKA 5LYJA 4DPMA 2O2JA 1CY6A 1G8PA 3ID6C 3IODA 4JSTA 5DHSA 2ZBEA 4LHZA 4OXYA 3MRVA 1FCJA 3COWA 2EZTA 2WABA 3KNZA 5ALIA 3TLKA 4ZICA 3KKEA 1WXWA 5H3CA 2WRZA 4D9KA 1FYXA 2L17A 3W3ZB 4OM8A 3LK7A 1F0PA 4DRXB 4NJMA 5EIOA 1V5FA 3GPBA 2CBGA 4GUAA 4ZI5A 3RC9A 1WRBA 5JQGA 1J25A 2P5YA 1QIFA 3O0TA 4P6VF 3VZSA 3IKTA 3LKDA 1QAQA 2PN1A 1HE1C 1ABFA 1CZOA 2HK9A 4CM4A 1YS9A 4D9CA 4MVCA 4R1NA 3S27A 3PKJA 3JVEA 4G36A 1GSOA 1OJLA 2J3IA 3MD0A 4RK6A 1U90A 3O92A 4WE3A 4E3ZA 4KAXA 3WA6A 1V26A 1BXZA 4A5OA 3C3JA 3WNQA 4TKLA 4LBYA 1A3CA 1C4KA 3T3DA 4ZZIA 1FTGA 2PLAA 5D1NA 4AQ7A 4P82A 3C0KA 2HV8A 1YS6A 5AHWA 1V5WA 2SBTA 3CH4B 3WLEA 3B9PA 3TQOA 1X7WB 4IQ8A 2Z8YM 1AZLA 1Q1GA 2GRAA 2VKTA 1GZ5A 1ZK3A 5IAEA 4JS0A 3A05A 3QQ5A 5H7XA 3VKGA 5FNZA 4IV8A 2HNBA 3KHUA 2NUPB 3PE6A 2YMMA 1HDIA 3ZXYA 3BERA 4HDQB 1YOVB 4YP5A 4C4TA 3ZHCA 3ZW9A 3A1FA 3OM9A 2HDHA 4II3A 4LF9B 4H6WA 2NZ2A 2HA2A 2I55A 3QLUA 5KO2A 2O5EA 1W4CA 1DRJA 2GJKA 1PEKE 4CNBA 1QO0D 1JBKA 4U2FA 3B6JA 3Q7SA 1KFKB 3EPLA 1IE3A 2PMDA 2J5BA 2Y8EA 3CJTA 5T4HA 1AURA 2YKGA 1G20E 1IN5A 2VYVD 5J59A 3VDQA 2OHHA 1U65A 3GNLA 1DBVO 5LQJA 4C1NA 1VFPA 2ZI4A 4Q66C 1BW9B 4ALIA 4EG5A 3RPEA 1SUFA 3JQ7B 4KO1S 5IABA 1B0UA 1N33B 2HUNA 5E4TA 5BSKA 4RHXA 4RNDB 4H7HA 4DC9A 3FI0A 1FBNA 1K5DA 1LLFA 1RAAA 1ULAA 2ADFA 2HT6A 1EUYA 5HFNA 2PV0A 3KKOA 4O63O 3R2JA 4MR8A 4HQOA 5K03A 4IVPA 3K6SA 3RFTA 1VYUA 5FIUA 5B6JA 1P81A 1UT5A 2X23A 3S7ZA 1LBIA 4G8DA 4P4TA 1NJFA 5AIBA 3WLNA 1XEXB 1JZSA 5KS2A 1H42A 1YJCA 3GF4A 1H2WA 2XGOA 3G2IA 4YRAA 5BR1A 1WW3A 3G9ZA 1NXTA 1F5NA 2AC4A 3D4PA 4R9VA 1CR1A 1AT1A 3PF9A 1EGAA 4C3UA 4RHEA 3BE5A 3BRQA 4G0UA 1U6KA 1DBQA 1ZH6A 4CMJA 1E5VA 3HCBA 3PNPA 1C14A 4XLZA 4U3JA 1UZNA 2QN3A 2D0PB 2X14A 3I73A 3R3VA 4JVMA 2ODEA 3WTBA 1KI1A 3ICWA 5BNIA 4P3NA 2H8GA 5DLQC 3BULA 3RI3A 2BR3A 5IJ0B 2LBPA 2Q3HA 5T4FA 3VI4B 4J0JA 4AKIA 3L93A 1RRFA 1TMKA 4UE3S 2HSDA 4ZYTA 2FETA 4P7FA 2VDPB 1FLNA 2XKJE 4YDHB 3U4AA 4Q05A 4OUKX 5KTNA 2YCLA 1QXSA 4UARA 1CCWA 4X00A 5DCLA 3V9PA 5BSEA 4DCOA 1XHFA 2MYNA 1FP1D 4LW8A 3K2BA 1WLSA 2GBGA 2PZMA 3OCXA 1CP3A 1WM1A 2LZ0A 2WHYA 5IUKC 2H52A 3MN1A 3SDZA 2H5LA 4BFWA 2I4OA 3UOGA 1NQXA 3V32A 1IEVA 3I2KA 5IFLA 4JUAA 1MO4A 2ZR0A 2A0YA 5EHIA 3KEOA 1ZRHA 2ZS9A 3TF5A 3G0BA 1FJ2A 5K0ZA 1TM4E 3P94A 3A14A 3OJEA 1CHDA 3I0NA 4LQ4A 2Q3BA 2X0EA 3U37A 5IVHA 3LXXA 1SVKA 1QO0A 1A5SB 4LZZA 4X91A 2VDLB 3DAHA 2MSDB 4W5OA 5I9LA 3GCZA 4JBHA 5DXAA 1F4PA 1Z63A 2QTGA 4K6CA 1JIVA 5K3SA 4YJ3B 1X1TA 1DOHA 2NSHA 4IGKA 5D3MB 1T4MA 3UO8B 4UCFA 4AMVA 4Y9UA 1DS6A 1VTKA 3GEIA 3HKBB 4AMGA 5K0CA 2EFDB 3BRWD 3W5DA 1HO3A 3LBYA 1NBHA 3TVDA 4AF8A 4IF6A 4B6SA 5D5PA 3ZTTA 3JZFA 3WYAA 1NNLA 3ZE1B 5FHQA 1OZGA 3FETA 5A5DA 5JJ5A 1CUZA 2WHEA 4TKUA 3T1YB 5IARA 4N49A 3TE7A 2VH1A 4O25A 3FDXA 4IEFB 3WSTA 1ITZA 4MVJM 4IR7A 2FJ0A 2FKNA 4G5YA 3BHJA 4UVHA 1EFRD 1T0HB 2GEKA 1A2KC 3ROPA 3VU9A 2I2DA 2WSMA 4MCJA 1UMBA 2QK4A 4QD3A 3V8VA 5KYYA 4YCNA 4NLLA 3RJTA 3HXKA 4ZTBA 5U1PA 1KY5A 1NXXA 1ORWA 3ZV7A 1T9BA 1KQNA 4G09A 3BDAA 2ZR8A 4M60A 4A2CA 3S55A 2IHVA 2P30A 1QAMA 1FQWA 1DBSA 1IL0A 4GP7A 4B8ZA 2I91A 4KMSA 1PS9A 3PA8A 2HOQA 2GCOA 2YN4A 4H1TA 5ESDA 1Z4PX 1IMJA 3W2TA 2D06A 2QD1A 3VNBA 2FXIA 4GR5A 1PWYE 2O06A 3NIGB 1PS8A 4LMAA 1JT9A 3I62A 1U0JA 2CHGA 1XQ1A 2EC5A 3BRSA 3MJFA 1VLZA 4O02B 3OF3A 4JI6B 5JHHB 2NYRA 1GL9B 1EP9A 5FPTA 4EI8A 3LT4A 4XIJA 1Q91A 5FI3A 2NSYA 2VUUA 4G26A 4N82A 4CQJA 4QYIA 3PEUA 3UANA 2B8TA 5IRCD 2LCIA 2VPIA 4QXMA 3D4IA 4WSOA 5TQ2A 4L85A 4LKOA 2ERCA 4BKUA 3D6FA 4GGPA 3ZQ6A 2GK3A 1Y1LA 4C0KA 3NT5A 3O9ZA 1SXJE 4EYQA 3CRNA 1JILA 4WOPA 3FD8A 1G4HA 1KMHA 1DJOA 1UDBA 1Z13A 2A94A 2G77B 1NW8A 2QJTA 2W5UA 3R1IA 4JC5A 4PRLA 4TT3A 5EE3A 2AL7A 1N1EA 1TMGE 2Z5GA 4TWAA 3JYOA 1RI3A 2GD1O 3K0CA 4WACA 1I9GA 1EPUA 5AT1A 4I1PA 5K8TA 3LFTA 3MOSA 4AXXA 1O94C 3F96A 3JWPA 5AYVA 4URXR 1S7CA 4P0QB 3HZZA 2QZ9A 1HDOA 2F8LA 1F4VA 1SULA 2VQSA 3EA5A 1JHUA 3R77A 4IRXA 4V0OA 4G81A 3SDBA 1J56A 3GMIA 3WZMA 3R9XB 2Q45A 1WHSB 1D09A 4PYKA 4O4HB 4AJHA 2QUKA 2I6GA 1Z6ZA 2JFVA 2XCQA 4HXEB 4RA9A 4QPPA 4GOMD 3OHSX 2A84A 4RKWA 1FY2A 2OQIA 1AKEA 3CWCA 4LSMA 2GEFA 2QAIA 5EJ7A 4JKIA 1LI7A 3B13B 3D02A 4JFAA 5HWSA 2ZE5A 1G2QA 5KKCA 1BXRB 1NHGA 3CX4A 3MBKA 2QF7A 3L4BA 4G1EB 4PQEA 3UTCA 3NYQA 4LJRA 1ZCFA 3N2KA 2W71A 4PG8A 4Z53A 2H63A 1J06A 3BAZA 2HD4A 2H59A 4JD5A 1ML4A 1SUAA 1MAVA 2XE6A 1E1CB 4RK0A 3GPCA 4RL4A 3VJLA 3EH1A 1FYWA 1SHUX 1PJLA 1TEVA 3JALA 4B46A 1PRYA 1EK6A 2XRZA 2CNNA 1C8KA 1ESMA 1PN3A 1XZEA 2Q5CA 3FAKA 5JLJA 1R1DA 5ILOA 3PG5A 2HSWA 1ZD1A 1JEJA 4JKYA 5F33A 4EGFA 4IJ5A 3LVQE 4OQPA 5CDSA 1Y89A 2XGJA 1EX9A 1F2UA 1L7QA 3ET5A 1QYDA 4DQLA 3WRXC 1E3MA 3DV9A 2WSIA 1U7WA 2OCAA 2BEVB 1LDEA 2Z43A 3DBLB 1CJSA 4XVHA 4YCLA 3HLYA 3VHXB 3HBMA 1P5FA 2W98A 2ZJ3A 1SIBE 3C1TA 4KMOA 2ATIA 5I4CA 2YJGA 1WMSA 1O5IA 1FZTA 4UVEA 4ZQGA 3B2EA 2QIPA 1XKQA 4ZAVA 1UBHS 1TQ2A 3EZFA 3DE2X 4R5HA 5EGSA 5EIHA 4FKBA 3HRIA 2RBGA 3NHUA 1J0DA 3SI7A 5LSAA 4P2BA 4AY5A 3B52X 4M6WB 3LY8A 3GJYA 2KHZA 3SKVA 4D8XA 1QIEA 1J21A 3SICE 8LDHA 5FYDA 3FJOA 3PNYA 4QUGA 3PXCX 1WB4A 1PJZA 2NTEA 3ENQA 4I1RA 5LBUA 3R76A 2XD4A 1O08A 2R11A 1JX6A 5J4HA 3BXHA 1RI2A 1MORA 1H23A 4EW1A 1I2CA 1OLXA 2YXLA 3E7XA 1MQAA 4BKRA 3C14C 3CSSA 3H8SA 1GWNA 1BQEA 1FX0B 3PDUA 5BN4A 5JFOA 5LMZA 3G0HA 2MINB 4BWYA 3KDAA 3B9QA 3JWEA 2FRXA 2L82A 4F1KA 3I28A 1OLUA 2P5UA 3DEKA 1J09A 4YIKA 1PR2A 5A4KA 1Z68A 3S70A 6NULA 1UKEA 1ADCA 1CFJA 1I3OA 1YFLA 1B15A 1X77A 1RMYA 2E5LB 2FPMA 3AERB 3ZWXA 2JA1A 5F3WB 4IF4A 5J23A 5LDHA 1XTVA 3EGCA 3TPCA 3CRMA 1I1HA 3AESB 5KVAA 1LDYA 3MJDA 3W2FA 1UM9B 3VR4H 3COJA 1DRKA 4BO9A 5BW4A 4FN4A 2ZB7A 1RP1A 5BVGB 3NQ41 3G88A 2BFDA 3DJYA 4UMDA 1KYYA 5I7SA 1KO7A 3C3XA 1NBMD 3CZ5A 2OCLA 2ADOA 2QLJA 1D1SA 4CFSA 3F9CA 3SVLA 5LCXA 2SKCA 3G1UA 3FNHA 3KAPA 4I4LA 4AN4A 4TZ0A 1V8ZA 1E3EA 3JQ9C 2WSBA 2ZUBA 8MHTA 1DIOB 4FGWA 3VHQA 4EBBA 4HX2A 1ZXXA 5HKOA 3DAPA 1JHZA 1X1CA 1Z29A 2HHLA 1MH9A 2LR0A 4KUHA 5DWQA 3MWJA 3R8XA 3SD7A 3U0VA 1EFVA 1RZRA 3E5RA 3QWIA 4I14A 5C4IA 1GRNA 1PWEA 2VQDA 3G2NA 3OFKA 3TS1A 2ATXA 4PY2A 3RVBA 1NY6A 1FP7A 1T43A 5DI3B 3NEPX 3T3GA 1CJUC 1A5BB 1TF5A 3N86A 3K16A 3NRCA 5IAGA 4M83A 1G9XA 1ZPDA 4DGQA 5EKTA 3F78A 2HT1A 1UZMA 1KGDA 2P9ZA 1EVJA 4BLUA 3C2QA 1P31A 3ZK7A 1DV1A 5IAOA 3C6XA 5FNVF 3WK4A 3RRXA 5C5DA 3R20A 3G6KA 3DBVO 1L6RA 4MQLA 4JLVA 4E6PA 3MXTA 4A26A 3ES9A 1AU9A 1OOEA 4DUZB 3EPPA 3EEOA 2BCGY 4TQAA 4P8RA 1W4AA 3QBTA 4KQ1A 4UEKA 1SC1A 5DGXA 5ICCA 4LKRA 3RVPA 1JWLA 2OGSA 2V74B 1E62A 1MHPA 1VZ2A 2Z4TA 4B17A 5IP5A 4GX5A 4PLCA 4MQMA 4B6RA 1U4NA 1Y3AA 4ZAXA 1XJWA 5K3EA 4AQDA 2DULA 1JG1A 3EF3A 3KAQA 2N3ZA 5JALA 1IJBA 1C1XB 1JQJC 2VTKA 4DREA 5FI1B 4Z51A 3R0ZA 1PT5A 4OO3A 1KORA 1L7VC 1NASA 3TB6A 4KTVE 2F1OA 1L7BA 1IZ9A 4M0CA 3AY0A 5G1OA 2ZVPX 3U7RA 3MCTA 1AK9A 3BE6A 4NYJQ 2UUCB 2IW1A 4LZWA 1A95A 1PLKA 3KVNA 4ARVA 5KJCA 3TECE 2W2TA 4S1WA 3RLIA 3L40A 4GKAA 4F5WA 1XA3A 2CYAA 1EUDA 3SVTA 3KP1A 3INTA 3PRKE 4MUJA 1Q7RA 1L5SA 3Q0TA 2BEUA 4YS6A 3NNSA 5AR1A 2B35A 3EIQA 5BRAA 2UXCB 5ALGA 1GHTA 3HTXA 4IEEA 2RGBA 4WUTA 4CMHA 1DT3A 1T5OA 3R75A 1FYFA 4JBXA 3ZDRA 1JKXA 4R0VA 3OESA 1E9EA 4ZQHA 5CLJA 3LKBA 4IFTA 4PZEA 4ZMSA 5K0TA 4A3SA 5F2NA 1Q2UA 4BO0A 3K9LA 1TM2A 3HB1A 1MABA 4PYRA 2BC9A 1DIGA 1Y8CA 3LO8A 3Q98A 3R0XA 4D0NA 4CTMA 3GFRA 2BGNA 3OETA 4L4UA 5SZJA 2ZPAA 3G6WA 2GYVA 2AJDA 1XZCA 4CM9A 4TN5A 3ZZ0A 2BI7A 1QFYA 1JR3A 1VIYA 2XDQB 3M82A 5BSHA 2GCEA 3FZQA 5GM2A 2XGSA 4JH0A 1XNQB 1DCTA 5CJJA 3QHQA 3SJ7A 4W6QA 1EFPA 4C4ZA 1WNTA 5F5LA 1B73A 2W70A 4IIEA 1DXYA 4G0QA 2XVYA 3RC7A 4DCJA 2CCKA 1GGNA 3ZY6A 2QN6A 1PJ2A 1YSCA 4AG5A 4MDFA 4QXQA 4YJ2A 1GTVA 2ZAYA 2AHOA 4R8SA 1PZHA 4D9HA 5K5EA 2W42A 1GNRA 1L3BA 3JQAB 3O73A 3QLVC 4ECEA 1B1CA 5HGJA 1QV7A 2CLSA 2P8JA 2J3LA 3T0GA 3C4QA 2AQKA 2Q8NA 5BSTA 2JKVA 1LPAB 1ZKMA 1JP7A 1HY3A 2YWRA 2P9TA 3IHWA 3X1JA 4EG6A 2B5OA 1KETA 2QUJA 1IB0A 3SSOA 2DBYA 3UAVA 2Z04A 1F3OA 2F9MA 3PJRA 4H77A 2H18A 2X7JA 2WEKA 2YN2A 3UYKA 1XZ8A 4FMDF 1PR5A 4RF5A 4Y9RA 3P2OA 3GV0A 3PD1A 5GVSA 2TSYB 1GUYA 2BJVA 3C3AA 2XSZD 2KQUA 1TCUA 2G9UA 4FR2A 4KI0A 1M34B 4KRXA 2YWFA 1Q11A 1TYBE 3NOVA 3EQ8A 2H2FA 4INJA 2R7NA 3H8JA 4Z0PA 4L9SA 4AKTA 4B6PA 4DR4B 1MQ9A 3KJHA 1DAHA 1XXHA 4RTJA 5F9FA 2VDWB 2UU9B 4V0NA 4LY9A 1KDYA 2A9FA 2NQ2C 1Y9EA 4ICIA 1K6IA 3F3MA 3UC5A 2VSOA 3NHMA 4G8CA 3PD0A 1TFRA 2J0UB 4H16A 5FLYA 4FOSA 3GLHE 2PS9A 4GT1A 5DWVA 5BURA 2DERA 2HQBA 4WKCA 1TD9A 1CY0A 1DC6A 5AVWA 2XWJI 5HSGA 1A7AA 5DBIA 2LUOA 4XYEA 3BSWA 4JBIA 4CI9A 2R8XA 4FX5A 2H65A 4HQFA 4I9GA 2VRWA 3HDVA 2FEKA 2JI9A 1OZHA 3CUYA 3ROEA 3ZHBA 5B12A 4YJFB 5ARCA 2YC4C 2IX9A 1G20B 2VF4X 4B75A 1OA1A 4YWHA 4EM6A 2ANCA 4OV6B 2ADMA 5EHNA 5HFJA 2B94A 3G17A 3TBFA 3P9RA 4EY6A 1O96A 1P1JA 1ZMTA 4H7EA 1D4FA 4BQEA 2O9JA 4AJIA 1E4EA 4ABYA 5JY1A 1JKJB 1XWFA 4CIWA 2O4CA 2NV6A 2J46A 2OD9A 4UM9D 2BI8A 5IJAA 7YASA 3HK2A 3KWFA 3GPDG 2BAGA 1XEAA 3TFWA 4RM3A 2HLHA 3C6BA 5ALEA 4B73A 2BL4A 3FXAA 4KYVA 1FW8A 3VH1A 4IAOA 4AN0A 3IIKA 1I4TD 5FWAA 2OWEA 2F9LA 3VDNB 4ZCIA 1W1UA 1P77A 2BFBA 1NXVA 1PQWA 2ZVQX 2NQTA 3QU5A 5I7AA 3PNBA 1P39A 2PO7A 2ZITA 1FTSA 4YO8A 2G5CA 5K51A 5DV9A 4BUCA 3WNCA 1L2TA 3WMFA 1RYMA 4LF5B 2RI6A 4AJ9A 1F8YA 4OB7A 1SXJC 4ZJUA 3VPBA 2HPAA 5EUQB 3GYGA 2GBPA 2JS7A 4E6EA 4ESEA 1UBSB 2QG6A 5BYAA 5IK2D 1EK1A 2FFBA 3HZOA 5K3FA 1QC5A 2IZ5A 5E4FA 1U1CA 4AY2A 1KOJA 2BR5A 2XUQA 1BE8A 1I4WA 2QYOA 4EW3A 2BFPA 1KK1A 3HNOA 4RZQA 3ZVMA 1ZRMA 4UUOA 2JGJA 3EVAA 2X9GA 3P97A 3V4ZA 4DBLE 2V9CA 4U6SA 5DASA 2YTZA 3QI2A 4GYJA 4JN6B 4DLNA 4ZI7A 3IB3A 3ZHRA 4GLLA 2JIMA 6PFKA 3CN7A 3DS8A 2YMQA 4MDYA 3OTOB 1L4GA 3PEWA 1G16A 3BQNB 3LQ1A 1PJRA 2X0RA 3H5IA 4LPSA 4QUDA 5IAAA 2ZUVA 1CS0B 2OAGA 2UZ3A 2XLCA 4ZV7A 3UJ6A 4CLOA 2JJ1D 4HUJA 3IDOA 1M2KA 4INZA 5HP4A 1N8KA 3AF3A 1O6BA 1BDJA 2XLBA 5CA0B 3CF4A 2O0KA 5LP1A 4FD2A 1L7AA 1G6Q1 4BNDA 5H8WA 1ZAYA 5CBPA 3SIRA 4ZHSA 3S2SA 5ADUS 4Y6RA 2NP6A 5BRNA 1M74A 3RHFA 2AFHB 1A5TA 2REOA 3JQ8A 1NVEA 1DWQA 3MCZA 3TD6A 5BV7A 2COKA 1PGOA 4LXYA 1A69A 4YMIA 3EMDA 3SS9X 3BFXA 4ER7A 2D4HA 3EJWA 5GVRA 1FP6A 3WIOA 2YFKA 3QFHA 4RSHA 3VC2A 3EVZA 2GN1A 4FHFA 4YRKA 4AULA 1PBTA 3V3KA 4UHHA 3NVKI 3RVJA 3TAUA 4I3FA 5CB4F 3BD8A 4L57A 4MKRA 5CURA 2IY7A 3KZXA 4DCTA 1TLLA 8ATCA 3N9IA 3JWHA 3G2JA 3U3RA 3VR0A 1W9HA 1IHUA 5EJ8A 3PRYA 1SHJA 1FNDA 1UAGA 4U2EA 3SEQA 5AM3A 3ZZTA 3OIYA 5AW7A 4FDVA 2IOFK 4RGVA 3T61A 2UUAB 1R4ZA 2DY0A 4MV5A 5EKDA 3UKOA 2PX3A 4NU8X 4PBTA 2Z3VA 4R2WA 4PO8A 3T94A 1PJ8A 2GZRA 3O1JC 4XSHA 5TGZA 4BU1A 4XTCS 1KAHA 1OFTA 3EH2A 3EZGA 3AI7A 3HL0A 4ZGGA 3KT6A 3DP7A 4IGAA 1OHHD 3TUIC 1TUGA 4J1TC 4X63A 4WRRA 1M6WA 1POXA 2ABWA 4A16A 5A4JA 5KWVA 2B4RO 3D1VA 3OEED 2EKPA 4J6FA 3EDOA 4YECA 2O3TA 3USCS 2PGOA 5EWJA 2OFFA 3GFGA 1PJBA 1QP8A 2VDVE 1ZJ6A 3F2VA 1B00A 4X45A 4HDNB 5JI2E 1IWPB 2QROA 2PQ0A 4UJ5A 5F77A 2V6IA 4Q21A 1KJ8A 2CVQA 3VAAA 1BVRA 1HURA 1EAYA 3GEPA 2V5AA 1BAPA 3GFPA 4Q3KA 1XIVA 3ZHVA 4ZU3A 2ZJFA 1BGWA 1D9ZA 5FEMA 3L1VA 4PO3X 5F73A 3W3AH 4ZVUA 1MQSA 3MQ4A 3IR7A 4O2AB 4J1TA 4XGRA 3L7YA 4NYMR 5EZQA 5ALFA 2WQ7A 4O8CA 4WXRA 4L28A 4TRJA 1K92A 2X42A 1TM3E 4JJ6A 4MGHA 1RU3A 4B8YA 1I6KA 2P2GA 3HB7A 2IVZA 1T6BY 1R0LA 3RG8A 2O52A 3AGQA 4I99A 3Q3HA 2YUTA 5ALNA 4ARAA 5BW5A 5AUOB 5GADl 2AEFA 1FSPA 1EWVA 4OQEA 4MUYA 5K0FA 1Z0AA 3LFHA 3S8YA 1I4EB 3IV9A 4X97A 4QT4A 4BP1A 3BBPA 1E60A 5F7OA 3INNA 5F7XA 1CQXA 5JHGB 2AN5A 1J5EB 4RHCA 3JQ7A 1Y82A 2E82A 4LTDA 1R12A 3TL6A 4A23A 1J22A 2HX1A 4HP8A 1N0IA 3OU7A 5H83A 2O1SA 3O93A 1MZVA 3PQCA 4H15A 1Z5OA 4CKBB 5BUCA 1H4QA 4R8LA 2V4UA 1DEXA 3AQ4A 4HH0A 4BB5A 5HQTA 3ESAA 4B3GA 2YZ2A 1JAHA 3AR3A 4MQFB 4PZ9A 3AHDA 2L2QA 1WVGA 2FN7A 2OECA 3H9JA 4PPGA 1RWWA 2GBCA 3IE1A 1UQUA 3M4NA 3RUDA 4B4OA 3FVTA 4D8UA 4LZOA 4MLZA 1N8TA 2DCUA 4I9NA 5J9FA 2YRFA 4NMXB 1R8SA 5FUWA 3I3OA 4TRNA 3K1ZA 5EN4A 4FDAA 4ZWNA 3BXOA 3PUYA 1QKJA 4DLYA 3E0QA 4DYHA 5EAIA 2D74A 4DJEC 1GDTA 1QQ7A 2NO7A 3E2MA 5AM0A 4Z2AA 1ZWKA 3ZBPA 1XMSA 3IP8A 4OMDA 2ZYVX 3CGGA 4H6VA 2AMLA 1KH3A 2ZS8A 4RGBA 4D43A 1LS6A 2Y0PA 3I8XA 4EPYA 3KQHA 1X7XB 3IQIX 5LQRA 4RDCA 3T3NA 3IDQA 1N4DA 3L0ZA 4N6OA 1VI5A 1Z2AA 3ZWDA 4UHKA 1ZXLA 3EOBI 1VCNA 3TAHA 4F56A 4G1VA 4TMVA 4ZCQA 2RIRA 4JIGA 4DCPA 4J0DA 3Q1LA 4JC8A 1RJGA 1CP2A 2DBQA 1IJFA 2JD2A 3FPLA 3QITA 4J6EA 5AI6A 3AM5A 4B34A 4Z3OA 1SQ6A 4HAXA 3UEOA 3RTBA 4BMZA 3L8YA 4PWZA 2X5JO 1DKRA 2ZUTA 3ZZ1A 2GA8A 2JH3A 5DCYA 2WF9A 1LBQA 2I4TA 1CRPA 5DKFA 1ADYA 2Q3FA 2C4MA 3M3PA 1DOAA 2DX7A 1U6JA 2AF3C 2NXWA 2P3QA 2ZRAA 4LWZA 4ZU1X 2CBZA 2O7NA 3DD1A 5KEIA 5AW4A 3GFOA 2DLCX 3V6MA 4ENPA 3AFHA 5GOTA 4S1OA 3ZCTA 4FQ8A 4D9NA 3HJNA 5GIOE 2P4EA 1M6VB 5LD2C 2YBEA 3QU7A 4X7MA 3ZJTA 4IG9A 3DLIA 5LUAA 1V96A 1CDDA 3SJAA 1XZKA 3EQ2A 4KAAA 4QGFA 5HQ3B 3LY7A 1NQOA 1EHCA 2Z95A 5E6SB 1P1FA 1VKNA 3F7NA 3X1ZA 3HUFA 1M6HA 2H5IA 2C7GA 2OQVA 1HEUA 3S2UA 1JGTA 3AI2A 2HSZA 3IJPA 5COBA 4LYFA 3ZDYB 2CV0A 1QRTA 3URKA 3ORFA 2PH5A 2H2IA 2ZOSA 4MKHA 4LQDA 4TTPA 1NVTA 3ZWPA 5M04A 4BWGA 3IAS6 5KYKA 2ZYHA 3AXSA 2CCGA 4IYRA 2WWIA 5HMLA 5DOVA 1MT3A 1C7IA 5CLQA 2O7SA 2QP9X 4NECA 2P6UA 4WNYA 3PC4A 4AZTA 4DY6A 1IU9A 5KTRA 5TGDA 3BQMB 1B8UA 4V1CB 1NIPA 1U7HA 2CMHA 3DFZA 3OMWA 3N2GB 1C4XA 3UH0A 2AKYA 3E2PA 4P93A 3X2SA 4S05A 4EY4A 1MMFB 2JIOA 4KSCA 2WM3A 1U7DA 4RMHA 2Q3LA 2G40A 1LD3A 3KHKA 5L3VA 4C0BA 1M0SA 4QJIA 1E8DA 1N9GA 1QHGA 1BMFD 2JARA 3VNQA 1EP1B 4KFTA 2Q6IA 4K9OA 3TCXB 1D8TA 3IEVA 5LOVA 1ZGJA 3I9MA 2QR3A 1COZA 3KUCA 2BOVA 1ZGHA 2JGAA 1JFTA 4A36A 2YWHA 4HYEA 3HC7A 2DQSA 1FUUA 2GYYA 2YNMA 3B53X 4TV9B 1VL0A 5EIBD 1BIFA 1JHXA 2GVDC 1KBZA 3VO8A 3FW1A 1U0RA 2PZGA 1JEDA 3L43A 4NJOA 3OURA 3AIMA 2WOOA 3HYLA 3QG1A 4L5YA 3WLKX 3W5AA 5I7OA 5KTMA 4JJIA 4M37A 4OJKA 2AW5A 2FK8A 2EATA 4AG3A 3D64A 4CN9A 4QRDA 2QJOA 5KTOA 3W04A 3JYHA 1X2EA 5THXA 1G5PA 3NM5A 2Y1LA 3ANYB 2Z4RA 5I8ZA 4IFIA 3ZCRA 4QECA 3TUZC 5CB0A 1FLDA 4CM8A 5EHZA 1XG5A 2QGNA 1N5JA 2QA5A 4HH1A 4ZDIA 5T67A 3V1LA 1Z0UA 2C9ZA 2AK3A 2OV1A 1UKYA 3BTSA 4R2MA 1JALA 4O2RA 2GUGA 1GSAA 3H84A 4PO1A 4RORA 3T5TA 3LFUA 1ZHHA 4BNYA 5ANRB 1O6GA 1TIKA 1VLVA 3ENZA 3O2JA 4J0QA 1FVOA 4XQ9A 5TARA 3GZTB 4BNUA 4PC1A 3CISA 1XTKA 4FBMA 3U56A 2V8OA 3CNHA 4PIVA 1LRJA 3C6KA 3SCZA 3UXEA 3OQPA 2XITA 3RU2A 2AJBA 1E69A 1PYOA 3E8MA 2GAFA 2B92A 1PJSA 4ZQCB 3VOSA 3WLSA 2ON6A 2ZYDA 4MUGA 1JE0A 3H9CA 3M4JA 4JI4B 1ZZEA 3ELBA 1F48A 5KPDA 4B3JA 5E9QA 3ISVA 1E1LA 2ZIAA 4YRRA 5BSMA 2XZDA 4D3XA 3T06B 3OCCA 4XM2A 4DJAA 4NCXA 3FROA 1SG0A 3WISA 2ID7A 5C8VA 3U5ZB 2ZRBA 3ADKA 4XARA 2QGFA 1GKUB 4GBMA 1Z2OX 1YQGA 3VKFA 4B4UA 2VTBB 1QH8A 4YJFA 1BEZA 2H17A 3OZIA 2VPTA 2DUJA 4IMIB 2R8BA 2ZRKA 4LXGA 4E46A 1W0JD 1R27A 4MWZA 4F8EA 3M6WA 3WKEA 1UBCA 3M8KA 1NLFA 5KWJA 3N8KA 3TFOA 9ABPA 3LYAA 4W1PA 2I78A 1FVHA 5AP9A 4EFKA 2AEEA 3DOFA 4OTZA 2JGKA 2WJYA 1D5CA 5BWBA 3FMIA 3ZEAA 2PAFA 3KKZA 1XZLA 4TROA 1E1KA 4ADSG 1USWA 4NCAA 1QRSA 3RD5A 2H9YA 3AEUB 3COVA 2W2NA 5FWYB 4OX9Y 2VT7A 5F9MA 5AOAA 4Y1RB 3JU3A 4UXIA 4DWWA 1WBDA 1VE7A 4DZRA 3CZ9A 4F46A 5JI3E 1N2BA 1FQOA 3A4YA 3K20A 3VVLA 2W6JD 3T7TA 4JP1A 4LSWA 2CXTA 4MUEA 4UHDA 3T9CA 2QLBA 5B7PA 1R18A 3LDAA 1VE6A 2VHWA 2OESA 4LECA 4GKBA 4NE2A 3ZHQA 1BHJA 1EK0A 4K03A 5ICSA 5I5GA 3DWFA 4WOBA 1X0VA 3IUJA 5FH9A 3ED1A 5CHYA 1UP4A 5I9NA 4MR9A 4YPVA 3HSSA 4BO2A 4KR6A 2YVLA 1PNVA 4DWJA 5BMVF 1NFRA 4M0LA 5EXSA 4XZ3A 1U8AA 4KWIA 4KN8A 3DV0B 3KE8A 2REQA 4HQRA 4MMZB 4RX1A 5EZYA 1MIHA 1QK5A 3ICVA 2HTEA 1XYYA 2VF7A 3F3SA 1T8PA 2FQ1A 1V4NA 3QLTA 5BMVA 1JLLB 3MMNA 2C97A 3QA9A 1WZEA 4GE0A 4IO1A 5DNEA 5A4FS 4A8JB 1KJJA 2VRCD 3O3MB 2Q5QA 5C5IA 2O7VA 2X8JA 8OHMA 3TTSA 5FTNA 3OLXA 3Q5EA 2BT4A 5JYEA 2MT9A 2PWBA 2C98A 2CEAA 1Y3HA 2GLXA 2R3SA 2AN1A 2ZLBA 3NUQA 1S9DA 4KX5A 3K30A 4Q3CA 1M2VB 5D84A 4DEYA 1KI8A 3USZA 4E4RA 5BVGA 5LNK1 3EVNA 1NVDA 1Y8ZA 1Z2CA 2ZBPA 1X3LA 1Z4QA 4JL5A 1PHPA 1SRRA 2PSJA 5F21A 3JQ9A 1QYIA 5EPOA 4XJTA 4KGDA 1SCBA 1W52X 2FG6C 3KJIA 1H0HA 2QSJA 1U9YA 1C1HA 1IM2A 4MLPA 4Q18A 1PFQA 1LDGA 2FI1A 3K70B 3M2PA 3FNGA 3SU8A 1R9NA 2VP3A 2ZTLA 2WB4A 2P9HA 3CX8A 1UQTA 3JAMA 4DRYA 5DTJA 5C80A 2V58A 4IDOA 4ZQFA 2B9VA 2JGLA 3KALA 4XFJA 4J0CA 5CH3A 2IY8A 1KDOA 4GM4A 3MMXA 4Q4JB 1L1EA 3VGPA 4XWWA 3IP6A 1R4MA 3GBSA 1SVSA 4KSBA 2VATA 2IHTA 4KDCA 5DCWA 4P32A 2YMPA 3PXAA 2YIMA 4OM7A 4HGPA 2WU0A 4RA6A 3KUDA 4Q7JB 1U6IA 1YZYA 2PLRA 1N1GA 3B70A 1E9RA 1NNSA 1Q1EA 2P1RA 3CG4A 3LVRE 4GHWA 4LI0A 1OH5A 3T15A 2H29A 3A10A 1I6LA 2CNDA 1DARA 2F7SA 3EXHC 1W4LA 1EDBA 1RXVA 3ASVA 3EFEA 2QXTA 3AKEA 3GRZA 1YRWA 1KMMA 4OY3A 4L76A 3OX1A 1DC8A 3V7UA 5KTTA 4GOND 3ZK9A 1WP4A 4HAZA 1U0HC 1FUKA 5LYJF 1O95C 3SEFA 3WOVA 1G6OA 2XUZA 3RH0A 2ZUFA 4LWPA 4Z4HA 4MLCA 5FWDA 2FW6A 1N6PA 2WC1A 3CRRA 3G02A 3ZKWB 5IZCA 3IA2A 5A62A 1ZONA 1KZ9A 2IYRA 1RZVA 4CTJA 5LKAA 3CVWA 2C57A 4P83A 1KVUA 3AH8A 2JI6A 3U9LA 3X1KA 2WKWA 3D4OA 4UBNA 4UPVA 4BLWA 3E4DA 3IKLA 4UC0A 5KYWA 5JADA 4M86A 2O59A 2C2GA 4KLZA 1TAUA 2G9VA 3DZBA 5AM4A 2JG3A 1UEJA 3DWGA 1ISSA 3GUCA 3B3JA 5BSGA 4TT8A 2F6RA 3AJDA 4PZCA 2ERXA 2HREA 4OL9A 4AZVA 3FTNA 2QTHA 4G1UC 1Z4NA 3T4XA 3O90A 1WF6A 4EI9A 1GAEO 5A5VA 1YRQA 2BJHA 4BJ1A 4R31A 3TJMA 1T5HX 3G3EA 1RBQA 4GPTA 4Q37A 2PUDA 2ZVJA 2OL4A 2GERA 2FPLA 3E03A 3FPGA 1CF4A 4W5HA 5FA6A 2ILTA 3TD2A 5H9WA 4OH7A 1YMUA 2H9AA 1OFUX 2GUWA 3VI3B 2RAUA 1NWHA 1GPDG 3F6BX 4FT2A 4P1ZA 1YNOA 3Q11A 2VYFA 3QMMA 1R9MA 1DT5A 1BRMA 1FC0A 2WT9A 1M72A 3OSUA 3HRHA 1E2QA 3G9TA 3PC8C 2CL7X 4RJ2A 2FWPA 4WECA 5ALUA 5KHAA 1NG1A 3R5SA 1C1DB 4L50A 5IT4A 2ZDGA 1M54A 4LF7B 4M8SA 3U19A 2D5LA 1LBSA 2PL5A 3PNQA 4QGGA 3ZN2A 4YAIA 4B44A 2LRHA 3LCJA 5EE0A 2C92A 1KQFA 1IEWA 1Z18A 5IJ9B 4QOHA 2VP4A 4PXYA 3BIXA 1NQ5A 3UB3A 2Q5FA 1UC9A 2DPGA 3MS2A 2FWJA 4OFZA 3K0SA 3SIXA 2IITA 3LPDA 2RGRA 1PR0A 4ENWA 3WQRA 4OD0A 1XAJA 4M4SA 2M1XA 1EJ6A 1YZVA 5DYWA 4WI1A 2YMLA 4ER3A 2J45A 1AQLA 4IIUA 3RVMA 4F3CA 2EP8A 4OFBA 1MC8A 3PR2B 4UHEA 2W4MA 4WGGA 4Z1MA 3IBSA 1V95A 2OCYC 3IBYA 5DCUA 3DM5A 1K75A 4DDMA 1NYRA 2EW2A 4WXHA 3RE1A 2L42A 3OUZA 1B2RA 3SJBA 2HYIC 3IPXA 3Q8WA 1EQUA 5H59A 1CE8A 1ZCAA 4N0PA 3K9NA 5CD9A 5C53B 1G8SA 4ND8B 4KSYA 3C8DA 5CDTA 4D6PA 1A76A 3ROXA 5FBWB 4B5LA 2Z83A 3H2YA 4ZXPA 5CDYA 1EM8B 2GO7A 1W19A 1GPUA 1KJIA 3I34X 1Z2DA 2Y27A 3JQDA 3PBKA 4X6LA 3RT1A 4YR9A 1DB3A 1JSXA 2ZIXA 3DOUA 2G9NA 2DGDA 2FUG6 2OY0A 4RPGA 3S2ZA 2JLSA 2FLVA 1PZFA 4AXBA 2OFWA 3NHJA 4FNAA 4QDUA 3EISA 3F3YA 1UF9A 2I1QA 1YBFA 4F3TA 2OR3A 3VHLB 2DYKA 1QP4A 5JV5A 2I6UA 1HRDA 2DZDA 5FXMA 1XQ9A 1OFIA 3GDWA 3UK7A 2NSDA 4D44A 4MJXA 3B8HA 5A7FA 3LSTA 2AC2A 2ZB4A 3HEBA 5EP1A 1FA9A 4TLAA 2FW0A 4UTZA 3S8MA 5C1IA 1JDBC 1VE3A 4Q9JA 4JJZA 1HT3A 1FYEA 4HFRA 2R62A 1PU2A 2ZWIA 1W48A 1RXUA 3PXBA 1TXGA 4IKPA 4KQ6A 5IYZA 5AVXA 5K6AC 1DWOA 1L4FA 1WDTA 2HWWA 2V1XA 1G60A 3O3OB 4UM8B 4C7VA 3DO8A 3TZQA 4P3PA 2IELA 1BDIA 4LVOA 2JBAA 4OXIA 2JVIA 4HPWA 4F91B 3T7DA 1MX1A 1JSCA 3KV3O 2O5CA 4H08A 4HTAA 1IIRA 1Y9ZA 1DE0A 2MR5A 2HHAA 1NR5A 5FL7A 3SC3A 2EQBA 4FUTA 2C0CA 2A78A 4W9NA 3SF8B 4W7IA 1GT6A 1SKAA 1YAHA 1W96A 2CDBA 4QUBA 4DPLA 1M2EA 1B0ZA 1HYGA 3M9XA 3A27A 5LD2B 4B40A 5JO9A 3P4XA 4I5IA 1NNUA 1NKTA 4K9DA 3TI9A 2ZZNA 1ZCBA 4MWSA 1DADA 3KU4A 4QLAA 3ZD9A 2M32A 2EJCA 3AZOA 3LZDA 5DLDA 1DCMA 3ZDQA 1XNJA 2EWMA 3ZWOA 2G4LA 1GTL1 1P9LA 1A4UA 2B78A 1J42A 2XNDA 1SR8A 2R65A 3IYLW 2BONA 5JS8A 3AIOA 1JG6A 1SUPA 4L6CA 3ULKA 2RAVA 3KXLA 2AQHA 1SKYE 4E5VA 4QULA 1JI3A 3QE4A 3A2MA 3UNXA 3SYMA 4EMTA 3QEOA 5WRFA 1XCOA 4ISCA 4GSKA 4TKUB 3VDXA 3U44B 1CR4A 4CXMA 1WE2A 3HS3A 2R8OA 1NUHA 3QUSA 1PNOA 4MRVA 3CZMA 4A5SA 3Q6NA 4UAGA 1G2IA 1EDZA 4WASA 3IILA 5AMXA 5L4NA 3RU9A 3K8YA 4KE6A 1ILEA 2WU3A 4WBNA 2MSNA 3VU0A 1T9DA 4CEIA 2LIVA 4IVRA 2Z6VA 2BKVA 1C3LA 2WVJA 3FB4A 3KQSA 1XL0A 1XC7A 4L3VA 5G4KA 1A1SA 2D1FA 2W2OA 1GZUA 4Q3EA 5CBPB 4JP3A 2JKZA 1FE8A 4PSAA 1LPNA 3HCOA 1GR0A 2FG5A 2GNOA 2GF9A 1JMKC 2GCOB 2HSGA 3B6KA 1CJBA 2ONYA 3DZCA 4L8FA 4XUGB 5A6SB 1LPMA 4M9RA 4YJ3F 5B58T 1NF3A 4XPIB 1MUUA 3FI9A 3K05A 2G88A 2H2DA 5IVIA 3E1GA 2HCTA 1ZVMA 2JHPA 2XYPA 1BVUA 4ZO9A 4YUVA 5SYMA 5TS2A 5HFAA 4MR7A 2K87A 4K86A 4UVDA 3MGKA 5ADHA 5MFPA 4KDRA 3FUWA 3JR7A 5CXXA 1T5LA 1V1JA 1W75A 3ABQB 3JWJA 1Q14A 4BP8A 5BWNA 1QHXA 1HRKA 1T26A 1TJYA 4IILA 2NTJA 5HS4A 1DHTA 4KLRA 5ALPA 4AJEA 3BWEA 4YRGA 5HJ7A 3MCAA 3KOZA 5LQAA 1E98A 4O4IB 3RVLA 2G07A 1UMDB 4B2PA 2DE0X 1KNQA 2JHCA 2FNAA 2Q6KA 5IYZF 1WPGA 4DL9A 5DGCA 1FFAA 1VPTA 1NT2A 1UAAA 2PQMA 1J33A 2B30A 2VA9A 2ZEJA 5CXSA 2RHDA 4F06A 1G1MA 2J9FB 4NOJA 3ENWA 1REQB 1TIPA 4JYPA 2YJTD 3ZU6A 2GRJA 1N8NA 1S8NA 3O21A 1ZA2A 1ZITA 2J67A 2XCLA 3NHAA 2F17A 4BMSA 2DHDA 3HU1A 3NHSA 1IZYA 3LT0A 2BH2A 5KNBD 5JYDA 1S96A 5GAJA 2XZTA 4AQYB 3DDOA 4E5YA 3ZQKA 2H11A 2BEWA 2C8LA 1XMQB 3AEKB 4R5MA 4X95A 5IDVA 2FMFA 4J4HA 2EYUA 5EIWA 1KKUA 4M54A 3R9XA 5ALOA 4NBNA 3DFUA 1KFCB 1B41A 1KI9A 1WWKA 2OILA 3EIFA 3KLPX 3N7TA 4YC7A 4C0AC 3TL2A 4RPLA 1IEXA 5U9CA 1VJ0A 5FJJA 1ZW1A 1AXGA 1W4RA 1OXSC 2B7LA 4JVLA 4LN1A 2FGKA 4ZODA 3ZE7A 5B4UA 4BKMA 4UZSA 1M9NA 3HZHA 4L8WB 1G3IA 3ZX5A 4FOOA 3QNWA 4TS1A 2WNHA 5G0VA 1F2VA 1CUJA 1EK5A 2KS6A 4K88A 5DFAA 1GQSA 4FONA 2LVBA 4H4EA 4FLMA 3PYLA 4IDCA 2JKYA 2F4VB 1CUYA 1ZJWA 3CINA 3FBTA 2G3YA 4QYXA 3O9MA 1J8MF 1NRXA 2Y1CA 3GEMA 4A8JA 3E9YA 1CUEA 1T13A 3IHKA 4PCLA 5ELMA 1W49A 4ND1A 2POCA 3HY6A 1A77A 1F9AA 3O2QB 2WTEA 2EWWA 3QPDA 4F1WA 5BWOA 5C51B 1Q1NA 1ZOIA 2YV4A 3C98A 2GZDA 3D0RA 4LUCA 2IBSA 4BZQA 4X1KB 1XTQA 4MARA 3WGJA 1GRRA 2QZ4A 1TNDA 2A7XA 2I1WA 3BGWA 5CPFA 1G63A 5KIAA 2XNCA 3UAXA 1JJBA 3RFCA 4NV1A 1MD9A 4OU5A 1IXKA 1M8PA 1QMGA 3JATA 3LH5A 4DUPA 4WZAA 1AIPA 2CDRA 4D02A 1YQWA 2O2HA 2ZBQA 3ML1A 2W0SA 4CM6A 3GAFA 2WJJA 2ZRCA 2NG1A 2GI4A 1MQ8B 3AU8A 1YASA 4RETA 3SM9A 5KZMB 3GH3A 5EPUA 1P1BA 2BDEA 5LZ7A 3ODPA 4FGJA 1DG1G 2XTNA 3PGMA 3BVPA 4KJXA 4LE0A 3ECCA 1I2MA 4D0SA 1E2UA 1RHJA 4XWTA 3K32A 2FWIA 1KZ4A 2XZLA 2A0KA 1H93A 4Q16A 5CCXA 2PMKA 1QRDA 3WFZA 4DJFC 3TSOA 4Q7KA 5D2CA 4MW2A 2HXSA 2ZVDA 3IUPA 1TCAA 4IIHA 9MHTA 4RA6B 4COOA 2HBQA 2NUPA 2P4SA 3WLTA 1TMYA 1B2LA 4HFMA 1UPXA 2Y1GA 3CCFA 3FWZA 3KZKA 1A8SA 1HL3A 1I7NA 4JC0A 4R3NA 3HHPA 1P73A 3BMQB 1SWWA 3GBVA 3OJFA 4LG1A 3QVXA 4YRDA 5NLLA 3ZOKA 3AJ8A 5ITZB 1NBEA 4ND6A 1EFTA 2QMZA 3WYFA 1YA6A 3REFA 3SDSA 2VBIA 3CIOA 3THSA 3TKLA 4BS9A 4ZHQB 3QSYA 4IH1A 4ZA2A 1EZ1A 3CEHA 4I55B 2FSGA 5L40A 3H87A 2FRDC 3ACCA 3TSAA 1RYEA 1ZN9A 4BVKA 5FUQA 2UYGA 2F00A 1AMNA 1EFHA 4Q7EA 2QV0A 1CHNA 2PSDA 1E2KA 1ECBA 3C15C 3KFLA 2G67A 2HQ1A 3COSA 4IY1A 1ZD3A 5FI0B 5KSPA 2JBWA 2XUFA 4EG0A 4WINA 5TF4A 2QTCA 3IJ5A 2GXUA 4MO2A 3V3TA 1QBKC 2VJMA 3PVZA 1KAQA 5ALTA 3HJBA 5KYUA 2Z1MA 3CZAA 4U0KA 3L1JA 4RFVA 1XF1A 1C0KA 2Q28A 4GUDA 1SXJD 2RGWA 4H59A 1DIHA 2VSYA 4MKFA 2YQZA 4BV8A 2G9QA 3I23A 3Q7TA 1WETA 5JISA 1DJQA 4OVKA 1AUPA 3QKRB 4C43A 1VJGA 1QGOA 4F0JA 2L69A 3DDSA 3S3TA 2Y2VA 4GWGA 4S2UA 4TSKA 1CUSA 3AUXA 1E2LA 3BDVA 4UJ3A 4TV8A 5AQ1A 1F8GA 1P7PA 4Q03A 1ZLXA 2QRLA 4UCWA 1JDZA 4EG4A 2OZVA 1RWMA 2AXQA 1H22A 4BP9A 2IUUA 2IF2A 1WMBA 3L6CA 4OU4A 3DLHA 3WKBA 5TDHA 2Q62A 1IZ7A 3C3MA 1U0BB 2CW5A 2DLNA 4WK4B 5AFSA 2XXAB 4YAFA 1OHHA 3HR4A 4C4YA 1FDOA 5CFMA 1GM5A 4RH0A 2IY9A 1J7JA 2ZYAA 3GCDA 1L4LA 2ZANA 3SY8A 1C1DA 4F3NA 2QLMA 3C74A 5D8DA 1BJTA 3S1LA 4CTKA 4FPXA 4P0TA 2G0NA 1H9BA 1M1ZA 2YS6A 2XQVA 3FGOA 3KLMX 4OATA 1M34E 3DAOA 4FC6A 4YDSA 4ARSA 1KRXA 4NBWA 4PAQA 2RI0A 4MH0R 4IUYA 3R7FA 3Q6MA 3BREA 3QBJA 3OM0A 2QW0X 5IJZA 2VQ6A 3KWLA 2D0DA 4ARZB 1G5FA 1RWPA 2YNMC 5BUZA 1MW8X 2X76A 3ETHA 3NBUA 3O3CA 4TV9A 2IGBA 5DK6A 1WXXA 1PZNA 1IHOA 1Q12A 3T12A 4Z9YA 1FUEA 2PUVA 1JZQA 3THWA 3W9YA 5KJ6A 2QW8A 5LLDA 4Q4LA 3MJVA 4RTSA 5ELLA 1OVGA 4CTOA 4MVJD 3W5VA 2Z5VA 4IJUA 1AZWA 4KV9A 2M6KA 4DC1A 1JE1A 2F1RA 2KW5A 1SUSA 2FYTA 3LCVB 3OSZA 1W93A 4CIAA 3RYCA 2FV8A 3TM5A 1XD8A 4K6FA 2PLFA 5GOZA 5TLSA 1RQPA 4KMRA 1PNQA 4HNAB 1BH6A 3W2EA 2X7HA 4RIGA 3MWYW 4C2TA 1OYVA 2FUKA 2BLLA 2PX0A 1ZIPA 2GVZC 2KE5A 3JQPA 1ISGA 3K31A 3ESRA 2FUCA 4H7FA 2OWDA 1N2ZA 5FCDA 3WLFA 1OU0A 4TMTA 3VPDA 4ERXA 1YB7A 2QX4A 5I45A 5FB3A 1FXSA 1NY5A 4F4HA 1T6ZA 2P7IA 3MWLA 3QWAA 5EMHA 1AHPA 5EJ6A 3B85A 1Y7HA 3E3NA 2C78A 1DTEA 1P61B 2PLWA 1RXSA 1X3SA 3VU9B 4B81A 4BFTA 1Y7PA 5JRJA 4QU0A 1A9SA 1KC3A 2O2XA 2YZKA 4JWKA 4MITA 4EY7A 2H1IA 1OZ0A 3LBAA 1GV0A 2GF2A 2W4QA 1W25A 5DYYA 1KEKA 4F2DA 3VR3A 4L5BA 1KIAA 2ZRJA 2MU1A 1W0JA 5KYGA 3OEHA 3S28A 1OROA 2BDTA 5ALRA 4MRPA 2FWMX 3SF0A 4M1OA 5BXQC 1JSZA 2NO5A 5EE9A 5I8PA 3FHOA 1IYZA 4DR2B 1V4BA 4K9MA 3KVRA 2WE7A 5AHKA 4L7QA 4FYMA 3L8MA 3JQAD 3NW9A 2OTCA 4OQNA 1V16B 3V7YA 1SXQA 4RVCA 5F9HA 3FHLA 2AN4A 3FYUA 3P0EA 3L6BA 3DA8A 2QQFA 3B1XA 3HXTA 1Z5GA 4Y6OA 4P3KA 2EX1A 4NE9A 1P4JA 1N2CB 1EG7A 1CR6A 5DXFA 4IXNA 1W1IA 4CRWB 3LHKA 1TJNA 2EU8A 1TZBA 3AEYA 3D43A 4B85A 4N6GA 4EZBA 5KJFA 4N3GA 5DM60 2MMCA 3C5WP 3M7IA 5C52B 1NONA 2JK1A 1PLJA 3AOEA 2QHXA 2CHVA 4XPZA 3MFQA 4JQSA 2W7TA 2ZSFA 2WSSD 3N0RA 3ZV5A 4J90A 3STXA 5EJGA 1XBTA 4BGEA 2ZP1A 3K6JA 3TLCA 4Q3DA 1XX6A 1BDHA 3BXXA 4DN6A 3KQVA 3QW4B 1C3VA 3R7SA 3B5IA 2GKSA 2JVJA 1IQ0A 1OBHA 1QYVA 1K9SA 1C9MA 1EGVB 2CJWB 3WBJA 4YAGA 2C2KA 1RE1A 3F98A 1RQ2A 2Q3CA 1HK7A 3V1TC 1ZMBA 3AG6A 1M34A 2ESRA 4PFSA 4V2IA 1XJQA 2N46A 3WTCA 2IOQA 1NR1A 1RIIA 1CUWA 1ZGBA 5BSUA 2F8TA 4ZT5A 5H82A 3LY5A 4MX8A 3T9BA 3UV3A 1G38A 2J87A 4CFZA 3L5OA 3DKVA 5LQCA 1GCIA 4MUHA 2HMYB 4Q9HA 4HI0E 1ZUHA 2E4VA 2BHRA 5J1SB 3D4BA 4ED9A 1O4WA 5JSFA 4KR3A 1QIJA 4HV4A 4LK3A 3H65A 1KQOA 1YS1X 1S4QA 3FCCA 1R3UA 5EZYB 1SOAA 1XN1A 5DGDA 1E7WA 1IY1A 2C8KA 3SXUB 4P35A 4QAQA 4WIAA 3NFRA 3UAWA 1HYHA 3GUVA 1N6NA 3ZOZA 1WPQA 4F4FA 4KG7A 2B3DA 1GEGA 1U5BB 3O2SB 3IS3A 3X3HA 3B9RA 4LJ6A 2VK8A 3BWBA 5H3LA 3ICCA 3JALB 1O03A 3O8BA 5D87A 3AJAA 2JD0A 3FTCA 1QS0A 2YIDA 2WMOB 1Z88A 3JZDA 2H4YA 4QFCA 1JMVA 5AICA 3SE7A 3GN2A 1DGQA 1GU7A 3D2BA 4EX7A 5KQGA 1E63A 3HKEB 3EPHA 1WZUA 3AFMA 4KIGA 1W6RA 3FA2A 1W4ZA 3HUEA 1JKJA 1F2UB 1TUIA 3MTGA 4JL8A 1VG9B 1RHRA 4LHSA 4X94A 1T6YA 1AUQA 1NVVR 3IT2A 4UHBA 3PQ4A 4XWYA 2WZQA 3JX9A 1I0LA 5ECWA 4MIYA 4FX2A 1BJRE 4B0OA 5KCMA 1XB2A 1X1SA 3KT0A 1PHRA 1VPLA 3KWJA 1TZCA 2DTEA 5JPCA 1OI7A 5J1TB 1RQ7A 1E77A 4O2BB 3QVLA 3OT5A 3RAGA 3A31A 4CF5A 4IS3A 3FDIA 2QPTA 2AOUB 3C6YA 2VKQA 3HGMA 4I9HA 3TCKA 3GL9A 3THOA 4BNWA 4CF4A 4F6CA 1ELOA 2NVBA 2OCIA 1L0BA 4MICA 3OZXA 4RULA 1TW2A 1C8LA 2PCJA 4QFDA 3S2FA 4KVZA 1Q77A 1H1LA 1R37A 2CNWA 4CMBA 3U4QA 1T29A 3Q7RA 3ENVA 4NDAA 2GPWA 3DMTA 4TS3A 4U2KA 4ZT2A 3CCBA 4TSRA 4B3DA 1GITA 4DANA 1QFMA 5CEFA 1KYZA 2RSLA 3L82B 5I6DA 1XLTA 2IIBA 1VKOA 3RC1A 4Y0AA 4EQ6A 5AW2A 4RELA 4BV3A 4E5SA 1JHOA 3FMFA 5MDHA 4Z7OB 1U4SA 2JI4A 4YUYA 3CEMA 1VIAA 1JJAA 1F7VA 2X86A 1RI5A 1T5DX 4GZ5A 3VPCA 2O8VA 4J76A 4PSDA 1NAIA 2MINA 4HN9A 1D9XA 3D3QA 3DFMA 3DMNA 3DL4A 5ICEA 1YCHA 5JNSA 3U7FB 1QP7A 3DPSA 1H6BA 3KSZO 3P9PA 2RHJA 5LA6F 1AQJA 1BZYA 4GVPA 2X0DA 5C18A 2YWDA 3AYXB 3B38A 1M1UA 3L7LA 4HEJA 3PF8A 4MWEA 2VFAA 2VBFA 1XLTC 4YB8A 4C78A 1ZINA 1FRQA 4WOJA 4WJZA 5IZ4A 4F5YA 3LLUA 3OOEA 5LXTB 3H3XA 5KNLA 2QR5A 1F38A 5CIYA 1CW2B 4FGLA 2Y66A 3BTOA 2D7CA 2PR2A 3CBQA 5LMNB 5HRUA 1V1MB 2CLOB 3I32A 1IK6A 1NKVA 3FPAA 4GXQA 2UYHA 3UMSA 4D97A 1FF9A 1Q15A 2XWSA 5CFLA 1QFXA 3CLSC 4X7RA 5EKXA 4UKDA 5BQFA 2CUNA 1VE1A 2HXGA 3FRHA 4YMSA 1DO8A 4BJ6A 2WF8A 3G0OA 3GLIB 1HG0A 3TQIA 1TYEB 1G7TA 5CBKA 3WGGA 5K8JB 1W2GA 2JZNA 3HA7A 4MPJA 4PRZA 2VUSA 1ADFA 1YVUA 3U4HA 3LKZA 4B3TB 2H3EA 4B6JA 4N5DA 3G79A 3CC8A 4E32A 2B25A 1ML3A 4R05A 3U6BA 2IYAA 4ZZ3A 4G3XA 2P1DA 5CD1A 1SKQA 1P4GA 1WU7A 3JATB 3UT5A 3MJCA 2EP7A 2IYQA 3R4CA 3O4GA 4MYRA 4EY5A 4NZPA 5A6VA 1MAHA 1MGOA 3LF2A 3CNNA 3F1LA 1JUDA 3H9UA 3W4IA 4DSNA 3W5BA 2GLTA 2TRSB 4FFNA 4LRQA 5CMLA 3IP1A 5K1ZA 2RI1A 3LQRA 5DEIA 3UAGA 3RHTA 2MR6A 3T3IA 5LL6P 3BILA 4DNPA 1HXHA 3JARA 5HE9A 3WMGA 1OH7A 1AF7A 2KB0A 1BTOA 2EXXA 4M22A 1U2ZA 4U9HS 1KSJA 3MIIA 4K6HA 2CT8A 3TW4A 3ZJYA 3E5MA 4D6XA 3LQKA 4M1SA 2BYTA 3QPBA 3VV2A 5BPFA 1DKMA 3HYRA 2B7CA 2BELA 1Y1KE 2H4FA 2MSLA 2YS7A 5K6RA 3O03A 3UATA 2P2CA 2ECKA 3BEOA 2ECOA 3ANXA 4URUR 4V2UA 2Z9BA 4OP1A 2HWKA 4XSGA 1IBSA 3KSRA 3R6LA 3E61A 4N1AA 4MV3A 3ORRA 1CUBA 2C58A 4JSYA 5LVAA 1ZUIA 1CJMA 4KXNA 1KAMA 3EEQA 2WSYB 2D2VA 3LTNC 1OAAA 2JFZA 1NMQA 5EMLA 1Z75A 1T34A 2O57A 2GAIA 4KAFA 4Z9XA 3K3PA 3AUSA 5CG1A 3I5MA 3GP5A 3HCFA 4RZSA 1ORRA 5FWXA 1ORIA 3DEZA 4ZHQF 2FUG1 3MCVA 1W1WA 3WDKA 4Y98A 3UMJA 1NW9B 4I50F 2CMDA 2V6BA 3DH0A 3HLKA 2JLVA 1XTSA 5EIXA 2OVFA 4W5JA 4ZJZA 1NVFA 4LF6B 1XMJA 3EWSA 1GZ4A 1WTCA 3QXJA 3WQSB 3GLFB 4HZUA 1F8XA 4J16A 4KN5A 3TQRA 1K5HA 1OT5A 1G8MA 1DJLA 1I36A 2PEYA 2V45A 4J0FA 3VH3A 1PL6A 2F1JA 3FPHA 1GSHA 4BNKA 3K72B 3RBAA 2ZRNA 2DSNA 1R5NA 2GXSA 3IV6A 4YT2A 2IS2A 3NAZA 4LF4B 1LTKA 1NBAA 4QDKA 1A7UA 2PV7A 4U02A 3BK7A 4O4JB 3F71A 2XCOA 4CR6A 5IM5A 1TTTA 3AVQA 2QJFA 2ODBA 4GBGA 2YJ4A 4CMIA 2XVXA 3A1TA 4XTRA 5FQNA 4Q4CA 3F49S 5KTSA 4J03A 1Z8HA 4JOQA 3BHMA 2VN8A 3FBWA 1PSZA 1TGVA 3UZUA 5FUVA 3VAZA 5BUQA 2YV2A 3GT7A 5JLAA 1D2GA 1SBHA 3QE2A 3ABSB 3MD9A 2ZTMA 2W90A 2AR9A 3NTXA 4QPCA 3U7QB 1PJ4A 1G8KA 5CAEA 5G1NA 4D5GA 2V4ZA 1CQPA 3BL6A 3Q3EA 4GI2A 2R6DA 4PLTA 1JSRA 4J1SA 3UWKA 3I1JA 1L7OA 1JDUA 3H1TA 1MO5A 1OF1A 5KWIA 4L4ZA 4GLOA 2R5WA 4PZAA 5DSZA 3UHOA 3A2NA 4P53A 4OREX 3TD9A 4FP9A 1W29A 4E12A 4HNTA 4FSDA 1ZJJA 3IT3A 3FX2A 1UL1X 1DDOA 3UENA 3MSCA 3LDUA 2VZ9A 2WUEA 1EKXA 2BMFA 4ZT4A 1IBLB 2QRHA 5EZSA 4JP5A 3TRFA 1R3DA 1X9HA 1XA4A 2GZAA 4Z4QA 5JDIC 2ZKLA 3ANLA 1ZM2A 2QTVA 3FBGA 1CNFA 3IFSA 4N9QA 3A6EA 3R3UA 3UWOA 5AVKA 4KE8A 3N8HA 5E1OA 1SHZA 2YYZA 3U61B 2PQ2A 3I92A 3UW3A 3OQIB 1RAEA 4H7PA 3IQFA 3SZUA 1LGYA 4D3ZA 1P5JA 5CK5A 1K5PA 1J9EA 4XGIA 3PC6A 1YF3A 3QGMA 5DIFA 7MHTA 1AGYA 2BUAA 2Q49A 4IJKA 4KCGA 3HJTA 2ZI9A 4FHEA 4PIPA 1VE5A 3DMPA 1VJ5A 3SMQA 3WV4A 3HMQA 2KWIA 5GM1A 2CLKB 2XNKA 3C41J 1N1DA 1PK9A 2XA9A 4PR0A 4DF3A 5KQPA 1I3MA 2BP7B 3QKWA 3FFBA 1XP5A 3QLJA 1C4WA 1CUFA 2J6CA 2DKOA 3HMKA 3I2YX 4GI5A 4OUDB 4QPJC 4EUNA 2GKGA 2PZKA 1J8VA 2Y4NA 1JQBA 1FXUA 4RKEA 4Y2TA 4H7IA 3OIUA 1A8HA 1SMKA 1E99A 4H17A 4HLCA 3QHAA 1Q84A 3WY9A 2IP4A 3WL7A 3EUWA 3WQBA 2C4KA 2DQ4A 2Q4OA 3C3CA 4JLWA 5B36A 3IQEA 3WBKA 1H69A 2I7TA 3RFXA 2IYYA 5E6UA 4PVDA 2HWUA 3VZRA 3GOQA 3L7DA 3KQKA 1W34A 4HJRA 4KPYA 4R3UC 2VZ8A 3I6BA 1G18A 3JQBC 4DY4A 2WKPA 4G1FA 1TO1E 4M87A 4MEAA 1FJXA 5CDFE 3MJEA 4TKMA 4HZGA 3WB1A 1O2DA 5H1YA 4Q82A 4X0EA 4UNRA 2P27A 4PAMA 3GN1A 5HNKA 4BBJA 1WKVA 5EUBA 5AKXA 5JNUA 4GKKB 1T2CA 1V9LA 4YUZA 3AIIA 3AL0C 4DMFA 3KJQA 1MB0A 2F3RA 3IXMA 5GJCA 2BGRA 2QX7A 5C81A 1OBFO 3QJGA 1E1DA 5JAMA 4JEIA 3W1WA 1H2BA 2CL0X 3P9IA 1A5AB 4FFWA 4MR7B 5LOVF 1PT6A 4YYEA 2PPVA 2PS0A 3IOMA 4MI6A 4QUJA 4R40A 1ORDA 5AKEA 4CKEB 4LF8B 1M2HA 4QJ5A 4BLOA 2B7BA 2MYTA 2Q0SA 5BQOA 2EVWX 2PXAA 4MIOA 1N3YA 3WRVA 1LC3A 1W87A 1BW9A 4MWOA 4KXUA 4PZZA 2EBHX 2VLIA 1JIUA 4OK5A 5TMBA 2V9ZA 3OE5A 3K9WA 4RF4A 1B6SA 1E96A 1GL3A 3BMOB 4ZO4A 3O38A 2YBDA 5A4DA 2I99A 5JO0A 3OLYA 3GJRA 5CX4A 1LNZA 1I4OA 3WLMA 2FFQA 4Q9KA 1BOOA 2RK4A 2FP4A 1MB2A 2EV9A 2PVPA 3O31A 3NXSA 4YQZA 1U94A 1VB3A 4LMBA 3O75A 4I36A 3MRSA 1AE1A 4G89A 4PM4A 3DR5A 5TSDA 4AY4A 1IOZA 2PGXA 5IG2A 1K0FA 1P5RA 2QPLA 4TWBA 5EGNA 4M8IA 5D86A 4R0MA 1MJ5A 2IL1A 1NI4A 3H1PA 4AP6A 4B3HA 3FGPA 1JLHA 5DP1A 4ZXFA 1ECGA 4F4JA 2ID8A 3DMHA 1SZCA 3Q9LA 1NTRA 5U4XA 4WZBE 2EKQA 1J8YF 2M6SA 1EP3B 4PPYA 3X1MA 4NCBA 4NZMA 4WKNA 3SE0A 1Q1ZA 3BMNB 5BT8A 1VSTA 1USGA 2ZU6A 1PJAA 4KQIA 3BE4A 3TTYA 2C7QA 2FPGB 1PWZA 1WEKA 2QRNA 3CEPB 2PUHA 1WSDA 4O8ZA 5PNTA 1XGKA 4G65A 4Z7QB 4EGQA 3FYHA 1ZUNB 1LX7A 5GONB 3N2YA 3HDYA 1FYDA 5LQKA 4I66A 4JIMA 4PAOA 1X1RA 3U31A 3SHWA 5E0OA 1U1DA 4JZKA 5EERA 1BOFA 2LXNA 4FCTA 1QTNA 2IIVA 4KYIB 1VDMA 2HJVA 2Q2VA 3PDIB 5FI5A 3I5AA 3WYBA 3H0CA 5EHGA 3KQMA 1PFUA 4AF7A 1RQXA 5B1SA 2XECA 3NI2A 1O9BA 5AKGA 3ZLUA 4X1KA 3B5EA 3EDYA 3HPQA 2QYHA 1ZBQA 3G7NA 2Y76A 1PSDA 2CYBA 2IU4A 1P2GA 2GD0A 2OQ2A 4JJGA 5CH5A 3TZLA 3D3JA 1KYIA 3AFGA 2UZ4A 3FVWA 1D6NA 1HT0A 4RJKA 2ZUEA 3PFBA 4EQZA 5KYXA 4GF5A 1QDUA 2I6XA 3T7SA 4DV3B 3A3OA 2IQ5A 3AIKA 2BVNA 1ECFA 2I76A 1LWOA 2ES4A 2E0IA 2GM3A 2OLKA 4LJKA 4Q6WA 4B7CA 1YGYA 3A37A 1M7BA 1TOAA 4TLCA 5CLHA 3PJDA 3FDFA 1GNTA 1U0GA 4NE7A 1DLIA 1GNVA 1SK8A 3ZV6A 3GI1A 4GG1A 2R1ZA 3THYB 5E8JA 3TG8A 4IQGA 1W8IA 1NUUA 1V35A 1T35A 1FNBA 2PFGA 4RXTA 3USES 4BLVA 1OFHA 2GBIA 4R1QA 2YJ6A 1EEXB 2VHUA 3KQTA 2W6NA 3WL5A 4BE9A 2VWGA 2OZPA 2P62A 1ISIA 1C3XA 5C8DA 5K01A 1LJ8A 4WCFC 3A26A 5HIKA 3E5NA 2E3JA 4FJ1A 1UMBB 1O9GA 3K0BA 1RYZA 1J90A 5AVQA 4JKOA 3WBBA 4U7WA 5AJXA 4RPHA 4CE6A 4DLSA 2AB0A 2PKQP 1DZIA 1RC1A 1K97A 2GPSA 2CLFB 2EJUA 3GU3A 4O2AA 1XCBA 1X80B 2IPNA 1Z6YA 1TDJA 3PCTA 1H8EA 5ITZA 1IHDA 2GHQA 3GYBA 1FQJA 1Y4AE 4OYYA 4X1YA 5HM6A 5ALWA 1XQYA 3F5FA 2WDZA 2PRJA 1TKRA 4M1ZA 4XWGA 4BP3A 2GASA 5BWMA 3CT6A 4DMMA 3NV9A 2J3HA 2D7JA 4G56A 2NV2B 1KEZA 5BN5B 2R6AA 1TF2A 1V2GA 3WGKA 4D9MA 1UJ6A 2GF0A 3CURA 3L7CA 4YCBA 1RAGA 3Q5GA 2C2HA 2NXNA 3VU8A 4X84A 4CUZA 4ZP1A 5GZ1A 5DHFA 1JKFA 1ZW6A 3K4HA 3NKVA 4BMCA 4I1OA 3OFJA 5EIFA 2OD7A 4Q4AA 5A3RA 1F0KA 2O2EA 3QENA 5D3KA 1AK2A 2ZAOA 4ZEXA 3IDFA 2XAAA 1QOQB 3DEJA 1UC5B 4PGAA 2GJSA 4QVGA 3TLYA 1K5GA 2QRVA 1SUEA 2HLPA 2Q2OA 3HKDA 4UAJA 2WAAA 4FGZA 4QBGB 2CVZA 5KQSA 2Q9BA 2Z2IA 4FLFA 2GDZA 4OEHA 2OM6A 1FQKA 4DLZA 3RS5A 4RK1A 2KLBA 4H1VA 3LHDA 4YRFA 3UC9A 2RHHA 4DV0B 2CBXA 4L8YA 4H7DA 2F8MA 4PLYA 4C3OB 2PSSA 3KRTA 3SSNA 1A98A 1GUAA 4C29A 5IK2A 5C8XA 1T0PA 1EJ2A 3L1HA 3PX2A 3HEAA 1YZFA 1YS4A 4G5HA 3ZBTA 3ZHYA 2XEXA 2YXEA 1EJBA 2OYSA 4QBHA 1JFRA 1Z15A 4BCDA 1NZJA 2XXAA 3FHCB 4MPTA 5FO1A 1UPBA 1LCIA 3JARB 3JD1A 4C7OB 2AJCA 2J48A 4EJFA 1QOPB 4TKVB 2A3RA 2GD6A 1T91A 3QUBA 1PS0A 3PX3A 4URZR 2NZXA 3NMUF 1XMOB 3GFTA 3H97A 4R8RA 1ZYUA 2BFFB 2D2EA 3PSHA 4IP0A 4JYMA 2UYYA 1IUOA 1XTIA 2DFTA 5LUBA 1JXOA 4TTTS 2QQ0A 5A5EA 4RWEA 4AT1A 4RNCA