2O8NA

Crystal structure of mouse apolipoprotein a-i binding protein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
233
Chain Sequence
AVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords ApoA-I binding protein
publication title Biochemical and Structural Characterization of Apolipoprotein A-I Binding Protein, a Novel Phosphoprotein with a Potential Role in Sperm Capacitation.
pubmed doi rcsb
source organism Mus musculus
total genus 75
structure length 233
sequence length 233
ec nomenclature ec 5.1.99.6: NAD(P)H-hydrate epimerase.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 2o8nA00
3RRJA 3RSSA 3RNOA 3D3JA 3ROXA 3RRBA 2DG2A 3D3KA 3ROEA 3ROZA 3RT9A 3RSFA 3RRFA 3RSGA 3RT7A 3RU3A 3RO7A 3RTDA 3RTEA 1JZTA 3RU2A 3RTAA 3RSQA 2AX3A 3K5WA 3RS8A 2O8NA 3RREA 3RTCA 3RS9A 3ROGA 3RTGA 3RTBA
chains in the Genus database with same CATH superfamily
1KKLA 3ZIUA 4NCHA 3DHYA 2G71A 4PHCA 4IGAA 3FDXA 1G6HA 3I3OA 3CC8A 4GLBA 2IU0A 1F6BA 4E5YA 4H7PA 1GPDG 4I50A 4Y98A 1H4SA 1QPGA 5FKJA 3MBIA 1CDZA 3CNLA 2C3MA 1JA0A 4JVMA 1CJUC 1E1LA 3U9LA 1P0IA 4IQ8A 3H2BA 4B09A 4RULA 1SKAA 2B4YA 2ZWMA 4NY1A 2IBSA 3UKJA 1KYXA 2EHJA 3IIKA 1TJNA 4FCWA 4G8DA 5DGDA 1YZKA 5IVPA 2VTKA 4RXTA 3REFA 3M4YA 3JS5A 1Z62A 1SC3A 1FP4A 2HK8A 4MAFA 4OBXA 3WQHA 4DTIA 5JAMA 2RJNA 1MW9X 3VR4D 1AT1A 2F4NA 3ACCA 4C04A 3TM4A 4WL0A 1PK7A 3UO8B 3PXGA 4BVJA 2HHHB 4AKHA 2OYCA 1G5RA 1R8QA 1R8SA 1NYLA 1C7JA 1VJTA 2YJTD 3O8BA 4JNCA 1XZKA 1HT3A 3DR5A 5EYPB 4B75A 2QD5A 2YUIA 3HB7A 1SVWA 4PSCA 3SE0A 4MDFA 2ATCA 3G9TA 3O83A 4IIFA 2MINB 5IKEA 3A4IA 3ZKWA 4C1NA 1E5LA 1WZNA 3E70C 4ZVMA 3A4YA 5D1HA 2Q50A 4REMA 2E21A 5KCZA 5EESA 3TOZA 3OEYA 4LZNA 1II9A 2RH5A 2QRKA 2Q46A 4A6XA 4ZQBA 3WLKX 4GZLA 4IRUB 1IQRA 3FYCA 3DD5A 4ZVSA 1H3FA 2ETXA 3KV3O 4N41A 3ABQB 2H8KA 4XCVA 4ZEWA 4J1TC 1ZHFA 2FCAA 5FBKA 2FSFA 4M9UA 4LHVA 1XTJA 2BKUA 3HJUA 3IS3A 3KWJA 3IH5A 2WHEA 3V1TC 4C89A 3I2HA 1ZOOA 2XCOA 4YCCA 2JFBA 3QKSB 1AB6A 3GLFE 3LZDA 5CLLA 1S0UA 2PT5A 1EE9A 4EGCB 1GCIA 2P30A 1WNTA 2XVAA 3GLHB 2Z43A 4Q7EA 2HIHA 2WIKA 2GJAA 4G65A 4BN5A 5F23A 5LSAA 1GRVA 5FTLA 1QANA 1DC3A 1JBQA 1S2MA 4N5MA 4XGQA 4ZMBA 5K0EA 3D6FA 3NBAA 4K6FA 2VHUA 4L3WA 1QGZA 2V9ZA 3N0TA 4QUKA 1D1QA 1TJ3A 2HI0A 4N7JA 1MRZA 3KXDA 4N5DA 3WV5A 1L7QA 5KDLA 4IWXA 3ADBA 1T2UA 1Z2DA 1HOXA 1YB2A 2BY4A 2J4DA 3TRDA 4DUZB 1JXQA 4R8LA 3G0OA 4H0NA 4PLGA 5UKDA 4PFJA 3O4GA 3TNFA 3UT5B 3VMFA 1G4UR 2OV3A 2PMKA 1KMMA 1VYTA 2WDZA 2A9OA 3BCHA 1Z6ZA 2FMHA 3EA4A 4II7A 4HNUA 3HACA 1H0RA 1P44A 1JQEA 2RIPA 2WJ3A 3R8XA 3ZW8A 4CV1A 3NDBB 1UT6A 4ENSA 1FDOA 4R9RA 3JWJA 4MITA 3DD1A 4DDWA 1QFZA 1X9GA 3RS8A 4K1LA 4TV9F 3WJ1A 1I1HA 2XCLA 1RZUA 5ULLA 4YUVA 3C7AA 1GTZA 1ONPA 3IKMB 2QVLA 1K2VN 3ESBA 2W6NA 3I76A 2X1HA 3U4AA 4YRCA 3Q5DA 4EI2A 1L5ZA 2OUIA 4OKNA 5EUCA 1GV1A 3S44A 4N5LA 4PIPA 1LDNA 2YMPA 1SQ6A 3VJKA 4MQ4A 1KI1A 4KJZA 5EIEA 4NEQA 2XRFA 4FU0A 4MSUA 3BSSA 1N2GA 3FMOB 2GK6A 3W9SA 5AK4A 3EGVA 4LY9A 8GPBA 1NNUA 3IVGA 2FP4B 1W1WA 1C9NA 2YJ5A 4TWAA 3FNQA 2NU8B 1M0EA 2VXYA 2APJA 4DIBA 5T4FA 1JTEA 5C46F 3E2MA 3B7WA 1GNRA 2L2QA 1XLUA 3PZRA 4IUBS 2IKSA 3F3SA 3NWPA 2NTYC 3ELBA 4TN1A 4U2EA 1UODA 5GOZA 3TLJA 2ZW9A 3ZD6A 1R9MA 2P2YA 4D46A 5KHLB 4QJ5A 3LUKA 3BWCA 4RTOA 1E3LA 3EIEA 4BBAA 4BE4A 4KBFA 1GOTA 1U28A 2X6QA 4A10A 2QMUA 1JHAA 2MYPA 1IRIA 3ETJA 4M3NA 2VAXA 2QD4A 4NCXA 2J6BA 3D3KA 5ER9A 1GZ3A 3ROZA 1RZRA 1SOUA 3L0YA 3NKFA 4PC2A 1FDWA 5HCNA 1DDGA 3SQNA 3V8RA 4H0FA 3KYBA 1W46A 2JASA 5HX7A 1YDGA 1USIA 3PXUA 2IF0A 3H16A 4F9FA 3K2BA 3JQ9C 1Q19A 2ZATA 5DCWA 5E4TA 3SKXA 1OBCA 1Z5UA 2Z30A 5DO9A 4P4LA 3NC0C 4TX1A 5EL0A 2Z56A 5DRTA 3DZ8A 4NZPA 2TECE 4RKYA 1G21B 3ILVA 5FR1A 2JAOA 3KTAA 4U3JB 4CNQA 4BJ3A 1IZZA 4H27A 2SCUB 2F59A 2YS6A 3N87A 3T5TA 3QBVA 4JX9A 3U48A 3GXBA 5AKJA 3X1WA 1RAIA 2O3UA 2Y9PB 1MAWA 1TC1A 3AU9A 2IEBA 4M0UA 4NHEA 2YZ7A 5EXTA 1H69A 5EVJA 2EJUA 5F2EA 2A9KA 3KPWA 4ABYA 3JRNA 5B1IA 2J6IA 2C2YA 2XA2A 2QD3A 4RTKA 2DF8A 3GT3A 3B8HA 5LP6B 4Y9SA 3VZPA 4JLOA 4M99A 1Y5IA 3WYEA 5FBVB 3B5IA 3FUTA 3VYTB 4C05A 2VNHA 3MK31 4CIVA 2CHUA 4V0OA 3TLGB 1X0XA 4CXMA 4OXYA 5I01A 5DNEA 1KFJB 1JHYA 3B7GA 3IHLA 4B32A 2WF8A 1U2DA 3X1XA 1K3UB 4BLSA 4W82A 5EJ6A 3JU3A 3LGSA 4ZN6A 5BNZA 3UXHA 4DA6A 5IKMA 3BQMB 4OHMA 3LD9A 3QI7A 4BNGA 3KETA 3MWEB 5AQEA 1OX4B 2C20A 4DXDA 2P2DA 3Q88A 3QVVA 3ZJVA 2XBMA 1K27A 2ZR8A 1I0LA 2JG3A 2N47A 3TS1A 4LFCB 4D4IA 3E48A 2XQGA 3FXAA 3RYCA 4R83A 2ZT5A 4X7RA 3WLPA 5HUQA 2X0FA 3OWHA 1FYDA 1PV1A 1W36C 1U3TA 3C6XA 1WVGA 3D4PA 4QFMA 1C3OA 2FZKA 2HA2A 2AJ8A 3AONB 3D59A 1K5GA 1O87A 1PNQA 2FW6A 3QA9A 4ML3A 3L0DA 1PS9A 4R1OA 1M8FA 2A0XA 3HHPA 2A14A 1ZLXA 3NM4A 1CY2A 1TU4A 2UYGA 1G38A 3TTUA 1A9PA 1OAOC 4OB6A 4ZQFA 4R8VA 1ZUIA 4L73A 3LUFA 5DW0A 5BXYA 4DPMA 1NFQA 1P1IA 1XZCA 3UV7A 5CBPB 2DFKB 1HL7A 3ZN2A 5FBHA 1D03A 2JD2A 3P32A 3PNVA 4LRQA 1E3WB 1Z0FA 2O3TA 2BM8A 2I8CA 5FO0A 5TPWB 1U7WA 2JHAA 4UHDA 2YV3A 3HU3A 2OTCA 3ZEIA 3TE6A 1PYDA 3KHSA 2ZB3A 3VR5A 3T3GA 1UKYA 4Z4CA 3CUEF 5EHQA 1S2OA 4JDUA 4KFTA 1KO1A 1NQ5A 2J5BA 2DLNA 1DQZA 2CE2X 1NOJA 2PD4A 1SUFA 2TYSB 5CB4B 4RVHA 5JCZA 2EFJA 4Q7JB 1WUIS 2Q9UA 3THXA 2CJXA 3OQIA 4MQ5A 2ZU0C 4BVHA 1E4YA 1GGNA 1M0SA 2J0EA 2ZJYA 5H7XA 3ZNOA 2QAGB 2IXAA 3L4EA 2AQHA 3VC3A 2I1QA 4MS3A 3TZLA 1QG4A 3AF0A 5EJGA 2H07A 4U2KA 5FAKA 4LWPA 4UUQA 4MPTA 3PICA 4HX9A 3O4RA 4LDQA 4LSWA 4LYYA 1J1UA 2Z95A 3KVRA 5ECWA 1ZC4A 2YJNA 5EWMA 4R1TA 4XFKA 3RLFA 3UYLA 4AJJA 4CG2A 2DG2A 1XAIA 1ADBA 4IV0A 4A5OA 1DBIA 4XCXA 3WWDA 3BICA 1R9GA 1RJFA 1GPMA 5AKYA 4GKBA 1U6KA 2DHEA 4NCJA 4NFLA 2GN4A 4R2MA 3SR4A 3TD2A 3ZWCA 1UPCA 4BRSA 3P96A 5K99A 4M98A 1B6RA 3RDPA 1I7PA 2NVWA 1Y1QA 2NXWA 1UK8A 2OPHA 3PDIA 5SICE 3UWSA 5HKKD 4C4OA 1F1JA 1Q74A 3OLXA 1YAJA 2WJIA 3QLTA 4UM5A 1ZFNA 4YRRA 4O0LA 4Q3AA 2I33A 4H7IA 4QUJA 2H1LA 3IR5A 4R9SA 3X2SA 3M7IA 3TQHA 2B9EA 3NGMA 1ZH2A 4GLLA 1F6WA 2YJ3A 3F3YA 4MJXA 2Z6VA 4DM4A 5ELXA 1KVQA 4O4IB 2HXYA 3A3KA 2QN2A 1H85A 4A6EA 1GCOA 1YJ5A 5IWAB 1OI2A 2RHHA 3ROTA 3U1VA 1EHYA 4OV6B 1MVOA 1Z56C 3STWA 1ZCZA 4ZMSA 1MH9A 1Z6YA 3CEPB 4D96A 1RCTE 1F2UA 3E6AA 4A2CA 3ZW7A 1ZKDA 2O8VA 1I51A 1MHPA 1ZOSA 3UJCA 2UYYA 1HE8B 5F7JA 1RPJA 3L4SO 1RCUA 1XTRA 1SOVA 3BSYA 4JIMA 4X97A 2DWCA 5FJIA 3U4GA 5ALYA 1OHHA 1HMYA 2UVDA 2ZBDA 4PYMA 4BXOA 1Q14A 3OMWA 2WP8J 2VKQA 4FDAA 4A73A 1F7UA 4Q93A 3FUWA 5HJ7A 3T4XA 3VYVA 4QDJA 5D5QA 2WV9A 1M2FA 3QYPA 1E77A 3V1NA 3PEFA 3ENKA 3EFOA 5DBFA 3WL5A 4BQRA 2QSZA 4QXPA 4C5BA 2HSDA 4PFQA 2FRDC 1XNGA 1KEEA 4R54A 2AEMA 1K0UA 2HMSA 3ONVA 4I4TF 4NC9A 1R0XA 2HM7A 3OVMA 4LYJA 3ZCPA 5DBHX 5JCOC 5A4MS 3AR8A 3OQOA 1WQ3A 1HE1C 4DCJA 4DVGA 1JKJA 4ENUA 1YDWA 3GOQA 4KB5A 3LPCA 5HRAA 3SJBA 3ZE8A 3T1HB 3WKAA 5I7HA 4Z9FA 2AD5A 2E5FA 3R40A 3DF9A 3WIOA 2ID4A 2HHLA 4NOJA 2HRBA 1XF9A 4C20A 3QEKA 4EGFA 3W90A 4ZDIA 1T9AA 4FJ2A 1CQJB 1M8JA 2FN4A 2SNIE 5ECYA 1S2IA 1U99A 3FNHA 4HXYA 4KR2A 3LDFA 3H9EO 1EPUA 2QXTA 3M9XA 5EVCA 5BSTA 3SHQA 1NVKA 4HTFA 5JZ9A 4XPIA 5KNCA 3ICEA 4LRUA 2R6R1 4K03A 4IJMA 3M9LA 4LGVA 4X1OA 3SICE 3VOBA 2L17A 3RC2A 1H2RS 1YGPA 4MWSA 3OLCX 2QUJA 2XTAA 1JJVA 1IN5A 2C9OA 4MKRA 3S2YA 4YV1A 4L85A 3SEAA 4RMJA 2ODQA 1DBRA 1E7YA 4HYTA 3T9BA 1R4AA 2CXXA 1U8EA 2PTGA 2Q5EA 2XDWA 4MW9A 1MC8A 1TZJA 2E48A 2HEIA 3VMMA 4LSZA 5ETJA 4M86A 1IEXA 4JLWA 4AJ9A 2SICE 2ZITA 4FI3F 3KSBC 2O3JA 5BUCA 1PSDA 1Y8RA 5FTJA 1EKXA 1AQLA 2O23A 3TLZA 4PC7A 4FHEA 1Z18A 2OORA 3UHPA 1AV7A 5LQSA 4A2PA 2DJ5A 4BX9A 2DEUA 3ZYCA 2W2NA 3ADKA 4P7KA 3GJ6A 3ZWPA 1RZ3A 5CX1B 2OXFA 2VJLA 3KT0A 4ND3A 1Q16A 3V9AA 4QDXA 2V45A 2FR1A 1UP7A 2VBGA 4WAUA 3DBVO 3ZDYB 3MYYA 3JQEA 8LDHA 1QBKC 4DFDA 2IW1A 3VR6H 5H02A 5F7OA 4R2IA 1MFZA 4YAJA 3QUAA 1NULA 4HK4A 4EM6A 1BNCA 3ZXIA 2NQ8A 3BXHA 3DBHA 1W5AA 5D87A 5IAAA 3TUIC 1Y6QA 4GQBA 1AUVA 1SXJD 4W9MC 4MP6A 3IMEA 1U80A 1YZNA 1RHKA 3AEUA 3BMQB 3D8RA 3T61A 1N3YA 1P5ZB 2Q0QA 4C3OB 4RDIA 3BHIA 3ONEA 1VJDA 5C0OE 2VDMB 4WOPA 4DIDA 2HQBA 2VTEA 1G5IA 3NXKA 1MIOB 1ENZA 3K9WA 3I34X 4PO8A 3OEEA 2GCIA 2JGAA 4EJFA 1JZSA 3RSHA 5JG7A 1GQRA 2I76A 2O5VA 1WXWA 1PG0A 3C3PA 1UANA 4K9KA 2PA3A 1T29A 2F2TA 3AEXA 3R5TA 4FILA 4XSHA 4C0LA 4F4JA 1RD4A 4BNKA 5LZ8A 3DYBA 5ALLA 1YS6A 1NBME 3HKCA 3JR7A 3OCCA 1WCV1 1JQLB 3M6AA 5C3MA 5EPUA 1QIKA 4OU5A 4UAJA 5ADWA 5AM1A 1C1XA 4A0QA 4P53A 3I61A 2FQWA 5A7GA 2OXRA 3A3PA 2JEOA 1G8YA 4L07A 4XD7D 5LBTA 3EZLA 1G6KA 1XRJA 2VKTA 3DVSX 1WXDA 2FZVA 4LOHA 3TDKA 4B87A 5ICEA 1B8NA 3GA0A 2YWGA 2BI8A 3GJYA 2A1TS 4LJKA 4F56A 4Q9NA 3SZOA 1C3LA 3BE4A 5DN9A 1D2EA 4Y0AA 2IVZA 4NV3A 4OXNA 3GVHA 3AEQB 3DVRX 4QIHA 1FFCA 3ZQKA 3HI6A 3DPIA 3Q7RA 1KTIA 3OZRA 1P9NA 2QZPA 3UHJA 2W58A 3PUHA 1FRVA 1A98A 1P5HA 2F9FA 2YFYA 4FXOA 4GWGA 5T6MA 2O05A 3Q10A 1SXQA 4P6VF 3M3HA 2NAFA 2KSQA 3B3QA 3DHWC 5T3YA 1H94A 3R3WA 4G5GA 4JEIA 1P2BA 1IMOA 1W73A 2VAVA 3DOEA 4HWRA 4IFEA 2GEBA 4NULA 4NJEA 1MF7A 2EFEB 2GA9A 2MYNA 3FGNA 1ZIXA 2CDCA 3NVKI 3PUZA 1PT7A 4DQ0A 1SD2A 2YV4A 4D8YA 2SKCA 5JARA 1EDDA 2M32A 3BF8A 3OOYA 5JRDS 5LYJF 1NE7A 3EZYA 5K2MA 2GM9A 3M1IA 3TZKA 1CUHA 1ECJA 1K89A 1FUYB 3ZGVA 3IQIX 1IL0A 3HUUA 3WISA 1P7WA 2OCIA 4FT4A 1KYQA 1G66A 3V2HA 4BFCA 2WSMA 3FDZA 4W1PA 1SQ5A 4QYIB 4J0QA 1ONOA 2P6PA 1VL0A 2NUTA 1SUDA 1OYYA 1RVV1 2VHQA 4M1ZA 1KQOA 5EC8A 4ZV9A 1QHEA 5H1YA 5HGXA 2VDRB 4AG5A 1VL8A 1QCCA 2G25A 3LLVA 4RNCA 4BFXA 3E8XA 4LCEA 4IQGA 4WOCA 1QPBA 1LH0A 1XQWA 3WNBA 4C4ZA 2CCKA 3H99A 2QG9A 4X85A 2ZBQA 4YRMA 3SE7A 3EPPA 1U7DA 5DNCA 3WRWA 5FWNA 2FJPA 1KVTA 3F9IA 3L5OA 2NZJA 2XQIA 3TO5A 1ULHA 3WAKA 4NBKA 4G5HA 4GEKA 2RK3A 1ZESA 3OM0A 1AS2A 1FSSA 5J2TB 4I1UA 4BNMA 2R1VB 3QELA 4ZGWA 4G0WA 5LPNA 3ROGA 4LF4B 1PNTA 5B1HA 3RAGA 1BH6A 4LZOA 1LA2A 3RTGA 5C4MA 5EJIA 4N82A 4IDCA 4RW0A 1RRPA 2QPAA 3HO6A 5F5XA 3GLIB 4AX8A 1DE0A 1W30A 2OFWA 3KAPA 1I94B 1R0SA 1NM5A 4QXQA 1I24A 3EOAI 1RLIA 2DQYA 2QG4A 2NU9A 1OFGA 5BOSA 3ZHUA 1AMOA 2YASA 1E9RA 4TV9A 1S01A 1MO2A 1JR3E 4ZU3A 2W2VA 5HKLA 2CFCA 3WGIA 1YZVA 1LKZA 1E2NA 1G6OA 2O48X 4IDDA 2QYTA 4CCSA 3MYRA 1FDUA 4NCBA 3IUQA 1T9GR 2R48A 1R88A 1YZHA 1CJSA 4D8XA 3CX6A 3AF2A 3KVVA 2BI7A 4NZZA 2BHNA 2CNWD 3JQFC 4B6OA 2H59A 2IZ0A 5CFZA 4H6PA 5EI5A 2H4JA 3DKRA 3LYUA 3L4JA 1RLJA 3VZQA 4TM7A 4ZZ2A 1L7EA 1N5MA 1JT9A 4MX8A 5KWEA 2YIMA 3C3EA 1NF3A 3OJCA 1SXIA 2R96A 1LS6A 1WS6A 1RHRA 1SKYE 2GWHA 2IVFA 4TWIA 2YWFA 4CMIB 1VL5A 1Z63A 3VNVA 1OYVA 1YR3A 3D0RA 5DGHA 1HURA 1QPZA 4DAEA 4NL4H 3NHYA 1J0CA 3BIJA 2FJ0A 2DFVA 13PKA 2FMUA 2R3SA 2HXSA 3ZXSA 1M8PA 4OU4A 4DB4A 1I4TD 2ZIZA 4ENWA 1ZOLA 5CVDA 5G0SA 3W04A 3U5TA 4CT0A 1XCLA 2DBVO 4P5DA 2OV6A 3DOIA 4KN9S 4RXUA 1V6AA 2ZXEA 1J24A 5ES3A 2C42A 4GKJB 5HZHA 5BRJA 1K8ZB 3AG6A 4GUAA 4AS1A 3RVJA 1A4IA 2WE7A 5EP1A 3D8TA 4XYGA 3CXRA 4JLSA 4FB4A 2BBTA 4PNPA 1YT5A 5ESWA 4J0KA 1W4CA 3BGSA 3UVEA 5JATA 4E30A 1HXHA 1W88A 2GPWA 2LKCA 5DCLA 2IQ5A 2R2AA 1OXVA 2YHSA 3OOWA 2LXNA 2PVPA 1T25A 1OI3A 4KAFA 1GD1O 3WS7A 4YUXA 2VO1A 2FPLA 2EQBA 4LQCA 1H0KA 5E1BA 3UV3A 3RKSA 5NLLA 2GEJA 4TWJA 1CR4A 1M6VA 2CXSA 3B51X 4YXWA 1VA5A 5G1PA 2AQ8A 2JAXA 3V1UA 2NZXA 5KVVA 1KSJA 1Y9ZA 2DBYA 3AUUA 3PUWA 4ITUA 3LVFO 4Q1DA 1GUBA 1M2VB 3RKUA 4EB6B 2GBPA 2FK7A 5JAIA 4Q7MB 4TKMA 4L4RA 4ARBA 4OP1A 1I2DA 4S2UA 5JAZA 2HMWA 1RTTA 1OFHA 3A1CA 3GEPA 3UHFA 4F5ZA 3KUCA 2NP6A 4UE2A 1YBVA 1I1NA 2PX0A 3LC1O 3DZIA 4WK4B 3CHYA 5BUQA 3WNDA 1I0IA 1F48A 3L7KA 1U04A 5IYZF 1DC7A 3PJGA 2CDNA 3ZJ4A 2QT1A 4FE4A 4PFSA 1TNDA 1G8GA 4D80A 3EXHA 5AHWA 3UK7A 3NT4A 3B6ZA 1CE8A 3QVXA 3G9ZA 1MNQA 3V7NA 5KSZA 4ZD6A 2AR7A 1KNQA 2MR6A 2H2DA 3F67A 5AHKA 2BBSA 1N7HA 2QRGA 4HH0A 4J2HA 2AXPA 3DAGA 5I4CA 1TPYA 1PG5A 1PJ8A 1FUKA 2GPJA 2J41A 2QB5A 1SJ9A 2AS0A 3HEMA 3HY3A 3ZZUA 1RAGA 3A1TA 1XA4A 1KYWA 3I62A 2XTZA 1KDOA 2YVLA 1H2XA 1ZD5A 4JFAA 1Y1KE 1Y8QA 4EATA 2YCLA 1PFGA 2PX3A 3LCVB 3TQTA 3I2KA 4F46A 3S29A 3WLJA 3KB1A 4US0R 1TVKB 1H9BA 4FFWA 5JZSA 3CUUA 3EGDA 1XDZA 2XGOA 1QP4A 2NUPA 3GD5A 4DLSA 4RAQA 2BHTA 4AMYA 4BBZA 2HADA 1K7CA 2BZ1A 2FUG6 2QP3A 2QRPA 3MJEA 4LXYA 1L9XA 3ORHA 1JR3A 2C7GA 4R2XA 1TT7A 4KXMA 4D9CA 2REQB 2IKQA 1JE0A 1UR5A 2BFDA 2H65A 2OXCA 4XUDA 3ZK7A 3SNKA 2C07A 1N0WA 1NQUA 3BCRA 3GVIA 3VU8A 2G72A 2I0FA 3H84A 5I9MA 4AP5A 1Z8NA 5CAEB 1YFJA 1AN0A 3HE3A 4IIGA 3CRNA 4IKEA 4ND6A 1H93A 1QGUA 4KGVA 1L4EA 1IWPB 1SD1A 1E6LA 4OAPA 3AJ9A 1LLQA 1YJ8A 3HBNA 3K5HA 4JASB 3H19A 4O2AF 1OH7A 4D3DA 3AEKA 1WRBA 1RMQA 2OZLB 2CUZA 2EKDA 1R0LA 3H4IA 2AUNA 1EFVB 3GLGB 4JKOA 1SVKA 4GPD1 1R5OA 1JJFA 2JI4A 2A67A 3CG0A 2PQ0A 3D2CA 1AKVA 3N2IA 3C3KA 3NBQA 1E8DA 4ZYTA 5KJFA 1GHTA 3EG9B 4M8SA 1E1QD 5CTAA 2Z6AA 1E5QA 3DEIA 2I71A 3C7DB 3GC6A 5ALMA 2XB4A 4CWAA 4A7PA 5I48A 4KK4A 3GV0A 3GYGA 3HB4X 3BMOB 1Z4KA 4WCFB 4E46A 5FOQA 4FOOA 1OVGA 2ASVA 1MXHA 2GBLA 2I4NA 3QU5A 4KH1A 3OFNA 1FU4A 2XTJA 3EQ7A 4NYJR 4CIAA 3TG8A 1F0YA 1HDGO 4F60A 3VKHA 2AGVA 3DZFA 5THXA 3KUXA 4J16C 2I67A 3VVBA 3QYFA 2FPXA 4KOEC 4KR6A 4E1AA 2WJGA 4UAUA 1CUYA 3ENVA 2XNSA 2NVUB 5LIPA 3UW1A 4EKYA 1KRWA 1DOZA 2GEVA 4Z9YA 1GEGA 3IAM1 2FUG1 3SXPA 2VJKA 4XSVA 3I4LA 4JROA 3OIWA 4OKSA 3T7JA 1Q0RA 2FLKA 2QWXA 3PEVA 1GP2A 3PVZA 5GZ6A 2ODAA 5FRDA 4I46A 1DO8A 5E9AA 4WBNB 1LBIA 2J3EA 1WSDA 3AGQA 4AO8A 3NIWA 1M6NA 2QRVA 2GX6A 1SCDA 3IQEA 1K7YA 4AQYB 2YWXA 1NLZA 4PTZA 5CH5A 3BXEA 3T5MA 2XODA 2RHOA 2WI8A 1TUIA 5JNSA 4OMFG 4LPKA 1WX1A 4MWBA 4M7OA 5F78A 3L2OB 2PKYX 5TEVA 5I8PA 3ZBPA 4GZMA 4X66B 2HUNA 4X1KB 2ZBEA 4D4LA 1ODSA 1SBCA 2ZU6A 3KV1A 3I8XA 3OFVA 2O4CA 3QFFA 1RM0A 5HFNA 4DEVA 2RAUA 4EK9A 5BRNA 1RQPA 1COWD 4U39A 1J4AA 2IRWA 3KCNA 1T1JA 1M1YE 2WLTA 3P9XA 4QLOA 5FNVA 1GGEA 4UM9B 4X64B 2R6ZA 2QZ4A 4K6GA 1DIHA 5GAJA 1XPRA 4RMNA 1E7QA 1JVSA 3ANTA 1C5KA 1QXSA 4KQMA 1SCNE 5FQNA 3RU3A 1VFNA 2VYCA 4N40A 1QP0A 1RDFA 4DLXA 3EZ9A 3VU3A 2FETA 1R7RA 2VWPA 2FMXA 2AZDA 4GOND 4PTYA 2OAQ1 2UZ1B 4RO0A 1RABA 4PZPA 1QO7A 1NLYA 2VDOB 4MI3A 1AQJA 3KUDA 1B1AA 3FIJA 3GUYA 5F2NA 4LWQA 1Z35A 4NBLA 4Y1FA 4MRVA 3CGWA 4QGAA 3OWOA 2H18A 2R4QA 1VZ2A 1QIFA 1B0PA 4L5IA 1THZA 1AKQA 2VN8A 4GPTA 1ZQ9A 2FF5A 5TMDA 1NBOA 3SK0A 1YJBA 1WD5A 2B6HA 3WLSA 2VRCA 4YXFA 1CV2A 2OGWA 4DQVA 2BFCB 1IVNA 2I03A 1LSOA 1A5AB 4INPA 1QAQA 2AH5A 5ADHA 2BZ0A 3EQ2A 1L5LA 3OIYA 3NDPA 1QHHB 1R5BA 2HRQA 3DG9A 1ZH4A 2B8JA 5HVNA 2OCXA 2CC2A 2R85A 5CH8A 5CG1A 3QWHA 4BPBA 3H8JA 1U7PA 1NJ5A 2VNIA 3BGDA 5EJEA 2AXNA 5KEIA 3SVTA 3AIKA 4ZI7F 4BGEA 2ZRHA 4IXMA 1V9SA 3A6KA 4LDJA 1EX6A 2FEKA 4RTLA 1V4VA 5AW8A 5DMXA 1SVSA 2ZJ0A 1L4YA 3J7TA 5DCUA 3VTFA 3HCWA 3X1MA 3CVYA 1NX6A 5HJEA 1WXHA 3EQ6A 4MAMA 2G6TA 4KRXA 2RC6A 2O5RA 2PSSA 1FNSA 1USGA 4PG6A 4ZQCB 3R7LA 3UV6A 4O4JF 4H08A 1YZ3A 4AJ1A 2Z8ZA 5B7PA 1H3EA 1JPVA 4LK2A 1AXGA 2XWBF 2F8MA 3GDWA 4CYMA 1YQUA 3SMVA 3MRTA 2CMKA 3IQWA 1VHDA 2Q3JA 1BFKA 1ZXXA 1U9ZA 2ZUCA 2BGKA 1C9YA 3M81A 4E2XA 1O03A 1RWOA 2OFOA 4D97A 5DTJA 1TECE 4I9GA 4RKEA 3GJ5A 3MT0A 4FLEA 3BFJA 1RTKA 1Z15A 3A4LA 5CDFE 2R6GA 2ZXFA 3PR1A 4WZBE 4BX2A 1KQPA 3T3EA 1PGQA 3A7EA 1ZD3A 2YICA 1GNVA 1VCIA 1SWVA 4EITA 1VCNA 2XMSA 3I1JA 2VT6A 1E66A 4G5QA 3W4IA 1NA5A 3DXFA 3IIIA 3V3KA 5AW6A 1FZQA 1QLJA 4HUQB 3HA2A 5LXTF 4C3ZA 3QFRA 5KJCA 2PRYA 1R6DA 4Q19A 2OECA 2WIDA 2X0EA 3O93A 1NLFA 4HPJB 2FU5C 3I45A 1FUEA 2FP3A 2DMRA 1G60A 2IU3A 2XDAA 3AGPA 3VJRA 2A0KA 2E4VA 3TD9A 4B7CA 1H66A 2C3OA 4B33A 1GZVA 5DN6D 3HK2A 2QX6A 3L7AA 5JLAA 2QT0A 3RVKA 3EIFA 4QBFA 2ONJA 1E3EA 5DBEX 4ANFA 5KWIA 3DWEX 2XZDA 1XZFA 3L77A 5A9TA 4OQEA 1WB5A 2BL4A 1HFWA 3D43A 3ENNA 3FAKA 4QOHA 3TW4A 3MRVA 3W3AD 1YWGO 5TJ9A 4DMHA 1RI5A 5DNDA 2PMEA 1EUQA 3QPDA 4TT8A 3DOFA 3A0UA 2C94A 4OOFA 2FFHA 2Y2UA 1A69A 4E5KA 3BHMA 1WDMA 4GMKA 2UZ4A 3GJSA 5FOTA 1R4MA 1X77A 5CLFA 1PTJC 1O94C 1TMOA 1UC5B 3E27A 1V1JA 3CX4A 3GLVA 4N3CA 4XB2A 4MGKR 4ZO8A 3H05A 1P1RA 3EBOA 1K4KA 5GQSA 4D8WA 4PPNA 1QRSA 1P9WA 1CS0B 1TB4A 5LYJA 3NNDA 1CUDA 3LK7A 4URUR 2WOJA 3MD9A 3R09A 4KXLA 1PWYE 3S27A 1GLNA 3DZHA 4BFUA 3EB9A 2GFHA 3HPRA 3H8WA 1C9JA 2BFAA 2BELA 1FJHA 1Q7EA 3AY6A 3T8YA 1E98A 3DT8A 5IC4A 3VVMA 3AKCA 3AM1A 3SC2B 3PQDA 2BFFA 3L04A 4TLDA 2CLKB 1LF0A 4CEIB 1DKQA 4EW1A 5K4AA 2D2XA 2HAEA 1W5BA 3WKDA 4DMCA 5ARDA 4PANA 4RL4A 1FLAA 4RHYA 3HG7A 1PUIA 1AQIA 4JEMA 5DMHA 5ALRA 3O7MA 1XT6A 3GWGA 4K9DA 421PA 5E95A 5CFPA 1I01A 3TF5A 2JJ8A 4FZ5A 3ZCRA 1GRCA 2I9KA 2UXDB 1HSOA 4PLYA 1ODJA 1X7YA 2B61A 3IQFA 2J3KA 4U6SA 4ZAGA 4HC4A 1G16A 1V9LA 4HNGA 4UHHA 1JG7A 5HF6A 1V39A 3RWOA 2DH6A 2CYBA 1D7OA 5E1DA 4YPVA 5A05A 2HUPA 5ALZA 3ABRB 4N47A 4CM9D 1SMKA 1JQ3A 2YN4A 3ND7A 1ZINA 3NUQA 3N5KA 3Q6MA 5LZ7A 4UDOA 5TC4A 1OPXA 4OXIA 4BMVA 4X54A 2VDNB 5GADl 3NT5A 1CVRA 2RFLA 5IVDA 4JV5B 2P6MA 4NFSA 5TMPA 2HDHA 3NI2A 4W5HA 1DC6A 1UJCA 3A3YA 4C0XA 2VPYA 5ES4B 3LRTA 5LOVB 3A1SA 3QKRB 1E1NA 2FUKA 3EMKA 4AY4A 2WYUA 2OOSA 2IYSA 3OZIA 4XWAA 1LV8A 1YUNA 4GC5A 5JZBA 1L5WA 2FFBA 3GJXC 3N07A 3F8TA 3KOZA 2IYWA 3WXMA 4D82A 3G2MA 2NQTA 1UPAA 2O8DB 1PW7A 4IMPA 3FTEA 4KO3S 2XDQA 2QDKA 3QKUA 4AI6A 4J1NA 2P1DA 5FOWA 1B8OA 4CMEC 5JPCA 5CDFA 3GW8A 4TSFD 3JZFA 2FOLA 5CIQA 1PR6A 2E89A 4TKVB 5C32A 4BNLA 4L1KA 3FYUA 4UUNA 4ARSA 4YUWA 5REQA 4EHFA 2WKSA 4TTPA 1BEZA 1AHNA 3ABZA 3I52A 1VDZA 3PYXA 4EKNB 1GPAA 2VYQA 2VUSA 3EDMA 3RFXA 1UK9A 3AWDA 3DAFA 3DDUA 3I73A 3ZE6A 4WZAA 2OHXA 2P9BA 4G56A 1BZYA 2ZQZA 3I2YX 1QBGA 2O8BB 2VDLB 1XKQA 5BWNA 1XEXB 4I0WB 5IM5A 3IKJA 5FA5A 2IHBA 5JQWA 3HNPA 1DLJA 2JCSA 2A57A 3O3NB 5ITVA 2UUAB 3KALA 3WB0A 4WVLA 3CVXA 2Q1UA 1VP3A 4HQOA 1KEVA 2G04A 3SX0A 3KEOA 3TVYA 2EZ8A 1SZDA 2Y27A 3D64A 3QF4A 5A4FS 3A6EA 1XZJA 4UBNA 1EP3B 3U4DA 3OIGA 5DTIA 3LUHA 4M54A 3NPMA 1RRFA 4RE5A 4Q4LA 1C2TA 3KFVA 3ZD7A 5HUHA 1XRRA 3LVQE 4MJ3A 4P08A 3CKMA 3ILXA 3L40A 2OCKA 3VZRA 5HA5A 1PX0A 3V97A 2JNWA 5KKCA 2G36A 3EIQA 3E05A 2CF6A 2VFAA 1L4BA 4TQGA 5CFRA 2BM9A 2A9JA 4HB0A 4KMMA 4NS4A 1VG0B 1YKSA 3L6RA 3HN6A 2I87A 1LPMA 3M34A 2FKAA 4JGGA 2MU1A 2GD2A 5CXXA 4JT2A 1W6RA 4O2BF 2DJIA 3WAJA 1ISRA 1MAHA 3DEHA 3EXIB 1KEZA 3RSZA 4FFNA 4HB4A 3FNGA 5KTPA 4OK6A 4BNJA 3DAYA 4AF6A 4EPWA 5GOTA 4EL0A 3TNDA 2ZRIA 3NM5A 5G0UA 1A5BB 1NHWA 4ID3A 2NO9A 5U1PA 1JEQB 2E18A 3L0ZA 2DPHA 2FMKA 3L8YA 4LHEA 5F52A 5K45A 2ZUVA 3TLKA 5A5VA 2YHAA 4R7TA 3KXIA 1HDYA 2WPDA 4PU0A 4X62B 2W8BA 3BMCA 2OO3A 3DLAA 5CXUA 3M1YA 5IDXA 4UHEA 3VPXA 3AF4A 4K40A 5IYZA 2G7MC 4LZPA 1XRNA 2GWRA 3TEJA 1MOSA 4F7WA 4UM7A 3DB2A 2VJMA 4HSGA 5C35A 4KZPA 4P86A 3LY8A 4ZAVA 1GDHA 4U2DA 4AJ2A 4V03A 3NORA 3IILA 3NJRA 3ZVRA 3TGPA 3RHSA 3WDSA 5DM1A 3R3JA 4ZOCA 3W2EA 2VXCA 3ND6A 1IOWA 2K7ZA 3BTOA 4ZZ3A 4JY7A 2DECA 3CE9A 4KN8A 3ZW9A 4E31A 2YL2A 4IIBA 4UDXX 3WKBA 1X86B 2ATIA 4FUQA 3WDLA 1YC5A 4ESHA 4MMYB 3NBXX 1QOQB 3BE8A 4IH9A 3A10A 5JE8A 4MCIA 1YRHA 5TQ0A 3ICCA 4NE7A 1CIJA 4DCCA 4UCWA 1DHTA 1N6RA 1X7HA 4C4PA 2C88A 2HRDA 1G3QA 4OF4A 3URKA 1MJGA 5SZKB 1KHTA 2RG1A 1M5TA 5FFNA 2X3YA 4KAXA 3H1GA 4MKIA 1W36D 5ABPA 1GUFA 4HMQA 2VTBA 4RQTA 1W2HA 1O7JA 3GI1A 4WADA 2R2GA 3OSZA 3KR2A 1DKLA 2XLBA 3QJ5A 2QY9A 4DRXA 1EH5A 2VL7A 1JIQA 3KJHA 1VBFA 1T5BA 2F3SA 3KQPA 1RRGA 2EBHX 1BU5A 2X1MA 4Z0PA 1UFRA 2C7VA 2X2EA 2XE6A 1PT6A 2YHUA 1I0ZA 1SC6A 4E2FA 3T7TA 3FOEC 3JAMA 4B1FA 1JEYA 1G2QA 5A71A 1JI0A 2CL6X 4G0QA 2C3YA 4JD5A 5BQ5A 3H2SA 4YYZA 1XDDA 4DLPA 3O8QB 5SZIA 3H1PA 5KNBA 2V5VA 1ISHA 2HWUA 2ZJ4A 1TEVA 4TMXA 2HXGA 4O2AA 2HWKA 3OLZA 5ED4A 1ZVQA 3UICA 3AK4A 3MSXA 5C5IA 4B4OA 4XTCS 2ZB2A 3T0FA 1JEJA 1EWRA 1WXFA 3MLAA 3CCFA 4JB3A 2FRXA 5IFLA 4PAQA 1K8XB 2YVQA 4OY3A 4YIKA 1IXSB 2QS9A 1G8MA 2Y68A 2A9RA 4GBED 1JAYA 4AECA 1BDBA 1N9ZA 3B82A 4DIOA 1TAGA 3U3ZA 1YL6A 2ZAIA 4TXLA 1L5VA 3PUXA 1E0SA 5A9SA 2C0PA 1SN7A 1IMJA 5I7VA 1NUSA 4WJKB 2D1YA 5DIZA 3TB6A 1E8MA 4L2IB 4WKBA 3B8EA 2R6FA 4B17A 1E18A 3QY9A 3MQ2A 4HAXA 4FYHA 5IVHA 2E4ZA 1DMSA 4EEKA 2GF2A 1Z6TA 2FFRA 4FYPA 5A04A 4N3NA 3NVMB 4RYLA 2O5CA 1LPAB 1TMKA 1K5DA 3VOSA 4C9BA 1I8TA 4DJJA 4ZYLA 2YV5A 2CXOA 3DE7X 3FBTA 1RLOA 3LDHA 4KIGA 4CLOB 5HTOA 1JX6A 3MCUA 4Y6SA 1ZVJA 3QEAZ 4I5FA 4P7JA 3KVYA 4TMVA 2H9IA 5BN5A 5I9BA 4OSPA 1UKVY 5J9FA 3NYRA 3GZTB 5K1ZA 2IY7A 4HAOA 1NVAA 2HU8A 2M98A 5DF1A 1YTLA 4YBZA 3BXGA 4V0NA 4NPHA 5C8XA 1DEOA 2B7LA 3ASYA 3LKZA 16PKA 1E9VA 3IDQA 3N75A 4X93A 1Q20A 2I4MA 1E5XA 1IY2A 1N2EA 4RQUA 2X9LA 4NZOA 4IXNA 4F1KA 1CVIA 3BFKA 3NHJA 1ZOPA 4PO9A 2W2LA 1ONSA 4A0GA 4FMPA 4N49A 4OM8A 2XV1A 3O26A 3MTAA 4Q9KA 5F33A 4AQDA 3ZQ6A 1CRZA 2G07A 3RC8A 4PZZA 1P31A 3WYGA 3RUHA 3EVDA 1B42A 4J1SA 2H2WA 4TGLA 3IBCA 3WE7A 4K9NA 1EJ0A 1R64A 3VUEA 2P77A 1JF8A 3ZG6A 4DNQA 5A9RA 3WY9A 5LC1A 1KSGA 4U9IS 2IHNA 3IB6A 1NVDA 4Z0NA 3NAZA 1MRSA 4Y67A 1B26A 3AFIA 1K7FB 3QP9A 1B8UA 2QA5A 3TIVA 3W3ZB 1V7CA 3KQVA 2JLBA 3S70A 2Y6VA 2XXAB 4NAUA 5HJ2A 5LQCA 3PUKA 1NVXQ 5DM4A 3D0QA 4ZC1A 5JO0A 3O4VA 3G7SA 4LXQA 1SQ0A 3K0KA 3TRFA 4AT1A 1CQWA 3LL4A 4PLPA 4G0PA 4BDTA 1VJ1A 3IUJA 1JAZA 2IUYA 4RKRA 1X19A 2VDPB 1JRLA 1VC2A 1YCGA 1YA6A 1VLHA 3CPEA 4ZO7A 4Z3DA 3ZWBA 4C2AA 1E6UA 1FYEA 3PHBE 2AG0A 2F3QA 3FVTA 4RZ3A 1VRCA 5FTKA 1QYXA 3JD4A 3D6NB 1XEWY 3D2BA 4NMMA 4Z3KA 3NBFA 2YQ5A 3IOEA 2D5IA 1LFDB 1QTIA 3K0CC 2QUIA 1XC7A 3HRHA 3W5HA 4QM6A 1SHJA 2ZJFA 2FZCA 3BJZA 3HBMA 4L76A 5D2CA 3RC3A 3SSAA 1IM8A 2AW3A 3EEFA 3O6VA 4AY5A 3TOCA 5IULC 3GPDG 4ITRC 4ZO9A 4XYEA 3VH4A 2O3QA 1S1CA 2F48A 1EGHA 2COKA 3BJIC 3T3PB 3WK8A 4MI1A 4EB3A 3O47A 5A7FA 3V80A 5C8DA 4IDBA 1E1CB 2VTVA 3DE5X 1GTMA 2XIJA 4EW6A 4JLUA 3KWFA 4ZAFA 3CH6A 3P0FA 4ZI7A 3RRFA 1WSBA 1NY5A 1XXLA 2KB0A 2OMEA 4AZ0B 2HSEA 4F4FA 2FDXA 1SHLA 4PIMA 1TTQB 2X2FA 4AU1A 3HB1A 1BHSA 4L3VA 3MB5A 3ETEA 5C34B 3KUUA 4NBSA 7MHTA 4HDAA 1GG9A 3CKKA 3E2PA 1AC5A 1NXSA 4ED9A 5BURA 3L6CA 2L42A 3KU4A 4CCYA 4W5TA 1DV2A 1B1CA 2F9LA 1U0RA 3HUFA 3PFWO 3TR0A 1J99A 3GMDA 2VHYA 4I9UA 1S7CA 1ZK1A 5BSEA 3TBKA 2IE0A 5ECGC 1E6EA 3OMLA 1N5JA 3STHA 2FPWA 3NBYC 1BYIA 5AW1A 5BWCA 4NTZA 2GKGA 1V16A 3LGAA 3NWOA 5ALDA 1V96A 2RAPA 5H9VA 3O84A 2NNLD 4ALKA 4PZUA 3WA6A 3NRCA 4FW8A 3PA8A 2BD0A 5FPTA 1R00A 4BGVA 4HDQB 2HMVA 2PWBA 3HCFA 4F06A 1M2JA 2WD8A 4TL8A 4E2ZA 5D84A 5BSRA 5B3JA 3AETB 4M6WA 4LHZA 1JJBA 3C7CB 4PG4A 4PVCA 2PZEA 5DWQA 3ILSA 10MHA 3JXEA 2CXPA 4PC1A 1E62A 1Z8FA 2PTHA 3GARA 1QQ6A 1HFEL 4IMRA 4XGNA 3V8VA 5IT9A 1EP9A 1OKKD 2ZSHA 1QVWA 1HUQA 3JW8A 4ZEVA 3QMPA 2C9CA 5DM0A 1C8BA 2B25A 4PG7A 4REQA 1G59A 2YOGA 1MA3A 4GWKA 2A3RA 1WABA 2AK3A 1D2CA 5DBGA 3OT5A 4TYNA 1NAIA 3OCJA 2AW5A 1N2XA 3E0QA 3FR8A 3L1HA 5FPYA 5I8ZA 4MA0A 1L9KA 4DZTA 4ENPA 3OX1A 1APBA 1E2BA 1Q3TA 1WR8A 2NVOA 3QUTA 3OHMA 2UYCA 3DDCA 1QG6A 3NH9A 1F8FA 5AJZA 4P35A 5K3FB 5KDDA 3UMFA 4C2TA 1KMHA 1AF4A 1L7NA 1QDLB 4A27A 3B38A 2JJ1A 3O1LA 4HDKB 2WA1A 1HM5A 2ZRBA 2DWOA 5JNTA 2HWYA 5DNWA 1G7CA 4UU8A 5AVTA 2KS6A 1ZJWA 2H6EA 1GSHA 4KTTE 4O25A 5B1SA 3WK6A 5BVGA 3GHYA 4JEHA 1T8PA 1N0IA 4LNUB 3L5KA 2WZQA 4GF5A 4A5SA 2I2CA 3G59A 3L7BA 2BYTA 2O2GA 1AKTA 4EPRA 4RCYA 3RVBA 5JZVA 4BX8A 1BWQA 1R8JA 4NENA 2VAMA 3P2EA 1IQ0A 3RREA 1GZ5A 1OVMA 2IQIA 4BNUA 1VKHA 1TEXA 1OLUA 4MYDA 4K87A 4OBBA 1N2ZA 1XVAA 2JHCA 4X41A 1HBJA 2CLOB 2OWDA 3SN6A 2IH5A 2EEPA 4QEZA 3GJRA 1M0WA 1NLUA 2B1RA 2QNIA 2VBCA 5EIOA 3IQXA 5BORA 5KC9A 3GK3A 3H5RA 1JDVA 1JLMA 1QNLA 1SXJB 3FBGA 3MEQA 4L51A 5IK2A 2VK4A 1XZNA 1VLQA 4QOIA 1ADJA 1OLSA 4ZV7A 4KXXA 4W5WA 2AVDA 2JCBA 3R7DA 2V3VA 5LUBA 3C6QA 3UJ7A 1QH9A 3N86A 1AK9A 4C43A 5FV7A 5LA6B 1QVRA 3KKLA 1K6EA 3ZIDA 2F1OA 1I14A 2IYTA 2P4QA 3UUGA 1PLKA 1YI0A 3SM3A 3JY6A 2DY1A 4AF7A 4O5AA 2R6JA 3FHOA 1UWLA 4X1IA 1P1CA 4WFQA 5IVKA 2NIPA 1T1GA 4R3UC 5L45A 2P9CA 1F8UA 3W6NA 1R4NA 2JZOA 1T5HX 4C5AA 1E1YA 3H13A 3NG1A 1PJLA 3RH0A 3RJMA 3HA3A 3PJDA 3REOA 4NATA 5KYTA 2DHQA 3DSRA 3JQPA 5A6VA 4LZJA 1K6MA 1OBFO 1GL3A 2OM2A 2AN5A 3ECCA 3BSFA 2EJVA 4CL8A 4E5VA 4RVSA 4Y9TA 3RIHA 1ESCA 3DMPA 4I3GA 1TUBB 3ZY4A 1UXKA 3JQGB 1HDOA 3FA2A 4CKYA 3R9XB 3EGCA 1CQZA 2BEWA 1IEQA 2C2MA 2QL9A 4K8OA 1Z7YA 5D1NA 3SG0A 1V37A 2OKCA 3BA6A 3TINA 3X2EA 4BKQA 2XUHA 2Q41A 1BKYA 3GIWA 1W59A 2IYEA 3SBDA 3T7IA 3DYVA 3KYDA 4DKJA 1FVFA 3IMGA 2XWJI 3LPNA 4LS3A 9ABPA 4WN9B 5ALNA 4F2GA 2XYHA 4B3MB 1ENOA 3PE4A 4HFMA 5DV9A 4JU9A 5HFJA 1KWKA 4IX1A 4YPFA 4KKVA 4WXEA 3FTDA 2G9NA 4TRNA 1BDIA 3BIXA 3AR4A 3DC7A 1P6QA 1KXJA 2VTDA 1ZGBA 4AVYA 1ZUHA 2CXTA 1DUVG 5KQSA 4PYNA 2FVYA 2Z1MA 1KDYA 4US1R 1E1RD 1YQXA 4G9GA 3B3GA 3CIFA 1J0AA 1U02A 4O1IA 3LXXA 1LPBB 4G5RA 2C84A 3HDJA 4MQUA 3W4KA 4EWLA 5LP6F 4HP8A 4NYJQ 4LCJA 1UFQA 3U3DA 3FKSA 2BFEA 4DAOA 1AGXA 4XASA 1EZ4A 3WGUA 2VJQA 4H6XA 2I3BA 2QD1A 3L0OA 3RYFB 4UTZA 2AFVA 1YTUA 2JLYA 2REOA 3KR0A 1XXHA 1UDBA 3K4HA 5JCXA 2WJJA 3L1JA 5B2EA 3FPAA 3QTTA 1XQXA 1UJ6A 1EVLA 3DC2A 4IH1A 2XOKD 4IH4A 1UDRA 2NV2B 4M7WA 3NBUA 5JC8A 1K8QA 3VR4H 2HD4A 1CFZA 3J81k 4O3MA 4KR9A 4EAQA 1B15A 2AWNA 2A84A 1Z12A 3IO3A 2Q0SA 3T4EA 1DWPA 2VRWA 4JXJA 2P0EA 4JR0A 4CG3A 3IP8A 2IK8A 2NO5A 2B82A 3A70A 2FN8A 3NVDA 2WVAA 3MMXA 3U4IA 1P1KA 1U7OA 1WVMA 2ZSAA 4HGNA 2C99A 4E5DA 1RR6A 4DUYB 3U0VA 2ZDGA 1F14A 2UVPA 1KFEB 4NE9A 1PLLA 4L4ZA 2VSQA 3LCJA 3CF0A 4BVBA 4E2WA 1WHTA 5FTMA 2K2QB 3BTVA 4CDGA 3ZHOA 3ICPA 3JSXA 1MOQA 1D0IA 4OHFA 4WK6A 3P20A 1BAPA 3Q9NA 4KQGA 4TTIA 1EP1B 2ZUUA 3DV2A 4CUJA 4I50B 1D9ZA 4KCGA 5DHAA 4C87A 4IOLA 3LVRE 4MW0A 3WL7A 5IZCC 2EW1A 3GH1A 1J49A 3I4FA 1U8CB 3BWYA 2IUUA 3ITKA 4AS2A 1T0BA 4XYMA 2AG5A 5LBIA 2WUEA 1CZNA 3AX6A 3EWIA 3SI7A 5KTKA 2HSJA 4MWEA 2OPBA 3SF8A 4ZJPA 3CZCA 2C0CA 2PSDA 2ZVPX 1NFRA 1K4YA 1Y4ZA 1FP4B 3AI1A 3TKLA 2G06A 2HBQA 4GOLD 3TL2A 3QSYA 3MRSA 3LO8A 1NF2A 3FPBA 5CB4F 1LVUA 4UBLA 4YQZA 2NYRA 3PGKA 4LG1A 4GR5A 5DHTA 3SC3A 1CF9A 1J70A 4EA9A 1PS0A 1R27A 1U2RA 3DMFA 4GSYA 1CVLA 1T1EA 5HTKA 4EMBA 1MU0A 3CW9A 1KO5A 1NNLA 1QP8A 2GT1A 3EG5A 4FOTA 4HR7A 3FLAA 1G19A 4S1WA 4EUHA 3WKEA 1RAEA 3B48A 2H63A 3JYHA 1EVZA 3MWKA 1BCRB 3CH4B 3QV2A 1JQJC 1C0IA 2W00A 4GGMX 1KWGA 4Z4GA 2HJRA 4AIIA 3ZCQA 4G2TA 2ZDHA 4HAIA 3NTOA 1CBUA 1JFRA 1S8OA 4CZ2A 5EMLA 3KWLA 3H11A 3PFBA 1NN3A 3CR3C 2HA3A 2DGDA 1OFTA 2HGZA 3QVTA 4MVWA 3B3AA 4GAEA 3LKDA 3LLSA 4M83A 2YXPX 5GVSA 2VDJA 4D74A 4XYLA 2XUIA 4XJTA 3HN7A 1C50A 1VPEA 2Y0PA 4YJFA 1XZQA 2JRCA 2NO0A 1RXUA 4YGYA 1XQVA 1UPBA 5JSUA 1ZD2P 1LK7A 1J8MF 1U65A 3DBRA 3ON5A 2ZPUA 4B4DA 1O0SA 1TU0A 3A32A 4PAGA 4G1UC 1EJ2A 4JBXA 1TADA 2PUDA 3ULKA 3FSRA 1GU1A 4JLVA 1MX1A 7REQA 4D8VA 3ZNQA 2D74A 5EXSA 3IA2A 2BGJA 3PNOA 4BNZA 1LC0A 1OT5A 5CK5A 1IZ9A 3PPVA 2ISCA 3O1JC 5GGXA 2AEFA 1PV4A 5ILQA 4FGZA 4O4IF 1GXSB 4LOLA 2OCDA 4JLAA 1QHYA 3AERB 2VEOA 4N0MA 1A7JA 3N53A 4U7JA 1QQAA 2H08A 4FWBA 2PYDA 2E6KA 2CVPA 1EQAA 2FE4A 4V0RA 2XNHA 4F91B 3HDYA 2QI9C 2BEUA 5DLQC 4UOEA 5J58A 1M8GA 3EZXA 2O2CA 4Q01A 1AU9A 1VTKA 2WJHA 3V8EA 2AEEA 3WTCA 5KYXB 2CXHA 1SQFA 1CFJA 1O6ZA 2C5LA 1KMNA 3AI2A 2M1XA 2H0AA 3TI9A 4A8JA 2HF7A 3A25A 1DQSA 3AY3A 2IEYA 4DABA 4X3CA 2H9YA 4DYHA 1O58A 2VNKA 2HR1A 2DOKA 2HZBA 1SBHA 1O9BA 1W76A 3UENA 2Q9AA 1QRAA 1RLUA 1NVMB 2BJHA 3FPFA 4WASA 1GYRA 4IV8A 3OUUA 3WLAA 1L7VC 1P2GA 3IPLA 2KJQA 3GEDA 1LWNA 3JAWA 5E8RA 2GZ1A 1INLA 1T5DX 1M5UA 4FFDA 4I6JA 3WMFA 4ALLA 5BNWA 2Q27A 1UKCA 3P71T 5A4JA 4U7DA 2FDCA 1ZJZA 2OE2A 1XYGA 3WOVA 5DM70 1N8KA 2HU7A 1V35A 4Q4AA 3VR6A 2GD0A 3O38A 1W0JA 4LJ8A 1ZNQO 4R98A 2J5KA 3E23A 3PHHA 2G88A 1NQTA 1WBDA 1QR6A 3W2TA 2Q7OE 4GUDA 2CMHA 2F6RA 3OTIA 4ZICA 3JV7A 1OXXK 4E3WA 4UJ3A 1JBKA 5I4KA 2OENG 1IRXA 1X1BA 2J7PD 3MOIA 1AZSC 1MG5A 1SKQA 3IX7A 3KAQA 1G3MA 1PWHA 3SX2A 1LV7A 4JI1B 2WM3A 3GLHE 4KFRA 4QBKA 5LLSA 2EG5A 4ODIA 3UJDA 4RVGA 5FPKA 4XARA 4P36A 4NECA 4BHTA 4BEJA 1TM1E 2OR3A 2O59A 2FF7A 2B35A 1E64A 3E18A 4IPTA 1EXVA 2K4MA 5BSUA 3HUDA 1T9DA 3FWNA 4B3IA 2VCEA 2GETA 2JD1A 4ZPJA 1RAAA 5J1SB 1PS8A 1ULSA 3PQ2A 1KIAA 5FWDA 4MUKA 1U90A 2AOWA 2RAFA 5H82A 5JSQA 3WRYA 2FH5B 4U5XA 5A4AA 3WO0A 4WINA 4ALMA 1SGWA 1TVMA 2PH7A 3LECA 4C7OB 4DF3A 3ZE1B 4EHDA 2HF2A 3LFHA 4JLKA 4MYRA 4H3VA 2V1XA 1A8PA 1AGRA 1OU0A 2D2IA 1MR3F 2LUOA 3KTAB 1QHSA 2OB2A 3I64A 5IKPA 2EERA 3GPBA 4N4AA 5FULA 3T3HA 1Q7TA 4ZI2A 5FH9A 1FSPA 2B4AA 2IUTA 4HUJA 2I8AA 1IEWA 3PITA 4YWJA 3U49A 3C48A 1L1FA 1ODLA 2IS1A 3PXBA 3E1SA 3LKBA 1I2MA 3N58A 4QOSA 5ADVA 2CD7A 3A05A 1FS6A 3AP1A 3EZ6A 4U8GA 3GT7A 6YASA 1JHVA 3CVWA 2WWVD 1A77A 2IZ7A 4Q12A 4ZRDA 1NP6A 4A8PA 4EQ6A 2R9VA 4CTJA 1NJ1A 2GZRA 4EVQA 1WETA 2A6PA 4GMXA 4BO2A 2QM0A 3DHNA 3K73O 1C30B 1OR8A 1QGAA 3K5WA 1B41A 3T1NA 4M89A 2QQFA 4XRRA 1O95A 2D3WA 4S24A 4AZ3A 1A76A 2BZSA 2JAHA 1FMLA 2B4KA 1P4HA 1JFFA 721PA 3NVAA 2AHOA 5DTEA 3MJ4A 4MOWA 1NU8A 5CJ2A 4AKEA 2CDRA 5KTTA 2ZR7A 2GK4A 3LX4A 2FEPA 2JEZA 2C5AA 3BGWA 2G5TA 2GTIA 3TZQA 4TL9A 2DUWA 1C3OB 4A0HA 1EWYA 2HCFA 3JQQA 4RZIA 5JDCC 3T3DA 1Q44A 2EAUA 3I01A 4MICA 1MO3A 5DNAA 1C81A 4M8LA 3GVCA 5F2OA 5KX5F 2BUAA 1EB8A 3VV3A 4XWKA 3QNUA 5I45A 5FWYB 1ZD8A 4C0BA 3ORSA 2EATA 1JHUA 1Y3HA 1MZVA 5KUTA 4D9NA 1A9QA 3DXZA 3BG5A 2OL4A 4XGRA 5ED0A 1DXOA 5CXSA 3GBPA 1CTQA 2Y4NA 2W6JD 4QPPA 2VPTA 5EYPA 5C1PA 1XLTA 2O8FB 3C97A 5F12A 2CZQA 1H05A 2PUCA 4KQWA 2MINA 3B3JA 5KAMA 3ZWDA 1TXGA 2NTJA 3D31A 2BISA 2O52A 3D0KA 1E60A 4YRJA 5B7QA 2NGRA 2FX5A 5GIOE 5JW6A 3HJFA 1G21E 3GJ3A 4Q48A 1N2HA 1OWNA 2RHRA 1MG0A 4Q1FA 4E09A 1XMVA 1QUFA 2GZAA 4G9BA 3IEVA 1TO6A 2VYNA 4FR5A 5L4NA 1VIAA 3JQ8B 3OQIB 4JYBA 4L6CA 3GEIA 5AM0A 1QIJA 3P9SA 4IIYA 2ECQA 3T1QA 3WIDA 5BYAA 2FWBA 5ISMA 1OTXA 2E87A 3ZWAA 1JMVA 3EZ2A 4TWRA 4F1WA 4DDHA 5EN4A 1LBQA 3N2ZB 1E6MA 3O7WA 2XQKA 2I22A 4ZAXA 2HQOA 2XGMA 1W7AA 3L7LA 4Z8XA 1Z33A 3I5UA 4MW2A 3W9YA 1SCKA 1T8RA 3BWXA 1KC1A 3HBLA 3QKSA 4R0NA 3URMA 1JVNA 2XAAA 2ZWOA 2P27A 3LCCA 3MGBA 1OT3A 3BXPA 5G4KA 2B3DA 2COEA 5GPBA 2QHXA 4AKTA 4R9NA 5JHHB 3SVLA 1BDJA 3HNOA 1VPVA 5KIAA 3KHTA 1KI4A 4IZHA 3ND8A 1N6OA 1VGQA 2ADFA 3JVEA 4KQKA 2P6NA 3PDIB 4EA7A 2W42A 4G0VA 3DMDA 3F7TA 3KAKA 5CT6A 4ND5A 1QYRA 4Y6LA 4TKLA 2VBIA 1R50A 1RC0A 2YQZA 3U3KA 3RVPA 2GYWA 1ZM9A 3EDRA 3U7FB 5CLIA 3FFXA 1E2JA 3T5CA 2O8CB 1IHYA 1NOIA 2H5IA 2CMFA 3UT5A 2ZFUA 1PL7A 1NMXA 4HJRA 3ND9A 2H2GA 1FPQA 1DX4A 1M75A 2HHCA 2XZPA 4J4BA 2Q6OA 2J9FA 1XROA 4FWIB 4LZZA 3UY4A 2R44A 4YGXB 3TPFA 2GUGA 1TZBA 2PH1A 4A1FA 2OGUA 1N7GA 5K05A 2JFXA 4L8FA 1JA9A 3HZOA 3QMVA 4HPWA 1XYYA 1GZ7A 2ON6A 2P9TA 3H5NA 2Q99A 3KZXA 1PFWA 1F2UB 1P2TA 2VDWA 5KOJB 2O0JA 1GU7A 1R6XA 3HDTA 3VNAA 1X7WB 4IEEA 4JJ8A 3E8MA 1XMIA 3QLVA 4P3PA 3AUSA 5H81A 3DXXA 5D8DA 3Q9UA 4K46A 1YDFA 4JBIA 1FYVA 4G0YA 2OAP1 1K4MA 3AHEA 4MGZR 1IFXA 3LGXA 1MENA 3WBKA 1DAIA 1I4LD 3JRXA 3UB4A 1WD7A 3S68A 4DNPA 3AUJB 3HU1A 3IBYA 3C5EA 3OCWA 3D3JA 2H4XA 4G6ZA 4B3HA 3HVKA 4MJ7A 3D8BA 4UPDA 5B4VA 1Z2PX 2Z1NA 2J1LA 2ZUEA 2WJPA 4WDQA 3EFOB 5K9ZA 4MW5A 4YCMA 1B16A 2QE7A 5AI9A 1UWVA 2C2BA 2IIQA 4KFUA 4WUVA 1CERA 1ZVMA 2ZP1A 5EFZA 1J21A 1JHDA 5HDQA 3S1SA 2EFCB 5F4ZA 1X0VA 4LPSA 4OLAA 3ABIA 1NR5A 1JKJB 4DLAA 2VCYA 3DCJA 5ALHA 4P3YA 5H8WA 1XZHA 3JQ6A 1BE0A 1SY7A 2IV3A 3N3AC 1SC9A 4MW6A 1TTPB 3WB1A 5ITZB 5DI3A 4U6QA 4Y2TA 3S2IA 4J29A 4G8BA 2VAWA 3Q40A 1Q1QA 4ZXPA 2HNBA 1NMYA 2P11A 3K9CA 3C14C 3O94A 2AR0A 3OP1A 4MVJG 2BMDA 5HGJA 4COKA 2V1UA 2WUVA 1U8XX 4Q66C 1ZVKA 3T5DA 4EO7A 2IH2A 4P1ZA 2WUWE 5EINA 2JLSA 1E2PA 4XOIA 1RM5A 4KRFA 1G21A 3OZGA 4U3JA 1FFHA 2SCUA 4RJJA 5FYQA 1POXA 3T1YB 1W35A 1UDWA 2XCTB 1U9IA 4FOSA 4JLJA 4FFBA 4UMDA 1RADA 1N57A 4Q3CA 1U2QA 1K98A 4NYIR 4RMHA 1XD8A 4WK0B 1N2SA 1O4WA 1P5FA 2RGDA 2DTEA 1NVVR 1Y8RB 5EJMA 4BYMA 5LP6A 3LX8A 4JUAA 3PDHA 1U0LA 3TLGA 3PD7A 4U02A 1J09A 2AI1A 3O3CA 3EPJA 2H54A 4BMOB 3IR6A 2H8GA 3Q7EA 1U11A 2IYPA 4UNSA 2FW0A 4O4LF 3F46A 4RACA 4LMPA 4FHZA 1QF6A 1GTRA 4KO2S 2CFIA 2GJ9A 3MWEA 5G0WA 3VO8A 3B9RA 1F51E 1IZ7A 3DBHB 3LKVA 4AMBA 4DNXA 5CNKA 1FRZA 1I7NA 1QE5A 2D2VA 4KWCA 4L9WA 4E12A 2FSVC 2OZVA 4RMIA 1XG5A 2QMOA 1BE6A 5HE9A 4B7ZA 3HZHA 1YS9A 4HNTA 4XW2A 4ZCPA 1KU0A 2AR9A 2NO6A 3RIMA 3D3WB 3GDHA 5HJ5A 1EESA 1C1HA 2NU6B 2B1GA 5GWXA 1QV7A 1CW2B 1KJZA 4JLBA 4PEVA 3U16A 3PT5A 3JYLA 3NH6A 4WX2B 2BKXA 5EE5B 4BV3A 1DTWB 1CUJA 4DR4B 5H3HA 3AR7A 5KC8A 1E7MA 4IDAA 3GB9A 4B0PA 4WFJA 1M7BA 2G63A 2EZ4A 2PZ8A 4OB7A 3S28A 5IX8A 5L3ZA 4KREA 1Y4AE 4TZ6A 2MYTA 1KARA 2WF6A 1ML4A 5I8WA 1E2GA 5IMSA 1SCQA 2ZBRA 3HKCB 1AV6A 5CBPA 1RI3A 3QSGA 3HBAA 2RH8A 3C5VA 2XE4A 3K31A 5G53C 2B8EA 3LY5A 1C1XB 4KX3A 1E3WA 1DJMA 3ICQB 4KQFA 1C80A 4MP3A 3B53X 3V5NA 3ZDXB 4KUHA 4US2R 5HNKA 4OSEA 5DNUA 4OK5A 3OQPA 3JR3A 1PJQA 4YLEA 4WLVA 1ZEMA 3O4IA 4E0BA 3HL0A 3NO4A 4HVTA 1JKXA 4QPNA 4Q3LA 2YRFA 1XMXA 5CB4A 1D07A 3N7AA 3J81A 1RWKA 5IBRA 2IYZA 4C0JA 2ZM5A 2QR2A 2WRZA 3M5CA 1FFAA 4XKJA 4DW8A 4P2BA 1LRKA 3N59A 1TLFA 1N4DA 5GGYA 1CQPA 1RAFA 3EEOA 3QVMA 3AILA 2IYUA 3ZDFA 1N8SA 4M36A 4BLTA 2FEXA 2F8SA 1PVOA 3PRHA 4WLEA 3G2PA 5G4LA 4IVPA 4O63O 3NTQA 4KAJA 3IP1A 1ZZGA 4KQCA 4LE2A 4MVXA 5CITA 1EZZA 3NB0A 1JPNA 2R62A 3KTOA 3IEMA 1DCTA 1UXGA 4N5HX 1DI0A 1VPLA 2VXBA 1NGSA 2CWWA 4PZEA 2C4WA 2OV1A 1KP9A 1H65A 1I3LA 1SBNE 1UH5A 3C41J 1JSCA 2Y1OA 3PPXA 4JB2A 2ZWPA 3HMKA 1NXXA 1Y1LA 2CGEA 3DE1X 5DVZA 2CBGA 5ALKA 1E99A 2ZUFA 5TMEA 4WY5A 3X3HA 4FLFA 2ZE7A 1RZVA 4CTMA 3V9PA 3VTAA 3COVA 2WWRA 2H06A 3U62A 1TVCA 2FX3A 3DV0A 3KKPA 3LYAA 3HB5X 1GO2A 2ST1A 3IIJA 3ILHA 4R8MA 1XU7A 2ETVA 4BO0A 1MC5A 2BTQA 3I39X 3SS7X 3NOXA 4O4IA 3PPYA 4HGYA 4PQRA 2W6MA 4QD3A 4Y1RB 2ANCA 5G1NA 3T7CA 5KREA 4B5LA 1MXFA 1RYEA 1D8AA 4WBNF 4LFAB 1NI3A 1WZEA 2P9EA 3I04M 4G81A 1ZGHA 5ERYA 1FFGA 3OY2A 2DT8A 4FR2A 4R16A 3BILA 4OI1A 3RU2A 5IJ9B 2NSYA 3PNMA 2VPIA 1T1RA 2XTMA 5FT9A 3EQ8A 1AQYA 5I5EA 2OHVA 1XPOA 3QELB 4QASA 1MO4A 4F3NA 1DBWA 2Q9BA 3QMMA 1CP2A 3G17A 3DDOA 3QLUA 2WZCA 4IXTA 4PW0A 1DFIA 3JWPA 2DLCX 3PVCA 1CRQA 3U1BA 2QZ9A 4DG5A 4S3MA 5C53B 1USWA 4JH0A 1OPRA 4MV4A 3TMYA 8ABPA 2QU8A 3RNOA 2ICAA 4TQUS 4YV7A 4R05A 2VHCA 3BK2A 3FN4A 5KOIA 4MDEA 1YR6A 1JLHA 3FHJA 4DB2A 4CMCA 1GFSA 2JDIA 5BNTA 3SHOA 4KYIB 3UMBA 5EWJB 3VHQA 1L1QA 1LZKA 2RBEA 2RGXA 4P0TA 4YTEA 3L92A 4B3BA 3RYHB 1DX6A 4O1HA 2R79A 4P81A 3IL2A 3IEKA 2W71A 2P9JA 1WM1A 2ZETA 2JAUA 4G26A 4J0GA 1SHKA 4RJ2A 2E5LB 2HV9A 3C3CA 3EIWA 3S7TA 3N7TA 4N0QA 2P6RA 4BCDA 2A7QA 1OI4A 3EA5A 3PHJA 1I3CA 4L4SA 3HGQA 1SB9A 4R8SA 1C4KA 4DLBA 4P0PB 1JYSA 1NR1A 2IU6A 1DTSA 5JS8A 3VDMA 2ZIAA 3OZWA 1CQJA 1E7WA 1NMQA 2IA5A 3CLSD 4MV8A 4WUTA 5FUVA 4F21A 4E4TA 5AQ1A 2CLFB 1W36B 2QLMA 3B9QA 5DFAA 1BVRA 1ZCAA 4MHSA 2C9YA 3E3NA 1R18A 1NVEA 2HK7A 3W6PA 2VJPA 3L0BA 4LBWA 1IIBA 4MQ6A 3HBFA 4MRAA 3HMQA 4CIXA 1FFXB 3RK0A 4I3HA 1R3UA 2AKYA 3IUPA 3WFJA 5BR8B 3CPHA 4QC2A 1NW5A 3GA5A 3UF0A 1XNQB 1IOVA 5AHXA 4EYQA 1GN9A 4LJ5A 2B7CA 3DMGA 3QI2A 2VDUE 3HCOA 2ZI5A 1LLUA 3GAFA 2LWIA 4WHMA 4L0DA 1RNLA 1F06A 3TUZC 3VFDA 2WBLC 2ZSDA 1CEQA 3C8ZA 3A1UA 3IVRA 4POOA 1MMFB 1VBKA 4OXQA 5EJ7A 4BUZA 5EJ8A 2I65A 1F0NA 5C5DA 4INOA 1WMBA 5IZ4A 1MZPA 4QUIA 4Q7LA 4KR7A 2PFKA 3C1OA 4NRDA 1AS3A 1Z2NX 1J8VA 1A9TA 3PB3A 4BASA 1NUTA 3A14A 2FVXA 1Z4OA 3TTWA 4P7FA 1YRBA 5EXXA 1XCGB 1THTA 4NESA 4RLSA 4Y2XA 3D5QA 3GLIE 2ZYWX 1M6VB 2HLNA 2YZ2A 3W9BA 3WJ2A 2DTXA 1N0VC 2O1SA 3FNIA 3LG2A 4G1MB 2P3QA 1ZBDA 3IBTA 5T67A 1X2BA 3VAAA 4CHTA 3FPHA 2RGNC 1K3TA 4FIZA 1HF3A 3LQ1A 3DM5A 3H1AA 2EKLA 2YWEA 3OF2A 4MYCA 2VHVA 1NQAO 4RGYA 2A92A 2PAAA 1T9CA 2HA6A 3BMQA 4JQYA 2P3SA 1X1RA 2I5PO 4UBIA 4L16A 3FR7A 2OFFA 2BGLA 1NQXA 4F45A 1B3BA 2JFQA 2SBTA 4JCCA 5AUNB 4NAHA 4PZ9A 1Z88A 1SKBA 4WOKA 1YUBA 1MIOA 5DT9A 4IKOA 4AUEA 4BMYA 2XSZA 4DQKA 4ESOA 1RQXA 5IDWA 2B4RO 3ZNPA 1A1SA 1ISFA 1BDHA 2VZ8A 4IWNA 4CFYA 5L3QB 1DL5A 1VMKA 3MBOA 4XDYA 4ZREA 5LMUB 2C1XA 1B6GA 1GAWA 5IM4F 5EP4A 1PKXA 3MXOA 3D5TA 4L3OA 5EE1A 3TUJC 1TCBA 1BWSA 2FWMX 4H7HA 3U26A 3I9V6 1K7EB 5FB3A 2DQ4A 3ONNA 4MV7A 1P8AA 2YWDA 2H5LA 4ZANA 4F4UA 3L4BA 4DILA 5KX5A 2R5NA 3VX3A 3KCQA 3KR9A 3DFIA 5G3ZA 1KETA 2CL7X 4RV9A 4QVGA 5HOEA 4H7FA 3T54A 5JLJA 3K9FC 1Y34E 4IDEA 1YOBA 2GBGA 3F3MA 3NDJA 4BB6A 1MB0A 5BQOA 4YMHA 4LJSA 2Q4EA 1LPSA 1FTSA 1BXRA 2CLIB 3H83A 3R5XA 1UP6A 3EGDB 4TXMA 3V2IA 3JQ7A 2NUPB 2W2TA 2EJBA 3CV3A 2JK1A 3JYQA 4G84A 4GX1A 4MIYA 4UAGA 3AFNA 3OHSX 5GJBA 1MV5A 3A4NA 5ILOA 2GASA 5B3LA 2CXUA 3SYLA 3Q8LA 4TTSA 5JJLA 2BFDB 1NIJA 5KHAA 3EXG1 4FPXA 4G25A 3N8NA 4EUSA 4FSHA 2H0QA 3U44B 1B0UA 4LZLA 4OTZA 3A6PC 4YP7A 3TSOA 3GP8A 1N1EA 2GDJA 1D2HA 3L7JA 4P31A 4R2HA 4RXMA 4BATA 5F3RA 2PWPA 3TW6A 4DMMA 2O2SA 4B2LA 4EY6A 1J0EA 4HNVA 3AEKB 4HG2A 3KQOA 3HXMA 4M0LA 1X42A 3R5HA 4KH0A 5E1MA 1M2WA 3IEXA 5KQLA 2WM2A 4XR9A 1IN1A 1DRUA 2IEAA 4HT3B 3A3OA 4LJAA 4IOJA 1MORA 2QIPA 3PFNA 3TAXA 2XUFA 5JSYA 1WF3A 4QHYA 4BFTA 5ADUS 5KYYA 5HIKA 1C7ZA 1E2HA 4GRAA 3D8SA 5K4HA 4Z4HA 1NW6A 4QFCA 1WF6A 1RWNA 5KMGB 3I9V1 4PQEA 2JIOA 4RIGA 4N3GA 4H3SA 5E1OA 2YV1A 3HU2A 2AUTA 1D6NA 5JDIA 3AHIA 3NUZA 5L6LB 4YHHB 3NTXA 4HBZA 3FCCA 5B53A 3I30X 2BGMA 2G83A 1ECFA 4C3VA 5GP1A 5J5AA 5FUQA 3OTOB 3OIFA 2ZM6B 1FC0A 3GZJA 4BBJA 4YRGA 2XHEA 3H5OA 2PUEA 4TZKA 1TO1E 4XIJA 2I2FA 2AYXA 1O95D 1QIHA 4PAMA 1N7JA 1F20A 1K7XB 1MB2A 1MIHA 2R1VA 3CUYA 1F9AA 3A4TA 4QRHA 3RFVA 3QW4B 1GQQA 1FSFA 5LUAA 1WDLA 3C16C 4LV5B 1V26A 4MPJA 2GXAA 3RUAA 3AJEA 2W11A 3PZBA 5LOVF 2IITA 4GPEA 4MKGA 5CPBA 2A5YB 4E1BA 2QRVB 1NP3A 2JIQA 4QGHA 4S1NA 1CT9A 1FJ2A 4AF8A 1QLWA 1CS4C 1T8YA 3UFXA 2GM4A 1GGHA 4MUNA 2B5OA 1ZX1A 4BZPA 2Q62A 2OBFA 4EG8A 4ZZ0A 2EP5A 3KKOA 3S8EA 1T4MA 1UJ2A 3CF6R 3PNQA 4OIFA 4OHZA 3V4PB 1QNFA 2QYSA 5LKAA 5K0TA 3CURA 3O3MB 4RJKA 2L82A 2Z9CA 1P60A 1TQ8A 4V02A 2VG8A 2BF7A 2G3YA 4YP9A 1K86A 4ACBA 1LBSA 5F1YA 2EKBA 5DBOA 1IK6A 1U0GA 4AW9A 1CRWG 4R51A 4HQKA 1UOPA 4IG9A 5CNJA 5FXMA 5B2FA 3DOJA 1FMTA 3KD3A 3QKTA 1D7AA 3EDYA 3C4JA 3TK1A 3NPAA 5FNVB 5COQA 2P4EA 2PBFA 3NIFB 3GLGE 1J8FA 2NYAA 4CFSA 3UM9A 1UDXA 4WXRA 3KWMA 3F2VA 4RTJA 2ZIWB 1PNOA 1ULZA 2ZYGA 4BJ5A 3B6KA 2VYND 2AMYA 5DULA 4IDOA 4TYPA 4Q9AA 1IQPA 3PL5A 4U1RA 2RKWA 4X7BA 1T1SA 1THGA 2XEDA 4CE6A 2P4UA 5LQJA 1RXYA 1XRLA 1GAQA 2WTUA 1Q1EA 3GJZA 1ZVVA 2RB5A 2QTTA 3EODA 4ETNA 4Y2GA 1ZGAA 2BJWA 3W7VA 2EFGA 3BJEA 1MRNA 2BH2A 4E14A 1EWVA 1BVYF 4ZRNA 5ITSA 2C5EA 3M6FA 3ZXUB 4EZIA 1CEYA 2JH3A 3KLBA 4C07A 2QF7A 2H2FA 2BMVA 5TGTA 1FS5A 2JJ2A 1D5CA 2WHPA 2BFPA 1N3LA 1HG1A 1M6HA 5IT4A 4TROA 4PRLA 5BV0A 2WZDA 1UZLA 2LIPA 3PFIA 3FE2A 1R9NA 1G291 4I9NA 1TZCA 1WZCA 5BN3A 1MBZA 5JSZB 1Z3IX 3NBZC 1U2TA 2VP5A 5JSKA 4BZZA 4JQSA 4KPYA 1YS4A 1IHDA 4QGBA 2HQ1A 4LN1A 5LNK6 3Q0IA 1CWUA 2G4LA 2CL0X 1B6TA 3M1AA 3EC1A 4QOFA 2I2BA 1S1MA 4YDHB 1P8JA 2IT1A 3IAUA 1MC4A 2NQ2C 2EFYA 4XVHA 2HPVA 3IFSA 1AKMA 5DWDA 3PIDA 3ROMA 1BX1A 4C03A 4DLTA 5FAXA 4CQNA 3EIOA 2NOAA 3CX3A 1HKUA 3HP7A 1GNSA 4JLMA 1TVEA 2E6UX 4MPPA 3W8DA 3RT9A 2KQUA 3W5IA 3Q8MA 1XMPA 1Y3FE 1Z6QA 2W8ZA 2C2HA 2ET6A 2FAXA 4O4LA 5LMNB 4L22A 1GYQA 4DUGA 5BWOA 4G37A 1V1MB 4KO4S 1P0PA 2CYAA 2FQYA 2QLNA 2GEUA 2ORYA 1H6DA 4NWIA 2JPDA 4B2YA 4DDVA 3P19A 2PG3A 2ZKLA 4OREX 2F17A 1BMDA 4JNKA 4BDSA 3ZTTA 1LS1A 3JD3A 4W9NA 4JMPA 3RUFA 3UT6A 1X7ZB 3TFOA 4ARIA 3M6UA 2VHJA 1ID1A 2BP7B 2QZJA 1WOYA 3MW8A 2P5YA 2WUDA 3W3AH 1VIYA 1A72A 2HJSA 2SECE 4C4RA 2M9MA 4D41A 5AOVA 1Q7BA 4TTVA 2LKDA 4AJLA 2XMBA 4D81A 1UWKA 3DCYA 4G1EB 2POQX 4AZSA 3ES9A 3CLUD 1UFOA 4ENVA 3KNZA 1NBMD 4QUGA 1CJCA 1WW8A 3AMVA 3E81A 1NDQA 1QK4A 3FPGA 4UCFA 2YXNA 3OJOA 4D3ZA 1MHTA 2CBZA 3SBOA 5EJ4A 1TVKA 3AFGA 3ZVNA 2WKRA 3CWCA 2RHCA 3GRAA 4IIEA 2Q3DA 1P4JA 3FZEA 2XGSA 4BKMA 1G2IA 5DBIA 5L3SB 4GX5A 2HMAA 5ERXA 3UJ9A 3F49S 1IHPA 3DTVD 3UEOA 4BVLA 1XOIA 1S7GA 1YDHA 1RXCA 3FCXA 2RH9B 2Q3EA 4ER6A 3N28A 4RORA 3VR1A 5CAEA 5F9MA 1WEKA 4UNPA 1V2HE 4TVSA 1YE5A 4RD4A 5P8WA 4KACA 4ZAYA 1ULAA 2WSYB 3T9EA 4WGGA 2EDAA 3L82B 4QBIA 1QLHA 1UBEA 4QPZA 2DY0A 3QWFA 4PLZA 2EF1A 1DG3A 2OHFA 3I6QA 3L07A 4HXEB 2DU8A 3W6UA 1EFVA 2PY6A 3R3UA 4ZVPA 3GLGA 1UKZA 4JWTA 3GQVA 4EYEA 2FQ1A 3ERCA 1R4MB 3ED1A 4RENA 4GX2A 4XQ0A 2WSIA 4UMVA 5DXAA 5HIJA 3S8MA 1KI9A 2JBWA 1YXMA 2W6IA 1JFTA 5CVVA 1PFVA 1WZUA 4MQEB 1OWLA 3H86A 1VSVA 4M53A 2R65A 1TFUA 1DIGA 2YNMA 2ZPTX 1W4AA 2R8EA 5F3WB 2GRUA 2LD4A 2A58A 2IS4A 1WCIB 1V3QE 3BMOA 4XIGS 1DFHA 1LVHA 1NXOA 4G5FA 4H0CA 1GARA 2GZ3A 1Q7RA 3FFBA 4X45A 5B1DA 3STUA 1T4BA 2BONA 2XUJA 3GCGA 3SLKA 1ACJA 5A4IS 2BMJA 3NHRA 1EFRA 3ZR4B 4GM1A 2RB4A 4EVSA 2PXAA 1U1FA 3EF3A 2QV0A 1FSZA 4RYDA 5CT8A 4UTRA 2PUGA 3CKLA 3DFZA 4LIPD 1J2YA 2YZNA 1CIVA 2K87A 5JXJA 2BV3A 4B47A 1DMRA 3AINA 4B2IA 1YI1A 2JIPA 2L18A 3TX2A 4MVJP 4PGMA 1Y98A 3WKCA 3KSAC 5IEBA 1ZR2A 4Y2VA 2ERYA 3HADA 5J5CA 4FYYA 3DONA 3OKCA 4IM7A 3PLAE 4IQ4A 1DCFA 2VP4A 1X7YB 3WLLA 1JXOA 3JYOA 5DK6A 5H5JA 3UJ3X 3F5FA 3UG6A 4WBNA 1S8FA 1F60A 1LW6E 2WVGA 4NBVA 4P4NA 3ZWMA 5KINB 1JTVA 2GS9A 1QQ7A 2JIZA 2G1UA 2QMQA 1TYCA 5BQXA 3LMKA 4TMKA 3MHTA 3KJQA 2Z3WA 3LZCA 2PAFA 4DY4A 1V8PA 4MI6A 1NPDA 3NNSA 1BG6A 2GJ8A 4RZXA 1TTTA 1IN8A 4E70A 3DAOA 2PLNA 5I7WA 1YQQA 1P0MA 1REQB 1W9MA 2N1MA 1Z45A 4EG4A 2D59A 3HI4A 4X1KA 2QPTA 3EJWA 3F90A 4JP2A 4BLUA 4MQBA 2NTEA 4YJ2B 4NP6A 3EUEA 1RPZA 4IRXA 1W0CA 2RK6A 2VPWA 3ZJUA 2R7NA 2QKYA 5FX2A 3BQ9A 2ECOA 3AFHA 4KI7A 3HSSA 4PFKA 1FYXA 4L02A 1TOAA 4DCUA 3E15A 3IESA 3D7MA 3G0CA 3AL3A 2FZGA 2HLDA 2BTOA 1YCDA 4ZRMA 4Z51A 3NYIA 2C4VA 4BMNA 1HQKA 4HNAB 5F9HA 3WQRA 1Q7GA 1C7RA 4DL9A 2HRCA 4QT0A 3TR6A 1Y6ZA 2B36A 1RYYA 4LI3X 1P17A 1II8A 3CMMA 3K0FB 4UHJA 3RF7A 1T2FA 3HCNA 1Z2OX 4ZOLB 1X87A 3RBVA 2ZS8A 4A3SA 3OJ0A 1CHNA 2ZSEA 1LPNA 3L6DA 2ZBVA 1S2NA 1G9TA 1Y5NA 3PSHA 3IT1A 4HWGA 4RETA 5IW8A 5REQB 5F51A 3ANNA 3WJAA 5IVIA 1HRDA 1PLJA 1Z28A 1ZGCA 3ZGXA 4AJPA 1B74A 1UZNA 4Q4CA 2QW8A 1AM4D 3UK0A 1G55A 1KDTA 3Q11A 4V0QA 3VH2A 4UARA 4MA4A 3TB4A 3QE3A 4WZAB 4PCAA 2M6KA 3L6EA 3COYA 4F5EA 3D3QA 2VF4X 5TQ2B 4GSKA 4C22A 2Z5FA 4H9GA 4N5IX 2BFCA 3BDAA 5KU7A 1V43A 2EWVA 4OO3A 1TW2A 2JCGA 1T5OA 1W93A