2O8NA

Crystal structure of mouse apolipoprotein a-i binding protein
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
233
Chain Sequence
b'AVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPTVLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEMPPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKGNPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ApoA-I binding protein
publication title Biochemical and Structural Characterization of Apolipoprotein A-I Binding Protein, a Novel Phosphoprotein with a Potential Role in Sperm Capacitation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 75
structure length 233
sequence length 233
ec nomenclature ec 5.1.99.6: NAD(P)H-hydrate epimerase.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03853 YjeF_N YjeF-related protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold YjeF N-terminal domain 2o8nA00
3RU3A 3RRJA 3RTBA 3RSQA 3ROGA 3RT9A 2O8NA 3RTGA 3RTDA 3K5WA 3RSSA 3RRBA 3ROEA 3RTAA 3RSGA 3RSFA 3ROZA 3RREA 3RU2A 3RS8A 3RRFA 3D3JA 1JZTA 3RS9A 3RTEA 2AX3A 3RT7A 3ROXA 3RO7A 3RTCA 2DG2A 3D3KA 3RNOA
chains in the Genus database with same CATH superfamily
4IVNA 1AUOA 5TT1A 3G0BA 1U0SY 4NLLA 1VMIA 4TQGA 4MGYR 4P3KA 3W5AA 1XZJA 1ZI9A 4MMYB 3MWJA 2GD0A 1GNPA 1WW2A 1X7ZB 2V8OA 4D41A 5A0VA 3HGTA 1X94A 2H1LA 3ZWMA 4YP1A 1JHYA 4GM1A 2HRBA 1GGNA 5EXSA 4NMMA 4CMEA 4EYGA 1Y5MA 2IDMA 1Z2CA 1Q1AA 3P19A 2AC4A 4A1OA 1W5AA 3JQAD 4NCBA 3WIVA 1MAAA 3GGGA 1KWGA 3PJDA 1VPDA 4LRSB 2BHRA 4ZZ1A 1ZKDA 2HHLA 3TQCA 2VP4A 1UPXA 4L9WA 3O9MA 5JSYA 2I1LA 3VI4B 4BHTA 5D2CA 4BUJA 1YRQA 3LUCA 2HNKA 2HPVA 1CIPA 1MIHA 3R5SA 2V6FA 3X1KA 2QVBA 1CRPA 1GRQA 2AWNA 3TBHA 1XNRB 1U4NA 1TK3A 4K9NA 5CVJA 2WVGA 4UXJA 4G1CA 4RNDB 3IFSA 1VHTA 5FOUA 4F5YA 4PLCA 1XAIA 2CFIA 3O0DA 3TFWA 2EKBA 1IXYA 3L84A 2J09A 3MFQA 1E6KA 5BUZA 3FNFA 3KUKA 3MWLA 5DLPA 2HR1A 4GLLA 4R6XA 2BTQB 2L42A 4BYMA 2J0UA 1GY8A 4A73A 5DM60 1EEXB 4Y1FA 2MCFA 4AMGA 2EW1A 1E58A 2I6SA 2ZYVX 4I14A 4DZTA 4Q24A 3BOSA 3EDOA 4AMVA 4EQZA 1SKQA 4V0QA 4Y2QA 2FPPA 1BFUA 3QVGA 1XNJA 1NKTA 1GFSA 2R1VA 3NNNA 1CUIA 4RY8A 1WPXA 3FKSD 4FGKA 1W49A 1XSEA 1AUVA 2R87A 4ZXPA 5ILQA 1QM5A 3EVBA 3TSAA 4LTMA 3A1SA 1L7OA 2G76A 3WNQA 3GUVA 4GF5A 1EG7A 1OAOA 1UPAA 3M4YA 4GP9A 3HXTA 2QE7D 3V46A 3BE5A 3M6MD 2FUEA 4EDFA 3QXHA 3TAUA 1E1NA 1JQJC 2RGEA 3DO6A 2CZGA 3PC3A 1EUCB 3FPSA 3PXBA 4MYSA 3IOYA 1PGNA 3VI3B 2Z1DA 3HI4A 4ES6A 1PTJC 3EXEB 2ANCA 2Q4TA 3UOGA 2OP1A 4ONEA 3M6AA 1QGOA 2PMBA 2VT2A 2JLBA 2WHYA 2HGZA 3KWFA 3LY8A 3Q9LA 4R9UC 2FPKA 5I9TA 5KYGA 1H4SA 4NOJA 4JA0A 4NFSA 1W0JA 3UWSA 2H29A 5DHSA 1IN7A 4KO2S 2IEZA 3TW4A 3UWDA 3VHXB 3ZS9A 3GJSA 4BMDA 1EIZA 2D7JA 1KOFA 1Z18A 2AG0A 2I6QA 4REOA 1UC9A 2G9QA 2J9FB 1DEAA 1NPTO 3H7IA 1FNSA 3A1DA 4XGNA 1BX0A 3DFUA 4B2LA 2X2OA 1LC3A 2HH9A 3FLEA 3OD1A 4X1IA 5HF5A 3QLUC 1U8YA 2PZLA 2Q2NA 1W5EA 3ELDA 1N4DA 5JUWA 5C31A 4JBIA 5JDCC 4MIKA 4CF5A 3E5MA 1KE2A 2H9AA 4O2BB 3FX2A 4DZRA 2IYSA 4JZKA 1L5NA 1FQWA 3V3KA 1NMXA 4MWTA 1V1RB 2HDHA 4KDFA 4HGRA 1AV6A 1SZDA 4P3NA 5LXTF 4EI2A 1W9MA 3C15C 2RG7A 3V1TC 1YA6A 3N8DA 3EVEA 3GLRA 2AE1A 3E5RA 3EGWA 2QS9A 1XD9A 4BASA 5DTRA 1G4UR 4WT7A 2FU5C 5JJKA 4GG1A 5H0IA 1S4QA 3RV3A 4QARA 2ZSBA 4LBYA 1U3TA 3RSSA 1P7YA 4MIEA 3DT9A 3QEOA 4YLEA 3CNQS 4AAYA 1Z74A 2G07A 2YYZA 1QNLA 3ZXIA 3E3AA 3IHTA 2ODEA 3MGKA 1W47A 3BN3A 4ZEXA 3LX8A 3WO1A 1D2AA 1XAHA 3HVUA 4MP6A 4DTCA 4D8UA 1X39A 2FEMA 3IMKA 3IVGA 5HFAA 4IIUA 1QYCA 1P7CA 4G9BA 4ZOLB 4EA6A 1QIIA 1PR4A 1VJRA 2YZMA 1M5RA 3HO6A 3DTVB 2HO4A 1OXXK 1I2CA 2P75A 2GJ4A 4H17A 4GBGA 4QXMA 1ZK2A 3VNQA 3J7TA 4K9DA 1H94A 4N1AA 4QVIA 2P9EA 1SO8A 1IB6A 4IIBA 1FRNA 4F56A 2AQHA 4IV0A 2CLLB 5FUMA 5BW4A 1WD5A 4YRFA 4AF7A 4OI2A 3LV8A 3RE1A 2IUFA 2QJTA 5LQRA 2BHNA 2DPMA 4CQNA 4QM7A 1Y7HA 2VHYA 2Q0QA 3BSYA 4IQ8A 3QE3A 3LUDA 2BM0A 1XEWY 3MWEB 5JBIA 4JWTA 3L0OA 2EATA 5EJ6A 4QUAA 5BQOA 2HC9A 4KYVA 2E85A 4BWFB 4KTVE 4DR1B 2P91A 4TQ9A 1M1XB 3DC2A 1MHTA 4O0LA 1B3BA 4AXXA 1ZD5A 3JQAA 4AKEA 4IDHA 1ZM7A 2B83A 3GRUA 4Z7JA 1ESNA 4G5SA 4BWVA 1NFRA 1X0VA 2EZUA 4L78A 5ILOA 2IZOA 3DGEC 4KAAA 4JYPA 4NJOA 1X87A 5H70A 1EVJA 1X80B 1I3CA 1N5LA 3ITDA 3H5LA 3PXCX 4G5HA 4JS0A 2UXBB 4OXQA 1NLZA 4LOHA 3KM0A 4RZQA 2AI2A 3X0DA 3UJAA 3G89A 2RFLA 1SU7A 3EPJA 1Q84A 1ZOLA 4EBFA 2VH5R 3V80A 1BW9B 3JZFA 2OHJA 4M9CA 4D4MA 4K6CA 2IIPA 2IHJA 2OFWA 1KVQA 4YI5A 3WGGA 3VR6H 4CL8A 2EKQA 2OCGA 1WO8A 1D8AA 1WVMA 2F7SA 1FUIA 1CJMA 3TUZC 4EGAA 3AVWA 1C3OB 1W6RA 2I2CA 1KJQA 1KA9H 2PBLA 2BWJA 4RKRA 4UM9D 3BE6A 4G26A 4C2AA 3JD2A 5CFOA 5F2NA 2GZHA 5LNK1 4Q19A 1WDKA 4KQ6A 1R74A 4Y7CA 2XTZA 4EOGA 5JDIA 3EC7A 4P5PA 2DY1A 4N18A 2HLHA 2CLEB 2OV2A 1EMDA 3JD0A 3H5NA 3FKSA 4W63A 2IS6A 4DLKA 3DO8A 1EFRD 4OKIA 3VFDA 3EJWA 4JKOA 1YL5A 2WDPA 1JQAA 1TM3E 3E4DA 1QVRA 5C80A 4RHYA 3FVTA 1O7JA 2QE7A 1RRGA 3IPXA 5EKSA 1T5BA 3LGXA 2GPAA 4EHFA 2C5FA 2CHUA 4YASA 5BR7A 1WP4A 4BUZA 2K7FA 1P6XA 3NALA 4MQ6A 1T2FA 1ZMBA 4C6HA 1F8UA 2WD9A 1MO6A 3A6EA 4Q15A 1NQOA 5L3VA 2G5PA 3DYIA 3ECAA 4S1PA 2O0JA 3G2PA 5BPFA 3GDGA 1HDYA 4LJRA 4N65A 3O8CA 5F1PA 3WRXA 2H9IA 4L51A 1M2JA 4A5OA 4WKNA 4DMRA 4LJ6A 3KOUA 1OWLA 1HFEL 3BIJA 2NYVA 3E9DA 3EWIA 3HKCA 3HVIA 1XEAA 3OZEA 4GHWA 4D97A 4EGSA 1B0AA 2FN7A 3ZWNA 4MW4A 4JJ4A 2ZBQA 5C5CA 2PUCA 2X5KO 3WLNA 4NMLA 1URPA 3FVWA 3EE6A 5LP6A 1U2DC 3GVXA 4GMDA 4IJUA 4IX9A 4MULA 5BN5A 2HY7A 3HDTA 3DS8A 3I9NA 2EX4A 2OD9A 4B71A 2BFCA 4P6VF 1XAGA 1GN8A 1PUJA 1QVAA 1ST3A 3OWXA 1CUFA 2HFJA 1EAYA 1LXCA 1TM4E 4C0KA 1IH8A 1TCCA 2A0WA 5TGTA 3ROKA 4DLVA 2ZRQA 3FTNA 1P5FA 2PX2A 4QLOA 4AM8A 3M1YA 3QX9A 2RGRA 3QLVA 1O95C 4MKZA 1YZ3A 1UKAA 3H9QA 4LVOA 4FS3A 4BQSA 1R6TA 1UBKS 1LWNA 3D5EA 4QNRA 4ARCA 5KJCA 3PWTA 3SICE 1BAPA 2P2DA 1PJSA 3FLBA 3HWWA 3B5JA 2HCJB 4AXBA 1QCDA 1ULHA 3OX4A 3P2IA 2OMEA 1TZ2A 2YHBA 3OM9A 5D86A 5ER9A 5I9MA 4J6FA 3KOOA 2Q4EA 5DGHA 1F5SA 2D1RA 1N34B 3H11B 2F90A 3JPWA 3T5GA 2I66A 2A58A 3RVQA 1M67A 5TT0A 1HX7A 1XX6A 3F46A 5DP2A 1NQXA 2PKWA 2OD2A 4MV6A 1LQ2A 4H9GA 4AQDA 4G0PA 5B53A 3LPMA 3OP1A 2DERA 2JLSA 1DQZA 3NT2A 4WCFC 1MGPA 1QYRA 2UZ0A 4RH1A 2FV8A 1QCZA 3VU3A 5AI8A 2OXIA 1M0WA 3G5MA 1EZ4A 4LOJA 2VP0A 1J8QA 4XM1A 1P1KA 4QNNA 3PYLA 2C9MA 4JV5B 3B1WA 1UOOA 1LY1A 1NMEA 3C6BA 4XW2A 1ODTC 3O94A 1SXJC 1XTPA 3T7DA 1DZ3A 3ZKWA 1QVWA 3DAOA 4PAQA 2EKPA 4M76B 1UDRA 4RQTA 4RTOA 5JYDA 2I2FA 4FE7A 3GZJA 1RRKA 2JBAB 2QD3A 5GIPE 2N47A 2C2BA 1YOVB 2P1ZA 3MT8A 4KWEA 2PZAA 1QGZA 3JALB 1SHKA 5IUNC 3PHLA 4PC3A 3K70B 4FOTA 4FI3C 4MHOA 4OHRA 4P36A 3LUKA 3SYKA 3TLKA 4EMSA 1QDEA 1L3BA 2RD2A 4FT4A 3LCUA 1A77A 3I3OA 4KUGA 3FUUA 1PE0A 3KTFA 3KXIA 1UC5B 3LL7A 3VZSA 1E8MA 3EH1A 4AJHA 4OHKA 4EI7A 1W59A 1V2GA 2N3ZA 2BGGA 5EI5A 3QI2A 3UMVA 2JFQA 4BFWA 4CM3A 4F6RA 1ZVVA 2AFIE 5B1YA 2YBEA 3I62A 2R6DA 4Z86A 4DLPA 3R41A 5DDIP 2FDCA 3GT0A 5FA8A 4Y2JA 5CFQA 2REBA 3H04A 5KMGB 1C9MA 1H0RA 1LA2A 1V4NA 4YCLA 1O94C 1U8XX 4UE2A 4CKWA 3OVMA 1TNDA 4HFJA 5JY6A 2LP4Y 3KHSA 3AVXA 1ODCA 2QMZA 2YJ6A 4E0BA 2R65A 1EE1A 3C8DA 4QATA 3ROEA 5CNMA 3RPEA 4D46A 5C8DA 2VWGA 2VJQA 4JKYA 5JSFA 5JZSA 2FVXA 3MW8A 4ZI5A 2ZRDA 3WSVA 1AGYA 2N75A 4OOEA 4EHJA 2AKEA 1GPYA 3KXKA 2FUNB 1B2RA 2V7VA 1YCFA 5DMXA 1DRVA 1YI8A 2LKCA 1RRFA 1RJ9A 2ZQYA 1FXUA 4FMCF 4MYCA 2PLFA 2B21A 4I4LA 3CSSA 1FUKA 1Z4KA 3AVYA 1UIRA 4G86A 4MXDA 1XHLA 2GTIA 3RG2A 2WU3A 3C8MA 1TW2A 3A2NA 4R31A 4B3DA 1FS5A 2VSYA 4QM6A 2EOAA 2QVYX 4RTNA 3KEGA 1NHWA 1LI5A 1EFRA 4QTZA 4E2YA 5IHXA 4UNNA 3GGJA 5LL6P 2QRHA 1KJNA 1N9GA 4BZQA 3EY9A 1JH9A 1U4SA 2FLKA 3U80A 1R1DA 4XQ9A 3FPHA 5AD1A 2IUYA 1SRRA 4QJ4A 1BKSB 3RM3A 4N6NA 2D1QA 1CERA 1L2TA 3A36A 4X63A 5LP6F 2WWRA 3GPDG 4XAQA 4JI3B 2OMKA 2Z9DA 3IOCA 1RBQA 4LYGA 4KXLA 2X8WA 3M5PA 4RS3A 4CKEA 5JNTA 3IT3A 3O8OB 4NY1A 2IF0A 3M81A 2EGUA 4GM0A 4OFXA 1T3HA 3IVXA 5KQLA 1DXHA 3LLUA 3AFHA 4XVCA 4P81A 3JQ7B 4NOMA 4R2LA 5A9SA 2FEPA 1E2FA 3DUWA 3K6SB 4KV7A 4J1TA 3PUZA 4CTOA 4AWBA 1JHAA 5KVCA 3Q8LA 2W4MA 2ZIAA 3DNFA 2DSNA 2PJZA 3ER6A 2X0IA 3UMJA 4BPBA 6REQA 4KN9S 3VO8A 2O57A 1RJWA 4F97A 1Z6TA 1DT5A 1J9ZA 1Z13A 2CDNA 3MHPA 4MUXA 4EG0A 4EJMA 2GHTA 1CR0A 3QPDA 3H4MA 3GT7A 2OO7A 3LPLA 4BJ6A 4H1WA 4M0FA 1P72A 2HA5A 4FGWA 4ND5A 2P9HA 2ODBA 2NSYA 2HDOA 1U90A 3F5DA 1V0JA 3IESA 4HFRA 1E4VA 2WWIA 3AH8A 3LNTA 3N70A 3DAFA 2DCUA 4MUAA 4NL4H 1OAKA 3CVJA 2Q21A 1D4ZA 3UXMA 4NCAA 4JI4B 1M66A 1NP7A 1UJNA 3HKDA 3ORRA 4M1EA 3JX9A 3KYDB 1SBNE 3V55A 3L8GA 5IULC 2GZRA 1M72A 3DZCA 3QKRA 3UWPA 3UHAA 3U4QA 1Q0ZA 4RU1A 1ZBQA 2D13A 4MCAA 4WECA 5TMDA 1OOEA 2B7CA 2BBSA 5F2OA 3ICVA 4DFDA 5IANA 3BB3A 3DDUA 1M5TA 1HM5A 2E4YA 1CS0B 4NMWA 3RWBA 2WAYA 4DYHA 3IAAA 2ZJAA 4Z4FA 4HLUC 5TS3A 3GFRA 1TMYA 5AJUA 5JXGA 1H05A 3CCCA 2P2YA 4QPZA 2FWJA 2BUBA 5JSUA 5IKXA 4EL5A 2L82A 4RM2A 5U1PA 4AIRA 1E3SA 4Z9YA 4Z7NB 1CRLA 1OWPA 2BFFA 1NW7A 1OFHA 4ND6A 1KOJA 1EDOA 3N0TA 4R8KA 3LCJA 4XDZA 2YZ7A 2ERCA 4CKBB 1MG0A 1QHGA 4ZT7A 3TLXA 2ZAMA 5SZIA 2LR0A 4OYYA 2FFAA 4FCTA 4P4SB 3G9TA 3K0BA 1ZIXA 4W1QA 1W96A 2GHQA 4GOMD 3T5MA 4BO5A 1Z0ZA 2PGIA 3U7JA 5LQCA 2O8DA 4RCZA 1B6TA 4GX1A 4EYSA 5B2ZA 3GCZA 3QFCA 1PR1A 2YZ2A 3FWKA 4C03A 1JFLA 4QKQA 2GCEA 5B3JA 1JLLA 3FIJA 2EKLA 2OYSA 4RELA 3L6EA 4UCXA 4Y9SA 4HVLA 3JZDA 3B1FA 4Q7JB 4D9CA 3OBBA 4WOKA 1WU8A 2NO1A 4NZZA 3AVTA 1CRQA 1EWKA 2XITA 4R98A 1ML3A 5DGXA 1FP4B 1DXYA 3UOAB 4EUSA 4NU6A 4KW7A 1DAPA 5LD2C 3TKLA 1KFCB 4QUBA 2FRDA 3R7AA 4PNZA 1DRUA 1T9GS 1TTQB 4ZC8A 2FZGA 3EVDA 2OQ2A 1JDBC 1UJ6A 2R8ZA 4L6AA 3QHQA 2YXPX 3HXOA 4C14A 4IDPA 4W7HA 2CK3D 1H1TA 1NVFA 2D4AA 1SUAA 5ECYA 3L6BA 2OBFA 4M0LA 2FSVA 3RASA 1SA0B 3K0AA 3N39C 4Q82A 3RLFA 4B4UA 1WUTA 1Q0HA 4LZZA 1R10A 3WGIA 3L01A 2CCJA 2QX9A 3MTQA 4PHFA 4EUHA 5MN4A 2X1VA 2BHTA 4HYQA 5AKZA 5EZSA 3LP8A 3ID6C 5EA2A 4IXNA 1GTG1 2PGAA 4DCOA 5AI6A 2WU1A 1GG8A 4WEOA 4Z4QA 3AJAA 3WOVA 3A1TA 3NATA 4UBNA 4PZUA 1DT3A 1Y8RB 2W71A 2FZ4A 1F60A 2X23A 1TDJA 3QPWA 4JGBA 5FH9A 1CE8B 3SF8B 1MO5A 4PYMA 3SR3A 3C43A 2G5CA 4FHFA 4RYDA 1TTHA 1RXUA 3LT0A 3WISA 3ZE9A 1B76A 2EFEB 2VTVA 3HJAA 3IPYA 1E2BA 5C2JB 2NZXA 3AR7A 3KLMX 1PR3A 2GN1A 2NU6B 1OI3A 3KEFA 2BBWA 5F1OA 4Q4HB 4AJKA 4M49A 2WQZA 4HZUA 4C7MA 3ZJVA 2A1TS 3BMNB 5HE8A 4K6HA 3OIYA 5JIBA 2XNHA 1SK8A 1YT5A 3AUSA 1NVVQ 3NXKA 4BX9A 2VP6A 2RG1A 1KYWA 4Z2YA 2NTEA 2ZYTX 3GEPA 3OT1A 4JJAA 3U31A 3ZY4A 4ALIA 4F60A 2C7RA 1YB2A 5M34A 4PYRA 4B5KA 4TXHA 1GZ7A 1TYCA 1N7HA 1YGPA 1SKYE 1ZEMA 4NNPA 2DY0A 3RS3A 1V7ZA 4OATA 4PSUA 1KU6A 2Y1CA 3BIXA 3ZJ5A 1NBMD 1P4GA 2J07A 1N2XA 4MNTA 3SE0A 2ZJ5A 5E6SA 3R9XA 2RH4A 1KI9A 1TF5A 3W34A 1B16A 1TUBA 2RC5A 5AUPB 2CNNA 5CG2A 4KOEC 4HXEB 1DBIA 1EQ2A 4B79A 1HDOA 2L17A 1FDTA 3FPAA 5KNDH 1KH3A 3QFHA 1Z8DA 1BJTA 3COJA 5JWHA 2TMYA 5WRFA 1R64A 2CMHA 2HRRA 5CYPA 3ETDA 4WD3A 2EBFX 3P2MA 2OHIA 3KCNA 4QXAA 4C4SA 1SXHA 2YHIA 1ICIA 5IF3A 2HHHB 4OSOA 2BGTA 5CP8A 3OURA 3NH6A 5HRCA 5TXGA 5ER6A 1X1SA 4FYIA 4MUNA 4X3OA 4Y6GB 3WB9A 4XYGA 1VKOA 1BX1A 2ZRBA 4IYJA 2GAOA 3HUDA 3KB6A 1RRPA 2XTNA 4TUYA 1P33A 2H54A 1RI2A 4II7A 4NJMB 4I3GA 1GQSA 3NTUA 3JYQA 4WK4B 3OZXA 5TS2A 4DT1A 2VKTA 3QEBZ 1G21A 1Z4NA 1QVVA 4XWGA 3WBFA 1XPOA 3THXB 1MZPA 2PS0A 1V11B 2KLBA 4CMGA 4RIEA 5G2OA 4CEIA 2VK8A 4P32A 1G38A 1FU7A 2EXXA 1M34B 3TGWA 3TPZA 3OF2A 1I6KA 2IYFA 3AEYA 3UJ6A 2QD1A 3UM9A 1WXQA 2PZMA 4WIAA 1F1JA 1VL2A 2JH8A 3DZKA 3VH1A 2QMHA 1LK7A 1XWFA 4EGFA 5HUQA 2DX7A 4DMHA 2JAXA 5G0SA 3T9FA 3V4RA 4FFRA 3ZD6A 3GAMA 4WNAA 4CWAA 2INGX 5J4HA 4IVPA 4Y0NA 2R25B 4DV3B 5EJMA 2AWOA 2MSEB 4IMPA 4BCCA 2QG4A 3OWOA 1BQ3A 3V5NA 3HABA 4KH1A 2J9RA 4EI9A 4I55A 5BWMA 1IQ0A 1NW5A 2VWPA 4QQFA 4BNMA 5KKNB 4JJGA 2XVAA 3EXHA 2PRZA 3GGDA 5JR3A 4R9SA 4CRWB 3OTHA 3ZI7A 2MSWA 1GR1A 2WC1A 5TMBA 2WJZB 1CQIB 4B3CA 3GXOA 3A27A 5KOHB 2VUSA 4RY2A 3NJRA 5IMBA 2ZE8A 5IVDA 1NF9A 3LZCA 4JEMA 5AW7A 2WSMA 5IBCA 3SAJA 3X1ZA 3PF8A 4EFKA 1F6DA 4LJSA 4N9WA 5F52A 4KQ1A 1X7WA 3CNOA 3V32A 4N5DA 2TYSB 2BKVA 1ZINA 2HWXA 4I3FA 4M36A 3MILA 3WYCA 2FLVA 5DYWA 1BGWA 4HDRA 4OUDA 1KZGB 3H05A 3UGQA 4KR6A 1DHRA 1DXQA 1M1NA 2EJTA 2IPNA 2ON6A 3N8GA 3TI7A 2OZEA 3EWSA 3HJNA 3UOWA 1Z6YA 1GJRA 2X2FA 5KOYA 3I5UA 3RIGA 4EDHA 2JD1A 4L5AA 4JYZA 1ZVQA 3NDRA 4I4NA 4M7OA 1BXGA 1BDBA 3A3KA 1C7EA 1U8CB 2Q3JA 5CB8A 2X3YA 1LVGA 2QRLA 5DTQA 4Q37A 1LBTA 1ZXBA 1DPFA 2C9DA 1JHQA 2PG3A 3CZ9A 2I22A 3EQ6A 3OY7A 3P9CA 1BRTA 4NATA 2QAIA 1IEVA 2PUWA 3JARA 1DE0A 1RCFA 1XALA 1KP3A 2ZRPA 3K1YA 4RTKA 1C1HA 1CUUA 2DTEA 2P78A 1OLUA 4FMBB 2HLDA 4Y0AA 1V9LA 4N5MA 1UWCA 3QE0A 4LWOA 1GUFA 5CX1B 5CK4A 4L2IB 4Z3KA 2CK3A 2JGIA 3GVCA 3EZ9A 3C8ZA 2RGNC 4F2GA 4JP1A 4D0RA 2I1WA 5E8RA 4I3HA 3S1LA 3TRIA 1BQ4A 4YCJA 2PMCA 2WYUA 1JDSA 3F97A 1ECFA 2R9VA 4IOKA 5U4QA 1RD4A 1YMQA 2PA3A 4P7KA 1QP8A 2X41A 5ESDA 4ENPA 2MOKA 3F6CA 4RGYA 4O1IA 4P92A 1WL8A 2P9YA 2CNLA 1N1EA 2ZAGA 4J1SA 1RPNA 3GLHE 3G2QA 3RFFA 4V38A 5HDBB 1OV4A 4JAVC 1VKHA 1NW8A 1CNMA 4DVJA 1PWYE 1VECA 4GI5A 5EKDA 5F98A 3UV6A 5B4TA 3OPNA 5JW6A 1FSZA 1JU9A 3TD6A 2J32A 1Y8CA 3SZMA 3EZLA 1G1AA 3A0UA 3KOXA 3K53A 2QN6A 2FAXA 2BGIA 2WF9A 2WSSA 4YCDA 1N2SA 5H9VA 3RWMB 3RT1A 4BQRA 1GU7A 3ME5A 3O74A 5E9WA 2Y6VA 1IBLB 3TR6A 4I50B 4INPA 3RYFB 2B4QA 1ZG3A 4L27A 5EZYB 4PXSA 4FLMA 4F4DA 2IS2A 1T3GA 4B7UA 2E18A 4C43A 5FHQA 3LPCA 4OMCA 3G2IA 4HX9A 3CKLA 3TF5A 5CH5A 2IHVA 2M32A 3F6SA 4JZYA 4LNAA 3ZDYB 4TUYF 4IZ6A 1NBMA 2AUNA 3JQGB 3LP5A 4K46A 1TQ8A 2Q6VA 3QOWA 5EWLB 4E5VA 4YMLA 1WBDA 4OFWA 1Q0QA 3SZGA 2GF2A 1NJFA 3KS9A 3DMDA 1OROA 3OP4A 5KQRA 5JJIA 1WABA 3OHPA 5L53A 1RKQA 3L41A 3PUIA 4HATA 3FF1A 2O2CA 3AV3A 4AJEA 1J0EA 1M1UA 3LJKA 4P93A 1JSLA 4W6QA 1U99A 3RVJA 1JKXA 3S7TA 3AVOA 4KG7A 4PCVA 3UCXA 1VP3A 2AI3A 1O3YA 2F43A 1MX5A 2P1RA 2XBUA 5H8WA 1YR6A 3D0OA 2D5BA 1OV6A 2RHLA 1GVNB 5JEDA 4XQEA 5SY9A 4NV3A 3B6EA 4RQUA 1I4EB 4I55F 3HUUA 3FNEA 2HJHA 1PG5A 5D85A 5H02A 2QLTA 4X1YB 3OFJA 3PE6A 1SEVA 4G5XA 4GR5A 4CMEC 1U0EA 3AHDA 3HU3A 3EOBI 4WGFA 4YO7A 3PC7A 1MDFA 3C5VA 3HSSA 2OC9A 3F71A 3TLZA 4BTEA 4E7PA 4POOA 5JH7B 4KX3A 4TLMB 1YJ8A 5AKXA 3UT6A 4XIGS 3FBWA 3UXHA 5L95A 1N2GA 2ODPA 5DBGA 2RIRA 1QYVA 3JQEA 1UQTA 1ZK0A 3EFOB 1SBYA 4OSPA 2VK1A 5AHRA 4WLOA 4HDMB 3VVBA 4B81A 4D0NA 3DOHA 3IDOA 3DEAA 1ICEA 1MQ8B 3OSUA 4JBXA 5BSUA 3ZI0A 4DIEA 3A4TA 2ORWA 4M46A 4LSGA 4BQNA 3EVAA 4LJ8A 1TI7A 2PKEA 2HWWA 1QGUB 2DPYA 1N8NA 1HK7A 1IIBA 2PZGA 4IOJA 3THOA 2DTXA 3FAKA 3GG2A 1U8TA 3C1TA 4JY7A 4A91A 5JAUA 3D3NA 4M9QA 3KDSE 3DL2A 2RBGA 3DDNA 3L02A 4POAA 8ADHA 1FFWA 4F1KA 2PD4A 2RHGB 2JG3A 2H0QA 1HTTA 5TQ0A 3P9SA 2ZJ8A 3GJ4A 2RI1A 1XFDA 4A9AA 2H48A 4BGDA 2GAJA 1UDCA 3GJ6A 1XZMA 2WJWA 1IPEA 2JEYA 1I0ZA 2LD4A 3ZV3A 1XRNA 1SG9A 2PR2A 4JUIA 4LS3A 5TPWA 4HQ0A 1FYXA 1G63A 4WOPA 1NUPA 2KMLA 1ESEA 5L6LB 4DLNA 1OAOC 3LECA 3TQFA 1IHYA 1RYYA 2FFRA 4L07A 2IKQA 2BLNA 2AX3A 5JZBA 1TZKA 5M5BA 4MHSA 2BEKA 3W1VA 4KGDA 2YNMD 4XLTA 1WDWB 4OYRA 5GJCA 1N33B 2FN4A 2QROA 2ZI5A 2YY5A 4M22A 1KSHA 3PEEA 1BMDA 2GR9A 2W6OA 4QREA 4KE9A 1NQ5A 2QTVA 3SJCA 1KYYA 5LUAA 4KR7A 4J76A 5IDVA 1YRAA 2HNBA 3ISTA 4IIVA 1ADJA 1T5TA 1ZHHA 3BHJA 3SYMA 4A2PA 5H3HA 1XTSA 1FMCA 4BLTA 1Y8ZA 1DVRA 1N5IA 2E5FA 4BIIA 1LEHA 1IOZA 3SR4A 4FIDA 2E3JA 2LTAA 3O8LA 2X9VA 1D1PA 2DBYA 1JJBA 3VHQA 3HXPA 1OGIA 1FJHA 3U7HB 1DJLA 1LNSA 2XZTA 3ABRB 1JFFA 2AEFA 5A3JA 5KOHA 3NKVA 4L5JA 3FCAA 4GL4A 2GI4A 2VXBA 3SVLA 3H6KA 1MORA 3PNQA 3OJEA 3EQZA 4RFSB 3ZEIA 5B58C 3FDJA 4ALLA 1M0EA 4IINA 4EB3A 4KWCA 1ZVKA 3QV1A 4M1MA 4MRMB 4IX1A 3TNYA 3C6YA 2QPAA 1PYGA 4LUCA 2HIMA 2XMDA 4MTCA 4CM9D 4CHTA 4OREX 4W82A 3OO1A 5BSRA 3TTUA 4PRKA 3EXIA 3UAXA 3INTA 2XCRB 4XQCA 3K1AA 1I3NA 2ZB3A 2QWXA 3ITEA 4K03A 1DJOA 1Z4JA 3S68A 4D3ZA 5AM1A 3PQ8A 4FUQA 5EVJA 1U63A 3DF9A 3UK2A 3F6YA 2M1XA 2GARA 3RH0A 2G9NA 4OJMX 5KAMA 5CR9A 5FPYA 3VOTA 2XUOA 3CF4G 3QVTA 5BQPA 1P44A 3R7DA 5JNWA 1KI6A 4OB6A 5F3DA 2IK8A 5DPMA 2N42A 1WZEA 1XELA 1N2CA 3KELA 3ZZTA 3GXBA 1FJGB 3SSOA 4BMNA 1PEAA 2FCAA 2QVCA 5F77A 3ZV7A 1HKHA 5FHRA 1FRFS 3N53A 4GFDA 4YR9A 3H0EA 1TZMA 4MR9B 1JEQB 3IIMA 5D6NA 2OCIA 3PL1A 3ZQ6A 1J33A 1J8MF 2IT1A 4KFTA 4HDNB 5FV4A 1PJZA 5IZCA 4FSHA 1PFQA 3MTDA 2IUEA 2ZT8A 1O4VA 3GZNA 4JLBA 5ALMA 4OP2A 4BNLA 4WL0A 3PJRA 4LZLA 3PBKA 3C3JA 1NSFA 1RZ3A 3CIFA 3D43A 3PYXA 1EWYA 3KQMA 3MOSA 3L4BA 3DOCA 2NN3C 5GOZA 3C3DA 2AUMA 1XPRA 1HFKA 2PY6A 4G09A 5K0EA 1QH1B 2FPXA 2O50A 2VF7A 2O20A 3AEZA 1FLVA 1FDOA 4GICA 3MF4A 3REOA 5IAKA 2FPGA 4JJKA 1AZSC 3OICA 1XZHA 1UDBA 4YVFA 2AF4C 3HXLA 2PYZA 3NFYA 4WKBA 3O2SB 1JB1A 4YRQA 3OCJA 1Q16A 1IEQA 1HT1E 2HWUA 1CUBA 3K73O 3EBLA 4J29A 2ZTHA 4QIHA 4U2BA 2B4AA 3SXJA 4QLAA 4CMBA 2GFIA 4YLGA 3OPMA 1Y98A 1WULS 2F1KA 3EZFA 3QY9A 4WXEA 4D99A 5IF9A 1QU2A 1KZ6A 3TQSA 1I8TA 2KWIA 3EEQA 1ZGAA 4XYLA 2QR2A 1FIUA 2R8YA 2UVPB 1AQNA 2EP5A 4UUAA 3REQB 4WK0B 1BCRA 3HUTA 3MJFA 3PFKA 3QVUA 4QOJA 4QBKA 4GOKA 1F12A 4P58A 5U9CA 4HDSB 5I4BA 2BMAA 2LKDA 2FPSA 3WXMA 5HBRA 1YQTA 4W7IA 4GX2A 4D5GA 1L3CA 3SBOA 3THWB 4O3FA 1OH7A 5F5XA 3KHTA 1DQYA 5T3UA 2G17A 4F1WA 3HKEA 4YLYA 1UFQA 1K92A 3CX7A 5EQDA 2PXAA 4LY3A 2ZJ3A 1U8EA 4FFDA 2O52A 2Z6QA 1DTWB 5JC1A 2POCA 3C6KA 4JKIA 5CYOA 1S2IA 3TVTA 4EW3A 3HTXA 3CCBA 5T4HA 1UM8A 1ZJJA 4ESHA 4Y0VA 5JDIC 1LBHA 3DMGA 1TO1E 2VZ0A 2CVOA 3Q88A 1EFPA 4V03A 3QNWA 4AJOA 1KMQA 1FBNA 3CEAA 5G4LA 2PUEA 5AHOA 3CR8A 3T7KA 1NV8A 2UDPA 3I04M 4PBRA 3K71B 1VA4A 3FDZB 1A2QA 3UAYA 5AW4A 4ZYWA 3EASA 3VQTA 1JRLA 5LSAA 4RPJA 3HLTA 3TX6A 3QPUA 3E3OA 3X1XA 2OHHA 4NOLA 3LOPA 1ISPA 1Q7TA 3CX3A 3SYNA 4JA2A 4H7PA 1NYLA 5K0FA 3DQQA 5EHQA 2GILA 3L04A 2AUTA 1ISHA 2PMDA 2YNMA 3IT1A 3ORYA 4UOEA 1FFBA 1X1RA 2PRSA 2ZLBA 3CEPB 4S0ZA 1G8MA 1GKYA 2BDTA 2F62A 2XQJA 4TMFA 1AK2A 2EFJA 1RCTE 4FW8A 2MJLA 3QEMB 3Q7EA 4S1TA 1YZHA 3P4UA 3GDWA 5EMKA 3WRXC 1U5BB 4L3VA 3PWZA 1ZJ5A 3V4ZA 5BVGA 3B5IA 1F3LA 5D3ZA 2J9GA 3R0VA 3AESB 4IJ5A 4H1HA 3M4JA 3K9FC 3MGBA 3D2LA 2EF0A 4QD3A 1IN6A 2AB0A 1D0SA 3O2JA 4A16A 1W48A 3LH5A 3P52A 1YULA 2CFSA 1RI3A 2IEYA 2GJSA 3ORQA 1ZH8A 4IGEA 4IIXA 5LP6C 2FSPA 4G23A 1E18A 4EARA 2P3LA 1VMAA 5I47A 5THKA 3A9VA 4EG7A 1UJCA 1VKZA 3CPEA 3G9ZA 3MWYW 1F8GA 5KC9A 3IHWA 1MRZA 3G59A 2AG8A 4DXHA 1Z0UA 2ECFA 1F20A 4HWTA 4Y2UA 1SU6A 3KSMA 2ZU6A 4QTUB 4YRZA 5JCJD 4YGXB 4CM9A 1UXIA 5HDQA 4LE0A 3SK0A 1PTKA 3FNHA 1E2JA 4XIIA 1OXMA 3AF2A 1GQFA 1LBSA 1WB5A 2EHDA 1SXJE 2FP4B 5ARDA 4EEZA 4QHTA 2EFDB 1EKXA 2NAPA 3FGPA 4AG5A 4EVRA 3AERA 1VPVA 5ELLA 2PSHA 3HYTA 4Q4JB 3VNVA 1L6RA 3LVQE 2H7XA 1ZD8A 1JDZA 3L9XA 4UNIA 3E53A 1QFZA 5F1YA 3OTQA 1RQNA 5LQKA 1SXQA 2CCGA 4KNYA 1P2SA 4KQFA 5IAOA 2WIKA 3PQCA 1XXHA 4QHYA 3K31A 4UZEA 4XIJA 4P22A 5KVQA 3L0IB 2ZM6B 1NUQA 1UBJS 1YB7A 3AM5A 3EZ7A 4UAVA 5HQJA 3SIWA 3WWZA 2QUIA 4NE7A 3BWYA 2BZ0A 4NECA 4BV8A 5IVPA 2GRJA 1UBUS 1ANKA 1YQXA 1L7XA 4AK9A 3RVMA 2GESA 2J9XB 4YJ3A 2IEDA 3QUQA 2OBYA 4IGIA 3OFVA 4QJBA 4UBOA 3ONEA 3RK4A 3I2YX 1J2UA 2Z58A 2L2QA 3QIVA 3CXUA 2FX3A 2J0EA 3ANLA 4FE3A 2ZWPA 4MX8A 5IT4A 1EDBA 4MV7A 1I2ZA 1R8JA 1QO9A 4N0PA 1DX9A 3U9LA 2XCOA 1W46A 2E1RA 3SLKA 1XRMA 2OPBA 3QFTA 3TSZA 1OR8A 3OF3A 4X94A 2JAHA 1M7HA 1DAGA 1BHQ1 4Q1BA 2G4CA 2IQ5A 1WV1A 4C6RA 4XM2A 5L7YA 3HCEA 2FOIA 2EARA 1EG2A 1VHQA 2GWRA 2VC2B 4MUFA 4LRXA 1DLJA 2AKAB 4AZVA 4TYYA 3ZHTA 3DOFA 3IAEA 3KDAA 1AKRA 2ZIXA 4GLFA 3UUWA 3G5UA 4RWZA 2W90A 3H5OA 4MW6A 5L51A 4ND2A 3UMRA 1RXYA 3DZFA 3HLYA 4W5TA 4ZCQA 4X64B 1T10A 5AVRA 3B3GA 1TVKB 1CY2A 4OG2A 2IU6A 3WV5A 3RAJA 1XTTA 2GEUA 2WICA 3V4FA 1K88A 4MW7A 4R7GA 1TLFA 4EF4A 4Z4IA 2IBTA 3HL0A 1CEQA 5D3KA 5G53C 1TGVA 3GDHA 3SHWA 2F55A 3UMGA 1PFWA 3NM5A 5EIXA 2FW7A 5GTDA 3N3BC 1YK0A 3F74A 1Z63A 4A27A 5CLGA 1NVDA 4MROA 3E7FA 1O1YA 1QHYA 4LYFA 4D6PA 3RIEA 3H18A 1ENOA 1U2EA 3PCTA 2SNIE 3CA8A 1O08A 1QK5A 2H1IA 1HQKA 2W6CX 4YJHA 2XKAA 3BJZA 3VR4D 2FXIA 2E4UA 4B6EA 3GZTB 4RHUA 4QODA 1DIGA 2C99A 1V43A 4G0XA 5DHUA 4E2WA 1XVVA 3L7LA 4EW1A 1VHLA 2O54A 1KMCA 1K3TA 3NYQA 5KNCH 3OIDA 2GK6A 1ECJA 1QJCA 1YACA 1Z28A 4P0TA 1EE2A 2ZGVA 5DLYA 2XDYA 4LG1A 4DMGA 4D25A 1A7JA 4BEJA 5A1TA 4FONA 5LMZA 2FUG1 3ZWBA 2ODNA 4NQRA 2Y68A 4U7DA 1T5DX 4F9TA 3OMXA 4E14A 4YRRA 1A5ZA 2V7TA 2HB6A 5IJXA 1KY2A 2XA9A 3T4EA 4F3YA 4G01B 4YRCA 1WPGA 4G65A 1V35A 5K4AA 2DC1A 4UPEA 2ZZKA 4D9IA 1JF8A 2PUBA 2VQSA 1ECBA 1XTBA 5IMSA 3I6YA 3RC8A 3E9NA 3KHUA 2NZYA 2ZXFA 5CEJA 1QFSA 3W5CA 1FFGA 2FGKA 3VDRA 1P7ZA 2DKFA 3NHYA 1M7GA 2IUTA 4LVCA 1KNXA 3AY3A 5G40A 3A06A 1MIOA 3RUAA 2QL9A 4LN1A 1YAJA 5AXBA 4BVJA 1KR5A 1EJ0A 3R6GA 4QRIA 4RK7A 1CQXA 4RESA 4ZA2A 4ID9A 5FPHA 3AWIA 4P98A 3O75A 2VP9A 2H07A 5K0NA 2VDOB 1IOLA 1WCV1 1HLFA 5LB4A 4RKFA 1T5IA 1L8LA 5FYQA 1S1CA 2Y76A 3VYSB 4KPEC 3RVNA 1I9CA 3M6WA 1NL3A 1XVIA 5BR8B 4ZVQA 3N2IA 1SHLA 3R7FA 1WHTA 3IDQA 1UWKA 3U49A 3ZX4A 2GNOA 1B8PA 5EIOA 3GVPA 1BDHA 1C80A 2QSYA 4Y1RB 3BD9A 2YY7A 5GGXA 4RULA 1GA4A 2VRNA 3FF4A 3G1WA 3O93A 5F5LA 5JCJA 1EK2A 1XCGB 1J6UA 3OQVA 1QWSA 4CQJA 2V6GA 4D6YA 1RLIA 5A4FS 4WASA 3QQPA 2JBHA 1P5JA 5HWSA 3CS3A 2R6JA 4XPZA 1A8QA 1YQWA 2CLHB 4DWOA 1AE1A 2QAGC 2QG9A 3D3JA 3KZOA 3RYIA 3X2EA 3QX3A 2B4RO 2PIAA 3FD8A 4EA8A 4YJ3F 3IQDB 5CM2Z 4AIIA 4KQMA 2PBZA 2XB9A 4FXOA 4MLPA 1ECPA 1G3QA 4HZGA 1P0IA 3RNOA 2ZBFA 2CVPA 3P9IA 2ILTA 3N6RA 3EEIA 3L4SO 2Z56A 4LNUA 4LF7B 4JFAA 1QC5B 3M7IA 4G07A 4GR9A 4X85A 4YP0A 3C5HA 1U1GA 3M70A 4INOA 2NUBA 1M9NA 3RVRA 6AT1A 2OG1A 4BFZA 3RS5A 5JS8A 1Z5VA 1A5BB 4JK3A 1HPLA 1A3CA 4RK0A 1LBQA 4HWPA 3A4LA 4IV8A 2P9CA 1EDDA 1NSTA 2B78A 3C6MA 2ZBGA 2P79A 1GGMA 2P69A 2YFYA 4JP3A 2JAWA 1PNOA 3OOSA 4EB6B 1R5BA 2BFBA 2BJVA 2XYHA 1JT2A 1OWOA 5ADWA 2RHBA 4O29A 5K0ZA 2WFLB 2D2FA 2EZ4A 3I92A 3OJFA 5B3JC 4YRIA 2BP7A 3CPJB 1NE7A 1MB2A 1C8KA 3SKVA 1NLYA 3F3MA 1W8IA 2QMEA 3DR3A 3BWEA 3WL4A 4L8LA 1ZDMA 1Y7TA 1E2LA 3P45A 4UM7A 3IR7A 5ED0A 4DJTA 3CT4A 1C2TA 2WLTA 4PLHA 5A06A 1R6UA 2J59A 3OQIA 4HGOA 2R79A 4ODIA 1WMAA 2FRDC 4L08A 1HFWA 4BECA 3RANA 1SUIA 3A4MA 1KE1A 3C6QA 5KX5B 3GLIA 1U2PA 2J45A 1DHTA 1E7RA 3R0IA 3BTOA 4N3NA 2V3WA 2XUPA 3SP1A 3VNBA 1I4OA 5SV2A 4CHGA 3HCPA 1RWOA 1P91A 3IAM6 1FW8A 1SBHA 1KMIY 1L5FA 2C5SA 2QW0X 3RIHA 1SBQA 4CCYA 5D5HA 1L3IA 2FSVC 4HYYA 4TKUA 5IS2A 1OBVA 2HBYA 4GLBA 3MPOA 4WESA 5HM8A 1CY8A 3BJRA 4DC1A 3BTVA 3O8RA 5KB3A 2V4MA 4AT1A 3AR8A 4IZIA 3WL5A 3DKIA 2I78A 3BFXA 1G0NA 3KQQA 4TV8B 3WO0A 4PN3A 2WUEA 4P35A 1MENA 2OVBA 2FPIA 2HZBA 1VSVA 4RVNA 3DCYA 3PFFA 3FPEA 5TQ2A 2LW7A 3K5PA 1CDOA 4X00A 5AOCA 2GD6A 2QTNA 3OCUA 3PRKE 3INGA 4BL5A 5FDFA 2VQEB 1C3EA 2P90A 2HQ1A 1Y6ZA 3AU9A 2VZEA 3QX7A 2HQOA 3QWFA 5C81A 5D7BA 4Y6OA 1NX6A 4NX2A 5AVUA 4R71A 2HA7A 3OIGA 3VR4A 3KP1A 4YV2A 3MSXA 1FDRA 4ZMRA 1JHZA 4JBNA 3O73A 3WMGA 3VAYA 5LQUA 3M2TA 2DQZA 1NIPA 4K1LA 4ECAA 1UXOA 1COZA 4H1TA 4ALKA 2IL1A 1DL5A 3DKVA 1DRWA 3QVLA 4EFNA 4P86A 1GUYA 1PVVA 1EHCA 1Y9EA 2G0AA 2I80A 3V2UA 4WINA 4PRYA 4XIFA 3URMA 4AKGA 1H3NA 4I6EA 1FDIA 2M98A 4CR8A 1VCHA 2BEVB 5TQJA 5IT9A 2RGBA 3CU5A 3U1TA 2HV9A 4B6GA 2OORA 1G6OA 3AUTA 3MXOA 4HS9A 2CHFA 5KYNA 2ZDQA 2VG8A 2R5NA 4M0PA 4YRBA 2Q46A 3M49A 3SF0A 3ZPXA 5HJEA 3RYHA 4MVJG 2D1YA 1THGA 4ENRA 5JEEA 1HE3A 3E1SA 4DMUB 3PQDA 3CX4A 1NBOA 3R7BA 2OGWA 4B6RA 1WDLA 4KL8S 4X8MA 1A4IA 1VYHA 2VDNB 3FZQA 1FP1D 3LFUA 1YB1A 1J8VA 3H9GA 3BRSA 2L19A 2NU7B 4IQGA 3PIRA 2WUWE 1E66A 2V7EA 3BH7A 3C3MA 4PHCA 5IYZA 3I0MA 3PLRA 1VJ0A 3GPBA 5D6OA 5EUMA 4C4TA 3JWEA 3LPNA 3TZEA 4RANA 4UM8B 4YJGA 3FNQA 3LRTA 1G3MA 2KS6A 4BO0A 3T1VA 5H82A 4UU7A 3AI7A 4LOAA 3KUUA 4LZOA 3J7AC 2PNJA 3JQ6A 4RPLA 4PHGA 5TSDA 2G0NA 3K4HA 2W5UA 3KEMA 5H80A 1BGVA 2TRSB 3VHLB 1G8FA 3RSZA 4ANFA 1TU0A 1KVUA 1RWPA 2ZITA 3CZ4A 1BDJA 4D4HA 3JQ8A 5SZKB 1N6RA 3CF2A 1KPIA 1P2UA 2ONJA 4PPYA 1T35A 2O0HA 2WG0A 2AZXA 3OZIA 3EXHC 4Q3KA 4C1BA 1FSFA 3F9CA 4B31A 4EVIA 4O08A 4M60A 2XI4A 4TTAA 2YRWA 5AW0A 5FRDA 3I9LA 1P39A 3JVVA 3KIPA 2OSVA 3TTWA 2PE5A 2FG6C 1QBKC 2V6BA 3KT6A 1TQ6A 1Y5RA 3M5DA 3OPYA 5DHQA 1OXSC 1OBOA 2HEGA 2Q49A 1GQRA 1K4YA 1LF5A 2X58A 3I23A 3K9QO 3L0YA 4RNCA 3S70A 1JXMA 4IR7A 4MUYA 3VNRA 2O3SA 2WG1A 2HXYA 2PM8A 3H75A 3C4VA 5DRYA 3L7KA 3UJ7A 1LX6A 2QD5A 4NK4A 1AZLA 2NSDA 3R3WA 2OXTA 3RHSA 5FA6A 1Z0FA 5D84A 2YKGA 3EOAI 5DLDA 4C7OB 3HBNA 2X8JB 1SOAA 4Y2PA 4GX5A 3UUEA 2JFFA 3CW2A 3LC7O 3U81A 5DNYB 3N2KA 3IE0A 3QUTA 4DN6A 5K4GA 4N5NA 1K6EA 5LQSA 4GZ5A 3RRFA 2VDKB 3KWJA 3TE7A 4YV7A 1GFIA 4MITA 1H2XA 1NM5A 4WNIA 1UT5A 4BZXA 4DCVA 1NC1A 4HNVA 1EVIA 1TAGA 2JIMA 3H9CA 1SOMA 1XQ6A 3GNQA 3IQGX 3K6RA 1ZA2A 5DOZA 3ZBPA 1JG4A 4MWSA 4XUGB 2XDQB 5KTSA 4M7WA 3VZPA 1ORWA 2Z1MA 1THZA 4W9NA 1VBFA 2KPOA 1G291 5B7NA 2BFNA 5DN9A 5ED4A 2RH8A 3T1TA 3ZIDA 4KGVA 2O8EB 1O2DA 1ZCJA 4DWWA 4YQFA 2WM9B 4O2LA 1CUWA 1PRYA 3U7QA 1ZGCA 1XDZA 4WFJA 2JCXA 1BD4A 1TCBA 4LXTA 3SVTA 1EDEA 1GNQA 2FX2A 5DWVA 5A2GA 2Q0HA 2CJYA 2PGOA 3U7IA 1AMNA 2ZROA 1U9IA 3OZ7A 4GBJA 3W9BA 2FPRA 1BEUB 4O4HB 2CJWB 2XCLA 1JTEA 3ZDCA 3A6JA 3HWRA 5EKXA 1FX0B 2UYYA 3ZIAA 1KI1A 1TLTA 5IAJA 3SEQA 1LPNA 3C3EA 4LDJA 1VL1A 2E1PA 3FMOB 4Z0NA 1RYBA 4OHWA 1N75A 4X1KA 2GRUA 5C1DA 3UJCA 1YQQA 4WMLA 4HX2A 1J49A 1C1YA 2JCBA 1O57A 3OOWA 3T9AA 5L3QA 1T0JB 2VSOA 3MJ4A 4LVUA 4UMEA 1YDHA 1XU9A 2I54A 3R76A 3FCCA 3TOSA 3K96A 1TYDE 1P0QA 3HY6A 4TOIA 1E9VA 1S7GA 2R47A 3RVSA 1TJPB 4JIGA 3M3DA 5TNXA 2C84A 2Q3CA 3QEKA 5CDUA 4TKMA 1N2ZA 5ES3A 1LPOA 3UICA 2ZR8A 1L7EA 4EVSA 5MFPA 4DGSA 4WOJA 5E6RA 3CH4B 4EG3A 3AJRA 1Z88A 2H59A 1KEEB 1AA9A 1AUQA 2P40A 3HG7A 2CXQA 5CFRA 3FFBA 1XTIA 4M87A 5KBYA 5IYZF 2VDRB 4BNDA 1QE3A 5JXWA 4WCDA 4MS4B 3KVNA 1I14A 3T5BA 1NVXQ 2V97A 2JFUA 1D4FA 1H2RS 4IWNA 1WZCA 1YJBA 3L8CA 4IL5A 1U7OA 4XPIB 1JPUA 2R6CA 1XYYA 1ORIA 3V7WA 4CMCA 3T52A 2ZRHA 1WXEA 1X2BA 2NTJA 4ARVA 1GAJA 1PT7A 1W30A 3PNMA 5GINE 3AF1A 3WQHA 3BXFA 1B14A 4E5DA 1VLVA 2Z9CA 1KS2A 4PZEA 3RYCA 5K3FA 2FSFA 3Q8XB 2HCBA 4FFBB 1RAGA 1FTGA 1A0OA 3LT4A 2ZAYA 4F5EA 3RRJA 2OCKA 1H8HD 1XVAA 2DBRA 3GV0A 4J4TA 1NXQA 4FNOA 3DFKA 4FZ5A 1GAWA 2ASVA 1T43A 3UJ3X 4M0MA 2FZCA 2IXFA 2F1RA 2C4HA 2ZSDA 2V54A 1WCWA 2NWQA 3Q3CA 4UASA 5E0OA 4YRKA 4Z2AA 2AMYA 3B3JA 121PA 3CRNA 3KO8A 4Q5IA 2E49A 3FRHA 3ILXA 1EZ1A 3NDJA 3F9IA 4Q9IA 3U2QA 1XNQB 2JJ1D 4XJVA 3TDNA 3A14A 5FV7A 1T8RA 2HBRA 1MVOA 4KPUA 2Q4DA 1PLKA 1Z0KA 4GRAA 2YHAA 4XVHA 4YRNA 2JD2A 5LDDC 4W4TA 1JBQA 2Q4BA 5DKFA 4MGKR 1EGVB 3ICOA 5ANRB 1LQUA 4BOYA 5BNZA 2HU8A 2GJKA 1PWXA 4INZA 1T5HX 5HQ3A 4A8TA 4WDRA 1QK3A 3SJ7A 3X1DA 1PVOA 3CR3C 4EG6A 2JBWA 4HD8A 3KTOA 4X6XA 4WCVA 2N0SA 1JHXA 4AMZA 4NU5A 1T0UA 1KGSA 2A6PA 4K9QA 2XQKA 4Y6LA 2A35A 1J20A 3WLQA 2HPZA 3BE8A 5DW0A 2B8TA 1Q95A 1YZYA 2HTFA 3C3WA 2ZJ6A 4R5HA 2A5YB 2C96A 2Y77A 2YYYA 1M2GA 2J6BA 1X86B 1MP0A 4HBGA 3QELB 3ZHCA 5M04A 2ZSEA 2CCKA 2XGSA 3EOZA 4PAWA 3ZVRA 4KN5A 2YCLA 4K9RA 3VVMA 3CW8X 3GLQA 2QT9A 4P8RA 4W1RA 5ALRA 2I2AA 4MINA 3KQOA 3ZXYA 1OLXA 2D0IA 1RQ2A 2DE0X 5EQFA 1Q0SA 4U2GA 4QECA 4ZVLA 4HI0E 2UUOA 3WLLA 1BJKA 3A6FA 2IOYA 2BZ1A 3EIHA 3V48A 5HJ5A 3E3MA 4IFEA 1W0KD 3RG8A 1ZOIA 3H97A 4B6QA 4YUAA 1P77A 1T2CA 2HSJA 4UEWA 4A82A 1GPJA 4NG5A 3ER9A 1KTVA 4ERNA 4E4RA 4ER6A 1ZLYA 4UXIA 2ZWIA 4G8JA 5DNDA 2HSGA 1QXSA 4KXWA 3K9CA 3LQYA 4X65B 2ZJ7A 3WQRA 2IPXA 4OY3A 3G2JA 5KYUB 1JUDA 2DUUA 5FD8A 3BREA 3KETA 4LF9B 1QYWA 1IZ8A 1OZ0A 3LS2A 3R20A 5TIIA 1FP2A 1NVVR 3UHFA 5AOBA 1DDGA 5K8CA 1F48A 1SNYA 4LISA 3BAZA 5KIAA 4G85A 2GAFA 4LV5B 3WV4A 2CUNA 2X42A 3KTDA 4MV4A 3V6LA 2YHUA 1MA0A 4YJFB 3REGA 4CTNA 5IP5A 3R3HA 4MW2A 3MBIA 1HSZA 5DH9A 3WDMA 5JAZA 4UNQA 4DNFA 2FW8A 4R5MA 5MF6A 2HT6A 4BQOA 3I61A 3QENA 1P7WA 4MZDA 3B9BA 4K6KA 4X95A 2FMHA 5DGCA 3TBFA 4CFYA 3ZDDA 1UMDB 3I9V1 1IVNA 4C6TB 3WGQA 3BFPA 5HOQA 2WRZA 4BXOB 1R6VA 2J3LA 2BFPA 2H4JA 3DNMA 4QPNA 1XTRA 4HLNA 1XEXA 2YJTD 4RFLA 4RK5A 2DHRA 5JJCA 4MOWA 1IYZA 2UXDB 4PX9A 2Y05A 1GRVA 2WILA 1N5MA 4RVSA 5EUQB 3WWYA 4KN6A 2H5EA 2ZWMA 4RA9B 1JDNA 3IV6A 3E9MA 2AR0A 3IQFA 2PX0A 2VUTA 4I9UA 1IK6A 1CJCA 2D6FA 1P4HA 3OJCA 1WSBA 3ABOB 3ITNA 1U7HA 1YFKA 1DAEA 2FFBA 2R11A 3RVPA 1IY1A 1U1DA 2O14A 4CMAA 1ESCA 5B57C 2PMWB 1K8YB 1U98A 2GO7A 2AFIB 4TZ6A 5CNIA 1R88A 5ITVA 5L7WA 2M6KA 2KBEA 1KC1A 3AW9A 3V9AA 3KUXA 5D3MB 5IC6A 5CAEA 5EXEA 3BWMA 3TW0A 5IZCC 5E7QA 5IDQA 1L4MA 1UFKA 5I7EA 4D42A 3K9WA 3E27A 3G9UA 5DTEA 1J39A 2YICA 3WNZA 5C1BA 2C77A 1JX6A 1U2TA 3JWIA 4JEHA 3L4BC 3LBHA 4MDYA 4I4IA 4UU0A 4Q9JA 4BUCA 3WFIA 4EY7A 1GKIA 1PN3A 1A8IA 3HVRA 1L9XA 4XTCS 4PHTA 3EC2A 4Q3OA 1H8HA 2H1VA 2B2XA 3HFRA 2PBRA 4MAMA 2A67A 4AYXA 4MEJA 2F3TA 2DTDA 2HXGA 1CLEA 1EQUA 2QP3A 1GCUA 2SKEA 1F6WA 3D1VA 2VAPA 5I5GA 2GZ3A 2ZR0A 4WOCA 1V7QA 3ACBA 3C6ZA 1T5LA 1DQNA 1CKEA 3DONA 3HYNA 2VJPA 2X6TA 2Z8YM 4GPBA 3HWSA 3N0XA 4WLEA 3EA5A 2FEXA 1T1IA 3IP1A 4AMBA 3VR1A 5FWYB 1H2AS 2FMUA 1R8QA 1U1FA 1E64A 2JJ1A 4NAVA 3B51X 4MUEA 4QFBA 5DP1A 3MXTA 4EAAA 3WGUA 1YDWA 4TTSA 4GVPA 4JJ8A 4EHNA 1YHZA 1VIYA 2A5JA 4OGFA 5BYBA 1LDGA 1O87A 3AKYA 1ZGHA 3ZDEA 1YONA 4ETMA 3PNSA 5EE9A 3STVA 1NG9A 1X1QA 5BUSA 3RTCA 1ZEJA 5FTJA 4EZEA 1NULA 1IPHA 1XZNA 5DBIA 4U2DA 4FFOA 3PC4A 4NBNA 2ZJFA 5EJ2A 1M2KA 2VYQA 1IC6A 3VYTB 4BKQA 1CYEA 3FYCA 2AW5A 1YR3A 3YASA 1DAMA 2VHXA 2E55A 1M6WA 1U5AA 3H1BA 1QIDA 3IE2A 3PVCA 1F2TA 4C6SA 3ZXSA 1RJFA 4B85A 5ES4B 2J3MA 4ZQGA 3AP1A 1VBNA 2DKOA 3PKJA 2IW3A 4I46A 3VTZA 3WYNA 4EUEA 2IH5A 2ZZNA 1TZJA 1H2HA 4J7UA 1OYVA 3SIPA 4QDZA 1N6NA 3WYAA 5B5SA 1ZUWA 1BVHA 1DWOA 1RQPA 2JFPA 3ZTTA 1E3QA 2ADMA 4CMIA 3RAEC 3MMPA 1IZZA 3SX0A 1L4GA 4UM5A 1C9EA 4QASA 4N39A 5EMHA 4UQOA 4II3A 5H59A 2HMUA 1W0KA 2YNMC 4IDCA 4PTZA 2BPOA 3FUCA 4LJAA 4UJ3A 4J0FA 4X20A 3L8DA 1QK4A 5AKHA 3HBMA 2QRQA 1YBFA 4AP9A 3UAWA 4EUFA 2YWDA 5B6JA 1SHJA 3CG0A 5LOVB 3ZWWA 4H08A 4H6PA 4M6WA 3AF3A 1T3ZA 1NOKA 4MQEB 1AF7A 5BOSB 4S1VA 3VOAA 3DQPA 5BN3A 3MAAC 1VBKA 4D3SA 1TUGA 2QQEA 2QPTA 4NOKA 2CV0A 4J4BA 3ZNOA 3U7RA 3I8SA 2REQA 3IUPA 3N05A 1EGQA 1CIJA 1TJ5A 3VU8A 1K7FB 2VHUA 1GGFA 1N6KA 2OR3A 4R05A 2ZUEA 5FWXA 4JT9A 3SXPA 1USGA 5LZ2A 4Z4EA 1Q7CA 2C88A 2CMDA 2HMWA 3HDVA 1T1RA 3LMKA 4WN9B 4DC0A 4FMPA 2EFHB 2HFKA 3KR2A 1NT4A 1UAYA 1ZUD1 2BLLA 3NOVA 4G3XA 4MGZR 4UFOA 3ZN2A 4EY8A 2PMKA 1KQOA 2WUGA 2Z6VA 5KTPA 1QKJA 2QRUA 2DUNA 3U4IA 4FHDA 2C00A 3ZVNA 2Y2UA 3ZXUB 1U8ZA 4NCKA 1CTQA 2MR6A 3RTDA 4B09A 3FZYA 5AIBA 4JOQA 2QY9A 2H7CA 4FFPA 2CMKA 4HNAA 2K4MA 3JTEA 1RWKA 2DT8A 4ABYA 1JEYA 3B7WA 4REQA 3ND5A 3QVWA 5DCLA 1KZYC 3GLVA 1E7SA 5ALGA 4DG9A 1Y4UA 4YPOA 1A4XA 2QZSA 4GKJB 4KFUA 1XJWA 5DW3A 3RSHA 4PZLA 4J0GA 3OKCA 2NXCA 3X44A 2QRVA 4CBVA 2JFHA 4RHXA 3K2BA 1F0PA 3MQ2A 4A0RA 4D2IA 5I7OA 1LPSA 1LPBB 1NA5A 3DV0A 3T41A 4XFDA 1MOPA 1N1MA 3TTYA 4UTRA 3BM5A 1Y6QA 3W6OA 1VIVA 3GRAA 4PW0A 4DY4A 4ENVA 1DP4A 2P8SA 2YIDA 2XMGA 3VUFA 2RHHA 3HR7A 4RGBA 5CHYA 2EGHA 3WLHA 5JOQA 4ESVA 5J4YA 3QNMA 3AR4A 3IVRA 3F1KA 4YYEA 1RHJA 2IYLD 4BAGA 3KZCA 4RA6B 5FPPA 3UT5B 2V58A 3UCEA 3FRIA 3H6HA 4AS3A 1FDVA 1JJ7A 4HMQA 3L7AA 2G1JA 4JWKA 4ZVUA 4I5FA 2MMGA 1I13A 1EVYA 3N59A 2IDJA 3HYCA 4G5RA 3PDJA 3W7BA 1O8BA 5I9LA 3FI0A 4C3UA 2V1XA 2WE8A 1T3TA 2ZPTX 5SZJA 1ZGJA 5BSWA 3QU9A 2D0OB 1RFGE 1UQUA 5FI3A 1OI2A 2QI9F 1E96A 1WB6A 2WF7A 5DLEA 1AB5A 1BEEA 3FWHA 1OHHD 2FK7A 3FE2A 4KMMA 4DANA 2B0CA 5IAGA 1FYEA 4KR2A 2X86A 4R2XA 3SSAA 5HXAA 1KEKA 3JWHA 2VYCA 1R0YA 3HCFA 3W4KA 3R77A 1EFUA 1Q92A 2QYTA 1U7DA 1C0PA 1SKYB 2H92A 3RVKA 2GLTA 1SVUA 4PCAA 3WKDA 1U3CA 2B2NA 2J41A 3KWLA 3ZGYA 1NIJA 4UNRA 4ARAA 6YASA 3HYLA 3OCWA 2PFSA 3VNAA 4EF6A 5FLKA 1PSWA 2OXFA 4AZWA 1RWQA 4FOSA 2PZKA 5BRJA 1RC8A 3A4VA 2FZWA 3L0SA 3RU3A 1DG3A 1DWPA 1UKYA 2TMGA 4KIWA 3W8FA 4BATA 1G0OA 2Q5IA 1TQHA 4KI7A 1PAUA 5PGMA 3SFTA 4BMVA 4D4IA 2WA1A 3RCBA 1M33A 3RC7A 1PFGA 3W79A 4YMUA 2XYQA 4DYVA 4C4XA 7MDHA 2W6QA 5G1PA 1KQGA 5CX4A 4ZFNA 5DYTA 3H5VA 2EYQA 3AB8A 1E3WB 3HZHA 1YBHA 3LKBA 3QMVA 4QBHA 2J7KA 2ODWA 1ORVA 2WVAA 1J07A 1OFVA 5TX7A 1BH2A 3AR2A 4U6QA 3PF9A 1M10A 4KSYA 4TL9A 2DBZA 3S2SA 3COVA 4X97A 4EVQA 4NBSA 2CF5A 1AKVA 4GGMX 5KS2A 4UEKA 4I4TB 3WGLA 3RUPA 5HPYB 1M8PA 3BSSA 2Q5EA 1G4HA 2ZYSA 4C20A 4IBOA 3BB4A 2FWIA 3B20A 4O5OA 4UE3S 1Z39A 2LCQA 3CN7A 1WOYA 4YUZA 3EDYA 5KYYA 3REFA 1LQTA 3M5CA 3P4XA 4TV9B 1DQRA 2GEDA 3LFHA 3VX4A 1J56A 3I5XA 5HZGA 1DAHA 5CH3A 1EXNA 3U5TA 5LYJA 5ENDA 5CT9A 3A6KA 3F49S 8LDHA 1FU4A 3W4IA 3AJ8A 3OO0A 1U2QA 2WZBA 4Q34A 2FZKA 3BMOA 3EDMA 3NIBA 1NHGA 2ACWA 2Z95A 3MIZA 4W8HA 4EHIA 5JJBA 4LF5B 4EG8A 5JD5A 3PGA1 2GN8A 1TQ2A 4B8ZA 2VBCA 4IDDA 5AKKA 2NPFA 1OQAA 3CMCO 4JHXA 3R9IA 5JS2A 3ZCTA 4YUYA 2H2IA 5B2EA 5LNK6 1D6MA 1I3LA 2CL6X 2UYQA 2AG5A 4E6PA 1V8PA 4IKEA 2Y9MB 4CEJA 1Y89A 4DV6B 3P9KA 1XMOB 1EWQA 4GKBA 3NVKI 1XKQA 2JLQA 4TLBA 5I7WA 1AXRA 4IXDA 1TF2A 3C14C 4X5OA 3IBCA 3RT9A 2Q7DA 3SS8A 2NO0A 3ZU6A 4EG4A 3FOEC 1JQLB 3BX1A 4WACA 1R18A 5MDHA 1DBRA 2OHGA 1CUDA 2O2JA 4E4TA 1N2BA 3I37X 3K1JA 4ALJA 5A5VA 4L74A 1L7BA 1Y1RA 3QWBA 2VWQA 3E7PA 1R0XA 3G68A 2R0QC 1RWVA 1RU3A 3WFZA 3TGLA 1W6UA 3JZAA 4EYEA 4FYVA 2C42A 2Y0EA 4IW3B 5CCDA 1O5IA 2FSHA 1OX4B 4V1CB 2OK8A 2NU9A 2OD7A 3VJKA 3DKKA 4U7HA 1MB4A 4JSYA 3BK7A 1PD0A 4CTJA 3K0KA 4BKMA 5IUJC 1W36B 1IJBA 4BYGA 2XGGA 4D3FA 1H65A 3O84A 5KNCA 3NEPX 4R8SA 4IZHA 4PYNA 3O4JA 4F86A 3PR3A 5A05A 1MJHA 3UB3A 2GXAA 3H8VA 4O4LA 1FMLA 2AZDA 3CLRD 4EUKA 1M73E 5IJ0A 4B33A 1E6CA 4DIKA 4GL2A 3TNDA 4IJWA 1UMCA 5FPTA 5BMVB 1Z6ZA 3I01M 3TLMA 1E5XA 2PN1A 1U0JA 5HFJA 3TLGB 2XR1A 3PNPA 5DULA 1QOQB 2OQRA 1KPGA 4UTVA 1AN0A 4UAJA 1OZHA 2B8EA 1C4WA 1UK7A 4BU0A 3S5UA 4QBTA 4B6FA 4E03A 2Y3IA 4DCCA 5C1PA 3RS0A 2IVFA 3PD7A 4XOIA 4YBRA 1F51E 3T12A 1J90A 3P9RA 5B1EA 3NHKA 5LBIA 2X2EA 3GVHA 3HH8A 2VA9A 4RJLA 5EESA 5F2EA 1A98A 1M0TA 1SVSA 2AVNA 2ZUWA 3KR1A 5IEJA 1UCFA 4K8RB 1XQYA 2VN8A 1RZUA 1NVBA 2JLAA 3D54D 3I28A 4MGIR 2BGKA 3T3MB 3GLHB 5C34B 1X15A 2FHSA 4ZAXA 2FH5B 1BCSA 5E4FA 2EFCB 5JVDA 3C24A 2UV8A 3E48A 4WUVA 1BO6A 1YFZA 1GZDA 3TTSA 1OIVA 4EJ0A 4YO8A 3L8MA 4KKXB 5ITWA 3IAFA 5CFLA 3NJ8A 3SQOA 1VYUA 3AG5A 3ONNA 3T4PA 3T7RA 2XE7A 4BMCA 5A5GA 4Q05A 5JSZA 2P3QA 2EDCA 2FG5A 2VSQA 3KYCA 3MSCA 5K0SA 5KMGA 7REQA 3QTLA 4JGIA 1AS2A 1EP9A 4Y6PA 5TGZA 1YQ9A 3F6EX 1OHHA 2QAJA 3FNGA 5BSFA 2C8VA 2CLMB 1GUBA 1C30A 1UBSB 2GPYA 2HLPA 2WD7B 1E0JA 2R8XA 1DO2A 3DFZA 4I8XA 5C1IA 1O89A 1GKLA 4MV9A 3RS2A 5AM3A 3P96A 5F1KA 2PT7A 4YRAA 1KY4A 5JLJA 4CLDA 1LLDA 2YUIA 4MKHA 5FUQA 2X4DA 4ARZB 4CKYA 2RK6A 3SVZA 2SHKA 4B32A 3Q87B 1IJFA 1F2UB 1CUXA 1ONPA 5CCBA 3TPFA 2E5LB 3E9CA 1WXWA 1SJ9A 3E3LA 1NQVA 1U2SA 4M7PA 2P9QA 4LMAA 3UH0A 3DOOA 1IRXA 1T4CB 1BN6A 1TO6A 1ORHA 3FB4A 4AKTA 1ODJA 3DLAA 1RLOA 3K0EA 3ZVLA 4B46A 4K3VA 4P4NA 4TSKA 4WBNB 2P68A 4OHPA 3STWA 3IUJA 2JGAA 4NP6A 2PZEA 4BNJA 1F4VA 1YCHA 2HJGA 3QOYA 4Z51A 5JCXA 4BQPA 4C89A 1V1JA 5EIWA 5L3RA 2ICAA 2NO5A 1Z6AA 2HJ9A 1FUEA 5LYJF 3ED1A 3VKUA 1G8GA 2O5RA 2XEDA 3E22A 4NE9A 5KKCA 2RK4A 2DGDA 3WLJA 2CV1A 1HOXA 1VLJA 3COPA 5J4KA 3SXUB 5C4MA 2JASA 5IN5A 1NLFA 3BXEA 1QLWA 2QNBA 1XMVA 2NVUB 4MV5A 2BFAA 2BN4A 3K20A 3U4MA 5E7MA 2JI6A 1C7FA 5JBNA 2AD1A 2C94A 2G1AA 4IDFA 3SZLA 4QEKA 5DYYA 1WSWA 5TJ9A 3OCZA 1UDXA 2W2KB 1TVMA 3ONFA 3PQ5A 3I6IA 3N76A 4HT3B 2NV0A 2P4UA 3UHJA 5LIPA 1KTIA 4PSAA 4PF1A 3LY5A 1QX4A 2CXNA 2DQSA 4KVGA 3V1MA 4MDEA 1G21E 1OSNA 4BNZA 1IHXA 5ALQA 5HJ2A 4FOPA 4I1IA 2OORC 3TK1A 2GJ8A 3RS7A 3PI6A 2IZZA 4GOOD 1HRDA 1A69A 4MJ3A 1PUXA 2H2DA 1E6MA 4Z53A 5HILA 1PFYA 4B84A 1CW2B 4R7ZA 1KFEB 3X1WA 1JR2A 3R7SA 2H85A 2AQKA 2K6GA 1RWMA 4LXGA 4Q7LA 4ZO7A 1RKVA 4ZP1A 4RVHA 1BWPA 1QV7A 4Z8YA 1N5RA 1SZJG 2QT0A 1A9XB 3DMHA 4WFQA 5K0LA 1PEKE 3AVQA 3IDAA 1F14A 2CT8A 4IOMA 1JLMA 2YW9A 4YP7A 4EEKA 2F3PA 4O4LF 4RZ2A 3U3KA 3A11A 3QVVA 3U1VA 1WSAA 5BVHA 2H1CA 1FB5A 3G5AA 1P7VA 5DT2A 3K1TA 1Z73A 3RKRA 1X7XA 2GEVA 2ZSHA 4AKIA 2OESA 1NR1A 1RMQA 1Z2OX 4CLRA 3WLMA 2BL4A 3D8BA 3OEYA 2WPDD 1EFLA 1T9GR 1UMKA 4PTYA 3S28A 1R5JA 2PDAA 2DOKA 3DULA 3NASA 4S2UA 4PWZA 5AJVB 3TZKA 1PJ2A 2QPLA 3NB0A 1CB7A 4Y2VA 4D43A 2UAGA 4DQLA 3CZAA 5BV2P 4RL4A 4DGQA 1KBQA 1EHIA 1RXEA 1YAHA 1Z4PX 1RWBA 4JXXA 2BSAA 3LVBA 5IVIA 1JH8A 3A4NA 5EGSA 2F9MA 3H42B 3SDSA 3T9CA 5I7RA 3E05A 4BB5A 3KHKA 1I4WA 2ABWA 1GPLA 1IWPB 1X38A 3PRHA 4P5EA 4C9BA 2FWAA 5JVDF 5A2QA 2W8BA 2OHFA 1RXWA 4HWOA 4A0QA 2GM3A 1U0FA 1FVOA 5K2MA 1Z3IX 1X8JA 1ZWLA 4MGEA 4PBSA 3UFBA 3OMLA 2OY0A 1PZGA 3V7UA 1EUQA 1Z2AA 3DTYA 4LY9A 1A04A 4RTJA 2B4KA 1O9GA 2W6MA 3NEYA 1KMHB 3QXGA 5DNVA 5DO9A 3SJAA 1UWLA 5ERGB 2V7GA 2P5TB 1OC2A 1OY1A 3N9IA 3GLUA 3MUFA 4PO1A 1UINA 2D0PB 2I99A 4ZRNA 1J5XA 4IGFA 2HF7A 4G2NA 4V0LA 1H3EA 3TXAA 4PGAA 5I7UA 2WK1A 1Q50A 4WKOA 1E1CB 1SVOA 4Q6BA 5JVDB 2GKOA 5GJWC 2MINB 4Z6KA 3TW8B 1GDDA 3NHWA 4NU0A 2QMYA 5DNCA 1NM5C 3H5RA 1G2PA 3N8KA 4TN5A 2ZI9A 2GPWA 1N5OX 3LC1O 3C39A 1YR2A 1RVDA 2V74B 2YC2C 4OBEA 3BWCA 4HWSA 3ZD7A 2BM8A 1S0UA 2NQ2C 1GQYA 3OOHA 4RX1A 1JR4A 1Y8RA 1AGXA 1C1DB 4FVTA 4R4JA 5E1MA 3S1AA 2F1OA 3WK6A 3ZV6A 4OLJA 4W9NC 1C4XA 5I6DA 2F8SA 4NENA 5G0VA 2C5AA 4ZANA 4YMVA 3U0BA 1OFTA 2QGZA 1E4OA 2ZYHA 5EMJA 1EA5A 2G7MC 1KPHA 4PICA 4Q4HA 4P5DA 3ILVA 1IN4A 4FZVA 1US8B 3MRXA 4EO9A 1OX6A 1XLWA 2PV0A 1SCIA 5DHFA 2JGLA 4YR7A 1BRMA 3K09C 3DZHA 3UFXB 3FJOA 1U9IC 2Y1FA 2C2ZA 2XE8A 4XIYA 3I1FA 2NU8B 7GPBA 2JF0A 5B1DA 3DBIA 5AK5A 1NBME 2BEJA 2EJVA 3PDIB 3Q12A 2VTEA 5L4LA 1BWQA 4HY3A 4JC5A 5GJVC 4UMVA 5TC4A 3THRA 4ESEA 4RHEA 4DJAA 3MD9A 4D3XA 1OZGA 2OOSA 5G4KB 4MUBA 2IZ0A 3OU2A 2G6TA 3GNLA 4HVCA 3GZ4A 5D5PA 5THQA 3ROQA 3VO9A 1E0AA 4XUCA 1U81A 5AI5A 3P94A 2XX3A 4M8LA 4MWGA 1CLUA 1FS4A 1M6VA 2QVZX 3B2EA 1GPMA 4NHOA 2GTHA 4E4YA 4ZODA 4A8JA 2CZCA 4NFHA 4B40A 2B5WA 2R8RA 4OQQA 1VYVA 3GCDA 4AJ1A 1OA0A 1QH0A 5C8XA 5JASA 4GRIA 1NPYA 1Z5GA 4ZT5A 4GSLA 4BRZA 3OX1A 3C3BA 3VH3A 3EZXA 4L4SA 1TD1A 3FHCB 3LQ4A 1FFSA 4MYDA 1LZLA 4RADA 1UK6A 1RHKA 5ECDA 3JYLA 4C30A 2V5UA 2BR4A 1X9HA 1G17A 1PSZA 2EX1A 2XGMA 3EN0A 3JCZA 3S29A 2VXOA 2W43A 3SGLA 1EEHA 1QMGA 3LXXA 3IQEA 2WHEA 2XQVA 4UD2A 1AY0A 5EHXA 3FKQA 1Q7RA 3LK6A 3ZJYA 3CY6A 4DLSA 1Y9JA 4ZALA 1IZYA 4PC6A 2PMEA 4TRJA 1VCMA 2BYTA 1V11A 3R5TA 3TLCA 1MNQA 2QM7A 3P9ZA 1Q0RA 2IU3A 2CMFA 3BGDA 3DUFB 1ULUA 1WZUA 4AQYB 1NAHA 2PRJA 1DMRA 3DBRA 5K6RA 3GLFA 5DE3A 2CDBA 4RPCA 4EYKA 3NT4A 1BDIA 3WP0A 1FE8A 4J1QA 1BYIA 2NG1A 2JGDB 2Y0PA 2GDZA 3Q7IA 4HVTA 1JKJB 2KB0A 3L7JA 1ZBDA 3STUA 3ZJ4A 4BNVA 721PA 4AS2A 4I1VA 4CDGA 2W93A 4REMA 5TR9A 1RLJA 3NJ4A 2G5GX 3KKLA 3GA0A 3M34A 5E6UB 1S2GA 3WMRA 5HGJA 4MVYA 2AYYA 2BAGA 2D3TA 2FOLA 1VQ1A 4QULA 3S27A 2I34A 1OI7A 4ZDJA 3TCXB 3DGFC 3D8HA 3ZLJA 2WPDA 4ZI3A 2FWBA 2XJ9A 4HQFA 5HMLA 5IH3A 4FYYA 3INRA 4DLTA 1QYIA 1FXWA 3MTAA 4DJEC 4D9JA 1AKMA 4PG6A 2OC4A 3T7CA 1ZAKA 2XMRA 3IELA 5IKPA 4O0MA 3MLEA 3OZDA 4YAFA 5B64A 1A97A 4AJPA 5HYVA 1ZU5A 1G5TA 4ZAYA 3TFQA 4QBIA 2EBUA 1TJ3A 1H5NA 3U60B 3AM3A 2DMRA 3B2NA 5EPOA 1S89A 1ZGZA 2QMOA 5IT0A 2NOAA 1T8YA 1Q14A 4ZOQI 2Y2VA 3GJ7A 2XECA 4Q7KA 3F0TA 4FSXA 4U5QA 1O6ZA 2B8NA 3QYPA 4V3BA 3S44A 3FPBA 3SC4A 4ZXFA 1ADBA 1D2EA 3HSKA 3DZGA 4GMHA 2VHTA 2H16A 2WD8A 4X61A 3KQWA 2P6OA 1O4WA 4DRXA 1A9SA 1HL3A 1ZM3A 4CCWA 3PXUA 3ESZA 3N5KA 4KQJA 4D45A 4ZI2A 1JN0A 4Q0MA 3M89A 4YC7A 2K2WA 4BLPA 1JU4A 2Y93A 1F4PA 2G06A 3SLRA 1JSZA 4CG0A 4FX2A 4R40A 5ALZA 4CM1A 3I2IA 5D00A 3L5KA 5CLIA 1YRHA 3GUUA 2GPNA 2VL7A 4DS3A 1EFVA 4W5HA 4EENA 2YV4A 4U7FA 5FOVA 3KDPA 5TRTA 1JA1A 4D4GA 1K5DA 1MJGM 2YYAA 3MCUA 4WCFB 4H1UA 1VMDA 1IEXA 1L4YA 2WNIA 2P9ZA 2ZBRA 1EH5A 3Q2IA 1NN0A 3GB9A 1W9HA 4Y1GA 3QUCA 5BN4A 5DB4A 1TEHA 4UVEA 1K6XA 5B1SA 1DKMA 2PFKA 4ND8A 4B7ZA 3IA7A 4IXTA 1Y7IA 2QYOA 1BWRA 2ZSFA 1T6YA 2VDVE 4KPGA 2XVYA 4ZOBA 4B83A 1RPAA 1SXJB 1ZNZA 2O8VA 3AETB 3L7CA 3F1LA 2AMFA 4DM7A 4X44A 2LZ0A 5HCUA 1U94A 3EIQA 1SY7A 4ZCRA 2X9NA 5DNWA 1H1DA 1JG3A 1I7NA 2HJWA 3MAGA 1G7RA 4ISBA 4CPDA 1GPDG 4GM4A 1YJXA 4O5AA 1ZR2A 1K0FA 4RK6A 4CLOB 1XUOA 2G83A 2BOVA 2A5LA 1MJNA 4HCJA 3A9UA 2I8AA 3LBAA 3GBVA 1SUSA 4HUJA 4ROSA 1N2CE 3EAGA 2RC6A 1PK9A 3E7WA 3WLOA 1M7BA 3R0XA 4OL9A 2R1ZA 2R85A 2Q28A 2MSLA 2I33A 3BDVA 4KPYA 2I7VA 3D2BA 4RLSA 2B36A 1C7JA 2QRZA 4J7AA 4JL5A 2NZ8A 3MK31 1KK1A 5DHRA 3U9SA 3HRKA 3UW1A 5AT1A 4E2ZA 1DBQA 1D2GA 1PS8A 1X2EA 2C83A 2R1TA 3P2EA 3PFHA 4C3OB 5ALFA 3K92A 3U56A 1VLLA 1ZCAA 3A10A 3QIAA 1AHHA 3RHZA 4UVIA 3TPCA 4OK6A 4NV0A 5TDHA 4DIOA 5K0JA 4RD1A 4UVHA 3SS9X 4S1WA 4AP5A 3U3ZA 5C7YA 3Q8KA 3UA4A 2ZDHA 1L7MA 1N3YA 4KXVA 4OHOA 4NBTA 3GF4A 1SBTA 1P0MA 1E2MA 5K0GA 3P9YA 3E58A 4C07A 4Z1MD 1DFHA 4BNUA 1OBCA 3DZ8A 4QZVA 2HN9A 3HZZA 4Y2YA 3II6X 4WTOA 3NG1A 4KE7A 4GPAA 1KH2A 1ELOA 2PTHA 4GXTA 1BU8A 2VPWA 2GUWA 1RIIA 1VSBA 4J9UE 5F2KA 5BR1A 3OZCA 5BUCA 3WDKA 4XWTA 1IBKB 1D4AA 3NBXX 1CF2O 4NBWA 3RSCA 9LDTA 3G9QA 5FLYA 5G0TA 3TOZA 3WHIA 5KWIA 3DP7A 1FXWF 2WIDA 3IOBA 4O6VA 4YGYA 1YZLA 3T1YB 1QHHA 1IOWA 1ZMOA 2VO1A 3GQBB 4JLPA 3VYWA 3U44A 3UKJA 3OQPA 5K45A 1JHRA 1PGJA 4YXWD 3PQ7A 4R54A 2GERA 4EABA 1MB3A 4FYXA 3ZX5A 1TUIA 5L4SA 4TXNA 1E0DA 5CA1A 3DL4A 4B73A 2Q6KA 2ZOSA 3BA6A 4G36A 4TVOA 2VBFA 1C9KA 5AK3A 1GA6A 5JG7A 1XQ1A 4UHHA 3RC9A 4D9GA 1D09A 3BK2A 1QGUA 1Z0DA 2MYPA 3DJFA 5EFZA 3RRXA 3NRJA 2Z6AA 1QBGA 1QG6A 4A6EA 4PLYA 1IK4A 3FOCA 1EBFA 5KYXB 1GPNA 1ECGA 2EC5A 2ZB4A 2FMKA 4RWEA 1ATIA 3ESQA 2W4QA 4WQMA 2YZNA 3KOMA 4Z5XA 4TZ0A 2VJBA 4UTNA 4G0YA 2PL1A 2QTWB 1GZSA 3LO5A 3NUQA 4AZTA 3MZ0A 3EODA 3TGPA 2YN0A 3NBZC 4B1FA 1PP4A 4KQ9A 3OZFA 4DA8A 4Q1CA 1UAGA 1IJEA 2GZDA 2NT4A 3DWEX 3H1AA 4QSMA 2X4GA 1N7JA 1RXVA 5K03A 3PC6A 2V3VA 1GGJA 1S3SA 2QI9C 3C6XA 2PWBA 4H59A 5ALNA 1YB6A 2VF5X 5K2OA 2O19A 2XZDA 3GJQA 4IGKA 4YDRA 1M2WA 3KVRA 3PGXA 3OG9A 4A36A 2XRMA 2IBMA 4MWBA 4GMFA 2YFQA 4MWCA 2PX6A 5AIAA 4C1NA 2H31A 2A5DA 2R84A 3BERA 3VPFA 4ZDWA 2D8MA 4BLWA 3EZNA 1XK6A 1ZUNA 1D0IA 1P1FA 4XOUA 1TJNA 1A88A 3ZTYA 4ZRDA 4BO8A 4RD0A 5HNKA 1AS3A 2V9CA 4L72A 2P9JA 1IXZA 1O6GA 2UYCA 1HE5A 2KYRA 2W2MA 1X8LA 1JR6A 3FI9A 3AMVA 1HLPA 4AZSA 5CDGA 5K8VA 4N0QA 5HZMA 3OE5A 3R5XA 4M9UA 4KDCA 5AKJA 2ZRAA 4FR0A 1TCVA 1PTJA 2EGGA 1RAHA 3D4NA 3DVSX 1DC4A 2