4N01A

The crystal structure of a periplasmic binding protein from veillonella parvula dsm 2008
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
296
structure length
296
Chain Sequence
GTSVTWSETFDGTKTDFAVKSAPTHAVSMSQATTEMMLQLGLDDKMAGTAFKEEEIYPPLQAAYDKVKVLSDKWPSYEVFMSVKPDFATGWPDSFSKRAIPADKMISQKVNIWIPESMLSTKADLETNFSDMIKLGEIFGVKPKAEEWVADQRKTLAAIQNKLKDLPRKRVFIYDSEDGQPFTAFEGYTTNILKLIGADNVMSGLGVDKTWAKGSWETVIAQNPDYIIIADYGNSIRNDDDFQQKIEKIKANPQLQDITAVKEGHFIRVKLSEITPGVRTVDALKRLAEEIHGIKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Periplasmic binding protein
publication title The crystal structure of a periplasmic binding protein from Veillonella parvula dsm 2008
rcsb
source organism Veillonella parvula
total genus 88
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4n01A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4n01A02
2XUZA 2ETVA 1M34A 2XDQB 4ND8A 5KOJB 3ZK7A 4XPIA 3PSHA 3EIXA 4TKVA 4FKMA 4WZAB 3AEQB 3AEKA 3PDIA 3TEFA 4MLZA 2AFHA 4INOA 4BBPA 4DBLE 3MINB 5KOHB 2PHZA 1M1YB 1KARA 1PQ4A 4PM4A 2RG7A 1ESZA 2Q8QA 3MD9A 4UDOA 5JG7A 5M34A 2OV3A 3AEUA 1FP4B 2OSVA 3AETB 1QH1B 4OXRA 4B8YA 1QH8A 3HH8A 2PRSA 4WN9A 4LJSA 5BVGA 1K75A 2R7AA 1G20A 1K7SN 3BE5A 4UTPA 3EIWA 2WI8A 2M6LA 5JJ5A 4K3VA 3LHSA 4IRMA 5GGXA 2XDQA 1L5HB 3HXPA 3K1AB 5HDQA 5KOJA 5KHLB 5CX1B 5FLYA 3TLKA 4PAGA 3LI2A 5JOQA 5M29A 4WZAA 1K0FA 3AEQA 1N2CB 3BE6A 3AERB 4OXQA 3MINA 4FI3F 5KOHA 1M1YA 2Q8PA 4MDYA 2YNMD 5CR9A 3U7QB 2AFIB 1FP4A 2OGWA 1G21B 4HMQA 3AETA 1QH1A 2MINB 4MO9A 2M6KA 3G9QA 5M2QA 2WHYA 1M1NB 3ZTTA 4GICA 1PSZA 5GGYA 4WNAB 3CX3A 3K1AA 1KAEA 1L5HA 4HMPA 4MX8A 5CX1A 4N01A 3R5TA 4TKUB 1H1LB 5JPDA 1MIOB 4H0FA 4WESB 4WZBB 4NNPA 3AESB 2PS3A 1N2CA 5HX7A 3AERA 4M7OA 2O1EA 3ZK9A 1QGUB 1N4DA 5I4KA 5BVHB 3U7QA 1EFDN 2XY4A 1M34B 4FNAA 1TOAA 5AFSA 2AFIA 1K2VN 4G07A 4ND8B 4XPIB 1N4AA 4TKVB 1G21A 2XH8A 2MINA 2QI9F 3HJTA 2PS0A 4FILA 3AEKB 3PDIB 3PSAA 1M1NA 3ZK8A 2AFHB 4H59A 4HN9A 2YNMC 4G09A 4UDNA 4CL2A 3GI1A 4WNAA 1N2ZA 2OV1A 3MFQA 3AEUB 3TNYA 1XVLA 5BVHA 4TKUA 1H1LA 1QH8B 1MIOA 3MWGA 2PS9A 4WESA 3NU1A 4WZBA 2X4LA 4WN9B 3AESA 3R5SA 3MWFA 3ZKAA 5BVGB 2R79A 1G20B 4OVKA 5M3BA 4LS3A 1QGUA 4NNOA 5B58T 2XQVA 4UTOA 1KAHA 3UJPA 4INPA 2XV1A 4HMOA
chains in the Genus database with same CATH superfamily
2Q27A 4R16A 1BKYA 1QHGA 2QG4A 3C3BA 3WKAA 3PLAE 1E3WA 2ZDGA 5JC8A 1QKJA 3T5BA 3DC7A 4BFXA 4WOPA 4MK4A 3X3HA 1P2UA 4NF2A 4C1NA 3VSAA 4CIWA 4DKXA 4V0NA 3ZJYA 3CNEA 4GP6A 4CR6A 4ECAA 4G5HA 2CNDA 2I4TA 3DZKA 4MWEA 4MCHA 2W6QA 1FU8A 5EWMA 2NO7A 5BNTA 3H9BA 3UGKA 221PA 3L7CA 3PEWA 5E6SB 4N0DA 2BP7B 3KYBA 3L0DA 3SOZA 1DRUA 4BMZA 4DIKA 3PENA 4BO1A 1RTKA 1TM1E 2C7PA 1IBRA 1XKTA 1J5XA 3B2EA 4RD3A 3R40A 1H85A 1U0LA 5LDGA 3U49A 3VC7A 5BN3B 1BRMA 1U1DA 2CT8A 4CNQA 2NU6B 2HRBA 2CXRA 2QUAA 2XRYA 2YZNA 4Q4JB 3NBMA 4L7QA 4QUKA 1MKYA 3L7NA 1P0QA 1FJGB 4DTIA 4XR4A 2ZBVA 1DDOA 1DC3A 4EL0A 2NU9B 5E1BA 4NARA 3LYLA 3HB4X 1T1RA 4RJTA 5EMJA 3ZXYA 4IIFA 1MDFA 2A67A 1PT6A 1XXLA 2AT1A 4FU0A 4Y6OA 3N5CA 1BVRA 3PWKA 3MQFA 2WTXA 4UEJA 4C2TA 2FHPA 4NZOA 4AURA 1AZWA 3P9CA 2BT4A 2IOYA 1Z5OA 4Y2VA 1E6WA 4ZI7B 3JYHA 1CVRA 2JEYA 3D3NA 1EX7A 4TV8A 3T9EA 4URZR 4LE0A 5F9MA 3KR1A 4FFPA 2C92A 4LE1A 1XOIA 5KQLA 1V11B 3BXZA 4P4NA 1E3EA 5KSZA 3BA6A 4DZTA 1IBLB 4NECA 3SLGA 8AT1A 1CUWA 2FPLA 1WY5A 4ZANA 5B1IA 2ZIEA 3UAVA 4QXMA 4NZNA 1XCBA 4KFUA 3B8EA 1HYHA 2Z2YA 3LKVA 3RSLA 2DR2A 1WCXA 1V4BA 2FH5B 4M0LA 4TSKA 3NP7A 2YDYA 3VYUB 2I71A 4WK4B 1BCSB 3ZN2A 5HFAA 3AH8A 4IINA 2R8XA 3HR4A 1Y4DE 2WMYA 3HUEA 4KYVA 4TZ0A 3RUPA 2PXCA 4YDRA 4ZQEA 2B1RA 1XKXA 3GRFA 3B20A 1R4MB 3I92A 4F85A 5DYIA 3NJRA 1AN0A 5G0VA 5IJXA 2JI8A 4L72A 5K3OA 5CT8A 3TX6A 3KT8A 3THYB 2RGUA 2YZMA 1O77A 2ZANA 1T5LA 4DN6A 5JNVA 3P32A 3ZGXA 4B71A 2F8LA 3PUZA 4UTZA 2GM3A 4X71A 4BNTA 4X20A 3GCGA 3KTFA 3ZLTA 4B3BA 3HG7A 4ALMA 1ELOA 1A8HA 2VPTA 3C8DA 3WWYA 4MKXA 1PGOA 3NHAA 4QLBA 2VJLA 1ZGAA 3OCCA 4RQUA 2WA2A 1KERA 1XCLA 4N8DA 5KTPA 1ATZA 1EFKA 1VE6A 4C4RA 2JCGA 3TW8A 4GDMA 4YRJA 1AXGA 3P0EA 1ZNQO 2D1RA 2P62A 1DL5A 4PPFA 1XTTA 1ZMTA 2Q9BA 1QB8A 2WF7A 5K0GA 2WIJA 5BT8A 3D7LA 2CV2A 3C3MA 1XHFA 1C0KA 3KKEA 1HE1C 1MABA 4C4PA 4RV4A 3K9HA 1V5WA 2PSSA 3BGDA 4ZVLA 1BU5A 2QRLA 3HBNA 3RUEA 1LW6E 1Z8DA 1ZHHA 4TKVA 5DT9A 2VJKA 4LZZA 2G40A 3BWBA 3DTYA 4QD3A 1CQJB 4EW2A 2VKQA 3PWSA 4G84A 4BBPA 3JQRA 5AVUA 4UE3S 2X5OA 3FBGA 3UUWA 3NRJA 3UV3A 2FLVA 3PGJA 4YPOA 5CEJA 4TM7A 3ZCRA 1T9ZA 1Q0SA 2CXTA 1N2EA 4LFAB 4YYZA 1JR3E 1Y1LA 4JXZA 1V7ZA 2JGNA 3G8DA 1I2MA 4ABYA 2CL6X 4YMHA 1D09A 4KIGA 2DKFA 4FGWA 1CRPA 4MRAA 4MGZR 1U0NA 4JR2A 3FWYA 2FEWB 2F67A 2XQGA 3W4JA 4W1PA 2W42A 4HXGA 4A7PA 2I66A 1RPAA 2HRQA 5JW6A 1OWMA 3M0EA 1RXEA 1DG9A 1OIVA 3PPYA 1QQAA 1NONA 1T6YA 4LXTA 4M38A 5IK2A 3ZU2A 4B17A 4F2HA 4ZARA 1FBNA 2RGDA 3GLIE 3RYFB 2MYTA 3L79A 2G9QA 4YRIA 1Y1SA 2SNIE 1FTYA 1BWRA 1H5UA 4FMDB 4F3NA 2WJZB 2K2QB 5JCZA 3HJRA 5TR9A 2CXQA 2WAXA 1UXIA 3NTXA 2BGMA 4NESA 1R3DA 3RSOA 2VHCA 3RF6A 1ZISA 3VR3A 5CB4A 3C98A 5HUHA 2I22A 5PGMA 3P2OA 1PR9A 2YVAA 1P1CA 3NOVA 3AF6A 4QGGA 5CDFA 2UVPB 2P4SA 1HG0A 4G0ZA 3WGQA 3S28A 2ZOSA 2AQHA 1L5OA 4BWVA 4FM9A 2XNDA 4IHJB 4FDVA 3CZ5A 1NQAO 4YNBA 1G9SA 1HTBA 2QSJA 3DXFA 4QTZA 4LNUB 4DQ0A 4FHZA 2I54A 2E6KA 4PBRA 4DWJA 5L3SB 4GF5A 4B8WA 3C15C 2XHZA 1THTA 4CCYA 2BHTA 3I2KA 3I9V6 3OFJA 2QTTA 2XDAA 3B6IA 5H02A 2Q3HA 4O2LA 2ZE6A 2NQTA 4LC9A 4I6JA 3IRUA 1NFQA 4RHUA 2IW3A 4I4LA 4JODA 4XLTA 1DG1G 2Y1FA 1NNSA 2A9OA 2AFIA 4ZQBA 5DMXA 4JI7B 1XMJA 1W7AA 1GWNA 1G21A 4JELA 4ZVKA 1RWXA 4QEKA 4UMEA 1HTTA 3BWDD 3KV3O 4H4DA 1M6NA 4QECA 1UIRA 1OTHA 4UVGA 5FWAA 5MN5A 2ZVPX 2Z3ZA 4BNDB 3SBEA 4C4TA 1IOVA 4W7IA 3PI6A 4B6QA 4CMJA 3AW9A 1DFIA 2W71A 2QQFA 3KZVA 2F8TA 3KBOA 1CY6A 2D2VA 4DLXA 3E27A 1QGZA 3O5AA 4IIBA 5TPZD 3ZWOA 4YFVA 3ZZ1A 4HFNA 4A1FA 3V7YA 2AZXA 1ZK4A 1OVMA 2Z8XA 3DBLB 5CFNA 5K6AA 1OLXB 3G9XA 4F04A 2JH8A 4FHGA 2EATA 2FZVA 1QVVA 2C5AA 2IA5A 2JVIA 2HF7A 1FP6A 3X1JA 2FF7A 2ZJOA 5LQMA 4BY9E 4ZJZA 5DYNA 1E1LA 4X8HA 1MN6A 1R6UA 2NUAB 1DBRA 2GNPA 3WBBA 3QU7A 3QUQA 2QM7A 1TQ2A 3Q6NA 3W5HA 4CKCA 2RHDA 4LVOA 3OOSA 4Q6WA 8ADHA 1DX6A 4LOJA 4B74A 3TF5A 3UXMA 1CJCA 1A7KA 3AUSA 3H4VA 5IAKA 4FXOA 4HSGA 5JNTA 5C51B 3T4PA 2X1VA 4REOA 5ENZA 1PGQA 2GCNA 1PQ4A 3G5MA 2AG6A 2VF8A 1PNVA 1U6KA 3BDAA 1EK6A 3H5NA 4JB0A 4R8SA 1LQ2A 1T34A 3O4HA 1RWNA 3Q15C 3V4PB 3U5TA 1JDNA 2O0LA 3HJGA 4HYYA 3ML1A 3ON5A 1LBEA 3ANSA 1UXJA 2WM2A 4O4JF 3NVMB 3QY0A 4L4RA 4EPVA 2QX9A 3OTWA 3PHBE 4W99A 4MHOA 1SPXA 4XX0A 4EUKA 4LBZA 1BEUB 1TAGA 1NBWB 1YAHA 2RCYA 3UAGA 3H13A 1K5DA 4UFNA 3NUZA 5CPBA 5ALLA 3S99A 3ZIAA 4B3HA 1D1QA 1FFAA 5GGXA 2YJ3A 2C5EA 1FX0B 4L7VA 2X76A 1PWZA 2MSEB 3GT0A 3UOWA 4C5AA 4DJEC 2R1VA 4MS1B 3EQ9A 4LJ9A 1DT5A 1TZCA 2X9GA 4Q00A 4W9NA 2QLNA 2A9JA 4UNPA 5JDCC 1KGDA 2XLCA 3TRHA 3V42A 4E2WA 4CEJB 4Z2YA 5A4JA 4MJLA 3DE5X 4A2CA 4HR7A 1Z4QA 4LRWA 1PR6A 4TS1A 4LZLA 3T41A 1XEXB 1GLGA 3CNBA 3TR6A 4C7KA 3CEHA 1N5JA 1QLHA 4M1MA 3OHPA 4PQYA 3G82C 1X2EA 2I6QA 4WVFA 2G0NA 3F71A 3TRKA 3O4VA 4MPDA 3AIMA 3U4QA 2PV7A 2QTRA 5ESWA 3K0SA 2ZREA 2CD7A 3ZWKA 1J1IA 3KZXA 3T7KA 4EHIA 3A36A 3H9EO 2AXEA 1TQDA 3PFNA 1UKVY 1PJSA 5EJGA 2OUKA 3K4HA 2GI4A 3ZUPA 5IVKA 3AB3A 1KMQA 1ZQ1A 3LGAA 3FY4A 5JMWA 1OH7A 4NDNE 2VBGA 3IPYA 2LVBA 3BIFA 2Q7DA 1U6IA 5TXGA 2OD9A 3G49A 4W8HA 3WJAA 2Z0MA 2JI4A 1E9FA 1NM5C 5TF4A 4M7WA 2VPXA 2AK3A 5F1KA 4ZU6X 2WMNB 4BNXA 2IE0A 1EJ6A 2QMUA 5L9AA 1COWA 1XDSA 1N7GA 1IPFA 3A1WA 1Y1RA 2WSBA 4CKYA 3AYXB 4US0R 1EX9A 1Y89A 1AQUA 3I28A 5JE8A 1N6KA 5DRTA 3QI7A 3FRHA 1NF9A 4W5WA 4U6NA 2P9EA 4XVUA 3PKZA 3RNLA 3LLMA 3A1EA 4R6XA 4WKNA 1OROA 1ENPA 1XI2A 4C0SA 4KJZA 3GRZA 5DLEA 1ULBA 1YQEA 4AF7A 4E5PA 3DMTA 3IP1A 4AF6A 5T8KC 4DR7B 1SIOA 2CHFA 1RBMA 1QWSA 3N3AC 4PG7A 4KPEC 2AX3A 3FZEA 3DBVO 3C5VA 1IWOA 1A8QA 3BL8A 1NRWA 3SI7A 4CTNA 5KYWA 1T6NA 2V0GA 4YIKA 3IOYA 1DPGA 2WSYB 3ZIUA 3ER6A 2CBXA 4XSHA 3IE0A 1BE1A 1YONA 1DXYA 5JATA 4C2UA 1RRMA 4ZO9A 2JBAA 3RAPR 4ZAWA 3HTXA 4EY7A 5JJKA 3I45A 5HIJA 4FEEA 1U9IA 4H4EA 3AG5A 2YYAA 5C7YA 1M3SA 4YROA 3HYRA 3W34A 1FA9A 1WJGA 2P9BA 3PXGA 3T3EA 2DFTA 4LZPA 2VZ8A 4GPEA 2VBCA 4YT5A 2XUAA 4Z4EA 3FYUA 1OTXA 3CUUA 3KJNA 4BJ1A 4D4MA 4HAZA 5HRAA 4B7AA 4EM6A 5CBPB 4MVJE 4MUXA 1C9DB 4DNOA 2PBLA 1JEDA 4AJIA 4AO8A 5KBYA 4IJMA 2FGJA 2UZ1B 4XGQA 5I4BA 5LU9A 4CQLA 3CNLA 2Z6UA 1N0HA 5GWXA 1Z7WA 2IEYA 4U2KA 1V26A 2V59A 1QF9A 4G9BA 3G2KA 4OX9Y 4AJOA 4DBZA 1FJ2A 1RM4A 1FNCA 4GQIA 4JKIA 3TL6A 4FFBB 1TUEA 2CXPA 3FUCA 3PBKA 2EGHA 1WNTA 4JOCA 3VZPA 1W85B 5D5HA 1E5XA 1JEQB 1VLQA 2RKOA 4J07A 4E7PA 4NLLA 1OT3A 2WTMA 3RSFA 3OJEA 2Q6VA 4IDCA 3V55A 4CGYA 1KAGA 3I04M 4V1CI 4ZVRA 1A4IA 2ZYIA 1U3WA 1XZNA 2QM3A 4JT4A 2D0PB 3BN3A 4LPSA 4XSVA 1PQYA 3WLLA 4Y6GB 2QWXA 4KPYA 2A78A 1X8XA 3TSYA 3WRVA 2R6FA 4N47A 3ZE1B 4C4YA 3IHWA 2UXCB 5FBHA 1F14A 2OCDA 3CZRA 4IPTA 2FAXA 5K0ZA 3DUFA 4IHJF 1FU4A 1GU0A 1IY8A 4EKIA 2YXLA 2HOQA 3AM1A 3OIVA 2J8ZA 2Z5FA 1UKCA 4OHYA 4Y2YA 2FV8A 1TVKB 5DU2A 3MTIA 1MX5A 3EOBI 2ZUVA 3PNYA 1F06A 3O8RA 1BHQ1 1H4TA 1SCUA 1VCIA 1DAHA 1YTLA 3HDYA 4Y1FA 3KP1A 2DPHA 1GZVA 3F67A 5IU6A 3MWEB 2VQFB 2C2HA 1RQPA 2Q9CA 1AURA 2CKMA 3QG5A 4FYWA 4CMIB 1TO2E 4YLGA 1MOSA 3UMVA 3EJ6A 2MMCA 4IV8A 4A73A 2OHXA 4AMVA 4B6FA 1YR1A 1AKTA 3QMWA 2O1EA 2AG5A 3FN4A 3HP7A 4DW8A 2ECQA 4EF5A 3OAAA 1RD4A 4AD8A 2P9QA 4B75A 1IZ8A 1YZFA 1G8KA 1AG9A 1TOAA 2W2OA 1A9TA 3NYQA 4MPPA 2FZWA 5JWOA 2YWEA 2KHZA 5AVSA 1I7NA 3IHTA 2XCLA 3MMPA 1N25A 5G3ZA 3WIOA 4XEHA 4TKMA 5CM2Z 1PCXA 4MYCA 3PEVA 4XW2A 4AJPA 4ETMA 1WBJB 3GLFA 3NHLA 1A8SA 2IXDA 5IS2A 5FHRA 2F8MA 3EFOA 1EQUA 4PQGA 4WZAE 4RIIA 1KIFA 3ETHA 1KJNA 2RBKA 4RZ3A 1F12A 4LGVA 5EJ9A 2Q4RA 1Z3IX 1EUCA 4P2GA 1A3CA 4FEGA 2CVZA 4DLPA 5JBIA 3PLNA 1RWOA 3U5ZB 2C00A 5G4KA 1IONA 2F90A 2EV9A 2Q6IA 2GCPA 1IJFA 1T2FA 4E70A 2ZQ5A 4HQNA 4R0MA 2JI6A 4JB8A 3L7DA 1DKQA 1X1QA 3TNFA 4CZ2A 2PL3A 5LLTA 4I4TB 4RO0A 3DZCA 1Z16A 2Q1YA 5JI2E 4PSCA 4LY3A 3FKJA 3ROPA 2V0NA 2DH6A 3DKKA 2PHZA 1E3TA 2XT6A 1P7VA 1B8PA 4L5YA 3LJKA 4Y3UA 4WCFA 3W7VA 4BLVA 4HV4A 3Q4GA 3OUTA 2VCEA 4D8VA 1GRCA 2OM6A 1M2NA 4M1ZA 1E1DA 1CQZA 1FDIA 1XQ6A 3BMNB 4MS4B 3UAOA 5A9SA 1BXGA 1FW8A 1V3TA 3U16A 3HDJA 5FRDA 3JQ9A 4HGOA 3HJHA 3GUZA 3UV6A 5JPCA 4ZALA 4IJ6A 2W70A 3ETNA 4QO8A 4G5OA 1GADO 2XQJA 1AUXA 1XKLA 4N41A 4JYBA 4CMHA 3Q8XB 1N1EA 4ZI3A 3P0HA 3OIUA 4GAEA 3A6HA 4HNHA 5AM3A 1U2DA 1E99A 4NOKA 3TNLA 3A1UA 2YTZA 4X8MA 4L78A 1VL2A 4L9RA 4DR3B 3DMDA 3C4QA 5SYMA 4BQEA 7REQB 5JI3E 1XRSB 5JCJD 1E2HA 1EVEA 4DA0A 5BV8A 2JFNA 1YZYA 2XGOA 4RNDB 4KQ2A 1F5SA 5BYJA 4J0KA 5IT4A 5B37A 3K05A 3PX3A 3TZ6A 4TXNA 3ESCA 1OAAA 3I58A 3BQMB 4TSRA 1L8LA 1W4RA 3VSBA 1EZ4A 1T9BA 2HMSA 2YY5A 3TS1A 3VKFA 4F9TA 4MICA 1NASA 1IXKA 3GFSA 3NBYC 4Z4HA 4YAEA 1R15A 4UFOA 5JCXA 1KHTA 4I8XA 1FRVA 5AKEA 4LYJA 1QIEA 3A6PC 4NZPA 3UY4A 1NW4A 3ZHOA 2H2DA 2OK7A 2VBIA 1TTPB 4HRYA 2GR9A 3SEAA 1Q7CA 3L6EA 1YDWA 1O87A 2CLOB 4GLFA 1FDRA 5GPBA 4AG3A 5HQ3A 1AQIA 4Q4CA 3DXYA 4MO9A 3ADCA 4KH1A 3UFXB 3MAAC 1P4JA 4UPEA 3PUWA 4UZEA 4E22A 1AKWA 4KPGA 4JOSA 2ZI9A 3KKPA 1OQAA 3QLUA 3K6SA 4OGGA 3HL4A 3BORA 3AWDA 4PY2A 1KJ8A 4P84A 4R83A 3EE6A 1GA1A 4KG7A 4JBGA 1XDUA 4BE4A 2YVLA 1PQUA 3QWAA 4S35A 4TWAA 3LG2A 4FZVA 4LXGA 1NR5A 4XIFA 6YASA 2A5JA 1UR5A 2HU7A 1TCUA 2W6ZA 4MW9A 5I7SA 4JL5A 1TKCA 5KPJA 1D04A 1UPAA 3F4LA 1LVGA 1RT9A 4QDOA 4D4LA 2XYRA 2Q7OE 4HEHA 3SR0A 2P5SA 2B4TO 3H83A 1I01A 2WYHA 3TLJA 1Y1KE 2RI6A 4OHKA 4NQZA 4RHCA 4H1UA 4DG8A 1TJPB 3R7AA 3VVBA 1ZRSA 3PNOA 5C7LO 1EDBA 2O2SA 2YNMC 2DFNA 4XOUA 3PK0A 4A5SA 3B1WA 5DKFA 5LB2A 2YINC 3WLHA 3EZ6A 3MGGA 5JO9A 3S40A 1PFYA 5KC8A 3M6FA 3AO0B 3RRNA 1GKLA 4KXQA 4R31A 2HDHA 5JWRA 5A9TA 4DV7B 4K6CA 1YL7A 4OQLA 1AO0A 2CZCA 1XMOB 3RABA 3QLVA 5TE9A 4OYRA 4G8CA 3F7NA 5HOEA 2VNJA 2PZJA 4A10A 3NTQA 1NG1A 3A28A 4LAFA 5IUKC 2KS6A 5LBTA 4IOKA 5CXQA 2RGGA 3IP6A 4M7RA 4EAQA 5FPTA 2C9CA 1I9CA 2RH9B 3BWMA 3IKMB 2XD4A 3CWZA 1Z8HA 3NHSA 4I5EA 4S2EA 1FE8A 4C0QC 2R2AA 1I13A 3COYA 4LY6A 2J3EA 1OYOA 3WQQA 3F3SA 4GVXA 3QX8A 4N5DA 1BOFA 3QU9A 2C9ZA 1Z37A 3V48A 4OLFA 2Y6UA 4KO8A 1G64A 1KWGA 4MDEA 2P79A 1K66A 1IB0A 4LRXA 1BFUA 3KLNA 3GFFA 2CMDA 1L1RA 2AQKA 1EHCA 2QNBA 3G0CA 3GUYA 3HE3A 4HPXB 4PC2A 2RAUA 5AXCA 1LDGA 1NI5A 3C6YA 5BUCA 3TNJA 5KVSA 3RO7A 4JI6B 5J63A 3EODA 2P5UA 4AM8A 1QVWA 4TWBA 1QUEA 4L5IA 4JSYA 1OUMA 3QVWA 4OKNA 1XNRB 2R7AA 1L7DA 1ZJ6A 2ODAA 3UJ6A 1EFHA 3LWDA 1G19A 3FLMA 3TSZA 1AK9A 1RYNA 1B1AA 3OKAA 1TA4A 2W48A 4U5XA 5T5QA 5B3JA 4BNGA 3GRUA 2VDOB 2POQX 4WJLA 4UATA 5AJHA 4WZZA 3PRJA 3X1WA 1YRYE 1HE5A 2QY6A 1GL6A 3DHNA 1L2TA 3I6YA 3QXXA 1JEYA 3WB0A 1VLHA 4RZQA 1LI7A 4IBOA 5GOTA 1AD2A 1EGQA 4WJZA 1FNDA 2QY9A 3BJIC 2P9TA 1Y48E 2YCBA 1XCOA 2Z5GA 4DC0A 5K6TA 5MF6A 3CY6A 4GQBA 2ZJ5A 4Y2JA 5DVZA 1YZ3A 3HFSA 2JRLA 3W05A 1GQSA 4FGZA 1Y1TA 1D0VA 1J97A 2ZATA 1JIIA 4OFZA 1SVOA 1ODJA 2UZ0A 4AKSA 3EISA 3ZE6A 1WOYA 2XYHA 3DWFA 2BKAA 3OMXA 1T4BA 5EQTA 2NPFA 4EA7A 2P2GA 4ZWNA 2GD1O 2VYQA 1EX6A 3DFKA 5CVCA 5F4BA 3T1OA 3OKPA 3AYZB 4QELA 4R5MA 4W9NC 3WICA 1XU4A 2H7XA 2ZETA 1M2JA 1TTTA 4O59O 5IULC 1TAUA 1PYDA 2C1EA 3ESZA 3CONA 2BZ1A 1PEYA 3D6MA 3TCXB 3TLZA 4CUJA 1DQNA 2R0QC 1HG1A 1YIAA 1IYZA 3KXLA 4Y2TA 3NBXX 2HZBA 4P7GA 2CLCX 1YQTA 4I1SA 2YW9A 1GPLA 1ORVA 2UUPA 3S3TA 3EZNA 2PT5A 1F3LA 1JSXA 2I8AA 2HJVA 3RJ9A 2RD2A 1T2NA 4DA6A 1RYMA 4EEZA 5JSHA 4MRVA 3CEJA 5CBKA 5EMMA 3CVYA 2H92A 3DV9A 1N5MA 1EA5A 2K4MA 4RH0A 3WGUA 2HYIC 1ZCFA 2EBUA 4WNIA 1CK4A 5DHSA 4BASA 5F2NA 2A9VA 2WNIA 3BHIA 3BQNB 3C3XA 3MMSA 4J0QA 1HFJA 1RRGA 4P82A 3OWHA 1ZOOA 2HSWA 2XJ9A 4PTYA 3FDFA 4RTSA 3I6ZA 3WV4A 1ULAA 3QHPA 1FQKA 4I4TF 1G66A 2HU2A 1IBKB 1OF1A 3UT6A 4ARIA 1WXWA 2XUQA 3OFKA 1CUHA 3EZ7A 5AYVA 5JVDB 2JJ1D 5ALFA 3K15A 3HO8A 3DTTA 4AJ1A 4E2YA 3MPUA 4OL0A 4HEA6 1Z2DA 4MSUA 3O2JA 1QIFA 1AN9A 1XP8A 2AZMA 1BCRB 3NEJA 2XT9A 3TAHA 1ORDA 1FDSA 2XA1A 3QW4B 4QDKA 4XLZA 4JEUA 5KSPA 4B3XA 3EYWA 5JNWA 4IRXA 1YAJA 2X1MA 1U7PA 3AR4A 4LHXA 5GQSA 3NBZC 4G2NA 3MUFA 4OU4A 5E7IA 5KDDA 4RTLA 3X1ZA 1KO4A 3AEKA 4ZAXA 3VNUA 1Z0JA 4RAQA 1JEJA 3AZPA 1XUOA 1MOQA 1NMYA 5DTEA 1WL8A 4WLFA 5TJHA 4I1PA 3DMTC 2OLKA 4XYMA 3IBTA 5AK6A 1OD6A 4UQLA 1FNBA 5FNVB 1KEKA 2X1LA 2HNAA 4M9UA 3JQ8A 1WNFA 1ZJJA 5IW8A 4EJ6A 4EGFA 2B92A 4UVEA 1Q15A 5DX8A 1DBIA 1BDBA 2PE5A 3M33A 3OF2A 2IUFA 3DE1X 2HWYA 3DS8A 3INGA 2VTBA 1G8FA 2O59A 1XRMA 4JB3A 1TIBA 4Q9HA 4RGBA 3T34A 1DTEA 3GQBA 3LCVB 2GF0A 3CW8X 1DPFA 3WRYA 1V1RB 2RGAA 2Z8YA 1LFAA 3U9TA 4EYSA 3E81A 4P5PA 3RSQA 4K9RA 3LZ6A 4V3CA 3WWZA 1R5OA 3FWKA 4KUHA 1CF4A 4CCSA 3JY6A 3VO1A 3FYUC 4QUJA 2J6HA 4E1AA 5CFQA 3M1YA 2V9CA 3LQ4A 4FR2A 5FLEX 1XLVA 1NMXA 3QVKA 1PJBA 1TMYA 4ANFA 1ABBA 3ADPA 2EYUA 2X0RA 2ZIUB 2ZIGA 3B53X 3EPLA 1ST2A 1Q5PA 1NJ8A 1XB2A 2REXB 3JD0A 1KXZA 1XAJA 1NSYA 4DEXA 2P3OA 3JZMA 1RYBA 5BSEA 4QAJA 3T4EA 3GOQA 4IAOA 2GA8A 2VK4A 5GINE 3ZGYA 4UTVA 3TIFA 5FEUA 3NHPA 4A8PA 3WB9A 2B3TA 4AZSA 1G9TA 2I4NA 1ZN8A 2JC3A 4QUIA 3RDPA 5K3EA 4M9SA 2XB8A 2FDXA 1FUUA 3RIGA 2N75A 1U7ZA 3AM3A 4WE3A 1X7YA 3PE6A 2C5LA 5B4TA 1SHUX 3L0PA 2FEXA 2WMOB 2WIKA 2Z9BA 3CZ9A 3SE0A 3WSWA 2QAIA 4IIEA 2BLNA 4OJQA 1TU0A 1JDZA 2Q2OA 4K81B 4C7VA 3BXXA 1O4WA 3E7FA 4FYXA 3SSOA 4B09A 2E5LB 2ZB3A 3NJ8A 5JY6A 3FRIA 3G7NA 4M1WA 4MA0A 1PFVA 1YDMA 2QVLA 4Y1EA 2R2GA 1J8FA 3S8MA 3MM4A 3LRXA 4QDUA 3SVZA 3W6ZA 4FILA 2O1XA 3D4IA 5B4VA 2OLJA 2AQIA 1X9GA 4YAKA 3EOAI 4R1OA 1YFKA 3CVOA 4LX0A 4UCXA 4ZC8A 4MIOA 4YMSA 4CQJA 4YUYA 4OEHA 1K06A 5K3DA 1UQTA 2BH9A 2A1TS 3T1QA 4L22A 2B37A 4Q3CA 3UHFA 1NAHA 2ZGVA 4HDOB 4R68A 5GJVC 4B4UA 4U7GA 4N48A 3MRSA 5EWLA 4YRDA 1LNQA 3BE8A 3S6JA 4E33A 1E4OA 1PJCA 4V2IA 4AJJA 2V4UA 4I1YA 4F3RA 2YV5A 1TVCA 3CR8A 3DEYX 1T35A 1ZUIA 2SHKA 4FS3A 4GOND 5DXAA 4DJFC 5IJ9A 3ZDBA 1QYRA 2GRAA 1IEXA 1KK1A 3FFAA 4CM4B 2CJYA 4OGWA 4XIGS 3NAMA 1WCWA 5TMDA 2BFCB 1DAOA 4BIMA 1TCVA 2H1OA 1IXRC 3SQDA 2GASA 2XBUA 1CULC 3D4LA 3ESQA 5KWVA 1TQHA 4UHCA 3A3OA 2GPNA 4HTFB 3I01M 5M34A 1JWLA 1T5TA 2M32A 1YHYA 2QJRA 4RTQA 1HY3A 2QL6A 2ZIZA 3MT7A 5KVCA 3HR7A 5AVVA 1FC0A 3KJFA 4C2AA 4WCFC 2QU8A 3ZTYA 1GKIA 1TCCA 1U1CA 2XZPA 1GA4A 1ZUWA 3O8LA 3KSUA 3R7DA 4MVCA 5CA1A 5SZJA 3R7BA 1HLGA 4JJKA 2PUCA 4ZZ3A 2I2FA 3JQ9C 2C7RA 1P6UA 3QP9A 3UWOA 2CB0A 2JD2A 2Z2IA 1U94A 1E9DA 3GLGB 4WKOA 3RIEA 1QZZA 2I4RA 3E5HA 1DJPA 1YQUA 4RSGA 4OYYA 1E94E 2UYGA 3MT9A 5FOXA 3NTOA 3OZVA 4A0QA 2O0JA 5CDUA 3IQDB 2B1JA 2OR3A 1U2DC 4XARA 4BX2A 1QTQA 2R62A 1URPA 3M2PA 1NURA 1CY8A 5JCJA 3WLFA 2QTNA 1X9HA 2HXSA 1L7OA 4FMBB 4A9AA 4YT4A 1CKEA 1D6JA 2HIAA 2JD0A 2MDTA 4BMVA 4DA8A 2QG9A 1ZR2A 3EVTA 1QRUA 3VR4D 3TBFA 2BTEA 4QX6A 2V7QD 1JLMA 4WBNB 1CUVA 1VKJA 5CDHA 3Q3IA 5EJIA 3MJDA 3RW9A 4X6UA 4I9NA 3P2EA 3OUUA 2FEKA 2RHLA 2WZBA 4BB5A 2V3VA 2DPYA 3S7TA 1M6WA 2B78A 3MCUA 1JXAA 2HGZA 2JF0A 2PX0A 4BRUA 3DE2X 2G1PA 2HF9A 1VSUA 5E6RB 3KE9A 1DCTA 2C20A 1A9SA 4ZEWA 3QELB 2OK8A 4OHXA 1ARZA 1BOOA 3D3EA 3HDHA 4JR0A 3FCXA 2QIOA 3TE7A 1T8UA 1WCIA 1BU8A 1FK8A 2XY4A 2H16A 2PKXA 3QEMB 4M98A 4PQFA 4D46A 2QP4A 1TZMA 3RR2A 4BEBA 2QJFA 4YFYA 1Y5IA 3IAFA 3JATB 3Q7SA 1ML4A 3ODPA 3QLUC 3QMMA 2PS0A 4D79A 4MB0A 4MARA 3SS7X 2O19A 2OBMA 3VVMA 4EO7A 3G2JA 2PSFA 4V0LA 4W8OA 5MDHA 1K3TA 1IWBB 1FFBA 1F8GA 4RTNA 2JGKA 3NHMA 5JVDF 2WM9B 2J45A 2PL9A 2FUKA 3E82A 4IIGA 1D07A 1H2EA 1UK9A 3RVOA 4EUFA 2BGWA 5EXSA 1TM2A 1L5SA 3GLRA 3G0IA 3D8HA 2GJ9A 4X6YA 1QE0A 3UK6A 1X1AA 4AYXA 2ASEA 5EXEA 3E1KA 2Y68A 1QZTA 3BMCB 4D9IA 4HZUB 4BQFA 4P93A 1U3FA 3IJEB 5FQNA 4KNWA 4L6IA 2PNFA 3JVDA 1DCKA 1A77A 4Z9FA 3I4LA 1J33A 3WIDA 1ZESA 4ZODA 3JPWA 5FNVF 3ETDA 1JA1A 3PP8A 4HNUA 1OXMA 2GWRA 3PIRA 2B6HA 1TJ3A 1JKFA 1LQTA 5DWDA 4C88A 1TFRA 3UC9A 1EUDB 3QLVC 4PLTA 3NOOA 3NB0A 1CZKA 5T6BA 6CHYA 4OXRA 4EOGA 3SM9A 5JS7A 4WT7A 2CWDA 4CLOA 4ZDKA 1ORRA 4K9NA 1RRKA 5KS2A 1Q77A 4AXBA 1ZIOA 2JVKA 1OBOA 1V5EA 3IKTA 2HZ7A 3BE5A 1SUBA 3LVRE 5CB0A 3PXDA 1GVHA 4I0WB 4DV6B 3V8PA 4ZGBA 5FTMA 1VIYA 4DIOA 1VCOA 3OQIB 5DGTA 1CT9A 5A9RA 1JYFA 2B20A 5FFNA 4QBHA 5H4GA 3WGKA 1BX1A 5FTKA 3NW9A 4BTEA 4IDEA 5HMMA 2JAHA 3KT6A 3MINA 1J56A 2LDBA 3SOPA 2IS2A 2Q1TA 2I7TA 3TGWA 1KDRA 1N9GA 3I83A 1RRVA 3A4YA 4AJNA 1U1GA 2H3HA 4EY4A 3JAKB 3AUXA 3ZHTA 1OCEA 1U7WA 4NATA 4LK2A 4K86A 3WWCA 1NPTO 4LXHA 5BRJA 2IXEA 1QE5A 2HL6A 2OM2A 2HWWA 3K9GA 1PG2A 1YA6A 4C7BA 2FK7A 3TIXB 2GBIA 2X0IA 5B3JC 5BN4A 1T15A 1WSAA 1Z4NA 2FSVA 3MHPA 4QEZA 1E6MA 1VBFA 3GBVA 3IH5A 4PG6A 3SR3A 3ONVA 3PXBA 4CUZA 3W5AA 2C9MA 3KZCA 3R7LA 1LA2A 1ADJA 3A1DA 1H3NA 3A10A 3ET5A 4RHEA 3KSZO 1DBQA 4OXKA 3UHAA 3SQXA 1C4KA 1M2KA 5JRZA 4DDHA 5HVNA 3IQXA 1MB0A 4MR8B 4JJEA 2CFTA 1LLFA 4X1KA 1IK6A 2RJ3A 3DF9A 1YOVB 3QITA 1ZGZA 4MUIA 4YPFA 4DMRA 2J7KA 5ULLA 4CFSA 3D4PA 4Q4DA 1OI7A 3GEPA 5A5GA 3GJYA 3KL4A 2BEVB 3U4AA 4L3VA 2BM8A 2R1UA 3IXMA 3QVVA 1KYQA 3JD3A 1U2QA 3TX2A 1SK9A 4HZGA 2NV0A 1EK0A 1E6EA 2FKNA 2H59A 4UUQA 1VA5A 3ZWQA 1B1CA 4G1BA 3U3JA 1W8DA 1E5DA 4E08A 4HNVA 3WJ1A 5F64A 1ZFNA 2JLBA 1UDAA 2C04A 2OZLA 4N76A 4JLSA 1DFHA 1L4MA 2PTHA 1AUPA 1X7ZB 2J9ZB 4DCJA 2Q5LA 3GELA 5KYKA 2W2PA 2WVJA 3FYDA 3VJMA 4XUCA 5AH0A 2HI0A 3O2SB 1KEWA 3NNDA 2Y05A 3DULA 2CY0A 1O9BA 1U11A 2HWUA 4HC4A 4Y9UA 1FFGA 3NWPA 4PSUA 5K0NA 5FJJA 2CLMB 2C3YA 3E1GA 1EDOA 1VI5A 4WUTA 4BQQA 5M3BA 1SUIA 2IU0A 4BAGA 1RXSA 4M0EA 5DYTA 5C7OO 5KTTA 2WSLA 4DE5A 3KB6A 2VXCA 4XIYA 2R8EA 4CV2A 2HWKA 1UBFA 1FTQA 2FZGA 2FZLA 3GZJA 1TLTA 1D5CA 4MXDA 1TYZA 3TTWA 1TUIA 4QU9A 4GOOD 3FTEA 1WB6A 4F1KA 1YD7A 1R5BA 1DE0A 1JSCA 4R1PA 4BVFA 4R54A 3ZBUA 4RCYA 1Y1PA 2G8NA 2XVZA 1BJTA 3C3CA 3DMHA 3M1IA 3PQ7A 4YP7A 1NDQA 1GZ5A 2OVFA 5JAZA 3N5KA 1KQPA 2EHDA 2JJ1A 2KMLA 1KS2A 3DKPA 2EWWA 3FDIA 3H5OA 3L5KA 1G2IA 2FFJA 4HB4A 3I5YA 1R8XA 1KFBB 1JHZA 2BE7A 5TS3A 5JAIA 1JVBA 2VP9A 1ZD9A 4HH3C 4IGIA 3A1SA 1T1EA 5JBQA 4H7PA 5D84A 1J5EB 3RHTA 3RLFA 4N1AA 5CVEA 4EEKA 2K7ZA 4PICA 1RJ9A 1P8JA 1WZNA 3K1AB 3BAZA 4G25A 3VR2D 1N6HA 2A5DA 3PNKA 2BUCA 5CNMA 3RGGA 1YZQA 1UJBA 5BUSA 1PYOA 2J0QA 2X7HA 2WIGA 2R8BA 3JQQA 2ZYAA 1OI3A 1SG6A 1ZKMA 2Q99A 1AZLA 1GR0A 2WIBA 4LXYA 4TYPA 2ZI6A 2WFAA 3T5GA 4RM2A 1IU9A 3AB7A 4U7WA 4R01A 3O26A 3I52A 2IV3A 2QAJA 3OCWA 1KEPA 2GHQA 4XQGA 2XT0A 5IKPA 5CFLA 5T64A 3BYZA 4HVTA 5HQ3B 2DPLA 3SXUB 5A05A 5CCDA 3E15A 2CUNA 4FGSA 1R9NA 1V7CA 3F8TA 3SLKA 3VISA 3ILXA 3IV6A 1GKYA 2XCTB 1IXYA 1GL9B 3WRYC 4BZPA 2QM0A 4LNAA 1P7YA 1PFKA 3G59A 3N7TA 2NU8B 1QS0A 2VDMB 3NAQA 5LMNB 1PS9A 2R8OA 3KB2A 3T9FA 1JSLA 1I3NA 4NX2A 1D1SA 2TMYA 1XVVA 2FN9A 3UG7A 4HDRB 3HUFA 2OOSA 3IMCA 1GG9A 4OMFG 3RC8A 3QXHA 4GZLA 4JD5A 1NJ2A 4OJNA 4ZI5A 4TSFD 4U7PB 1PR0A 1SVNA 4E12A 2JFGA 2XYVA 3MRVA 5I51A 5B7NA 1H0RA 5CH8A 3O4FA 2NWQA 1BEEA 4LK3A 5LQDA 3C6QA 4JNCA 1JHYA 4D57A 4H4CA 2FPRA 4N0PA 1FY2A 4NPAA 3E58A 2ILVA 2IYSA 4ZA2A 1L5LA 5LP6B 1N34B 3VHQA 1G20E 2PL5A 4B6JA 4XYEA 4PINA 1JXMA 2P5TB 3VDXA 2OL4A 2ZRMA 2XH8A 4EB0A 3D4OA 1M8KA 1GNRA 1NTOA 2ZFUA 3ABQB 3VNSA 2UKDA 2Y1LA 1BE8A 1Z0IA 3KDSE 3LWBA 2QX4A 5KTMA 1QAMA 2G77B 3KJZA 2GO1A 4G09A 3R3SA 3TLGB 4DT1B 5HUJA 3ZDDA 4I6GA 3MAGA 3FVQA 3QFSA 5BWLA 2OE2A 2E18A 5E0KB 2AJLI 2QE7A 2RJOA 3Q41A 4FQ8A 3IIMA 1GSOA 2HQ1A 1KA9H 3I3SR 3NVDA 4J0DA 1CJTC 3ZHBA 4S0XA 5JHGB 1AGXA 2IZZA 4JU9A 1Z5WA 2Y3IA 3SZ3A 1SVLA 1SU4A 2E4ZA 4HQ0A 1KVQA 3OQ1A 5EMHA 4H1WA 5BW8A 1R3UA 3PTZA 1NW6A 3UJPA 4F8YA 2QT0A 4J8PA 4MUYA 1FZTA 1FNMA 1EB9A 2H07A 4NEQA 5AVXA 5E2AA 2FUNB 2CLHB 3P19A 3NT5A 1HNNA 3U0BA 5EKXA 4ETWA 2O8FB 5HTKA 4PPGA 3D5EA 4R9UC 3UAYA 3F73A 3LCCA 4IIXA 5DDIP 1SKAA 4MI1A 2XUGA 4OHWA 3FGOA 1CQPA 1M5TA 2QTZA 1JBQA 2K6GA 1EXNA 3G5TA 2ZM6B 4A0GA 3NO4A 3CWQA 4OBBA 4QFDA 1QIHA 1MC1A 4MPRA 4EJSB 1IVSA 1NYTA 3K16A 4W5NA 3E8SA 1IOLA 2JASA 2PUHA 5K0EA 1VQ1A 4F3KA 3HXQA 1Q20A 2AKEA 1I5EA 1E2EA 1OYWA 4RGYA 1K7SN 4AY6A 1W87A 3P9PA 3WX0A 1W49A 1WHSB 1VE7A 1Z5GA 1HBJA 4XD7D 5EFOA 3CTMA 1P5JA 1QC5B 3BD8A 2CVFA 3L5OA 3LHSA 3OM9A 2IUYA 4HDAA 1ZDMA 4MAAA 2V5UA 1HFWA 4L6CA 1RQ7A 4IEFB 3WAGA 4H7JA 4D8UA 1VL8A 4JH0A 4WXHA 1K6XA 4OXQA 1OBCA 4RL4A 4EG3A 3CN7A 2R9VA 3H1BA 3WSTA 2GLTA 4PNPA 4QVIA 2XLBA 5TY0A 1FFSA 1W46A 4AYTA 4P3YA 4CLHA 4EY8A 1AK2A 4U2GA 2I3DA 4G65A 1QP0A 2FE1A 1C7EA 4C6SA 1ZEJA 4GUAA 1GGEA 1HDIA 1N6RA 3MSXA 3OJXA 1KYXA 4FP9A 3H18A 1JDBB 5EZQA 3TUJC 2BL4A 1NRXA 1QGDA 4H7KA 2R5WA 4O2RA 3ZTTA 5ALZA 4NCXA 3OHMA 3PFHA 5AUQA 1CY1A 4JBHA 2AN9A 3LOPA 1EH5A 4ESVA 1N2XA 5JH7A 2XNSA 4LFBB 3FLAA 1P2GA 1Y81A 3H04A 4P7FA 2GKGA 3C5HA 3CX3A 1XVAA 2GHRA 1REQB 5KX5A 3CRVA 2OXIA 5EXXA 1PVVA 1X0XA 3V3KA 5EIXA 4ETIA 1XDZA 2C2GA 4FLMA 1E63A 3ANYB 1EDZA 3ZOKA 1UAGA 3BDIA 4ZZ0A 2AMJA 3FW1A 4M7OA 2FW0A 2J6BA 5HJ7A 3BMOA 4G41A 4YK7A 4EA9A 3C6KA 2HA7A 2V4MA 821PA 4F6CA 2V7QA 4UBLA 3TUIC 4AT1A 4LX8A 4HWSA 1RLUA 4RPIA 5F2EA 2YZ7A 2CZQA 5BQ3A 2ZRCA 1DX9A 1II9A 3ZH2A 2Q0HA 2F3UA 3C8HA 4XGRA 1DCMA 2GF9A 3QU5A 1SZDA 3UKJA 3WK7A 5H3LA 4NHEA 2IODA 2WJIA 3H19A 4AG5A 4AJHA 2LCIA 2CJWB 3KSAC 4JK3A 2MSDB 3BH0A 3EFHA 4ARUA 1LDBA 2C78A 2ZCUA 2YHIB 3DLIA 3FAKA 4JIGA 5SZIA 5AVZA 1R9JA 2Z4SA 1KI9A 3AUAA 3WHLA 2HMAA 2J3QA 1T3LA 4EFLA 3CX7A 3K0FA 1AS0A 3GEDA 4RU1A 5IPFA 4FFRA 4YRPA 1YASA 1A97A 2W2LD 1ENOA 1L9XA 1N2BA 1PJ8A 5LOVB 1DKMA 3AIIA 4UTOA 2W2VA 1K9VF 4G0PA 2D7JA 3WGYA 2QK4A 1YJQA 5KQPA 2W43A 1Y9AA 2X7JA 2ZYRA 3NWOA 4D8YA 4FEAA 5JS6A 3FSJX 1P3DA 4H35A 3CCCA 4KN8A 4KPUB 1YS2X 4I8IA 4JMLA 1CUBA 4AWAA 3ZLVA 1KP3A 4YJFB 4DYDA 2FMFA 3WLRA 1TIKA 4JGIA 1MR3F 4RHXA 1TA9A 3M1AA 4EZEA 4BNUA 1SK8A 2H1CA 1LNZA 5ELLA 1DTWB 3EEOA 4JWTA 1II8A 3LY9A 2A2ZA 3M83A 2C2OA 2J3KA 3HWSA 1E62A 2ZZKA 1F2TB 4OUDA 3TLXA 3WL7A 3N2ZB 3A32A 4CLXA 2Q5EA 3CJRA 2LUOA 3WSVA 4KQ6A 1Y9EA 1QH8A 1PI3A 5EXTA 5K5EA 3IA7A 3JD4A 5AW5A 1BW9A 5EYPB 3W5CA 3J81A 4ENRA 4TLMB 5HM8A 1U1FA 3ZBPA 1S3GA 1NU6A 4R8RA 4KQJA 3P2KA 2WU8A 3EGOA 3HJBA 4KQGA 3O47A 3UOAB 4PE5B 4IIUA 3X2EA 3T3HA 1O6CA 4G63A 1ZOPA 3AEQA 3GLHA 2D1YA 3PNPA 4C3UA 2L42A 3OQBA 4HLDA 2TSYB 1ZG3A 2BHNA 4BP1A 2AI1A 1T0BA 1X7GA 4NY1A 3ZWXA 1J9GA 2XBMA 5ALUA 2XXJA 4DGQA 2J9XB 4LCEA 2G72A 4D3YA 3DT6A 4BFLA 2Q49A 1JR3D 4IFBA 4BS9A 4Z1MD 2OCIA 4G97A 5A02A 1IN8A 1JHXA 1V2GA 3SEZA 1JAYA 5CFZA 1G7CA 4DC9A 4IRUB 3SLRA 4QGAA 3UCFA 2JJ8A 1F2DA 3JALA 1AO3A 3LDFA 2J3IA 3RAJA 4ITUA 1MX1A 2NZ2A 1Q50A 1QMGA 5LJLA 5D5QA 3A6ZA 5AK3A 4B83A 4EBBA 4KNYA 1HQYE 1SFRA 5AVWA 3AY7A 1L8QA 1CR0A 9GPBA 3MCTA 5LP6F 5F3RA 3TR5A 1JHUA 1BMFD 1QXSA 2QQEA 4NRDA 4OP3A 5SY6A 3LM8A 2G76A 2Q3MA 4MRSA 1SQ5A 4OJMX 5SZHB 3JW8A 3I37X 4OJYA 5DWQA 5FUMA 5FWYA 1N92A 2VP6A 5BVHB 2X86A 1BEZA 1B0AA 1OKKA 1T10A 1ZKDA 2QRPA 1OYVA 3JWGA 3KT3A 4ZT6A 1Z39A 3ZWMA 3Q6MA 1J23A 1QYWA 5DGXA 3ECCA 2FSVC 3F9IA 5A62A 1SBYA 3V4SA 3GJQA 3TLYA 4LKRA 3THXA 4YO8A 1RJWA 1FXSA 1EINA 4QRDA 3KAPA 1LWOA 16PKA 1T3TA 1RWKA 1TCBA 4PYMA 5LXTB 4KDRA 2BMVA 3P9RA 4GYYA 4QSHA 1LS1A 3BB4A 3IODA 2IVZA 3NOQA 1PJ3A 4QBIA 4REMA 4A26A 5A4IS 3B9PA 4AUNA 4MRMB 4TS4A 5KSWB 3OM1A 5IFKA 4PN7A 1MIOA 1LW7A 2IZ1A 5E4YA 4R4JA 2OYSA 2HQRA 4MHTA 1DC5A 2O3TA 4FNGA 3ILSA 2YY6A 3O95A 1K6MA 1P6QA 4Q9LA 3P1JA 3Q40A 2B25A 4CR8A 1GARA 1QNFA 1W4LA 2PM8A 2X6TA 1C4OA 3UUGA 3V8NA 2EW8A 4L4XA 4O2AB 1I4EB 3VYWA 3OETA 5ALEA 1QX3A 3OEHD 2NIPA 2EP8A 4R2WA 2ODQA 5ITSA 2FTKE 4N3CA 1PNRA 2Z57A 2CYBA 2GAIA 2REOA 4FOSA 5DEOA 3TD2A 2YH2A 3M9WA 3MJCA 3VSDA 2ZSEA 3WV5A 2O8VA 1MX3A 1K63A 4ZK6A 1GAEO 4CI0B 5B1YA 2Y77A 1W47A 4BO9A 2ZE8A 1HE4A 5CLGA 3WI7A 3G17A 5FO1A 4ECEA 4YUAA 3NDJA 2AR0A 3NPMA 3ORQA 3EUWA 1CUJA 1EBUA 3DA8A 4UAJA 5AHRA 5LDDC 3SE7A 1XDBA 1TRKA 1WSBA 2RB5A 1E0JA 2Z1NA 2XUOA 1XA4A 3E7WA 3HWRA 4OQNA 1TYEB 4WY8A 1B3RA 4C05A 4MP6A 4I4IA 4HNAB 1DAEA 2JLQA 3MWLA 3NC0C 5J2UB 4YAOA 2YJTD 5IEBA 1YCDA 5CGQB 1I3CA 1K8XB 4AF8A 4AQDA 3KXIA 3R7WA 4LV6A 4M0DA 5LLSA 2ZW9A 1R12A 2W00A 4WZBE 1WLYA 1TKAA 1WXDA 3OURA 4Y7CA 3WDLA 4ZEMA 2ENWA 2YQ4A 3F6SA 1H4QA 3D1VA 2QOEA 3RQSA 3SC6A 1HR0B 4J90A 2ZRLA 2Y0PA 1CUYA 3D59A 1UWLA 1XTIA 3FJYA 1M6VB 2RDMA 2ZJ2A 3PGA1 4GU5A 4HDMB 3C6XA 4ZU1X 3U2QA 3VR2A 4CMKA 1LLDA 1R4AA 5B4UA 3U4MA 2C95A 2PGAA 4DR1B 3CSUA 1NUSA 1YR7A 4NK4A 3GN2A 1P9RA 4YPVA 3EXIB 3SFVA 4C07A 3NRBA 1YA4A 4D9JA 1G3UA 2WW8A 4YJKA 5DH9A 1AS3A 2NZJA 4QJ4A 3ZX5A 3AR9A 1K8RA 3V1TC 3GEGA 2Y1GA 4RJLA 3IAS1 5T4EA 4P3KA 4N7RA 5AVTA 1XZAA 1E7RA 3DFZA 1H05A 3GG9A 3H84A 1KE1A 3SXJA 1KC3A 1QZXA 4BUJA 3NS7A 1AUQA 4D9HA 4DPKA 3RUCA 4KRFA 1Z38A 1ZC3A 2R48A 2IP2A 1MT3A 3A9CA 5EESA 3CF4A 5C8YB 3S2FA 2YYYA 4DB4A 1FFDA 1Z4OA 2AH5A 1LDYA 5K3CA 3GZ4A 1M1NA 5ANRB 3RGWS 1X19A 5L3RA 3D6FA 1ECJA 2BEKA 2XI4A 1ZN9A 1LB1B 2PX4A 1OHHD 1YBAA 2BJWA 4R2IA 5ECDA 1GPMA 3MFQA 3PPVA 4OG2A 5IJAA 2EQ5A 1DX4A 1ND5A 2ZBDA 4KX5A 4CEIA 1B42A 1ZNXA 2OO3A 1ISSA 5LOVF 3SGLA 3MC1A 4H6WA 1EK1A 3LC1O 1E1YA 2ZYHA 4Y0VA 5G0SA 4Y1RA 1I94B 1ZJ5A 1YVEI 3PXAA 4XVQA 4EF6A 2BFBA 1E8MA 2ZBUA 3MWDA 4OSOA 4ZOEA 3RT9A 3LZDA 5KOJB 3ZK7A 1XROA 2QMEA 4FB4A 4JLJA 3ANTA 4K0KB 2EX0A 2JG3A 4IOLA 1R1DA 2IXGA 5DM70 1VFPA 4FYJA 3GGSA 4Q19A 4F1JA 3N3BC 4A6DA 2BR3A 2R96A 4DDWA 2PFGA 5DGIA 2AJBA 1KQGA 2QVGA 4LQ4A 2DH5A 5D51S 2ORWA 1ESNA 1E59A 3DQZA 1DADA 4C7OA 2AMFA 5IT0A 3EVFA 4GI3A 4QBKA 2VJQA 2ZR7A 3TPZA 2VDWB 1LLCA 3WOVA 2WAMA 4P4SB 3K5PA 3RYHA 4U9IS 1VDMA 1NRIA 3OJ0A 3LFTA 1TM3E 1OFGA 4D44A 5C5DA 1S2IA 1KETA 2P67A 1F51E 2ZXEA 2D4AA 3G89A 4L2IA 3BBLA 4ZYTA 2HA0A 2DUNA 2PYZA 2CDRA 2BEUB 3DNPA 4R2XA 4XIIA 3ANXA 3KQHA 4KAXA 4KMSA 4O4JA 2GBLA 1MG0A 3WYBA 3W5VA 1VBNA 1RMYA 4NCKA 3Q2IA 4RJ2A 3WQHA 4GRDA 1BN7A 1OTYA 2YY7A 4ZCRA 2C2ZA 3QVLA 4FXPA 3GD5A 4R41A 5DBOA 3LKZA 4US2R 2IYAA 1I3OA 3I9LA 4J1NA 5JAUA 4BRZA 1JQDA 2E85A 3B51X 5KIAA 4EI9A 3AF1A 2R25B 1R0CA 2H2IA 3UKOA 3DQQA 4XD7A 1SBIA 1UP7A 1E66A 2JHAA 2GEUA 2VJPA 2B8EA 3AM4A 5B2ZA 5LA6B 4MVJD 3TG8A 2EKBA 2GSDA 1ZK2A 3HLYA 2AD1A 4IUBS 4KFTA 5FNZA 2Q9UA 1NPDA 1OAOA 3W2HA 3PHIA 4R1UA 3Q87B 1O6ZA 3T4XA 2A30A 3UPUA 2NAFA 5IHXA 1CR2A 3JRWA 5HMLA 4JLAA 3OMWA 4ZMBA 2DY1A 4PFKA 2I2AA 5GJBA 2JFOA 2JLWA 4URWR 3ZLBA 1EJBA 4MUMA 2UYQA 4HN4B 3DR5A 2R6R1 3ZDCA 1DC7A 4R2HA 3OZFA 1WXIA 2ACKA 4FYYA 1Z5NA 4OXYA 4MCAA 1ZO8A 4L9WA 5HS4A 3BKWA 2C8KA 1DLIA 1OVGA 1YS7A 3H0EA 3HB5X 4NIMA 2JHPA 3HI6A 1E9AA 5ALTA 3UZUA 1XU9A 1H9BA 1E3WB 4XEUA 2DTXA 3C70A 5CH3A 5LXTF 4FFWA 1TT7A 3AF5A 4UVDA 5BXQC 3NM6B 1A71A 4D9NA 3DE7X 3ZWWA 1ZK0A 2Z08A 2AOWA 2NSYA 5SICE 1OX4A 1O95A 1AX9A 2OFXA 1ZGBA 3CLSD 3C43A 3NLLA 3U3KA 3QSGA 3LFHA 4IDFA 5EWMB 3PL5A 2RMKA 4ZP1A 1AGPA 1GR1A 4TMFA 2IX9A 2HXGA 4BQNA 3B6EA 5K0TA 10MHA 3N6RA 4OQ4A 3HDTA 2B94A 1FUEA 4UNNA 4JFAA 1M2EA 3PFGA 5EPOA 1QO7A 3WYGA 5DYWA 4JBYA 4UTNA 1E9RA 3V8MA 2J0VA 1GQQA 2DPGA 3KX2A 3PYMA 3DPUA 4WEQA 4O2AF 3V2IA 2WF9A 2Z09A 1R8YA 2Q7XA 1NXTA 4YRNA 4S05A 3JYPA 1Y82A 5BWBA 1RAGA 4KOAA 3WFZA 4XQ0A 2GGSA 4J9UE 4K9SA 1PV2A 2VQSA 2DLCX 1Q7RA 4GRIA 5EIWA 4LMRA 1XLUA 1JDVA 4QM6A 1I2BA 2W6CX 1EFTA 2QRVA 3IUNA 1BXKA 1EUZA 2DG2A 1Z6TA 4P0QB 1RHRA 5KYUA 1YDGA 5DSTA 1ESZA 1GU7A 2JFBA 1Z2NX 2PVSA 3F6EX 2W2LA 3PFKA 4TV8B 4LPKA 3IJPA 1PLJA 3GEHA 3PQ8A 7AT1A 4MROA 1GXSA 4PR0A 5IKOA 2ZZNA 5J58A 4LDJA 2JIDA 5YASA 1CB0A 3TECE 4ENVA 1TVEA 4ILKA 4E46A 2PUDA 2A92A 2Z98A 1KAQA 2Q6KA 2X58A 4KXMA 5CD9A 3CBQA 4HSEA 4DQXA 1C3EA 4RZIA 4FJ1A 2IXAA 1TAHA 1Z15A 3HR8A 3K9LA 3OP4A 4R05A 4B43A 1OFVA 3L8GA 5EXPA 2PSJA 4URVR 2P9GA 4O5OA 3VHLB 2KI5A 1D2GA 4P80A 4R1NA 3Q10A 3JYLA 4BNYA 3RUHA 3D8NA 4KIUA 3PC8A 5DM60 1J9ZA 4F11A 4YAJA 2G1JA 1D03A 3SX0A 4LYEA 1R8JA 4PZLA 1YDHA 3NV7A 4H7DA 1NE2A 5J59A 1JG3A 1E92A 1E7YA 4HMQA 2QBYA 3TXXA 5IN5A 3PA8A 2HQSA 2O8DA 3AJAA 2H5JA 2R8ZA 5C4IA 1QP8A 5AW4A 1FF9A 1JIKA 4X20B 5HW0A 1MZPA 4HDQB 4KXLA 3KXPA 4YCJA 1E79D 3KUDA 1LZLA 1PKEA 1RABA 3S27A 3ZLJA 2F4VB 4MWDA 1XD2A 3QUAA 2PGLA 2FVXA 3L0CA 3L7BA 5K0CA 1D4ZA 1FEZA 1PR5A 2V7XA 3IOCA 3WR5A 3I4CA 3TW8B 4ER0A 3DMYA 3H7AA 1E0DA 3HU1A 5DLYA 2B3DA 3RWOA 2JAPA 13PKA 1HC7A 2ZBGA 3PCTA 4HGYA 5KKCA 1IUNA 3H8WA 3EH1A 1JKXA 1JR3A 2HLNA 4GQAA 5CW2A 4ZVPA 4Z1MA 3ZK9A 4BFVA 2QS9A 1IB6A 1MABB 2BBOA 1GFIA 3WLOA 2LNDA 3RKRA 1FFEA 1XIVA 3SSAA 4B31A 5EVJA 5E8JA 5CFMA 1KDOA 5DT2A 4X61A 4TKVB 2FEOA 3U80A 3VZBA 1Y1QA 2MINA 4B4OA 1MIHA 3DEHA 3AUJB 3OZXA 4A15A 3KWMA 2IY8A 3CRQA 1T1GA 5ALHA 3BSYA 3ETJA 2UYCA 4EY3A 3N86A 3U3DA 2FZEA 1U8CB 3HBMA 4NFLA 1PF7E 1KY4A 3BWEA 3GLIA 1BMFA 4IKOA 1PJQA 1QQ5A 2GBPA 2QD5A 1P4RA 2XGGA 2YR0A 4LHWA 3UAWA 3VJKA 1M1YE 5GVRA 5K0FA 5A6SA 3ZBTA 1ZMRA 4EI8A 3I2HA 3I64A 1G8GA 1ID1A 3O8BA 2BFWA 3U4CA 4PX2A 3I5AA 3PDWA 1VB5A 2D0IA 2VRCA 2Z83A 4BIIA 4CMEA 1J21A 4G1CA 1H0SA 1TQ4A 1JA0A 1NULA 4IVPA 3CLUD 1MEEA 4R84A 1T9KA 3BWXA 5DSXA 5EKUA 5TPWA 4K9PA 1M5UA 4NCBA 1Y8QA 3IV9A 2YIMA 3I9V1 3NBUA 2DVMA 3AOGA 2OFFA 1C3LA 1YULA 4PZAA 3ZHRA 5K01A 2CDNA 1RIIA 1B2RA 1F17A 1EM8A 2G70A 2AK2A 2DU8A 4W5HA 5BSVA 3EPHA 3WGMA 1YVRA 3SM3A 3W2TA 2Q4TA 2MYPA 3GPCA 1A88A 3GJ7A 1KAMA 1NBEA 3RRJA 1SXJE 5ABPA 4KXFB 4DLUA 5HSGA 5TIIA 3BHMA 4R3NA 5KJ6A 1E3SA 1TYBE 1ZOSA 2WUDA 4WVLA 3HACA 2WILA 4P3XA 2WZDA 4QU8A 1G18A 2RHBA 5CB4B 1HRKA 4N6GA 2J85A 2NSJA 3FCSB 2HSGA 1PU2A 2PH1A 2ZUSA 1EVZA 2WT4A 3KQYA 3OEHA 4HWOA 2QPAA 3CIFA 4EB3A 2XE6A 3WKCA 2QMZA 2HBYA 2O5RA 3F3KA 3LUJA 5ISMA 1C8KA 3FLBA 5B1HA 1N75A 1NMQA 4JXXA 1V43A 1SU6A 3VR0A 4CCYB 4HVCA 1JTVA 5JU6A 1X7DA 3JRNA 4O0LA 3URMA 2BR4A 3GK3A 1WD5A 3FOFC 4DQUA 1POWA 3N7UA 3SFZA 4UTRA 2PU5A 2GWHA 3P9XA 2GPSA 3DNMA 5LA6F 3ZE8A 2FE4A 3AG6A 3H9JA 4MJ7A 5EG5A 3EPKA 2AFIB 1YB5A 2PD3A 1GG5A 1HLPA 3MCVA 4MYRA 1ZQ9A 3B3GA 3EXHA 1G21B 4TMXA 4WUVA 5CUQA 1M34E 2WJHA 3UTDA 4KWTA 4B2IA 5CK5A 1OXVA 4FNOA 3OG9A 3EHEA 1I10A 3PTAA 1VPEA 3MUOA 4BN4A 3EEBA 4MDHA 4KYTA 1HQDA 4JLPA 1JAHA 3EZ2A 1BJRE 1YUMA 2AFHE 5A4DA 1QM5A 4XCVA 5EVCA 3L93A 1G0OA 2FZ4A 3TOSA 2ZS8A 1HSZA 1Z17A 1B43A 2E49A 3VV2A 1BE0A 3U1BA 1HX7A 5CLJA 1XTBA 1XJWA 2QMYA 4NVRA 4RHFA 2Y0BA 3BH7A 5DW0A 5FBZA 1ORHA 5ICSA 1XMQB 2OV6A 5DN6D 2QAGC 3MGKA 2QQ0A 4LOLA 4F9FA 4KUGA 1GQYA 2FOLA 4N65A 4OFBA 1PQWA 1QCYA 4S1OA 2ORED 4QOGA 1S01A 3X2SA 1XTJA 1Z13A 3QQPA 3O31A 3VU0A 4MGEA 3LRPA 3EUFA 3VSCA 4BZXA 1OJ7A 4NBSA 4CKCB 1CU1A 4RIGA 4X60A 4XM0A 3MOSA 3BX1A 3DEIA 4GI7A 2ZUUA 1OI2A 5KNDD 3JQ6A 3B6MA 5GV7A 3JWHA 4XPZA 3OLCX 2B2NA 1JG6A 1UMBA 3KVNA 2L0XA 3PXEA 2BKLA 4EJ0A 1JR4A 4F60A 4DBLC 1Q3KA 2X40A 3O03A 3RUAA 4JX8A 3ZYCA 3HXTA 4BE9A 1ZVVA 2W90A 1XR3A 3GAMA 2XQKA 3K1YA 3KKLA 2IDMA 2VR1A 3LFUA 3O73A 3GCDA 3BC1A 4FT2A 5I7FA 2BFOA 2XKKA 4KTTE 2V7PA 4GC9A 1Z0UA 5CT6A 3IBFA 4OPMA 4OV6B 2NXEA 3PD0A 4PAMA 4OQPA 2QMHA 4HWRA 1Z35A 1P0MA 2HUPA 4TTJA 3TBKA 4YRKA 3ET4A 1WPXA 2FJ0A 1W2GA 3BH6A 4XX0B 3TVYA 5E9QA 5B58T 421PA 3KAJA 2IPXA 2XMGA 2AMLA 3IT0A 4BAZA 2A0WA 2A1IA 4N03A 3A8TA 3RUFA 1Y9ZA 4MQEA 1KQ3A 1N5DA 4DTCA 1O0CA 5J4HA 2Q3EA 3JV7A 1K3UB 1W44A 2R1VB 1YF3A 4Y9RA 3IQWA 4IO0A 2HU8A 1LPNA 2GBGA 3NHUA 1NE7A 2R68A 5BWCA 4TV8F 3RK4A 2IEBA 1ATIA 3GNTA 5K99A 1KBZA 1V8OA 1J0BA 1XXHE 2W2KA 3H87A 4MYHA 4M8SA 1F48A 4OMDA 2ZVJA 1TX4B 1P2FA 2F8SA 2E87A 2FSGA 1R4NA 1TMGE 2RHGB 3CEMA 2ABWA 3ECAA 5DNEA 4MVYA 4G8BA 2L17A 2ZWVA 3G1WA 2EWMA 5IJZA 3HJFA 1DC4A 2WU3A 2LKCA 3GZNA 3U4QB 4JMPA 3CGGA 2IRWA 1LY1A 4MGYR 4X64B 3ESDA 1EFCA 3ZGOA 5EJAA 2P1DA 4AB1A 2A1TR 2B8JA 3IPLA 3GFTA 4IJQA 5IDVA 3AKZA 2HF8A 1E9VA 4TZTA 1L7MA 2AC4A 3LQQA 1D3AA 5I3ZA 1RFLA 4ZIRA 4KQHA 2EX1A 3I8OA 3VDQA 5C5CA 5JR3A 4HLQB 5ER9A 2D1SA 2OC9A 3QEOA 4JOQA 2OA0A 1JI0A 3EC1A 2ESRA 3KEOA 5AKXA 5F1YA 4BO5A 1MJ5A 2RIRA 4EG6A 4N3AA 1Z45A 4HX2A 1YC5A 2QIPA 4XIJA 4YECA 1V96A 3UJHA 4XB1A 4DCNA 1OA0A 2P90A 1MBZA 3NBKA 4H17A 4UHEA 5CR9A 1UFQA 5CJPA 3NT2A 3VUEA 4FOOA 5ALDA 3U19A 4CWAA 2BI7A 3IULA 3VKUA 3FJ1A 3RU3A 1KI8A 4AP5A 1GSHA 3BT7A 9ATCA 1I3MA 4K9QA 2GYWA 1R9MA 3HPRA 3C24A 2I4MA 2GBLC 4I9GA 4MMZB 5P21A 3STWA 4XR9A 5AVKA 5H68A 4BCCA 5FPYA 4MEAA 5GGYA 1RQNA 2XIQA 3UV7A 1RBQA 4CKXA 5HCUA 2D06A 4NOLA 4QKQA 3F7MA 4H3HB 5TSDA 4TM8A 4TTIA 4R8KA 1VCNA 4XM2A 2JAQA 2WLSA 2YVQA 2WIFA 1E2IA 5KYWB 2Y6VA 3IT1A 5EJFA 1T25A 2IQIA 2WD7A 1RJDA 1H3FA 4MVJA 2APJA 3I09A 2DWPA 1RM0A 2Y1CA 3QUBA 5DHFA 4TXJA 2OTCA 4PN3A 4S2UA 3QEBZ 2JBAB 1TW2A 1HDGO 1Q0TA 4UXJA 3ERCA 1EVKA 2EGUA 1OAOC 3OC6A 1KJ9A 3PJFA 1WDLA 4PLZA 5FUVA 2J0EA 3ADBA 5IAGA 5E3JA 4I7EA 5AM5A 1L6IA 4ZYVA 2F9FA 5AXAA 3FGPA 4MW1A 2GRUA 3MTDA 4GX1A 5EHGA 1UMKA 3KZ1E 4L0MA 1IEQA 3FYUB 1CIJA 1X14A 3M6AA 5CNKA 3D31A 3HO6A 3KTDA 4KUEA 2H85A 2HMTA 3T9CA 3VR5A 3W5IA 4E1BA 3T5PA 2DJ5A 3D7RA 1YJAA 4RVUA 2XXAA 3NGLA 3MBIA 1SKMA 2C42A 3O94A 5ALJA 4Q3LA 4CQLB 2ZJZA 2X3UA 4IUDS 4C0JA 4X84A 3MOIA 5FAKA 4P4UA 2JNWA 5JSUA 1NUHA 1P3Y1 3R09A 1E4VA 1E2UA 1QANA 3WGLA 3H9CA 4C4XA 2E0IA 4GMXA 5KAMA 2QW8A 3W5SA 4WA7A 4EKDA 4EVQA 2LGJA 4ZT5A 4QJ5A 3PL1A 1QYDA 3QKTA 2IXTA 5LYYA 4CEHA 1RI1A 1QO0A 3PWZA 5LSAA 4CN8A 3RVQA 1WX1A 4NAUA 5CAEB 3TI7A 1USVA 4PHHA 1UPCA 1ECLA 1L4NA 3EIHA 1T2CA 1KMNA 3MHTA 1CEEA 5E2BA 1KZ1A 4B76A 5ICMA 1CZNA 3WBJA 1U3UA 4S24A 1M54A 5D87A 4AY4A 1XSEA 5C35A 4AXXA 3GA7A 3KEFA 3DUFB 4OCZA 4G0WA 1Z25A 3A11A 3GH1A 5CVVA 1ISFA 5IAJA 5TJ9A 4MUEA 2J5RA 5A03A 3Q11A 4LZJA 2PBFA 2R6JA 1A82A 3O7MA 4O08A 5F2KA 2PX5A 3SSNA 4OI4A 2FQWA 1QORA 4XB2A 3VHRA 1D2AA 2V6JA 3VOTA 2GERA 1SCUB 2OO7A 5AJWA 5EJEA 4LA4A 1X1RA 2PGNA 4C89A 1UXGA 3OZ7A 2AV6A 3TMYA 4WZAA 5I7EA 3LXRA 1IMOA 3PXCX 1Q2UA 1GGFA 2VCYA 4MPTA 4MVJH 4WWHA 5BN5A 3JTMA 4DCPA 5C4GB 4BVLA 3HU2A 1D1PA 1QF6A 4V1CA 4GKBA 1GZHB 1LQUA 1M66A 1NJ6A 1ODSA 2LRHA 2PQ2A 4NMWA 3I73A 4RDHA 3B2NA 3MJHA 5CB8A 5JANA 4V0KA 4UM5A 5JCOA 3OA0A 4L8YA 4D9BA 1US8A 1T9DA 2DE0X 2D62A 4QVKA 4RUKA 5JASA 2BSXA 1ODCA 3GLFB 3TPFA 4X94A 3IP9A 2IHNA 3EFOB 1U2PA 1Z4JA 1RS0A 1G8HA 1Z75A 1RBYA 3G68A 5AKKA 2O8EA 3INNA 3NORA 5WRFA 3EUAA 2PGOA 4FOPA 1EUCB 3GMSA 1H2FA 1FUKA 3HZRA 5C80A 3UIEA 1ID8A 2WT9A 3ASUA 3FMVA 3Q7IA 4H3KB 1YR9A 3OZSA 4J6EA 4L02A 1RHQA 4KVGA 5G4KB 1GPAA 2D5LA 2O7VA 2XGMA 5JROA 3WIUA 5CW1A 1SWWA 4D9GA 4QE3A 4YCAA 4DCSA 1RZVA 4ISCA 1B8UA 3MUEA 4WCDA 4YA6A 5L51A 2IC5A 1M7GA 1UCFA 4X0EA 4XWAA 1LWNA 3EXEA 4R7ZA 3ROFA 4ZVVA 4CG1A 2HHAA 1OFIA 3MIZA 4NZZA 4WCFB 4ARVA 3HYNA 3B3FA 3RS4A 1E79A 1O54A 1V6SA 3EB9A 3EVNA 3MGCA 4NYMR 4AZ3A 1KTIA 3GLUA 4Q16A 1BXGB 2J9RA 4LQCA 4URFA 5A9SB 2X0JA 2J46A 1HDCA 3B5EA 5CJJA 4G26A 2WWYA 4YO7A 1VFNA 4HO1X 3FHJA 4AZVA 1VHDA 2HA3A 1QO9A 4CQMD 3IRVA 4EHFA 1F8UA 2Q1SA 3H4MA 4RVCA 4R2KA 4RDIA 1J99A 1Z82A 2BEJA 5FPKA 1IHXA 1G2QA 1V47A 2FN8A 3HI4A 3GFGA 5F12A 3ZG6A 4DJJA 1P80A 1AF7A 3L6RA 4TKUA 2P9YA 4WESA 1ZD1A 3NKVA 2E21A 1G6KA 4NZMA 2A86A 2G1KA 2GZAA 5IM4F 2QLMA 3V2HA 4G81A 3ZCPA 2GESA 4KV7A 3MSCA 4NNOA 2F17A 4PVCA 2OBNA 2R6ZA 3SZLA 1B8NA 3EAFA 1SKYB 1ZRMA 1XQVA 4I9FA 3VOSA 5CG2A 2YIVX 4UBJA 1YK0A 3IPRA 5HNKA 1EIWA 1A2BA 3H0KA 1AKYA 1X2BA 2IZ6A 2ZYTX 5H1YA 3SYTA 1MO2A 1QQ6A 3AVVA 3PDIA 4FVTA 1DWPA 1FQWA 3DJFA 2ONKA 1T1IA 1L5FA 4LJLA 2VH5R 3RBZA 2JANA 3V4ZA 4XA8A 8LDHA 3O0TA 4MI9A 1SC1A 4G4SO 4CMEC 1JKJA 3K8OE 4UKDA 5IZCA 3SWWA 3OD1A 1XYGA 1NJ5A 1Z0FA 2W6IA 3PDCA 5AXBA 3DR3A 4M1TA 2W0MA 4PNHA 1SBZA 3CH4B 3VTKA 5ALYA 3R41A 3HKBA 2H65A 4DSAA 2H4XA 3MTAA 1C9NA 4MB6A 1MQ8B 1ITZA 3D1LA 4C5BA 3HO1A 1PD1A 1BVYF 3H7IA 3RG2A 3K6SB 3FOBA 3QE4A 2HBRA 1NNEA 4XTRA 1DU4A 2VSQA 4IDAA 5B30A 3BE4A 3KUUA 3ELYA 3HWWA 4Q03A 4UU1A 1RZUA 2YWHA 4U6SA 1C7ZA 4NU6A 2TS1A 5B36A 2XYPA 3E05A 1CYEA 3SFTA 1PFQA 1LK0A 1DAGA 3FCCA 1KAOA 3AF0A 2H1LA 5LZ8A 2C7GA 2QP3A 3NBAA 2Q1UA 4TYMA 1FRZA 2MYNA 3ZXSA 1GFWA 1BE6A 3G3EA 2I6XA 3BZBA 3HVHA 3DWGA 2XITA 1MC4A 3IGFA 3KPYA 3O82A 4ZQIA 1M8PA 5BMOA 5JAPA 5KJCA 1K5PA 2I1LA 2GH1A 2XMRA 1P2TA 4CM5A 1HMPA 1Y5RA 2CMGA 3E7PA 3DE4X 4KRYA 4YP1A 1VL0A 2ZI3A 5E6UA 1RE0A 2X3YA 3AHFA 3FNIA 1C7IA 4EIWA 4PG8A 4PQEA 3QBVA 5I7HA 3MRTA 4D4IA 2OC4A 3DLTA 2JBHA 3LPMA 1EFVA 2HK8A 1GAJA 5FO0A 2F9MA 4QG3A 2RH5A 4YMWA 4CT4B 3KSBC 1TU3A 4I36A 5MN6A 2KSQA 4J2OA 2K7FA 3SYKA 2SKDA 2YYSA 3LWNA 4W7SA 3N8IA 1XL1A 4Q4LA 1XZEA 1YUBA 2GN2A 3D54D 3C6MA 1OASA 3EXHC 1RMTA 3BOSA 4MITA 1RI4A 4Q1DA 5IWCA 4DM3A 3KFXA 5D85A 1D0SA 5D3MA 5HZHA 2G09A 4Y2UA 4INAA 1NJFA 3U6KA 3ANNA 3D8RA 3DQPA 1V4NA 3PEEA 3PUHA 2W22A 4RY9A 1J20A 2NZWA 4EUSA 2AWOA 1Z5PA 2GKSA 2I4LA 2FYTA 2G9VA 2WK1A 3I53A 2FSFA 1RQLA 3H3JA 4OA8A 1JMKC 1YIDA 3R9KA 2A4KA 3D2BA 3NFYA 4GX0A 4LDZA 3ZGNA 1R0LA 4PLVA 5E7QA 1NY6A 3RHSA 4HN2A 2C9YA 3TNYA 2YXNA 2G9NA 4JSRA 1JZSA 1TM5E 1WLSA 1W8IA 3F6CA 1RKUA 3DLAA 1X70A 3DSRA 4ZO8A 3O8DA 3MTJA 3FHLA 3H1AA 4D6XA 2AQ8A 3R5SA 2H51A 4XWYA 4DL9A 4MWSA 5JXIA 1IRXA 1GRVA 3INTA 1HT2E 3EWAA 4CUKA 2QD4A 2QORA 4JXJA 1XPJA 3DVAA 3M6VA 5BMVA 5CP8A 3UT0A 1CRZA 2ZT7A 3BXHA 5M7EA 4YMUA 1F6WA 2PA0A 3ZGVA 3TQOA 3VYVA 4BKQA 2P41A 2ZR0A 4KO1S 3CRZA 2V8BA 4F3YA 1KDYA 4FKMA 5HBRA 3DAOA 1JEYB 1E77A 1U8AA 2QZZA 1WF3A 2J4FA 4DABA 2PLAA 4NAVA 5CG1A 4KHZA 5DK6A 3OM0A 3HHPA 2AN5A 3LT0A 4KXVA 4TWZA 1A9PA 3BCRA 1NZJA 4NONA 4UHFA 1ILEA 4LSMA 3GMTA 4J0CA 4RLSA 2V3CC 4NV3A 1TJ5A 1UFOA 3AFNA 4X45A 5E2IA 1XTSA 2INGX 5KPDA 4CRWB 2B7BA 2WJJA 3FVVA 2JGDA 4BDTA 3EPJA 5DX1A 4UBNA 4LVCA 1NOIA 4M1OA 1I1QB 4PHCA 1OH5A 4WN9A 1E1QA 3MPOA 4FGJA 3RJTA 3BL5A 4W63A 2ZP1A 4B79A 2WOJA 2E6UX 1QE3A 4DV3B 4PCAA 1A0OA 1U8XX 5A3QA 1RJFA 2VT2A 4JZKA 1KI6A 2EYQA 4WL0A 5FL7D 3DLCA 2CLIB 3ITKA 4IQFA 4EJ2A 1HDXA 4RSRA 3F9RA 4ZVOA 3F2IA 3D0KA 4HEA1 2P2ZA 4P2BA 4XE5A 5E4FA 3ZPXA 4OMCA 5AJZA 2GM5A 4LMAA 1WPRA 4HI0E 2O5VA 4GPD1 3KALA 1O2DA 1C50A 2AOVA 4ZYXA 3ZD6A 4IZOA 3EMVA 2FMXA 3E9EA 1YQWA 3BEOA 3AKDA 1SKQA 3UK0A 5H8WA 1AA6A 1GTMA 1R18A 2QUKA 3QX9A 2IE8A 5BY2A 3QFFA 5A5EA 1AY0A 2QTHA 5FBKA 1BC5A 3DTVA 3FBWA 3FKSD 1SVIA 5J47A 4DV0B 3H42B 4DG5A 2IGBA 2OSBA 1W59A 3S2SA 2OYRA 4XGNA 3Q0EA 1OT5A 2YN0A 3LF2A 1CHDA 1QV7A 4UM9D 1X1DA 2QX7A 4TT8A 4NBUA 3DOEA 1ODLA 2G08A 3GNQA 5BOSA 5ARCA 3A3PA 3ZVLA 5I5EA 2DT8A 3G02A 3HM2A 3EXG2 2LCQA 1NW3A 4DUYB 1P5RA 1ST3A 2HDWA 1NFRA 1MXFA 2H4WA 1VRCA 2I2CA 2VG8A 3IEUA 5DISB 2Z1DA 3IAEA 4D3ZA 4IQGA 3GRRA 2IYNA 2V7WA 5TT1A 4NZYA 1LKZA 1IZ7A 1O8BA 3AXTA 3U7QA 4F96A 1KYWA 4Z9XA 4DLTA 5TQ2A 3HY6A 2I03A 3EZ9A 4G07A 5EJ8A 2ZXFA 2FZKA 4L74A 3MELA 4AO7A 1S6YA 1W96A 2ECKA 2HK7A 3I5MA 4V0QA 4EPTA 1EBBA 3ZI7A 1NZFA 2VL7A 3AEKB 4NZ9A 4D92A 4CKZA 1ZUNA 1PWEA 4Q1AA 1YRBA 1AA9A 1M8GA 4IJ5A 1AV6A 2RAPA 4DS3A 1V3VA 1KEUA 3IVRA 3O83A 4F84A 4JI3B 2RGBA 3L18A 4XFJA 2IS1A 1VL5A 3CUEF 3KD3A 2I7XA 2OORA 4ZVQA 3BCSA 5FUWA 4AWXA 4YASA 2P69A 3JQ8B 2ZBEA 4JCCA 1PS8A 5DXFA 4JC0A 4EG0A 1A27A 1SMKA 1YCHA 5T7BA 5TF0A 4Q3OA 3ZGLA 4DR6B 1V8PA 1MG5A 3AUTA 4P7JA 2FRVA 2Q2VA 1J5PA 1CQXA 1WP9A 3CYFA 3I5UA 1ZXXA 4JA0A 4ZK2A 2VTBB 1EE1A 3JVEA 1NOKA 2ECFA 1EXDA 3GQBB 1CZRA 2MU1A 4ADSG 2YV4A 4Y6QA 4AYWA 2DWQA 3K92A 4KQFA 5FEMA 1GU1A 2Q2QA 4D1YA 1TK9A 3FWPA 2ODTX 1ECPA 2H29A 5IKMA 4FZJA 3VXKA 4OJKA 1W5FA 3FZGA 3GR6A 1ZZGA 4U7FA 1JR6A 1KZ6A 1G6OA 1CFZA 2CF5A 2CHEA 2WFLA 1K6IA 4HRXA 2IZ7A 1O94D 1CW2B 1S2MA 1PJTA 4ZVMA 1KDTA 4C08A 5ES4B 4UAUA 3KVVA 3CR7A 5JAMA 2J1LA 5LZ5A 2PZGA 4HOYA 5TMEA 4HLNA 2D6FA 3UGTA 2C4MA 1S2DA 2ZITA 4O4LF 4TMVA 4ALKA 3V8QA 1B76A 1PT8A 3T6KA 4CMBA 3NI2A 4DCOA 4MA4A 5JMOA 3FSEA 1PBTA 1N2IA 1OLUA 3BWYA 5EUQB 3K30A 1JT9A 1VKZA 5CTJA 1D1TA 1RPTA 1TM4E 3CH6A 5DTRA 4F3TA 2NV6A 3DZGA 1RXVA 1X7YB 2FW6A 1HZZC 3CX8A 3WGHA 1BJKA 1JMVA 4N9WA 4UTXA 2BONA 4EQ6A 1P9LA 1UJMA 3EGCA 5M29A 2ORVA 5I9IA 4M55A 3I0NA 3OPYA 4HH0A 1Z2EA 5JHHB 3EG5A 5FOVA 1JQJC 1ND6A 3OCXA 3PD7A 1QK3A 1K6EA 2PMWB 2DJIA 5MFPA 2IYOA 2QN1A 2C7OA 3A58B 5JJIA 5ADVA 2H8GA 3O8OA 3DCJA 3AGQA 1PFUA 2MSLA 4JLUA 5H9WA 3IESA 1MO6A 1FVHA 2PY6A 1MO4A 4F5DA 1UC4B 3IUQA 1HT3A 1M10A 1V3UA 3TINA 3DLPX 4F5ZA 2H1VA 4CMAA 3F1LA 4KXNA 5C8XA 5IXJA 2GN6A 1GZ6A 3DZDA 3HKCA 1XVIA 3EQ2A 3CLTD 1P7PA 3WLEA 1ES9A 3R3ZA 3LUCA 3A05A 3DZ8A 3AFMA 3MWJA 3UICA 1SKUA 1Y98A 1D6SA