4N01A

The crystal structure of a periplasmic binding protein from veillonella parvula dsm 2008
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
296
structure length
296
Chain Sequence
b'GTSVTWSETFDGTKTDFAVKSAPTHAVSMSQATTEMMLQLGLDDKMAGTAFKEEEIYPPLQAAYDKVKVLSDKWPSYEVFMSVKPDFATGWPDSFSKRAIPADKMISQKVNIWIPESMLSTKADLETNFSDMIKLGEIFGVKPKAEEWVADQRKTLAAIQNKLKDLPRKRVFIYDSEDGQPFTAFEGYTTNILKLIGADNVMSGLGVDKTWAKGSWETVIAQNPDYIIIADYGNSIRNDDDFQQKIEKIKANPQLQDITAVKEGHFIRVKLSEITPGVRTVDALKRLAEEIHGIKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic binding protein
molecule tags Transport protein
source organism Veillonella parvula
publication title The crystal structure of a periplasmic binding protein from Veillonella parvula dsm 2008
rcsb
total genus 88
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4n01A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4n01A02
4B8YA 5M34A 3AETA 2AFHB 1QGUA 4K3VA 1L5HA 1G20A 2AFIB 1MIOA 4FKMA 2Q8QA 4HN9A 2O1EA 1K7SN 3MWFA 4MX8A 5CX1A 1G21B 1N4DA 5JOQA 3R5TA 1H1LB 3AESA 2XH8A 4HMQA 2WI8A 4LJSA 5KOHA 1M1NA 3MD9A 4FI3F 4FILA 3NU1A 4UTOA 4WZBB 4HMPA 5BVGB 3R5SA 5KOHB 3AEUA 1KARA 4N01A 4WESB 2XQVA 1N2CB 3AEQA 1M34B 1TOAA 1XVLA 5JPDA 4H0FA 4OXQA 2XUZA 3AEQB 3AEKA 3K1AB 2XV1A 4ND8B 4OXRA 1G20B 2AFIA 4UDOA 4WESA 3EIXA 4WN9A 4NNOA 3GI1A 3MFQA 1N4AA 1H1LA 4ND8A 3HH8A 3TEFA 5BVHA 3AERA 4LS3A 4DBLE 2PS0A 2YNMD 5GGYA 3ZKAA 4UDNA 5CX1B 3U7QB 3TLKA 4PM4A 1PSZA 4WNAA 4WN9B 4FNAA 5B58T 3AESB 4G09A 2PS3A 4G07A 3U7QA 2MINA 3PSHA 1M34A 2OV3A 4TKUA 2Q8PA 4TKVA 3CX3A 2WHYA 2X4LA 4TKVB 1K75A 3AEKB 4TKUB 2M6LA 4CL2A 3HXPA 2QI9F 4HMOA 3MWGA 5M3BA 4BBPA 2XY4A 1G21A 3AERB 5I4KA 1M1NB 3ZTTA 1L5HB 1QGUB 1EFDN 3ZK8A 5BVGA 3K1AA 4WNAB 3ZK9A 1KAEA 3PDIB 2R7AA 3HJTA 2M6KA 3UJPA 1FP4A 4PAGA 5BVHB 2XDQA 1M1YA 1N2CA 3PSAA 4UTPA 5HX7A 5JG7A 4M7OA 2RG7A 1FP4B 3AEUB 3AETB 3LI2A 1PQ4A 3MINA 4WZBA 5FLYA 3BE5A 4IRMA 1QH1B 5HDQA 1QH8A 1K2VN 3LHSA 3ZK7A 1QH1A 4WZAA 5JJ5A 4INPA 2PRSA 3PDIA 5GGXA 5M2QA 4XPIA 2ETVA 4MDYA 3TNYA 4WZAB 2YNMC 3G9QA 5CR9A 1MIOB 3EIWA 4NNPA 2XDQB 2R79A 1N2ZA 4H59A 4INOA 5KOJA 4GICA 2OSVA 5AFSA 2OGWA 4MLZA 5KOJB 3BE6A 5M29A 1K0FA 1QH8B 2PHZA 1M1YB 2PS9A 4MO9A 1ESZA 1KAHA 2OV1A 5KHLB 2AFHA 2MINB 4OVKA 3MINB 4XPIB
chains in the Genus database with same CATH superfamily
3WRVA 2GARA 1ZN8A 4E12A 2CLDX 2ZWOA 4UUAA 5B3LA 3U56A 1V6AA 3FOAA 5CB0A 4DWJA 1RZUA 4L7VA 5H9WA 1R6XA 5I7UA 2HA2A 3SICE 2XXJA 4DIUA 5B7QA 5C80A 2WW8A 2F4NA 3W6NA 1P18A 1L4FA 2GPYA 4E3ZA 4EX7A 1KFBB 4B76A 4ZQCB 3K70C 1JJFA 1E3LA 1T2CA 3GN2A 1ODCA 4WCFB 2A1UB 4HRAA 1CFJA 4FXOA 1OHHA 2FZEA 2SKCA 1BN6A 3SDZA 5C53B 2BMAA 4XYMA 4RHYA 4LK2A 1ZN2A 4Y2GA 3CEHA 4ER5A 4QKQA 4RTJA 1I51A 2Q2QA 3O2JA 4K9KA 5JSYA 3F6PA 1K8ZB 3LC2O 5HZKA 5K7SA 1WKVA 2VJLA 3TW8B 2GMWA 1SCDA 1W7AA 1IHYA 1N92A 2OZLB 3OAAA 1Z5PA 1EWRA 1YB4A 3AHCA 1JZSA 3FTDA 1GTZA 4MR9A 4RFSA 4RD4A 4YH1A 1JFFA 3WSVA 2NMVA 2ZITA 3AJAA 3B3FA 1VPVA 1U0NA 1LSOA 4LQCA 1Z6PA 4QBFA 3OZTA 2PJDA 5TQ2A 4AJIA 4R9SA 3ER6A 3AY3A 1JI3A 2B1RA 1T2VA 3IAFA 2GHRA 3H2IA 4YJKA 4G0NA 1BYUA 1PLKA 2Q7XA 2P0EA 3AW8A 3WYNA 4AS2A 4DUGD 4B4VA 1GG9A 3A9CA 1YR1A 1XRSB 3UHOA 1PJCA 1JYFA 3F3YA 1WY7A 4Z0TA 5TDHA 2VHEA 3EVZA 2QNRA 2Q8PA 5T67A 5K0BA 1XQ9A 3NWBA 5ECWA 2CWWA 4DF3A 1JVSA 2ZB7A 1OWLA 4G8JA 1TCVA 4D42A 1RHUA 3LUGA 2FJUA 3IR7A 3VU3A 4EL5A 4H27A 1U0SY 3QU2A 4YCBA 5DLPA 3O38A 2I99A 4OLBA 3VJLA 4Z4EA 3IE0A 1PJ3A 4H31A 2L2QA 3CLTC 2ZSBA 3CLUD 2FSPA 2QRHA 4COKA 3QTLA 4YCCA 3LK6A 3R20A 3MA0A 1N6LA 3QK7A 4ZMSA 2FDRA 4MVJD 4E7PA 3A32A 3CN9A 2AFVA 4MJ3A 4S1VA 2Z6QA 3NFYA 5B57C 2ZBFA 4HQRA 3VR6D 4DMFA 4HNTA 4H1TA 3AEUB 1DJNA 1QNLA 1RWNA 2ZT7A 2JGJA 1P1BA 3W4KA 5DCWA 3AOGA 4OQQA 1DQYA 2PRKA 5BQPA 3MTJA 4BFXA 2AW5A 4IS2A 1C2TA 3DV0B 1LVGA 4P7JA 3AYZB 2EVWX 3KPYA 2CLIB 3ZJVA 1Y6RA 3NBMA 4I5FA 2PN1A 3M2TA 4IJUA 2MHCA 3B5JA 5GY7A 3REOA 2WJZB 4PIMA 1MEEA 1TI7A 4NQZA 1S3SA 2WINI 4MDYA 1X7ZA 1VFNA 1OXUA 2P2SA 4QC2A 4UM9D 2ASEA 3HN7A 4WPGA 5CFRA 1U1DA 2ZJFA 5EJ4A 3EIWA 4U2DA 4CEHB 3ESRA 2WJYA 4HAXA 5D5HA 2HSDA 3OOEA 3O4FA 5EIBC 3GGOA 2A78A 3PT5A 2GEBA 4F8YA 2PWYA 1U3TA 2R8PA 3D6VA 3QVKA 4MVJP 3LTEA 4NQRA 1V37A 4Q4HA 3ZC3A 4B3FX 3O1IC 2QN6A 1II8B 1KAGA 2IC5A 3GNLA 3ZDFA 4A0RA 4B48A 1GN8A 1UMBA 1P45A 3EXEB 4AZ0B 4M89A 1JIUA 2HI0A 2I8AA 2QWXA 4KAAA 4RK1A 4JI1B 3O93A 3JU3A 3TJZA 4RA6B 1ISJA 1CNEA 3E81A 4HOYA 5KTOA 4RDXA 5KOYA 3SI7A 2ATCA 4GT1A 5A2GA 2O8NA 3ADKA 3IPYA 4QDTA 5IUKC 1NV9A 1YRWA 2NYAA 4P4TA 2ZFUA 3WJ2A 3T5PA 1H2XA 2B0JA 3AESA 1VRCA 1KEPA 2IU3A 3HZHA 4B9AA 1URPA 3LV8A 4RS4A 4GL2A 1IVNA 4XKJA 3LT1A 4TLDA 1EUYA 3MRVA 2G9QA 1I8TA 2J6IA 2QD2A 2AZTA 4QBTA 1TJPB 4N0MA 4L27A 2P35A 5E6UB 3KEMA 1SCKA 3ERCA 1B93A 4R1UA 4XGQA 5ALZA 3A4NA 4WESB 5JBIA 4Y2YA 4RSMA 3UV6A 2QV0A 3NOXA 1L2TA 1RLOA 4GPEA 3TZEA 5TJHA 3CE6A 3MRXA 2JD1A 1JF8A 1Z6ZA 5KWIA 2V45A 4O4IA 1Z4KA 3RAEC 4B3TB 2QU8A 2FEWB 2JDID 2WWVD 2H0AA 1MA0A 1L7DA 4PCVA 3C3MA 3MEQA 4KJZA 3RWBA 3IKTA 2WIBA 1ZIPA 1NAIA 1RWVA 1ZNWA 4E09A 4LZOA 1VLVA 5BUZA 4MVCA 4AMYA 1A9SA 1RJWA 2XGJA 3IHLA 4TV8B 4BLTA 3OQJA 1UBOS 4NCNA 4X93A 5LZ2A 4EA6A 4OJNA 2WIAA 2OXFA 3P19A 4I7EA 2ONKA 5TARA 3I6QA 5CXQA 5B1EA 1L9XA 3AG5A 2NXJA 3BE4A 1A9XB 1RJEA 2P2YA 2ZRQA 4MZXA 3SFVA 4EG6A 1JH9A 1UEJA 3WLFA 3WL3A 5IUJC 1I7PA 1ZDMA 1O94C 5KAPA 4PAMA 1MB0A 2RGBA 3QF7A 1UIRA 4DCCA 1AH2A 1B6GA 4HJXA 3QHPA 4QGGA 5C7IO 1ODIA 1PZHA 2VP2A 2OKCA 2Q5QA 5H68A 4MQBA 4EIWA 3OKCA 3QEMB 4PR3A 3G2MA 5JXHA 3HKBB 2WM8A 4HNSA 4CQMA 1YZHA 1NFRA 1PW7A 2FZWA 3WB1A 1O2DA 2ORVA 4A92A 4YDSA 1HTBA 5T6MA 3CT4A 4GSKA 3RC7A 3WLIA 2H3EA 3KKKA 3PCXA 4JB0A 4US1R 1EHIA 4WBXC 2VZ0A 4B8WA 1V0JA 2JHFA 3AGPA 1NX6A 1CYDA 2FJPA 3QKTA 10MHA 1Y8CA 3M6MD 1OT3A 2DP4E 3HXOA 2G5TA 5HEKA 5KJ6A 2ORIA 2REBA 1LPAB 1X7GA 2QORA 2QOEA 3HACA 3MCVA 4KYVA 4OOEA 5UKDA 3V1KA 4E33A 3IA7A 4KB5A 3SK0A 3DFFA 3LCJA 1BU8A 2M9MA 3CUWA 3LFHA 4OTZA 1KRHA 1LSSA 1TYEB 1YRYE 4V0OA 5AHOA 4XA8A 3TAXA 2PUCA 2I2BA 4I1IA 4RIHA 2HK9A 4NYMR 2X7HA 3X0DA 4LDRA 3EEYA 1JDNA 2DH5A 1CQIB 1WKBA 2YMQA 4R16A 2NZXA 1W0CA 1FS6A 3GLHE 1TIKA 2CBZA 5M29A 2JIQA 1I3MA 2VDVE 1HMPA 4M54A 3L79A 4MQMA 4OL0A 4PZZA 4BLPA 3GXOA 2XKJE 3KXIA 1JVBA 1P8AA 3L7KA 3NX4A 4O4HA 3SFZA 4MDEA 4TYNA 4TM7A 4YA6A 1W35A 2YUIA 3IEVA 4UHKA 4GPTA 3TL3A 1QTQA 4IIGA 4RTMA 3O3NB 5GJBA 4LGYA 2NO1A 2TMYA 1X2EA 3E82A 3H99A 2Q21A 2VRCD 4X6UA 1WZNA 4NG5A 3UCXA 4AUEA 2DGDA 3GEEA 4L8YA 3ZOZA 2YIVX 1W88B 4F96A 5B64A 4Z49A 5HW0A 3RIYA 5BNZA 4I4TF 2VUIB 4XX0B 1PFQA 4MWDA 4YUVA 2DBYA 3UUGA 1BXRA 1T8RA 2MU1A 1IZYA 1CPYA 2OOKA 2GX6A 3QXJA 2ODTX 5GQSA 2NU8A 3EXG2 2PMWB 4EHJA 1ITZA 3LPMA 1BVUA 3PUKA 4MPRA 1E3IA 4WQMA 3ETEA 1NW3A 2ZB2A 5H7XA 1P19A 1S5PA 2CHFA 4GM4A 5HF9A 1FU7A 4RPGA 2FUKA 1ARZA 4ZVMA 2R5FA 2IODA 1R6DA 2HXGA 4N5HX 2J7PD 4WESA 4F85A 4ZRMA 2Q9CA 4EY6A 1V5WA 5AKZA 4C0BA 4DYDA 4P0QB 2VXYA 3UK1A 4M37A 2V54A 4U02A 1QHHA 4JFAA 1TW3A 3IPRA 4QECA 1C0EA 3JZDA 4I46A 3W9UA 1HM5A 5B58T 2BGGA 5JXGA 3CUUA 3ZGXA 1DXYA 1FXSA 1YJAA 2GK3A 2OFPA 3NIWA 3X1JA 5JXIA 4KR2A 4QBHA 4EYSA 2IF0A 1YJCA 1NG1A 4TLEA 2HHLA 3CQ9A 4MA4A 4DV6B 5DH9A 1YR8A 4G36A 3VKHA 1S89A 2JZCA 3CLSC 3BA1A 4IFBA 4ZMRA 5HGXA 4KLAA 1ZUD1 1QWOA 2F6RA 2PL3A 1MQSA 1UMBB 2GT1A 2XUPA 2H17A 3SM9A 5JZVA 4I1PA 5C4GB 3E9YA 4KDEA 3V8EA 1EDEA 1Z4MA 2ZDQA 1LBTA 3I72A 3P20A 4R1TA 3C6MA 3PDUA 3QMMA 4Q4HB 2UXCB 1AY0A 3HBFA 2GCGA 3V7YA 2R8OA 1X13A 5C8VA 1O96B 3EY4A 1I24A 1TKAA 4REQA 2RC5A 2VTDA 4JX9A 5DISB 5K0EA 1ZMRA 4GZ6A 2F1HA 4L9WA 5ABPA 4TZ6A 1N5OX 1EWVA 1JLSA 1D8TA 1DQRA 3GQVA 3NNSA 5TY0A 5FLYA 3JAMA 4NYMQ 3CR7A 4J94A 5AM2A 2VNAA 1VA5A 2YJGA 1VGQA 4JGGA 5EA2A 2VPTA 4KK3A 5CB4F 3BIJA 4OB7A 4RORA 5GWXA 3T5BA 4Q9KA 1K3FA 2VYCA 2OFXA 5DE3A 3V1UA 1W9HA 5EIWA 5JUWA 3D8HA 1DAKA 3IHKA 2PWPA 1JLKA 5J4LA 5CIWA 1DKQA 3F3SA 4BNTA 3CVYA 1X1CA 4DJJA 3RU9A 1J0AA 1CQZA 3ZZTA 5AFSA 2COUA 3UXHA 3EC7A 3R7WA 1F0NA 3EQ6A 3IPCA 3FPHA 2YRWA 1IMJA 4BE9A 4DB2A 3KJIA 1DVRA 4YAKA 3CRVA 4KAXA 1A2KC 1TE2A 4UMFA 4YRTA 3GRPA 1ZJZA 2C2BA 2PGNA 3PNOA 2ZRKA 1JDBC 4AFNA 1PUIA 2P7IA 5TPWB 2AQIA 3GRCA 3KS9A 2BE9A 1SVWA 1T8WA 2QXYA 4HWPA 2IOFK 2D1SA 2POQX 1CQXA 4EVQA 4CLOA 3OEWA 4CCAA 1M7HA 3G9ZA 4QUJA 3U7IA 5IPFA 3QUTA 5DWVA 1IHUA 5EJ2A 2R44A 3IEKA 3O1LA 2RHOA 3RC3A 4Q7MB 1B76A 1CUUA 1R4NA 3PPVA 2X8BA 1KETA 3I2KA 5DP1A 2AN9A 5U4XA 1FFXA 2W2MA 3HDHA 1GGEA 4IVPA 1VTKA 4RHEA 3PGKA 2QGZA 3I5AA 4LHXA 3JQGB 1O4WA 1TF2A 1SCQA 5GM1A 4PYMA 3GPDG 1I7SB 4LYFA 1CJKC 1QTIA 4RIIA 4RFSB 3GLHB 3KOOA 3TCXB 4DKXA 5G0VA 2QL9A 2IYAA 1TAUA 4ZKDA 4LXGA 4YN3A 3M4ZA 3KOWA 1DAHA 2PT5A 2OWDA 3B36A 3GPBA 5A3VA 3TPZA 3RUFA 4FFVA 4JLJA 3RKSA 4JX8A 2RGNC 3C70A 3KZCA 1ZHOA 1KI4A 3NM6B 3V4PB 1NG9A 4ESHA 2IP4A 2NO7A 4Y1GA 3H42B 1DNPA 1L5QA 1S8FA 3FTCA 5I7OA 1NBWB 5L3RA 3SNKA 2RGEA 4XOUA 4IV0A 2CJXA 1H9AA 2JKYA 1Y6GA 2VYNA 1VIMA 3AUSA 1EMDA 2XGMA 4ARBA 3DDSA 3AMVA 1IB0A 2PQ0A 2BY4A 5EE1A 5KYWA 3BEOA 2OC9A 3KKOA 1CJMA 4UDXX 5FWYB 3UNXA 1T8UA 4NRDA 1GG8A 4WZZA 3E9MA 3A37A 1I1HA 2VATA 1OT5A 3BGIA 2AKYA 1EVQA 4LJKA 1XDBA 2A9JA 4I4CA 2IQ5A 4DXDA 2FQYA 2UVPA 2EJWA 1B3BA 3OTIA 3MB5A 5IAKA 4CL2A 2EIXA 3N07A 4QD3A 5K3DA 2C3PA 4DS3A 1CEXA 4LDAA 2VQ6A 2A92A 5EJEA 2WSYB 3LA6A 2OCDA 4G5QA 4FDVA 5CXXA 3VR3A 4M49A 3JVIA 2JFBA 5EE0A 4EJMA 4N82A 3U0BA 4CUJA 3WDKA 5E9QA 4POOA 2RK4A 3KXPA 1JPJA 1DS6A 2GJ8A 2HPHA 5DYIA 1O9HA 1AHHA 3ADOA 1ZFNA 4XWKA 1F17A 1XRRA 4D9GA 3EXIB 1RXVA 3AOEC 1FP4B 1TLTA 1S8AA 2CDCA 2VHJA 5DCYA 4G5FA 3RG8A 5GM2A 1O95A 1NYRA 2DFVA 2PXAA 2YXLA 2ECPA 2W4QA 2ZANA 3PE4A 1JKJB 1VLQA 4L76A 4E51A 1NASA 1EGMB 2H57A 4OPMA 5EINA 1EGQA 1GZHB 3KT0A 4FZVA 1K08A 3DVQX 2JIZA 3LYHA 2KM1A 3L4EA 4PRKA 4DNXA 1R8YA 4S24A 4FLMA 2HJVA 4RAOA 3IAS1 3CG0A 1Z2PX 4BBZA 4OB6A 3GW8A 5LQMA 3UAYA 1T24A 1EE1A 2HF2A 3OA0A 4CQMB 5I4BA 3IOMA 3S5JA 1TCCA 2CLSA 2PUWA 3ZZUA 1TM1E 1FDIA 4WFIA 3DO5A 4MUXA 2CDRA 5JALA 1ZUIA 3EIEA 3LW7A 1LRKA 5D1NA 1MPXA 3D2BA 3VC3A 1E1CB 3AY7A 1G20E 1K88A 1V8DA 2HIHA 3JQBC 4FDMA 4FOSA 1ONSA 2C04A 4Q47A 4WCDA 2FUG1 3SKVA 4WKNA 2GBIA 4DNFA 1HLGA 1MJGM 1QFMA 2GBLA 3HLKA 3UWKA 3BC1A 3QLVC 1GXSB 4ZEOA 5CEJA 2KB0A 2ZJZA 3LBIA 4FZRA 1ZGCA 2O2JA 5DTEA 3RRXA 2VOJA 2MSNA 2JHPA 4E2XA 4L72A 4HZUB 2C7RA 3EIHA 1HI9A 2E4VA 1KNQA 3TLYA 3F96A 2FW9A 3Q8KA 1KQOA 2VXOA 3N2IA 1VHQA 1M8FA 3PXBA 2PJZA 2WAYA 1VYTA 4R2MA 3X44A 3BCHA 1H5NA 1GGMA 1I4LD 2IZ7A 3DHYA 3GK3A 5EXSA 4EPYA 1N2CB 2Q41A 5E6UA 1RYHA 4G97A 2BHLA 1V7ZA 4F3KA 1RRMA 4P3PA 1ONOA 2B0CA 3L43A 3PITA 1KJNA 1NXWA 2WD7B 2XV1A 3CH7A 2DKNA 3KQTA 1MX5A 3T41A 2I76A 1CG6A 1PS0A 4WECA 3R9XA 2NAPA 3OKAA 3VU9B 4W1RA 3LC7O 3R0QA 4LGCA 2BOVA 4X7BA 3SS7X 3BF7A 4HY3A 3TOVA 4R1LA 2YFKA 3O8QA 4HGPA 3O2SB 2D2XA 2YNMA 2ZPUA 4CL0A 2ZRAA 2FVXA 2BEVB 4AC9A 2YMPA 4LWPA 4CMGA 4YRMA 4XRGA 1ICIA 2F9MA 3NWEA 1PK9A 1RWOA 1VIAA 4O2AB 4CMIB 5FWNA 4G85A 1VLJA 5AVTA 3LUDA 1HNNA 1II8A 3HPQA 4S35A 4DJ5X 2AVNA 3RT7A 1WM1A 1ZI9A 2ZXFA 3KQQA 3LVQE 3QFHA 3RO7A 5JW6A 2X13A 1ID8A 3FYTA 4DL9A 2I6TA 5FPPA 4KMSA 4D9MA 1M2GA 1R5BA 1VRVA 3AHDA 1NE7A 2ZB8A 1CEYA 3U80A 3Q8MA 4BJ3A 3ILYA 1AD2A 2YXNA 3RS8A 5EJAA 3DLBA 4WY5A 3JR3A 1ADGA 5E1MA 1SUDA 1T10A 3GOHA 2R48A 3DVRX 3EGDB 2Y1CA 5ER6A 5GJWC 1DRVA 1XEAA 4DIEA 1R4AA 3ACCA 3HGMA 4G9BA 2YYSA 3EZ9A 4K26A 4F4FA 4FCTA 4KR7A 1IHPA 2X2EA 1CVRA 1AGNA 3NVMB 4U3JB 4RA9A 1ZYUA 3CBGA 2MDTA 3X1DA 3VKGA 1EX6A 1GGVA 1GRNA 2VSXA 4ID9A 3WV4A 1TUBA 3PNVA 1CY2A 3RHSA 4AICA 5FUQA 4PAQA 3LLCA 2WNSA 4TN1A 3IP6A 3JRXA 3LPAA 1EVZA 3NPAA 1EDOA 3B6ZA 2AXNA 5AKJA 3IEMA 5EY5B 5ITZA 1YL7A 3I9V6 1IPEA 1NYTA 2X58A 2C7BA 1RXIA 4FQ8A 3AILA 5D3MA 3G2HA 2WA1A 1JQ3A 4UPEA 5HBGA 1X42A 2QDXA 2CLCX 3LM8A 2BFBA 3HJUA 2AFHE 3EZ2A 2VL7A 3L06A 3A1WA 1FYWA 3F5FA 5F4ZA 3REFA 1G19A 1QGZA 2HQ1A 1O95C 4FCWA 1XRQA 4YRZA 3AI7A 1TQHA 4KXQA 2Y93A 3EGXB 4BGIA 4LRSB 4P32A 3AHHA 1E96A 5C8YB 4D3SA 4IUYA 3V8MA 4QFCA 2CLFB 4IUBS 1H69A 1R2QA 2BJWA 3N05A 4IKPA 4WMLA 3ZWQA 5ALIA 2P0AA 1P7ZA 3KL2A 3FHCB 1KVSA 2FFRA 1Q7RA 2QE7A 2BMFA 2WF9A 4G6ZA 1CQWA 4KE6A 2H1OA 3W5BA 4OYRA 3FGPA 1I5OA 1KR2A 1AK9A 4Z9BA 3RT1A 4U7WA 1R5JA 3VC1A 7GPBA 5AW5A 1ZD9A 4YJHA 5E9JA 4F2GA 5CPBA 5DU2A 3TW8A 1NJ6A 3CB4A 5IEBA 1Z2CA 4PHCA 1A4XA 1IDOA 2ZJBA 4CLXA 1UKEA 3VOSA 2V6FA 2E87A 2RBEA 4NBKA 4TXMA 5F98A 1W44A 1VHDA 3B3GA 1ZJYA 4HAZA 5IDVA 1TA0A 3UZUA 1M75A 3I9MA 5CYPA 2CMGA 2EFCB 3UYKA 2DWOA 4LYEA 4EFDA 1UZMA 1QK5A 3EMBA 4AZTA 1SIUA 3NEYA 1H0HA 3PE6A 4W9NA 4DQUA 3UKOA 3GPIA 2MMGA 3LE8A 4P8RA 1CY1A 4WGFA 3MS2A 4OYLA 1J00A 3ZJYA 3Q7IA 4KZKA 2XMPA 1CKEA 3UVEA 2BGMA 4F0JA 2BFDA 4P4SB 5FYQA 3VKWA 2RH4A 1D2MA 1FXUA 3N8NA 2GILA 3O9VA 1NJ1A 2R8RA 1FVHA 1J1ZA 4G2NA 3CZQA 4EGAA 5IYZB 2CL5A 2XVXA 3SZGA 5ETJA 4HVLA 1D8AA 1E79D 5JSZA 2OORA 3CX3A 1NUHA 4DA8A 3TVDA 2VSYA 3HP7A 3UWSA 4WJLA 2DXIA 3H4IA 3NNNA 1UMCA 3NO4A 4MHOA 1YBFA 2RB4A 4PPQA 5DTQA 1OFGA 3B12A 3CLHA 5LXTB 1FUIA 3NM5A 3QELB 1DIAA 5CVTA 3TAHA 9ATCA 5B37A 3UB3A 1HFJA 1V45E 4ZCMA 1NVDA 1M1NB 1W73A 5K3EA 1SBYA 3DE2X 2Q07A 2XNSA 4V0MA 3UAVA 2J0UA 4FFNA 4MR7B 3TQSA 1QBKC 1H3NA 4Z0NA 1SUSA 3PFHA 3CONA 4IJWA 3WQHA 1V43A 1Z45A 4MB2A 2EFGA 5CX1B 1P6XA 5DGXA 1RPJA 4NONA 3RRYA 4EUHA 2ZSEA 4HRVA 3CWCA 1U6KA 3OLQA 4NBSA 2Q7OE 3WI7A 3ESZA 1WDTA 1Z3IX 3MGGA 4GQBA 5FTNA 2H5IA 4QUEA 3ESYA 5T6BA 1U0RA 3HN6A 3O8DA 3AQ4A 4S0XA 1FLDA 3S81A 2VTBB 4QELA 2HQOA 2DUWA 4KMRA 2JJQA 3JD3A 3T1TA 1U5BB 5BWLA 1BZYA 1A98A 1QWSA 1SZDA 1VSQA 2ETVA 1D5WA 2HPAA 4BB9A 4EDFA 4RMHA 3A6KA 3CINA 2Z08A 2RIPA 2TYSB 5HS4A 4HO1X 2FVYA 4QBIA 3LPNA 2NVBA 1EFUA 4B0OA 4NU0A 3P4XA 4KXMA 5I9NA 5SYMA 4EFNA 1ZQ9A 3M5WA 3LHFA 5AHKA 2HF9A 3TR0A 3I01A 1H9BA 1MQ9A 1GQ2A 2DG2A 4B8YA 2C9BA 2QRVB 1JAYA 1CUJA 4XYBA 4PSCA 4R2LA 3ZWWA 4NXNB 1Z4NA 4C0AC 1JA9A 4R1MA 3DLTA 1ZH2A 2Q8QA 2JIZD 3GRVA 3EQ8A 2II6A 2PGXA 4MO2A 4O63O 4UPVA 4UUQA 4ZZ2A 1Z0ZA 2XLCA 1KY4A 3KJNA 4E7OA 4C6TB 2YVQA 4WWHA 1TQ2A 2C7GA 4UATA 1YS1X 2Y05A 1X0VA 5REQB 5MHTA 1JG1A 5AM1A 2D59A 3HDQA 1J99A 3KT3A 4TRRA 1GNLA 2W6IA 3CXRA 3CZ9A 3O8BA 5DTJA 1FCJA 2BBSA 3L7OA 2FPGA 3KQUA 4QXQA 5A3RA 4DR7B 1NQTA 1KPGA 2YRFA 1KDTA 5KYXB 2PZBA 3QKRA 2C4TA 1VHLA 1JB1A 2G1UA 2QTRA 3N70A 3QVUA 4N54A 1WXEA 4OG2A 3S70A 4EKIA 4RVOA 1BGXT 2PMCA 3B52X 3OPNA 5LQCA 4PNEA 4MICA 4RZXA 5HGJA 1WB4A 1TEZA 3BAZA 2CVOA 2G28A 3EZGA 3WIUA 4XYLA 1PTKA 2AFIA 2HO4A 4HDNA 4BYMA 1DV1A 2F3TA 4ZYYA 1EK5A 3LUAA 1QIDA 2LTAA 2PS0A 3ZHBA 1EUDA 1DKPA 1BHQ1 1T6NA 1PS9A 3H84A 3JQCA 2X9NA 3TQIA 1WSDA 2WMDA 4Y3UA 2BGIA 1CR4A 1GYRA 1F5SA 1CR0A 3QTBA 5DFAA 1GYQA 3UFXB 1LLUA 2OZEA 121PA 2B83A 4Q4JB 4UAGA 4U0KA 2YICA 2O52A 3T4EA 3W2HA 5GJVC 3AI3A 3WK9A 1C9MA 2ZWAA 1W2WB 3C7CB 3KV3O 4HEJA 3FYUC 4GXNA 2WWRA 3BMQB 3DG9A 2FEAA 1V11A 5KOIA 2WTBA 4BO7A 1M83A 2D4AA 1I3NA 1QYWA 2FWPA 3BJMA 4NATA 3G8BA 4PS1A 4W6QA 4UQLA 3ZWOA 1EVLA 4KQXA 4F12A 1QQAA 5ICFA 3PQFA 4UVHA 1JQEA 1NU8A 3ICVA 4UNQA 3EG5A 3RUEA 4ZYUA 1KZGB 2H31A 2L18A 1R27A 5A7GA 1CXZA 4EL0A 3L49A 4I55F 3DW1X 3HC7A 3DOOA 1CUSA 2WE7A 4I4TB 2RB5A 3F6BX 2GBGA 2FWJA 2QW0X 2XWSA 4GUDA 4K9NA 4KWCA 4PSVA 4QTXA 1PJ2A 3ZG6A 3UB4A 1JHYA 5L7TA 1EFHA 8MHTA 4AI6A 5AOCA 1JA1A 4UNIA 3UPTA 4Z8YA 4X95A 4QHSA 1AS3A 1QV6A 3GZJA 5CITA 4ZEMA 1QH1B 4H1HA 1OXTA 4JEIA 4M86A 5A4AA 4RTPA 4AJOA 5EIBD 3HO6A 1KYXA 4BKPA 1X8JA 1OLOA 2R85A 1EM6A 3M1YA 3LQ2A 4QPPA 4DUYB 4FDUA 3BDAA 3KVRA 1ANKA 3AUTA 1II0A 3LCCA 2QTBA 3CG4A 4CODB 2O3TA 1C3OA 2JL1A 1L4YA 3KQMA 4NYJR 3GJ3A 3Q7PA 2Q1YA 4YRFA 4E5NA 3RC2A 3WGQA 2P5YA 2PXXA 2XB4A 3N2ZB 4Q9DA 5BT8A 1TM3E 2A2ZA 2RSLA 5ELXA 4X71A 3ROGA 3BD9A 3BEDA 3BXXA 5BN4B 1I6LA 4AKHA 4C4XA 5CNMA 3HJCA 3HNRA 3ZX5A 7ADHA 2AXQA 4MEBA 1D4ZA 4BMOB 2OLJA 4CTKA 3UKDA 1YI1A 2JGFA 1YDMA 5J4VA 4JWTA 3R3XA 2EV9A 4EUSA 5JV5A 4RULA 3THXB 1ZVMA 4GSYA 1FXWA 4D4MA 4IPTA 5EKTA 1L5YA 1IN8A 2VCYA 5FQOA 2P62A 3G89A 4XLZA 1BX1A 1MNQA 3RASA 4B9EA 1VHTA 2JFQA 1SY7A 2E5WA 4GYYA 1JTVA 5CB6A 1QX3A 4RVCA 1TO1E 2WKSA 2J08A 4TVSA 3SR4A 1ENPA 3C3XA 3LQRA 4MUFA 4YP7A 3UWDA 5C32A 1KQFA 4WZBB 2CGEA 5JNSA 2DFPA 5IMSA 2K5UA 2XLBA 3S0JA 2KLBA 3LUHA 5A05A 1Y9EA 2ZWMA 1J49A 2PLRA 1UDBA 2R62A 3FUUA 2M2IA 3E4DA 3C1OA 3KM0A 2CJWB 3WOHA 4Z3KA 4EKDA 5EPOA 5I4CA 2A6PA 4NDNE 5ALXA 1QCZA 1NU6A 4LYJA 1S2OA 2VKQA 3II6X 2NSJA 3LO5A 5ESRA 5CIYA 1O97D 1XJCA 1CR2A 3VU1A 1D2CA 3D3KA 3Q10A 3IAEA 4HI0E 4N7JA 1Q57A 4JHLA 2AYZA 4UM7A 5KJEA 3DTVB 3ZE0B 5LP6B 1J8DA 4L8VA 4CRWB 4ZYTA 3ZNNA 2OO5A 5ALMA 4M1MA 1GAXA 4IWXA 1BMTA 3VDRA 4CLHA 4AS1A 4AECA 2CCGA 1ECLA 1F51E 2RGUA 3C87A 4XWOA 1DINA 5IYZA 2B21A 4IINA 3ABRB 2YXBA 1XRPA 3BMOB 2VNJA 4QGFA 4MI3A 1OWOA 4JI3B 2XW6A 4DARA 2OV3A 1A4IA 1VDZA 5CT8A 5A9SB 3E22B 3TS1A 5AJXA 2WYIA 1X19A 2WZBA 4ZYZA 4EMTA 1H4VB 1KIAA 2A94A 1YE3A 1ZINA 2OGUA 5DNWA 5AM5A 3LBAA 3H2GA 1BIFA 2C96A 5FPHA 1GR0A 4TV8F 1FW6A 4Y18A 2YWRA 2GWHA 3B5IA 5J2TF 2GVNA 3AG6A 4D8WA 4XM2A 3B9RA 1MH1A 3CZ4A 4L2IB 4R51A 4AYWA 4D82A 4O1HA 5E9WA 3T5GA 4OBWA 3AJEA 1G5TA 2NVOA 3DLCA 1JTEA 1YKGA 1OB2A 4V1CA 1RQNA 3ZGVA 1FP2A 1G63A 1WEKA 2FP4A 2XB6A 3R44A 2CL6X 4H0CA 3DH0A 4LGMA 4PYNA 4E5MA 1YDEA 2FMUA 2JLVA 3KJQA 4QU9A 5KQMA 4UVEA 1CUGA 3EHDA 4WLFA 1YA8A 2B3DA 3FCEA 1G2IA 4L0DA 3QOYA 4M8LA 2GJAA 3SD7A 1ABBA 1T3LA 2VP4A 3EXHC 2ASVA 1DOAA 1XU4A 1E8DA 3FZGA 1CDOA 1GQQA 1GUFA 4ETWA 1R00A 2Q6LA 3B20A 3QU4A 1UCFA 5DV9A 1TZ2A 1UMCB 5CFPA 3URMA 3LKBA 3GH3A 3LBHA 2C2HA 1ATZA 1LPBB 3ZHRA 4U6NA 4KQEA 3I6YA 5CYGA 4CKZA 3E84A 3S7TA 2ZUSA 4IY1A 1P9RA 1PZFA 4PSUA 4MKRA 3H5IA 1E2KA 3I1FA 3KZXA 3ZIDA 2WUWE 3HHPA 2QLJA 1NXTA 4QM7A 2XKAA 5HXAA 4Q1EA 1UJ6A 4X1OA 3X2SA 1EX1A 1XZLA 3PT9A 4OJYA 3BJEA 4E14A 2A14A 3COJA 2OYRA 2HPVA 4YV7A 4A0GA 3RLIA 1NN5A 1Z82A 5ICMA 1J21A 1JFLA 3VR6H 2P2ZA 3I1IA 2HT6A 3TIIA 1FSZA 1DWPA 2NG1A 5DLDA 3ZLVA 1DC8A 1MPTA 4CKXA 2VEDA 1YE5A 4G41A 3Q11A 4QQKA 3LXRA 4CM3A 1PKEA 4K28A 3G7UA 3V97A 3IJEB 4CHGA 2HF7A 5JAMA 3U9SA 1DKOA 4B33A 5KYUB 3VR0A 1ZZGA 1YIOA 3ITEA 3H65A 4QJBA 5SICE 2H8GA 2WUFA 4I4IA 4OAQA 3WP0A 3VR1A 3W5VA 2FOIA 2YKGA 3QQ5A 3TL2A 4NE9A 4URWR 3Q4GA 1JLRA 1HQKA 4I8XA 3VPXA 3L7DA 1RMQA 1KI9A 4H08A 5AUNB 2AOUB 3CSSA 4PQYA 5IP5A 1IM5A 1I4DD 3PXCX 4UXJA 1JR6A 1Q0ZA 5JVDB 2Z95A 3DEAA 4HTFA 4BVGA 1ZOSA 2X4IA 1TT5B 2ZKLA 4KNVA 4LZZA 4OBEA 2VZ9A 3PPXA 4HLUC 5EXEA 1CZNA 3DAHA 3X1MA 1PDVA 1C7RA 4UDYX 2HEIA 3U7QB 3JASA 2J9RA 3DDNA 1VG1A 3KL4A 4KPGA 1CJCA 2WTEA 2EWMA 3QMWA 1K7CA 2AMFA 3ITKA 4FI3C 2O7SA 3N8IA 1CSEE 1TZKA 2VXBA 2XUAA 4GH5A 4H4EA 4O2AA 5BWBA 4AX4A 3RUDA 2PRYA 3BF8A 3NG1A 1F8YA 2GAOA 4TX1A 2RDMA 1NC3A 1BWRA 2HMYB 1E4EB 4J3NA 1FTSA 3N87A 1DBWA 3OI7A 4R98A 5JMOA 2WHYA 2P9TA 3SHVA 5U1PA 3DEZA 3AHJA 4AP6A 3B6KA 3M6IA 1EJ2A 2V59A 3MWGA 1G21A 3HI4A 3ZTWA 3GEGA 1V16B 3WLMA 3B8HA 2B30A 2L42A 4R3NA 3ZTTA 4GDFA 1KP3A 4B7UA 2AMLA 2WSBA 3A6PC 3R9XB 5F1KA 2WD7A 2NP6A 3HABA 1KQ3A 1YZKA 2FPKA 2WNHA 3CF4A 3GJXC 3FZQA 4A27A 3R75A 1RKVA 1Y3FE 1TTHA 1N2CA 3AI2A 1HURA 1NQAO 3DNPA 5FADA 4BNWA 5KX5B 1ZU5A 2QN1A 3O1HB 4M0PA 1RADA 2CW5A 3FR7A 4BV2A 2GF0A 2ZBDA 2X5XA 3LFUA 4LZLA 4DMLA 4BXOB 4YT8A 2Y0EA 2QRNA 2A0FA 3AF2A 4DIDA 2WSSD 2XWJI 3LECA 3TPFA 1YK1A 3H8JA 4H3HB 2BTQA 2QSYA 4KLZA 5EEHA 2YBDA 3UICA 3UGKA 2QJFA 4FS3A 3ZWPA 2DJIA 3CX7A 4K9OA 3HU3A 2XUFA 1MOPA 4LRWA 1FYDA 1KI2A 3HJAA 1M76A 4Y1FA 4XIYA 1QYDA 1U8YA 2OORC 1YZGA 2OG1A 4H59A 5KTRA 1W88A 2GN0A 3ICPA 2IX9A 3KFLA 3GEIA 4HWTA 2OO7A 2ONCA 1TCUA 2UYYA 1FMTA 3RFVA 2Y2UA 3QFFA 5A5DA 2OILA 3E58A 3FB1A 3ZDRA 2JARA 1ZGGA 4Q3DA 1ECPA 4JGBA 2QL7A 5K8IA 2AL7A 4CDMA 1Z47A 2YJ4A 3GNSA 5EHNA 2KI5A 4XQ9A 2JF0A 3E5NA 1I4WA 1EQ2A 4QLAA 3H19A 3PQ8A 2F8TA 1T5IA 2JLZA 3E5MA 2OHHA 1CDDA 3C8MA 1DO0A 3EZNA 4G81A 3LHIA 1ZRMA 4ZVUA 4HNVA 2XH8A 1N0UA 3M70A 4GP9A 5GZ6A 3STVA 3S4YA 4BLWA 1SXJC 4I08A 4ENRA 3CMMA 4X1YA 3B85A 4CR8A 3O5AA 2AN1A 4CLRA 1H9CA 1XJWA 3EASA 1UPCA 4Y2PA 2VJPA 5LYJA 1TPYA 1RPZA 3ORQA 2V5VA 2CFCA 4PRLA 3BORA 3O4HA 4S3MA 2HRDA 1QDLB 4J7UA 1OF1A 4Y7DA 5JCPA 5BSRA 1IHDA 1O5OA 5KNDD 1HETA 1J22A 4R2JA 2PZEA 3GZNA 2JLAA 5B5SA 5CDSA 2NPOA 3SSAA 3V8PA 2W48A 1VE7A 3LUCA 1C7EA 3PIDA 3U61B 5EFOA 1IQPA 1OIWA 1HKHA 1QGAA 3HCNA 3R8CA 1ZUNA 1XCPA 3S6JA 4YFYA 5AVUA 3B6IA 3FXAA 5F7XA 2GK4A 2XQIA 4QQFA 4QU5A 5CIQA 4ZVRA 3UA3A 1W29A 3JQAD 2YJ6A 2PX3A 3BIWA 3QUAA 4OKSA 3L18A 2FFJA 5ECYA 3ZKAA 5JFGA 5TF4A 3FCUB 4R5MA 4Y2HA 4GM0A 1FQJA 2X5KO 4QWWA 2H00A 4F8JA 5KQGA 3IKLA 4CXMA 1U2QA 5BXQC 3AVVA 3E6AA 5LZ7A 3AB7A 4Y6QA 2A0KA 3GGPA 5F35A 3OUZA 3GFTA 3PX3A 4DJDC 2DQZA 4RM3A 1B16A 3H3JA 2NSDA 1HE5A 1UDWA 5DX1A 2R6HA 4EY4A 4ZI7F 1GAWA 4EQZA 2CE2X 4OSOA 3N8HA 3R4VA 5A03A 1U8ZA 4JR1A 3KT8A 2JGMA 2BDUA 4ID3A 2H2AA 4BHTA 5EKUA 4B43A 4YB8A 1YXMA 5CDFE 1G8PA 1UOEA 3K0AB 1JKJA 4KRYA 5ALGA 3C5HA 3D02A 4CI0B 2XVMA 4I19A 2BLLA 1P4AA 3I45A 1S3FA 1CS0B 1YJBA 2KBFA 3EIQA 4QATA 3ROKA 1IZ8A 5BV8A 3BYZA 3PHLA 1FMLA 4GBJA 4UAUA 4RPCA 1E2UA 3DTVD 4GOND 5D00A 1W9MA 4OLAA 1M6EX 2DBVO 4QGHA 1KOGA 2GEDA 1BEEA 1DG3A 1ECCA 4XH9B 2IDJA 4O2RA 1ECGA 4PLFA 5I48A 5C52B 3V00A 2H48A 3E9ZA 3Q3JB 4JJFA 3I9KA 1K92A 4S1WA 4US2R 4BVFA 3UY4A 1O5IA 1ESNA 2WOJA 3M1LA 2I78A 1P33A 4RQAA 5B7PA 4KEAA 4PBTA 1UKVY 3L8FA 1H94A 2ZIVB 4LF4B 3JQBA 1OREA 1TF5A 4AXXA 1M2NA 4KQHA 3PUIA 5ALNA 5JHGB 4QAJA 1RHKA 4JLOA 4PC1A 2Y0CA 3AH8A 1YZYA 2DMRA 3HCRA 4PO9A 5LP1A 5EIXA 3T3NA 1ZXBA 2YN4A 4QUBA 4EF5A 5FWYA 3D7KA 2NPFA 5KWJA 1BX3A 4WXYB 4D43A 2IHZA 1BOFA 3NAMA 3TEMA 1XD9A 2VJNA 3BJRA 2YXDA 3IS3A 3PQCA 4PC7A 4YJFA 3SDSA 3EZXA 4GKJB 3T15A 1GZ4A 1NXPA 2ZEJA 3L0ZA 3T9FA 4CT0A 2ZAGA 1A1SA 3W5SA 4Q1VA 5JDCC 3UW1A 1JAIA 3LQ4A 3EOAI 3R7WB 3NJRA 4U1RA 4BB5A 4DG5A 4J1TC 1KJIA 3DKVA 4EITA 1D0VA 1PGNA 2OUKA 3FFXA 3N8KA 4FGKA 1MNAA 3GAAA 2O1EA 3WGZA 1BKSB 2HRCA 5C0OE 3SSMA 3BWCA 3W1WA 5JNUA 4U6QA 3SQNA 4MW1A 1ZC4A 3VMFA 5BUCA 1R5OA 3FPJA 5DWDA 1NE2A 3W5DA 5FWXB 4KI0A 2X9GA 4WUTA 3VVCA 5HRUA 2JH8A 2PYZA 2GN8A 5LC1A 2HQRA 1EUQA 1AT1A 4N40A 1UAYA 4DFDA 2ID9A 2A5JA 3IJ5A 2D7JA 3QLVA 1EBBA 2VTEA 2JVIA 3VBEA 2HDNB 1Q16A 2C94A 2D5CA 2VN8A 3HB7A 4PZ9A 4G0MA 2OHVA 5DHQA 1MORA 1OBHA 2EKPA 2H2DA 3BZUA 4NVRA 1RACA 1V9LA 2XYRA 3LOQA 5BOVA 5DNVA 2C9DA 3GEDA 1FUYB 1OQAA 1WZCA 4KN9S 1XVAA 4QUHA 3QLJA 4YS6A 4F97A 3IL2A 4G5GA 4M6WA 3U49A 3IQGX 1WULS 2W22A 1ACJA 1Y4UA 3HYSA 4U4AA 2OTCA 3MCWA 3FFWA 5E1BA 5K6RA 3M4JA 3T35A 1A0OA 5B4VA 4PGHA 2C31A 4XIFA 3FWHA 1P2FA 2HCFA 3A6GA 3IYLW 3UG7A 1QQ6A 2Q4DA 4IIUA 4WUVA 3RTDA 3F5DA 5BW6B 1Z88A 2FOXA 2XEDA 3GCDA 1RE0A 1XEWY 4FP9A 4X54A 3V4SA 3HN2A 3NDIA 4JDPA 3PFWO 3DVLA 4YCJA 4DCSA 1EFLA 2OBYA 1V1MA 5HKLA 2EKQA 2VDLB 3A31A 3UUWA 4PC6A 1QGUB 1O4VA 2A35A 5F77A 1V25A 3JQPA 4YPOA 3D0OA 4KUHA 4BIIA 3TF5A 3CNOA 4OI2A 3VXKA 3LSTA 3C5CA 1JXQA 4RQUA 2QLNA 3AL3A 4H7KA 2ADFA 1QC5A 5DHPA 5T57A 2IV7A 1GLNA 2YCLA 2ZR9A 1C9NA 1LWOA 1PJBA 3A2LA 3DMTC 4FYHA 1GFWA 5FOTA 1GA6A 4U2KA 4RKRA 1ZOIA 1W4ZA 3T0FA 3W3ZB 3VFDA 2Q1XA 2C4NA 3DQZA 5FXMA 4NR0A 2WEKA 3KVYA 4JODA 3LG2A 4R8VA 2JHCA 3VYRB 3S1AA 3PL1A 2D1RA 1QP8A 3C3KA 1DIGA 3TOZA 2IP2A 4Q7EA 4IGAA 3W8FA 2I6XA 4ZCTA 4OHXA 2W0MA 4HLQB 4PX9A 4XSHA 4KVZA 5EHIA 4C87A 1FNDA 3EY9A 4Z1OA 2G8LA 3RRZA 2R65A 2GJ4A 3DR5A 1DX9A 3HUDA 3KTAA 4LQ4A 4BNLA 1UP6A 2I4TA 2VPIA 2XYQA 1JMYA 3OQPA 3FPLA 4LVNA 4JCOA 4O4HB 1XA3A 2GK7A 4G1VA 3IJRA 5EMNA 5C51B 4M36A 4BMCA 4QOIA 5KTYA 3FTQA 3KB6A 4YAGA 4EG1A 4CG3A 1E2LA 4FMBB 1Z29A 1JLLB 4G86A 5BW4A 3M6AA 1E9DA 3GYGA 5I7VA 4QUDA 4P86A 1VL0A 5GOTA 3RYHA 4KKXB 4B75A 4A5SA 2H2FA 5AVRA 2K6GA 1CZKA 1E99A 1VL6A 3AM5A 4M1EA 4ZVKA 4YRLA 4E3WA 1K7SN 1TGYA 3GROA 3H6KA 3H2JA 4NBVA 1K5GA 3BSSA 2JVKA 4OSPA 3RSLA 4RPKA 1ZGHA 3ZU4A 5A6VA 3C7AA 3GGJA 2P2NA 3QV1A 1EU1A 5LVAA 5B6PA 1QF6A 1MABB 3LQFA 4QE3A 4MWCA 3T0IA 3ZXSA 1PWYE 4I14A 4MPPA 2G67A 3GH1A 4Q4AB 3UHJA 2QT1A 3NC0C 2W6JA 4KQMA 4U2BA 1F2VA 1BXRB 2V97A 3EUFA 4U63A 3P32A 3WP1B 4XX0A 5H80A 3P9PA 2DWPA 3U1BA 4K6FA 1D7AA 3RYIA 2QY9A 2P0YA 1CTQA 2QIPA 3AGQA 3NTQA 3OFJA 4MCAA 3A58B 2YBEA 4HQFA 4XDGA 3NONA 2GD1O 1U3GA 2LCIA 1QVRA 1Z33A 4XE5A 2XCTB 5FORA 3WNVA 2RGAA 5JAZA 1W49A 1OGIA 3AERA 3QPUA 4YP6A 1PNRA 1G55A 2VDKB 3ZEIA 1Q2UA 1JSRA 3VJKA 3CLSD 2HJGA 1WLSA 1KERA 2INGX 1KBQA 1D4FA 2GETA 3DKRA 4QQ8A 5DCLA 4QJIA 3OX1A 4HX2A 4X63A 3SZ3A 4DCPA 2IT1A 4HT3B 1LF0A 1SKYB 2DC1A 4C2AA 3OZWA 4P83A 1A7KA 4FBMA 4FR5A 1FC0A 2GZ2A 5CEEA 3THRA 3AONB 4K46A 1OSNA 4UEOA 1IN4A 4DV7B 2QUAA 1B8PA 1VRWA 2DHRA 2VBCA 5JIBA 1CF4A 3KX2A 2ZWVA 4FQ5A 1NUUA 3NATA 3BFPA 1KU0A 1X70A 1F14A 4KMMA 1NHGA 5ALOA 1T5DX 3K16A 2ZYRA 3RAGA 3U9LA 3SR3A 3SBDA 4L15A 2DULA 2V96A 1W0JA 4HXEB 2J9FB 3UXMA 1UT8A 4B3CA 2IVFA 4JEUA 3C8ZA 2PD3A 4Y7CA 1PV2A 1MOSA 3HSSA 1CRQA 1HG0A 4PZCA 1XEXA 1IJKA 3DMDA 1EFPA 1GZ6A 2HNKA 2OAEA 2ONJA 1Y42X 1R74A 3F7NA 1U9IC 4K9PA 4GXTA 5EQDA 3K70B 2CYAA 1T3HA 1AQLA 1T6BY 5CP8A 2GJKA 2CFIA 4JEHA 1FOEB 2BKEA 4QODA 2R00C 3RANA 1DOZA 1E79A 1HDIA 1MO5A 1T4CA 1LDEA 2GFQA 3A28A 4JBIA 4JI0B 4PX2A 4ZPXA 3ZK7A 4D9NA 2B7CA 4AX8A 1YJ5A 4C9BA 4DLXA 1K4MA 2M32A 3PTAA 3MUNA 3R0IA 1WZEA 2Q5HA 2Y1FA 4QREA 4B6EA 4N65A 5A9RA 4BVJA 1K06A 3K32A 2ZI6A 2XDAA 3E8XA 4HJRA 1BWPA 4IW3B 3RQSA 5IN4A 2QTLA 2AUMA 3SBXA 1W5TA 5AK4A 4B3XA 3LPDA 4CIAA 4RNDB 1NVVQ 2VUSA 5IAGA 4BFLA 1JT9A 1QH8B 4RYLA 1KHHA 1VSUA 3BJZA 4FD2A 1G5QA 1LUAA 1U1EA 5EP1A 5IDQA 1SNYA 3COYA 3OU6A 4QOFA 2HHCA 3A7EA 3DFKA 1MAWA 2BPOA 3BX1A 1D2HA 5KC9A 2QRZA 3I37X 1SUIA 5KUTA 1G20A 4RVUA 1KJZA 1QIFA 1H6BA 5FEMA 2PX4A 2WWWA 4H77A 4KQ9A 5ALWA 5I5GA 2I1VB 1NF8A 2O20A 3MWFA 4RH0A 3STUA 5AW8A 4F92B 1RAGA 4JL6A 1BKDR 2VF5X 3IXLA 2C7PA 3M3HA 3OSUA 4CKWA 2CLEB 4HTAA 1V5GA 3PS9A 2C2YA 1NW4A 1NBEA 3BRWD 3HU1A 4FUQA 4XEHA 1QG4A 1UMDB 3OMXA 4IDNA 3RHTA 2WD8A 4M9SA 5DM0A 3V2UA 5BUSA 4PLTA 1ZSNA 1G6Q1 3HXKA 3IMCA 1UDCA 4WLEA 4ZQIA 5JH7B 3AEUA 3KSDO 1T13A 3DF9A 1P5RA 3AZOA 3C14C 3TLMA 2G88A 1MDFA 4FEGA 3CVOA 1J8VA 1KNXA 2CXHA 4LHSA 4PIPA 3BGDA 3PG5A 1UJNA 3G0CA 1EZ4A 3TW4A 5AXDA 5KYYA 4BEJA 2CHUA 3OJ0A 2REQB 2CLOB 1X3LA 2EJCA 5BV7A 1AKMA 1D0IA 3EGIA 1PV4A 1E4EA 3B9BA 4DMMA 4PG4A 2WIGA 1PS8A 3U7RA 3W3AD 4EHDA 3D9QX 4Z7OB 2QTFA 5EZ5A 4HC4A 1T9BA 2JIRA 1OYVA 2ZU0C 3TR6A 1X1QA 2IYNA 2W2KB 3WLTA 4WN9B 5EWJA 4FOLA 1O77A 4JKIA 3OCXA 1KAMA 4N3CA 4RJIA 1P44A 2IPNA 2D1TA 4MGKR 4A0SA 1QGDA 4TS4A 4IVQA 3CNQS 3UJ6A 5C3MA 5JECA 4G23A 1ORWA 4WKCA 1MB2A 1PVVA 3FNEA 1NF3A 1XT6A 1KA9H 5GONF 1J9ZA 2VJMB 3FI9A 3A27A 3J81k 2QBYB 2IPLA 2ZJ1A 1PJRA 3DV0A 3KU1A 3SJCA 1W30A 2E37A 4YWHA 2G83A 3IV9A 4A2CA 2OZLA 5ULLA 1SCAA 4C29A 3ADCA 3UJPA 1BEUB 2Z04A 3F6EX 4HAIA 2PXHA 4FS8A 5BNWA 3PWKA 5IZCC 1S1MA 4ZU6X 2J9YB 3OTWA 4WXMA 3ZGNA 3OY2A 3OY7A 3IEXA 1DPFA 1JWBB 1HTTA 1NVEA 2H1WA 3PPWA 2IE0A 1L8QA 3H75A 5K4AA 3K6RA 1YCGA 1Z6GA 1XALA 1OE0A 4K8OA 4C05A 3G0HA 2RHTA 4CV1A 5I9BA 5HKKD 1WU8A 2WJAA 5ICCA 4OJMX 1PSDA 4OHZA 1JNXX 1DDGA 1M2WA 1O89A 3EVBA 3F9IA 3LIIA 4O59O 1V8FA 4AUNA 5DX8A 2G72A 3A1VA 4Z99A 1LD3A 4D44A 3K96A 1ESMA 1I32A 5JD5A 2N9UA 4C08A 1UJBA 4EBFA 2CT8A 2CCKA 4X1KA 4XR4A 1JAHA 5I3ZA 3DLIA 3DPIA 1UBCA 3ZDXB 4A8JB 2P4SA 2PHZA 1Z4PX 5CHEA 3MC1A 4KGDA 3F5MA 4NV0A 1C1XA 1TW2A 1GTSA 4H1VA 3PVZA 4MVWA 2QMUA 3IULA 4F3CA 3OQ1A 2PGIA 4WKOA 1BOOA 4URVR 1LI5A 1Z62A 4MVJH 1M67A 1SA0B 2X41A 3FSGD 5ERGB 5FHQA 1ORIA 5K8CA 3L4JA 2IYFA 4S05A 2I29A 2BHNA 2G04A 5KWSA 4ITRC 2QXUA 3KNZA 5KVVA 4DLBA 4LXHA 1ZMTA 4WNYA 3TLBA 3A6HA 4DEXA 4MZDA 5JJCA 3FAZA 1OU0A 3KQPA 1ZX1A 2PBLA 4Q02A 4UOQA 4EKGA 2D5IA 3EYAA 3P9SA 1NVGA 4K88A 1XZBA 1IY0A 1R50A 3PYXA 4RW0A 3KEGA 1C7FA 3EB9A 1Z6XA 4V24A 4KFTA 1PGJA 1ONPA 1XWWA 3FKJA 4URZR 3B78A 4MJXA 4X90A 3PQ6A 1MX1A 3UMBA 4Y6GB 1TQ8A 1AKTA 4IIFA 1LF5A 2QTWB 3P9XA 3QA3E 4D3ZA 4PZEA 2ZQYA 1KC3A 1G3MA 1G7TA 1T5HX 4MCJA 1LRLA 5A9SA 4BJHB 2X4DA 1ENYA 1J56A 4B81A 1OLSB 1GARA 4KNWA 3RTBA 3GVIA 3SZUA 2HBQA 3ND5A 4CMCA 2EJBA 4W8HA 1UT6A 1VCMA 1NOJA 3H2KA 4DA6A 4FB4A 5JMPA 3QE3A 1FYFA 2C99A 1N5MA 1NVVR 1VJRA 2DUUA 5EWLB 5EHXA 3G0GA 2DT5A 2RGRA 5DVZA 2D54A 1KO1A 5AK6A 2X0EA 3Q2KA 4LMPA 1YJ8A 5IASA 1GNSA 2RH8A 3ESBA 5E6RA 1UJ4A 3HV2A 3W9SA 3I6BA 2WHRA 5JANA 5BWOA 3DVAB 1WMSA 1VIVA 1W1UA 1LDGA 3C6ZA 2RI1A 3ZQKA 3DOEA 4PZLA 3BKWA 5I8PA 1XCMA 1L8XA 1N1EA 2CJWA 1AG9A 1STOA 4QUAA 2WIKA 3I8XA 2W2XA 1E2BA 4LAFA 4MMZB 5BNIA 3ENWA 3MB8A 3IAM6 4LV5B 4TTPA 2D7DA 3CEPB 1CUHA 4M4SA 2Z6AA 3SIWA 1I7LA 3WLJA 1IZ0A 3E0XA 3A6FA 1F4PA 5BMVA 5AP9A 2FJ0A 1L5RA 4R9RA 3D6NB 4OLHA 4DUPA 2WY2D 2JCSA 3QKWA 2ZR7A 1RRGA 2I0FA 1FYEA 2PFSA 2V7XA 4F93B 3CCCA 2VC2B 3MINA 1V1RB 2Y1EA 4K6MA 4E1VA 1KWGA 3TKAA 1GV1A 3M7IA 2QVZX 4MQ6A 4L73A 1NN1A 1EFTA 1T1GA 4GKBA 2PTGA 1SVOA 4PHTA 5TQ0B 2E82A 1E9AA 3EGCA 3KTDA 4UUBA 1RHJA 1BVRA 3OC6A 5E3IA 5JE8A 3NC1C 2V7TA 5M2QA 4CIBA 1VI6A 3M4YA 2GXUA 3MOSA 3KFXA 1SBNE 3F3KA 2XDYA 4ZT7A 3LY8A 4ZU3A 4XIGS 1GL9B 2A9OA 1Q0PA 5BN4A 3G9TA 2KWIA 3KG2A 1X1DA 1QE0A 1IOZA 4EW1A 2HGZA 4OSEA 4I3FA 4ALKA 1HDZA 3TCNA 4DYVA 5BN3A 2O8FB 3K5IA 2IXTA 2J3MA 2PBRA 1F8XA 3AHIA 3LOUA 2HA7A 5KVCA 2NYUA 2X2PA 5LQAA 2ECFA 3MMSA 3ZWAA 4MO9A 4RD3A 1QVWA 2AFHA 4MYTA 3AP2A 2IDZA 3M1AA 4GMGA 4ZOLA 3P71T 3U7FB 1XRNA 2PSDA 1UWKA 1V95A 1JZTA 3O8RA 4GLOA 2JGNA 1I1OA 4E5KA 3L77A 2QI9C 4MHSA 3NHUA 4HNRA 1XNQB 3B82A 2EG9A 4PEVA 4EJFA 1V41E 1F6WA 1L5NA 4EVIA 4EA9A 3EH2A 5B1HA 3V1YA 1E1DA 1L5KA 4PRZA 4D9HA 5KQRA 1G9TA 1DDOA 5J2TA 1UEXC 1VE3A 2J59A 4EGQA 3CUSA 3QJYA 1P61B 4C3ZA 1GV0A 3EH1A 3AW9A 4YP5A 4JBLA 4XSGA 4FILA 3THWA 2HJSA 3NWPA 3MJEA 4I4TA 3S8EA 3CUKA 3JPWA 1NBAA 1PDWA 3JYNA 4H6VA 3WWOA 1VFPA 2D06A 5G3YA 1FYVA 4CQMD 4ARUA 4JT4A 1SEVA 2ZR0A 2PT7A 3SFTA 1TU3A 1SHZA 3L1JA 1J07A 5DBEX 2AG0A 2JHAA 2WOOA 3I04A 3BHNA 4J0IA 5IT4A 5B3AA 3IE2A 3NQ41 2ONZA 3VTZA 2I4MA 5JJIA 1XE3A 1X0XA 3DAOA 1VA4A 4ASUD 1AVTA 1CX9B 1I0LA 1KZYC 1Q1AA 1Z34A 3EARA 3CNHA 1ZM7A 4RJ2A 1Q3HA 1M9NA 2DYKA 4L9RA 2ACVA 4PTLA 4ZT6A 2JB9A 1HZZA 4F2WA 4OQFA 3T6KA 2QAIA 4RE6A 3GDWA 4X62B 2J5KA 4RWZA 1SHUX 2PUJA 1VZ2A 1RAIA 1P1HA 1T0IA 4J07A 3HDJA 1ZD5A 5DT9A 3HEMA 2V65A 1L6RA 1UC8A 4I1VA 4K40A 5CJPA 4N03A 3QE2A 4Q05A 2V7QD 4MQ4A 3RSCA 4D8UA 2X0IA 3BGWA 3G8AA 2EU8A 4PWZA 1SG6A 1XF9A 2H1CA 3S2YA 4D3DA 4E03A 1AKQA 2BL4A 5DBOA 1UK7A 4IV8A 1QANA 1RKXA 1JT2A 3KWLA 3P52A 4RGQA 2H18A 7MHTA 3MNFA 5TSDA 5IWAB 3ETCA 3KWJA 3FCAA 3O6VA 4P31A 4URUR 2N1BA 1GQOA 1QU3A 4ASUA 5DGIA 4BE4A 4CV2A 3FRHA 4FPXA 1BX0A 3R40A 1KGDA 1M1YA 2YVLA 3NGLA 3OIUA 3PSAA 4L4XA 3KEOA 5EZSA 2FSSA 4HDQB 2RG7A 1Q77A 3MN1A 5IS2A 3FY4A 3GAFA 4IFTA 3HUUA 3ELBA 4WY8A 1YR7A 3HR4A 2KJQA 1S9DA 3TI9A 3ZN2A 4EM6A 1TMYA 2VCHA 1XMVA 4C04A 4L57A 1P1FA 4LJ4A 4ZHQF 5BSKA 2NU6A 2JCYA 2I3GA 1XNRB 3CH4B 3OVMA 4OHFA 1MU0A 3D4LA 5K2MA 1A77A 1SU6A 3KOZA 3G0BA 3QF4B 5B3JA 3R76A 1TEXA 3P26A 4IXWA 1JBKA 1WHTA 2GTIA 2PO5A 2FB9A 4LCBA 3WQRA 3Q0TA 1DCMA 1M1XB 2IIQA 2FPLA 2VJAA 4R05A 4BRSA 3RF6A 4C03A 5ITVA 5KX5F 3EVCA 4KVFA 5EVJA 2F7SA 3NHYA 3TVYA 2WB4A 1CVIA 3RYTC 3OIDA 4XFKA 2GDZA 5EMLA 1GVHA 4CL8A 4KQ2A 4IGEA 2HZ7A 3BTUA 2R8ZA 3RJZA 2N47A 3EUWA 2TS1A 4NMLA 1T0UA 3OIWA 5DYWA 1CEQA 4MYCA 2CVHA 2DHDA 2DCUA 3UWPA 3ZWDA 2Z83A 1WS6A 2YHUA 2OQVA 4CTMA 3MT8A 2VI5A 1SOAA 2Q5JA 1LBIA 3IP3A 3AR8A 4DRYA 3I4LA 1V3UA 2FW8A 4WOCA 3GMTA 4NCXA 1NYLA 1PR0A 3EFHA 4RF3A 1B41A 2H4JA 2DTXA 3C3AA 3KO8A 4IDBA 1U3WA 1WSAA 2VT3A 5HG0A 3UFBA 4GBGA 1DBSA 1G18A 1UC4B 3HKCB 3OQBA 3V33A 5LQRA 2B92A 1DHRA 5JO9A 3A3NA 4UE6A 1DBQA 1PJ4A 3DZKA 5B36A 3E22A 1IHXA 1LVUA 2BGLA 4LKRA 4C0JA 5CFMA 4HEHA 4QRHA 1Z18A 3I2YX 4GYJA 1EPUA 1DWQA 3GFGA 3ON5A 1QSGA 3QELA 4LRUA 1KO7A 1Z68A 3G2JA 4MV6A 5CU7A 4Z1MD 5T5QA 3WKDA 4CG1A 1XXHB 4XD7D 4IH1A 4JY7A 1ZKDA 5EKDA 3HA7A 3JALB 1E58A 4LVUA 5L3QA 5J3JA 1GG5A 3AUAA 4PLWA 5FF9A 1GPKA 5LP6A 5C5EA 3PHBE 5GGYA 5JRJA 1P2BA 1Z26A 4BKMA 3FPSA 4ALNA 1WETA 2R68A 4PR0A 3UJ3X 2CNDA 1GDTA 5HUHA 1U1CA 3VPAA 1AXRA 4ICIA 4NJMA 3Q5EA 4P4NA 5AK3A 3WRXC 1JGTA 5CA1F 1G9SA 1CB0A 3WO0A 1QQ7A 1UWVA 1Y1SA 4YBRA 2G63A 2WWIA 4QEKA 2JNWA 3GLGB 1RWMA 3JVEA 5LL6P 1N6RA 2P4QA 5FYDA 1CY6A 5LLDA 5FRDA 4BGVA 2JC3A 3LZCA 4RD6A 4YRQA 1FDVA 4HUQB 1U2TA 3X1WA 3ENNA 3VKFA 2FMFA 3AP1A 4EG4A 1SIWA 4KI7A 2N75A 4EYOA 3HB5X 2FR8C 4FJ2A 1BDHA 1B6SA 1E2IA 4AMGA 2C4UA 3M83A 4KTVE 4CDNA 1NXQA 3UH1A 1SHLA 3PNLA 2M6KA 3PFCA 2E1RA 2MYPA 2IQIA 5FUBA 3RM3A 1RQLA 1JEOA 3Q72A 1BQEA 4F6RA 1T1IA 4E6EA 1SHKA 2HWUA 4IXMA 4RZUA 4XGRA 5CT9A 4ZT3A 5H4HA 1MJFA 5LDGA 3RAPR 1OAAA 1Q17A 1YFJA 3CLTD 4YRRA 3ABIA 5TLSA 4YMGA 2H5EA 4MDFA 5DM1A 3EZFA 1U6IA 1GPYA 2YW9A 3VDQA 5AXCA 4LCEA 1RQ7A 3E2PA 2IYTA 4O25A 1PT5A 1A8QA 5DIFA 1FSGA 2AI2A 2OD2A 4LNAA 3GDFA 4R9NA 4X85A 5FTMA 1NGSA 5FI3A 4BVEA 4C14A 1N6PA 3S1SA 3TSYA 5CFNA 1EZ1A 2OD7A 3BGOS 1Z3CA 3JWGA 5T4EA 3VHXA 3P9IA 3NTVA 2HSGA 1BDIA 4PWYA 5BR7A 2A3NA 3PNMA 1JXOA 4P33A 5KDOA 1GITA 4JVOA 3EFOA 5FOQA 4H18A 3NBFA 3T3IA 1QIHA 3AQIA 1YR3A 2IZ1A 3H16A 3Q9LA 3ZV6A 4YI3A 5JZ9A 3VM6A 2BFBB 4GX1A 1HZZC 1DZIA 3IUJA 3MZ0A 1SUAA 3THXA 2J48A 2IYSA 1ZSYA 4BATA 1GZ7A 4JT9A 2FH5B 3H1EA 5HIAA 3QNMA 3K31A 3CF4G 4JGIA 1MFZA 1PL7A 3TJMA 2P4EA 3K9NA 5BYAA 4ND3A 3X43A 2AH5A 4DZTA 4CR6A 4AZSA 2Q2OA 3UK7A 1WEHA 4G0QA 4BKRA 2VNSA 4RVGA 4C76A 5EPEA 3RU3A 2QN3A 1NLUA 4HYTA 3N3BC 4P5PA 3HCEA 2PO7A 1AXGA 2J45A 4P7BA 3RV3A 4GF5A 5KOHA 4RK4A 3EF3A 4X60A 1B8OA 4HRYA 3TOXA 3U4GA 3TW6A 5P8WA 5DW3A 5ENDA 1ZMBA 4WJKB 2YWHA 3Q40A 1USWA 1NVUQ 1V11B 1ICEA 1SOWA 3BMQA 1W59A 5IN5A 1RM0A 3HVUA 1NJFA 3AR4A 4R7GA 2XMRA 2Z5FA 3ZUGA 3ZV7A 1CRZA 3F2VA 4I9UA 4F56A 3G6WA 1YL5A 1C7QA 2AOTA 2ZETA 2ZATA 4BV9A 5JAIA 2JW5A 3EPPA 3GI1A 3HYTA 4BWVA 1IBSA 1H1LA 4FYPA 2IPMA 3ZDEA 1K9VF 1XRMA 1USIA 1X1AA 1WD5A 2XIJA 4HUJA 1XVVA 2H2GA 1RKBA 2VP3A 1X7HA 1G291 1D2GA 2R6ZA 2IYEA 1Z4LA 1U94A 4Q9HA 3P0HA 3O2QB 3PFKA 1L5FA 2VQSA 1WABA 5JD6A 4J0GA 5JCJD 4P3KA 3B1XA 1Y82A 3ESAA 4NFLA 5EERA 3I2HA 2RAVA 4XQEA 3SYLA 1Z7EA 4V03A 4F04A 2HA3A 4A10A 1RXSA 2H4ZA 2VYQA 4QXMA 1P7WA 1P72A 1EI9A 2OG2A 5FR1A 4N8SA 1E2FA 4WKPA 2BEUA 1T5TA 3C5VA 4QG7A 4RFVA 4A8PA 4Z4IA 1XQWA 3TIGA 1VL8A 2EP7A 3HB1A 4BTLA 4GVLA 5FWAA 1WXQA 4JJ8A 4PSKA 4N9WA 4PSDA 5LBUA 3C41J 3ZS8A 2B6NA 2WLSA 2B61A 2B82A 4ER7A 3ZHTA 1USUA 1UXIA 2ODBA 1AQJA 3CKMA 4IZIA 4X94A 1M5UA 3DBLA 6REQA 1NVWQ 3M6LA 3M3DA 5K9ZA 2HYIC 4FINA 1H0KA 5B2EA 2ODQA 3WNDA 2COKA 3CE9A 4HFNA 3E48A 4AM8A 4X5OA 2X0JA 4J1SA 4L28A 1QUEA 3IODA 5ES4B 1AKWA 1UK9A 3MJ4A 1QHFA 1BQ4A 1YACA 3QYPA 4LVCA 3VH3A 1ADFA 4LFAB 1CJUC 1XTPA 3ZVRA 1O1YA 3RJ9A 1N2HA 3TWOA 3UN1A 3EULA 3ETJA 4MUMA 3EK2A 3LD9A 4DXAA 2AQKA 1W4BA 3TYXA 2BMVA 3BB4A 4BAUA 2G8NA 2F64A 3W6OA 4E0BA 4OY3A 3UC5A 4DUZB 2PQMA 2VZLA 1L8LA 1EAYA 1CF2O 1LQTA 2VK4A 1VLZA 2JBWA 4IIDA 4IIJA 1E6LA 4X3CA 2BFCB 5DIZA 2HO5A 5TQ0A 2X0NA 3NAQA 4JVSB 3ML1A 3TPCA 3ABQB 2ECOA 4C7MA 4Q3AA 2QTMA 3OCWA 2R47A 3H8SA 4M8IA 5HJ5A 3GLIB 3QP9A 1XQVA 1ZBDA 4PPFA 1A5ZA 4ZTZB 3VH1A 2IHNA 3QEOA 3USCS 2YJ3A 1XZAA 3I32A 5F1OA 1JECA 4DLWA 5DX0A 2DWQA 2NO4A 3GJ8A 3OIFA 4NG4A 4LJRA 3DP9A 2O0MA 2EX0A 5A04A 3K72B 4ZEVA 4TROA 5DI9A 3C6QA 5EIAA 4KR3A 1QHIA 4DVGA 3GQBA 3SXUB 4R6XA 1WXDA 1ZISA 4JI4B 3MCUA 5AKXA 3VTKA 1R37A 2OXIA 4YV2A 1U7XA 2Z2ZA 3SX4A 4QZVA 2RKOA 2ZE5A 4UOZA 5HZGA 1R1DA 1N9ZA 4LG1A 3UJAA 4DMKA 5IT0A 1FS5A 1M1NA 2R4TA 3GVCA 5JYBA 2C58A 1GFSA 5DGHA 4F38A 5LYJF 1SUEA 5EIOA 2PGAA 1QLWA 2AX3A 4FT4A 3D5EA 1R5NA 1P1JA 4RPHA 5LXTA 3I23A 5FLXA 4WGGA 4TRJA 4M7PA 4A0FA 4DILA 1HEIA 5JJKA 3FYCA 1JQBA 3IP8A 5LNK1 5KZMB 1IUPA 1DTWA 1QM5A 3FYUA 2Q5CA 2WFLA 5K51A 2OBMA 4JITA 2IYUA 2H1FA 3L7CA 5ARCA 2R86A 5CCXA 2VUHB 3WIDA 3NTOA 5AJWA 1VXOA 5L53A 5DEOA 3V8QA 3HMQA 3K6KA 4REOA 1C1DB 5ENVA 3KYDB 3LSYA 4GGPA 3T5MA 1J39A 3V80A 3ZCTA 1DGQA 4DJFC 3ZBQA 3A70A 3R41A 2BP7A 1JJAA 3LFTA 4J0FA 3FNRA 1H3EA 1FDWA 1T9HA 4ZZ0A 3ABZA 1P1CA 3D2LA 5L7WA 1SRRA 3INTA 2UXBB 4ZQBA 4R3UC 4CJXA 4UASA 1X1BA 3I64A 3EA5A 3UMSA 4EPRA 1M7BA 1CUWA 2AIRA 2AF4C 3VZDA 3GLFA 4X66B 2NLOA 3FPCA 2QPTA 3F73A 3AV3A 2IXFA 3E7DA 3L7BA 5E4YA 1QPZA 3L7JA 4OQLA 1G0NA 1H2FA 4EI2A 1LLDA 2JH3A 3U48A 2M1XA 3U16A 4RY2A 1VXRA 3WMWA 1R66A 2JI6A 2WP0A 1EUZA 3O8LA 2EW2A 2OUIA 4LKOA 4F4CA 3QVGB 2R7AA 4B3JA 3B1JA 4EX6A 1R9NA 3ED5A 1DFGA 3GGGA 4BRUA 4HEA6 3PXXA 1LNSA 4QQRA 5H16A 1KEUA 4OXYA 4BQQA 3JD2A 4P34A 4MB0A 2F3UA 2AC7A 4QGAA 4QYXA 2HAEA 2O9JA 4X1KB 1QO0A 2HIAA 3HA3A 3WNZA 3TUZC 1CT9A 3RUIA 4YR9A 4AKIA 2IU0A 3BCRA 3DOJA 2BGNA 1U3UA 4JVLA 1R0RE 2C1XA 4J9UE 4K2AA 4DDMA 1ZCBA 5AVZA 3LF2A 4MUYA 5L9AA 3A1NA 1KVRA 1P3Y1 3GC6A 1U0TA 4AIIA 4E70A 2G4LA 4ZOBA 2LBPA 4IKOA 2ZBGA 1LX7A 1T1JA 1PR5A 1HT3A 4PO8A 1QO9A 3AJ8A 4UHJA 1T9GS 3L6RA 2YOGA 3QVVA 3HVIA 2MR5A 5EHZA 1W93A 4MV0A 1E6CA 5CGQB 3GPCA 4MKHA 3C6YA 2P9BA 3D0RA 2CDAA 3VUFA 2EQ5A 4EYKA 2R8BA 3MTGA 4ENWA 2KHZA 3AC0A 1I5EA 3CUYA 4W5WA 4HH1A 4IQ4A 4TL9A 3UAZA 3TGLA 3CYFA 5AVYA 4ON9A 1UBKS 2MSKA 3GCGA 1LBSA 4KQ6A 4XDHA 1NMQA 2EX1A 3H7AA 4OQ4A 3OZRA 1IHOA 1TYCA 5CVUA 3WR5A 4H7IA 5DN6D 2MTBA 2D5LA 3O9ZA 1ZD8A 2WVAA 3EQ9A 3IRUA 3NTXA 4MRMA 4KO2S 4RD2A 1E2JA 4RK5A 1TX4B 4ZVVA 3WNQA 1U28A 4UVIA 3SF0A 3T7TA 4TTIA 4JI2B 1U1IA 5IU6A 1NVXQ 1GQFA 1OUMA 2O1WA 3EC1A 1CQJA 3P0EA 5AW7A 2HWXA 4PZUA 2O7RA 3V1TC 4YMVA 1KRXA 1EDDA 2O0JA 2GJSA 1KWKA 3MLAA 3CB2A 4QJ3A 3OHMA 2ZJ5A 4RV5A 3ELUA 3K1JA 2HM7A 3WLSA 1M8JA 2ZGVA 3EIFA 3WL4A 3WS7A 1G2QA 1OV4A 4JBNA 1WB6A 2Q0QA 3B9QA 1CIJA 1HA3A 3KSBC 3AVWA 3E3NA 4JI6B 4ND8B 2PX8A 5HK9A 3QY0A 5C9ZA 5ICSA 5JI3E 2Y1KA 3FCYA 4QULA 3FVTA 2IYWA 5BYBA 3U9TA 4CF7A 4JJZA 2XMCA 3SM3A 4TKZA 3SQDA 3T95A 3M6WA 4ZEWA 3TOSA 1R4MB 5KTNA 4ZOCA 1UKZA 1SG0A 2J6HA 3L46A 3GMSA 1ZQ1A 1TPZA 2JCBA 3Q87B 1UM9A 4JK3A 1IMOA 4XVQA 4BX2A 4RVNA 4Q4DA 3W5AA 1B74A 1LPNA 3HJBA 2E4AA 4XVHA 5J2TB 4JENA 4XAQA 1GSHA 2Z2JA 4UZSA 2YASA 2QTHA 4MP8A 1CZUA 1WUJS 1CIVA 3AIIA 4B35A 2B34A 1J0EA 1Z8FA 3LDFA 4D4JA 3H9UA 4K9SA 5HKOA 1JDSA 4OHPA 5JWOA 1OYOA 1U9ZA 1GLGA 5CA0A 3LDGA 2IKSA 3GEBA 4MTCA 3PHGA 4H7FA 2BTEA 4XDYA 4O1IA 4D26A 3RSFA 2J5QA 2AG1A 1CUIA 5HNKA 3CLRD 3OU2A 2V9ZA 2DQYA 1A7AA 2ZPTX 5KVSA 3BERA 1ZA2A 1MHPA 3VO1A 4QX6A 1R6TA 4BJ1A 1YB1A 4KSBA 3O75A 1KDRA 4OATA 2FG6C 3TL6A 4MDHA 1W5EA 4FFPA 1XHLA 3HFRA 4BNIA 3ZLTA 2XVYA 3NETA 4IJ5A 4BFUA 3GUYA 3KQOA 3WFJA 4UTNA 3TD9A 3KAJA 2F62A 4FGLA 4C4PA 1AV7A 5L45A 1QFXA 2BRUA 2ZTVA 3G68A 4ME6A 1RI3A 1DBVO 4FOPA 3MUOA 3CF0A 1S8OA 1E1CA 5D01A 5CLLA 1YZQA 4UJ3A 1O6FA 2F17A 2JD2A 2C83A 3L02A 4PVDA 5C2JB 5CAEA 4HYEA 1Z25A 2OM6A 4U2GA 5LB2A 4ALIA 5F3WB 3W78A 1W96A 3U4DA 4U8HA 1I14A 4WFQA 1JH8A 4AY2A 2BHTA 2CXSA 1JR3E 2QNIA 4FC6A 4S1OA 4GEGA 1GUDA 1WV0A 4JT2A 4TMFA 4F21A 2YV1A 4N0QA 4ZYVA 3RIMA 4KBYA 1LLQA 2GFHA 3NCHA 3WZ2A 2C5BA 1JG6A 3W8EA 4EP1A 3EAFA 1EP2B 2FPXA 2GRUA 3L6BA 4XFDA 1FNBA 4KR0A 5FTWA 4DKJA 4YAWA 3IT2A 3HXTA 4D0GA 1UDRA 5KHLB 1SHJA 2GOYA 4D96A 4HG2A 2UUPA 4FKZA 5C1BA 4Q3KA 2SNIE 5BSGA 2Q1SA 2O0KA 3KKPA 1QIGA 2UV8A 4B4UA 1WHSB 1QS0B 5DXJA 2QG6A 3EGWA 5THXA 4DREA 4OU5A 1BXKA 1E1RA 2WZQA 3ZHXA 2WHXA 1EJ6A 1WVIA 5FOVA 5JVDF 4PIVA 4R8LA 3UGQA 2HLPA 4J3JA 1EINA 5K8TA 1Z38A 2X9VA 1Z2OX 2W8BB 1V7QA 3O9MA 1R9GA 4B6SA 3ROMA 1O97C 4WA7A 4LNUA 4BQSA 4EEKA 5J4HA 1P7YA 2YY7A 4M0LA 5FKJA 2UVPB 1VBNA 2P6MA 3E3MA 1A8PA 5B55A 4HWRA 1T36B 1JDZA 2WAMA 3A04A 3HKBA 2Y1XA 4IV5A 4OLJA 2JAPA 4XVRA 3V4FA 1YAJA 1PT9A 5HDBB 3AEKA 2I1WA 4XCVA 4XJXA 1WOYA 3WWCA 3JQQA 4OQPA 3ZE7A 3F6SA 4HK4A 4M9CA 1QQ5A 4IVRA 4DLSA 1UQRA 2IYPA 3NBUA 2I91A 3FI0A 5HIJA 4Q34A 3PF8A 1QIJA 3OM8A 4IHAA 3QXGA 1L5OA 3B48A 3I1JA 1OPRA 2JFXA 2H4YA 2M6RA 3B7PA 1PR9A 4KQIA 1CUAA 5DHTA 3NVAA 4S12A 2CDBA 3EAGA 3U3XA 3KOUA 4Q4AA 4GKKB 4TKUA 1TC1A 2PVSA 3BGSA 3QE0A 4B5LA 4ZYXA 3PR1A 3UK0A 4HN2A 2YDXA 1PUXA 2WVJA 3TR5A 1FJXA 2WFAA 4Y6OA 1J7JA 1L4LA 1NKTA 1SWWA 1VHWA 3WV5A 3VSEA 3P0RA 3TRIA 2WPNA 5SYAA 1DP4A 2VJKA 4OHUA 3IOYA 1FS4A 1GNTA 1JEQB 1QKJA 2C5EA 3A36A 3V8NA 4BFTA 2IDMA 2EHJA 2Q5FA 5C7LO 3CGWA 3AVXA 2JGAA 2UYOA 2WPDA 4OFZA 3FG9A 1XU7A 5K0ZA 2H92A 3R09A 4MRRA 2WTMA 3ORFA 1PLLA 1YUNA 1QR2A 2O6LA 4PAWA 3OH8A 5FUMA 5JYDA 4P22A 1ZOLA 3VSBA 3JWIA 1J97A 1YCDA 1RLIA 2X23A 4KCGA 1B7GO 2GUWA 3N0WA 5CUQA 1WZ2A 4MP6A 2IF2A 3MW8A 4HVTA 2RI6A 1Q12A 4KO1S 2BSQA 1LEHA 3FVWA 4ARVA 3H1AA 3MT9A 1G38A 1P3JA 2BVNA 2EP5A 2IUEA 3A11A 3C43A 1G8FA 4GOXA 4O2BA 4INPA 4AVYA 1QE5A 3O0TA 2RHMA 2DKFA 3U44B 3FD8A 1FX0B 2DT8A 1Z2NX 2DSTA 1SBQA 1WRBA 2RJ3A 3KWMA 3MD0A 3PWTA 4MV5A 4NEGA 4COOA 3E1SA 4GNKA 1IN5A 4KIJA 4GX0A 3ZE1B 2CUZA 1QC5B 3PDJA 1F2UA 2FW7A 5L40A 2CV2A 2NTYC 2F3QA 1QTNA 5KYNA 2LCQA 2VJMA 2QBYA 1LC0A 1MGPA 1H22A 2BUBA 2OV1A 4IZHA 4KK4A 4IX1A 5MFPA 1EIZA 2QMQA 2ZJYA 3B2NA 3UJHA 5CURA 4E2FA 1SJ9A 3VC7A 1G17A 3DYBA 1DL5A 3DD1A 4N4AA 2OSBA 1JKFA 4JS0A 5NLLA 1BH2A 5KYGA 2E0IA 2ECKA 1XFAA 4FN4A 3AVQA 3P0JA 1UBSB 1QIIA 3F98A 2C82A 3FDIA 1YQWA 4HNAB 1ACLA 5AD1A 2PMDA 4BKUA 2W90A 4Z4GA 3L6UA 1WNTA 2YQ5A 2EIHA 4KO8A 2B1QA 2CKDA 3PJRA 3U4QB 4PQGA 1FFEA 3NU1A 1OTXA 3K9LA 3FWNA 5C7OO 1L4UA 2JLSA 5M04A 1NRWA 2GNAA 1UQUA 1BKYA 3BHMA 3I0NA 3R1IA 2BWJA 2B36A 4QHTA 3ELWA 4B31A 4N01A 1TVCA 2JCXA 4C30A 2QW8A 3EA4A 4LSWA 5JZMA 4EZBA 2GCPA 2BRUC 2COEA 1GCUA 2NZVG 1OX6A 3L84A 3LP5A 3QITA 1J4AA 2VXCA 4QSMA 4RUKA 5DF1A 3SEFA 4ZJPA 5CBPA 1QYRA 4M0CA 3MTDA 3NKFA 4KWEA 4R8KA 1OCEA 4DQDA 1COZA 2ZBEA 2PKYX 1H66A 2OD9A 4BNUA 3K0HA 1L7VC 1X6VA 3HKDA 1KEWA 1QHHB 4DLYA 4CPDA 2ZRMA 1Y9JA 2D2FA 4H60A 1ZICA 4LC0A 2X22A 1GPH1 1VM6A 3LIPA 4WCFC 4B5KA 1Z39A 4V0RA 2OWEA 1S2MA 4U9UA 2AR7A 3E35A 3KKZA 4MQ5A 4CKWB 3VC2A 4RVFA 3IVMA 4DDVA 1XRLA 1CJBA 4B3SB 2XB2A 1X87A 2ZSFA 3EBPA 4UU1A 1YDHA 5AW6A 4IIYA 5TS2A 3T3DA 5LKRA 2J3DA 3PEUA 1YRBA 1GPUA 5H0IA 2PUAA 3QUCA 1IIRA 4E4YA 3FFTA 4CNBA 5DNCA 4TKUB 1Z7YA 3UT5B 2H0QA 4PFQA 5CJJA 2APJA 1CERA 5FPTA 2DPLA 1XKLA