4N01A

The crystal structure of a periplasmic binding protein from veillonella parvula dsm 2008
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
296
structure length
296
Chain Sequence
b'GTSVTWSETFDGTKTDFAVKSAPTHAVSMSQATTEMMLQLGLDDKMAGTAFKEEEIYPPLQAAYDKVKVLSDKWPSYEVFMSVKPDFATGWPDSFSKRAIPADKMISQKVNIWIPESMLSTKADLETNFSDMIKLGEIFGVKPKAEEWVADQRKTLAAIQNKLKDLPRKRVFIYDSEDGQPFTAFEGYTTNILKLIGADNVMSGLGVDKTWAKGSWETVIAQNPDYIIIADYGNSIRNDDDFQQKIEKIKANPQLQDITAVKEGHFIRVKLSEITPGVRTVDALKRLAEEIHGIKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic binding protein
publication title The crystal structure of a periplasmic binding protein from Veillonella parvula dsm 2008
rcsb
source organism Veillonella parvula
molecule tags Transport protein
total genus 88
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4n01A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4n01A02
4B8YA 4N01A 2AFIB 2PS0A 1FP4B 2R7AA 5CR9A 1L5HA 5CX1A 5BVGA 3BE5A 4HMOA 1G20B 5KOHA 2PRSA 4PM4A 4UDNA 1ESZA 4WN9B 1QH1A 3EIWA 4G09A 1TOAA 3AEKB 4TKVA 3HJTA 3ZK9A 3U7QB 5I4KA 1H1LA 2ETVA 4WZAA 4NNOA 1QGUB 4ND8A 5JG7A 3TLKA 4K3VA 1G21A 4MX8A 1M34A 2PS3A 4WESA 1PSZA 5KOHB 4HMQA 2XH8A 4GICA 4FI3F 4H59A 1QH1B 4LJSA 5HDQA 4IRMA 1KAHA 2XDQA 4TKVB 5JPDA 2YNMD 2WHYA 2RG7A 3AESA 5FLYA 4WZAB 3HH8A 3MINB 4XPIA 3AERB 4MDYA 3AEUA 4CL2A 4MLZA 1MIOA 3AEQA 4MO9A 3G9QA 2OV1A 3PSAA 5KOJA 3TNYA 4WESB 1K0FA 5JOQA 2AFHB 3PDIA 4FILA 3MWFA 4INPA 1K7SN 3MD9A 2MINA 2XDQB 3R5TA 3MWGA 5KHLB 5M2QA 4WZBA 3AETA 3MFQA 4XPIB 1L5HB 5BVGB 5CX1B 4FKMA 1MIOB 1M1YA 3AEQB 5B58T 2M6LA 4M7OA 4UDOA 2XY4A 1PQ4A 4UTOA 5BVHA 5JJ5A 4OVKA 4OXQA 3TEFA 3PSHA 2PHZA 4INOA 5GGYA 1K2VN 1XVLA 1QH8A 1H1LB 4FNAA 4TKUA 1M1NA 4ND8B 4WZBB 3AETB 3ZKAA 4NNPA 3LHSA 1G21B 1FP4A 1M34B 3ZTTA 1N4AA 2OSVA 1M1YB 2Q8QA 4WNAA 5BVHB 2X4LA 1G20A 2YNMC 3BE6A 4G07A 4WN9A 1N2CA 1QH8B 3AESB 4TKUB 1M1NB 2XUZA 3AEKA 3GI1A 3AEUB 3U7QA 2OGWA 1N4DA 4HN9A 1QGUA 4BBPA 5KOJB 5M34A 2XV1A 3PDIB 4WNAB 3R5SA 3K1AA 2MINB 2R79A 4HMPA 3ZK7A 2WI8A 4DBLE 5HX7A 2O1EA 2QI9F 5M29A 1N2CB 5GGXA 1KARA 2OV3A 5AFSA 2AFIA 3CX3A 3MINA 3AERA 1K75A 1N2ZA 2M6KA 3ZK8A 3NU1A 1KAEA 2Q8PA 4UTPA 5M3BA 3K1AB 4PAGA 4LS3A 3UJPA 2AFHA 2XQVA 4OXRA 1EFDN 4H0FA 3EIXA 2PS9A 3HXPA 3LI2A
chains in the Genus database with same CATH superfamily
1DAMA 3DFKA 1A7JA 1AXRA 1R1DA 5JH7F 1U9ZA 1KIMA 2XNSA 3I12A 3BE5A 2OBLA 2R6GA 4XQ0A 2BF7A 4RD3A 1MD9A 1X7YB 2XGJA 1JPVA 2W6CX 2HJRA 3IIIA 1QPGA 2NTJA 3G2MA 3AFHA 4HZUB 1QTIA 3DE4X 4KSBA 2AX3A 1Z16A 1RLUA 2BI7A 4QWWA 3RSGA 1U8FO 3DM9B 1FLNA 4R2JA 1T1EA 1N7GA 4UTXA 4AP9A 1H6CA 3L0OA 5E6SB 1XV5A 1A8HA 1GT91 4LSWA 1QQTA 2R2GA 3JVUA 3DBLA 4MYDA 1JQBA 2EDAA 3TW8A 4ZI7F 4UTNA 2RGUA 5ITZA 4TUYF 4I1PA 3NLLA 5E4TA 1RPNA 3N59A 3OUUA 3TWOA 1IEQA 4RXTA 1DC6A 3LQ1A 2Q4OA 2PWZA 2W48A 4OREX 4TT8A 4ZO9A 2GDJA 4BBAA 4BBZA 2I6QA 3K4HA 3PIDA 5NULA 2VI5A 4XPZA 4NPAA 2V8OA 1OFHA 5G2OA 1MIOA 1R0WA 3I92A 4Q9IA 3HCBA 2L42A 4BZXA 3MWEB 4FZRA 4FFPA 4UAVA 4D6YA 1P5JA 1VHTA 3WTBA 3ZGZA 2AFHB 1XX6A 2FSIA 4IMIB 1DBPA 1VBNA 2B61A 2C04A 1GPKA 3KKKA 2CCJA 3QUTA 3HB1A 3V7WA 2A33A 3W2HA 4XRGA 5KWEA 5KCMA 4Q3DA 3DG9A 1ZCFA 2FCAA 5TQ0A 1QTQA 3RYFB 4DHEA 1JEYB 1GM5A 1Z0SA 5LBIA 5T8KA 4EVRA 5LWQA 3DBHA 1Y1KE 3NUQA 3ZE7A 1O95A 2BEUB 3WKBA 4L07A 3I9KA 2JC3A 4KZPA 4RQTA 5I9BA 4D0NA 2OHFA 2J7PD 3AILA 3FDZB 2VBGA 2QTGA 4OHVA 4TX1A 3TLEA 1GIAA 5BVHA 1X94A 2Z4TA 1H2EA 4E5NA 4O2BF 4XSVA 4POOA 3ZCUA 3ADBA 3ESBA 4CT0A 1MQ9A 3OX4A 3TSWA 3KOXA 1QP7A 4QOJA 3NG1A 3QW2A 2Q3JA 2CJYA 1JMVA 5DM4A 4C4SA 2VQEB 1T8YA 2QIPA 2HCTA 1DKMA 3LGSA 2FUEA 1N5DA 3G0CA 3L4BA 1QIJA 1KVTA 4KV7A 4L6AA 5LKAA 3ZGLA 2DFTA 4X24A 3OZUA 2ZSIA 3WLOA 5L7YA 5J9FA 4MP8A 4BZWA 3HBLA 1KTIA 3RIHA 1PWZA 3I9NA 3PYMA 3AUJB 1UIMA 2IA5A 4WPGA 1YRAA 1QMGA 5DTIA 1M1NB 3VTAA 1TADA 3PDUA 3O6VA 2A30A 2AIRA 4O08A 2YW2A 2AHRA 1MEJA 1QGUA 3F96A 3K1YA 1JT9A 2D4AA 1CNFA 1OC2A 1VIDA 2PGNA 4A23A 1RWVA 3EPKA 5KSZA 3RAFC 2C92A 3GRRA 4NBWA 1M72A 3BB4A 2YTZA 4LYHA 5LLSA 2XSZA 4F0JA 1AHHA 5FA8A 4F3TA 1NAIA 3GJ8A 3L0BA 3INYA 3Q98A 3I9LA 1A2QA 2H5LA 1QFMA 3KQPA 4P4SA 2QZJA 2HTFA 4JLVA 1VKRA 4CQMA 5IKEA 2AJLI 4L9SA 1ZGCA 3CNNA 2DHDA 2NUPA 3RD5A 3G23A 2YIJA 3IURA 3W05A 1WSBA 4X9XA 3MTAA 1Q1NA 5MN6A 1CZOA 1YKFA 4FVTA 5D8DA 1ZC4A 3LSTA 3W3AA 2R48A 5ENVA 4B46A 3M4XA 4OHZA 3WMGA 4GFDA 1A9ZA 3UFXB 4HB3A 1J1ZA 4LF7B 3F6CA 2IEAA 1E3LA 1E1YA 2X8WA 3I4FA 1JQ3A 2CYAA 3K8YA 3R6WA 3T1OA 3IVXA 4JC4A 5CA0A 3HWRA 2VK4A 3L0CA 3GFTA 4DDTA 5HIKA 2AN4A 1WW2A 2P4SA 3TGLA 3UPTA 2BSQA 1UAGA 3LOQA 2CXHA 4MQFB 2I54A 2OO5C 2YCBA 2A4MA 2FR0A 1T5LA 2GJ9A 4FYIA 3FG9A 1Z2NX 4LV6A 4IHKA 4H7FA 5GJVC 3OD1A 3S2SA 1T5OA 2ODBA 5LVAA 4GPBA 4NATA 4D96A 1P5HA 4M37A 4WK6A 5L53A 1WSWA 1PQYA 3V7FA 5JEDA 4DEXA 2OCYC 1Z2CA 2WD9A 1QB8A 1J2EA 5EGSA 1TM1E 4AYWA 1QO0A 1TJ4A 4EYOA 3PNBA 4B6SA 4EGQA 2VDLB 1E2JA 3E1KA 4Q9AA 1VJ0A 2WU1A 3T41A 3ZCSA 1KMMA 1HQCA 1PFWA 1FJ2A 1SBNE 2ZDGA 5JAPA 5KNDH 5DSTA 4YDQA 3GIDA 2V03A 2WJ3A 3CH5A 1U0EA 1Y4ZA 3BZWA 5AJXA 1RXVA 4E5KA 2Q0QA 4KFSA 1AUPA 4CV2A 2ZE7A 1EVLA 4TQUS 4IJWA 1C80A 4KPEC 4FILA 1RLJA 2XEDA 3L7JA 1SHLA 2C5HA 3EDOA 3FCEA 3R3HA 3NDJA 3DEJA 4HQNA 1SVWA 3C7CB 4NZZA 2JZOA 2QM3A 4BCCA 2HIHA 4MPJA 3PWZA 1SC9A 1V5WA 3F5SA 1XAHA 1PNTA 4XTCS 1ZIYA 3A26A 1CUUA 1FMFA 2EVWX 3W8EA 5U4QA 3O4FA 5EMLA 3HTXA 2IS6A 3WWCA 2D7DA 3IQWA 3TEFA 1T10A 3FVVA 3HA7A 3GA7A 2QI9C 2GX6A 3UAXA 4UHKA 3I5YA 5F3WB 4JX8A 4DA6A 5ALVA 5JMPA 2B8WA 5IAGA 2GZDA 4N76A 1CR6A 3BGIA 3LC2O 3K5PA 3UKOA 5H1YA 1KBZA 2HREA 1PLLA 3I04M 1VRVA 4M7WA 4P3OA 3D5TA 1CF4A 3GLGA 4GW3A 2HIAA 1KIFA 2IDZA 4NCIA 2WOOA 3ZZNA 4EQ6A 3RFFA 1YRBA 2CL5A 3R0ZA 1QH8B 4OK5A 4ARIA 1MAUA 4QFCA 3ZZTA 4D0RA 4BFVA 1KYTA 1VJGA 2IPNA 2QZ4A 3GJTA 1ESCA 4JCOA 2HYDA 2VDPB 4L4ZA 4LDPA 5SZKB 5TE9A 3WRXC 3MBKA 4YAOA 5DHPA 2PT6A 7YASA 1PU2A 2J5BA 3PWSA 221PA 1U0TA 4FD2A 3SF8B 3K0CC 3SK0A 3CPJB 5T7BA 4Z1OA 2VJOA 3DD5A 2HMAA 2JLCA 4MH0R 4S1WA 1U2DA 2FETA 2VHVA 4NMLA 2JD1A 3KWMA 4PXYA 5FORA 1NW5A 3DKVA 3IQHX 2JCBA 1TA9A 4K9RA 1IM2A 3M4YA 3DC2A 5F64A 4Z2AA 3A37A 3TZKA 4PANA 2YIDA 3W5BA 1X86B 4J91A 4LRXA 3TX6A 3X1XA 2BUAA 1I7QB 4BP1A 4DF3A 4YMVA 1UPCA 4TTJA 4RF5A 2PM8A 2D7JA 4RK7A 3MUOA 3R7SA 1VP3A 4OG2A 5FI3A 2QVCA 2DJIA 4I3GA 4BGEA 1C8BA 3UUGA 3HU1A 2IQ5A 2ZZKA 4IRUB 4M87A 2OOKA 3IXQA 4P3YA 3PNLA 2WUWE 3R3SA 4AF6A 1Q7TA 2XR1A 1R18A 3DEZA 3PC7A 4LBVA 4YJHA 1D6JA 1KYQA 5CR9A 1G0OA 4UZEA 1RSZA 5CX1A 3IOEA 1HNXB 1JKXA 4KI7A 3THSA 2QJRA 1MX3A 1P4RA 1GKYA 1STOA 1UC5B 1VXRA 4LRUA 4ACBA 4URVR 1N8SA 1CQXA 2NYRA 4BJ5A 5LIRA 4LBYA 1NN0A 4LHZA 1I0LA 1DXQA 2PGLA 4OB7A 1HNZB 1SHTX 2GF0A 2QQ5A 3DQQA 3MOSA 4JBGA 3WGQA 5CFRA 4JJ7A 3KSAC 1GTL1 1WR8A 1BH2A 4QHYA 3FPHA 4XWKA 1Z7WA 4HWOA 2WY2D 2V45A 1QE3A 4PR3A 4AS2A 2WYUA 2WMNB 2B9VA 2NT4A 1CS0A 3HADA 1X9IA 3KP1A 2YZNA 3F97A 4FUTA 1HTBA 2ODNA 3I58A 4P31A 3MG9A 2Q7DA 6YASA 5KNCH 3O8CA 4OFXA 3W5DA 2GI4A 3A6JA 4C4ZA 3QSYA 4HL6A 2C8VA 4URWR 3MT8A 121PA 3SGLA 1YR3A 1NU6A 1Z6QA 1R6XA 3IIKA 4MLZA 3ZXUB 4JBWA 4ZVVA 4B3FX 1Y81A 2O54A 3PFBA 5LD2C 4NU0A 3KLPX 1SH7A 1NXTA 2OAEA 4ZCPA 1V47A 1VCMA 1Z56C 5FNVB 3EK2A 4XDYA 3VR2A 5JJBA 3QENA 4X45A 5FPTA 3ZKWB 4EI2A 5LXTB 5IHPA 3OC0A 4NL4H 3QVGA 3QW4B 3NVMB 3TZEA 1ULSA 3VR3D 3H4TA 3LXUX 3I2KA 2AOWA 3LG2A 3GNLA 1H2FA 2YXBA 4N7MA 2B4YA 3ZBPA 5HUJA 4K03A 5GWXA 1YTLA 2IUFA 4U2BA 3GEHA 4HPJB 3E3LA 4F5WA 3F2VA 1ZD8A 1W48A 3WSTA 5KWSA 1X3SA 1ZM7A 1Z7BA 2R86A 1C9EA 3M8KA 2FFRA 1XZDA 2EKBA 4RPGA 5JC1A 1G98A 1XEWX 2WA2A 4KH1A 1Z4PX 4IIVA 4WINA 3FOBA 5I9TA 4NIMA 5T41A 4QYIA 1QO7A 2TRSB 3QG1A 1FX1A 3AB3A 2DQ4A 4BWYA 3U16A 2O8DB 4KUHA 4MS4A 1RAFA 2NT3A 2ODEA 3L1UA 5FD8A 5KX5F 2WT9A 4K8RB 4NYIQ 4RM2A 3OWXA 1D2GA 2J4DA 5EN4A 5TQ2B 1WPXA 1QBGA 3PE3A 4FPXA 3KUKA 4MR8A 1EGAA 4X90A 4FEEA 1Z7GA 3VR5H 4I08A 3RUEA 1I6WA 1XRSB 2HI0A 1GGNA 3F3YA 3SDSA 3I3SR 4NYJR 5DT2A 1EFLA 1EXDA 3T1NA 1WBJB 1U81A 3OO0A 2GN4A 4LHEA 3H97A 2HDOA 3KJEA 1L4BA 3DMDA 1T6XA 3SQOA 2KW5A 1SXGA 2EP7A 2HN9A 1PF7E 4QUGA 4LNHA 3R09A 3K09C 4QO8A 4RHCA 4RVOA 2RCYA 4MPRA 4JZKA 3T3GA 2ZIVB 4AIIA 1BJRE 4X3PA 1TAHA 1UKEA 1OXMA 1G5QA 3TVDA 5B7NA 2ZIXA 3ZIUA 2FG5A 4PICA 4MDEA 3ON5A 3ZNOA 3V4FA 2P3QA 3QBEA 1MENA 1GO2A 2P9HA 2VYQA 3AG6A 2EBHX 3JU3A 3W5HA 4LXGA 1JW9B 1WW8A 3E05A 4YUVA 3OQPA 3IS3A 4X95A 4RFLA 5BN3A 3KJQA 4KWIA 2IE8A 4WFKA 4CMCA 3L4SO 5LQCA 3OEHA 3M6FA 2Z1NA 1A9RA 5A62A 3QPWA 1R64A 1UJ6A 1G1AA 4PSCA 3RF7A 4AKGA 1K0UA 2QDKA 1BE6A 3RRZA 4BKUA 1XD9A 4IP0A 4QDTA 3BJIC 4N3AA 2I4NA 1WX1A 2RHHA 1H2HA 4HDAA 4FZ5A 2YYAA 3MTDA 3HUDA 4KYVA 1II9A 1QDLB 2MYTA 5ALPA 3UK1A 4DLKA 3EGWA 4FYKA 4M1MA 2I29A 3SZRA 1PSZA 2UUOA 2ZRNA 5CB4B 4HMQA 2EGHA 1XTBA 1O5IA 2KS6A 2TECE 1FLDA 3LVRE 2NADA 4AZVA 2JHFA 4RKFA 1KC3A 2XUGA 4BO8A 1JGTA 1WCXA 4OI2A 4I50B 4IXNA 3SNKA 3VNRA 4ALKA 5CFOA 1ISRA 2R7NA 1NFFA 4MB2A 2QUIA 4GPEA 4KN9S 5DLDA 4JYPA 3SZLA 3ZZMA 4B4WA 5C8DA 3P52A 2E7ZA 3D5QA 3PSAA 4FT2A 4KOAA 2IOYA 2DQZA 4QECA 2AMLA 3ZHBA 1SU7A 3UANA 4D74A 2C3UA 3JQGA 4IUCS 4B2YA 4O2AF 3M3HA 4BNTA 4IIFA 3F6BX 4NV0A 4FUQA 2COKA 4HDNA 3EVTA 1TGVA 2Q3FA 4E1VA 5ALRA 2QX9A 3HKBA 4GI7A 1DBRA 1VJDA 3W2FA 2Z2IA 2HLDA 3TQSA 2J87A 1DOHA 4FKBA 2NTVA 3EN0A 2VP5A 1RI5A 1U3DA 3RYCB 2AN9A 2XB9A 1ZN7A 1PFUA 2QE7A 1E1QD 1H9BA 2AEFA 3K2IA 5GGYA 5H16A 5J2TF 2UZ3A 1C41A 1NVMB 3IAHA 4ZT5A 3UAWA 3IUJA 1TF2A 2W6QA 5HA5A 1JMYA 5JS2A 2ZWAA 1NR1A 1FP4A 4UM9D 1KNXA 1T1RA 4QOFA 5B3LA 3KZOA 3FPFA 4JLJA 3C0KA 5F51A 4B31A 4PLPA 1ESDA 1O0SA 4WOPA 1T0BA 3ZJ5A 5BWLA 1Y6ZA 2F59A 1UM9A 2PKEA 4OXIA 1SHKA 6AT1A 3K9NA 5BV0A 3ABSB 3DLAA 3PQEA 3KHKA 3GZNA 4RKEA 1U28C 3R23A 4QBHA 1W59A 4UUAA 3BFJA 3U7QA 2B1GA 3I6YA 2C0QA 2IHBA 3DJFA 1W5SA 3EVZA 3NM5A 3KQVA 2RAUA 1I2AA 2IOFA 1QQ6A 2VKQA 2YH2A 2A86A 3MOIA 3SY8A 2F7SA 5REQA 4EO7A 5JH7A 4LX8A 3GVXA 1NXOA 1JJIA 1GNPA 3N8KA 4HS9A 2YV1A 4I19A 1Q7EA 1YVEI 2JJQA 1ODCA 1XXLA 1YIDA 3ELYA 1H42A 4NBKA 2HYIC 3PTLA 4MWEA 4Q6WA 1F2UA 3L7MA 3TRFA 2B25A 2R66A 1EM8B 5FA5A 2XNDD 4PPQA 3JATB 4C2UA 1M0SA 1CZUA 2Q99A 2LNDA 2I78A 3AXSA 4ZQBA 1XZPA 4K46A 1PFYA 4IICA 3GQBB 3KB8A 1QONA 1UFVA 2X2EA 1QWOA 1U3GA 1KO5A 1UT5A 1XROA 2JH9A 3EH2A 2JIZA 4NBSA 1LBEA 4TUYA 4ZI7A 1KVQA 3TFOA 4ABTA 2ZB4A 1MO3A 3PENA 5E4FA 3JQBC 3KQTA 1SZCA 2OBFA 4E2WA 1K98A 5I3ZA 2M1XA 4L72A 4B73A 4GH5A 4MWDA 1SUEA 4MOWA 3ZHCA 1E2MA 2YN4A 1M2KA 4UASA 1KQ3A 5HWSA 2AC4A 2EKPA 1YL6A 5CLGA 1QAQA 4YRCA 3TLXA 4GDMA 1GPYA 2Z4RA 3I34X 1D2MA 3LM8A 1AK9A 2AOUA 1HYHA 2PKYX 3C5HA 2DZDA 3Q10A 4PN3A 4ZARA 3B3GA 2IIVA 4NRDA 5A5FA 4LJ4A 1NVTA 2VTDA 4MCIA 4X1KA 1G21E 5KVCA 2O2ZA 3DB1A 1YBMA 3SM3A 4Y1FA 2N0SA 1M1YE 3E0QA 4A6PA 2IFTA 2QQGA 3GNQA 2XMPA 4GICA 1PL7A 4IGIA 4X6UA 3SF0A 3BCUA 5ADHA 3UOWA 1BVRA 2QAGC 3DFFA 3CLHA 3S1AB 1EE1A 3NKLA 3T9CA 1TYCA 2HJ9A 4TKVB 3PS9A 4IHAA 4YC7A 3TD6A 1G5PA 4H77A 4ILEA 2XUKA 5AW5A 3U17A 4O2BA 3NMUF 3VO2A 3ZWBA 3SKXA 2LIVA 5LQKA 5C8YF 2NP7A 3EJ6A 4HXYA 2JCYA 4CIVA 1JEQB 3IMGA 3WAGA 5CU7A 3P9PA 5G1NA 4A5SA 1AA6A 1ITZA 4GOOD 5JZBA 1IWBB 2XB2A 3D3QA 4EHLA 3RU2A 5MHTA 4I7EA 4RVCA 1ZUIA 1A2BA 4RHYA 1OF1A 2CJPA 1AMUA 3ZV3A 3K6RA 1M6WA 1NF2A 1LQ2A 2I71A 3VU9B 3OUZA 1QIFA 2UVPB 4Q1AA 5HZHA 5AKGA 2ZXEA 3IXLA 1A9TA 4ND4A 2EKDA 3ZWDA 4EF6A 5EJ9A 1K3UB 3LQ2A 2XCQA 4M0DA 4FMBB 3X1YA 4D5GA 1P6QA 3E8SA 1C4XA 3M70A 4AF8A 3WIUA 1REQB 1M34B 1KWKA 3DMFA 1UCFA 3OVMA 5HCUA 2EL7A 3FPKA 3OKCA 5EQTA 2DFNA 3A2NA 1KZ9A 4V02A 1QIHA 2JH8A 3E84A 3IXMA 3T3DA 2JIQA 4KKVA 4RPIA 3K6SB 3KPWA 5FQOA 2Z4SA 2H1WA 4GPD1 1QHYA 4KTVE 5JRZA 1T4CA 4HP8A 4NG4A 3V34A 1IY9A 2AI1A 5HSGA 4JFRA 4U7WA 3SE0A 4GLBA 1P62B 3ROMA 1YFZA 2XECA 2DG2A 2GWRA 2OBYA 3Q1LA 4D9FA 2BEWA 2HU2A 2XYPA 1WQ3A 2NLOA 1W5EA 1O94C 2O48X 2P3SA 2E82A 4KRYA 4ZDWA 4YUYA 4GXRA 1A5BB 2OZVA 3I3OA 2BTEA 4QO7A 1PGJA 4NEQA 4BVJA 4XQ9A 4J1SA 3ZHSA 3F71A 4FJ1A 3E3MA 3OZRA 2QX8A 3QF4B 1YT5A 1V41E 4NMXB 1NFQA 1E59A 4P81A 3DLHA 2BFOA 4D44A 1V43A 5HKLA 4N6GA 3SOZA 3EC2A 4LX0A 3HJNA 3WGUA 3BL5A 4RLSA 3D1JA 3GAZA 4DMFA 1C9JA 1VJ1A 1PJLA 4LTMA 4OUDB 4AZ3B 2CJFA 3AG5A 3IA2A 2RHDA 3Q87B 2J9ZB 2VJAA 5EKDA 3UH0A 3BH0A 3A4LA 1O77A 3AKDA 5HEKA 5BVGA 2FEOA 3IP3A 2AVNA 3TNFA 3BD8A 1NVVQ 2AC7A 3ANTA 2JI8A 1XQWA 2WWRA 4QUIA 2XMQA 2WSMA 3MTEA 3TE7A 5D86A 1NXXA 3G17A 3GYBA 4FHFA 4YEDA 4Q3OA 2QAIA 1H93A 3UENA 3LCMA 5IJ9B 3UXMA 2ATVA 4Z3OA 1YQEA 3G8DA 4E2YA 1A27A 2IVZA 3VNUA 5K6TA 2FWIA 2I6XA 4ICIA 4PZAA 1MX5A 2G88A 4DIKA 4YGYA 3DGEC 3SBXA 1N0UA 1PVDA 1G5FA 1UXGA 1A5TA 1M5UA 1VB3A 3AT1A 5U4XA 2LV8A 3SIRA 3ROQA 3WLHA 1W49A 3GLHB 1HY3A 4XPIA 1SXJC 4UJ5A 1JKJB 1J56A 2FGKA 1KH2A 3OY2A 2QTVB 2GK4A 1K8ZB 2FW0A 4KEAA 5F2KA 4KTTE 2LCIA 3CUVA 1J7KA 1R0ZA 2AKAB 2CUKA 2XZDA 2ZQZA 2GHQA 3PKZA 5AKYA 2M32A 5DYYA 5JOQA 1N36B 2WVGA 1G20E 1SXIA 2XYQA 3DYBA 3SHOA 5HZMA 1SBIA 5DN6D 3NOQA 2GZ2A 4Y67A 4HAYA 1YDGA 4BP3A 4DPLA 4FS3A 2GN0A 2O2YA 4G9BA 3FZGA 3JRWA 4HTFA 4FMDF 4OQZA 3AO0B 3BF8A 3R24A 4FOOA 2PX8A 3TM4A 3WGZA 4C3OB 3AEQB 2EL9A 2AG8A 3DM5A 1IDOA 1RHKA 1ULZA 2H2HA 2J9FB 3KFLA 1XZAA 3RHSA 2W71A 1YZYA 1HV8A 5AXAA 2VEDA 5AI6A 3NPAA 3G8YA 4BLSA 1I4DD 5HS6A 6Q21A 3Q6NA 4B6JA 3ZU6A 4G8BA 1DINA 1SCUB 1Y3FE 3L4EA 2V5UA 4UHJA 3OZAA 5IP5A 2BFDA 3TJMA 1EPUA 3VKVA 4L4YA 3WGGA 1T4GA 4YRQA 3K20A 1OW3B 2OKCA 2GHRA 3IQEA 3AF0A 3LYAA 4LSGA 1N2CA 2QTTA 2H5JA 2Y2UA 1MG0A 4ZEXA 2FRXA 3PR3A 1BN6A 1GZ5A 3R8XA 2AN3A 1Z8HA 3IPAA 3EH1A 2ZT5A 3LGAA 2GLXA 1VPLA 4GVPA 4I6JA 4IUYA 4EF5A 3G1UA 4DLVA 1SC6A 3O0DA 1KSHA 4EWLA 5A4KA 4ASUA 2YJ5A 1TTPB 3R5SA 5FFNA 3CU5A 5CVEA 2PZ8A 2ZJ4A 3JASB 4O4JF 4B3RB 4QYSA 4UCFA 2IHUA 3H5AA 3J7TA 4RJLA 1AF7A 1KARA 4YREA 4U3JA 3SXPA 3TL2A 1DWOA 1XVTA 1FSSA 3DMTC 2P40A 4KN8A 1M3SA 3ZJ4A 1CIVA 2MOKA 4PZPA 5COQA 3AERA 4DADA 2WFLB 1Z4MA 2ZJBA 4PHGA 2NW6A 1TMOA 3BF7A 4NE2A 1XHEA 2LD4A 2WG0A 5EGNA 1G6Q1 4IF6A 2W98A 1TVKB 4KYIB 3ZWYA 4DMLA 2POCA 1DUSA 3OQIA 5A5EA 4TSFD 1YE3A 2QQEA 4JSRA 2WTMA 4TYYA 5GOTA 2CW5A 4JB3A 3CUSA 3NVKI 4AO7A 1O96B 4V0RA 3L8ZA 3AR9A 2O8NA 4BP8A 1YS4A 1Z36A 1XTZA 3FN4A 1L4MA 3ZGVA 3G5AA 4HOYA 4L8WB 3OSUA 1GU1A 3H6GA 1JQJC 1RQGA 4DV3B 5C53B 1QAOA 4FYYA 5EQJB 2VZ8A 4P92A 4LMBA 3E70C 1FUEA 5FQNA 4RCVA 3R7AA 1V4NA 4E51A 5FTJA 2XQIA 3EAFA 2QMOA 3OU2A 2Q1UA 2X5OA 4MGHA 3QWAA 3HG7A 1QLJA 2Q3EA 4UQPA 3MLBA 1U04A 4XDHA 4NCBA 1M8GA 5ITVA 1GRQA 3ET5A 3QEBZ 3R41A 4TYWA 4JL6A 2BLLA 3BWYA 2GBLA 2R4TA 4FSXA 1TT5A 4KPGA 1W2GA 3KU4A 2HQSA 5DGTA 5TY0A 5HIAA 1H2AS 2OFWA 2HA7A 4H17A 2RJOA 3HN7A 1GILA 4EW3A 3W90A 2YNMD 1X87A 2KHZA 2WHPA 3FSJX 1YL7A 3HMQA 4JI3B 1IXZA 1UBRS 1GNQA 2C1ZA 1G2PA 3CE9A 3IA7A 3T9EA 9LDTA 1I7DA 1NRIA 2H9AA 3O91A 4LWZA 4EUKA 1U1DA 3PHGA 3CN7A 4XD2A 5MFPA 1FNSA 2XWPA 1GPJA 4LFBB 4K86A 1E2FA 1K0FA 3IERA 1UZUA 2O05A 4FR0A 1PLKA 4IJUA 3KJGA 4EOGA 3A9WA 5GTDA 4RPHA 4LV5B 1EHIA 1QM5A 2WM2A 3C45A 4LRWA 1H6DA 5KX5A 3VOTA 3F5FA 3NGMA 1DO0A 3AIOA 4OQLA 3C70A 4H7DA 4HAUA 4Q3KA 1JPNA 3N2KA 2QN8A 1XA4A 2F9MA 5LJLA 3CEAA 2RJ3A 2YIVX 3BIWA 3ICVA 4CLOA 3F47A 1ECBA 1U1GA 1ODFA 4WLFA 1CIPA 1HL7A 1G59A 3AW8A 3GJ7A 5GAJA 4FLMA 5HE8A 1SRQA 1X7ZB 1ZK4A 5HE9A 3DBRB 3ETGA 3G2LA 1K8YB 4NDNE 3WNBA 3TW0A 1JR3A 3UHFA 3K96A 3KKNA 4HGNA 4G23A 4EI9A 4F12A 5KTRA 1TO2E 4Q47A 5EZ5A 5TVKA 2G71A 1M6YA 3QVJA 2AZDA 4KCGA 4LQ4A 5KOYA 3TZLA 3EPJA 4GEGA 3RT9A 3VKGA 5LQAA 2QJWA 3CYFA 3AFIA 1CY0A 3WNVA 1UJ5A 1TA4A 3COZA 1ZI9A 2C8KA 3OPNA 2CDCA 1EESA 1UKVY 1QUEA 1AZTA 2X8JA 2RC5A 4OXNA 4UNQA 5AQEA 5CVCA 4PAOA 5D3MA 1NC1A 2WZBA 4M0CA 1IE3A 1RM5A 4BWVA 4DJDC 1RKQA 5JAHA 2PMWB 2ZR8A 1XRLA 2ZBFA 4YK7A 4O5OA 2EX4A 5ALMA 5I4IA 2F8TA 4YASA 3DP7A 4OYRA 5DCWA 4LVCA 4BFLA 2FPOA 1XMXA 1ZZGA 4RHTA 3DUFA 3LECA 1J0DA 1HDGO 1BS2A 2ZJAA 5A0FA 3H2HA 3A27A 5K2OA 3WDLA 3EVGA 4BBJA 4KRFA 3VR6A 2G3YA 1PQUA 4QKQA 1C7EA 2H1SA 1LK0A 2XYGA 3AJ9A 2DCMA 2G08A 2QN9A 3QVSA 4MEJA 1WQ4A 2H1HA 4WJLA 3CVUA 4RY2A 2JGJA 4NECA 4Z4GA 3GBVA 3IL2A 4IJQA 1RM3A 3G2KA 3QXCA 4D3YA 1SKYB 3MJDA 4I4NA 1UBNA 1Z5GA 3SX2A 1Q1EA 1LS1A 3VSAA 1FBNA 3ANYB 1B26A 1ZVVA 3NEPX 2CL7X 1XMQB 3PXGA 2REOA 3P0RA 4MAMA 1W36C 2A9VA 2AMVA 1WXHA 1Q1ZA 4UDNA 4BN5A 3LDGA 3O4HA 4L1KA 1ZCBA 4ZDKA 3EIWA 3OX3A 1GNVA 4E7OA 2ACEA 5TPWB 4JUDX 2F3TA 4EBBA 1P18A 4Y2JA 4WZBE 4G56A 3DYIA 4RW0A 4O2AA 1LLUA 1TVEA 2P6OA 1E89A 3OTHA 3RFUA 1KK2A 2QR5A 4F8JA 1FQKA 3T12A 3G5UA 5LNK6 2FFAA 5AI9A 5F33A 4RTKA 4PZUA 3J7AC 5T4BA 3ANLA 1L3CA 3KTAA 3WP1B 3V9AA 4HEJA 2ZI5A 4BNHA 2NP6A 1NXPA 2JLVA 5GJBA 2HEIA 4NG5A 5FOXA 3RSOA 5CAEA 4ZKEA 5SZIA 4RL6A 3Q7IA 4C6SA 2C8LA 5J2TA 2J45A 2V7EA 1OWOA 4CM5A 1FZTA 2HDHA 4AQDA 1WKBA 1J0XO 1VMIA 2Y1KA 3EG5A 4PS1A 3C3YA 4P3NA 5KJ1A 1P8AA 4PHTA 2A57A 3I5UA 1ZL2A 1HI9A 4TLLB 5K0NA 3QUCA 4GOKA 1L7DA 4HUQB 5SV2A 3AUSA 3OPMA 1SIWA 4II3A 3W2IA 2HIMA 1YVDA 3IELA 4MV7A 4HNHA 5AQ1A 3OKFA 5FUWA 4PIVA 2ETXA 1MGOA 4L95C 1F20A 2K2QB 1ODKA 3RUIA 5D7BA 4DSTA 1DRWA 1K6MA 1XP8A 3CX7A 4C4PA 1OKKA 3OURA 4X1IA 4CIXA 1GVNB 4TQGA 2A0XA 2D54A 3AH8A 3V2IA 1SK8A 2WPDD 3BTSA 2ORYA 3BTVA 3P2YA 1T0PA 3GLFE 1COWA 1PR9A 3UAZA 1DT3A 2JKYA 2ESRA 1Y5RA 2C84A 2R5FA 2W2OA 4RV5A 5DP1A 1KU0A 2I2FA 4UU1A 4BUCA 4DSAA 5J1SB 4PONA 1E32A 1S2MA 4IFTA 1SULA 3AM3A 1QVVA 4NS4A 3GX1A 1CEXA 2VDOB 4RD4A 2CFIA 2H11A 4AWBA 4MQBA 1JDBB 3SKVA 1NYRA 2J41A 4YJ3F 1EE9A 1T91A 1WUIS 2A5GA 1XCLA 5JXWA 2FN7A 1R5JA 3H99A 4R1NA 2XUHA 3OCVA 2WWHA 1HSZA 3QHAA 8GPBA 1MH1A 1Q74A 1XCOA 2VHZA 3GRCA 5ERGB 4JI4B 2QKYA 1VLHA 1HDRA 3SZ3A 2FE1A 1T9GS 3TLZA 3N05A 1RKUA 1UOOA 3NHAA 5B6PA 2I2DA 2WHRA 3ESZA 1EXNA 3DMGA 3IBGA 2OCDA 4OBEA 4R1QA 5TGZA 3L1VA 5A0VA 1PGQA 1OFVA 5B1HA 2J3QA 5TSDA 2Q7OE 5KWJA 3N28A 1C4KA 5TVGA 2Q8PA 1IAVA 4LNUB 1UP6A 4YY3B 3Q0TA 5KIAA 4U8HA 1KDTA 5BPFA 4L74A 3M1LA 4M9UA 1UXOA 3EGXB 1BXKA 1M2JA 3CEJA 2MSCB 3GLUA 4GKAA 4J3JA 3VBCA 5IC6A 1JAXA 5L95A 1Y98A 1MOQA 4UCWA 3SYTA 1V9LA 5KSPA 3VJMA 1L5HA 4FFSA 2XI4A 3R7FA 1X80B 3ZS8A 3CXUA 3THWB 4XGQA 5C8YA 1MU0A 2Q0XA 4N5HX 1YA6A 5DULA 2BHRA 1C14A 1CEYA 2F1KA 1ADGA 1XFAA 4DNXA 2QBYA 1YC2A 2CN1A 4TV8F 4M53A 2HMSA 1XNHA 1ZEMA 4B7XA 1JBEA 2G17A 1LQTA 1LVGA 3DV2A 3EF1A 3LW7A 3D6JA 4ND8A 4NESA 3Q3EA 4IDCA 1C2YA 2C7GA 1Z75A 4R1LA 3M6IA 4S35A 3ROFA 3TUJC 1Y8CA 4NK4A 3G68A 5FV4A 1WAMA 1FTYA 1HEUA 2VPXA 3GFQA 2WAXA 5CEJA 4DUZB 1M0EA 1RABA 3PXXA 4P4GA 4QBKA 2GPYA 4RA6A 2DY0A 1UDRA 1JILA 4JB0A 1R0KA 4PFKA 5CCDA 3W79A 1O4VA 1E6UA 3DBIA 1RP7A 3UJNA 1BH6A 1YS7A 1R8YA 5KB3A 1EBFA 3GDHA 3TDNA 5IK2A 4AXXA 1AQNA 2XUPA 1BEEA 2P4EA 1JECA 1QGAA 4FFLA 4JLNA 1SBQA 2DPMA 3HY6A 4L16A 4QUDA 2NU7A 3WY9A 1SXPA 3SG0A 1Z0AA 3GJQA 4JMPA 5DSZA 1WVGA 2BFCB 4MKIA 4RMNA 3BD9A 4JH0A 3WFJA 1T3ZA 2WU4A 2IPOA 3C3DA 3X1JA 3ZOZA 4M1KA 4PAQA 4PO8A 3WWPA 5LC1A 5CCXA 2DY1A 2HJSA 1IBCA 4AJLA 4EJMA 5IMBA 4AJKA 4CR7A 3G0OA 3LBAA 4JLPA 3A4VA 3LUDA 4KR0A 1GQ2A 4B3JA 2QSJA 5EIFA 1JDTA 3I9MA 3W2TA 4EJSB 3Q9NA 2J07A 1JHUA 4F8EA 4Z7JA 1OROA 2C1EA 3VU8A 4KI0A 4CL0A 4GL4A 2VHJA 2VUUA 1V71A 1U9IC 2C42A 4OBXA 3EWSA 3ORHA 4QPCA 2BM9A 4PC7A 2QRJA 1EX7A 3GWZA 4K6KA 1SM4A 1I8TA 1P2VA 4P08A 2OSVA 3CX4A 4IW3B 4JBXA 1L7PA 1WHSA 2PFSA 1K08A 4Z4FA 3KALA 1BRTA 3C3PA 4ZO7A 4XQCA 3JQPA 1LBHA 1RAHA 5CT6A 1CY6A 2C5GA 1PVOA 3KC2A 5LQJA 3EZYA 5F2EA 5GMOA 5G0WA 5G02A 2C7VA 5BN4A 2M98A 3H9GA 2JHAA 2JG3A 2IY7A 1KAQA 1SXJB 3L7DA 1L5GB 4TWBA 4WJKB 1MORA 1BEZA 4PLGA 4JWKA 2ZSJA 2WI8A 4K05A 3KS9A 3MEQA 1WA5A 3RC3A 5FL7D 5IASA 2VDJA 2PGOA 4A73A 2PVSA 5JI3E 5JDIA 2D5BA 2QPLA 4LEIA 1E4EA 3PCTA 1U0OC 4ARBA 1UDWA 1USVA 2F1IA 2REQA 2YHAA 3L7BA 1QE5A 3OEEA 5C34B 2WM3A 1KKLA 2CVZA 5E6RB 2EARA 3NBZC 4IEFB 4KNYA 1TCUA 3U61B 2TS1A 2ZYAA 2IYWA 4ND7A 2VNKA 3FYUA 4MXDA 2EFJA 4J3FA 4DC9A 3KB1A 1GFSA 5GVRA 3TIVA 1XVVA 4U2KA 3L8MA 4KQEA 4TMXA 4Q19A 5KNBA 1N9GB 1LCIA 2EF1A 4OMFG 4BQSA 4M3NA 4C20A 4DBLC 4DR3B 1T4DA 1YRLA 4PFSA 4MS3A 5HILA 5ADWA 3AC0A 1NBMD 5TC4A 2V7PA 3T7AA 3FTNA 1W96A 2WV9A 3CUUA 4CLRB 1AT1A 2D5LA 3VDRA 3ZNPA 2LW7A 4JLAA 1GLNA 2IYOA 3EISA 5F5XA 1R0SA 1ZGGA 4J49A 3SBEA 2IZ1A 3PD1A 3VU0A 4ER0A 1EUQA 3PE4A 1NR5A 1VPVA 1G55A 1YZTA 4OGWA 2DHQA 3UW3A 3QFHA 1N5OX 3IESA 4XFKA 2UUBB 1K9SA 3AF4A 4MUYA 5A9SB 1DUVG 3OTQA 4CCWA 2WJYA 2WIDA 2Z58A 4YO8A 3QPDA 3TXAA 4MVXA 1EG2A 2JLZA 3R4CA 1CP3A 2I4LA 3KUCA 3PYLA 1N7HA 4WEOA 5DF1A 3IVAA 1NDUA 1SIUA 5HFAA 3OP4A 5HGXA 1R12A 3N07A 5FO0A 4CG1A 3IAXA 5BW5A 5SZHB 2BH9A 3AKCA 4DJ5X 1K97A 2P9GA 5C3UA 3HP1A 4ZPJA 3VH2A 2BBTA 2X1VA 3G9QA 5DP2A 4IJMA 1JDSA 1SUFA 1CEQA 2P75A 2NO5A 1IPEA 5TEWA 5IDXA 1QP0A 2JFYA 3FOWA 4ZO8A 2KB0A 2ADFA 1XWIA 2AT1A 1G3QA 2KLHA 2XDQB 2GUGA 1E7SA 4EBFA 2ANBA 1T35A 4EY4A 3OM8A 1ISGA 3BRWD 4WVLA 3PRKE 1G291 1HTTA 3PGXA 3H7AA 3OI7A 4A8JA 4CKBA 3EMDA 4ARZB 1GAXA 4KIFA 5EP4A 1F6BA 2FLWA 5BO5A 4B4OA 4E5MA 4BX9A 5AJZA 2EERA 3PNOA 2JGFA 3NHWA 2V3VA 2AG0A 4HJXA 1DTWA 2GBCA 3DKKA 1W4RA 5H68A 3SEAA 2C0CA 2L19A 4YQEA 3CCBA 2ARKA 4MW7A 4O4JA 4I9FA 3TSOA 3STWA 3R75A 1OQAA 2NO4A 2R6CA 3KTOA 1LUAA 5E9WA 4M60A 3ZDYB 5BQFA 1GZVA 4QG3A 2H06A 1IC6A 1AKQA 2BONA 2OAQ1 3AP1A 3K32A 4ZN6A 4ZTUB 5D6NA 3S99A 3LFHA 4KDEA 4TLDA 1KJJA 4JROA 3BMNB 4DVGA 5FBQB 2FMTA 3P8ZA 1EQ2A 2MR5A 3GT3A 3J80A 3ROTA 4Q1EA 4QPJC 2W6IA 5ER6A 3SI7A 1SVUA 2G6TA 3FPGA 4Q9NA 2EZ4A 1O9HA 2OLEA 1AQ6A 5TGDA 4DRZA 4ISCA 3TUIC 2OGWA 4A16A 3L8HA 4MGYR 5ITWA 3KQKA 1PZMA 1U1CA 2D5CA 2PT9A 3DV9A 3GW8A 1E61A 3P0EA 2RK3A 3NV7A 4JB8A 3RVLA 1J2TA 2QT9A 2VZ0A 1DL5A 1YU6A 4YMGA 3D6UA 3H6KA 4UFOA 4YRSA 1M2EA 4OFZA 2HLHA 1XELA 1ZOSA 1Y8QB 4W9MC 4NZYA 3QV1A 4MLDA 5CVJA 3HYSA 1HT2E 1UBEA 4YJ2F 5EJIA 3A4YA 1PTKA 2GM5A 3U9SA 3L1HA 5JNRA 2J5XA 4DQLA 4OI4A 1CQWA 3MINA 2R4UA 3VJRA 4AI6A 2GNPA 1MV5A 1FYWA 2XRFA 2J0UA 1QIEA 2P2CA 3DXXA 3LUJA 3OQMA 1N5KA 1HT0A 4UTPA 5EWJA 3D6TB 4EPXA 3RLIA 1M9NA 2OD2A 3PITA 4JODA 4OXRA 1D4FA 2GB4A 5EC8A 5A3VA 1PQWA 3LWBA 4M1OA 3T94A 1D5CA 2XCUA 1FSFA 2RKOA 3WRYA 1KE2A 3G49A 2J9GA 4N01A 2OP0A 1B8VA 2ZJ0A 1R9NA 4Z0NA 5I4CA 2PPVA 4D9IA 3IV6A 2W8BA 5KHAA 5IT5A 2YUTA 3C1UA 4XVCA 2QLTA 3CLRC 5DDIP 1NE2A 4N9WA 4UBJA 1NUPA 2QUAA 1YHZA 3OEYA 1YMVA 5CYPA 5ARDA 3KYDB 4D9BA 3MT9A 5JFGA 1G3MA 1I7PA 2RHJA 4JC5A 3S40A 1BCSA 4JP8A 4OSEA 3OA2A 3QRWA 3WQQA 5KQGA 3PBKA 2YRFA 4ITUA 4XM1A 2Q4EA 1GL9B 4W1PA 1G8GA 4GG1A 4KWTA 1AKMA 4FHCA 4K40A 4ZDJA 5EZYF 3DLPX 3F4BA 1NW7A 1XEXB 2YFQA 3JQ9C 4JQYA 4XWYA 4ZO6A 3K8OE 5K0CA 1KEEA 5FUYA 1H2BA 4ITRC 5L6LB 1E9CA 1T3HA 3RBXA 1RXIA 2RJNA 4QODA 2VNAA 1VLLA 4NF2A 5DWQA 2GXSA 4BMVA 3ASVA 1JHVA 2QLJA 5AJWA 3TQTA 3ZY4A 3L46A 3EZNA 3K70C 2W2LD 2O3SA 4KQ1A 1IY8A 4HAVA 4M98A 1IJEA 3WLSA 1KKUA 1PYDA 5TDHA 5JJCA 1E4VA 1PAUA 4UUBA 1ST2A 4X64B 4NULA 4CLDA 2QUKA 1FVXA 4I5IA 5DM70 4FW9A 3HVKA 1YF3A 1PFKA 2ZUFA 1F9EA 2PUGA 1O3YA 5H80A 3IP6A 1FSGA 1ZK2A 2WUFA 1NDQA 5K3BA 2VSXA 5KNDD 3L7NA 2YHIB 1JU3A 5GIOE 3WWZA 2JA1A 2GVDC 1UM8A 3FCAA 4KGDA 2XF2A 4RD0A 4CYMA 2C9BA 4EJ0A 4M0MA 1F0PA 1HDIA 1HORA 2XWBF 3T1VA 1M2VB 1RYFA 4P35A 3KDSE 1HE1C 2R1UA 4TKUA 3HYLA 4X7BA 4L15A 3RBAA 2NQ8A 2GEKA 3DD1A 2UYOA 2CXTA 2ON6A 1FP6A 4I1YA 3BCRA 3S2EA 1VLJA 3HRKA 3UMMA 5HQ3B 3MIIA 1CY8A 5KINB 1CZRA 1DT5A 5TB5A 1DKNA 2IELA 1YGYA 5CPBA 2CXOA 3LNCA 3WGOA 1M5RA 2BE9A 1O97D 1XU7A 2PUVA 2RGNA 4IMPA 1JMKC 2GN6A 2ZRFA 3EXEA 4NCJA 4TTQA 2XUAA 4P22A 2EJWA 4Q05A 4UHFA 3URMA 1G9TA 1A9OA 3QPUA 3EHDA 4LAFA 1YZHA 4YONB 1JEEA 4YRAA 3UQYS 3GCXA 3EOZA 2V4ZA 1D1TA 2WJAA 1WPGA 1TUBA 3D3EA 3GOQA 3K2QA 4HGPA 1KO4A 4K26A 4RSGA 4UARA 1EX6A 4CHGA 5KYUA 4X8MA 1I3MA 3PFWO 4HDSA 2YIMA 3BL6A 4HLUC 4MR9B 4RPKA 3IPRA 3O92A 1LNSA 2LP4Y 4KIWA 3U39A 4WZAE 4KREA 4DQXA 1Z62A 3C5WP 5G1PA 1E5XA 2RKBA 3X1MA 4PRLA 4YRZA 1JB1A 3BWBA 3C7DB 2YY6A 3LTNC 2QRZA 5BNFA 4REMA 3ICQB 2AI3A 4BYMA 1UMDA 3ETJA 1ZNXA 1A5SB 1EXMA 2IGTA 3IPCA 4IFEA 5DO9A 1JH8A 1P7ZA 4ARSA 4B48A 3M6MD 4Q34A 1EA5A 3NDRA 3A7EA 1YQ9A 4F5EA 2D2VA 2JCGA 3EXAA 5F52A 2QZ9A 3A1DA 2AXEA 3I5MA 1XPJA 4MQ4A 4E11A 1SKMA 3TJRA 2HR1A 2E4AA 3JAMA 2FZ5A 3E4DA 4OCZA 2G80A 1KI9A 1KO8A 3L3BA 5LP6C 2B8NA 3S8YA 3AOEA 2Z8ZA 1JUDA 4D3SA 3JALB 4YO7A 1LW6E 2GN9A 2VP3A 1PVVA 5DOVA 3SIWA 3WGMA 4PWZA 3I4LA 4MVJA 1MJNA 3BDAA 5L3SB 2N75A 1TL7C 1QV9A 1MAAA 4FT4A 1IZ7A 3Q6IA 3U62A 2QRMA 4AO8A 1AUVA 4ED9A 4F92B 4XGNA 2KWIA 1NW3A 2AW5A 1PEDA 4GE0A 1QAMA 2NUTA 3BFXA 2IIPA 1QV7A 3PICA 3BKXA 3LC0A 2XW6A 2GN8A 3EEFA 2X0FA 1YC5A 1J5PA 2PSJA 1SHJA 4HUJA 4MSUA 3M1YA 2YOFA 4O4HB 5DYIA 4DN6A 2QPAA 5FBZA 2AD1A 2IUTA 1Z35A 4V0MA 1QGZA 1OYWA 2DBYA 3B1ZA 3C8DA 1PN3A 4N0DA 4WTOA 2ZRLA 2IYPA 1JHMA 3P97A 5T4HA 3NFYA 4JUIA 3TTYA 3WFIA 1MJ5A 3WJ1A 4X1OA 3ZIAA 4NJEB 4PPYA 4K9LA 3KQHA 1HDYA 3D4PA 4IV5A 3Q40A 1O87A 3ZYCA 1XTPA 1C1HA 1RLMA 3LU1A 3UK2A 4H1WA 5EJ4A 1C8KA 4JGIA 4TTPA 4UAJA 5J40A 3OETA 4ZEVA 2R6AA 4XARA 1NX6A 4G0PA 3IHWA 2NWQA 3RU3A 1DMRA 5ICFA 4ENTA 1XWFA 4KMRA 1NMYA 4X6YA 5KNCD 3AETA 1V9SA 5C2JB 4QTUB 1U9CA 2P6UA 3R40A 1WXXA 3GLRA 5C5EA 2DTDA 3ORRA 1E2DA 1PS0A 4ND3A 4CTJA 1C9YA 1E2PA 1IEXA 5EHNA 3AF6A 4QHSA 5DNEA 4CN8A 4MDFA 3CPHA 3LX6A 2W90A 1RQRA 3IMKA 3PXCX 4YJ3A 3G6WA 2GCOA 3L5KA 4ZRDA 4B4DA 2R00C 1H8HD 1P73A 2BEVA 2FFBA 4XYMA 2G70A 4B3HA 1PR1A 3MQ2A 5TXGA 4A2CA 3H2IA 5AW7A 2AB0A 4N0PA 3ASYA 3EFOB 3W9BA 1G21B 4ND2A 1VRWA 3BX1A 1ML4A 2ONYA 3TM5A 4MHSA 1M1YB 3TLGB 1D0VA 1ORWA 1HQKA 2PAFA 1Q11A 2Q8QA 3QBDA 5ALWA 1ESNA 3B70A 1VG1A 4E4TA 3B1JA 1BOFA 4AVYA 1OZGA 1QHIA 3JWIA 3SQNA 1DV1A 1O4WA 1Y3BE 1O9BA 2FHSA 1LTHR 3NT2A 3Q2IA 1L7AA 1NUTA 2FR8C 5FF9A 3USES 4A5OA 3T35A 2ZBPA 4BQQA 3FMPB 4PAMA 3AX6A 4R41A 1HFEL 3LQFA 2ZVDA 3QVUA 5DSXA 1WCV1 2C58A 1AUQA 2NGRA 3HR4A 3JAKA 2WTUA 2ZULA 2W2MA 2B1IA 1WHTA 2AYYA 3JZAA 4PYQA 1PWHA 2BGLA 3GHHA 3TNLA 3GROA 4TN1A 3C5CA 3T3IA 2CLKB 4JXZA 2B2XA 4JR1A 1DTEA 4JLMA 2B34A 4XWOA 4E88A 2RHMA 4K2AA 1L4FA 1ZI6A 4H6XA 1PR3A 2HIGA 4TV8A 3VR5D 1AO0A 1OT3A 4M22A 2YN0A 2X22A 4A0FA 3BC1A 2P0EA 3W1WA 2X2OA 3KBBA 4FWBA 4KGZA 4KNVA 2Y66A 1Z5UA 1TF7A 1XOIA 2HO4A 2VBFA 4H15A 4LS3A 4D8XA 5AW0A 5B1SA 3A1NA 3CKMA 4ALJA 1CTQA 1LXCA 2R8RA 3PHCA 4K1LA 5J5CA 2F1RA 2O23A 2OZKA 2O8EA 3BOSA 4I4CA 3ZWXA 1D7AA 5A1TA 2PS0A 4MVWA 5EMJA 2XZTA 4AYTA 4O4LF 2WU0A 2AJ8A 4HMOA 2ATXA 5DGCA 1HFJA 3LA8A 4JUCA 3ZLBA 4BV9A 3EVNA 5K51A 1JSCA 1Z5WA 2JFNA 1CR2A 3MMZA 1RKXA 2P91A 2R8ZA 3ELBA 3N6XA 3D64A 4OXYA 5E6UB 5E8JA 3PL5A 4CMGA 3MB5A 1T15A 1U11A 4NBVA 2JFBA 5ILGA 1XI2A 3CG0A 2IYNA 1P3JA 1M73E 3FKSD 4IINA 2W83A 3H05A 5C3MA 3EEQA 1GFZA 1HBJA 1BD4A 1E79A 1ZSVA 1NJ6A 1C3OB 4Q93A 1OGIA 1K89A 4XWGA 3G7NA 1CLEA 4IOJA 3SZGA 2Y68A 4RJIA 2CBZA 3H75A 4H59A 3TLJA 3C48A 4Q1CA 3RI3A 2JFXA 3T06B 4ZJPA 3WRVA 2JI6A 4L6IA 5FWNA 3PD0A 2Q1WA 2DH6A 3KL2A 3PI7A 4DGSA 2JJ1D 4E31A 1BQEA 4PZ9A 1DXYA 2HQRA 3O8OA 4CZ2A 3FNQA 1I4TD 2ZYRA 3DPIA 3K8ZA 3H87A 4UAGA 2G9NA 2ADOA 3AKYA 3ZV4A 4A6EA 4R2XA 5T8KC 4QZVA 1M8FA 1NNEA 2IQIA 3B2NA 3JQ8B 2Y9PB 4L51A 3RK1A 1OBVA 5MGNA 1O95C 3K2BA 3ESXA 3ZCXA 3HCAA 3GUCA 2NAFA 2IYXA 2OZLA 1XRQA 2X15A 4Q82A 3GLVA 7AT1A 2A1UA 3NC0C 3NHRA 4MP3A 1TLTA 5C37A 5TX7A 3EXHB 1N5MA 3F6PA 4QULA 1FSZA 4R01A 4X61A 1C3XA 4KIJA 3KKQA 3K73O 3LIIA 5AKXA 2VDVE 3ICPA 1NQOA 2G36A 3PZBA 1TKRA 1IVNA 5AO9A 4CM4B 5AVYA 5FI0B 1P0FA 1XVIA 3VOAA 3L4BC 3UA4A 3E22A 3FB4A 1DAOA 3RODA 1QRSA 1HA3A 4ABYA 4DA7A 4RXMA 4J75A 1NZJA 3NCTA 4G5SA 5IC5A 1CNMA 3AZOA 3AHEA 2W11A 1CUJA 1V2GA 3AY7A 3CF6R 3T5GA 1XNGA 2W6JD 5SYAA 3B53X 3TW4A 5KJFA 1Q6ZA 3CBGA 3PTZA 4EHJA 1R0XA 3NGXA 5HJ5A 2X0EA 3PQFA 2G76A 3QEKA 3DLCA 3FETA 3L18A 2XTMA 4Q6BA 5T4FA 1SUAA 3IO5A 1BA3A 1EJBA 1OZFA 2QTBA 1DPGA 3EXIB 4IY1A 3WXBA 2GYUA 4RVFA 4YUXA 4M4SA 5DNCA 3RSQA 3LLCA 1J9ZA 4LXUA 5K6AA 2WP8J 4COKA 4IIGA 5ECGC 2PKRA 4FHGA 4MAFA 3LV8A 4BNDA 2IZ0A 3QEAZ 2O8BA 2NSDA 4KSYA 3G2JA 1P9NA 3VR1A 3D8TA 4IIDA 4N3NA 2CHQA 1V4BA 2FZKA 1N6PA 2LDXA 2ZAOA 3AGPA 4FCCA 3RROA 1IQUA 2Z8XA 4BDSA 4IIHA 4J0GA 5IWAB 3VR3A 2ZDHA 1ENYA 3Q7SA 3CTPA 5F23A 1NW6A 3WG9A 1DFIA 4L57A 4QUAA 1XU4A 2NN3C 4YIHA 3UHOA 1TGYA 3IKMB 2LE0A 1YBVA 2HUNA 3PX2A 4X7RA 3NAQA 4UPVA 1TZKA 1W4ZA 1AGNA 1Z8DA 2MSWA 2ZBEA 4BJ3A 4C88A 3CR8A 3T7IA 2KMLA 3QLEA 4YALA 4CTMA 5IAJA 5JPCA 2D5AA 2WP0A 2CSXA 2QXYA 1PCXA 5KCZA 3HCNA 1T8TA 3DH0A 4MQUA 1XPRA 3ZV6A 1HYBA 4D8UA 1I13A 1WPRA 2JATA 1JFSA 2WJGA 3MLEA 4G5RA 3V55A 1NP3A 4IHJB 4F6CA 5BXQC 2E21A 1UFOA 5JJKA 3RM3A 4JGBA 3HU3A 3N53A 1H6AA 1HT1E 1QFSA 2JBHA 2ODTX 4NBNA 4XDGA 4YAWA 4D9JA 1XZHA 3ZZUA 4BB6A 3HCFA 3DWGA 3O2QB 3EFEA 4M1EA 5AHXA 5C5CA 2KBFA 3G2HA 1YV9A 4MRAA 4R7TA 3LT5A 4RESA 5FWYA 2EJVA 2C4TA 5I9MA 2BI4A 3MT7A 1W73A 1WIWA 2IP4A 3HCWA 2PL1A 5CYOA 1NSYA 1SUSA 3T3HA 3Q11A 3ZQJA 1WBBA 1Z4NA 1TZMA 2J59A 4TYQA 4UKDA 4TWRA 2FXIA 5BOSA 3PHJA 1KI3A 2NTEA 4TXLA 5CMLA 5J43A 3GFRA 2OMKA 2ID9A 4CFYA 2C1XA 2JPDA 4FEAA 4FC7A 5FR2A 4ZI3A 5K05A 4EJ6A 3NDIA 5FJJA 1E58A 1CU1A 4EUSA 4BJHB 2G1PA 1EJ6A 4PQEA 1T25A 2HU8A 1EUDB 1Y7HA 2IX9A 3CX6A 3QK7A 1LTQA 3E4CA 1QYWA 1ZOOA 1XJWA 2ENUA 3PUHA 3QVKA 4FBGA 3U3DA 1FDUA 4NONA 4DMUB 3FZQA 4G97A 5JRJA 5D84A 3SXUA 3I0NA 4LTNA 4BV8A 5C1PA 1W88A 2XCIA 4XCQA 3ZHQA 4BMCA 3OJ0A 2ZUEA 1XZBA 2XRMA 1Y3CE 1G4UR 2YY7A 3E1SA 1KPHA 2CHGA 3S4YA 1VBKA 1OLXA 2FGJA 4A82A 1W4AA 4RZ2A 4DLAA 1Q20A 1T8UA 2QN2A 4YJ2A 3OQBA 4GSLA 4IO0A 4W7IA 4BQNA 3RF6A 3KXKA 4IG4A 4KXMA 5DE3A 3CEPB 3GUYA 3JVVA 1TTQB 1IEWA 2P9QA 3HKEA 3JWEA 4XUEA 3RIYA 3H5VA 4CW7A 2II6A 3TN7A 3OECA 3ZQUA 3U19A 2H3EA 2UZ1B 2VYCA 3KNZA 3LX4A 5IPFA 1E63A 5EE1A 1XPUA 3V8VA 1YS1X 4Y7CA 3I30X 4IEIA 1FJXA 1U2DC 5EIAA 3R44A 1XMJA 2YL2A 1HQYE 4R1MA 1TM7E 1IZZA 1H6BA 1JAIA 1E1MA 1XCMA 4UATA 3H42B 2FG7C 2NXCA 2H07A 3K5HA 2JGRA 3N2GA 4RSHA 1DBVO 3BEDA 5JS6A 1JFTA 5EE3A 3E03A 2VXCA 5BWCA 2BKVA 3ETHA 3GK3A 1D2HA 2AHOA 2QWXA 1GYQA 3LKVA 3PV0A 3O3NB 2YWRA 1FMCA 4DMCA 1SOWA 3RKUA 2ATEA 1XQXA 3STVA 3I01A 1ZCZA 2WE8A 3C3XA 3K1JA 3NYWA 3TSYA 4QU0A 3ZVRA 3JQ7B 5T3YA 3U1BA 1JL3A 1DVRA 1Q7CA 2H1FA 1IYZA 1FNCA 2HRQA 3CLSD 2HY7A 3OA0A 5DV9A 4HVCA 4CETA 3RS4A 4HYYA 1YFLA 1XMIA 3N3AC 4G5XA 1ECPA 4ZPXA 2C5LA 3ONEA 5EZYA 1L7MA 4UPDA 5BQ5A 3LPLA 4WKPA 3BIFA 1E1QA 3R2JA 4C6HA 1S96A 2OCLA 3PG5A 1TT7A 3L7KA 4LXQA 4X94A 2JGAA 4UQLA 5KQRA 4OJNA 2G06A 4IHQA 5NLLA 1Q3TA 2PO5A 3RNOA 2GASA 2WKRA 2EJTA 4R2HA 1XLUA 4WV3A 1Z5OA 3WYEA 4C87A 2CB0A 3DCJA 4Z3DA 3PUWA 2BR3A 5PGMA 2AE2A 1AZWA 4Q9LA 1B3RA 1F0YA 5J58A 1IHOA 1YQQA 1NR7A 3IQXA 2V8BA 5F35A 3G82C 5GM2A 1GN9A 4G67A 2XOXA 1DKQA 3HM9A 1EAMA 5JYBA 4NCXA 2O0HA 4UMDA 2YHUA 4HWTA 5AWFC 1IB6A 1QOZA 3O5AA 3SJUA 3ZN2A 4Q1BA 1Z4OA 4CKWA 3LP6A 4P54A 1XALA 1ECFA 3NNDA 2WHEA 2BISA 2J9RA 4PZYA 4UEOA 1RYHA 1X74A 4AB1A 5LZ9A 2CXPA 2Q5IA 3ADKA 2I4MA 2VR1A 5K8UA 4PZ0A 4UC0A 2QJFA 4GR5A 4XEHA 4YP5A 1GDDA 2LRHA 4UVHA 2I2BA 2AWOA 2P9BA 1AKWA 2X7JA 3TL6A 4BNXA 1MOPA 5KOJA 4WESB 1VSUA 2WSSA 4ZT3A 3W9YA 2X5XA 4A9AA 2XNDA 1I32A 3DUWA 4BUJA 2R8EA 2PAAA 3SHWA 5CEFA 3REQA 2H65A 1X6VA 3N6RA 3P9NA 4I1IA 4TVSA 2PO7A 5M2QA 1RYEA 3GGSA 1T6YA 2ZEJA 3KQUA 4MRNA 2Q28A 4J1QA 1F8FA 5HNKA 3AFMA 1JR6A 4B6GA 3UPUA 4PGFA 4YJGA 3VGPA 4E2XA 2EJBA 3HSKA 3PHIA 3RADC 4MMYB 3D0KA 1OH7A 1U3WA 5ELMA 1KY3A 5LP6B 3A9SA 1K2VN 2WIGA 5DCUA 2QTCA 1JR3E 5ECDA 4CF4A 3FYDA 1JS1X 4WZBB 3UATA 4PTYA 1TJYA 1YSCA 4YYEA 3P2KA 3DL7A 3RK4A 2FUNB 1BQ3A 2P9YA 4GBED 4IQFA 3ZTTA 3MAJA 4G1EB 3QF7A 4KVGA 2ZI7A 4DUGD 4EM6A 3IP1A 2AR7A 4MI6A 3EPRA 1QE0A 2FOXA 1VECA 3S2UA 2H0RA 2FPUA 3NH9A 2DSTA 4OQXA 3G3EA 3ZVLA 5LP1A 1XJQA 3BHMA 3GAAA 3HB7A 1AX9A 2Z2ZA 3ND6A 5DBHX 2X4IA 2X6QA 4B4KA 2ZGVA 3CSSA 1ADJA 3TQRA 3IFSA 2DWOA 3E2MA 3TFWA 1PBNA 3WYAA 4RMJA 1PZFA 1VIVA 3LRTA 5EYPB 4NCAA 2PY6A 1QS0B 4ML3A 1BO6A 4DCCA 3I53A 4GLOA 2MYNA 3EPHA 5CYFA 5A6VA 4PC1A 3AEZA 5JXIA 3HJCA 1P91A 1E7RA 2A0YA 2PL5A 5CH3A 2CJWB 3T3NA 3A2LA 4XH9B 2JHGA 2I7CA 1YJ5A 2HHJA 4RV9A 2OM6A 3IYLW 3V1KA 3JARB 5JCOA 5DNYB 1P7YA 4W6QA 4AULA 5K0SA 1B4DA 2CNKA 2FAXA 4QJ4A 5G40A 2R4QA 4LDZA 4TLBA 5T6MA 2BKLA 1IBKB 4QOSA 1FFEA 2IDJA 3RV3A 4UNRA 3D7RA 3GLFB 1C7IA 2HWXA 2BKUA 1R4NB 3F9IA 5JDCA 3U6KA 4GGPA 2E4WA 1LLQA 3RHZA 2CV1A 4CQNA 3AIMA 1YH3A 4R5MA 5HRUA 3MBIA 1K8XB 2JGKA 3GVPA 3H18A 3A7DA 2BM8A 2I3GA 4ZIRA 5JHHB 3HYRA 1Y6GA 5KYXB 3QYFA 2AEJA 5A5DA 4ZAVA 3UXEA 3HRIA 5C31A 2ETVA 3CT6A 4Z4IA 3PRHA 1APBA 1KETA 1TD9A 2CLLB 2DCUA 3BB3A 2APJA 2GBPA 3FHOA 4IZHA 5KOHB 2JJYA 4MV4A 3CH6A 1SQ5A 2VA9A 4HNAA 4ZA2A 4ZEMA 2JIBA 4NZMA 1MB3A 2I6GA 3ZTWA 3KKPA 1GHTA 3QLVC 1U5BA 2CFOA 4OV6B 4TYMA 1Q1GA 3N2IA 2IUUA 3T5CA 4C2TA 4QA9A 5AHOA 1M0WA 1OGJA 2P5UA 2C2ZA 3HDHA 3OF3A 4PO9A 1IRXA 1XTQA 4BO4A 2BWJA 3NANA 3UUWA 4D4GA 4DPKA 4F4JA 1DCTA 2ISSD 1BWSA 3S68A 2H2GA 5AXDA 4O8ZA 3RS8A 4NX2A 1WZUA 1ADFA 4YCSA 5A4AA 1TZ2A 2GO7A 3NUZA 1YI0A 1N3IA 2QM7A 3QITA 1UUFA 4BP9A 3AFNA 3MUEA 3GXOA 1AJEA 1EDOA 4LC9A 1G8PA 2FMUA 2M6LA 3OLVA 2YVUA 4M7OA 3I5XA 2ZRGA 2C31A 5E0OA 1GQOA 1MF7A 3GPIA 5U9CA 3UCXA 2BKXA 1AC5A 2IEYA 4JV5B 2RBGA 1SURA 2Q9CA 3KYCB 5JHGB 3OOSA 1G60A 2WT4A 1IK4A 2ZB8A 2EW8A 3IRVA 3QJYA 1YUBA 4TXNA 1Z4QA 4Q1DA 4MQMA 1PJ2A 4MGKR 4OTZA 5JW6A 4XZ3A 4II2A 4EB3A 3H7IA 3DBLB 5JRDS 3TW8B 3W06A 4J8PA 1KO7A 3SKYA 4ZK2A 5ITZB 3COWA 1KQFA 4US0R 3SJZA 4E33A 4MGIR 3VPXA 3Q7RA 3PNYA 4MQEA 3SCZA 1ZN8A 3OIDA 1G3UA 2QZZA 3E15A 2VAWA 3T7CA 1R27A 4RLQA 1AQYA 4EB0A 3DL4A 3KJIA 4ZYVA 2G72A 4WCFA 2L69A 3LT1A 1EE2A 3DOEA 3TDMA 5IULC 3GD7A 4OAQA 3KU1A 4ZVPA 3O8RA 4WN3A 1FX0A 1DWQA 1YRHA 2G5GX 4YTEA 2I7DA 1P39A 3IT1A 4O4LA 3PA6A 3N9IA 4UXJA 3ZIDA 3F4KA 2BTQA 1IZ0A 3Q41A 4K6CA 1QRRA 3NALA 4AY3A 2NV6A 4HX2A 2YMLA 4P82A 3ISVA 2SICE 4H7JA 5DYNA 3DBHB 4EEZA 3IULA 5DN6A 1QYXA 2PZLA 1THZA 4QLBA 4LDAA 2VBCA 1CRLA 1RFGE 1KDRA 1JZSA 1LV7A 2VL7A 4MUAA 4TMZA 1BDJA 1I14A 1ILWA 2XVMA 2G67A 3PFIA 5EXSA 5IJZA 3HBNA 2ZIEA 3EQ7A 4XB6B 3PR1A 5GONF 4AZ0A 4DMRA 3W2EA 4OP2A 1YVPA 4FZVA 3R0QA 2IWRA 1KMHB 3CNOA 3K4QA 4ZODA 1FDSA 1EDDA 3VSBA 3ZXSA 2IEZA 3AI3A 1NUQA 5AK0A 5AMXA 3CE6A 2I8LA 2WOJA 1OI3A 4PM4A 4RGYA 3F3MA 4G24A 4DYVA 5K20A 2ZQYA 4C7OA 1F7UA 4QGBA 4ZIRB 2OZEA 2IZZA 3IIJA 4HLDA 4WXHA 3RFCA 3OIUA 3ILXA 2AOVA 3LDAA 3LT0A 4DRXA 1JFLA 5A3JA 3ECAA 3HZRA 2BH2A 4ZZ2A 1QGUB 3QGMA 5T6BA 3EC7A 4CJXA 4DABA 1FE8A 4YP1A 4F1KA 1OR8A 1M1ZA 3NC1C 1PJ4A 3HI4A 4IJVA 1Y6QA 1RQ2A 1PG0A 1YCHA 5EMNA 2I8CA 1P3Y1 3F8WA 2C2BA 1HDEA 3KXLA 4HAIA 4I9NA 4RPJA 4XXHA 4C7MA 1C30B 1GNSA 4NPHA 4YBZA 1B41A 2JS7A 4Q18A 1F48A 4QTZA 5FLYA 4M9SA 1ENPA 4E6PA 4EHNA 3AEUA 4BPBA 4RFVA 4QUBA 4CQMB 4CKEA 4EFDA 2K7ZA 3B1WA 5G41A 1EZ4A 4QQNA 4UXIA 2NUPB 2VPYA 3DHNA 3W7VA 1P2BA 2ZJYA 4IH1A 4RORA 2WJ4A 5FT9A 1RZRD 2YC4C 2QTFA 3K0SA 3PJGA 1VG0B 2O6LA 3G02A 3KR2A 2E18A 2VYND 3O9ZA 5GZ6A 1DFGA 1F2TB 4OQDA 3PC3A 5K8TA 1USGA 4TSFA 1XXHA 1KXZA 3EZ7A 5FAXA 4HDRB 4Q3AA 2XT9A 4U9IS 4I46A 3FX2A 3PQ2A 2BFMA 1BU8A 1FW8A 3WLJA 1FS6A 3VDMA 4O1MA 4XJTA 1EFAA 1N0VC 4V0OA 3UAVA 2NZVG 1QLHA 3W6PA 3C97A 4S3MA 5D6OA 2I4IA 1NBWB 2G9QA 5CTAA 1QK3A 4G25A 1KI6A 1R8XA 3TNJA 1N4AA 3STUA 4ZYYA 1TAUA 2HU7A 3OC6A 1A9XA 3PR2B 2C3YA 4ZHQB 2WT8A 1IZ9A 5AI4A 4HSGA 1ZM4A 4IIUA 3GFPA 1CE8A 3RDPA 3EW7A 4NEGA 4I3FA 2CF5A 2XWQA 4DSNA 2ZQ5A 2QRHA 3RT1A 4J07A 1DC5A 1IHUA 3DCNA 5ELXA 4HN9A 1WV1A 3DT8A 2BPOA 3GJ4A 1H23A 1JTEA 3AIKA 5ES4B 1JDUA 5ESDA 2IYUA 3UG7A 2FEAA 2I65A 1V9CA 1XN1A 4LBZA 2H00A 4KRXA 4LZAA 5FH9A 5HX7A 2NU9A 3WHPA 2H57A 2D59A 2RHLA 1RWXA 2B99A 2AUNA 3SZMA 3RVDA 4RABA 5JECA 3COJA 1GZDA 5FHRA 3QKSB 4IOKA 1GWNA 1DQNA 3ZVNA 2HJVA 4B35A 1ZD5A 2XADA 2QRVA 2BD0A 2IYTA 3AI1A 2NUAA 1FPMA 2E1PA 1IB0A 5F4BA 2ZCJA 3MFQA 3DP9A 5E38A 2W22A 2C9CA 3QWIA 2IY8A 3DEYX 1D6MA 2YXPX 4Q7QA 4EW6A 1WB9A 4L22A 1IN5A 3U44A 2A14A 3UOGA 5KMGA 2P4UA 3JQAB 4OLHA 1E6CA 3HZZA 1AN9A 2OCPA 2GPWA 1RWOA 3GLGB 2PGAA 4KVZA 3T7EA 4EQ6B 1COZA 1GPAA 1SUBA 4U63A 4X6LA 1OV6A 3TX2A 4A92A 4EPYA 1U4SA 3KVRA 2BMAA 1IZYA 3ZK9A 2R6ZA 3NHBA 5JNVA 2GKGA 2JAOA 4FJ2A 5CM8B 2IEIA 3HCEA 5LYYA 4WBNB 1RM0A 2A4KA 2BHSA 4H7IA 2O9JA 1GOTA 3DQZA 3FF4A 3JR7A 3PQDA 4GVLA 4YNBA 5FPSA 3ZVMA 1O0BA 3AU9A 3QY9A 3P9KA 2AS0A 1VIAA 3F90A 5JLJA 1NQTA 5CH8A 4BVGA 2YQZA 1Z2PX 2PGIA 2OORA 3DZJA 2E4ZA 4KU4A 3GFSA 1MJHA 2QG9A 3NTLA 6REQA 1QORA 2I2AA 2PQ2A 6ABPA 2PN1A 3UB4A 4EVQA 4AKHA 3AMVA 4DT1B 2Q6KA 4U7TB 1P9LA 4BVAA 4EDFA 4JHLA 1PJBA 2WTXA 4PFQA 3TQOA 1CZLA 2QW8A 1M74A 1ACLA 3ENWA 1PK9A 3WDSA 5A7FA 3CJTA 2V4UA 3C6QA 4CU2A 1Q3KA 2EKQA 4P93A 4YCCA 1G6HA 4ZOAA 1CRWG 3M4ZA 2VAXA 3GYGA 1BCRA 5JSHA 1I6KA 4D8VA 1CLUA 2EU8A 4CHTA 2NVUB 1JU9A 1PL6A 3N74A 2JLBA 3DEAA 4N0EA 4YJHB 5CX1B 4DZZA 3A1VA 1Y6FA 1QP4A 5B58T 3VC7A 2H31A 5HW0A 1CCWA 2HZ7A 3R3ZA 4BQOA 1P4GA 3NT5A 4YB8A 3QHPA 4KNWA 5DBIA 4W5HA 2ZVQX 4WLVA 1HG0A 4BO7A 4BMYA 2WA1A 2J0VA 3B6MA 5THXA 2RMKA 2Z9CA 1TQ6A 2B8TA 3MWJA 3RS0A 1SFRA 3NTQA 2FMFA 3W6OA 4CE6A 3F7TA 3LPNA 3IOYA 4ADSG 1UP4A 3CLTC 4LNAA 1YU9A 4A8PA 3FBWA 5LA6B 1Y1RA 2I0FA 4EMBA 3Q72A 3JSXA 1V7CA 1U2TA 4G1CA 4NDZA 4PRZA 4EGJA 1QH9A 1IULA 4LOKA 1GTZA 3SC4A 1LSOA 2JIMA 2GSDA 1E92A 1NWHA 2OM2A 3D7SA 4PYMA 1KAMA 3OIGA 4CNQA 1YUNA 1YI8A 5ALKA 5BOVA 2HQBA 3L8YA 3HHEA 3T9BA 3BVPA 3F5DA 3MJFA 3PUIA 4IBOA 1ND6A 4ND1A 3ILVA 3ITNA 3EMVA 1Y4SA 1C3JA 1PZXA 3KTDA 4KAFA 4DIFA 1B3BA 3CMCO 1V2HE 2G6BA 1NUUA 2GPSA 5E1MA 1JQLB 3RSLA 3PEFA 3WGLA 4BVHA 3OFNA 5CDSA 1E3EA 2I2WA 4MAAA 2WF6A 4HGYA 5CITA 5K0FA 2RH8A 3DTNA 4EDHA 1P7PA 1M5TA 1RDFA 2QVLA 3NHZA 1IXRC 4RELA 4P3XA 4ZJUA 1Z26A 3ES9A 2PRIA 1R6DA 2JFPA 4RPLA 5KQSA 3GFOA 1JIXA 4XB2A 4TKMA 3B6EA 3IAM1 2GAJA 3JYOA 2H51A 4ZGGA 4DA4A 1Y1TA 2FP4A 4MLCA 4MRMA 4FM9A 5A6SA 2BGWA 1A1SA 2WPDA 1HDOA 4ZEOA 2XGSA 2QLBA 4NAUA 2YOHA 4JT4A 1YR8A 1TJPB 1PHPA 3Q7EA 4MR8B 2P79A 3LL4A 4WOCA 3V5NA 2FXVA 1D1SA 5B6IA 1L7XA 1ZEJA 2G1JA 3RIMA 3OE7D 3QYAA 4QDKA 3JD0A 2GBLC 3DE7X 1LRJA 1RE1A 1RRFA 2I2XB 3V6LA 3DHYA 4CF6A 1KYIA 5LQSA 3JCZA 1L5QA 2PUFA 3D2AA 4H7HA 3E1GA 2G1KA 3ZU5A 1YBFA 3MJCA 1M1UA 3RUHA 2CXXA 4H1HA 5ALLA 2PRYA 4EMSA 1GSOA 2CHFA 3CPEA 3SVZA 4BVEA 4NMHA 3ORYA 3SR4A 2HU5A 3H4VA 3FUTA 4NJMA 4WZAB 4EITA 1I2CA 1U7WA 4FCWA 2OV1A 2BR5A 4CL3A 4OH1A 5HTOA 2I6TA 2ZIXB 2DWUA 3L0PA 4NAHA 4OK6A 5D7NA 1KI4A 3W04A 2CNWD 3CGGA 4GC9A 4ZCRA 1SA0A 1ZIXA 1W9MA 2AQIA 3QFRA 3STXA 3PT5A 3CVWA 5BN3B 4WDRA 4DCVA 4E4RA 5C1BA 1V3UA 4P6VF 3T4EA 2IZ6A 1G7RA 1W52X 3IR7A 3WK5A 2J3HA 1NX9A 3R6GA 4PNHA 2OB2A 1KQNA 2GCPA 2HSJA 4HN4B 5IAOA 1S8FA 2Y1DA 3JSAA 4R9NA 3QU9A 4IWYA 3U48A 4D0GA 2HBRA 1TNDA 2BT4A 3OOJA 5HZKA 3AGQA 3KLNA 3SLKA 4H3SA 2GVNA 2WIKA 13PKA 1DOZA 2UDPA 1OFGA 4YMUA 2BZSA 1XZCA 3M3DA 2Z2XA 2FWBA 4BECA 2RB5A 1VHJA 3OLXA 2HV9A 2GK3A 4RADA 4DCUA 5ITSA 1FYDA 2KBEA 3BYZA 2BGKA 4HWKA 3GT7A 1BFKA 1MRNA 3ZD6A 4EUNA 2D1QA 4Q15A 4WNAA 2QD2A 2NZWA 5FHQA 5FYDA 3RJMA 4ZV9A 4MW2A 1RPZA 4JP5A 2YWBA 4PQGA 3QA9A 4NH4A 2F4VB 2REXB 3GNSA 3CQ9A 1HLPA 3UEOA 4KFUA 3CRW1 1N5LA 1YAHA 3PFKA 2EQ5A 5LU8A 1N75A 1XZIA 2JFVA 2JDID 2WD7A 2WQ7A 1IU9A 1WNTA 2O0KA 2A9RA 3O84A 3R6DA 3YASA 5CB0A 1R50A 1S1MA 4GOXA 1YB5A 3SC3A 3JQGB 4MP6A 2WWVD 3BSSA 1OIXA 2XCLA 3L6BA 5CM9C 2IH4A 5CRIA 5BWOA 2J3DA 2JLWA 4GPTA 5CT5A 4CIAA 4B3CA 1NMZA 1NVBA 1GJRA 1RU3A 1SG6A 1V3VA 2NSJA 3EXFB 3ETCA 1XO1A 3F67A 4B79A 1BFUA 2BN4A 3CO5A 3HR7A 2HMYB 4PCUA 2JK0A 2DUJA 2WJWA 1CULC 1PIWA 3AR7A 1Z29A 4ZALA 4EK9A 1F4PA 4M7RA 1O54A 4FFBA 2DKNA 2F48A 2NPFA 1L1EA 2C4WA 3MILA 1AXGA 3N8NA 4KXYA 4X85A 3N7AA 1G63A 1NM5A 1T8WA 4H0FA 2FZVA 3O8QB 2P5SA 2W2KB 2C5BA 3NH6A 4FOPA 2YJ3A 4K9SA 5ALXA 1VLMA 2I3AA 3QNMA 4LWPA 1ZINA 5DCLA 4MPDA 821PA 1IHDA 1FP4B 3BK1A 5LDDC 1XAJA 2HT6A 2HPZA 1C50A 2ACWA 1LPMA 2C4KA 5A7GA 4LZWA 5ALQA 4EZEA 4WKNA 2CZQA 5JAQA 5KVAA 1L4EA 1PEAA 4MVJE 1HE2A 1L5LA 2HTEA 4OB6A 1UM9B 3DWIA 3OUTA 3GRAA 2AXQA 2WWXA 3GZNB 3U7QB 4TWJA 2CT8A 3G6KA 4HH1A 4U2EA 2XKKA 2CFRA 3AHFA 1HXHA 1KRXA 3E9YA 1Q91A 3D8NA 4KW7A 3TZ6A 2QXUA 4GX0A 4B3GA 3LRPA 3VYTB 1NJ1A 4QAJA 1TAGA 4YUWA 1D2RA 3VH3A 1WETA 3AHJA 2DPYA 1ZK1A 8LDHA 2P35A 2QUZA 3I04A 4O6VA 2ES4A 2R7LA 4LE2A 4X7PA 1F2UB 2NYVA 5DXFA 5FL7A 3CW2A 4BFSA 4L28A 2YWCA 1E5TA 1QG2A 1XQ9A 3E9QA 5IBRA 3OPYA 4D41A 3VSEA 1G8SA 4OHOA 4EHAA 4JA0A 1G38A 1ATIA 2EDCA 2RGWA 2Z3ZA 3PDIA 3PNSA 4G26A 5F1OA 4GO1A 4ZI7B 4BY9E 3OH8A 5JS1A 2G4LA 3OT1A 3VVLA 4EYEA 3LOPA 3TTWA 4C0JA 4NOLA 3EDYA 1AMOA 1TEZA 2BLNA 2EV9A 3LUHA 1N8KA 3A8TA 5JSZB 1T2FA 4IKOA 4KYUA 1EMDA 1PFGA 1CQJA 4KG7A 2BE7A 5AKIA 2Q1SA 2SBTA 5AM4A 2J7KA 1F0KA 1OJLA 2Q0HA 4IV8A 5K3CA 3RRBA 5FPHA 1WV0A 1T1GA 1PSDA 4D7AA 4HWGA 3H8SA 2IYAA 3W3ZB 1X7GA 4EFNA 1U2RA 2R85A 3DZCA 4F6LA 3KBOA 5BPHA 3Q8KA 1O8CA 1NBMA 2AOUB 2ZSEA 4NU8X 4RC9A 1YR2A 1CFZA 2AJBA 1W76A 2OQRA 3AY6A 3KCNA 4L5CA 4PZLA 5TJHA 1Z28A 4TOIA 4B34A 3DZFA 4BPRA 4BE7B 5BWBA 4K87A 4OQPA 2VJMA 1XNJA 5KSWB 5CVVA 4W8HA 3KUUA 1N2GA 2LCFA 3H5LA 3NZEA 2DWQA 3OE5A 3UK7A 3I6IA 2H9YA 1NW8A 1NVEA 4M9CA 1O94D 2A84A 5CTJA 4OQQA 4BVBA 2IHZA 4Y2GA 2D7CA 1KP2A 2QW0X 3BJEA 3HYCA 2NNLD 4O59O 1Q2XA 4QGFA 2VS1A 5GONA 1EVIA 3D4OA 3EQ6A 3W6NA 2X1HA 3TRIA 1WVMA 4QD3A 2WILA 2AZ4A 2Z57A 2O2DA 2HUPA 2XMSA 1PNOA 1BVHA 1GY8A 1E1LA 4V3CA 1XAGA 3WDMA 4XR4A 3LCRA 5AVXA 3CA8A 2L0XA 1UMBB 2VIIA 4EHHA 2DPXA 2HFJA 5C9ZA 2PSHA 1GZ7A 4J94A 1I6MA 2EQBA 2JFHA 1L4KA 1E2HA 2ZT7A 4NDAA 5F7ZA 3GPLA 3OLZA 5LB2A 3HLYA 3BRWA 3A4NA 5F2OA 2ZCVA 2EJCA 3WB1A 3TI7A 5J23A 5ENZA 4GVXA 4AROA 3QKRA 4MW5A 5A04A 3LPAA 3ZHVA 3ZCPA 2CNDA 4EA8A 1O08A 2G9UA 4ZOQI 5IN5A 4CDNA 4FDAA 4ZI5A 2A2ZA 2VHEA 4C3UA 3L6RA 3EXG2 3R5JA 4DY6A 5KZMB 5ILQA 4AJOA 2WAYA 4Q5IA 4Q3EA 1LNQA 2FW9A 2SCUA 1E3IA 3AVYA 3R5KA 1VE3A 1YCDA 5J4LA 5HF8A 1X0VA 3CRNA 4DIEA 5AESA 1JZTA 1VMAA 3DAYA 3F98A 2CGEA 4IG9A 3CX8A 1HZZA 1WS6A 1LC3A 1YB6A 2QF7A 1G9SA 2IEGA 2V7QD 1RZ3A 3FUVA 3MWYW 3O9MA 1TJNA 2E48A 2FSUA 2REBA 4YRPA 5IEJA 4URYR 1J25A 1DE0A 1V5EA 1G5IA 4RNCA 2RHCA 3FCCA 1SCQA 2IDMA 1BVUA 5A3SA 2PH5A 2UZ4A 3PC2A 2BEWB