3NRCA

Crystal structure of the francisella tularensis enoyl-acyl carrier protein reductase (fabi) in complex with nad+ and triclosan
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
256
structure length
256
Chain Sequence
GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVLPCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase (NADH)
publication title Structure of the Francisella tularensis enoyl-acyl carrier protein reductase (FabI) in complex with NAD(+) and triclosan.
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Oxidoreductase
total genus 86
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3nrcA00
1FDWA 3FSRA 1PWZA 4UAGA 1M6WA 1MC5A 1PGQA 2CD9A 4W9NA 1VLLA 4WCFC 2BFPA 2XAAA 4J0EA 4YJHA 1EFKA 5BQFA 3EC7A 2DBRA 2QHXA 4YAIA 1YOVA 2O3SA 4XKJA 5C5IA 4I9UA 3HWRA 1SOVA 1ZNQO 5THQA 3I9OA 2ZATA 3SC6A 4CLOA 2VUSA 4PN3A 4Q3BA 2W4QA 1VJTA 1EFLA 1WZEA 1PJ4A 2YY7A 2VZ9A 3PRJA 1C0PA 2GPTA 2VRBA 3JQ8B 3ZH2A 3RCBA 4JIGA 4MPDA 3D5TA 4KQWA 4AG3A 1TI7A 2FPGA 3HZZA 2PR2A 3WIDA 1BTOA 2VHYA 4WKGA 1E7WA 3W8FA 4DYDA 4B79A 2G1UA 2DPHA 2I65A 4MVJM 3RBVA 2WD7A 3ICPA 3QP9A 3AM5A 3UN1A 4QQRA 1RM5A 2AQHA 2ZJ0A 3V1UA 4J7XA 3E6AA 4M54A 4PG7A 2YHIA 2VN8A 4ITUA 2O3QA 3RUCA 1EVIA 2GZ3A 2GF2A 5A9TA 3WTCA 3QVSA 1PJCA 2LDBA 1T25A 1T4DA 4QX6A 3GLQA 1QV7A 4IZIA 2BFAA 2FWMX 4PLHA 2BH9A 2O3JA 3V1YA 1E6EA 3FHLA 2WM3A 1LXCA 5FWNA 2P9GA 3PEFA 4R1UA 1DC5A 3CIFA 3JQ9A 3JQFC 4BKOA 4D3SA 4N5LA 3VKVA 2NVUB 4YT4A 5BNTA 2WD8A 1GDHA 1NQ5A 2AXQA 3M2PA 4WEQA 2PGLA 3JQCA 2VWHA 2PZLA 1FMCA 3V2UA 1PL7A 1ZKMA 5A03A 3PIDA 4E0BA 3DHEA 1H9BA 3JQAD 2FZWA 4L4SA 3DWFA 5TX7A 5B12A 1DJNA 4QFDA 1PGOA 1YGYA 3D3WB 3UVEA 4YT5A 1M75A 5I9NA 4CMBA 1K6IA 5EIOA 2EGHA 2VYNA 5EQFA 1CIVA 4OO3A 1AE1A 1U28A 1RWBA 3ZWCA 4GWKA 2RH4A 3K9QO 3ZHBA 2D3TA 5DP2A 1U4OA 3JQDA 3DBLA 2J3JA 5G0UA 1TLTA 1EUZA 5C7IO 1I5RA 4Z0HO 1ONPA 5IDYA 1R4NB 1JKJA 2I99A 4UVIA 5JDIA 4JN6B 3EAGA 5TIIA 4O5OA 4ZQFA 2WEKA 4BNTA 1C1DB 3KSDO 3QE3A 4URFA 1ONNA 1GADO 3ORFA 2VHWA 2B83A 2FR8A 3D4OA 4J91A 4AFNA 1GPJA 2D8AA 1G0OA 2AEJA 3D7LA 3RU9A 3ZV5A 3VDRA 1EK6A 4GWGA 1E7YA 4PLVA 2YDXA 3OJ0A 5KTKA 4J4BA 3SLGA 5IFLA 3V8BA 5A02A 2Q49A 4CQLA 3TQHA 2X0RA 2JHFA 4RVSA 3ULKA 4YAEA 1LBEA 5KJ6A 1P1RA 5THKA 4HUJA 3IP3A 3OQBA 3JYOA 4CM8A 2PNFA 5A9SA 3RC7A 1N1GA 4NDNE 1SOWA 1F0YA 3KEQA 4EBFA 1P3DA 1ADGA 4CR7A 3AOEA 4II3A 1HDRA 2HMSA 2HMUA 4MIYA 1R16A 3T4EA 1ZFNA 4PLTA 3C1OA 1L1FA 3UGKA 4R68A 3WDSA 4UULA 5CEJA 3TL3A 3VHRA 4I5GA 5T64A 3PWKA 2HDHA 4BNXA 2IEDA 3U4DA 4A5OA 4J9UE 5KCZA 3A14A 4YBZA 4Z0TA 5BSFA 3PHLA 4CPDA 4J0FA 5AYVA 5JAMA 4CL3A 5HBRA 2EERA 4IDDA 1IHXA 4YTEA 4ZQBA 3TZKA 4A10A 3WYBA 3KEOA 3VPGA 5CDTA 2QRJA 2GUGA 1NHGA 3H9JA 3ICCA 5A3JA 1JKFA 4ALIA 3WX0A 4FDAA 3PQFA 3NV9A 4YRBA 3RWBA 1R0SA 4CM7A 1L7DA 2C2XA 4XJSA 4ALNA 3OA0A 4TWRA 1X7HA 1KBZA 3WQQA 1ZVMA 3DBVO 2R6JA 4PLFA 4BQPA 3LQFA 4W7HA 3ZNQA 4OOFA 3H7AA 3P19A 2GSDA 4RQUA 1D7OA 4FJ2A 3PP8A 4NMHA 4Y9DA 1KEWA 1LLDA 2P68A 5EMHA 1A4UA 4I1IA 2V6GA 2Q3EA 3AK4A 3KSUA 3KETA 3HDQA 2HK8A 3DAGA 1Y8RB 2Y0DA 1KVRA 4YJGA 4RQTA 4LN1A 3V5NA 3DBRA 3DZBA 5L40A 1Z7BA 1U8XX 3BMNA 5U4QA 3ZI0A 2ZCUA 5AXAA 3AI3A 4CM5A 4M8SA 3AUAA 2O7SA 3INRA 4NPCA 1LDMA 3PYLA 1ZJYA 4PLZA 1NVGA 1CWUA 3EUWA 2GDZA 2O3UA 1BXGA 1ZMTA 5AXBA 1IHYA 4BKUA 1BDBA 3BHJA 4FJ0A 5IXYA 1PIWA 4XGKA 3WQRA 4K6FA 2RCYA 4LISA 3DBHB 5L7TA 4LMPA 1WNTA 4J1TA 3MJ4A 3H5AA 4Z0PA 4EGFA 4W4TA 2O3RA 1I3MA 3ASUA 2DLDA 5F1KA 5TT0A 1X14A 2DTXA 3K92A 3BZUA 1T24A 4XQEA 3G79A 4LVCA 2VNAA 2XXBA 3IUPA 4D41A 4YAJA 4IIVA 4RCVA 1GR0A 3QWBA 1ULUA 2IZ0A 3I6IA 5CDYA 1HLDA 3A06A 4BMNA 3H9EO 1XKQA 3M1AA 5BSEA 2UVDA 2XPCA 1PJSA 3GNSA 4D43A 2B4QA 3F6YA 4KUGA 2PK3A 3BTOA 4K26A 4AJOA 3SVTA 2P91A 1UDAA 1E1MA 1RM3A 1O95A 4CLHA 1J0XO 3S8MA 3VZPA 3HE3A 3VZSA 3OIGA 2G82A 4YAKA 2C54A 2P5YA 1KC1A 1WP4A 2PD4A 4HY3A 3ITDA 4E5NA 2DBZA 3PGJA 4B4VA 4DQVA 3GG2A 4R51A 1QKIA 3M1LA 1EZ4A 2EEZA 3TWOA 4FFNA 4FR5A 3JTMA 4HFNA 4R69A 3RFVA 1EMDA 2GCGA 4FFLA 4MKXA 3I23A 3OETA 1I2ZA 1UAYA 3BAZA 5IAAA 4ALLA 3JQ8A 1VC2A 5U1PA 4ROSA 2C7VA 2JD1A 2QQ5A 4HFJA 2ZK7A 3NTOA 5JE8A 2VHVA 2V65A 1ENPA 4E5YA 1GUYA 4YVFA 3ZHYA 5C37A 4UREA 4TKLA 3C3XA 4NBVA 5EINA 1I3NA 4ONEA 2Q4EA 2TMGA 3HB5X 3ZDFA 3K31A 3CH6A 3UFXA 2FSVA 2GRAA 1ZXLA 3AJRA 1I10A 1HLPA 1N9GB 5DOVA 3A28A 1XIVA 4N5NA 1MXHA 1A9ZA 1HSZA 1VPDA 5L7WA 1YONA 3QWFA 2FPIA 1Y6JA 3E48A 3WICA 4U7WA 3FNEA 4ALKA 4YJHB 4Q9NA 1EDOA 3ZWNA 1O94A 1YOVB 3I4FA 4NU6A 1ZMOA 2YZ7A 3QJ5A 4BKPA 4PLGA 4TRNA 1LRJA 1DAPA 3RC1A 1W6UA 2JAPA 5T8KA 1WMAA 3LYLA 5G0WA 3OEWA 1DOHA 2O23A 4FW8A 3WG9A 3L4BA 4N7RA 1GV1A 3D3WA 4JROA 5JFOA 2YFHA 1XR3A 3GN1A 4R54A 4WLUA 3GMDA 5T67A 1H6CA 1YB1A 5I8WA 1UXIA 3LT2A 1LLCA 3WBBA 5JXWA 1DRWA 4PRKA 3H2SA 2OL4A 1SC6A 5L3ZA 2IE0A 1TXGA 2PY6A 2Y1CA 2YHIB 1HYHA 1F12A 2NQ8A 2Y68A 3O03A 3ZCXA 1DIBA 4BO5A 2VWPA 3AY3A 5C3MA 3OBBA 3DC2A 5ITVA 1LDGA 3ETGA 4A27A 2EWMA 1W73A 1EVZA 3AY6A 2CY0A 4P4LA 1DHTA 3BHMA 3HNPA 4QFCA 2PGJA 1A27A 1EQ2A 2Y05A 3CINA 1HEUA 1ISHA 4MIOA 4O6VA 2DBQA 1C1DA 1M67A 4TRJA 3U4CA 3TOZA 1ENZA 3O26A 4CODB 3H3JA 2P4HX 1G6KA 1LRKA 2P5UA 2AEFA 2W2LD 1CERA 4ZD6A 1P1FA 4FS3A 2POQX 1PL8A 4PLWA 3GNTA 4M89A 4BNHA 1UJMA 4BMVA 7ADHA 1J5PA 2D0IA 1IB6A 5KOIA 3PFFA 3FWNA 2FR0A 4JX8A 3E9MA 2OXIA 2CF6A 1ISJA 1Q0HA 3ZWPA 3I9LA 1U5AA 4YEDA 3U62A 4XYGA 1D8AA 4PVDA 4J6FA 3D3EA 3DBLB 3TFOA 2BFMA 2NTNA 1T2CA 2P4QA 1MG5A 4LK3A 2P9EA 3SX2A 3GAZA 4CM4A 2JHGA 2O50A 3KSZO 1N7GA 3TDKA 1KVQA 1R66A 3KLPX 4GLLA 4CMCA 4F3YA 4CM3A 1T4BA 1YL6A 4HP8A 1YB5A 1I01A 3B20A 4GLOA 1Z7EA 1C0IA 1XWFA 1HKUA 2Q1TA 1CQJA 3PLNA 1OFGA 1H9AA 2A4KA 3DMYA 1VSUA 1P74A 2CDAA 1UXJA 5H81A 3NT5A 3F1KA 2SCUA 4ZQGA 3ZU2A 3OJEA 3JQ6A 4RO0A 4CQLB 4MVJH 1LDNA 2Y1EA 4OMUA 4DXHA 1X0VA 3D4PA 5DBIA 4EUFA 3L77A 3X2EA 4RPHA 2CDCA 4P8RA 2XXJA 4RDIA 5TQVA 3DEYX 1ISMA 3FTNA 1OBFO 3W8DA 4CMHA 1RKXA 4CM8B 5A9SB 4A03A 4B4UA 5AOVA 4RZIA 3RFTA 5GZ6A 2X5KO 3WBFA 2AHRA 3PJEA 4HXYA 3DOOA 4INAA 4DMLA 4DPLA 1W4ZA 5EJ2A 2FOIA 1UUFA 3WLFA 2FR1A 1MXFA 3MCVA 4B7XA 3RBXA 4JCOA 1JU9A 2NUAA 4CMAA 2WYUA 4CLDA 1JA9A 3UF0A 4OQYA 4KWIA 1U3TA 3N7UA 2PA3A 3MTJA 3ENNA 4XDZA 4DYVA 1DLJA 3QWAA 3UH1A 4ZA2A 2QX7A 4FFOA 3GG9A 1ZSVA 2O2SA 5BSGA 1B15A 4BMSA 4DL9A 2YV2A 4D7AA 3MJTA 3MWDB 1V0JA 1PGJA 2ZTUA 3QHAA 2Q50A 1PQPA 3KM0A 2C29D 3PWZA 1HDOA 1NBOA 3CTMA 1X0XA 2GZ2A 4XQCA 1U8FO 3IL2A 4RV9A 5AXDA 4Z9XA 1PQWA 2HMTA 3HHPA 2C59A 2CMDA 1EVYA 1ZIDA 1Z45A 4KQXA 4DLLA 3E5MA 2I3AA 4RVDA 3Q0EA 3DMTC 2Q99A 3VAZA 4NG5A 3C85A 4CMEC 3DBRB 2CDBA 1FF9A 1A9YA 1NQAO 1XHLA 1HE4A 3I9KA 4CM9D 2X58A 1TT7A 5BNFA 3ONEA 4FFRA 1U3VA 3PGXA 5CHEA 4GPD1 5G4LA 3P5SA 1NQOA 1U3UA 4OKNA 4B3JA 3KB6A 3KYDB 1T2AA 1NVMB 3C7AA 3KYBA 3ZWVA 3OH8A 3K2EA 4EJMA 4X54A 4GH5A 4XX0A 4GX0A 3SLKA 1BXGB 2RBEA 4RL6A 3RJ5A 2PV7A 3RFXA 3RVDA 1NR1A 1GTMA 1E6UA 1NFFA 2DVMA 3NRCA 5KNLA 4YRDA 5IDWA 1UP4A 3JQAA 1EE2A 3CMMA 2YQ5A 4N5MA 3TRIA 5A9RA 3FPLA 5I9LA 3RSHA 1VL6A 1FK8A 3EHEA 3RD5A 1KYQA 1WPQA 1MUUA 4BGEA 2CZCA 4R16A 3RUEA 4OH1A 3HFSA 4XIYA 5IJZA 4GSLA 1CETA 2HAEA 1X13A 1YL5A 2DPGA 2O48X 2ZQYA 3P2OA 5LDGA 3ROPA 3F46A 3FR7A 3K73O 1F14A 1V8BA 1OOEA 3RC9A 2YYYA 4XEHA 1ADCA 1FDVA 3JD0A 1ZK3A 1KY5A 1N9GA 1VL8A 3HSKA 4HFMA 4UUPA 4RJTA 2Z1NA 2J3HA 1A72A 4HV4A 1U4SA 4PFJA 1JQBA 1EUDA 4LMRA 3ETDA 1U9JA 3H9QA 1XCBA 1HYGA 1P9LA 3WSWA 1QLJA 1VJ1A 5JMPA 2NQTA 1EDZA 3NT4A 4FN4A 5A5EA 2R2GA 3KTDA 1J4AA 4WOKA 4AJKA 3CZMA 2Q1WA 2OBNA 1N92A 1HE2A 1QYVA 1ZXBA 5DCUA 4IIUA 1CYDA 3JD2A 2CVQA 1YO6A 5DN9A 5HS6A 3RC2A 1SEVA 3GDGA 5KKAA 3L0DA 3N74A 4AJ1A 4NIMA 1I3KA 5JCJD 2QYSA 1G1AA 1VKNA 1H2HA 2JCXA 5F1OA 4D79A 3R1IA 3IIEA 4B4OA 5COQA 1G0NA 4JNKA 3DZKA 5A5FA 1TT5A 4JQCA 2AMFA 1JDJA 5ICSA 1XYGA 3F4BA 4JBHA 1BXKA 1E3EA 3HUDA 3IS3A 2EJWA 3NGLA 5I7EA 1HXHA 3GFGA 1LSSA 5T8KC 3CSDA 2GNAA 4UEOA 4DBZA 3WSVA 2B5VA 4PG8A 3S2IA 3EDMA 5TJ9A 3ZHXA 1BXZA 4U8GA 3E18A 3SJ7A 1DO8A 3CPSA 2VT2A 2IYOA 1ZK2A 3DZIA 1WZIA 4MP3A 2UUOA 4BNJA 3GR6A 5FI3A 4MP8A 3ZWOA 1PR3A 4BO1A 4WCFB 1DXYA 2VCYA 5LCXA 4YT8A 4ND5A 4I5FA 1E7SA 3V1TC 2AA3A 4YYZA 5ER9A 4XRGA 3CMCO 1NQTA 1SO8A 4WLVA 5B37A 1YQDA 3VH1A 1U1IA 1LSJA 2NTVA 3TOXA 4BO8A 3PYMA 5DCWA 4K9DA 1ZCJA 2J5QA 4N54A 4YDRA 4UVGA 1GQQA 4TRRA 3AW9A 5T57A 4E5PA 3PK0A 4JLWA 1NYTA 2X0NA 3JQGA 4IDFA 2DKNA 3A9WA 3KHUA 3GOHA 4GVXA 4W6ZA 3VH4A 2BF7A 4YRAA 4OXKA 4OAQA 1JW9B 4MP6A 5JSFA 4U0KA 1VI2A 1RJWA 1GEGA 5DT9A 3VVBA 4YT2A 4U6SA 2DFVA 2VYVD 1E7MA 2G17A 3CXRA 1H6AA 5ADHA 1CQIA 3IOYA 2PZMA 3DQPA 4DA9A 1XELA 2AE2A 4D0RA 1UP7A 3G0OA 4CQMD 4EJ6A 4AJLA 4M49A 1GV0A 2BGKA 2A92A 4BO3A 3T7CA 1X1EA 4RORA 3ZWWA 2HRZA 1NAIA 3GDFA 4AJ4A 5I7VA 1DPGA 1B3BA 2PZKA 3FBGA 3DL2A 1SCUA 2CSUA 2DFDA 2Y67A 1K3TA 3GZNA 1EUCA 5TSDA 4FD3A 4GKBA 4CMIB 2NU8A 3HN7A 3MJSA 4RF5A 2WJPA 4BS9A 1U7HA 4XB2A 2O4CA 2ZIZA 1O89A 4GVLA 3MOGA 3I52A 3A4VA 1PJ2A 3ST7A 1B2LA 1WDLA 1E7RA 1M76A 3W4IA 1GUZA 2VZ8A 1IZ0A 3SBOA 1IUKA 2EGGA 2ZJ1A 1Q1NA 4XQGA 2I6TA 1DEHA 3HB4X 5FYDA 3HFGA 3M6IA 1HZZA 3MWEB 3GRPA 1QMGA 3CUKA 4BO2A 1AHIA 3ASVA 4NFHA 4CM4B 1X15A 5IZCC 3R0IA 4L9RA 3NX4A 4J4HA 1Y5RA 4UVHA 3RKRA 4L4XA 4L8VA 3WGGA 4D3DA 2NM0A 4PZCA 1YWGO 1KY4A 1UH5A 1DC4A 4CV3A 4QO7A 4BNMA 4GX5A 1PJ3A 5I7FA 1A5ZA 4IDCA 3GPDG 2ZTMA 2AG8A 4TSKA 2GYYA 4JGBA 4CR8A 1ENYA 2Q46A 1F06A 3K30A 3H2ZA 3EYWA 4HWKA 4FJ1A 1KVUA 1A4IA 3TN7A 1D4FA 5HWSA 1Q7CA 2D2IA 2DT5A 2PLAA 5TNXA 4XWYA 3U9LA 3QVTA 3VPXA 3EY4A 1HT0A 3V2HA 4PLYA 2HMWA 3OQ6A 4A2CA 1T2DA 2F00A 3RI3A 3ZWYA 3DR3A 3MZ0A 4C7JA 2DQ4A 3JD1A 4BQRA 4BO7A 1TB4A 3FI9A 3QSGA 2HU2A 1QORA 3PXXA 4IJUA 3Q6IA 2HMVA 2FSSA 3OJOA 3NDJA 2X7HA 4U0JA 3GVCA 1OC2A 4AJ2A 1PTJA 4GMGA 3ONFA 4LW8A 5F5LA 2UYYA 4DPMA 5U9CA 4QECA 5JC8A 3I9JA 2PD3A 4NJMB 3JD3A 1TVEA 1DAOA 4BVAA 5KVVA 1DIHA 1ID1A 3BMQA 4BB5A 1M2WA 1UZMA 4IS2A 2VYND 3G3EA 1MFZA 3KYDA 4G81A 4KOAA 1RYDA 4P22A 3L6OO 4IGFA 4R9RA 2Q2WA 1ARZA 2J3KA 4OSOA 3IJPA 1DIGA 1AXEA 5LDHA 9LDTA 3MJCA 1ENOA 4IPTA 4YB8A 4DIBA 2X1HA 2Q1UA 3FF4A 1LQUA 1AXGA 3AU8A 2HO5A 1WW8A 4GBJA 5JW6A 3ZNPA 2QZZA 2E4AA 1GD1O 1YQXA 2WMDA 2WDZA 2ET6A 3DAPA 3VC7A 1OZAA 2X0JA 3OSUA 4LSMA 3JSAA 1HETA 3R6DA 4AJPA 1I0ZA 3GEMA 1E1LA 2B4TO 3GT0A 1UP6A 4LCEA 1V35A 5G2OA 2EJVA 2OFPA 1DFIA 1LDEA 3AM3A 1E3SA 4HFRA 1JWAB 4R3NA 3JYQA 4E2YA 1YJQA 3LC1O 3GVXA 3RUFA 5A4DA 4MIEA 4OYRA 1HZJA 4GX2A 4BNYA 4ZQHA 4E21A 4F6LA 2H6EA 2HUNA 1MLDA 5HTOA 2DUWA 1YKFA 1PGNA 1SZJG 4KWHA 3FNHA 1PU2A 4I08A 4XA8A 3RKUA 3PJGA 4CJXA 4BNGA 2IYPA 3DAFA 5F5NA 1E77A 2PGDA 2X9GA 3L6EA 3GA0A 3WFIA 1Q0QA 4E5KA 3TF5A 5CP8A 1YBMA 1ADFA 4NBTA 1LQTA 3JQAB 1B14A 1B8PA 1OMOA 1PS0A 1UR5A 2CNBA 4GSKA 5JPIA 3U3XA 1S6YA 1VSVA 1LRLA 3ZV4A 1CJCA 3S1LA 2Y93A 1BDMA 4MKZA 5CEFA 3G49A 2X9NA 2ZB8A 1D1SA 1SMKA 5DP1A 3AU9A 4QO8A 4ND1A 1K5HA 3PQDA 4FC7A 5ENVA 3VPSA 5ICMA 4W9NC 1ISGA 1P1KA 3H9UA 2JCVA 1JVBA 4OXYA 1L7EA 4Y6RA 3V2GA 2EF1A 5G0VA 2QIOA 5JY1A 3UKOA 2RAFA 2YW9A 5ES3A 1CEQA 3STHA 4E4YA 1ISFA 1IYZA 2R00A 4B8WA 3JYNA 4NQZA 3GHHA 3GRKA 1FJHA 4EJ0A 5IN4A 2Y66A 4XIJA 3C24A 3AFMA 4MVJI 4PZEA 4RPKA 4TRMA 1QXSA 4IZHA 4MINA 5K6AA 5EL0A 3JD4A 1VE9A 2GR9A 3WGZA 3O8QA 3ENKA 4GMFA 2AQIA 3BMCA 1NP3A 4IGEA 1VJ0A 4MJLA 5JS6A 1QLHA 4QEDA 5MGBA 1E1KA 2GN4A 2VUTA 4NBRA 4UUOA 4C7KA 4WCFA 4R5MA 1SB8A 3FBTA 2IDZA 1P1JA 3PDUA 3E8XA 3AUSA 4G65A 1V3VA 2NACA 3LT0A 2I9PA 5HS4A 3W4KA 2VWGA 4EUEA 3S2FA 1XU7A 2WE7A 1LI4A 2PFGA 1RYEA 1NNUA 1QP8A 1U2DA 2EG9A 4JJFA 4LSWA 3PDJA 5CFZA 3JYPA 3QV1A 4BNKA 3JQ9C 2HK7A 1HTBA 2IXAA 2HLPA 4K1LA 1N1EA 1TT5B 4D3FA 3D1LA 4I5EA 4IQ8A 1VRWA 2ZB4A 1XSEA 4JBIA 1P31A 3RROA 3RAJA 4DBVO 1YH3A 4O63O 2FRDA 3WMWA 1YRLA 2A35A 1PJLA 3G1UA 4N18A 1HDZA 1WMBA 3R3SA 5BT9A 2DAPA 4EW6A 3VH3A 1IL0A 3QY9A 3E82A 4CUKA 3QQPA 3W8EA 1MGOA 1JKIA 4CLXA 4MVJA 1UXGA 1GFSA 1DB3A 1NVTA 2Z5LA 4Z9YA 4PLCA 5C7OO 2PZJA 6ADHA 4P4NA 1JTVA 3FR8A 4PRLA 4D0SA 3TZ6A 5L9AA 1YBAA 4R5HA 4TMFA 4BNZA 3JQFA 3KLMX 2VQ3A 4WASA 1P1HA 4ID9A 4RF3A 2ZTLA 4BV8A 4H15A 1XDWA 3H5RA 4BOYA 4CMIA 2W2KB 3ROKA 3P2YA 2FZEA 5HA5A 1ADBA 4EDFA 1HYEA 3WS7A 4DVJA 4L75A 1KETA 1B16A 5JDIC 4EYEA 2BI8A 1ZJZA 3DHNA 3GGPA 4L4RA 3JQGB 3WB9A 1PSDA 3RUIA 4I5DA 3KYCA 2YHUA 3K6JA 2O4UX 2OP1A 3NEPX 4IQ0A 5JDCA 1YVEI 3AOGA 4B7CA 4FQ8A 4CL8A 3OFSA 3O38A 1DRVA 3T4XA 3F1LA 4BB6A 3UCXA 5TT1A 1H6DA 3H65A 1Z74A 4XCVA 2Q45A 3DXFA 4WUVA 5GY7A 4NK4A 5JLAA 2BMAA 1YL7A 1ZK4A 4WE3A 2NVBA 3GVPA 4ZVVA 4BGVA 2VRCA 4KP7A 4KUHA 4LVUA 1YDEA 5BNIA 2FPPA 1R37A 4FB5A 4HX5A 1FDTA 3H5NA 2WWRA 5L7YA 2AQKA 2Y0CA 4BGUA 3GZNB 3DONA 1E3LA 4LCJA 2JAHA 3L9XA 4RDHA 1PR9A 1MA0A 4LRSB 2V6MA 1E92A 4IJVA 4FFPA 4YWJA 4BNWA 3CEAA 3AOEC 5EN4A 3ABIA 3QWIA 1XQ1A 1HE3A 4O1MA 4PIVA 1NTOA 2GN6A 3I83A 3OEYA 2GD1O 4R01A 4XDYA 4FCCA 1YBVA 4WK6A 3W1VA 5L51A 7MDHA 4L74A 1DC3A 1K2WA 4CMKA 4AL4A 1GL3A 1ZZEA 4HBGA 1PZFA 2YDYA 1PZEA 1ZH8A 3AFNA 3RUDA 3C7DB 4MDHA 3ZWMA 4DLBA 4G2NA 1KS9A 2E48A 1O0SA 1GZ6A 2OZPA 3L6DA 2BKAA 4OJNA 3UHAA 2ZTVA 2HRBA 2C20A 2OOSA 4A26A 1HWYA 4E12A 5G0SA 1QYDA 5JO0A 4OL9A 4BHTA 1HRDA 2Z1MA 4NJMA 3ZWXA 4DIOA 1V9LA 4MO2A 3WGHA 1AHHA 2WSBA 4WCDA 4BNFA 3ANLA 4ALJA 4BIIA 4EEXA 1FXSA 4YPOA 4ZJUA 5JBIA 2EW8A 2O7QA 3WWZA 3ZU3A 3AI2A 1BW9B 3MJEA 3LT4A 3IDSA 3WMXA 2OBYA 1IOLA 3CE6A 1E5LA 5L4NA 5TS3A 3K5PA 2PKQO 1AUPA 4AICA 4DMMA 1NPTO 5CPBA 2X6TA 1D3AA 1GZ4A 1LDYA 1DBVO 2X0IA 3D4NA 4RLHA 4YQZA 4Z6KA 3P7MA 4Q3CA 1PGPA 3WYCA 1EQUA 1Y5MA 3IP1A 4YAGA 6LDHA 1GU7A 1I2BA 3ZHZA 3E5RA 1BGVA 4NI5A 3H6KA 1BVUA 4J1SA 3PJDA 5EPOA 1LSUA 1N5DA 3NAQA 1XLTA 3GUCA 4MVJE 2HSDA 3Q2KA 3EVNA 2EP5A 3U0BA 5DCYA 3QWHA 5JAQA 2OGUA 3JQ7B 3IJRA 4E31A 4Z3KA 3S2GA 3D0OA 1JWBB 1IPFA 2LDXA 1ZK1A 3KBOA 2B4RO 1OAAA 3BMQB 3IQDB 4EI2A 3INGA 4ZHSA 1R15A 4C4OA 4B3HA 4OKIA 5EQDA 3EK2A 5K9ZA 4NR0A 2B36A 1CRWG 3H3FA 1WDMA 4IDBA 1LEHA 3NYWA 1T1RA 2OHXA 1N7HA 1E3WB 3BIOA 4XGIA 4ND3A 2V7PA 3HJAA 4DGSA 1A7AA 3PHHA 4Q39A 1UZNA 4Z3DA 1U7TA 2JD2A 3RQSA 1LA2A 3ITKA 4O59O 2QYTA 1I36A 1BVRA 4BKQA 5AXCA 4ZRNA 2FMUA 3H4VA 4OIMA 3KRTA 5EERA 2A94A 1UAGA 3HADA 4IBOA 3VH2A 3PHIA 1LLUA 3WWYA 3EZLA 4WLEA 2I66A 3FNFA 4LRTB 3ANNA 3CZRA 2Q2QA 2NSDA 3OA2A 4Q3EA 1BRMA 3NDRA 3TPCA 4JJGA 1JAYA 3BA1A 3GF4A 4YJDA 3OF2A 3RUAA 4J7UA 3IUSA 5F3RA 3IAHA 3GZ4A 3NGXA 1VL0A 1MX3A 4Q3AA 2WTBA 2DM6A 4XB1A 1NPDA 5IXSA 5JYDA 4E2XA 3JQBA 1R4MB 3ZZNA 2X4GA 4ZICA 5L45A 1ZO8A 2X23A 5MDHA 5DOZA 3RIHA 4MVJG 3ZV6A 4DC0A 4NH4A 4Z9FA 3UAGA 2DUUA 2R00C 3OJFA 3WQSB 1EEHA 5JYEA 3I3OA 4OSPA 2W8ZA 1H5QA 3GK3A 4J9VA 4PVCA 1B7GO 3TFQA 3WGOA 1BMDA 3BXXA 2X8LA 4BO4A 5CG1A 4O0LA 5L4LA 2P2SA 2VOEA 4IDGA 1R6DA 4NZ9A 3ROQA 3PHGA 3ADPA 4Q3NA 2B5WA 1U5CA 1YB4A 3PVZA 4WLOA 3U5TA 1WDKA 3O4RA 4NHEA 3DB2A 4IS3A 1DJQA 3C1TA 1NASA 3WGIA 1C1XB 3ZW9A 4PZDA 1I30A 1C3VA 3KV3O 2J3IA 3C1AA 4Q3DA 2D4AA 3DZHA 3Q1LA 3GVHA 2Y1GA 5TF4A 5BR7A 1B8UA 3QA9A 1QSGA 5F21A 3BTUA 3L4BC 3UCFA 1YJ8A 4KZPA 4OHUA 1B26A 1GAEO 1FDSA 4Y6PA 3O8QB 3PTZA 3TNLA 3BMCB 1LNQA 2W98A 2PKQP 3DTTA 5I7SA 1NFQA 1E0DA 1ISIA 4HADA 1Y8QB 3VZRA 3JCZA 3FN4A 4NBWA 4WGGA 3IKTA 4FOSA 4OXNA 4IJWA 2B0JA 2D5AA 2D59A 3O9ZA 5AQ1A 3DDNA 3F5SA 5KVCA 4F6CA 4FSHA 1H94A 4RVGA 5DBFA 4NK5A 2CF5A 2W2KA 3ON5A 4KDEA 4J49A 3UCEA 4J90A 3X2FA 3KOUA 3GPIA 1A71A 4AVYA 4E3ZA 1AGNA 1EBFA 4XJTA 5I8ZA 3JV7A 3VZQA 2ZYAA 3DZJA 3LVFO 1PX0A 1GYQA 8LDHA 1V6AA 3JYLA 1LSOA 4H3VA 2V6FA 3LZ6A 4FPXA 4H16A 4R4JA 4BNNA 3K2BA 2JFFA 4ZRMA 1O9BA 3RJ9A 3EMKA 1BG6A 3B1JA 4II2A 4E6PA 2ZYGA 3WTBA 4DLAA 3HDJA 2AG5A 2GLXA 5A04A 2YV1A 2VHXA 2ZB7A 4J2HA 1R12A 1PQUA 3DFZA 1E1NA 1ZW1A 2Y0EA 4UUMA 1O5IA 1MP0A 4I9NA 4ND2A 4HNGA 1LTHR 4WOJA 4NFYA 4IUYA 1ZEJA 1GUFA 3F9IA 2J5KA 2OORA 2NLOA 5DF1A 2YV3A 1GQ2A 2JFHA 4OGWA 4XYBA 5JDCC 3WGQA 5JY6A 3JQEA 3BYZA 3VDQA 5JNLA 2ZCVA 2FN7A 1HF3A 1MV8A 3D64A 4P4GA 5H82A 4OM8A 4QSMA 3HQ4O 1GEEA 2RHCA 3UUWA 3VTFA 3FTPA 2YJZA 4OOEA 1QG6A 3I1JA 1KC3A 1PJQA 5B4UA 3G1TA 3K8ZA 5T5QA 4AJHA 2CUKA 4Y67A 3H8VA 2RHRA 1YXMA 4DREA 2O3TA 3ONDA 3RBZA 3GC6A 3I9MA 3KYCB 4JP2A 4F45A 1P33A 2UV8A 4BKRA 1Q0LA 2WYWA 1HSOA 2HJRA 4IXTA 2G0TA 3FPCA 1W8DA 5KIAA 3IC5A 1LC0A 1F8GA 3E03A 2XOXA 1Z73A 1MB4A 3ETEA 1WWKA 4J1NA 5H83A 1NHWA 4S1VA 2NNLD 3HDHA 4E5MA 2JL1A 3DZFA 2GASA 4NFSA 2JKVA 5KJ1A 3LC7O 1E6WA 3TZCA 2NADA 3CKYA 3ZN2A 5FF9A 3OJLA 2Q4BA 4WECA 5JC1A 4IJKA 2ZKLA 1I2CA 4DWVA 3GNQA 4DIFA 5ENDA 3SXPA 1SNYA 2JCYA 4PLPA 4RF4A 4RVHA 4ILKA 3H9GA 5I9MA 3VPHA 2B37A 1OC4A 4MKRA 5L95A 3DOJA 3FCOA 1PZGA 4BNIA 1BW9A 1NWCA 5IDQA 1TA4A 1XU9A 1E3JA 3UICA 5KJFA 1T2EA 1V3UA 4TROA 4YQYA 2BRUA 1UZLA 5TJHA 1C14A 1KIFA 2W90A 3GFBA 1YE3A 4YJFB 4CLRB 1P44A 3PZBA 2BGMA 3RU7A 5J23A 3C8MA 4RGBA 1QYXA 3NDIA 4ESOA 1HDGO 2EKPA 3OICA 4WEOA 1ZSNA 1WVGA 4KTTE 5KJCA 4DRYA 4HNHA 4J1QA 1QYCA 2I76A 2B69A 2BFOA 5B1YA 5G0TA 2JFGA 1XG5A 5IG2A 4R1SA 1A7KA 3PLRA 5F1PA 4OQZA 1DLIA 3FNGA 3HDYA 4IXWA 3COSA 2HCTA 3WLEA 1K89A 2C7GA 2YUTA 3B1KA 3I4CA 2IZZA 4TKMA 1H0KA 1I8TA 2AEMA 1XA0A 3GUYA 1LC3A 3PI7A 2VTEA 2I3GA 3JQ7A 2PH3A 1TEHA 4XZ3A 3DOCA 4R1NA 4DQUA 1K0UA 4XD2A 1ZSYA 2FY8A 4M86A 4FFMA 4W82A 4E32A 2V6BA 4RVUA 2E49A 4J2OA 3IMFA 4HKTA 1PJBA 3GHYA 1GCUA 4DQXA 3ZU4A 4YXFA 4D42A 1JN0A 1NR7A 2H63A 5FEUA 1V3TA 3E9NA 4JJIA 2X9VA 3TSCA 3QIVA 5B4VA 4QTZA 2Z95A 4A0SA 1E3WA 2TMDA 2VTDA 4BGIA 5L53A 1T1SA 3NUGA 2UAGA 5DULA 2IODA 3QVOA 2WYVA 2IXBA 1P77A 1DHRA 1VKOA 1E7QA 3DO5A 1EK5A 2GGSA 1ZEMA 4DC1A 4UEKA 2Y1OA 3B1FA 2CFCA 1D1TA 1JVSA 4RPGA 5CPFA 4J43A 3HG7A 4KUEA 1O6ZA 4IMPA 1KEVA 4WNIA 1J49A 3ADOA 3BMOB 3DMTA 4PCVA 3BHIA 3PIIA 5G4KA 5GMOA 5B4TA 4CMEA 1PZHA 2BHLA 4BL5A 4B3IA 3BTVA 5L4SA 2EKLA 4WNCA 2C2YA 2FP4A 5KKCA 1DFHA 4PG5A 3AUUA 4PG4A 1GYPA 1JLLA 3F47A 1NWHA 2XF8A 1P1IA 5IDXA 1MG0A 4CV2A 1RPNA 3FD8A 2NU9A 4Y8VA 1R4MA 4BNLA 4M1QA 1NXQA 3Q3CA 5CDGA 3OM9A 3Q2IA 4JBGA 3WIEA 4IDEA 2W2LA 4DPKA 1ML3A 2G5CA 3ZU5A 1EBUA 4H7PA 4UEJA 2BI7A 4NNJA 1BSVA 3S2EA 2NV6A 3NKLA 5COBA 4IMRA 5KWEA 1R0LA 5TC4A 5IF3A 4AJIA 2VNSA 5EESA 3U4HA 3DFUA 3N58A 2GZ1A 3JQBC 1DDOA 1PS8A 3KUXA 4A73A 5JAIA 3SC4A 3E9QA 2AW5A 4GAEA 4NBUA 1X1TA 2EW2A 3LK7A 3LF2A 2P9CA 1RM4A 3PPIA 4MVJP 2ZYDA 2D1YA 1C1XA 1SB9A 3F5QA 1XEAA 1QYWA 2C0CA 3GGGA 4MOWA 4CQMB 3KZVA 3QRWA 1H2BA 2EKQA 4B7UA 4XYEA 2RIRA 1QV6A 4B4WA 3AI1A 4EUHA 4XR9A 4D46A 4XYMA 3W6UA 3ZV3A 4J3FA 2D5CA 4PG6A 4TVOA 4BO0A 1U2GA 3PJFA 1F17A 2BGLA 2Q1SA 3C7CB 5C7LO 1BHSA 1Y8QA 3Q9NA 5JAZA 3Q9UA 1DIAA 3KVOA 5CDSA 1UXKA 4FIZA 1NAHA 3WGTA 3A1NA 2VWQA 4WLFA 4A7PA 5AVOA 2CVOA 4R1TA 2HJSA 1DSSG 1RM0A 4CUJA 3LT1A 5A05A 2VZ0A 3ZW8A 4BUCA 4FC6A 3B70A 3PZRA 5ER6A 3WR5A 3ZGYA 1P0FA 3BTSA 3K96A 1WXDA 3LSYA 2HQ1A 4IM7A 5LC1A 5TLSA 1GQYA 4ND4A 1K6XA 4WLNA 2NVUA 1S7CA 3WYEA 3E1KA 3D5QA 2PTGA 4GL4A 4CLOB 2QG4A 3AWDA 3GN2A 3RASA 1PL6A 2DTEA 2VHZA 1H93A 4YA6A 1KVSA 4IDAA 1DFGA 1N8KA 4GX1A 1ORRA 2C5AA 3WNVA 1UXHA 2E37A 2QRKA 3B6ZA 4GGOA 4M87A 4ZN6A 4AJNA 4QUKA 4B8ZA 5A3VA 3I6QA 1Y9EA 2WD7B 2CVZA 2PD6A 1KERA 3U49A 4CMGA 3NT2A 5DDIP 1CDOA 2EHDA 4D44A 1HE5A 1GY8A 3QVWA 3S55A 4L73A 4FGSA 3VKUA 2WE8A 2VUUA 3GDOA 4FOOA 3IKVA 1LU9A 2ZB3A 3ANMA 1ULSA 4JK3A 5A1TA 1OI7A 2YFQA 4WJZA 2DU8A 1IY8A 2IZ1A 3AUTA 5JMWA 2ZQZA 4E33A 1R4NA 3LLVA 2GO1A 4BO6A 1YDWA 1IULA 3PYXA 4K28A 1Q2XA 3RUHA 1Q7BA 3TJRA 2DBVO 1T2FA 5GZ3A 3FWZA 2JD0A 1LDBA 1I24A 2C82A 5ILGA 3OIDA 1Z6ZA 4KMSA 4MVJF 2J8ZA 4BV9A 3PFWO 4J4TA 4W99A 3ZWBA 1YQGA 1GCOA 4DTIA 2Y1FA 4R41A 4E30A 4BNUA 2HK9A 1ZK0A 2F1KA 3DTYA 1HDXA 4CMJA 1FDUA 5DZSA 1R0KA 3UXYA 4RVFA 3UOGA 4R3WA 4Y6SA 2PKRA 3VTZA 5IN5A 4CM9A 3EW7A 4L0QA 1B8VA 4UVDA 2EIHA 1SPXA 1ONOA 1QRRA 3L4SO 3OP4A 3DZGA 3ROMA 3VOSA 4EEZA 2B35A 3GH3A 4F46A 3EZYA 2NU6A 1LX6A 4JP3A 3U4IA 2X5OA 4YR9A 2EP7A 1X7DA 1HL3A 1LUAA 1J6UA 3AM4A 3I5MA 4J16A 1EVJA 3WXBA 5COAA 3QVXA 1KEUA 3WFJA 1X7GA 3OHSX 1GZ3A 1KVTA 3GY0A 2YQ4A 2QRLA 4G5HA 2X5JO 3OQ1A 3OMLA 2EV9A 5JCXA 1Q7GA 1HDYA 3TZQA 2HKIA 1WAMA 2VT3A 4E2WA 1Y1PA 4WPGA 2IEBA 2OP0A 4IQGA 1EE9A 4YJFA 4CLRA 3TL2A 1F8FA 4I9HA 1MFPA 4S3MA 3GQVA 3MOIA 3W4JA 2X86A 5TGDA 1SBYA 4XGNA 3DHYA 4QXMA 1M6HA 2BLLA 4RPJA 3WNQA 5HM8A 3UW3A 1YS4A 2Y99A 3OECA 5CDUA 2GERA 2PH5A 5HRUA 2GN8A 4CV1A 2GN9A 3QLJA 4RLSA 4YACA 1KOLA 5IZCA 2OUIA 1Z75A 2C07A 3NTRA 9LDBA 3VVCA 4ZGWA 2JJYA 1B3RA 1C0KA 1NM5A 2ILTA 3HN2A 4CM6A 3OIFA 1GPDG 3L07A 1K6JA 8ADHA 2PWZA 5TRTA 4GKVA 1DIRA 3EVTA 4XR4A 1NPYA 4E2ZA 5FI5A 4JXKA 3ZNOA 2O2YA 3ZNNA 4W7IA 4AJEA 2RH8A 1I32A 3PHJA 4EITA 3LDHA 5DNAA 1Y8RA 4XYLA 4KTVE 2J5RA 4ALMA 3QW2A 3FRJA 2E82A 1W0CA 5JCJA 4BNVA 4IINA 3INTA 3WJAA 4MVJD 1XGKA 2QZ9A 2VOJA 5IZ4A 3NJ8A 3MJVA 4LGVA 4NU5A 1I33A 1IE3A 3F3SA 5A06A 1ZUD1 3GMSA 3SEFA 3TZHA 4E13A 4EZBA 4AJJA 2E6UX 3LU1A 2NVWA 5CAEA 1E5QA 4TQGA 1T26A 2OMEA 5KVSA 1P0CA 3BMOA 3LLSA 2EXXA 5CG2A 3DBHA 3SJUA 4TZKA 2DC1A 4TVBA 3ZWAA 4D45A 1UDCA 4CR6A 4QT0A 3KXDA 3GEGA 4IY1A 3GGOA 1BWSA 2I5PO 2Y1DA 1QR6A 4J7CA 5ILOA 2UUPA 4P38A 3W6ZA 1O8CA 5BSHA 2QW8A 2Q2VA 1VM6A 4CUZA 4CV0A 1E3IA 1U3WA 1IPEA 4K6CA 1CF2O 5K0ZA 3GEDA 5KJEA 4GI2A 1LLQA 4YJGB 5FFFA 4RZHA 2BD0A 3WGYA 1H6BA 3R3JA 1LJ8A 3KO8A 1Y7TA 4PGFA 3BMNB 3F4LA 1PS9A 3AY7A 2NTJA 4RPLA 3G17A 2X22A 2VRCD 3NTQA 1DRUA 1N2SA 1MC4A 3LC2O 1PEDA 4I8XA 2AE1A 4BO9A 3LF1A 1GYRA 2DTDA 4XQ9A 4RF2A 2AQ8A 1PWXA 1NFRA 1XQ6A 4GQAA 5KVQA 3MEQA 1SEPA 4L76A 3I9NA 2J6IA 2VYVA 3PWSA 4R9SA 1JAXA 2C5EA 5G4KB 2BELA 4UUNA 5GZ1A 1I3LA 1P45A 4XRRA 1HDCA 3U09A 2OO5A 1PJTA 4GGPA 4NJOA 4CQMA 2H1SA 4U5QA 3WJ7A 1KEPA 3WOHA 5DBGA 1C0LA 4FBGA 2H9IA 3GVIA 4ZU3A 1M66A 1SAYA 2IRWA 1Y9AA 3EGOA 4DUPA 2H5LA 1DC6A 3T7EA 2A9FA 4CLEA 2UDPA 2G76A 4KDFA 4YCAA 5ITWA 2NWQA 1NX6A 2NU7A 4UVEA 2FHSA 3GAFA 4FGWA 1ZBQA 1IZ9A 4M55A 5T6BA 1B0AA 4TZTA 3L9WA 4ZQEA 3VPFA 4CM1A 1AN9A 3M2TA 4U6QA 1WLYA 1Z82A 4Y98A 3PQEA 3Q11A 5JO9A 3MTGA 3NJ4A 5K6AC 2I67A 1UDBA 5CEEA 1Y81A
chains in the Genus database with same CATH superfamily
1R27A 4L08A 2RKBA 1PWZA 3L1IA 1BRTA 2Q7OE 1X80A 4H7IA 4RM2A 1M6WA 1PGQA 2CD9A 4HAWA 1E6MA 1DELA 3LM8A 3W2FA 4YJHA 1DC7A 1EFKA 4G67A 1ORIA 1V37A 2QHXA 3PHBE 1YOVA 3P0IA 1J70A 2O3SA 4S04A 1IVYA 2QN9A 1CC1S 2OKCA 3DV9A 4E88A 2C5LA 3GLTA 5FA8A 1QGUB 4XVRA 4P92A 2PR7A 3SC6A 1R0YA 4WZBA 4PN3A 4NBSA 3OQNA 2W4QA 3LWBA 1CVRA 4ZO4A 2OPBA 2D1TA 4D80A 2EDAA 2R1VA 3ZH2A 1E2QA 2JBWA 1X7WA 2J30A 3D5TA 3SKXA 2APJA 1BTOA 2IQ5A 2HLDD 1FDIA 4P3OA 3R75A 3W34A 1PX2A 1H1LB 2G1UA 1T6ZA 1VPEA 2RDMA 3K6RA 3RBVA 4BX9A 2OXFA 3I2KA 4WXHA 2AQHA 3V1UA 4AQDA 2FRDC 4IHJB 3BILA 4NBNA 4RH3A 4KMMA 3RAPR 5A9TA 5CFRA 3K2IA 4MW9A 1UMDA 1U94A 4ZVOA 1OWPA 4B80A 3ZIDA 3CEMA 1T4DA 1MJFA 5FJJA 5AJZA 5JPCA 3Q9LA 2BFAA 2FWMX 4IZIA 1BQ3A 4MUBA 4BFSA 2WVJA 1M2GA 1OILA 1E6EA 4IXDA 2IX9A 1JRLA 5DGIA 1LXCA 1UFOA 2X5XA 2NXEA 4BJHB 4M46A 1CQWA 1UT6A 2Y2UA 2O8VA 4H7KA 4MRPA 4GUDA 4EHJA 1GILA 3TI7A 2PT6A 4PHCA 2NVUB 4YT4A 1VG8A 1PW7A 3IEVA 4FDTA 3TW8A 1HX7A 1CD5A 2AXQA 1AZTA 1G3MA 3EW9A 5FR1A 1MCZA 4X3CA 2VWHA 1IXYA 3MN1A 1VJRA 2X9LA 1ZKMA 4BJ6A 1CFZA 1VLHA 2FZWA 1ESNA 2BWJA 3DWFA 4ENWA 4UFNA 1T9AA 2B3TA 2LGJA 2RB4A 2ZETA 2VDJA 1GRQA 4P98A 5BV8A 4CT4B 3K7EA 1E4VA 1SKQA 2FVXA 3O1HB 3WDLA 5I9NA 5AW6A 1DAMA 3KKZA 4E4RA 4FNMA 4EMSA 2XUZA 1BA3A 2H4FA 5EQFA 1CIVA 2VI5A 2HXGA 4M1ZA 3LUKA 3PC7A 4A2WA 1AV7A 4B76A 1G2QA 2YOGA 3EVZA 3O84A 4PN7A 5LLDA 1N3IA 3MAJA 5J9FA 3DBLA 1N9KA 3P9NA 1SUBA 3TEFA 5G0UA 1WBBA 1TLTA 3UPDA 2GXUA 2WB4A 1U7UA 3AR6A 4NYIQ 3VR6A 1I5RA 1M2HA 4OG2A 1K7EB 4Z0HO 3KKQA 3A7DA 2HNKA 3BJZA 1N3YA 4RJIA 3VU3A 5DNYB 2FPXA 4FOLA 5JDIA 3L06A 2RMKA 5IULC 2QJWA 5TIIA 5TQ2B 4K5QA 2X8JA 5AHRA 4ZQFA 5GPBA 4PQEA 4COOA 5EE9A 3HKEA 2MSNA 1C1DB 2GPWA 1M1YB 2GMWA 2R4UA 2P6OA 2RGXA 1NBME 3G0DA 4TWZA 5FPKA 5INTA 2CXHA 3D6VA 1C2TA 3K0BA 2O8BA 1SQSA 1GADO 1NXPA 2JB9A 5ALIA 4BTVA 4IQFA 3CEPB 4BVFA 1SCJA 5KOHA 1M8JA 1G0OA 1K8QA 2AEJA 3CR8A 1N0HA 3ANSA 4MV7A 3ZV5A 2QR3A 3DAOA 4HVCA 3WRYC 1Z4PX 1EK6A 3D0RA 3ZY4A 1E7YA 3A1DA 2H16A 3G7NA 2YDXA 3IVGA 5DPMA 1E2JA 3RREA 2X6RA 4D4HA 3AB3A 4CQLA 2UUCB 1CUJA 4KXQA 3TQHA 2XKJE 1CJUC 3EH1A 3DDSA 5JS1A 3MA0A 2O8NA 4U3JB 5KJ6A 4TMXA 1ZD3A 3D6NB 4BX2A 1P1RA 1GLNA 3HCAA 2J48A 3EPPA 4TM7A 1WL8A 4HUJA 3IP3A 2ZS7A 1E89A 1PYDA 3K20A 4US0R 5A9SA 5KSWB 5BRNA 1G291 1N1GA 2HREA 4H7DA 3LE8A 1IC6A 4EBFA 5A2QA 2BGGA 4FZVA 1JI3A 1ADGA 1GG9A 3NBMA 4AKSA 4CE6A 13PKA 2AI3A 4TGLA 3ET4A 4LE0A 1R16A 4G26A 1GVNB 3FVVA 1DV1A 3CLHA 3E5HA 3KKOA 4ZEVA 5A5VA 3ZDBA 4YFYA 1FP7A 2H31A 5ALGA 3UEOA 4UULA 2JIQA 2Q5IA 3EWSA 3DV2A 1Y5NA 1KS2A 2HDHA 2JRLA 4EO7A 4MA0A 2IEDA 3U4DA 5DNVA 4ER0A 2FFJA 4ZANA 5KCZA 1GAQA 4MWBA 2AKAB 1BO6A 3NEAA 3PHLA 3T35A 4GZLA 5BSFA 2E5LB 5AYVA 2CJPA 4BMYA 2RK3A 5JAMA 3MRSA 3OKFA 4Q7KA 1IHXA 2FYTA 5AH0A 5D7BA 3TZKA 4A10A 4E1VA 3KDAA 4HEQA 3UG7A 2GUGA 1NHGA 3EIXA 4DMUB 5I4IA 1XZLA 1ZHFA 3IPAA 2HU7A 1QIKA 2FF5A 1D0SA 4FDAA 2PX4A 3PQFA 2Y27A 4MRSA 4YRBA 3RWBA 3V4ZA 5BRJA 4WXYB 3F5DA 4CM7A 1S2NA 4GOXA 4D4LA 4DIUA 1WEKA 1KH3A 1F4PA 3OA0A 3N28A 3LFHA 4ISBA 2OWDA 1KBZA 3AHIA 1SCIA 4OATA 3WQQA 4WJLA 4AN0A 2CJWA 4WY8A 4EHDA 3LQFA 4HAZA 1H22A 4RM3A 3ZNQA 4PINA 4WMLA 2GYWA 4EPWA 1YQTA 1TKCA 4GBED 1QK4A 4PAQA 3PP8A 3VZBA 1FX0A 1KEWA 1LLDA 3GFOA 1KI3A 3W2EA 1A4UA 3CG4A 1KYYA 3G5AA 1WQ4A 3Q85A 2R7LA 4LDPA 5HRAA 2FN3A 1DDIA 4FFSA 2PWBA 3WIOA 3CR7A 3GJ6A 1G19A 5L3SB 1IN4A 1CDDA 4DLXA 2WA1A 4LKRA 5BYBA 1A88A 1Y8RB 4Q4AB 2R3SA 5CX1A 5FX2A 5GV8A 1DCMA 3LKZA 3FDZA 4YJGA 4YLGA 3ZE1B 3CHYA 3DZBA 2J5XA 2Q6TA 4TWJA 2QTWB 2HR1A 1M1UA 4LDQA 1JUDA 5J4KA 1QJCA 5AXAA 4EHBA 1JX6A 3AI3A 2ZIWB 1TJNA 1JU4A 1UBCA 1LY1A 4NPCA 3SY8A 5F7JA 4PLZA 3ER9A 2GCEA 4QT4A 1C8KA 4WFJA 1YZFA 5JARA 3EUWA 2O3UA 4QBIA 1XCJA 1XVVA 1BXGA 3G2PA 2LE0A 4BKUA 3TIFA 3BHJA 1PIWA 4F4UA 1C1YA 1P80A 4RVOA 5CR9A 1S01A 3DBHB 5JRJA 2FB9A 3H5AA 4IO1A 4EGFA 2OD9A 3KXIA 4I1SA 3JATA 3ASUA 2WWVD 5TT0A 2VS1A 3QEOA 1K8XB 3CE9A 1XJ5A 5BQPA 3BZUA 5IM4A 1T24A 4R8KA 5KQLA 4DLSA 2FHPA 2O2HA 3OJCA 1THZA 5G1NA 4BMDA 1CQXA 1R9MA 1ZUNB 3SFVA 5CDYA 5AMXA 1PF7E 4I4TA 3FCXA 1U5BB 3QW4B 3M1AA 4BXOA 3U4QB 4BJ3A 3GP3A 4HLDA 2AJLI 3GLHE 2F9LA 1XZPA 2YIMA 2XW6A 2FEXA 1EWRA 3LGSA 3GNSA 4D43A 5ALVA 3F6YA 4K8OA 2PK3A 4V2IA 2OO7A 1NI4B 5C1OA 4OHVA 1EXDA 3RS2A 4JU8A 2HMYB 2B99A 3TLKA 4P32A 1O5OA 3I3SR 3O1IC 2WU3A 1WZCA 5DYWA 4B17A 3E3NA 3OIGA 4KDCA 3IDAA 4YAKA 1K6EA 5LZ9A 1FYWA 2C54A 1KC1A 4F93B 1R5BA 4LOAA 1QNLA 4E5NA 1T8SA 1AT1A 3N8NA 1X74A 1C3OB 2DHQA 2IH5A 1QKIA 1QS0A 1EZ4A 2EEZA 2HLNA 4FR5A 3ZCRA 2ORED 1GGJA 1QGUA 1PI3A 4JYCA 3AXTA 4R7GA 3B85A 3M81A 4FFLA 1JJVA 3I5UA 2JAQA 1UAYA 4AY6A 4ALLA 3IAS6 1MO2A 3RAGA 4ZKDA 1VC2A 4OVKA 4QSHA 5U1PA 1C9DB 3GPCA 1ZNZA 1S5PA 4HJRA 2G1JA 5JE8A 1S4QA 1NMYA 1GUYA 1LS6A 1P17A 1OTHA 2GD0A 1QFZA 1XEWX 4YVFA 3GGDA 3ROEA 3SYRA 1H1LA 3HCWA 3C3XA 4NBVA 3LH5A 1KJWA 4QOIA 4HLQB 4ONEA 1CJBA 3HB5X 2TMGA 3LWNA 2QTCA 4BZXA 4F2HA 2OY0A 3IE1A 1I7QB 2H11A 2A5JA 1U7DA 1I3OA 2GRAA 3E4CA 4OXRA 4ER3A 1QIFA 5IJ0A 3G2NA 1NURA 1U8ZA 3LCCA 5C3UA 1GCIA 2G3YA 5EE5B 4BC1A 1E4YA 1HLPA 5G41A 1N77A 1XF1A 4H4DA 1E9EA 4FEEA 4UAJA 4N5NA 3K8QA 3RVKA 4M9RA 1HSZA 2F43A 1PDVA 3P9KA 4GC5A 2ZOSA 4G3XA 3CLKA 1GA1A 2GB4A 2IV7A 3FNEA 4ALKA 5LWHA 4HLNA 2P0AA 1O08A 3TD6A 5LFAA 1EDOA 3F6EX 3ZWNA 2I2BA 3BICA 5FBQB 4Z49A 3FPAA 1C50A 1JXOA 3QJ5A 1LRJA 1DAPA 3RC1A 3E9ZA 2HBRA 1T9GR 3R0QA 1S9DA 1VA4A 2PQ2A 3ORYA 1M8PA 4YP9A 1PT9A 3OEWA 3QFHA 5KYYB 5GV7A 2P9JA 3AFHA 1CU1A 4E70A 2EJUA 3K94A 4M0KA 4R0NA 1W29A 4JROA 3GYGA 1ZJWA 2QM8A 1EIWA 3CN9A 4F21A 2VUIB 1Q20A 3GMDA 4O1HA 1HORA 4P4SA 5DBEX 4YMUA 3QVJA 1RRVA 1LLCA 2C4KA 5IEBA 1PJZA 5JXWA 3GLIB 5HVNA 1YVPA 3H2SA 3NS7A 3N0WA 4KXUA 3W5JA 1AZLA 1FFEA 1TXGA 2AOTA 2R7MA 1TTHA 2WUGA 3MCTA 2XWJI 3MTDA 2JFUA 4B6PA 1XHEA 4IUCS 4XSVA 1ZM4A 2VSNA 3FVTA 3PXBA 4H1HA 1A5AB 3ZWKA 5I7WA 5KOYA 3RAEC 4B3SB 2AI2A 1BFKA 3U48A 3HJGA 3DVSX 2NQ8A 4URWR 4HNVA 3THSA 3AW8A 3RF7A 4KPYA 4KW7A 2YXNA 4BO5A 1Q3HA 1V39A 2ID7A 2EWMA 4KFSA 1YZUA 3AY6A 1N2XA 5IFKA 4WESA 3BHMA 5C7YA 1W88B 1KO7A 2IPXA 4H3HB 5C81A 5CX4A 2PGJA 1TO1E 1A27A 5CFNA 4DBLC 2OTCA 2PYIA 1U0GA 4MIOA 2DBQA 1C1DA 1M67A 1LVHA 1S2MA 4J0IA 5FD8A 3U4CA 2YBDA 2CXNA 3NOQA 2ZJ8A 4NYMQ 4ZO9A 3H3JA 2P4HX 2RIPA 4O02B 1EUQA 2W2LD 2BMEA 1P1FA 3UHPA 3BL8A 1ZJ6A 3HVUA 1NX9A 1XHFA 4GI1A 4O4IA 4HVTA 1VSBA 1OBVA 1MAVA 2QG9A 3HBAA 5KYVA 5E4JA 4NULA 3LA8A 2RHMA 3O7MA 3VR5D 5KTPA 3V4RA 1USUA 5D00A 3DMFA 1T9BA 4QTTB 3FWNA 4OI0A 2AFVA 5D86A 1GITA 3A2NA 3QLEA 3V7UA 1PVVA 2ZM5A 4RA6B 1TTTA 4LXTA 2INGX 3ZWPA 3I9LA 5JXGA 4ZOLB 1DAEA 1M5TA 1U5AA 1SC1A 2ZBRA 3E2PA 1UOEA 4N0DA 1V48A 5F35A 2FR8C 5JU6A 1PWYE 2F3RA 2NNWB 1XDUA 1D8AA 1Z34A 2XQVA 2ZSIA 3VJMA 4BFXA 1CQIB 4J6FA 4YDQA 1XZEA 2PUAA 5G1OA 4Y2XA 4KR6A 4QRIA 3RHTA 3GAZA 2GVNA 4PZUA 3SM3A 1N7GA 4IV8A 3GPLA 2BGWA 1VMDA 3UAYA 1Y7IA 4CMCA 2PSSA 3D2LA 3GA7A 1BDJA 1IY2A 1GU0A 1T4BA 2IY7A 1T6BY 4F3YA 3AL0C 4GLOA 4PYJA 4BVEA 4WZAA 1C0IA 4PXYA 5EUCA 3UTCA 1HKUA 4NECA 2Q1TA 1OFGA 2A4KA 2NPIA 5IEJA 1OYOA 4DJEC 2UYHA 4DCOA 5KDLA 4RTRA 1UXJA 3NT5A 3ZGLA 1G63A 4ZCSA 4D97A 2SCUA 2WJ4A 2Q8NA 4DV4B 1E0KA 1J2UA 3JQ6A 2QTGA 1KSJA 2ZI7A 5FLKA 5G3YA 2JPDA 1LDNA 4ETIA 3RARA 1PR4A 3G9ZA 3QU2A 1PCXA 2QBYB 3GJQA 5ICCA 2ZRGA 2GETA 2YWDA 3N2YA 2JA1A 3L77A 4NCAA 1OKKD 1GG5A 3TVTA 3FTNA 4MJXA 1KI2A 3QYFA 4CM8B 5B3KA 1PT6A 4P0PB 4QASA 2QAJA 3PPYA 2OO3A 5DW0A 5M34A 3URKA 4N12A 4RTNA 2QVLA 1QQTA 2OQIA 1CUCA 4O08A 4UZFA 2FOIA 1UUFA 5JJKA 1H8ED 4ODIA 4LS3A 5C32A 3QU7A 3GRZA 1IN8A 3KB2A 1P0MA 1WPGA 2GHQA 1JU9A 4JCOA 4LE2A 4LZNA 1JG4A 4M21A 4CLDA 1G98A 1OXSC 4EL0A 4EG1A 4FYKA 3O8NA 1U3TA 3N7UA 2PA3A 2ZWPA 2V8OA 1MOPA 2IHTA 2V7QA 2ZRCA 4H59A 4XDZA 5DLQC 4YHHB 3QWAA 5F73A 3BGSA 1V2HE 1YQQA 4OLJA 3UH1A 4ZA2A 1CUAA 2QX7A 1SC4A 3GG9A 4MRRA 4DSUA 1JALA 3D54D 4FT2A 4ZV7A 4BMSA 5A3QA 3IE0A 1G2IA 2FGKA 4JWKA 5EPEA 3N2GA 3BDAA 5IUJC 4DUZB 2R47A 4FYPA 3L1KA 1WF6A 4M0EA 4YWHA 3SQXA 2WLSA 3FGPA 2ZTUA 3QPDA 4QREA 5AM4A 2Q50A 6Q21A 2AD1A 3KZ1E 3THRA 5BV0A 1C7FA 1YCDA 4ESEA 3KEFA 3R3HA 1SM4A 2W6OA 2YFYA 3P20A 5EXPA 1E99A 3CTMA 1X0XA 2GZ2A 3Q88A 2JLYA 1U8FO 3OEHD 4JI2B 3OX3A 2X8BA 3ZGXA 1QGDA 5I7UA 4MDYA 1AQJA 1PQWA 3I04A 4KGVA 4XSHA 1G8PA 2CMDA 1ZIDA 3EVCA 4YLYA 1EHYA 4E09A 3UBTA 3OE7A 3V3TA 4QTYA 1KEKA 1MZVA 4AW9A 2HLHA 4GNRA 5J4YA 4N49A 2Q99A 3NHSA 1HT3A 2ENUA 1WE2A 2A5FA 3DBRB 4QOJA 3FUUA 2C4WA 1FP2A 2OA0A 1U2TA 2UZ1A 4ZEWA 2YXDA 1KPHA 5BNFA 1VP3A 3E1SA 4FFRA 1NRJB 4L7VA 3N05A 1VE3A 1KNQA 1NI4A 2EBUA 3R7LA 5AI0A 3TYXA 3CZCA 3ZWVA 1NVMB 3C7AA 1VMKA 1RYYA 4OKSA 2NZ2A 4X54A 1FVOA 1UDWA 2CL7X 2EAUA 2X19A 1V5GA 2BJHA 2H2GA 4GX0A 3MINA 3SHTA 1L4FA 1N75A 4DCSA 3OFNA 3TRKA 3AFIA 4KQ9A 1N7IA 5DTIA 1DNPA 1JDSA 1NFFA 4ZV9A 3RH0A 3VX4A 1SXIA 3ZE6A 2WNSA 2P5TB 1JIUA 1ZM3A 2I7TA 3AHCA 3CMMA 4FZ3A 2YQ5A 5DRTA 3TRIA 1XMVA 1QG4A 4GM0A 4AZWA 3AYZB 1SXJA 5EKTA 3BD7A 1DOAA 3FOFC 3EHEA 1PTKA 3RD5A 3O8RA 3FFAA 1KYQA 4HAYA 4X5OA 4AURA 4RD1A 4P7KA 4BGEA 4L2IB 2CZCA 4R16A 5WRFA 4MTCA 4ZYZA 1QHSA 2FDXA 2V0CA 4QULA 2F7SA 4X20A 4OSEA 1ID8A 2QRGA 3EQ7A 5DHRA 1XZFA 2Q9BA 2JVIA 3SQWA 2D5LA 1XTVA 2J0QA 3BL5A 5I7OA 3HKCA 5B7NA 2ID8A 3FR7A 3JZFA 4N40A 3JRNA 3IHTA 1M73E 4JI3B 1V8BA 4F9TA 1OOEA 3RC9A 4ILEA 3TCXB 4C1BA 2IF2A 2B1JA 4XEHA 4BUJA 4DM3A 3AR9A 3JD0A 1KY5A 1Y9JA 1CSEE 5C8YA 4KAXA 1YS2X 2XUIA 1NN0A 1RKQA 4UUPA 1PR2A 3BQ9A 2Z1NA 1FC0A 1RLIA 3C5VA 3ETDA 2C3YA 4PC7A 3H9QA 1HYGA 1YZGA 1P9LA 3IT1A 5B57C 3WSWA 4JBNA 3FMGA 3ZDDA 1VJ1A 2NQTA 3NT4A 4FN4A 3V7NA 3KJEA 1DAKA 2VJDA 4WOKA 1NJSA 4FBMA 3QHQA 5ISMA 1MABB 4Q7EA 5EAIA 5JEEA 4ND6A 2VZEA 1YRWA 5DV9A 4IIUA 5LMCA 1S3GA 2GJ4A 1J06A 3LW7A 1YO6A 1VP9A 1PDWA 1YAHA 3E7WA 3CS3A 2DB3A 3N74A 4NIMA 2DWCA 4WAUA 3F2IA 2XSZD 4RLQA 5KYYA 3HK2A 1S1MA 4ARAA 1VKNA 2P2CA 4C0KA 4YUYA 4K9RA 5F1OA 4RK6A 4OHOA 4D79A 4NMWA 1CJTC 1GTZA 4IFIA 4YGYA 4COKA 4LOJA 1O97D 2NUPA 2ZSEA 4XX1A 1BKSB 4A2QA 3U7FB 3DZKA 3IIMA 5A5FA 2AYYA 3TTXA 3GLIA 1JDJA 1Y4SA 1XYGA 5ICSA 1RFGE 2ZPAA 3OZFA 2ORIA 3GFGA 1IDOA 3TW6A 4XVQA 7AT1A 2GNAA 2IEZA 2B94A 4XM1A 1UOPA 3NORA 2B5VA 2GZHA 3ABSB 1TU3A 2ZWVA 3QMPA 1MGPA 3R4CA 5ALKA 3S2IA 1TF5A 3PGA1 4U8GA 2OYCA 1KO8A 2P9QA 3CPSA 3IPXA 4B2IA 5JBQA 3FWKA 1ZK2A 3PUJA 1ECGA 1YE8A 2PGOA 1RYBA 4PAOA 2P6RA 3RS9A 4UTXA 4BBZA 4BO1A 3FPEA 1RLOA 3WJ1A 3L6UA 2VNJA 4IIFA 4MWGA 1GT91 1CYEA 3BWBA 3NIDB 4GBMA 1FSGA 2J3MA 1KGDA 4AUNA 5AVXA 3A36A 1M6EX 2HT6A 1E7SA 3O83A 2W6MA 3ED1A 4LC1A 5KWVA 4WLVA 2PQ6A 3TZLA 5B37A 1AK9A 1T4CB 2XX3A 5BV7A 2AZ4A 2RH5A 2R8BA 2ZJ3A 4LHZA 5DWDA 3PHCA 4EA8A 4CKWB 1U1IA 4DCTA 1ILEA 1MTZA 1GPUA 1LSJA 2NTVA 3NBQA 4YV7A 4BO8A 5DCWA 4K9DA 2J5QA 4N54A 1UAAA 4UHDA 2C8VA 4TRRA 3QE2A 1UBNA 2G28A 4DA6A 2ODPA 5BSTA 2GKOA 3T1OA 3GOHA 4DARA 3ZWQA 4YRIA 5KHAA 2BF7A 1VPLA 4BN4A 4CBVA 1TK9A 4F1WA 1S8FA 3QKUA 5J1SB 4OAQA 3L7LA 3RHSA 1JW9B 4Q12A 4Y9UA 3AR8A 4U0KA 5JSFA 4PF1A 1JBKA 3PT5A 3NUZA 2PMKA 4M36A 4MAFA 2G17A 3CXRA 1H6AA 5ADHA 5ED4A 1ZR2A 4IDNA 3H8WA 1CQIA 2V8BA 3PS9A 4XPIA 2I3DA 1K9SA 2AX4A 1GGMA 1UEJA 4RKYA 2AE2A 3ELDA 3QPUA 1NBMD 4L1KA 2CE7A 5HFNA 4D0RA 4G1EB 4CQMD 1FLAA 3SYTA 3GP8A 2O8CA 8GPBA 2X8WA 4LZJA 4R1PA 1GTRA 4E7OA 1Z7WA 1VBFA 2C78A 4L7QA 4Q6WA 5G02A 3T7CA 1WSBA 2HRZA 2VCHA 3QLVC 4HZIA 4AZ3B 2BMWA 4CEHB 1ZRSA 5DNUA 4BZZA 3Q7EA 2CSUA 4LV5B 4V0RA 2Y67A 1ECCA 2PUHA 1IHDA 5A71A 5TSDA 3NEYA 4POOA 4CMIB 3ETNA 4RJLA 5LB2A 1SUCA 3MJSA 3ZS9A 4F4JA 4RF5A 4WOCA 2C9DA 2ZSKA 1BKDR 3EEBA 3IULA 2O4CA 1IMOA 2YTZA 2XTJA 4UPEA 1O89A 3PQ2A 1HGXA 2VDQB 2WKWA 2FPUA 4NCKA 3U7QB 1ZESA 2HHJA 1C30B 2P77A 1VCMA 1E62A 3FMVA 3IO5A 1X7YA 1M0TA 1B2LA 2ZDHA 3CPJB 1FP1D 3MWYW 1A82A 3OE4A 4JT4A 4KL8S 3W4IA 2VZ8A 3SBOA 3DL0A 3KQWA 1Q1NA 1SCDA 4TS1A 4XQGA 4UU1A 4QXQA 1KRWA 1E4EB 2NYVA 2JLUA 4CEIB 1ZCBA 2LRHA 5LVAA 3GRPA 5AOAA 5HMMA 3HVRA 4FOPA 1QVRA 4NOJA 1UADA 5CLHA 2GK4A 4H0CA 4EHAA 1GRNA 1TZJA 1D4AA 3SZRA 3CRW1 1D2GA 1P4GA 1YZLA 2WF9A 4L9RA 4J4HA 1I5EA 1Y5RA 4LYGA 4UVHA 4W9RA 5IKMA 4L4XA 4NHOA 5DSZA 3WGGA 4LNHA 2W4IA 4NYJR 1TM5E 1YWGO 3MS2A 1BXRB 1TQ2A 4D6YA 1IZYA 1S8NA 2H4ZA 5JSYA 2QSUA 4QO7A 4BNMA 2O0LA 1PJ3A 4GX5A 4UPDA 4QDXA 3W5SA 1CQJB 4EFMA 3L7BA 4IDCA 1M7HA 3GPDG 4KU4A 3TRFA 4KVZA 1D1QA 2ODNA 3PXGA 2BFBB 4TSKA 2HA6A 5FB3A 2YJ5A 4JGBA 1Z22A 3UATA 2KPOA 3KAJA 4CKBB 4CR8A 2VBIA 4ZOBA 4C7VA 5IC6A 5F4BA 5LWQA 1YHNA 2CNKA 1KQ3A 2CVHA 3AIOA 5ESRA 5ARCA 3SOPA 2FN4A 4GKJB 1J23A 4MUFA 5FQOA 3L4EA 3I92A 4ID3A 4UW9A 1W49A 3OIUA 3H4IA 3IP5A 3QLUA 3EY4A 1HT0A 2Z3ZA 1M2OB 4DR7B 1XT6A 1E6CA 2R68A 1T2DA 4BAZA 3UB4A 4XIFA 5BW5A 3DKIA 2I2WA 3HCPA 4C7JA 4X1KA 4JC5A 4BO7A 1TB4A 4B6QA 2G80A 2WWYA 2HOQA 1EYZA 3CW8X 2GPSA 2HMVA 1PVOA 2I6UA 1U6JA 2IU4A 3CZAA 3NDJA 3OOJA 4QPJC 1YFJA 1PEAA 4X6XA 2GZSA 3WMEA 2OB1A 1JEQB 4I81A 3R5SA 1XMPA 5A1JA 3ONFA 3H6GA 3AEUB 3DTVB 5U9CA 1XL0A 4QWMA 5KU1A 2PD3A 4G5GA 2GPNA 4NJMB 4BATA 1TVEA 4DV5B 5KVVA 3V42A 2RJNA 4BVAA 2QN3A 2XCTB 3EA0A 1GSAA 2JFNA 1DIHA 3UA3A 1NXVA 2ZT8A 1SQ0A 1UJ6A 3KSRA 3NHPA 5CT6A 4BB5A 5CDFE 2AB0A 3CY6A 1MFZA 4H6WA 4KOAA 4IIYA 1SUDA 3L6OO 4P22A 8ATCA 4IGFA 1I4WA 2X14A 3VU9B 2FPLA 2Q2WA 2X9QA 5EFOA 1Z25A 1A9OA 1CP2A 1MB0A 1RIIA 3A04A 2W00A 2EQAA 3SEZA 1KDZA 3O8CA 1AUVA 5GJVC 1WABA 3V80A 4C06A 5LNK1 1N1DA 1XTZA 3ZK8A 1V5WA 2DT8A 3S4YA 5DCLA 2IXGA 4M1EA 3FFWA 3I12A 1LQUA 1OWNA 2HO5A 5JW6A 2QZZA 2E4AA 1GD1O 2PM8A 2WDZA 1CS4C 1X8XA 2ET6A 1K5GA 1YR6A 2H57A 2QRZA 3AGQA 3DAPA 5AVZA 2WG1A 1Y37A 3EXIA 4RELA 4L2IA 1HETA 3REFA 1I4LD 1RT9A 1IZ8A 1U99A 5LP6C 4CGYA 1Q83A 3PFHA 3GFPA 3GEMA 3NXKA 1KO1A 1P61B 3C6ZA 1SXQA 4ARZB 1E1LA 1G41A 4LCEA 1V35A 3BSSA 3CEHA 3I09A 4H6XA 5G2OA 3ZCQA 1Z4NA 2EJVA 1DFIA 4HQLA 2CNWA 3D6FA 5JS2A 1AA6A 4M98A 5K8JB 2XB2A 3WAKA 1G4HA 1E58A 2EJCA 4HUQB 2OO5C 3TR6A 3X1KA 2FDCA 1LF5A 2QE6A 5IVKA 1GZ5A 4DSTA 2X0DA 4URUR 4BNYA 4INJA 2H6EA 4LXXA 4JLDA 2HUNA 1MLDA 1IJBA 3TKLA 5HTOA 3FLEA 1PGNA 4JOQA 1H9CA 4KWHA 3OOHA 1CX9B 3LBAA 2O14A 3H6HA 4I08A 4BKQA 2AOVA 2WTUA 4BLTA 1H4VB 3WLRA 2YZKA 4BNGA 2IYPA 1K27A 2VP5A 3L7YA 4XW2A 4DMCA 3GA0A 1W48A 3WFIA 1Q0QA 1IM5A 2HZBA 4MUIA 3TF5A 3ZE8A 3MXOA 1PZNA 2KWIA 2ESRA 2OV6A 1LQTA 3P0EA 5BOVA 3K9NA 1B14A 1B8PA 1TIPA 2QMYA 4GSKA 5JPIA 2UZ4A 1T5IA 1OZHA 3HVHA 2HQBA 3DVRX 1A7UA 1HFWA 2Z56A 4IX9A 1UBOS 4V0ME 3WGLA 1F4VA 2Q3BA 1BDMA 2N1MA 2QX6A 4MV3A 5CEFA 1S3IA 1XXHE 2ZB8A 3SP1A 4CCAA 4ND1A 3PQDA 4QNRA 3THWB 2CZGA 4KHZA 4WCVA 3K0HA 3WDKA 2JLZA 4KYIB 4F12A 1FZTA 1DI0A 2RAVA 1T9GS 4DMKA 1P2FA 3CEJA 1CEQA 3QTTA 3STHA 5LMNB 3CW9A 5HK9A 2QUJA 5F9MA 3IBGA 2XT0A 4Z4EA 4Q1FA 3JYNA 1R50A 3GRKA 3LQQA 4RXUA 1NOIA 4EB8A 3WL3A 3GJYA 3AFMA 4RLFA 5EP1A 1AX9A 5BR1A 3H04A 4JJEA 1ZN7A 2ZUBA 3G13A 1VHJA 2BEVA 3H1EA 3K0KA 2EX0A 4X93A 4PXAA 4ABTA 1MO4A 3DMHA 5DWQA 3RTBA 5L6LB 1HBJA 2GR9A 3QKSB 2IS4A 4RESA 5BUSA 1SKYE 2OB2A 4A16A 3VR4D 3K9FC 5IVPA 3OD1A 1USVA 4I5IA 4OIFA 4PNZA 4R5MA 4X9XA 4DXDA 5LUAA 1P1JA 2R6CA 4MUKA 3E8XA 3WK4A 1E1YA 1I7PA 1KI4A 4H6VA 2WWGA 2DWUA 1DIOB 4DCMA 4LXQA 1D2MA 2I9PA 1MHPA 2NO6A 1W59A 4MW5A 3AIMA 2YS6A 3GU3A 2VWGA 5ALYA 4Q21A 1JHZA 3TD9A 3T8YA 2RG1A 1NQUA 2R5WA 1W8IA 4ME6A 1NLYA 3CJRA 3FGZA 3LBHA 3RVJA 3P26A 1T4CA 2PFGA 3KUUA 4Q4CA 1GRCA 4BFVA 3E27A 1QP8A 4CKWA 1B6GA 1U2DA 4ZTUB 1G7TA 5GINE 3N70A 2V5VA 3OZRA 3QV1A 4RYDA 5DI3B 4BCCA 5CLLA 1C3LA 2HLPA 1XTPA 1BZYA 4UD2A 4G56A 1NXWA 4K1LA 4UU0A 4D3FA 1VB3A 3RFCA 4EGAA 3P2IA 1TDJA 2ZB4A 4IQ8A 1Y33E 1ZPDA 4F96A 4G4IA 1P31A 4GP9A 1MOQA 1VGVA 1YH3A 4L16A 5FPQA 1KFJB 4Y1FA 3OPYI 4WZZA 5JI3E 2OESA 4JHXA 3W6NA 3LUFA 5KNCH 2A35A 1PJLA 1NMSA 3G1UA 1HDZA 1WMBA 4I55B 1U7OA 4WKBA 2UXBB 3SPXA 4MB2A 1IL0A 2FWBA 4A6EA 5BP7A 5EQJB 5HFAA 1W52X 4CUKA 1GN8A 3BEDA 3KT3A 1MGOA 1FLNA 2QEQA 1NVTA 3OF3A 3W90A 4BNDA 1V16B 2JASA 2PZJA 3C14C 1CR0A 3NBZC 3SYKA 3FR8A 6ADHA 5AI8A 3AF2A 1Y8ZA 1YBAA 3B5JA 4R5HA 4TMFA 4CEHA 1J8QA 2F55A 2VQ3A 4QBHA 3UMBA 3HLKA 3HRHA 1UC5B 4RF3A 1XZQA 4BN5A 1P9NA 4YBRA 4CHTA 1XDWA 3PDIB 5E7QA 4CMIA 5FWXA 4UOEA 4YR7A 1UBLS 4M9SA 3A10A 4IWXA 2GM9A 3BERA 1V7PC 4B74A 1RWNA 2NOAA 3LFUA 4EYQA 1QWOA 3FPBA 3UYLA 1B16A 3LP6A 3GEIA 4D9EA 3ASYA 1OASA 2BI8A 4DIEA 5JDIC 5K5EA 3U7QA 5LQMA 1C30A 3JQGB 2I4RA 4W9NC 5ADVA 4M1MA 4U7TB 2B3DA 5SY4A 3K6JA 1WCWA 3U7EB 4US2R 4RQBA 2PSEA 4IQ0A 1I7SB 3SAJA 2RARA 3OIWA 5JDCA 1J0EA 4B7CA 1ZGCA 4FQ8A 4YUVA 1RBQA 4CL8A 4QUIA 3W5UA 3T4XA 4BB6A 3F1LA 1BGWA 3FB4A 1H6DA 3LUAA 3HBFA 1Z3CA 4GE0A 5KQMA 1DO0A 1G42A 1R3UA 2N46A 2Q45A 1A9XB 4EENA 1Y7LA 1X42A 3F0TA 4YRNA 4TYQA 3Q9SA 3QNUA 5LD2C 1X6VA 3L43A 1ULHA 3E9EA 1RC0A 1LJLA 3OPYA 1VMAA 4RY8A 4PC6A 4UZSA 4BB9A 4ZVVA 1GO2A 2VRCA 3PGKA 3WQHA 4JXXA 2DETA 4KP7A 4KUHA 1ESZA 4UEWA 2C9YA 1MW8X 1T13A 4IAOA 3IQFA 1T9HA 4YV0A 3U80A 1FDTA 4JKOA 3KJHA 5L7YA 2Y0CA 3F9RA 3JRXA 3VR2A 1EUCB 1JMYA 1ZU4A 3PC3A 3LTNC 2JAHA 4NTZA 4AO7A 4KAJA 4LRSB 1JDPA 2BFBA 4IJVA 4XGRA 2CNLA 4PIPA 4BX0A 1A7JA 4UTNA 1J21A 3BX1A 4WI1A 1SUIA 2VRNA 3LBNA 2XIJA 3LRTA 5NLLA 1NW7A 3TFWA 3GARA 2O52A 5LIPA 4PIVA 3LQ2A 2JLBA 4IOLA 5B58T 1QGED 1HLGA 4UARA 4AXXA 1YBVA 4F04A 1I3CA 1QO9A 3C3WA 2N42A 4HEA1 5EYPA 3TNJA 3ZXXA 4UBMA 1M2OA 1JQDA 3EFOB 1OXMA 3RAFC 4NMLA 1PZFA 5D01A 2YDYA 3PQ7A 3SKYA 5ICEA 2XCIA 3GJSA 2HQOA 4RA9A 2A33A 3RUDA 2VT7A 4MDHA 3U7HB 1GGNA 1O94D 1GTG1 2CHUA 2FNAA 2P9FA 2IPOA 1O0SA 1T5SA 4HPJB 5UKDA 4ZYXA 1XKLA 5JI2E 1GZ6A 1V8OA 5EWJA 3SNKA 4OJNA 4XWWA 2FZLA 3JQPA 3UHJA 3ZC3A 3IHKA 1C1HA 1F20A 1IOZA 3E3LA 4RHFA 4A26A 1HWYA 2WWIA 2WHRA 1QYDA 1PJAA 3DTVA 3IOBA 1DXQA 4G1BA 4OL9A 1GSOA 2GNPA 2JGMA 1HRDA 3CJQA 4KH0A 2XYPA 4NJMA 5I7RA 4E5SA 5ES4B 3WGHA 1AHHA 1NSTA 2WSBA 2OHIA 2Z2XA 3G1WA 3PR2B 4QBTA 2LD4A 2ZSDA 3DTNA 4YPOA 4ZJUA 1U90A 5ESXA 2O7QA 3K5WA 2PX3A 3B7WA 4K8RB 4KQ2A 3WWZA 4E94A 3WKAA 3B5EA 3OX2A 4Q9AA 4M0CA 1SA0B 2RGUA 1LPMA 4KPUB 1TGYA 3LT4A 3K71B 3UHOA 4L9AA 3RLFA 2OBYA 2QI9C 1IOLA 1GDDA 4I1RA 3F6PA 2I4IA 3DDZX 5ARDA 2QD2A 3WFZA 1D2EA 1XD2A 4W9MC 4KN9S 4BWGA 5L4NA 2VP2A 1CDEA 2XEXA 3I2GA 3DAHA 4A0GA 1V41E 4TLAA 4PPQA 1GTL1 4DA0A 4W5TA 2WYHA 4XUEA 1DJMA 3DEFA 5CPBA 4YQZA 3A1UA 1XQYA 4FGUA 2AWNA 2X0IA 1BCRA 4MEBA 4RLHA 2V7BA 1C9NA 3TKAA 5CLGA 3P7MA 4Q3CA 2EFJA 1SK8A 4L28A 4MKIA 1EQUA 1QTRA 5HQTA 3CV3A 2C2WA 4GMDA 2F3SA 4WADA 1WX1A 4W63A 3H6KA 2HIHA 5EPOA 4ARZA 3V8QA 3C6QA 3JYHA 1RJFA 1T3HA 3A25A 4QICA 3A4TA 3TQFA 4UTVA 1Y6GA 2P75A 3EVNA 2ZXUA 2AC4A 4ABYA 3N6XA 4YRCA 5JAQA 3U0BA 4D0NA 3NEJA 3LQRA 2EJTA 2FLVA 2R85A 3AZOA 5DX8A 2QXTA 1ZK1A 1RXEA 4XWKA 2CCGA 3W9BA 4WA8A 1CULC 4DLYA 4QPPA 1ZH4A 4B3HA 2AVNA 5FUVA 2ZULA 3ZE2B 2WJJA 4NR0A 4EYGA 1GM5A 2UYGA 2WUFA 5FNVB 1IWBB 3IX7A 4V39A 5HP4A 1AGXA 2OHXA 2E87A 5AM0A 4EPVA 3AWIA 4F2PA 3ERCA 4X92A 2NO0A 3ANYB 1TQ6A 3M6LA 2V7PA 2R6GA 2WT9A 4DGSA 1J90A 1A7AA 1T36A 2ANBA 2HV9A 2QXUA 3LUPA 4MQ5A 2PWPA 3WE7A 1V11B 2QDXA 4E03A 3HCRA 3LHIA 4OD0A 2ERXA 3NWOA 3FGOA 2HM7A 4MR7A 2C99A 3RQSA 2Y9MB 1LA2A 3G8YA 3OPXA 3OKPA 2GAOA 3HI6A 1BVRA 4JUIA 4O59O 1BFDA 1SWVA 4PR0A 3TIXB 3ZR4B 4KBFA 4YMIA 3KZMA 3H4VA 3HR7A 2Q3CA 4RW0A 4IBOA 1I51A 3OCCA 4QOEA 3VH2A 1XWWA 1D6JA 3Q4GA 5J59A 1PG2A 3EZLA 3GWGA 4XLTA 3MGKA 2BHTA 3NH6A 4WLEA 3FNFA 2J33A 3K6SB 1BDIA 2B30A 4Q3EA 2ZR9A 3KT0A 1BRMA 1TD1A 3OCZA 5BORA 5F2NA 3A1FA 5BSRA 2C58A 2M6LA 3RK0A 3S2SA 4F4CA 2H0QA 3D0KA 5CLIA 1Z0ZA 3I73A 3RUAA 3T52A 1JNYA 1TUBA 5EEHA 5DU2A 3S27A 4V24A 1TEZA 1HA3A 5SY9A 4J7UA 4RTOA 2GK7A 2AF4C 3ESXA 3IUSA 5F3RA 4BEBA 3IAHA 3NM4A 4CKCB 1EWKA 3NGXA 2QGZA 3ZW7A 4G8CA 3DEHA 4WOBA 3TLXA 2IWHA 2DM6A 2QMQA </