3NRCA

Crystal structure of the francisella tularensis enoyl-acyl carrier protein reductase (fabi) in complex with nad+ and triclosan
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
256
structure length
256
Chain Sequence
GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVLPCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Enoyl-[acyl-carrier-protein] reductase (NADH)
publication title Structure of the Francisella tularensis enoyl-acyl carrier protein reductase (FabI) in complex with NAD(+) and triclosan.
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
total genus 86
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3nrcA00
3M6IA 2VZ8A 2PK3A 2VQ3A 3H9EO 4H7PA 4JQCA 1U8FO 3WBBA 3D3WA 3AOGA 3LK7A 4BNMA 2YFHA 1U4SA 2P4HX 3VH3A 2HMUA 4PLYA 3BXXA 3LQFA 4ESOA 2P9EA 1EK5A 3LT2A 3PFFA 4KWIA 4DIBA 3GZ4A 3UVEA 5U1PA 1BG6A 2GZ2A 2PZLA 2XOXA 3JYOA 3FNHA 3PTZA 1I2ZA 4GMFA 1SO8A 3OJEA 4R16A 3KYBA 1SEVA 1V3TA 3RI3A 1YDWA 1PEDA 2QZ9A 2FWMX 1QYVA 3PZBA 1IHXA 4AJLA 1VPDA 1NVTA 1YQDA 4GAEA 1C1XB 4GSKA 1Y8RA 3VPXA 2IXBA 3GK3A 4KUHA 4YT8A 5CDUA 1GD1O 3PIDA 5G0TA 4DYDA 1NHGA 4DMMA 5IAAA 4PIVA 5DNAA 1ZEJA 2QW8A 1YWGO 1JKFA 4HP8A 3W1VA 3PJGA 1ZXBA 2X5JO 3H9UA 3I9KA 1DIBA 3WX0A 2FR0A 5KJ1A 1DIRA 3B70A 1Q0HA 4I5EA 1T2FA 2BGLA 3BMCB 5C37A 3VPSA 3O4RA 2ET6A 4AJNA 3KEQA 2DTEA 1ONOA 2C5AA 5JE8A 1M67A 2QRJA 5G4LA 1XKQA 2GNAA 3BZUA 3TWOA 1YOVA 4CMIA 3H2ZA 3PVZA 3JYLA 3IKVA 4TRMA 3PYXA 4MP3A 5GMOA 4CJXA 4XZ3A 2CDCA 1K2WA 4WCFB 2VNSA 1H6DA 3ADOA 1XCBA 1P1IA 1MUUA 4D0RA 2GLXA 3CH6A 2QYTA 4A0SA 1ISGA 3PHIA 4YJGB 5B4VA 3R0IA 4RZHA 2ZTUA 5CAEA 1FK8A 4GSLA 1DJNA 4QFDA 3GNQA 2EKLA 2Q3EA 4HFMA 4BL5A 4YAKA 2W90A 3C7AA 4K9DA 4YJFB 4AFNA 3H5AA 1XQ6A 3BYZA 2OORA 3KLMX 1UXIA 2LDBA 4MIYA 1H0KA 3GR6A 1MB4A 4XWYA 1YVEI 4L4XA 3V2UA 5EQDA 4UUNA 5CG2A 4CLDA 1R0SA 3WG9A 3GQVA 4B4VA 1ISJA 2WMDA 3G1UA 3ZV4A 3GVIA 2ZQZA 3HADA 3HDYA 2ZJ1A 3LF2A 3EZYA 4O59O 5JCJA 4CMGA 4TWRA 4FGWA 4L74A 3RBVA 4HY3A 4PG6A 3SEFA 5DCYA 4YEDA 4BKPA 3F1LA 2GN9A 3GPIA 4PZCA 4CM5A 1U5CA 4HUJA 3KZVA 1LLQA 3VOSA 3VH2A 3VTFA 1C0PA 1EFLA 1K6JA 1VKOA 2QG4A 3DZBA 1IB6A 2IYOA 4R1NA 3TOXA 1KEVA 3GGGA 7MDHA 3O38A 4FFNA 2FPGA 1Y8RB 4OKIA 1ENPA 1MP0A 1UAYA 3BMNB 4PGFA 4UEKA 1GQQA 1HDOA 4N5MA 2CVQA 3RKRA 3AY3A 2FN7A 1B15A 4GVLA 2RH4A 3TQHA 1UZNA 3WIDA 3QLJA 3ONFA 1E1LA 3DZGA 3TF5A 2Y0CA 4WGGA 1KEWA 3NKLA 3FBGA 4AJKA 2TMDA 2A35A 4J7CA 4EUHA 4FB5A 2YJZA 4PLVA 1ADCA 3JD0A 4FC6A 3FI9A 2GO1A 5TJHA 1IL0A 2OO5A 4A7PA 1XHLA 2DU8A 2I3AA 1E3IA 4PLCA 1GZ3A 1UXGA 3BMOB 3GFGA 3PDUA 1MLDA 2DUWA 1GUYA 2HK7A 3Q2IA 1YOVB 3H6KA 4NK5A 3H9GA 4CMIB 1I3MA 1Y8QA 4CMBA 3DTTA 4QO7A 3JQ6A 5I7EA 4MVJE 3VDRA 1KVTA 5HTOA 2VHWA 3I52A 3QY9A 5L4SA 3GVPA 5IF3A 3RFTA 2EV9A 3NEPX 4D43A 2PGLA 3I9JA 3PEFA 3QW2A 4TZKA 3PWKA 4E2XA 1D4FA 3ANMA 1V0JA 4JBIA 2X5OA 4DWVA 5KVVA 3S2EA 5L7WA 1ENOA 3WFIA 3F5QA 1U28A 2LDXA 2NQ8A 1HETA 2Y0DA 5L40A 1B7GO 3UCXA 1TLTA 4W4TA 1HWYA 1M2WA 3IIEA 3PHGA 1LQUA 2NV6A 4CM1A 2PD6A 3GVHA 5ER6A 1QLHA 2VYND 2WE8A 2BF7A 3M1LA 4FN4A 2OOSA 1Q7GA 4YPOA 1LRJA 1ZK4A 3KB6A 4RZIA 1P1FA 4KZPA 1EVYA 4FCCA 1YQXA 3DO5A 1V3UA 3CTMA 5HS6A 3ZWOA 4FOOA 4HKTA 1K6XA 1GEEA 3Q6IA 3P2YA 3C24A 2VNAA 4E32A 4PFJA 1L7DA 2A92A 3FCOA 1HE5A 1ORRA 2C82A 3F3SA 3JD3A 1EBUA 1EUDA 4IGEA 3NDRA 1GAEO 1KIFA 2QZZA 3ZWVA 4Q3NA 2CFCA 1D3AA 3PHHA 4BGVA 1JTVA 3AOEC 3WMXA 4ZQFA 3PJDA 1VJTA 2X0JA 4OXNA 1UR5A 1T4BA 3PHJA 4DMLA 4DPKA 3RC1A 1KERA 3JQFC 4J1TA 4AJPA 4TROA 4J90A 4Z3KA 5BSFA 4Z0HO 1GDHA 2Q49A 3ZHYA 3TZQA 4FOSA 2J5KA 3U09A 2JFGA 2OL4A 4E2WA 3DXFA 5KJ6A 3DZJA 4IJKA 3HE3A 4A27A 1DFHA 3JYNA 3INTA 1PGOA 3WGZA 1I24A 3WMWA 1T4DA 1Y8QB 1N9GB 3UN1A 4BO3A 1ZK1A 4M1QA 1V35A 2A94A 3E9QA 3AU8A 3ZWBA 4RF4A 4XGNA 3GZNB 3D5TA 1NPDA 1GEGA 4JGBA 3I9MA 3OIGA 4NDNE 3ROQA 5CG1A 2HDHA 2BH9A 3JYPA 2GDZA 4LSMA 2NACA 3DBVO 3PHLA 1F14A 1LQTA 3VVBA 2UDPA 4KUEA 2J3HA 3OF2A 4FQ8A 4J1QA 3M1AA 1V8BA 4Z9YA 4NJOA 2AEMA 1F8GA 2IYPA 4KP7A 4IM7A 2E6UX 3OETA 3PJFA 3ROKA 1XELA 3VH1A 2PNFA 4XB1A 4NIMA 5TGDA 2ZB8A 1Z45A 3HN7A 5FF9A 4WUVA 3QE3A 4IJVA 4U6SA 3V1YA 1PL8A 3I3OA 3TDKA 1A4IA 1IHYA 3AUAA 3HSKA 2V6GA 1ZCJA 1E0DA 2R6JA 2BI7A 3DHEA 3ZNQA 4DBVO 3ZWAA 1C0LA 4Y9DA 3AUTA 3NUGA 3GAFA 1ZJYA 4XIJA 3DL2A 2Z5LA 3ETDA 2UYYA 3GC6A 4KQXA 1LX6A 2P68A 1RM0A 3HN2A 3I6IA 5A05A 3ZHZA 9LDTA 1XWFA 4I5FA 2AG8A 3JQ7B 5JC8A 4HFNA 3DOOA 4CUJA 5DF1A 3WB9A 3DMTC 1LLCA 1ONNA 2IZZA 1A7AA 4Y6PA 5A04A 3K2EA 4Z0TA 4JX8A 3H4VA 1ISFA 3MJCA 5TX7A 5CP8A 4XYMA 4DQVA 3BTOA 1E6EA 4PG8A 2W2LD 4B79A 2C29D 2BFAA 3ASUA 1OZAA 3DAGA 3JD1A 1OC4A 5CPFA 1E3LA 4RF3A 3MTGA 3MWEB 4WECA 1IULA 1B14A 5I9NA 1AN9A 3GNSA 3LDHA 1XIVA 1W6UA 1VLLA 1PJ2A 4FFMA 1XA0A 2HMSA 3BHIA 1WZIA 2O7SA 3ZWMA 5JYEA 2YV3A 2I3GA 4U0JA 4EI2A 1N7GA 1Q0LA 5JAMA 5THQA 2HK9A 1FMCA 4JBHA 1DC6A 1N1GA 4Q9NA 1CYDA 1VI2A 2HMWA 4E4YA 3OQBA 1EQ2A 3K96A 1ADGA 3G1TA 5JXWA 3WR5A 3EC7A 4PN3A 5TSDA 3LT4A 4NR0A 3ENNA 5JDIC 4YQYA 1Z75A 3VC7A 5JO9A 2B4TO 2B0JA 3MTJA 5C3MA 5T8KC 1WP4A 5HA5A 1O95A 3OA2A 4L4SA 5EMHA 2PWZA 2EERA 3A28A 1KC3A 4NBVA 1BXGA 1MA0A 3RFXA 5I7FA 1B26A 3P19A 1FXSA 5DULA 5JDCA 1C1DB 2G1UA 3LVFO 4GQAA 2VYVD 4IBOA 3VKVA 3HWRA 1XQ1A 1NWCA 1QV7A 4YAJA 5H81A 2IEDA 4RV9A 1EE9A 4YTEA 4DLBA 1ZIDA 2ZYDA 1X7HA 1VRWA 4XYBA 2OFPA 2QQ5A 1EE2A 3S2IA 2Y99A 3I4FA 4AJ2A 3GLQA 1ZK0A 3KOUA 2AQKA 1MV8A 5DCUA 1LC3A 1Z73A 4CR8A 3N7UA 2VYNA 4PG7A 1TT7A 2NU7A 1LRLA 1NFQA 3DFZA 1B3RA 5JNLA 2Y66A 1YJQA 4PZDA 2PGJA 3H7AA 4QQRA 1DPGA 4J2OA 3RQSA 1PZGA 3UGKA 2YDYA 2PZMA 3RASA 3TFQA 4BO6A 3OBBA 3JQGA 4IDDA 1ZNQO 1GYPA 5IFLA 1VL8A 3WOHA 3B6ZA 3WSVA 4WEOA 5FEUA 2Q4EA 3PRJA 1MFPA 1P33A 1WDKA 5GZ3A 1U3VA 4NG5A 2I5PO 4MOWA 4ROSA 3QVXA 4AJEA 1JWAB 1JVSA 1PU2A 5ICSA 4R1SA 2O3SA 3F47A 2Y93A 4L9RA 2EHDA 4FDAA 4A10A 2Y1DA 3OMLA 3WYBA 1HYEA 5ENVA 4ND2A 4W9NA 3ZI0A 1X0VA 2C59A 4BNXA 4KDEA 1AGNA 3GT0A 4DQUA 4D0SA 1XYGA 4EUFA 4DL9A 5MGBA 1GZ6A 1D1SA 5DDIP 1S6YA 3KUXA 1UUFA 4OO3A 3RIHA 2CDAA 3IL2A 1XU9A 2IDZA 3GUYA 3H3FA 1PIWA 1ZMOA 5L7TA 4QX6A 4IDAA 1DRVA 1ZW1A 4L73A 1PL6A 1T1SA 3TPCA 4BNFA 3BTSA 4J4TA 2FMUA 2AQIA 4XGIA 4B4OA 3JQBA 3C7DB 1BXGB 1UDAA 2NTNA 5JMWA 1P0FA 3CZMA 3UFXA 1GU7A 5COAA 1R0LA 2V6MA 4XA8A 4GWGA 5HRUA 4J4BA 4CV3A 1O0SA 3GDOA 4KTVE 3LSYA 3DBRA 2PZJA 3E8XA 2W4QA 4OOEA 2UUOA 2W8ZA 2PTGA 2ZYAA 5TF4A 2GERA 4RPJA 4U8GA 2I67A 1FDVA 2VTDA 3LC1O 3SLKA 4QSMA 1DC5A 4YBZA 3VH4A 4XRRA 1PJSA 2QIOA 4P22A 3AY6A 3RCBA 1J5PA 1ZSYA 5AXDA 1DIHA 3GOHA 1BW9A 4OQYA 1GPJA 2D8AA 4CLEA 1RJWA 1JWBB 1SZJG 4OOFA 4INAA 2O4CA 2W2KB 3AW9A 1QG6A 1R0KA 1MG5A 4EW6A 3NJ4A 2D1YA 2ZATA 5F1OA 1J49A 1M6HA 3GN1A 4DBZA 1MGOA 4D44A 4XB2A 3IDSA 2EJWA 1Z82A 2V65A 1PQUA 1ENZA 3E03A 4I08A 2R00A 2HKIA 3PWZA 3QWBA 4IDCA 3E82A 1LSOA 3ZV6A 2VRBA 1G0NA 2GYYA 1HKUA 4J1NA 1DC4A 1WWKA 3HG7A 3QWHA 1C1XA 4N18A 3V1TC 2B5WA 3U5TA 2Q2QA 2VUSA 4WNCA 3HZZA 5KTKA 1GQYA 3ROPA 1KBZA 2Z1NA 3K73O 1DB3A 3HNPA 4BUCA 2VUUA 3I6QA 1E5LA 3D64A 5ER9A 4PLGA 3SJUA 4RPHA 5KWEA 2OXIA 3VZSA 2W2LA 4M89A 1EVJA 2HAEA 3DR3A 2PR2A 1ISHA 4JJFA 2XXBA 4ZICA 5J23A 3NX4A 3BMCA 3IS3A 4BNTA 3QQPA 2AMFA 3NYWA 4IQ8A 3SBOA 4E5YA 5T64A 1C14A 1NQOA 1UDCA 3DZHA 1ZVMA 3K9QO 1I01A 5ITVA 2H9IA 2PGDA 2O48X 2J5QA 4YCAA 1XEAA 3ZNNA 4ND3A 1Y7TA 2TMGA 1GV1A 1YS4A 3E9NA 5F5LA 1YE3A 5FFFA 2V6BA 4DPLA 1XG5A 1ZSNA 3DBRB 2BFOA 1E3SA 3WFJA 4Q39A 4R4JA 2HU2A 2BHLA 3HHPA 4OM8A 1E77A 1OMOA 1NTOA 1HSZA 4R5HA 4MVJF 4IJWA 1HZZA 3L4BA 4YJGA 3EUWA 4WE3A 4XYGA 4NQZA 2H6EA 2JAHA 5DCWA 2Q2VA 4GX1A 1SCUA 1ZSVA 4E6PA 4GBJA 1P74A 3OJOA 1NPTO 3DHNA 4UUMA 1BW9B 2GZ3A 3RFVA 1VJ1A 3U4HA 1HLDA 2DFVA 2V6FA 5G0WA 4I8XA 2EGHA 4MVJI 1BRMA 1DOHA 1PGNA 4RVHA 2VYVA 3G79A 2AG5A 4D7AA 5KIAA 1WDLA 5EQFA 2R2GA 3OIDA 1M76A 1YL5A 1PL7A 4KQWA 4QFCA 2BD0A 3WGIA 3IJPA 4F46A 2DM6A 3MJSA 3AFNA 3UXYA 1HE2A 2DBVO 1CQJA 4PLHA 2WYWA 3PQDA 4Y6SA 2B69A 4L75A 1N5DA 3KTDA 4ZRNA 4DA9A 4BO1A 1E1NA 1ZKMA 2E49A 2YQ5A 3B1JA 3MOIA 4N54A 5AXCA 2PZKA 1E5QA 1BSVA 1OOEA 1YBMA 4DC1A 1PS8A 1A27A 4IZHA 4U5QA 2Y1GA 4CMEC 2NTVA 4GL4A 1K5HA 4P38A 3BMNA 1GUFA 4BNIA 5A02A 2PD4A 4NJMB 1I32A 4M49A 3GVCA 3QV1A 3RD5A 3EVTA 4J4HA 1KVQA 3RC9A 4JP3A 4OQZA 4PCVA 3GRKA 3OQ6A 1P44A 2H63A 5FI5A 5JAQA 3IP1A 4NBRA 5IDQA 2HMTA 4MVJM 1YQGA 1Q7CA 4YQZA 1Q2XA 4RORA 5HM8A 1U2GA 5AXBA 2Y67A 4FS3A 1PJQA 2VOJA 2Y0EA 2NUAA 3GNTA 3KYDB 3DZKA 1QXSA 3PWSA 3BMOA 3VTZA 3WGYA 1E7WA 2X9NA 3DAFA 2HLPA 4RLHA 5JBIA 1B2LA 4R41A 4DVJA 4J43A 3B1KA 4UVGA 4JLWA 1I2BA 5G4KA 1TT5A 4ALKA 3DBHB 3SVTA 1LA2A 3I9OA 1PJ4A 4NK4A 3K5PA 2VHVA 2PV7A 4UAGA 3HB4X 1KY4A 1P31A 2X1HA 1N92A 3M2TA 3LC2O 4GX5A 2Q2WA 4BNLA 5T67A 4MVJP 4XDZA 2JL1A 1QYWA 1DJQA 1KVSA 4E3ZA 1BGVA 3W4IA 1KY5A 4OIMA 2VT3A 3FF4A 1LTHR 2VWPA 2ILTA 1SOVA 1JA9A 2ZYGA 4F6CA 3WWZA 3L77A 1P1RA 2QX7A 1RM5A 2C20A 5THKA 3WS7A 3S2FA 1JN0A 4WKGA 1K0UA 4I9HA 4XRGA 1SBYA 1YDEA 3ITDA 3ETGA 4KUGA 4BB5A 1PX0A 3X2FA 4URFA 1LDEA 2QRLA 3I23A 3OICA 4WLUA 3ZHXA 1E7SA 1HF3A 2SCUA 5I7SA 1QORA 4RQUA 4PLPA 4B4WA 5IDWA 3DZFA 5IZCC 2JCVA 4A73A 2EW8A 5CFZA 4ZVVA 1M6WA 4FIZA 2GN6A 1HYGA 1LRKA 3ASVA 3C8MA 4IDBA 2RHCA 5EESA 3CE6A 2FOIA 2O3RA 1HDZA 5CDGA 2J5RA 2BKAA 1X13A 2NM0A 4NI5A 3EY4A 3WXBA 3BMQA 2CY0A 4J6FA 3P7MA 5A3JA 4QTZA 4B7XA 4CMCA 8LDHA 2B5VA 1OC2A 1YJ8A 3I9LA 1IUKA 3SLGA 1QLJA 4D41A 4CV1A 4EYEA 1NP3A 4E5PA 1DFGA 2BELA 3I1JA 1IPFA 4C7KA 1LLUA 1Y9EA 1DIGA 3D1LA 1NFFA 1PS0A 3VDQA 3PGXA 4CPDA 2GZ1A 4Y6RA 4EUEA 1WMAA 3P5SA 5G4KB 2YYYA 1TT5B 4A03A 1N9GA 2DPHA 4LGVA 2AQHA 2DUUA 2NLOA 4AJHA 1U4OA 4PLZA 3K31A 3GZNA 2UAGA 4Y67A 3WTCA 1TA4A 4DREA 1NYTA 4WLOA 4XQEA 3S1LA 2ZIZA 3S8MA 4Q3CA 1XLTA 5IDYA 4BOYA 3U0BA 3WQQA 4CV2A 1OFGA 3Q0EA 3QVOA 4YYZA 4FGSA 4LW8A 3H3JA 4EJ6A 1DAOA 3ON5A 3G0OA 1G6KA 1BTOA 1HDYA 2IODA 4GH5A 4JN6B 3AUUA 3WYCA 2PA3A 4OXYA 4CQLB 2ZTMA 3KSDO 2X4GA 2O50A 1EBFA 5JSFA 4PG4A 1WW8A 2CF5A 2DLDA 2HMVA 4G81A 4R5MA 5ILOA 3KRTA 4QECA 1R66A 1M66A 3PGJA 5HS4A 3GDFA 3CPSA 1XU7A 2JAPA 4TRJA 2PFGA 2UVDA 1WZEA 3DOJA 2NNLD 3RROA 4ALIA 4BS9A 4WLFA 4I1IA 5A5EA 1RYDA 3INGA 3W6ZA 5KNLA 1JAXA 5ENDA 5FWNA 3OA0A 4RVSA 1NM5A 1LLDA 2EKPA 3JQ7A 2YV2A 5DP1A 5HWSA 1O94A 1I36A 3GEDA 3PFWO 2F1KA 3QJ5A 3JD2A 3RUEA 1D1TA 1F12A 2DVMA 1U3WA 3T7CA 3BMQB 1IYZA 1CIVA 3RUDA 2E48A 2PH5A 3R6DA 3VZPA 3KHUA 5C7IO 1ZZEA 3K6JA 3ZWPA 4BGEA 1ULUA 2I6TA 2O2SA 3RU7A 3NT4A 1E6WA 4G5HA 5T57A 2DKNA 4UREA 4M8SA 4IDEA 4BO2A 1LBEA 3JQBC 2EJVA 4O0LA 3JYQA 5DBIA 4Z9FA 1R15A 1AXGA 1I5RA 3DEYX 3M2PA 1NNUA 1NVMB 1ZJZA 1I0ZA 3EW7A 3EDMA 4W82A 2DT5A 4KWHA 3ST7A 3JQ8A 4HBGA 5H82A 5ADHA 4YJHA 3FWNA 3H5RA 4QEDA 3KVOA 1HE3A 1QKIA 3FWZA 4F3YA 4J49A 5KCZA 2FRDA 1DRUA 3DAPA 2O2YA 1PJTA 4LSWA 3ZWXA 1O6ZA 3W4KA 2NU6A 3WGOA 3EYWA 1GPDG 1QYXA 5T5QA 1GQ2A 4R54A 1KEPA 3TOZA 1DBVO 1DHRA 5BSEA 2DBQA 3JQ9C 2GSDA 3GHHA 3IKTA 3RJ5A 5DBFA 5EN4A 5L4NA 2VHYA 5BNFA 5JC1A 4UEJA 3N74A 2YDXA 1HDGO 4O6VA 4LVCA 3VZQA 2B35A 2J3KA 3TFOA 1XDWA 1YB4A 4YACA 2I65A 4RVFA 1YGYA 3KLPX 5AOVA 4ALLA 4ZGWA 4S1VA 4KDFA 4TZTA 3FPCA 3UW3A 1C1DA 3KYCB 1B8VA 2BGKA 1XR3A 2B4QA 3TNLA 3UCFA 1U5AA 1MC4A 2GR9A 1GTMA 3D5QA 1OBFO 4XDYA 4MDHA 3AK4A 2R00C 4NMHA 5HBRA 2AEFA 2HRBA 4XYEA 1R4MB 3B1FA 5C5IA 3A9WA 2JFHA 1T2EA 1BDBA 2X22A 2WE7A 3IJRA 3ZV3A 1LI4A 2O4UX 5KVCA 3ZN2A 3IP3A 4E5MA 5U9CA 5A5FA 2A9FA 4R3NA 4OL9A 3CUKA 2IRWA 1I30A 1LDNA 1EZ4A 3GF4A 3QSGA 4LVUA 4DLLA 2C2XA 2DTDA 4BO5A 1A7KA 3MJEA 1NQAO 3PJEA 5LDGA 3H9JA 4YVFA 1ISIA 1YL7A 1MXHA 1AHIA 3FR7A 4XKJA 4YR9A 2RHRA 1NPYA 2YHUA 1R16A 4N5NA 4IQ0A 3UICA 3WNVA 4G65A 3AI2A 2CUKA 4W6ZA 4RJTA 3LF1A 5K9ZA 1ZH8A 2DC1A 3MZ0A 3FRJA 1FDTA 4WLEA 4HV4A 3JQ8B 4C4OA 5I8WA 3RC7A 4YJHB 3QP9A 2X58A 2I66A 1GFSA 2ZB4A 3GMDA 2ZB3A 4WCFC 3PIIA 1PWXA 1NFRA 1K6IA 4MIEA 3DC2A 1E7RA 4OAQA 1GR0A 3BAZA 5F3RA 4WEQA 4BKRA 1T24A 3P2OA 3K30A 3L4BC 4CODB 3IUPA 8ADHA 3ANLA 1DEHA 3E1KA 2BFMA 2FR1A 3BHMA 4TKMA 3V2HA 2IE0A 2B83A 3AJRA 3CZRA 1P1HA 1YB5A 2DTXA 4CM6A 1UP6A 1R6DA 2OBNA 1QMGA 2WD8A 4HFJA 3KETA 3MJ4A 2WDZA 3PZRA 5KKCA 4B8ZA 3RVDA 1E3JA 4BNUA 3VPHA 1X7DA 1A4UA 2X23A 3I4CA 1NR1A 4TKLA 3ORFA 1KVUA 1NAHA 2FPIA 3HJAA 4B7CA 1FF9A 3DMYA 3TRIA 1Z7EA 1E1MA 1HZJA 3CEAA 4NFHA 4UUPA 2WTBA 2G0TA 3DTYA 2GF2A 2YY7A 2G76A 4CMKA 3DDNA 1EUZA 2X6TA 3FSRA 3ZH2A 2AW5A 3U4IA 1H94A 4EJ0A 1UXJA 4RF5A 4ZA2A 1O89A 3EGOA 5L53A 4YRDA 5GY7A 4CQMB 2D5CA 4DC0A 2IEBA 3JQEA 4RDHA 1YL6A 4W99A 4DXHA 1QRRA 4CLHA 1T2AA 2P4QA 3QA9A 5KKAA 4WNIA 4BO0A 3JD4A 3F6YA 2O3UA 4D3SA 4H15A 4RF2A 2X86A 1VL0A 4HX5A 4OSPA 4QUKA 2NQTA 5AQ1A 2W2KA 3ZU4A 1I2CA 1PGPA 2OGUA 4II3A 4PLWA 2J3IA 3NRCA 2WYVA 1UP7A 2FSSA 4MP6A 5F1PA 4ALNA 5IXYA 4I9UA 4U0KA 4LRTB 1B0AA 2VTEA 4HNGA 3K2BA 5DBGA 2GN8A 3NAQA 3JQCA 1NWHA 4B4UA 4CLXA 4KMSA 4BGIA 3PDJA 5CDYA 5JYDA 2CDBA 1JLLA 4MP8A 1EFKA 2QRKA 2DPGA 1HE4A 2VZ0A 2VWHA 3MJVA 3MEQA 4NBUA 1N7HA 1E7YA 4R69A 2O3QA 4R01A 1N2SA 1PS9A 1RYEA 4BKOA 1BDMA 3RBXA 3GUCA 2ZTLA 1JKIA 5JPIA 4OGWA 4S3MA 4E33A 3D7LA 4TRNA 1HLPA 2Y68A 5CDSA 1K3TA 1VSVA 4JJIA 2EW2A 3K8ZA 4D46A 1IY8A 4RVGA 3SC6A 5A9RA 4Q3EA 4B3IA 2X7HA 4YB8A 4BO4A 3C1AA 1PQPA 5AYVA 3QWAA 2POQX 4DIOA 4F6LA 1WLYA 2RCYA 4J91A 1XGKA 1GUZA 3OEYA 2X0IA 1H6AA 1IZ0A 1KC1A 4II2A 3HDJA 4IINA 3B20A 4JBGA 2CF6A 1J4AA 4G2NA 1Z7BA 4BB6A 1YONA 4IS2A 1C0IA 1R12A 1QR6A 1OI7A 3HUDA 3V8BA 2AA3A 3JQFA 3W4JA 4Q3BA 1HSOA 1H5QA 1QSGA 4BQRA 1PWZA 5EIOA 3ZNPA 4ONEA 2CNBA 4MVJH 2EEZA 5BSHA 4I5DA 2YUTA 3SXPA 1UP4A 1AUPA 1P77A 1NAIA 1EEHA 2D4AA 4LCJA 3HFGA 4FC7A 4ZQBA 1A5ZA 1Z74A 4YWJA 4AL4A 1A9ZA 4OXKA 3ZV5A 4NBTA 5EINA 3GEGA 4WJZA 5L3ZA 3DBLA 5CEEA 4WK6A 1DLJA 1PZHA 3LT1A 4CL3A 3KXDA 3ZCXA 2WEKA 3CINA 4FJ2A 4E0BA 3FNEA 4PG5A 5KOIA 2VN8A 2PKQP 2VWQA 1QV6A 3L6EA 5MDHA 4QO8A 3V1UA 3MCVA 2EIHA 3I5MA 5DOZA 4YDRA 5DP2A 4H3VA 1ZK3A 4M55A 3WDSA 4QXMA 1HDXA 4BGUA 4IUYA 4RDIA 1Q0QA 3L0DA 3KEOA 3ZWWA 1GADO 2Y1CA 4DRYA 4MO2A 3C3XA 1KOLA 2C0CA 2OBYA 3F4BA 5F1KA 5KJFA 3MOGA 1NQTA 2CVZA 4TVBA 4B3HA 1TEHA 5ES3A 4EJMA 2Y05A 1DLIA 2VOEA 1GCOA 3D4PA 3OM9A 3EMKA 1JQBA 5B4TA 3QVWA 3ICPA 4JNKA 3FR8A 3QVTA 4LCEA 2JD1A 2OP1A 3AFMA 4Y98A 4CLRA 4NJMA 1P1KA 2D3TA 1EDZA 5L7YA 3A06A 2NVUB 1PSDA 2D0IA 2JD0A 5AXAA 1BHSA 3TJRA 3UCEA 2H1SA 2RH8A 1C0KA 2IXAA 3PLRA 3V5NA 2O3TA 1PR3A 3FTNA 2WYUA 1BVUA 1C3VA 2Q50A 1ADBA 1PJLA 2E37A 1ZEMA 4E21A 4WOKA 3FHLA 3KYDA 4D3FA 1O8CA 3VZRA 1JU9A 4IMPA 4TSKA 5TLSA 3H5NA 1Y9AA 2ZKLA 5C7OO 3IOYA 4WOJA 4KOAA 4A5OA 2VWGA 4ZD6A 2ZCUA 1CERA 4E12A 2CZCA 3VPFA 4BO8A 4FW8A 2DBRA 4JP2A 4GMGA 4PZEA 1YBVA 3DBHA 3I9NA 3QIVA 4GGPA 5G0SA 1YO6A 4LISA 3FNGA 5JLAA 4CUKA 1ZFNA 3E9MA 3RWBA 1T2DA 2FZWA 1A71A 1GY8A 1LSSA 5L9AA 4I9NA 3T7EA 1CWUA 6LDHA 3R1IA 1WNTA 3PLNA 1H2BA 1TXGA 4Q3DA 4J0FA 4IY1A 5LC1A 3DWFA 1Y6JA 4IGFA 1WMBA 2Q45A 2ZB7A 4DUPA 1W0CA 3DBLB 4C7JA 4WASA 4WLNA 2GRAA 2YHIB 4D42A 4D79A 4E31A 4R3WA 3KO8A 3A4VA 2GGSA 3G49A 4E5NA 1KYQA 4BKUA 4IIUA 2F00A 3A14A 2RBEA 5JS6A 1H6BA 3CXRA 3NDIA 1YB1A 1NBOA 3OHSX 1UZLA 4YAEA 4ILKA 3GMSA 3ABIA 3GPDG 3ITKA 2AE2A 4YAGA 4RCVA 2HJRA 5L4LA 1T26A 4IXTA 2VHXA 5TT0A 5JDIA 4YA6A 3KSZO 4UEOA 4ZHSA 3C7CB 4PVCA 3ZW8A 5A06A 3AWDA 4K1LA 3I83A 1ZO8A 2OUIA 5T8KA 4IJUA 2P2SA 2Q1SA 3BIOA 4FJ1A 4NFYA 4EBFA 2ZCVA 3W8EA 3WLEA 1NX6A 4ND1A 2GUGA 4MKXA 5EL0A 4CM3A 4XEHA 3RKUA 4FD3A 4CLRB 4NFSA 5G0VA 3WSWA 5JFOA 2NU8A 1SC6A 2UUPA 3BA1A 3IQDB 4NZ9A 1NQ5A 2NU9A 3FTPA 3PK0A 3WIEA 3ULKA 1WAMA 2D59A 2YV1A 3ZW9A 2G82A 5I8ZA 1LU9A 1JVBA 4GKBA 4AVYA 4NBWA 2JFFA 1UXKA 3KM0A 4BMNA 1GV0A 1IPEA 4ZQHA 1NASA 2C2YA 3WGHA 2B4RO 1NXQA 1LDMA 2DAPA 4J7XA 1SB9A 2EXXA 3R3SA 1U1IA 3LT0A 3Q9UA 3HDHA 4JK3A 2O23A 3U49A 2IZ1A 3WGTA 1Y5RA 4PRKA 1UJMA 3F4LA 3FPLA 2QYSA 2X9VA 1ARZA 4UVEA 2WD7B 3HFSA 4Q3AA 1ONPA 2VUTA 3OJLA 1EMDA 4M86A 3OSUA 2D5AA 1E7QA 2I99A 1TVEA 4CQMD 4MIOA 2J8ZA 4FBGA 5GZ6A 1JDJA 2OHXA 3GDGA 1PTJA 5KJCA 4TVOA 5EERA 4R9SA 1SAYA 3AI1A 3W8DA 1HDCA 2GCGA 4CQLA 3NTOA 4NU6A 4W7HA 4BNYA 5A4DA 4ID9A 1QP8A 1NR7A 2JKVA 3AU9A 3QHAA 2X8LA 1D8AA 2A4KA 5DOVA 4FJ0A 3UAGA 3WWYA 1Z6ZA 2XXJA 4GI2A 3F1KA 3JQAB 4XQGA 3UKOA 3D0OA 1DDOA 1KEUA 4CUZA 3ZWNA 4CM8A 1YKFA 4IQGA 5JY1A 4H16A 2Q1WA 1YRLA 4GX2A 1X7GA 2Q4BA 1PZEA 1FJHA 2PKRA 1V3VA 3D3WB 4K28A 5IZ4A 4IIVA 1ULSA 3VVCA 1IZ9A 2GASA 4O63O 1HL3A 1UAGA 3O9ZA 3INRA 4NPCA 1X15A 2W98A 3O03A 3FD8A 4RPLA 1F17A 1GL3A 5H83A 1F0YA 3OFSA 1U7HA 4OHUA 2QHXA 2BMAA 3WGGA 2PKQO 4BNHA 2HK8A 1FDUA 1LSJA 3H65A 4E30A 5JAIA 3LLVA 4EITA 1WPQA 2C5EA 1IOLA 3IMFA 3O8QA 2E4AA 4K6CA 1UDBA 4LMPA 1EVIA 4R9RA 4FFRA 1A72A 5JDCC 4EEXA 1F06A 5A03A 4NH4A 2I76A 1VM6A 3VPGA 4CLOA 1J0XO 4YXFA 2J3JA 4CR6A 2HCTA 3AI3A 1MG0A 5C7LO 2P5UA 5JW6A 1ZK2A 3BTUA 2B37A 4PVDA 5TS3A 4XX0A 3U3XA 4CMJA 3WYEA 5IG2A 3DHYA 4HNHA 2JHFA 1E3WA 4RPKA 4FPXA 4XQ9A 5BQFA 3LZ6A 1E1KA 4J9VA 1HXHA 3JQDA 4WLVA 2AHRA 4HWKA 3R3JA 2WJPA 4YT4A 1X1EA 2JCXA 3H9QA 3KV3O 3PI7A 1X0XA 2NTJA 3RJ9A 3VHRA 3DB2A 4JXKA 5DZSA 3STHA 2FSVA 4XR9A 3A1NA 3FBTA 3RC2A 4GPD1 2Q99A 4OYRA 4ND5A 1LNQA 3CKYA 3Q1LA 3WTBA 4QT0A 2AQ8A 4AJ4A 3KYCA 4GLOA 1ML3A 3W8FA 5G0UA 5U4QA 1U3TA 3NJ8A 4L0QA 4B7UA 1TI7A 3MJTA 5B37A 4AICA 1ZMTA 4J9UE 4CM8B 4DGSA 1D7OA 2G5CA 1R4MA 4A2CA 3HB5X 4RLSA 3SC4A 1HTBA 4IXWA 4LN1A 1CJCA 1W4ZA 1LDGA 3K92A 1WVGA 2OMEA 1EQUA 2Z1MA 4MINA 4W9NC 2FY8A 3DOCA 4M87A 1B3BA 2EP5A 3TZCA 4RQTA 4CM9D 4BNGA 5K6AA 4PLTA 3OH8A 4Y8VA 1HT0A 1FDSA 5DN9A 2OZPA 1MXFA 3U62A 4GX0A 3TZKA 4IMRA 4HXYA 2C54A 3LYLA 3WICA 5TJ9A 2IZ0A 4AJOA 4R1TA 3X2EA 6ADHA 3NGLA 2EKQA 2P91A 4R68A 3RBZA 2H5LA 3L9XA 4YAIA 3O8QB 3NT2A 3NT5A 5EPOA 4CMHA 3MWDB 4E2ZA 4XR4A 2B36A 1H6CA 1JAYA 3TSCA 3UUWA 4CLOB 5IJZA 2VT2A 1ISMA 5KJEA 2DQ4A 5CDTA 1U2DA 5BNTA 1A9YA 1RWBA 3TL2A 4BHTA 3T4XA 1P3DA 4N5LA 5K0ZA 3SJ7A 2YZ7A 3E5RA 4LRSB 4JROA 4DIFA 5LDHA 1SEPA 1FDWA 2NADA 2C7GA 4D3DA 3ZGYA 1E3WB 1L7EA 4MVJG 5COBA 3L9WA 3PP8A 4J3FA 2NVBA 4PLFA 1ZBQA 4DTIA 2Q1UA 1VE9A 3U9LA 3HDQA 3RSHA 5GZ1A 2P5YA 5A9SA 1E3EA 3E6AA 4BV8A 4IZIA 1EVZA 4E2YA 1U8XX 4XJSA 5JCXA 1ID1A 4BNNA 2YW9A 1LEHA 3IAHA 3S55A 2ZTVA 4FR5A 4CMEA 3WQSB 4MVJD 4RL6A 1MX3A 1HEUA 2X0NA 3G17A 1YH3A 1T2CA 5TNXA 1P1JA 3ZHBA 4DPMA 2AE1A 3KBOA 1Y81A 1DXYA 3JSAA 1DIAA 3OECA 2RIRA 1B16A 4CQMA 7ADHA 1AHHA 4AJJA 1LJ8A 4IDFA 1GZ4A 2Q1TA 4WCDA 4D45A 4KTTE 5L51A 3GGOA 2VRCD 1MC5A 3SX2A 4NU5A 2DBZA 1VJ0A 5G2OA 2HO5A 3ROMA 1R4NA 3E18A 4RGBA 2GN4A 4F45A 1V6AA 4GVXA 4XIYA 1DC3A 3NDJA 5FYDA 4BO9A 3VAZA 1YXMA 3F5SA 4EEZA 5BNIA 4ITUA 3LLSA 3NV9A 1SPXA 3ZWYA 3ZU5A 3HQ4O 4CM7A 1L1FA 1GYQA 3UF0A 1HDRA 5TQVA 1U9JA 2C07A 4E13A 1PJBA 3UH1A 2FHSA 3GHYA 3OEWA 1J6UA 3OJ0A 4FFOA 4LMRA 5CPBA 4DQXA 1G1AA 4FFPA 4J2HA 1H9BA 1O5IA 4U6QA 1UH5A 4IS3A 3W6UA 5KVQA 1EDOA 1SNYA 3LC7O 1GYRA 1DSSG 3E5MA 1N1EA 3PQEA 1Q7BA 2EF1A 4OJNA 3PXXA 4XYLA 1M75A 3EK2A 2HQ1A 4R51A 3D4OA 2D2IA 3NGXA 2BFPA 1ZXLA 4P8RA 1U7TA 5KVSA 2EGGA 5ICMA 2XF8A 5A9SB 4AG3A 2O3JA 3ENKA 2O7QA 2AXQA 3ONDA 3GEMA 1YBAA 1RM3A 3DQPA 5IZCA 3CSDA 3S2GA 4BNKA 2NWQA 1S7CA 3GN2A 5COQA 4U7WA 4ND4A 1BWSA 1E6UA 3ONEA 5I9MA 3RU9A 1CF2O 1WDMA 4AJ1A 2ZQYA 2JHGA 4IPTA 2GPTA 4ZU3A 5JY6A 3RUIA 3RAJA 2P9GA 1IE3A 3UHAA 5IXSA 4N7RA 1DRWA 2WWRA 4L4RA 3JQAD 3GY0A 1E7MA 2PD3A 2HRZA 9LDBA 4XQCA 3Q11A 3IUSA 1P45A 1BVRA 2BGMA 3ANNA 3AM5A 3OP4A 2P9CA 3WGQA 5EJ2A 1H9AA 1DFIA 2I9PA 4O1MA 5TRTA 5CEFA 4GWKA 4XGKA 4R1UA 1CDOA 2G17A 2XPCA 1R4NB 5F5NA 1H2HA 3C1TA 3N58A 3NTQA 4K6FA 4RPGA 5A3VA 4IDGA 1JKJA 1I10A 3GAZA 3WLFA 4MKRA 3QWIA 4NNJA 2CD9A 1E92A 2CSUA 3GVXA 3E48A 1P9LA 4RO0A 1KETA 2NVWA 3ZDFA 4BVAA 5JAZA 3H2SA 3BHJA 3GG9A 4WPGA 1LUAA 4XCVA 3C1OA 2VHZA 4JJGA 3KSUA 2X0RA 4EZBA 1LDYA 3D4NA 1PJCA 4MKZA 2BRUA 1I3KA 4P4NA 1CEQA 1V9LA 4DYVA 1DAPA 3DZIA 4CR7A 4CM9A 1BXKA 2ZK7A 1O9BA 4UVIA 3WQRA 3Q2KA 5IN5A 5BSGA 3PYMA 4M54A 4RVUA 2VZ9A 4ZQGA 5TC4A 1VL6A 3GG2A 1XSEA 2E82A 1W73A 2NVUA 4BQPA 5CHEA 5TIIA 2PH3A 2ZJ0A 1NVGA 1SMKA 2FR8A 4E5KA 1QYCA 1HYHA 1AE1A 4W7IA 4GKVA 1RM4A 2XAAA 2X5KO 3CMCO 3V2GA 3D3EA 1AXEA 5A9TA 4CMAA 1VKNA 1SB8A 5BR7A 1TB4A 3FNFA 5FI3A 3ZU3A 4TMFA 1PZFA 4J16A 3TL3A 4P4LA 1F8FA 5L45A 1UZMA 2FP4A 2VCYA 3WJ7A 4GGOA 2C7VA 3TZ6A 2Z95A 4MJLA 4ZN6A 3AOEA 4JCOA 4RVDA 4YRBA 1GCUA 3PYLA 5F21A 2PY6A 1X1TA 2YFQA 1U3UA 3JTMA 1ADFA 2CVOA 4GLLA 1CQIA 4BNWA 4NHEA 3FN4A 1ENYA 2RAFA 2V7PA 3COSA 3EAGA 4ZQEA 3G3EA 4J1SA 3UOGA 1OAAA 1B8PA 5IN4A 2Y1OA 3L6OO 4YRAA 2BLLA 4B3JA 5A1TA 3L6DA 3AY7A 5JMPA 5L95A 4YT5A 1EUCA 4EGFA 1T25A 4Z3DA 1H93A 4XD2A 2Y1EA 4ZJUA 2HSDA 3JCZA 2JD2A 4HADA 2YHIA 4BIIA 1Y5MA 4MVJA 4ALJA 4PRLA 1RPNA 4CM4A 4UVDA 3U4DA 4ALMA 5JCJD 3ZWCA 2JCYA 1Y1PA 3ADPA 3U4CA 4B8WA 3Q9NA 2Q46A 1LXCA 3JQ9A 5B1YA 5I7VA 3QRWA 3GFBA 4TRRA 2HUNA 3GA0A 1LC0A 5T6BA 4HFRA 1K89A 1BMDA 1EK6A 2FZEA 4LK3A 2BI8A 1N8KA 1PGQA 2J6IA 2NSDA 4DLAA 1DHTA 4K26A 2EG9A 4FSHA 2VRCA 3RUAA 3EHEA 3AUSA 3ICCA 4JIGA 5CEJA 5AVOA 3ZU2A 3JQGB 3EVNA 1PGJA 1I33A 3PQFA 3PPIA 3LU1A 4I5GA 4L76A 1SOWA 1CRWG 4L8VA 4BMSA 5BT9A 3O26A 3C85A 3RUFA 2DFDA 3CMMA 4BMVA 4X54A 3RUCA 1UXHA 5DT9A 4Z0PA 1RKXA 1BXZA 2Y1FA 1G0OA 3AM4A 5ITWA 4UUOA 3Q3CA 3ETEA 4BV9A 2WM3A 4YT2A 1PR9A 3TZHA 4Z9XA 4AJIA 5ILGA 3DFUA 3TN7A 1QYDA 4A26A 3RUHA 1VSUA 2OP0A 4BNJA 1I3NA 2X9GA 1HRDA 1PJ3A 3EZLA 3L4SO 2WSBA 3OIFA 3QVSA 3ZNOA 3VKUA 3AM3A 2EP7A 4FFLA 3DMTA 3OQ1A 1LSUA 5LCXA 4BNZA 2PLAA 2YQ4A 2FPPA 1KVRA 4OSOA 1I3LA 5I9LA 1B8UA 3ZZNA 4XJTA 3BTVA 1DO8A 3CIFA 4OH1A 3H8VA 3DONA 3GGPA 2UV8A 4J0EA 3L07A 1MFZA 3OJFA 2CMDA 2WD7A 1ZUD1 4J7UA 4MPDA 3IC5A 3GH3A 4YJDA 4BNVA 2EWMA 4CL8A 3WBFA 4Z6KA 5IDXA 5K6AC 5B12A 4BKQA 3WNQA 1CETA 3GRPA 4CV0A 4P4GA 4UULA 1KS9A 2HJSA 2JJYA 1NHWA 4O5OA 3T4EA 4EDFA 3F9IA 4UVHA 4WCFA 3JV7A 1I8TA 3F46A 1LDBA 4CM4B 2GD1O 1JW9B 1P0CA 1Q1NA 1X14A 4BO7A 1W8DA 4ZRMA 1T1RA 4TQGA 1PQWA 1R37A 1VC2A 4OMUA 2AEJA 3JQAA 4OKNA 3WJAA 5TT1A 3QWFA 4YJFA 5B4UA 5JO0A 1WXDA 3NTRA
chains in the Genus database with same CATH superfamily
1MO4A 3A7DA 3M6IA 3Q3EA 5CT8A 4B4DA 2O5EA 4O4LB 1U2DC 2VZ8A 3ISTA 1I9CA 4JQCA 4FYYA 3R9XB 4D25A 2HCBA 2CXXA 5DEOA 1VBKA 3WBBA 1XNRB 3AOGA 3L3BA 1CJKC 2CHVA 4ESOA 2VH5R 1Z8HA 4WKBA 1Q3TA 2PYDA 4YRMA 5I9IA 2OFXA 3EG9B 3GZ4A 3PVSA 4EZBA 3JYHA 4MQMA 3AH8A 3IEXA 4Q6BA 2WWYA 4B17A 1ES9A 2Z2ZA 3JYOA 2WM9B 3RAFC 2NT3A 3HU5A 4R16A 3COYA 1ZH0A 2XCSB 2EX1A 4ZDIA 1WXXA 3IKMB 1SEVA 1V3TA 3I2YX 1QGDA 3FVWA 4Q7KA 4GBED 2OTCA 3PZBA 1XHFA 2IUYA 5DK6A 1JUDA 5ALWA 1YQDA 4KXFB 5F9FA 2QXTA 1C1XB 3VPXA 4YT8A 2AZ4A 3WWOA 2ZQ5A 1GD1O 3PIDA 3L40A 2LIPA 1XMPA 1KMQA 2YFKA 4MS1B 4DA7A 3KUDA 1ULZA 4JB0A 1XEWY 4BBPA 1JKFA 1VG1A 5CVVA 4P83A 3B52X 3CU5A 4TN5A 3I92A 4LJAA 3IT3A 1DIBA 3I05A 3COZA 3LAWA 1Q0HA 1KI8A 3PPYA 3KTAA 5C37A 2CBZA 3DZDA 4TTIA 1Z2DA 5C1OA 3VPSA 5CBPB 1JFLA 4OJYA 3KAPA 4AJNA 3KEQA 3GUZA 3P0JA 2ZBUA 3SXUA 2CLEB 2JATA 1XKQA 2B1JA 3OFVA 1RXVA 5KSWB 2QAIA 1K7FB 4I1UA 4H7IA 5FBVB 5E0KB 2V7UA 5KNDA 4J2TA 4YYEA 3H2ZA 4XSGA 2CUZA 3JYLA 2BBSA 4MP3A 4CJXA 4MWTA 3IDOA 1C2YA 4WCFB 3OE4A 2IYEA 2VNSA 1H6DA 2ZXEA 5C34B 1OPXA 2RAPA 1Y9DA 4MYHA 1A50B 2GLXA 2SKCA 3ANXA 3PNVA 4JCCA 1MQSA 2A5DA 1TADA 2GH1A 3VO8A 2V0NA 1U11A 1BCSB 4K3VA 4RGQA 2CVHA 4YJGB 3R0IA 1EAMA 2ZTUA 2IUTA 9GPBA 3SHQA 4MS4A 2WYOA 2Q3EA 4HFMA 4WOBA 2ERYA 4YAKA 3NNDA 1ETHA 4IO0A 4U2DA 2P9YA 3H5AA 3CE9A 2QTCA 5DX1A 4B2PA 4ZYWA 1KGSA 1RNLA 1Y3IA 2LDBA 1AMUA 1ORDA 1H0KA 1ZN7A 5DGHA 5BUSA 2ZYUX 4Q1CA 2WU8A 5KBYA 1S1CA 1V26A 3ZLVA 3KVYA 1ZJWA 5CG2A 1JI0A 3HO6A 1R0SA 5IK2A 1FYEA 4EK9A 3FOAA 2OD2A 2AJDA 2NIPA 3BL6A 3GD5A 1HOTA 5FJJA 2YBEA 3B89A 4PX5A 2GAOA 3OWOA 3QBVA 1OKKA 2OESA 3G59A 3Q5EA 4RJIA 2VPTA 5TQ2A 3SEFA 3OF3A 3EVCA 5JJ5A 5DCYA 1IIBA 1P2TA 1ZJ4A 1PR4A 4FHCA 4O8ZA 3RTBA 4OBEA 3GPIA 5TMDA 4C0KA 1NVBA 1UDXA 4CM5A 1WUTA 1QX4A 3KZVA 1R8SA 4WKOA 5AM4A 1LLQA 3SBXA 2OECA 4Q02A 2CSXA 4MICA 1K6JA 1VKOA 3A6ZA 3ASYA 1ZGAA 3DZBA 5FX2A 4KIGA 4NAUA 3TTWA 3ZVMA 3L7LA 4TPKA 1YS6A 7MDHA 1FP4A 1WXEA 3O38A 5FWYA 1MP0A 3HGQA 2XMZA 4TMWA 4M7WA 1BFUA 4BX3A 2FG5A 3ROXA 2OWDA 2FW0A 3A31A 1SWVA 2IHVA 2VC2B 3BWEA 4LVOA 3AY3A 4JBXA 2UZ0A 3CNHA 1B15A 1YKSA 4B71A 3SZRA 1RZRA 3ZUPA 4GVLA 3TQHA 2ZRDA 1CVRA 1Y8CA 3DV0A 3F71A 4PFSA 3DZGA 2H07A 4GYJA 3BSFA 5E4YA 3TF5A 3P0FA 5EXSA 3ZKAA 1XLUA 4EY7A 1XTZA 4EUHA 4FB5A 1R9GA 5KSYA 1H4VB 2AMLA 3JD0A 3LX6A 2JI4A 4HNQA 3SBDA 1P6XA 3VKHA 1WSBA 1MW9X 1IL0A 1SD5A 1XHLA 3IP9A 1E6MA 1JLMA 1O54A 2IXGA 3EDCA 3Q88A 4LXYA 1WV1A 1UXGA 3U26A 4B6PA 3UK1A 5IVKA 2HK7A 3M8KA 2EKBA 3H2YA 1YOVB 2H1WA 3AHHA 4LQ4A 1X3LA 2ZR7A 1GTSA 3BWXA 3TE6A 4CMIB 1W25A 3AR3A 4CMBA 4MA0A 4PZZA 1M7GA 4ZK6A 4UCXA 1RC0A 2I7CA 4O4IA 4MVJE 3W77A 5A1JA 3FGZA 4HMQA 4RHFA 4OHMA 4ER5A 5L4SA 2EV9A 3BD6A 3NEPX 4ZMSA 2OBFA 2PGLA 2WKQA 4CQNA 2BISA 3PL5A 4PZ0A 4E2XA 1D4FA 1XDUA 1GPYA 1V0JA 3CUWA 2X5OA 2Z2XA 4KXXA 4CEIA 4JLJA 3KKMA 1PUXA 3ESDA 2VJKA 5CLLA 3WFIA 1WUHS 4OHYA 2LDXA 3KQSA 1ATZA 1B7GO 4RMNA 3UCXA 5LD2C 3TKYA 4AZ3B 1M2WA 1XVLA 4QARA 2K7FA 4I99A 2OXCA 3GJ6A 5BOSA 2WIDA 1WCV1 4URVR 1XMJA 3QBTA 3GFSA 3GVHA 3B7PA 3FVRA 5CA1A 3ETCA 2BSAA 3WHIA 3GFRA 3A4NA 3TAXA 3KZ1E 1ZM4A 5IYZF 1OHHD 5F35A 4TWZA 3TRJA 1R10A 1P1FA 2C92A 1EP2B 1EVYA 1CUVA 1ODJA 5B1SA 2IS2A 1MDFA 2P7HA 3ICEA 2OWEA 1NGSA 4TLCA 5HS6A 4DCMA 5LMCA 2JAQA 2KX7A 2RSLA 4N0MA 1W0JD 4GBGA 2I33A 2I3ZA 3U56A 3IQWA 3VGJA 1DG1G 2ECKA 3K32A 1G7CA 2VXYA 3C6KA 2ENUA 3GJ4A 4PFJA 2A92A 2JBAB 4L57A 2C82A 3KOZA 2JGAA 3R44A 3W0LB 1EBUA 3WLTA 1X42A 2ZFUA 4PC7A 3U19A 3BBLA 3HY6A 1F60A 2C2MA 1A1VA 1YC5A 5I3ZA 5E7QA 1RWWA 4AY6A 1JTVA 2GEBA 2N46A 4YJ3A 1GCIA 1K8XB 2JCBA 5CJPA 4YRNA 2PUAA 4ZQFA 2OV4A 4D6YA 1NMYA 2PLNA 1IZ7A 2LPMA 1MU0A 1LV7A 1U2PA 2JI7A 3DDUA 3PHJA 2FMKA 2CYCA 4DMLA 4DPKA 2IS6A 3JQFC 1W47A 1UBNA 1EXDA 2NXEA 4OU4A 1OH5A 3TM5A 5BSFA 3JWJA 4Z0HO 5DHTA 2ZIXA 4AC9A 5F2NA 1P0QA 4MUJA 4CHGA 4KIUA 3TLBA 5EHXA 2JFGA 2OB2A 2PXCA 1Z25A 3EXIA 2OL4A 4V03A 1JKXA 2XXAA 5KJ6A 1WABA 1XTTA 4HMOA 3O3MB 2GWRA 5KDOA 1ESEA 4FNOA 4IGAA 1DFHA 4ZJYA 3TNDA 8MHTA 1XZBA 4B3SB 2B9EA 5HF9A 1WXHA 1UFKA 2NO4A 4BB0A 2QTAA 3N2GB 1N9GB 2YC4C 1OX6A 1ZK1A 1E9BA 5J2TA 3E9QA 4C6TA 3RIGA 3GLFB 2JAXA 4HDKB 1HBJA 2XDYA 4B09A 4H77A 3EBOA 1E2HA 1NPDA 5C8ZA 1IY1A 3FPGA 5LM3A 1DKQA 2DPYA 2WHPA 2B8WA 2B99A 3RJMA 5K8CA 2VPWA 5KNBD 4KNWA 1OXKB 3DBVO 1E5TA 2IE8A 4E5SA 2XMSA 5LNK1 3MRTA 1AG9A 4PYMA 5AJVB 5EJ7A 4IGIA 1L4YA 4GZ3A 2O1EA 2QORA 1I7SB 1UKEA 3K72B 1TM2A 3C8ZA 3IBCA 4KP7A 4P3YA 5AW5A 2W42A 4IM7A 3JASA 4WN3A 3FNIA 3OETA 4CVNA 4OYHA 1A2QA 5LXTA 4ZV4A 1LWOA 3DM9B 2ZB8A 3RBAA 1Z45A 3HN7A 4NSNA 2FZKA 1KQGA 3T06B 2RD2A 1UAAA 5FF9A 4IJVA 3N76A 3FM9A 4U6SA 3BE8A 3TDKA 3IB6A 4XCQA 1RQRA 4HDCA 3AUAA 1M7HA 1G5PA 4B48A 3P0IA 4YCNA 1M1YA 1E9SA 1F4LA 2HLNA 5IAEA 4M1WA 5SY6A 1N3YA 4F86A 3IIKA 3SMVA 3E2MA 4ZAXA 1ZIOA 1N2XA 4RKEA 3K0SA 5SYMA 3SFTA 1RJDA 5EHGA 1XA3A 4QOJA 1NBEA 4YS6A 4CBVA 3AR5A 2G1AA 3AR9A 4CTNA 2Z5LA 3LKBA 1T2NA 3OQIA 2UYYA 3OQVA 5EUCA 4POOA 2FDRA 1S0UA 3SC2A 1QO7A 4B82A 1RM0A 2JB9A 5CLHA 3T15A 2A9JA 1VFPA 4XOUA 1Z8DA 4HGNA 5H4HA 4OATA 3E15A 3DYBA 4IIXA 3ZK7A 2XE6A 3D2AA 3C3PA 3CRQA 3LKDA 2G5TA 2QSYA 3THYA 5TVGA 2Z43A 5A4KA 3RADC 1U3FA 3AFHA 1CIPA 1GO2A 1Z5OA 2Y4NA 1TRHA 2FPSA 3V6LA 2QY9A 4B3CA 4P2GA 2BSQA 4B3MB 3PNSA 5C0OE 3WKEA 2QM8A 2RI1A 2YYSA 1RPAA 1M9NA 1ISFA 1YCDA 3H4VA 4QGFA 1K97A 1UBSB 5JNSA 3KQNA 1QF6A 4ZOBA 3FCXA 1WTCA 4Y2XA 2IUUA 4HWOA 3HABA 4LHEA 4WJKB 2JAWA 4HLNA 1NI4A 2W2LD 3K3PA 4JVOA 2YZ2A 2W2OA 3A36A 3DAGA 3IR6A 1OZAA 3W1WA 2AXNA 3ZVKA 3S5UA 4BFYA 3MWEB 4DIDA 3FTCA 3LUFA 3E7WA 5E3IA 3LDHA 5L6MB 1LNZA 2FRXA 1W6UA 5JARA 4GS5A 1P2BA 2EFYA 1PJ2A 3LUDA 4FFMA 4RZUA 3VI3B 2O7SA 3ZWMA 1EEXB 4BASA 4EI2A 4CKBB 1N7GA 2P9QA 2EL7A 4GPZA 3RJTA 1KFEB 3SZLA 5ELXA 1V1JA 1FYXA 1FMCA 1W93A 1W581 3NP9A 4JBHA 4NZOA 1ND6A 4Q9NA 3JY6A 5HDBB 2PGIA 4BZZA 4E4YA 3WGLA 2PX6A 2AX4A 2OCPA 2YVAA 3ABSB 5JXWA 5CRIA 1PX2A 4N65A 2AZDA 3P0EA 4QYWA 5TSDA 3UAWA 4D9JA 5KQPA 3L4JA 4NR0A 4URZR 1SXJD 4YQYA 2YXLA 1Z75A 3H11B 4GXNA 4CF3A 2I22A 2H5IA 3VR5A 4R0MA 4B0OA 3C8DA 3RYTC 1LPMA 3SAJA 4DMRA 1VPWA 2O8EA 4JMLA 4RXTA 1MKYA 1FDOA 2CUNA 4LDJA 5FJIA 5LNK6 3FLEA 1GGJA 2PWZA 1CHNA 2P75A 2WT4A 4PNHA 5CT6A 3ZX4A 3TEMA 1KC3A 3A26A 1PSZA 1JR3A 3CEMA 3RFXA 3UKDA 4AAYA 5I7FA 4KU4A 3AI7A 1CPYA 2FX2A 1RLJA 3FFBA 2VYVD 1D1PA 3HYSA 4Z53A 3ZG6A 3TQCA 2GCEA 1NWCA 3R5XA 4JC8A 1QIGA 4MV6A 2AKYA 5H81A 4Q7QA 4OB6A 1O87A 2HN9A 3PNYA 1CCWA 5KYKA 1G66A 4RV9A 3UJPA 2R8EA 3EXEB 3MWFA 4KK4A 3W9BA 1O4WA 3WMEA 2YOFA 2C4NA 1XC7A 5EMKA 4BN0A 1O6FA 4MI9A 2QPLA 1G8KA 1FS4A 3N28A 3LHDA 1OBVA 2F17A 3D4IA 1CY6A 4K6MA 1E1CB 2QAGB 2Z8ZA 4RK5A 4X8HA 5DHQA 3FYUC 3N7UA 1PNRA 2Q2NA 5C1BA 2ZUEA 3FCSB 2WU4A 1TT7A 2NU7A 4JB8A 4QC2A 5C8YA 5DLQC 1WXIA 3NWPA 5E9QA 1MEEA 3H7AA 3UQYS 4QQRA 1DPGA 3RQSA 1HE1C 1OF1A 1YZFA 5AI5A 1PZGA 5F2EA 4W9MC 2ZM6B 4OI0A 4KKVA 1G4UR 3RASA 3OBBA 4G8DA 3CUYA 1KAOA 1XHEA 1ZNQO 1NKSA 2C9YA 3M34A 1GYPA 1I4LD 3L0YA 2IV7A 2VK4A 1MAWA 3IAXA 3ZBQA 4WEOA 4LE0A 2PJRA 1MFPA 1P33A 4LKRA 4DY4A 4KO3S 2BEKA 1MOPA 5JSQA 4M8NE 3Q7IA 1IBRA 2ZM5A 4HWTA 1UIMA 3QYFA 2IHNA 1A4RA 1B0ZA 2WUGA 3BWVA 3MRSA 3QVXA 4MUBA 1JWAB 3HLKA 5GONB 3WLAA 4JI7B 1PU2A 3A6KA 3OZXA 1MZPA 5D6NA 1PQ4A 1WLSA 1ISSA 1W4BA 2O3SA 3PS9A 3RT9A 4XLTA 1SHLA 1NL3A 1EUQA 2OC4A 4NOJA 3VRHA 3TAUA 1EVKA 2ODPA 4YUYA 2J0SA 4HMPA 4B0PA 3HSSA 2AG1A 2CWDA 1RRMA 1S8OA 1TA9A 3N6VA 4ND2A 4OVKA 4TWAA 4W9NA 3ZY6A 4AQDA 4W5OA 4KQFA 2FK7A 1R0RE 1AGNA 1JEQB 4JBWA 3PSAA 5G02A 2J32A 1JPNA 5TQ0B 3TW8B 3ZC3A 4MHTA 1XYGA 1CUBA 1ZZGA 3PIRA 4L16A 5DDIP 2BJVA 4UFPA 2ACVA 2YZMA 1SIUA 5FWXA 1HEIA 3C98A 1TAQA 1JAIA 5G1OA 3TZBA 3H3FA 4EYSA 4F85A 3E9CA 5HW0A 5L7TA 1IEWA 2IP2A 821PA 4L73A 5H5JA 1PL6A 1GLGA 1JDSA 1TO6A 1FFGA 2QMQA 3N5CA 4J4TA 5EZYF 1ANKA 1Z2NX 2FMUA 3HLYA 4XGIA 3SX0A 3WRYC 3C7DB 1ZGGA 1Z7GA 4NCAA 1QHYA 5FOVA 1UDAA 4TTPA 2V74B 1SBZA 2QKYA 4PYRA 1GU7A 2JA2A 4XA8A 4GWGA 2ZU6A 3OCXA 5M29A 2A78A 2BFDB 1J7JA 1RMTA 1QKKA 3R2JA 2YL2A 3LSYA 1TX4B 3DBRA 4JIMA 1KPHA 3DD1A 1PW7A 1NMQA 3LOPA 3OM0A 4KQHA 2PTGA 5A4FS 1GGKA 2N42A 4U8GA 2O20A 1FDVA 3GRAA 4ZVSA 1M54A 2KI5A 2BBWA 3LUCA 3OOHA 5AI8A 4S0XA 1U2TA 2HB6A 4I1RA 1RAFA 1DC5A 1VP3A 4F60A 1O7JA 3ICWA 4QDZA 2ZT8A 3KAJA 1PJSA 4XRRA 3RCBA 5DNUA 3KZKA 2FMHA 1L5VA 2DPMA 4OGGA 1XQXA 3SCZA 5F51A 2QRVB 3I01A 5EJ4A 3EJWA 5G40A 2D8AA 3TZLA 3H5WA 4CLEA 2IOQA 2ZYWX 4DLSA 4TLAA 4EKEA 4ZYXA 5BSVA 3DLBA 3TIGA 2CKMA 2GDJA 2PVCA 2O4CA 1YZUA 5HZMA 2YXEA 1K88A 4C0HA 2Q6LA 3QI7A 2ROQA 2W2KB 5B55A 2Z9BA 4MMZB 3SIWA 2R1VA 3U3RA 4CDMA 4EO9A 5IMSA 5CVJA 5DEIA 2XCOA 1R0KA 2J1LA 1ZOLA 4V0KA 5A0TA 4I4TF 1V8PA 2A1UA 2OO5C 2P67A 5ETJA 3HBLA 2KE5A 2H7XA 2G9RA 3V4OA 3TJZA 1J49A 1M6HA 2QJTA 1UBTS 5LOVF 4XB2A 4PIPA 2EJWA 4FMDF 3CG0A 1D2CA 3C14C 3BUSA 4MXDA 5CFNA 3E03A 4I08A 4WXMA 5AVWA 2GA8A 1DBQA 2J9XB 3NM6B 4MYTA 5IEJA 2C8KA 2W2VA 4F9EA 5BQOA 4N8DA 2GYYA 2JIBA 2R6AA 4MYDA 4J1NA 5IKMA 5ALXA 3QWHA 2WFAA 4P5EA 5DXAA 3DLHA 1C1XA 1QS0B 2G8NA 4JU9A 3FTDA 1K7SN 1AS3A 5CK4A 4CG2A 3JZAA 4BGDA 4UPEA 3W5DA 1OZFA 2QLTA 1GQYA 2Z98A 1KBZA 4EG8A 1YF3A 3GIDA 2VUUA 3OZIA 1E5LA 5KTNA 4F4FA 4PLGA 1M83A 3KVRA 1NF8A 5KWEA 2GJSA 1FBTA 4I3FA 1T9DA 1R9NA 4ME6A 4ZICA 3NX4A 2VK1A 4OIFA 1A8UA 4BNTA 3WLLA 3QQPA 3M5CA 4P7BA 4RD6A 4D6XA 4BLQA 5T64A 2D1SA 4MZXA 3DZHA 3K9QO 4MV9A 3K0FB 2H9IA 1D4ZA 4FD2A 4LMAA 3T7DA 2VHJA 3DDCA 1N6NA 4BVJA 2YS6A 3HP1A 1BC5A 2WMOB 1C3OA 2BTEA 3O4GA 3KVVA 1Y7TA 3AGQA 3OU7A 4ND3A 2I2FA 2V6BA 1COZA 4XFKA 3ZJUA 4EF4A 1P0IA 1XG5A 1E2DA 1NDQA 1Z5ZA 2G8LA 2IU6A 2JKYA 3D2CA 4M2LA 4Q39A 4R4JA 4TGLA 2BHLA 2W2MA 1MENA 4OM8A 2PAAA 3A37A 4XARA 5CCDA 3FOFC 3FNQA 5EZ6B 1W5AA 3D8NA 4GPTA 4YJGA 5IT4A 4LFAB 2OXRA 3EUWA 1EFRD 4XYGA 1JA0A 1KEZA 4ZT3A 2RKBA 1Z4MA 1ZIXA 1UPBA 2Q2VA 5M2QA 5CTJA 3FTFA 3LX4A 1L4NA 4GBJA 1G2IA 3OJOA 4JODA 3FVVA 1BW9B 1WPGA 3RFVA 1CUDA 1VJ1A 3GL9A 4RVCA 2B5OA 4OMCA 4JVMA 1HLDA 1CS4C 2RHLA 1U02A 4PC2A 4M9QA 2EGHA 4TSFD 3CVJA 3QPWA 3U17A 1Z6QA 4MEBA 4ZZ2A 1PGNA 3R7FA 4Z0NA 5G53C 2RGBA 1TF2A 5E2IA 2R2GA 2FJUA 3OIUA 4GC5A 4HAXA 4NDZA 2X0DA 4ABYA 1NUSA 1PL7A 3A1CA 4JYCA 1ZJ6A 4KQWA 2WFZA 1E99A 4YUZA 1TZKA 2BD0A 2F2TA 1AKNA 1VGVA 3NHZA 2WI8A 3OM8A 4DIUA 4RTSA 3A2MA 2PJZA 2WAYA 2WJIA 4F71A 4ZTBA 4X7MA 3BQ9A 1GFWA 3D2LA 4KR0A 2BKLA 2QRMA 3KTDA 2XUGA 2RHWA 3GJRA 1WBJB 3TQQA 2VNKA 2R96A 3A0UA 4DA9A 3F3KA 2BAGA 5EGSA 3IE1A 4N54A 3V8RA 2PZKA 3FMFA 3AIIA 3HMQA 2R7MA 3SG0A 1I2DA 5DX8A 4KN9S 4MKGA 4C2BA 4DUYB 1Q0SA 3MM4A 1JSLA 4Z54A 2DSTA 3HL4A 2Y1GA 3HRKA 2O8EB 5KOHB 3EFEA 4D9NA 1GUFA 3NTXA 1V9CA 4PANA 1H8HD 3K1TA 4M49A 3QV1A 4FXOA 2R5FA 3DMDA 3CRRA 4RH1A 4ZOAA 3FPAA 3RC9A 4HLQB 4KQEA 4F3NA 3PPWA 4H4EA 3OQ6A 1P44A 1IQPA 3DMFA 3IP1A 4EB0A 5IDQA 4MVJM 2EFGA 1Q7CA 4PGAA 1XJ0A 4U4AA 4MI3A 4QASA 4RORA 4YQZA 4BWYA 1Y8AA 1U2GA 2O7NA 4B3GA 1A2OA 1EWVA 1U9IC 2B1RA 3ZDRA 3MBOA 4GUDA 5CXXA 2Y0EA 2XITA 3GNTA 1V43A 1FFHA 1Y5NA 1IM5A 2SKEA 3KYDB 4RMHA 1TYCA 1W5EA 2X19A 2C4KA 3EZFA 4L0MA 3TDMA 4F3CA 1JR3E 4PM4A 5K3CA 1GNLA 5EJMA 4BMXA 2B0CA 5JWRA 4FWBA 4JLWA 1G2PA 3E35A 1KA9H 1TT5A 2C5HA 4C4RA 3IEMA 2ATXA 4NK4A 5JROA 4IMJB 5KHAA 3TGPA 4Z4EA 1G8HA 3AX6A 4C4AA 3KZNA 1JIJA 4Y6OA 1PD1A 4TQAA 2MU1A 2QIPA 1QB8A 2Z08A 1MNAA 4YMVA 4US0R 4F9TA 4MVJP 4XDZA 5IT9A 4U2KA 4DV6B 4NV3A 1N1DA 5ICEA 1GRVA 4NXNB 1KVSA 3OU6A 4FGUA 4Z86A 3KQKA 1HNXB 4HEJA 1BGVA 1MB0A 1POXA 2GAAA 4DJAA 3W4IA 3WJ2A 3ZE6A 4NULA 5LMUB 1JH9A 1TQ4A 4QRDA 4CG0A 1XYVA 2H8GA 2ILTA 2GM3A 4QVKA 3MWKA 4BVEA 1WE2A 2PRSA 5GJVC 4Z7JA 4D9BA 1DQSA 3RS5A 1EWYA 4A16A 3NEJA 1R8YA 1XTKA 3F96A 4C4TA 1BDHA 4YI3A 1RM5A 1Y42X 5KSPA 4UM9B 4ZFNA 1U7XA 3NTUA 3VV3A 1WUYA 2FLKA 2A0KA 3CLKA 4H1VA 4WKGA 4RSMA 1ZIPA 2O0KA 3OESA 3L5OA 4GM4A 5EJ5A 1RHRA 3F6CA 3ITDA 3THWB 4OGFA 1NU6A 4TQ9A 2O19A 5AKLA 1JU4A 3X2FA 2WP8J 1H0RA 4ZV7A 4OGLA 3OICA 5CX1A 3U9TA 3MFYA 4CETA 2PWBA 3ZHXA 1RWPA 1GTG1 2SCUA 4L5YA 2REOA 3KU4A 2AKEA 4G63A 3SFZA 4P0QB 3O8OB 3BJEA 3C0KA 3GFQA 2AFVA 1Q7EA 4R6XA 4HGQA 4L78A 1N3BA 4PSAA 5IZCC 1CJUC 2JFPA 2GXQA 3I5UA 5CFZA 2WA2A 5FBLB 4FIZA 3O8LA 1ZI9A 3WV5A 1H9CA 3C8MA 3C97A 5DISB 2ZT7A 1A69A 1VSTA 3EVBA 3JAKA 4F2GA 4P0PB 1E0KA 1ZJ5A 2O3RA 2BM8A 4CRWB 3HB0A 4NF2A 2XZLA 4RPCA 2BKAA 2PANA 3IHWA 1KI4A 4RZ2A 1K86A 2CY0A 5IU6A 2VBIA 2WAAA 3P7MA 3FSEA 1T9ZA 4H6WA 1SUDA 5FUYA 5A3JA 2P11A 1BRTA 4M21A 5FIUA 3VU8A 1G18A 3HU1A 1PUJA 4GI5A 4CMCA 1KZ6A 4XEUA 5BUQA 1DAHA 1N32B 1KO8A 4Q4AB 4CV1A 4IVNA 5F3WB 2NSLA 3PV0A 3DNFA 5HG0A 4E5PA 1DFGA 3SHWA 1OT5A 1XE3A 1IEVA 2C0QA 2XGMA 3P8ZA 4XVHA 4ZZ3A 2ORVA 4Q7EA 3VTKA 3WP1B 4ARZA 1Q6ZA 4DRXB 5JAHA 3H42B 2UZ1A 4MQBA 4QYXA 4X41A 3IJ5A 4LYHA 4A0HA 2EFCB 3LL4A 1UFRA 2XRFA 3W5JA 3BB1A 4IGKA 3WISA 3KB2A 2ON6A 4KNVA 4Y6RA 1U7ZA 2YJTD 3P5SA 1JJBA 3VOTA 2YYYA 5J5VA 4A03A 1N9GA 2DPHA 2DUUA 1GJRA 2D2EA 3EGDB 1B93A 3K31A 1LJUA 4R2KA 4CZ2A 2CLFB 4Y67A 4AI6A 4LTNA 3FOCA 3RABA 3GA5A 3LIIA 2QL9A 1TA4A 1XZKA 1J22A 1D2EA 2WR8A 3QMMA 4XQEA 1FBNA 2H17A 5IDYA 2LR0A 3CLSD 3WQQA 2O0JA 1OPRA 3GXOA 1QDLB 1E98A 1NIJA 1A8HA 4FGSA 4LW8A 4MJ7A 5DO9A 3U3KA 3PSHA 1YI8A 2QR5A 2Y92A 1DAOA 5DNYB 4DSOA 2QYHA 2DEUA 1XK6A 2BFFA 1G6KA 1SH7A 2IODA 1OIXA 3G6WA 3VR3A 4G5RA 3K0KA 1OX4B 3CCCA 3MSXA 4OXYA 2ZTMA 2V0CA 3KSDO 4QPCA 4TKVB 2CLDX 3O8BA 4QUGA 4H7EA 1UPFA 4JP5A 5JSFA 4Z7OB 3CQ9A 1WW8A 2CF5A 1VMKA 4G81A 1KXJA 3HU2A 4GZLA 3RWMB 3KRTA 4QECA 3Q85A 1SCQA 3IO5A 5DYNA 2XUPA 1R66A 1M66A 3PGJA 4HB2A 3DWEX 4PHFA 4BLPA 1DVRA 2JAPA 2UVDA 1WZEA 2QZJA 3NAGA 1ZL0A 1ZVKA 4RK7A 2CC2A 4FE3A 3P2IA 5A5EA 1UT8A 5BYAA 4MCJA 5BW5A 5JRDS 5IYZB 3JVVA 2GN2A 3INGA 1VSQA 2WB4A 3V42A 4EPXA 3WK8A 2XX3A 2X76A 2JEOA 1SOUA 5FLXA 4RQBA 1FSFA 1J09A 5FWNA 1IMOA 4RVSA 5D51S 4Z4IA 1NM5A 4Q34A 3CO0S 3V6MA 4EGJA 1XPUA 2EKPA 4RIHA 4LZPA 1WOYA 2CJWB 3HJNA 3C3KA 5HWSA 2JLUA 3N8NA 1QWOA 3GRCA 2PIAA 4HDSB 2ANCA 3LVRE 1A5AB 4G0ZA 5REQA 3RUEA 1YRWA 4YP7A 2V1XA 4OLJA 2G4CA 2UVPB 1U3WA 3T7CA 3BMQB 4C5BA 3CVWA 3KK0A 4ZYLA 3L0CA 4XD7D 2PUEA 5T3YA 3R6DA 1OSNA 4RD2A 3KHUA 1IHUA 1RJFA 2CB9A 4TMVA 5ED4A 1M2VB 1REQB 2QGZA 2I6TA 2XVMA 5BSTA 4CFYA 3NT4A 5HK9A 3ZZ1A 4ER6A 1Z4NA 1E6WA 1W48A 3ECCA 4G5HA 1GZUA 2DKNA 2G5GX 4UREA 3IODA 5T57A 3PC7A 3V46A 3VNBA 3TBFA 1UZAA 4MLPA 4UFOA 2MT9A 4O0LA 3ZCVA 3Q12A 3JYQA 4K2AA 1N25A 4UBIA 1I5RA 3MWEA 5FPYA 4W82A 1FVOA 1NSYA 3ST7A 4QUBA 3LZCA 2IX9A 2BP7B 3JQ8A 2FSUA 4HBGA 4ZVLA 2UYCA 1YZKA 2PRIA 3H5RA 1X6VA 1GXSB 1HE3A 4QEDA 3EIUA 4F3YA 4Q4DA 1UPXA 2P9JA 3A4LA 3H9BA 5I7OA 1OREA 1E64A 3PICA 3IE0A 1PJTA 4U9IS 4LSWA 4UHJA 3VYUB 3FETA 4CKBA 3D3JA 1O6ZA 5DX0A 3DYIA 4MUXA 2YRFA 3MUFA 2WTXA 3B5IA 1GPDG 5CNIA 2ZSJA 4TS9A 4XWOA 1GQ2A 1KEPA 2ZRJA 2HPAA 4CIAA 1G9SA 1VHLA 2DBQA 1XUOA 5BSEA 2V9CA 1XF1A 2ZAMA 1K63A 3BWBA 3ORRA 1JDPA 3U2QA 2W6JA 2BE9A 1G8MA 1LW7A 5CTAA 3SLRA 1NRWA 3DGFC 3H11A 4XUDA 4YRPA 5GPBA 4E94A 5BWLA 4O6VA 3QUTA 2AX3A 2QTHA 3NCTA 5JADA 3NHBA 5AVRA 4QU8A 3R20A 4YACA 5CM2Z 4WD3A 2HJVA 2CJPA 1XFAA 3N07A 1FA9A 4S1VA 1R4ZA 4FCWA 4TZTA 3V7YA 4QT4A 3KYCB 4KLNA 1B8VA 1W7AA 1XR3A 1UKZA 4KB5A 2B4QA 3AJEA 1XQWA 3TNLA 1TKRA 1TCVA 1HL7A 2QXUA 3OJWA 3HL0A 2QSZA 3DLPX 4OBWA 2QB5A 2QQGA 4MDHA 1BS1A 3AK4A 2ETXA 2O0MA 2R00C 4NMHA 4X20B 1L2TA 3ZS8A 3H1EA 1ZG3A 4U9HS 4Z2YA 5JG7A 2V3CC 1U2SA 4RSHA 3IJRA 2WE7A 4LZWA 2QX6A 5KVCA 1R18A 5E8RA 4E5MA 1F7UA 2HSEA 3PEWA 2BKEA 1PJRA 5AW7A 1E1CA 3T5BA 5K4AA 1ZRNA 3KJNA 2AOWA 1J39A 4DBLE 4YRKA 1NX9A 3ASZA 4YP0A 4OL9A 1DI0A 1RLOA 3CUKA 1ZMXA 3ADKA 3B8HA 5DTJA 5DTMA 1LDNA 3WLSA 4UPDA 4K2HA 4LVUA 4DLLA 2C2XA 1U9YA 2H2GA 4KPUB 4ZIRB 2OAEA 2B34A 5CGQB 1QC5B 4PC6A 5JYCA 4YVFA 4I3HA 1MXHA 2ZDQA 3R9IA 3BXHA 4RTJA 4TKUB 4XKJA 2J3MA 4YR9A 5DNVA 4R40A 4G0QA 3D3NA 3KL2A 1SKQA 3GP5A 1QGZA 2L18A 3UICA 1HLFA 3AI2A 2CUKA 2JGDA 2A58A 3LF1A 3OE7A 3UUGA 1MW8X 1ZH8A 3T1NA 3D7SA 4N3CA 4Y9RA 3FRJA 1X39A 3L02A 3RVJA 4C4OA 1P4JA 4Z9AA 3RC7A 4YJHB 4FHZA 5AUNB 4OD0A 3I0NA 2XTNA 2XEXA 2VJAA 2ZB4A 2ZB3A 1NZDA 3GMDA 3RIMA 3PIIA 2X6RA 1J7KA 2VTBA 1G59A 1K6IA 5BQPA 1N9KA 4OHPA 1JIQA 2O06A 4C5CA 4YMGA 3BAZA 2R3SA 3NVMB 3SHOA 1XEXB 4WEQA 1SXJC 3DLAA 1L7PA 3M6XA 4BKRA 3FZNA 3K30A 4CODB 4EY8A 3MINB 1JEQA 1K98A 4BLOA 1JXMA 5TQ0A 3FPSA 4F3KA 4M0DA 2B83A 2HM7A 3VSAA 1SBQA 3QPAA 1L6RA 1WF3A 2VAXA 2ZE6A 3NATA 1FMFA 5BQXA 4YROA 4XFJA 4JDPA 1CRLA 3HVKA 5EC8A 3W2TA 5LQDA 3DYVA 1O6GA 4AS2A 3DEFA 1WMEA 3A2KA 3PZRA 3ILSA 4O2LA 3ZIDA 3GBSA 1KR2A 1YE8A 3KQYA 1T8YA 1A4UA 1DWPA 3PBKA 4H27A 4R9VA 3RYIA 4LPSA 1KVUA 3KQHA 2FKNA 4R71A 1K4KA 1W76A 3R5SA 3QMPA 3DMYA 1KQ3A 1Z7EA 721PA 1HZJA 3CEAA 4R2WA 4UUPA 3ZOKA 1IIRA 1J0AA 2BFDA 3N6XA 3PKIA 3K9LA 1C7JA 3C3BA 1CDEA 3Q3GE 1ABFA 4UPVA 5D2CA 5KCZA 2YY5A 4UHFA 1R3DA 3P27A 3ZH2A 2NUTB 4BVGA 4PAGA 4ZA2A 3GYBA 1BROA 1G6Q1 4YRDA 3UA4A 5FCDA 4P6VF 3F6RA 4NJEA 2IEBA 5BR8B 3GJ5A 4M0CA 4IEIA 3ITEA 1U0TA 1XBTA 1NKVA 2HTFA 4ZCPA 3FJOA 3DTVD 4QYMA 4BLUA 4C04A 2HQBA 3ZYZA 3VGPA 1T2AA 2BBTA 2BMJA 2LBPA 5KKAA 2R4TA 5DYTA 5BVGA 4HDAA 1F0PA 1NY5A 1UK6A 2KLBA 4NX2A 2O3UA 2C8VA 4OMDA 2QE7D 2Z57A 4P86A 4OSPA 1EFHA 4O8CA 2NQTA 5CDFE 2W2KA 3ZU4A 4NS4A 3HRIA 1P62B 3ZTTA 2ZB2A 4EPTA 4MP6A 4JGGA 4KODA 2Z3VA 4I9UA 1HTTA 4LRTB 3LQKA 1T3TA 2GN8A 3JARA 4X00A 1G4HA 2AJTA 3CH7A 5AVZA 2ZZMA 4NYJQ 3DSRA 2ADOA 4ZCLA 4MWEA 4X6UA 4Y1FA 3PDJA 3VSDA 4HWPA 4I3GA 2CCGA 2PXAA 1BD4A 5CDYA 2ZPTX 4EKGA 4UCFA 4MP8A 1EFKA 2ACEA 3ZD6A 3HCBA 3L84A 3PWTA 1WMDA 3GLFE 3GARA 3A1DA 1MA3A 2GLTA 4ZT5A 1W8IA 1BMTA 1QS0A 3F97A 2IUSA 3N8HA 3N7TA 4R01A 1DKLA 4BEVA 1YT5A 3RUPA 4FSDA 1G1MA 2RFLA 3GUCA 3KCNA 5JPIA 4OGWA 3ZGLA 4REQB 2YOHA 3ANYB 3VDNB 2Y68A 3IXLA 2G7ZA 1QGYA 1T8WA 1R0CA 5AK0A 1U0EA 3QM1A 4ZOCA 2ZIWB 4YB8A 4BO4A 3VA7A 2VUIB 3ZZ0A 1KAEA 1H1LB 3RR2A 4JJEA 1EQAA 1O6BA 2POQX 1P19A 1JDBC 1OZ0A 2Y8EA 4F6LA 1NF2A 5LB2A 3IURA 1DAKA 2FSFA 2ZUBA 3K0FA 2QN1A 4KC0A 4NV1A 3KPWA 3ZXUB 1GUZA 4ZC1A 3TUZC 3OEYA 3LI2A 2X0IA 1H6AA 1KI3A 1RQXA 1NJ6A 1ZGHA 4II2A 4L9AA 4Q05A 3W5IA 3HDJA 2X14A 4IINA 4DZTA 5CX4A 2B98A 2FEKA 1W36B 4UTOA 2QBYB 2CF6A 2BFWA 3EVEA 1HEYA 1YVRA 1VB3A 4G2NA 4TYMA 4RBNA 5ADUS 1Z7BA 2BCGY 4KGDA 2MYPA 1BKYA 1MEOA 3UB2A 2XYVA 2AA3A 3JQFA 3W4JA 4Q3BA 2XQKA 1G4AE 3ZVNA 4J0CA 4S0ZA 2E4UA 1KMHB 5C3UA 3OX2A 3ECSA 4G36A 4H1UA 5CJ2A 4NICA 5BSHA 1VPVA 4JX9A 4I5DA 2YUTA 4YLGA 5ALLA 3SXPA 4C7VA 2FUKA 1EXNA 2D4AA 3DDOA 4Q48A 3UTDA 1A5ZA 1Z74A 1A9ZA 2LGJA 2DHEA 5EINA 5KCMA 2ZROA 4GYWA 5CEEA 3IQEA 1PZHA 4OLBA 3MTIA 4DR3B 2JJQA 3GCWA 5B1HA 4PG5A 2VN8A 3L6EA 2VWQA 3KKPA 5KB3A 1C7ZA 3SQXA 2CEKA 2C4TA 3ZLUA 2EIHA 1JQ3A 1MPXA 2QL7A 1Z5NA 3OKCA 4RELA 1T6ZA 1JJVA 3UZUA 2BSXA 2XCLA 1E6LA 2XWSA 4QXMA 4WZZA 3WDSA 3T5PA 1UPCA 1SUEA 2W58A 4U7FA 2NSJA 3HSYA 5TEWA 3L0DA 1NG9A 2RHGB 2PLRA 2ZJ8A 3ZWWA 3FTEA 1GADO 2Y1CA 3HA5A 2XRYA 3FLBA 4O33A 4XVUA 3UMMA 4AKSA 2IPAB 3L7CA 1Z0SA 5BMOA 1TEHA 3CNLA 4BFTA 5AVQA 3LUHA 2Y05A 3WK5A 3I2HA 1PWHA 2IELA 2G70A 1W19A 3PD1A 5CB4F 5LOVB 1SXHA 4JI1B 4TT8A 4HQLA 5B4TA 1ZNZA 1OI2A 4FMDB 2OZKA 3ICPA 3PUXA 3QVTA 4Y98A 3S1AA 3AFMA 4CLRA 1NF9A 3PKJA 3THXA 1Y0BA 1EDZA 2W2QA 3A06A 2V5UA 3HR4A 1TIPA 1H1TA 3F98A 4GM1A 3K71B 1HFEL 5LMNB 3X1DA 4U39A 5CYGA 1C9JA 4DUGD 4HT3B 2CV0A 1G41A 3A6DA 3U7GA 3TKLA 3QH4A 5HFNA 2G6TA 3T5TA 4FI3F 1YK1A 3PL1A 3QG1A 3QKSA 2EFEB 2E37A 4LRXA 3U7QB 1JLKA 4RACA 3GA0A 4N03A 421PA 1MJNA 3PUVA 4WOKA 2B7BA 3KYDA 3HR7A 1J8YF 4WTOA 1JU9A 3N0RA 2W00A 3A2NA 2ECFA 4TSKA 5AI9A 2KLHA 3GJXC 5GIOE 1OVGA 3S2YA 4DHEA 4A5OA 2P1DA 1JGTA 2JPDA 1Y1TA 2PL3A 2ZCUA 1ATIA 3D6JA 4FP9A