3NRCA

Crystal structure of the francisella tularensis enoyl-acyl carrier protein reductase (fabi) in complex with nad+ and triclosan
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
256
structure length
256
Chain Sequence
GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVLPCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase (NADH)
publication title Structure of the Francisella tularensis enoyl-acyl carrier protein reductase (FabI) in complex with NAD(+) and triclosan.
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Oxidoreductase
total genus 86
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3nrcA00
4OOEA 1DIRA 4FS3A 2HUNA 1ADCA 4OH1A 3WDSA 3JQ7A 1P77A 4LW8A 4A73A 3DBHB 4XQCA 3GN2A 4FOOA 4I9NA 5C37A 1YBVA 8ADHA 5F3RA 1G1AA 3C7DB 4OOFA 1X1TA 3JQAA 3GGPA 4MO2A 4CMIB 5IAAA 3PQDA 4XDYA 1S7CA 2O48X 5ENVA 2Q3EA 1NR1A 1VSVA 5I9MA 3DQPA 5JAZA 4R51A 2YFHA 4HY3A 4IGEA 5IG2A 4BOYA 4DIBA 2P4QA 3K92A 2G82A 1K2WA 3LC2O 1P1JA 3PHLA 4XRGA 2FPGA 4CLDA 1LUAA 3DAFA 3QA9A 1ISGA 2X5OA 4PLCA 1BW9A 4IXWA 5DOVA 4E2YA 1VE9A 5TT0A 5U1PA 4F45A 4JBIA 4PZDA 3QW2A 2AG5A 4B79A 3AOGA 4B3JA 3RWBA 2R2GA 4TMFA 3MOIA 3OIDA 1OMOA 5TIIA 3ZWXA 3DEYX 1H93A 1YRLA 1CERA 3ROQA 4WLFA 4AJOA 1TEHA 4KQXA 3SLKA 5CDSA 1HT0A 3LT1A 2J3IA 5KJ1A 3D3WA 3DBLA 1EE9A 4ZHSA 2D5AA 4J4BA 1M76A 5HM8A 3GVCA 1PL7A 2VN8A 4J2OA 4RVUA 3ZWMA 1UZLA 4CM7A 5L40A 1LNQA 3CSDA 3E9NA 2E82A 2YDXA 3GRKA 4U6SA 2NU6A 2WYWA 4CL3A 3TL3A 1KERA 5H83A 2EGGA 4JK3A 4IIUA 2DAPA 3DBRB 2W2KB 4N54A 3H9EO 4H3VA 1A71A 1U4SA 1CDOA 2Y99A 3JQ7B 4CLEA 4JJFA 1D1TA 1EK5A 3JD3A 1SO8A 1GYPA 1Y1PA 4XYGA 4ZQGA 3U49A 4KWHA 1EFLA 1LBEA 2Q50A 4CMKA 1GYRA 1MP0A 3PGXA 1JQBA 4GWKA 3RI3A 2Y0EA 2PV7A 4JBGA 3F46A 4JROA 2DU8A 3DMTC 1EQUA 3I6QA 4OMUA 2PZJA 4GL4A 1YL6A 4EDFA 4UULA 1C0PA 4NH4A 4MVJF 3G0OA 3WX0A 1DHTA 5LCXA 3HFGA 5AOVA 1BRMA 1R66A 2VRBA 1FDTA 3S8MA 3ZWYA 2OXIA 5JCXA 2C59A 3ZN2A 1KC1A 4PRLA 3RUAA 5K6AC 1O8CA 2YQ4A 3RAJA 3WGOA 1XR3A 2C2XA 3K2EA 3GEDA 4HP8A 2DT5A 4O5OA 1U4OA 4DC0A 3HJAA 3WSVA 3ZU3A 2GN9A 2ZTUA 5LDHA 3BHMA 1LSOA 2GGSA 3HDQA 4ZQHA 3DAGA 4P4GA 4X54A 2IZZA 4WGGA 4R9SA 5AXDA 2P9GA 2GDZA 2WD7B 5A02A 1V3VA 1HE3A 3M2TA 3NUGA 4FBGA 3D3WB 3DBLB 4Z9XA 2ZTVA 4XX0A 2O3TA 1P45A 1ZJYA 4M54A 4FFOA 3LT0A 2PZMA 2DPHA 1EK6A 1PJSA 1XIVA 3FRJA 4R5HA 3SJUA 2YYYA 2I66A 3ZZNA 2DBQA 4BNJA 4HFMA 3OSUA 1UXHA 4MVJI 4YAJA 4NI5A 3GEGA 5KVQA 3VPSA 1PWZA 3F1KA 2OO5A 4L4SA 3IKVA 3X2FA 4GSLA 3TJRA 3DC2A 3SXPA 2P2SA 3ITKA 1ML3A 1EMDA 3LLSA 4OKIA 1R0SA 4R54A 4TZKA 4RLHA 5GY7A 5J23A 2D59A 2OGUA 3ANMA 2CZCA 4UUMA 5BSEA 4N5LA 4B3HA 1ZBQA 1GZ6A 3GN1A 1LSSA 3MJCA 1ZO8A 4KUGA 1OBFO 3P7MA 3OP4A 3EGOA 2X0RA 1GD1O 4WLUA 3EYWA 3D4PA 1AGNA 1TT7A 4I9HA 1Q0LA 3L4SO 4BNWA 3NKLA 3W8FA 3QIVA 4A0SA 1AXEA 3D4NA 3OJFA 3RCBA 5B1YA 3FNHA 1DLIA 5DCWA 2BKAA 1XYGA 2HK7A 4EI2A 4WLOA 5B4VA 3PHJA 3SLGA 5EQFA 3JQ6A 5KIAA 1TXGA 2GD1O 1A27A 4CR7A 4CM6A 3KOUA 4DPLA 4I5EA 2YW9A 4KMSA 4CM8A 4EW6A 3KYBA 3H3JA 1O6ZA 1GCUA 1A4UA 4BS9A 2ZB8A 1JU9A 3GZ4A 1PR9A 2PFGA 4J9UE 5CAEA 1E3SA 5JDCA 1PWXA 3D4OA 3KYDA 2QIOA 2VYND 5L53A 4BGEA 1DRWA 4P4LA 1IYZA 3BMCA 1ZH8A 2FR1A 3WWYA 3A14A 1XU9A 4TRNA 3WOHA 2I99A 2CVOA 1W73A 2HDHA 1CEQA 4XA8A 4BNUA 2X0NA 3HNPA 3OH8A 3E6AA 2E4AA 3JQFA 4OQZA 1ZEJA 2E37A 1N8KA 4RDIA 1GTMA 1WXDA 5BNFA 3LDHA 1DJNA 3L4BA 3OICA 5JY6A 3R0IA 4J2HA 4LVCA 3JQBA 1E1NA 4XR9A 4XYMA 4NQZA 4EZBA 4ALKA 3I1JA 3BTSA 3IS3A 1GQQA 3SVTA 3FBGA 3I4FA 1BGVA 1X0XA 4DUPA 4BO8A 3AY3A 5JMPA 1DHRA 1UAGA 4BKUA 1V9LA 1HYHA 5JFOA 1Q0QA 1D7OA 2EERA 4IJUA 5DF1A 4MP6A 3WGTA 2Q1UA 3EAGA 2Y0CA 4FB5A 2BHLA 2VOJA 2AQ8A 1GQ2A 2C29D 4DQXA 3OJLA 1EBFA 4ALIA 4PLTA 1R6DA 1Y6JA 3CZMA 1HDZA 1WMBA 7MDHA 3B20A 1MB4A 5KVSA 3BXXA 3TRIA 1A7AA 3F1LA 2ZQZA 1ENOA 2V7PA 1PJCA 4JP2A 5L7TA 3GRPA 4RGBA 1RM3A 6LDHA 1NX6A 2B4QA 4CQLA 4GGPA 3BMNB 4YVFA 3KYDB 1R15A 1IOLA 3LSYA 4ZRMA 3WS7A 2JD1A 3ZV5A 5IZCC 4J0FA 1U7TA 4Q3EA 1ADFA 4U6QA 5HS4A 3BMCB 3WJ7A 3BAZA 1TT5A 2Y93A 4WPGA 1D8AA 1QV7A 4BNFA 1H6CA 4W4TA 2YV2A 4DWVA 3Q11A 2O4CA 1X7GA 1AUPA 5TC4A 5DT9A 3QRWA 4UUNA 1NQAO 4J43A 1Y8QB 3RROA 2VQ3A 1PGJA 4PIVA 3RU7A 3P2OA 3AFNA 4RVFA 1E6WA 2QHXA 4WCDA 4BNYA 2DC1A 1T2AA 2Y1OA 4R41A 3NGXA 4PLPA 1Y9EA 3V2HA 4G2NA 5C3MA 5CEJA 1ZSYA 1Q7BA 1I3KA 3QVXA 2WM3A 1IY8A 3QVOA 1CIVA 4O6VA 2QQ5A 3PHGA 5I9LA 1B3BA 4AL4A 4E5KA 2AG8A 1NPTO 2B4TO 3HZZA 1R4NA 3EZYA 4AJLA 4YJGA 5L4SA 1I10A 3GA0A 4ROSA 2GR9A 1O94A 3TZKA 4DYDA 3MJ4A 2DUUA 5IDWA 5CP8A 1X14A 1D1SA 4NBVA 1PGQA 4UVIA 1J49A 2GCGA 1UUFA 2DVMA 3I9MA 4W6ZA 4ZRNA 3V8BA 2VNAA 4EEZA 5FEUA 5ER6A 3T7CA 2D3TA 1ZZEA 3HDYA 3HDHA 5LC1A 1BDBA 5I7SA 5K0ZA 3ADOA 4XD2A 4YQYA 3KUXA 1Q0HA 2PLAA 4LSMA 3GF4A 1WP4A 2EXXA 3RQSA 2HJRA 1XGKA 3RUIA 5F1KA 3D5QA 2BFOA 2EF1A 3U3XA 3NDJA 3G49A 4WKGA 3C24A 1QXSA 3ZU5A 1C3VA 1Y5MA 1ZW1A 1JAYA 3PI7A 4PG7A 1EVJA 3UAGA 4AJEA 1T26A 4AICA 5IF3A 4IDDA 3ZV4A 2FR0A 4CMEC 3GZNA 3E48A 1JLLA 2LDXA 3DTYA 4BO6A 2ZTLA 2FSSA 3HN7A 5F1OA 4TVBA 2PKQO 2RBEA 5A3JA 1UXJA 2PKQP 4NBRA 3A4VA 4XB2A 4YCAA 5KJFA 1J4AA 5EN4A 2X9NA 3JQGA 3LF2A 4L0QA 2R6JA 2NWQA 4BNLA 5TGDA 2V65A 4PLZA 2R00A 4NJMA 4D44A 5EIOA 3LT2A 2Z1NA 4W99A 3P5SA 3W4JA 4B4UA 3OEYA 3QWAA 2HMWA 4L9RA 4F6CA 2ZB4A 1WLYA 4BKRA 2IZ1A 3QHAA 1R0KA 4J6FA 4PZEA 3RBZA 4NK5A 4C4OA 1RYDA 5U9CA 3QE3A 5GMOA 4QO7A 5KVVA 1R4NB 4ZQEA 1RJWA 4EGFA 1DIBA 9LDTA 4RF5A 1BHSA 1AE1A 3W8EA 3WGGA 3R1IA 3DOOA 2YJZA 3JD1A 3RVDA 3S2GA 1NHWA 4ZQBA 1KY5A 4A03A 2E48A 3F4LA 1VL6A 1LTHR 5L7YA 3COSA 1SOWA 4DL9A 5JYEA 4U0JA 1M6WA 5TX7A 2VYNA 4O0LA 1QRRA 1B8VA 4E32A 3Q9UA 2PGJA 3ZHBA 2G76A 3JQDA 4CUJA 3S55A 3VKVA 1RM5A 4GKVA 4MVJM 4YQZA 3CKYA 5K9ZA 1GEGA 3DBVO 4XGKA 4HV4A 3RUDA 2V6MA 1PJ4A 1DFHA 4W7IA 4AG3A 1DC4A 2Y1CA 4AJ1A 3AW9A 4Y6SA 2V6FA 3GZNB 3NT4A 2NVWA 1QG6A 1EVIA 3PJFA 3QV1A 1A5ZA 4GMFA 5T8KA 2EP7A 1PSDA 3V2GA 1ULSA 3VAZA 1KVRA 3AWDA 5IN5A 1NYTA 5IDQA 5ITWA 3NJ8A 5DCUA 3L9XA 4JJIA 1K0UA 3JQGB 2I76A 4EUFA 3BMOA 3PTZA 2BI7A 2PD6A 3GG9A 4BKQA 3MJTA 3I3OA 3NDIA 3ROKA 1K6JA 5A9TA 3V1UA 4DLLA 4J7XA 3KTDA 1UJMA 3L6EA 3AI2A 3UN1A 4DTIA 4Z9YA 4U7WA 1ARZA 4YT4A 4P38A 1RM4A 4KWIA 1G6KA 3IAHA 3WIDA 1N5DA 1NASA 1NVMB 1W8DA 1SAYA 1ZCJA 2EV9A 3BYZA 4LRTB 4ZA2A 3FCOA 4D43A 3QVTA 1XQ6A 4JJGA 3O26A 2G0TA 4WE3A 2Q2WA 2WMDA 4ZGWA 5TRTA 3B1JA 3GY0A 2DBZA 2FZEA 1QMGA 3ONEA 4E30A 2AQHA 1IPEA 2VWGA 4IMRA 1HDYA 4PLWA 3ANLA 4L75A 1B16A 1DEHA 2CVZA 3ZGYA 2AQKA 3FHLA 1H0KA 5L9AA 5I7EA 4R01A 3WG9A 1J5PA 1E92A 4TVOA 2WE8A 4XKJA 2TMDA 4OGWA 3E5MA 4CPDA 4RPLA 5KWEA 2D5CA 4XEHA 1O95A 4UVGA 3DAPA 3VDRA 1DB3A 3OM9A 3RKUA 3UUWA 5BSGA 1ZKMA 5JDIC 1TA4A 4DBZA 1AHHA 2ILTA 3RFXA 4BO4A 4FC6A 1NVTA 1H2HA 2G1UA 2RAFA 1LDYA 1E3WA 3AUTA 3U0BA 4R1TA 2BGKA 2JD0A 3Q2IA 3ZNOA 2PTGA 4ALLA 1M75A 3U62A 3IOYA 2JHGA 3PWKA 4PRKA 4YT8A 4GLOA 2WTBA 2YUTA 1YL5A 3JTMA 2FOIA 1SB8A 1EQ2A 1FXSA 3JQCA 3PWSA 2VWQA 2EWMA 3N7UA 1VKNA 2VYVD 3H9QA 4BNIA 1IZ9A 1T24A 5A5FA 3ZU4A 1CETA 3GH3A 1YKFA 4YJDA 3TPCA 5L4LA 3SJ7A 3JQ9C 2W2LD 3G1TA 3BMOB 3OIGA 2YFQA 4DIFA 5G0VA 5ICSA 3BA1A 1VM6A 2O3JA 3EHEA 4WCFA 3SC4A 3ON5A 1V3UA 4CQMD 2ZQYA 4HFJA 5B4TA 4R3WA 3DZHA 3F5SA 3O9ZA 2GF2A 3O03A 3VPGA 4NJOA 4IDAA 1W6UA 4DA9A 1P9LA 4Z9FA 4UREA 5JMWA 3IP1A 2X4GA 1FDVA 4AJ4A 4OSPA 1VSUA 3PP8A 1YJ8A 2J5KA 1PJBA 1ZFNA 4CLRB 4XCVA 3RC1A 3KV3O 3D5TA 1EVZA 2DUWA 2UDPA 3BIOA 3GVIA 3LZ6A 4RPJA 2H9IA 2I6TA 4YAIA 3KXDA 2B0JA 2Y67A 4IQ8A 4IXTA 4D41A 3WTCA 3PJGA 1U3UA 1Y81A 4FFRA 4GPD1 4IDFA 1LJ8A 1Y8RB 3GG2A 3T4EA 4A27A 4OYRA 1P0FA 1PIWA 2GLXA 2C20A 2VT3A 4GKBA 1C14A 4J90A 3HWRA 4NMHA 3CH6A 4D0RA 1P1RA 4RF3A 3RC9A 5A05A 1MX3A 1QKIA 4YTEA 1E3WB 4FQ8A 4PG5A 1NHGA 3O8QB 3AM4A 1P33A 4HUJA 2QRLA 4QT0A 2VTEA 3C3XA 3NTRA 3MCVA 5JLAA 5CEEA 3T7EA 1PL8A 2O3QA 4L8VA 4K6CA 4MVJG 3INTA 3NAQA 3OF2A 1L7EA 1HE2A 4NBWA 3MJEA 1A9ZA 1UZMA 2J5QA 3KBOA 5LDGA 4ND3A 1DC5A 1L1FA 1XA0A 2C54A 3TQHA 4LVUA 3WICA 3CINA 4JXKA 1EUZA 5TJ9A 3HUDA 2EW8A 4CLXA 1DOHA 1U2GA 5JC1A 1YGYA 1Z7EA 3JQ8A 1GV1A 2UV8A 3ABIA 1H2BA 3Q2KA 5BSHA 5L4NA 4GBJA 2J3HA 5EPOA 3GFGA 3ICCA 3PLNA 1XSEA 3A1NA 4MKRA 2NU8A 1P1HA 4A7PA 2PD3A 3RUEA 4LN1A 5EL0A 3D3EA 1PQWA 3K8ZA 1QLHA 3M2PA 4E33A 2VTDA 4CV0A 1P1IA 2RH8A 4RLSA 4Z0TA 3CUKA 2AEJA 1WW8A 3OFSA 2O4UX 2BFMA 3IJRA 4DREA 1WNTA 3DONA 5TT1A 3PK0A 4RZIA 1VI2A 1DIAA 4ALNA 1VJ1A 3GUCA 1DJQA 4RPHA 4RF4A 1P0CA 2EP5A 2YDYA 4IDBA 2D1YA 1NQOA 2HO5A 4BQRA 4DYVA 3K30A 3NTOA 4ID9A 4BMNA 4YBZA 1NBOA 4FSHA 2Y05A 2AHRA 1SB9A 1NTOA 3FR8A 3R3SA 4P4NA 3RUHA 5I7VA 3PZBA 3ZNPA 3E5RA 1CQIA 2FY8A 4KQWA 3Q3CA 1HXHA 2FSVA 1DFGA 1NQTA 3JQAB 1GEEA 2FMUA 1OAAA 4Q9NA 1UDCA 1HTBA 1WVGA 1E7RA 2NVUA 4XJSA 1GV0A 1UH5A 2EG9A 4LCEA 2A35A 2X86A 4R1NA 3FNFA 1CYDA 1FMCA 1GUYA 2GO1A 3H9GA 4IJKA 2C7GA 4XYLA 1YJQA 3K31A 1N1GA 2P68A 4L73A 3VZSA 1E5LA 3CIFA 4R5MA 1BXZA 2HU2A 2NADA 4HFRA 1ISIA 5ILOA 1ZSNA 2O7SA 2PWZA 3LLVA 3MJSA 1BW9B 2AEFA 1HDGO 3E18A 1X1EA 4W9NC 2QYTA 3WTBA 3JQ8B 1JKFA 3DTTA 3DHYA 2RCYA 4XDZA 3TOXA 2DTDA 4W7HA 3U9LA 3W1VA 2CDCA 2IYOA 2VUSA 2VZ8A 3BHJA 4MKZA 2IEBA 3CTMA 3ST7A 2CSUA 5A5EA 3WGIA 3IC5A 4Q39A 4RZHA 4FJ1A 1MLDA 1TVEA 2JCXA 3I4CA 3W4IA 1DFIA 2OOSA 4YR9A 4YJFA 1X13A 2JAHA 5CHEA 1FDUA 4ZVVA 1U7HA 2Y0DA 1PEDA 2PY6A 2YZ7A 3DOCA 4M49A 1YS4A 2ET6A 4WLNA 3ZDFA 2XOXA 2C2YA 4UEJA 3AY6A 3TZCA 2J5RA 2J3KA 1R12A 4GSKA 5FF9A 3RJ5A 5GZ6A 1PJLA 3EZLA 5IXSA 1RWBA 5IDXA 4RO0A 2HSDA 4WEOA 4UUPA 1EBUA 4R3NA 3F9IA 4CM3A 4QTZA 1MC4A 3R6DA 3UCXA 1A7KA 4GGOA 3V5NA 3UVEA 1N9GA 2VZ0A 5T5QA 3ROPA 2VYVA 1ZVMA 4I8XA 1YB1A 4A5OA 4BB5A 1PX0A 1N7HA 4IDGA 2X23A 4DRYA 3RC2A 2DTEA 2J3JA 3H9UA 3DMTA 1EZ4A 3HADA 2W2LA 4XJTA 1LQTA 4CODB 1Z74A 4MJLA 2NVUB 1E7SA 5TQVA 3FNGA 2CVQA 2HK8A 4GX1A 4CQMA 4FFPA 5ER9A 3C1OA 3OJOA 4FFNA 4TRJA 1XG5A 3GEMA 1RYEA 3IP3A 3JSAA 1BWSA 1ZUD1 2EGHA 3GOHA 4KTVE 1I36A 4U8GA 2NTJA 4XYBA 5ENDA 4CM5A 4AVYA 3KEQA 4CMAA 5K6AA 3W4KA 4D3FA 3VPXA 3WFJA 3PRJA 1CJCA 4GVLA 1ZK3A 4Q3DA 1T25A 5ICMA 3KLPX 4J16A 5HTOA 1LC3A 3RJ9A 2OP0A 4Z6KA 4RQTA 1PZGA 3AJRA 4AJPA 3ZWBA 2QZZA 3DHEA 4NFYA 3W6UA 1I2CA 2TMGA 2AQIA 4HADA 1NWCA 4D79A 3GGOA 4UAGA 5G0WA 2WEKA 2VUUA 1BXGA 2E49A 2POQX 4QFDA 3ICPA 3PQEA 1QSGA 4NPCA 4YJFB 3UFXA 1HZJA 2H1SA 3LYLA 4IIVA 1PGNA 1ADGA 2PZKA 3JYLA 2B5VA 1X7DA 2JCVA 2NLOA 4D7AA 2OFPA 3UXYA 1X0VA 4J1TA 5DP2A 1F14A 3WXBA 4BNVA 1Z45A 4B4OA 4E2WA 2WYUA 4J9VA 5TLSA 3L9WA 1F12A 5COBA 4BNKA 5CDYA 2EJWA 2QW8A 2PK3A 4PLYA 4RF2A 5DOZA 4M86A 1T2DA 3TWOA 1LC0A 3NT5A 4IJWA 4S1VA 1IE3A 1KEUA 1R37A 4OXKA 5CDGA 1N9GB 5T64A 3QQPA 4NIMA 2GN6A 5THQA 4B4WA 3VH2A 5HBRA 4YT2A 3H4VA 2O3UA 4J49A 4OSOA 1MXHA 2EJVA 5JO0A 4BGIA 2GN8A 4E12A 3H3FA 3HFSA 4BO2A 1WDKA 5EMHA 1QYDA 2FRDA 2WYVA 5A9RA 1GY8A 4PVCA 1B8PA 3PFFA 3TZ6A 2B36A 3GK3A 1HDXA 5JAIA 4MIEA 4NU5A 4FW8A 3CZRA 5FI5A 3ZU2A 3ZV3A 1BVRA 1YQGA 5BNIA 3BHIA 2RIRA 4PG8A 2XF8A 2AW5A 1O89A 3PDJA 4BO1A 2CDAA 5H81A 1DC3A 4CM8B 2G5CA 4FGSA 4GLLA 1ZXBA 3WGZA 1KYQA 3S2IA 4AJ2A 3QJ5A 2Y1FA 4OO3A 3PVZA 4GAEA 5DBFA 1I5RA 1E7QA 4FFLA 1YO6A 1XU7A 1I3NA 1YOVA 3A9WA 4NHEA 4IMPA 1JA9A 3H5NA 1P74A 4RCVA 5BSFA 4E5PA 3OA0A 3PWZA 3UKOA 3KHUA 2X58A 1ENYA 1R4MA 1N1EA 1O0SA 4FDAA 1NNUA 4Y67A 1B0AA 4QO8A 1CWUA 4FC7A 5FFFA 4NZ9A 3EMKA 5TS3A 4NNJA 1WZEA 4RDHA 1LQUA 2C07A 4MPDA 1J6UA 2GUGA 1LLCA 4MP8A 2IODA 4H7PA 4E5YA 1YBAA 5COAA 3OQ1A 4HBGA 3HHPA 2BELA 3MEQA 3ZWNA 4BHTA 4R1SA 4RPGA 2Q49A 3I23A 3ULKA 1A9YA 3I9JA 1PTJA 4IY1A 4E3ZA 5DCYA 2GN4A 3K73O 1DIGA 5BNTA 4JBHA 5I8ZA 4K1LA 4CM1A 5A1TA 5T57A 2DBRA 4O63O 5AQ1A 4OKNA 4TRMA 1NXQA 2J8ZA 2VWPA 4XIJA 3F3SA 1CF2O 4Y8VA 5EESA 1IHYA 3FN4A 1SZJG 5COQA 1KVUA 2BH9A 1PL6A 2PGDA 3RIHA 3VVBA 5G4LA 3PJEA 4ONEA 4GX2A 2PNFA 1ZSVA 3LQFA 2QX7A 4OIMA 3RSHA 4DXHA 4RQUA 1N7GA 1P31A 2PR2A 2JFHA 1ZK2A 3IQDB 1NAIA 1NWHA 4CV1A 1KEPA 1IL0A 2OL4A 3JV7A 3DZJA 3SBOA 4AJKA 3OA2A 2Q1SA 3I5MA 1KEVA 1A72A 1PJQA 5AVOA 1PZEA 1Z73A 5JS6A 3H9JA 4J91A 3EDMA 2HQ1A 1T2FA 4Y9DA 4CM9D 4CQLB 1YWGO 4DLBA 4BO3A 5HWSA 5IZCA 5DULA 3NT2A 2X0JA 3DL2A 1HDRA 5G0SA 5JPIA 4Z0HO 1NFQA 1B8UA 2OHXA 4AJHA 5B12A 5C5IA 5I8WA 2H63A 1TT5B 1WZIA 3I9OA 2HRZA 3WLEA 4YPOA 1R4MB 1L7DA 2A94A 1UP6A 5DZSA 2ZCVA 3GDGA 1VC2A 5IN4A 3PYLA 1LDMA 1VRWA 4YEDA 1HZZA 1LDGA 4Y6RA 4G65A 2GASA 3EVNA 3GFBA 4DBVO 3GDOA 1I3MA 3AU8A 1HDCA 1I3LA 4N5MA 3WQQA 1H94A 1ENZA 2NM0A 2D2IA 4E2ZA 5KNLA 4NBTA 2ZYDA 1YH3A 5F5NA 1MA0A 3LT4A 4OXNA 4E5NA 3DDNA 3EC7A 1Z75A 4R68A 4S3MA 4NFHA 4YJGB 3ZNNA 3CMMA 4YAEA 3I83A 1LDBA 2P4HX 3C7CB 3ZV6A 1WAMA 3FBTA 4M89A 4E13A 2DFDA 2VRCD 1LEHA 1JVBA 1H9BA 2SCUA 5KKAA 2V6GA 5JO9A 3KYCA 1JN0A 2OORA 5JSFA 1X7HA 5CFZA 4L74A 1U3TA 5KTKA 4K9DA 1E7MA 4XR4A 1FJHA 1JAXA 3WYCA 3IUSA 1OZAA 2DQ4A 4B7CA 1SCUA 1JTVA 2CF6A 2ZB7A 4MVJH 3ZWAA 3ANNA 3HQ4O 5L45A 4MKXA 3ZWPA 3Q9NA 4XRRA 4FJ2A 1K6IA 3DFZA 3DHNA 3E03A 1VPDA 5HS6A 1SBYA 5JAQA 2JFGA 5JBIA 4HFNA 4LK3A 4GH5A 4KP7A 3FWZA 2QG4A 3AUSA 2NTVA 2GZ2A 4J0EA 3GMSA 4PZCA 3GVPA 4FN4A 1P1KA 1V3TA 4DQUA 4D3DA 1LLQA 2BRUA 3C1TA 4I5DA 2CD9A 5AXBA 1XDWA 2Y1DA 3AY7A 1XEAA 2I67A 2EKQA 3FTNA 4FR5A 3TNLA 2Z1MA 2PZLA 4BO5A 2OBYA 2WJPA 4QUKA 4U5QA 2PD4A 5TSDA 3ORFA 4NJMB 2A92A 4ALJA 4CMCA 3WQRA 2NNLD 2YHIA 5L95A 3MWDB 3TFOA 3DOJA 3ZHXA 3JCZA 4BUCA 5GZ3A 4QFCA 2F00A 4LISA 5TJHA 5KJEA 1GR0A 4AJJA 1YVEI 4IQGA 2VCYA 3QWFA 3AM5A 4UVEA 1ZK4A 3DWFA 3OJ0A 5H82A 1I2ZA 3NJ4A 5IDYA 3ZI0A 3RFTA 1IZ0A 2CDBA 4QECA 1BG6A 2CF5A 2JKVA 3A06A 3SX2A 4CL8A 5EINA 3OBBA 5IZ4A 3GC6A 4C7KA 4IUYA 1MFPA 4I5GA 2HAEA 2HK9A 1T2EA 3HG7A 4DIOA 3GPIA 1H6DA 2XXJA 3H65A 3VTFA 2I5PO 1QLJA 3WMXA 4OHUA 3AOEC 1HWYA 4LMPA 3PPIA 1E5QA 4YA6A 1MGOA 4DQVA 3ZWWA 1E3IA 3B1KA 3I52A 1GCOA 1S6YA 4QQRA 4YJHA 3BTOA 1MV8A 5F21A 1PJTA 4B4VA 1DPGA 3N58A 4HNGA 3GT0A 3GAZA 2H5LA 5U4QA 2FWMX 4GX5A 3UH1A 1NAHA 4D3SA 1LX6A 3TF5A 3JYNA 4CMJA 1SEPA 1DIHA 3KLMX 3UICA 4DPMA 3C8MA 1TB4A 5A9SA 3JD0A 4MP3A 3GQVA 3JYPA 3AUUA 3G79A 4DMMA 3ZWCA 3F47A 4RVDA 5CPFA 4BB6A 2GSDA 3WYBA 1K5HA 1U8FO 3E82A 2VZ9A 4IJVA 2C82A 2IZ0A 2D4AA 1ZMTA 4K28A 4I1IA 3BZUA 4BO9A 2YHIB 4EBFA 3BMQA 1GZ3A 4WLVA 4CMBA 5BT9A 2AE1A 2IDZA 2WSBA 5IXYA 2HCTA 3VOSA 4BVAA 5F5LA 3WQSB 1RPNA 4XQEA 4G5HA 3WFIA 3MTGA 2FR8A 5G2OA 1DO8A 3UCEA 2O3SA 2Y66A 3OEWA 1Z6ZA 4EJMA 5A06A 3AI3A 4A10A 1DXYA 3JD4A 3TZHA 2VT2A 2ZCUA 4Z3DA 2W90A 1HSOA 2JCYA 5FWNA 1HDOA 4CM9A 5CPBA 1HYEA 3GMDA 3G3EA 4G81A 1H6BA 4FJ0A 1XHLA 2RHRA 3FTPA 5JDIA 4YYZA 1I2BA 1VL0A 4MVJA 1PJ3A 2YHUA 1YQXA 1U2DA 4DMLA 1T1SA 2O2YA 1HL3A 2OMEA 2JAPA 4PLVA 3FPLA 4UVDA 4DLAA 4EITA 1HKUA 5MGBA 1U3WA 3HB5X 1JKIA 4PFJA 2EEZA 1G0OA 4D0SA 3K5PA 3GNTA 5TF4A 1UXIA 3H7AA 3UCFA 1KVTA 1LRLA 1FF9A 3IIEA 4WECA 1LDEA 4ZN6A 2Q1WA 1VJTA 4EJ0A 4GQAA 1V35A 4BNNA 4YDRA 1CRWG 3DZGA 3IJPA 4HWKA 4OJNA 3WSWA 5A9SB 2Y1EA 1B14A 1B7GO 4B8ZA 2Q1TA 4II2A 1DSSG 3WGQA 3JQ9A 4R69A 4IBOA 4J4HA 4GVXA 4O59O 1JDJA 1WPQA 4K6FA 3RU9A 3ITDA 4WCFB 1V0JA 3D1LA 3O4RA 2B35A 4J1NA 5T67A 5JNLA 4WK6A 1R0LA 2VRCA 2CY0A 3LK7A 4NFSA 2NVBA 3BMQB 5L7WA 1YB4A 1EFKA 1KBZA 1ISJA 4BNTA 2X22A 3CXRA 1HE4A 2O2SA 3QP9A 2DTXA 1ISMA 1YDEA 4Y6PA 3VH1A 1VL8A 3IDSA 3EW7A 4CR8A 5A04A 4NK4A 3NRCA 1E7WA 1Y5RA 1IPFA 5DDIP 1GPDG 4H16A 1IHXA 1GADO 1KY4A 2EKLA 1MG5A 3FWNA 3FSRA 2CNBA 1QYCA 4WLEA 2VHVA 2I3GA 1GQYA 3NTQA 2QRKA 1OI7A 3KB6A 1RKXA 4LRSB 2OZPA 2WD7A 3AU9A 4OQYA 3OQBA 2RH4A 1XLTA 1MG0A 2VOEA 3N74A 4BNMA 3FR7A 4IS2A 2DM6A 3INGA 5KKCA 4R4JA 1BMDA 1T4BA 2XAAA 1JVSA 1UR5A 3PZRA 4ZD6A 4F46A 3EK2A 4P22A 3C7AA 3DZIA 3V2UA 3H5RA 1LLDA 1LU9A 5IJZA 3MWEB 5THKA 2P91A 3OQ6A 1DBVO 3HB4X 3Q6IA 3P2YA 1ENPA 4N5NA 4ZJUA 4QSMA 3K9QO 3GGGA 3P19A 1NR7A 1UDBA 3RC7A 4XQ9A 1NFFA 2X7HA 9LDBA 5TNXA 4A2CA 3AM3A 3Q1LA 4HX5A 1LSUA 2VHWA 1LXCA 3GNSA 1ZJZA 2Q2QA 2X9GA 3RASA 1U1IA 3U4CA 5I9NA 1LSJA 1OC2A 3OIFA 3ZHZA 5IFLA 4DGSA 2PH3A 1H9AA 4UEKA 1RM0A 4BL5A 2DPGA 2Q99A 3LC1O 3ZCXA 2DFVA 3IL2A 2X5JO 1Q7GA 1SOVA 2BGLA 3K2BA 4ND2A 2CMDA 5C7IO 1VJ0A 1GU7A 1KIFA 4KUHA 3ASUA 4WASA 5JAMA 4Q3AA 1KOLA 3DZBA 3M1LA 2BLLA 1MUUA 3WIEA 2Q46A 2AXQA 1XWFA 4ILKA 1Q7CA 1IB6A 4XWYA 3FI9A 2V6BA 2X8LA 1NP3A 4N18A 3ZWVA 1LLUA 3ZWOA 2BI8A 3HDJA 1T4DA 1DAOA 1EUDA 1IULA 3D0OA 3W6ZA 2NSDA 1ZXLA 3LF1A 2BFAA 4Q3BA 2C0CA 3WBFA 4L4RA 1F8FA 3ENNA 3OHSX 5JDCC 2VHXA 1QYWA 2QYSA 4E4YA 5MDHA 2YY7A 4DVJA 4PLFA 3R3JA 3QVWA 5L51A 3CE6A 3VH4A 1E6UA 2QZ9A 3H2ZA 5DP1A 3WMWA 4OAQA 4A26A 1EEHA 2GRAA 1I8TA 1BSVA 4GX0A 2JL1A 4RVSA 4XZ3A 1F8GA 2FPIA 2HKIA 3AUAA 3RKRA 2VHYA 3MZ0A 1PS0A 2IRWA 1JWBB 1UZNA 4B8WA 4RL6A 1Y7TA 3JQFC 4TKMA 2WWRA 5DBGA 3FNEA 4KDFA 1GDHA 5B4UA 4FGWA 1H5QA 4PG4A 3L4BC 1UXGA 4YWJA 1E7YA 2B83A 5JXWA 2PH5A 3JQBC 2EIHA 4PG6A 5KCZA 1HEUA 4IS3A 3WLFA 4MOWA 3KEOA 1ID1A 1NPDA 1I24A 2X6TA 1XCBA 4Z0PA 3VPFA 4BMVA 4NR0A 4XIYA 4MDHA 1WDLA 1MC5A 1N2SA 5ES3A 3S2FA 3QSGA 2NQ8A 3GAFA 3L0DA 1EDOA 1KETA 2ZYAA 4W9NA 1A4IA 3WBBA 4JX8A 1C1XA 1EUCA 1FDSA 3KSZO 3NEPX 1C0KA 4GMGA 4NBUA 1ADBA 4LGVA 4CUKA 1LDNA 1T2CA 1E3EA 3F6YA 4J4TA 2IXAA 1MXFA 4YXFA 2GYYA 3PDUA 2FZWA 4JP3A 1ZMOA 2D8AA 2PGLA 3QY9A 3TDKA 3U5TA 4WEQA 4IPTA 4CMHA 3PYMA 1Z82A 2ZJ1A 2ZKLA 3V1YA 4Z3KA 1BDMA 5G0TA 1JKJA 2NUAA 2IEDA 4LSWA 1C0IA 3I9NA 1AXGA 4HNHA 1O9BA 1VLLA 1ZK0A 4BIIA 2XPCA 3VTZA 1C0LA 3BMNA 4JGBA 1PQUA 3EVTA 4WOJA 1P44A 1WMAA 1PR3A 4TRRA 4YRAA 4MVJP 3RBXA 4J1SA 3STHA 4BKPA 3K96A 1DRVA 4IM7A 3X2EA 2RHCA 2D0IA 2W8ZA 2VWHA 2A4KA 2B5WA 3ETDA 4ESOA 1Q1NA 4YB8A 1GL3A 3FD8A 1JWAB 4YACA 3TSCA 1Y8QA 4Q3NA 4E31A 1O5IA 3WYEA 3DB2A 3NDRA 3QLJA 4YAKA 1HLDA 1YL7A 2ZTMA 1PU2A 4AJNA 1XQ1A 1GUFA 3B70A 4CR6A 3W8DA 4F6LA 4GWGA 4CQMB 5I7FA 4QX6A 3S1LA 3ETGA 4E5MA 2W4QA 3H5AA 1VKOA 2LDBA 4XGNA 4BO0A 3RD5A 5C7LO 1KS9A 4BQPA 4J7UA 2DKNA 3ZW9A 5KOIA 1QYVA 1ISHA 2OUIA 1AHIA 5CG1A 1NFRA 2AEMA 4UEOA 2GPTA 4OM8A 2JJYA 1ONPA 1BXKA 1E1MA 5CDUA 4D45A 1OFGA 4EUHA 3VKUA 1T1RA 4PN3A 3HSKA 2BFPA 1C1XB 4WOKA 3KETA 2X9VA 4FOSA 3ZW8A 4BNGA 3HN2A 4J1QA 3WNVA 3VPHA 3SEFA 2Q4BA 3BTVA 3DO5A 5DN9A 4DPKA 2DLDA 4E0BA 5A03A 1BXGB 1FDWA 3PHIA 2Q4EA 2EW2A 3B1FA 3GHYA 3VHRA 5JE8A 3F5QA 1KC3A 4M87A 2ZIZA 4BO7A 5EJ2A 3WB9A 2JD2A 3F4BA 2NTNA 4YT5A 2YV1A 2B37A 1UAYA 1ORRA 3KO8A 3NYWA 4I08A 1QP8A 4BV8A 5KJ6A 4LMRA 4URFA 4RJTA 1P1FA 1PQPA 3RFVA 2P5YA 1GYQA 3VZPA 1QR6A 4TSKA 1JW9B 3UOGA 1GZ4A 3U4IA 2Y68A 5JC8A 1M66A 1U9JA 1XKQA 1W4ZA 3ASVA 1B2LA 4TZTA 4ND4A 3GNQA 1HETA 3M1AA 1QV6A 2B69A 3VDQA 4HXYA 1ZK1A 5EERA 3ETEA 2OP1A 1HE5A 2GERA 3DZKA 5ADHA 3WNQA 2R00C 2C5EA 2Y1GA 3PFWO 4BNHA 3JD2A 3BTUA 4RV9A 1I0ZA 4TKLA 1E6EA 5FYDA 3DMYA 4Y98A 4FIZA 4CM4A 2CUKA 5KJCA 2HMVA 3UHAA 3E1KA 4WJZA 2UAGA 1I01A 4BGUA 2PA3A 4PLHA 4AJIA 5G4KA 3U4DA 1IUKA 1B15A 4KTTE 4I9UA 5BQFA 1KVQA 4K26A 3DFUA 3OMLA 2X1HA 5BR7A 4MIOA 3UF0A 1M67A 4ZICA 2C7VA 2AMFA 3GVHA 3L07A 4PVDA 5JCJD 2HRBA 3C1AA 2JFFA 3PGJA 3KVOA 1U3VA 2BMAA 1YOVB 1Y9AA 3PEFA 4CJXA 1DC6A 3VVCA 4E6PA 3CEAA 3GR6A 4M1QA 4O1MA 1FK8A 4WUVA 4KOAA 4UUOA 1E3JA 1NQ5A 4MVJD 3KZVA 4BGVA 4FFMA 4H15A 4NDNE 2HLPA 1D3AA 4BKOA 3TFQA 2FP4A 2QRJA 4QXMA 8LDHA 3GDFA 1ZNQO 3NGLA 4ND5A 1WDMA 5C7OO 4F3YA 1NPYA 2Z5LA 1V8BA 3VZQA 3TOZA 5FI3A 5GZ1A 3RUCA 3ZNQA 4LCJA 4B7XA 4CUZA 2EKPA 4IZIA 3M6IA 4OXYA 1MFZA 3VZRA 4MIYA 2I9PA 1GFSA 1NVGA 2ZB3A 5T8KC 5HRUA 3QVSA 4FCCA 3KM0A 3OETA 4IQ0A 4AFNA 2Z95A 1W0CA 1E0DA 5AYVA 1HYGA 1TLTA 4KZPA 1KEWA 3JQAD 3JYOA 4ALMA 2UUPA 3INRA 3DZFA 4ZQFA 2VHZA 4J7CA 3WGYA 5JYDA 2BF7A 2GZ1A 2GZ3A 2NU7A 4YRBA 1R16A 1LRJA 3MTJA 4E21A 1QORA 3OJEA 4CM4B 2O7QA 3GVXA 2AA3A 4MVJE 3ONDA 5EQDA 2HMTA 1UP7A 4JNKA 4BNXA 1EVYA 1I33A 2AE2A 2IXBA 3TL2A 1F0YA 1U28A 5G4KB 6ADHA 1HF3A 1C1DA 2C5AA 2VNSA 2W98A 3JYQA 4GI2A 5DNAA 3VH3A 5B37A 4R9RA 1E77A 2UUOA 1NM5A 2FHSA 2HMUA 4EUEA 2X0IA 1PGOA 4XB1A 2B4RO 2P9EA 3TZQA 1PS9A 1F17A 4M8SA 1UDAA 2XXBA 4JCOA 4PGFA 2Q45A 2ZATA 4JLWA 1OC4A 2HJSA 2E6UX 4DC1A 2VUTA 1YONA 4CMGA 3PIDA 3ADPA 3H2SA 1YE3A 7ADHA 4II3A 1DRUA 1YB5A 4PLGA 4W82A 4CMEA 3AFMA 3ONFA 1U5CA 1BTOA 2HMSA 3GUYA 3EY4A 3DR3A 2O23A 3AK4A 4YAGA 4JQCA 5AXCA 4EJ6A 4I5FA 3U4HA 1G0NA 4XQGA 1K89A 3I9LA 1PS8A 1Z7BA 3LC7O 3ZH2A 4ITUA 2YQ5A 4KUEA 4WNCA 2JHFA 3L6DA 4B7UA 1B26A 2IE0A 1F06A 3VC7A 4QEDA 2ZYGA 1SNYA 4U0KA 2NQTA 1GUZA 3Q0EA 2BD0A 5ITVA 2I3AA 3QWIA 5AXAA 5HA5A 2NU9A 1BVUA 4KDEA 2PKRA 3UW3A 2X5KO 5A3VA 2BGMA 1PJ2A 2J6IA 3E8XA 1X15A 3I9KA 4IDEA 4YRDA 3WR5A 3CPSA 3JQEA 4C7JA 3LVFO 4R1UA 1LRKA 1P3DA 3WGHA 1QYXA 3E9QA 1XELA 4EYEA 1K6XA 1PZFA 4WCFC 3NX4A 5CG2A 1EE2A 3A28A 4MINA 3S2EA 2FPPA 1E3LA 3KYCB 3B6ZA 1V6AA 3PJDA 3PLRA 4UVHA 4BNZA 1LI4A 1WWKA 2ZK7A 4JIGA 1UP4A 2Q2VA 2O3RA 1SC6A 5G0UA 3D64A 4INAA 2CFCA 1C1DB 1CQJA 4CLOA 4CLRA 2WD8A 1YDWA 1SMKA 3LU1A 4Q3CA 1ONNA 3MJVA 4B3IA 2F1KA 4FPXA 3NV9A 1ONOA 2IYPA 3PQFA 3K6JA 3CMCO 3FF4A 3HE3A 1SPXA 3I6IA 4P8RA 3FPCA 3L6OO 5KVCA 3GLQA 3ENKA 1Y8RA 1TI7A 3IKTA 2NACA 4RPKA 3T4XA 1EDZA 1OOEA 4L76A 1LA2A 1DAPA 3DXFA 3H8VA 2O50A 4E2XA 2I65A 3IUPA 4XYEA 2OBNA 3DBHA 3PXXA 4L4XA 4D42A 1ULUA 1PGPA 1E1LA 3G1UA 3UGKA 4IZHA 3MOGA 4BMSA 3O8QA 1HRDA 4ZU3A 4M55A 4CV3A 1E1KA 4CV2A 4CLHA 3OECA 4CMIA 2UVDA 1B3RA 3EUWA 4J3FA 5L3ZA 3WJAA 3QWHA 1YXMA 5CEFA 4IGFA 1D4FA 4IDCA 3C85A 4TROA 1DDOA 1HLPA 4OL9A 3KRTA 1YBMA 1N92A 4WNIA 4FD3A 4N7RA 1M2WA 4TWRA 3AI1A 4PCVA 1ZEMA 1AN9A 5ILGA 2G17A 3E9MA 4HKTA 4D46A 4ND1A 4XGIA 1GPJA 1Q2XA 3RBVA 3GHHA 4NU6A 2DBVO 2UYYA 3PYXA 3G17A 2EHDA 1HSZA 5DBIA 1K3TA 2WE7A 3IMFA 1J0XO 2H6EA 5JW6A 5JCJA 1PZHA 5JY1A 1U8XX 1DLJA 5F1PA 1YQDA 2P5UA 3GPDG 4BV9A 4RVGA 4RVHA 3ROMA 3AOEA 3H6KA 3QWBA 2P9CA 2ZJ0A 2WDZA 3WWZA 4CLOB 1ISFA 1GAEO 1SEVA 4JN6B 2NV6A 4RORA 5T6BA 3SC6A 2A9FA 2FN7A 3KSUA 3L77A 3TN7A 2YV3A 3U09A 4YJHB 4NG5A 3V1TC 4EEXA 4IINA 5CDTA 3ZHYA 1H6AA 5A4DA 1M6HA 3D7LA 1I30A 1U5AA 1KVSA 4TQGA 1UXKA 3RUFA 3PIIA 3PHHA 2GNAA 4R16A 3O38A 3DBRA 1ZIDA 2W2KA 3KSDO 1I32A
chains in the Genus database with same CATH superfamily
2HXGA 5JJKA 4ZI7A 3WDSA 4YX9A 1GGVA 1OAOA 2ZUUA 1PK7A 4H35A 3CEPB 2QM3A 5JZMA 2Y1LA 2BJHA 1ODSA 3DWGA 3F7OA 1YCDA 3FOEC 5C1BA 3EDRA 2YWBA 3DO8A 5DHUA 2IYEA 2XE4A 3RYFB 3C7DB 1NZDA 3SYMA 4YMTA 2DJ5A 4XDYA 2FZKA 3QV2A 3EEIA 4OQNA 3KQSA 1R5JA 3ZHQA 2Q3EA 2IZ6A 5I9MA 4HDSB 2FFJA 5JNTA 2GAIA 3B3JA 4HY3A 1YRQA 4K46A 2JI7A 3N05A 4MKFA 4DIBA 4EG3A 3K0AB 2VYFA 1EAMA 1DUIA 1E1YA 2WKSA 4JT9A 4OSEA 4UEQA 5DI9A 3B12A 2H4XA 4C5BA 1WEHA 2WF8A 3PBKA 4ABTA 2X5OA 1BW9A 1QQ7A 4Q4CA 1PP4A 2KB0A 4JBIA 3U7JA 2CNLA 1IBRA 4PZDA 2VF8A 1TTPB 2QTCA 2UUBB 3CN7A 1PG5A 3ETCA 4OATA 3IEXA 4M1OA 4F8EA 3AHFA 3UUEA 4H08A 1Q14A 1OXVA 3BULA 4NYJR 4YMIA 3REGA 5BW4A 2DB3A 2XD9A 5LB4A 1X7YB 3OIDA 1OMOA 4KQ1A 4EY3A 3SXUB 3NOQA 1J2JA 3VKFA 1JQKA 4C0WA 1RWNA 3SBDA 5KYKA 1ORHA 3K0BA 4FK8A 3ZBTA 2RK6A 1G66A 3DL0A 3MXOA 5CD9A 1JUDA 2XYVA 1ICIA 2VZEA 1PN3A 1Z62A 2D5AA 3LDUA 4J4BA 4TWJA 5TR9A 4ZHSA 5HM8A 2GX6A 2OCGA 3K94A 1Z2EA 3EUEA 4J2OA 1UZLA 3O0DA 2R7NA 4NY1A 1C3XA 4PHHA 3QMMA 4X8HA 3SVLA 3BBLA 3HWSA 3HY6A 5L40A 3GRKA 3HV0A 4ABYA 4EH1A 5A5VA 5LOVA 1GWNA 1VCNA 2W2OA 2VJOA 3G0GA 4CL3A 2JH8A 4Y2QA 1R10A 4QJ4A 4ZVNA 1IQRA 4LIPD 4Q9KA 4QGAA 5DLQC 1KQNA 2DPXA 4N54A 5I9TA 3ZY3A 2GEDA 3BH0A 3IUQA 4QOIA 1SRRA 3FFBA 4H3VA 5FEMA 5FL7D 4BE7B 4EB6B 4G85A 3SEQA 1CDOA 2Y99A 3BK2A 3JQ7B 4CLEA 2RGCA 1Z3CA 1EK5A 1X7ZA 3JD3A 1SO8A 4F4HA 3IOEA 2P4UA 1SVMA 4NEHB 1RJEA 5E9QA 3RG8A 2PKWA 1GYRA 3MQ2A 1PX2A 3ZCVA 4IIFA 3LQRA 5IULC 3STVA 2Y0EA 4ARUA 2ALJA 1G18A 5I51A 4PQRA 4JROA 1UBKS 3WDMA 3I6QA 3N2IA 3UZUA 4FMPA 2AJ8A 4P3PA 4EDFA 4RU1A 1SK8A 2D3WA 2ID9A 5DWQA 2Y8EA 1EESA 1YJ5A 5EXTA 3HKCA 2AI2A 1LFDB 2FGKA 5GPBA 1QK5A 1CQZA 3BFPA 5K6RA 2OB1A 3HFGA 3I28A 1AHPA 2GCIA 2VRBA 4CQJA 3LAWA 1JSXA 5DYYA 5C80A 3S8MA 1L5KA 1VFNA 5JCXA 2O6LA 2GTIA 1KC1A 1PZXA 3ETNA 2FW1A 1W35A 5K6AC 1X92A 4QTXA 2VC2B 4ZDWA 1VB3A 2DR3A 2FPGB 4UASA 2HIMA 2PH1A 1SY7A 4A0FA 1KSGA 3F6BX 4KHPB 1Y9DA 2OHOA 4HWRA 3DQZA 4IIJB 3NM4A 3V33A 5LDHA 2C1XA 4ZO6A 5H02A 1D09A 3SJAA 3C6XA 3HDQA 2JLUA 4R2JA 3KQQA 1KOJA 1T1IA 1XDZA 1QIDA 2IZZA 2OGWA 1XD9A 4OXIA 5CX1B 3AP2A 3DR5A 3ZCUA 2OAP1 2WRZA 5A02A 5J4KA 5F9HA 3D3WB 3LS2A 2P7HA 2EU8A 2V7VA 2ZTVA 4XX0A 3FTEA 1ZJYA 2V9CA 2F3PA 1H85A 2ZXEA 1EK6A 2PLRA 2ZIEA 1REQB 3AILA 1ZCFA 3FRJA 4R5HA 4WGFA 1G8SA 5CXUA 2YYYA 2I66A 2PZAA 3P4UA 5K8VA 3TO5A 3A6DA 2Q5CA 1WCIB 5HFJA 2IOQA 3OZCA 4MVCA 2DSTA 4HWPA 4UDXX 4TTTS 1YJXA 4PNZA 2WJJA 1OYVA 2WWGA 3TJRA 1V2GA 3DC2A 4MYHA 3SXPA 5AI9A 3WLSA 3LLSA 3DFIA 1R0SA 1G8GA 2VJLA 4RIHA 2OCXA 1DGQA 4RLHA 4CKWA 2EF0A 1M2VA 3R20A 1G9TA 1JH8A 5CB4B 5K45A 3ESQA 1E61A 4OJTA 3EIXA 1AKYA 1RAEA 4ZYTA 2P0AA 3W5DA 3Q8LA 2Q5LA 4DV1B 1GZ6A 1C8VB 2ZRPA 1ZO8A 2Z8YA 3MJCA 1OBFO 3N76A 4KXNA 1AK1A 1J8MF 2ONCA 4RGYA 3DF9A 5LP1A 1K8XB 3MQFA 4FWTA 2PEZA 2WHPA 4U3JA 2GAAA 4O5AA 3EYWA 3FWYA 5I7UA 1L4EA 2QAIA 3ZXXA 4L27A 1TT7A 3OQPA 5IK2A 1Q0LA 1RHRA 2HCRA 3SE0A 5I7OA 1ETHA 1P7VA 2Q2NA 2IBMA 5TVKA 1XTPA 1DARA 4Z7OB 5HM6A 3QBVA 1AXEA 2SICE 3D4NA 4KCGA 3RCBA 5DM4A 5FOXA 2XMZA 4EI2A 2HK7A 2ISCA 2H1HA 3SLGA 1V5IA 1XCOA 1Y4AE 2A0YA 2D8MA 3DKPA 5EQFA 5H0IA 4E6EA 5KIAA 1VL5A 2GD1O 4JR0A 2NO1A 1HGXA 3D7NA 3EODA 2GA9A 5CA1B 5I9BA 5IKXA 3KYBA 4OPMA 5ADWA 1O6ZA 1UQUA 2RKOA 1N3IA 3VPBA 4K9QA 5AVWA 8GPBA 3KLNA 1JU9A 2PFGA 1VGQA 2PL3A 3WLQA 1D5CA 4LS3A 1TAHA 3PRKE 1E3SA 2IIPA 4N6NA 4NP6A 5JDCA 2PBLA 2PMDA 3SX0A 1BEZA 3KYDA 1EP2B 1THZA 3GA5A 3GGDA 1JG1A 5EHZA 5L53A 4G24A 3ZQ6A 3FMFA 2YXEA 1E20A 4V0NA 2IOFK 5DX0A 2X9QA 3WWYA 1SELA 3H99A 3JAWB 1AO0A 2ZIXB 1Z0DA 3UWMA 2R6HA 1KDTA 3INYA 1B6RA 1W5FA 2GKGA 4BNUA 1CEQA 3HDTA 2G1KA 3M4JA 5I7AA 3OH8A 4KRXA 4GEKA 3OC6A 3VV2A 1D1QA 3LKBA 3JQFA 4JZKA 3V7UA 5IHXA 3VR4A 1U8ZA 5JHGB 2CV1A 1OVMA 1ZEJA 2R751 2X13A 3L79A 5EXSA 2W7TA 4RDIA 1GTMA 1WXDA 2ZJBA 4OK3A 3NXKA 2PUTA 2FXVA 5KSWB 1ZISA 2XOKD 5TY0A 3ZDBA 3OICA 5BN5A 4HYQA 3AUXA 4HGYA 4N6GA 4YO8A 3CH7A 1E1NA 2QYOA 2X4IA 3GCWA 4KQCA 4NQZA 3THRA 4B6EA 4EZBA 1MQSA 2PX3A 1XA4A 2O2DA 5AIBA 5K01A 2C5LA 2I1QA 3DMHA 3HGQA 4NLLA 2PJRA 1BN7A 1EP9A 2O1XA 5D00A 5J58A 3E9CA 1M10A 1W5BA 3ZCQA 5FPKA 2HDOA 1DHRA 1UAGA 5FLKA 4BKUA 1V9LA 1HYHA 3D6JA 4Z53A 1D7OA 3DL7A 2NUPB 1EFVA 1OHHD 3RC8A 3KUUA 4Y2RA 1F0NA 3AERB 4Y3UA 4JI7B 4LSGA 4BMXA 2AQ8A 1CX9B 2C29D 3A9VA 1U2PA 5KAPA 4CKBB 4EJSA 1E4OA 2XRZA 3P1JA 4EHIA 5LU9A 3SJZA 1R6DA 5HXAA 1Y6JA 4G89A 1HDZA 4Z3OA 3QI7A 1VJGA 3BE8A 5KVSA 3A2KA 3E0XA 4UFNA 2ZI4A 4P7FA 1UEIA 2PIDA 2WLSA 3LUBA 1EA5A 4C0KA 3H3XA 1TKRA 5D51S 1WCWA 4M1MA 1J39A 5LQMA 3DXYA 1RM3A 5EWJA 6LDHA 2C5HA 1RQNA 3W6OA 1NX6A 3UIEA 3M6LA 1GPMA 3BMNB 1U3CA 5T3YA 1IOLA 1NMQA 1O95D 1L5YA 2JD1A 3T4UA 3UV7A 3WIUA 3ZV5A 3WZMA 1AKEA 2H06A 1ADFA 3GEEA 4HGNA 4U6QA 4ID3A 4LJAA 4BP8A 4F4CA 2H18A 1D8AA 2BKVA 4WPGA 1O03A 1JTFA 2ZVJA 3NVKI 1WG8A 3DBIA 1UK7A 4A8PA 1RPZA 5JYCA 3NC1C 1X7GA 1AUPA 1P5RA 3G2NA 5LB2A 2VDRB 5GOTA 4RY8A 2V7QA 4PNEA 2VF2A 4K88A 1GTRA 3UMVA 5LZ4A 3RAFC 1UPAA 3T9EA 1NQAO 3EXFA 1V9CA 4J43A 2A9KA 1Z36A 4UATA 4O4HA 4LY0A 2VQ3A 3A2NA 5E1DA 3RU7A 1Z6XA 4NXNB 4GKAA 3T7SA 1IIBA 1YQEA 3AFNA 3OP1A 4KSCA 4WCDA 3WHKA 5AI4A 1F9EA 1QH0A 4P82A 3OZUA 3ZGLA 3M4YA 3REQA 4PLPA 4KR7A 5CB6A 1MT0A 1VBMA 4G2NA 4HDAA 4EZEA 1I3KA 5H3HA 4PIPA 1XRSB 5C3MA 4NPHA 5I9LA 1CIVA 1XVTA 3I01A 1A04A 3M6UA 4LWPA 4K86A 4X6UA 3TLGB 3HSYA 2IY9A 3WS7A 3LIIA 4AAYA 1EA7A 2ACVA 2HNAA 3C5VA 3PC3A 1NPTO 5A5DA 3NEJA 3HZZA 3H0KA 3MCZA 4LYHA 2F55A 4WBSA 3A7DA 3L1IA 4AJLA 3IEIA 3LNCA 5L4SA 3GD7A 4YRIA 1SRQA 2JIDA 2WW8A 4HSGA 5B7NA 3N8IA 1U6IA 4Q4JB 2PGNA 2SKEA 3U3ZA 3TRKA 4EQ6B 2CL0X 2C92A 1BZYA 3MJ4A 4UC0A 1EX9A 4DWOA 1JEAA 2W0SA 5SZKB 4CW7A 4AFNA 3DXZA 3OPYB 1T2UA 4R1OA 1AUXA 1Z7GA 1QHIA 1YFZA 4UVIA 4JI5B 5K8UA 3U3KA 2ZJAA 3NEAA 2ZTHA 3I9MA 3C7KA 3GMTA 3KQMA 4LA4A 4EEZA 2VNAA 5FEUA 3OY2A 2MMGA 4V0LA 4XXHA 1NJ8A 2D3TA 2FLWA 1KDZA 4NL4H 5I7SA 1QK3A 3ADOA 3AM1A 4FGKA 4YMSA 1JAIA 2H85A 2C03A 3KUXA 1P17A 3NOXA 4Q3LA 5AI8A 4ZQIA 5J3JA 2VDWB 3EC1A 3G23A 4LSMA 3ROXA 2ZSHA 4UKDA 3B48A 1K6MA 3SJBA 4D6XA 2NP6A 2HJRA 1VSQA 1Z2AA 5DHSA 2BFOA 2EF1A 3DJYA 3PEVA 3PUHA 2ZANA 3RVJA 2VK2A 3G49A 2Q0SA 3WJ2A 4NX2A 5KWSA 1JXOA 1GNVA 3KKEA 2O2IA 5IBPA 2W2XA 2VHUA 4OUDB 4DJJA 1JAYA 5F2KA 1WRBA 3OURA 4LXXA 1EVJA 5E2IA 3ZE7A 4EI8A 4GL2A 4AJEA 1DEOA 2FR0A 3LD9A 3E48A 4EG8A 5K0SA 1IXKA 4BO6A 1L9KA 2O8BB 1OA0A 1F6DA 4DEYA 1L4MA 2R44A 4RCZA 2X0FA 2V7BA 2PKQO 1J8DA 2NXJA 1CS0B 4FHDA 3S1AA 4DJFC 1UXJA 2KQUA 2PKQP 3F3YA 3OFVA 4TXMA 4G1BA 2ZJ6A 5HZHA 5H68A 3MN1A 2OM2A 3MWKA 2IXEA 3DLCA 3JQGA 1X7XA 1TAQA 4IYJA 1TUGA 2R6JA 5AM5A 4Q7JB 4BNLA 4KAXA 2B61A 2ZI3A 2R00A 4AUMA 2CD7A 3M5WA 4HV4A 3QEBZ 4FB4A 1Q83A 2JFWA 2J0UA 4GP9A 1FUYB 3A9UA 1Y6RA 1LW7A 3LUJA 4FFSA 5CW2A 2NG1A 4BWFB 3C6MA 2DKFA 4L9RA 1F3LA 5DPMA 5FIUA 5CT9A 4P3XA 1L8OA 3L6UA 4ZXPA 5K0LA 1E6CA 2IZ1A 4BKRA 4C9BA 3RBZA 4CVNA 2HHHB 3C8DA 2BP7B 1LPSA 3W78A 2O5RA 3I73A 1Q20A 2H9AA 1GU0A 1XTIA 5GMOA 1G6Q1 3LUKA 1R4NB 3W3AD 4AMYA 4X85A 3ZVMA 4I50A 1RJWA 4L8FA 5CFNA 3RG2A 1M5UA 4GLJA 2J3QA 3E2PA 1A1SA 4QTYA 5ALKA 1BCSA 2WAXA 2YYAA 3ILYA 3O3NB 4I0WB 4D57A 1AE1A 4WXMA 1W36C 4R2HA 4RWZA 3R1IA 3RVDA 4C1BA 2QVYX 3DHWC 3KE9A 1VQ1A 2ATXA 3DEAA 1T0BA 3W2EA 3HWX1 2WU0A 2YJ4A 4A03A 5KWIA 2E48A 4QARA 3RHTA 2ZT5A 4PZ9A 2A0FA 1QVWA 1QH8B 2HBYA 2YZGA 3COSA 1YS6A 2UZIR 4UARA 4YECA 4DL9A 1G7RA 3VKGA 2I4OA 4UM8B 2O52A 3RTGA 2BZ1A 3AT1A 3NFYA 1QRRA 1B8VA 3LQQA 1MABB 4LZWA 5DK6A 4D9CA 3MB5A 1QIIA 3C8UA 4N65A 3SZLA 2PU5A 1AH2A 2R1VB 1RM5A 1FNSA 4GKVA 5SYNA 1YB2A 4HLNA 1W2GA 3ETHA 4GZMA 2IE8A 4KL8S 4L5BA 1XKXA 4U9HS 1ZNWA 1U8EA 1GN9A 2PL9A 5KX5A 5C8YA 4AWAA 4NEQA 1FQWA 1GEGA 1VIDA 2GLTA 3DBVO 4JOSA 3HLTA 4XGKA 4ZAVA 5BRNA 4AG3A 1PJ4A 1NLYA 2X14A 4L2IA 4BFYA 3M9LA 2OYCA 4AJ1A 2O20A 3W6PA 3H5TA 1Q50A 3AW9A 3CNQS 4EO4A 1H1DA 2QQGA 3INNA 3GZNB 1ZVVA 1QG6A 3PJFA 1CB7A 1P39A 4EGQA 3TGLA 4GMFA 4ZHQA 5E6UA 1MQ9A 1QG0A 1ULSA 1Z0UA 2EZUA 1KVRA 2Z83A 3A25A 3FWKA 3HJUA 1UC4B 3I37X 3UK6A 1O6BA 5BMOA 5LZ9A 1Y5IA 3ICQB 3AWDA 1UBUS 2QTRA 4I4NA 5EMJA 1NYTA 5IN5A 1Q95A 1VIYA 3NJ8A 1SGWA 1K63A 4MRRA 4JJIA 1C1HA 2DFLA 5IKOA 5L3QB 2ETVA 2I76A 1ILEA 3KFLA 3N1UA 3S5JA 3F8TA 1Y9ZA 3EVBA 3PTZA 4B3RB 3CF0A 2NO7A 1QE3A 1QQ6A 3NHYA 4QGHA 1SCNE 5JZSA 4E3WA 4F11A 3F7TA 1DCTA 4J7XA 1VDZA 2WF7A 2HT6A 5INTA 4U7WA 2GTHA 1V37A 1XP8A 1US8B 5FUWA 3WIDA 1N5DA 1KQOA 4HAWA 5DTQA 1O58A 4R1MA 1YQUA 1I3OA 4BLTA 3CLVA 2FQXA 4Y2TA 4KX3A 4WE3A 3HCCA 5LXTB 4PHGA 4C7OB 1M1YA 3VZCA 3GY0A 2JGEA 4ZT3A 3ONEA 1WF3A 2IDKA 2VFAA 4C87A 4E30A 4IMRA 2VWGA 4W8GA 1HDYA 5D84A 5LUBA 1UBCA 3ANLA 1EK0A 4ESVA 1B16A 1B73A 1D0IA 1EDBA 1NJGA 2AQKA 5BN4A 2G9RA 3KJXA 1X39A 1G7CA 3WG9A 1GAWA 1QR2A 1SBCA 2PYDA 4R9NA 1DBSA 4OGWA 1KIMA 2ODPA 2PRIA 4CPDA 2D5CA 2GS9A 3E05A 3VDXA 1GSIA 4XEHA 1I7DA 2W2PA 3NPMA 4OM7A 2V98A 2OV6A 2QNRA 2ENWA 4EA6A 5JDIC 3HXOA 4JXZA 1KZ7B 1TA4A 3L0CA 1PI3A 1AHHA 3DEIA 4HPWA 4OHYA 2ILTA 5FPPA 5CBKA 1JFTA 3RFXA 1AG9A 4OD0A 3BE4A 1W1UA 1H2HA 3AUTA 4BUZA 1E3WA 1LBHA 3I6ZA 2Q6LA 5KTMA 3Q2IA 2PR7A 3IPXA 1A5SB 4FDLA 4KK3A 4ALLA 5JVDA 3EVDA 3U62A 4MS3A 4YCMA 2CVPA 2OZLA 2WTBA 2YUTA 2A33A 2JCGA 3PC8C 2G9VA 4HTAA 1EQ2A 1F8YA 5AP9A 5A6SA 3A1DA 5HUQA 3KT0A 3PWSA 3T7AA 2EWMA 1YR6A 3B2QA 1VKNA 2VYVD 2CLOB 1DDGA 1TCCA 3H9QA 4BNIA 1H4QA 3WK4A 1T24A 3PNKA 1G20A 2QJFA 4CRWB 2I6SA 3R5HA 1SPBS 3HVHA 4KYTA 1SD1A 4CT5A 3GJ0A 5ISMA 4TVSA 2WWXA 2X2FA 2PEYA 3OE5A 1OXBB 2ZRQA 3DUWA 5AFSA 1G21B 3BA1A 1VHJA 1NKVA 2O3JA 3EHEA 4QYIB 3ON5A 1JDVA 2ZQYA 3UAVA 4TS1A 4KWEA 1A4XA 3F5SA 3O9ZA 5LP6B 1L4LA 4XVCA 5ALPA 4NZZA 1QZTA 4IDAA 4DA9A 4N3GA 1P9LA 2EVWX 4GSYA 3CJQA 3WGVA 3KV1A 5HOEA 5AJHA 3MERA 3E9YA 3LRXA 2X4GA 4MR8A 5AJTA 1A9XB 1ZI9A 2VJCA 1JR2A 4JVMA 4KO8A 3NASA 4KQMA 4PV7A 5CK5A 2IYAA 4GPBA 4YJ2B 2C8JA 4KPYA 2MYPA 4MIKA 1Z16A 1ZH0A 4LJ9A 3RRFA 3N28A 5JAQA 1SHLA 4C6SA 3NHJA 4RPJA 1R0ZA 4WK0B 3STTA 3G0BA 5KSZA 4P7BA 1J21A 2Y67A 3NBQA 5AKLA 1UKZA 3L7BA 5FUYA 3WTCA 2KWIA 3ISVA 3CNHA 2AOUB 2C57A 3PJGA 5DM70 3SX4A 4BN0A 1XKTA 1E1QA 3THWA 1JLKA 1Y8RB 3BIFA 1S02A 3O95A 1ACMA 3LBNA 2E21A 1L3CA 4OQEA 3KUDA 1ZGHA 2GLXA 3BKWA 4IVNA 3E22B 3EQ6A 4X65B 2XDQB 1C14A 3G1WA 3ERCA 3STXA 3CH6A 4CN9A 4EG5A 1P1RA 1ID8A 2GK6A 1YZYA 5AJWA 1SVNA 3JQQA 2QL9A 2ZUDA 5I3CA 2VPTA 3CJTA 3EASA 2WZDA 4CYMA 5B3KA 3MBOA 5AKXA 2IYUA 3E70C 4OMFG 1AUQA 1NHGA 5JEEA 1TA9A 1YVUA 1YBFA 2R66A 3QOYA 4GC5A 4GXRA 4HUJA 2VTEA 4QT0A 4Z1MD 4CQNA 5JJLA 2QPAA 3ABSB 1PL8A 4N0DA 2Z9DA 4TXLA 6ABPA 1QAQA 4DT1A 2XTMA 4EOGA 3DOHA 2JW5A 5CIQA 4LKOA 3IB6A 1M34A 1AKWA 1WL8A 5CCEA 3DDHA 3WFZA 1RC8A 4YUZA 3MJEA 1X94A 3AESB 3VU8A 1V7ZA 3O92A 1ULBA 3KBOA 3PG5A 5DHTA 4F38A 1KAEA 3QGMA 1L4GA 1PT5A 1DC5A 3QVMA 1XA0A 5EE0A 4UCFA 4D92A 3WICA 4ZMSA 4B6QA 1L7QA 1SKUA 4CLXA 1U2GA 2E3JA 2H1RA 5FBRB 1Z7EA 2TSYB 4OGLA 1MEJA 5L4NA 4UDNA 1T29A 3R8FA 1VYHA 3ICCA 1XSEA 3A1NA 2ZXUA 2PN1A 4YRGA 5LR6A 2PSEA 5DGCA 4KQEA 2GFQA 2GPYA 1QLHA 1NULA 3WGKA 3K6SA 4IVPA 2YVUA 5HSGA 1RP7A 2X1MA 3ZWQA 1P1IA 1PLJA 1O9HA 4V2UA 1SUBA 3SZOA 1T5TA 3V7WA 1T5BA 4ZDIA 4M0LA 4L3OA 4N7MA 3EGWA 2W6JA 4DREA 3ORSA 5KREA 4GYWA 4BBPA 4BLVA 1GLGA 5TE9A 1DX4A 1SUDA 2AHOA 1VI2A 2H59A 2K2QB 4RZIA 3U3OA 3TG2A 1VJ1A 4PC3A 4K9LA 4U2GA 2JLAA 1BQ4A 1QVZA 3IE2A 1NLMA 1EQAA 3T9DA 2HM7A 5FV4A 3ZHSA 1JT2A 2EP5A 2X8JA 5HQTA 2D1YA 4FQ7A 5F73A 4EAAA 4BQRA 3R9WA 4DYVA 3K30A 4UTPA 3RTEA 1I4WA 1ZZGA 2XA2A 3F78A 3GLFA 1XAGA 3VO2A 4ZI7B 5KNDD 1TKCA 2C4WA 4FYIA 1RTKA 1T35A 1W2WB 2JGNA 3G2MA 5B3AA 2E6KA 4GDFA 2AHRA 2BFCB 5KTRA 4EECA 1NTOA 3FR8A 3W8NA 4DG8A 4EA8A 3WNCA 1DQZA 4UFPA 1F6WA 1FXWF 1CE8A 3U81A 1NVKA 3BSYA 3TVYA 2DH5A 5J2TA 3Q3CA 5HE8A 5J1SB 5LZ7A 1UFOA 2WPDA 1UDCA 2R6FA 4R9UC 1ZD3A 4LY3A 1QTRA 4KWTA 3DKIA 4RD6A 3R0QA 1QO9A 3AHCA 2POCA 2WSMA 3WHIA 4TMXA 4TGLA 3ESYA 2X86A 4OQXA 4JDPA 2VH2A 5JSKA 3KWLA 1K66A 3ESAA 2QR5A 1VJDA 3VA7A 4W5WA 1D4AA 3D8SA 4W5NA 4XYLA 4LOJA 5MF6A 1TDJA 3HYRA 3CIFA 4Q24A 3W2TA 3VYWA 1M33A 1QG4A 2CMGA 4NAVA 1BXZA 4HFRA 1WA5A 1ZSNA 2YNMA 2O7SA 1BW9B 3D6FA 1E2PA 2AEFA 3MNFA 3T3DA 1X1EA 4O25A 4WX2B 4C6TA 1QJCA 4U5XA 3QBEA 1GO2A 1MNAA 3DTTA 4M98A 1Z68A 5TPZD 4DLPA 2IYOA 2J5BA 2ZG6A 3NHWA 3BHJA 3GROA 2IEBA 4PPNA 5EVJA 2YMQA 3ST7A 3BDVA 4N7BA 5A5EA 3N86A 3IC5A 2H2IA 4MQ4A 3ODGA 3N75A 4RZHA 2DLNA 4D0LB 4IFTA 3IULA 4C4TA 4HJRA 2ORYA 1FJXA 2D54A 1X13A 4PWYA 3IHWA 4MQUA 4M8IA 1U7HA 3SICE 4BFSA 3V7YA 1YS4A 3BA6A 3ZDFA 3KVVA 4IYRA 3HYLA 2R6R1 4UM9D 5JR3A 3TZCA 2NPOA 1K68A 2UYGA 2WVHA 2HPVA 4MGYR 5FF9A 1P4GA 2IUYA 4MVXA 1FB5A 2I62A 1XJ0A 3DTVB 1ML4A 2Z2IA 4UUBA 3T7JA 2V1UA 4N76A 1IAVA 1GLNA 2EFDB 1KI6B 4RO0A 1EBUA 5EZ5A 4UHCA 2QLLA 3NVDA 2C78A 2VJBA 1ZN7A 4P54A 2A1TS 3R6DA 4QTZA 3T5MA 5B2FA 1A7KA 2BHNA 2PYIA 2XKBA 3T35A 2O2GA 4WY2A 5EJ4A 2EGUA 2I55A 2DHRA 4RIEA 3ROPA 2ZR7A 4U7HA 5JH7A 3S4YA 1R18A 2JGMA 3NHUA 4M21A 3EPKA 4EFDA 4FONA 4RK1A 1UOEA 5I47A 1JFVA 2J0VA 2WTAA 2DTEA 4RIGA 1C4OA 1JIXA 2IW1A 4B34A 5J9FA 3CNLA 2AOTB 5DBHX 2QT0A 1PYDA 3N8NA 2AC7A 1ZOPA 1VE6A 5IH3A 1SBZA 1A9SA 3MPUA 3WWPA 1GCGA 3DNMA 1QGUB 1NDHA 1Q17A 2HK8A 3DHVA 1DG9A 1IBSA 2MYTA 4FFPA 4L08A 4NHOA 2R85A 4EI7A 4EGSA 4TVKA 1XG5A 1RYEA 3NBUA 4LXHA 2NTJA 3HCBA 3ZHVA 1R9NA 2IUEA 4B44A 1I2DA 1CNMA 2V97A 5A71A 4CMAA 1BDJA 1KO4A 3R40A 2JJ8A 3WIVA 2BISA 2H3EA 3C3AA 3VPXA 3X1ZA 2COEA 3THOA 5JCZA 2IHYA 1GM5A 3SZMA 2WU8A 1OLUA 4ER7A 3I5AA 3DVSX 4DF3A 1LC3A 1M54A 1VPVA 4JUAA 4Z6KA 4XJXA 2JDID 3DPIA 1MIHA 4G37A 4KLZA 2GPJA 4PPGA 4ZP1A 3GJTA 4OBBA 2CSXA 221PA 2AQIA 5CLLA 3H5OA 2YN2A 4UZSA 3NHPA 4FEGA 1XFAA 2SNIE 3T9BA 2LW7A 3GJXC 1PJ8A 2C9MA 5IKPA 2V3CC 4P84A 3HJTA 4KDCA 2UZ1A 2B92A 3BILA 4PAQA 3V6LA 3PQEA 3R7WA 2XJ9A 3J7AC 4ZEOA 4YJFB 1FYDA 3K8YA 2WF9A 3UFXA 3LYLA 2WSYB 1PFYA 2DG2A 2WWFA 1X7DA 4KR9A 2QN1A 1WXFA 3JVEA 2RB4A 4B4OA 4E2WA 5DHAA 5H4HA 4M6WA 1O4WA 1Z29A 3DV9A 1RIFA 4RF2A 5JPDA 2BSXA 2H31A 3ZJYA 2A6PA 5IT5A 3O9MA 2YR0A 1T2DA 3FPHA 1LC0A 4XUEA 1YS2X 2XLBA 1R8SA 1VI6A 1WSBA 2SKDA 1BD4A 1IE3A 1JSCA 3RRNA 3VOTA 2NV0A 4N9WA 5FBKA 1N9GB 4ENVA 4CKWB 1ES9A 2HWUA 4YR7A 4Y18A 3W7VA 3EWNA 4ZCTA 1H2EA 4QVKA 3MG9A 3IOCA 1IY1A 4J49A 5DW0A 2EJVA 4QOHA 2GN8A 1LPAB 2JBWA 4E12A 3GIDA 4GMHA 4YBRA 2KLHA 1QYDA 2K4MA 2FRDA 5KZMB 2O5VA 3S68A 1RP1A 2IEIA 2ZVQX 3IVCA 4PVCA 3MM4A 3TZ6A 4F9GA 3BQMB 3QU7A 1MC1A 2H4FA 3N0TA 1KTVA 1P9WA 1HDXA 5JAIA 4MLCA 3CLKA 5CH5A 1VSTA 2WVAA 3KCNA 2BJWA 1IRXA 3ZU2A 4KXFB 1BVRA 1GOTA 4RZUA 5BNIA 4G5OA 3DOUA 2VPPA 2EJCA 5FX2A 4IFEA 2B8NA 1ZJ5A 1DI0A 3SZRA 1S2MA 2RIRA 4PG8A 2XF8A 3MS7A 1G2QA 3G7SA 4TV8B 2JGFA 5BYJA 2VA8A 3C5CA 4WFKA 5B58C 1S1MA 4NCBA 3AXSA 2NQ2C 5DJ5A 4BO1A 1UL1X 2Q29A 1X8JA 2B6NA 3PNOA 1TRHA 3ZUGA 4PZLA 1N6HA 1SOAA 2G5CA 2XA9A 3HP7A 3WGZA 1KYQA 3DE4X 2XBMA 2Y71A 5CNJA 1ZU5A 4OO3A 4M1TA 3SHTA 1RQ7A 4FR2A 1OX4A 3ME5A 4FFLA 3V32A 5J2UF 2LP4Y 5T4EA 3A9WA 4MRSA 1TEVA 5F23A 3L92A 2QUZA 1RWOA 1NLZA 5CYOA 1YR3A 3RIEA 4HDCA 4LZJA 1KARA 3PWZA 3UKOA 4JUBA 3LM8A 3BWCA 1JHAA 3KHUA 5DGHA 1Z4PX 1ZQ1A 1Y89A 1ZD4A 2ISSD 1N1EA 1O0SA 1SZPA 4Y9UA 2PGIA 4OYYA 2J9FA 4QO8A 4YMGA 2GPNA 3D8UA 5FFFA 5AVSA 1GG8A 3EMKA 1WZEA 4RDHA 3GLGA 3V55A 3VR5A 5E4JA 2C2GA 1LQUA 1LPNA 2HGSA 4R2MA 3FOAA 5AM2A 4UUAA 4H7PA 1PFKA 1GT6A 2FGJA 2UYQA 4RC9A 5LQDA 4UMDA 4G9BA 5KS2A 4HBGA 3QKRA 3ZU6A 3J81A 3BB1A 1HT2E 3AP3A 2AMLA 3I0ZA 5AUQA 3TFWA 2XQGA 3WXBA 3G85A 4IUDS 3RIYA 3WISA 4C5CA 2FUG6 1HL7A 5BN5B 1RAAA 5C4GB 2QBYA 4QUIA 4F04A 4YFVA 1NQXA 2BEVB 1PTJA 1BD3A 3CB2A 4JLDA 1G8JA 1BS1A 5EFZA 2GN4A 2QRPA 1EVQA 1MHPA 3K73O 1AB5A 3QXSA 4JI6B 3R23A 2VQEB 3L49A 3P27A 2QNIA 4PPQA 4DCOA 5GM2A 5A1TA 3ZQUA 2Z43A 4HNVA 4OKNA 2EG5A 5AQ1A 3RH0A 3VOBA 2QRMA 4GHWA 4S04A 6YASA 3FN4A 4BASA 1LJLA 1VG1A 1A1VA 3E9EA 3Q3JB 4G8BA 5COQA 4LTMA 1H2XA 1MC8A 3UWSA 3S6JA 2I6GA 1G7TA 1BHO1 3LQYA 3O75A 4OP3A 4AMZA 4RIIA 4MV0A 1UT6A 3SG0A 4XFKA 3G5TA 4FW9A 3IQHX 5EHIA 2IVZA 3HCPA 4KXMA 3L3BA 5H1YA 1DBWA 5JAPA 4AZ3A 5E6SA 3CN9A 3TPFA 2GMWA 3KVYA 3DCNA 1ZK2A 3A2LA 2C9OA 4JJ6A 1Z3IX 3IQDB 1KYZA 1QH9A 2INGX 3GB9A 4GYYA 4Y1RA 5H4GA 1NWHA 3H4IA 2XCOA 1IL0A 2NXNA 3F5DA 4GE0A 4FCWA 2A8YA 1ORWA 3JV7A 5C81A 3OCYA 4UDOA 2XXAB 5AIAA 3OPMA 4I99A 4TUYA 1KEVA 4GR4A 4XAQA 3IHKA 2AJBA 4BYGA 4MYTA 4YQEA 1KQ3A 1CK4A 1LQ2A 3D3KA 3H9JA 1O6GA 4J91A 1U8YA 2VJAA 3OMWA 2VK1A 4M37A 4CM9D 1TTTA 2AZTA 4B32A 3NIGB 1OFIA 4DANA 2DWQA 4NCAA 4POAA 3DMPA 2WZBA 3PPWA 4A6PA 3OU7A 5D3MB 1XTKA 5G0SA 2LV8A 2V55B 5IAKA 2CNOA 1NFQA 3HJBA 3M33A 2C97A 2PSFA 3PUWA 4BE4A 4HOYA 4NBLA 2NO5A 4LFAB 5FPSA 1JPJA 2BDEA 2HRZA 4YPOA 3UBMA 5K8CA 1R4MB 2A94A 3NHBA 4G0MA 5DZSA 3KKLA 1Y4DE 4FR0A 5K8IA 1LDMA 3H5LA 4FYJA 3T61A 2AJTA 1J1ZA 1VE5A 2ISQA 2QGNA 3RU2A 2CHFA 2YHAA 3NWBA 4PCAA 4O29A 2X3UA 3IVRA 1GPBA 2GASA 4O4HB 2OVBA 1EE1A 1F0PA 2HK6A 3GDOA 2I2FA 3MOSA 2PUDA 5HIAA 3AU8A 2J3LA 1AK2A 4JP5A 4QDOA 3QM1A 3DYVA 1A9QA 4JUFA 4ZCQA 3R9IA 1P19A 1NRIA 2ZYDA 1Y1RA 5A62A 3N2YA 3SR0A 4NKRA 3LPNA 1ZKDA 3E58A 1CJMA 4D1YA 3C41J 1OZFA 1JR3A 1JI0A 4EPXA 3EC7A 1AZTA 1ZOSA 4R3UC 4R68A 3ZE6A 2R60A 4S3MA 3H1AA 1BXRB 1RI4A 3LUAA 1N36B 5L9AA 2PL1A 3DT9A 4YAEA 4ZCMA 2BKXA 1LDBA 2HREA 2P4HX 2QNBA 1A8QA 1Q0RA 2ZIWB 4B3MB 2IGTA 3V00A 4E13A 3N0XA 2W2QA 3VC3A 2VRCD 3AVXA 1LCIA 1JVBA 1XKLA 2V8OA 4RSRA 4E14A 5JO9A 4DTCA 1GG2A 2CLLB 1G3IA 3KYCA 1JN0A 4R8MA 5BXYA 1X7HA 5CFZA 2D2XA 4L74A 1U7DA 5AVYA 5KTKA 4DV7B 4XR4A 1FJHA 3A6EA 4N39A 4NV1A 5J4YA 1JTVA 2CF6A 2QU8A 3L8ZA 1JNYA 3EZ6A 4P4UA 5F52A 3ZWAA 4IH9A 3RTCA 3OPYI 2E7ZA 3N2NA 2J9RA 4OKSA 5G1PA 4HAIA 3QZUA 2W9XA 3DHNA 4DSNA 5JS7A 1L4BA 2XQFA 4AP5A 3QFHA 1UJNA 1ZBDA 3CR3C 3OQVA 1LNSA 3H9CA 4HAVA 4HFNA 2DP4E 4US2R 1CVIA 2LBPA 1M34E 2BFDA 2QSZA 2Y76A 4GPAA 5EJAA 1P9OA 1DAEA 5CR9A 4RJLA 4C43A 2L19A 1OH8A 5EEHA 1KOFA 3AUSA 2N47A 2IYTA 2ZUEA 5LQUA 4J0EA 5B30A 4S1TA 3G2IA 3K0FB 2Q41A 4XFDA 2W43A 4PZCA 4AU1A 4FN4A 5M2QA 5EHNA 3WKCA 1M1ZA 1F48A 2H4JA 2I3ZA 3WL6A 4AXXA 5TQ2A 2Y1DA 3S1AB 1OU4A 3ZOKA 3FCCA 1YZ3A 2I67A 2EKQA 4X6LA 4FR5A 5HKOA 3QUSA 1U9IA 3CO0S 2Z1MA 1A98A 1RHMA 1YZQA 2C2KA 3FPJA 4PX3A 3EPJA 1DBPA 4ASUA 3FSEA 2WJPA 1X7XB 5AOCA 5LYYA 5C4MA 2DUMA 3R5KA 3GLKA 1L7VC 4FTWA 5HRAA 3PDHA 4ALJA 2FPWA 4AW9A 4I55A 4RXUA 5LIPA 2J09A 4LJ8A 4QPZA 4TN1A 1XMIA 2OPHA 1JLHA 4BLSA 1O2DA 5JNWA 1ZYUA 3DOJA 3JCZA 3ZHXA 5GZ3A 1WSDA 4MEBA 2F00A 1HG1A 4LISA 4V03A 2YVQA 4AJJA 3Q6MA 4QXPA 4IQGA 2VCYA 3QWFA 7GPBA 2EFCB 1GTVA 3G0CA 1KK0A 1DKRA 2GJSA 2QN8A 3DWFA 3ZI0A 2ON6A 3OZDA 3CUSA 3MWFA 4I50B 1TL7C 2XMCA 2CDBA 4QECA 4BKQA 4PBRA 3JPYA 4K3VA 5AUNB 5IM4F 4FHEA 4K9OA 3OBBA 4C7KA 4IUYA 1BCSB 2OENG 5EIBD 3WGJA 1ZGAA 1IBMB 2WU1A 2WT9A 3I64A 5I7WA 4X1OA 2FDXA 2QTGA 1P1CA 2Q4TA 3DEJA 3HG7A 5FLYA 3TIFA 1JG3A 1SA0A 4O0MA 2XXJA 4HUQB 1ZD2P 2VH1A 3IAAA 4GLFA 3DTNA 4LHYA 4LNHA 4OB7A 4D6YA 3R6TA 5CFOA 1QLJA 3BGVA 4OHUA 1C29B 1WMSA 2CZQA 1Z6YA 2XUFA 3I42A 3HYSA 4MO9A 4TMWA 2OXTA 3SGLA 4NZPA 2QL6A 5FTWA 3RVKA 4MWSA 2JLYA 4C6RA 1MGOA 1WOYA 3A3OA 3TSYA 4X8OA 1JILA 4DQVA 4DCGA 4GUDA 1E64A 5EP1A 4GU5A 1KGDA 3I52A 3T7TA 1E9BA 2QV7A 4QQRA 4YJHA 3V8PA 2DT8A 2B7CA 5HKKD 1MV8A 2Y9PB 5DW3A 2ONKA 4QGGA 1A50B 2C1EA 4IQ4A 3GAZA 2H5LA 4D2IA 3DT6A 1G1MA 2QSJA 5EKUA 3EF3A 3JWEA 1E89A 2OYSA 4KRYA 4DNFA 3KJHA 3ZJ5A 2OG1A 4LXIA 3BOSA 5FNVB 3UICA 1M5RA 5AK3A 3UJPA 4Q9HA 3C8MA 1TB4A 5A9SA 2FEMA 2RH9B 4PYLA 2AF3C 2BTQA 2YJGA 2CHVA 3FCYA 2M9MA 3OFNA 1A5AB 1ODTC 1UFVA 2QT9A 3AUUA 4UNIA 3OTHA 4RVDA 3F5FA 3D81A 3WZLA 1JJFA 1QNLA 1R9JA 2IU3A 4FUQA 1JIUA 1IOZA 3NTLA 4PAMA 1AO3A 1P7YA 1U8FO </