3NRCA

Crystal structure of the francisella tularensis enoyl-acyl carrier protein reductase (fabi) in complex with nad+ and triclosan
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
256
structure length
256
Chain Sequence
GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVLPCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Francisella tularensis enoyl-acyl carrier protein reductase (FabI) in complex with NAD(+) and triclosan.
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Oxidoreductase
molecule keywords Enoyl-[acyl-carrier-protein] reductase (NADH)
total genus 86
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3nrcA00
1DRWA 4XYGA 2PH5A 4R16A 3ICPA 4XIYA 4E13A 4RQUA 3RBZA 2Q46A 3PP8A 4ZA2A 4ZQFA 5A05A 3L07A 1JKJA 3F6YA 1JU9A 3ZU5A 4IJKA 3WIDA 2PZLA 1XEAA 5COBA 1ENOA 1LDMA 3F1LA 4I5DA 3T4EA 1LDGA 3N7UA 4PVDA 3LC7O 1A5ZA 2EF1A 3MJSA 3NYWA 3AOEC 2EGGA 2YZ7A 4ROSA 4EGFA 5A06A 2YJZA 1JAYA 2P91A 3RBVA 5G0TA 2XPCA 1EVYA 2Y0DA 4KWIA 3EVTA 3W8EA 1UH5A 3IUSA 3O8QB 1V9LA 4YQZA 1D3AA 3PHHA 3MCVA 2HK7A 4NQZA 1NR1A 2BGMA 5DNAA 4WLVA 4CM8B 1Y8RA 3E82A 3H9GA 3KVOA 4MVJD 5K6AC 4WEQA 1ZSVA 1E7YA 2HMTA 3DHYA 3EZLA 3QVOA 4CLOB 5IDQA 1ZCJA 3FR7A 3C7AA 4DIOA 3CUKA 3DBLB 1UZNA 5ICMA 1F8FA 3UF0A 3DEYX 1C1XB 4RPHA 4GX2A 4AJ1A 2OHXA 3TF5A 3O38A 5JSFA 3PWZA 1B2LA 2GLXA 2RBEA 3FNHA 4HX5A 4Q3AA 3OEWA 1Q7GA 3C1OA 3HWRA 1MG5A 3PGXA 2Q2VA 1BDMA 3C3XA 5JDIC 4AVYA 1LSUA 3PHLA 1PSDA 2E37A 1JA9A 4RDHA 2GF2A 2W98A 5HS4A 3I4CA 1O9BA 2Q1UA 3QJ5A 4GH5A 4GWKA 3CXRA 3PYLA 4BS9A 2CY0A 3AY3A 3PJFA 4IMRA 4BOYA 1UXGA 3ANMA 1PS8A 3DOOA 4TQGA 4D79A 1DRVA 1RM4A 1RWBA 1YQXA 1RPNA 3L9WA 3KYDB 4ITUA 1B14A 5JW6A 4Z3DA 1R15A 1FJHA 1GEGA 3M2TA 3RSHA 2GASA 4CUZA 1K0UA 2NU6A 4NBRA 3WG9A 2OZPA 3DBRB 1X7DA 1I3MA 4BKPA 1P31A 1RM3A 1JVSA 4R1NA 3UAGA 3LSYA 4H3VA 3VTZA 4FFRA 3V1UA 1HF3A 3HDQA 3ZWCA 3D7LA 4QFCA 4XR9A 1VPDA 2PNFA 1ZBQA 4BNIA 4K28A 2I3AA 1ZUD1 4W6ZA 3DBHA 1LRJA 2NVUB 1ZK4A 2FSSA 3PI7A 1LJ8A 2NVUA 5G4KA 2J8ZA 1FDVA 4PG7A 5H82A 1H5QA 1HYEA 2FR1A 4EJ6A 1YDEA 4UVEA 4P8RA 4DLAA 1SCUA 3H9QA 4FB5A 5ITWA 1P1FA 2NTVA 1DIBA 3D3WB 4G2NA 4MVJG 1E7RA 4OOFA 5TQVA 4CMJA 3ROPA 4I8XA 3AUTA 1Y1PA 5LCXA 5BSFA 1PS9A 5AOVA 3JQ8B 3K2BA 2IZZA 2B36A 2CUKA 4XQGA 4HY3A 4Q3DA 5JAZA 3V5NA 3KSZO 1B0AA 3OQ1A 1PJTA 1T2DA 3PIDA 1SBYA 3GMSA 3EDMA 1SEPA 2IZ0A 2AA3A 3SBOA 4PLZA 4XQCA 3M1AA 1F06A 1PU2A 1DPGA 5CPFA 4RQTA 3B70A 2HKIA 1WLYA 1N9GB 1ZEJA 3NGLA 4E5YA 4CM4A 5TNXA 1Q1NA 3VH3A 4CLRA 5JYDA 4O5OA 2A35A 2FPIA 4D3DA 4MP8A 3DAFA 1E5LA 1TT7A 4WPGA 4GAEA 3DHNA 3EAGA 1Z7EA 3PDUA 1QLHA 1Z74A 3JYOA 5G2OA 3BA1A 1EUDA 1TEHA 1ONNA 3INRA 1DHTA 3QE3A 4J4TA 4O6VA 4YJHA 2X6TA 1B7GO 1SAYA 1XG5A 4YJFA 4HUJA 5JBIA 1C1DA 2J3JA 4TRNA 2X86A 2AEMA 1YJ8A 3AI2A 3DZFA 4ZJUA 4FCCA 2VN8A 1YBMA 4LSMA 1NFQA 3U49A 1N92A 1WZEA 2HLPA 1O94A 4HNGA 4KQWA 2I9PA 3ZZNA 1N1GA 3C1AA 1PJQA 3V2HA 3IAHA 3KBOA 4YAKA 2RH4A 4PVCA 1IPFA 5FI5A 5TX7A 5KOIA 4FC7A 1BXZA 2VZ9A 3GLQA 2HDHA 2Z5LA 4X54A 5B12A 4PLGA 1LSJA 4MJLA 3NTOA 4WECA 4TMFA 4BKOA 2P4HX 2AE2A 3NDIA 2R6JA 2X5JO 3ADOA 3PTZA 2ZCVA 2PZJA 1YB5A 3LVFO 3OICA 4U6SA 3HUDA 3WTCA 1DIRA 4B4OA 3U62A 3ST7A 2VHVA 1AUPA 4CM8A 3SVTA 3JQEA 3PGJA 4ALJA 1HSZA 5JE8A 5F1KA 1NYTA 2FRDA 3QSGA 3QHAA 3HN7A 3KB6A 3OFSA 3ZV3A 3H2SA 4XJSA 2GN8A 3P2YA 3SEFA 4PFJA 2UDPA 1E3IA 3E8XA 4UUPA 2NNLD 3F4BA 1P1JA 2VNSA 2G0TA 1HE4A 1KVSA 1Z75A 3GRPA 1LI4A 4JP2A 3H2ZA 3DZIA 2BFMA 4CR6A 1ORRA 2V6MA 4F6LA 4I08A 2ZIZA 4HNHA 2ZYAA 3KYCA 1YE3A 1HETA 2W4QA 3JTMA 4LMPA 5KNLA 2WDZA 3IUPA 4Q39A 1LX6A 1I3LA 2WSBA 1QV6A 1ZK2A 3GZNB 4AFNA 3AFNA 3GGOA 1YB1A 2Q3EA 1LNQA 2RCYA 3JQBA 4E4YA 4YRDA 1WDMA 3FF4A 1PIWA 4S1VA 3WYBA 1XU9A 4BQRA 3BTOA 3E5MA 4EUEA 1WW8A 4GQAA 3JQDA 1T4BA 3TDKA 1A4UA 3VVBA 5MDHA 3DBLA 3F3SA 1LDBA 1DIGA 4BO7A 1L7EA 4D42A 4DMLA 2G82A 1P0FA 4W82A 4NBTA 2R2GA 4DIBA 2NV6A 3OH8A 2CF5A 4TZKA 1CETA 2CMDA 3FNFA 1J6UA 3SLKA 1B8UA 4RVFA 3TFQA 2RH8A 4IGFA 2ZYGA 1HE5A 1MUUA 3GDGA 4M55A 4R9SA 4IM7A 3U09A 4U5QA 3Q2KA 4E2WA 5DCYA 5BSEA 4O1MA 1T1SA 2JFGA 2V6FA 4BO6A 1PJCA 2AMFA 3L4BA 2NUAA 5A04A 4CMIB 5B4UA 4WUVA 3C85A 2C54A 3KEOA 1I3KA 3ETEA 3GY0A 1U3TA 1ZEMA 2W8ZA 3GNQA 1KBZA 1ARZA 4YQYA 5CPBA 3TOXA 3WXBA 1WPQA 4BNMA 4A03A 1K89A 4E0BA 3ZWAA 3GVIA 4C7JA 1D4FA 4CMHA 5JC1A 3STHA 1BW9A 2VYVA 2D4AA 3WGTA 2DTEA 4RVDA 2IDZA 5L53A 1I5RA 2O3UA 4PG8A 4NHEA 1LLDA 1KEUA 5U1PA 1MLDA 1UXJA 4FD3A 4NIMA 4IDFA 5T8KC 3VH2A 5HM8A 1M2WA 3H3JA 5HBRA 1NX6A 3H5RA 4CMGA 1NR7A 3GGPA 1KEVA 2X1HA 4IDGA 4IINA 2OFPA 1H6BA 3HZZA 4BNZA 2YDYA 1KVQA 2JHFA 3TZHA 3DO5A 3AU8A 1O8CA 4EEXA 1IZ9A 4UEOA 5GZ3A 3SJUA 9LDBA 4FFOA 2DPHA 1X0XA 3VZRA 3L77A 2VOEA 5I7FA 3PHIA 3IC5A 4ZQHA 5A5EA 5HWSA 5JO9A 3A9WA 1ML3A 2NQ8A 1LRKA 4R68A 4P4NA 5JCXA 4OMUA 1HZZA 4YDRA 4CM4B 1N2SA 1NQ5A 4DTIA 3FRJA 2P4QA 5T64A 4NNJA 5T57A 1QLJA 1E3LA 5A03A 4WNCA 1FDTA 1XIVA 2ZJ1A 2JHGA 1EE2A 4A5OA 5KVVA 1T24A 4UUNA 4BNXA 1DJNA 3RUDA 4AJKA 2QRKA 3DWFA 5CDGA 3AM5A 4WCDA 3FTPA 3WGYA 1QYDA 2AQKA 5ER9A 4TWRA 5TGDA 1N7HA 4JBGA 3UKOA 1Q2XA 1Y8RB 3F9IA 5EMHA 2BI7A 1U5AA 4DBZA 2O3QA 3S2GA 2QRLA 4MVJM 1YS4A 3ORFA 3DR3A 3GC6A 4XB2A 4CLDA 5JNLA 4KOAA 4WLNA 2YUTA 4GKBA 2UUOA 3INTA 5EPOA 2VWGA 3I9LA 1EFLA 2HRBA 3ETDA 3KLPX 1HYGA 5JAMA 3PLNA 1BXKA 4OXKA 3AW9A 2C2XA 2JD0A 4Z0PA 1ZSYA 2J5KA 3H3FA 4GKVA 3JCZA 4LCJA 1ISGA 2PD6A 4FN4A 3SXPA 1U28A 1UUFA 1W73A 3X2FA 5JY6A 4JROA 1EUZA 3VPXA 4BNLA 1KERA 5HRUA 1EQ2A 4CUKA 1BMDA 4YJHB 3AWDA 2CVZA 2VHXA 4L76A 4BNKA 2DUWA 4CODB 4RVSA 1P3DA 1VC2A 4BKRA 4J1SA 5DCUA 4ALKA 4I9UA 2RHCA 1BTOA 4MVJI 1ISHA 2CDAA 1K5HA 3BZUA 4CMAA 5I9LA 4NU5A 4TSKA 5HTOA 3ZV4A 2OL4A 1MXHA 1CYDA 1U2GA 1Q7CA 2O2SA 3NRCA 1GQYA 2X0RA 3HSKA 1UR5A 1VL6A 3UH1A 3RVDA 1XLTA 3RFXA 3OBBA 4YT4A 4YXFA 3BMQA 5DF1A 2EJVA 5L4LA 4QEDA 4RLHA 4D43A 3CH6A 3WSWA 3CEAA 1Y5MA 1ZSNA 4BV8A 1UP4A 1LXCA 3GUCA 2VYNA 2CVQA 2VZ8A 3MTGA 4YJGA 1M66A 3GZ4A 3KM0A 1I2CA 4EDFA 4EJ0A 3FWZA 4CLOA 2VOJA 3S1LA 4RF4A 4QO8A 1KC3A 4WASA 4EEZA 3VVCA 1P9LA 3AY7A 4G5HA 4RCVA 4O59O 2HU2A 3DONA 4XIJA 1XQ1A 3AU9A 5AYVA 4ALMA 4JGBA 2O7QA 2YV1A 1A71A 4CM6A 5KJCA 1T2EA 1ONPA 2BELA 2CF6A 4DUPA 1PZGA 2PGDA 4O0LA 2AQHA 3KTDA 1C0IA 2VUSA 4J7XA 4PG4A 4NBWA 4OO3A 1IB6A 2P5YA 3BMCA 1QKIA 2B5VA 3Q6IA 4Y98A 2V7PA 3K30A 1Q7BA 3WR5A 1HE2A 1E7SA 2CDCA 4NZ9A 3LT2A 1Y7TA 2ZQYA 4J0FA 5EESA 1LC0A 1QYCA 1BG6A 1LRLA 2AXQA 5DULA 3A14A 1KVUA 5FYDA 3SX2A 4BO8A 4J9UE 1XHLA 5CEEA 3O9ZA 3QVWA 4LK3A 3U4DA 3ONDA 4DIFA 1U4OA 3T7EA 3OECA 1T2CA 3WGOA 4DPMA 1HYHA 2C59A 1PX0A 3PLRA 5DT9A 4Z9XA 3OETA 1ZVMA 1PTJA 2E82A 4BO4A 2AQ8A 5H83A 4BO0A 1P77A 1VL0A 2OUIA 3DZGA 4OGWA 1PJ2A 2IZ1A 1PWXA 3SC4A 3PVZA 1MFPA 2NLOA 5CDUA 3U4CA 2X58A 5HS6A 2GSDA 4LCEA 2EW2A 3KZVA 1WXDA 4TRJA 2ZB7A 3UCXA 4ID9A 2O3RA 3GVCA 1TI7A 4N7RA 4CLHA 1ADCA 1EQUA 4BGUA 1ZJZA 1O0SA 1ISFA 1R4NA 1UXKA 3WFIA 1UZLA 4OH1A 5CG2A 3VPFA 2HAEA 3NJ8A 4XWYA 3QRWA 1HKUA 5F3RA 3PYMA 1U3WA 2B35A 3RAJA 4E21A 3Q11A 4CV1A 4BO1A 3ENKA 4C7KA 1M75A 1HWYA 2YV2A 4Y8VA 4OQYA 4MINA 3CPSA 1DO8A 1LDYA 1K3TA 5JAIA 2VTEA 3GPDG 4PLCA 8ADHA 3BHMA 3QP9A 4E32A 4RF5A 4Y67A 4YVFA 3W8FA 2FOIA 4R3NA 1U7HA 2BHLA 4YPOA 3ZCXA 1T2FA 1HRDA 4UULA 5DZSA 1BW9B 1E92A 3E18A 1IY8A 1N1EA 5G0UA 4DQXA 3GPIA 1OZAA 3VH1A 1JLLA 3O03A 4J2OA 2EWMA 2PD3A 2QRJA 5L7WA 1MC5A 3FPLA 1NVMB 1DFHA 1ZNQO 1PQPA 3VPGA 3OIDA 4D3FA 4J49A 4XB1A 1BWSA 3MJEA 1XDWA 3QY9A 4YT5A 3DDNA 1RJWA 4XGNA 2DLDA 3M1LA 1MXFA 2FZEA 4OKIA 3WICA 3ZU4A 2X9VA 5T5QA 3JD1A 4PLTA 4IXTA 3OEYA 3QQPA 2VRCD 1PQUA 1W6UA 4NBVA 3UHAA 3WQSB 4PGFA 4BO5A 3RASA 3CINA 3BMNB 3DFUA 2Y67A 1PS0A 1DAOA 4P38A 1VJ0A 3ASUA 4DVJA 2PZKA 3NDRA 3ZWNA 2B37A 1EUCA 4CM3A 2I3GA 3ZV5A 5JDCA 2WJPA 3EHEA 4YAJA 4A2CA 4F46A 4OXYA 1V6AA 4FOSA 4IQ0A 3HN2A 2G17A 4BB5A 4RVGA 3CMMA 4D45A 1WMAA 1U9JA 2P68A 3ZU3A 1XCBA 2CFCA 3AOEA 3TFOA 3KLMX 5JFOA 1X13A 2Y1GA 4ZD6A 3TZQA 3WOHA 3GDFA 1HDYA 4PRKA 1QR6A 5C3MA 1J4AA 3Q9UA 3ETGA 4IIUA 3GG9A 3R0IA 3I9KA 4CM5A 3AM3A 4AJEA 3GOHA 4YR9A 1YKFA 2JCVA 3RUCA 4OL9A 1U2DA 1DC6A 2FMUA 2DU8A 2B69A 5ICSA 4MKZA 2VNAA 3MJ4A 4JIGA 1OI7A 3JD2A 4KWHA 4IZHA 3GK3A 4BGEA 5JO0A 1U7TA 4JJFA 4BNVA 1C0KA 1YONA 1XR3A 2VUTA 4WK6A 2D3TA 3HB4X 1B8PA 3NT5A 4MPDA 1NAHA 1VM6A 1A9YA 2PA3A 4YCAA 1WNTA 5L40A 4BGIA 4WCFB 1DBVO 3FD8A 3JYQA 3GRKA 2XAAA 4PRLA 4GX1A 2JD2A 1PGPA 1XGKA 3OJOA 4FJ0A 3D1LA 2OP0A 3R3JA 4KTTE 4FBGA 1U8XX 3GN1A 2IEBA 2NSDA 3HADA 3UICA 1QMGA 3LF1A 1ZH8A 2FPPA 3RROA 2VWPA 3HDJA 3I9MA 3RI3A 4OXNA 4OKNA 1X7GA 1X1TA 1YL7A 4GMFA 4KP7A 4FDAA 2C5AA 1B15A 2JAHA 4R1SA 1NASA 3N74A 1NFFA 1I33A 1ADGA 1B3RA 2FPGA 3DAPA 1R37A 4BGVA 3TL2A 3Q1LA 3O8QA 4DQVA 4Q3BA 4TVBA 1YL6A 4AICA 2PLAA 1YXMA 2I6TA 3RUHA 2F00A 4NH4A 2YY7A 1IUKA 2B0JA 1XU7A 1Q0HA 3MEQA 5KJEA 3VHRA 4CM7A 2GRAA 1E6UA 5DBGA 1HLPA 4L4RA 3R1IA 5HA5A 3LLSA 5AXCA 2I5PO 2CZCA 2ZTUA 3GGGA 2D59A 5B1YA 3WGIA 4F45A 1GZ6A 1DFGA 3AFMA 3W1VA 4OHUA 4CMCA 2P9GA 2BFAA 3KHUA 4IY1A 3TOZA 3DTYA 1SEVA 4ALLA 4C4OA 3KEQA 3ROQA 1KVRA 2TMGA 4UVIA 3GG2A 3WBFA 1BVRA 4UUMA 3QWHA 2AG8A 4L0QA 1P33A 1FK8A 3FNGA 1KEPA 1PL6A 4LRTB 3LC2O 3GH3A 3GQVA 5BQFA 1PWZA 2DFDA 2YYYA 2HSDA 4XD2A 4XDZA 3CMCO 1EK6A 1ISIA 4XRRA 2EIHA 2NVBA 2O2YA 1PL8A 2AW5A 3HDYA 1X15A 5KVCA 1I2BA 2NTJA 2Q49A 4WLUA 1HDZA 4QQRA 4MIYA 2EW8A 4J1TA 4Q9NA 4JQCA 4NJMA 3QLJA 3JQCA 1JWBB 3M6IA 1WVGA 1DRUA 4FGWA 4H7PA 4HFRA 4EUFA 4P22A 1E3EA 3EYWA 3OIGA 2EHDA 5A3JA 2IXBA 3IL2A 1LC3A 4KUHA 5EIOA 4ZRNA 3OJEA 1LDEA 5TRTA 5KVQA 4EW6A 3WYEA 1P74A 9LDTA 3LT0A 1K2WA 3QWBA 4DPLA 1H2HA 1NQOA 2X8LA 2Y1EA 5JYEA 4TZTA 4JJGA 1R0SA 5JXWA 3ZHBA 4WCFA 2FSVA 2GCGA 2C5EA 1R4MB 3RCBA 1TA4A 2JD1A 3A1NA 4JLWA 4E5MA 3ZWYA 4EI2A 1H9AA 3TL3A 3BTUA 2PWZA 3BMNA 5DBFA 2WWRA 1EVZA 2Q4EA 1X0VA 4W7IA 1LLUA 2DQ4A 3ZWBA 4QX6A 2HJSA 2E49A 5L7YA 2CNBA 3I23A 4YAIA 4R4JA 3VPHA 3S55A 3U5TA 1K6IA 1UXIA 3GT0A 3PRJA 1LSSA 1T25A 2BKAA 3EY4A 2P9CA 3K31A 4KUGA 5C7OO 4J90A 1PL7A 1I2ZA 4ZICA 2PKQP 2HRZA 2NQTA 4IS2A 4HFMA 5IZCA 2C29D 2Y99A 4NR0A 3RFVA 4W4TA 3G17A 2C20A 3G1TA 2IRWA 4BNTA 4TRRA 4WLOA 4XRGA 4FGSA 4HWKA 4BB6A 1P1HA 1SB8A 3RWBA 2GYYA 1VSUA 3ZNQA 1QRRA 2PFGA 1UP6A 3HE3A 4E12A 1PJ4A 1ZJYA 4J4BA 1FMCA 1H6AA 4OJNA 3WWYA 4FR5A 3SJ7A 3E48A 3FTNA 3UCEA 1DAPA 3KYCB 4CV3A 3E9MA 4KDFA 2V6GA 3WMXA 3WS7A 1LU9A 5U4QA 2FY8A 1LTHR 2VHZA 4LGVA 4RVUA 2DBZA 3GZNA 1NWCA 1OFGA 3DMYA 1GYQA 3NDJA 2UYYA 2YV3A 1D8AA 1CDOA 4PG5A 1I01A 1VRWA 5IN5A 3P5SA 4A0SA 3RFTA 1XYGA 4U7WA 3DBRA 3KOUA 3B20A 5FEUA 1A7KA 1U3VA 2ZTLA 3D64A 2H1SA 5DOZA 4N5NA 4Z9FA 2D5AA 3PPIA 4Y6PA 3RIHA 5K6AA 1NNUA 3OSUA 1VI2A 2HK9A 5TT1A 4QSMA 3U9LA 2IE0A 2BFOA 5JS6A 1KYQA 3ITKA 1FXSA 5DDIP 1UAYA 4PLYA 1LUAA 3WSVA 3KETA 1I32A 4J6FA 5THKA 4PIVA 1E5QA 2Q1SA 3DZBA 1XA0A 4N18A 4CM9A 1YBAA 4FQ8A 1PGJA 3K5PA 3P7MA 4ZGWA 2P2SA 5G4KB 3K96A 4CMKA 2BLLA 3ZI0A 3D3EA 1QYXA 1EVJA 2QYTA 1HDGO 4R1TA 4GX0A 4DXHA 3B6ZA 5L51A 1E1MA 2J5RA 5THQA 1A9ZA 3RUFA 1GZ3A 1G6KA 2AEFA 3HFGA 5C5IA 2NU9A 1Z7BA 1DIAA 5DP1A 1PEDA 3Q3CA 3OP4A 2Y93A 1YQGA 3L6DA 4EITA 5IZCC 5FWNA 4E31A 1VKNA 3WLEA 1I30A 2VT3A 2PGJA 4CR7A 1KVTA 5K9ZA 4ONEA 2I65A 1X14A 4UEKA 1A27A 1ZFNA 1JKIA 2B4TO 1GY8A 4NFHA 2LDXA 1RYDA 3WGHA 1EK5A 3OJLA 2A4KA 2EV9A 3FR8A 3D5QA 3WFJA 2WYWA 2C07A 1F8GA 4OSOA 1E7MA 4RZIA 4XEHA 1BRMA 2GR9A 5CHEA 3V2GA 3GEDA 3VAZA 1WDLA 1KC1A 1BGVA 2NWQA 4WOKA 1HDOA 2QQ5A 1EBFA 1Y5RA 2YQ4A 4B3JA 4FFLA 2VRBA 4IIVA 2GO1A 5I8ZA 1R66A 1RYEA 5A5FA 1Z82A 4IQ8A 2I99A 3KV3O 1JWAB 1HEUA 1VSVA 3Q2IA 3FWNA 4N54A 1AXGA 3ZNPA 5IZ4A 2G1UA 4R1UA 2AHRA 5EQFA 4YYZA 4GSKA 5I9MA 1SOWA 1EEHA 4ALNA 4PCVA 4AJJA 4B4WA 1KETA 2Y68A 3RC9A 4MKRA 4Y6RA 4NU6A 2UV8A 4AJLA 1I8TA 3IS3A 4QECA 3RJ5A 4DWVA 3WJ7A 2NU7A 2POQX 5BT9A 1MX3A 2VWHA 1IYZA 3OQBA 1I0ZA 1PZFA 1JTVA 5ITVA 4MP3A 2BGLA 1O5IA 3BMQB 1ZK0A 3KXDA 5G0SA 1F0YA 3EVNA 3M2PA 3RC1A 1R0LA 4UVHA 2ZYDA 1T2AA 3HDHA 3K9QO 3AUAA 3JD0A 1BSVA 2J3HA 3DZHA 4Z9YA 1LBEA 1E3JA 3H65A 1OC4A 2FP4A 4IDCA 4B3HA 2QIOA 2OBYA 2VTDA 2DUUA 4FSHA 1W0CA 3ONFA 4D7AA 4PZDA 5COQA 4M86A 1GCOA 3HG7A 1P44A 2PY6A 3EC7A 4GMGA 4IDDA 3GVXA 1ZO8A 1GADO 2DAPA 2YW9A 5JPIA 2NADA 2W2KA 3ZN2A 4ZQGA 1V35A 3EK2A 2J3KA 4E3ZA 3U3XA 5CDYA 4B7CA 1YH3A 3MWDB 4YT8A 1WZIA 1GTMA 3KO8A 3H5NA 4HP8A 4IQGA 3WQQA 1V3TA 3ZDFA 2DKNA 4CMIA 1J5PA 2H5LA 4HBGA 3NT4A 4LVUA 4NJOA 5T67A 4BMSA 1PZEA 1QP8A 4JBIA 4XYLA 4OAQA 3Q0EA 4OOEA 3AUUA 4E2YA 4YRAA 1V3UA 4Z0HO 3ZU2A 2ZB4A 4BNJA 2EGHA 5CDTA 4LRSB 1ISJA 1W8DA 1DXYA 1K6XA 5IDWA 2CDBA 3PZBA 4PLFA 1XKQA 1DEHA 4IDAA 4IJWA 1AN9A 3A06A 2I67A 4LISA 4UEJA 4CQLB 4BQPA 2GPTA 4CQMD 1CEQA 1S7CA 1KY5A 5L95A 1GYPA 4UREA 1LDNA 1Y81A 3S2IA 3FNEA 4RPKA 4BNHA 1T1RA 3K2EA 3K8ZA 3EMKA 2CSUA 3IKVA 1GPJA 5FFFA 3QV1A 4CM9D 5B4TA 1ENZA 4Z0TA 3PK0A 1I24A 4M8SA 1PQWA 1VE9A 4J2HA 5C37A 3VKVA 3ZHXA 4P4LA 4AJNA 1UXHA 1SB9A 3I9OA 3W4IA 2O7SA 1HDXA 1PGNA 4PN3A 1BXGA 4WKGA 3PQEA 1YDWA 1GQQA 2BF7A 1IZ0A 4EBFA 1OOEA 1KOLA 3ZWPA 3ONEA 4L9RA 1ISMA 4XYMA 4IJVA 2BGKA 4YACA 1DJQA 4GI2A 1HXHA 2VUUA 3PEFA 5DN9A 3RC7A 2J6IA 3JQBC 2Y1FA 5G4LA 3I9JA 1U1IA 3B1KA 1RKXA 4E6PA 3GHHA 3GVPA 1PJBA 1A4IA 4R5MA 4FFMA 4GLLA 3SC6A 2RHRA 5TSDA 4XYEA 4CMBA 4L74A 2C82A 1M67A 5TIIA 1V8BA 3GA0A 4U0KA 1R0KA 1NPTO 1D1SA 2CVOA 3PIIA 4JN6B 3LT1A 3U4HA 4B8WA 2GZ1A 2PH3A 3I4FA 1TT5A 3EW7A 3OQ6A 1ZIDA 1Z73A 4L4SA 2ZK7A 4YT2A 5IXSA 1NHGA 3W6UA 2J5QA 3DC2A 4W9NA 3LQFA 5KVSA 3PQDA 1G0NA 3PWSA 1HE3A 1XQ6A 2Y0EA 3ADPA 4GVLA 4RO0A 4UVGA 4NG5A 4NK5A 3F46A 3ASVA 4QO7A 5KIAA 1R4MA 4KTVE 4BKUA 2WD7B 3BAZA 1U8FO 4MIOA 1C3VA 1EDOA 3F4LA 4IMPA 4E33A 1NVTA 2ILTA 3AJRA 3ZNOA 2GGSA 1AXEA 5KKAA 2BRUA 3IQDB 1ZMTA 4IS3A 4QT0A 5IDXA 1E1KA 1P0CA 2HUNA 4M89A 3JQAD 5TT0A 5MGBA 4MVJE 2OXIA 3T4XA 3W4KA 4AJOA 5IAAA 4R9RA 3K73O 4DPKA 1HLDA 5F21A 3JQGB 4PLWA 5AXBA 1RM5A 4RF2A 3U0BA 3WGZA 1JQBA 2HJRA 4G81A 5TJ9A 1U3UA 3ZH2A 1BDBA 2EKLA 4BNYA 1UDCA 3MJVA 4YB8A 3WNQA 4J9VA 4E2XA 1V3VA 3OJFA 3H9UA 3K6JA 3V1YA 4FW8A 3WYCA 1MP0A 3W8DA 2GDZA 2EEZA 4WE3A 4U0JA 5JC8A 4WJZA 3HQ4O 1QV7A 3JQFC 1PGQA 4GGOA 4CMEC 3JD4A 4YAGA 4IXWA 3ABIA 5COAA 4YTEA 1JDJA 3TQHA 5BNIA 1NQAO 1XSEA 1TVEA 1GD1O 1GQ2A 1I36A 5BR7A 3WMWA 5ENVA 7MDHA 2FR8A 4PLPA 2EG9A 2Z1MA 4B3IA 3IJPA 1CQIA 1QORA 3RQSA 4E5KA 5JY1A 5L4NA 4XJTA 2VHYA 2SCUA 3DHEA 4M1QA 5ENDA 6LDHA 3F5SA 3JQ9A 2BFPA 1T26A 1XELA 3L4SO 2E48A 1GFSA 1JVBA 4XA8A 3KSDO 1IPEA 4JX8A 4I5FA 4D3SA 1S6YA 1ID1A 2HQ1A 5JDCC 4AG3A 4GLOA 3KUXA 4KZPA 2PZMA 1LQTA 4TKMA 4CL8A 2X0NA 2DPGA 4KMSA 3I1JA 5JMWA 2HK8A 4RORA 4EJMA 4FJ1A 2DBVO 2OMEA 4F3YA 1BHSA 1E1LA 1CF2O 2ZQZA 4GX5A 4NBUA 1SPXA 2IXAA 3W4JA 4RJTA 5CFZA 2VHWA 3DMTC 3LU1A 2EKPA 3JD3A 2C2YA 4RPLA 4XQEA 1NM5A 4B7XA 3HJAA 3LF2A 2GD1O 3CKYA 1H6DA 3I9NA 2X9NA 1TT5B 4DC0A 2W2LA 2OOSA 1Y8QB 1NXQA 3E1KA 2VT2A 4ILKA 1E6WA 4PZEA 2I66A 3UW3A 1NWHA 3LT4A 4Q3CA 3JQAA 3DBHB 4XGIA 3BMCB 5AVOA 1GUFA 1ZK3A 4MOWA 3ZHYA 3RU9A 4DYDA 5AXDA 5JCJD 1QSGA 3DB2A 1N9GA 3WX0A 2VYVD 2NTNA 3RUEA 4FOOA 2YQ5A 3NV9A 1AHIA 2WE8A 1U5CA 3F47A 1GV0A 3NT2A 4J4HA 4MKXA 5JCJA 2GNAA 2FR0A 4FS3A 4WGGA 1BXGB 1YO6A 1F12A 2NACA 3I5MA 4W7HA 3ZNNA 3JQFA 3S2EA 5F1PA 4CMEA 2BH9A 3H9EO 3HNPA 2FHSA 2XF8A 4L4XA 4CJXA 1PR3A 3C8MA 4HV4A 4K1LA 4QXMA 4RV9A 1Y9AA 5EQDA 4Z6KA 2ET6A 3GFBA 5H81A 3TSCA 3ZW8A 3G79A 2DTDA 5L45A 1OC2A 1NHWA 1E77A 2BI8A 5A02A 1WMBA 4RL6A 4NJMB 1E6EA 2OORA 3A4VA 4DREA 2HMVA 4MO2A 4D41A 3GEMA 4BO3A 3QVSA 3JQ9C 4MIEA 2NVWA 2XOXA 3JQ6A 5EINA 2Q4BA 1ULUA 4EYEA 3MZ0A 4MVJF 2QG4A 3BMOB 2H6EA 4J43A 3BMOA 1E0DA 1WWKA 1GU7A 3OA0A 5B37A 4P4GA 3ZW9A 3HB5X 3VH4A 2EXXA 2XXJA 2YFQA 3QW2A 4GPD1 5ES3A 3D3WA 1R6DA 4XX0A 3G0OA 5ADHA 4DYVA 1UDAA 1DDOA 3DMTA 4UAGA 4CQMA 3IP1A 2WD7A 4PG6A 4Z3KA 4WLEA 3PJEA 2WD8A 4NK4A 3UUWA 1PJLA 3PFFA 4FPXA 5LC1A 2B83A 3QVTA 4J16A 2Y66A 5IFLA 4PZCA 2Q99A 4B4VA 2V65A 3BYZA 5BNFA 2AE1A 3CIFA 2DBQA 2ZCUA 2GZ3A 2VYND 1X7HA 2ZTMA 4YWJA 4A73A 2O3SA 3LDHA 2GERA 1OBFO 3DZJA 2D0IA 4BO9A 3GAFA 1GZ4A 4GWGA 1F14A 3NTRA 4RLSA 1NBOA 1OMOA 2YFHA 5A4DA 1P1RA 2W90A 1ZKMA 2D5CA 4L8VA 4LVCA 3O26A 4QFDA 1LEHA 4HFJA 4D46A 1BVUA 4NDNE 4YJDA 1Y9EA 4GGPA 5EJ2A 5L7TA 5IDYA 1H93A 4CLRB 1AE1A 1MV8A 1WDKA 3E9NA 3P2OA 3V8BA 3DQPA 1DC3A 4AJIA 2PTGA 1IHXA 3VTFA 2UAGA 1L7DA 2WEKA 4XCVA 2AQIA 1PJ3A 2IYOA 4S3MA 4E30A 4BL5A 1VL8A 3I3OA 1C0LA 4RVHA 4A10A 5CEFA 1GCUA 3PJDA 4R51A 2GUGA 3RUAA 2DTXA 1N5DA 1H94A 1YWGO 2DBRA 1SO8A 2GZ2A 2WTBA 3DOJA 1QYWA 4LSWA 1DFIA 5FF9A 2IYPA 1DC4A 4II2A 4PLHA 4URFA 2OGUA 3TZCA 4CL3A 2P9EA 2PV7A 3OM9A 3VPSA 3IJRA 4HXYA 2A92A 4XKJA 4J1NA 2UUPA 2NM0A 4LMRA 1AHHA 1ZZEA 3FPCA 2P5UA 4FC6A 1A7AA 2YHUA 4XYBA 4FJ2A 1RM0A 2FZWA 4AL4A 4G65A 3IDSA 3TPCA 1VJTA 2ZATA 3UCFA 2EP7A 4I5GA 1G1AA 2R00A 1C0PA 2JL1A 3FBTA 4KQXA 1IE3A 4N5MA 4DC1A 5I7SA 1DLIA 2PR2A 4UUOA 4QTZA 1LLQA 2X5KO 1E7QA 4U6QA 3W6ZA 5AQ1A 3ZWOA 1JAXA 1YBVA 2EP5A 5DBIA 3VOSA 5B4VA 1JKFA 1Z45A 3LK7A 1EVIA 3ITDA 3TJRA 3RUIA 3WJAA 1LSOA 2EERA 4DL9A 1Q0LA 3LZ6A 5IXYA 3L0DA 4J3FA 3WWZA 1SNYA 4I1IA 4IDBA 2Y1CA 3MWEB 1I10A 3DOCA 5CP8A 4RZHA 1UAGA 4J91A 1KEWA 2X0JA 1KIFA 2I76A 2C0CA 3ROKA 4BNNA 5TLSA 2G76A 1YJQA 3SLGA 4KUEA 3ZWVA 4BUCA 2YHIB 3ICCA 1B8VA 4J7UA 3GNSA 2BD0A 2IEDA 4NFSA 2G5CA 1E3SA 1P1KA 3ZWXA 4L73A 5A1TA 3RKUA 5LDHA 3TWOA 3DTTA 1O89A 4A26A 3JQ8A 3AM4A 2Q45A 1YB4A 4IDEA 2PK3A 1QG6A 2E4AA 4I9HA 4D44A 3JYNA 3TNLA 1HTBA 2VCYA 1UZMA 4I9NA 4Q3NA 3VKUA 3HFSA 1CIVA 4E5NA 3A28A 1YVEI 5IF3A 5KJ6A 3NGXA 1VLLA 4XGKA 1GR0A 2FWMX 3RD5A 1ULSA 4GVXA 4CLEA 5BSHA 5KTKA 5ER6A 2H9IA 6ADHA 2Z1NA 5K0ZA 3Q9NA 2X7HA 1XWFA 1SC6A 4YRBA 2D1YA 3WNVA 1B3BA 2B4QA 2JJYA 1TLTA 5L9AA 1FDWA 3FHLA 1H2BA 4A27A 5JLAA 3IMFA 4IJUA 1NQTA 3H8VA 4JK3A 4FIZA 4E5PA 4BIIA 5CAEA 4HADA 2XXBA 2JCYA 4EZBA 4JCOA 1ADFA 2HO5A 4RGBA 2QZZA 1IULA 3RBXA 1N7GA 4WLFA 3IIEA 1O6ZA 3I6QA 1H6CA 2O4UX 5IN4A 3E03A 4XDYA 1HL3A 2GN6A 1FDSA 3DXFA 4BNUA 2E6UX 2GN4A 1NPYA 2D2IA 2WYUA 2WMDA 3C7CB 3B1FA 3CTMA 3EZYA 3PQFA 3V2UA 4AJ2A 5IJZA 5U9CA 3G1UA 3H4VA 1M76A 4MP6A 3R6DA 3GR6A 5EL0A 2QHXA 2VQ3A 3WIEA 3H6KA 4KDEA 3WGGA 5GZ1A 4N5LA 3H5AA 2PD4A 3GHYA 4M54A 4F6CA 3ENNA 3ZHZA 1NPDA 1E3WA 4ND1A 4RPJA 5BNTA 5A3VA 2X4GA 2X23A 4TROA 1E3WB 3E5RA 3EGOA 3TZKA 3CSDA 5F1OA 4ZQEA 1HSOA 3AI3A 5ILOA 1TB4A 1GYRA 3QWIA 5KCZA 4DLLA 4DMMA 5CG1A 3COSA 5I7EA 3AI1A 1C14A 4GSLA 2QYSA 3GAZA 4B7UA 3RC2A 4EUHA 3IOYA 3RKRA 5L3ZA 4R69A 4UVDA 3BTSA 4IPTA 1WP4A 5G0WA 5EN4A 3PYXA 1ENYA 1R16A 3D0OA 3QIVA 2ZJ0A 4ZVVA 3WLFA 4BNFA 1V0JA 4I5EA 1PGOA 5F5NA 2DC1A 3AK4A 3D4OA 4CM1A 2V6BA 4K26A 1DIHA 1D7OA 1O95A 2J3IA 3D4PA 2PGLA 1MB4A 2VWQA 1QXSA 5CEJA 4CQMB 4RF3A 4K9DA 4ZHSA 5GY7A 1AGNA 3G49A 3I52A 4DA9A 3KRTA 3E9QA 2X9GA 3PJGA 5T8KA 3TN7A 5DP2A 4J7CA 3BHIA 4ESOA 3DL2A 1IHYA 3JQ7A 3TZ6A 3JYPA 4Q3EA 2BMAA 4FFNA 5C7LO 5CDSA 5KJ1A 1ZW1A 1YL5A 1PZHA 1HDCA 2JFHA 4INAA 5BSGA 5KWEA 5JDIA 2O48X 1EFKA 1ENPA 2OO5A 3CZRA 4DLBA 2RIRA 5GMOA 5A9SA 3K92A 1KS9A 2HMUA 2O23A 2QX7A 3L6OO 2Q50A 3UVEA 1B16A 5A9TA 1CJCA 4BHTA 4WOJA 1CERA 4M49A 2CD9A 5LDGA 2W2KB 1FDUA 4JP3A 1Q0QA 3G3EA 4IGEA 2Q1TA 4XZ3A 3OA2A 3C1TA 4BO2A 4OYRA 2JCXA 4Y9DA 4RPGA 1CQJA 2O3JA 4ND5A 1NVGA 3GVHA 1J0XO 3ZGYA 2ZB3A 2F1KA 2Q2QA 1K6JA 1NFRA 3QA9A 2D8AA 4BMVA 1TXGA 2EKQA 1DC5A 5F5LA 4AJ4A 1OAAA 1C1DB 1KY4A 1EMDA 1E1NA 1EZ4A 3VC7A 1G0OA 2JAPA 3ON5A 1R12A 3NTQA 1SMKA 1DOHA 4R3WA 3VDRA 3L6EA 4NPCA 2X5OA 3GEGA 2Q2WA 3BIOA 3OIFA 2Y1OA 2A9FA 4IBOA 1M6WA 2OBNA 3R3SA 5KKCA 1YGYA 1UP7A 1NP3A 5IG2A 3BTVA 1PJSA 4QUKA 3FCOA 1IOLA 1L1FA 1Z6ZA 1GUYA 2EJWA 3GN2A 1C1XA 3WQRA 1Y8QA 2O4CA 4CUJA 4JXKA 1I3NA 4H16A 3BHJA 1MA0A 4AJHA 5A9RA 4CV0A 3JQAB 3VDQA 1A72A 3AOGA 3U4IA 3ROMA 1DB3A 1GL3A 4R5HA 1WAMA 3FI9A 3MJCA 2X0IA 3QWFA 4TVOA 3WTBA 3GNTA 5I7VA 3QWAA 4O63O 1DSSG 1ZK1A 5TS3A 4OSPA 2ZTVA 3FBGA 4L75A 2ZKLA 5ILGA 2WM3A 1EBUA 3NEPX 3PDJA 1Y6JA 3DAGA 2RAFA 3ZV6A 1FF9A 3F1KA 2VZ0A 3VZQA 4BNWA 3JYLA 4HKTA 3JSAA 5GZ6A 3JQGA 4OQZA 4YA6A 3GF4A 1DHRA 2Z95A 3CE6A 1YOVA 1PR9A 1IL0A 4YJFB 3S2FA 1N8KA 4BVAA 2PKRA 1CRWG 4GL4A 1J49A 5T6BA 1QYVA 4HFNA 3UXYA 5EERA 1NTOA 1GEEA 4E2ZA 5C7IO 2B5WA 4J0EA 3UGKA 3ULKA 7ADHA 1SZJG 1MGOA 4U8GA 3NUGA 2Q1WA 3X2EA 4D0RA 2IODA 4R01A 4ALIA 4ZQBA 4ZU3A 1VKOA 2O50A 3N58A 4YAEA 3F5QA 4YJGB 3PZRA 2AG5A 2UVDA 2DT5A 3DBVO 2Y05A 3FN4A 2FN7A 5KJFA 3LYLA 1B26A 2OP1A 1EDZA 2WYVA 2A94A 2DVMA 4YEDA 3PHGA 3VZSA 1GV1A 4NFYA 4BKQA 5DCWA 2WE7A 4W9NC 3HHPA 4DBVO 8LDHA 5JMPA 4TKLA 3NAQA 2QZ9A 2W2LD 3IP3A 5TC4A 4WNIA 1CWUA 4DQUA 1GDHA 4CPDA 2R00C 3JV7A 2TMDA 3LLVA 3WBBA 1W4ZA 3ANNA 3RU7A 2GN9A 3MJTA 3H9JA 3MOGA 4ND4A 4BNGA 4NMHA 4J1QA 3S8MA 3GDOA 4II3A 1DLJA 3TRIA 4JNKA 4MDHA 3WB9A 5J23A 1LLCA 3QVXA 3WDSA 3LC1O 4BMNA 3OJ0A 2H63A 4W99A 4K6CA 1HT0A 5FI3A 3NKLA 3KSUA 3EUWA 2YHIA 1ADBA 3C7DB 2NU8A 1LA2A 2Y1DA 3MOIA 3PFWO 4B8ZA 1P45A 2B4RO 4MVJP 4ZN6A 1LQUA 2LDBA 2DFVA 4OM8A 1JN0A 4NI5A 3VZPA 3C24A 3KYBA 4IZIA 3OHSX 5AXAA 3UOGA 4ND2A 1UJMA 3PWKA 3B1JA 1MG0A 4Y6SA 4DRYA 4ZRMA 1GPDG 2QW8A 3INGA 4JJIA 1GUZA 4LW8A 1JW9B 5TJHA 1MC4A 3WGQA 3ZWMA 2HMWA 4R54A 3AUSA 3UFXA 2ZB8A 5I8WA 1VJ1A 1YQDA 1F17A 4IUYA 4K6FA 2AEJA 2JFFA 3D4NA 4MVJA 1ONOA 3NX4A 5G0VA 4B4UA 3FSRA 3GMDA 4RDIA 2O3TA 3P19A 2VRCA 2C7VA 1HDRA 1SOVA 1E7WA 4H15A 3L9XA 3NJ4A 4R41A 1H9BA 1ZXLA 1NAIA 3I83A 5TF4A 4WCFC 2C7GA 2HCTA 4LN1A 4TRMA 5I9NA 3DFZA 1GAEO 3UN1A 3PHJA 1MFZA 1YOVB 3OMLA 2X22A 4ND3A 3CZMA 4M87A 4XQ9A 3V1TC 4AJPA 3DZKA 1U4SA 4JBHA 3E6AA 3H7AA 3IKTA 4FFPA 4BV9A 4YBZA 4OIMA 4CQLA 2YDXA 5JAQA 1P1IA 3RJ9A 4A7PA 1ZMOA 3OF2A 3KYDA 2PKQO 3I6IA 3O4RA 4DGSA 2HMSA 3L4BC 1X1EA 4CV2A 3BXXA 3JQ7B 3ANLA 4XR4A 4MVJH 5L4SA 3MTJA 4CLXA 5DOVA 1EE9A 3GUYA 2Y0CA 3GFGA 3AY6A 4PLVA 1HZJA 4WEOA 4CR8A 5A9SB 1H0KA 1T4DA 3ZWWA 1YRLA 4GBJA 1M6HA 1ZXBA 1UDBA 2DM6A 4D0SA 4B79A 3PXXA 3D5TA 1D1TA 1R4NB 2JKVA 3T7CA
chains in the Genus database with same CATH superfamily
4EG6A 4D02A 5EKDA 1VIAA 1A7UA 3V7UA 4H77A 5CCEA 3COJA 3G5MA 4E13A 4RQUA 4MQFA 2D1QA 3EIOA 2BSXA 2Q46A 3R6WA 5AKEA 4A1OA 2WFMA 3PQCA 3QKWA 2P6UA 3R0JA 1O0CA 4LXTA 3QKTA 3ZU5A 1Q2UA 5JNSA 4ILEA 4DCJA 2GD2A 2FSFA 4FNOA 1XTJA 3KB8A 2IU3A 4F1WA 4CKBA 1XZIA 3PFIA 1ENOA 3DLAA 4FE7A 1MAUA 4DW8A 2VZEA 3HYSA 4LYAA 1H8ED 1SUAA 3PFHA 1A5ZA 2J3LA 3MJSA 3NYWA 4M83A 2B61A 2QTAA 2Z9DA 2IUEA 2R85A 2X3YA 2OOKA 1Z88A 1NXWA 2K87A 2PAAA 1VL2A 2YJ4A 2PL5A 3DFMA 4KLCA 2GVDC 1A96A 4RMNA 1CQWA 2PSHA 3W8EA 4RMHA 3ICVA 3IUSA 1QH8A 3O8QB 1V9LA 1KDTA 3KDSE 3PHHA 1QHSA 2YN0A 1DBRA 3DHWC 3EVCA 2D74A 5DNAA 3K6SA 1STOA 1ZZGA 4I1PA 3E82A 1SC4A 2ZBGA 3WLOA 1H4VB 5EWLA 3V1KA 1ZSVA 2HMTA 5IDQA 2VK2A 5KDOA 1QU2A 3FR7A 3C7AA 3G1WA 3D54D 2DPMA 1UDXA 1UZNA 4PNHA 4ZREA 5EWMB 4AX8A 1NDUA 1PR6A 3UF0A 3BWVA 3NMUF 1UDWA 3VNAA 1M3SA 2AJCA 2DFPA 1C41A 4GRDA 3VAYA 2QORA 3TF5A 3JX9A 4WKBA 2BGRA 2YWHA 4O1HA 1MO6A 2PS3A 1A9XB 1TLFA 3KHKA 4O2BF 5JSFA 1A9XA 1ULBA 4HX5A 2CSXA 1U0OC 1QAQA 5DSTA 1YS1X 4FHFA 1JZQA 1RYFA 2XQGA 3RS7A 3UXMA 3PB3A 2Q2VA 3CUVA 4P7BA 4C30A 4I1OA 4OXXA 3KB2A 4KSYA 2G9UA 1GRVA 3V55A 3MINB 3QYJA 4JA0A 3RS3A 4AVYA 2ID4A 5CB4F 1LSUA 3VQTA 4F3TA 4PC3A 1YZLA 3SM9A 2ZE7A 4HO1X 2V54A 3FUUA 3AZOA 2Q6VA 1L8XA 2FEWB 2ZE6A 4A0GA 1ULHA 1VRVA 4ZYLA 1A9RA 1O9BA 2XYGA 3FMFA 3QJ5A 5M29A 1U1CA 4C08A 4MB0A 3TLMA 5H9VA 1BAPA 2RBKA 3GW8A 5AUNB 3X1DA 5BORA 5B55A 3U4QA 1VGRA 4A6XA 4R7ZA 1PS8A 2NZ2A 1RM4A 1RPNA 2WU0A 1SUBA 4H08A 3D3QA 3TM5A 1TECE 1FJHA 2V96A 4LOHA 1GNPA 2DQKA 1GEGA 1GQSA 2ZPTX 4MZXA 1G8HA 3OM8A 2NZYA 4N39A 1K0UA 4R1QA 4X84A 3RSHA 3B9BA 2NU6A 3G0DA 3KR2A 5H4GA 3EPJA 4NBRA 3L8GA 5F73A 1EP1B 2BEKA 2OZPA 2XRFA 3WG9A 1P31A 3RJTA 1Y82A 1L3CA 4RVOA 2OA0A 2QE6A 4G85A 2NZ8A 3AESA 4I1VA 3R75A 4N6OA 4R0NA 1GNVA 2PZGA 3LDAA 2UUCB 1FMJA 3IPLA 3QEMA 3PFGA 2OPBA 3GPLA 3PVSA 1UANA 3DB1A 3HDQA 3QF4B 3KKLA 4LXGA 3S2SA 1W9HA 5IFLA 1G8GA 5CW1A 1FVXA 4LECA 5BV0A 1VXRA 2GESA 1PEYA 1YE5A 1TYCA 1VPDA 3A58B 1IRIA 1ZBQA 4GQIA 3A9CA 4GMXA 4O2LA 4MS3B 5LJIA 8AT1A 2IU0A 2AB0A 4GFDA 3M49A 3WIVA 1V37A 2AOWA 1ZUD1 2IGBA 3K0FA 3BULA 2A58A 3F9RA 2FSSA 3VNQA 4RMIA 4YJ3B 2J8ZA 3H1FA 4P81A 2JARA 2NO0A 3PR3A 1U1GA 2ZBPA 5H82A 2FR1A 2PCLA 3E81A 1YDEA 1UC9A 1NXVA 1I2AA 3IYLW 1R9JA 2C8VA 3L7JA 3H9QA 4UVEA 4DNFA 2CL0X 4FB5A 2NTVA 4ZIRB 2Z4SA 1DIBA 4YAFA 4YAUA 3BWMA 3AZQA 2FRDC 2R6HA 3L7AA 4IEFB 4MVJG 3IUBA 3GFVA 1RAAA 1T0HB 4JR2A 5LCXA 3EFHA 1TCUA 1NLZA 5AOVA 3VC1A 1UWLA 4S12A 2B7CA 3JQ8B 3K2BA 1UAAA 3A6DA 3FTCA 2J7PA 5GTDA 1U80A 4PZUA 5JS1A 2RJOA 3OIVA 5FWDA 1KOFA 1E8NA 1N2GA 1FUEA 3FYHA 4MI9A 4RK6A 4LCBA 4QNNA 1C4KA 5JAZA 2VJOA 2ZSFA 1THGA 2PUAA 3RSGA 3V5NA 1GZ7A 3BS4A 4E94A 3B5JA 1TEVA 4BFUA 2EAUA 1NG9A 1Z4PX 1VSBA 3OQ1A 3B38A 2HEIA 3W2TA 4ZJZA 3PIDA 1JWLA 5B2FA 1QNLA 1XD2B 3Q8MA 1FXWA 1K7SN 3M7IA 1V95A 4RETA 1BN7A 2IZ0A 3M6VA 3WLPA 4UE3S 4PLZA 2F3UA 3JR7A 4W5NA 1QIMA 2P0EA 3M1AA 3NHZA 3A6JA 5A0TA 4FIDA 2ZUEA 3SVZA 4RQTA 2PVPA 4W1RA 2VXCA 1B0UA 1WLYA 3EZ7A 1A88A 1ZEJA 1AIPA 2FPXA 2ZZKA 3ENQA 4HEHA 3UAWA 3P0FA 2HFKA 2J67A 2A0XA 2GKGA 3N0TA 1XQ9A 5D8DA 5KYVA 4D3DA 2X1LA 1ODFA 3GLHB 4X90A 5AJWA 5AJZA 4EG8A 1I6MA 3PDUA 4M38A 4ER6A 2ON6A 1Z74A 2QVLA 3OPQA 3TQRA 2CDNA 4V3BA 2JIBA 3AQ4A 3IDAA 2MINA 3F7OA 3UAOA 3GUHA 3I34X 1L7VC 2MINB 4MUEA 4D4IA 1XPOA 5F3WB 1SULA 3QE3A 4J4TA 4NCNA 4O6VA 1JHPA 2M1ZA 3QH4A 1EFVA 4YJFA 4HUJA 5JJ5A 5LZ4A 1C1DA 4BZQA 3QEBZ 2UVQA 3ETJA 5CGQB 2BIFA 5E9JA 1YJ8A 3N87A 5JNTA 5IYZF 4ZJUA 1WSBA 4FCCA 5EQTA 4LSMA 1NFQA 2D0DA 1IN5A 3RU2A 3CS3A 5E2BA 4WL0A 2G77B 3VV3A 1E9EA 1WTCA 3V2HA 3IAHA 2JDID 1OH6A 1AGYA 2FZCA 2NU7B 3FUXA 4V0MA 1OBHA 4L3WA 1OKKD 5HKKA 4DA6A 1RLJA 3M8KA 4MMYB 4P82A 4DIMA 1AQ6A 3M83A 2M6LA 1O3YA 4I5IA 2F55A 3LSTA 2P0AA 3LW7A 1Y7LA 3R0QA 4FTWA 3NDIA 1DQPA 2R6JA 2I4TA 5HZGA 2D5BA 5HE9A 4BGEA 1YB5A 3FF1A 4U6SA 3HUDA 2SICE 1MRZA 3U62A 1XZMA 4B6GA 4EB6A 4LRXA 4IL5A 4R9UC 2BFFA 1Y3AA 3TGWA 4CM8A 1KQ3A 2H0QA 1E2HA 1EB8A 1XDSA 1NYTA 6ABPA 3CH5A 3H2SA 4XJSA 3I9V6 1O9GA 4TYQA 3HFJA 1VBFA 2A33A 2Y9MB 4BFXA 1HA3A 4IO1A 4MW0A 4UUPA 2G80A 2CNLA 1P1JA 2VNSA 4NATA 2UYCA 2G0TA 1MJNA 1SKUA 2B9VA 1V43A 4GRIA 1UM9B 2GFHA 1LI4A 3GRPA 4NY1A 2QMUA 2BFMA 4IEEA 2RB5A 4F6LA 1S2GA 2ODWA 2JFZA 2KMLA 1XTKA 2ZIZA 3MC1A 3FMGA 2MYNA 4I08A 1KSGA 4XCXA 1S3GA 1E62A 1HETA 1F4PA 1JAHA 4F4DA 1TYDE 4QTTB 1SUIA 4UCWA 1CUEA 3DSRA 1LX6A 1GAQA 1I3LA 1Z6PA 1L9KA 1C9DB 2XKAA 2VNJA 3MTBA 4INPA 4MW1A 1YR3A 3AFNA 4R1MA 1AM4D 1MPXA 1YB1A 3FDXA 1KIMA 9ABPA 4KWEA 121PA 2WW8A 3GRUA 4S1VA 3WYBA 2XNDA 5CFRA 1BMTA 4H1WA 3NCTA 1LVGA 5IKOA 1WW8A 3LXMA 4GQAA 1W88A 4YUXA 3CU5A 1J0DA 5I5EA 3L8HA 1JPNA 1QBKC 4BO7A 2I8LA 1L7EA 2QG6A 4D42A 2VSYA 4DMLA 1X8LA 2QT0A 2VP9A 3OQNA 3ACBA 1I7LA 1P7WA 3FGNA 4DDHA 4JI0B 1ZGBA 2NV6A 3EXHA 1FYWA 2CF5A 4TT8A 4TZKA 1CETA 2F9FA 2BFEA 1SVOA 3DDCA 4GXQA 2Q3MA 1XPUA 1VJGA 4RJIA 2KPOA 1W52X 2BMEA 4IGFA 2RGNA 3VTAA 1SXPA 4IF6A 3GDGA 5HMMA 1K4YA 5TMDA 3TSAA 4OYHA 4Q1VA 4U5QA 4DA4A 1W96A 2JGNA 1E6CA 1GGKA 3CRW1 2OENG 4O1MA 3UXHA 5BSEA 4R8RA 1T1SA 3CNBA 1C9MA 1USIA 2V6FA 1A8SA 1PJCA 3QFCA 1NVUQ 3H5TA 2B4KA 3H4TA 3PBKA 2HXYA 1KTVA 4D9HA 5B4UA 1G3IA 2BEVB 1UPXA 4W8HA 2C54A 3SQNA 1I3KA 3FAZA 3GY0A 1IOVA 2YOFA 3PGMA 1MVNA 1NVXQ 1ZEMA 2W8ZA 3GNQA 4C4TA 2FNAA 4YQYA 4KE8A 1XVTA 5DHUA 4AMUA 1QQ7A 4NEGA 3U31A 5JNUA 4A03A 2WYOA 4LWZA 3ZWAA 2UYGA 3GVIA 1H4SA 1BE0A 1WPRA 3BXFA 4NMXB 3SJAA 3ET4A 2VPWA 1IJEA 2ZYTX 3GAMA 3CYFA 2VDWA 4TM7A 1BOOA 1KP9A 4L5JA 2IDZA 3A4IA 4XWKA 3IULA 3S99A 1KEUA 5U1PA 1MLDA 4FD3A 4FFBA 1JECA 1TQDA 4NIMA 4IDFA 4ID3A 3FMPB 3QVVA 1ZNXA 4HQ6A 2PT9A 4LOLA 3SZGA 3H3JA 4TV8A 2AOTB 3LBHA 2AR7A 3UHOA 2X4DA 4KX3A 1G7CA 1KEVA 2X1HA 1IWPB 2Z57A 3HKEB 1VE3A 2OFPA 1H6BA 3EZFA 1NBHA 1C5KA 5K8CA 3TZHA 1WR8A 3DO5A 4NZMA 5JD4A 3AU8A 2AUMA 3HWX1 3R3ZA 3S5UA 1UKEA 2VQEB 4BVFA 5C34B 2NUBA 4L27A 1X0XA 3AIOA 4UBKA 3S29A 1IQ0A 4BLUA 4JWTA 1I4DD 3WIOA 5I7FA 3BD9A 3OFVA 5FQNA 3TLGA 3TQFA 5A5EA 3DUWA 3FPEA 1GJRA 3NHWA 421PA 5HWSA 4XLLA 1DO2A 1LPAB 2H4FA 1ML3A 2TSYB 4FEEA 4R68A 1QE5A 2H1RA 2H4YA 2VUHB 1N6OA 3GFQA 4OHCA 5BT8A 4OMUA 3AR3A 4CM4B 1N2SA 2CDRA 5DYYA 3FRJA 2QA5A 4HWRA 1AQYA 2P4QA 4JBLA 1J9GA 1R0YA 4R8SA 5T57A 1QLJA 4C0SA 5ETJA 5TEWA 5A03A 1BXRA 1FDTA 3D4LA 4B87A 2JHGA 4W7SA 4BLQA 3HPQA 2Q3DA 5KVVA 1T24A 3T3EA 1DJNA 3LYAA 3WKEA 3ELBA 5A3QA 1X7WA 3TQIA 1YR9A 2I4OA 3AM5A 4QZVA 1YF3A 3ORSA 3PHBE 1W1UA 1P7VA 4NYIQ 2NP7A 2P9FA 4ZDIA 4JBGA 1Q2XA 5IBRA 3MGCA 2VLBA 3WIUA 1J90A 1QQ5A 3ILVA 2H2HA 4FP9A 5EMHA 1U5AA 3VRHA 3VZBA 5I7UA 3FUTA 4FHCA 4N0DA 1AMUA 3THXA 1GZUA 1L7BA 3CF4A 1KTIA 4CLDA 3DR3A 3CVYA 4P4SA 5HCIA 4CT5A 1V45E 4E15A 4YMTA 3O2JA 2W0SA 3INTA 5ITZA 3UB3A 3ENZA 4DQKA 3LPCA 3TUZC 2Y71A 2BZ0A 1QMPA 4BNDA 3KLPX 1LF0A 4IFTA 2GBFA 4NS1A 1FSZA 1B6SA 3N53A 4BTEA 1R50A 1WD7A 4Z51A 2X8JB 1ZP6A 2JD0A 4Z0PA 4LCJA 3O4JA 5F9HA 1ISGA 1BE8A 1V25A 3SXPA 1OZ0A 1UBOS 3K0SA 3K8QA 3VR6A 1YDMA 2D8MA 4G5OA 1OAKA 4JT8A 3VPXA 3X2FA 1MAVA 3RE1A 4DMUB 2XZOA 2ZXEA 3NHMA 1EQ2A 1BOFA 1AMNA 4MCIA 2ECFA 2VHXA 4E46A 2WJIA 3ZDDA 2DLCX 4CODB 4LBWA 2ZE8A 1VC2A 1GTL1 1CUBA 4X5OA 1PYOA 1VG0B 4J1SA 1CRZA 2VJMB 1E9DA 2ZPAA 1Q7TA 1BZYA 1K5HA 2FZLA 1RVDA 2ZSHA 5C8YA 5HTOA 1MXHA 2C3MA 3GROA 4QGHA 1KYIA 1NDQA 3RPEA 2O7NA 2XTAA 4A8HA 3FHOA 2O1XA 1UR5A 1KMHA 5L3QB 1E58A 1XLTA 1QIDA 2IYXA 2HI0A 2OILA 5DF1A 2NW6A 2XDWA 3OAAD 3N2KB 3VNRA 1ECCA 1RYMA 3E7DA 4D43A 3UK6A 4UD6A 2A5JA 1APBA 4ZZ0A 4LRQA 3DV0B 4HVLA 3BWBA 2QPOA 3HKEA 4H7DA 2XT9A 5FAKA 2O8FA 4HJRA 2OZEA 3HMQA 1VZ2A 4LE0A 4M0UA 4W1PA 3TRHA 1P0QA 3W8NA 5HMLA 4LOAA 3GUCA 5C1DA 2VYNA 4YJGA 3VTKA 1NXPA 1VCNA 3MTGA 3GZ4A 4KR0A 2ZIWB 1RZVA 1DAEA 1UC8A 4WNYA 4DYHA 1DV1A 2MYPA 4S0ZA 5AW9A 1ZMRA 2XV1A 1NMSA 3S1LA 3H1EA 4JC5A 5LP6B 1KEEA 2CLCX 1JH8A 2LP4Y 2QN1A 2CHFA 3DD5A 3PVCA 3DE4X 1NT2A 4OP1A 3UGQA 2BP7A 3GGDA 3TE7A 1BH2A 4PHCA 4EEZA 5AVYA 3AY7A 4RCVA 2I7DA 4O59O 3WGLA 2WJAA 3HU1A 1RC0A 1VFPA 1XQ1A 3DM5A 4P7JA 4DR5B 1C3LA 3NLLA 3FLMA 2P90A 4D1YA 1A71A 3TUJC 3UJ7A 1GA4A 5DLQC 2HSZA 2WM9B 5C8YF 2E4VA 1U0GA 1VI6A 2YHAA 4RHFA 4RXUA 1T9ZA 4OO3A 1BA2A 3TLYA 3KOZA 3TNYA 1U31A 2LIPA 1QKIA 1X80A 3GA7A 4FI3F 2V7PA 2EBFX 1T8YA 3K30A 4L4YA 2Z4TA 4P93A 4QOFA 1YA8A 1JEQB 3LFHA 4DS3A 1XTQA 1XVUA 1ZI9A 4YRLA 3LT2A 4X63A 3L7IA 5IPFA 1KMCA 1NN1A 2XA2A 3MMZA 5DULA 1BG6A 4RTOA 2AXQA 5SY6A 3AXTA 4JXZA 5IKEA 3ESDA 1MQ8B 4Z4EA 5AHWA 2R7KA 1L5KA 3GJ6A 5F64A 2CHUA 5CXSA 1FUIA 1GSOA 2XR1A 3UMBA 3U9SA 6CHYA 5ED4A 3MAAC 5D1HA 1IDN1 4TKVA 3BGSA 4PPFA 4DIFA 3GCWA 1U4OA 4EA9A 3T7EA 4QBIA 3ZQJA 5EEHA 4DPMA 3I8SA 2ZBDA 2C59A 1PX0A 3JZFA 3PLRA 4PYNA 4Z9XA 2B7BA 3OBIA 3DMFA 3UQYS 4F72A 1PTJA 4FOLA 4BO4A 1BC5A 1NZJA 4ZO7A 4YRNA 5H83A 3EQ6A 2CE2X 2EZTA 3NWPA 4MWEA 3ZWKA 3UAXA 4X91A 1J2RA 3DEIA 5DYNA 2R7NA 1M5UA 1FQJA 1CKEA 5AHXA 5FNVA 1W30A 3DZGA 3CVJA 1GSIA 2A78A 4LOIA 4MARA 4OGWA 2ZRHA 3SFVA 5KYYA 4IJMA 3SKXA 1S8FA 5KB3A 4DILA 5LN1A 3U4CA 3RIEA 3OOHA 3JW8A 4F4CA 5K6RA 1DUIA 3FE2A 3EQ2A 3KZVA 1WXDA 2ZB7A 2O5VA 2ODBA 5D1NA 1F6WA 5BO5A 4XFDA 4KSCA 1EDBA 1TI7A 4N7RA 3VAAA 3I42A 1EQUA 3ZQ4A 4OQQA 3C39A 1ZJZA 2ODNA 5TMBA 3VC3A 1Y4AE 4D25A 5TGZA 1U0RA 2R7MA 4OH1A 4H1TA 5DBOA 3VPFA 2C98A 3TQQA 5F3RA 1FUYB 2EIXA 3KKKA 1U3WA 3DGEC 3RAJA 1WBBA 4OH7A 3LCJA 5IM5A 4Y2GA 4B76A 4ND8B 4RHTA 1NSTA 5IM4A 2Y3IA 4Y8VA 1EXVA 3NUZA 4PS0A 3IBYA 3NHBA 3SJBA 3CPSA 3QKRA 1NN5A 4YDHB 1LDYA 2QIPA 1K3TA 3TW4A 3ZHVA 5CCXA 2XMRA 3D3JA 2JEZA 8ADHA 1GQOA 2HA5A 5LP6C 4Y67A 4NBNA 4QRDA 3BB3A 2FOIA 2B1GA 3WMGA 4EJSA 1U7HA 2CJPA 3VKWA 5BMVA 1W1IA 2ZITA 4YPOA 3ZCXA 1T2FA 1EFHA 3W06A 4UULA 1BW9B 1E92A 3QLTA 1N1EA 2JLZA 3LHIA 5JYCA 3QMWA 3RB8A 3BWYA 2FFJA 1P5FA 1RXYA 1SBCA 4D0LB 5K8LA 4OL0A 5HZHA 5ALHA 3IQHX 3AYXB 3SYTA 1H65A 3ZXXA 1DG3A 1L7RA 1T15A 5C8VA 2QRJA 2ONCA 2QYOA 3PSHA 1W4LA 2QX6A 1NVMB 1O95D 4J94A 3KPVA 3LQ4A 4EFDA 3HCWA 3CW8X 1YQUA 1ZNQO 3KXPA 3UMGA 1EESA 3O5AA 2FSGA 2C99A 2PIDA 2ZRNA 1WHSB 3JALB 4J49A 4LC1A 1XHFA 1BWSA 3V8MA 2Z3ZA 1P8JA 3UANA 4FLEA 3ZE1B 4DLWA 1LK7A 3SKYA 4RPCA 2GAJA 4YT5A 1CNEA 4Y6LA 2DLDA 3RU3A 1MXFA 1L8QA 1U0NA 3B2QA 2FZEA 1P3JA 3MXOA 4OF4A 5FPSA 1YAJA 3SQLA 3ZU4A 1T5TA 1NMQA 2O57A 4IXTA 1AKQA 1XRJA 3ETCA 5EUMA 4GW3A 4RACA 4F12A 5CFNA 3DFIA 3L02A 2VCHA 2VRCD 1C9YA 2II6A 4BWGA 5DNUA 1T8UA 1JG6A 1JIXA 4BFWA 1YUMA 4JHXA 1IHPA 1IN4A 1E1CB 5BVHB 3CINA 1Q20A 4HGYA 4LRUA 3ZVLA 1PS0A 1P0PA 4B48A 1U9ZA 3OIWA 1SWWA 1EUCA 1TRHA 4H7FA 1TMYA 5CYFA 4KGZA 4CM3A 1P7YA 1JSRA 2WJPA 4PO1A 3OZRA 3UMCA 1U1EA 2AUTA 1Z0DA 1X39A 5DVZA 1ZBDA 1BKSB 1UIMA 3M4YA 4OXYA 5JSZB 1DEKA 4GKKB 1K88A 3HN2A 3JZAA 2CN1A 4MW9A 1M10A 5FBLB 4YREA 4A0HA 2HN9A 3CMMA 1V1MA 4KO3S 4KQ2A 1BD3A 2BI4A 1G8YA 3AY0A 2W6NA 4QBGB 3U7HB 1RZUA 3TFOA 1CC1S 4E3WA 3LCRA 5C7YA 2XHEA 1W5EA 5ELLA 1X13A 2RK6A 3I8OA 5FIUA 2VG8A 2QLFA 4N0EA 3LHSA 3TZQA 5BOSA 4NE9A 5GIPE 2HDWA 3ZUGA 5IMBA 3UC5A 2EDCA 4JLVA 1J4AA 2V9ZA 4CM5A 4COKA 1BS2A 3R0ZA 4DBLE 2JCVA 3RUCA 4TL9A 4EB6B 1U2DA 1PP4A 5CYPA 4NENB 5C3UA 2R86A 4WADA 3H2KA 3QE2A 4QT4A 2C3YA 5ICSA 1K3UB 4Q4HA 4MKZA 3UAZA 5F7XA 1V2HE 5BVGB 4OHWA 1TKBA 1O6CA 3NEYA 4X1OA 1V6SA 2G4LA 3DE1X 3GK3A 3IP9A 4KXMA 1E6KA 4Q4AB 4NCHA 2CMFA 1IJBA 1KAGA 2QRHA 2ZAYA 3UJCA 3G2OA 2Z09A 1YONA 1PEAA 1XR3A 2VUTA 1R3DA 1C3OB 3B60A 4WK6A 5PNTA 3UT6A 1B8PA 1W35A 4DADA 1YHYA 3AJEA 3H2GA 4YCAA 1G8SA 1DBVO 3FD8A 3JYQA 4DSNA 1PNTA 5E7JA 4H0CA 4HS9A 1DQRA 3R7BA 3HY4A 4GOMD 1AUXA 2QL6A 3COZA 1AHNA 4BRSA 4UNRA 1U5BA 3FTDA 4MDFA 1S5PA 1XMOB 2R1TB 4L6CA 3MLAA 4FBGA 4ND6A 3HBJA 2ZRFA 3UICA 3PUXA 5KTOA 1TYAE 1ZH8A 5IYZA 1N2ZA 3HU5A 4REMA 1UMDB 1BMFA 3VO9A 4AURA 1UMDA 4DMCA 2XUQA 3GLGE 4U7HA 1TIKA 3OLWA 1YL7A 4U7TB 2QMZA 4KP7A 3ZEIA 5B5SA 3W5CA 4ZJPA 5EWLB 2YR0A 1GLGA 4R1SA 1NFFA 2G09A 3OCUA 1B3RA 1I33A 4PFQA 3NHPA 4WBSA 4QFMA 4P0QB 1M72A 1XL1A 4Z7OB 3AV0B 3VNUA 1E0SA 1P1CA 3S6JA 4B74A 1NRJB 4Y1FA 4ME6A 3Q1LA 1QH8B 3O8QA 3T9FA 5I9BA 3VR5A 3UMYA 4MQLA 2E5WA 2QW1A 3DAYA 3QEMB 2NSLA 3SBXA 3I3SR 4AICA 4ETNA 4ZDKA 5KNBA 3NDBB 3IAM6 4DIEA 3RUHA 3IO5A 1WPXA 4D92A 4NH4A 2PMCA 2C4NA 2Q5LA 4MA4A 1D09A 1PKXA 4PZZA 3PTAA 3ICEA 4MYTA 1WPGA 5CB6A 2YHSA 3OCVA 5HKBA 3EOBI 1AY0A 1G9XA 4X8OA 5K3FA 3UC9A 5DBGA 4Z9AA 1ZUIA 4MVWA 2GPJA 3LK6A 2G25A 2ZJYA 3UK2A 1Y98A 1AA6A 2BBWA 1KI3A 1U0SY 3VR0A 2P3SA 5K09A 3SYRA 2CZCA 2ZIAA 2E85A 2ZTUA 2D59A 2IHBA 1ZVQA 1X86B 5B1YA 1WCIA 4P1ZA 4KYUA 1GZ6A 3G7UA 2FEOA 3AFMA 3CX7A 3LFUA 3WL6A 2R11A 4OHUA 2P9GA 4LV6A 2D00A 3H87A 4YHBA 3W1EA 4A8JA 3ZDBA 4N3BA 2XOEA 3UK7A 2XMZA 2PKEA 3OZEA 5EGNA 4J0DA 5EJ6A 1FJGB 1BE1A 2YWBA 3PJRA 2BHTA 2VC2B 1LNZA 3KSRA 3QPDA 3PIRA 5DM0A 1P9WA 5LU9A 1RHQA 2BDEA 3GEIA 1KEPA 2XVAA 3TRDA 1T4MA 3T3PB 2A0YA 2DFDA 3OE7D 3DEAA 4B82A 4TTVA 1T43A 2XB9A 4XDZA 4PSKA 4BBJA 1EK6A 1OAOC 2RGEA 1LPNA 5G1OA 4JJ7A 4Q0MA 4R71A 2AW5A 1EWVA 2MSKA 3DULA 3HDYA 3KWLA 4G36A 4I14A 4IJ6A 4CW7A 3CR8A 3GGJA 2FV8A 3LBYA 3MM4A 2IGTA 4MIYA 4JQCA 3HBFA 2VYCA 5TMEA 2E18A 4PBTA 5A62A 3F71A 721PA 1LBIA 1ETUA 4IDNA 4Z9BA 1UMKA 2D0PB 2ZWIA 4HFRA 2E1PA 2QK4A 4B81A 1YDGA 4P22A 5ARDA 4YUWA 2EHDA 4E5DA 3IPCA 3LY7A 2PXCA 2CUNA 4XIIA 4FDUA 1NF8A 5KYXA 4LKRA 1RIIA 3G0IA 4RA6A 2D3WA 3L7KA 5KVQA 1P74A 2ISCA 3H8JA 3WYEA 4LI0A 1WETA 4ZAZA 2CFRA 5KNBD 4H0NA 4DPLA 2X8LA 3QFFA 2WIDA 5JYEA 4YN3A 3DMRA 1D2NA 1PR4A 4OBWA 4M3NA 4NYMQ 4OHOA 2FSVA 4RWZA 1HQDA 4E70A 2GCGA 2GHIA 4UAVA 4TYNA 1R4MB 2L2QA 1YASA 4D8WA 3A1NA 4MWZA 2ZOSA 2BZGA 1QP7A 1A9PA 1ZI6A 3E61A 4MPTA 2XYPA 4EI2A 3R0VA 2G28A 2W2VA 3PG5A 3LPAA 5KQPA 1EWKA 1V11B 3KJNA 2DUMA 3FCCA 4QX6A 1S3SA 4HN9A 4MKIA 5EHNA 4EVQA 4RTQA 1Z2PX 1OHHD 5EE0A 3SC2B 4HNVA 1ZOIA 4LWQA 3EXAA 1XAGA 1ORIA 2V5UA 4ATNA 2P9CA 1CUSA 5EHGA 2X5XA 4K9OA 1PL7A 3UMRA 1MA3A 3HA7A 1ZLYA 2EFEB 2HRZA 4G0QA 1K2VN 2NQTA 1ESEA 1XLVA 3MCUA 2EL9A 2SNIE 1SU4A 4S1OA 2C29D 3IR5A 1TPZA 3ZWQA 4L22A 4CFSA 4AZ0B 3BWEA 4RH3A 1QGUA 1NUUA 3G17A 3FA2A 4I19A 4W4TA 2DT8A 2QP4A 1LH0A 3TIXB 2OB1A 3O94A 3QXXA 2LCQA 2BF4A 2OPHA 4RLFA 2GCOA 4TRRA 4WLOA 3PC2A 1R00A 4FGSA 2VF7A 1MJFA 3A1WA 3R44A 3UUFA 1RYNA 3HKDA 3MRSA 3GLIB 3KYIB 2GYYA 3VJLA 5JSHA 5IAGA 2PFGA 4Q7QA 1UP6A 1GAXA 2ZFUA 3VPBA 1PJ4A 3RRYA 4J4BA 1FMCA 3IIKA 1PAUA 3DDWA 5KTPA 3VSEA 3UA3A 3T99A 1USKA 2YCLA 3NGMA 3FTNA 4GYJA 3RS0A 3OC6A 3IEMA 1DAPA 2CD7A 1NF9A 3OIUA 4CV3A 3ZKWA 2V03A 3CWZA 4F38A 3AGQA 3WMXA 3VDXA 5U4QA 3PV0A 3WS7A 2A5LA 1WF6A 3AEYA 2J45A 1KFEB 4LGVA 3DMYA 3EULA 4LZOA 3TGPA 3DWIA 2VSNA 4NEQA 5IHPA 1OZHA 4OLBA 2YV3A 1A4RA 4X6LA 1CDOA 1FFAA 1WRBA 2FU5C 2O2IA 3ITEA 1V26A 1DNPA 5KWSA 2Q6IA 1C1YA 2WAAA 3DBRA 1DKOA 4BEJA 3B20A 5C4IA 5IEJA 2VHCA 3LXUX 3O8OB 2W93A 5REQB 2FR8C 3RV3A 3KZOA 1RJ9A 2WU4A 2OLJA 4Z9FA 3RIHA 5LMZA 3ZS8A 3UZUA 4A5SA 5TT1A 1SN7A 2IXTA 3I39X 4JGIA 3U9LA 3ZW7A 1KYQA 2L42A 5F51A 5DDIP 4JB2A 2A9KA 1WZUA 4LWPA 4EHLA 1SA0A 4UHEA 2I4LA 4C7BA 4ZOLF 1L4YA 2Q1SA 1M34E 2ZG6A 4FYMA 3K5PA 1JZSA 5H70A 1UKYA 2P2SA 2FZGA 1P7ZA 5G4KB 5IJXA 3PEWA 5ALEA 5FUYA 1ABEA 5JFGA 1VSQA 3UKDA 4CIBA 4L2IA 5KNCH 4TV9B 1JXAA 3UTCA 2R8RA 5AKHA 2AV6A 2J5RA 3KUCA 3A25A 5HIJA 1GZ3A 5LZ7A 4EZIA 1H4QA 2NU9A 1M6EX 4ZDJA 3C43A 3G8DA 2WB2A 2Y1KA 4AN0A 1QHHB 2JH8A 3FUVA 4DMKA 4Q4DA 4P0PB 2XVZA 2XI4A 2ZTHA 3NOOA 2GILA 2NXEA 3M5DA 3OCCA 4OJQA 3QUCA 2IYFA 1TAUA 4HLUA 4UNSA 4E31A 4KXXA 3SX4A 1ZM4A 2AKEA 1C4WA 3FOWA 1G5FA 2IXEA 3T5GA 4K9QA 3CLRC 3UHFA 1V1JA 1KVTA 3HVHA 3TR6A 1X14A 3IESA 1QGOA 3P94A 2WAYA 2W2XA 4TKVB 4RBNA 2ZAGA 3I6MA 4C3OB 4IMJB 2YWXA 1GU0A 4OHXA 4YX9A 3AUJB 4MB6A 1O58A 2A4KA 3FR8A 1G19A 1FEZA 3DTVA 3W5UA 4Y6OA 2WYWA 3HKBB 3KPYA 3AMVA 3HBNA 4OSOA 4AWBA 3N07A 5BNWA 1Z2CA 2BBOA 5A4KA 1KC1A 2ES4A 2ZYSA 4E88A 1BGVA 3PD1A 4F3KA 2P62A 4JJ4A 1ESCA 1HDOA 5DXJA 1Y5RA 2AFHA 2YQ4A 4JJEA 3F67A 4EY6A 2VRBA 3HLKA 2WOOA 4IIVA 4DCPA 4ZCSA 4EGJA 1IVSA 1H2RS 2W6OA 5K4AA 1GKLA 1RYEA 2QYHA 4WT7A 5KSYA 5CNMA 2GA8A 2GN2A 3Q2IA 4XQ0A 3C3BA 1TTPB 2OV8A 4HMPA 3S7TA 1SBTA 3ZNPA 3L40A 1I5EA 1I3OA 1I51A 5AVXA 4GC5A 3EH2A 2F43B 1N34B 4AAYA 3GLUA 1E59A 4QG7A 2P9BA 4DV4B 3CIOA 5JAUA 4MVXA 3DP9A 1SOWA 4JVLA 1EVKA 4IHJF 4ALNA 4DNXA 1XZKA 4KH0A 3ER9A 4F85A 1T2NA 3E9YA 3RC9A 4A0RA 4Q4LA 3CC8A 4NU6A 2UV8A 4AJLA 1T34A 2IYVA 2XTNA 2M2IA 2P1DA 3ITNA 3RJ5A 3S4YA 2MSDB 1SCUB 1X8KA 3DE0X 4DWVA 3AB3A 5BT9A 1PEKE 3COPA 4IDOA 4LZLA 1UMCA 3GMIA 4R8KA 2H3EA 3K53A 1GO2A 1IXKA 1XZEA 4OJKA 2I62A 3KQHA 1VPWA 3ND7A 1QZUA 3KXDA 3EVNA 1TZ2A 1N7IA 4FMBB 3CN7A 2VI5A 4PANA 2NP6A 2Z98A 1NOKA 4BNMA 4O5AA 1NONA 2ZYDA 3HDHA 4ZYYA 4ZVQA 2J3HA 3H0EA 2W6IA 1LBEA 1JLLB 3KXIA 4OFZA 2WSMA 1FP7A 3CRNA 1XD9A 4HTFA 4Y18A 4TKUB 4URHA 3PHCA 3T5BA 1GILA 2AL7A 2C3OA 2QIOA 2OBYA 2GEJA 2WKRA 3PNSA 2VYQA 4UMFA 4DV1B 1W0CA 1FP6A 4PZDA 1PFQA 1DCFA 5COQA 1H1TA 3JVUA 1GCOA 4X65B 3GJXC 2DHRA 2I3BA 1P44A 1W44A 3AXSA 3EC7A 3P2KA 5BYKA 1GADO 2YW9A 3JAWB 3NXKA 4JFRA 2C5FA 2W2KA 4MEAA 1ZRNA 1U9YA 1L4BA 1UBTS 2GJ8A 3EK2A 3D2AA 4HEA1 3G2MA 1PWYE 4E3ZA 2IQIA 3H1PA 3GV0A 5DXFA 2I2DA 1TC1A 1JHMA 2XBLA 1CZUA 2ID9A 5FHRA 2OCYC 1B76A 4B7CA 3A05A 3RT1A 3K94A 4HBZA 4YT8A 2RE8A 1AKNA 4WY8A 2A1TR 2FSIA 3BMXA 4JHLA 3KO8A 4MROA 1XX6A 4Q3OA 4HP8A 4JI2B 1JPJA 1V3TA 3ZDFA 4CMIA 1J5PA 3AHJA 1CY7A 5HDBB 4M60A 4Q1BA 2W70A 1FFDA 1ZESA 1RPTA 1EI9A 3AUUA 1OIVA 1BHO1 1U0EA 4TS4A 4E2YA 3VI3B 4RE5A 2PRYA 1V3UA 1B73A 3RARA 4UUQA 4KLZA 4LF8B 3DT8A 3DXZA 2AZDA 3C3PA 1VKRA 3D6JA 2MHCA 5D7NA 4C4SA 2DFTA 2VBFA 3HVJA 1DP4A 5F5XA 5JT1A 1G7TA 5JISA 4F84A 1DXYA 1L2TA 2FDXA 3OPNA 2CDBA 3PZBA 1U8EA 2FOXA 4N40A 3OIYA 4PSAA 2D2VA 4IJWA 1KZHA 2RGBA 3QU9A 4RVCA 2XGJA 4CQLB 1X8XA 3ESYA 4BQPA 3L1HA 4CQMD 5L95A 3D8NA 3TM4A 4RGQA 1Y81A 5LUAA 4QIHA 4D0GA 1W36C 2Q3BA 1FLDA 2FPLA 3HNOA 2FFRA 3EMKA 2CSUA 1J8QA 3I9FA 3QBVA 4MCJA 3H16A 4CM9D 4ZAVA 3PD7A 3CKMA 3REQA 1ENZA 3BH0A 2NZUG 2RGYA 4HUQB 4RYDA 4Z0TA 5H80A 3WYNA 1PQWA 3LDGA 5IVDA 4ZK6A 3DOUA 3LCVB 4L3OA 4QXRA 1W1WA 1AGRA 5C37A 4KR3A 3VKVA 3ZQUA 5FV7A 2IP4A 4U9UA 4AJNA 5BN4A 1UXHA 4HQOA 1GPLA 3VO8A 1G5QA 1WDWB 3SOPA 4OB6A 1II0A 2JIRA 3W5VA 1VBKA 2XIJA 3BDIA 1HO3A 1J24A 3WK6A 4BLTA 3EEOA 1S3FA 2XMQA 4XUDA 1HDXA 2CUTA 5EZSA 1VIVA 3KE9A 3O4HA 1YTLA 3PT5A 1BXGA 4YCBA 1QKJA 5HHTA 1PYDA 4GBED 1IK6A 1YULA 2W43A 1GQQA 2BF7A 2OAP1 5GM2A 5B3JA 2JHAA 4EBFA 4KRXA 2OQ2A 4YUAA 1XZNA 2HUPA 1SU8A 1GDDA 2F9LA 2ONZA 3MCTA 1V48A 3ONEA 4X92A 2Q0XA 3UV6A 3X44A 3GJ3A 7YASA 4GI2A 3RC7A 1RBMA 2VSQA 3GLSA 5P8WA 2Q27A 3TR5A 2CCJA 2Y1FA 2XCQA 1EUQA 1ZLXA 4UUAA 5J4LA 4NBKA 4WMLA 2ZWAA 3MW8A 2IPLA 3GHHA 5B57C 5JQGA 3GUZA 1N75A 3GYGA 5BSKA 4FFMA 4GLLA 1NN3A 4HWPA 2K2QB 3UWKA 2HA6A 4OPMA 4CMBA 1NW6A 1H2WA 1GQRA 2PX4A 3HUEA 4IIHA 3FTEA 5BW6B 3OHMA 1V8BA 4AZSA 4AF6A 4R2HA 1R0KA 1NPTO 2IJGX 1M2GA 3PIIA 3EXHC 4JB3A 1KBQA 3LT1A 2YZGA 4JJZA 3I4FA 1DRJA 3EW7A 3WNBA 4F9FA 5E0KB 1CUJA 2NPOA 2J5QA 4UAJA 4JR1A 4W9NA 4JP1A 3UWDA 1FC0A 1KIAA 2LPMA 2OHOA 1HE3A 3G2HA 3R9IA 4MI6A 2Y0EA 3W2HA 1QUEA 1SXJA 3ADPA 4UVGA 1X3SA 2NNWB 2VFAA 4LBYA 4NG5A 3F46A 4RHCA 3T9CA 5I7RA 5JLJA 2O8DB 2ZUDA 3IAS6 2P9QA 4RK1A 4XGRA 1U8FO 4X3CA 1EDOA 3BE6A 3IP8A 4RABA 5ALRA 1FYXA 5H3LA 3ZKAA 1M0WA 2YBDA 4E33A 2ALJA 2QMOA 3TLBA 4C4AA 4MPRA 1KYWA 5E4JA 2GGSA 3KP1A 5KKAA 1UPUA 2BRUA 1J2JA 4U00A 5IDXA 4XSGA 3VFDA 1KQFA 2NV0A 5EHQA 1U3DA 2K6GA 4WZBB 1E18A 3JQAD 5ALSA 2GCNA 3CNEA 2BEUB 1X92A 1G9SA 3OPXA 3IOCA 4KPUA 4AJOA 3VGPA 1OTXA 4E22A 3FKSD 3KXLA 1JBQA 2H59A 3TJMA 3STUA 2IOFK 4DPKA 5AXBA 3T7JA 2WVGA 1YACA 1H8HA 1HT1E 1SBHA 3ONWA 1KJYA 1FJXA 1MB2A 3LKZA