3NRCA

Crystal structure of the francisella tularensis enoyl-acyl carrier protein reductase (fabi) in complex with nad+ and triclosan
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
256
structure length
256
Chain Sequence
GFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVLPCDVISDQEIKDLFVELGKVWDGLDAIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISAYSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGVAKASLEATVRYTALALGEDGIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGITGEVVHVDAGYHCVSMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Francisella tularensis enoyl-acyl carrier protein reductase (FabI) in complex with NAD(+) and triclosan.
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Oxidoreductase
molecule keywords Enoyl-[acyl-carrier-protein] reductase (NADH)
total genus 86
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3nrcA00
4UAGA 4TKLA 2WD7B 1C3VA 4UUMA 3OQ6A 4WNCA 1ZEJA 4RVDA 3RFTA 3RC7A 3I6IA 4A26A 3A28A 1IUKA 3B20A 2FSSA 3SLGA 1E7WA 4NG5A 3TZKA 4ND2A 1NWCA 4N5MA 1CIVA 2QRJA 2GASA 3DOOA 3G1TA 3HQ4O 3ROKA 3VH1A 4PN3A 3ZNQA 3K2BA 1PGNA 2DTEA 4Z9FA 4NIMA 1XSEA 1JU9A 1YL6A 3NAQA 1P77A 4TMFA 1I3MA 1EK5A 2GN8A 2X0NA 4PVDA 5DOZA 5B12A 4CLHA 2J3KA 2P9EA 2WEKA 5KOIA 1E7MA 1P3DA 1CF2O 2GZ3A 3ZWWA 3VOSA 4B8ZA 2X1HA 4CMKA 5IXYA 5JBIA 4R1TA 3VDQA 1HE5A 2Y0CA 2H6EA 3I4FA 4XQCA 1RYDA 2XXJA 4GX1A 2Y66A 2IYPA 4OYRA 2PGDA 4B3HA 4BO1A 2FZEA 3S8MA 1O0SA 1HXHA 4AJ4A 4AJ1A 3WMXA 3ICPA 3PQEA 4RDIA 2PD6A 4A7PA 1QLHA 2HJRA 3JQAB 2HAEA 2NQ8A 1QLJA 1SNYA 5IDXA 3LZ6A 3H9QA 4HFMA 4FC7A 2EEZA 2TMDA 3OA0A 5H83A 4M89A 5KKAA 1ZXBA 4EJ0A 1GZ6A 3JQAD 1I2CA 2E4AA 2YZ7A 6ADHA 1LBEA 3IMFA 5ILGA 3N7UA 5JPIA 3FNEA 1A72A 1PJ2A 2YQ5A 4DVJA 2EIHA 5LDGA 3RUEA 3V2HA 3ICCA 5DCUA 2PGJA 2Q1WA 1AXGA 1ONPA 1DIGA 3JQ7A 5JAQA 4EUFA 3NT5A 3QP9A 4WCFA 1FXSA 2QIOA 2YFHA 3OP4A 1JDJA 4XGNA 1W8DA 5JMPA 5IZ4A 5KVVA 1E92A 1DRUA 1NFFA 4Q3CA 1J0XO 3UKOA 1ZK0A 1HDXA 3RD5A 2PD4A 1E5LA 3E82A 3MZ0A 5EQFA 2R00A 2UUPA 2NTJA 1UH5A 4TZTA 3TZCA 3WYCA 3JQFA 4YJGA 3BIOA 1PJBA 1HETA 3GUYA 4AJLA 1EFKA 5T6BA 1U2DA 2B5WA 2X86A 4ZU3A 4XQEA 3VPHA 4PGFA 1PS8A 3FNGA 4PLPA 1CDOA 1BW9B 2BFMA 4Y6SA 1HDRA 2AQ8A 4J9VA 4XIJA 1E6WA 5T67A 5I8ZA 4R16A 1O95A 4YDRA 4BMVA 4BVAA 1D3AA 3FR8A 4MP8A 2TMGA 4WJZA 4CR6A 3IC5A 2O7SA 5KJ6A 4WLNA 3M1AA 4I8XA 5BNIA 2C54A 2EKLA 1AHIA 1U1IA 4MVJF 3I9NA 1E3WB 1VSUA 4CMGA 2O2YA 4XD2A 4Y98A 2HMWA 1GZ4A 4D0RA 2X0RA 1KEUA 4CMCA 1NP3A 2ZQZA 1PR3A 3WLFA 1I01A 4JROA 2YHUA 3SBOA 3OF2A 4ZICA 4A2CA 2NQTA 1EUCA 1DC4A 3H3JA 4DTIA 4PIVA 3X2EA 3RQSA 4U8GA 3X2FA 1LU9A 4WE3A 4IPTA 2G5CA 5JDIA 3IP1A 1B8VA 1DJNA 2UYYA 4BNXA 2FZWA 5IF3A 5JY1A 4XX0A 1I36A 4UUNA 5JNLA 1LDMA 2EWMA 1YL5A 3KEQA 1PR9A 1A7KA 1WXDA 4GX5A 3DDNA 1J49A 3JQBC 4Y9DA 3WSVA 1C1XB 1EBUA 4DBZA 2VRCD 5KWEA 3R3JA 1FJHA 1LEHA 1O5IA 4I9NA 3CE6A 5TF4A 2Q49A 4WGGA 4ALLA 3R1IA 5ES3A 2AHRA 2WD7A 1B26A 1KIFA 3ZU3A 4CMEC 4HY3A 4C7KA 3ZWBA 1HLDA 1MX3A 2QRLA 4XGIA 5TSDA 3PYXA 1K5HA 3ZWNA 3A14A 1GR0A 1EQ2A 1NHGA 4JQCA 4MKXA 4TVOA 1I8TA 2PTGA 4QX6A 3TL3A 4J0FA 4DA9A 3L4BC 4FJ0A 4XCVA 3E48A 1RM5A 4PZCA 3GG9A 1YWGO 1ONNA 2NV6A 3FPCA 3MTGA 3W4KA 3HN2A 2GRAA 2ZIZA 3NGLA 1HRDA 1HF3A 3BHIA 3E8XA 2NTVA 5DDIP 5CG1A 1HZZA 4R4JA 4E13A 1JVSA 3JYNA 5ITWA 5JS6A 1H6DA 4Y6RA 2LDXA 4NNJA 1HSZA 2A4KA 1N1GA 1YB1A 1WLYA 3JQ6A 4PG8A 3B1KA 1XIVA 1U4SA 1PGQA 1R4MB 1YOVA 4CMBA 4FOSA 2DBVO 3M1LA 1EK6A 2I66A 1WDMA 1VI2A 3PP8A 4M86A 4CMHA 5KVSA 2Q45A 1QRRA 3F3SA 3V1YA 1LC0A 3L6OO 1P44A 1VL8A 3FWZA 4MP6A 1N8KA 1K6JA 4KDFA 1C0IA 5ER6A 3V1TC 2IYOA 5KJ1A 3COSA 1SO8A 1IE3A 3JQGB 4WEQA 2VZ9A 3BHMA 2HMUA 2E48A 5DT9A 3CH6A 5HS6A 2OFPA 2RHCA 4W9NC 4E30A 1T4BA 1Q1NA 4N18A 8LDHA 1C14A 2PWZA 1QYDA 3KTDA 2ILTA 2W2KB 1NQ5A 1RYEA 4OOFA 3OJEA 3MOIA 4OOEA 5I7VA 1HWYA 4OXYA 5IXSA 4FN4A 2FSVA 3PPIA 2WDZA 2DLDA 4I08A 2I76A 4M55A 2ZCVA 3H2ZA 3D4NA 4IZIA 2DPGA 3O9ZA 2J6IA 4CMIB 1ADFA 3PLRA 3ZHBA 2W2LD 4CM8B 5IDQA 1OI7A 1X7GA 5L51A 1DHTA 4NK4A 2Q2QA 4CLOA 2I67A 3WQQA 3ZWVA 3DTYA 1ISHA 1XHLA 2AE2A 1WAMA 3AWDA 4PLCA 4BNLA 3Q11A 4TRNA 1Y81A 4BIIA 5JO0A 1Y9AA 2EW2A 3DL2A 3NUGA 1LC3A 3WWZA 1EUDA 4BO8A 2X0IA 3WYBA 3GNQA 5ER9A 2JHFA 1UAYA 2JHGA 4XR4A 1F17A 1UR5A 3DAPA 3CMMA 2YQ4A 3HSKA 4OSPA 1WP4A 2EGGA 2PV7A 3PQDA 4J7CA 1WVGA 1N7GA 2HJSA 3ZDFA 4E21A 5A3VA 4R1NA 3RFXA 3DB2A 1HE3A 2X22A 4Z3DA 4B4WA 2EKPA 4DQXA 2XAAA 2CD9A 1H2BA 4PLZA 1GY8A 3E6AA 5AVOA 2Y99A 3QLJA 3PXXA 5HA5A 5IDWA 4DLBA 2BFPA 4KOAA 4NJOA 4XDZA 2FRDA 5G0VA 4A73A 3JQ9A 4OJNA 5H81A 2B5VA 1YB4A 1T4DA 3IDSA 4XDYA 5KKCA 3L6EA 4QQRA 5JAMA 1KVTA 2DTXA 2ZCUA 3GLQA 1YS4A 2AEMA 2EXXA 1YONA 3QWFA 5A9SB 2X6TA 4N5NA 4D43A 3IL2A 4BO7A 1XKQA 4Q3EA 4J90A 3INGA 2C29D 1E7YA 1H93A 2X9VA 2CDAA 4BV8A 4UUOA 1MGOA 4L76A 3INRA 4ALIA 4YXFA 3NTRA 3FCOA 3KHUA 5T8KC 4HXYA 3DZIA 4YJHB 1RKXA 3HUDA 2VYND 3DFZA 1PZEA 1A4UA 2G17A 1X0VA 4LCJA 3KSZO 4ALNA 1T2EA 5AYVA 4JX8A 3DMTA 3ASVA 2Y05A 1B8PA 2EP7A 1D4FA 3AUAA 3OA2A 1EVIA 4DIBA 3ABIA 2C5AA 2CF6A 2HU2A 4BNJA 4LCEA 3WGZA 4RZIA 3VPSA 3JV7A 1T2DA 4Q3BA 4YBZA 3WIEA 3TQHA 1YDEA 1LSUA 3QVWA 1BW9A 2UV8A 3IS3A 1V3TA 4E5KA 3PI7A 5CDSA 2NACA 3ORFA 2R6JA 1R0SA 2C2XA 3WFJA 2QHXA 3ONFA 4MO2A 2WJPA 3QSGA 5FWNA 1FDUA 3GAFA 4ZA2A 4CM5A 2EJWA 3Q0EA 1R4NA 3M2TA 3NDJA 4S1VA 4Q39A 3QRWA 4M87A 1QYVA 4D79A 3DHEA 2ZTVA 1L1FA 4IDEA 1Q7CA 2GDZA 4PLYA 4KWHA 1DLJA 2OHXA 3UVEA 5IJZA 1I10A 2D5CA 4C7JA 1I30A 4MVJE 5LC1A 2AQKA 2OO5A 4PRLA 5IN4A 4ZQHA 3LLVA 1I0ZA 3GY0A 4B4UA 2CDBA 3IKVA 3PIDA 2UAGA 5F1KA 2BRUA 4D42A 4YJDA 3SJ7A 4DGSA 1U28A 4BO4A 2VZ8A 2UDPA 1M6WA 2W2LA 3U09A 1SB8A 3VZPA 2O4CA 1IYZA 4R9SA 1DBVO 4M54A 3TOZA 3RU9A 4DQVA 4CUZA 3F4BA 3VZQA 1V3VA 4DRYA 2B69A 3PWSA 3Q2KA 5FI5A 3WTCA 1ZJZA 2EP5A 1HDZA 3PWKA 3QVTA 1BXKA 2RH8A 4U6QA 3V2GA 2C0CA 1YVEI 4YJGB 1KVSA 4PFJA 5EERA 2BLLA 1ZJYA 4EZBA 4K6FA 1B14A 2H5LA 3AY6A 4RQUA 3RCBA 3FTNA 4JJFA 1RM4A 1HYHA 3HDHA 1GTMA 5DCWA 4CR8A 4QSMA 1Y8QB 3LF1A 2OZPA 2J5QA 5FYDA 4O6VA 3AUTA 4LSWA 4HKTA 1DOHA 1NYTA 2PY6A 5JAIA 1VKOA 2O2SA 5G0UA 2OBYA 1E1KA 1E3LA 2GO1A 4I9UA 4CLOB 4F6CA 3DAFA 5JC8A 4TKMA 2EJVA 4BNMA 4DXHA 3DBLB 3VC7A 4Y8VA 5DBIA 3VPGA 1EE2A 4YJFA 3KETA 3GDGA 2IXAA 2HCTA 2PKRA 1TLTA 4MVJD 4IY1A 4PLVA 5FI3A 5A05A 4XJSA 3GNTA 1PTJA 3H7AA 4AJIA 2YUTA 4LN1A 3UH1A 4IDCA 1VE9A 5B4TA 4B79A 2YFQA 3SVTA 3TWOA 3FR7A 3H3FA 4G2NA 2PA3A 4WCFB 2ZB8A 1NBOA 3CUKA 4FDAA 3ZNOA 2EHDA 1MFZA 1HZJA 5AOVA 3UAGA 2VYNA 5L4SA 3EZLA 3GDFA 3MCVA 4JN6B 1H2HA 2Y1GA 4S3MA 2Z1NA 1S6YA 4CM4B 1LSSA 4CQMD 2BGKA 3LU1A 3D7LA 5TC4A 5I9MA 3H9GA 1EZ4A 2P2SA 3HZZA 2HLPA 4W82A 1NNUA 2GERA 4CLDA 2B37A 1JLLA 2Y1DA 3UICA 3LYLA 2CZCA 4O1MA 2H9IA 1X13A 2Y1CA 3I1JA 3F6YA 3M2PA 2NVBA 3OETA 2QYTA 3C8MA 5F1OA 1UDAA 3JQDA 1G0OA 1ADGA 2RAFA 5I8WA 3JQ8A 2G82A 4ZHSA 1FDSA 4GVXA 1C0PA 3I9MA 3ZWYA 1JWBB 2Q2VA 1Y8QA 3I3OA 2B0JA 3HB4X 3DWFA 2PKQP 3PK0A 3TNLA 4MJLA 5CDUA 1UXJA 1DXYA 4RCVA 3PZBA 3EY4A 4WECA 4D45A 1YDWA 3D3EA 1ZVMA 4UEJA 5L95A 5GZ3A 3KO8A 4YA6A 1F0YA 1ID1A 4RPHA 1ISJA 1HLPA 3PHIA 5JYDA 1GAEO 3DEYX 5A4DA 2R2GA 3PHLA 2I5PO 5IFLA 3U62A 3RI3A 1PGJA 3GVCA 4MVJG 3WJAA 3G79A 3EZYA 4J4TA 1Z7BA 3GGGA 1WMBA 1ISGA 3ZGYA 5KNLA 2BHLA 4N5LA 1BWSA 3WJ7A 3C7AA 4RVHA 1YGYA 1OC2A 1OFGA 1ZZEA 1T2CA 4Q3NA 2J3IA 1P0FA 1PGPA 4CMIA 1DDOA 1D7OA 5IN5A 4Y67A 2C07A 4AL4A 3ZH2A 1GYQA 4BNKA 1M75A 2RCYA 1U3TA 3H9UA 3JQGA 3U4IA 2Y1EA 4IZHA 3RBXA 2VRCA 3QJ5A 3RUCA 1EBFA 5L53A 1K6IA 2B4RO 1NPYA 5A06A 4OKIA 3N58A 3D4OA 1EDOA 4JP2A 1RWBA 2BI7A 4XYBA 1TT5B 1QMGA 1QXSA 4NMHA 1N1EA 2DQ4A 2HK9A 4GMGA 3RWBA 5JAZA 3JSAA 1UXIA 1LQUA 4A27A 2AG8A 3AU9A 4FB5A 5K6AC 4F3YA 3ADPA 4AG3A 4OIMA 4XEHA 3H4VA 1UZLA 1QYCA 3BMNB 1E7QA 1YBVA 4MKRA 1KY4A 2BFAA 2O3QA 1KC3A 2DAPA 1P31A 2X8LA 1ZK2A 3TFQA 4EUEA 1UUFA 4R1SA 4CQLB 2CFCA 2CY0A 5EPOA 4W7IA 2HMVA 4E5MA 5JYEA 2Y1FA 1NXQA 1D1SA 1BHSA 3GMSA 1XU9A 2Q46A 2YYYA 1TA4A 2FR8A 3AI2A 4XYMA 4L4RA 4GX2A 5C5IA 3ZZNA 4NDNE 4U0KA 3WG9A 1IULA 3F1KA 1DHRA 3QVSA 1HE2A 2VTDA 5CP8A 5FF9A 2EERA 4ESOA 4PLTA 4BGEA 2PH3A 2ZB4A 4W99A 5IAAA 3JYQA 1KVQA 1Q0HA 2G76A 2I3GA 2PFGA 3DAGA 4GX0A 2GR9A 3RC9A 3PZRA 1XR3A 3AY3A 1HDOA 3P7MA 3GZNB 1O8CA 1YJQA 2P4QA 3EVTA 4MOWA 3NKLA 3HDQA 4J4BA 1IPFA 2PD3A 1M2WA 4FFLA 5L3ZA 3PGJA 3Q3CA 2V65A 3R3SA 2WD8A 5KJFA 3F5SA 1Q0LA 3WNQA 3AI3A 3GVXA 3OIFA 5TT0A 1LNQA 2O3UA 4XYEA 5JCXA 5L4LA 3LLSA 1MA0A 1R37A 3UGKA 1DEHA 4K9DA 3E9MA 4XRRA 1SMKA 4ND3A 4BO2A 4KZPA 4NK5A 1U3WA 2HDHA 2JAHA 3QHAA 4J1NA 2JCXA 4JBGA 4W9NA 4NU6A 4YPOA 1U3UA 3GN1A 1XG5A 4DMLA 3QIVA 1PJTA 5TIIA 4RL6A 1A4IA 1SB9A 1PQPA 5COAA 1TXGA 1R4NB 2X7HA 3DBHB 3F46A 4ITUA 4OKNA 3RKUA 3EUWA 1H94A 1DSSG 2PR2A 3RAJA 1XU7A 2Y67A 3BMQB 4GKVA 2VUUA 1ZMTA 3WGGA 1X7DA 4F46A 4Q9NA 3GVIA 3GFBA 3W6ZA 2Z95A 1E6UA 4CV3A 3L6DA 4TVBA 3T7CA 4BO9A 4WASA 3KLMX 1EE9A 2IZ1A 1LDGA 1WW8A 2Q50A 3I5MA 4IGEA 4NBUA 4BL5A 4ZJUA 4BB6A 1ULSA 1SEPA 4YCAA 3L4SO 1U2GA 5JY6A 2V6MA 1KYQA 3EAGA 4RF2A 1Y8RA 3BMCA 1HYEA 3DXFA 4XYLA 1QYXA 1Z75A 3GRPA 3BTSA 2CMDA 1LQTA 5I7SA 3EGOA 4RZHA 2FPPA 1O89A 1U5CA 2JAPA 4IIVA 1T26A 3QQPA 5JSFA 4BO5A 1GCUA 3ZHYA 3ZCXA 4ALMA 5A9TA 3QVOA 3W8DA 2ET6A 3E03A 2BELA 5DBFA 3WX0A 4YT8A 5CEJA 2GF2A 2GNAA 5J23A 3OJFA 2FMUA 3QA9A 4IBOA 3RUFA 1U9JA 1HSOA 4EI2A 1XELA 3KLPX 5DBGA 5JC1A 4YT4A 3WFIA 4Z9XA 4P4NA 3HFSA 3FNFA 3MJVA 1UZNA 3UHAA 4PCVA 3OHSX 2O4UX 4E5YA 3NT2A 2E6UX 4WKGA 4YT2A 4WEOA 3RKRA 7ADHA 1PIWA 3ADOA 1OAAA 1DPGA 3RROA 3W4JA 3ZW8A 3WGHA 4L75A 3QWAA 2ZTMA 1VSVA 4YJHA 3ETGA 4D46A 1ZIDA 2HKIA 3GC6A 3WYEA 4KTVE 1W4ZA 1YB5A 2D8AA 3ZV6A 5KJCA 3GVPA 3INTA 1ZK4A 2BGLA 3PHJA 3U4CA 1RM3A 1G6KA 4OSOA 3OM9A 1UDBA 3FHLA 1DIBA 3MTJA 5F1PA 1Y9EA 1ONOA 1IHYA 1B8UA 2B35A 1ZK1A 3ROMA 5T8KA 2H1SA 4YJFB 4MKZA 4A5OA 1B0AA 1H9BA 2F00A 2X9GA 2QZZA 3TL2A 5HM8A 4UVEA 3OICA 1HKUA 4NFYA 3DMTC 2PZJA 2OXIA 3KZVA 1N5DA 1WZEA 2PK3A 2POQX 1J4AA 1LLUA 2Y0EA 3E5RA 4GKBA 3JD4A 4N54A 1A9YA 3QWIA 5ICMA 1BXZA 1KEPA 2VHWA 1JAYA 1DAPA 4X54A 1TB4A 3K30A 1I24A 4XR9A 3ONEA 4YQZA 4W7HA 3ZWPA 4ZVVA 1E1MA 1KERA 5BQFA 1CRWG 3HE3A 5L9AA 4RVGA 2A35A 3H5NA 3PYLA 3ZU4A 2RBEA 4E5NA 4A10A 1V3UA 4CM6A 2VNAA 2J3HA 2I6TA 3ROQA 4YRAA 2JD2A 2VHYA 4IDFA 1XCBA 1QORA 2X5OA 1PJ3A 3B6ZA 1ISIA 4CM1A 3KEOA 4Q3AA 4NPCA 3AI1A 4PG4A 1X0XA 3KUXA 3WSWA 4CV2A 2LDBA 3QV1A 3HHPA 3RJ5A 1Z45A 4FJ2A 4IMPA 1XLTA 2I99A 4JK3A 2NVUB 1MG0A 5AXCA 4CV1A 2GN9A 4DREA 4DPMA 3PHHA 4R5MA 5U4QA 3KSUA 2FWMX 1VPDA 1PJLA 3K31A 4TZKA 3HDJA 4CR7A 3CZMA 2HK7A 2GSDA 3Q2IA 4L4XA 1ZSVA 2XOXA 3SXPA 4J2OA 3JD0A 5THKA 4XB2A 1JKJA 3L77A 1DB3A 3D64A 1A9ZA 2QG4A 1GPDG 1U8FO 1DC3A 5TT1A 3PJFA 1ADBA 1GPJA 1ENZA 1IZ0A 4XJTA 4RF3A 2VTEA 2V6BA 3G49A 1N2SA 1GFSA 1E3IA 3ZWCA 3WIDA 2VZ0A 4EBFA 4AJ2A 4IMRA 4RVSA 4L8VA 4E12A 3ITDA 3JYOA 3A06A 3IJPA 5L4NA 1BTOA 3S1LA 4Z3KA 1U4OA 5F21A 3ZWXA 4RO0A 5CFZA 4R51A 1LSOA 2OORA 3W8FA 1CWUA 3IUPA 1WWKA 5IZCA 1D8AA 3OEYA 1FDWA 2NUAA 1Z82A 2AW5A 3EVNA 1PQUA 2OL4A 5G0TA 3TZHA 3NV9A 3VH3A 4EEZA 3FPLA 3LQFA 1I3KA 5MGBA 3SJUA 4WLUA 4ID9A 1ZMOA 4GWKA 5A5FA 3MWDB 2VHZA 1LA2A 3UXYA 4DMMA 4EEXA 1GV0A 2CNBA 4J1TA 4PG5A 2YHIB 1GYRA 3ANNA 5L40A 3A9WA 3LC1O 4RVUA 4B4OA 1PQWA 1YBMA 1LJ8A 2X5JO 3O8QA 4B7CA 4D3FA 2D5AA 1NFQA 3TSCA 4WLVA 2X4GA 3GGPA 1HE4A 4LSMA 4FW8A 4YB8A 1ZXLA 1UP4A 4DIFA 4AFNA 3AU8A 2NADA 4P4GA 2VWHA 5JE8A 2J5KA 2V6GA 2AEFA 2FY8A 3GA0A 3D0OA 3VKUA 4H3VA 3HG7A 2VUTA 2PH5A 2EW8A 5KVQA 3WGQA 3F47A 4NZ9A 1RJWA 4KQXA 3GVHA 1V6AA 2FN7A 2DUWA 4BQPA 1ZSNA 2QRKA 1N92A 5COQA 5T57A 2ZTLA 1AGNA 3VH4A 1ZO8A 2NSDA 3KYCB 4TRMA 3RBVA 2DC1A 1NVTA 3FF4A 2ZB3A 2J3JA 4R41A 3M6IA 1BRMA 1JVBA 3WBFA 4E0BA 4OAQA 2CVQA 1E1NA 3F4LA 3IP3A 4OXKA 1QP8A 4IDGA 4EUHA 4MP3A 1GUFA 1YL7A 4YAGA 1AN9A 3W6UA 3KOUA 4FFMA 1NFRA 2Q3EA 3I9LA 1ZFNA 1I5RA 1PS9A 1PSDA 1KOLA 3VHRA 2UVDA 4FS3A 1K3TA 1T2FA 1CQJA 2C5EA 4GVLA 3RBZA 2E49A 1EDZA 2VRBA 3DZKA 3C1OA 1VJ0A 2VT3A 4CMEA 2VYVA 4RJTA 2PLAA 1NQTA 2DFDA 5JDCA 4I9HA 1X1EA 2CSUA 1Y8RB 1LLQA 4MDHA 3LC2O 3DONA 4IS2A 1B2LA 5A5EA 5T5QA 1HDYA 2JFFA 3CPSA 1S7CA 2ZKLA 1N9GB 3ZV3A 4E33A 1C1XA 1UZMA 2RHRA 1YQGA 1KC1A 3DOJA 3GF4A 3UCFA 3CINA 5BNFA 4MVJI 1R15A 1DLIA 4BKPA 1A71A 4OM8A 3LC7O 2ZB7A 2D0IA 1R0KA 2RIRA 4J91A 5KCZA 3G0OA 4H15A 4J3FA 1R16A 5G4LA 3K92A 4WOKA 4Z0HO 3GOHA 2YDXA 3D5QA 3MOGA 3WBBA 4I5GA 4PG6A 1XA0A 3RUHA 1SAYA 1V0JA 3KSDO 5DOVA 2FP4A 1O6ZA 3R0IA 1JN0A 4IQ0A 3AY7A 1X7HA 2PZMA 1FF9A 3BMNA 4ZRNA 5KTKA 3L9WA 4P38A 5G4KB 3HFGA 3AOEA 4YAKA 3UUWA 3P2YA 1DRVA 3HB5X 5F5LA 1ADCA 4CMJA 2D59A 3DBLA 1MG5A 1H0KA 5TGDA 3N74A 2C59A 3B70A 1DO8A 3NDIA 3CMCO 4QFDA 3OJLA 1LRLA 4HX5A 1G1AA 4GSKA 3GHHA 4YAEA 3TN7A 4BB5A 2JFHA 2EKQA 5GY7A 3U49A 1I32A 4E2ZA 5ITVA 3LDHA 5CAEA 4BV9A 1PZHA 4J16A 2VQ3A 5CHEA 5EINA 2PZKA 3NEPX 4Z0PA 2VHVA 4CM4A 1MXHA 1ZBQA 3NRCA 6LDHA 5DULA 3GEGA 1SBYA 1W73A 2WE8A 4IXWA 2NU7A 5DP2A 3I6QA 4K26A 2Q4BA 4U5QA 4E3ZA 3V1UA 3UFXA 2Q2WA 4DPKA 1IZ9A 4J2HA 4AJOA 3BTOA 5DNAA 3MEQA 4B7UA 2YW9A 3W8EA 4PLFA 5CPBA 1ISFA 5LDHA 3CKYA 1I3LA 1TT7A 4ROSA 4FBGA 5G2OA 2OMEA 2YHIA 3H9EO 2P5UA 4MVJA 3VDRA 4U0JA 1PL8A 3H6KA 1H6BA 1LLCA 4I5FA 3GFGA 4IDBA 1DC6A 2FR1A 5HBRA 1BSVA 1EMDA 4I5DA 2XXBA 3KRTA 4IIUA 3UCXA 3U9LA 5A9RA 3WGOA 3DHYA 3C85A 3BMOA 1HYGA 4HFJA 5G4KA 3DR3A 3IQDB 3ONDA 1DJQA 1PL6A 2O7QA 1MC5A 3H65A 3QWBA 1ARZA 4CQMA 2ZK7A 4YVFA 5CDGA 3S2EA 4MIYA 4BNNA 4GAEA 1O94A 1NASA 3O03A 1J5PA 1Q7GA 3K6JA 2C7GA 3EHEA 1TI7A 3KYDA 4GBJA 4WOJA 3D4PA 1I2BA 1VKNA 2ZJ0A 3AUUA 4HWKA 4BHTA 1GADO 1NPDA 2DVMA 1H6AA 5B37A 4CL3A 2B83A 2BFOA 1JAXA 3JQCA 4HP8A 4TQGA 1A5ZA 4BKUA 1E3EA 4RF5A 3BAZA 5DZSA 3DO5A 1M67A 1P9LA 1K6XA 3OEWA 1EVYA 1ULUA 3ZU2A 3AFMA 2O3TA 4PVCA 1NR7A 2EG9A 3EW7A 3VPXA 1VL6A 4NU5A 3PLNA 2VWQA 3ZHXA 1I2ZA 3A1NA 5JFOA 1ZKMA 2JD0A 3G3EA 4BNYA 5B4VA 3PJDA 5KJEA 4RLSA 1CJCA 1DRWA 1JWAB 3ITKA 4ZGWA 2PNFA 5GMOA 4HBGA 3U4DA 2AEJA 3GPIA 1DC5A 4PG7A 1JA9A 3RSHA 4D3DA 4R1UA 2GZ2A 4CODB 4MVJP 4YACA 3JTMA 2VN8A 3WLEA 9LDTA 1HEUA 3WR5A 5FFFA 3UN1A 1XYGA 3T4EA 5L7YA 3HN7A 5DCYA 3FNHA 5JO9A 3JYPA 4PRKA 2JD1A 1Y1PA 1FDVA 3LSYA 3ZNNA 4XRGA 1TEHA 5L45A 4YT5A 3E9QA 3I52A 2BI8A 2PKQO 2A92A 4GMFA 4R3NA 4R01A 1XWFA 2HMTA 3AM5A 3E5MA 4XZ3A 3DZGA 3ZNPA 5IDYA 5C37A 4D3SA 1GL3A 3VAZA 2ZQYA 2GYYA 2VWPA 4AJPA 4L0QA 4DPLA 4B7XA 4ND4A 3C7DB 5ILOA 4L9RA 5H82A 4DLAA 1LXCA 4UREA 4E5PA 1UJMA 4WK6A 2GUGA 3F5QA 3STHA 3RUIA 2DU8A 1GUYA 1FK8A 4CM7A 3TRIA 4E6PA 3PJGA 4FGWA 4LRTB 3NGXA 1CYDA 4IJWA 1GQYA 1BG6A 3T4XA 4JGBA 4CM3A 2OGUA 1BXGB 4WCFC 4XWYA 4MVJM 3JQ8B 4O63O 3P5SA 2HMSA 2IZZA 2NVUA 4I5EA 1Z6ZA 3LT1A 3HJAA 3KBOA 3QVXA 2YV3A 5CPFA 3WICA 3SX2A 4II3A 4LW8A 4FC6A 4MINA 3RU7A 3E9NA 1X1TA 4BNFA 2R00C 4BNHA 4Z9YA 3SC6A 2GGSA 3ZWAA 1ENYA 2G0TA 4KUGA 2Y93A 3TOXA 5A04A 4D44A 3MWEB 5B4UA 4CV0A 1E3WA 1PL7A 2DBRA 1AXEA 3K96A 5AXAA 4E31A 4MIEA 2FPGA 3ON5A 4OH1A 1PJSA 4OQZA 5AXBA 4OMUA 2H63A 4FFPA 3CSDA 4CQMB 2OUIA 1SOWA 3LT0A 1U3VA 2WTBA 4J0EA 3K8ZA 4EGFA 1LRJA 5BSHA 3TPCA 3PFWO 2IEBA 3MJTA 2ZYDA 4ND5A 3GHYA 1P33A 3I23A 1LUAA 1GZ3A 1OZAA 1OBFO 4R69A 3GGOA 1B15A 4UVIA 2Q4EA 3FTPA 4GI2A 4HFRA 4J1QA 1EVJA 2P91A 2VT2A 2WYWA 1GU7A 1ML3A 1BDBA 1GQ2A 3JYLA 4B3IA 4OQYA 2DM6A 3AM4A 1K2WA 1RPNA 2J5RA 4WNIA 5F3RA 1NTOA 4JBHA 1KEVA 1UDCA 2AXQA 1QKIA 4IUYA 5A03A 4PLWA 3UW3A 1PZGA 1XQ1A 3OJOA 1ZCJA 2IRWA 3SLKA 1KETA 5A02A 3WDSA 4TRRA 5JDIC 3MJEA 2CVOA 3AW9A 5AQ1A 4FOOA 5IZCC 3R6DA 1R66A 4G5HA 4YQYA 3PFFA 2OOSA 3AJRA 1WMAA 4FIZA 5A3JA 4CUKA 1MC4A 4KDEA 1QG6A 1ZW1A 3JQBA 2WM3A 1L7EA 3CTMA 4J43A 4QXMA 3ZV4A 3PTZA 5TNXA 1CETA 1UXGA 4IDDA 1V35A 4JP3A 3BMQA 4E2YA 4XB1A 1HTBA 2Z1MA 2V6FA 4O5OA 4BGVA 1YE3A 4YWJA 4ZQGA 4HV4A 3TJRA 4OXNA 2FR0A 3KV3O 4JLWA 3KYDB 4HNGA 3AK4A 2XF8A 3GT0A 4M1QA 3B1FA 4Z0TA 3RC1A 2QYSA 3L4BA 1K89A 2HO5A 1T25A 3GZ4A 1VC2A 4KUHA 4L74A 5TRTA 2UUOA 2DKNA 1IY8A 2JL1A 3KXDA 3PYMA 4CL8A 3O38A 4NBRA 2DTDA 4O0LA 3RJ9A 3GZNA 1G0NA 5MDHA 4NFHA 1KVRA 1T24A 1XEAA 3IIEA 4NBTA 3A4VA 1ISMA 3OECA 4KMSA 3VPFA 2D4AA 4CLRA 2C2YA 2WSBA 1E3SA 4UVHA 1HT0A 2Y1OA 1NQOA 3IJRA 4HNHA 2AG5A 1YKFA 1YQDA 4GGPA 4NJMA 3JQ7B 3ETDA 4WCDA 4FPXA 4UEOA 1DAOA 1NX6A 3CIFA 3VTFA 4EITA 4U7WA 2P9GA 5TX7A 3PDUA 4GPD1 1H6CA 5JXWA 3NX4A 1YQXA 2HRBA 4IQGA 4BOYA 3WQSB 1B3BA 4DC0A 1E5QA 2DUUA 4INAA 5K6AA 1N9GA 1AHHA 4FFNA 1Q7BA 4R9RA 4IJKA 1KS9A 3EYWA 5EN4A 1FMCA 3TZQA 2Y0DA 4DYVA 4K28A 1WNTA 3BTVA 1PJ4A 4XA8A 3MJCA 3KB6A 4WLEA 3C1TA 4YAJA 1Q2XA 4O59O 4YTEA 3QY9A 1DFIA 1JQBA 1V9LA 1I3NA 1C1DA 4YR9A 4QO8A 2YY7A 2BMAA 5DP1A 2DT5A 2JCYA 2O3RA 4TSKA 2OP0A 1YH3A 1R6DA 3P19A 2GN6A 5TS3A 4ONEA 1C0LA 2X23A 3ZWOA 4BS9A 2ZYAA 4EYEA 5L7WA 4GQAA 3PRJA 3OMLA 4G81A 5ENVA 1K0UA 3S2FA 3ENKA 4PZEA 5B1YA 3LT4A 3RFVA 1XGKA 4QUKA 1Z73A 3GPDG 4TROA 1PZFA 4AJKA 4RPJA 2Q1SA 3NJ8A 3C24A 5BNTA 4J4HA 4AJEA 4F6LA 3AOEC 3WS7A 1JKIA 2O48X 3FWNA 2WMDA 4LGVA 3H9JA 2GCGA 2I65A 4G65A 1E7SA 4DL9A 1P1HA 2GN4A 3NJ4A 4FGSA 4HADA 1B3RA 3DZHA 1WZIA 3O4RA 3OQBA 4P8RA 5I9LA 2IZ0A 2QX7A 3T7EA 2QZ9A 3GEDA 1VJTA 4DBVO 5HTOA 3GN2A 2D1YA 3JCZA 4W4TA 3ZW9A 3OIGA 4JJIA 4GWGA 3SC4A 1PS0A 2O23A 3ASUA 3UOGA 4BNWA 4IINA 4BO6A 4GL4A 1ZK3A 2F1KA 3DZJA 4QT0A 5DN9A 2A9FA 4CMAA 5C3MA 3FBTA 3GRKA 5C7IO 4J1SA 5G0WA 1IL0A 3VVBA 1F14A 1LDYA 1YXMA 2VYVD 5CDTA 4ZD6A 4D0SA 1T2AA 1P1FA 3L07A 5BSGA 2CVZA 2P4HX 4MIOA 4P22A 2HRZA 2NU9A 3D3WB 5CEFA 2ZJ1A 4J7UA 2I3AA 4K6CA 4XQGA 2RH4A 4J7XA 2G1UA 2FPIA 1A7AA 3DBRA 4R68A 2YV2A 2W8ZA 4UVGA 2AQHA 4RORA 1P45A 2X9NA 4BGUA 4CUJA 4OGWA 5BSEA 3WQRA 3HDYA 2VCYA 4PZDA 5GZ1A 3AFNA 1F06A 4CQLA 3ULKA 1MXFA 4RPKA 5K9ZA 4ALKA 3K73O 1Y5MA 3ST7A 4CLRB 1NHWA 4IJUA 3EK2A 1EVZA 3LK7A 3OJ0A 5THQA 2W98A 4NFSA 1EEHA 2CUKA 3HNPA 1EQUA 2QQ5A 4DLLA 4BO3A 1W6UA 2VWGA 3V8BA 2GZ1A 5ADHA 3IOYA 4HUJA 3F9IA 1GEGA 2B4TO 4BNUA 1ENOA 1VL0A 2DBQA 2Y68A 5C7OO 3OBBA 4OHUA 1BDMA 2YV1A 3WWYA 3ZHZA 1SZJG 4NHEA 4E2WA 2NWQA 1DIAA 4KUEA 4FCCA 2QW8A 1GCOA 5JMWA 5CG2A 1E77A 2AA3A 2EF1A 1ZEMA 4EJMA 3FD8A 1XQ6A 3HADA 2P68A 4IM7A 5U1PA 1LI4A 1T1RA 3NYWA 2J8ZA 1PX0A 4QTZA 2Q1TA 1LX6A 3DZBA 3PWZA 4KWIA 4JIGA 4D7AA 1SOVA 4ILKA 1LDEA 2NVWA 4DQUA 5TJ9A 4Z6KA 5I9NA 1ORRA 2HK8A 2IEDA 2ZTUA 1WDLA 3PIIA 4XYGA 1EFLA 5DF1A 2IE0A 3WGIA 5HS4A 1Y5RA 3ANLA 2SCUA 3FBGA 1XDWA 3FN4A 3VVCA 4B8WA 3GG2A 3DC2A 1VM6A 2NU6A 3DQPA 3G1UA 3GEMA 4K1LA 4M8SA 4DYDA 4CM8A 8ADHA 1MUUA 3TF5A 1D1TA 2GLXA 1LDBA 4C4OA 4ZRMA 3H2SA 5G0SA 4LMPA 1FDTA 2BD0A 3GNSA 5TJHA 1KY5A 4LVCA 3WNVA 4J9UE 4FFOA 4RF4A 3KYBA 4DUPA 5JCJA 3VTZA 3DZFA 1E6EA 1UP7A 4BNGA 4P4LA 1MFPA 3RUAA 5KIAA 4A03A 1U8XX 2WWRA 1GD1O 3V5NA 4F45A 1YJ8A 3FRJA 3D1LA 3GUCA 2W90A 3JD1A 1P1KA 5EL0A 4ALJA 1MLDA 4RPLA 3BMCB 2E37A 3E18A 3ZU5A 3RASA 1R12A 3JQFC 1SEVA 3PQFA 2DBZA 3OSUA 4YRBA 4PLHA 1JKFA 4IXTA 1ZUD1 3PGXA 3TFOA 2EV9A 2X0JA 3LT2A 1KVUA 3AOGA 4AVYA 1P74A 4OL9A 1WDKA 3ZI0A 4QECA 9LDBA 4MPDA 4IGFA 2X5KO 4DWVA 5I7EA 2ZYGA 4KTTE 1X15A 4PLGA 3Q6IA 5IG2A 3LVFO 1BMDA 1YBAA 3F1LA 4UULA 2B36A 4NJMB 4N7RA 5BT9A 1LSJA 2HUNA 5JCJD 3PJEA 4BMNA 3D3WA 1ZH8A 1AUPA 1TT5A 1NVGA 3I9JA 1ZSYA 3L9XA 4ZQBA 3U4HA 1M76A 1DFGA 3O8QB 3I4CA 3JD3A 1P0CA 5JW6A 3WGTA 2BH9A 1OOEA 4FFRA 4UVDA 1V8BA 3RC2A 3H5RA 1NM5A 4NR0A 5EESA 4OO3A 1F8FA 1TVEA 3ETEA 3JD2A 5ICSA 3E1KA 1P1RA 3QWHA 4XGKA 3Q9UA 2NTNA 3U3XA 4M49A 4JCOA 4LK3A 4AJHA 5I7FA 4YYZA 3NDRA 1JTVA 4URFA 3EC7A 1LLDA 4ZQFA 1IOLA 3NTOA 3OIDA 5COBA 4NBVA 2D3TA 1ENPA 1LDNA 4IJVA 1JW9B 4R3WA 4LRSB 1GYPA 4CJXA 4AICA 1GQQA 2JFGA 2V7PA 2B4QA 3ANMA 1IPEA 3WOHA 1M6HA 2VNSA 1SC6A 3KM0A 5EMHA 4EW6A 4BNIA 2JCVA 1NQAO 3BA1A 3C1AA 4WLOA 1MB4A 2Q99A 4NH4A 3DMYA 1HL3A 4TRJA 2WYVA 4E32A 2HSDA 3P2OA 2FHSA 4FJ1A 3DBVO 4KQWA 1Y6JA 1I33A 3GQVA 5A9SA 2YJZA 3ZV5A 1H5QA 4NBWA 1OC4A 3I9KA 5CDYA 1Q0QA 3NTQA 3ZN2A 4KP7A 3AM3A 3KYCA 4GLLA 4CPDA 2IDZA 4JJGA 4II2A 3V2UA 2AMFA 4BUCA 1PWXA 3C7CB 1SPXA 4FSHA 5KVCA 3GK3A 4IS3A 3JQAA 1U7TA 3IAHA 2O3JA 3OQ1A 4CM9D 1WPQA 2FOIA 2IXBA 4JNKA 2PZLA 2OP1A 3VH2A 4GLOA 4I1IA 3PHGA 1IHXA 1DFHA 1NPTO 5A1TA 1VRWA 4WUVA 4E4YA 1NAIA 3QW2A 4XIYA 4XQ9A 3RIHA 1DIRA 4AJNA 5CEEA 4DC1A 2WE7A 2JJYA 1NVMB 5TQVA 1KBZA 3H5AA 3GMDA 4ZN6A 4BNTA 3S55A 2I9PA 3OH8A 3B1JA 3DBRB 3BHJA 4B4VA 4YEDA 1Z74A 4L73A 3Q9NA 3ROPA 3TZ6A 1QV7A 5JDCC 2OBNA 3L0DA 4MVJH 4BKQA 1LTHR 2VHXA 4A0SA 2A94A 4J6FA 3JQEA 2GPTA 4NQZA 4QFCA 1BVRA 1UAGA 3CEAA 3W4IA 1L7DA 4UUPA 1PEDA 2C7VA 4IQ8A 1VLLA 4J49A 4GH5A 4BQRA 1CERA 2D2IA 1QYWA 4QO7A 4QEDA 2DPHA 4LISA 5ENDA 1BXGA 2E82A 1SCUA 1UP6A 2CF5A 3AUSA 2P5YA 3BZUA 2O3SA 1CEQA 5T64A 1IB6A 3ZWMA 1N7HA 2P9CA 1BVUA 3DOCA 1AE1A 1YRLA 5HWSA 3RVDA 2BGMA 1PJCA 3CZRA 3MJSA 1QR6A 1KEWA 2NNLD 3KVOA 5FEUA 1Z7EA 1W0CA 5F5NA 1LRKA 3S2GA 3IKTA 1U5AA 3MJ4A 2AE1A 3WGYA 1BGVA 4WLFA 4EJ6A 3K9QO 1E3JA 4BO0A 4CLEA 1O9BA 4BNVA 3K5PA 5C7LO 3BYZA 1F12A 3BTUA 5JLAA 1UXKA 1C1DB 3CXRA 4LVUA 4JBIA 2X58A 3GH3A 5LCXA 4WPGA 1MP0A 5EIOA 3RUDA 1R4MA 1YOVB 2BF7A 1F8GA 2O50A 3EDMA 4FR5A 3TDKA 4W6ZA 1NWHA 4EDFA 1PU2A 1B7GO 3PEFA 4HFNA 3JQ9C 3QE3A 4FD3A 2DFVA 1UXHA 2VOJA 3DFUA 3VZSA 3WB9A 1RM0A 4ND1A 4RGBA 4BGIA 4ZQEA 4U6SA 4RVFA 4RQTA 1NR1A 1GEEA 4DIOA 5EJ2A 1R0LA 2ZATA 4H16A 4BMSA 3GDOA 1GDHA 2Q1UA 4RV9A 2WYUA 3UCEA 7MDHA 3ENNA 3U0BA 3D5TA 4CLXA 5TLSA 4R5HA 1PWZA 2W2KA 3HWRA 3VKVA 3C3XA 3H8VA 4H7PA 3WXBA 4BKOA 5EQDA 2W4QA 5L7TA 1PJQA 4FQ8A 4GSLA 4BNZA 1A27A 3I9OA 4IDAA 4B3JA 3EMKA 1GUZA 4BKRA 1GV1A 4UEKA 2BKAA 5K0ZA 1U7HA 3UF0A 1C0KA 1ZNQO 4YAIA 3WTBA 5U9CA 3BXXA 1T1SA 4RPGA 1P1IA 2HQ1A 3K2EA 1B16A 3WMWA 1CQIA 1E1LA 1MV8A 3GAZA 3OFSA 4RDHA 2CDCA 5AXDA 3DHNA 4R54A 2IODA 2NU8A 3G17A 1P1JA 2C20A 1QSGA 1E7RA 3DTTA 1DIHA 2Z5LA 4Q3DA 4D41A 4XKJA 2VOEA 3PDJA 2EGHA 2NLOA 4GGOA 2XPCA 3I83A 1E0DA 1Y7TA 2NM0A 2YDYA 4E2XA 3U5TA 3IUSA 4RLHA 4YRDA 1NAHA 4L4SA 1HDGO 1YO6A 3VZRA 5HRUA 1M66A 1EUZA 2C82A 3Q1LA 5GZ6A 1X14A 2AQIA 3FSRA 2JKVA 1PGOA 1VJ1A 3BMOB 4NI5A 3DBHA 2VUSA 5BR7A 1OMOA 3PVZA 3FI9A 5BSFA 3LF2A 4TWRA 3O26A 1HDCA 3GR6A 1J6UA 1H9AA 4LMRA 4AJJA 1QV6A 4Y6PA 3SEFA 3S2IA 3NT4A 4JXKA 2GD1O 4CM9A 2PGLA 3W1VA
chains in the Genus database with same CATH superfamily
2QVZX 1JPVA 1WCYA 4UAGA 3B6KA 2WK1A 3FCSB 3GA7A 1J00A 1PR6A 1NVFA 1NNSA 2HC9A 3PC3A 1OXXK 2XVZA 3DP9A 4UU1A 3N7TA 2YJ5A 3RFTA 9ATCA 1EUYA 1XCPA 4FD2A 4ZU6X 1WTAA 3A28A 1IUKA 3IE2A 2FSSA 2OVFA 2Z5GA 4NG5A 5CB4B 1Y1QA 1X1SA 2J7PA 3UK2A 3NHWA 1JHYA 1KYXA 4YDHB 4N5MA 5E38A 4M1YA 5KO2A 2A33A 2Q1YA 2EP8A 3SEZA 3CVWA 3G1TA 3U31A 3ROKA 4XOUA 3TD9A 3UWSA 1Z2OX 3PQ3A 1S3FA 2WILA 1Q3HA 4QGGA 3LI2A 5BV8A 5CFRA 1N3LA 4ESVA 4UM9B 2Q9UA 1YL6A 2DWCA 1P2FA 3LIIA 3OCUA 3NAQA 3PNVA 5CB4F 3EQ6A 3BKXA 1VBMA 4HNAA 4TMFA 5FYQA 1RVV1 5DOZA 4PVDA 4QSHA 2F6RA 2Q5OA 5C8YF 4OGFA 3U3KA 1EJ2A 1Z25A 1YB7A 4IYJA 5IJ0B 1P3DA 1CF2O 2I4RA 1HFJA 3A9UA 3B13B 3DE4X 3V4ZA 5KNCH 3ZI4A 1JWLA 3IERA 4FI3C 3T34A 3VDQA 1HE5A 5E3HA 2Y0CA 3CFYA 3D81A 4QOHA 1XLTC 2V54A 2JRLA 4O4IF 3ZKAA 4OMDA 4XQCA 2E1RA 1PR4A 3I9FA 1FYDA 4OYHA 4ZYTA 4OYRA 1VIYA 1OFIA 4MROA 4B6OA 4Q3KA 2FZEA 3S8MA 1JIJA 3SBDA 2MR5A 3K0SA 3MELA 1XFDA 3TXYA 2OHGA 3KOXA 3WLLA 1UBOS 3BDVA 1TMKA 1CB0A 1G5RA 4E11A 3DMDA 1SNYA 3P20A 4OFZA 4AZTA 3DPIA 5EKSA 5BSWA 5JADA 5AIBA 2X9QA 2YVQA 4JR2A 2EEZA 2QMZA 4NENA 4R31A 5KKAA 1I2MA 4M89A 5CCEA 5K03A 3PXUA 4C0QC 1UC4B 3E58A 1OYVA 4ASUD 2PTHA 4GMDA 2H57A 3HYRA 2KMLA 1J2EA 5JPIA 3IMFA 1ZD1A 1EWVA 2H5JA 2NPIA 1KYZA 4G9GA 3H2KA 5DGTA 2FUG1 5LDGA 1BROA 2NGRA 3ICCA 1QC5B 5DCUA 4YCMA 1NKVA 1CZUA 2Q1XA 1GRQA 1DIGA 4ER7A 2ECOA 1QAMA 2HJ9A 1AS0A 1FXSA 3QP9A 2ICAA 3VKWA 2QIOA 1CX9B 5D87A 4HLUA 3RW9A 1JAZA 3V1MA 3LL4A 2IHKA 2YCBA 1T5HX 4LQ4A 1UMKA 5IZ4A 5KQRA 3E27A 5KVVA 1KE2A 2NUTA 5FUMA 1EI9A 4Q3CA 4Y2RA 2FWJA 4L15A 1N5OX 4DJAA 4QXOA 4G67A 5ICEA 1YCHA 3SWWA 5JQWA 4KI7A 2EBWA 1O7JA 4ZTBA 2F4NA 5GONA 2PD4A 3ECCA 2QMEA 3E82A 5H3HA 3MZ0A 5EQFA 2ZM6B 3Q7IA 2R00A 5KTPA 1I7NA 2UUPA 1FUUA 1UH5A 1MCZA 2HNKA 2OBBA 2VJKA 1IM5A 1BHQ1 1N0VC 1XEXB 2CLOB 2I78A 2RH9B 3KLNA 1EWTA 4YJGA 4BNDB 1DNPA 2C3PA 4GLFA 3RR2A 1U2DA 2B5WA 3QUBA 4ZU3A 1P18A 3VPHA 4X66B 3NYRA 3MTDA 3CZQA 1ICIA 2OWEA 1EE1A 4DPKA 1PS8A 3FNGA 4PLPA 2BFMA 3R3VA 2I7VA 5B57C 3R44A 1E6WA 4QGAA 3VA7A 2P7HA 3MPOA 5LQUA 1VHLA 3ZDBA 1T6YA 3NNDA 3C4QA 5SY6A 3K9LA 1VJDA 3DVLA 3VAAA 1C2YA 1ZM3A 3CNHA 3OLQA 4PPFA 4WJZA 4MYRA 3BERA 4KW7A 2YJ3A 4N0DA 4CR6A 4RJLA 2GVNA 3GFPA 3T5DA 2RGAA 5KJ6A 1FRZA 2V3WA 4HLDA 5M04A 1BCRA 4JXXA 4C4RA 3UIEA 2NSYA 3O3CA 3W05A 1U1IA 4L72A 1FW6A 2J4FA 3PNMA 1VECA 2FVYA 4O3MA 2HDNB 3DUFB 5EJ5A 3GU3A 3MYYA 3OIWA 4Y98A 5KU7A 2Y27A 2ZRCA 4D0RA 1D0VA 2OAQ1 2X0RA 3C16C 1NP3A 2VJOA 2PJDA 4FMPA 2IKQA 4PS1A 3BGOS 1H1TA 1M6VB 1RDFA 1EFHA 3MBKA 3WHLA 3WZLA 5I7OA 3N6XA 4XASA 3KAKA 3U9SA 3IXMA 1NMSA 3V8RA 2D0DA 1DC4A 1V5EA 3PQ6A 4TV9B 3H3JA 4DG5A 1I4OA 4PIVA 2MSNA 4DXDA 4EYQA 4ZT2A 4U8GA 1FRQA 4TTTS 1ILWA 1E79A 2V9ZA 4Q82A 2G5CA 1PK7A 4N40A 2FZWA 5IF3A 1QTRA 4ARIA 4NZMA 4WK0B 3ZE7A 4UUNA 5JNLA 2KE5A 3PUHA 3EDQA 1F2VA 1SM4A 3FJ1A 3JAKA 4K6OA 1IBKB 3DDNA 2HPZA 2QLTA 2EJCA 2FWBA 4Y9DA 3FG9A 1AKUA 2H2IA 4U2KA 5EIHA 5KWEA 3GFTA 1O5IA 2OENG 2VAXA 1DARA 3CE6A 4N12A 1USGA 3NRJA 4WDRA 1RQ2A 3LKZA 2BTEA 4TLEA 3GLGE 1YNOA 4TSFA 3ZDAA 2BPOA 4N76A 1TLFA 3ODGA 5AT1A 2P3SA 1ZZGA 5ENZA 2WJ3A 4C7KA 4YIHA 3BXGA 1HLDA 1YQEA 1OBOA 4MR9A 4US1R 3DOIA 1FFBA 3UHOA 4EYGA 3FTFA 4QX6A 1XKXA 2ECQA 2JGEA 3TL3A 3EMVA 2ZG6A 4GXQA 4HDRB 4IIJA 5AICA 2YV5A 3ZDZB 4ZI7B 4FJ0A 4KYVA 4EKEA 1QTQA 3E48A 3HB0A 1QV9A 1RM5A 2CBZA 1NVXQ 1YWGO 3IV9A 2Q8NA 3Q6NA 1UDWA 5F3DA 4GOLD 5B7QA 2GRAA 1KPHA 1HRDA 2JIOA 1J7JA 4RZSA 1H5UA 3EVCA 3GD7A 1L4EA 2OFXA 4H1HA 4E13A 4JQSA 1W5FA 3EFEA 1J2YA 3JYNA 1ZN7A 1H6DA 5LQJA 2BTQB 3FZQA 5A6VA 4Y6RA 4BEJA 5HX7A 3VKHA 3RJMA 1E8DA 1U5BB 4N1AA 3ZBUA 2P2YA 2A4KA 5CW1A 4LXYA 4W5TA 3R2JA 4PG8A 3MVEA 2JA2A 3A8TA 4C6TB 1SGWA 3BFXA 4NOLA 1XTUA 2RKWA 1FMTA 1ZU4A 1JHQA 3D6HA 3GCWA 3P2EA 1TD9A 5CB4A 1IWPB 2QTLA 4CKCB 1JFTA 4GKJB 1QH9A 1I4LD 2QLLA 2WZDA 2OC4A 4MQFA 4M86A 1TJ3A 1M7HA 2XB8A 1XZNA 1LC0A 4HXFB 4C20A 5CGZA 1OH8A 1K6JA 1YZLA 2IVFA 2XNSA 1X7ZB 4ZEWA 3SZ3A 3K2IA 1CUEA 5B3KA 1O4WA 2GA8A 2J48A 4O4IA 4A4DA 3LUGA 2FXIA 4MEJA 5ALLA 4D92A 4DN6A 5TPWA 1UPBA 1P39A 4P0TA 4RGQA 3PTAA 3H5WA 3U17A 4PF1A 4WEQA 3RWMB 1DTWB 2VZ9A 5DT9A 3EVDA 3IRUA 4NBLA 3VSDA 2XUKA 3STYA 5HS6A 2OFPA 4W9NC 1YUNA 4E30A 5KKNB 5F9HA 1FCJA 4GNKA 4AXBA 3SBEA 4PR3A 4CKEB 2XZLA 4I2NA 3AL0C 2W2KB 1D2RA 2IT1A 4GR4A 2M6KA 3UA3A 3OJEA 3H9BA 5AW3A 1IIBA 1Q1EA 3KUCA 1V5FA 3I2FA 4Q1FA 2PM8A 4KC0A 2BEWA 4MPJA 4OXYA 4I08A 1GZDA 2G4VA 2WDZA 3IPYA 4FDTA 4UD6A 2VPPA 3QZUA 3ESYA 1Z7WA 3C6YA 4G97A 4ZO6A 4A9AA 5KYTA 4IZIA 2RONA 2QUJA 1WEKA 1LV7A 2IE8A 2J9XB 1FW8A 2WHYA 2W2LD 3JZFA 1JNXX 4LC1A 4OREX 5EXPA 2O7RA 2Q2QA 3IIIA 3LHKA 1AC5A 2XW6A 4MMZB 1D6MA 2CK3D 3F6PA 3DTYA 2R68A 3DF7A 2JIQA 2DULA 3UJ7A 2QSJA 1B43A 1R0YA 1VP9A 4PHTA 2AE2A 4TKUB 2GM5A 4ITVA 4C3UA 4C4AA 4D5GA 3AWDA 2JHPA 3HA7A 4PLCA 1G19A 4QATA 4B6QA 5IJ0A 4DLKA 4AUMA 3LYUA 3P9YA 1U2GC 5ESWA 4BP3A 4KPFC 1QIGA 3UGTA 5JO0A 2P6RA 2EW2A 3NUGA 2D3WA 4A8PA 4NSNA 4DCNA 2QM7A 4TOIA 1MTZA 4BO8A 2V1XA 1ULZA 3VO2A 1WXWA 5MN4A 5IFLA 2V4ZA 2CC2A 1UDRA 4DSUA 3P4YA 2JHGA 2WFLB 3BKWA 3NBKA 4JJEA 2PBLA 5K4HA 2I9KA 2F59A 1QCDA 5DEIA 2F1HA 3CYFA 1TK3A 3DAPA 4BYMA 3PT5A 4RAQA 3WHKA 3CIOA 2FPUA 2EGGA 4PQEA 3SGLA 5KQPA 1N7GA 1QAOA 3EVZA 3BGSA 2HJSA 2XCQA 4FYMA 4LBZA 3LBNA 3SCZA 2W2OA 4OLJA 1MEOA 4QU0A 1TZCA 3FE2A 3ND5A 5EJGA 5F7XA 1T2NA 2OMKA 3DKKA 2EKPA 3PQCA 1MX1A 3O84A 3UMRA 2Y99A 3SZRA 3V8VA 1THMA 3L1VA 3R7FA 2BFPA 4NJOA 4BMZA 4DLBA 3HEAA 3HKDA 5CMLA 1DRJA 2C96A 4H1WA 3LUBA 3IDSA 2BBOA 2KQUA 2LZ0A 1XXHE 1SVWA 4QQRA 2GS9A 1OJ7A 4X62B 2HF2A 4YMGA 1NLMA 2XRYA 2OCPA 4H7EA 1B8OA 1KYTA 3QWFA 3S0JA 3TAHA 2X6TA 1WLSA 2O2JA 2P65A 2P9JA 4BO7A 2CT8A 2ZBQA 2EBHX 2ZUFA 3ILSA 3QY0A 3GLSA 2X9VA 2Q5FA 3EXEA 3Q98A 4YXFA 2HM7A 2J6CA 3EUAA 1FNMA 4BBAA 3KHUA 1TK2A 4GZMA 2AVDA 3IT1A 4HXYA 1RKXA 2EFDB 5T8KC 1U2RA 2YWHA 3NBUA 1PZEA 4HATA 5FBQB 1D4ZA 3FYUB 1E2JA 2G17A 1E6LA 2QX6A 1QVWA 2V4MA 4H7FA 4RHUA 3L6BA 4DR4B 2IHZA 1QHNA 4JX8A 1WPGA 2ORVA 3UXHA 4R9NA 3AUAA 1U7DA 3W8NA 2CNNA 4G2TA 3ABIA 4R3UC 3ZCPA 3GLHA 4ZCMA 3HY6A 3IT2A 3WGZA 4B6PA 2H7YA 2C8JA 4YMSA 4XLZA 1PKEA 2Q7DA 1XXHA 3GWZA 2UV8A 1QO0D 1VGQA 2Q2OA 5DN6A 4AYWA 4E5KA 3D0QA 3QE2A 3QX9A 5CDSA 4F11A 4EG3A 2HCFA 2NACA 1RBYA 4TUYB 3O5AA 4IJQA 1I14A 3A4NA 4Q7QA 2QHXA 3HNRA 3R6TA 5BSTA 1XFAA 5FWNA 2XT9A 3SN6A 4EFLA 3QPCA 1X80A 1MU0A 1FU4A 1RLUA 1USUA 1UWVA 2EJWA 3IELA 4Q6WA 4U7TB 1N2GA 5EZYF 3CLUC 1TAUA 4MHOA 1ZLXA 5A4AA 4S1VA 3FGOA 3QRWA 1BHJA 4M87A 5LM3A 4D79A 1L1FA 1KJ9A 2J85A 1FB5A 1R27A 2ID4A 4KWHA 2A30A 2ABWA 2GH1A 3V1NA 5K2OA 1I10A 4CVNA 2TS1A 1VJGA 2OGTA 3E3OA 2G70A 4MVJE 5AMXA 3T7AA 3VR4A 3ZTTA 1UFKA 2QP3A 3DPSA 4LX8A 1VMIA 2B21A 2I1LA 4HYQA 4Q48A 4CT0A 1BE0A 1PR2A 3GY0A 3GLHE 5DHTA 4IRMA 2HQRA 4B4UA 4JSYA 4Z7QB 1PDOA 2NT3A 3IKVA 1S4MA 1CP2A 1LWNA 2C2HA 2O6LA 4G1CA 4GDFA 4KR6A 2Q0SA 4YUZA 3KKKA 4QBTA 3BXHA 4ZXFA 3EWIA 4OD0A 5JCOC 1T2UA 3T3MB 3KAJA 2O9JA 3EXIA 5GOZA 3U09A 1SB8A 3AVUA 4BDSA 3SOPA 3VZPA 1P9WA 2VDWA 3F6BX 3GPCA 3HCWA 3KWJA 4M54A 4M9QA 3VHXB 5FBVB 1IK6A 3OOWA 4W5JA 5KWSA 1BN6A 1ODIA 1KE1A 2NX2A 1M3SA 3S28A 4CUZA 3DLTA 1V3VA 3FLBA 4RW0A 3ZOKA 3Q2KA 3M8KA 4XTCS 1TVMA 4MR7B 5EXXA 1HDZA 5FI5A 3WTCA 1JDUA 3KSBC 1VJRA 2RH8A 4PZPA 4IMIB 1K66A 2H7XA 3PGA1 1DO0A 3T95A 5K3EA 2JAXA 3T8YA 2B8WA 1OBHA 4HNSA 4PFJA 4RE6A 4ZAFA 3NHBA 3WLMA 4B09A 5EIBC 4ZKEA 5I01A 1ZJYA 3WBJA 3U7EB 5I6DA 2EL7A 1UJBA 1PWEA 1B14A 2ZVPX 3AY6A 1CUFA 4RQUA 2FEKA 4AUEA 5HW0A 5JWRA 3L4JA 5C0OE 2Y2VA 1OF1A 5DCWA 3RV3A 3CUEF 1SULA 4EPYA 1Q1GA 3HUEA 3KWMA 2NXEA 4ACAA 4BFVA 2A9OA 3IP8A 3D9QX 3JWJA 1Q22A 5E1DA 2YR0A 3DTNA 3AUTA 3A4LA 3LBHA 3WL5A 1DOHA 3GRZA 4QG3A 1AVTA 2VEOA 1EXDA 2V7XA 5DTJA 3RIXA 2WJIA 3P32A 3RVNA 5K0BA 1HT2E 4QQKA 3MNFA 5EJ6A 2JGFA 1N6PA 2V7WA 3VC7A 2QN1A 3T5PA 1DAIA 1KMIY 2L17A 2P1DA 4R9VA 5HF6A 3VPGA 1Q3TA 3UHJA 2HCTA 4MVJD 5BOSB 8ATCA 1M8JA 3SE7A 4LXUA 4XJSA 5CVDA 1ICEA 4TL6A 3U37A 1N2ZA 2H17A 3OU2A 5CNIA 3CUKA 1NBOA 3DL4A 1U1EA 1NP7A 4EH1A 1EJ6A 2QLBA 3HUFA 3NG1A 2XB9A 2QRZA 3A4MA 1CDZA 2JFVA 2VYNA 3NIDB 1CE8B 1G41A 2XTNA 4MRSA 4D4HA 4CEIA 3GDFA 4IFIA 1SIBE 4JI0B 4HDRA 3QBDA 1BQEA 4KQCA 5H68A 2VJBA 4FHGA 3T9EA 4CM4B 1RXVA 3TNYA 5DFAA 1IIRA 3PENA 5JU6A 3HZZA 2HLPA 3HSSA 4NULA 4MGYR 4G0XA 1NNUA 1ZNYA 2CHUA 1E32A 1XJWA 2GCOB 1Z4MA 2QV0A 1I6KA 1WDTA 3HA3A 4L3WA 4QBFA 5DSZA 4DT1A 1HDEA 5I7WA 2PUTA 4HB3A 1X13A 1PNOA 1O9HA 3VOBA 3VM6A 4BP1A 4CFYA 1W0KA 3IUJA 1I7QB 4L5YA 4ZVNA 1KRWA 2FEAA 1MORA 3JQDA 3NHJA 1G0OA 1ADGA 4G3XA 4JA2A 5CVJA 3DYVA 3OCYA 3JQ8A 5IKPA 2G82A 1FDSA 2ZBRA 4GVXA 1DQRA 1G3IA 3OZUA 3A37A 5K0EA 4ID3A 4EHBA 1JWBB 1IJFA 2NZ2A 2Q2VA 3MUOA 1TLLA 2B0JA 3R6LA 4NOKA 1YUBA 5JI3E 1RWOA 2EFCB 2OZLB 3AR8A 2WF8A 4ZU1X 4JQZA 4MJLA 1U2DC 1UXJA 4IOMA 4FWTA 2Z6VA 1XZLA 3ZXUB 3PZBA 3EY4A 3K4QA 3ZHRA 4NMMA 4UEJA 3KB1A 3M6VA 5IF9A 5GZ3A 3RYCB 5C51B 1F0YA 1ID1A 2JFBA 4XQ0A 1C80A 2DR3A 2ZAIA 1JGTA 1GPAA 1VG1A 1C29B 2F9MA 5JYDA 1YVPA 3WGKA 2OK8A 3DEYX 5A4DA 1XN1A 1QVRA 4RKWA 4UTRA 5DCLA 4JQYA 3TSAA 3I3SR 3MTAA 3LV8A 1ZVJA 3WJAA 3G79A 3VU8A 4TVSA 4XDGA 5P21A 3I8XA 3RGWS 3OQPA 4EVRA 1JIUA 4J4TA 5DRYA 4FX5A 3WL7A 4NS1A 1NF2A 1WMBA 1X1RA 2WJVA 3OCJA 3HHEA 4MO9A 2WM2A 3LWDA 4QUEA 4N3BA 1Y33E 3D6NB 3FPJA 4WN3A 2XCTB 3ICQB 3BSWA 3VR6D 4RVHA 1QJCA 4AP9A 4IFBA 1OFGA 3AGPA 3ZYZA 3BXZA 1P0FA 2YXDA 1PGPA 4BLQA 4JI5B 2Q0QA 2FPPB 2WUDA 1DQZA 3PXEA 4UHHA 5IN5A 2WIAA 1QHYA 1YBFA 2RI6A 3EXFB 3TLMA 2I7CA 4M4SA 5FI0B 1M75A 4IHAA 3FIJA 3QVGB 5IT9A 2ZAGA 4MX8A 2Y1EA 2O2GA 2YC2C 3CISA 2OB1A 3M83A 4IZHA 5HKLA 4EY7A 3K0AB 1JEJA 3WYDA 3FPAA 1ZM4A 2AWOA 1MOQA 1SD5A 4ZVPA 1K6IA 3SHWA 2AUTA 2IIQA 2B4RO 5IS2A 4CU2A 3AL3A 3SR0A 4YYEA 2H48A 3VNQA 4KU4A 4XYBA 1TT5B 4URZR 1DV2A 1PNQA 4FOTA 2I2DA 2ZSHA 4GMGA 5JAZA 1OVMA 5LQDA 2C3MA 4Q05A 2BDTA 3SYNA 4RSGA 2NV0A 4G36A 3QKIA 4DV2B 1LQUA 2ZR8A 1YQWA 2H2HA 2ID7A 3OTHA 1KI3A 1PJAA 2CW5A 1E1DA 4YC7A 3DKIA 2GUWA 3ISTA 5EA2A 4AG3A 2WABA 4OIMA 3FM9A 3NR2A 4EJSB 1N2JA 1GU1A 1UC8A 3GH1A 3C3CA 1DC8A 4KLNA 3BMNB 3HY3A 4MKRA 4HDKB 1Z0FA 3DT6A 2F8TA 1W2WB 3AVXA 2NSHA 4TTIA 3MWEA 2OO3A 2I87A 4EUEA 3AESA 1TM1E 3R3XA 4R1SA 4IMJB 3BEOA 4I4IA 2Q6OA 2CFCA 3PDIA 4N0QA 3CPHA 4R0NA 3ADKA 1P5JA 4W7IA 3L7DA 4XUEA 5EPOA 5F5XA 3WMRA 1COWD 3DLBA 3BUSA 2J0QA 1XU9A 2CLLB 2Q46A 5DM2A 3AI2A 2CXSA 4TV8A 2AX3A 4G1EB 3NWEA 4L4RA 2RKBA 4RPIA 4XYMA 5DXFA 1KZGB 3I76A 2RFLA 5AVSA 2H59A 1F4LA 1W4BA 2JS7A 2QENA 3CLTD 2DY0A 4UZSA 4MGEA 5IYZF 2VHCA 2EERA 4BGEA 4W99A 1XZ8A 4TXHA 3KDPA 3NCHA 1Q0HA 2ACEA 3KG2A 2QRMA 4GX0A 2ANBA 1I9CA 2GR9A 2H54A 3D2BA 4Q47A 4JGIA 3RC9A 3UWDA 1XR3A 3AY3A 1V16B 3P7MA 3B2NA 1KP2A 3GQBA 4WZBE 3EISA 3BHNA 4JEIA 3ZHSA 1ZESA 3D0KA 5C52B 1E60A 1Y4DE 5GONB 2B4AA 2P4QA 2J6BA 3O2QB 4IOLA 1AB5A 1ABFA 5TPZD 3X2SA 4FYYA 1RW4A 4OK3A 4BQOA 1IPFA 2PD3A 1Z17A 2YNMC 4C0BA 5CYPA 4CL0A 1ETUA 1ZH0A 4TMWA 1A95A 5EVJA 4I55B 5KJFA 1FQJA 1NUPA 2AG0A 1LQ2A 3F5SA 1Z4LA 1JQJC 3H1AA 2XMRA 3N8KA 8GPBA 3QW4B 4XW2A 5EP2A 3WNQA 2AJDA 3AI3A 1QGDA 2LXNA 3GVXA 2A0XA 3KUDA 4PC2A 2GETA 5TT0A 4XYEA 3Q1KA 4FEEA 5JCXA 2WTNA 5CXQA 1DEHA 3IV7A 4C0JA 3MWDA 1SVMA 1I4TD 2J9FA 2GCNA 3G5LA 1V1JA 1FIUA 4RIEA 1FX0A 2G9RA 1MOPA 2JCXA 1LPPA 4J1NA 1JSCA 1WVIA 1OXBB 3BA6A 4NARA 2VSFA 3TQFA 5FX2A 1U3UA 1XTTA 3I9V1 3CLRC 1E2IA 1BFKA 4DMLA 1JSRA 3LIPA 2F1JA 4IYRA 1MQSA 4X1KB 1PQPA 1I4EB 1TXGA 1FVXA 3QKUA 4S1TA 1PUJA 2WJYA 2YZKA 3DBHB 3OTWA 3PUWA 5HJ2A 2JFYA 4XWOA 3EUWA 4YI3A 1BMQA 1H94A 1OFVA 4TLAA 4DRXA 3BRCA 2CFTA 2CHEA 3UTCA 5DTQA 4MQEB 4XLLA 3FVTA 3PXBA 5CDFE 3CZCA 4F46A 5JH7B 3GFBA 3A6FA 4ZWNA 2A14A 3B7GA 1NTRA 3B48A 3MOSA 2CMHA 4KX3A 4TVBA 3UMJA 4D9EA 4DQDA 2HWUA 4XOIA 1IAVA 3ZVRA 1RI5A 3GFRA 1NBWB 3EXG2 4XJVA 2ERCA 2H7CA 3SX4A 3PKZA 3ONWA 1UMDB 4YUAA 4JZYA 1FSFA 4HCJA 3L4SO 4XUCA 2R7AA 2VK4A 2AUNA 4CF7A 2X1LA 4NMWA 5NLLA 5BW5A 5F2NA 2YRWA 5DTIA 3BMCA 3BL8A 2VJDA 3FW1A 1QTNA 1R6AA 1R6VA 3AJAA 3BTSA 1VBKA 3H75A 4FNMA 4GR9A 4MGIR 4MPPA 4RTOA 1CUUA 1JTEA 1VA4A 1VPLA 4I50A 5I7SA 2FN4A 4QDXA 5L6MB 2O0JA 3DVRX 2WTEA 2JAUA 4ZYZA 2MHCA 2POCA 3Q88A 3HXPA 3T6KA 2R1UA 5DBFA 3TLZA 4H77A 2GNAA 1YI8A 4IBOA 2FMUA 2HSGA 4V2UA 3G2MA 5LXTF 2QV7A 3IQHX 5DBGA 2REXB 4GRDA 2HXYA 3T54A 2D62A 1K1EA 3HFSA 4RTPA 3CX3A 1REQB 3H4IA 3OHSX 3RKRA 7ADHA 5ILQA 2PRSA 4OQQA 3VVLA 1DPGA 3MCZA 3RROA 4AO7A 3GLIB 1O08A 5KC9A 1AZTA 1VSVA 3ETGA 3C3YA 3LGSA 4QPDA 5KTMA 2O5EA 2GLTA 3DP7A 3NH6A 5A71A 5KJCA 2VJQA 1ZK4A 4AD8A 2QUZA 2CUNA 3FA2A 2QTGA 3GARA 1RIIA 2I03A 1YZKA 4U5XA 2E4VA 4WZAA 2FP3A 3FHLA 4U02A 4WXRA 2BEKA 1Y9EA 2GRJA 3FLAA 1B8UA 4R2IA 3WLTA 5IUNC 2Z83A 1L5FA 5JVDB 4UTPA 2VBFA 5JAOA 3BDIA 4JVNA 3ELYA 5SYAA 3RRZA 4AQDA 5C5DA 2TYSB 1BXRA 2C1ZA 3RU3A 4HAYA 4CDNA 3ZUGA 3DVSX 1H9BA 3TEJA 3V55A 3V9PA 4PBRA 1QC5A 3KXKA 1PWHA 4IUDS 2HZ7A 3PEUA 2GWRA 1B0PA 2VZEA 3AHJA 1YE8A 2GVZC 3KZVA 4MLZA 3E5RA 2Y0EA 2POQX 3IAS1 1J4AA 5AI8A 1QQAA 3JD4A 1J99A 3GGCA 3QWIA 1YA4A 5E2AA 1DKNA 1TB4A 4ODIA 4CEIB 4R7ZA 3ONEA 4Z8YA 4DV3B 3JZDA 4W7HA 2OG1A 3K8QA 4ZVVA 1U8UA 2RGBA 2WU4A 1Z56C 3BIJA 5E7IA 2A5DA 4JS0A 5L9AA 5I7UA 4KR0A 3O8CA 2VF2A 3UB3A 1HOXA 3A6JA 5AWFC 4A10A 4BAGA 5L3QB 1EHYA 1P5FA 1U2SA 2VNAA 2J3HA 4HEHA 3ROQA 2FVXA 2VHYA 3O1HB 3R40A 1XOIA 2E4ZA 2X5OA 4MS3A 5D5PA 4DB4A 5JTUA 3QPAA 1ISIA 1WETA 4UCQA 2YMLA 4FEGA 5AI5A 4NPCA 1YFZA 1G9XA 2WJ4A 1XB2A 3AI1A 2C3YA 3RV4A 1R4ZA 1GFIA 1DPFA 1HE8B 3LS2A 3LWNA 4BB0A 3QXCA 3PFIA 1LTQA 3VR5D 4C4ZA 4CV2A 5I4BA 1F20A 3U7RA 4NV1A 2VP9A 2JIMA 3HHPA 2ZETA 2DYKA 4HGPA 5EEHA 4FJ2A 1T29A 2CN1A 1NGSA 1XA3A 2P79A 5H3CA 4JK3A 2E2WA 1UBLS 1L3IA 4CV1A 3ERCA 5ANRB 4C89A 1CFJA 3PUJA 4MYHA 3IAS6 2RG7A 2W83A 3PHHA 3QUQA 5DNWA 1XD2A 2VHEA 1V1MB 2PMFA 2XUHA 4L8GA 4M1WA 1SIWA 4QICA 2XH8A 2DHDA 2BFNA 1PJLA 3FHJA 4LVNA 1GT6A 4TZKA 1KU0A 3NEJA 4H59A 1QH1A 1WOYA 2VSQA 1EJ0A 4M22A 5JCOA 2G9ZA 3Q2IA 4K8RB 1HFKA 3DWGA 2QN2A 4J2OA 5THKA 3I01M 3RK1A 3MCAA 3D64A 2ONKA 1RHJA 1U8FO 4WNYA 3K9CA 4IGAA 1N3YA 1WD7A 4YBRA 4RBNA 4CT4B 1B42A 3JZIA 1GPJA 1AZSC 2WF9A 2ZSUA 1NVAA 2PSFA 4KLZA 5TPWB 1IZ0A 3HBMA 4ENUA 2JG3A 1G7CA 1IEWA 4RF3A 4V39A 4XD7D 2O8CA 1ORIA 4K3VA 1N2SA 4U7HA 5A0FA 3KJNA 4CW7A 5JWOA 3LPLA 4RFSB 3ZWCA 3WIDA 5DYWA 4EBFA 2CLEB 4AJ2A 1Q95A 4RVSA 4UEQA 1BE6A 2WHPB 2DZDA 3ITDA 5EHZA 4BXOB 3WLNA 4HAUA 2RAUA 1FRNA 2WWHA 2SKDA 3FFXA 3W7VA 1BTOA 5EC8A 3MHPA 3EZNA 3IDFA 3ZWXA 1LV8A 1RXIA 1MW9X 1JU4A 1TCAA 4LWPA 3EEBA 4GPZA 2OORA 3DB1A 4HDMA 4L16A 2BOVA 1CNEA 1SCJA 2M6RA 1I2AA 2QTBA 4IJMA 4RK1A 3TQCA 4RH0A 2C5FA 1Z82A 3GW8A 3RWOA 3EVNA 3REQB 2R8ZA 4DA8A 3NV9A 4DWWA 1XI2A 3BREA 4BFXA 3PDHA 5AUPB 5BV7A 5IU6A 2ZUUA 4WXMA 4FN5A 3GT7A 1MRNA 2GXSA 2QR3A 3C3EA 3K71B 5EIXA 1LA2A 4LY6A 3U1TA 2D2XA 2CNBA 3LY9A 1UBNA 4XSVA 5CLHA 3L4KA 1E1QA 3A9WA 4GZLA 4PZYA 4RVUA 2X3UA 5FOVA 1PQWA 1YBMA 3KZCA 4ZOCA 4DZTA 1NRWA 2FOXA 2ZYSA 4NZOA 3M4YA 4XFKA 1IQRA 4F5YA 3HP4A 3TSCA 3QTBA 4WLVA 3TH5A 5CA0F 3GQBB 1VSTA 4NCJA 1ZXLA 1UP4A 1XZHA 1L7PA 2PIAA 2VWHA 1V39A 2Z2KA 3EUFA 2IHYA 2WB2A 3CRVA 3F8WA 5KNBA 1OB5A 2AEFA 2ONJA 4E1AA 1DAHA 2Q5JA 3ZE6A 2PH5A 2UVPA 1U0OC 5JBQA 1QRSA 4BVKA 3I73A 4KQXA 1WNFA 1XQVA 2IGBA 2QD1A 3HV0A 3V7FA 4JV5B 4TV8B 2ZRNA 2QRKA 3QPBA 1LBTA 4IJ5A 3ANTA 2BZSA 2GPNA 2BMEA 2V5AA 1E1RA 5DGHA 4EKYA 3OF5A 5LUBA 1A7JA 3VH4A 4PO8A 3DTVB 3QXJA 1JILA 1Z0UA 3B36A 4AROA 1TJ4A 2WAYA 4RX1A 1QOQB 3HUTA 1NVTA 3GRCA 1H2FA 3FF4A 5GADl 5K3BA 2ZB3A 4TYNA 2PGIA 2HXSA 2WIFA 3INYA 4D4JA 1HNWB 4WBSA 4KO8A 1E1NA 3B9PA 3F4LA 5EP4A 3V1KA 5LXTB 3ESZA 3GLUA 4EUHA 1NYQA 4MP3A 4MS4A 1AN9A 5CX4A 2Q3EA 1GGEA 4EO4A 3FTDA 1ZFNA 1I5RA 1PS9A 1PSDA 3LWZA 4G1FA 3W2EA 3LDFA 1K3TA 5BORA 4UE6A 2RHGB 2C5EA 4GVLA 4BWGA 4Q4HB 1EDZA 2Y77A 3ZTWA 5K0LA 3L7BA 5B1IA 3RVOA 3WNDA 5C8VA 2CEKA 4UUBA 4CMEA 4ER3A 3HH8A 3C4JA 4R0MA 4A91A 4RJTA 2HLDA 3NKVA 2PLAA 1JI0A 1Z2AA 4IIBA 1CW2B 4KAAA 4NY1A 1VB5A 3L8MA 1L1RA 1Y8RB 1LLQA 3F96A 3DONA 1Y3AA 2VDWB 3EA0A 3TI9A 4DEYA 1K98A 4IS2A 1O4VA 2X7JA 2ZR7A 3AERA 3L04A 1HDYA 2JFFA 3UJBA 1R0BA 1X86B 1P0IA 1KDPA 1N9GB 1IQUA 1G2QA 1UZMA 3BQNB 2CBGA 4R1LA 4RACA 5JS2A 5FNVB 3F7NA 4GZ3A 1V4VA 1XRPA 3OAAA 4JLPA 4IIGA 2B6NA 1TF5A 1UWKA 3NHMA 1TKCA 1Q3KA 2JI4A 2H4HA 1U3DA 2ZB7A 3OZBA 4O2LA 1MTOA 2RIRA 4R40A 5CVUA 1WZNA 3M4NA 3VDXA 1TIBA 2OAP1 4JVLA 3TX2A 4REMA 4EG0A 3IPRA 1N3BA 1NXOA 4RH1A 1QIDA 4I5GA 1QHSA 4AWBA 1UK8A 1FLVA 3KSDO 4LPKA 1ZGGA 4UZEA 4FUQA 5LXTA 5H8WA 1WM1A 3O9MA 4JL5A 2HA0A 5FA6A 5H0IA 2C61A 1JN0A 2ILVA 3P9QA 3AY7A 4KQ9A 1OPXA 4X44A 5KOJA 3C5WP 3JWEA 3L9WA 3LKBA 4UEWA 5G4KB 3WKAA 5KX5A 4EY5A 2YZMA 3A7EA 1U81A 3UMBA 3WP1B 5GVSA 3LPNA 2BCJQ 3P2YA 1DRVA 1TJYA 3O74A 4JBLA 4JVMA 5F5LA 3RVMA 3UATA 5B7GA 2D59A 4XUGB 3ENVA 3IKMB 3D6UA 1JLMA 4KE7A 2DE0X 4DLXA 1A9RA 2F3QA 4ND6A 4JI7B 4KXWA 2Q21A 2J6HA 1DL5A 2R6CA 2A8YA 3CCCA 3DEKA 2JFNA 5DLQC 1T9GS 5KAMA 3WLKX 4CWAA 4CEJA 3O0TA 4WINA 3STUA 1WBBA 1Q0ZA 4FNAA 1L4GA 2NP6A 2WMOB 2Z2YA 3TN7A 2JFXA 3NHKA 2EKQA 3ND9A 2XADA 3CBGA 4A92A 4MWDA 1OH5A 2OG2A 3EODA 2F3RA 4BV9A 4J16A 3TCXB 1C9DB 5EINA 1GKUB 4CM4A 4DQ0A 1MXHA 2ZYRA 6LDHA 5LWQA 3VR4D 5DYTA 5AKHA 3G2QA 3FYUA 3Q4GA 4WY8A 4EY6A 3VOAA 1W73A 2AF4C 2NU7A 1D1PA 4UDOA 4W8GA 4WXEA 3I6QA 4A1FA 2Q4BA 4EB6B 5F2EA 3UFXA 1NMQA 4QXPA 2Q2WA 1ZWLA 2B9VA 4KQ6A 3P9KA 1IZ9A 2VXCA 4J2HA 4AJOA 3L7KA 3BTOA 5DNAA 3X1MA 1KNXA 3JQRA 4KCGA 3W8EA 4FUTA 4M1OA 5DU2A 4PLFA 4AP6A 4BJ6A 4C0KA 1ISFA 3I04A 3TECE 3KTOA 5LDHA 2W0SA 5BN1A 1PFYA 3DR5A 1TT7A 1V9CA 2B30A 4RM3A 4B3RB 2XWJI 1LFDB 2JLQA 1D0IA 3VDRA 3DJYA 3M6FA 2CLMB 1LLCA 4IDBA 3QELB 1OLXB 5HBRA 3RYFB 3F73A 1W85A 4KSYA 4U7GA 1U8AA 4I5DA 4C6RA 1TE2A 2XXBA 3UCXA 5A9RA 5F35A 1JG6A 1OT5A 1O87A 2OHOA 3FWYA 3DHYA 3GA5A 3QXXA 4TUYF 1F7VA 1S1MA 2FH5B 5AJHA 1ZLYA 2NUBA 5DLYA 5G4KA 4DG8A 5KX5B 1UOQA 1X1BA 2VNKA 1V43A 2ZULA 3DR3A 1XDZA 1JXMA 4HD8A 3ONDA 3U1BA 5AW9A 2BGTA 1PL6A 1SC9A 5KOHA 4DSZA 1ARZA 4KO3S 3EXHA 4CQMA 1DEKA 4BQFA 2G1PA 3OU6A 4ZMSA 2JJ2A 5JZOA 1KJIA 4OXRA 1CB7A 3TAXA 1DG1G 2ZRKA 1QZZA 3KJEA 3KYDA 4GBJA 3PC7A 1W29A 1VKNA 1IN1A 4Z4QA 3JPWA 4Y2PA 1CUDA 2NQ2C 1GADO 1NPDA 2DVMA 3HN6A 3MB8A 4WNAA 2HT1A 4TKVB 4MJXA 4XVRA 2O2CA 4LNHA 4Y2SA 1A50B 3CG0A 4I8DA 4TQGA 1A5ZA 3OUUA 1U0FA 3UJPA 1H0HA 1QIIA 4RVCA 1JHDA 4BFTA 3K1ZA 4L1KA 2XKBA 3CZAA 3BAZA 5ED4A 3NHUA 4C1BA 2FZVA 1UBSB 3DO5A 3USCS 3HJFA 1P9LA 4H4CA 4HDMB 1EH5A 2EGUA 2YY6A 5E6SB 4JITA 4DBLE 1T9CA 5FOWA 4Z4FA 5A0VA 4R81A 3O75A 4NPAA 2R66A 5KWJA 4NU5A 1EQAA 4Q7KA 4LF8B 1YB6A 3FTQA 3W2TA 5JFOA 1ZKMA 1FUIA 3VU1A 4QQNA 2LV8A 5B4VA 1C30B 2X9LA 4N7JA 4TTVA 4OXIA 4MNTA 5KJEA 4DDKA 1CJCA 3P9CA 5REQA 2DSNA 1JWAB 5IXJA 3EDYA 1AKNA 4ZGWA 4LYYA 3BL5A 2PNFA 5GMOA 2Y0PA 4F7WA 4BLSA 3U4DA 3EXEB 1WF3A 2R7KA 3H2JA 3KL2A 4NE7A 4PG7A 3TL6A 5B7NA 3L8ZA 5FPTA 2G71A 2CYBA 5DHSA 4LCBA 2WLTA 4ROTA 5AM0A 3FZYA 1EK2A 4BXOA 1B2RA 4DV5B 4C7XA 3VI3B 1K5DA 2DPLA 1MIHA 1AG9A 4FYKA 4Y0VA 1PLJA 2ES4A 4MUEA 2PMWB 5EE3A 5H4HA 1O0BA 3T3IA 1AUQA 4P36A 1Y3DE 2DHCA 2EOAA 5AQEA 1XYGA 5D3KA 3AO0B 5DCYA 1QVAA 2IF0A 2X8AA 2BFFA 3BWDD 3RG2A 2QRGA 3RJTA 4PRKA 3N2NA 1P19A 1YS2X 4JJ6A 4L2IA 1Y1PA 4K87A 3SR4A 4KR7A 4RCYA 4XRGA 4BZQA 4YT5A 3C3KA 1FP1D 4KPYA 4ZKDA 2ZXEA 2BI8A 2XHZA 4PQRA 4GMFA 5CHYA 4R3NA 3UMVA 4NCKA 5JVDF 2JBAB 1SA0A 3R8XA 3E5MA 1SUCA 2XRFA 3PQ2A 4XZ3A 1YAJA 3RGGA 1ZOLA 4J8PA 2DCMA 3LA8A 4JR0A 1X7WA 3IMCA 4MUKA 2LE0A 3LP8A 2GZRA 1Z4KA 1D03A 1FS4A 4L0QA 4BAZA 1CRPA 4D25A 2CXTA 2AZ4A 4G0YA 5AUQA 3O92A 1CR0A 4C7OA 3HGQA 2LIPA 4ND4A 5KQGA 2R8XA 2VJYA 1QH0A