3U5TA

The crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from sinorhizobium meliloti
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
241
structure length
230
Chain Sequence
NKVAIVTGASRGIGAAIAARLASDGFTVVINYAGKAAAAEEVAGKIEAAGGKALTAQADVSDPAAVRRLFATAEEAFGGVDVLVNNAGIMPLTTIAETGDAVFDRVIAVNLKGTFNTLREAAQRLRVGGRIINMSTSQVGLLHPSYGIYAAAKAGVEAMTHVLSKELRGRDITVNAVAPGPTAVRDRFAKLAPLERLGTPQDIAGAVAFLAGPDGAWVNGQVLRANGGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from Sinorhizobium meliloti
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
total genus 75
structure length 230
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3u5tA00
1TT5B 1YQDA 2FP4A 4JROA 1A9YA 3DBVO 4I9HA 3UHAA 5EPOA 5HA5A 1BVUA 1X7HA 4MIYA 1EMDA 9LDBA 1BDBA 1JDJA 3QY9A 1QLJA 4QXMA 4RGBA 1PTJA 1BXZA 1XYGA 2OHXA 3JYQA 3JYNA 3WJAA 1LSJA 4FCCA 2EWMA 2NU6A 4BQPA 2V6GA 4ZICA 3OJLA 1A7KA 3KUXA 3X2EA 4EGFA 5IZCC 4ALNA 4FGSA 4MKZA 1DPGA 3Q9NA 1K6IA 3D4OA 1ZXLA 4U8GA 2BMAA 4E6PA 2EKLA 3WQSB 3DBRA 4N5LA 1EEHA 2B4TO 3HN2A 5A3VA 4UEOA 3WOHA 3HJAA 3JYPA 3QWIA 3DWFA 1U9JA 3U4DA 1W73A 1P74A 2YDYA 2X5KO 2IE0A 1R15A 3DFUA 3I23A 3MEQA 3PJEA 4L9RA 5AQ1A 5CFZA 4S3MA 2I3GA 2WWRA 1RM3A 3AFMA 2NVBA 1YQXA 3MWDB 1WAMA 3KV3O 3KVOA 2VHZA 2FRDA 3JQ8B 5C7LO 1U5AA 3JQEA 2PD4A 2J3KA 1O8CA 4FN4A 1T2DA 3H65A 4YPOA 2P9CA 2CNBA 4IDAA 1HSOA 2W2KA 1MGOA 2D59A 3QQPA 2CF5A 4CM8A 5B1YA 3UAGA 4CQLB 5CAEA 4JBHA 3M1AA 1YB1A 2BHLA 2Z5LA 3QWAA 4NG5A 2GYYA 2F00A 4C7JA 4RDHA 4EUFA 1SNYA 4TZTA 4XIJA 2ZQZA 3ROPA 1J49A 3RFXA 2NQ8A 3TNLA 3BMNA 4YAKA 4OH1A 5JYEA 1I3LA 4IDGA 5BT9A 2P68A 3AM4A 3JQ7A 2CDBA 3BZUA 1YQGA 2VUTA 1H0KA 3EYWA 4FDAA 5IG2A 4Z9XA 5TGDA 4E2WA 1IHYA 3ZCXA 2J3JA 3NAQA 3VPXA 5C7OO 5H82A 4DXHA 3TPCA 1IUKA 1V9LA 2HK7A 1TVEA 3DAPA 5BNIA 3OJOA 4IY1A 2NV6A 4M55A 4FJ1A 4WKGA 1DC4A 4BL5A 2W98A 3JCZA 4PFJA 3IJRA 3LZ6A 5C37A 2EGGA 3UKOA 3DZBA 4AVYA 3F3SA 4N54A 2OMEA 4RPHA 1Q0QA 5IAAA 4ALJA 1DRWA 4BO6A 5L45A 3DHYA 4EYEA 2VZ9A 1QR6A 2IZZA 3PHHA 4YWJA 2E37A 5CDGA 4FFRA 3I52A 3QV1A 2AEJA 3VH4A 2G76A 3BHIA 4ND5A 3KYCB 5I7VA 3P7MA 4HX5A 1K0UA 2IZ0A 5ITVA 4E5PA 5EESA 2FPPA 1GDHA 1C1DB 1V8BA 4HBGA 3H3JA 1NFRA 4KP7A 4A0SA 4CMIA 4Y8VA 4RLSA 2B69A 2ZCUA 2Y67A 5TSDA 3FPCA 1N7HA 4PG5A 4XWYA 5GZ6A 3WGYA 3WGHA 2I5PO 2GZ2A 1Z75A 2FR8A 4Q9NA 4WLVA 4Z3DA 1ULSA 4MJLA 3WBFA 1UH5A 2JCVA 1BW9B 5JCJA 5LDHA 1LA2A 4NK4A 4YJGA 3LYLA 3HE3A 2OXIA 2B83A 1P44A 2HDHA 2AQIA 1MG0A 2B5WA 2QZ9A 3UCEA 1NWCA 5HS4A 1ZK3A 5FF9A 1KY4A 1YH3A 5TS3A 4UAGA 3R3SA 2WE7A 1KBZA 3G1UA 1KEPA 5EL0A 3QRWA 3L9WA 1T1RA 4J0FA 2GZ1A 1VM6A 1VKOA 3ZW9A 4CQMD 5JO9A 2DC1A 2DKNA 3ZV5A 2YY7A 1BTOA 5FI5A 2PLAA 3EGOA 3ONFA 3GLQA 2HKIA 4CLEA 2C82A 5TRTA 1H6BA 4E3ZA 3TFOA 2A35A 1B8UA 1NR1A 2Y1EA 3DDNA 4IJKA 5L9AA 3SBOA 9LDTA 1FXSA 2ZYGA 2B37A 1ISMA 1PJBA 3JQ8A 5DNAA 4OQZA 4RO0A 3S2IA 4PZDA 5K6AA 3ANLA 2CZCA 5A9TA 2I67A 4WCFA 2I9PA 4CMEC 1J4AA 4J4TA 4BNTA 3MOIA 2ZB8A 2EF1A 2VRCD 4FW8A 2NU9A 4E2YA 4Q3EA 1NQOA 5L4NA 5EQDA 5JNLA 2CVQA 2OUIA 1DIHA 3GH3A 4EDFA 3PI7A 3QE3A 3GFGA 5B4UA 5DT9A 4ZVVA 1GEGA 2DBRA 4K6FA 4R1SA 1E5LA 1P1KA 3LK7A 4E33A 3KYBA 1NHGA 3PJDA 3K96A 4OO3A 4ZQEA 4IDEA 2Z1MA 4ZJUA 1UJMA 3X2FA 3CMMA 1EK6A 4H7PA 4CM5A 4BO1A 3OJFA 4FFPA 1QMGA 3DOOA 4K28A 1HF3A 1Y8RB 5EJ2A 1DIGA 2AEMA 2C0CA 2TMDA 3I9LA 3L4BA 1NQTA 2RIRA 3STHA 1ZW1A 4RCVA 5DBGA 4BIIA 1V6AA 4UUNA 4GVXA 3RUDA 3ADPA 2RHRA 3H8VA 1WVGA 5A04A 4JJFA 4MVJM 3ZWVA 1RYDA 1TLTA 2VT3A 1PWXA 4KTVE 3GY0A 2Q2WA 4S1VA 2Y93A 2DQ4A 4FOSA 2FSSA 1A72A 4C7KA 1KVTA 4EUHA 3FNFA 1T4BA 4BO9A 1PGOA 4IINA 2EJVA 4TZKA 4EJ0A 1T2CA 1XEAA 2A92A 2HAEA 2NTVA 2OOSA 4J1QA 4I9UA 1FDSA 1QKIA 2X9NA 3ZWOA 4BOYA 5TF4A 3Q2IA 2VWPA 2X8LA 1U3VA 5IDYA 3KYCA 3PK0A 4YT2A 4YVFA 3E8XA 4D45A 1ZSNA 1X13A 1G0OA 1C0KA 1E5QA 3KLPX 4PLPA 4XIYA 1KETA 3I9OA 4NBVA 1S6YA 1P31A 5CHEA 3ENKA 3AI2A 4UVGA 3ZHBA 4FJ0A 1H9BA 4R1NA 3WJ7A 4BNNA 1Y1PA 1CEQA 2YHIA 1LLQA 1ZK1A 4XCVA 1HXHA 4I5FA 1SEVA 3VOSA 1XG5A 3BMOB 4JLWA 4Q3CA 2BH9A 3MJSA 2QQ5A 1U8FO 3ZH2A 3E48A 1MV8A 2Q50A 4FC7A 3FR8A 2VWQA 4QT0A 2WD8A 4HKTA 3AUUA 3GHHA 1NR7A 4ITUA 2X6TA 1V35A 3WTBA 4JGBA 4OOEA 1ADCA 4L4RA 5JC8A 3R3JA 5A03A 3TL3A 3OF2A 5A3JA 1P77A 1DLJA 3RD5A 2BFAA 1LDNA 3H9GA 4XGIA 5AXAA 4DRYA 4L74A 1UZLA 2PGDA 4RLHA 1IL0A 4UVHA 2Q99A 3HWRA 1KS9A 5K0ZA 5T5QA 1ZIDA 1KVRA 3O4RA 5ILOA 4D3FA 1U1IA 3UICA 1M6HA 3UFXA 3DMTA 3NDIA 3UGKA 4CM1A 1SAYA 2VYVD 1NFFA 1GAEO 3DO5A 1XELA 5ER9A 4YT4A 4RVHA 1NM5A 4RPKA 1LXCA 1VE9A 4J7CA 3VPHA 4HADA 5JE8A 5TT1A 5JBIA 3M6IA 3W4JA 1K2WA 1E1MA 2A9FA 3C1AA 4JP2A 1I3MA 1P3DA 1PL8A 4ONEA 4GVLA 3RWBA 2GERA 4UVIA 4WECA 4I9NA 3V1YA 3O03A 4XD2A 3IL2A 4GMGA 4RZHA 2FR0A 3D3EA 3VPFA 5LC1A 1SMKA 3S55A 1FDVA 1OC4A 2LDXA 1LC3A 3RC1A 3WR5A 1O89A 3Q9UA 5TQVA 1ONNA 1ZEMA 2OP1A 5DP2A 1Y8QB 5L40A 1D3AA 4RDIA 3PWKA 4W6ZA 1T4DA 3W6ZA 4P4GA 3FCOA 3DONA 2YV1A 4OSOA 4YA6A 3IOYA 4J91A 4WJZA 1SO8A 4Z0PA 3WYCA 5JC1A 1KVQA 3H7AA 3IP3A 2OO5A 4D7AA 3BXXA 2O3UA 2ZQYA 4U7WA 2Y0DA 4R9RA 4FB5A 4CM7A 3LC1O 3E6AA 3WSWA 1EZ4A 2GD1O 3R6DA 4EUEA 3WNVA 3INGA 2WMDA 3FF4A 4CLXA 4E4YA 1WZIA 1ISIA 2BLLA 4FIZA 4KTTE 4TRNA 1LRKA 1R6DA 1XQ6A 1M76A 1ONOA 3DEYX 3BYZA 3CE6A 1XU9A 2VQ3A 4BO5A 2H1SA 3WGIA 2Y0CA 4NPCA 1TT7A 1G1AA 4CM6A 1HSZA 4A7PA 3ZHXA 2X1HA 3O9ZA 3O26A 4MO2A 1XGKA 3F9IA 3LLSA 4CQMB 3M1LA 1DJQA 3KBOA 2CFCA 1T2EA 4GQAA 4BO8A 1DIBA 4CMJA 1K3TA 1Y6JA 2EKPA 5ILGA 1LQUA 1LBEA 4XB2A 4WLOA 3AUAA 4GH5A 2E4AA 2VUUA 3UOGA 4CM4B 3O38A 2C5EA 2CY0A 1A71A 2AQKA 4IS3A 5THKA 4NJOA 1ADFA 3VKUA 1MA0A 1X7DA 3H5AA 4WE3A 4NNJA 3WBBA 3FNHA 4BB6A 2HU2A 2YFQA 4MVJE 1G6KA 3LLVA 5KCZA 3OICA 3GRKA 5CG1A 3COSA 4OL9A 4ND3A 5ER6A 1DIAA 3NTOA 1KVSA 1NWHA 2A4KA 3JTMA 3ZHZA 3LQFA 5A4DA 2VYND 1E7YA 3DAGA 5I8WA 4CPDA 4MVJH 4AL4A 1UR5A 1HDZA 5MDHA 2Y1CA 1CQJA 1DXYA 3L0DA 3UVEA 4D79A 3HB4X 4YDRA 4PLHA 3DTTA 1GQQA 3VH3A 3PVZA 2I65A 3FTNA 5DOVA 5F5NA 2HJRA 3KM0A 2IEDA 4J0EA 5IZ4A 2GNAA 1J6UA 3IUPA 2UVDA 1JVSA 3S2GA 4A27A 3TWOA 1BWSA 4PVCA 2PWZA 4XDYA 3E1KA 4A73A 5CP8A 2NVWA 2PZMA 3NRCA 4JCOA 4ILKA 3ETDA 4YB8A 2H5LA 2NVUA 7MDHA 3RFVA 3CTMA 3AWDA 3WIEA 3GGGA 1I01A 3L4BC 1UDBA 4GLLA 1DBVO 1QYXA 1Z73A 1J5PA 4CLOB 2B0JA 4M8SA 4TRRA 2ZJ1A 4BUCA 3P19A 1PJ4A 4RVFA 1DHRA 3BTVA 1R0SA 4P4NA 2G17A 3WIDA 2Y05A 3MJCA 1YL7A 4AJLA 1M67A 4IGFA 1B2LA 4PRLA 1WDMA 2HLPA 4DPMA 3A14A 4WEQA 2FN7A 1LDMA 4URFA 3BHMA 1DC5A 4PLYA 3QP9A 4ID9A 3ITKA 4BNIA 3F4LA 1VKNA 3WX0A 3AM3A 5G0SA 1I10A 1HT0A 4W9NA 2NTNA 4XX0A 3TSCA 3N7UA 2X0RA 2JD2A 1LX6A 3MCVA 3ZWWA 5T57A 3NJ8A 2PTGA 1LRLA 4XJTA 4YJHB 4D43A 3S2FA 1PGQA 3VVCA 5A5EA 1LLDA 3GFBA 4DMMA 4NFYA 2EW8A 1F0YA 1U3WA 3D4NA 4OQYA 3DC2A 3UH1A 4BKQA 4KMSA 3F4BA 3VHRA 5JSFA 1EVIA 2RCYA 1QYVA 4AJ2A 3PHGA 3I4FA 4L75A 4IMPA 1B8PA 3EC7A 5COQA 2BKAA 1HTBA 2PZLA 3L9XA 3KETA 1WDLA 2DFDA 5B4VA 5TJHA 3AY6A 1LDYA 3NUGA 3EVTA 5A9RA 1I24A 3QWFA 4XDZA 5JCJD 1VJ0A 3SEFA 3ITDA 4NQZA 3CKYA 1R66A 1GQ2A 2D4AA 1XR3A 3P2YA 1ZFNA 1O0SA 2GN9A 4LCJA 4W7HA 1WLYA 2J8ZA 4GPD1 1ZZEA 1X0XA 2OZPA 3GK3A 3JQFA 3W4IA 5U9CA 4J4HA 3V1TC 5FYDA 3WNQA 4L0QA 1R4NB 2Q2QA 3DZIA 1VJ1A 3PP8A 2OBNA 2BRUA 1YKFA 5I9NA 1SCUA 4OKNA 1D7OA 3DL2A 4DYVA 4QQRA 2YDXA 3RU7A 3DQPA 4DBVO 1XHLA 5TJ9A 2QW8A 5CPBA 1AHIA 1QXSA 2POQX 3VZPA 1N2SA 4QUKA 1B14A 1QP8A 2ZIZA 4U6QA 3DZHA 3B1FA 1GV1A 1GQYA 3ZNQA 3VZQA 1DDOA 1ZJZA 2FY8A 1DHTA 2YW9A 3JD4A 4LRSB 1VL0A 4BV8A 2I66A 2CDAA 3FWZA 2DM6A 3BTOA 3S2EA 1T2AA 1CIVA 3H9JA 1K5HA 4AJNA 3OA2A 4IMRA 4J4BA 4ALLA 3OP4A 1C3VA 1KIFA 1U7TA 1BG6A 2BELA 2BFMA 3ZHYA 1YONA 4FFMA 5TT0A 3OECA 5HS6A 8ADHA 5K9ZA 1N1EA 4J7UA 5F1PA 5JAQA 3W8FA 4PG4A 3GR6A 3JYLA 2JFGA 4MVJF 4XB1A 3KEQA 4NBWA 4OOFA 4XA8A 1YL6A 3HG7A 2BI7A 4IPTA 2EGHA 3RROA 2OGUA 3SJ7A 3ASVA 1CQIA 1QV6A 1YL5A 3F47A 2X7HA 5JAZA 1PZEA 3WGTA 4A03A 2Q49A 1UP4A 3L6EA 4I5GA 5KJFA 3GMDA 3GEMA 3EHEA 2D5AA 2UAGA 4FSHA 1KC3A 4GSLA 1R0LA 1YGYA 3W8EA 5IN4A 4GKVA 4RVSA 4KOAA 4B4OA 1X7GA 1ML3A 3KSDO 6LDHA 1O94A 4DGSA 5F5LA 3RUEA 1Q0LA 1SZJG 2BD0A 2IYPA 4QO8A 3RI3A 3OIGA 3RUIA 4MDHA 1GD1O 1H5QA 2JAHA 2B36A 2O7SA 2WD7B 4BV9A 5B4TA 3VTFA 3AUSA 3SLGA 3NGLA 1EVJA 5EMHA 1N9GA 4EEXA 3GN1A 2FHSA 4R3NA 4OHUA 1VRWA 5KVVA 2RAFA 5L53A 4QFCA 4CMGA 4D41A 4DWVA 4JIGA 2C29D 3TRIA 2CMDA 1EDZA 3IKVA 1F14A 4L73A 4YQYA 3OSUA 1N92A 1M66A 5JAMA 4TWRA 3JQ7B 3ZWBA 4LK3A 3GVXA 1YOVA 4DQUA 2VHYA 4M54A 2I99A 3AK4A 1B7GO 1Z45A 3H9UA 2RHCA 4FOOA 4NJMB 3U0BA 3VTZA 2HMSA 5G0TA 2ZTMA 1CRWG 2WYWA 2YZ7A 3EUWA 3HSKA 3I4CA 3LF1A 4CM9A 1E7SA 3G79A 3NYWA 3F6YA 1UAGA 3KYDA 1VI2A 4Z0TA 3RJ5A 1NVMB 3KOUA 1U3TA 1C0PA 4J3FA 4M49A 4X54A 1WDKA 3LC7O 1W4ZA 1MXFA 1HDOA 4ZQFA 5HBRA 7ADHA 3WWZA 3WGOA 1IZ0A 4NBTA 1ZEJA 4JK3A 4CM9D 5GZ3A 1DJNA 4IJWA 3U9LA 2PKQO 1QLHA 3E82A 3A28A 1AGNA 3BTSA 2DFVA 3P5SA 1O9BA 1Y9AA 4GX5A 4DTIA 3G49A 2B35A 2DAPA 5HWSA 2B4RO 3NTRA 1AE1A 2AG8A 1E3WA 4E31A 1HDYA 5K6AC 1Y5MA 4RL6A 3PLNA 1ENYA 5A06A 2X9VA 1W0CA 1BXKA 1Y8QA 4NIMA 1VPDA 4NU5A 2PKQP 4Q3AA 3JQ9C 1PS9A 5GZ1A 1TXGA 1RM5A 2YJZA 4TQGA 3KYDB 3NX4A 4FFNA 2VNAA 3ETGA 5BR7A 1T1SA 1B8VA 4BO2A 4D42A 3A9WA 3AM5A 4MP3A 2VWGA 3RCBA 2W2LD 3OH8A 1B15A 2C2XA 4HFNA 4RVDA 1F12A 4HFRA 4R1UA 3JQAA 3CUKA 3VVBA 4B7CA 2Q45A 2AXQA 4QECA 2BGKA 2GN4A 1LDGA 2V6BA 4BNXA 2EXXA 3U4HA 4XGNA 5L4LA 1RKXA 1B26A 1C0LA 4P4LA 4P22A 4UULA 4ZA2A 3D4PA 4XR4A 3H2SA 2H6EA 2UUOA 4JQCA 3S1LA 3GGPA 2FR1A 4ZD6A 2DPGA 3QWBA 3ETEA 4XQ9A 5I9LA 1UUFA 2Y1OA 2X0JA 2J5QA 3OQ1A 4EJMA 5BSGA 2VHXA 2X5OA 2G5CA 2XXJA 4YAEA 1GY8A 1NASA 1FMCA 5G0UA 4GSKA 3PRJA 3BMQB 5F21A 3IDSA 4MVJP 1EE2A 1Q1NA 2P5YA 3ZWYA 2O3TA 4WNIA 3HFGA 1P1JA 4YTEA 1JN0A 4UEJA 4DA9A 5DDIP 1DLIA 1JKIA 4U0KA 3WYEA 3HFSA 4XQEA 4YJDA 3OMLA 3F1KA 1HE4A 1HYEA 3GDOA 1TEHA 1SB9A 4II3A 4F3YA 3GGOA 4Y98A 1GFSA 5G4LA 4YAIA 5IDXA 1JW9B 3TF5A 1LUAA 4CMCA 3RUFA 3JQFC 1GEEA 3U62A 1O95A 4W4TA 1OOEA 3AY3A 1BW9A 3KSZO 1E7RA 2YHUA 2Q3EA 3RAJA 1UXGA 1DAOA 1PU2A 2EEZA 1H6AA 3PJGA 3DBLB 2GR9A 2X0NA 3ZGYA 3B70A 1C1XB 2NWQA 3FD8A 4FFLA 4CLRB 5T67A 4IGEA 2EJWA 1E1NA 3ICPA 4J9VA 3RIHA 4YAGA 2HK8A 4I08A 3DMYA 3DBHB 1C1DA 3K5PA 1IULA 2V6FA 3FNGA 5I9MA 3RC2A 1C14A 4RVGA 2V6MA 4W99A 3F46A 3PQEA 1CF2O 4E0BA 2VN8A 3VZSA 1I30A 3QVWA 4PLFA 1JTVA 1T24A 4M87A 4XYGA 1ZO8A 4DLBA 4RJTA 1T26A 3EZYA 3I9MA 3KEOA 3O8QA 1W8DA 4PZCA 4OYRA 4AG3A 2AMFA 2HMWA 5EQFA 1MXHA 2ET6A 4DIBA 1P0CA 1XSEA 3DMTC 4NI5A 2VZ0A 4DREA 1Z6ZA 3T7EA 2GASA 4FGWA 1JWBB 1V3TA 3VH2A 3WTCA 4J49A 4HXYA 4YBZA 1ADGA 3PHJA 5KVCA 4MP8A 4NHEA 4KDFA 1DC3A 3IKTA 1X14A 3DBLA 4BNMA 1NP3A 3DHNA 3GVPA 4MVJI 4NH4A 3I9JA 3DZGA 2C54A 3ZV4A 4B3JA 1PX0A 4BNKA 1FDWA 1MUUA 3GVHA 1OMOA 4R51A 3V2UA 2XPCA 2W2LA 1E3LA 4WCFB 3QVSA 1LLCA 3FWNA 1PIWA 2J3IA 4YRAA 5COAA 2DU8A 1IY8A 4OXKA 2ZYAA 5DCUA 3PPIA 1F8FA 3HNPA 2Y99A 3W4KA 3QWHA 2E6UX 4DBZA 3HB5X 4TKMA 4FJ2A 2F1KA 3QA9A 4BNVA 5IF3A 3PWSA 1PJLA 4QO7A 3HN7A 2ZKLA 3DOCA 1Y7TA 4DIFA 4IXTA 4RQUA 4PG7A 2NQTA 3U4IA 3D3WB 4G2NA 3JQGA 4YJFA 1Y8RA 1Z7BA 4K26A 3W1VA 4M89A 3HHPA 1YO6A 4LVCA 2VYVA 4CUJA 4ND4A 3OJEA 1YB4A 2X86A 4RF4A 5BNTA 1FF9A 4BB5A 1ZXBA 2B4QA 3PGJA 1LI4A 1A7AA 1EBUA 4PN3A 1DO8A 2C07A 2GN8A 2IYOA 2WYVA 3E18A 3TFQA 1K89A 4I5EA 3GF4A 1E3SA 4K6CA 4KQXA 1PGPA 2FPGA 2VTEA 1JWAB 4R41A 1ISJA 4BMNA 1E6EA 1Y81A 4YXFA 4DIOA 3MTGA 5TLSA 3N58A 5JLAA 1CDOA 3K2EA 5C3MA 5U1PA 3ORFA 3WMXA 5KKCA 2QIOA 4DQXA 2UDPA 2NACA 2X4GA 4E12A 1AXEA 3H3FA 4XYLA 5JY1A 2R2GA 1HYHA 3WGZA 5IJZA 3TZQA 2O2YA 4HUJA 1RYEA 3GDGA 3VDRA 4B4VA 2OL4A 3PIIA 3ZV6A 3T4EA 5KNLA 4G5HA 3E9MA 4R5MA 5BSEA 1N1GA 3R0IA 2LDBA 3LDHA 1E92A 2GZ3A 1NXQA 2JD0A 3ZWCA 3ABIA 4E5MA 1SC6A 3SC6A 2PH5A 3L77A 3RFTA 1YBAA 3KTDA 5ICSA 4AJKA 5BNFA 5ES3A 1LEHA 1BSVA 3E9QA 5CDSA 5AXBA 4LGVA 3ROMA 3BTUA 3RKRA 2CVOA 4BO4A 4JN6B 1A27A 1GZ6A 2GPTA 3MJTA 2DTEA 3VKVA 3WLFA 2AG5A 4HFJA 2O3JA 4AJIA 3C7AA 4BNZA 3IC5A 2DVMA 3M2TA 4UVDA 4LVUA 5JDCC 4B4UA 4ZRNA 3RUHA 3I6QA 4OIMA 1HLPA 5L7TA 1LC0A 3AU9A 2WYUA 1P1HA 2UV8A 4IZHA 3ZW8A 4GWKA 3QVTA 5KTKA 4BO7A 1H93A 2Q1SA 1E3EA 3OETA 4R9SA 4CV3A 1WZEA 1E7QA 2AW5A 1FK8A 1QRRA 4FS3A 1NNUA 4CM3A 4II2A 3NGXA 4LN1A 4P8RA 1RWBA 4BGEA 4BKUA 4WPGA 3Q6IA 3KZVA 4W82A 1PWZA 4CUZA 2OORA 4QSMA 4BGUA 1AHHA 3JYOA 2HJSA 2NVUB 3K73O 1QV7A 1DFGA 4YQZA 3TDKA 3OHSX 3K8ZA 3F1LA 4WCDA 4ZQHA 4AJEA 5IXYA 3BA1A 4R68A 2QX7A 2WDZA 1V3VA 1I3KA 2QRJA 3JV7A 4PZEA 3INRA 5CDYA 2HCTA 4F6CA 4GX2A 3SC4A 4I8XA 4BNLA 3JD3A 1F06A 4FC6A 1YOVB 1YDEA 4B79A 4NFHA 2EP5A 3GN2A 1W6UA 4MINA 1YE3A 2AHRA 4RZIA 1UXJA 1EE9A 2DT5A 3FBTA 2NUAA 5I7FA 5L95A 5KJ6A 3L6OO 2EIHA 4MPDA 2O50A 3V2HA 2IZ1A 3FBGA 4AJJA 2GGSA 5IFLA 3PZBA 2GSDA 4IDDA 1R4MB 2B5VA 3JD1A 4B8WA 1IYZA 5A05A 3ONDA 1WMBA 1PZFA 3ZI0A 4CL8A 2O7QA 3L07A 3N74A 4M86A 2FOIA 1P33A 2NU7A 4J6FA 1J0XO 1OI7A 1WPQA 1ZMTA 2D1YA 4BVAA 1E7MA 2HQ1A 3GVIA 3GEGA 1P1RA 4D0SA 2QRKA 1YBMA 4D0RA 1L7DA 4GGOA 4NMHA 1PR9A 3WMWA 1E3WB 4KQWA 3HDQA 3GNSA 4GKBA 3WYBA 2NU8A 2Q4EA 4NFSA 1P9LA 1PS0A 1GUZA 3F5SA 3KHUA 3W8DA 4A2CA 1ZK2A 3WQQA 2PH3A 4YRBA 4LCEA 1GZ4A 4CLOA 2BFPA 2XXBA 1TA4A 1JKJA 1U2DA 4HWKA 3WB9A 2X5JO 2JHFA 4FPXA 3DZFA 5GMOA 4PLCA 3ZWMA 3PQFA 1CERA 4TMFA 3GOHA 2FWMX 2W4QA 5I7EA 4GWGA 3RSHA 3QLJA 4ZHSA 4DVJA 2PGJA 3K92A 4ZQBA 3WICA 1CYDA 5L7WA 1BXGB 2QHXA 3K9QO 4R16A 1XCBA 4OXYA 4CR6A 4FD3A 2C7GA 2D5CA 3MZ0A 5EERA 1GUFA 1E3JA 1YB5A 1H6CA 2BGMA 4UEKA 1V0JA 4GL4A 4NU6A 3E03A 3MJ4A 4CL3A 1ADBA 2EP7A 1LQTA 1JKFA 3CPSA 5DCWA 1FJHA 1SBYA 3BIOA 4DPLA 1HDRA 2YFHA 4IDBA 3JQBC 3GUYA 2ZB3A 3JD0A 3BHJA 4G81A 1UDAA 4JBGA 3QVOA 2WTBA 1Q2XA 5KOIA 1R16A 3FSRA 3G3EA 3NDJA 3PDUA 4YEDA 4KWIA 1GPDG 4R01A 5BSHA 1H2HA 1HZJA 2HO5A 2ZB4A 3UXYA 2GUGA 4BHTA 1HEUA 3OIDA 2NNLD 2D3TA 4E2ZA 2D8AA 1S7CA 3HDYA 5ADHA 1KERA 1QYWA 4E13A 1ENPA 1RPNA 2E82A 3HADA 2Q1WA 1KEVA 4J2OA 4CUKA 3H5RA 1LU9A 3AW9A 3GAZA 3F5QA 2X9GA 4LMRA 1WXDA 4FFOA 3GUCA 4IJVA 1JVBA 2NSDA 1E1LA 2PNFA 3BMCA 3H4VA 2BF7A 1DSSG 3LSYA 5DP1A 5TX7A 5JY6A 1I5RA 2QG4A 4N7RA 3GPDG 2JD1A 1EUCA 3GG9A 4OAQA 4EI2A 3HDJA 2IEBA 2YHIB 3ZDFA 4CQLA 1A5ZA 4N5NA 4BGVA 1UZMA 2HUNA 1I3NA 1VLLA 3G17A 3IJPA 1L7EA 2OFPA 4G65A 4IQGA 2GN6A 4XR9A 2Q4BA 2VRBA 3WWYA 4DPKA 2IDZA 4O0LA 2Z95A 3WSVA 2PFGA 2GRAA 1DC6A 3FN4A 1I33A 5JMWA 3MJVA 1P45A 2VOJA 4CV2A 4J90A 2ZB7A 3AU8A 3HQ4O 1L1FA 3GZNB 2EERA 3QSGA 5T64A 2EKQA 1HE3A 1RJWA 3ZWXA 4Q3BA 4GMFA 1GCOA 1HE2A 2EHDA 1XIVA 2AA3A 5DN9A 2O3SA 4TKLA 4CM8B 3PHIA 3RBZA 4B3IA 2GO1A 4PLGA 4PG8A 3UN1A 5EIOA 1LJ8A 3PLRA 4CR8A 1GV0A 3PYMA 3S8MA 3B1KA 1B0AA 3OBBA 1O6ZA 4B7UA 3AFNA 5IZCA 2YQ4A 4DQVA 3PFFA 4A5OA 1AN9A 3GA0A 2VHVA 4J43A 2XF8A 3EMKA 1E77A 2NM0A 4UUPA 1ISGA 1PJCA 3DHEA 2YQ5A 3TN7A 1ID1A 4CJXA 2HMVA 3ULKA 4BMSA 1AXGA 4Q39A 1Z82A 3K6JA 2FZWA 1NYTA 3KLMX 3V5NA 3O8QB 1AUPA 1DRUA 2PK3A 1KOLA 2W2KB 3AOGA 5IN5A 3ZWAA 5H83A 4BKRA 3ST7A 3CXRA 4OMUA 5IDWA 2P4QA 4MP6A 1U28A 1R4MA 1ZNQO 3JQ9A 4PG6A 4CV0A 3PYLA 3ANNA 3FI9A 3V2GA 2AE2A 3SX2A 4MKXA 3OEWA 1D1SA 1UAYA 1EFKA 2Y1GA 1ONPA 3KXDA 4D3SA 3TJRA 4EJ6A 1EUDA 4UUMA 3IIEA 3ZU3A 4HP8A 1B3BA 3ZNNA 3H9QA 3ZWPA 4N5MA 1ZJYA 5EINA 3OFSA 4O5OA 3JQGB 3C1TA 5JPIA 1E6UA 4LW8A 5JDIA 1NQAO 5LCXA 1NAIA 3INTA 1PZHA 4WOKA 1VSUA 2JKVA 4U0JA 1UP6A 1R4NA 2VZ8A 4IDCA 4Y6RA 3C7DB 4F6LA 5JO0A 1CWUA 5IDQA 2GF2A 3IUSA 3ZWNA 1A4UA 4B8ZA 3ZNPA 1YS4A 1PR3A 3CZMA 4L76A 1VL8A 3DZKA 1O5IA 4CMHA 4DYDA 1HRDA 5KKAA 4J1SA 1EQ2A 1CJCA 1OFGA 4DUPA 4CMBA 2C20A 3RBXA 1NHWA 1U4OA 2IODA 5C7IO 3GHYA 4RV9A 4NBRA 5J23A 2H9IA 2WEKA 4YJFB 3NDRA 5G4KA 4BNHA 4UREA 2HSDA 4CV1A 1GCUA 5KJ1A 5H81A 1PGNA 2JJYA 5B12A 4GBJA 4TVOA 4TVBA 3AUTA 3PEFA 1T2FA 3AJRA 4IJUA 5L51A 1PJTA 4YJGB 3BMQA 3AY7A 4BNWA 1IPFA 3KB6A 4H3VA 3JQAB 4D46A 1KVUA 3ONEA 5CEFA 5KWEA 3C1OA 3NTQA 4CQMA 2DUWA 1WW8A 1PZGA 1LRJA 2QRLA 4DMLA 3BMNB 2DLDA 2PD6A 4DLLA 2VTDA 4D3DA 1UXIA 3IAHA 1R37A 3KO8A 4MVJG 5DF1A 1I2BA 3G1TA 5KJCA 4MVJD 1MFPA 4E30A 4Z9YA 1NVTA 1P0FA 1JLLA 4BNGA 3I6IA 1BVRA 3T7CA 1CETA 4ND1A 2Y68A 4B7XA 1NPTO 2RBEA 1DEHA 3OQ6A 4XQGA 4KDEA 4ZU3A 2WE8A 1UXHA 4OM8A 2I6TA 4KUGA 5C5IA 1NPDA 4BS9A 3DOJA 4E5NA 4FBGA 1ENOA 2Y0EA 2CVZA 3CEAA 3ASUA 2JHGA 5JFOA 3DBHA 3QW2A 2DTDA 2PV7A 1EDOA 1PQUA 2V7PA 1N9GB 3FNEA 4J7XA 4ESOA 4AFNA 3JQBA 1IB6A 8LDHA 2PR2A 4L4SA 1FDTA 3P2OA 3ZU2A 1B3RA 3E5MA 4XRRA 1QYCA 2DBZA 3LT1A 3NT2A 1H94A 4BNYA 1QORA 5FWNA 4LRTB 2P9GA 4LSWA 4R54A 4J9UE 2P5UA 1NFQA 3U5TA 1B16A 4ROSA 5DCYA 4J1TA 4PLWA 2C2YA 1PJ3A 1SPXA 5F1KA 5JW6A 3C24A 2YUTA 3I9KA 5HTOA 1ISHA 1I2ZA 4IBOA 3W6UA 4IUYA 1JAXA 4BO3A 1A9ZA 1HDXA 2NTJA 3EK2A 3MJEA 3I1JA 4R1TA 1PL6A 5JMPA 4BNFA 1F17A 4JP3A 3D64A 1M6WA 1E1KA 3JQ6A 5AXDA 4EEZA 5I8ZA 5A5FA 2AQHA 3I83A 4OKIA 1OBFO 1XDWA 3B1JA 4JX8A 5EN4A 3KSUA 1SOVA 2G82A 2JCYA 2HRZA 5L7YA 2ZCVA 4F46A 2Q46A 1UZNA 3DXFA 4GI2A 2C5AA 4J2HA 4XYBA 5CEEA 3BMOA 3OQBA 3B6ZA 4O59O 5ENVA 1BMDA 4IIUA 4L8VA 1OZAA 1C1XA 4OSPA 5TNXA 5BSFA 4BNUA 3D0OA 1IPEA 3E9NA 3FR7A 1NAHA 2Z1NA 1BDMA 3I9NA 1BGVA 3DZJA 1H9AA 4D44A 2O3RA 1ZK0A 1HYGA 1ZK4A 3PDJA 2D2IA 2O3QA 5DOZA 3U4CA 1I36A 4R69A 3RQSA 3PYXA 4WLNA 1GTMA 3ADOA 4PIVA 2BFOA 4Y6SA 3RUCA 1HWYA 4O63O 5U4QA 1N5DA 4CMIB 4KUEA 3HUDA 2JAPA 4WK6A 4ZRMA 3RJ9A 4XRGA 1UP7A 2HK9A 4BKOA 4MIEA 4CMKA 1HZZA 1A4IA 1XLTA 5DZSA 3WLEA 5THQA 2QYTA 1RM4A 3WXBA 4EITA 2D0IA 3NT4A 1ZCJA 5IXSA 3DAFA 3DBRB 2CUKA 4PLZA 4JJIA 1YXMA 3TZHA 2CSUA 1NQ5A 3GDFA 2E48A 3VAZA 4BGIA 1MX3A 1GYRA 3B20A 3GPIA 1FDUA 3PJFA 3V8BA 2BGLA 3VH1A 3HZZA 1ARZA 2PD3A 4ND2A 3Q1LA 3CMCO 2AE1A 3LT0A 6ADHA 4QTZA 4RPJA 4DLAA 3U49A 3LC2O 3ROKA 2FPIA 2Q2VA 1NBOA 3K2BA 1ZKMA 1I32A 5TC4A 1XWFA 4WCFC 4PLVA 4CMEA 3VPGA 5G0WA 3K30A 1HETA 2FSVA 2TMGA 3C85A 1LSUA 3RKUA 3R1IA 3LT2A 3WFJA 4CR7A 4NDNE 1MP0A 4ALIA 1V3UA 4RVUA 4R3WA 1BXGA 1ZVMA 3D7LA 4OGWA 1G0NA 4AJOA 4YRDA 4E2XA 1E3IA 5MGBA 3H9EO 5JDCA 3DR3A 3PGXA 3SJUA 4DC1A 4E5KA 1U8XX 5TIIA 2O23A 3PQDA 3Q11A 3QIVA 2QZZA 2NADA 2P4HX 4MOWA 4WEOA 4U5QA 4BMVA 5CEJA 3I3OA 1TB4A 1Y9EA 3AOEA 4P38A 1LNQA 3ANMA 4IIVA 4A10A 5G2OA 1LDEA 3DTYA 4PLTA 2JFFA 4Q3NA 3K31A 3PHLA 4RQTA 5JDIC 3CIFA 3VDQA 4B3HA 3NJ4A 2PZKA 4ZQGA 5AXCA 2FZEA 1UDCA 2WJPA 1PQWA 2W8ZA 1GPJA 1I8TA 2DBVO 4JXKA 4Z9FA 1PL7A 1NPYA 4B4WA 3ZNOA 4I5DA 3CINA 4EW6A 5A1TA 3TQHA 4R4JA 3WQRA 4M1QA 2PKRA 4IQ0A 1BHSA 3OIFA 4LISA 4H15A 1DRVA 1E6WA 2ZTLA 2JFHA 1YJQA 5ITWA 1K6XA 5T8KC 3L6DA 1ZH8A 1LDBA 4QEDA 4WLEA 4YAJA 3RVDA 3MOGA 3GT0A 3KRTA 1KEUA 4XYEA 3JSAA 3ZU4A 1IOLA 4DL9A 3EY4A 4OXNA 2HRBA 2RH8A 5FFFA 1KEWA 4OJNA 5A02A 2OBYA 4IZIA 3G0OA 3D3WA 3WGQA 1VSVA 1M2WA 2R00C 5L4SA 3DFZA 1LLUA 4CLHA 1DOHA 4RPLA 2BI8A 2ZK7A 1P1FA 3RASA 3OA0A 1DFIA 3RU9A 4EZBA 4CLRA 1XKQA 3RBVA 1Z7EA 3HDHA 4XEHA 4DC0A 3UCFA 1ORRA 2J5RA 5L3ZA 4Q3DA 4RF5A 3NKLA 2ZTUA 3A06A 4WASA 1HE5A 1R0KA 1N7GA 1K6JA 2VRCA 4J16A 2QYSA 3IS3A 3ON5A 1EVZA 3VZRA 3JQDA 1Y5RA 3EAGA 3M2PA 5CPFA 2WSBA 1U3UA 3GZNA 2JL1A 3GRPA 5LDGA 1GADO 3TZ6A 1DAPA 2C59A 1GUYA 3QJ5A 4BQRA 3PXXA 2O4UX 3WS7A 2W90A 3UUWA 4AJ1A 3GC6A 4L4XA 4ZGWA 4Y6PA 1MC5A 3UW3A 4YR9A 4IDFA 4RPGA 3CSDA 2DTXA 3ROQA 2E49A 1YBVA 3I5MA 2EV9A 3U3XA 1X15A 2G1UA 2X58A 1X1EA 5G0VA 1HL3A 1PGJA 1WNTA 2P2SA 1SOWA 4BNJA 1ISFA 2VOEA 1M75A 1HDCA 1Q0HA 4FR5A 5AOVA 3EVNA 4UUOA 3IMFA 1Q7BA 3PTZA 3ZU5A 3FPLA 5JAIA 4PCVA 1F8GA 1NX6A 4RF3A 1ZSVA 3UCXA 4BO0A 1LTHR 1XU7A 3CZRA 4MIOA 1E0DA 2OP0A 1IE3A 4E5YA 2ZYDA 1MFZA 2PA3A 3EDMA 4YYZA 1R12A 4E32A 1VL6A 4GAEA 2YV2A 4IS2A 4N18A 2VNSA 1U2GA 1KY5A 1U4SA 2O48X 5GY7A 4Z6KA 4HNHA 4KZPA 5AVOA 3T4XA 1EFLA 1IHXA 4WGGA 4XGKA 1ZMOA 2VWHA 3RC7A 4PVDA 1MLDA 2I3AA 4XKJA 3WGGA 1GL3A 1N8KA 2Y66A 2ZJ0A 2Q1TA 3GZ4A 4Y9DA 4WLUA 4WOJA 4AJHA 2HMTA 3LT4A 2ILTA 5A9SB 1ULUA 4E21A 2EW2A 1RM0A 1X0VA 1YWGO 3E5RA 2ZTVA 4GX1A 1VJTA 5B37A 5ENDA 2CF6A 2J5KA 5KIAA 1Z74A 1MB4A 1TT5A 1H2BA 2X0IA 3DB2A 3IQDB 4YT8A 1WMAA 5G4KB 3FHLA 2R6JA 1PS8A 1H6DA 2YYYA 2Y1DA 4XQCA 4YJHA 4GGPA 3BMCB 4QX6A 3WDSA 4NK5A 1WWKA 2Y1FA 5JYDA 5F3RA 1PJ2A 4CMAA 1JU9A 1ENZA 1PJSA 4Z0HO 1OAAA 1GR0A 3SXPA 1BRMA 1I2CA 5DBIA 3GNQA 3FRJA 3WG9A 2V65A 3AI1A 1EVYA 1LSOA 4J1NA 3Q3CA 3OM9A 4O6VA 4K1LA 2HMUA 4ZN6A 1KYQA 2WM3A 5CDTA 1SB8A 4Y67A 3TL2A 1T25A 4ALKA 3EW7A 1IZ9A 3GMSA 5CDUA 1ZBQA 4IXWA 3H2ZA 4LMPA 4R5HA 1YVEI 3C3XA 5DBFA 2O4CA 2IXAA 3TOZA 1EK5A 5DULA 4CLDA 4AICA 4EBFA 4AJ4A 1I0ZA 3V1UA 4F45A 5A9SA 2Q1UA 5JXWA 3GVCA 4WLFA 4MKRA 4HV4A 2H63A 1XA0A 4K9DA 4UVEA 4IM7A 2VUSA 3RUAA 2P9EA 4NBUA 5HRUA 3QVXA 3GG2A 2DBQA 3ZN2A 2SCUA 4YT5A 2P91A 4IQ8A 4PGFA 3LU1A 3PIDA 3OEYA 1QYDA 1SEPA 3CH6A 2I76A 4XZ3A 2GLXA 1Q7CA 2YV3A 3A4VA 3GNTA 2RH4A 3PFWO 4O1MA 4MVJA 4RF2A 2XAAA 2ZATA 2DUUA 1PSDA 1JA9A 1WP4A 2IRWA 3ZZNA 4CM4A 1EQUA 1NTOA 5FEUA 4YCAA 2X22A 3Q0EA 3GEDA 1PQPA 3A1NA 1OC2A 2VT2A 2VYNA 4WNCA 4INAA 4NJMA 1ZSYA 4NZ9A 3H6KA 4LSMA 1EUZA 2NLOA 2G0TA 2X23A 1X1TA 3H5NA 4YACA 2UYYA 4BKPA 5BQFA 5HM8A 2VHWA 5COBA 3MWEB 1D8AA 4W7IA 3NT5A 3RC9A 5JS6A 3JQAD 3LVFO 1KC1A 4JBIA 1YJ8A 3C7CB 1D4FA 3MTJA 3QHAA 3AOEC 4I1IA 1GZ3A 3BAZA 4QFDA 4A26A 3WFIA 1GU7A 1PEDA 1DFHA 1QG6A 5FI3A 3TOXA 1MG5A 3C8MA 4ALMA 5ICMA 3VPSA 1GYPA 2AEFA 1D1TA 1VC2A 3PWZA 4NR0A 1YRLA 2J3HA 5KVSA 3GAFA 4JJGA 3D5TA 2WD7A 3L4SO 2AQ8A 4U6SA 4XYMA 5AYVA 2JCXA 3ICCA 4FQ8A 4GX0A 3ZV3A 5I7SA 1HDGO 4CODB 5F1OA 3TZCA 3GQVA 3JQCA 1LSSA 4C4OA 4H16A 2VCYA 4XJSA 3FTPA 2GCGA 2GDZA 1C0IA 5T8KA 3U09A 1P1IA 3EZLA 5T6BA 3VC7A 5JCXA 4TRMA 2FMUA 4KWHA 3TZKA 5CG2A 1NVGA 1HLDA 5KJEA 4GLOA 4W9NC 2A94A 1TI7A 1DIRA 1HKUA 3NEPX 1EBFA 1JQBA 1QSGA 3AI3A 3OJ0A 2C7VA 3IP1A 3UF0A 4Z3KA 4HNGA 4RORA 4HY3A 4WUVA 1U5CA 2CDCA 1DB3A 2UUPA 2R00A 1JAYA 1PJQA 5KVQA 3SVTA 1Q7GA 2PGLA 2DPHA 2IXBA 2XOXA 3LF2A 4TROA 2PZJA 2O2SA 1MC4A 3Q2KA 2EG9A 2PY6A 2CD9A 3ENNA 1ZUD1 4JNKA 4PRKA 1E7WA 1UXKA 3PZRA 3SLKA 4TRJA 3JD2A 2J6IA 4KUHA 3NV9A 4AJPA 1GYQA 4HFMA 3D5QA 1U7HA 3D1LA 1XQ1A 1YDWA 4TSKA
chains in the Genus database with same CATH superfamily
2W00A 4Y9TA 3CXUA 1RZRA 2W2VA 1FB5A 3LHSA 1TQ6A 4PCLA 5JC1A 2E3JA 3ZX5A 5HA5A 4RTNA 1UJ4A 1FS6A 5K3AA 1KI1A 1Y8CA 1ZJ4A 1FMLA 2QX9A 3HA3A 4RGBA 3JYNA 1LSJA 3OMWA 3QPVA 4FCCA 4FEAA 5JANA 1QIIA 2V6GA 4ZICA 1J7KA 1CZRA 2GEBA 3I58A 1KAQA 3G23A 3KUXA 1M0EA 3BQNB 4MA5A 1ZIYA 5B64A 1XZFA 5K0BA 3FCUB 3ZGVA 1H8HA 2GFIA 2PMWB 5IEJA 1E2PA 3KK0A 2IXFA 2QUBA 5CB0A 1N0VC 2ZSAA 4MKZA 1M6VB 4HS4A 2W0SA 1I3CA 5EJMA 5EMLA 2VXOA 4RSGA 3WWCA 1VE7A 2XMGA 1T2NA 1K8YB 1NBIA 2HYDA 1QJCA 3UWDA 2P75A 1YIOA 3QWIA 2BFNA 3DWFA 3HY3A 1U9JA 3N0VA 4TTSA 4L22A 4A8JB 1W73A 3VNQA 4BWGA 1EGHA 1NMZA 2FH5B 2YDYA 4AZ3A 4OMDA 1R15A 3UWOA 2AB0A 4CDMA 2FEXA 4DHWA 5CFZA 3I5UA 5AKGA 5J43A 2I3GA 1RM3A 2QAIA 4LHWA 4YMUA 1EVKA 2HSJA 2NVBA 2PH7A 3HA7A 2DFLA 2UU9B 3STYA 5BN1A 1RC8A 3FNIA 1KZYC 2VHZA 4IEFB 1U5AA 5JZVA 4CBVA 3JQEA 2MSDB 3D0QA 4NV0A 3NTLA 1IY2A 3O8BA 5AHKA 2AFRA 3R6GA 1J8DA 4IDAA 1JHAA 4D9KA 1XV5A 4ENVA 2G7ZA 2HEGA 3C1UA 5DX0A 3SF8B 5BYKA 1KMQA 1MX9A 3AYZB 3UAGA 4CQLB 3HXLA 5CAEA 3NUQA 4KW7A 2ZU0C 3QWAA 1YASA 2BHLA 4TV9F 4ZO4A 2ZUVA 1QG4A 5DHAA 3Q8MA 4BVKA 2HV8A 4CXMA 1J8MF 4EUFA 5D7NA 1IEWA 5FOQA 2ZQZA 4HN4B 3PF9A 3ROPA 4DABA 4LBYA 1FYEA 3BMNA 2WVJA 5LQRA 4FSXA 4YAKA 4B45A 4V0OA 3DE7X 4QUBA 4OH1A 3ZXXA 1AN0A 4EKDA 4IDGA 5CYOA 1EAMA 1F9AA 2GJ9A 3CNHA 3BZUA 3WOVA 2GN2A 1YQGA 3EXEB 1H0KA 3WHKA 2C83A 4X6LA 5LYJF 4RTSA 5FPSA 1YB2A 2WIJA 1MD9A 4FLMA 1C9YA 1WOMA 3LIIA 1IEVA 2FJUA 5CFLA 4X66B 1W5EA 2FEOA 5JYBA 2BTEA 1EFDN 2QD2A 4DXHA 3TPCA 3T9DA 1V9LA 2HK7A 4MGZR 3UK0A 4G01B 3GIWA 1EX6A 2MMCA 2OQ2A 1TVKA 3OJOA 4IY1A 4M55A 4FZVA 4WKGA 3VC2A 3C14C 1DC4A 3W9YA 4BL5A 5K8UA 2W98A 5KU7A 6AT1A 2FPWA 2IE8A 1L9KA 3R5KA 3IJRA 3R3WA 5TGZA 4FIDA 2EQAA 3SE0A 4RK0A 2A58A 2EGGA 2P6UA 1L0BA 4MYHA 4PNHA 2VP0A 2XNDD 2YIDA 4N54A 2QQGA 3U81A 4RPHA 1Q0QA 4AVYA 2RBGA 2HHJA 5EE3A 1IY0A 3OT4A 3LUJA 3ER6A 5CLQA 2VZ9A 3B7PA 5DW0A 3C8UA 1QE3A 2E37A 3I52A 2WFAA 1AK9A 4HYYA 1XCPA 1EX9A 2G76A 3HKCB 1G1MA 3KYCB 4R8MA 1ZD8A 2BP7B 3P7MA 5ITVA 3BZBA 1G3IA 1Y1TA 2FPPA 2ZRGA 4X0EA 2G0AA 4X8OA 1TE2A 5FTWA 4P3PA 4Y2VA 4H3KB 4KP7A 2D5LA 1N6PA 2YWXA 4INZA 5B58T 1BGWA 2ZTHA 4IUDS 4OSEA 2B7BA 4R2WA 4Y8VA 1S2OA 3A6PC 4DQLA 1L5KA 4EY6A 2IBTA 2ZCUA 1WSDA 1HMPA 3ZKWB 3FPCA 1N7HA 3QEMB 4LKRA 5CJPA 5GZ6A 4A0QA 1DNPA 4C03A 3AG6A 5ICCA 3LDUA 4ZTBA 4Q9NA 4WLVA 3HVKA 5KWSA 1GLNA 2RGWA 4ECEA 1I4WA 2JLUA 4NC9A 2WAMA 5LDHA 4YJGA 2DR3A 1THTA 4Z9BA 2NXEA 3U6KA 3CFYA 2EBWA 1S96A 3IP6A 2OXIA 3WV5A 1MG0A 1G2PA 3UCEA 2V9ZA 3L41A 3CLHA 4RD3A 4MI1A 5HG0A 1NWCA 2XNJA 1ZK3A 3G9QA 1W4BA 1KY4A 3OZEA 4JB0A 1E96A 4P3OA 1CUDA 1KBZA 3G1UA 2FQXA 3EQ9A 1OX4B 2ZIXB 1OB2A 4B40A 1U7UA 1VM6A 1VKOA 2VDNB 5JO9A 2DKNA 3VO9A 2OT3B 4H4EA 3LX8A 2PLAA 3I12A 4O02B 4YJ2F 3BS4A 1GTSA 3WI7A 5TRTA 3LQRA 2F59A 2OA0A 1LBIA 3TFOA 3HKCA 1N7IA 2ZYWX 3QELA 3DDNA 2WB2A 3LWBA 1GVNB 4OLJA 5E8RA 4DA6A 5H4GA 2MHCA 3M6MD 1CUCA 3UPDA 4UXIA 4P84A 5IKXA 2ZI9A 3IEPA 1P72A 3JQ8A 4L4ZA 3CE9A 4JU8A 2BSQA 4JB8A 4RO0A 2CZCA 3ZZTA 2PJDA 2XZDA 3R7NA 3IPRA 1J4AA 3U3DA 3K9FC 4J4TA 4JS0A 5BNZA 1MEJA 1D2NA 2EF1A 2JIBA 2VRCD 5EJFA 1Z38A 4ZVRA 4Q3EA 4F97A 5JCZA 5L4NA 1T3HA 1X7WA 2VT6A 1XRPA 2OUIA 3OAAA 5G40A 5JNLA 1GGVA 4EDFA 3OT1B 3PI7A 1BJKA 3QMVA 2V1XA 4QNMA 4TLBA 3VV3A 5B4UA 4DGQA 2PS3A 1U7OA 5KUTA 1TIKA 1YZGA 3PGKA 1T35A 5DEIA 5CNIA 1P1KA 1OF1A 2NSLA 3B12A 2WLSA 4OO3A 4ZQEA 3BG5A 3JATB 1JJAA 1M0WA 3KD2A 3SP1A 1UJMA 3X2FA 3CMMA 4MUBA 4L15A 4CM5A 2C0QA 1HK7A 5BNWA 3MERA 3AKCA 4WNYA 4MW2A 1HF3A 2YWFA 3OC6A 8OHMA 1EFHA 1KMCA 1JIVA 5JASA 2C0CA 2TMDA 3QVJA 4AN0A 3L4BA 2IIBA 1CUUA 1LQ2A 2ID9A 4D5GA 2WM8A 4LV6A 5EJGA 3STHA 1ZW1A 3FCYA 3T15A 3JAMA 4FWIB 3CLVA 4BIIA 5FUQA 4XCXA 2C4VA 2RHRA 5JTTA 5TEWA 5A04A 1N1DA 4JJFA 1E4EB 1RYDA 4MLPA 4UMVA 3L8CA 3WYGA 1TLTA 3NXKA 1PWXA 1UMCB 2FWJA 2X8AA 4KTVE 3TQFA 1EJBA 4X6XA 2WTUA 4S1VA 3ASZA 5C8YF 2Y93A 3PFNA 2GB4A 4CKYA 3LQYA 2IPOA 2CLKB 2ZEJA 2V7XA 4JLDA 2PQ6A 3FNFA 1W76A 3AB8A 4PBTA 2EJVA 2Y2VA 1EYZA 2BGRA 3KJXA 2BONA 4IDHA 3FJOA 2HAEA 2OOSA 2VR1A 4HTFB 4J1QA 1XYYA 3TQOA 1FDSA 4MA4A 4OKSA 1F9EA 3I6ZA 1U3VA 3G0BA 2QTMA 1F4VA 2F9FA 1WCIA 4NV3A 4DQKA 1X80B 2BEVA 4N0DA 1KDTA 3RAGA 1JJ7A 1ZSNA 3R76A 2X0EA 5KS2A 4QASA 5BT8A 1LFDB 1KETA 3MSXA 4N03A 2PAFA 2WU4A 3ENKA 3IYLW 2AMYA 5FB3A 4IICA 2HDNB 1T15A 4RMGA 3SKVA 3VJKA 3STVA 4CCYA 3ZGZA 4PAMA 2QQEA 4B9EA 2VLBA 3MYRA 5AVTA 1R0BA 1G7CA 3E9CA 4LNAA 2QBYB 3QKWA 3MAGA 3CKMA 2QK4A 3OEHA 2G4CA 2J08A 4BVFA 1SEVA 4H6VA 4JYCA 4TV8B 1MF7A 4F5EA 3BMOB 2BH9A 3DOIA 3LH5A 4UMFA 1DP4A 2VNKA 2W8BB 3LQQA 5HDBB 2QVXX 1MQ9A 4QE3A 2ZVJA 3AKDA 3K8YA 5AK4A 3CVVA 1G7TA 1GWNA 1VCMA 4IH9A 3R7WA 5FPHA 1D2MA 4FC7A 5C4GB 3T1NA 2WIBA 1IY9A 3GHHA 3M1YA 3AF6A 2VF5X 1NR7A 5EGSA 4Q3LA 3NHSA 3D02A 4EYQA 5DWQA 1TAHA 1WV0A 3WTBA 3IXLA 4JA0A 2G71A 4V1CI 4EFLA 4OOEA 5JD5A 1PUJA 3INNA 2G7MC 5A03A 3A3YA 4P5PA 5BUCA 3NB0A 2X9LA 1LDNA 3IAM1 1WRBA 1IONA 1QGDA 4NCNA 2C1EA 5IKOA 2PGDA 4F84A 4RLHA 4ZP1A 4F9TA 3KE8A 3T9EA 2FDCA 2TS1A 5ILOA 2GCEA 1SCJA 2ONJA 2PE5A 4D3FA 2QR3A 2H3HA 1ZD4A 4XTRA 3SFVA 4PC6A 3TB4A 3UFXA 2ZRLA 1B6GA 5BSWA 1OWMA 5FBVB 5ALJA 2D8MA 3DO5A 4BFWA 4YT4A 3KQQA 2BSAA 3PL1A 1IM5A 2G8LA 3V4LA 2D0PB 1BS9A 4PX2A 1LXCA 5CB8A 4I1PA 1I4LD 4M1YA 1VE9A 2HJ9A 4J7CA 4QLBA 3UPTA 1J1ZA 1YDFA 1Z4PX 3QNUA 3M6IA 4OB6A 3W4JA 5JBIA 1Z2AA 5BV1A 1XZPA 5E8JA 3C1AA 4JP2A 4ONEA 3RWBA 3FWHA 3AEZA 1F4PA 3LY8A 4I9NA 2J4CA 4TPKA 4YFYA 3GUZA 3I4LA 3CWQA 1YZFA 2X4LA 1PBTA 3GLUA 4NZYA 4RZ2A 3D3EA 5JH7A 1DQZA 1RRGA 2GUWA 1IHDA 3B48A 1SMKA 2C0PA 1C80A 3LOQA 3MXOA 1OC4A 1E1QA 5C1IA 3W2TA 5KQGA 3OD5A 1M1YB 1ZEMA 4RSRA 3R9WA 5JECA 3NGMA 2WWGA 1T4DA 1XJCA 3C98A 1OBHA 1QOQB 3LCUA 2E5LB 2WJGA 1EFCA 1TYAE 4GXQA 1IWBB 1DRJA 2TRSB 5FHRA 4RDCA 2YV1A 4OSOA 1JPVA 4M1SA 3ACBA 2G08A 2V7BA 4LC9A 2A57A 3PDHA 3GUUA 1USWA 2APJA 2ODWA 3ACCA 3RO7A 3SYKA 4US2R 1WXFA 3OQOA 3IP3A 2JVJA 2QVLA 2P7HA 4KO8A 1KP2A 3D7KA 5LB2A 2Z6QA 4G09A 1I6LA 3RW9A 1NXVA 2IQIA 4C05A 1S3SA 2Y0DA 3ENVA 4FB5A 2ECFA 2OD7A 3LC1O 5ELMA 3E6AA 2ZWVA 3WSWA 3KOMA 4QODA 2H57A 1RYNA 2R6AA 3RV4A 3EBPA 2GD1O 1DGQA 3DEAA 3R6DA 2MYTA 3WNDA 1KS2A 3UJ6A 1VGQA 3KVNA 4F8YA 1VMDA 3SZOA 4KTTE 4TRNA 5D86A 1LRKA 1HH4A 1M76A 1U3FA 1XF1A 3IULA 3DEYX 2AJDA 3LRTA 4GVPA 3CE6A 3M89A 4RS3A 3QI7A 4MV3A 2IYQA 1KKLA 3WGIA 1ECJA 3IGFA 2JANA 3RVQA 4A7PA 3KLOA 1X8XA 2YWHA 4S05A 4JUBA 4IIJA 4TVKA 1I6KA 1OLXA 3EW9A 3O26A 5FWDA 4ZEXA 1CC1S 1XGKA 3F9IA 4NABA 4H7JA 4CQMB 3IAXA 2VHTA 1USIA 3HEAA 3M1LA 5MN4A 1STOA 2RI1A 2CFCA 3E23A 2YXBA 1P2TA 2ZJ7A 3B2EA 2GK6A 4DCNA 1ZOSA 2J46A 4Z4EA 4BQSA 1UPTA 3DV2A 1JG2A 1K5GA 3P4UA 5ECGC 4E6EA 4G0UA 5EXDA 2IV3A 1V45E 1AOXA 4MQUA 5ILGA 3ZGOA 2R7AA 4YRNA 2VXBA 3AUAA 2ZYVX 4X90A 1UZAA 6NULA 2GXQA 1NYQA 1R4AA 1QZ3A 2VUUA 3NHPA 5A5GA 3UBTA 4IUCS 4AS2A 5I48A 2AQKA 4X7BA 1NIJA 3VKUA 1OFHA 2B30A 1CQJB 2QOEA 2HF7A 1JDSA 3U3OA 1JE1A 5HKKA 4DV0B 2GBLA 1IUOA 2HU2A 2YFQA 4MVJE 4EAQA 5KOJB 3AXSA 4FMCF 3GRKA 4URZR 3N5KA 5ER6A 2VDUE 2H5JA 3NTOA 3FZNA 1XTUA 3JTMA 4WXHA 1L4KA 3FSEA 2F3SA 3ZHZA 4DA0A 5FBQB 1E94E 3SG0A 4MVJH 5J40A 2IIPA 3BCSA 1CQJA 2IYZA 4KLRA 1YR6A 1KZ4A 4MEJA 1GLGA 4OP3A 4PIMA 4WT7A 5LM3A 1ORHA 4D79A 4JI2B 4QC2A 5JXJA 4RZSA 4YDRA 1T0IA 4PLHA 2J9ZB 3C3YA 3DTTA 3UXEA 3PVZA 3C43A 1OU4A 4M1KA 5EP3A 4UHHA 3BERA 3H1GA 1E1QD 1KOJA 1X7ZA 4FS8A 1JR3A 2CJWB 2GNAA 4J0EA 4PZZA 4WX2B 5ALYA 3IUPA 4BFLA 2CNKA 4P2GA 4XPIA 1F8XA 1GTJ1 4IL5A 4EPWA 5AVUA 3IOBA 1BWSA 1N2CA 1HFEL 2PWZA 2VTKA 3HDGA 3QVGA 4FZ5A 5KTRA 4CGZA 1GZDA 2YRFA 4BU1A 2W2XA 5EHXA 2GJ8A 1MDFA 3NRCA 4MYTA 1GGEA 2OSBA 4GICA 1RC1A 4UM9D 4YB8A 2H5LA 1IJKA 5FUWA 1U0LA 4IOLA 3E81A 4GOXA 3GGGA 1I01A 2FMIA 1WS6A 2ETXA 4UBLA 3WQBA 1B0ZA 3X1KA 1Q0RA 1Z6YA 2XCRB 5H3HA 4RV5A 4PX9A 1C2YA 5BWBA 2PBZA 2PUFA 1IUPA 3HWSA 3GWGA 3X0DA 4JLPA 1O08A 1DHRA 4RVFA 3S27A 1K9SA 4XQ0A 4DEVA 4YLEA 2RDMA 3J81A 2PJRA 3L7KA 4AJLA 4JV5B 2Y9MB 1JSRA 3Q8KA 4IH1A 4DA7A 3V33A 1W9HA 3DULA 2BPOA 3C3EA 5IAGA 1WDMA 2HSWA 4GPBA 4GDMA 4ROTA 4DPMA 1AMUA 1NRXA 2P77A 5AW0A 3AC0A 1FY2A 3PCRB 4PLYA 3QLVC 4FEGA 3R24A 4BNIA 5A4KA 5A7FA 3WX0A 5G0SA 1I10A 4W9NA 1XVTA 2IP1A 3TSCA 3UUFA 3ZQUA 2Y0BA 3UHPA 1NRIA 1G8GA 1NLMA 3MCVA 3OZGA 4QYMA 3B53X 1ODCA 1XTSA 3ECSA 3LMKA 2PTGA 1LRLA 2VK4A 1L5YA 4XJTA 1ONBA 2FB9A 9ABPA 1YNOA 2PG3A 4D9GA 3H13A 2PL5A 5LJIA 2R79A 4XFJA 3GFBA 1QQTA 2DWOA 1D2RA 2CFTA 3RK4A 5A3QA 5MHTA 1GHTA 3DP7A 4ZAGA 3UH1A 2GAJA 3UWKA 3EIFA 5JSFA 3VGJA 2M32A 2ZG6A 3ME5A 1SCBA 4P33A 4PFKA 5EWLB 1TJYA 3M83A 3T4UA 2DX7A 4BTLA 3SS8A 1KYXA 4HB0A 3PFIA 2E9SA 3H1FA 3GYGA 2PQ0A 5EMMA 3DXXA 3HFRA 3QMWA 2NSYA 2Y1KA 4FGZA 3AGQA 5E1MA 2MR6A 4LZLA 2PZLA 3KETA 2Y2UA 2X8BA 4X60A 3VI4B 4MPTA 2ACKA 1H2WA 1RRPA 1ZC3A 2H07A 3EQ7A 3NUGA 2WMYA 4RD4A 4BECA 1I24A 5J1TB 2MSKA 4HYEA 3VX4A 5JCJD 3S8EA 1Z0SA 3V6LA 5KSWB 4Q1CA 3DWEX 1NIPA 1PTJC 3G2MA 4MX8A 2ZSFA 5DWDA 1R66A 4YONB 3DM9B 1KI7A 4WFQA 3ZS8A 5IKPA 1GQ2A 4MITA 4MVCA 3G89A 4FDVA 3RDPA 3W5HA 3ZV7A 4XWWA 1NA5A 1MPXA 2YVUA 5EMKA 4ZOCA 4DNQA 1HMYA 1L7AA 1RQ7A 2WQZA 3W5AA 5JV5A 3MVEA 4UM5A 1ZUHA 3DFKA 4HX2A 4J4HA 4L4UA 3MPOA 1QH9A 4ZVSA 4L0QA 1SCQA 1XT6A 2NYAA 2XWJI 3R8CA 3RVBA 3ZIDA 4KRFA 2OBNA 2BRUA 5DHUA 3DEHA 5TQ2A 1X7XA 5IVDA 1E2QA 4FXPA 3DBOB 6PFKA 2IY8A 3PPWA 4LAFA 3BB3A 2AJCA 2JKYA 4QQRA 3NAMA 4LUCA 4MI3A 4DBVO 1XHLA 5D01A 1G3QA 2C2BA 1AHIA 1EDDA 3GJ6A 3Q7PA 3VZPA 2NP6A 2HSZA 1B14A 1TJ5A 4QUKA 5HF9A 4XWOA 1V2HE 4U6QA 1BXRB 2W83A 4C22A 2RAVA 3NPAA 4TMWA 1PWYE 1DDOA 2R1UA 5G1OA 1J24A 1ZRHA 1XD9A 1UJ5A 1DHTA 2YW9A 4LRSB 5DYWA 4EO9A 4YMHA 2G72A 4MV9A 2AUNA 4FM9A 5A6SA 2HRDA 4EY7A 1GQFA 4M7WA 2DM6A 3S2EA 1T2AA 3KQKA 5CT4A 3TDNA 3H9JA 2ZPAA 4JOBA 4RYLA 1TVMA 2CLSA 3EIEA 3FNRA 4IMRA 3OP4A 4J4BA 4N82A 1Y7HA 3ZYZA 2OAGA 3IUEA 1KYIA 3GGDA 3JALA 5JJCA 2JLAA 1SFRA 3V4VB 2YYSA 3K7EA 2BFMA 1ESCA 1YONA 4YRIA 1N1EA 4I4LA 2JA2A 3W8FA 4UHJA 1K7XB 2IL1A 2JFGA 3O83A 4X9XA 2QLTA 3RVOA 4YC7A 3CLSC 3HG7A 1YJCA 1XMSA 2BI7A 4IPTA 1E2FA 1RJEA 5EKDA 1GRNA 2I1WA 5A6VA 3UNXA 1SVSA 3M70A 1XPJA 1QV6A 2ZPTX 3P0FA 1BKYA 3CLTD 4HDQB 3RRNA 3WGTA 4I1VA 2JAXA 2Q49A 3L6EA 5K4AA 4WOCA 4CIVA 5KDDA 2DETA 2O0HA 2XTNA 1E2DA 2D5AA 2X2FA 1KC3A 4GSLA 4CHTA 1SPBS 2Q3CA 2PO7A 2WA1A 4GBMA 4P86A 2QNIA 3JR3A 2UUBB 4GKVA 1PR4A 4KOAA 4BC0A 1M1XB 1S2IA 3IKLA 3T8YA 1GPUA 1RVV1 4B4OA 5HKLA 1LTKA 1OD6A 2DPXA 1SBIA 3KSDO 4MAFA 5H80A 1SZJG 3T5AA 4XGRA 3M5PA 4INPA 3ZZMA 1VSQA 3RUIA 1NJFA 4BN0A 1Q21A 2F8MA 1Z83A 1GD1O 3B9QA 1H5QA 1E9FA 1R6BX 3CJQA 3DTVA 1AA9A 2PVPA 2FOLA 2B36A 2OD2A 3LGAA 2OLKA 4LNUA 4DANA 3ZTYA 5B4TA 4YIHA 2O14A 2OCXA 1VJGA 4NAUA 4OVKA 1OA1A 1EVJA 3L46A 5CLGA 4K6OA 3S70A 2ZRPA 3GN1A 2CNWA 3DNFA 2XBMA 1H4SA 3WK8A 1P62B 4QFCA 2R5WA 4D41A 2AXPA 1V8PA 4DWVA 2GM3A 4TTVA 4UHKA 4FKZA 5FBZA 3TRIA 4AZ3B 1EDZA 2CDRA 3IKVA 3E2PA 4MRMA 1XVAA 3I28A 4QL3A 1YZQA 2XMDA 1N6LA 5BN3A 3FYSA 2IHYA 4B35A 4BGDA 1M66A 3GJTA 3NYIA 4GMKA 4UE6A 3V80A 2IY9A 1AQNA 3ZWBA 4KR7A 1EA5A 4QWMA 1DBRA 1MO5A 2O2DA 1Z9BA 3EXEA 3SSMA 4K0KB 4LYDA 5EHQA 3TH5A 3OU6A 4RELA 1DQRA 4QG3A 2YWBA 2RHCA 1QB7A 2W2TA 2ZIWB 3PEVA 1OLUA 2HMSA 4MW5A 5CNMA 2IF0A 5ITZA 1XQWA 1CRWG 2WYWA 1ZCAA 1DAIA 3I4CA 4CM9A 1EFRD 4TTPA 5I7OA 1VB5A 5EXSA 3C6MA 3F6YA 5EJ9A 1UAGA 2WHPA 3HPRA 3KYDA 2GCPA 2C31A 5EIFA 2YOFA 5KYYB 4Z3OA 4N0PA 4R05A 1NVMB 3EZXA 4M49A 4X54A 3WFZA 4DIKA 5KQRA 2VC2B 3H9BA 1L6RA 1QRUA 1JDVA 4HAOA 1BKDR 5TS2A 3BMXA 3DE6X 4L5AA 3TR5A 1O96B 1HDOA 4OQPA 2ERXA 5HBRA 2B78A 7ADHA 3WWZA 1ACLA 4PR0A 3L02A 4TTJA 3GAMA 1IZ0A 4BLWA 1ZEJA 4JK3A 4N12A 2WG2A 5BVHA 2FK7A 3U9LA 4ZI7B 3RS4A 1M8KA 2HWKA 3QPCA 4GF5A 2PKQO 2JZCA 3QXJA 1AGNA 3RODA 4D25A 4EGCB 1O9BA 1Y9AA 4K8OA 1B74A 1L4NA 4PIPA 2B35A 4GT1A 3ZZUA 4DTIA 2RCNA 5HWSA 2J0QA 4WFKA 4CGYA 3ND5A 2VS1A 4Z4CA 1AE1A 1FTGA 1NNSA 2IIQA 4MZXA 3TBHA 4E31A 3H2GA 4F8EA 1HDYA 3F98A 2ZUFA 1AF7A 3AF2A 3H87A 4X92A 3KVVA 1YK0A 2FX2A 2R7LA 3PQ3A 4KFUA 5A06A 3BB4A 2F2TA 1UK9A 2Y1LA 3RYIA 3TOXA 3W34A 2QE7A 1BXKA 1MAWA 3QQ5A 2YINC 2WJVA 3JQ9C 3W5VA 2C5SA 3FNBA 1PHPA 2OHGA 5GZ1A 4UKDA 3AONB 3ELWA 1TXGA 3DNMA 4Z49A 3EA5A 1RM5A 3MT9A 4AB1A 4U3JB 3CR8A 1ZX1A 3KYDB 4E5UA 3R4CA 3AERB 2QRHA 1L5LA 1OH7A 1KARA 2O8EB 4DCVA 3NORA 3KQVA 5FTNA 3OG9A 3DYVA 5ALLA 2HNKA 1B8VA 1X87A 2J7PD 3TGLA 3HL0A 3Q5DA 5LFAA 1L1EA 3QLVA 4HNSA 1Y42X 3WC4A 4FHDA 2OFFA 1QZUA 1TQ4A 3E15A 2ZUCA 1QIMA 3NTUA 2C2XA 4HFNA 1F12A 4MJ3A 5E9WA 2M6KA 4QBGB 1GRQA 3JQAA 4RH1A 1GL6A 4WQMA 3ZDEA 2Q45A 2J7PA 2L19A 4ISCA 4MS1A 2BOVA 1LV8A 3PA8A 4GI1A 4QECA 1QANA 2NX2A 2FFQA 5GGXA 2ZP1A 1I80A 3T5TA 2VHCA 4COKA 3LBYA 1R88A 1WD7A 2C3MA 4JL8A 3LJKA 1FSFA 4EVSA 2ZDGA 4MMZB 5FAXA 4LPSA 2Q7OE 3D4PA 3DZ8A 1F0KA 4XR4A 1NKSA 1L5HB 2VZEA 4DJAA 3S1LA 1QCCA 2KMLA 2Z1DA 2VHEA 2DPGA 3C6XA 2OV1A 1VDZA 4PGMA 3D3KA 1S2GA 1AGXA 1QU2A 2FOXA 5ARBA 1S9HA 1GT91 2Y1OA 3ESBA 3FI0A 4NMXB 4EJMA 2G9UA 5BSGA 4RACA 5LP6A 3G2HA 4INJA 3CO0S 1SUEA 2OR3A 4I9FA 2XGMA 3TLYA 3U39A 4BYMA 2FJPA 3K1AB 3TCKA 2HWXA 2BHNA 2PX2A 1QPBA 2A9RA 4Z7JA 2M6SA 1CDZA 3KZNA 2YC2C 4WNIA 1J39A 1L8AA 1OTXA 4CKZA 2BUBA 4FUTA 1H2AS 4NCHA 5H70A 2CJFA 3UPUA 2Q21A 3ABSB 1DLIA 5ALDA 3HFSA 4XQEA 3TAHA 2LV8A 3EPLA 4YJDA 1PJZA 3OMLA 3F1KA 3GJ3A 3NC1C 4D97A 2ZE6A 1NVEA 1TEHA 4F38A 1E66A 4HLUC 1GFSA 5G4LA 1SM4A 2Y1WA 2R44A 4YAIA 5C4MA 5C5DA 4CMCA 3OPNA 1W0KA 2DP4E 2V7QA 1FNCA 2F43A 2DQSA 5MFZA 3AY3A 4Q5IA 2B21A 1FBNA 5EJEA 4OCZA 4PPGA 1BW9A 3KSZO 4MV1A 1KJQA 2O2IA 2L82A 4O8CA 1QH8B 1CR2A 1NKTA 1DAOA 2Q4RA 2E0IA 1NVDA 3QH4A 5D00A 2A5GA 5FUXA 2BFFA 3QVUA 3UMSA 1CY8A 3UK1A 3ZDXB 2QJWA 5KQMA 4NOKA 1A1VA 3CNNA 2DR2A 4FU0A 4N3GA 3N2GB 4P32A 5AI9A 1CUXA 3WDLA 1NVWQ 2CEKA 4EA6A 5JJBA 5DK6A 1AUQA 3BE5A 1G55A 3RIHA 1W0KD 3SZRA 2D1TA 2P65A 2XE6A 4I08A 3S1AA 3DMYA 1SN7A 3K5PA 4JT2A 2A86A 3H42B 2MDTA 1N36B 5I9MA 3NNNA 3NHMA 3RC2A 2P6RA 1H1LA 4UZEA 5I7AA 3AL0C 3EGVA 3O0TA 4BP1A 4HT3B 5HUJA 1A9OA 4N6NA 3VZSA 1X8JA 4JWTA 4XE5A 1I30A 1W34A 3QVWA 3DC7A 3F78A 4KJZA 3K9NA 4JODA 1JTVA 4UHFA 1LI7A 4XYGA 4MQ5A 4RJTA 3JPWA 5G3YA 3EZYA 3KEFA 2W7TA 3KEOA 3O4FA 4FBMA 4G5SA 4Y2TA 4DDHA 2QR2A 3BWEA 7ABPA 1APBA 4TUYB 2NUPB 3T3HA 1VBNA 1CQPA 4OYRA 3IAFA 5HF5A 5ALWA 4AXBA 4D3XA 3ZXUB 1ODTC 1O0BA 2QEQA 3NBZC 5F76A 1CS0A 3PHBE 4D8WA 4EY4A 3LO5A 5CXQA 1ZI8A 1MXHA 5LOVA 2X4IA 2Z5FA 1HFWA 3NETA 2PJZA 4K87A 3T7EA 5AVQA 1EWVA 2GASA 1NP7A 1BH2A 3F71A 2M1XA 3CX4A 2MYUA 4J49A 1PX2A 5DW3A 2OQRA 3OE7D 4HXYA 4B5KA 3N9IA 1AKEA 1A7UA 2I4OA 3PHJA 4NE9A 4O4IB 4LFCB 2AH5A 5JNWA 5KVCA 2W58A 2OV4A 1JG7A 4ZV7A 3IKTA 5ALHA 1YUBA 1Z36A 2IYYA 2JJQA 4HHEA 1NP3A 3U37A 4BNMA 5JWOA 2QX6A 1UQUA 3LPLA 4FONA 4G4JA 5AKJA 3U9SA 2AFHB 3CUVA 3EBLA 1WXXA 3LXRA 1HTTA 4NH4A 4P34A 3I9JA 3JWGA 5AJYA 1DAMA 4NHOA 1E6MA 3I5XA 2YJNA 3ZV4A 3UGQA 1U11A 3GVHA 4TWBA 1OMOA 1QG0A 4DXAA 4MJXA 3PXBA 1RPZA 1IXRC 1CR0A 2BKEA 1BWQA 2GILA 3AO0B 1VPLA 3C87A 4L3WA 3WKAA 5BYAA 3MCUA 4AIRA 1I4TD 4MWCA 5IM4A 1FE8A 1Q44A 4PXAA 1T29A 4MLDA 4KC0A 3UJHA 4KH1A 2FWBA 2J09A 1ZN9A 2G67A 3HRKA 4BQOA 5IJZA 4OXKA 2R97A 3PNVA 2IEAA 5CBPB 1WCYA 2Y4OA 4K0RA 1P91A 5DN6A 3W4KA 4P80A 4NBLA 4R98A 3HB5X 1HQKA 2NU7B 5I51A 3MB5A 1KF0A 4FJ2A 3DFFA 3NM5A 4YQEA 4MDYA 1VA4A 3U19A 4BNVA 3I2KA 2P79A 2HA6A 1N3LA 3EIHA 1H2YA 4QQNA 1QQAA 2ZKLA 1Z6QA 3UT0A 1P8AA 5FOSA 4EOGA 5DXAA 4Y6QA 1T0HB 4ETWA 3HJRA 1QK5A 4IXTA 1T5IA 3DCNA 3WKDA 4EHFA 3D3WB 3S8YA 1E9BA 2VBCA 3IA7A 4YJFA 2C5LA 1Z7BA 4K26A 3A4YA 2FW0A 4KACA 4M89A 2B7LA 4M9SA 4MS3A 3W1VA 1CY6A 2K7ZA 4LVCA 3B3GA 3WYDA 1UOOA 2N42A 2VYVA 5JQWA 3OJEA 4BBZA 1SD1A 1S3GA 3LVRE 1IXZA 4YCSA 3M9XA 3U44A 3U7FB 1HLGA 2VF4X 1NBAA 1L4GA 3PGJA 3H2BA 4YH1A 1A7AA 4EHNA 4DGSA 2WZBA 2WP0A 4JYBA 5LNK6 1U63A 1RHUA 3IAAA 1VDMA 4MS3B 4JI8B 1HNXB 1XLUA 3SEAA 4DSNA 5ALEA 3O47A 4R41A 4ACBA 1KKMA 1PGPA 4BMNA 4QAQA 3EZ2A 1Y81A 4L6IA 4Y2UA 1XEXA 3ZCQA 4YXFA 3CNOA 3MTGA 4YRGA 3QXCA 3TQSA 4BBJA 1NBEA 1CDOA 3CUEF 3GFPA 2YXLA 3WMXA 4B6JA 5KKCA 3OD1A 2ZSEA 2ZS7A 3CSSA 4N6GA 3TO5A 5CM8B 5CDHA 5KSYA 2NACA 2X4GA 1RKUA 4OP2A 5JUWA 1Y7LA 1CFJA 1GFIA 3DE5X 2P69A 5D5QA 3G2PA 2B7CA 5EUBA 3EVAA 4DM3A 3BRWA 4EW3A 1JHUA 2GLTA 2AXEA 4HUJA 4B4VA 1RYEA 3GDGA 4UDYX 4AZWA 2ODTX 1G2QA 3OZDA 4CTNA 3PIIA 2AZXA 1ONSA 2PBLA 4RDXA 1OJLA 3E9MA 2FZCA 1VIYA 4D8YA 3N1UA 4GECA 3OX1A 4NZMA 1NXQA 3NI2A 3ZWCA 1SC6A 5IMSA 2J0EA 3A1FA 3SC6A 3BWVA 1O6CA 1WDTA 3RFTA 4AJKA 4YP6A 5BNFA 3P9YA 3E9QA 1BSVA 4MVYA 1JLSA 2I4NA 4CWAA 3RKRA 2CVOA 1WZ2A 1VQ1A 3J80A 3SNKA 1N2EA 4PV7A 4TLEA 2V6IA 3C7AA 3O94A 4ML3A 5C8DA 1RBMA 2GAOA 4B4UA 1TZKA 5JDCC 2B1JA 2Z2YA 1R8XA 4OIMA 3R7SA 5L7TA 2AUMA 5CX4A 3GJ4A 2REQB 4H9GA 1RWPA 1DDIA 1LC0A 1RKVA 1QAMA 2BFWA 2QLLA 2WYUA 3CONA 4RZUA 4HRVA 1G21E 1V16B 4Q1BA 1X38A 3E05A 3PICA 2EYUA 2Q1SA 4XW2A 2GKGA 4EHAA 4R9SA 5HIAA 1QHHB 5ALFA 1V37A 3TCNA 1QRRA 4PHCA 1NNUA 3N0RA 2FZVA 3LDAA 1REQA 3VU0A 3FDIA 3CPJB 4L5YA 4FFBA 2YFKA 4BGEA 2J0VA 1FDOA 2HA2A 1U7XA 3KZVA 1WBDA 3CB2A 5E1DA 2OORA 3WLTA 1WW3A 3NJRA 1MNQA 4Q9DA 4S1PA 3PDWA 1ORDA 3K73O 3KDAA 4HRXA 4M6WA 4ER3A 3OHSX 4IKEA 3F1LA 2C3UA 5DI3A 3UK7A 4LX0A 5AKXA 4BCDA 4DARA 3K0CC 3HJUA 5IXYA 2WF6A 3O3OB 5LXTF 4LZWA 5LP6C 5D3ZA 2IV2X 3E2MA 1V3VA 3RLFA 5H16A 1I3KA 4UMDA 4PGAA 3T7JA 3JV7A 3TX6A 2I2WA 2EAUA 3K16A 4HLDA 4KLZA 3WLSA 1KPGA 3KWJA 4NONA 2WC1A 4CG2A 4GX2A 3SC4A 2PLFA 2OEPA 4C0HA 2K87A 2W4MA 1NYLA 1KO7A 2A5FA 4KRYA 3IQZA 2FN9A 3AP1A 3JD3A 5IWAB 4FC6A 1YOVB 3AW8A 4BTEA 1GAXA 3KFVA 2PR7A 1CVIA 4NFHA 5BXYA 2EP5A 3GN2A 2WYHA 1URPA 1W6UA 4MINA 5BQOA 3X1YA 2AHRA 4UAVA 1RJDA 1UXJA 2IYAA 1EE9A 2V3WA 2B8TA 1NATA 2BY4A 2CMFA 1JKJB 3BL6A 4OG2A 2HRQA 3KHKA 3DEZA 3ZQ4A 4ZGBA 1ZM9A 2QG6A 3GD7A 5GIPE 3FVTA 4H35A 4AJJA 2GGSA 4GC9A 3W2EA 5LKRA 3CR7A 2OYCA 3C39A 1MTZA 1Z18A 1RYBA 3LFUA 1R4MB 5AM5A 5BN5B 1QG2A 4RJJA 5CDFA 2OSVA 3ZQKA 1KQFA 2JLVA 1E5VA 1NN5A 3BD7A 3O8CA 1XPOA 4H0NA 3EMVA 3MT7A 1RHRA 4NWIA 5EQJB 3L07A 4CL8A 2JHPA 1M2JA 5LNK1 3U4MA 2FOIA 1UMBA 4NZOA 4PZ9A 1ZIPA 2HIHA 3D54D 3VYUB 1WPQA 2OOKA 4F9EA 4IIYA 4CFZA 2EBHX 4TV8F 4KE8A 4QVGA 1G7SA 2B1GA 2FCAA 1COWD 5DTJA 4UNRA 5YASA 2HQ1A 3GVIA 5EZYB 2RGYA 3HNOA 4G24A 2RHTA 2QRKA 4JOQA 3ML1A 2WAXA 3LPCA 4XIGS 1GDTA 4GEGA 1NOIA 2PLNA 4HB3A 5FPYA 3WMWA 3D8SA 3ORHA 3QFHA 3FMVA 3OX4A 1S0UA 4JT8A 2L2QA 5AO9A 5TQ0A 4R8VA 3WYBA 5HTKA 4EF4A 1Z13A 1U9CA 1P9LA 4MUMA 4PX3A 2HD4A 3VDNB 1AK1A 4B1FA 2NG1A 3PLAE 2ZIEA 1Y89A 1A97A 3MS2A 4LCEA 3SGLA 4HUQB 4JKYA 2XXBA 1DC7A 3FIUA 5F9FA 3K6KA 3COJA 1ADJA 1JKJA 2O5VA 3I37X 3NBXX 2X5JO 3EGDA 4MQ6A 2TYSB 4LXYA 5CVDA 4KFRA 2OHVA 3QHPA 3PQFA 4WAUA 1CERA 1I7NA 1ZGHA 4ZCSA 3GOHA 2VFAA 1IVSA 3LLCA 3D6HA 1Q1ZA 4L27A 4UOZA 3W78A 3PUJA 5L7WA 1J23A 2QHXA 3OHMA 1ZOOA 2O8BA 2WF9A 1M6EX 2NSHA 2OXFA 2G9RA 3GZTB 3WO1A 3RSGA 4OBEA 5IW8A 3WK9A 2DY1A 1H6CA 1T4GA 4DEXA 4RADA 2EFCB 4AY2A 4UEKA 3I2IA 4TYMA 1V0JA 4W5WA 1YZUA 4W9RA 2GQ0A 3MK31 4A92A 1M1NA 2EP7A 1ADBA 2J32A 1FP4B 1T9BA 4P93A 1T8YA 5HF8A 4AG5A 1GJRA 1K4MA 1FFWA 4HL6A 4UBMA 1HDRA 1QGUA 2YFHA 4IDBA 2ENWA 3MLEA 4PAGA 3BHJA 2QD4A 3PB3A 4P54A 3CEPB 1RWMA 3H2HA 1UDAA 4UNIA 3RVSA 2ZJ8A 3IAEA 1VB3A 2H08A 1NDQA 2WTBA 1CJMA 3RBAA 5KOIA 1IM2A 1F2DA 1NQVA 2CSXA 1FC0A 1LJUA 3PDUA 2AZMA 3P2KA 2VDQB 2KM1A 2J67A 3A1EA 4TSFA 3LNCA 4QVKA 4R01A 2XF2A 4KLCA 3UWSA 1H2HA 2HO5A 1GA4A 4FMCB 4FGJA 4OM7A 4TTRA 5D1NA 1U1FA 3OIDA 2HJWA 1TZ2A 2D3TA 2IT1A 2NNLD 3WRXC 4FMBB 5AI4A 3M6XA 4CRWB 4TWAA 4B3RB 3FZEA 3C48A 3QPDA 2YW2A 3AF4A 4CIWA 4XLLA 5BY2A 4E13A 1GRRA 2H9YA 2ICAA 4E4TA 2IJGX 2E82A 2VAVA 3HADA 3HABA