3U5TA

The crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from sinorhizobium meliloti
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
241
structure length
230
Chain Sequence
NKVAIVTGASRGIGAAIAARLASDGFTVVINYAGKAAAAEEVAGKIEAAGGKALTAQADVSDPAAVRRLFATAEEAFGGVDVLVNNAGIMPLTTIAETGDAVFDRVIAVNLKGTFNTLREAAQRLRVGGRIINMSTSQVGLLHPSYGIYAAAKAGVEAMTHVLSKELRGRDITVNAVAPGPTAVRDRFAKLAPLERLGTPQDIAGAVAFLAGPDGAWVNGQVLRANGGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
publication title The crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from Sinorhizobium meliloti
rcsb
source organism Sinorhizobium meliloti
total genus 75
structure length 230
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3u5tA00
3UGKA 1ID1A 2AW5A 4J9VA 3OEYA 4FFOA 1HXHA 1KOLA 3WTBA 5GZ6A 5AXAA 1P1FA 1Y8RB 1HDCA 4GI2A 1FF9A 2PKQP 4XDZA 3WLEA 4DBVO 1F8GA 1HYEA 3ROQA 2X58A 4XQCA 4GSKA 4UUOA 3VPXA 1YL7A 1HT0A 4IIVA 3UH1A 3RJ5A 1OAAA 2PTGA 3ZHZA 2PD6A 4YVFA 1QG6A 2IYOA 5U1PA 1ZVMA 4EI2A 1NAHA 5B4UA 5LDHA 2JD2A 4B3JA 2VWGA 5KKAA 1GV1A 5EJ2A 2O7SA 2Z1NA 4QSMA 3QWBA 2PZMA 4OXYA 3STHA 1ZMOA 4PLVA 3Q9NA 1MFPA 4CMBA 2HRZA 2GN8A 1XU9A 3JSAA 4Y8VA 3Q2IA 3MWEB 3GAFA 3KSZO 4YJHA 4ND5A 1YRLA 3K6JA 3GA0A 4GWGA 3HSKA 4EUHA 3BTUA 5JY6A 1Y8RA 4RPHA 3NT5A 4L73A 4R1UA 1OI7A 2CVZA 3Q6IA 2NACA 1T2EA 2CY0A 5LC1A 3U4CA 2VHXA 3D3EA 4E2XA 3KSUA 3IC5A 4UVGA 4UEKA 3PJFA 2YHUA 1X0XA 4QEDA 1RM0A 1N7HA 2HKIA 4IGEA 4IMRA 4IQGA 4XX0A 4OOEA 3SC6A 1F06A 4WOKA 2AEJA 2C29D 5JLAA 3OETA 4Y6SA 3NDRA 5IDWA 5L40A 4II3A 4WKGA 2VRCA 2IXAA 2ZCUA 5KCZA 4HBGA 4S1VA 1I24A 3UFXA 1A72A 1BXGB 4CPDA 1B7GO 4G65A 4E5KA 5FI5A 4BV9A 2Q4BA 1X1EA 3AW9A 3HB4X 3PYXA 2YJZA 1Z74A 2D4AA 1HDOA 2YV3A 5JW6A 4DVJA 3PYLA 3JQBA 2NQ8A 1Q7CA 4NQZA 1CETA 2DTEA 3GG2A 1JAXA 5AXCA 4PG5A 5G0UA 2QIOA 4RVUA 2C59A 3R1IA 4CM4B 1IUKA 1KEUA 1H9BA 1JVBA 4J3FA 4KTTE 4UAGA 4LRTB 1AHIA 4PG7A 2YFQA 2EKPA 4KTVE 1MA0A 3RC9A 4XR9A 2Q1WA 1H6AA 3H2SA 1BXGA 2AQKA 4NHEA 4CODB 4I1IA 3ONFA 1PZEA 1SOVA 5A05A 3UKOA 1NVMB 5T67A 1EQUA 3D4PA 3JQ6A 7MDHA 4Q3DA 4M49A 2RCYA 4FJ2A 3ZCXA 4N5LA 2AG8A 1Y5RA 1LX6A 3G3EA 2JD0A 2HRBA 2J3IA 3WYBA 1EMDA 3AUTA 4Q9NA 4R5MA 3I6QA 3KRTA 5DULA 5I8ZA 3MJ4A 1EZ4A 1I30A 3GNSA 4OOFA 4CM4A 3WICA 3F4LA 5EN4A 3RCBA 3PDUA 3DWFA 4CJXA 4F6CA 4CUJA 4K26A 4S3MA 2YV2A 2WYVA 3E9QA 2RIRA 3BMNB 1PL6A 4DIFA 4LRSB 4CM9A 1R6DA 2EJWA 3ZWYA 3I83A 4RDHA 2BFMA 1K5HA 2FMUA 2G0TA 3ICCA 3NRCA 3NT4A 1QP8A 4CR6A 4WLUA 5AVOA 3AI3A 4MVJA 3HNPA 4XWYA 4BO4A 1GAEO 3LQFA 1J0XO 2RAFA 3IDSA 3ZN2A 3ZV4A 3DR3A 3DAPA 2VRCD 2C5EA 2WE7A 1U3UA 3FTPA 1S6YA 4OKIA 4CMAA 1LDGA 4AJIA 1FXSA 5K6AA 4PVCA 1LLQA 1GYPA 5CPBA 5JNLA 3VZRA 4C7JA 1Y9AA 5L4NA 2FR0A 3UCXA 1D1SA 3WWYA 1Y5MA 3H3JA 4ALMA 3BMNA 2IXBA 4WCFB 3ZV6A 4DQUA 4R1NA 4KQXA 1KY4A 5LCXA 2EXXA 3D3WB 2PLAA 3DBRB 3GG9A 1DRWA 2X5JO 1NXQA 3KVOA 4IDGA 2G17A 1W6UA 3QQPA 1NVGA 4MP8A 5G0VA 1RYEA 4WCDA 3VPGA 3LK7A 4Y6RA 2R6JA 2Q1SA 4ZRMA 3RUIA 4RCVA 3VHRA 3NT2A 4BO7A 4NBUA 4Z0HO 3ZWBA 1R0LA 1N1GA 3TWOA 5EINA 2J8ZA 4KZPA 4TSKA 3ZDFA 5AQ1A 2ZTLA 5ER6A 3ZWOA 5JMWA 1LA2A 4YQZA 1PJQA 4DUPA 3I9KA 2X9GA 3E5MA 3AWDA 1P1IA 2W8ZA 1M67A 3FD8A 3NTRA 4EDFA 3WIEA 2FR1A 1V0JA 4OXKA 3D3WA 1KEVA 3DBRA 4FFRA 4EZBA 4A5OA 1PJLA 2H5LA 1Y6JA 3KBOA 1MG0A 3H5RA 1E7WA 2EKLA 5CDSA 3V8BA 3DMTC 4IJWA 4J4BA 2GR9A 2BFOA 1P31A 3GMDA 5ILOA 4J7CA 5G0WA 1DFHA 2GNAA 3Q9UA 3T4EA 1WMBA 1BVRA 5B37A 2CF5A 1ZXLA 5JDCA 5KJFA 1DRVA 3FNFA 4ALJA 3FWZA 3QV1A 4MVJD 2VUSA 1JKFA 4E13A 3DMYA 1GCOA 4J4TA 5TT0A 1EQ2A 1JW9B 2ILTA 4ALLA 4R1TA 5KKCA 1A9YA 4JBHA 1GADO 3TZCA 1MB4A 1E1NA 1LNQA 4MOWA 1MLDA 1UXGA 3O4RA 4FOSA 5ER9A 3SLGA 2XXBA 1V6AA 3VC7A 1X7HA 4YAGA 2O3TA 1IZ0A 4XB2A 1I32A 3NTQA 4YBZA 3CXRA 2OBNA 5JO9A 1XYGA 1NPDA 4E33A 1UDAA 3PIDA 3LYLA 2J6IA 4R51A 2WM3A 1DC5A 4P4GA 4BMVA 4UVDA 2Y67A 1FMCA 3ROMA 4B4OA 3ZV5A 3JD3A 1T24A 3AUSA 3G49A 1VSUA 1XLTA 4DYVA 1AXEA 3PRJA 4BS9A 4CM8B 1N9GB 3CUKA 1NBOA 1UP4A 5L51A 4M89A 1U8FO 1A5ZA 2IDZA 3GUCA 3GEGA 1WW8A 1I5RA 4BNFA 4PLWA 5AYVA 4OSOA 2Y1FA 4BGEA 4BNWA 5JY1A 1P1HA 2PKQO 2C82A 2FPGA 2QZZA 4M54A 1XEAA 3GGPA 2D0IA 3LT2A 4R3WA 4DYDA 1WDLA 4XQ9A 1Y8QB 4HFRA 1SOWA 4BIIA 1HDZA 3E5RA 4BNMA 2P9CA 4GMGA 2G76A 4P38A 1U7HA 4D45A 1ULUA 1BSVA 4CUZA 4YRAA 3HWRA 1H6DA 3BMCA 4IXWA 3B1FA 5IDQA 2O50A 2DC1A 4FFMA 4CM8A 1N9GA 2VOJA 1PJCA 4J0FA 3ZZNA 1GQQA 2C2XA 3D7LA 1D3AA 1GEEA 2GLXA 2C5AA 2Y0CA 3FPLA 5ITVA 4PG6A 2R00A 3S2IA 1UP7A 5EQFA 1JWAB 5EL0A 3D64A 2QRKA 4HWKA 4TKLA 3DZGA 3WSWA 4EBFA 3WGQA 1OZAA 2Y1CA 3LF1A 1Y8QA 4I5GA 3RFTA 4BNKA 1DC4A 1G0NA 4G2NA 3GVHA 4CM6A 1HRDA 4TVBA 5B4VA 3N58A 3C8MA 4ZVVA 2CDCA 5KVQA 3D1LA 3UXYA 4GLOA 3EMKA 4IDEA 3U62A 1HLDA 4XQGA 2X5KO 4NMHA 5GZ3A 2VCYA 1IHYA 1RM3A 4B8ZA 1HYGA 1R37A 2GUGA 4FGWA 4LN1A 1JU9A 4A0SA 2OL4A 1AN9A 2WJPA 3Q0EA 2BI8A 3WGGA 2WWRA 2AHRA 4DGSA 3OEWA 1ZZEA 1T26A 1I2BA 1U3WA 3DTYA 4RVSA 2R2GA 5IZCA 3GZNB 1V8BA 4L9RA 3V2HA 1YBAA 3UICA 1L7EA 2V6MA 2C20A 4XYMA 1E3WA 1L7DA 4ILKA 3JD1A 1Q0QA 3GY0A 4CUKA 1T2AA 2DT5A 4XRGA 5CG2A 1U9JA 1U5AA 3RBXA 4WASA 1QYVA 4KDEA 4W9NA 1NQTA 4I08A 3ASUA 4J91A 4OXNA 2PFGA 3VDRA 3DZFA 3GDOA 2WE8A 2JKVA 1B2LA 4PRLA 4CLEA 1E92A 1U5CA 4B8WA 2HUNA 3RKRA 1TVEA 4OYRA 1K0UA 4BKUA 3K8ZA 3HG7A 3JD4A 4BO0A 3UUWA 4XIJA 1ONOA 1E7QA 1QXSA 2GRAA 4XRRA 4AJEA 1MXHA 3L4SO 1YS4A 2YQ5A 1E0DA 3EZLA 4WLNA 5BNTA 3PGXA 3GZNA 3GPDG 2G5CA 5A02A 1M6HA 1NPTO 2BD0A 4BB5A 4YB8A 3Q11A 1T4DA 4EUFA 4BNVA 2PD4A 1ZKMA 1JTVA 1UZLA 1XCBA 4YRDA 5IF3A 1E3LA 5T64A 5L3ZA 1HE2A 1I01A 4CMIB 3QP9A 1O8CA 2VHZA 3C1OA 4J9UE 5TSDA 3MJCA 5G2OA 1XWFA 2OMEA 4RORA 4OJNA 1H94A 3ANLA 3S1LA 3QWFA 3P5SA 1NTOA 4FFLA 2Y1EA 2I9PA 2NUAA 4IS2A 2A35A 3RU9A 1YH3A 4K9DA 2Q99A 4XJTA 3HJAA 4YRBA 1OMOA 1GUYA 3L0DA 2Q2VA 1E1KA 1O9BA 4IDAA 4PRKA 3K73O 4G81A 4K6FA 5FF9A 1FDUA 5KVSA 5G0SA 2O2YA 2I6TA 4GX0A 3RUEA 5C5IA 4RF5A 3A28A 2JAPA 1C1DB 4DL9A 3T4XA 1XU7A 2X9NA 3PDJA 4BKOA 5TNXA 1LRJA 1A71A 1SEVA 1VSVA 5GMOA 5L4LA 3AJRA 5KVVA 2VWQA 3DB2A 5F1OA 1KC1A 4MVJI 2JJYA 5IN5A 4CMIA 4IXTA 1XDWA 4YJFB 4OKNA 2VOEA 4F6LA 3PWKA 1AXGA 2VHWA 1WWKA 1LLUA 2B69A 3WGOA 3QVWA 4GGOA 4ID9A 1U2DA 1ZXBA 4MIOA 2HK8A 1Z73A 4KWIA 1KVUA 1VKNA 2OZPA 3I23A 1DOHA 1OBFO 1OC2A 1P44A 3PZBA 1MP0A 3CZMA 6ADHA 4M87A 4Q3BA 3WQSB 2F1KA 5CPFA 5C7LO 1C1XB 5BT9A 2UYYA 4LSMA 1MUUA 4N7RA 1I2CA 1E77A 5F21A 1C1DA 2JHGA 1CF2O 1WPQA 4R9RA 4I8XA 2D3TA 1LTHR 1N2SA 3RUFA 5A03A 3PVZA 4BNTA 4PG8A 3TFQA 3PLRA 5KJ1A 2GZ2A 3LC2O 4J43A 3QWIA 3BHIA 4YJFA 4BNLA 4CM5A 4NBRA 4WNIA 1LQUA 3B6ZA 1ONNA 3M2PA 2VWPA 3BHJA 1YB4A 2C7GA 1UXJA 4MINA 2BHLA 2FY8A 4F3YA 1QLHA 1LSUA 3COSA 3F6YA 5ADHA 1AGNA 3I9LA 3EHEA 3CIFA 1LXCA 3W4JA 4CLXA 1VJ0A 4D3DA 3O38A 2YYYA 3FPCA 3OJEA 3WS7A 5TF4A 4YJGB 4LVUA 3CTMA 1HWYA 5A3JA 4OIMA 1C1XA 5JCJA 1NPYA 3IKVA 2NTJA 3IAHA 5B12A 3UCEA 3QW2A 2FOIA 1YJQA 5L45A 5BSGA 4IDFA 4MVJG 2J5QA 3KYCB 4OHUA 3H2ZA 4MKXA 3E8XA 2XAAA 4MVJH 3UAGA 2VYNA 3DL2A 3JQ8B 4JJIA 3V5NA 1WDMA 2OO5A 3BHMA 3EK2A 5TS3A 1GCUA 4GGPA 2BFPA 3A06A 4I9HA 4YAKA 3KO8A 1UXHA 4JX8A 4FPXA 3C1AA 4WE3A 3GGOA 4E6PA 1O94A 4ND2A 4FSHA 5F5LA 2ZB4A 3F9IA 2ZIZA 3NAQA 1PJ4A 3KETA 1YL6A 4NK4A 4CR7A 5KOIA 3H8VA 4EUEA 4YJGA 2BFAA 1JKIA 4IGFA 4M86A 3OMLA 4J1NA 4HNGA 1IPEA 5HBRA 1SC6A 4DXHA 4ZRNA 3AY7A 3MOGA 3VKVA 2OORA 1B15A 1SMKA 4CV3A 5BSHA 5A06A 3I9JA 4FS3A 5L95A 4OAQA 3TPCA 2OFPA 4A7PA 2DUWA 2O48X 3QIVA 4RQTA 3CPSA 4R41A 3C7AA 3TL2A 3JQ8A 4JCOA 2VN8A 3K2BA 2PR2A 2Q49A 4FDAA 4LISA 4CV2A 3OJLA 3MJTA 3E48A 4JN6B 5G4KB 3DDNA 3DZIA 1CQIA 1BHSA 1HL3A 1GZ6A 1PR9A 2EP5A 4QFDA 1QV6A 2HK9A 4GQAA 1ISJA 2O7QA 4XD2A 1DB3A 5IFLA 3ZV3A 4CLRB 2QQ5A 4R68A 4E12A 5FEUA 1K6IA 3MEQA 4CM3A 2AXQA 1QR6A 2H6EA 5DOVA 3TQHA 3GLQA 4CMEC 4GPD1 2ZJ0A 2W2LA 3CE6A 4PLPA 3LT4A 3GMSA 3SJUA 2DU8A 3IKTA 4B7UA 1K2WA 4YJHB 4AJKA 2ET6A 3F1LA 4U7WA 4ZQGA 3QJ5A 3I5MA 2VT3A 1C0KA 2FSVA 1LDBA 3JQDA 4PG4A 1B8PA 5TGDA 3FBGA 4JBGA 2JFFA 3GRPA 3ZHYA 5G4KA 4LMRA 4CV0A 3WLFA 3DAGA 4HY3A 3A1NA 2AEMA 1VKOA 2QX7A 1ADGA 3EC7A 3NJ4A 2PGLA 2VYND 1AE1A 1ZSYA 3KTDA 4CLRA 3ONDA 4R3NA 2ZJ1A 3HE3A 4IJVA 4ZJUA 3PZRA 2GASA 2GD1O 1LU9A 1DEHA 3BA1A 4FW8A 4NJMB 1ZH8A 3K5PA 4CMCA 4TMFA 4BNUA 1IYZA 3QWHA 1LLDA 5DN9A 3U4HA 1T25A 4AJ4A 3RUDA 2HDHA 3GN2A 4PVDA 3R6DA 4B7CA 3MJVA 1C0IA 1XR3A 1VC2A 3U4DA 4R16A 4ALKA 4R1SA 3WGIA 1PJSA 4OMUA 5L9AA 3NYWA 3VH3A 4P22A 3JQBC 3L9XA 2ZQZA 1ENYA 3WGHA 5IXSA 1U7TA 1XQ6A 2PD3A 8LDHA 3SX2A 2EP7A 5TQVA 4YA6A 1ZUD1 2WDZA 3EY4A 1Y1PA 4AVYA 5T8KC 4D3FA 3KM0A 4NJMA 1SB9A 3BAZA 4IUYA 5DBIA 4BO1A 4RZIA 3F4BA 3N74A 4OH1A 5JMPA 4ALIA 2CFCA 4A10A 2X0RA 1LUAA 2UUOA 1H0KA 3JQCA 2QYSA 2E37A 2P91A 5T5QA 4BNNA 5JPIA 2AA3A 3JYOA 1E1LA 1YB1A 4TZKA 5ENVA 2VHVA 3PXXA 3WYEA 1PU2A 2XF8A 4UUNA 5TRTA 1ADBA 4BGIA 4J49A 5KVCA 1ZCJA 3V1UA 1TT7A 3WWZA 4GLLA 4DWVA 3EVTA 3EAGA 2D5CA 1J6UA 3DFUA 3ANMA 1N8KA 3HN2A 4M55A 2P4QA 2AEFA 4E5YA 5ICSA 4IMPA 1Z7BA 4RV9A 3RJ9A 4YXFA 5IXYA 3GDGA 3JD0A 3GT0A 1MC5A 1B3BA 1BW9B 1UP6A 4INAA 1YO6A 4B79A 4IBOA 4IJUA 4URFA 4NPCA 5EIOA 4YTEA 1NASA 1HDYA 1SO8A 1P74A 3JQAB 1WDKA 4BKRA 4BUCA 1WXDA 2O3JA 1CRWG 1FDSA 2O3RA 3QVSA 5EQDA 4WJZA 1B16A 3DQPA 3VZPA 4WLFA 2BELA 2WSBA 3LC7O 3B20A 3GF4A 4AJOA 1BMDA 3FRJA 3I6IA 3HN7A 1G1AA 1ZJYA 4AJNA 4BO8A 1BWSA 1GZ4A 1YONA 2D8AA 1IL0A 3VPFA 3CH6A 2JCVA 4NJOA 4N54A 4JJGA 4O5OA 4Z9XA 4U0KA 1P77A 4GWKA 1P45A 4HNHA 1BW9A 4IZIA 1WNTA 1ZK0A 4WNCA 4BNIA 1GFSA 4DC1A 3WG9A 3VAZA 3U3XA 5I9NA 1SPXA 3AUAA 4EEZA 3JQAA 1K3TA 5COBA 4XYGA 3PGJA 2DTXA 1NWCA 5B4TA 4E31A 3DBVO 4MVJE 5EESA 1QKIA 2NU8A 3DEYX 5KNLA 3WJAA 4E5NA 5I7SA 3M2TA 2DM6A 2OP1A 2WTBA 1H93A 2D59A 3NDIA 4RF4A 1HDGO 2HU2A 4MP3A 4G5HA 3ZGYA 2HQ1A 3U49A 4ZHSA 1XG5A 1LRKA 2AQ8A 3W4KA 2PWZA 4KWHA 3U4IA 4HV4A 2C2YA 4BKPA 2EW8A 2B0JA 5I9MA 3UCFA 2EV9A 1DIHA 2YW9A 2C07A 4L76A 4WCFC 1G0OA 5KJEA 5I7EA 4QECA 2VTEA 4W7IA 2E48A 5DP2A 2EIHA 4IDDA 3EVNA 4W6ZA 4PZDA 3IUSA 4BB6A 1I3MA 1XGKA 1QLJA 2JFGA 1XQ1A 1LDYA 1IOLA 1TA4A 5BNFA 3FNGA 2NVUB 4UEJA 2GN4A 3D5TA 3ON5A 2P2SA 3GRKA 3G1UA 3NGXA 3O8QB 3E18A 2YV1A 1PJTA 4CMKA 2QZ9A 4YWJA 2RH4A 5JDCC 4RGBA 4EEXA 4ZN6A 2CVOA 4GMFA 1I10A 1LQTA 3VTFA 1XHLA 3L4BC 3PJEA 4QX6A 1B8UA 2ZYAA 1EVIA 2SCUA 1PQPA 2QW8A 3WGZA 1GZ3A 1X13A 3A9WA 3FSRA 4QO7A 1LDEA 1PEDA 4QO8A 4RLSA 2DPGA 3ORFA 1GQ2A 4F45A 4J2HA 5F1KA 1HSZA 2EHDA 3DOCA 3DONA 2A9FA 3JQGB 3FWNA 4FCCA 4BO6A 5CFZA 4IDBA 4PZCA 4XYEA 4DMLA 4CM9D 2PGJA 2Q2QA 1MFZA 1ZFNA 2Q1UA 4H3VA 1PWXA 4GX1A 1E3SA 1YQGA 3PK0A 2HCTA 2NVUA 3HZZA 4EJ0A 3O8QA 4RL6A 3ADOA 3NUGA 1YBVA 3LT0A 1PIWA 1M75A 3B70A 3JQAD 4LMPA 1BGVA 4TQGA 5ES3A 4Y6PA 1IULA 1ISGA 3VVBA 3U5TA 4BV8A 5CEJA 4DMMA 5MGBA 5HS6A 1ZSVA 4NZ9A 1MC4A 2IRWA 1Z6ZA 1FJHA 4FR5A 5CDTA 1HZZA 1WP4A 2Q1TA 2VTDA 3DTTA 4KUGA 1RM5A 5HTOA 2JCXA 5JO0A 2D2IA 3ASVA 4Y98A 2D1YA 3PFFA 4WLVA 2RHRA 2HMWA 3JQGA 3E6AA 3NEPX 3OHSX 1E6WA 1E7SA 3EGOA 3NTOA 4E2YA 4ZQEA 1PL7A 1ZW1A 4DPKA 1T1SA 3QVOA 3R3JA 2CDBA 5CDGA 2O23A 1PL8A 1P3DA 3ZHBA 2NTVA 3KV3O 3O9ZA 3OA2A 3BMCB 1XELA 4NFSA 2I3AA 2PGDA 2FPIA 5AXBA 1ZBQA 3G1TA 1P0FA 3GEMA 3PP8A 3FR8A 5ENDA 3F5QA 3TNLA 1XSEA 4U6SA 4IPTA 3CINA 3FI9A 1EBFA 5L7WA 5G4LA 1U2GA 4TRRA 3ZNPA 4Z3KA 1GV0A 3AI2A 3CZRA 2Y66A 3UHAA 5CEFA 4CLHA 2UVDA 2FN7A 3VTZA 4LCJA 4W7HA 1QMGA 3NV9A 2D5AA 3KB6A 4LSWA 4DPLA 1G6KA 1MG5A 2Y0DA 4RO0A 3PHIA 4A26A 3GVPA 4WOJA 3UVEA 4R01A 4JP3A 2E49A 3C7DB 4BNJA 2HMVA 1UAYA 4D42A 3MCVA 4J7UA 2JAHA 1YJ8A 4DIBA 2DTDA 3S55A 3I1JA 1I3LA 1PSDA 2O4CA 1Y81A 1R16A 5JBIA 3ZWVA 5DCYA 1W4ZA 2OUIA 3O26A 4AL4A 2J3HA 4J7XA 1PGJA 3NX4A 4N5MA 1T2DA 1UH5A 2NADA 5A4DA 2B5WA 5IZCC 1E3WB 3PJGA 4RPJA 4BO9A 1CEQA 4RDIA 3I9MA 5JAMA 1DSSG 4TZTA 4CMJA 3NDJA 3A14A 4UREA 1I2ZA 4NBVA 2PNFA 1PGPA 3BXXA 2X23A 1LDNA 4R54A 1WAMA 2W90A 3TZHA 3ULKA 4RVFA 1LSSA 1PZGA 4ITUA 1EE2A 4OO3A 1Z75A 4BGVA 3W4IA 1LRLA 3TF5A 4RQUA 3QVTA 2GGSA 1ISFA 4X54A 1BRMA 1E3EA 4XCVA 2AMFA 3OP4A 4ND3A 3WMXA 3AY3A 3QA9A 1DDOA 2Y1OA 4XB1A 5THQA 1IB6A 1W73A 1SCUA 3GQVA 4GAEA 5F3RA 3KOUA 2Z1MA 3L6OO 3PHHA 2E4AA 1DBVO 3AK4A 2POQX 3I52A 3VOSA 1UXIA 2FWMX 3Q3CA 1ZK1A 1O6ZA 1E7MA 1VLLA 1R0SA 3OIGA 3RVDA 3WJ7A 1C14A 2B4RO 4MKZA 3GH3A 1EK5A 4O59O 4YAJA 5IDXA 3AY6A 4HXYA 4GX5A 5F5NA 1SEPA 1DIAA 3PHGA 1FDTA 3MZ0A 3TZQA 2VUUA 3HADA 5C37A 2PZJA 1NR7A 2BGKA 3WGYA 4L4XA 1ORRA 2X4GA 2ZTUA 3H65A 3LZ6A 3ANNA 4A03A 2HJSA 3W8DA 4EJMA 5K9ZA 4PLHA 3ENKA 1BXZA 1LBEA 1ENZA 1MV8A 4XGKA 5ITWA 3K31A 1PX0A 4MVJM 3RUAA 1DPGA 5A9SA 4XGNA 3WNQA 1GTMA 4NBTA 2QYTA 3EUWA 4D43A 3MOIA 4GH5A 2FPPA 1WVGA 1BTOA 1RWBA 1ONPA 2DBQA 5KTKA 1ADCA 3U0BA 4JXKA 1ISHA 2FHSA 3ROPA 4Q3NA 2V6BA 3IIEA 3WR5A 4UVEA 4MO2A 2X5OA 4K1LA 4XJSA 3TJRA 1EUCA 3OA0A 1VI2A 1E6EA 1NHGA 4C7KA 1E5LA 4DC0A 2I99A 1UDBA 3KYBA 2ZQYA 1CJCA 3QY9A 5BR7A 1JN0A 5L7TA 4TROA 2FSSA 1H5QA 3X2FA 4AJ1A 1Q7BA 2XOXA 3ENNA 2PV7A 2IYPA 1X0VA 2QHXA 3OECA 2GDZA 4PIVA 5EERA 9LDBA 4BQRA 1EFLA 4GL4A 2PZLA 2FZWA 2AQIA 3HUDA 4L4RA 3AUUA 3VH4A 3FHLA 4E5PA 1HZJA 4E3ZA 3DOJA 2B35A 3PWSA 4YAEA 3R0IA 4IDCA 1MGOA 4O6VA 3WX0A 1M2WA 3ZHXA 1UXKA 5FFFA 4ESOA 2F00A 1DJNA 2ZYGA 1UUFA 4ZD6A 3JD2A 2NU7A 4OM8A 5JE8A 3ETDA 2P5UA 2J3JA 2EG9A 3TOZA 3KEOA 5JSFA 4R9SA 3WTCA 5BQFA 1GEGA 3FN4A 2O3SA 4N18A 3ZWWA 4P8RA 1CERA 1HKUA 3OIFA 3ETGA 4HKTA 5ILGA 1CWUA 3TRIA 4YT8A 3H9JA 4CMHA 5C7OO 2B36A 2WD7B 2I67A 1BVUA 4NU5A 3HFGA 5JC1A 1LSOA 2HSDA 3D4OA 1K6XA 3P2OA 4GX2A 3PHLA 4EJ6A 3I9OA 3LF2A 3AOEC 2BH9A 2ZB3A 4H15A 2NVBA 2YY7A 1U3VA 1P1KA 1P33A 4LW8A 4A2CA 1PJ3A 4XGIA 1YB5A 1TEHA 4JK3A 2C7VA 3BIOA 3RUCA 1GDHA 4E21A 3RASA 2ZTVA 5HS4A 3ZWNA 4BO2A 2H9IA 4D0SA 3D4NA 3HDJA 3IQDB 4UUMA 2PY6A 2XXJA 2EWMA 3AI1A 1I0ZA 4MP6A 3S2EA 5H83A 5TLSA 4HFMA 3TFOA 2W2KB 2WD7A 2QRLA 3H4VA 1CIVA 2YFHA 2EERA 1VRWA 2X9VA 5IG2A 4NG5A 4AJ2A 1R66A 4HUJA 2X0NA 1Z45A 4XEHA 3QSGA 1ULSA 3H9QA 4Z9FA 1NQ5A 4I5FA 1P1JA 2DFVA 2X86A 1E1MA 3LVFO 2I5PO 4I9NA 4PLCA 4Q3EA 4YDRA 2YHIB 1VM6A 2Q2WA 4IQ8A 2B4TO 4UVIA 5DT9A 2PH5A 3I9NA 4RZHA 5AXDA 4QFCA 3ZWAA 2P68A 3RAJA 1NQOA 3OQBA 1KVRA 3WB9A 4U0JA 4RLHA 1UAGA 1ZJZA 2TMDA 1P0CA 1WMAA 1GY8A 4CL8A 4W99A 2YUTA 3FR7A 1LI4A 1DAOA 4UEOA 3JQ9A 2W2KA 4FC6A 3ZU3A 3ONEA 5B1YA 3FF4A 2IZ1A 2HMTA 2FP4A 4KOAA 1O5IA 2Y0EA 2Q45A 1E7RA 1C0LA 3JQFC 4BOYA 4WLOA 3RUHA 4RPGA 3ABIA 4Y67A 5JXWA 3CMCO 3INRA 4AJPA 5IN4A 3H9GA 2YHIA 1QYDA 4D41A 4RPLA 3ZWCA 3KHUA 4YJDA 3M1LA 3LLSA 1YQDA 1M66A 2OP0A 4MVJP 3MJSA 5C7IO 4W4TA 3F47A 4M1QA 3HDHA 1NP3A 2RBEA 4J2OA 4LK3A 3DHNA 4AICA 1R4NB 1I36A 1TXGA 3SXPA 4J1QA 3W8FA 4B4WA 2Y05A 3OJ0A 2DKNA 3RROA 1NFRA 2I76A 3L77A 4JROA 1H6CA 2ZB7A 1ENOA 3S2GA 2YDXA 4DTIA 4BNHA 1WZEA 4IIUA 1C0PA 1DHTA 1U1IA 2FRDA 4UULA 4CLDA 4R5HA 3KUXA 3ZNOA 5H82A 2X6TA 2ZB8A 3L6DA 1F12A 3KZVA 2HO5A 2VRBA 1D8AA 1LLCA 2BKAA 5JDIA 1X1TA 3SC4A 3TSCA 1NR1A 5JCJD 3KLPX 3BTOA 3H9EO 3JTMA 2DAPA 5JYEA 5CHEA 3FNHA 2B83A 1VL8A 5T57A 4D0RA 4YACA 2DQ4A 2I3GA 2ZTMA 1NQAO 4Z6KA 2ZK7A 1GPJA 1ZEJA 1KETA 1R4NA 4NFHA 2VZ9A 4DPMA 2IZ0A 4FIZA 5CAEA 2WEKA 4GSLA 5BSEA 1QORA 3ZU5A 3DFZA 2CNBA 3PPIA 1EEHA 1N1EA 5IDYA 2CDAA 3HB5X 2B5VA 2PZKA 2QRJA 4XYBA 4CL3A 5DCUA 5TJ9A 3E9MA 5KJCA 1JWBB 2I66A 4BNYA 3M1AA 5JS6A 1N7GA 1B8VA 4JGBA 5I8WA 4MKRA 2A92A 3G17A 3S2FA 5TJHA 1UZMA 3IJRA 2Z5LA 4HFJA 1KVQA 2VZ0A 1PR3A 4CMEA 1L1FA 2EF1A 5HM8A 4AFNA 3WGTA 5C3MA 1IZ9A 1UZNA 4LVCA 5L7YA 4E2WA 5I7VA 2DBVO 1RM4A 5DBGA 3TZ6A 5JAIA 1DJQA 3OQ6A 4JNKA 4U6QA 1PQUA 4PLZA 4R69A 3F46A 3W8EA 3U09A 3W1VA 3KLMX 3UOGA 3JYQA 3KEQA 1XA0A 2J5KA 2FR8A 1KS9A 3C7CB 1B3RA 4WEOA 1Q2XA 1LDMA 2Y99A 3TZKA 4TRNA 4YYZA 3UF0A 2OBYA 2OGUA 1GPDG 3SVTA 1HLPA 5JYDA 4J0EA 3F1KA 2JFHA 4GKVA 3G0OA 3IJPA 5AOVA 3NJ8A 4NI5A 1GUZA 3PWZA 1S7CA 1DIGA 1VL0A 2GYYA 3QE3A 1SAYA 2Q50A 3OM9A 1TT5B 3F5SA 4ND1A 1PJBA 3DZBA 3PLNA 1DIBA 1H2BA 1M76A 1IE3A 4I9UA 1FK8A 2AQHA 1T2FA 1U3TA 1W0CA 2W2LD 3DHYA 5GY7A 3WOHA 3B1KA 3SLKA 2P5YA 4BNXA 3HFSA 1JQBA 1DLIA 3RSHA 4FFNA 4QXMA 4KP7A 4D46A 3QVXA 3Q1LA 4PFJA 4A73A 3TN7A 3IUPA 3GOHA 5DP1A 3TL3A 3Q2KA 5MDHA 1D7OA 4TWRA 4IJKA 2HLPA 4OSPA 1KYQA 2CF6A 2IEBA 2GCGA 1K89A 3HQ4O 3PQDA 4FBGA 2OXIA 4C4OA 1V3VA 1MXFA 3C24A 2VZ8A 1Q1NA 4J1TA 3VZSA 5A5FA 4U5QA 2EEZA 2PK3A 1PQWA 3I4CA 4YPOA 1KERA 5KIAA 4BGUA 4JQCA 4ROSA 3A4VA 1TT5A 4B4UA 1KC3A 5L53A 5T8KA 2UAGA 4WEQA 5CEEA 1Y9EA 1A7KA 1KBZA 4DRYA 3S8MA 1YL5A 3L07A 4EITA 3BTSA 4Q3CA 3GZ4A 4GKBA 5K6AC 1DFGA 3ST7A 1YGYA 5KJ6A 3B1JA 3ZWPA 4KDFA 5JCXA 1EK6A 2E6UX 4E2ZA 2Q4EA 3TOXA 1CDOA 5DDIP 3GPIA 3OJFA 3DZJA 1TI7A 2GZ3A 1UR5A 4RPKA 1EFKA 2AG5A 1ZK3A 3SBOA 4E5MA 2OHXA 3CEAA 5TIIA 4D3SA 1HTBA 2CMDA 3QWAA 4B3HA 1DXYA 3BZUA 2VHYA 3ETEA 1A9ZA 3RC2A 3WQRA 7ADHA 3DXFA 2EW2A 5KWEA 3RD5A 1A27A 4BMNA 4N5NA 5HWSA 5HRUA 4E4YA 5U4QA 3GFBA 4J16A 2IE0A 3LT1A 1JVSA 1P9LA 1CYDA 3RI3A 4HADA 1HE3A 4ONEA 3GEDA 2Q46A 4R4JA 1XIVA 5BNIA 1A7AA 2PH3A 3DBHB 3IMFA 4DLBA 4CQMB 3W6ZA 3C3XA 5EMHA 1KVTA 4WGGA 1I8TA 2C0CA 4O1MA 3PI7A 4K28A 3RBVA 1B14A 1DLJA 2YZ7A 4NNJA 3F3SA 3JYPA 4KUEA 1ZIDA 2V6GA 1QV7A 4FB5A 1DAPA 4RVDA 4ZICA 4P4LA 3PEFA 2X8LA 1LC3A 4QUKA 3BMOB 4FD3A 4DLAA 3MJEA 1HSOA 1HDXA 3T7CA 2V7PA 1E3JA 1QYWA 3FTNA 3FCOA 4XZ3A 1NHWA 1PZHA 2LDBA 1ZK4A 1E5QA 2FZEA 2NNLD 2ZATA 3LU1A 4EGFA 4BNGA 2DBRA 1UJMA 4AG3A 2BRUA 3H5NA 3DBHA 1ISIA 4NR0A 4CQMA 2GF2A 2EKQA 2ZYDA 1A4IA 2NM0A 3EDMA 2NU6A 3O03A 4ND4A 1VJ1A 1R12A 1DHRA 3V1YA 2BLLA 2DPHA 2O3UA 3H6KA 4J1SA 1YKFA 3WQQA 4IM7A 4QTZA 5CP8A 4B4VA 4BO5A 4AJLA 4WUVA 1VL6A 2V65A 4CQLB 2BGMA 3ZU2A 2BI7A 2VT2A 1NFFA 4PCVA 4L0QA 3BMOA 2OOSA 4YR9A 4W82A 4WCFA 3MTJA 4CR8A 2G1UA 2HAEA 4BKQA 1HF3A 5FWNA 4OQZA 3GN1A 2DBZA 2PKRA 1DO8A 1X15A 4TRJA 1IPFA 3X2EA 3GGGA 1EVJA 3HDQA 4HP8A 4H16A 4FGSA 3OSUA 3FNEA 4BVAA 1NAIA 3ROKA 2BGLA 2ZKLA 3QHAA 3GUYA 1ISMA 3LDHA 4CM1A 4O63O 5CDUA 3ZH2A 4OQYA 2H1SA 4FC7A 1DFIA 2X0JA 3PFWO 4CQLA 3E03A 1T1RA 1Z82A 5JAZA 4PLGA 3L4BA 1QYCA 3ZNQA 1ZMTA 2PA3A 5COAA 2JL1A 3UW3A 4ZQHA 3AFNA 1NM5A 1JA9A 5CDYA 4F46A 2NWQA 4OL9A 5A9RA 5ICMA 2NVWA 2WYWA 3RKUA 5EPOA 5GZ1A 1X14A 3DMTA 3E9NA 3MTGA 2GERA 2CVQA 1PTJA 1N92A 4BQPA 2A4KA 3ITKA 1FDVA 3WFIA 4DBZA 2E82A 3CSDA 4EYEA 4RF3A 3QRWA 4NH4A 4J4HA 5COQA 3OQ1A 4HX5A 4IINA 1HE4A 4O0LA 3WNVA 2O2SA 4RVGA 3GVCA 1MX3A 3L6EA 1OOEA 2AE2A 1KVSA 1KIFA 1H9AA 2Q3EA 3DO5A 4B7XA 1PGOA 5A1TA 9LDTA 5LDGA 2R00C 4CQMD 1ZEMA 1RKXA 1RPNA 4L75A 3WYCA 4PLYA 4CM7A 2CZCA 2GZ1A 3JV7A 4L74A 1HE5A 3MWDB 1EUDA 2NTNA 4II2A 2G82A 1JAYA 5T6BA 3DHEA 3RFVA 3RC7A 3DOOA 3N7UA 1NX6A 1C3VA 1BG6A 4NU6A 4XIYA 4MIEA 2AE1A 1LEHA 2CUKA 4NFYA 4D7AA 3NKLA 1OC4A 1GUFA 3KYDB 4QT0A 1YQXA 1JLLA 2Y68A 5H81A 3V1TC 1RJWA 3H9UA 1I33A 3KXDA 5TX7A 1R15A 4CV1A 3EZYA 3V2UA 1ZNQO 3ZWXA 4GBJA 4DQVA 2VQ3A 3LLVA 3M6IA 3WBBA 3RC1A 1DC3A 2WYUA 1X7GA 2X7HA 4DA9A 1WZIA 2J5RA 4KMSA 3DBLB 4H7PA 4K6CA 3E1KA 3AU9A 1Q7GA 4FQ8A 3CKYA 4W9NC 3GNTA 1H6BA 1RYDA 3DZHA 4Q3AA 3GVXA 3RFXA 3GNQA 4PGFA 3JQ7B 2C54A 5A04A 1O0SA 3JYLA 4YCAA 1VE9A 2VYVA 1T4BA 3KYDA 4B3IA 4YAIA 1YWGO 1R4MB 3PHJA 3ITDA 5A9SB 4EW6A 2Z95A 1NFQA 2X0IA 3T7EA 2JHFA 5IAAA 1ENPA 3OICA 4Z0TA 3QLJA 3FBTA 2EGGA 4Q39A 1EE9A 4KQWA 4L8VA 3C1TA 1E7YA 3VPHA 3DBLA 3ZNNA 2J3KA 3W6UA 3ADPA 5HA5A 4ALNA 1NVTA 1QSGA 5THKA 3P19A 2GPTA 4DREA 1ZSNA 2WD8A 3GR6A 5BSFA 3E82A 3JQ7A 3VDQA 1P1RA 2P9GA 1GYRA 4UUPA 5DOZA 3RBZA 3PIIA 1GD1O 4YT5A 1YBMA 2NSDA 4J6FA 3AM3A 4J90A 1GQYA 1R4MA 2Y1GA 4FOOA 2CD9A 3L9WA 3SJ7A 1PS9A 1V9LA 3DZKA 2W4QA 3OIDA 1NNUA 3JQEA 3OFSA 2DVMA 4DIOA 5DZSA 1PGNA 1V35A 2JD1A 3WDSA 5TT1A 5IZ4A 3RWBA 3ICPA 1SZJG 3CMMA 1J4AA 3JYNA 1U4OA 3RU7A 4JLWA 2VNAA 1GR0A 1F17A 4XR4A 1W8DA 2JCYA 3IOYA 1U28A 5I7FA 3VPSA 3K2EA 1FDWA 2CSUA 3HHPA 4GVXA 3GK3A 1VPDA 1SBYA 4PZEA 3V2GA 1F0YA 2NLOA 3LC1O 3PYMA 2Y1DA 4IZHA 1I3NA 3U9LA 3IP3A 1B0AA 4I5DA 1PS0A 5FI3A 3DAFA 1OFGA 4XYLA 1F14A 1BXKA 5F1PA 1YOVB 2V6FA 1N5DA 4L4SA 4RJTA 4YT4A 3WFJA 3H3FA 3WBFA 3RQSA 5U9CA 4M8SA 2VYVD 4NDNE 2IODA 3AM5A 4E30A 3K96A 3WMWA 1ARZA 3OF2A 4YT2A 3WXBA 1AUPA 2YDYA 4DLLA 3C85A 2VWHA 3K92A 3D5QA 1IHXA 3H5AA 3VZQA 1PWZA 3SEFA 2HJRA 1E3IA 4QQRA 4MVJF 2RH8A 4OGWA 2P9EA 2BF7A 2P4HX 4CLOB 3TDKA 1HYHA 3D0OA 4GVLA 3HDYA 1EUZA 3GFGA 4ZA2A 2QG4A 6LDHA 1AHHA 4P4NA 5CG1A 2DUUA 3GAZA 1KEPA 1LSJA 2I65A 2GSDA 4LGVA 1T2CA 5G0TA 1YOVA 4JIGA 2WMDA 1O95A 2XPCA 1PJ2A 4ZQFA 1QYXA 1ADFA 4BNZA 4YQYA 4DQXA 1UDCA 2DLDA 4BO3A 1Q0LA 4MJLA 4WLEA 3DC2A 1EDOA 4U8GA 1BDBA 1CQJA 4WK6A 2UDPA 2Y93A 3AM4A 3JCZA 3VVCA 4D79A 1D1TA 3K9QO 2HK7A 2TMGA 2IZZA 3OH8A 5IJZA 1X7DA 4E0BA 3PJDA 4TVOA 3IL2A 4NK5A 4CLOA 4CMGA 2NU9A 4XA8A 4D44A 1JKJA 3INTA 1EVZA 5K0ZA 2O4UX 5DNAA 1I3KA 1KEWA 2GN6A 3P7MA 4PN3A 1YVEI 4ZU3A 2ZCVA 3OJOA 3P2YA 3PTZA 3JQ9C 1LJ8A 5I9LA 4IY1A 5J23A 3GDFA 4MPDA 4Z3DA 5FYDA 2RHCA 3ZU4A 1PZFA 3IP1A 4Y9DA 2O3QA 1ZK2A 1DIRA 1YDWA 1VJTA 3K30A 1K6JA 3I3OA 2UUPA 1PS8A 3R3SA 2HMUA 1SB8A 5A9TA 1V3TA 3AOEA 4PLFA 1SNYA 2IEDA 3ZI0A 1GU7A 1EDZA 4ZQBA 4AJJA 2GN9A 4WECA 3VH2A 2NQTA 2YQ4A 1EBUA 1XKQA 4XDYA 8ADHA 3WIDA 3EYWA 5JAQA 1YE3A 1O89A 1J49A 4JJFA 4FFPA 4JP2A 3GC6A 3INGA 3LSYA 5TC4A 4IS3A 3KSDO 2W98A 1Z7EA 3VH1A 2DFDA 4MDHA 1HEUA 4KUHA 1IY8A 1DC6A 4FN4A 2A94A 3GVIA 1H2HA 1HETA 1PGQA 4E32A 4YEDA 2VNSA 1ML3A 3GHHA 3WSVA 2B4QA 1NYTA 3BMQB 5JC8A 5A3VA 4NIMA 1DRUA 1NWHA 1B26A 2GO1A 2EJVA 2X22A 3AU8A 4Z0PA 5JDIC 4BHTA 3ZW9A 3IS3A 2UV8A 1JDJA 3I4FA 4AJHA 1YDEA 1ZO8A 1J5PA 5L4SA 3AOGA 5A5EA 1E6UA 3G79A 1QRRA 3BTVA 4TKMA 5DBFA 4UVHA 1R0KA 4FJ1A 4RVHA 1Y7TA 1YXMA 2X1HA 2EGHA 3KYCA 3H7AA 3NGLA 1EVYA 3VKUA 4RF2A 3UN1A 1HDRA 4WPGA 2NV6A 1M6WA 1GYQA 4IQ0A 2B37A 2LDXA 4PLTA 1LC0A 2BMAA 4NBWA 4XQEA 1D4FA 1V3UA 3PQFA 4JBIA 3EW7A 1U4SA 1TLTA 2HMSA 3ZW8A 1GL3A 1F8FA 1BDMA 4ZGWA 1WLYA 2VUTA 1Q0HA 3BMQA 4BMSA 4LCEA 5JFOA 4FJ0A 4BL5A 5DCWA 3JQFA 3BYZA 1U8XX 5DF1A 3ZWMA 4MIYA 3OBBA 4TRMA 4XKJA 4Z9YA 4A27A 4HFNA 3PQEA 3GHYA 2H63A 1TB4A 3AFMA 1A4UA 3RIHA 1KY5A 4I5EA
chains in the Genus database with same CATH superfamily
1L4FA 3AYXB 2VR1A 3K6KA 5C8VA 3RRJA 3M5DA 3MLAA 4BB9A 1KDZA 4HWRA 1Z2DA 2DEUA 1DGQA 3WRXA 1Y8RB 4B9AA 3H5VA 2PKQP 3TTXA 3BFVA 2H4YA 1A4RA 3IBSA 3OZFA 4XQCA 4GSKA 3L7YA 2EGUA 3DBOB 4HAIA 1XYVA 2OCYC 3CXUA 1HT0A 2CWWA 3AHJA 1O87A 1TKCA 3RJ5A 3MERA 2FR8C 2ATXA 2DF8A 2XUAA 1A69A 1YR1A 3GJ6A 2C5BA 4P3KA 2UVPB 4KAFA 4EI2A 4YVFA 5BN5B 3KR9A 1W85B 1ZVMA 2FMIA 3SHVA 5B2EA 1EX7A 1UJ6A 1JECA 1T8UA 4REQA 5EJ2A 5FO0A 3C74A 1ML4A 4UJ3A 2PZMA 3CR3C 3FTDA 4C3OB 1Z4JA 4RACA 3ZVLA 2ALJA 2FPXA 4PHFA 4PLVA 1MFPA 2CHEA 4IJMA 1SQGA 1TIPA 3N2IA 4IVPA 3GJ5A 3T9FA 3VDXA 3B2QA 1S89A 2GN8A 4CMBA 1EZZA 1FXWA 1U2PA 1WA5A 1XPJA 2AWOA 1RCUA 3MWEB 1RLJA 2ENUA 4UHJA 3T7SA 4XVUA 2P7HA 2BLNA 3HACA 3KSZO 1Q1QA 4M9RA 2G72A 3CO0S 3GA0A 4HNRA 4GWGA 4EUHA 2LGJA 3BTUA 3IQIX 4TWIA 2WJIA 1Z0SA 4EMTA 4YRPA 4B40A 1XTZA 2RK4A 1G66A 2DR2A 1Z2NX 2QEQA 3DD5A 5F9FA 2OENG 3HXKA 2CY0A 1H1TA 1G41A 3KSUA 5FWXB 1Z5WA 3IC5A 4X0EA 3EGDA 4UEKA 5BMVF 3EWSA 3T5PA 1C8BA 1YS1X 1RM0A 2MINB 5CCEA 5ENZA 2Q9AA 4TKVA 4WOKA 2AEJA 3SHQA 2HL6A 3OETA 3NDRA 5C8YB 5IDWA 3OU2A 2QS9A 1BS2A 1TU4A 2RJ3A 2ZCUA 1N4DA 3RLFA 3CX4A 1CHNA 4S1VA 3TRHA 3UFXA 1A72A 5KCZA 4PAGA 2OV2A 3HPQA 4Q1FA 2QRZA 4PIMA 3HZOA 4BV9A 4DLSA 4CF7A 1BVYF 1JNXX 2Q4BA 2Q5HA 3RVJA 3WGLA 4A2PA 3SZ3A 1PJ8A 4GPEA 4NOMA 3ADCA 2VTBA 3LOQA 2NV2B 1EM8A 1XCOA 2XV1A 3BSWA 4XVCA 1QK3A 3C8DA 3I04M 3UJPA 2QAJA 3A6DA 4JAVC 4TVKA 4YGXB 5DGDA 1T8PA 1XDZA 3H13A 4Q48A 1UL1X 2I2FA 1NT2A 3PT5A 1NC1A 1P9OA 1KDVA 3U6BA 3WLRA 1R9JA 1N0UA 3K5WA 4GMXA 2P8SA 3M5CA 2JJ1D 4QDZA 1BEUB 1N6NA 1X7WA 2XHEA 2AK3A 3DNMA 3R1IA 5ELMA 5HEKA 4UTOA 1NJFA 1IUKA 2WU4A 4MRMB 3KQPA 4Q37A 1OU0A 3C15C 2F62A 4LRTB 5NLLA 1AHIA 1CY7A 1JKXA 1LF0A 1QGED 2YFQA 4PG7A 5EKDA 2PMBA 3T61A 4B2LA 2GYUA 1MA0A 4XR9A 1TD1A 4GXRA 4AKHA 3UUGA 1H6AA 1OPRA 3DO6A 2DECA 4NHEA 1NVEA 2A58A 4V2IA 4G85A 5ALYA 3V8QA 1TD9A 5LP6A 1SOVA 5A05A 3G59A 2Q6LA 1V9SA 5EMLA 3JQ6A 5F35A 1Q3TA 4E07A 2BGGA 4G4SP 7MDHA 1NN1A 2GJAA 2H06A 3DEFA 3M3DA 4BATA 4AKGA 4QRIA 4FJ2A 1VJGA 2GYVA 4MX8A 4N5LA 4S24A 3ZCXA 3BGWA 3A2KA 1QVAA 3AP2A 2ETXA 2YWRA 2JD0A 2CLSA 5JI3E 1Z17A 3TD2A 2HSGA 1RYHA 3VAYA 1F8UA 2F17A 2ZUWA 3SIPA 3LX8A 4V1CI 4RK1A 4FT2A 1XLUA 2EJBA 2IF0A 2NSLA 3AUTA 3EAQA 1MB9A 3KRTA 3MJ4A 1EZ4A 1I30A 3KOYA 4OOFA 4WZ6A 3WICA 3RCBA 4CM4A 3PDUA 3DWFA 1NP6A 4FKBA 4TV8A 1OXBB 2IOFK 2X0FA 3NATA 1L5ZA 4PSAA 2YV2A 3E9QA 5CFNA 1U0GA 5CYOA 1P1BA 1NTRA 3R5JA 3EG5A 4O4LA 4L0MA 1RP1A 5D1HA 3UAOA 1P60A 1ZCZA 2XVXA 3ZWYA 3P9RA 3H5TA 3H11A 4H2DA 4MKIA 1SQ6A 4LC9A 1JXMA 4KE8A 5AM4A 2BFMA 4P98A 2G0TA 1XROA 3HV0A 5E0KB 4CR6A 2GSWA 3AI3A 4MVJA 4XWYA 1XXHB 5AVOA 2A9VA 4QM7A 2H11A 2PUTA 3PX3A 3ZV4A 4U2DA 5CBPB 1TO6A 3LWBA 2FETA 3DAPA 4JKOA 2XIQA 1YFKA 2C5EA 5DX8A 1F5SA 4G4GA 1CUZA 5AHRA 3ZCTA 4CL2A 4Q19A 4MV9A 1LDGA 5E6RA 2V3WA 4ERXA 5JPCA 5K6AA 1M2FA 2Z09A 1B0PA 2VLBA 4PVCA 3SYKA 5AESA 2IL1A 1BX1A 1AC5A 1GYPA 1XZBA 2NUPA 3KQMA 1SXJC 3MS2A 4LNHA 3VZRA 5JNLA 1NNSA 3NM6B 4DUYB 1D4AA 2FXVA 4G8DA 1XVAA 2QUZA 3UCXA 3DGEC 3DC7A 4RS3A 5JBQA 3BMNA 3K0CC 2ES4A 3RYFA 1QE0A 2WTEA 1F51E 5LMCA 1WKVA 4QTXA 2C03A 3DBRB 1DRWA 4C6TB 3DKPA 5CIWA 1E0AA 1NXQA 2G9QA 3FJOA 2VK1A 1XMQB 4R84A 4MS4A 3CSUA 1M8KA 1Z7WA 4X7MA 1GQSA 5A5GA 2NT3A 2JHPA 4JA2A 1G8GA 3V7UA 2R6JA 1G7TA 2YIJA 3GLIA 1B6GA 2Q1SA 3K9BA 3UJ9A 1NBWB 1ZRHA 2L17A 4CDNA 3IIMA 4JGIA 4NBUA 4Z0HO 4BRZA 1CRPA 3TWOA 5C52B 2J7KA 1L5SA 3C6YA 4NQRA 2CCKA 1WU7A 1UOOA 2J8ZA 4KZPA 1RRVA 2D6FA 2WJ3A 5LLTA 2ZTLA 4DRZA 1A82A 2PWPA 1RTKA 1YVDA 3I32A 4UPEA 4D3XA 3OFNA 3IH5A 3NU1A 1T8RA 2V7WA 3E5MA 2RONA 5FPKA 1M67A 4EDFA 3DYBA 1Z2PX 4B7AA 3D3WA 1ZU4A 5JXGA 2PGNA 4LRQA 4EZBA 3V4PB 3L6UA 1XA3A 4IV8A 1E7WA 1PWEA 1D09A 3JQPA 3RIXA 4XWGA 3SF8B 2FX5A 1OWLA 2WSMA 1W4BA 4ZI5A 4A1FA 2COKA 4D9EA 4QT4A 2RGWA 3MINA 5JWOA 1JDBB 3QOFA 1L4BA 1UKYA 1WVIA 1BWRA 1Y63A 2Q0QA 5DKFA 3T4EA 2VQFB 4OXIA 1Z6XA 4HF7A 4R7ZA 3I1IA 2HRQA 1TZBA 5JDCA 4GPZA 1DRVA 4D3YA 1O0BA 2E1PA 2R60A 3QV1A 5CNKA 5D85A 5DBOA 4Q6WA 1YVUA 4ALJA 1FJXA 1QH1B 1PRYA 2IYEA 3QITA 5TT0A 4J4TA 2ZITA 5FCDA 1JW9B 1RIIA 4M1ZA 5KKCA 4R1TA 3AUXA 1S01A 4PZAA 3O8RA 3LDAA 4BZZA 1GRVA 1L5FA 2DR0A 2FPSA 2CUNA 1JQJC 1DBSA 3DVAA 4KR0A 3NASA 5SZKB 4BMXA 5JAUA 5F2KA 4Y9SA 4XIGS 2ETVA 2AHOA 4MROA 4WKPA 4C88A 3KQSA 4PHGA 4HD8A 1MLDA 5AVTA 3B12A 1AKYA 3M1YA 4FOSA 1HMYA 1KU6A 4LGYA 4ENVA 5IVPA 4YMUA 1QGAA 4RA6A 3NQ41 4JFRA 2LNDA 1RHUA 4BE9A 1ZHOA 3H19A 3A9SA 3FGOA 4FLFA 2CLEB 1UDAA 1IK6A 3LYLA 1TCBA 1QB7A 4PAQA 2HSWA 4NTZA 5JXIA 4NY1A 3AILA 3OT5A 4L72A 4BMVA 4UVDA 4CG1A 3NIBA 2P4SA 3IURA 3FCUB 4XLTA 1G8JA 1XLTA 2PLWA 7GPBA 1AXEA 3PRJA 2R65A 2PWYA 4F8JA 4YV0A 1TVMA 1NYQA 1N9GB 1RQPA 1UP4A 1XEWY 1L5YA 3C98A 3CUKA 3DFKA 2NO4A 4HWTA 4ABTA 2HBZA 3CUTA 3N28A 3OEED 4EJSC 1JEYA 4TWZA 1DOZA 1Y89A 1YS7A 1TZJA 1GAWA 2OK8A 3DPSA 4G1EB 4LZAA 4PLWA 3ZCVA 4BNFA 5ALFA 1HFWA 2OD2A 1P7CA 3B6EA 3QTTA 4Z9BA 4BGEA 2HJGA 2GCOB 4XD7D 2IV3A 1EK0A 2IXDA 2PKQO 1G59A 4P2BA 3LT2A 1SG0A 3GGPA 5TV2A 4DYDA 3Q85A 3UZUA 3RSGA 4EHDA 4GBGA 3K70B 2R1VB 4IKEA 1SOWA 3D7NA 3ZHQA 4HUQA 1HDZA 4JB8A 4BNMA 3CLSD 5DYIA 1SBCA 3TXYA 5HG0A 4QBTA 4F86A 2IS2A 2G76A 3KLOA 4TYMA 1U7HA 3GFPA 2I8LA 2J6BA 1QQAA 1Z33A 2LE0A 3VX3A 1DS6A 3AVPA 4AZ3A 3SZOA 4CUZA 5GIPE 5JASA 4O2AB 3HWRA 4KAXA 1KK2A 2W2OA 4IXWA 4OL0A 5IDQA 1OFUX 2RAUA 2HFKA 1CUHA 2O2GA 3LKVA 4DIDA 4FFMA 4N3BA 4J0FA 4JELA 1ZM7A 3ZZNA 2DCUA 2PH1A 1OB5A 4FQ7A 1C7RA 3VOAA 1CUXA 1ZGGA 2GRUA 1D3AA 2VEDA 4BTLA 3W0LB 2GLXA 1WXQA 3VR3A 2AD5A 2BISA 1RXEA 4NV0A 5J4HA 5AVUA 3L7AA 1XLVA 4PG6A 2IXGA 2QROA 8GPBA 4Z9AA 1UP7A 2FLWA 5EQFA 4ASUA 1UINA 1JWAB 2VFAA 5EL0A 1C4KA 3D64A 4N0EA 4FGUA 4HWKA 3VNBA 4TKLA 1TYCA 5DM70 4X1IA 1JFTA 2XNCA 2Y1WA 4LDPA 4EBFA 3L7IA 5I4BA 2DJ5A 3BVPA 1E3QA 2Y1CA 3PXEA 2C2MA 4NOKA 3RVMA 2HTEA 1G0NA 3OSZA 3UQYS 4UKDA 1KI6B 3ABRB 3DDUA 3OOHA 1YNOA 5KVQA 1PZNA 4BVBA 3TBKA 4DB2A 3UG7A 4GLOA 1I13A 4YI3A 2YZGA 1NF3A 4NMHA 5GZ3A 1TEXA 1IHYA 2FLVA 4QEZA 4ZHQA 3U3MA 2WIKA 3U61B 1HYBA 2GUGA 1L5NA 4LN1A 1NUHA 1QHHA 2XT6A 2JIZD 3JWEA 1AN9A 1F0KA 3Q0EA 3V48A 1OH7A 3C70A 3TNFA 1ESZA 1A8IA 1OFIA 2AHRA 2V98A 3F96A 3N8NA 1HG1A 1MEOA 4OQQA 5ALHA 3BL6A 1T36B 3I4LA 4R6WA 3ZE9A 5I8PA 3J7TA 3Q8KA 1T9ZA 3VU8A 1T34A 2E5LB 4BMYA 4H1UA 3EZFA 4AAYA 5B6JA 4PNHA 4BQEA 3THRA 1L7EA 1E1YA 4EUSA 4YH1A 2OVBA 2H4FA 1WHTA 1Q0QA 2FW9A 3TZBA 3SXUB 2WU3A 2FG7C 1N8SA 2O1XA 3CEHA 4MYUA 4M9QA 2J3DA 2D2VA 3KJQA 1FNSA 4OHZA 4YMLA 4TTVA 1I1OA 1UZUA 4I4TB 1FVOA 1YU6A 2ORWA 1KGDA 5AUOB 4G4IA 2K4MA 4NE9A 5FNZA 1WZCA 2HSZA 2P6UA 3LA8A 1B2LA 1U5CA 1FQWA 3NORA 4OYRA 5C8YF 1FBTA 3RVLA 1ZOLA 3HG7A 4UMEA 1IRXA 1JE1A 4BO0A 4OK3A 4B6PA 3R41A 1RVV1 2QBYB 4XIJA 2GRAA 4XRRA 3U17A 1W581 1MXHA 3MWKA 5GV7A 3HDVA 4G4SO 4PYMA 3WMGA 2JI4A 3GJ0A 2AG0A 1JHRA 3HGTA 1N0WA 3PGXA 3IQHX 4HNSA 4I36A 2G5CA 4ZAWA 3ZX4A 1XZQA 5A2GA 1UFOA 5DNWA 2QN8A 3A9CA 4W8OA 3JVVA 2JJQA 3D0KA 3KQQA 3P9YA 4HH4A 1DC7A 5CXSA 4HDSA 1CD5A 1T4DA 2A5GA 4H9GA 4R2MA 2BIFA 3WRYC 4MYHA 4WDRA 4PC3A 3T95A 1NLMA 4ZZ3A 1KMCA 1JTVA 3NKVA 4KXXA 4DJJA 3H6GA 1ZOOA 5L3ZA 1IBLB 1RKBA 1I01A 5EOVA 1JG4A 1V7ZA 1L5MA 3QP9A 4K46A 1O8CA 4QVGA 2VHZA 4ZVLA 3O3MB 4J9UE 4CMIB 2ZJBA 3BRSA 1SCBA 2ZYSA 4PBTA 1XWFA 2N1MA 5IC4A 4FYVA 2PS9A 4OJNA 2IEYA 2O0JA 3ANLA 5J3JA 3VYTB 1B1CA 4FFLA 4PIPA 3UK1A 2NUAA 5LLSA 5AVSA 2A35A 1DUIA 2O1WA 2Q99A 4OGGA 3HJAA 4PNEA 1DP4A 1GUYA 4CT4B 1Q12A 2Q8PA 1Z13A 1E1KA 2V5VA 3FSGD 4HO1X 4PRKA 3SOPA 1PWYE 1BCSA 3H8SA 4K6FA 1IZ7A 4KSBA 4HAZA 1E2BA 3VUFA 4HNTA 5BV2P 1BH6A 3IQEA 3AF3A 5FF9A 4RHYA 3AC0A 4RANA 5G0SA 5C5IA 4OP2A 2JAPA 3V8EA 1E9RA 4DL9A 2WWXA 4JBWA 1FPMA 1U2RA 1B8NA 2OLJA 1L5HA 3M0EA 2ISSD 4KACA 5DN6D 1A71A 1SEVA 3L6BA 3DLTA 5TVKA 3VNAA 3AJRA 4MQEB 4C0SA 1GNVA 1S3FA 3PPWA 3HEAA 1M10A 4XVHA 2ZQ5A 4UHEA 3R6LA 4IXTA 5BW4A 4YJFB 4X6XA 1V16A 1HE8B 1KORA 4LFBB 2VHWA 1LLUA 5HYVA 2JRLA 4Y0VA 6REQA 3D4IA 2Y4NA 3KEMA 1ZXBA 4ID9A 2HK8A 3GJRA 1PDVA 1KVUA 2OZPA 4O8ZA 4QNMA 4ZQIA 1OBFO 3O3OB 2FW8A 4CN8A 3AZOA 3IXQA 4G97A 4ER3A 1PEYA 1EBBA 3E3NA 4Q3BA 4AIIA 5KTMA 1ZUNA 3D6FA 1W96A 5I47A 4N39A 3IULA 3K0AB 4I55B 1AQUA 4LSMA 5B3JA 1I3OA 2HA6A 4MW9A 2I4RA 3H4MA 5DMHA 1F2TA 5EHGA 3T3EA 1C1DA 2IYYA 1C3XA 1GNRA 2OHVA 3NXSA 3X1JA 2HR1A 4QC2A 1L6IA 4BXOB 4R9RA 1U7ZA 5IJ9B 4HXGA 1LTHR 2PE5A 1BRTA 2AVNA 3FCYA 1NLFA 3LBAA 2Q5OA 4BNTA 2B6HA 3QH4A 2M2IA 3LC2O 4Q24A 3BHIA 3I9V1 3QVGB 4NBLA 4NENB 5H16A 1A9RA 4NBRA 1LQUA 2RDMA 4AO8A 3MTDA 3L0OA 4K2HA 5A3RA 4ZAVA 3M2PA 3A70A 3BHJA 5D3ZA 3NC0C 3FDJA 4KN6A 4KQ2A 2BHLA 1C30B 2ATIA 4MINA 4F2GA 5BR4A 2C58A 1LSUA 3F6YA 2YCLA 1AGNA 1FTWA 1X8XA 3I9LA 4KO8A 4KIUA 3CIFA 4L08A 2XMQA 1JG7A 3W4JA 4D3DA 3O38A 3UBMA 3FPCA 2O8FA 2ORYA 3WS7A 1XTSA 2ZSBA 4YJGB 1JIJA 4IDQA 4OIMA 1C1XA 4PRYA 4XDGA 2VA9A 5JCJA 1NPYA 3ZVNA 1JNYA 2NTJA 2OCXA 3GJQA 4KEAA 2ZI5A 4KIWA 4ESHA 3UCEA 3QW2A 3DCYA 2UUBB 2FOIA 3I05A 2JIPA 1YJQA 2LV8A 2VHQA 2R6FA 2FQWA 1GGKA 3T1YB 2XA9A 5CVDA 5JXJA 3TLKA 3KYCB 3Q5GA 4PO3X 3H2ZA 2WB4A 3TXXA 4CDGA 5DW0A 2R47A 3E8XA 2VAMA 1VPVA 1Y4DE 3X3HA 1S9HA 4E03A 3KYIB 3UAGA 3CWZA 4EM6A 1SCIA 4MVXA 3BHMA 2I2CA 4IYJA 2FFHA 5TS3A 2J3QA 1NVXQ 1M54A 4CIYA 4ZAXA 1GCUA 3IRUA 4HJXA 3UBTA 3B9BA 2FSHA 2BMJA 3KO8A 1SIOA 4YUAA 1NXSA 1I7PA 3IPRA 1MW9X 4TOIA 3SBDA 3TQIA 4HZUA 1FLAA 1CQIB 3S1SA 1Y98A 4FEEA 3L1IA 1O94A 5EP1A 2X5NA 4QPDA 3RT9A 2WOJA 3TTSA 1Z0FA 5DHSA 2ZB4A 5LB2A 4D4GA 1PJ4A 2NP6A 1ZXXA 4FYHA 5EMNA 3QVJA 4M86A 1GPUA 2HT6A 4HNGA 1L7RA 1SC6A 1OI3A 1Y82A 1IBKB 3MOGA 3AIOA 4ESEA 4ZREA 3TW0A 3PD7A 5LBTA 1AH2A 4AKIA 3QEKA 3QLVC 4EIWA 4EOGA 3WXMA 1AQJA 1ZGAA 3HFJA 2O48X 2QTCA 4ARVA 5EQTA 2JATA 3NDPA 3FZNA 3QIVA 5IJ0A 1R6VA 1RZ3A 1Z3IX 4KRYA 4R41A 1X7XA 4PINA 2ZIAA 5SZIA 2EIXA 2QUAA 2HDOA 3M83A 4OGKA 1XD2B 1N34B 2PR2A 1JFRA 1Y1SA 1L8QA 2V0NA 5K0TA 1IC6A 1E61A 3VV3A 4JN6B 2II6A 1ICIA 2XE7A 3STYA 2FUNB 1UKAA 3DDNA 1KZ1A 3DZIA 3N2LA 4UTVA 1YR6A 1PR9A 4OHMA 1B43A 1TPZA 2EP5A 1QV6A 4KLCA 4XI9A 5FH9A 3E0XA 3ZV3A 3TFOA 3AVQA 4N7JA 5FEUA 1CJVC 1K6IA 3EA4A 4URWR 3MEQA 3SBEA 4CM3A 3PLAE 2AXQA 3KVVA 3LCJA 4NCBA 2ZT8A 5KYGA 3EEOA 1XTIA 2CFTA 2QRGA 3HH8A 3G9XA 4Q01A 3RTGA 4OFBA 1LF5A 2XH8A 3CE6A 3S8YA 1XALA 1YF3A 1Q22A 3TQRA 4NLLA 4YJHB 4AJKA 2Z08A 1YQEA 2Z2IA 2BR5A 4WNYA 2Q9UA 3F1LA 5I7RA 5KS2A 2OQRA 3BGDA 5L3QB 3WIVA 1IZYA 2XB9A 2VT3A 2GJKA 2P3SA 1OH6A 2JA1A 3KR0A 5AJXA 2F8SA 2MYPA 4LHVA 1W2GA 3AEUA 4E22A 4PQEA 5TGDA 1NULA 3ZHYA 5IF9A 3N0RA 1CR4A 1GAJA 3WMFA 4AZ0A 3MSCA 1DRJA 2AEMA 1J7JA 1VKOA 3SYMA 2G5PA 1YE8A 5FA6A 1FSFA 5IDVA 1F60A 1UPAA 1ZSYA 4HQLA 1U8ZA 2Y2VA 3QKSA 1A9QA 1W88B 2GASA 1L7OA 5U4XA 1G5TA 1G5HA 1S8FA 5CXUA 3BA1A 4UNIA 1Z26A 2FE1A 4CMCA 4TYYA 4Q00A 3HM2A 1A96A 1KP3A 1NL3A 4BECA 5KDDA 3QYAA 3ZDDA 3P9PA 2EC5A 1QONA 4MA5A 4BNUA 4LJ8A 1T2VA 2OYSA 2C9BA 5LU8A 1L4UA 4Y2GA 4AJ4A 1Q44A 2P6OA 3OT1B 4G6ZA 2PGAA 3MJVA 1KY3A 1C0IA 1XR3A 2R6AA 4JVSB 4IHJB 4O2AF 4R16A 1ZOIA 4R9UC 4S35A 4AX8A 4MR9B 2QL9A 4FILA 2B92A 4DCPA 5A4KA 2O05A 4A4DA 2WQ7A 3KU4A 4FIDA 1H2XA 3BB4A 3PUWA 5LUAA 2QKYA 1WR8A 4G9BA 1U94A 4ZV9A 1OTYA 4LKOA 2DR3A 2I4MA 4MUAA 3JWGA 5EXXA 3WGHA 2D7CA 1R9GA 2BF4A 1T5BA 4U00A 3ZYZA 3N39C 2Q62A 4YNBA 1C5KA 3BSYA 4IHKA 5CLFA 5TQVA 3CZ5A 3Q3EA 1OLXB 1BOFA 3NYQA 1VDMA 4W5TA 4AO7A 3G9UA 1OKKD 4HQ0A 5TF0A 3ZD9A 1NIPA 4QU8A 4IGKA 2HXSA 4E15A 1TAQA 3KM0A 1V48A 2JGEA 4E5UA 5EQJB 1ECBA 3UJHA 4CT5A 2FVXA 1TQ8A 2I9KA 2ZW9A 3N74A 4QXQA 4A10A 1QOZA 1H0RA 1LUAA 3DAOA 1H0KA 3MRXA 3HS3A 3CZAA 3PUHA 4G1BA 2WTMA 3DM5A 3AHCA 2V7VA 4K81B 2AA3A 2AVDA 1E1LA 3JYOA 2QUHA 1KJ9A 5K4HA 1X1BA 3COWA 4LXQA 2Y92A 2BI4A 1TNDA 3GARA 1DDIA 3IQXA 3GMTA 4MB0A 4KQMA 1ADBA 3B5IA 5KC8A 2R8YA 4OJMX 2QUBA 3V1UA 1XZDA 3GJSA 4JLOA 1TT7A 4I4NA 1G21B 3K1AB 1J42A 2QN6A 3KJGA 2WVAA 3EVTA 3EAGA 4JLJA 3OZSA 4K6GA 2D5CA 1A9XB 1J90A 3FGNA 3HN2A 3X1YA 4ZOAA 1H3FA 4KBYA 1WEHA 4RK4A 3DEJA 5ICSA 4IMPA 4UHFA 1A4XA 2H2DA 1CRZA 5ABPA 1GU0A 2H0AA 4YAGA 4YRFA 1B3BA 1B6TA 2QZJA 4INAA 3OBIA 1KO4A 1QP0A 3C5CA 4IJUA 1QC5A 4NPCA 5IVDA 1Y3DE 2Q8QA 3M82A 1UM9B 3SZRA 4XPIB 4G67A 1D7AA 1C9DB 2R6CA 1P74A 4OATA 2DMRA 1JHZA 5EJ7A 2O3RA 4CKEA 1TW3A 4M0LA 4WN9B 5AM0A 3DEAA 5JTUA 4WLFA 2A9QA 2BELA 3HCCA 3KLNA 3DVRX 3OP1A 3GF4A 5LZ9A 5JD3A 4Y18A 5SYNA 3WMEA 4B3RB 1NQUA 3A1SA 4B84A 1AKQA 2OPBA 3I6IA 2XE4A 4G5XA 2WJ6A 1UBRS 1GZHB 1WQ3A 3CLVA 4GM1A 5H9WA 3CH6A 2BGJA 1JZSA 4GOND 5ARBA 3JARA 4JGGA 4JJGA 4F7WA 5HJEA 3ORHA 4M37A 1E1QD 3TKLA 2PQMA 5HFJA 1WG8A 4IZIA 1Y3IA 2AFHE 3VNUA 2SKDA 4KGZA 1GFSA 4JUCA 2V7BA 2NT4A 1SPXA 1U3CA 4YECA 3AUAA 3PRYA 2BYTA 4EEZA 5DHFA 1ORVA 3JQAA 1K3TA 3H97A 1CZUA 2OCGA 1X80A 4DV2B 2BN4A 4JR1A 1L4YA 2JBAA 5CB8A 3DV9A 2QTMA 2GZAA 3DBVO 1QKIA 1L5LA 1KYZA 2JFXA 4S1OA 1RQXA 4DXAA 4LKRA 4E5NA 1R6AA 1VSTA 5C81A 1FY2A 1VPLA 3HNOA 4LJRA 1KKLA 4D6YA 1EA5A 1AKMA 2OP1A 2WTBA 3NDIA 3CF0A 4DLWA 4F72A 2BGTA 1HDGO 3NFRA 3NIGB 4OHCA 5IZCA 3DZCA 4M6WB 3S1AA 3TYXA 2JRCA 4MMXB 4Z0NA 4ZHSA 1T0HB 2PSEA 3JRXA 2AQ8A 3IAXA 3RAEC 4PYQA 2PWZA 4UOQA 1SUCA 1QK5A 3OZCA 1JHXA 5I9MA 1AJEA 2EV9A 2SCUB 3KTAB 3VVMA 4ESVA 1F2DA 5KJEA 5IEJA 2RB4A 4G1CA 4QECA 5K8IA 6ABPA 2E48A 2E4XA 1Q1GA 2NYAA 2EIHA 3G85A 3PDIB 3PT9A 4G5YA 4RD0A 1US8B 5DP2A 1KFKB 3DFMA 4RTJA 1S02A 4LE2A 4PX2A 2F4VB 3TCXB 3SQXA 2OG2A 4PQGA 1GNSA 1OVGA 1PYDA 2GM9A 2JFGA 3L40A 4P08A 5TQ2B 3TBFA 1LDYA 4D9NA 1CFZA 3BJEA 5YASA 1EGAA 1UIMA 2PVSA 2ISCA 2WHEA 3D5TA 4G0NA 3GRKA 2GXAA 5TGTA 2YV1A 1V47A 3GH1A 5DI3A 1PJRA 4B6QA 3ZHTA 3KFXA 1YJ5A 3VO1A 5A0VA 2CVOA 1EXDA 1O6FA 4LJ5A 4CF6A 2FW1A 1U0LA 1DE0A 4YRKA 5CCXA 5CYPA 1XN1A 3MWLA 4FX2A 4I55F 3DE7X 3GQBA 3JVIA 3DZDA 3NIDB 4QO7A 3HJUA 3RRFA 1SXJA 4X3PA 3RDPA 2XDAA 5F1KA 4FYYA 4R0VA 4UEWA 3DOCA 3TS1A 4NE2A 2FWNA 2Q1XA 1RE0A 3A6KA 3EGCA 4Y1GA 3K0CA 1Y1TA 3LIPA 2V9CA 4WZAE 1AKNA 4NEGA 2RAPA 3VSCA 1W75A 3L0ZA 5KYWA 4RXUA 2FW6A 4XYEA 1JPUA 2F1RA 4QYWA 1WXFA 2PGJA 1MFZA 1YB6A 2Q2QA 1NVVQ 2FRVA 3CWCA 4GX1A 4L3VA 2DXIA 1JDBC 2DQKA 1TYBE 3B7WA 3ESRA 1LZLA 2ZSKA 4EY5A 1DQNA 3VR0A 3NUGA 1YBVA 3DLCA 3F6CA 1BMQA 4GEGA 1V11A 5GPBA 3SCZA 3PFGA 3LWZA 1G3IA 2FPIB 2WWIA 3G0HA 1PIWA 5H4HA 2VAWA 3ABOB 3HL0A 1K5GA 3C3BA 3EDQA 4LMPA 4TQGA 5ES3A 1IULA 4BTEA 2W2MA 1WCWA 4BV8A 4Z3OA 1U7DA 1ZSVA 1KNQA 4NZ9A 2IRWA 3D31A 1LPBB 4FR5A 1E2PA 4INPA 4PAMA 2X2PA 3T3GA 5EJ5A 2Q1TA 1WP4A 3DTTA 5ALSA 4ZRDA 5LQKA 2R6R1 2FX2A 3KYJB 3C6BA 3MGKA 4IHQA 3H2GA 3PITA 1J21A 5CW1A 4ZGBA 3ASVA 4KL8S 4D99A 5HTOA 2ODPA 5AW7A 1N2CB 1X7ZB 2HCBA 1ZX1A 2ID7A 5A6VA 2HMWA 1KL7A 1DQYA 2VSQA 2I7VA 3HR7A 3DGFC 2H2IA 3QBDA 4QDJA 3EGOA 3IAUA 5AH0A 5CDGA 5GIOE 4PE5B 4R9NA 4ZQEA 1DT5A 3WLQA 1ZQ1A 1EJ2A 1PL7A 3FLBA 3LGXA 1FUIA 3F5DA 3R3JA 2J5XA 1GDTA 5E0OA 1PL8A 5FEMA 1P3DA 2NTVA 3KQLA 1W4CA 1XELA 2J1LA 4NFSA 1BQ3A 2BR4A 2I3AA 3T3NA 1P0MA 2CNWA 2FEOA 2PGDA 3E9DA 1KMQA 5AXBA 4ILEA 2SBTA 4CM9A 1P0FA 3PP8A 2J9XB 3KE9A 4RV4A 3FETA 4E70A 3AJ9A 4E1AA 3CINA 5LWQA 1GZDA 2XSZA 4AMVA 1WXWA 4LRUA 2BMWA 3UKJA 4TVSA 1ITZA 1GKUB 1U2GA 3ZNPA 4BLRA 4YHHB 3RJMA 4KXNA 1HY3A 5IH3A 3TQQA 5CEFA 3T15A 1OH5A 1FLNA 3AG6A 2DHQA 2RMKA 4OXQA 2DZDA 2V1XA 4LBZA 4EI8A 5FTKA 4TMTA 3IUMA 4LSWA 1EAYA 2VZEA 4ND8B 4A26A 3OTOB 2WQ6A 4IF6A 1XBTA 4WOJA 2QOEA 4L5JA 1Y5LA 5CIQA 2IW3A 5IEBA 1ID8A 4BNJA 1E96A 1NF2A 3I01A 5DI9A 5CA0A 4CHGA 2FMTA 2B3DA 3M89A 4J7UA 4X65B 2QM8A 2L2QA 1UT5A 1YJ8A 2VDMB 3T34A 2FFBA 4PR3A 1QZ3A 2DTDA 1KSGA 3I1JA 1I3LA 4OHVA 3FYCA 1GPMA 3IESA 1DKNA 3QPBA 5HIAA 1YJCA 4ZOBA 5IT4A 3I8XA 5C7YA 5DCYA 4E1VA 3I5AA 1HUQA 1W4ZA 1XEWX 4L8GA 4I81A 1GGHA 2OUIA 2X8JB 5C35A 4NBNA 4AL4A 1S8OA 2J3HA 1OAOC 3H17A 1V5EA 3E22B 4RCZA 1PGJA 3NX4A 4L95C 3FCSB 4IEEA 1I4WA 2IY7A 3FGZA 3KT3A 2H1VA 3LY8A 3SKYA 4TXMA 1RQRA 3PJGA 1WB4A 1CEQA 2CHGA 3DKRA 3EMBA 4M9CA 4EJSA 1E3MA 1ODJA 4CMJA 2HRCA 2I55A 4WKCA 4UREA 3A14A 1WQ1R 2QLTA 3EOZA 3TCNA 3WAGA 1XNRB 2JGDB 3BXXA 4YDHB 4TLBA 2X23A 3ULKA 4YPFA 4RVFA 4TMXA 5HRCA 4OO3A 1NRXA 4BGVA 3KS9A 2PQ2A 1LRLA 5M04A 3EVCA 4DS3A 1LK5A 4PQYA 2MSDB 3PUXA 1ZITA 2P2CA 2CLKB 4TXJA 5ICGA 5J43A 4Z2AA 3ZJUA 3WMXA 1U80A 4O4HF 5AQEA 5THQA 1NE7A 2GJ8A 2GN0A 2QGNA 2G3YA 3PFHA 1SCUA 4IWYA 4JODA 3T9EA 4WFJA 2XBLA 4OF4A 2I2DA 5F3RA 4I14A 2LZ0A 2FWMX 1DQSA 1EU1A 1ZK1A 1WULS 2RIPA 1O6ZA 4E51A 4MRSA 1VLLA 1R0SA 3CUVA 3OIGA 2WD9A 2B4RO 4MKZA 4QODA 3AV0B 3V8NA 2FPPB 4E5VA 1XZAA 4NCAA 3MBKA 4HDRA 4WHMA 5AVXA 3RS9A 1P9WA 1YQWA 2GXUA 5AW5A 2IPMA 3COVA 3NHJA 5SY6A 3PKIA 4MJ3A 4IHJF 4A91A 3HADA 3AVWA 4QHYA 5H8WA 3ZXIA 1SVNA 2NO5A 3ZI4A 1QS0A 1WF6A 2O8VA 2W8BB 1KQNA 3EHDA 1MOZA 3USCS 4BRWA 3CF6R 1ORRA 3GLFA 1Q92A 1ZM9A 2V5UA 3GRCA 3H65A 3LZ6A 4A03A 5B6PA 4XOIA 3PC8C 3R40A 1L5QA 4JHXA 4AP6A 1TAGA 3ENKA 4Q47A 2L42A 1QPBA 2VP2A 1T8WA 4L07A 4RNCA 1MV8A 3OQNA 5IFKA 5ITWA 1TVKA 3ZHRA 5GADl 1TLLA 2MT9A 2YWDA 5JSHA 2CXXA 4ZKDA 3ED5A 3RUAA 3NP9A 5A9SA 4BFYA 3IQFA 2ZR9A 4QBKA 3DTVB 3CRQA 1FS5A 2QYTA 2GAAA 1DXHA 1VIVA 2O2HA 4D43A 4CIWA 3SHFA 4GH5A 2WR8A 1WVGA 1RWBA 3F6BX 4L22A 1E1RA 3TGLA 3QEOA 4G0XA 5FR2A 4L8WB 4D9MA 2FHSA 4RPCA 1VJRA 4MI1A 5D5PA 2W6MA 2R3SA 3IDQA 1X1AA 2Q07A 1FTQA 2QU7A 1QG0A 3GJXC 3LAWA 4HTFA 4UVEA 5FOQA 1Z0ZA 2VQ6A 3GRAA 4ZQCB 3UT0A 1WZUA 1UBMS 3HJRA 3IEUA 4XJSA 3HXQA 5J2TB 3IT1A 2BVNA 1VI2A 1E6EA 5HUQA 3BXHA 3KWMA 5JTTA 1CJCA 2OXFA 3E23A 1VHTA 1ZIYA 3QY9A 5BVGA 3O8OA 2IIPA 4CVNA 3FDXA 1FP6A 4ACBA 3ZDZB 4F3TA 2ZSUA 1Q7BA 1QYRA 3HA2A 3OAAA 5LWHA 1RBQA 2QHXA 2I8AA 1A9OA 3F78A 4OQ4A 2A7QA 4EA9A 4LC1A 5FAKA 2XMCA 2JCBA 3F74A 3V7YA 2AR7A 5AW3A 2C8JA 1JDSA 3Q2OA 1U7WA 3EMVA 1QYIA 3JALB 3QBVA 4JJ4A 3B38A 4S2UA 1REQA 2JLVA 3SFVA 1F6BA 1A8SA 3VH4A 2PHZA 2VDUE 2JEOA 3R7DA 1WB9A 1M6VA 3RO7A 1W29A 2XD9A 1WZNA 3ROTA 4E3ZA 5KC9A 3PWSA 2IIQA 3TCKA 3R0IA 4IDCA 4TTPA 5K3DA 1MGOA 1K06A 2EVWX 1UXKA 5FFFA 3U48A 1XCMA 3ZK9A 1CNFA 2NU7A 1G291 4OM8A 3F7TA 4CKWB 3PUKA 4BX3A 2Z5FA 5IUKC 3PUYA 3K9CA 2Q3DA 2QD3A 4UU0A 4YUZA 3IEKA 4YCBA 4RTSA 2HADA 2O3SA 3WRYA 3I8OA 1T9GR 1BMFD 1QG2A 3A04A 3JTEA 2MMCA 4M53A 5ILGA 3ZXUB 2XXAA 2J09A 3MNFA 2ZJZA 1BU8A 4JQOA 2QIPA 5F4BA 2FP3A 3FFBA 4JLDA 1L5OA 4FR0A 1BKDR 3GD7A 3QMPA 3LPAA 3AL3A 3D4OA 4NL4H 3MWGA 3P2OA 1Z6TA 3U3ZA 4EJ6A 1RYNA 3PPXA 2X40A 2ZB3A 4FB4A 3L4JA 3Q7RA 1Y7IA 4ZODA 5SV2A 2A86A 3UAZA 5AHOA 3QFFA 4A2CA 4P34A 3T99A 4LQ4A 4XGIA 1FP4B 3RTBA 1N8NA 3SAJA 1GPAA 1T0PA 1GDHA 3L92A 3MB8A 3NEJA 4NEQA 4C1BA 2H9IA 4QYIA 1UBLS 1FTNA 4LYGA 4HRVA 3OTQA 5BPFA 4ZOQI 1NMZA 5EPUA 5IT5A 4AY6A 1FX0B 4ZO7A 3R3WA 1IU9A 2EWMA 4NDZA 4YRLA 3EEFA 4C7XA 5IULC 3WRWA 2O8CA 3L5KA 1YIDA 2GD0A 1K75A 1MIOB 1NX9A 5KPJA 2DE0X 5H83A 3WK9A 4DSAA 5TLSA 2QD4A 2QV7A 2SKCA 1D04A 1Z0JA 1EWRA 2QRLA 3BXEA 1ISSA 2DG2A 1G20B 2O52A 2XYVA 1F7UA 2YFHA 2EERA 4QJ3A 2NTYC 4DG5A 3NBYC 4LJ7A 4YMIA 5K8UA 4FYIA 2IP4A 4FE7A 4IDPA 1Z45A 5DRTA 5K0EA 1ULSA 2EBUA 1NQ5A 2DFVA 3LVFO 3GRFA 3IRVA 4JENA 5IC6A 4UBKA 2I5PO 2C4TA 4F5YA 4Q3EA 1FCJA 2QMOA 3U80A 2IX3A 5BWCA 1WMFA 2ZRHA 2B4TO 2CYAA 3DTVD 2JI6A 2PH5A 1BS1A 2YXDA 3SM9A 3TQTA 1K5DA 1L9XA 2QJOA 3OIWA 5I5EA 4NYJR 4YP9A 1Z8FA 1UMDB 5FV7A 3L1JA 1NI4B 2RGNC 2FSFA 2VYFA 1XCLA 1G5FA 3GFVA 3LY5A 3KELA 4MVYA 1Y3FE 4YLEA 3R9IA 4LHYA 2IP2A 4AJ9A 3P9QA 8ABPA 2RG1A 4D6PA 4RLHA 3G2PA 2VDOB 2TMDA 3R09A 3WLJA 1BFKA 1Y4AE 2D0DA 2OKCA 2VDJA 2CXQA 3R7WA 4DJFC 2YUTA 2OV4A 3P97A 4MKGA 5A4AA 1H2WA 2B7CA 3AKYA 4UBLA 3U7EB 1SCQA 3KVNA 3RTDA 4QXPA 3FF4A 2J9ZB 3R8XA 3UJ3X 3IQZA 5B1YA 2OAQ1 2PZ8A 2HMTA 4BX9A 4DUGA 5J4KA 2GCPA 2FP4A 2ZBDA 2Y0EA 4KCGA 1E7RA 3O3CA 4HDKB 2F9FA 1C0LA 3HXTA 1EFTA 4JLSA