3U5TA

The crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from sinorhizobium meliloti
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
241
structure length
230
Chain Sequence
NKVAIVTGASRGIGAAIAARLASDGFTVVINYAGKAAAAEEVAGKIEAAGGKALTAQADVSDPAAVRRLFATAEEAFGGVDVLVNNAGIMPLTTIAETGDAVFDRVIAVNLKGTFNTLREAAQRLRVGGRIINMSTSQVGLLHPSYGIYAAAKAGVEAMTHVLSKELRGRDITVNAVAPGPTAVRDRFAKLAPLERLGTPQDIAGAVAFLAGPDGAWVNGQVLRANGGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
publication title The crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from Sinorhizobium meliloti
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
total genus 75
structure length 230
sequence length 241
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3u5tA00
4Q3BA 3ZHBA 3HG7A 3JTMA 5I9LA 3H7AA 4QFDA 5ER6A 5I7EA 4PIVA 3MJTA 5L53A 3IL2A 3IOYA 1DC3A 3H4VA 4GL4A 4O63O 4PGFA 4J1SA 5I9NA 2VNSA 2CDCA 3DR3A 5JY1A 3BAZA 4PLGA 4HFJA 4J0FA 1WPQA 4CMCA 4CM5A 2X0RA 4FIZA 1QV7A 3RFTA 4XRGA 1YB5A 4E0BA 3WQSB 4HUJA 4GMGA 4L9RA 4FJ2A 1ZJYA 1DIHA 2BGLA 3DB2A 3LU1A 4QO7A 1T2AA 2DPGA 1LC3A 1SB8A 1UAGA 3HB4X 1U3VA 4BNJA 3NYWA 2XOXA 3DAFA 2NVWA 1DC4A 1GD1O 1UJMA 1NXQA 4PG4A 3A1NA 4NFSA 4J1TA 4KWHA 4QUKA 1QYXA 4BV8A 5CDUA 4FB5A 4J43A 5BNIA 5MDHA 2FSVA 2PNFA 1IY8A 1O0SA 4E32A 4ZA2A 3RUIA 3I4CA 3H5AA 2E82A 1HT0A 3JQ8B 3L9XA 4YA6A 3BMCB 4P8RA 5G4KA 4BIIA 4NJOA 2R6JA 1SPXA 5JC1A 3RC1A 3D4PA 3DC2A 1LDBA 2GN6A 3VPXA 5EQFA 4BNKA 4W9NC 1D1SA 3H9UA 3GK3A 1H94A 2C54A 4PG6A 4J91A 1PIWA 4YT5A 1BTOA 5AYVA 4GQAA 1Z7BA 4J16A 1H6AA 3CINA 3MWDB 4MIOA 2VWQA 1H0KA 4B4UA 2JKVA 1O8CA 2VYVA 3GAFA 3JD4A 5F5LA 5CPBA 5JCJD 3EYWA 2UYYA 3UVEA 5A1TA 4GGOA 3LYLA 2JHFA 4BNIA 1Q2XA 4NR0A 3PHLA 4ROSA 2W8ZA 1E6WA 2O7SA 3FNEA 3JQCA 4CUZA 2CMDA 3RAJA 2NVUB 3G1UA 1SOVA 1HDOA 3WLEA 4LMPA 1DLIA 3P19A 3WB9A 1LLUA 2HLPA 1GU7A 4RPKA 4S1VA 1VL0A 3W4IA 1ZJZA 2JCVA 4EJMA 2VQ3A 1WWKA 3CMMA 4FC6A 4GKVA 3UCEA 4CR7A 4EJ0A 1UP4A 1X13A 4K26A 3WTCA 3KTDA 4XGKA 3K92A 1ZK0A 2CFCA 2I66A 4J1QA 4WLOA 3RUDA 1B2LA 4NJMA 1HXHA 2OMEA 3H3JA 5KJ6A 2YZ7A 1Z7EA 3ZV4A 2RCYA 3KEQA 2GPTA 3GNSA 2JAPA 2WEKA 1BDMA 4PG7A 1GUFA 1ZIDA 1WZEA 1ZMOA 4UUOA 5JAQA 5L4LA 1B8PA 5H81A 3OJ0A 3OETA 3I4FA 1HDZA 2HMWA 3EZLA 2HMTA 1A9YA 2GD1O 3D3WB 1MX3A 1H5QA 2GGSA 2JFGA 2QX7A 4CV1A 4JBIA 3QWBA 1YXMA 3TFOA 1IPEA 3DMTA 1R0KA 4E5KA 2GNAA 4CM4B 1LDNA 4A73A 3NTRA 1YQXA 2BFMA 2Y1GA 3ZNPA 4C7JA 4WEOA 4URFA 4UEOA 3N74A 2X23A 1PWZA 4TZKA 3RBVA 2YQ5A 1L1FA 1J4AA 3Q2KA 4BKPA 4Z0TA 1VE9A 2Q1WA 5HM8A 1NPDA 1DIBA 5FFFA 3FR8A 2W4QA 1UUFA 3PHJA 4IXTA 2AQKA 4I8XA 2EGHA 5KKCA 3WSVA 3DHNA 1J49A 4X54A 3WGZA 4HFNA 1DXYA 1BVRA 1ZXLA 3Q1LA 3S8MA 4ZHSA 1IHXA 1M66A 3WR5A 3DBHB 3WGIA 3WSWA 5IZCA 3JQ8A 2V65A 4E2XA 3BMCA 2B37A 3AK4A 1AN9A 4NBUA 4ZJUA 2EKQA 3B20A 3L6DA 4LISA 3SBOA 5B4TA 1LSJA 1KVRA 4EITA 2I9PA 1P1RA 3VZQA 4YAIA 3V2UA 1B3BA 1PS8A 3TZKA 4Y6SA 3E03A 5H83A 3PZRA 4WLUA 2PD3A 2ZB8A 5C7OO 1IPFA 5L7TA 1EVZA 3C1TA 1P0FA 2NQ8A 1ZEMA 1DOHA 3WQQA 3FPCA 4KOAA 5KVCA 4JJGA 4JBGA 4W7HA 4B3HA 3QSGA 2PH5A 4FFRA 3PHGA 2V6BA 4XDZA 3S55A 4PLHA 3BHMA 5CFZA 3NTOA 2NU7A 1LLCA 4A26A 3A4VA 2RIRA 4J49A 2VOEA 4EYEA 4I9UA 1VM6A 4UUPA 1PS0A 5HBRA 4B8WA 4ID9A 1KVUA 1PGNA 5I7SA 3GR6A 2LDXA 3AI1A 1T2CA 2IYOA 4FFOA 3LT4A 4CM1A 4MP3A 4XD2A 1GZ4A 3L6OO 1W6UA 3DHYA 5ENVA 4BL5A 1VL6A 3CUKA 3IKTA 2PTGA 3AM3A 3V1TC 2LDBA 2WYVA 3JQFC 4I5FA 4HXYA 1ARZA 4XQ9A 2CVQA 5TJ9A 4IS2A 2Y1EA 1IHYA 3D3WA 1U2DA 3JD0A 1TT5B 3KZVA 3PJDA 2X5OA 3ZHXA 5CDYA 3Q9NA 2FSSA 4CMEC 3HE3A 5FWNA 1SBYA 1T4DA 1ISFA 1NNUA 3RU7A 3DZBA 1N2SA 9LDTA 5A02A 1H93A 2WWRA 2RH8A 1H9AA 4I1IA 4J7XA 4RL6A 5KCZA 2A92A 3X2EA 1PS9A 1D3AA 4RVUA 1RM5A 3NGXA 3HSKA 2HMUA 2IZ1A 5U4QA 3GN2A 4DMLA 2XAAA 4Z0HO 3BTOA 1GQQA 1KEVA 1OAAA 4Z0PA 1I33A 1ORRA 1YL7A 2E6UX 2GCGA 1Q1NA 2VT3A 2JD0A 3JYNA 1EZ4A 2WYWA 4YDRA 3I9LA 5L4SA 3JYLA 2DBRA 4QFCA 4WGGA 2FP4A 3OIFA 5IXYA 2JAHA 2ZB7A 3AFNA 4YQYA 2O23A 1ZFNA 2DKNA 3FN4A 4Z6KA 4HWKA 4BO5A 1I3LA 2BF7A 3GDGA 4G2NA 4CV2A 4IQ8A 3JQ7B 3I52A 2P5UA 2Q1UA 4R9RA 5JDCC 4A10A 3DXFA 4CL3A 4DIFA 5JAIA 1M67A 3DONA 2VHWA 2X86A 3WGTA 3IUSA 4P4LA 1LSUA 5IAAA 4R68A 1H2HA 1DRUA 4HBGA 4MVJG 4ZU3A 3OICA 4D3DA 4YAJA 2O3TA 5IDQA 1HE5A 2W90A 4Y6RA 5IG2A 1ONPA 2DBQA 4M87A 4PVDA 2B4QA 3ZWVA 1RWBA 5DZSA 2EEZA 2C7VA 3NJ8A 2D59A 3DEYX 3DHEA 3H5RA 4CUJA 1O94A 5HTOA 1DDOA 1D4FA 4QTZA 1B15A 2VHYA 1E3WB 1E3LA 1D7OA 1XCBA 2D2IA 3DTTA 5LC1A 3SLKA 1EBFA 4I5EA 1Z45A 3AY6A 1XR3A 5F3RA 1CF2O 2ZYGA 4B3JA 4NMHA 3VH2A 5GY7A 4E5MA 1BSVA 1RM0A 2PZLA 2CDBA 4YBZA 1GL3A 3U49A 4BGVA 3PLRA 1KY5A 1YVEI 4E4YA 2ZQYA 5L4NA 4CLHA 4IJUA 3U3XA 1NAHA 2B5VA 1PGQA 3DAGA 4Q3EA 1I2BA 2FHSA 4DMMA 4FS3A 2P4HX 3NAQA 3JSAA 3ENKA 1QORA 2CUKA 2V6MA 4W7IA 1IUKA 1O95A 4MPDA 3ROKA 1C14A 2FR0A 2B5WA 1A7KA 4BO4A 1TT5A 2CDAA 1MXHA 4L76A 3GHHA 3E82A 1WZIA 3E5RA 5DT9A 1EUDA 1P1HA 2ILTA 2ZK7A 3ZWYA 3PI7A 4RF4A 3UN1A 1B8VA 2D8AA 3IAHA 3LC2O 1B8UA 5HA5A 3C3XA 4GKBA 3QW2A 5GZ6A 4DUPA 2GERA 1E5QA 2NWQA 3PYLA 5B37A 4LSWA 4OQZA 2BI7A 3HFSA 2J5KA 5T57A 5T5QA 1F17A 3NEPX 4A0SA 3IDSA 1DB3A 4NH4A 3EUWA 1PTJA 1MA0A 1DBVO 4OKNA 4Y6PA 4ZGWA 2UV8A 4BNMA 3GN1A 3OA2A 1V0JA 5L3ZA 1VRWA 5TNXA 4O6VA 3ZV3A 5G4LA 5C7IO 7ADHA 4TRNA 5JBIA 1WP4A 3CSDA 1W73A 1L7EA 2EV9A 2PGJA 4YQZA 5EERA 3CE6A 2VZ9A 1I24A 3MOGA 3VPHA 3LK7A 1I2CA 3P7MA 3JQ7A 2GO1A 1P1JA 2IZ0A 1VKOA 1CETA 3ZWXA 3OJLA 4C4OA 5T8KA 3LC1O 3AOEA 1DSSG 3E5MA 1HLDA 1VSVA 1K89A 2VCYA 3GA0A 2JL1A 4LMRA 2AA3A 4E2WA 1P44A 5G2OA 3DZJA 1XWFA 4GPD1 3UF0A 2DAPA 2PKQO 1AHIA 2GR9A 3EC7A 3TSCA 4BQRA 5A4DA 4FPXA 2FR8A 3VKVA 4XJSA 1FDVA 3L77A 4N5NA 5DOZA 4YJDA 3KSUA 5AXBA 1LDEA 1BXGB 1E3WA 1EK6A 3GEGA 4KMSA 1T2FA 3HHPA 1LNQA 2CF5A 1U4SA 1QLHA 4ONEA 1PQPA 2QG4A 1NVTA 4AFNA 1KOLA 5FYDA 3V1UA 4E2YA 1NQAO 4PZEA 4FJ0A 4TVOA 3P5SA 4B4OA 3BA1A 1UZLA 3WJAA 3GEDA 1B7GO 1VL8A 1QLJA 1Z74A 2VUSA 3PYXA 3O03A 1ADCA 1F12A 3RC7A 4D79A 2VUTA 3KOUA 3ITDA 2QW8A 4OAQA 4KTVE 3GGPA 2P2SA 3TPCA 1N7GA 2P9EA 2RHRA 1KEPA 3QRWA 3EVNA 4F46A 1QP8A 4UREA 4YJFB 4XGNA 1ADGA 3SXPA 1ZW1A 2EWMA 4BS9A 3V1YA 4L0QA 3UGKA 2CD9A 4YWJA 3L4SO 1P33A 2BD0A 2BI8A 2PY6A 4G65A 1WDLA 3FTNA 5F21A 1Y8RB 2O2SA 4HP8A 1F14A 1LXCA 1Y9EA 2JJYA 4R3NA 3O8QB 2EP7A 4CM9D 3HFGA 2RHCA 2FRDA 1KY4A 1I30A 2Q1SA 2WYUA 5AVOA 4DVJA 5TX7A 3RU9A 3OP4A 4AJ2A 4NBTA 3DBLB 4DWVA 4OXYA 1XHLA 3VZRA 3F1LA 4YR9A 3BTSA 4BGIA 2C2YA 5A9RA 2Q4BA 3E6AA 2OORA 1WDKA 3ZGYA 2O3SA 3RUHA 4RF3A 4ALLA 1N1GA 1EQ2A 3IUPA 3AOGA 2YDXA 4EUHA 2Z1MA 2AHRA 4R54A 1U7HA 3OIGA 5ILGA 4YT8A 1PU2A 3WX0A 2WMDA 2NU9A 3MTJA 5THKA 4E21A 1LA2A 3H8VA 5G0VA 3WMXA 1Y6JA 2NM0A 4XCVA 4R1SA 2HK8A 4M55A 2W2LD 3KVOA 2VWHA 1HYEA 3F46A 2PH3A 3OM9A 2JCXA 4CLXA 1IL0A 4M89A 4JNKA 4DBZA 3OJFA 1LDGA 4H16A 4PZDA 2EF1A 3DZGA 4BUCA 1VKNA 4OQYA 1EUZA 4BO0A 9LDBA 3GUCA 1GEGA 2Q45A 1I8TA 4R4JA 2DC1A 3T4EA 3WMWA 3L4BA 1WAMA 2GYYA 1ZSYA 2VT2A 1EMDA 5A03A 4D46A 1NTOA 3GZNB 4GX5A 1BXGA 2B0JA 4PLFA 5ES3A 2X7HA 1CQIA 4DQUA 4J3FA 4NPCA 4AJIA 2PD6A 3FPLA 2OBYA 3B1FA 3ZZNA 1HDCA 4RPJA 4YAKA 1DIAA 5L95A 1OC2A 2HO5A 2HMVA 3KYCB 2NNLD 3WNQA 4CLRB 3NGLA 1PR9A 1IYZA 1X1TA 1C1XB 1JU9A 1LTHR 4CR8A 1OC4A 3TN7A 1E5LA 3DBRB 4H3VA 1Y1PA 1RM4A 4OGWA 4ESOA 1MB4A 4ZQEA 1PQUA 1J5PA 4YJFA 1IE3A 4KTTE 1QMGA 4IDBA 3H9JA 4IGFA 5HS4A 3PVZA 4R51A 4U6QA 5A9SB 4P4NA 1B26A 1C1DB 1O89A 1Y8RA 3GMSA 2I3AA 2VTDA 3F3SA 4D0SA 1BHSA 1XQ6A 1SMKA 3O8QA 2J6IA 3FBGA 2Y66A 4CMEA 4K9DA 1ISGA 1CQJA 3OA0A 1V3TA 1YOVB 1ISHA 3DBLA 3OSUA 4JJFA 1A72A 1T26A 5CEJA 3D4NA 3OQBA 2Q99A 5IDWA 2B4RO 1HDYA 1R4NB 4XYMA 5ITVA 2PLAA 4PN3A 5ICMA 1FF9A 5DP2A 5DCUA 4A27A 2XXJA 4QECA 4IJWA 3TNLA 1SC6A 3G79A 3JQBC 4DXHA 3RWBA 2YV1A 3SC4A 1U9JA 5DCYA 1JA9A 1T1SA 1M6HA 2G5CA 3H5NA 3PPIA 2PD4A 2CZCA 2Q46A 4BNTA 4ZICA 4GAEA 1U3WA 2AMFA 1HDRA 1S7CA 3K96A 1MG0A 3ZNOA 2DUWA 3C24A 4NZ9A 2I76A 3ZWNA 2D5CA 3QWAA 4QSMA 1N8KA 3UCXA 3GVIA 3NJ4A 4GX1A 4B4VA 3QVXA 4LRSB 2PK3A 1PGPA 2EJWA 3LSYA 2GZ3A 5KOIA 1ZEJA 5JS6A 1WDMA 3ASUA 1XU7A 3QA9A 4W99A 2O3UA 4YRDA 3WFIA 2H9IA 1E77A 2JCYA 4OH1A 3ULKA 2OBNA 3GZNA 1PJ2A 3W8DA 4N7RA 2Y93A 1U5AA 1M75A 3GDFA 3DZHA 3GUYA 4MVJH 2VZ8A 1HE2A 1IOLA 2EXXA 2H1SA 4WLFA 4YYZA 4FW8A 3GY0A 3ONEA 3KYCA 4CLRA 2O3JA 3HB5X 3PK0A 3AUUA 5EJ2A 1C1XA 1LRJA 2Q2VA 4NHEA 4XB1A 4KUEA 1V8BA 5B4VA 2EJVA 3LQFA 3U0BA 4A7PA 4QT0A 4IMPA 1G0OA 4EUEA 3Q0EA 2OHXA 4GMFA 1JKJA 1YQDA 3DBRA 4HNGA 2VTEA 4OXNA 5DBGA 4WE3A 2QRKA 1PJTA 3M2TA 4XQEA 3TF5A 3KXDA 2AG8A 1DAPA 4NFHA 1OOEA 2ZTMA 5EMHA 3L9WA 3E1KA 3D5QA 4Q3DA 5A9SA 2A9FA 2WM3A 3BTVA 3U09A 1HWYA 5G0WA 1C1DA 5CDTA 1HDXA 1GUZA 2Q2WA 3PFFA 5I7FA 2NTJA 5JAZA 3FBTA 4MVJD 3B6ZA 4DIBA 1PJ3A 3EW7A 5BT9A 4B8ZA 3KM0A 3MCVA 4CM7A 1FDUA 1PR3A 1E3SA 1YOVA 2OUIA 3EK2A 3PEFA 3HN2A 1QG6A 2Q4EA 1HTBA 2EW2A 5COQA 3K8ZA 2VRCD 1CIVA 4B7CA 4CODB 5C7LO 1LSOA 3DZKA 5CDGA 5DCWA 1R4NA 1DFIA 4CUKA 4NBWA 2PA3A 4F6CA 5I7VA 4MVJE 5AXCA 3ZV5A 4ZD6A 1CRWG 3M2PA 4NG5A 4LVUA 5BSHA 1F8FA 1XG5A 4C7KA 1KS9A 4L75A 4YXFA 4DLBA 1LDMA 4II3A 3R3JA 3OEYA 3KSZO 3FF4A 1E92A 4CMHA 4W4TA 1E7QA 3F47A 3QY9A 1AXGA 1OBFO 3B1JA 1FDWA 3O9ZA 2GN8A 3VPFA 3WG9A 4NBVA 2B83A 3NDRA 1LC0A 4BQPA 4NNJA 1MP0A 4AJHA 3DBVO 4E12A 1VPDA 1Q7CA 3H9QA 1ZK3A 3FCOA 1LI4A 3TDKA 2HJRA 4WK6A 1ADFA 1ENPA 2E4AA 4LCEA 1EVIA 4O1MA 1GEEA 3JCZA 3OJEA 4MINA 2IE0A 1YBVA 3ZDFA 1K2WA 5ADHA 4PLTA 3WBFA 3WNVA 1H6CA 3RUCA 3I9OA 1VLLA 3AWDA 5IF3A 3D0OA 4LRTB 4GWGA 4R9SA 3U4HA 2X0IA 4B7UA 4OL9A 3RD5A 4WUVA 2DFVA 2Y99A 1PL7A 1TT7A 2GF2A 5IN4A 1JVSA 3AU8A 1FMCA 2O2YA 4RVFA 5BQFA 1EUCA 4PLCA 4BMSA 1UZNA 3KYBA 5G0UA 4L73A 3HNPA 2X58A 3FWNA 5TC4A 1QYVA 4U8GA 4AL4A 4GSKA 1IULA 1E1KA 1I5RA 3AU9A 4IJVA 1B16A 1E6EA 1EVYA 3SX2A 4RJTA 5KTKA 4GI2A 4FDAA 3NKLA 3S2IA 2OL4A 2QYSA 3C1AA 3RUFA 2VHZA 4CM9A 4PVCA 3D5TA 3TL3A 1T25A 2PKQP 2JHGA 3ETEA 4R3WA 3VOSA 3WXBA 3C7CB 3GZ4A 3JYQA 5JNLA 1VJ0A 4ALNA 1PZGA 1W4ZA 5A3VA 4BNZA 1MFPA 3O38A 2P5YA 3BMNB 2NVUA 4PFJA 5IN5A 3JYOA 2G17A 3ZV6A 1RJWA 4F45A 2E49A 4Z9FA 1MUUA 1LSSA 4BV9A 4JGBA 4BGUA 3K5PA 1PGOA 3OJOA 4WCFB 3AUTA 1YONA 4G81A 1KVTA 4D42A 1YQGA 2OGUA 3INTA 4YTEA 4EZBA 4IIVA 2AE2A 5CG1A 8ADHA 4IUYA 4UVGA 2ZTLA 4OJNA 3WJ7A 2SCUA 3MJ4A 3GQVA 2R00A 3Q3CA 4ND5A 2FY8A 3O26A 4BOYA 4JN6B 1JKFA 5JDIA 3TOZA 2DT5A 3D1LA 1YBAA 2W2LA 5IDYA 5CHEA 4XRRA 3NRCA 2H6EA 4LCJA 2I5PO 1QSGA 4RGBA 4GVLA 1Z6ZA 5A3JA 2Y68A 2J3KA 2G76A 4IQGA 3ROMA 5IJZA 1KEWA 3O4RA 4KQXA 5EESA 1NAIA 5BNFA 2DQ4A 4UEKA 5K6AC 2C59A 1X0VA 4CM4A 3ZWMA 4HV4A 5KWEA 2HCTA 1UR5A 1BVUA 2X9GA 3AY3A 1J6UA 3LF2A 1Y5MA 3S1LA 4YVFA 4GH5A 2DBVO 4FJ1A 3JQDA 3WWZA 2VZ0A 1IZ9A 4NK5A 3LT1A 5K9ZA 5KJFA 1XSEA 1H9BA 2XF8A 3Q6IA 4D45A 3GDOA 5BSGA 1PGJA 3VPSA 2IEDA 3ETDA 2EG9A 1SEPA 4BNLA 1EE2A 3IMFA 2UUPA 4MVJM 4RDHA 3IJPA 2BGKA 4XKJA 1HKUA 2X0JA 4ZQFA 1PQWA 4PLZA 4RZIA 5CEEA 4UAGA 3LZ6A 4WLEA 3OECA 5AQ1A 3LT0A 4D0RA 3ANLA 3DBHA 1NBOA 1GUYA 4XIJA 4E30A 3AUSA 1GYQA 1U2GA 3DAPA 3PLNA 1WLYA 4YJHB 3F1KA 4M1QA 3H9GA 2W98A 4DC1A 3RCBA 1E7YA 1X7DA 4IGEA 4OSOA 1JLLA 5JLAA 3RASA 4J7UA 3NT2A 3IKVA 3MEQA 4FN4A 3LDHA 3QVOA 2OOSA 5JPIA 3WGYA 3SJUA 3H9EO 1WVGA 3BMNA 4PZCA 3U4DA 3I83A 3ZWPA 4CQMD 4BO1A 2X0NA 1VSUA 3F4BA 1X0XA 4E5PA 3JD1A 2DTDA 4MVJP 4WCFA 2QZZA 2YQ4A 1WNTA 4CMIB 4XEHA 2BRUA 1XA0A 1NFFA 4DC0A 1E7MA 1HSOA 1Z73A 4IZIA 3VPGA 5I9MA 5U9CA 1PEDA 2BFOA 4MIEA 4BNXA 1YDEA 1ZO8A 2B35A 2DUUA 2NV6A 4XQGA 5DDIP 4DIOA 4LN1A 3UFXA 1DEHA 5U1PA 3K73O 3QQPA 3K30A 4RVGA 1PJSA 2BGMA 3DOOA 2V6FA 2YJZA 3OBBA 4JP3A 1E1NA 2A94A 4WCDA 1MV8A 3GGOA 2PZKA 3DWFA 2EIHA 4QO8A 3ICCA 3V8BA 4CV3A 3WWYA 5EL0A 1GPDG 1ID1A 3L6EA 4HX5A 4FGWA 4Y8VA 2D0IA 4AJPA 4WLVA 3I5MA 3INGA 1YGYA 4AJNA 5AXAA 3AM4A 1Z82A 4Z9XA 1XDWA 3IC5A 3K2EA 3ITKA 4LSMA 2PGDA 4XYEA 4DBVO 1UDAA 4FGSA 1TA4A 1R37A 1LQUA 5KIAA 1GPJA 4YRAA 1PSDA 5ER9A 1E7SA 2I65A 4IY1A 1U28A 1OMOA 1XYGA 2GN9A 4MP6A 4RVSA 4XX0A 1JN0A 3F9IA 1ZSNA 2X1HA 1ISMA 1RPNA 2AQIA 1QXSA 2QIOA 3C7AA 4R1UA 5CDSA 1ZCJA 2QRJA 3LLSA 3ON5A 4XYBA 4EGFA 2O50A 3GVXA 3ZWOA 4EW6A 1K6XA 2WDZA 3KUXA 4ZQHA 3VTFA 4YJHA 4CMBA 4LW8A 1V6AA 1I3MA 4RZHA 4NI5A 2AE1A 2C82A 4XR9A 2AEJA 5JO9A 1AUPA 3GEMA 4XQCA 1K5HA 2X4GA 8LDHA 1G1AA 4N5LA 3TWOA 4W9NA 4MKXA 1Y8QB 4MVJA 2WD7B 4RF5A 2IODA 1H6DA 4EBFA 2Q2QA 1LX6A 3DMTC 3VH3A 3QE3A 2A35A 4B79A 2O3RA 3NUGA 3KBOA 5L7WA 2RAFA 1XEAA 3DO5A 2VRCA 4I08A 3IS3A 4HADA 5EIOA 4JXKA 4BGEA 4IDAA 4XB2A 4J1NA 2YHUA 2VYND 2GLXA 4BB5A 1DJQA 1NQOA 4O0LA 2E48A 3OMLA 4CMIA 2P9GA 4IM7A 2FWMX 3UXYA 1QR6A 3GH3A 3BMOB 1UZMA 1F0YA 1P74A 1QYCA 3OEWA 3GVHA 4JIGA 1X15A 1TVEA 3EGOA 4DQXA 5TF4A 3TZCA 2HUNA 4YAGA 4K28A 4R5MA 4JQCA 2B4TO 3KLMX 4UULA 3ZW9A 3U4IA 1MLDA 2ZJ0A 1SO8A 4TQGA 3PQEA 1NHWA 3GPDG 5LCXA 1NPYA 3BHJA 4NDNE 4R01A 2ZYAA 2BFPA 5IZCC 4AJKA 3S2GA 3GFGA 5DN9A 3DQPA 3NDIA 3JV7A 2J3JA 2X9NA 1NVMB 4J9UE 3QJ5A 5COAA 3OQ1A 3KETA 3UUWA 1P1FA 2ZJ1A 2DFDA 4U7WA 3JQAD 3HDQA 1UP7A 1VJ1A 4ZRNA 5GZ3A 3ZHZA 1LRKA 4TROA 1DIRA 1NX6A 3CEAA 2JFFA 4XDYA 1HSZA 4CMJA 1GADO 1NP3A 1SB9A 4FR5A 4BNGA 4Y9DA 1K6IA 4J4TA 3K6JA 1GZ3A 1WW8A 4KQWA 4E33A 1K0UA 4KDFA 2IXAA 3ENNA 1NYTA 3GOHA 3FSRA 3PFWO 5BR7A 3CPSA 4BKUA 4E2ZA 4AJLA 4MJLA 4TKLA 2IEBA 4MKZA 4UVIA 2VNAA 4ND4A 1SCUA 2DVMA 4IDFA 3TZHA 1N1EA 4WNIA 4CM8B 1JAXA 2WJPA 2NQTA 3FNHA 1P1IA 2FZWA 1NPTO 1O9BA 2J5QA 2Y67A 4HKTA 2XXBA 3I6QA 4OIMA 1ZK1A 1UXGA 4GLLA 3ST7A 1LBEA 1V3UA 2BKAA 2HQ1A 4HFRA 3ZH2A 1X1EA 5I8WA 4GSLA 4R1TA 4AJ1A 3WLFA 2J5RA 3EDMA 3VZPA 4GX0A 4CQMB 3STHA 3KYDB 3MJVA 1Y8QA 1U3UA 2FZEA 2WD7A 3RQSA 4BO8A 2GRAA 1HE4A 1TB4A 4EEZA 1GFSA 3DL2A 1Y81A 1RM3A 3ANMA 5FEUA 2ZTUA 3FRJA 3U4CA 5CP8A 3T7EA 1ADBA 1E1MA 5L7YA 3WGGA 4ALKA 1KEUA 3MWEB 2Q50A 3OHSX 5A05A 4AJEA 2EERA 5A06A 3FNGA 3VDRA 1EBUA 2BELA 3WFJA 3COSA 5F5NA 1EFKA 5JMPA 3QVSA 4B3IA 3BMOA 3PHIA 4EUFA 3GPIA 3I1JA 5IFLA 4N18A 4FQ8A 5JW6A 3KB6A 2V6GA 1ISJA 1BW9B 2ZCUA 3RSHA 4U5QA 1TEHA 4IIUA 1BMDA 3L0DA 4NU6A 5THQA 1I3NA 4WKGA 4R69A 3CZMA 1M6WA 5EQDA 3EZYA 5F1PA 3R1IA 1H6BA 4RV9A 3NDJA 3JQFA 3CXRA 2JD1A 1GAEO 3ZWBA 1Q7GA 1HYGA 3H65A 3F5QA 4TMFA 1E3JA 4PRKA 4ZRMA 4YRBA 5A04A 3DOCA 4CLEA 2CSUA 3UCFA 4DA9A 1QKIA 2YFQA 4UVDA 3I23A 3Q2IA 2HAEA 2HMSA 1NQTA 4R5HA 4BMNA 3RKRA 4MDHA 3H3FA 1P77A 4GBJA 4CLDA 5JYEA 3FR7A 4TRMA 3VZSA 3MJCA 4ND3A 4P4GA 2EKLA 1PJCA 1U8XX 4TKMA 2C20A 4IXWA 3M1LA 1KETA 5T64A 1HDGO 4TSKA 1HZJA 2Y0EA 4OYRA 2I3GA 2VHXA 2GUGA 5JSFA 3V2HA 2R2GA 3W6ZA 4AICA 3GRPA 2DPHA 4DQVA 4WJZA 1VI2A 1XLTA 3PJFA 2C5AA 1Q0LA 4CM8A 2HRZA 3HUDA 3HQ4O 3QLJA 1EDZA 3TL2A 3X2FA 5JO0A 1ZZEA 2QYTA 3RUEA 2C0CA 3PIIA 4KUHA 2WD8A 3CMCO 2GASA 4FD3A 4EEXA 1Y7TA 5ENDA 1T4BA 1E7WA 1HYHA 2Z1NA 4MOWA 3Q11A 3BTUA 5KJCA 4L74A 4RQTA 2YFHA 2QQ5A 1DC6A 4W6ZA 1B14A 4TRJA 2ZQZA 1NASA 3ZHYA 3LVFO 1R0SA 4CQMA 2JFHA 3GG9A 1FJHA 3KYDA 3NT5A 4U6SA 4L4SA 2DU8A 3P2YA 2IYPA 3ZNQA 5KNLA 2A4KA 1HF3A 4XZ3A 3DFUA 5JDCA 3MJSA 3V2GA 4IDEA 1F06A 3RC2A 1UDCA 1A5ZA 4S3MA 1MFZA 3A14A 4BNHA 2FMUA 4XIYA 4XYLA 3IJRA 3WGQA 3RROA 1LLQA 4KP7A 1BRMA 4U0JA 3B70A 1KYQA 4WPGA 1LJ8A 2PV7A 4Z3KA 4AG3A 3AFMA 4XA8A 3VVBA 4RPHA 1KERA 3I9MA 1W8DA 1PZHA 4CJXA 4B4WA 2ZTVA 3BYZA 5B1YA 2PWZA 4XYGA 3RKUA 4OOFA 3N58A 1EQUA 3ADPA 4ND1A 4O5OA 1BW9A 4BNVA 3LLVA 4E5YA 3FWZA 1YS4A 3JQAB 1WXDA 3JD2A 4CLOB 5KVSA 3HN7A 3PGJA 4NQZA 1R4MB 1CERA 4P22A 4RPLA 5HRUA 4M49A 3IP3A 2Q3EA 4KWIA 2CNBA 3PZBA 3QWIA 1ENYA 1UXIA 2ZB4A 2HSDA 3LT2A 2Y05A 1A4IA 4NK4A 2IRWA 1SOWA 1DPGA 1QYWA 3CIFA 3PDJA 4FFNA 4OO3A 2Q1TA 2P68A 1R15A 5T8KC 2Y1DA 2OO5A 3AOEC 1OZAA 1R12A 4PG5A 1JWAB 1EVJA 2J8ZA 1J0XO 4KUGA 3GG2A 5AOVA 4TWRA 4RLSA 4D44A 3DMYA 1JVBA 2PKRA 4IINA 1C0PA 4OM8A 3AY7A 3ZWCA 3AJRA 3D3EA 1Z75A 3S2FA 5G0TA 3QWHA 2C29D 4ALMA 3VH1A 2C7GA 2UUOA 3PJGA 3HDYA 1DFHA 1IB6A 4DL9A 1AHHA 3EY4A 3ASVA 4H15A 2ZKLA 4GX2A 3WYBA 5IDXA 4UVEA 1E7RA 1ONNA 2J3HA 1HE3A 2HKIA 2PGLA 4BO9A 3DTYA 4QX6A 3W6UA 2EGGA 3LF1A 3D64A 5A5EA 4RPGA 2NVBA 3VKUA 3VHRA 2EW8A 3PXXA 4MP8A 4NBRA 1E1LA 4UUMA 4JK3A 2YDYA 1D1TA 1WMBA 2HRBA 2WE8A 4IZHA 3U5TA 1G6KA 5KJ1A 3QIVA 2DTEA 4IBOA 4L4XA 2NU6A 3GVPA 2WE7A 4FC7A 4OKIA 1ZNQO 4Q9NA 4WEQA 3TZQA 4BO6A 3DZFA 1PJLA 4WOKA 3K31A 5GZ1A 4LVCA 4Q39A 1ZKMA 4DREA 3C8MA 1CWUA 2VYNA 1A71A 3M6IA 2CF6A 4JX8A 4MIYA 3ZW8A 3PGXA 5F1KA 2ZIZA 5CG2A 3G3EA 1N92A 1R6DA 1I3KA 2YHIB 2ZCVA 1ZSVA 3TOXA 2YY7A 4DLAA 1JQBA 2I99A 4D3FA 5TIIA 2GZ1A 1D8AA 3ZU4A 1T2DA 3P2OA 3PJEA 1ENZA 3E48A 2IXBA 2PZMA 5DOVA 5IZ4A 3KEOA 5GMOA 3U9LA 3GLQA 4H7PA 1DHRA 3U62A 3JQ9C 3R3SA 2HK9A 1K6JA 3EVTA 4YJGB 3RJ9A 4R41A 1R16A 4JP2A 4GGPA 2F00A 5MGBA 5EINA 2O4UX 4IMRA 2OXIA 3ZCXA 3JQAA 4CLOA 1F8GA 1R4MA 3VDQA 5B4UA 1LUAA 1DLJA 2DTXA 3GAZA 4BNNA 2Y0CA 3SVTA 2NUAA 3GNQA 3WICA 4W82A 5JYDA 1E6UA 4JBHA 1P9LA 2W2KB 4YACA 1U5CA 2VHVA 4GLOA 4CL8A 1SZJG 1SNYA 3VC7A 3H2ZA 5KKAA 1YO6A 4YT2A 3KV3O 4M86A 3ZWWA 4RO0A 1GQ2A 4KDEA 1UXHA 1U4OA 3AM5A 3GC6A 4CMGA 4D3SA 3HWRA 2GSDA 3HADA 4FCCA 5DP1A 3ADOA 4PRLA 4AJJA 2V7PA 3L07A 5JC8A 2Y0DA 4HY3A 4ZQBA 1DAOA 1T24A 4JLWA 3L4BC 1DRVA 2OP1A 3MOIA 4YB8A 1B3RA 4XR4A 1EE9A 3G0OA 4BNUA 1UH5A 4FSHA 2D4AA 3PIDA 3AUAA 4IPTA 1Y5RA 4DGSA 1YL6A 2B69A 2EKPA 3PYMA 4R1NA 4UVHA 1NR7A 1OFGA 2VWPA 3BHIA 2AEFA 4N54A 3GT0A 3K9QO 2G1UA 1I36A 3RI3A 3UKOA 3QP9A 5L40A 3BMQB 4FFPA 3ROQA 3GGGA 1OI7A 4WASA 1S6YA 2RH4A 2G0TA 2BLLA 3FTPA 5HS6A 3W1VA 1A9ZA 2FPIA 1FXSA 3I6IA 4J6FA 3C7DB 1A27A 1SEVA 4I5DA 1U1IA 1YH3A 1MGOA 1GCOA 5CEFA 2AQHA 4E13A 1QYDA 1K3TA 2VRBA 4EDFA 5LDHA 4CMAA 1L7DA 4LGVA 4BO7A 5C37A 2BFAA 2NTNA 3UICA 4E5NA 1PJQA 4J4BA 5I8ZA 4OOEA 3HJAA 3W4JA 3CKYA 2GDZA 3HDHA 1PL6A 2ZB3A 4J7CA 2YHIA 3R6DA 1I0ZA 6LDHA 1YB4A 4BKQA 1JAYA 5FI3A 1GYPA 1C0IA 1HETA 1UXKA 3RC9A 3DDNA 1UP6A 5TGDA 4D43A 2PZJA 3NTQA 1KVSA 4D7AA 4CR6A 4F6LA 3KRTA 4HNHA 3I3OA 1BDBA 1ZVMA 4IQ0A 4QQRA 4YJGA 3PHHA 2O7QA 3I9NA 2I6TA 2IDZA 3UHAA 5L9AA 1CDOA 4XJTA 1CJCA 1DO8A 3PTZA 4BNWA 3D4OA 3PQFA 3E18A 5T67A 4GWKA 1JKIA 1LU9A 3GNTA 2D5AA 3QVTA 4M54A 2WSBA 3RBZA 3G49A 1T1RA 2POQX 1YL5A 2B36A 3WS7A 1KC1A 4A5OA 3IQDB 4AJOA 1V35A 5ITWA 2O48X 2O4CA 4RORA 1YDWA 3GRKA 2W2KA 5B12A 4IS3A 3TQHA 3MZ0A 1Q7BA 3ONFA 4Q3AA 2HU2A 1EK5A 2FR1A 3EAGA 1P1KA 1RYEA 4JROA 1PZFA 4GVXA 1N9GB 5JAMA 2PR2A 2X9VA 4DLLA 4LK3A 5L51A 1NR1A 3ZI0A 5JCXA 3GFBA 1U7TA 2NLOA 7MDHA 2WTBA 4E31A 3WGOA 2DM6A 4BKOA 3PRJA 2UVDA 1HRDA 2ZATA 6ADHA 3E8XA 3D7LA 4PLYA 1NFRA 1TLTA 1QRRA 3WDSA 1YJQA 2QRLA 4MKRA 1GTMA 4INAA 4TVBA 3ZU5A 4DYDA 2O3QA 5JMWA 1E3IA 5DBFA 4ILKA 4Q3NA 1FDSA 5C3MA 2G82A 2YUTA 4IDCA 2GZ2A 5CPFA 5TT1A 3BMQA 2TMDA 3UH1A 1E0DA 1DHTA 1N7HA 3QHAA 1GQYA 2HJSA 1DFGA 3KHUA 3R0IA 4YEDA 4CM3A 3FHLA 2Y1FA 4WECA 5FI5A 2BHLA 3PWZA 3JQBA 2AG5A 2IZZA 2NACA 3ZU3A 4BB6A 4A2CA 2P91A 4ALJA 2YYYA 3BIOA 3ETGA 3WIEA 4BMVA 1BG6A 2C5EA 3A9WA 1SAYA 3HDJA 1RKXA 3KLPX 4ZVVA 1DC5A 4BO3A 3K2BA 4Y98A 2GN4A 1QV6A 4I9NA 4J2HA 5TRTA 3WTBA 4O59O 1GYRA 3EMKA 4II2A 3UW3A 4ALIA 1GDHA 4IDDA 4OHUA 5JXWA 1NWCA 3GVCA 4B7XA 1LQTA 3ROPA 2YV3A 4UUNA 1MXFA 4M8SA 1PJBA 1C3VA 4K6CA 1BXZA 4N5MA 4FFMA 4K6FA 2J3IA 4XGIA 5A5FA 1P45A 2VYVD 2VUUA 1NHGA 4CV0A 1ML3A 4DYVA 4G5HA 5ILOA 5FF9A 3KO8A 3F6YA 4A03A 3BZUA 1E3EA 3FNFA 1AXEA 3WIDA 5EPOA 3BXXA 2JD2A 1TI7A 4OMUA 1ZMTA 2AW5A 5JFOA 3SEFA 4ITUA 1XQ1A 4WLNA 1YJ8A 3ONDA 4MO2A 3DFZA 2FPGA 4BO2A 1N5DA 4RCVA 5BNTA 1ZK2A 1O5IA 3E9QA 1GZ6A 4XWYA 3FD8A 5T6BA 1EEHA 5IXSA 1PZEA 2D3TA 3V5NA 4DTIA 4J0EA 2FOIA 4ZN6A 1YB1A 5TS3A 2YV2A 1GV1A 3RBXA 3SLGA 3VTZA 5JCJA 3RFVA 3ZU2A 1A7AA 2BMAA 2P4QA 4NFYA 1N9GA 3GF4A 4L8VA 4EI2A 4JCOA 5F1OA 4RVHA 1R0LA 2OZPA 4DRYA 3QWFA 2I67A 4TZTA 3SC6A 3SJ7A 1EFLA 1UXJA 1ISIA 1JDJA 4CQLB 1VC2A 4I9HA 4U0KA 3TFQA 1X7HA 3OIDA 2EHDA 1MC5A 2VOJA 4J4HA 3JQEA 3CTMA 3E9NA 1PJ4A 4L4RA 4PLWA 5A9TA 4FOOA 4JJIA 2P9CA 2Y1OA 5L45A 2X8LA 5DNAA 4CM6A 4FFLA 3ZN2A 1YRLA 3WOHA 4AJ4A 2CVZA 3TZ6A 3A06A 3WGHA 2Y1CA 1ZBQA 2CVOA 3ZNNA 1LDYA 3JD3A 4YT4A 2DLDA 5KVVA 4Q3CA 1ONOA 4FOSA 4J90A 4CPDA 1CYDA 2ZYDA 1CEQA 1MC4A 5TSDA 1I32A 1V3VA 1XIVA 3NV9A 3MJEA 1IZ0A 3AW9A 4BVAA 2XPCA 2EP5A 3VAZA 1H2BA 5H82A 1PX0A 4J9VA 3RUAA 1I2ZA 5JY6A 2X6TA 1C0LA 3W8EA 3NT4A 1FK8A 1G0NA 2Q49A 3WYEA 1Q0QA 1XU9A 2NU8A 1X14A 5TJHA 2RBEA 3FI9A 2FN7A 2X5JO 1NVGA 1KIFA 3H6KA 2AXQA 4RDIA 1GV0A 2AQ8A 3RVDA 2NSDA 1V9LA 2UDPA 4EJ6A 1LEHA 1GCUA 5EN4A 1HL3A 5CAEA 2H5LA 3OFSA 1NFQA 2ET6A 1VJTA 3ICPA 1DIGA 1KVQA 4OXKA 4YPOA 5COBA 1P31A 3WYCA 4IJKA 4MVJF 4PLPA 5LDGA 1NWHA 2PFGA 2OP0A 1P3DA 1EDOA 3ORFA 1YE3A 5DF1A 2R00C 1AGNA 3JQGB 1ZH8A 2CY0A 2QZ9A 4WOJA 3ZWAA 3DZIA 5ICSA 1U8FO 5C5IA 5JDIC 4WNCA 2HK7A 3JQ9A 3F5SA 4HFMA 4MVJI 4PG8A 3EHEA 1XELA 3INRA 1YKFA 4Z9YA 2YW9A 5TQVA 1MG5A 3A28A 3OH8A 3PWKA 4DPLA 1UAYA 4NU5A 3C85A 2F1KA 3AI2A 1M2WA 2X5KO 3T4XA 5J23A 1Y9AA 4QEDA 2HDHA 4DPKA 2VN8A 2UAGA 3OQ6A 2C2XA 5KVQA 1BWSA 1JWBB 1C0KA 4P38A 1LLDA 3CZRA 2AEMA 2NTVA 1B0AA 1ZK4A 3G1TA 4TRRA 4Z3DA 5TT0A 5HWSA 4RLHA 1GY8A 1HEUA 1UDBA 3PDUA 3UOGA 1BGVA 1Q0HA 1I10A 4FBGA 2BH9A 1NM5A 2Z95A 4CQLA 2FPPA 1T2EA 4BHTA 1U3TA 3W4KA 5DULA 2DBZA 4K1LA 4RQUA 3RJ5A 1XKQA 4E6PA 3QVWA 3ANNA 3MTGA 4YAEA 4BNYA 5DBIA 3VVCA 2OFPA 1TXGA 2Z5LA 1I01A 3IP1A 5AXDA 1W0CA 1ENOA 4PCVA 5KJEA 1ZUD1 3TJRA 1YBMA 2C07A 3QV1A 3KSDO 1ULSA 5K0ZA 4BNFA 1X7GA 1YWGO 1NQ5A 3W8FA 3WBBA 3PWSA 5BSFA 5JE8A 1ULUA 4AVYA 1HZZA 3PQDA 3GMDA 1P0CA 1ZXBA 4RVDA 1KBZA 1KC3A 1R66A 5G4KB 3RIHA 3I9KA 3OF2A 2X22A 4RF2A 2D1YA 3PP8A 3LC7O 4E3ZA 3WQRA 4J2OA 4CMKA 1AE1A 5K6AA 5TLSA 3ABIA 2E37A 1PWXA 5G0SA 3VH4A 1GR0A 1HLPA 2TMGA 1JW9B 1M76A 3H2SA 1O6ZA 4YCAA 3GHYA 4F3YA 4Y67A 4R16A 4D41A 4WCFC 5BSEA 4ND2A 3F4LA 1XGKA 2H63A 1FDTA 2NADA 3G17A 1JTVA 1WMAA 3UAGA 4ZQGA 3Q9UA 1A4UA 4DPMA 3TRIA 3DOJA 1BXKA 3JQGA 3NX4A 4IDGA 4NIMA 4OSPA 3RFXA 3N7UA 4KZPA 3B1KA 3AI3A 1RYDA 1LRLA 4NJMB 1PL8A 4QXMA 3HZZA 1DJNA 3JQ6A 3IIEA 4I5GA 3CH6A 4UEJA 1DRWA 3S2EA 2VWGA 2QHXA 3C1OA 3E9MA 3M1AA 3T7CA 3I9JA 4BKRA 4PLVA 3JYPA
chains in the Genus database with same CATH superfamily
1MAUA 2HNKA 4Q3BA 1PR5A 3C8DA 2PU5A 2GCOB 2X77A 3WLHA 2B34A 2B99A 2OR3A 4DADA 3THWB 3RR2A 3A7EA 4ARUA 3EGCA 4PIVA 5LR6A 1JPNA 1X7YB 1DC3A 3MUOA 1YZQA 1M0TA 4FHEA 2HN9A 4PZ9A 2H31A 3DR3A 3BAZA 3Q8KA 3CWQA 4YJ2F 5A6SA 4HFJA 2XB2A 2X0RA 4FIZA 5FWDA 1U0JA 4D4JA 1I4WA 4XRGA 3FTFA 2WTEA 5T3YA 2AXNA 4A8PA 4E0BA 3WQSB 4AMGA 3ZW7A 4GMGA 4FJ2A 3ABQB 3FRHA 4I1YA 4LRUA 4ND7A 4O8CA 5HP4A 2DSNA 5FOQA 1JFLA 4X92A 1SJ9A 1T2AA 3RV4A 1YACA 5IM5A 1UEIA 1JL3A 1LC3A 2HUPA 2PT9A 1U3VA 2XOXA 3OOYA 4NH0A 4ENTA 5EHXA 2V5VA 2NVWA 1DC4A 1D8TA 1E4VA 3R5HA 1NXQA 4NFSA 4ER0A 4QUKA 1ES9A 2JGAA 3OU6A 2WJHA 1PR0A 2A5YB 1J9EA 1L4NA 4J43A 3JRXA 3QELB 5ICEA 2OV8A 3DJFA 3GQBA 2Q4OA 1W85A 3A31A 3G2NA 4G37A 2PUGA 1A77A 3H5AA 5FORA 2E82A 5MF6A 2V1UA 5DKFA 1E5XA 5AK4A 5EZYA 1RAEA 3D0QA 1XXHA 4N0DA 1LCIA 3DWEX 3ZZ1A 5ALSA 1SPXA 4JYZA 1OZ0A 2JJMA 2JZOA 4ECEA 2O0MA 3SYLA 2GTIA 3VPXA 4G86A 3JASA 4OQEA 5JASA 1HPLA 3P4XA 2ZT6A 4JXXA 4BLTA 4J91A 1V71A 4K9NA 1DWPA 5HJ5A 4HQNA 3I01M 1VKHA 1RQPA 1XPUA 2B3DA 3C8HA 4BJHB 3VKGA 3CINA 1XMIA 4PS0A 2HBZA 4BLUA 1QPZA 2C2GA 1OX4A 5JJCA 1RDFA 4O5AA 4Z4IA 3H16A 2BSQA 5EPUA 3UVEA 4P0PB 3M6UA 1LD3A 3BXZA 4OHVA 1FP4B 3A9UA 4JELA 3RFUA 3RTGA 2XKKA 3HCAA 4LJ7A 4ROSA 1E6WA 5CH8A 2O7SA 2Q07A 1QHHA 3FNEA 4CQNA 2CMDA 3M3PA 3ADDA 1O5OA 1VLHA 5JCOA 1IZ7A 3GJ3A 4LMPA 3WLEA 5FV4A 1Q11A 3CNOA 4FNAA 2HLPA 3SS9X 4S1VA 1VL0A 2ZETA 3BICA 1ZJZA 2NU7B 5HHTA 4AKTA 2AS0A 3CMMA 4GKVA 4CR7A 1XZEA 2GZRA 1RXUA 2JIRA 3IFSA 2D1FA 2FEWB 1ZUHA 3KTDA 1TQ8A 5H9VA 1QBGA 4BAZA 1ZK0A 4Q05A 1GTVA 2RC5A 1JHAA 2V7UA 1B2LA 2HBRA 1E2MA 3AJ9A 2VR1A 121PA 5BSRA 1KR2A 4P7BA 1C81A 1GUDA 4OXIA 4RETA 4ZCQA 5KJ6A 1RC8A 1Z88A 1BXRA 4GR9A 3NDBB 5IK2D 5IBPA 2RCYA 3KEQA 2H0AA 5IXJA 2VHUA 1NJFA 1GUFA 3FWHA 4ZTBA 4D3XA 1TJ5A 1NQUA 2DWQA 2H2AA 4MAAA 3H9BA 4FYKA 3H7IA 4S1OA 5JAQA 3OETA 1AGXA 1LPSA 3I4FA 3EVZA 4UTRA 3ZVNA 5KTPA 3LS2A 5F3DA 1D2AA 1Z6AA 4B7ZA 2VP5A 2ZSBA 4I4IA 3N8KA 2ZRDA 4KV9A 2GK4A 1NNI1 2IF0A 1GGHA 3OM0A 5DWDA 4JBIA 2H7CA 3IAM6 3K94A 2CL6X 3QWBA 4O4JF 4Z51A 1YXMA 3TFOA 4E11A 1R0KA 1PQYA 4E5KA 4A73A 1Z5NA 4V0QA 4HB0A 1JR3A 4EEKA 2HREA 2Y1GA 1KIAA 3RO7A 5AKHA 4AUKA 2HHLA 3JR7A 2V7XA 2ATXA 2OXRA 1C8VB 2QTMA 3G2PA 3LBNA 3RBVA 3I30X 2DUNA 1XQXA 3RBAA 1TIBA 4KAJA 3BD8A 2W6JA 1UPXA 2JANA 3ONWA 2JK1A 2FE1A 4I1VA 4Z0TA 2ZUWA 3T4PA 1UBUS 2YWCA 4XI9A 4RV5A 5HM8A 5HUHA 5K03A 2O0JA 3COYA 4E09A 2W4QA 4OREX 4D8VA 2GBCA 3K71B 3PHJA 4IXTA 5BWNA 1P5JA 2F1HA 3QPAA 4MB6A 4I8XA 4R81A 1JZSA 4OHBA 4N1AA 4TYNA 2FPKA 1J49A 4X54A 2RH5A 2O14A 1R0YA 3VSEA 2M98A 4NMWA 1BVRA 1ZXLA 3Q1LA 4JJ6A 3S8MA 1U7UA 1XVIA 2FP4B 2ZRKA 1IHXA 4BQQA 1KTIA 1LZKA 2WA2A 1PKEA 2FX2A 4BVJA 1MO3A 2Z8XA 3WGIA 2YFKA 1ZI9A 3ICEA 3JQ8A 2XOKD 4Q4JB 3BMCA 4D9CA 3AK4A 2ZOSA 5AJTA 2F64A 3SBOA 5B4TA 1EPUA 3DUFB 4C3UA 5EGSA 4WZAA 1KVRA 4MUEA 1KSHA 5C8ZA 3ZGVA 3R40A 2F3QA 2Q6OA 4ZP1A 4RK5A 3SVZA 4YNBA 1ZMXA 4OAOA 4I2NA 4Q5IA 2FZ5A 3VZQA 2W6ZA 3TZKA 4YAIA 4Y6SA 5B58C 3AERA 1N3YA 3ND9A 3HYLA 4C0SA 3PB3A 5H83A 3GEPA 1ODKA 5C7OO 3GUZA 5KU7A 3QEMA 5CM8B 4YUVA 2OFFA 1L7MA 5L7TA 3VHXA 1KH1A 2NQ8A 4AYXA 1EINA 3WQQA 1Q16A 4KOAA 3L2OB 5GINE 1BA3A 4URXR 1EJ6A 4KJZA 5DTQA 1AKWA 2GOYA 5KAMA 4KI7A 1J42A 3CNNA 3QSGA 3UJHA 1Z06A 3EGDB 3U1VA 4PEVA 2CDRA 1BHJA 2DWOA 4I3FA 3AFGA 1C8LA 4O4HA 3NTOA 4CCYB 2D5IA 4A26A 2OCXA 3A4VA 4XSHA 4AN4A 4X63A 4DB4A 1Z6PA 2GBIA 2H9YA 2VOEA 4HQOA 1VM6A 2XYVA 3BL6A 1J0AA 2O8FA 4EHHA 5DHRA 2R1ZA 1GKLA 5I7SA 1XBTA 4BX2A 3GR6A 1AB5A 1THZA 3L93A 2AN9A 3HCBA 4OUKX 4GXNA 4B81A 2FEMA 4RYDA 5IJ9B 3K16A 3CG0A 3L6OO 1W6UA 3L4EA 4NV3A 2MYNA 1CFJA 3CUKA 3L7KA 5TMBA 3AM3A 3V1TC 2LDBA 3QPCA 1IHDA 5A3RA 5AOAA 3JQFC 1W29A 1QIGA 4I5FA 3IOMA 2PWBA 3LL7A 4XQ9A 4D82A 1XTPA 1PSWA 4QVIA 1NVFA 1OB5A 2HJ9A 2RGRA 3O3NB 2WSSD 4RSGA 1QTQA 4NAVA 3H5LA 3T8YA 2ODAA 4IS2A 1NW3A 1EFTA 2PMCA 4M37A 1YCGA 3W9UA 1V37A 2D1RA 4HDRB 1A2BA 2ZYRA 3JWJA 1SKUA 1SUFA 1XX6A 3BWBA 2GXQA 4GPTA 4PSDA 1RRFA 2X5OA 4WH0A 4W5HA 3I4LA 3UO8B 4Z1MA 1DGQA 3Q9NA 4R1MA 4DJJA 4MRRA 1N5OX 3D0KA 2FDRA 4D92A 7AT1A 2NZYA 2NZVG 1SBYA 1L8OA 5B2EA 4IVNA 3D2LA 5A02A 3FSGA 3NHSA 1MW8X 3KPUA 4J7XA 5KCZA 3H5WA 4UTVA 4TKVB 1DAGA 2B1GA 5REQB 1ZIPA 1RM5A 1F1BA 5GOZA 1K5PA 1GL6A 3H04A 2VPTA 3REQA 3W5IA 2AI3A 4ENSA 1BC5A 4Z0HO 1I5EA 2JLCA 1CHNA 1TZ2A 3IXQA 1OAAA 3AHHA 2GK6A 3OZBA 3C39A 1X80B 4YAFA 3SC2B 1I33A 1ORRA 5TMPA 1YL7A 4RELA 2QROA 1IK6A 4OLJA 7GPBA 1A8IA 4MI9A 1MVNA 4LZAA 4GD3Q 4BJ3A 2ZJAA 2CXPA 3UKDA 3VYWA 4QE3A 4KFSA 5IABA 4Y1RA 3CRMA 3QEOA 5JMTA 1UJ6A 4EPWA 2JAHA 2AK3A 2PUDA 3CW9A 2ZB7A 4ZQIA 2R4TA 1DBSA 3REGA 4Z86A 5LXTA 1JXQA 3ISJA 1T6NA 2HJGA 2ODTX 2NOAA 4IQ8A 3EDCA 3JQ7B 1RMTA 4HB3A 4G5RA 4F21A 2CBZA 5F77A 1VHTA 1RWMA 3DONA 3WGTA 4B48A 3AKYA 4QDJA 1UBGA 2QYHA 5KX5B 1DRUA 5CCXA 1T5DX 3LHDA 3SP1A 4P82A 5KYNA 3L8HA 3RFCA 4OPMA 1LFDB 4BFCA 3ECAA 5KPJA 5IDQA 1L4UA 2AOUB 4AQDA 4HNAA 5D00A 3Q98A 2WT8A 4R0MA 3EAQA 2EEZA 1DPFA 2C7VA 4Q1FA 3BX1A 3DEYX 1VKRA 1WD7A 4W1PA 3DVAB 3NDPA 1ZISA 3BQMB 4QTZA 3U31A 2XDWA 3ECSA 3U3DA 1E3LA 4U39A 1XCBA 4QZVA 2D2IA 2M9MA 2O5CA 3KR9A 3NHMA 2RHMA 3AETB 3AY6A 1ZHOA 5CT5A 1VZ2A 2Q9CA 1WZNA 3VAAA 4OKSA 4B3JA 2DB3A 2CXRA 4EPRA 2RHDA 3LRPA 2PZLA 1UJ5A 2V74B 3HWSA 3JXEA 4EI9A 2XKAA 2O1EA 1GL3A 1Y3CE 1YB2A 3KOYA 3PLRA 1N6RA 3A6DA 3B9PA 4N3NA 3U49A 4YCLA 1O0BA 1N2GA 5JS1A 4JJZA 1JBKA 5L4NA 4MR8B 4IJUA 3K0SA 1IWOA 1PGQA 2WBLC 1L5LA 2WQZA 3HRHA 3OMXA 5EP2A 2CUKA 3TFWA 2J0EA 5DN6D 1IUKA 1O95A 1R10A 1SHZA 1XDSA 1JG4A 1C14A 2AJCA 2IHBA 3S5JA 3VSAA 3WYGA 2PUBA 3T3MB 4BO4A 1TT5A 2CDAA 3P9ZA 2FVXA 2PL9A 4F3RA 2VDPB 5BN4A 1E2JA 1KOFA 1MABA 3TQSA 4RY0A 2JB9A 3OC6A 4NZOA 4TTRA 4URHA 1E9BA 1SPBS 3W34A 2Z57A 1FJGB 1XQ9A 3M5DA 4TX1A 3KWFA 1OBHA 2HLNA 3HSYA 3O1JC 4OQPA 2A7XA 5TMDA 2QN8A 4CU5A 1X8JA 2R8EA 4MPTA 4TL6A 4KQKA 3UN1A 1FTYA 4GE0A 2ZBGA 1CRZA 3MQFA 3U37A 4E5SA 5EMMA 1CEYA 3EVAA 3IVXA 3T9CA 4ZPXA 3QW2A 4YGXB 5K8IA 2DECA 2P3QA 1E5QA 2H18A 3U7RA 4JLPA 1G3MA 4NYIR 1TKRA 3HXTA 3PYLA 4S04A 3FETA 5KQLA 2BI7A 4RCZA 4TTAA 4QULA 4LFCB 3R5JA 5D3MB 2OBXA 1DB3A 4NH4A 4O4IF 2BUAA 5LZ2A 1GILA 3IDOA 3OIVA 4IHQA 2H7VA 3OC0A 5LDDC 3UC5A 2R6GA 4LA4A 2FZCA 7ADHA 1ODIA 3RSFA 1KEEA 3KQHA 3VOAA 4ENRA 2N75A 4UM8B 4FZ5A 4ZYVA 1QV9A 3BGDA 2ZYIA 4YQZA 5H3HA 3RYFB 3LC0A 4DCCA 1I24A 2EGUA 2C3MA 4UEQA 1OX6A 3VPHA 4H7KA 2NU9B 4AO8A 1VHQA 5DSTA 3PPXA 4REOA 2HI0A 2QVCA 1U9CA 3VTAA 3X3HA 5CD9A 1BS2A 2QR5A 2C2BA 2AMVA 2IOFK 3SBXA 1DSSG 1Z62A 3ZD9A 4C4OA 1VSVA 2Y4NA 2VCYA 4YMGA 3GRUA 1WZ2A 1E1QA 5B1DA 1L8AA 2QR3A 2AA3A 4UCFA 3EYAA 4O2AF 4DABA 3DV0B 4KQHA 1VPTA 2R7LA 2QNBA 5JJKA 4GE3A 4Z4EA 2I8CA 3NCHA 2J5XA 3TG8A 2EL9A 4KNWA 3DMRA 2I62A 3KJZA 2GR9A 1JLHA 3EC7A 1XWIA 2J4FA 3KKZA 5A4DA 3MT0A 4RD4A 5U4XA 2JH3A 2PH1A 1FDVA 2WWIA 1T5SA 2ZI3A 3VKVA 2IX9A 3H5TA 2GJKA 2IDKA 3FB1A 4MUBA 3S0JA 4F6RA 1CQPA 4BE4A 2VDWB 5KPDA 1NXWA 1CQIB 1TYAE 4MEJA 1QLHA 1PQPA 1NVTA 3PXDA 1B41A 1RP1A 2P9TA 1Z5ZA 1ADJA 2QV0A 3QUSA 4N03A 4OA5A 3GCWA 3VNSA 3AYXB 1VGRA 4FJ0A 5LOVF 2FWBA 4B4OA 1DEXA 5EQJB 2GHRA 3BA1A 2EW1A 4UM9D 3THSA 5KYWB 1N6IA 3IVAA 2BHRA 1HFEL 3OURA 3EC2A 2H2HA 4IWNA 3RC7A 4CL0A 2VUTA 3KOUA 4DIEA 1ZDMA 5TPZD 3L8DA 2QW8A 2CMGA 2P9JA 3ZCTA 1D9ZA 3HJNA 3RHFA 2P9EA 6PFKA 1OE0A 1KEPA 3GL9A 3PC8C 3QRWA 3HB0A 1N8NA 3RIMA 1E9SA 1YULA 2QGZA 2UZ0A 5E1MA 4FMCB 5BPHA 1XHEA 4XGNA 3HB1A 1XRRA 4BS9A 3ENWA 3ZHRA 2EKDA 3W5DA 3PFIA 1G20B 3W9SA 1W1UA 4YWJA 3W0LB 3FJYA 4GM1A 4BMOB 1AXRA 1SCBA 3L4SO 3CT4A 4OHWA 2JKYA 3THYB 2GJAA 5CLGA 3EB9A 2I4NA 3FF1A 4HP8A 2PUVA 1PDVA 2WG1A 2FFJA 3E5HA 2FZKA 2DF8A 2EP7A 2LV8A 2MSWA 3E3LA 4FILA 2GQ0A 2C9DA 1KAOA 4FXOA 1DEAA 4Q00A 4AIIA 4XVCA 2FRDA 3TNDA 3BSYA 2F8LA 5CLLA 3VJKA 5FOSA 1KXJA 5TX7A 3VI3B 1UWLA 2X0EA 2CK3A 3L43A 1MOQA 2P78A 3KNZA 1CUXA 1XHLA 3PNKA 1BOFA 2I03A 2ORVA 4OXYA 4QBGB 3S2ZA 5F23A 5KHOC 3RAGA 1I0IA 3BTSA 3O75A 3SM9A 4OJQA 5DHUA 2BUCA 5FLXA 4BV8A 3E6AA 3FMOB 4N3BA 2OORA 3PCXA 3OP1A 4FFSA 5EE1A 2HH9A 2QA5A 3OUZA 1UF9A 2FOLA 4JKYA 1TADA 3IHTA 5CURA 1U0OC 2GZAA 2XITA 4RKRA 5LQJA 4RF3A 1F60A 2EFDB 2GESA 2ZYHA 3LLMA 1JXAA 3DE6X 4EUHA 2AHRA 3UWOA 2YRXA 3EF3A 4R54A 3ZCUA 2FFAA 1U7HA 2YVKA 2Z9DA 4GBGA 4QG3A 1N4DA 4EFLA 2QUIA 2WMDA 3ZDXB 1VFPA 3MTJA 4N41A 2QUZA 1E9VA 2H57A 1XFDA 3QBVA 1M8FA 3ME5A 1SC9A 3H8VA 4HEHA 1Y6JA 4LE0A 3Q88A 4XCVA 4R1SA 4DEXA 2CC2A 2C3UA 3FUWA 1EI9A 4ZV7A 4TLMB 2OZKA 3IMKA 3RANA 1HYEA 4G01B 2LKDA 3F46A 4WRRA 2PH3A 1CCWA 2JCXA 4CLXA 5LKAA 2NSLA 5LFAA 3H1AA 1A4XA 3VHQA 4DVGA 1DI0A 4DBZA 2IV2X 1Y82A 1EAMA 3E4CA 3ZE6A 2QBYA 4XGQA 1IDN1 2EF1A 3DZGA 3CVWA 4AW9A 4QLOA 4BO0A 1C3XA 1THTA 5DYNA 1QCZA 4HB4A 4DHEA 4BJ5A 2O8VA 4B35A 2GYYA 4XTCS 1ZSYA 4QBHA 4B0OA 1EMDA 1BDIA 3GLHB 4GX5A 5AM1A 3UUEA 2OD9A 3AFHA 4PLFA 3WADA 4UD2A 3WL3A 2X7HA 5AW0A 3R0VA 3GV0A 4J3FA 5G3YA 1NG1A 3FUTA 4P3OA 4UUAA 3NWJA 4TQAA 3HMKA 4Z0NA 9ATCA 3ZZNA 3CLTC 2X3YA 2Q5FA 4CQJA 4MEBA 3BS4A 4FDVA 4Y2JA 1Z5OA 4YAKA 3MRVA 1RU3A 2HMVA 1Z8HA 2NNLD 3RTCA 3SNHA 2G6BA 2HA7A 1YB7A 2KLHA 3WNQA 1CJVC 1PR9A 2J7PA 1NV9A 2MSCB 1PZNA 1E3QA 2OQ2A 4QU5A 3TQRA 1FNNA 2QTRA 5DX8A 5EUCA 4BEVA 5J2UF 3LUCA 3TZLA 4JMPA 3ZBUA 3DBRB 2I6XA 3GUVA 1AV7A 3IQEA 5HX7A 3CU5A 1Y1PA 4ESOA 4ZQEA 1KSJA 2CNLA 1JAZA 1C8KA 3DEFA 3SE7A 4I1OA 3DLCA 3OZEA 3TQTA 4IDBA 3H9JA 1CZLA 5HS4A 4CRWB 3QNUA 1NUPA 4RZUA 3SJBA 3QYJA 1N2EA 4R8RA 4CKWA 2IX3A 1LGYA 2O1SA 2VDUE 5ALDA 3OQOA 3ZK9A 3EY9A 2WU4A 2VTBA 2YKGA 4ZI7A 1WPRA 1O89A 2I2AA 1Y8RA 2XVAA 3GMSA 2VTDA 3F3SA 3NATA 4D0SA 2CNWA 4YP6A 1E0JA 2J6IA 2Y66A 5I9BA 3DOUA 4MUYA 2Y3IA 2ISCA 2C88A 4JVSB 2WU1A 4K9DA 5CRIA 5FR2A 5IC5A 3TDMA 4RTNA 2G88A 2QL6A 2P1DA 2QE7A 4EH1A 1ISHA 2XA9A 2WHYA 2J3LA 1XNRB 3EF0A 1XK6A 3PFBA 1DL5A 1T13A 1T26A 2GNOA 4ODIA 3EWAA 3KSBC 1QK3A 2FZ4A 4K9RA 4X1KB 5KYKA 3FKQA 4NMMA 2I7XA 3H2HA 5T4FA 4V1CA 2L82A 3DOEA 3KKKA 4XFJA 1DQPA 4UMFA 5DP2A 3BERA 4LKOA 4TMVA 5DCUA 4KO4S 2IPOA 4QECA 1A5SB 4WK4B 4ZOLA 4A27A 1IN1A 3CISA 2C4UA 2CMKA 4M22A 1ZD1A 3RWBA 1IQRA 3HB9A 5DCYA 4PCUA 4S2UA 1Z6XA 4GRAA 3K5HA 4KBGA 3PPIA 4NV1A 2PD4A 3D6VA 2Y1XA 3GBSA 4PBSA 3VQTA 2BGJA 1HDRA 3WMEA 4DJDC 3C24A 1Q0PA 2VQ6A 3FUXA 3M1IA 3DTVA 4R1LA 1N8KA 1VHDA 4IOKA 3UCXA 2KB0A 1Z34A 3F98A 4B6RA 4F12A 4LRSB 5C3UA 3BXEA 4G9GA 2EJWA 4QOJA 4P32A 4H27A 5CNKA 1R3DA 1JHRA 4LYGA 3AF4A 3QA9A 1NT4A 5P8WA 2XODA 1IEWA 2C94A 5ESXA 2BN4A 3WL6A 4CKEA 3EZ9A 3IA2A 4D9KA 4DAEA 5IPFA 3W5JA 3VC2A 2NZJA 3LVQE 3W8DA 3PU6A 4YMUA 3P0HA 2FUCA 4MVJH 3D6JA 5FTNA 3SX4A 4MYSA 4E2YA 4LGMA 4KZKA 3F0TA 1UOPA 2EXXA 1YQEA 4BMZA 2BL4A 3F6CA 3WHKA 2Z2JA 1JZQA 4DS3A 5FRDA 5EJMA 4EABA 3D7SA 3EMVA 4BFYA 2ESRA 5J1SB 5CXXA 1AC5A 3AUUA 4KWCA 4MSUA 4DG5A 2ZAMA 4NWIA 5E9JA 1C1XA 1LRJA 5B7QA 3IPRA 4GC5A 1EK0A 3N2EA 3EGEA 4KUEA 3RVQA 4CDGA 1ABBA 3LQFA 3O31A 1N3BA 3QPVA 3U0BA 1AF4A 4EHFA 1G0OA 3QYPA 2OLJA 2OHXA 1RBMA 1RYHA 1JKJA 1YQDA 4GMFA 4JZKA 2OV3A 4FDTA 1VRVA 3P52A 5KMGA 1Y9DA 2F59A 2I2XB 2DHCA 3AL3A 4JL5A 3EG9B 2ZIEA 2PJDA 3FJOA 1GRNA 3KXDA 2ZRJA 1DAPA 1G8MA 5KQGA 1OOEA 1YR2A 1WB9A 4IIJF 5EMHA 3K3PA 4FYHA 3E1KA 1IXYA 3GJXC 2R6DA 5E3HA 2WM3A 4B4KA 5G0WA 5MN5A 5JEDA 2MYUA 4K9KA 1NTRA 3DVLA 2CHQA 4TUYB 4NQRA 1FUEA 4I66A 4BTLA 1AKEA 1GNPA 3B6ZA 1PJ3A 2JKZA 1B93A 5BT9A 3KM0A 4PSKA 1NI5A 4F2PA 3MCVA 1SXQA 1RQ2A 1YOVA 4JCCA 4F93B 5A62A 3PEFA 1RZRA 3ND6A 2ZJ7A 3HN2A 3KL2A 1MPTA 1P3Y1 1E5DA 2OCAA 2P6MA 2XB8A 1CIVA 3I09A 4IDQA 3CRW1 4V0NA 4CODB 2SCUB 5C7LO 4KN6A 5AI8A 3II6X 2AUTA 5DWVA 5E4JA 4NMXB 1Z2PX 3HLTA 4HRXA 1AV6A 3ZV5A 4Z49A 4P98A 2D2XA 2AYYA 3BJEA 1NF8A 4NG5A 4PTLA 3RS7A 3S81A 4NBKA 2W4MA 2DFNA 2AEEA 2O5RA 4M2LA 1ORWA 3UH0A 1IN8A 3W3ZB 3STYA 3WJ2A 4ASUA 3ELYA 5BMVB 4C0AC 4M1MA 1SRQA 1WSAA 2GZMA 5IVKA 3OEYA 2ZBQA 3RAPR 1KU6A 1RI1A 5BR4A 4PSCA 4CTOA 3EVFA 3WLPA 3BXPA 1U8AA 2UXBB 1G6HA 3Q3VA 1NZDA 2VLBA 2OAEA 3Q8LA 2PWYA 4ZAWA 3VPFA 2ZP1A 5HTKA 1DKRA 2ECKA 2VHJA 3C5CA 3NDRA 1MIHA 4NBVA 4BQPA 4EENA 5CLFA 5A0TA 4MK4A 3DOIA 2HSWA 4KQFA 3UK1A 4AY5A 4JVOA 1P6UA 3DBVO 3ZZMA 2OLEA 4C78A 3B3GA 3RVOA 1Q7CA 5DXJA 1HRKA 4ZV4A 1RSZA 1MEEA 3QU7A 1LI4A 2BDTA 5ALVA 3DMNA 3OLWA 4CFZA 1UM8A 2QPOA 2CLFB 1KQNA 2E4AA 2OILA 4FHZA 2LRHA 3DLTA 3KOXA 1SVIA 4O1MA 3OJEA 4RTPA 4LAFA 2IE0A 2NUPA 3VM6A 3R5FA 1TTTA 1P5HA 1XTTA 4PAOA 4Y1FA 3WNVA 1PT5A 5JBQA 5C32A 5KQPA 3IEUA 3RUCA 3CVUA 5BV0A 1NMZA 2ZAIA 2O8NA 1CE8B 1G6OA 2P9ZA 2CCJA 2W22A 3LOQA 4KIWA 5IF3A 5CJPA 3H2KA 2X0IA 3RD5A 2EIXA 4IUDS 1ORTA 4N6GA 1KJ9A 4G67A 2RGNA 4LV5B 4REQA 1G6Q1 1UOEA 2HA4A 1E20A 2PZBA 3TI9A 2GF2A 1TUIA 2JASA 2Q4RA 4LJYA 4AZ0B 1JVSA 1NVUQ 1Z6YA 3LW8A 4JH0A 5AJHA 4X7RA 4LHXA 4II7A 3R7BA 5DHFA 2BFFA 5HIMA 4BMSA 5G0UA 3HNPA 4PNZA 3DW1X 4IUBS 4WFKA 4U8GA 5IKOA 4AL4A 4RXTA 4IJVA 1HQYE 2X6QA 4KOEC 3TW0A 5H0IA 4FDAA 2PX8A 1R5JA 1UCFA 1XB2A 2QYSA 3AXSA 1GSIA 3C1AA 4GR5A 3IBTA 4JU9A 4RKWA 1KDOA 3NHUA 4CIBA 1YV9A 3O83A 4KAFA 3N8DA 5D3QA 2ZM6B 2JHGA 3I5AA 3PXUA 2W6PA 4BJ6A 4EW3A 1UDWA 2ZUVA 4W5RA 1X9IA 5LPNA 5HIKA 4C0XA 1MFPA 1VLMA 3O38A 2P5YA 2FPMA 4ABTA 1SKBA 3BMNB 2NVUA 3AR5A 3QBDA 4FYPA 3ZV6A 1GJRA 3OTOB 1RJWA 1VMKA 4DV3B 4LTNA 1MUUA 4L51A 1LSSA 5E2AA 2TMKA 3K5PA 1F7UA 4FHGA 4MWGA 1XVLA 5DGXA 1LBIA 1U9IA 1KVTA 2WZDA 1C9JA 3D8RA 2OGUA 4G81A 4X85A 4E88A 3U9SA 1XQWA 1J1IA 2GRUA 3ZLBA 4RTJA 2I2DA 2B98A 1JJ7A 1VBNA 3CRNA 3K20A 4IUYA 1XQVA 2ZSUA 4PS1A 4RDCA 5BWCA 4UW9A 2YWFA 3GQVA 2P2ZA 4WL0A 1YR1A 2UVQA 3VO9A 1V47A 2WW8A 3OCZA 2FUEA 2FY8A 1GGMA 2OOKA 1T0IA 1NLFA 3CM0A 2E5FA 3W8RA 4RTOA 4YI5A 2JJ1A 3O2NA 3HJUA 4RHTA 2EJUA 2DT5A 1T9GS 4S35A 1YBAA 5IDYA 3NRCA 3UATA 2H6EA 1RLOA 4EYQA 2I5PO 1OXTA 4A2WA 1HZZC 1ZRHA 2VP9A 2J33A 1Z6ZA 4ZI5A 1CB7A 2Y68A 3B78A 4EJ2A 2J3KA 4XGRA 1Y1SA 2OV1A 2XUZA 5GIOE 3V80A 4IQGA 1YNSA 2Y71A 4P5DA 4KQXA 4C4RA 1I9GA 1VBMA 4AKSA 1NAIA 4UEKA 2CLCX 3TLBA 1FU7A 2YJNA 5B6IA 4HV4A 4X65B 5DLYA 2HCTA 5D1NA 1QRSA 1TYDE 4MS1B 2ZITA 1BJKA 4RQTA 1RZUA 2NNWB 3LF2A 3S2UA 2QP4A 2GNPA 3S1LA 5HFJA 5KYTA 1HTTA 1QDUA 2IYFA 2TYSB 2GHQA 2DBVO 1Y4DE 4WZZA 1XJ0A 1TO1E 4NK5A 2AI2A 3MELA 2YBEA 4C14A 3R44A 4Y18A 4B74A 1XSEA 1SCDA 2XF8A 3BPSA 4DRXA 5BSGA 3GDOA 3KKNA 4MHSA 4PFSA 1PFUA 3OCJA 4XX0B 2OBMA 3DZ8A 3IMFA 2Q41A 2UUPA 4X24A 4WV3A 4F9EA 5K45A 2C2ZA 3IJPA 1W0KD 3GP8A 2XNSA 1IQPA 1IEVA 2Q1XA 1PQWA 4PLZA 1XN1A 3KT6A 2GK3A 3OECA 3LT0A 3HY4A 3ANLA 4NCIA 4WMLA 4A0FA 3VU3A 2YY6A 2AR9A 2F1RA 4L6AA 3S70A 3DLHA 4M1QA 1D0IA 3H9GA 1DVRA 5LN1A 4BTVA 1YASA 1QHFA 2BM1A 5FPQA 2PIDA 5ALLA 4MR9A 3OPQA 4YI3A 1FA9A 4MQEA 2Z5VA 2EL7A 1WLSA 1H23A 4JP5A 4BV2A 1GPWB 5JVDB 3V7FA 4LJ8A 3GYBA 4EW1A 1JLLA 2FDXA 4DLKA 3DFMA 1J06A 5I3CA 2RGDA 1YFLA 2G9UA 2GS9A 2EBFX 2YC2C 3D9QX 3R23A 1GU0A 3KOMA 4JWTA 4ZALA 2E7ZA 2NIPA 1P5ZB 4GZMA 5GJVC 2XUFA 4HGPA 4M1YA 2OOSA 3BSFA 3L0PA 2YFYA 1KH2A 3DAOA 3DDZX 5GP1A 1U6KA 5I5EA 4GL2A 4RK7A 1B0ZA 2G67A 5L95A 2GJ9A 3PUHA 4ZARA 2ONJA 1Q44A 3EDYA 4TPKA 4ZCTA 1EK2A 2BFCB 3I83A 1K08A 1RLIA 2WU0A 1CS0B 4C1NA 1SQ6A 3F4BA 4URVR 3LH5A 1X0XA 2XGJA 4OIFA 3FZYA 4C7MA 4BBAA 2DTDA 4L95C 4LKRA 3TXYA 3ESCA 3CVOA 3ETHA 5IAOA 3BE8A 1OVMA 1YHYA 3S68A 3D6NB 3ZHQA 1B1CA 2X19A 2AFRA 2BE9A 2BRUA 1XA0A 3L8YA 3WBKA 1NN1A 3LJKA 3PUJA 1D7AA 1HSOA 1QC5B 1B8NA 5EFOA 5EJAA 3H19A 4LYFA 3NHAA 1YKSA 5U9CA 4J1TC 3QEKA 4MIEA 5CMLA 1N2JA 1N9KA 3SWWA 1QPBA 1V5EA 2KBEA 4P3NA 2B7BA 4CU2A 3EWNA 3ZIDA 1XAGA 4IRMA 2HDNB 5LBTA 4CF5A 4RVGA 2WK1A 2G5GX 2Y4OA 5EZ6B 3VV2A 2F2TA 3DMDA 4TKUA 4AYWA 1SA0A 4YWHA 4MWBA 1E2PA 1IAQA 2GI4A 4QO8A 1MX5A 2C1XA 3EQ6A 4DBLE 5I7OA 3IAUA 3OZ7A 5CIQA 3WGUA 3EIUA 3JAWB 4LWOA 3KQUA 3AUYA 5IAEA 1JSXA 1ZUNB 4HX5A 1AF7A 1ILWA 4FGWA 4J16C 5H02A 3L01A 2C3YA 1JTFA 4AJPA 4PYKA 2XB4A 3RVKA 3KC2A 4AJNA 4B4DA 1IK4A 5IH3A 1VHLA 1Z82A 3AM4A 4ZPJA 4KQ9A 5IF9A 1GGNA 1Z2OX 5KTRA 5LWHA 1M5RA 3K2EA 3KQKA 3ITKA 2HV8A 4DBVO 5AVZA 5IT4A 4U63A 1TA4A 3RARA 1H4SA 4KNYA 4C01A 2J7KA 5F7XA 1GPJA 1G4AE 4TQUS 1OILA 1UZUA 1E7SA 1Z7WA 8OHMA 1JV2B 3DC7A 4TS9A 1D5CA 5L3SB 5C1PA 1OMOA 2JARA 3DLIA 1GTG1 2COKA 4MCJA 4MP6A 3WAKA 2F4VB 1FVXA 3T1HB 3F9IA 3NFYA 1ZSNA 2XMBA 5CAEB 4LNUA 4PX2A 2VNIA 4O33A 4CDRA 5HPYB 4US2R 3P26A 1QR2A 1GPNA 2YW2A 4D80A 3FPHA 1ECGA 3KJQA 2VNJA 4OP2A 1QO0A 4J94A 5LWQA 2H1RA 3KUXA 1R6UA 3VTFA 2YIMA 4YJHA 4FE3A 1E2FA 1QHSA 4AS2A 3VU0A 1I3MA 1ZHFA 2ZVDA 1KI2A 4RZHA 5AI5A 2E4ZA 2C82A 1T4MA 1QQBA 1PLJA 4XR9A 1E6MA 1JFSA 3UAWA 1FVFA 2E6KA 2VJLA 2Y1KA 5JO9A 3E3MA 4BFXA 2IP2A 4XQCA 1JQAA 1WUKS 1XD2A 3URKA 1WF3A 1L5FA 1MX9A 8LDHA 4G0OA 3QXGA 1G1AA 1OFIA 3GDWA 4W9NA 3H8SA 4ZXPA 1Z83A 4TWBA 1I7NA 2PZFA 1EDDA 1AGRA 4M0EA 2WIBA 4QGFA 2AC4A 5JQGA 3P2JA 4B79A 2VO1A 3T1OA 2RAFA 1XEAA 1URPA 2F8MA 3DO5A 4GLFA 2VRCA 3I64A 4I08A 4B73A 1XAJA 5IASA 3TB4A 2QZJA 4ND8B 4Q9DA 3M5CA 2IUEA 4DJ5X 4ZO4A 4BB5A 2WJWA 1DJQA 1TU3A 3I37X 4Q4HB 4G0MA 3ERCA 1MMFB 2RI0A 3O8LA 3JQPA 5FYQA 3UXYA 4DMCA 1QR6A 4D3YA 3UBTA 3EGVA 3ZDDA 2P7HA 1QYCA 1U8TA 2PRSA 2PX3A 3NR2A 4G63A 2H16A 4FI3C 4KH0A 4K28A 4F91B 3N0XA 1PFKA 1JNXX 1I80A 2HDOA 3MGKA 3OLXA 3Q5GA 4R0VA 4PQYA 1UMCA 4W8GA 2ZJ0A 3JZFA 3K1JA 2XCRB 1G5FA 1BE8A 1X7WB 1NPYA 4NDNE 2G4LA 3FSEA 3RTAA 2P67A 5IZCC 5AK5A 2NSHA 4IV5A 3S2GA 3BT7A 1BWQA 3NDIA 2IYZA 1R0WA 2G36A 2J3JA 2C3OA 1P7PA 5COAA 1TZBA 1OWNA 3L7IA 1Z5GA 4W9RA 3B52X 2ETVA 1RJGA 1XRPA 10MHA 4NDZA 2A9KA 4PRZA 5B53A 3QUTA 2DFDA 1RXEA 5GZ3A 4A6XA 3HDQA 1UP7A 4JGGA 2ECQA 4WWHA 1J2YA 1WSDA 1ZU4A 4XUEA 1L7PA 2PH7A 2FPWA 1X42A 4TS3A 5EPEA 4Y9DA 3GGJA 3IILA 5EKSA 5HCIA 3G0GA 1AHPA 1S0UA 2YL2A 2QJWA 5FUVA 2RKBA 2CXSA 1WW8A 5FUXA 2J6HA 4EYGA 4R9UC 3O8DA 3PRHA 2IXAA 2PWPA 1RYFA 5BR7A 3PFWO 4ADSG 3CPSA 4OJMX 3Q8MA 1CR0A 1UJ4A 2Z8ZA 2O8CB 3T0FA 4MPRA 2QVBA 4HNUA 4J0GA 2O54A 2GJ8A 4EZEA 2ZJ2A 5JECA 1KJYA 2KMLA 2NUTA 2Z04A 3QEJA 5FBRB 5A71A 1W5EA 3VUEA 4PYJA 5LKRA 2XB6A 4QUIA 3PA8A 3S40A 3SOZA 2ZJOA 1E79A 3IAEA 4FIDA 1OLXA 2WJPA 2NQTA 2E4WA 3FNHA 4LDQA 2AG0A 3GMTA 1P1IA 3OY2A 1E61A 3MTQA 1NPTO 3OAAD 4YYZA 5IYZA 3UMJA 13PKA 5BQPA 2Z6VA 4YASA 4OIMA 1Y6ZA 3I34X 5CB4A 1LBEA 2BFWA 2BKAA 3GJZA 4BEJA 3NRBA 2XRFA 3TRJA 5ALHA 2CV2A 4IIDA 1C7FA 5KOJB 2QTCA 4RFVA 5HCUA 1USIA 3VZPA 3LX4A 1ORVA 1YZFA 1NVBA 3IP8A 1XRLA 3STHA 1TFUA 2ZU6A 3QVJA 2BJVA 2A5GA 2GN1A 4UD6A 3IKJA 1TYZA 3H1PA 1Y8QA 3HJRA 4G1MB 5IX8A 3SYKA 3ZKAA 1KJNA 3LZDA 3EPHA 3H13A 3ZR4B 1GFSA 8GPBA 3G8DA 1Y81A 5ECGC 1RM3A 3ANMA 4XJVA 5FEUA 3KJNA 4AAYA 1NI4A 4YPFA 4CF6A 3FRJA 3SQOA 2YV5A 3U4CA 1Y3IA 1M1YB 1CZKA 2KLBA 3NFRA 4BZWA 2PUCA 1AZSC 1CZOA 1E4EB 1KEUA 2GEKA 1SC4A 2VH5R 4LZJA 4DZZA 5JU6A 3CJTA 3UJ6A 1GSHA 1XRMA 1L7AA 1YJ5A 4TS1A 1Y7IA 4I1SA 3WFJA 5B6PA 5IWAB 1SK9A 3BMOA 4QM7A 1TW3A 4B6SA 1ABFA 3DBOB 3GPIA 3PXBA 1TYCA 3I1JA 1OU4A 2XE6A 4FQ8A 5FPKA 2V6GA 2FWRA 4Q6BA 4U2GA 2I7DA 4XVRA 1JALA 3IAFA 1TEHA 1EM8A 1U8YA 1YNOA 4BBPA 3MYYA 2JBHA 2IEGA 3HA3A 4BVFA 3GELA 4UHFA 4DNQA 4HYEA 2GPAA 3UBMA 3VR1A 2FYTA 2RG7A 4R2WA 4MRPA 1RE1A 5BVGA 3OX1A 4LY6A 2V4MA 3K2IA 2B8TA 2ZIFA 2BMEA 1YJCA 4RKQA 2FKAA 3AG5A 4MB0A 3HKBA 3P4UA 1TCBA 2K7FA 4I19A 2C1ZA 4M38A 1UQTA 1FPQA 1H2AS 1Q83A 4R83A 3DOCA 3CLTD 3I6ZA 2Q4DA 4HLDA 4CLEA 2H7XA 2QE6A 5AI6A 4DA9A 1QKIA 2YFQA 3A4LA 2ZB2A 4GI5A 1G4UR 4JLOA 4UVDA 7REQB 3KUKA 4NL4H 1X1SA 4GS5A 4HLUA 2HAEA 3C8UA 4H1UA 3MK31 1KP9A 4R5HA 5TE9A 4BMNA 4MDHA 5EVCA 1CY0A 4J8PA 1V5FA 3BG5A 5JZMA 2FTKE 3EDOA 2VAPA 3MW8A 2R7MA 3Q12A 4MYDA 4QUGA 3T9AA 3VZSA 1PJCA 1U8XX 2IYWA 3KJHA 1P62B 3OD5A 2C20A 1Y1RA 4UHKA 1I9CA 5JADA 1CR4A 1TAHA 3MJHA 4OAPA 1DELA 2Y0EA 4OYRA 4A0GA 2VHXA 5K0GA 4HGYA 2GUGA 2JRLA 3L41A 5GVSA