1CR1A

Crystal structure of the helicase domain of the gene 4 protein of bacteriophage t7: complex with dttp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
277
structure length
245
Chain Sequence
MRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTGVVLVVICHLKTDLRGSGALRQLSDTIIALERNQLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords DNA PRIMASE/HELICASE
publication title Crystal structure of the helicase domain from the replicative helicase-primase of bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
total genus 78
structure length 245
sequence length 277
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1999-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03796 DnaB_C DnaB-like helicase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cr1A00
1OYYA 4LK2A 4PO8A 2FPKA 3GJXC 4GZLA 1E79D 4Q66C 1MABB 3GLIA 3KX2A 3T1OA 1UM8A 4OK5A 4PXAA 4GFDA 1N0WA 2JLSA 3A8TA 4QHTA 2OE2A 2QE7D 2R6AA 4PHFA 4AYXA 4B74A 1JEDA 2YOFA 2VL7A 1X1SA 2P5TB 1NKSA 1J7KA 1T5IA 3AVQA 4C0HA 1NL3A 3KKNA 2NO0A 5FTNA 4NYJQ 2SHKA 1G7CA 3EZFA 4HAXA 2QMOA 3QPVA 5JCZA 2Q0HA 1D2EA 1R0WA 2A3RA 2ASEA 4B6FA 2H17A 5L3SA 2Z4RA 1EX7A 2FG5A 4OI2A 4YDSA 2R65A 1TEXA 3NH9A 4R2IA 1KSGA 5J47A 2UZ3A 3LO5A 4U5XA 3G5UA 1JPNA 1AZTA 1Z0JA 2OV2A 2YHSA 3DHWC 4IDPA 2XTNA 3HR7A 5AJYA 3X1YA 3RRMA 5B57C 4IFEA 4PHGA 4FINA 5HCIA 4OK3A 3KXKA 4TYPA 3VR3A 2FMXA 3TQFA 3TBKA 3U44A 3IO5A 3LLUA 3KB2A 2YNMA 5KU1A 2V8OA 2JLYA 1TX4B 4LBZA 4LHVA 1G3UA 1QVAA 3K9GA 1FNMA 2ZRIA 3CUEF 3FWYA 2W2VA 3FFAA 2Q3HA 2O0KA 1NY5A 2G1KA 4V0NA 1KK0A 1KO5A 4MA4A 4DLSA 2J0UB 1E1RD 2QAGA 3HWSA 2NO1A 3CIOA 3FHOA 2ZRNA 2FNAA 2YOHA 2BBSA 2RGEA 1W4CA 4NHOA 1KAGA 1RFLA 2BMDA 3MD0A 1U99A 3VR5A 2CCGA 4NCHA 1PUJA 3TUIC 4AIIA 1XCGB 1E1QA 3QVUA 4V03A 2CK3A 1IN7A 5CDFA 1HQYE 2IYQA 3ICQB 4M4SA 4XH9B 1BS1A 2CE7A 1AS3A 1XEWY 4GSYA 4IJMA 5FBWB 3C16C 4LPKA 2G3YA 2VP9A 1SULA 4QJ4A 1XD9A 2WKQA 1OYWA 1XMVA 1VCMA 2J59A 4GOJA 3TVDA 5TVKA 4BFSA 1R0XA 4BFZA 1MOZA 1LB1B 4R2HA 4N3NA 2NPFA 3V9PA 1XEWX 1FP6A 3L8YA 4M1WA 4UXIA 3GLFA 2OILA 1HH4A 3OF5A 2F7SA 1E9DA 2X1VA 3EXAA 4X8MA 5B64A 4URVR 4JVNA 5CYPA 5LD2B 1SHKA 2ZRKA 4DDWA 4A0GA 3SFZA 5JJIA 1K5GA 2IUTA 4DCUA 4M1KA 1AGRA 4PHHA 1WBBA 1J2JA 1US8B 1T3LA 4Z54A 1ZNWA 2BEKA 4DDVA 3GJ5A 4ZCIA 3N5CA 1GKUB 4PO9A 2GJSA 2AD5A 3KQUA 1IOZA 1Z22A 1NG9A 1KOFA 3ZZUA 4ZO4A 5BYKA 2Y8EA 2H5EA 4DVGA 3P4YA 5EQTA 4EPRA 3GLHB 1B23P 4E03A 4XIGS 2O8DB 4LJ5A 3LX5A 1R2QA 1OH8A 4HLQB 3B85A 4W5HA 1QDEA 1CLUA 1E6CA 1JNYA 2A9KA 4HSEA 4PX9A 4NH0A 1HV8A 4R98A 2YINC 3Q5DA 2PJRA 5KUTA 2B7BA 3W5JA 2FEMA 4XTCS 4A2PA 1FPMA 3EARA 3GLIB 2A30A 1FOEB 1GUAA 3BK7A 3OIWA 1P2TA 1IY2A 3CONA 4IOJA 5BYJA 1KI9A 1P60A 5EP1A 3CR7A 4KSCA 4JYCA 1NRJB 1G291 2Z5FA 3WMGA 4WVFA 3A6PC 3PUZA 4HDCA 5LB4A 1GZSA 2XJ4A 2REOA 3MMPA 1GG2A 3CWZA 4A6XA 4A8JA 2HCJB 4BLQA 2CHVA 5BQ5A 3EZ2A 3UANA 3NC0C 3UIEA 4C0KA 2NG1A 3A58B 4JBWA 4B44A 3WBJA 4UJ5A 2IYTA 2B6HA 4CIDA 2VP5A 3U61B 1TU3A 4QM7A 4Q1BA 5LD2C 5JHGB 4KSBA 2IHYA 4P4TA 3ZQ6A 2PLRA 4L8GA 3U44B 1DAGA 3QI2A 2WIBA 1VYUA 4DLYA 4PHTA 1KO1A 1KDTA 1CJVC 5J4YA 3NDBB 4JLJA 3I4LA 4V02A 5HKKA 2C2HA 1IN8A 2NZJA 1A5TA 5FOWA 3B1YA 2QAGB 1FQKA 4PZYA 1A1VA 2O8EA 3RS0A 4URYR 3RC8A 1KO4A 5AJWA 1RYHA 3QKUA 3CNNA 4TL6A 3RDPA 1KKLA 1EFHA 2QMEA 3SDZA 3TJZA 5EUQB 3N2IA 1YZNA 5C46F 4I1UA 2IF2A 2F1JA 4O3MA 4MGKR 1W4AA 2GJAA 3GEIA 1YZKA 5JWHA 1LFDB 5TDHA 5JI3E 1CRPA 3PCRB 1W4BA 4K81B 4B32A 2HF8A 4LRWA 3ADBA 1MV5A 2WSMA 1NP6A 4LBVA 3SOPA 3QXXA 2ERYA 1E32A 2JDIA 4BFWA 2V7QA 4D6PA 3TK1A 3GLFB 1E9AA 2RMKA 1KJZA 3CRW1 4M9ZA 2J0VA 4B6EA 1FX0A 1KY3A 1U0HC 3BFXA 1ZD1A 4KFTA 4UNSA 1M7HA 1KI6A 2J7KA 2RHDA 3JVVA 3D3QA 4F93B 1TAGA 4M22A 3J81k 1I2MA 2ZRJA 1AM4D 2E87A 3MFYA 2ECKA 1H8ED 2W6ID 3H2YA 5KDLA 1II9A 1XMSA 3Q72A 1SVIA 2VLIA 3RS7A 5FTMA 4QGHA 4IW3B 2REXB 1GRRA 1M7GA 2IS6A 1OH6A 3VHXA 1RIFA 2AXNA 2ZETA 4JMPA 1S3GA 2BHRA 5C4MA 3U7HB 2BCGY 5KDDA 4G01B 3FYHA 1G41A 1L4YA 1SHZA 3KQLA 3EASA 3CKLA 1X8LA 3BFKA 3GLGA 4LJ9A 4TLBA 2IYLD 3HDTA 2D62A 1HTWA 3OEHD 2G9NA 3AF2A 2QAGC 1II8A 5E7JA 4ESHA 3P20A 2H57A 1C1YA 5G40A 2HYDA 4M2LA 4EUNA 3KJGA 4TYYA 1ZC3A 1CEEA 3O8CA 2FGJA 121PA 1X86B 3F0TA 1EGAA 1GKIA 4M1OA 2ZRPA 1J8MF 1X1RA 4Q9KA 1YZTA 1RRGA 2H8KA 2QP4A 1EK0A 2KSQA 2GVZC 2KI5A 3FHCB 3P32A 4K46A 4DLRA 1Z0DA 3KZ1E 4DLUA 4ITRC 4D80A 3B5JA 2VRWA 5KNCA 4U7DA 2IT1A 4HYYA 5TV2A 4L9WA 3QXCA 2O8FA 3QXHA 4TZ6A 2ZVPX 4QJ3A 2A5JA 2KBFA 4FI3C 5FI0B 4ON9A 1P5ZB 3IPYA 1GP2A 3FE2A 1DO0A 3U6KA 2GF0A 1RJ9A 4A8JB 5K8LA 2PX3A 2GVDC 5P21A 4ABYA 1P2UA 5AR1A 4A0HA 1EFRA 4JVMA 4TSFD 3V4FA 3SQWA 1KK1A 3AGPA 2QM8A 3TE6A 3I62A 3AUYA 2VHTA 1KDOA 5FPHA 5IF9A 5KDOA 2O0HA 2FZ4A 4MKFA 2GJKA 4IHQA 4B3FX 1KY2A 2RHMA 4WZBE 3SJBA 3K0AA 4OJKA 3R9XA 1Z6AA 2BCJQ 1SVLA 1NMYA 2EYQA 4ESVA 3QEOA 1SGWA 1UKZA 2YWFA 1P73A 4EPWA 5CDFE 2QRZA 4FWTA 1VG8A 4LHYA 3OFNA 3ZYCA 4Q7MB 1UADA 3DL0A 1IM2A 1TF2A 4NU0A 3D6TB 3RS2A 4BLTA 2PT5A 3PIRA 4Q7JB 1LY1A 1P9RA 3CR8A 3KJHA 3S1AA 2CDNA 2IYSA 2GZDA 1DO2A 3X1DA 4M1SA 3TUJC 4LBYA 2XAUA 2B8TA 2VP6A 4I4LA 1P72A 2CLDX 2RGCA 3OHMA 4C0AC 1JR3A 1FUKA 3ASZA 3B7GA 2XSZA 2Q6TA 2Q3MA 4D25A 4F38A 4W9MC 3I5YA 3SJCA 4Q4HB 2BBOA 3QKTA 5AUQA 1TF7A 4N0EA 3BS4A 3WMEA 1DS6A 2VF7A 1X6VA 3W6NA 2H92A 1F2UA 2GXSA 2WJJA 1R0ZA 2J7PD 3T34A 4Q9JA 1HEIA 2CEAA 4JL5A 2AR7A 2XNDA 1UDXA 3CNOA 2F9LA 2ZRCA 1G3QA 1ZCBA 3SHWA 2ZE7A 1YRBA 4DWJA 3HJNA 3TIFA 5ELXA 2V9PA 1OB5A 3U7FB 3NBYC 4LDJA 2H18A 3IO3A 2CNWA 1FX0B 3EW9A 4ZIRA 4BEJA 1KI6B 4BFYA 1OV4A 3EWAA 4IDNA 4ZI3A 3ND9A 1G5TA 1MT0A 5JWOA 3LDAA 3TQCA 2XB4A 2CMKA 3F3YA 2WJGA 4HAVA 4DSUA 2OG2A 4GMXA 1ZBDA 4B2PA 4LV5B 1Z06A 5DN6D 1T0JB 1R6BX 2F1RA 4OHVA 3REFA 4EPVA 5K8TA 2DBYA 3ND8A 2MSDB 3VNUA 4F4IA 2ZTSA 5J4LA 4AWXA 3UG6A 2IXFA 2JLZA 1DARA 4A4DA 1ZD9A 3UXMA 4OQXA 5KYKA 2F9MA 3GLGB 4ZCLA 1ZM9A 4M1TA 1AK2A 2WMNB 4ZDWA 1YZLA 3FMFA 4HATA 2Q9BA 2QQEA 4E22A 5B58C 4TT3A 1QRAA 1W1WA 4PZLA 1Z29A 4OHXA 3TRFA 5GJVC 4C0LA 2LKDA 5FOSA 5FUVA 1G5RA 3TSOA 5JSZA 5DIFA 3AVWA 2ZRFA 2V3CC 4YXWA 3F8TA 3IPXA 3RVBA 2P6UA 1T6NA 3X1WA 3CX8A 2OZEA 4BEBA 4KU4A 2NOAA 3EZ6A 2ZJ2A 3LRPA 5AK0A 5JLJA 3WRYC 2D2EA 3KFXA 4QG7A 5KSPA 3PJRA 3EAQA 1QZXA 3NC1C 5AUOB 3THOA 5BN5A 4Q1EA 4LJYA 1C4OA 2W6JA 4QBHA 1G8HA 1XX6A 2EFCB 2R8RA 2UVQA 2W2TA 2L0XA 3AVOA 3C15C 4ACBA 4NP6A 5L3VA 4QHYA 4PAQA 1P6XA 1Y3AA 1RJ9B 3KQHA 1ZW6A 2WV9A 4DT1B 1CP2A 3BJIC 2W58A 3VQTA 2I3BA 2VSFA 3LXRA 2VBCA 2WJIA 2GCNA 4F92B 4FMBB 1OSNA 1WMSA 5ANRB 2V6IA 4DRZA 1NVWQ 3WNBA 2MMGA 2UKDA 821PA 1E9BA 4RCZA 3JVUA 2WICA 3CX7A 2EFGA 1N6IA 3A1WA 1AN0A 4GI7A 3K0AB 4KI0A 4XWKA 2HLDD 5H1YA 1SXJD 4HLUC 2WVJA 4II7A 5EXPA 1PV4A 3PEYA 4YLGA 3SNHA 2OT3B 4HAYA 3AQ4A 4TN1A 2ZRMA 4JLMA 4RY2A 2ZS9A 4FCWA 2KE5A 2R6CA 2RKOA 1NKTA 3EZ9A 3SYLA 4MQBA 1LW7A 3S1AB 1DAIA 1T3HA 5GJCA 3JZMA 2ZI3A 3EPKA 2QGZA 4PFSA 2BWJA 2JJ8A 1IY0A 1O87A 3H84A 4OQFA 1OT3A 5CK5A 1YR7A 4LGMA 1UBEA 4Z1MA 3VFDA 1PVOA 3L0OA 1G1MA 2XTMA 1DG3A 1G16A 1P4SA 1I4DD 2D2FA 2PEYA 2C9YA 3CF0A 2XJ9A 1E2DA 4LCBA 4EJSA 2X19A 1E9EA 4AC9A 4LY6A 3B2EA 4GOXA 5J4HA 2OBNA 1F2UB 1ZVQA 3NVAA 2P5SA 4KLZA 4D0GA 1E79A 5F9HA 2CL6X 1Q21A 2YWEA 3DOEA 3MWJA 2HF9A 3CRQA 4C0JA 4GRAA 4LYJA 2AXPA 5E95A 2PL3A 2QE7A 5KSZA 3B6EA 4Q4JA 1NMXA 3NKVA 4FD2A 1UKVY 3C7KA 1U9IC 3MAAC 1CKEA 4ZIRB 4YMUA 4JS0A 3GLGE 1KI8A 3MJHA 4EPXA 2ZI5A 2G0TA 2BKEA 3FVQA 5H68A 5E7MA 1XU4A 1W0KD 5AUNB 4G0NA 5JWRA 3QBTA 2YKGA 1NMZA 2C03A 5BN3A 2E9SA 1XF9A 2BBTA 2Z83A 2LWIA 1LTQA 3KJEA 3EIQA 3LA6A 4JLBA 2QT0A 1HA3A 4BPBA 3EA0A 4Q18A 3TMKA 3T12A 1KI7A 2ZS7A 1G6HA 4DLVA 2I1QA 5JI2E 1G6OA 4RSGA 1KI1A 3PITA 1JBKA 2FFBA 4DSTA 4Q02A 3QSYA 3BORA 4MDEA 2GCPA 5JSZB 1E1RA 4D0NA 1UDWA 1WE2A 3VR1A 4J0QA 4AKHA 2G0NA 1XJCA 3HPRA 5EZ6B 621PA 3RRYA 1KKMA 2NO7A 4IVQA 2ZRLA 3I92A 2OAQ1 2GF9A 5HE8A 3VR6A 1H8HD 2ORWA 4TQUS 3IHLA 2GAAA 2JAQA 3GEEA 5SZJA 3QF4A 3THXA 2JLUA 3BC1A 4JSYA 1UF9A 1IONA 4QL3A 2IS4A 1VHLA 5LB2A 2QROA 3KUCA 5IRCD 2FFAA 2QQ0A 1ODFA 2CE2X 2ZJ5A 2JJ1D 5E4FA 3RAPR 4MUAA 4XVQA 4HLDA 3CRRA 1EXMA 3KKQA 1E2EA 4KBFA 3SU8A 4D82A 5KHOC 1LS6A 1UEIA 3UWOA 2IYUA 2XXAA 2ZJ8A 3RLFA 2EQBA 2FZLA 4HAWA 4TMZA 2J3EA 4F4JA 3NBZC 1KSHA 2ZRBA 2O0JA 2RGDA 2ZRAA 1JR3E 3W6OA 4B73A 1PLLA 2QMHA 2QPOA 1CR1A 2VYFA 4URZR 2CCJA 1B0UA 1BO6A 1FZQA 5G53C 4WA7A 3RABA 1ZNYA 4US0R 4KODA 3ZVNA 1Z3IX 2D3WA 2XZOA 1QBKC 4PC1A 4TYWA 3AKEA 2IXGA 4A6PA 1QHYA 2FSGA 2IYXA 1JB1A 4D4LA 1SZPA 4L9SA 3HU1A 2HT6A 2J45A 2WJVA 1E2KA 2WJYA 1V43A 2H1LA 2A2ZA 2HEIA 4NDZA 2QN6A 2VPPA 4QGGA 2R44A 1VCOA 3QPUA 2KB0A 3LNCA 4AI6A 1OFIA 3TVTA 3R9WA 4NZYA 4CYMA 4OHZA 4P31A 3CF2A 1Z6GA 2YWGA 2ZJYA 4K8OA 1M74A 2GK6A 4IDQA 1IN6A 3NWJA 3WXMA 3BH6A 2ZJZA 4AKIA 4KXFB 4ZKDA 5JHHB 1SXJE 4EJSB 4AYWA 3E1SA 3GFOA 2ZI6A 1XMJA 4MRRA 2IX3A 2ZJAA 2GAOA 2OBLA 2Z4SA 3LAWA 1KDRA 2KWIA 5FUXA 5JBQA 3BGWA 2YYZA 3L82B 3B1WA 1F5NA 3NBFA 2A5DA 3A1VA 4ZCMA 1ZP6A 2C9CA 4MRNA 1P75A 2HJGA 5EUMA 1ELOA 2ZROA 3PENA 1ZAKA 5HTKA 5UKDA 3DDCA 1ONBA 1Z8FA 1R5NA 4KAXA 4NKRA 4H1VA 2F43A 3AH8A 4JKIA 1SVSA 1LV7A 2ZUDA 2GBLA 4TL9A 2WTUA 1TL7C 4B35A 2C5LA 3ADDA 3IDQA 1P3JA 3ZVRA 4FMCF 1SVOA 3UMFA 3AVYA 1N0VC 3CO5A 4OQMA 3OIVA 4QGFA 3VR4A 1J70A 4GNKA 1G8GA 4JLVA 1GAJA 4LYFA 2C04A 3DZDA 2ZUBA 5GJWC 4B3CA 1D8TA 2RGBA 4EFNA 1AIPA 1NJFA 4N1AA 3U4QA 3CPJB 2QSZA 4EDHA 4KCGA 4A92A 3D8BA 1ZIPA 2EWVA 1FMJA 3PG5A 1Q3TA 3QNUA 1CIPA 1N6PA 1Z0AA 4LV8B 4HAZA 5CIQA 1QHNA 1ZYUA 5IT5A 3HP1A 3NDPA 3IQWA 4LI0A 5HCNA 5B30A 1KTVA 3K0CA 4M21A 1XTKA 2B21A 2EVWX 4QBIA 4PAOA 1L8QA 3IEVA 1MH1A 3BB4A 3LBNA 1XCMA 4NE2A 3ZQJA 4E09A 1U81A 3B1XA 4OHWA 3R9IA 1UBGA 2XOKD 1WB9A 3QF4B 2OAP1 2CVHA 4KVAA 3THXB 3R20A 3PEVA 2ZI7A 4W5WA 5KOYA 3R8FA 4QNRA 3H86A 2IYYA 1I4TD 2YWHA 1DAFA 1ZMXA 3CWQA 2DWOA 2BDTA 4Q4AA 2ZS8A 1NN0A 3REGA 2VHQA 3CW2A 4IEEA 2RAPA 1AS2A 3N70A 3VU9A 2ZR7A 1NI3A 1N6NA 1NLFA 3CPEA 3AKCA 3CLVA 2ODEA 1W44A 5BWMA 3AVPA 1M7BA 1TU4A 3AV0B 3EIHA 5DO9A 4FXPA 3B9PA 3CZPA 2XXAB 1CJTC 1U8ZA 2AKYA 5FH9A 3QG5A 3ZVLA 5A4JA 2P3SA 1T8UA 4IOMA 4LJ4A 1I4LD 1C9KA 3IBYA 3CRMA 4HUQA 2RB4A 2PMKA 3ETLA 421PA 3QUSA 1WQ1R 3EC1A 4CZ2A 2JLWA 1TF5A 5L3SB 3U2QA 3AF1A 2XNSA 1SKYB 3K0EA 4Q48A 4B75A 3HYTA 4TQ9A 1H8EA 2W6IA 2ZRGA 3C41J 3FDIA 2VHUA 4YONB 1M2OB 1G17A 5H70A 1GIAA 1R8SA 4RZ3A 5HZKA 3L0SA 2ZE8A 4A9AA 1UFQA 2O52A 3FHTA 4DEYA 1PJRA 4Z8YA 1G7SA 2FPMA 3SI7A 4XWAA 4IOLA 1SVKA 2R9VA 2J1LA 2O8BA 3KXLA 1CRQA 1W7AA 1OIVA 4HB2A 4F7WA 4M8NE 1OFUX 1RRFA 1BKDR 1S9DA 3LVQE 1E2MA 3OEHA 4X8LA 1OIWA 4JLKA 5G3ZA 4C30A 2GESA 5IDVA 4LX0A 1G7RA 2UZIR 2ZITA 3E5HA 3KKPA 3CB4A 5E3HA 1MRSA 3IIJA 1D6JA 2JIZD 2ZYWX 2BMFA 1II0A 4JIMA 4JLPA 1AGPA 1XZPA 3BERA 1HURA 5KSYA 5KPJA 1N5IA 3BH0A 1CU1A 3K0SA 2QAJA 2WOJA 2F3TA 3DKVA 5CJPA 2JATA 2TMKA 2QY9A 1QHHA 1WDTA 2ZYVX 4UJ3A 1DEKA 5CLQA 3ZIAD 1JJVA 3TUZC 4C0SA 2FU5C 3G0HA 2F43B 4M0LA 2IW3A 2P67A 4JT2A 4QXAA 4BE7B 4DDTA 1WF3A 1E2PA 2QPAA 3ZJYA 1W36D 2HCBA 1JI0A 1TQ6A 2C77A 3GJ8A 1DE0A 3GJ6A 2XZPA 3HPQA 1MR3F 2ZQ5A 4TLDA 3FTQA 4FMDF 3SBDA 1GITA 2VP0A 1P62B 3K70D 2QPTA 3U4QB 2FF7A 4MGYR 1GTVA 3VKGA 4HDQB 3LQQA 5DHFA 3AM1A 1XP8A 1H65A 1XCPA 4V0MA 2JASA 3CZQA 4ZPXA 3QBVA 4TTPA 4TWZA 2ZPTX 3AGQA 2ONKA 1UKEA 5DE3A 1XNJA 2J9RA 2ZI9A 2CLSA 3WY9A 4BLSA 4CEHA 5LPNA 3ZD6A 2OO7A 4MYHA 4OQNA 4PR0A 1VYTA 1Z0IA 2YJTD 2JGNA 3PR1A 4Y0AA 5JCPA 1EWQA 4PC6A 4RZXA 5F3WB 1NJGA 4QKQA 4WXRA 1YZGA 4WZAE 3V4RA 4NCIA 1YE8A 2IYRA 3I1FA 2GCOA 5FFMA 4IOKA 3K9NA 2NGRA 2NO9A 1YKSA 3VR2A 5HR5A 1E9FA 3GFPA 2GXQA 4FW9A 1BIFA 1HYQA 3D31A 3P1JA 5FR1A 5B2ZA 3VMFA 1N6KA 1S1MA 4PSAA 4IVRA 1XXHA 3WP0A 4MRPA 3WNDA 1NNEA 1EWRA 1U0LA 2EFEB 3FGNA 4IXNA 2CHQA 1VMAA 4QNMA 3W34A 4Q4AB 1I2DA 3VX3A 1OXTA 1SKYE 4I1OA 5C1BA 5FL7D 1O3YA 4G1UC 3VU9B 2AFHE 1Q12A 2J7PA 3K09A 3TW8B 5C4GB 3C14C 4RFVA 3WHLA 5IK2D 2VSXA 3BXZA 4TL8A 1FP7A 1AQUA 2RCNA 1SVMA 3CH4B 4OBEA 1NSFA 2XEXA 3AVXA 2GEVA 4WW0A 4NYMR 4JBXA 4Q7KA 2BBWA 2EFHB 5FTKA 1E3MA 2EYUA 3MWLA 3H0KA 3OE7D 3RYTC 3VTKA 1TPZA 3FMOB 3EPLA 5DSZA 4ZDJA 1G18A 3N2EA 1AQYA 3EG5A 1ETUA 4HUQB 1TUEA 1UPTA 1XB2A 1XJQA 5KNDA 2IS2A 1W2HA 3UPUA 4XOIA 4A2QA 1E2LA 2NPIA 4AURA 1EESA 1QG4A 1W49A 2YC2C 3SHFA 5GJBA 3GCGA 3PFIA 2JLVA 1BH2A 3RWMB 1HE8B 1N5JA 3Q7PA 3A4NA 1ZCAA 2BV3A 1NVUQ 2K5UA 1MO4A 2DFKB 1UBFA 1DAEA 2VF8A 2ZI4A 4POAA 5DN6A 4C4PA 4H1UA 1Z6TA 3AEZA 3AVVA 5JS8A 5C18A 1E2GA 3GP8A 1WA5A 1XFAA 1XPRA 1GRQA 3G82C 1W0JD 3AVUA 2DHRA 1Z6XA 2ZAMA 2O8BB 2KJQA 2BEJA 2CCKA 1DPFA 4Q1CA 3K0CC 4OK6A 2ORIA 2ZSDA 2ANCA 3AF0A 4DXAA 3KKMA 3LW7A 4CVNA 5CJ2A 4BECA 3OZXA 3QXJA 2OESA 2GXUA 4HB4A 1CBUA 1OH7A 2V1UA 3CBQA 3ASYA 1GWNA 2OFXA 4TMVA 2O8EB 3DEFA 2FGKA 2YOGA 2AK2A 3AB3A 3IGFA 2ODWA 1E0SA 4PTLA 4OJQA 3OIUA 3IILA 3OIYA 4QBFA 4AKEA 4WBSA 3SYNA 4NTZA 4DC9A 2CHGA 1QHHB 2PX0A 1JALA 3WMFA 3NH6A 1GL9B 1VG1A 2GJ9A 3C8UA 4HUTA 4G3XA 3QENA 1G5PA 1LF0A 3MCAA 4XWOA 1VHTA 2W0MA 1QF9A 2QP9X 3NBXX 1D2MA 1P9NA 1S1CA 2MMCA 4EAQA 5AUPB 4RD4A 4UNPA 3WYAA 1QVRA 2F1HA 2QEQA 1TQDA 2RGNA 3IUYA 4B47A 1L2TA 5BXQC 1OW3B 1E69A 1J90A 4LJ8A 2WWHA 3UMSA 3DKPA 2ZSFA 5F9FA 1KNXA 1E2QA 4ARZA 2F55A 2VHCA 3ZD7A 3ICEA 1D9XA 5LDDC 4A8JC 2VQSA 3TGPA 2VP2A 2ATXA 2HLDA 2QENA 5CK4A 1PZNA 1BMFD 1SXJA 4Q4LA 2D06A 4MUBA 5HZHA 1W5SA 4WXPA 3VHLB 2GEDA 4CEHB 4TLEA 1NN5A 2PT7A 4KYUA 4C3ZA 5TXGA 3JZAA 2FDCA 3QIAA 2GWHA 2GEUA 1NG1A 3LWNA 1HY3A 1NN1A 2EW1A 1DTSA 4GPTA 5FR2A 5L3RA 3WRXC 4DLWA 3IQXA 4D2IA 1P9WA 3PVSA 3QKSA 2A5GA 2BM0A 1KAOA 2GCOB 2QA5A 4LYHA 4OI4A 3RC3A 2AD1A 4AY2A 1Z63A 1G8YA 1OB2A 4XSGA 3SJAA 1GILA 1E99A 1G8FA 3A37A 3NG1A 3ZS9A 4ASUD 5DGXA 2JLRA 4V0OA 3X2SA 4NYMQ 1VCIA 1XXHB 3O8BA 1YRAA 4BFTA 1II8B 2ZU0C 4LOAA 3GQBA 3B78A 5FUYA 4NCKA 3M4YA 4FN5A 4UXHA 4Q9LA 1S96A 3GMTA 3R8CA 4CW7A 2DR3A 4HB0A 4C0BA 1Q1BA 1MO5A 4JLOA 3MG9A 4TZ0A 4C2UA 2QU8A 4DBLC 1UBCA 1CJKC 1E2HA 2AFIE 3LW8A 4HI0E 4PO1A 4US2R 2HYIC 2IC5A 4DZZA 4XVUA 5FBLB 1KO7A 3Q5EA 5DH9A 3NHBA 4DLTA 3T5GA 4MRVA 1HT1E 2FJUA 1CJUC 3MRSA 3B1ZA 2ANBA 2WKRA 4JLAA 5L8VA 1VIYA 3M0EA 2O8FB 2P6NA 5JEDA 3T35A 4ZV4A 4DEXA 2ZJOA 2OLJA 5FOUA 4BLPA 1DOAA 1OKKA 1W0KA 1CR4A 4GL2A 1KI3A 2CL0X 3BE4A 1AA9A 5FPYA 4DLXA 1QHGA 4X8OA 3PV0A 1E2FA 2W0SA 3BBPA 3GJ7A 4RD6A 2DFLA 2GILA 1ESMA 2J87A 2QBYA 3LBHA 4LHXA 2OXCA 5CB8A 5JECA 3RSOA 2HT1A 4PC2A 4LUCA 2WAXA 3CX6A 4Y0VA 2GHIA 2JEOA 2A78A 1S4QA 3ONWA 1GM5A 3ZDQA 2FFHA 5EE0A 4G5GA 3VKHA 4DIDA 2QMUA 3KL4A 2PCJA 1E9RA 3U3JA 2XX3A 3OEED 1RRCA 2OFWA 5SZIA 3I8SA 3IIMA 4MYCA 4LJAA 3KJIA 3LFUA 1NF3A 4KFRA 1BOFA 1E9CA 1XWIA 1G3RA 4TYNA 1E94E 2W2XA 1H8HA 2P65A 3NEYA 4B3GA 3BWDD 4B71A 4RD2A 4V0ME 5FBVB 3I61A 2I4IA 1G7TA 4TQAA 4LJ7A 1HQCA 5L3QA 2ZM5A 3P4XA 2N46A 1SKQA 3MJRA 4TLAA 3HU2A 2PH1A 4QGAA 1ZM4A 5E7IA 1F3OA 1F60A 2FX3A 4L15A 4P0TA 2JJ1A 3O8DA 2HDNB 1E98A 4BZXA 3L8ZA 5BW8A 4HAUA 2OCAA 4R7ZA 1VG0B 1P61B 4TL7A 4O2RA 4PPFA 5AJZA 4YC7A 1NY6A 4MKIA 1IN4A 4ERNA 1XEXA 3CPHA 4ARZB 3H4MA 1G3MA 1A2BA 2PZEA 5TY0A 721PA 3I3SR 3KDSE 3Q3JB 5EE1A 3W90A 1SXJB 3T61A 1XXHE 3AP3A 3L0IB 2DFNA 3LV8A 4FWIB 1W2GA 4GT1A 4BQSA 4EPTA 1FQJA 1YZUA 1ZU5A 4XD7D 3PUXA 1E0KA 3LXXA 1NBMD 1U8YA 4P33A 3PQCA 4KV9A 1OHHD 2IL1A 3ZGXA 4YMTA 5FTLA 3QKSB 2OLKA 1FW6A 3T1TA 4IXMA 5GVRA 1ZUHA 4FMCB 1K5DA 3QKRA 2P6RA 2FSIA 4EPYA 1VECA 4GDFA 3FOZA 1CJMA 2XITA 3K0FA 2ODBA 3SJZA 5F2EA 1GKYA 3KTAA 2IWRA 5KO2A 3RANA 3SBEA 2A7QA 2DWQA 3GFTA 1XJ0A 4RKEA 1E96A 3NHAA 3KKOA 2QG6A 3THWA 4BZQA 3OESA 3AP1A 4XTRA 2XTZA 1T91A 5J4KA 2ZJBA 2AK3A 4M9SA 1CR2A 1GRNA 1DAMA 1U0JA 2FEOA 4G5SA 5J40A 4JYBA 4B43A 2Z6VA 3EPJA 1OXSC 5BN4A 3SN6A 2XZLA 2F1IA 4QC2A 2BIFA 4BUJA 2BJVA 1OIXA 4A36A 1S9HA 4MRSA 4PC3A 4DSOA 5FOXA 2WOOA 1G4AE 3U3MA 4URWR 4HDOB 3R7WA 5JJLA 3AKYA 4TTQA 3U3OA 1BYUA 2OEPA 3PXGA 2RGNC 4OI1A 2IA5A 4JKYA 1SVWA 3DPUA 5FPSA 1FUUA 2A5YB 1U2RA 1JR6A 5EP4A 5G3YA 4B2LA 2ZSBA 4M53A 3KXIA 2JJ2D 3A1TA 1E4YA 5JEEA 1SXJC 1ZNXA 4A82A 3MSXA 5EE5B 4NCJA 5F98A 2OHFA 3KUDA 2QBYB 2WHXA 2IF0A 2ZUCA 4OL0A 1IXSB 1NSTA 1COWD 3QY0A 4KFSA 4DUGD 4UNRA 2VA8A 3EA5A 5DISB 3KQNA 1F48A 4A15A 1N6OA 4IKEA 1ZD8A 3WHKA 3T15A 2QTHA 3M6AA 4MDFA 3K53A 3RWOA 5JZVA 2WKPA 2GA8A 4MKGA 5FOVA 3W5IA 4CT5A 2WBLC 4URXR 2R6GA 5CLLA 2BOVA 2WPDD 2ZIAA 5EP2A 4YMVA 2JLQA 1DAHA 1JQJC 4RFSA 3PEWA 1WXQA 2JCSA 3PUWA 1PUIA 2IUUA 2EFDB 1U8AA 3O8RA 4Q03A 3W3AA 1UEJA 3B9QA 3SC3A 1L7VC 1XZQA 1OPXA 4MGZR 3CNLA 2V54A 1GFIA 2XOKA 3WP1B 4UKDA 5JMTA 3T1VA 3LLMA 3U3KA 4CEIA 1S0UA 4P4SA 2O8CA 3IEUA 5L3QB 2ZRDA 1ZNZA 3DZ8A 1RVDA 3FKSD 4AG6A 3TSZA 4B48A 2BC9A 1DG1G 2VO1A 3BD9A 4X8HA 3TW4A 1M34E 1YHNA 3L43A 2AL7A 4NYIR 5CB6A 2IEYA 4FCVA 1KK3A 5D3MA 5FBRB 1N25A 3QE0A 1YZQA 1Q44A 2ZSAA 4DHEA 1UAAA 1E2IA 1IBRA 1VYVA 2FFQA 3EIEA 2PEZA 1GNPA 1XTIA 4HLCA 4I81A 4Q00A 4QFMA 3T1QA 3TH5A 1LVGA 1RZ3A 4Q4JB 1XDBA 1XEXB 1T9HA 2ZYUX 2G6BA 1A2KC 2QGNA 4D4KA 1ZUNB 4DCSA 4ZI2A 5AJXA 2C98A 4IVPA 2FA9A 2PCLA 2Q3FA 2YC4C 4B2IA 4QBGB 3LX8A 1OFHA 4G5QA 1PLJA 4B3DA 2OXRA 2IUSA 3OAAD 3UATA 4V0LA 2IYVA 1MO6A 2O5VA 4PPGA 1KNQA 2YVUA 4HZIA 1WCV1 2REBA 2GKSA 2ORVA 3WBKA 1W47A 4QHSA 3SFVA 3MGCA 3W3ZB 4KLNA 2OCYC 5EXXA 2WSSD 2FV8A 3A36A 4QJ5A 1YQTA 4UNQA 3EZ7A 4P3YA 3QKRB 3C5HA 4GMDA 3VX4A 4HEJA 4Q1FA 3V00A 1N3BA 1NVXQ 4R71A 2LKCA 1CR0A 3K0FB 4PPQA 4FMDB 5IHPA 1RC8A 3KTAB 4DJTA 2Q21A 4PPNA 2V4ZA 2C8VA 4EFMA 3THWB 3EC2A 4Q01A 6Q21A 2XGJA 4NBSA 5FUWA 4GBMA 1M6NA 2JIZA 4ACAA 1N6RA 1K8RA 1WRBA 3AKDA 2AKAB 2Z43A 4IFBA 2DFTA 4CGZA 3QJYA 3A1SA 4TLCA 1NBME 4EJSC 5JJKA 2CJWA 3KB1A 2DY1A 1R8QA 4B33A 1OXXK 1QHSA 3ZIAA 4US1R 3R7WB 4D26A 2H7VA 1RKBA 4M1YA 3W9YA 4D4MA 2V6JA 3WYFA 3HU3A 5A5GA 5CYOA 4D4JA 1F2TA 3WYGA 2QTFA 4OYHA 2N42A 4L4UA 1Z5ZA 4DCVA 3QEJA 1PLKA 2G1JA 2ZSEA 1R10A 1Z07A 1T0HB 5DI9A 2OBMA 1Q1ZA 1TQ2A 4Q47A 2ZREA 2P2LA 3THYA 3BFVA 2G83A 4KVGA 3B1VA 4BFUA 5KTYA 8OHMA 1KZGB 3L0PA 2JLXA 3X1ZA 3TLXA 1QHXA 1JEEA 3ADKA 4M9QA 3VKWA 4UQOA 1CULC 3C5CA 4QRHA 2C9OA 2J41A 2QNRA 2DWPA 3NXSA 4MH0R 5SZHB 4S35A 2NIPA 1Z47A 1FTNA 1GL7A 3DMNA 2IYZA 3RSLA 4BWYA 3ZLJA 1TQ4A 4KBGA 4AKGA 3ZZ0A 1T8TA 1BYIA 2FWRA 4RFSB 1E1QD 4EQ6A 2CK3D 2HV8A 1KJYA 4NYIQ 4GOKA 4Q19A 4B76A 3B13B 3KQKA 4KFUA 4U02A 1JAHA 1Q1EA 1R5OA 2ONJA 4CEJA 1U98A 1XD8A 1K6MA 1T4GA 1FFHA 1G8PA 2QRNA 2ZRHA 4JJZA 4LSGA 4W5JA 4AD8A 4CEIB 3B60A 4P4SB 2O8CB 2X8AA 5H8WA 3I32A 4D81A 4LZZA 1MO3A 1TEVA 2G88A 3QG1A 5K8IA 4C7OA 2WWGA 1MRNA 3QQ5A 4C2TA 3O47A 4URUR 5FL3A 3TNFA 4MGIR 1W5TA 3NIBA 2X2EA 4M1MA 1A82A 1KJWA 5FL7A 4O2LA 2PBRA 1DELA 5D3MB 1TUIA 2LCFA 1KMQA 1IJEA 2PZGA 1ZM3A 3W8NA 5IK2A 2WZQA 3Q9LA 3RNLA 4OI0A 3RRNA 4RJLA 4BRWA 4PSKA 1Z83A 3ZZTA 2YZ2A 1ZUIA 1G19A 4JT4A 5FI1B 3OE7A 1KGDA 3UG7A 1LNZA 4RKFA 3QF7A 4KO8A 3NTUA 1XBTA 5FBQB 1IY1A 1YU9A 1RW4A 1OH5A 4WZ6A 4FIDA 2EU8A 3LH5A 2G77B 3C4JA 2DCUA 3UMRA 2HUPA 4TSFA 4EKDA 1CXZA 1KI4A 2MSCB 4EFLA 4IEIA 3AF3A 1HE1C 1IQPA 4FCTA 1VDZA 4Q4HA 4V0KA 1Q22A 2W83A 1UKYA 1ZINA 1OF1A 1XD2A 3U6BA 3BRWD 1TTTA 4BASA 5HE9A 4DDUA 4Z51A 5DNYB 2CVFA 2ZAOA 1U90A 2OUKA 1W0JA 2N1BA 3U5ZB 5TMPA 1FL9A 3RS4A 3PUVA 2RH5A 3B82A 3U3RA 4Q7LA 3RHFA 2C78A 2FPLA 2GZAA 2AN9A 3AP2A 2PZFA 4Z8XA 2V55B 2WWIA 4P4UA 4XSHA 1WBDA 5EXSA 1LS1A 3VAAA 4LJ6A 1EFTA 3U7GA 1Z6YA 1X3SA 1DADA 1IAQA 3IBGA 1JQLB 1OLOA 3UKDA 2CBZA 3GLHE 4MITA 5HPYB 1Z0KA 4RD3A 2CJWB 2HJVA 3GD7A 1E4VA 2HXYA 3I73A 4UXJA 2R2AA 4HLUA 4DCNA 2GETA 5JRJA 3Q85A 1FTSA 1GL6A 1NLZA 4PSVA 5EXTA 1QHIA 3QPWA 4LBWA 4KJZA 4DIEA 3GPLA 4CRWB 2IXEA 1F2TB 3GLIE 1W36B 1IN5A 4I1SA 1M1YE 4YDHB 4RCYA 3PEUA 1GOTA 2QT1A 2IYWA 1VG9B 5TARA 2A5FA 4Q5IA 2F3RA 1EFCA 1F6BA 4MYUA 4NCNA 4A1FA 5C2JB 3K70B 2I1VB 2IK8A 1ZIOA 3GJ4A 1ZC4A 1NIPA 1KSJA 2GBLC 3K9HA 4XVRA 1YR8A 2HXSA 5CIWA 2NTYC 3EX7C 2ZE5A 3THYB 1W48A 3B8HA 2VTKA 1NN3A 5HKKD 4TTRA 3ZS8A 1TMKA 1P2SA 1ZM7A 1BMFA 3D7MA 3BB1A 1J8YF 3SE0A 1DBSA 3CM0A 3LVRE 4IRUB 4YMWA 3GJ3A 4A0FA 1W4RA 3T06B 1GNRA 2GDJA 1E2NA 4CT4B 2V1XA 2PLFA 1KYIA 2AWNA 1AKYA 1R4AA 1N5LA 3LY5A 4EQ6B 1SQ5A 2OSBA 3HR8A 1KI2A 3ZH9B 1YJ5A 2WM9B 4RZUA 5AWFC 4G5RA 4CEJB 2RGXA 2NZ8A 3MWYW 1EFUA 2IWHA 1KSFX 521PA 2OCPA 1AKEA 1JPJA 2E1RA 4H9GA 2VEDA 2QTVB 1U9IA 4ASUA 3BH7A 2Q9AA 1Z2AA 4DT1A 4TMTA 5J4VA 3DOFA 4C7OB 1NVVR 2JDID 2V7QD 2Z0MA 3H1TA 1Y63A 1KDPA 2B8WA 4M9XA 3A1UA 4PC7A 1IJFA 3CH5A 4R9UC 3MLEA 3Q8XB 4GZMA 1XRJA 4DKXA 5TB5A 1N5KA 1ZRHA 3NEJA 2QM7A 4QOSA 5DI3A 4DB2A 5EE9A 1JXOA 2ZR0A 2OFOA 3RS3A 1EX6A 5DHAA 1YR6A 4PZZA 3F5FA 4PQYA 4LYAA 1Z08A 3UK6A 4RD1A 2QSYA 2GTPA 2F6RA 3I5XA 2VP4A 4Q1AA 1E0JA 3TKLA 1W36C 1VCNA 2GJ8A 1KK2A 5DLQC 4GP6A 1E0AA 2VIIA 4CDGA 2FN4A 4DCTA 1XTSA 3DVLA 1A7JA 3K70C 4TYQA 1CS4C 3RRZA 4OQLA 5KSOA 1XEFA 2IHBA 4JSTA 5JS7A 5FPTA 3GLFE 4F4CA 4MKHA 4AYTA 2WMOB 4G5OA 1RYFA 4GP7A 1VTKA 1Q20A 4C0QC 4MYTA 1XD2B 1QG2A 1GDDA 2D74A 5EJEA 3SEAA 4JVLA 4E5UA 4KITB 3FPAA 4B3XA 2KBEA 2B7CA 3P26A 3EPHA 4I99A 1S2MA 4HZUA 3UWKA 4OHYA 1R0YA 2WJHA 3K8YA 2J46A 4YMSA 1Q0UA 2C99A 3K1JA 3T5DA 5GVSA 3OEEA 2VH5R 4PANA 2OM2A 4C9BA 4WAUA 5EP3A 5FPKA 1HUQA 2C95A 5CM8B 1D9ZA 2ZEJA 1IXZA 1N6LA 3SYKA 1N2CE 3I72A 2BM1A 1D2NA 2EWWA 2C96A 2PMDA 2D7CA 3MWKA 1T5LA 3PUYA 2R62A 5CITA 4DSNA 1IXRC 2GZHA 1R7RA 2QZ4A 4TMKA 4F91B 1EFRD 1JXMA 1ZJ6A 1KHTA 4ZDIA 4IDHA 1VIAA 2CXXA 4HB3A 3K9LA 4BLRA 1KO8A 2DB3A 2FSFA 3Q7QA 4PQFA 3LQRA 1E9SA 1AS0A 4WOPA 1VKJA 1G64A 1RE0A 2YV5A 3OFND 2DPXA 2MSEB 2X77A 1XTQA 3IHWA 2AWOA 3SR0A 2ZYTX 1KZ7B 4PAMA 3FMIA 1XPOA 1OE0A 2GK7A 2VHJA 3DO6A 3BAFA 2J5XA 3LBIA 2J0SA 2WWYA 1JR3D 2ERXA 2ZVQX 2XSZD 1A4RA 1NVVQ 1W46A 3U7EB 1ANKA 5K8UA 1RPZA 4LV6A 3FKQA 4XD7A 4JBYA 1NBMA 1OHHA 2IEZA 3L2OB 3KFVA 4QM6A 5AJVB 2D4HA 2NO6A 2QI9C 1XMIA 1KMHA 4Q1DA 4JJKA 1V5WA 2NQ2C 2PJZA 2BMJA 3FB4A 1Q1QA 3TSWA 2NMVA 4O25A 1MABA 4B3BA 2XNDD 4I1VA 3AUXA 2ZU6A 3FFBA 1OJLA 4JVSB 4U00A 2BJWA 1JAIA 4WIAA 1CTQA 4A0RA 5CM9C 2WAYA 4LHZA 3BOSA 4BLOA 5M04A 2CNWD 2RGAA 4ILEA 5DI3B 3W6PA 1EG7A 2GXAA 2GRJA 1G4UR 1T3SA 3A4MA 2IS1A 3QVVA 4L5BA 1XTJA 4NONA 2FOLA 1E2JA 4Q9HA 3A4LA 3ZVMA 4KYIB 2BMEA 1N6HA 3I8XA 4AG5A 3TAHA 3WNCA 3K09C 5DYIA 5DYGA 1OXVA 5J5CA 2BKUA 4DB4A 3ECCA 3W8RA 4JL6A 1U94A 1DAKA 2XB2A 1GSIA 4NYJR 4LHWA 2ZANA 1Q57A 4OKSA 1TADA 2OCBA 4BFVA 3E2IA 3GJ0A 4N0DA 4W7SA 5EZ5A 3HYRA 4RVCA 5KPDA 3IKJA 2AX4A 2X2FA 5KNBA 1Z0FA 2ZR9A 2JJ2A 2VSOA 3TAUA 4B34A 4LPSA 4Q9IA 2WWXA 1MKYA 2WWFA 4TT3D 1HT2E 2FSHA 2P0EA 1AJEA 4LWZA 1COWA 3QOFA 4DUGA 4NPHA 4YQFA 1ZU4A 4L16A 2J0UA 1M8PA 4PQRA 5FTJA 2D7DA 2QORA 5JRZA 2FH5B 4YXWD 4JLNA 4HZUB 1YVDA 2JA1A 2QUZA 3RS5A 3X1XA 1TNDA 3TR0A 2WPDA 4BZPA 4AK9A 1J99A 4A2WA 1UJ2A 4BFXA 4CF7A 1XPUA 3E70C 2CLCX 2AHOA 2W6JD 3EWSA 2ATVA 4TMXA 3IIKA 4UNNA 2J0QA 2DYKA 4JLDA 5EE3A 1KIMA 1DVRA 5A0FA 5FOTA 1ESNA 1L4UA 1YR9A 4E07A 3SS8A 2W00A 5GADl 2Q9CA 3AF4A 4O0MA 1P7CA 1WP9A 2BVNA 1S8FA 2WWWA 1N0UA 1OKKD 2QL6A 3VNVA 3DMDA 1FNNA 2FE4A 3FKSA 2RGGA 4P32A 3MUFA 1JJ7A 4RZ2A 1P2VA 1NIJA 3QXSA 1X8JA 1ZM2A 4EIWA 4S2EA 1JECA 221PA 3FMPB 4KHZA 1AZSC 2ZXUA 4NMMA 1IHUA 2WIAA 3SQXA 2CL7X 1R5BA 4D0LB 4Q21A 4NL4H 4XJXA 5SZKB 3TR5A 1Z2CA 1Q3HA 1LF5A 3M1IA 1GVNB 3DM9B 3P27A 3SZRA 1VPLA 1XTRA 1G21E 1FMLA 1US8A 4IDOA 5G41A 4JL8A 2ZE6A 1D5CA 1OFTA 1RRPA 4ZKEA 4DLZA 4JZKA 5JFGA 3CRVA 4TMWA 4RD0A 3OAAA 1G20E 3BB3A 1NLYA 3DM5A 1X8KA 4Z1MD 1Z28A 1G9XA 5D3QA 3BIFA 1GNQA 4ZDKA 3AVTA 3GLHA 2R6DA 3CF6R 2QP3A 1S3SA 2O8DA 1CF4A 4BRUA 3ADCA 1OXUA 4LC0A 3U60B 4LC1A 2ODNA 2WSSA 3LD9A 5LBIA 2GNOA 2H16A 2B92A 1G3IA 2IBMA 2R6FA 4BGDA 1KMHB 3GEHA
chains in the Genus database with same CATH superfamily
3LPDA 4I9GA 1FJGB 1JBQA 2H63A 2V5AA 1IRXA 1A8UA 1NW8A 1V7CA 1YNSA 2DG2A 2FPKA 3COYA 3EXEA 2A0KA 3D6HA 4F5YA 3I53A 3HTXA 5F5XA 5KSWB 1Y7TA 2VNIA 3T1OA 3FCUB 4ABTA 3N6RA 3KT3A 1PJ4A 3RHSA 4AMYA 4KXMA 3KYDA 2P2GA 2Q1XA 1UXGA 4F3NA 4LOHA 2OE2A 2QE7D 4KUGA 1JEDA 1TJNA 2PWBA 3B3AA 3GNLA 3S0JA 3SZMA 1NKSA 1NZJA 1OX4B 3P9NA 3X0DA 4C0HA 1NL3A 2I6GA 2NO0A 2FPUA 4OQDA 4UHCA 5EUBA 5FTNA 2PMEA 3CLHA 3EZFA 4HAXA 2RHTA 4FLMA 4RK5A 4ZCPA 1LZLA 3OTIA 4J76A 5LDDC 2OTCA 1ZH0A 3M4ZA 5GM2A 5JCZA 2B34A 2Q0HA 1D2EA 1YCDA 2I6XA 2ODAA 1R0WA 2A3RA 2ASEA 3DCNA 2H17A 3QW2A 1YRYE 4N47A 5C3UA 3R7NA 4BQEA 2H48A 2C9BA 3G6WA 5HBRA 1KSGA 3TSAA 1U3CA 2UZ3A 1Z8NA 4BNXA 4DC0A 3HXOA 4MPDA 3ZCTA 1JFSA 3HMQA 4WKBA 5HF8A 4R3WA 3DHWC 2VH2A 4FZJA 2BKXA 5AJYA 5D5PA 4PHGA 4QYSA 4OXYA 1M2WA 2J9XB 4OK3A 1YA6A 2NUAA 3VR3A 3TQFA 4FGJA 3LLUA 4L5CA 3DQPA 1TZ2A 1TX4B 2QTZA 3W1EA 4AJJA 3C4QA 3NLLA 1ZIDA 3TSCA 3MMNA 3HI6A 4I8IA 4Z2AA 2GPTA 3OZDA 2H4WA 5AM5A 2X5NA 5AOAA 2UU9B 2I7CA 2X23A 2XUQA 5IM4F 5IVIA 3E61A 2G1KA 3UMJA 4ER6A 1KO5A 4FSXA 2RGUA 2G72A 1XRNA 3F96A 1UWKA 1FFBA 1R8XA 2J0UB 3IMGA 1NBWB 4KE6A 2AJCA 2YJ4A 3EXG1 3UJ7A 2NO1A 3NO4A 3CIOA 3FHOA 3OO0A 4X97A 2Q0QA 2FNAA 5G0UA 5BO5A 4J7AA 1U3TA 3D6JA 3VUFA 4A1OA 1CB7A 1OZ0A 1W4CA 3RIYA 3VR6D 4NHOA 3W1WA 1KAGA 3HCNA 1KEPA 2BMDA 2FPIB 3MD0A 5FLXA 4Y30A 3VR5A 1IJBA 1SBIA 3D7NA 1PUJA 3LC2O 1YJXA 3R7FA 4D8TA 4AIIA 1K08A 2CXQA 4V03A 3OY7A 3OJLA 3R3SA 3VDQA 1XQ9A 4R69A 4EG5A 3C8HA 1BDIA 3ICQB 4M4SA 2QSJA 3KR1A 2Z5LA 1AS3A 5AW5A 1RPJA 5FBWB 5JPIA 1DX6A 4YRGA 2ZM6B 3H7IA 3C1OA 3LUPA 3T4XA 3M70A 2IFTA 1VCMA 2J59A 4KOEC 5K0BA 1JWLA 4JJ7A 3GEBA 2EDAA 4BFZA 1MOZA 2O1WA 3EA4A 4MW9A 4QO8A 1QGUA 1NI4A 4LTMA 4R2HA 4DL9A 3VSBA 3HFJA 1KWKA 1FP6A 4U63A 1RYYA 2OILA 3MRXA 1SRQA 1V39A 2F7SA 1UJ4A 3MC1A 4YAWA 1XU9A 5K8CA 2PX8A 1O96B 1NVEA 1FUYB 4NPCA 3SZGA 1Q0TA 5B64A 4URVR 4N5DA 1OI3A 1Z4PX 2AMYA 3EF1A 3TS1A 1FFYA 3DFKA 1NF9A 1KJ8A 3GGPA 1UM9A 4XFDA 4DDWA 3SFZA 5JJIA 1K5GA 1Y81A 2IUTA 4DCUA 5B6JA 3CRZA 2J08A 5GWXA 1X7YB 1WBBA 5IJAA 2A1TS 1KF0A 2BEKA 1OZHA 3FJ1A 3OD1A 3OVMA 4CM4B 1OREA 3ABOB 5D7BA 1SFRA 1IDN1 1U5AA 2HR1A 1GXSB 3EF3A 3FF4A 4M54A 2AD5A 4D3ZA 4ZEMA 3KQUA 1DXHA 1IOZA 2XE6A 4B82A 1HO3A 5GZ1A 5BYKA 1JIQA 2H5EA 2Y8EA 3DT9A 3HS3A 3R5KA 2NLOA 1JN0A 1PL8A 1CVIA 4MDYA 1XZNA 5I4KA 1ULTA 1WCYA 1G8SA 2QG9A 2Y0EA 5F35A 4ZTUB 1B23P 1EU1A 2K4MA 2O5CA 4XIGS 3THRA 5LYJA 4LJ5A 1R2QA 2VXYA 5K0ZA 1PVDA 1XC7A 3B85A 4YYEA 3RI3A 1OH8A 4NULA 2P2SA 3A2KA 1G5HA 1E6CA 1EQAA 2QD5A 3FPBA 2WUEA 4MQFA 4ZMRA 2HIAA 2B7BA 3HYSA 2MTBA 4QDKA 4U7FA 3W5JA 1EUDA 2IP2A 2VBFA 2IJGX 2YIDA 1FYEA 4DIBA 1GUAA 1YMVA 3OIWA 3PA8A 1U8FO 3QFCA 3FJOA 1KI9A 4BEVA 2W2PA 1P31A 5AVJA 5EP1A 3WLOA 4A23A 4KSCA 1JSLA 4GYWA 4PBSA 1G291 2Z5FA 1PN3A 2HSWA 3IODA 4I8DA 1NXPA 3UJBA 3JQEA 2PX2A 1VBFA 1J24A 3ABSB 4CV2A 3KO8A 5TGTA 2REOA 5DRYA 4A6XA 2HOQA 3P8ZA 1MUUA 4IFIA 4C4ZA 9GPBA 2CHVA 2GLXA 3BBLA 3LVFO 4RHUA 4JC8A 4FDLA 3NC0C 4AY5A 3D2AA 1VQ1A 3A58B 2Y92A 5T4BA 2I1LA 4Y1GA 3OMWA 3VKUA 1L4GA 3CV3A 4UJ5A 2DEUA 1YQWA 3U09A 2CKDA 2XUJA 3I6BA 1HXHA 1NDHA 2NXCA 1TU3A 1Y8ZA 3TLMA 1OLSB 4ARIA 2YJ6A 1JHVA 2JAHA 2N0SA 4L8GA 4CQLA 4TWRA 2ZSHA 4TS1A 2OD9A 4DFDA 4GD3Q 4DLYA 2N47A 3BKXA 1KO1A 1KDTA 5CB4A 2YY6A 2SECE 3LKVA 1QONA 1HMPA 2XVMA 4D9IA 5J4YA 3MB8A 3HEBA 4IH4A 4JLJA 3PYMA 1DMSA 4MR7B 1QQBA 2ONCA 3TIXB 4G37A 4V02A 5JASA 2NZJA 1A5TA 1U2PA 3LDUA 4PZYA 1J2TA 3A1FA 1D1TA 2AN5A 5DGHA 4F46A 2O8EA 2G5GX 2ZBVA 4URYR 3ETHA 4GX5A 5EJ2A 4ZVLA 4WZBB 5LFAA 3RC8A 1V8DA 2V7GA 5AJWA 2JANA 3HDYA 3QKUA 3SYRA 4TL6A 3GU3A 1G2PA 1B14A 1KKLA 2H2AA 3Q9UA 4K2HA 3TJZA 5EUQB 3A1DA 3WO0A 1YZNA 2L69A 2GN2A 1GTSA 5BT9A 1Y1RA 2OD2A 1HG0A 2X0RA 4YO8A 5C46F 2IF2A 5AJTA 2F1JA 3JRWA 4EF4A 5CD1A 1MOPA 4MGKR 4O3MA 3I23A 4WCDA 3OCYA 3GEIA 1ZVVA 1UP4A 3KLNA 3QXGA 3F5MA 3CY6A 3ZKWA 1RWPA 3NAMA 1THTA 5JI3E 1BDBA 4B32A 3O3NB 1BROA 5HR5A 2JJYA 3E23A 3E35A 2C31A 1SOUA 2O4CA 3NIFB 3T7EA 4F85A 4F8YA 3IR7A 3IA7A 3R3VA 1R15A 3V46A 1ZFNA 1KIAA 1Y8RB 4KO3S 5GV8A 2DHDA 1ISPA 4ZICA 3UWPA 4CODB 1JSXA 4JJEA 4ZGGA 4WOKA 3T3PB 5KNLA 3ITKA 4D6PA 1BX3A 3GLFB 1E9AA 2B78A 3FVRA 4M9ZA 3CCCA 1QRDA 1JQEA 1NXXA 4H4EA 1KY3A 1U0HC 2O2SA 2VVTA 3BFXA 4NBKA 1M7HA 2J7KA 3DBLA 4UNSA 3ZE0B 1RAAA 4QZVA 3OTOB 4CI0B 1PNRA 3NZEA 3M6FA 4KDFA 5AW0A 5ICSA 4DUZB 1T9DA 2G7MC 1RWKA 2I2BA 1ZOIA 1Q92A 3DOHA 4GRIA 1UJMA 2Y0DA 2FTKE 2ZRJA 3GAFA 5TRTA 4MINA 2E87A 4OFBA 2B1JA 3MFYA 3H2YA 2IU3A 1II9A 1WAMA 2H51A 1PQWA 3ESRA 4PYIA 3L7BA 4FX5A 2REXB 2YICA 4IIJA 4QGHA 4XDHA 1NXQA 3WL8A 1OH6A 1X15A 1RIFA 2AXNA 2X8JB 2ZETA 3H4IA 1S3GA 3IHKA 4JMPA 1XUOA 5JANA 3U7HB 5KDDA 4G01B 4I5DA 1J5EB 2B37A 2YMQA 4JKOA 3CKLA 1DTWA 3FI0A 2B5WA 3PQ5A 2F1KA 5EMLA 1JHQA 3AONB 3ONVA 1Z6ZA 4NS4A 2Z8XA 2G9NA 1WSAA 1BZYA 3AF2A 5JSYA 4E46A 4XVCA 3WQQA 1P4JA 1O6ZA 4ESHA 3LKDA 2UZ0A 5A3JA 1U0SY 1CF9A 1AUVA 4OUDB 2DUWA 1QUFA 2HYDA 4B6PA 3KJGA 3A1NA 2GPWA 4YRDA 1GZVA 3UMYA 3O8CA 121PA 1GV0A 2GZSA 2PMWB 2ROQA 2ZRPA 4JI3B 4DLKA 1J97A 2BKAA 4FMPA 1X7XA 2G6TA 1YZTA 3BRQA 3DBOB 3I5AA 4Z0TA 1HWYA 1EYZA 4B3SB 2QP4A 3S40A 4FYJA 1EA7A 3FHCB 3Q3IA 3NI2A 1RD4A 2CKMA 4QDOA 1Z0DA 3EDMA 2PFKA 1O6BA 1V5IA 2FQXA 5DT2A 1QQ5A 1AH2A 4OLHA 5IJ9A 4M0FA 1Q7CA 5KNCA 4RTNA 2VDLB 1K7EB 4S0ZA 4L9WA 3QXCA 4IS2A 4D5EA 1PWHA 4TZ6A 4QJ3A 4KVFA 3B6KA 5TQ2A 5ADWA 4N7BA 3L01A 1N4AA 2P1RA 1Z5OA 4YRLA 5HJ5A 3RTAA 1M2VA 4XYBA 1QO0D 3N86A 1CW2B 1P4GA 3LF2A 3V8EA 1HYEA 1NW7A 2JI6A 3NHUA 3OT1B 4D57A 4A0HA 1EFRA 5EUCA 4TSFD 4CGYA 4DG9A 3SQWA 3QOWA 4LOLA 3TE6A 3H19A 4UBNA 5KDOA 3SVZA 1FFWA 1GY8A 1P8JA 2FZ4A 4B3FX 1KBOA 1V1JA 3AHFA 4WZBE 1E3JA 2WWVD 5BMOA 4MMZB 3H6KA 3STWA 2ZATA 3EZXA 4OJKA 2V74B 3UAGA 5JPDA 1N57A 4MW4A 2NU8B 5C8ZA 2AXEA 1A2QA 1K3FA 1EINA 1Y6QA 4PG4A 2AZTA 5I5GA 3RSZA 1QNFA 3K8ZA 4LOIA 2F9FA 3TXXA 4EPWA 1P73A 2UYYA 1H85A 1K8YB 3E8SA 4IWYA 4RTQA 3UAYA 4WBNF 4Q7MB 3QUCA 1FXUA 1UADA 2B69A 3RLIA 3DL0A 3SIWA 3WK5A 3D6TB 3S2UA 3RS2A 1D6NA 4AU1A 3PIRA 4Q7JB 3LUDA 3D1VA 4F96A 2F3UA 4F1WA 5KKNB 3KJHA 2SKCA 4RK1A 3UCEA 4DLPA 2BFBB 3WLIA 2ZSUA 2CJYA 3E1KA 2NUPA 4K9QA 4EW2A 2B8TA 2CLDX 4C06A 2RGCA 4A8HA 1V26A 2ZDQA 1FUKA 2FFRA 3MTEA 5F1OA 1WNFA 3WHIA 2PKWA 1IJKA 1F2DA 1XCLA 1XZJA 3L7IA 4BMVA 2Q3MA 4RE5A 5AKEA 4W9MC 2SCUA 3SP1A 4N41A 2NZWA 2AYXA 2VF5X 2E55A 5JVDF 1U9CA 2V7WA 3DD5A 1YR1A 1M75A 1Q95A 3EF0A 3WMEA 4ZHQB 4OHMA 2P27A 1L5OA 1OV6A 1UR5A 1JPVA 1R18A 4FONA 4GI5A 4GVPA 5LZ7A 2WUFA 4OJTA 1F2UA 1R0ZA 2B7LA 2J7PD 3T34A 4J4TA 4EWLA 2W2LD 3ZI4A 1DPGA 2YJ5A 3JD0A 4XUDA 4QBTA 3B2QA 4BN0A 4REOA 1GTL1 5C9ZA 2XUAA 2QLMA 2XQVA 5DM1A 5LIRA 4U8GA 3IAS6 1A5SB 1RAFA 2R97A 2YVQA 3VMMA 3WV4A 1G3QA 1TM1E 2WVAA 1ZCBA 4PS0A 5CW2A 4Q7QA 5H3CA 5JADA 5JARA 1VE1A 2V9PA 4MCAA 1PGOA 2O0MA 3NBYC 4WY2A 3HQ4O 3EULA 4LDJA 4AJ9A 4FCCA 2X1LA 2QR3A 1QLWA 3EW9A 3GWZA 3MJTA 4ZIRA 2IPMA 1KI6B 4WLFA 4ZI3A 1BXRA 2F00A 1WETA 1GZ3A 3I37X 3NW9A 3T9DA 3ZXXA 5CVTA 1AXEA 1PQUA 3LDAA 4RCVA 3JQ8A 2CMKA 3OG9A 3SEZA 3F3YA 3CJQA 4MUEA 2J07A 2JVKA 4X41A 5LQJA 5CVEA 3BYZA 3KV3O 4EJMA 3LJKA 3G88A 2AS0A 4LV5B 1T0JB 2BFAA 3HP4A 3K35A 4JELA 3REFA 3BMCA 4A27A 1EVJA 2DBYA 2GTHA 2OCKA 3ND8A 1EA5A 5K8TA 1ZGZA 1EEXB 1J0BA 4F2GA 1P7ZA 3UG6A 3UUGA 1H1LA 3NBMA 2MU1A 4K6MA 3G85A 5JW6A 1DARA 1ZA1A 2QVLA 4I3FA 5KZMB 4UBLA 5FAKA 5IWCA 3G8DA 4F9EA 4R1PA 3H05A 1ZM9A 3CMMA 3H1AA 4FHFA 4JB0A 4M1TA 4ER0A 2WMNB 4HF7A 4UBJA 3TKAA 3FMFA 3QEMA 3TW0A 3CT6A 1LDYA 4AMBA 5AQ1A 5AVTA 5JZBA 3ZGZA 2RHWA 4E22A 5FKJA 4LRTB 5AI5A 1VP3A 4PZLA 2RH9B 4BYMA 1DV1A 5JXWA 1RZRD 3T9FA 3D8HA 3PHBE 4AKTA 2GPSA 3AZOA 4M6WB 3QFRA 4XCXA 2VAMA 3AVWA 4FBMA 2UXBB 1IUOA 2DH6A 2V3CC 2ZT7A 2CJFA 2BTQB 3EEFA 1L5YA 2CV2A 4AXXA 3GW8A 1E2BA 1XA3A 3IE1A 1JEQB 3NTOA 3DB1A 3OPNA 1O77A 1YBVA 3DTVB 2RHJA 4QG7A 1I1HA 1W30A 4R3UC 4MTLA 2X5OA 3P4UA 5MN5A 3RFTA 3G0IA 4Q1EA 4GQBA 3GLKA 4MVJM 4QBHA 4ZXFA 3ESBA 2R8RA 2IDJA 5T7BA 2WABA 1RJEA 1YVUA 4C04A 4ND6A 1ZA2A 3C15C 1ODTC 2SICE 4MDHA 4NP6A 4ACBA 4QHYA 4ZAYA 2P91A 5L3VA 1ZESA 2VFAA 2ZUTA 3TLBA 5FXMA 4CCAA 4DTCA 1ZW6A 5EXEA 5C8XA 2VUTA 4UFNA 2W58A 3LXRA 1I3KA 3UTCA 5HZGA 4G0VA 4OIFA 3ZX4A 1BMDA 1N34B 2V6IA 4DRZA 1HYGA 3WNBA 4WY5A 1ACMA 3DPSA 2JIOA 5DNUA 2WICA 2H11A 2EJBA 1EP9A 1TW2A 1N6IA 3EGXA 3GROA 3IP8A 3JD2A 4HDNA 1E5TA 3S6JA 2R1ZA 4JCCA 4XWKA 2HLDD 2PV7A 3K4HA 3MWEA 1S7CA 2BFCB 1P1KA 4NU5A 2V6GA 5AH0A 4BJ5A 1I3LA 1J7JA 2Y2VA 5DDIP 4ODIA 2VHZA 5HFNA 1W96A 4MW5A 3WKEA 1HFWA 3SNHA 1PV4A 2OT3B 2NZYA 1PJZA 3H65A 3AQ4A 3R3HA 4LRYA 4RQBA 2HJHA 3QA9A 1YULA 4BATA 2FLKA 4CIXA 2ZRMA 2CUKA 2ZS9A 1PBNA 4HRXA 1VFNA 2KE5A 2WFLA 4QPCA 2CNDA 2FUEA 1NKTA 3SYLA 4D74A 3DE4X 1TMGE 1HI9A 3PC8C 1UFVA 4MQBA 1QANA 4U9UA 5JMOA 1P91A 2VAPA 5GJCA 2XLBA 3SQOA 2VN8A 3H0EA 3HB1A 4G1FA 2ACEA 3NBQA 3H9JA 1VL2A 3RIMA 3LTEA 5K2OA 2QQGA 4WCVA 1YR7A 1PVOA 4AW9A 3L0OA 2BM8A 4QQNA 5FAXA 4TUYF 1ICEA 2QQFA 1M1NA 1DG3A 3B3FA 2AZXA 1I4DD 2D2FA 1EFVB 4DG8A 1ZICA 2XJ9A 4V24A 4FDVA 1Z6PA 4BE9A 4EJSA 1ID8A 2P5UA 1RJFA 4AC9A 1ZD4A 4AICA 1T36A 3DAHA 3BDIA 3BD6A 4BVEA 1M2EA 3QVMA 3EHDA 1M10A 1RAGA 4KLZA 4D0GA 4QTTB 3JSXA 4UU8A 3ZPXA 5FHQA 3DOEA 1M2GA 3CRQA 4X84A 3W78A 2COKA 2C8KA 4HDMA 4QUBA 3NWBA 2PL3A 5I47A 2RARA 4MUHA 4G0PA 2QI9F 2QE7A 5IUNC 3B6EA 1V2HE 4Q4JA 1FQOA 3S44A 1SU6A 3AXTA 4RACA 3C7KA 2AG5A 4UBMA 1L7XA 3C74A 3UFXA 3H3XA 4EMUA 1XEAA 1CKEA 2LTAA 1BN7A 1XRSB 4UAVA 1NHWA 4X44A 2RH8A 3HCCA 3MCTA 1BX0A 5C52B 4F7DA 2JPDA 2ZI5A 2EW8A 2ZTVA 1J2RA 4PINA 4G41A 4BBJA 1YQEA 2XCLA 5HYVA 5E7MA 1XU4A 3KS9A 3CSSA 4XGIA 4D9GA 1JDBC 3LCRA 3O8QB 3VR6H 1ZOLA 2YKGA 1NT2A 3H1EA 1HFKA 2V96A 3PPVA 1SUAA 2C03A 2E9SA 1CUUA 3ABRB 1U7DA 3AR6A 3M1AA 2BBTA 2XY4A 4Y6LA 3IUJA 3RVKA 1IHDA 1FDUA 3T5PA 2OK7A 3KJEA 4OBXA 3EIQA 3W4JA 1OMOA 1P1RA 3LA6A 1V96A 1Q5PA 4FYHA 2ZVDA 4K1XA 2Y6VA 4RIGA 4Q18A 3CKMA 3FIJA 1CY2A 3VGJA 5KTTA 3RKSA 4ZOQI 5AYVA 2Y71A 1KI7A 2QTLA 2XMZA 4XQEA 3WGIA 2FKAA 2OSVA 4GR5A 3SSMA 4D0SA 4R5HA 1G60A 4EF5A 2E5LB 4XFJA 1FNDA 3Q2IA 3P9CA 1R74A 1GGVA 3K9QO 2I1QA 3DKKA 5JI2E 5L9AA 3AT1A 1JBKA 3LUHA 3OU7A 1VLZA 3ICCA 3OZFA 3BORA 4MDEA 3QE3A 4GM0A 5JNLA 2JFPA 3AFMA 4WLUA 5KX5A 2GCPA 3LUGA 4RMIA 1OI7A 2RCYA 4D0NA 4E4TA 4AKHA 4P83A 1KP2A 1GR1A 1XJCA 4MW1A 1AKRA 4PZPA 1QOZA 4TKMA 4ZVOA 2L19A 2ZRLA 3I92A 4G26A 2GF9A 1C1HA 1HX7A 2QYTA 4KPUB 1PW7A 2RH4A 3FBTA 3VR6A 3WLJA 2GAAA 3AHIA 3BK2A 3C3DA 4X94A 3GEEA 1UJ6A 3TMAA 4RK0A 5BN1A 2JLUA 5C7LO 1OFVA 4JSYA 1UF9A 3BWEA 2UYGA 5CU7A 1ZN9A 3M1YA 3RRFA 4HADA 5AW1A 5L4SA 1D6SA 4L8YA 2HIHA 3P9RA 1K8XB 3KUCA 4V39A 1SUEA 2WC1A 1JQ3A 1VJRA 2BGNA 2YXEA 3UUWA 2XGOA 1H4VB 2FEAA 1QK3A 5E8RA 1JDNA 5EYPA 3ENZA 1EXMA 1I10A 3R4CA 4DCCA 3JQ9C 3KQTA 3U4DA 1CDDA 2KQUA 1EQUA 2ZYIA 4D82A 4BAGA 4NG5A 1TT5A 5EEGA 1UEIA 5K0JA 4BVBA 4G1BA 2GLUA 4NATA 4TMZA 3AUJB 2YQ4A 3E7DA 4HAWA 4W82A 3UEOA 3WG9A 3ZNOA 5CX1A 2YWCA 2ZRBA 2O0JA 1F38A 1JR3E 2AQIA 4DARA 3KLMX 3Q9NA 1PRYA 4B73A 1RI5A 2NZXA 3MSCA 3MMSA 3SNKA 2VYFA 1N0IA 1B0UA 2Z6QA 2HF7A 5AMXA 3JU3A 4Y6OA 1S2LA 2DFDA 1YFKA 5G53C 3S4YA 2KLHA 3NGXA 4OXQA 3ZWBA 2A9FA 4INOA 1ZNYA 3SXUB 1OGYA 3BF8A 1WXGA 1Z3IX 2D3WA 4KODA 4BO2A 4EZIA 5BUCA 3U56A 2XGGA 2EZ8A 2OHXA 5KREA 3GYBA 4UCQA 5KOIA 4D4LA 1DKRA 1SZPA 2ONYA 2XEDA 3HCOA 3R5XA 1M2OA 2HT6A 4L9SA 4UVEA 1E62A 2NYRA 2YBDA 3IOMA 4EVSA 3DBVO 2W2KA 2HEIA 3JCZA 4NDZA 3DJYA 1F0YA 1EPUA 2R44A 2C29D 16PKA 1KXJA 2IKQA 1YL7A 4X45A 2H7CA 4NBNA 3F7MA 3PJFA 1Z8HA 4BCCA 4FYWA 4LSWA 5BR4A 4Q05A 2F67A 2H8GA 2WI8A 1SNYA 3AFNA 3BXGA 3CF2A 1Z6GA 1IATA 2BEWA 3LA8A 3MPOA 2F3PA 5LZ5A 4HWSA 3BH6A 3I05A 3RTEA 5DWVA 3T5MA 4AKIA 3U1BA 1EAYA 4B9AA 4DF3A 3TZHA 1NR5A 3E9ZA 1F9AA 1YF3A 3DE2X 4W9RA 4JP1A 5ALMA 5DCWA 2OBLA 2P2DA 4F9TA 1KDRA 2EEZA 2KWIA 3MF4A 3BGWA 3QTTA 2XNJA 4R3NA 1UANA 2QK4A 3PF9A 4TMYA 4QYIA 1F5NA 1QAOA 1EVZA 2A5DA 2EBFX 1SK9A 2PZ8A 3A1VA 1ZP6A 3CEMA 3DV2A 3DW3X 4V3BA 4DMFA 1ZAKA 5HTKA 1S4MA 5KS2A 4J7XA 3O9ZA 4PLCA 4QQFA 1GDTA 1R5NA 2PAAA 4KAXA 2DTEA 3ZWWA 4JKIA 4PLHA 1QK4A 1KDYA 1PJ3A 4TL9A 1H2ZA 4RA9B 4HK4A 3Q5GA 4DG5A 3AINA 3RYFB 2I2FA 2C5LA 2WWRA 3L5KA 5IN5A 4B35A 7MDHA 4FMCF 3A0UA 2Y1XA 2I2WA 2OQVA 1BTOA 5DLYA 2JIQA 3CFYA 1AOXA 2QUHA 1HPLA 1V3QE 4I19A 3KSMA 2AE1A 1I1QB 4JLVA 4UTZA 4KQCA 5KVCA 2C04A 1KARA 2ZUBA 3DZDA 4YAEA 1D8TA 5BN3B 4EFNA 2W6ZA 4MLPA 1NJFA 4RETA 5EWLA 5EIEA 4KACA 3CPJB 3ZW7A 4EDHA 1C3JA 2RAFA 1P9LA 1XVTA 4NJMB 3G6KA 2OBXA 3LPAA 5CNKA 2IYAA 2IOHA 1TKBA 2CN1A 2XOXA 3JPWA 4JYMA 4JBGA 5J5AA 2E5FA 3OKFA 2VDQB 1CIPA 4KIUA 4GPAA 4EGFA 3OA2A 3SD7A 3IEPA 4UAJA 5LJLA 1IWPB 1NVFA 4L57A 1LBSA 1QHNA 4P58A 1ZYUA 3B6JA 2WWTA 4ZPJA 3T3MB 4DR6B 3IQWA 5C8YF 2VNAA 4YMLA 3MYYA 2RC6A 3K0CA 4M21A 3UJCA 1FTYA 3NVKI 1GZ5A 3EQ7A 4NJEA 4QFCA 2XQIA 3HUFA 1YKFA 1L8QA 1P29A 3OJWA 1LQUA 3QLVC 4RMNA 4OB8A 2C4TA 2ON6A 3LBNA 3FYUB 3NXKA 3ZZNA 5JZSA 3OFJA 3J81A 3ZQJA 4HPWA 5B3AA 3GDFA 3B1XA 2H1FA 4OHWA 4HGYA 4OD0A 1UBGA 3MXTA 2I7TA 2JFVA 2PQMA 1WB9A 3QF4B 4KVAA 3THXB 1I3CA 1FP4A 1CZLA 1ULSA 4TOIA 5FF9A 2V3VA 2IYYA 1NBEA 3INGA 1DAFA 1FVOA 2W6MA 4Q4AA 4RF2A 5EHQA 4LW8A 5I4CA 3NUZA 2C7RA 1LGYA 2ZS8A 1NN0A 3FPLA 2PSSA 3REGA 4C6TB 4IEEA 2C7QA 1AS2A 1ZJJA 3I04A 3MT7A 3Q8WA 1XMXA 4L3WA 2VJYA 4TSRA 3REQA 3VU9A 3CPEA 3TW8A 4ETIA 3CLVA 2ODEA 1CZKA 3WL4A 1P17A 1X13A 5BWMA 3M81A 4YASA 4CIWA 3EIHA 1YUMA 4MRNA 2NSJA 2WUVA 3K4PA 3PT9A 4FXPA 1YS1X 4OHKA 5TS2A 1CJTC 4EF6A 2AKYA 1A77A 1IQ0A 4JASB 5DM4A 5FH9A 3IUEA 1FFXB 4E21A 5K01A 3L4JA 2FVXA 2XI4A 6GPBA 2J5RA 2WAOA 1I4LD 2GJ4A 2J3JA 2O2CA 3H3FA 1W5EA 1C9KA 3QLTA 1G98A 1TK9A 1UJNA 3VYSB 1Y89A 1WTCA 5FIUA 3HUTA 4N7RA 3ZWDA 2JNWA 1SUBA 4IUYA 3KT6A 4N0QA 3RROA 3U2QA 3AF1A 2XNSA 4U4AA 4LY9A 3Q87B 3A9VA 2NT3A 3K0EA 1N92A 5CPFA 1UJCA 5TNXA 1GAEO 4FFWA 4B75A 2B20A 2H85A 1HYHA 1VJTA 4KQEA 4TV9F 4UULA 3C7DB 3C3EA 3FTFA 2ZRGA 3C41J 2OXIA 3FDIA 1E1NA 2V58A 2IXTA 1TEHA 3DFIA 5IKEA 1NKVA 3DH0A 4RZ3A 5HZKA 5REQA 1VZ2A 2M6LA 4GC5A 1EH5A 3BWCA 2HK7A 2V4UA 3BZWA 2G71A 4ND1A 1QYWA 4NU8X 1PX2A 2O52A 4OIMA 2V7TA 4WLVA 5KYUB 2FSSA 3FHTA 4Z8YA 4LXYA 3R5HA 3T3HA 2X8BA 2GWRA 1ISSA 2PS3A 1ADCA 3OPXA 3KXLA 1MVOA 3QJGA 1OIVA 3DULA 4F7WA 4M8NE 4AUMA 2H52A 2IHTA 5GZ3A 1S9DA 5ALTA 1OIWA 4JLKA 1QFJA 3DNMA 3ON5A 1F06A 4HCJA 4GKJB 3KKPA 1CUGA 2V6MA 3OIFA 4X7PA 4K8RB 1A96A 2JIZD 5EVJA 2X0EA 2ZYWX 2FUNB 3K9WA 1EKXA 4O59O 4EG7A 3BERA 3K8OE 2O3TA 5KSYA 5FX2A 5KPJA 1N5IA 3KKKA 4ZVMA 4MJ3A 4HS4A 3K0SA 3NM6B 1VM6A 2QAJA 2WOJA 2F3TA 3DKVA 3GRVA 2IGBA 3WDSA 2NACA 3DBHA 3H9BA 3O2SB 1U0NA 2GBGA 4UJ3A 3MB5A 1W5BA 5BMVA 1LLQA 1PFKA 2C4HA 2FW0A 1E66A 4C0SA 1YE5A 1JFVA 1E8MA 2F43B 2WYHA 3W77A 2JD0A 3WLFA 2IHJA 2ID9A 2IW3A 2P67A 3MEQA 1A8PA 2FMHA 2IZ1A 4JT2A 4PLZA 2AVDA 5GONB 4F1JA 4MX8A 2HCBA 3WI7A 2W8ZA 1TQ6A 4CDNA 1QO0A 1YOVB 1UPUA 1YRHA 2UUBB 4ZOCA 1CQJA 1MR3F 1O94D 1PFVA 4FMDF 4JJIA 2VP0A 1B6GA 4EJ6A 2J3KA 3RUFA 3W9SA 1YDGA 3LQQA 3AM1A 1XP8A 1ESEA 4V0MA 3DVAA 3WIBA 4ZPXA 2BFDA 4ALMA 5EJ9A 3QVTA 1RPNA 3GA0A 3OQMA 4YN3A 5KAPA 2VDNB 1UKEA 1X0VA 2XT0A 4RHXA 4FFBB 5EMJA 3WGLA 1I6WA 2ZI9A 2XGSA 5CURA 4DS3A 4KR3A 4X9XA 1S8OA 5LPNA 1SOVA 3CX4A 4LIPD 4IZ6A 5BOSB 1Z0IA 5AOBA 4DV2B 5C1PA 3GNQA 3G3EA 3AO0B 2DAPA 2FR8C 2YJTD 3HNRA 2BEVB 3AEUA 4Y0AA 5JCPA 2FPRA 5I7FA 4PC6A 3ZY4A 1WEKA 2YZNA 2ZSIA 1RZRA 5F3WB 3WIDA 4BVFA 2XV1A 1J1IA 2EW2A 1VA5A 2C4VA 2LGJA 4NCIA 1YE8A 2IYRA 3I1FA 2JA2A 3E9RA 5G0TA 1EVYA 5FFMA 4IOKA 4UHKA 1GGHA 2NO9A 4WLEA 1YKSA 5D84A 3V4SA 4YS6A 1E9FA 5ALGA 1ZLYA 1BIFA 2I2CA 2Z04A 4GI1A 1S1MA 3KR0A 2VPWA 2GCIA 2M9MA 3ODPA 3DEYX 3PXEA 4FNAA 1M5UA 4PSAA 3SX2A 1NNEA 3ZK7A 1EWRA 1RWOA 4XB1A 1R66A 5CFPA 1QTNA 1MQ9A 2ZP1A 3LNTA 2P9JA 1DKQA 2J32A 2Y6UA 2B4AA 3CYFA 3OQVA 4QELA 4R1UA 2AFHE 1SUPA 2IV2X 2J7PA 2AW3A 1QCYA 2QRPA 1E2UA 4ZVSA 4H6PA 4BBAA 5IK2D 4FOTA 4DRXB 2GF2A 3F5SA 3E82A 3TRIA 1DC3A 3ETEA 1IL0A 3HJUA 1DJPA 1NSFA 4UDOA 3AVXA 2GEVA 3KM0A 2NXEA 4NYMR 1X14A 3DAYA 3HKDB 4Q7KA 2BBWA 5JFTA 5LR6A 3MWLA 3EPRA 3HJCA 4Z86A 2V7PA 3ELUA 4MTCA 4WK4B 3EPLA 1ADGA 1AQYA 3EG5A 3N0RA 2A3NA 3QUAA 3AUFA 4HDRB 4HUQB 1XB2A 4HMQA 4MV5A 4RM3A 3V1UA 5JDIC 5KEIA 2IS2A 1QH1A 1R9JA 1CYEA 1EBFA 2NP7A 3L4SO 1L5WA 3AR3A 4RV5A 4MW7A 2YC2C 2HZBA 3WDMA 3CKYA 1LSSA 3E9DA 1BH2A 3NPAA 1HE8B 3RWMB 2GEKA 3QKWA 1T6BY 3A4NA 4LHSA 2K5UA 3ZDBA 2FPGA 1DAOA 1GZHB 2ZI4A 3TRDA 2PYIA 4I46A 4RHCA 3ORSA 4XPIB 2X0KA 3AR2A 2O7RA 1AURA 3LM8A 5JS8A 4HWRA 4X7BA 1ZJWA 3P9YA 1IYZA 4M0CA 1QKJA 1XFAA 3R7DA 2FMTA 3O1JC 4TV8B 2DKNA 4RLSA 4JI1B 1GRQA 3E3NA 4FSHA 1P7WA 4BO8A 1Z6XA 2ZIWB 1XKXA 3D43A 4X1IB 2KJQA 1LNSA 5BVHB 2O8BB 2ORIA 1XQ6A 2ZSDA 1RXIA 1GYQA 2PMCA 1K0UA 4BQPA 2RE8A 3DLBA 2IPXA 2OESA 1Y7IA 4HB4A 1YASA 2GEBA 1VLHA 3ASYA 3DZCA 4DMCA 1MC8A 5EHGA 4TMVA 3DEFA 4YJ3A 3D64A 4D8WA 3IILA 4A16A 1ZRNA 3IJ5A 4AKEA 1EWKA 5ICEA 4NTZA 3A9TA 1EUYA 2VXCA 2O2YA 2YXDA 1QB7A 2JLCA 4NAVA 1ZBQA 3TN7A 4ZK2A 2IZ7A 1T4MA 4G3XA 1H42A 5AM1A 1VIDA 2XWSA 4KPFC 2QVGA 1FY2A 1LF0A 1U2GA 3BTOA 2O19A 3BXXA 1IB0A 3L18A 4J16A 4XWOA 1QF9A 3NBXX 1P9NA 4ZOEA 1S1CA 5BQOA 3ZZ1A 1JLLA 3BFPA 5AUPB 4RD4A 2OMEA 3KU4A 3FMGA 5KJCA 1R0KA 3JYLA 5CIYA 1T4CA 4O1IA 5JAOA 1RVV1 10MHA 1KEUA 1TQDA 1Z7EA 3HV0A 3ET4A 1SZJG 2KW5A 3LP8A 5JNVA 5F7JA 4B47A 1JH9A 3PGXA 1L2TA 2WZBA 4LG1A 2YV2A 2RK6A 4YJFB 5BXQC 1J90A 4K6OA 4LJ8A 1SPXA 2ZRQA 4YACA 3PXXA 4AZ3A 4ARZA 4IIGA 3PDHA 2XB8A 3Q7IA 4I6EA 4MZDA 4N5NA 2FJ0A 5YASA 5K8VA 3TGPA 2HLDA 1GPUA 4EYOA 4FYIA 4OM7A 1D5WA 1WG8A 1I33A 3KQMA 5CG2A 2D06A 4MUBA 1GTJ1 2GEDA 2H06A 2WYOA 4HQKA 4YB8A 5TXGA 4JYZA 1Z82A 5DSXA 1F8UA 3ROEA 5FUQA 5CDYA 2GWHA 1FLAA 3AWIA 3M2PA 3KOYA 3RVMA 3HCAA 3WE7A 4CMIA 1DTSA 2OP1A 4DLWA 3DTVD 3OU6A 2POQX 2OFFA 3JWHA 1M8JA 3RUDA 3IQXA 5IYZB 3L8GA 3N2LA 3JVDA 3ELDA 4X20B 2GCOB 2QA5A 3R5FA 4LYHA 3V8PA 4TXNA 1VPWA 2C8JA 1IBCA 5TPWB 3OWXA 2WE8A 4K6KA 1E99A 2J9FB 1G8FA 1SB9A 2GD0A 1M6YA 4W8HA 5DGXA 2JLRA 1J8VA 1VCIA 1LVUA 3ED5A 3N8GA 4HWOA 5FA8A 2JH3A 5FUYA 3W8DA 4EYEA 3VZQA 3M7IA 1WZCA 1MTOA 2J0EA 3EEQA 1EZ4A 3GMTA 3HDQA 2DR3A 4TZ0A 4GLOA 4IM7A 3T7KA 5ALNA 4MYSA 1CJKC 1J22A 2AFIE 3B3GA 4F5EA 1XU7A 1X19A 3VH4A 4CKCA