1CR1A

Crystal structure of the helicase domain of the gene 4 protein of bacteriophage t7: complex with dttp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
277
structure length
245
Chain Sequence
MRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTGVVLVVICHLKTDLRGSGALRQLSDTIIALERNQLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA PRIMASE/HELICASE
publication title Crystal structure of the helicase domain from the replicative helicase-primase of bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transferase
total genus 78
structure length 245
sequence length 277
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1999-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03796 DnaB_C DnaB-like helicase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cr1A00
1N6IA 4OQLA 3TBKA 3K53A 3PV0A 1OIVA 4U5XA 3WYAA 3KKOA 2QMHA 3WMEA 1G19A 1I4LD 2UZIR 1DARA 2CLCX 4GRAA 4Z1MA 1E98A 3MG9A 1DG1G 2XNDA 4FN5A 1G8FA 4KCGA 1AGRA 1OJLA 5KDOA 3EZ6A 4JT4A 4W5WA 5LPNA 4TL8A 4EIWA 2VP5A 2GJAA 2Q6TA 3CZPA 3NXSA 3KQHA 3K0FB 5FUWA 1OHHD 1AKYA 2OXCA 2JIZA 2QT1A 3HPQA 4LK2A 4MGKR 4EJSC 2F9MA 1F5NA 2ZE5A 4L16A 5FPHA 1KKLA 1XU4A 4BLPA 4CYMA 1G7TA 4PTLA 3KQLA 1JR3E 4XWAA 4DDVA 1LB1B 3OIUA 2ANBA 4TMZA 4ZCIA 4US2R 3HP1A 2AFHE 4XOIA 4IOKA 5H1YA 4MRVA 4CZ2A 4M1WA 2FPMA 3PCRB 3AEZA 4XVQA 5F9HA 5JJKA 3PUXA 2JLXA 2EYUA 3NC0C 4GOKA 3I3SR 4NCKA 3EIHA 1E99A 4W7SA 1W0JD 2ZQ5A 5JWHA 3U3RA 4HB3A 1G7SA 1G3MA 2EFHB 3BH0A 1WQ1R 3PFIA 4Q47A 2J45A 1R0XA 2KJQA 3L2OB 2VF7A 4HAVA 1R5OA 3U3MA 4DDTA 3QQ5A 3P4YA 3C16C 2J0UB 3QXSA 2QP3A 1DAGA 1DADA 2GNOA 1G8YA 4YLGA 4Q4JA 2KE5A 3CPEA 3NHAA 3CB4A 2HV8A 2YZ2A 5KDDA 5LB4A 4HYYA 2XXAB 4NH0A 1P75A 1FMLA 1OXVA 1LVGA 1U9IC 2ZI6A 3VTKA 3EW9A 4MKHA 4LHYA 1HE1C 2ATVA 2EYQA 4V0MA 2ZVQX 1CIPA 5HCNA 4B32A 4DLXA 4M1MA 1U0JA 3E5HA 4XD7D 1SKYB 4NYJR 1E79A 4ARZA 6Q21A 1F2TB 1XXHB 5L3QA 2GBLA 4M0LA 1RYHA 2G0NA 4YMUA 1YQTA 2ORWA 4I1UA 5C46F 4U7DA 2WWYA 4OI4A 4RKEA 1FUUA 3SYLA 4AK9A 4B71A 5DN6D 1Q21A 4FMDB 2F9LA 5CJPA 2R6DA 1I4TD 4A2WA 4RD4A 2IEYA 3IEUA 4EAQA 1KOFA 2XX3A 3T15A 3LV8A 1NBMD 3IQWA 2CHGA 4JJZA 1ZD1A 1XZQA 1WCV1 5EQTA 2GA8A 2ZI3A 3CH5A 4HLUA 4JYCA 4YMSA 1G6OA 2QM8A 4JL6A 4EQ6B 3KKMA 3QF4A 5KO2A 1U0HC 4IDHA 2FU5C 1OXUA 1OT3A 3HU3A 3H4MA 1RRCA 2O8BB 2HT6A 2VP4A 4B3BA 2V1XA 5B2ZA 1XMSA 3GLGB 1LF5A 2FOLA 2IBMA 2RGNA 5EP3A 2VIIA 3AVOA 2ZS9A 2HEIA 2W6ID 2ZPTX 3HR8A 2HUPA 2CJWB 2IYXA 3SBEA 1DS6A 2WTUA 1IY0A 1SKYE 2BC9A 2WWWA 1JALA 5FPTA 4X8HA 1XEFA 1XXHE 2QTVB 4OQXA 3WNCA 3P32A 2H16A 4OQNA 1H8HD 3TSZA 2FF7A 4JMPA 4TSFD 4WW0A 2JLRA 2K5UA 2NMVA 4D80A 4DVGA 2G83A 4CRWB 1GL7A 2IEZA 1ZM4A 5IT5A 4LX0A 3K09C 4G01B 4JLKA 3RANA 3K0SA 2ZEJA 1NNEA 5AUOB 4M53A 1VCNA 721PA 1Z0DA 2HJVA 1NLYA 1XEWY 2EFEB 2ZJBA 2V8OA 2O8FA 3VMFA 4I81A 4GT1A 2GCOA 2XTNA 4ESHA 4NP6A 4RVCA 4NDZA 3CH4B 1I4DD 3PUYA 5FR1A 5JZVA 1N25A 4TLAA 3RS2A 3WHKA 2V55B 4WIAA 5EZ6B 1FOEB 2ZRHA 2O5VA 3ZD7A 3LDAA 3GLGE 2ERYA 1Q20A 1ZD9A 2QORA 3QUSA 4B2LA 1WMSA 1EGAA 2WSSD 1P72A 2C9OA 1QHSA 2CL6X 4NYIR 1D8TA 1KAOA 3SN6A 1EWRA 4PQFA 1A4RA 4BLRA 2QGZA 1CJUC 4DLYA 3GLIA 4H1VA 4DJTA 4BFYA 1E2FA 3H0KA 3Q8XB 5CJ2A 4DUGA 3I5XA 1EFCA 3U5ZB 4DLSA 1U8YA 3RVBA 2AWOA 1IM2A 4E22A 2XB2A 2OHFA 2DWQA 3QKRA 4M4SA 4JKYA 4DT1A 4OK6A 1W46A 2R65A 3QKTA 5JBQA 5KDLA 1WP9A 1G5RA 4TQ9A 1D5CA 1E9EA 1Q1EA 4B3GA 4Q01A 1XD8A 4L5BA 4TYYA 3GJ0A 5FOUA 4A8JA 2ODNA 1SXJA 2OILA 5EP4A 5EZ5A 4Q5IA 1Z28A 4PAMA 3MWLA 4WOPA 1P9RA 2ZRMA 5L3QB 5FBVB 1DAKA 3VR4A 2WIBA 3KKPA 5D3MB 3SJZA 4GFDA 2VHJA 4D82A 4TMTA 3RAPR 1M7HA 4B48A 4C7OA 1P9WA 1SHZA 1OHHA 2HF9A 5JHGB 1D6JA 1T3SA 3HYTA 3U4QA 4BASA 4UNSA 5IK2D 4KBGA 1CS4C 4US1R 5F2EA 5FL7D 4TYWA 1MABB 4JLNA 2WVJA 2FSFA 4BFTA 2C95A 1GWNA 2KWIA 1G7RA 1NVWQ 4PC2A 4BFWA 5CM9C 4Q9IA 4JS0A 1GNRA 5K8TA 2GAOA 1P62B 2QSYA 2CHVA 2C9YA 4PC1A 2XZPA 3CPJB 3MLEA 2ZYWX 3C41J 5EE3A 4KSCA 4GP6A 1PJRA 1W0JA 2EWVA 2C2HA 3AB3A 3B85A 4HLDA 3GLFB 2VO1A 4OHXA 2G1JA 1XPUA 2RKOA 3GLHB 5J4KA 1SVLA 2NPIA 4J0QA 3BJIC 4HUQA 4CEIB 1GNQA 2QTHA 2V6JA 3PITA 1W2HA 4FMBB 3LQRA 4DIEA 1W36D 5GADl 1G4AE 4HZIA 4M2LA 3A58B 3C15C 1IN6A 2C99A 4LJ8A 4XVRA 1YKSA 1T8TA 4NCNA 1KMQA 2GZHA 3CUEF 4XD7A 1DPFA 2IYZA 3EASA 2OSBA 2ASEA 4QM6A 5TVKA 4CT4B 2QQEA 4OK5A 3UK6A 1OLOA 1GILA 4B3DA 4AY2A 1XTKA 3OHMA 4FCWA 3BFVA 1NBMA 1GOTA 3QVVA 3W9YA 4KI0A 1NVVQ 5JEEA 3GLFE 3GLIB 1G64A 2ZTSA 1HE8B 4FCTA 3CRMA 1G8HA 3RC8A 3GLHE 1SVOA 4M9XA 4ZCLA 1KJWA 5CLQA 3THWA 5EE5B 4DXAA 3CR8A 3KDSE 4WBSA 5C4MA 2W0MA 3REGA 1G20E 4E07A 4RSGA 1OH6A 5J4HA 2FZLA 2OBMA 5TMPA 2RCNA 3DKVA 3H1TA 2VP0A 4TTRA 3JZAA 4IOMA 2AD5A 2WOOA 4TLCA 1UKZA 4X8LA 4UNQA 4GBMA 4Q66C 5FOVA 3FVQA 4CVNA 4TL6A 4IDOA 5FI1B 4LYHA 4PR0A 4ZKEA 4D4JA 1KO8A 1UF9A 4NE2A 4JBXA 5DSZA 3ZD6A 2W6IA 1Z0FA 4LV8B 3X1YA 3OIVA 2IWHA 2D62A 1KY2A 1TEXA 3R8FA 4M1KA 4RJLA 3LA6A 2JA1A 2G3YA 1F2UB 1H8HA 4KVGA 1OH8A 4TSFA 4MGIR 4HAZA 2Q3FA 1E0KA 3THOA 1FTSA 2ZROA 4AYXA 1E4VA 2H1LA 3C8UA 5FFMA 3GLIE 1T3LA 2W00A 3FE2A 5CLLA 1LF0A 4DCUA 1A2KC 1VCMA 2AN9A 2G9NA 3EXAA 1YR7A 4R98A 2AK2A 1E3MA 1EX6A 5BN4A 2RH5A 2IS4A 3DVLA 3NBZC 3OFND 3T1TA 1N5LA 2H8KA 3AKCA 1XCPA 4BPBA 3M1IA 4N0DA 4D0LB 1LFDB 2WWIA 4A15A 1SVMA 4LDJA 4NCHA 4MKGA 4B3FX 5GVRA 2QPTA 3H84A 5F98A 1S4QA 3KFXA 4MUBA 1JQLB 1DO0A 2C03A 3CRQA 4HDQB 2GBLC 2QAGA 4KITB 1UPTA 2GESA 3I72A 2RMKA 4NCJA 4AD8A 1W0KD 4HUTA 4B3XA 3EPJA 3KTAB 3I92A 3AM1A 1N6RA 3RRZA 3ZJYA 3UMRA 1EXMA 1CU1A 2CBZA 1UFQA 1U2RA 2NZ8A 3QI2A 1VECA 4JLAA 2RGBA 5L3RA 1G3QA 1NMZA 1G3IA 3X2SA 3P1JA 1AS0A 2Q3MA 1K5DA 1N6PA 4HUQB 3VR2A 3THYA 2G0TA 3A1WA 3TAHA 2ZJOA 4PANA 2F43B 1VKJA 3QXHA 3SFZA 4HLUC 4US0R 4DHEA 2ZM5A 4LJ9A 5IF9A 4C0HA 1AQUA 1YZUA 4LC1A 1A7JA 1F3OA 2J0QA 5JLJA 2XGJA 4UXJA 1JAHA 1QVRA 3Q3JB 3K1JA 3KFVA 2JEOA 3MJHA 3F8TA 3CF6R 2F1RA 2ZAMA 3QNUA 4BLOA 1OE0A 2XZOA 2PT7A 2Q3HA 5CK5A 2CEAA 5SZJA 4A36A 1E94E 2GJSA 3AVWA 5FOTA 3B6EA 2YOHA 1KI3A 1MO5A 2CL7X 3KQKA 2ZU0C 4PQRA 5E4FA 1XEWX 4RD6A 4URUR 1X8JA 2ZJ5A 1NSTA 1CTQA 5FL7A 4A0RA 1BMFA 2ZU6A 3EWAA 2MMGA 2J0SA 2G1KA 2WJHA 2ZRLA 1CJVC 3LX5A 3UKDA 1E1QD 1P2SA 2RAPA 5EE1A 1Q1ZA 1QHXA 2ZJZA 4CEHA 3QY0A 1IOZA 3KX2A 4D0NA 1E2KA 4XIGS 2FFAA 2YWGA 4TLEA 4URVR 4Q7KA 2IT1A 3SZRA 3RDPA 3ZLJA 1KGDA 4GOXA 3A1VA 4PZZA 3L82B 5KSZA 1NN5A 3EPHA 2GK6A 1BO6A 1JJ7A 1HV8A 2WHXA 1LY1A 4WZ6A 1UBEA 4JLMA 1A2BA 1DAMA 4CGZA 4FMCB 2OEPA 2FGKA 421PA 5DYGA 3EAQA 2IYYA 2ZSEA 2B21A 4BRUA 4B6FA 1SULA 1T3HA 3A1TA 1M8PA 1XD9A 2L0XA 1RRFA 5DHFA 5SZKB 1ZINA 2DHRA 1RYFA 1SVSA 4Q9LA 1CEEA 1NVXQ 2ZS7A 1X3SA 1ZM3A 5FTNA 4IFEA 2R6CA 4ASUD 1IN7A 1NY6A 2D3WA 4F91B 1P73A 2N42A 4URYR 1BYUA 5B58C 3PIRA 1Z08A 4I1SA 4EUNA 2AXPA 1FQJA 2CVFA 2QGNA 4TL7A 1IHUA 3K0FA 3FKQA 2VF8A 1T0JB 1DAFA 1LV7A 1RJ9B 1KMHA 1YRAA 4UNNA 2JAQA 3N2IA 4OQMA 4DSTA 4JLOA 4ESVA 4IDQA 3SBDA 3LW8A 3G0HA 2JASA 2IS6A 2CXXA 2WKQA 3DOEA 3QPVA 4BLSA 3G82C 4DDUA 1E2DA 1E2JA 5GJWC 3W6OA 1SXJC 4AKGA 1E9DA 2NO0A 2ZITA 1TU4A 3I1FA 2IF0A 3MSXA 1EFUA 4PPFA 2GETA 3PJRA 4JL8A 3SJBA 4YMTA 4LPSA 2KBFA 5EP2A 2OE2A 3U7EB 4POAA 3WNDA 4DDWA 1GL6A 2Z83A 3UXMA 3A4MA 4EPRA 1AZTA 1AIPA 2DFTA 5FUVA 1AKEA 2IL1A 4WZBE 1ZD8A 3QXXA 2ZRAA 5KPDA 1G8PA 3VAAA 3THYB 3AVUA 4LJ5A 5FBQB 2GAAA 4XWOA 4PPNA 2QE7D 4IRUB 3MFYA 4L15A 4LV5B 5AJZA 4ZKDA 4FMCF 3UATA 5C1BA 2J0UA 2V3CC 1Z83A 2OM2A 2ZANA 3KJIA 4WA7A 4BFXA 4QOSA 1IXZA 1E2NA 3B7GA 1KIMA 2R8RA 3CNOA 2J59A 4BEBA 1NL3A 1K6MA 1RIFA 3VR5A 1O87A 1MO3A 2XXAA 4Z54A 5JWRA 1XPOA 3WHLA 3PEWA 4F4CA 3GPLA 3VX3A 4Q1BA 3HU2A 3T61A 4JVMA 3HWSA 1ZCAA 3R8CA 1XMVA 4MUAA 4XSGA 3ETLA 1KO7A 2WJIA 4Z8YA 3SJAA 4FD2A 1T5IA 1WXQA 1Z07A 1F2TA 3TAUA 4LYJA 1XXHA 4PPGA 1K5GA 4AKHA 2QPOA 1YRBA 2PZFA 4KO8A 4LPKA 3ND9A 2FA9A 4UNRA 3OFNA 3PG5A 3SNHA 1NJGA 1XTSA 5FTJA 4DRZA 3ZYCA 4DBLC 1CLUA 3NH9A 2VPPA 4IOLA 1IXRC 1UADA 5EXSA 1ZC3A 2VHQA 3KXLA 3R7WB 4DLUA 1NG9A 5BYKA 4CEHB 2EU8A 3SFVA 2HYIC 3M0EA 2A2ZA 2ZUCA 5A4JA 2A5YB 2IA5A 3S1AB 4MGZR 1PZNA 1I2DA 1XF9A 4Q4HB 3GLGA 2QM7A 4DZZA 1TEVA 1XEXB 5SZHB 5HZHA 3FKSD 4TQUS 4NU0A 5EUQB 1UM8A 1JB1A 2ZE6A 2CJWA 1UKYA 3PVSA 3C7KA 2QP9X 3IPXA 1AJEA 2CCJA 4IW3B 1E9RA 3IUYA 1IN4A 1RKBA 4GSYA 3K70B 1ZRHA 1P4SA 2BKUA 1QHGA 2PBRA 1XBTA 4B2PA 4D4MA 2I1QA 4G1UC 3Q7PA 1MRSA 1B0UA 3OIWA 5EE0A 1GAJA 5SZIA 5J4YA 1W36B 4LJYA 4K81B 3TUZC 4LJ4A 2I4IA 1E2MA 1OXXK 3B1VA 1KI2A 3KJEA 3KKQA 2YC4C 2ZJ2A 1NF3A 4A1FA 1JAIA 1KMHB 1W44A 1Z6GA 4QL3A 2UKDA 2IYTA 1M2OB 2J9RA 1Z5ZA 2XB4A 2YWFA 5J40A 1GSIA 2DR3A 3KUDA 4X8MA 3MMPA 4A6PA 4P33A 3QSYA 1AQYA 3GJXC 1X1RA 4EFLA 1D2MA 1M34E 2QBYB 2ZRIA 3GMTA 3KXIA 3IHLA 2C9CA 4TTQA 1X6VA 1FUKA 2HDNB 2P6RA 1NP6A 3TUJC 1KAGA 1X8LA 4HAUA 1NRJB 5LD2B 3FDIA 1TX4B 1Z8FA 2EFDB 3SDZA 4M9SA 2QMEA 2WV9A 1CULC 3CONA 3Q9LA 2NO9A 1OF1A 1GG2A 1E2PA 2OCYC 2JJ1D 4Q7JB 4GZMA 2FFHA 2OLKA 3UMSA 1FX0B 5AWFC 1JXMA 4QJ3A 1OB5A 3M4YA 3DOFA 4C0AC 1P2TA 3IGFA 3QKSB 2FWRA 3CR7A 1CKEA 1HT2E 1P3JA 3TW8B 2OUKA 3RNLA 2QUZA 3D6TB 2JLVA 4JL5A 4B44A 3RABA 1XPRA 2VHUA 3ZS9A 1TQ4A 1FFHA 1Z47A 2C8VA 1WB9A 1AA9A 3WNBA 1HUQA 1N3BA 4OJQA 2G77B 3GQBA 2WIAA 3U3OA 1OFUX 3A37A 3P20A 2ORVA 1W7AA 1AZSC 1N5KA 1MT0A 2RGGA 2E1RA 5D3MA 1VG8A 1UEIA 1R5BA 2CDNA 2AR7A 3FMOB 2EQBA 3GFPA 4TMKA 4ASUA 1CJTC 2TMKA 4LBZA 4TYQA 2Z4RA 5FBLB 3FFAA 1MKYA 5EXTA 5HCIA 3KQUA 3QG5A 4Q9HA 4DKXA 1W48A 4Z8XA 4AYTA 1EX7A 1U8ZA 1YU9A 2KBEA 1QRAA 1N2CE 3B9PA 1L4YA 2OCPA 3K9GA 4MYTA 1MABA 1W5SA 3U2QA 2GJKA 3LY5A 5HPYB 3PXGA 3ASYA 3MD0A 3ADDA 2IS1A 4H9GA 1XD2B 4YXWD 2ZR9A 2FEOA 1W1WA 3SHWA 5DNYB 1Z3IX 2A5GA 2BJVA 4LHWA 5G3ZA 4LCBA 3HR7A 3T5GA 1G5PA 4QNRA 2JJ2D 1O3YA 2PZEA 4GMDA 4JVNA 4D25A 1KO5A 4XH9B 5BYJA 4KXFB 1FW6A 4P4SB 3MJRA 3EZ9A 1E0JA 3C4JA 2WICA 1N0WA 4G5SA 3MUFA 2GVDC 4LY6A 3RC3A 4CT5A 3GLFA 4U02A 4L9SA 1X1SA 4YMWA 2VEDA 2B7BA 3NBXX 2WJYA 4ZDIA 3WY9A 3AV0B 1Z63A 2WBLC 2YINC 4BZXA 3GLHA 3R9IA 2QE7A 2RGCA 5E3HA 1N5JA 1FL9A 4IFBA 4OQFA 5KSOA 2VBCA 1GM5A 4CEIA 2P2LA 2VSFA 4JLPA 2QA5A 4Q4AB 1NJFA 1IONA 4HLCA 2J7PD 3LNCA 4WZAE 1CBUA 1DAIA 3MAAC 1S2MA 1ZU4A 5FTMA 3VNUA 3ICQB 1BS1A 5CB6A 1GZSA 1EWQA 1D2NA 3IILA 4GMXA 2H57A 2ZE8A 1S1CA 4RCZA 1DAEA 2ZRPA 4BGDA 2VP2A 4M9ZA 1FNNA 1Z6AA 3W5IA 1ZVQA 1AN0A 2ZSDA 1NG1A 4ZDWA 3DDCA 1Z6XA 2C78A 1Y3AA 4IVRA 2O0JA 1QHYA 2RHMA 3F5FA 1UKVY 2H17A 2WPDD 4TLBA 3CNNA 3ZZTA 1XTQA 1M74A 1W47A 4B3CA 4DB2A 5JJLA 1ZMXA 1JQJC 2VH5R 2ZJYA 1U99A 1NVUQ 4MQBA 2WM9B 3VFDA 2GF9A 4R9UC 2XEXA 3OZXA 1E9FA 3N70A 4I1OA 5FOWA 2AFIE 2D7CA 5JEDA 1S3SA 5EE9A 4URWR 1S96A 4LBVA 4KHZA 1AS2A 2OLJA 2PH1A 4QHYA 1WRBA 5DGXA 5EXPA 2QU8A 5CB8A 3BB3A 4LYFA 2AL7A 4R2HA 1OH5A 1VCIA 3SEAA 3K0CA 1E2QA 1P7CA 2IYRA 3FKSA 4PSKA 5FPSA 2JLWA 1H65A 4II7A 2REOA 4Z51A 4LHVA 3TQCA 3VR6A 1YJ5A 3RSOA 3NDPA 4TMWA 1UAAA 1HEIA 3EPLA 1GL9B 1U90A 1F2UA 1TQ2A 5CM8B 1SQ5A 4G3XA 3WYGA 1FMJA 4O2LA 2NGRA 4M22A 2LWIA 2QN6A 1QHHB 3DPUA 4NL4H 4PAQA 2ZRDA 1RE0A 2JJ8A 1SVWA 4ZDJA 2CE2X 3LQQA 5E7JA 4DCSA 1SVIA 1CRPA 1DG3A 1GDDA 2Q9BA 2ZIAA 3O8BA 1QHNA 3CRRA 3RWMB 3T5DA 3P26A 3L0PA 4RKFA 2FNAA 3ICEA 2D06A 1VYTA 1EESA 3RYTC 4RD2A 3AVXA 2DFKB 1EFRD 4QKQA 1ZC4A 4PHFA 2GCNA 2PL3A 3AVQA 2Q9AA 2F1JA 2CCGA 1ZP6A 2ZYUX 3K0AA 3AGPA 2ZR7A 4BRWA 2FPLA 1RZ3A 5AJVB 1II0A 5C4GB 3NKVA 5KNDA 1G4UR 5G53C 2VP6A 3RS5A 4NONA 1PV4A 4PO9A 2XNSA 3AVYA 3R20A 3O8CA 3GEEA 5HE8A 1Z2CA 5JS8A 3KTAA 121PA 4Q21A 1AGPA 1L8QA 1T4GA 1VMAA 2JJ1A 2RGDA 3QEJA 4B74A 5FOXA 3SC3A 4PPQA 3K70D 2OG2A 2QAJA 3AKDA 1XX6A 2V9PA 3QE0A 4YDHB 4B43A 3NG1A 3WXMA 5KSPA 1E2LA 5BQ5A 3W3ZB 1NN1A 2F43A 3CLVA 4AIIA 2EWWA 2CNWD 3KJHA 2GVZC 4EDHA 4N3NA 4WXRA 2ZRBA 3TH5A 4TTPA 2FSIA 1L2TA 1ZIOA 2OFXA 3FFBA 2JDID 2PEZA 1NMYA 2ZI7A 1HQYE 5G40A 4M1OA 2P65A 5EXXA 3AP3A 1DE0A 1P2VA 1XMJA 2B8WA 3CX7A 4BEJA 3BIFA 4KYUA 5TB5A 1XB2A 1E32A 2A30A 5K8LA 2A5DA 1OXTA 3B9QA 3F0TA 5DN6A 3RS7A 2CL0X 1T0HB 4LRWA 3ZVMA 3IEVA 2QENA 4C0KA 2O8EB 1E9SA 3LLMA 3ZQ6A 2GTPA 4AG5A 2VA8A 1HA3A 5EUMA 1J99A 3JVUA 3ZH9B 3TR5A 4B47A 3E1SA 4LSGA 2BBSA 3BH6A 4A2PA 1E96A 2RGAA 2W2TA 1TAGA 2BEJA 3BBPA 3LO5A 4LWZA 2BCGY 5GJBA 4Q9JA 3RWOA 4AURA 3R9XA 2XSZD 1JBKA 4OBEA 4C30A 4NYJQ 2JLYA 4NMMA 2GJ9A 4IVQA 3LH5A 4E03A 4YXWA 2IWRA 3SR0A 3ZIAD 2QL6A 1VG0B 4FW9A 1B23P 1XP8A 2CE7A 2JJ2A 3RS3A 3N2EA 2HLDD 3NWJA 4URZR 3GJ6A 4L4UA 1OSNA 1E69A 3ZVRA 5BN5A 4KFSA 4IDNA 4KFRA 3K9LA 2ZRKA 2Z0MA 3IBGA 4AI6A 1GKIA 2YC2C 3DEFA 2NZJA 4TT3D 2BDTA 4V0LA 1FTNA 4MKFA 1XWIA 3TR0A 3AF3A 4MRPA 4ILEA 4M21A 1ESMA 1KJYA 2ORIA 3BS4A 1YE8A 2ZRFA 2J7PA 1E6CA 1QG2A 3T1OA 2N46A 1P2UA 2A3RA 3CW2A 3ADCA 4PC7A 1IBRA 2XTMA 2B7CA 1VYUA 3PEUA 4JLBA 2IUUA 3BORA 4DCTA 2ZREA 2VRWA 3THXA 1VIAA 1A5TA 1RJ9A 4V03A 4O3MA 4BFZA 3NIBA 3T35A 1KYIA 1II8B 2IYQA 4IEIA 2DBYA 1OW3B 4S35A 3LW7A 5DHAA 3SE0A 1YR6A 3K0AB 1PUIA 2ZUDA 2R6AA 2WSSA 4B2IA 4E5UA 3OEHD 1FP7A 3Q72A 1OB2A 1UJ2A 2WPDA 3O8RA 1NSFA 2N1BA 1UKEA 4E09A 1XNJA 3AKEA 3QIAA 1KK0A 2B6HA 2Q21A 5TXGA 2RHDA 1FP6A 3VHLB 1KK2A 2VYFA 4H1UA 1E2EA 4MYCA 4GDFA 2ZVPX 3IQXA 3PR1A 4BLQA 3O47A 5LDDC 1ZNWA 5CITA 3UPUA 1JPJA 3U44B 3D7MA 1ESNA 4RZ2A 1NN0A 1XCGB 3Q85A 5A5GA 5FUYA 4AC9A 4OI2A 1U9IA 1XJCA 4AWXA 2W6JD 2BMEA 4RZ3A 3QOFA 4QBFA 1G16A 3Q5DA 1R5NA 4LJAA 2DYKA 5J4LA 4NYIQ 1E1RD 4K8OA 1G21E 1IN5A 2FH5B 1C4OA 2WJJA 2LCFA 2PMDA 2FPKA 1G9XA 4B76A 1R8QA 1CJMA 2YHSA 1G17A 2O8CA 2RGNC 3C5HA 4P4UA 4DLRA 1CR2A 4A6XA 3EA5A 5ELXA 1E9CA 4QGFA 2YJTD 3CKLA 4LV6A 3TJZA 2XNDD 1Z0AA 2X77A 1Q57A 4TZ6A 3X1XA 1Q3HA 2JLUA 2OAP1 3V4FA 2EVWX 5JRJA 3QJYA 3KZ1E 1JEEA 3A4LA 2ZR0A 1V43A 3IHWA 3KUCA 1E4YA 1T8UA 5IK2A 4JT2A 2QI9C 5TARA 2XZLA 3U6KA 4Q18A 2ATXA 2B8TA 2EW1A 5JWOA 4UXHA 3AUYA 3FHTA 1GKUB 4JSYA 5DIFA 1GIAA 5KTYA 4L8GA 2NOAA 3R7WA 2A78A 2JLSA 2E9SA 1U94A 2ZS8A 4GOJA 5B57C 2YOFA 4OYHA 3EIQA 4ZIRB 1MR3F 2O8DB 4BZQA 2FGJA 3BWDD 1NLFA 2C98A 1UBGA 2PCLA 4Q02A 3S1AA 3W6PA 3U6BA 3ASZA 1CF4A 1KNXA 3HJNA 5M04A 4Q4HA 2CLSA 1XEXA 2RB4A 1YHNA 221PA 4EPYA 3OESA 4EPTA 2GJ8A 3CRVA 2OO7A 3CZQA 4PZYA 3I4LA 3B13B 4Q48A 3R9WA 1EK0A 1X86B 3IIMA 4P3YA 4Q1EA 4PX9A 3V4RA 5L3VA 2IW3A 5GJCA 1US8B 3EC2A 4EJSB 4IKEA 1RRGA 1MRNA 5EJEA 2IF2A 4F93B 2PJRA 2ZYVX 3MRSA 1N6HA 4ACBA 2CNWA 3ND8A 3QEOA 2IX3A 3UG7A 4DEXA 2V1UA 2ERXA 3TSOA 2JDIA 3BE4A 1QDEA 2C77A 2HCJB 3THXB 3BERA 2QQ0A 1N6LA 3MWKA 3K0CC 4KJZA 3LBHA 3AF0A 4BFVA 3B5JA 4IXMA 2PLRA 5HZKA 2SHKA 1E79D 4ZPXA 3KJGA 4W9MC 1KTVA 1R0YA 4MGYR 4NYMQ 1N6KA 1P61B 4QGHA 4KFUA 1LS6A 3T12A 4A8JC 4HSEA 2O52A 3HYRA 3VR3A 3W8NA 2BVNA 1HQCA 2E87A 1CR0A 3GD7A 2QBYA 1J8MF 4RD3A 2Z43A 1J2JA 2WMOB 4IHQA 3BC1A 2ZRJA 3NBYC 2J41A 4U00A 5JRZA 2IS2A 4Q1AA 621PA 1N5IA 1E0SA 3CBQA 3OAAD 1P9NA 3C5CA 1S9HA 3FWYA 3W3AA 2BWJA 1OIWA 4WXPA 5FR2A 1TADA 1E2HA 1YZGA 5FTKA 1TUEA 3LX8A 1TQ6A 1XZPA 4A2QA 2H18A 3J81k 2DWOA 3U60B 2XSZA 2GDJA 3L0OA 2DFLA 4X8OA 3B82A 3ZIAA 1WDTA 2PX0A 1SZPA 1Z29A 5FH9A 1AM4D 1FX0A 3A6PC 3TE6A 2CVHA 1ZUHA 5FUXA 3GEHA 2QG6A 4DEYA 4ZCMA 3QKSA 4M8NE 1VG1A 2HLDA 2W0SA 2OV2A 3PUVA 2FSGA 1JNYA 3EX7C 3PQCA 4OHWA 4CW7A 1OKKD 2WAXA 4TQAA 3FMPB 2ZUBA 5DLQC 3WYFA 4D81A 4TT3A 2GWHA 5AJWA 1XJQA 3K8YA 4TYPA 2O8CB 1G291 3BRWD 2P5TB 4MRRA 4QC2A 3UANA 5FPKA 2Z4SA 1T6NA 2QRZA 1TF5A 2P6UA 3AQ4A 3Q7QA 3TUIC 3FHCB 4TL9A 2X1VA 1F60A 5AJXA 4TMVA 2P5SA 5A0FA 2CMKA 4KODA 2H92A 1IJFA 3AP1A 4Q9KA 1A1VA 2NO1A 4AKEA 4O25A 2P6NA 1RVDA 4MITA 4F4IA 2AK3A 3LAWA 4OKSA 2WOJA 4DSOA 2IYVA 3PUZA 1R7RA 1VHTA 2A5FA 4CF7A 3I62A 4TN1A 5JCZA 3RS4A 2CHQA 2IK8A 5JECA 3B1ZA 2PJZA 3UMFA 4W5JA 2J5XA 3QKUA 4KLZA 4MYUA 4M9QA 3LWNA 1FPMA 3OEHA 4HEJA 4KU4A 5KHOC 4FWIB 2XOKD 5E7MA 1XD2A 4UKDA 2DY1A 3ZGXA 4C0LA 4RD1A 8OHMA 2P67A 1D9XA 4I4LA 4JBWA 2HXSA 4JLDA 1W0KA 3C14C 4BLTA 3FGNA 3I8XA 1DBSA 4QG7A 1Q44A 3NTUA 5L8VA 4DWJA 4C0JA 1VPLA 2DCUA 3ADKA 5BXQC 4HZUB 4P4SA 4XVUA 5FOSA 3SQXA 1ANKA 4FXPA 1NN3A 1IJEA 2IYLD 3FYHA 1ZAKA 5IRCD 4PHGA 1R2QA 2P3SA 2BMDA 1KI4A 3B1WA 3LBIA 2ZYTX 4EFMA 2W6JA 1QBKC 1BH2A 1MH1A 3NDBB 1RPZA 1Z22A 2KI5A 5UKDA 2J0VA 3IO5A 4Q4AA 1E1RA 1VTKA 2EFCB 4QJ5A 2CK3D 2V7QD 1E2IA 2ZAOA 4PFSA 5CK4A 4DIDA 4GZLA 2QPAA 1EG7A 3T06B 4LJ7A 2ODEA 2JCSA 2WKPA 5DH9A 4DC9A 4CEJA 1KNQA 4PZLA 2D2EA 3U3JA 2J1LA 1ZNYA 3GCGA 1NKTA 3EARA 1SXJD 5BWMA 1Z06A 1S1MA 1N6NA 1Z2AA 1P60A 5G41A 4UXIA 3EZFA 4YMVA 3AP2A 1VYVA 2ZRCA 1KI6B 1KHTA 4B33A 2IHBA 1R8SA 4LHZA 2UZ3A 4QHSA 4N0EA 4B75A 4D6PA 2QMOA 4KV9A 1NIPA 2ZSBA 4CDGA 5KNBA 1AS3A 4B6EA 4LBYA 2OFOA 4I1VA 1NKSA 4TYNA 5IDVA 2JLZA 4A0HA 2AKYA 1TQDA 2A9KA 1HH4A 1ZNXA 4R7ZA 3G5UA 2FZ4A 3FPAA 1E1QA 1DELA 3OF5A 3SQWA 2UVQA 4XSHA 4URXR 3I32A 1II9A 3KXKA 3ZZ0A 3GJ5A 2IXFA 3MCAA 3ADBA 1DTSA 2QSZA 2XITA 4QXAA 5KOYA 2OT3B 2FN4A 1KK3A 3IBYA 5J47A 1S0UA 3OE7D 2C5LA 2YNMA 1CR4A 1CRQA 2REXB 3BK7A 4A82A 4RFSA 1JI0A 4B35A 3DM9B 2FMXA 2REBA 3AVPA 3SU8A 3U3KA 4AG6A 3K0EA 2QP4A 3A1UA 4ON9A 1QG4A 3L43A 1KO1A 4PSAA 2OBNA 2R6GA 2IXGA 4LC0A 2J3EA 1KKMA 2NO7A 4RCYA 2EFGA 3RS0A 2QAGC 1Q22A 2ZI5A 2BOVA 1PLKA 1L7VC 4F92B 4IVPA 3T1QA 1YR8A 2AD1A 4QGGA 4Q00A 1QHHA 1W2GA 1TNDA 3PUWA 2WWGA 2BJWA 3O8DA 3TNFA 3LVQE 4F38A 4KFTA 2ZJAA 3CX8A 1NVVR 5J5CA 4B34A 2DB3A 1U8AA 2WWHA 3AUXA 4RZXA 5AUQA 3NEYA 3Q5EA 3KKNA 4PC6A 2W2XA 1U98A 2AXNA 2ZRGA 4D0GA 4KSBA 5G3YA 2PLFA 2HXYA 4LHXA 2ODBA 3RSLA 1J7KA 3X1DA 2GXUA 3NBFA 4DCNA 5BW8A 2NPFA 4HB2A 2WJVA 4UNPA 5FBWB 1FZQA 2IHYA 5C18A 2AWNA 2IUTA 2J46A 1OFTA 3TGPA 5KNCA 5DYIA 3OAAA 2FJUA 1XMIA 4PAOA 1T5LA 3SS8A 1RFLA 4PO8A 5FPYA 3UWOA 3D8BA 4JLJA 4DSNA 4XWKA 4LBWA 1OH7A 1FNMA 1W4AA 1S9DA 2VQSA 3ZDQA 4C0SA 2PMKA 4HAXA 2NIPA 2NO6A 3DHWC 3AKYA 4JZKA 2R2AA 4IOJA 1R4AA 1GP2A 5H68A 2YWHA 4FCVA 1C1YA 1Z6YA 3TW4A 2PX3A 3WP1B 5K8IA 4QM7A 3B2EA 4YONB 3FMFA 1OYWA 1OKKA 2ODWA 2OXRA 3DZ8A 2GEUA 2FDCA 1Q0UA 4CEJB 1IAQA 3SYNA 1R0ZA 3TRFA 2FG5A 1JR6A 1TPZA 1FQKA 1XTJA 2JGNA 3NVAA 3X1WA 1TF7A 4LOAA 5JI2E 2GZAA 4JJKA 2QROA 3TMKA 4JVSB 1M7BA 2HCBA 3D3QA 3I73A 4GI7A 4JYBA 3K70C 2CLDX 1YZTA 4NCIA 4NPHA 4OL0A 2O8EA 3IDQA 4C9BA 2V6IA 5L3SA 4L9WA 4FMDF 2GKSA 1RW4A 3LVRE 1JEDA 1ZM9A 1G3UA 1KI8A 2HF8A 3QXJA 1W36C 1N0UA 2JLQA 3W34A 4R2IA 2GXAA 4RY2A 2FSHA 4QBGB 1QHIA 1DOAA 3VU9A 4MDEA 1ELOA 4ZI3A 3V00A 4HATA 3A36A 2IYWA 2F7SA 2ZRNA 3U61B 3CNLA 1A82A 2AKAB 3LD9A 5JI3E 4YC7A 2XOKA 5DI9A 1SHKA 5GVSA 4M1TA 1S3GA 4RFSB 3GJ8A 3DM5A 4JBYA 2BV3A 4HDCA 4PC3A 3IKJA 4A9AA 3VKGA 2QY9A 1D9ZA 3QBVA 2J7KA 2ECKA 4QHTA 4Q7MB 3QPWA 1DO2A 4BWYA 4BE7B 3UG6A 1J90A 5AJYA 2FFQA 1R0WA 2YKGA 3OEED 1M6NA 1Y63A 3BB1A 4Q1FA 2XTZA 1WBDA 2WWFA 4DLVA 3EZ7A 1TMKA 2VSOA 3A8TA 3WRXC 4F4JA 5LD2C 3BOSA 1TL7C 3A4NA 2H7VA 4Q4JB 1GUAA 1ZBDA 4Q1CA 4XJXA 2R6FA 3LXXA 1W5TA 2CK3A 2V7QA 4QBIA 5DO9A 3RRMA 5D3QA 3H86A 2H5EA 5K8UA 2ZJ8A 5HR5A 1TTTA 1QF9A 4LGMA 5HKKD 3PEVA 1MOZA 3F3YA 3GJ3A 4Q03A 4ARZB 3CPHA 1MO4A 4LI0A 4NZYA 1OFHA 4GPTA 5ANRB 2F3RA 4DB4A 1II8A 5JFGA 4RZUA 4PHTA 3FOZA 5CIWA 1P5ZB 3TK1A 3D31A 2GF0A 5FL3A 3VQTA 5AUNB 3VKHA 3X1ZA 2IC5A 1UBCA 2NQ2C 3QXCA 4A0FA 3W8RA 5B64A 3IPYA 4JIMA 2LKCA 4C3ZA 4OHZA 5IHPA 2G88A 1BMFD 2NG1A 1GRRA 4G5QA 4OJKA 1XRJA 4HLQB 1X8KA 3WRYC 1Z0KA 3ZZUA 3QF4B 2BEKA 3EC1A 4HDOB 4K46A 4AKIA 2QMUA 4KBFA 3U44A 4HB4A 1ZIPA 3CIOA 4XTRA 1IQPA 2DFNA 3OE7A 4P31A 1ZW6A 1HYQA 4C0QC 1JR3D 1OPXA 5TDHA 4EPWA 5JJIA 1UDWA 1W49A 1S8FA 4V0ME 1GVNB 4I99A 1YZKA 3BB4A 5LB2A 4DLWA 2DPXA 2GEDA 1J8YF 2GXSA 4QGAA 1HT1E 5JCPA 5FI0B 3AF4A 2WAYA 4GP7A 1KDPA 3GJ4A 3WBJA 3HDTA 4A92A 3K9NA 3I5YA 5JS7A 2QEQA 2VHCA 2WMNB 2YWEA 2JATA 5JSZA 4NYMR 1BOFA 1YZQA 5AUPB 1G6HA 4C2TA 2R44A 2O0KA 5H8WA 1G1MA 1ETUA 5E7IA 4UJ5A 3MWYW 4BECA 4V0KA 4Y0AA 2NTYC 3CM0A 4KVAA 5L3SB 2O8FB 4IJMA 3ZS8A 2WKRA 4OHYA 2GCOB 1UBFA 3L8ZA 3DMNA 4V0NA 3SOPA 1KJZA 2WJGA 1H8ED 2C04A 1E9BA 3BXZA 3CWQA 4TMXA 4JSTA 2MSCB 3VU9B 2BM0A 2YV5A 1PVOA 2D74A 2Z5FA 4BZPA 2B92A 2VSXA 5HTKA 3UWKA 3EIEA 3I8SA 3B8HA 1GKYA 4NHOA 2I1VB 1IY2A 2D4HA 2WZQA 3TSWA 4D26A 2GRJA 1NIJA 3B1YA 3NH6A 2RGXA 3IIKA 1NY5A 4ERNA 3P4XA 1M1YE 4ZIRA 1LTQA 3CF0A 5KUTA 2O8DA 4M1YA 1COWD 1ZM2A 1RC8A 1KI7A 4OI1A 2FFBA 1LS1A 1HTWA 3AH8A 1ZU5A 1Z6TA 2AHOA 1GRNA 3DL0A 3NEJA 1KZGB 1WF3A 4IEEA 4D4KA 1XTIA 3VKWA 1GITA 1KDRA 1N6OA 1KSGA 4N1AA 1ZYUA 3B60A 5GJVC 1U81A 4QNMA 5DI3A 2VP9A 4WAUA 3SJCA 3GP8A 2GK7A 2MSEB 3QKRB 3VHXA 1OYYA 4IXNA 3TQFA 4CIDA 1DEKA 4ZO4A 4DT1B 3QBTA 4BFUA 5AK0A 2ZI4A 1US8A 1KDOA 4EJSA 2MMCA 1TU3A 1ZCBA 3RLFA 1KI1A 1ZJ6A 3CRW1 3KQNA 3CO5A 4YQFA 1MV5A 4EKDA 4A8JB 4C2UA 5JHHB 3AF2A 1SXJB 1J70A 4RD0A 4JVLA 1YZLA 3DMDA 4MRNA 2D2FA 3TVTA 2LKDA 1MO6A 4TLDA 4FINA 3WBKA 4XTCS 1E9AA 4HAYA 1HURA 2GEVA 3W90A 2QTFA 2GILA 4UQOA 1Z0JA 5C2JB 4C7OB 5DE3A 1F6BA 3BAFA 1K8RA 2W2VA 3BFKA 4QFMA 3U4QB 2DWPA 2W83A 2XJ4A 1G8GA 5KU1A 4BUJA 4QBHA 2YYZA 2QNRA 2F1HA 4ZDKA 2D7DA 1SGWA 3SHFA 5HE9A 3U7HB 3HPRA 5AR1A 2PEYA 4S2EA 1XCMA 2ONKA 2A5JA 1KI9A 5BN3A 2OCBA 4NKRA 4LZZA 4ITRC 2VL7A 3GFTA 3HU1A 4D4LA 1W4RA 1XFAA 4DCVA 2BMJA 1SXJE 3EG5A 1N0VC 2WSMA 4B73A 3EPKA 4P4TA 821PA 1DVRA 2FV8A 2VTKA 2X2EA 2HJGA 4LJ6A 1TUIA 1KZ7B 2GZDA 3GJ7A 3OEEA 4C4PA 5JSZB 3L0SA 1Q1BA 5CDFA 1LNZA 4Q4LA 1IXSB 1GTVA 2HYDA 4Z1MD 1TF2A 4P0TA 2GCPA 2GHIA 3U7GA 3CWZA 1NMXA 5FBRB 1CJKC 1KDTA 2O0HA 2BHRA 4KLNA 2BBTA 1PUJA 1NLZA 3W5JA 2P0EA 3EWSA 2BKEA 5E95A 2I3BA 5HKKA 2KB0A 1G41A 2JIZD 2W58A 3JVVA 4V02A 4D2IA 2CCKA 3M6AA 4Q19A 4QRHA 2AX4A 2XJ9A 1EFRA 1D2EA 4O2RA 3VX4A 4A0GA 4EPXA 3PEYA 1R6BX 4IDPA 1Q12A 3CF2A 2R62A 1YVDA 1ZNZA 1RRPA 3IO3A 3N5CA 4ACAA 4TZ0A 2V4ZA 1EFTA 1JECA 2ZI9A 4GNKA 4JLVA 4DSUA 4R71A 4YDSA 4ABYA 1QVAA 1G5TA 1L4UA 3LRPA 3TVDA 2QRNA 2ZXUA 2G6BA 4W5HA 3L8YA 2Z6VA 1YR9A 2FE4A 2YVUA 2ZETA 3KL4A 1JPNA 3RRYA 4UJ3A 3AVTA 3A1SA 3I61A 4Q1DA 5TV2A 1U0LA 1ODFA 1OV4A 2OESA 2A7QA 3H2YA 3K9HA 3MGCA 1VIYA 3THWB 3QVUA 4OHVA 4EFNA 1F48A 1WE2A 3EZ2A 3K09A 4HZUA 4TWZA 5DI3B 5CIQA 4Y0VA 2ANCA 2ZE7A 4HAWA 1XTRA 3TIFA 2IXEA 3BH7A 1JR3A 1Z0IA 2BM1A 4LUCA 1OFIA 1CR1A 3ZVLA 2F55A 1GFIA 1CP2A 3L0IB 1HY3A 5CYPA 1UEJA 2V54A 3QF7A 1KSHA 4NTZA 2OZEA 2F6RA 2PT5A 3QENA 4BFSA 1T91A 2IYSA 4MRSA 2BBWA 4G5RA 2OAQ1 1VDZA 1OXSC 1ZUIA 4F7WA 1ZM7A 4O0MA 2BIFA 4P32A 4AYWA 5JMTA 3LBNA 5TY0A 3AVVA 3T1VA 1NBME 2F1IA 1C9KA 1LW7A 4KAXA 1KI6A 3UIEA 1NI3A 3B1XA 1JXOA 4C0BA 4DLTA 4PHHA 1PLJA 3E2IA 1UDXA 1DAHA 3AF1A 2BBOA 2FX3A 4PSVA 4GL2A 5P21A 2VHTA 3EA0A 4Q7LA 4NBSA 2Y8EA 1YZNA 5EP1A 2Q9CA 1CXZA 1GRQA 1H8EA 3ONWA 1XJ0A 1WBBA 2HT1A 3WMFA 3JZMA 2BCJQ 3E70C 1W4CA 4BQSA 3CX6A 4MDFA 1G18A 1GNPA 5CYOA 1VCOA 4EPVA 1BKDR 1IY1A 3FB4A 3ECCA 1Q1QA 1VHLA 1ZUNB 4FI3C 2QAGB 2MSDB 1COWA 4DLZA 2OBLA 3LLUA 3DKPA 4HB0A 3FMIA 3LXRA 5KYKA 2QT0A 3DZDA 3FHOA 3T34A 3MWJA 4M1SA 1M7GA 3PENA 3LFUA 1SKQA 4MA4A 1JJVA 5F9FA 1KO4A 2IYUA 2WWXA 1KK1A 2X19A 2OCAA 1IN8A 3TLXA 3BGWA 1EFHA 3B78A 2KSQA 3NC1C 3GEIA 2ZSAA 4QJ4A 2ONJA 3GFOA 2VLIA 3WP0A 4V0OA 3RHFA 5B30A 2FEMA 3VNVA 1R10A 1G7CA 1V5WA 2OFWA 2ZSFA 3DO6A 1PLLA 521PA 1OIXA 2C96A 3ZQJA 1XDBA 1QZXA 2QZ4A 1E2GA 4RFVA 1E0AA 3NHBA 3FTQA 3OIYA 4FIDA 2IUSA 3IIJA 4PQYA 4JKIA 5KSYA 4G0NA 4G5GA 5FTLA 2BMFA 4LYAA 4FWTA 1BIFA 1Q3TA 2F3TA 3BD9A 4MKIA 4MH0R 2X8AA 3SYKA 3KB1A 4PXAA 5H70A 4OI0A 1W4BA 1AK2A 1ONBA 2R9VA 4PO1A 3U7FB 3W6NA 1VG9B 2Q0HA 2PZGA 3TKLA 1SVKA 5F3WB 5CDFE 3QG1A 4G5OA 1P6XA 2X2FA 3V9PA 2PCJA 1KSJA 4DUGD 3KB2A 2RGEA 4HI0E 5KPJA 4EQ6A 1BYIA 3SI7A 2J87A 4WVFA 4OK3A 3AGQA 3WMGA 1T9HA 1G3RA 2O8BA 5DISB 5LBIA 1KY3A 4A4DA 3BFXA 1KSFX 4ZI2A 2YOGA 4ZV4A 3RRNA 3REFA 4KYIB 4MYHA 2GXQA 3ZVNA 3VR1A 2XAUA 5J4VA 3QPUA 3P27A 1WA5A 1I2MA
chains in the Genus database with same CATH superfamily
2ZSHA 1N6IA 5DXJA 4AXBA 1O97C 2YJ6A 3E82A 1E3LA 2Y1WA 2JBAA 2YYSA 4ND4A 4P3NA 4QE3A 2RHWA 3WMEA 1G19A 1I4LD 3ZW7A 5BPHA 3HDJA 1UP7A 1X14A 1QH0A 3GAAA 4GRAA 4Z1MA 2WPNA 1E98A 2WVHA 4R6WA 5LLTA 1G8FA 5HBGA 4PVDA 4KCGA 4LWPA 2XMSA 3DOJA 2FWNA 4MEAA 5CUQA 5KDOA 1Y5MA 4EIWA 2OENG 1H94A 1Y82A 2GJAA 4ANFA 3WQBA 4MCHA 3KQHA 5FUWA 3E03A 5CDYA 4K40A 1PFYA 5DHUA 2OXCA 1JHYA 2JIZA 3R3YA 4LF6B 1R8YA 4NZMA 2QTMA 1W73A 5FPHA 4KVZA 4CYMA 2I4NA 4BLPA 4PTLA 3C7DB 1DC8A 3KQWA 3A6KA 5E0KB 3O0TA 4ZYXA 4B3TB 4LZPA 4XWAA 2PGAA 1LB1B 4J1TC 1VQ1A 1TFUA 5EWMA 3EA4A 3ANSA 2EJWA 2WT4A 2QNIA 3C87A 3TS1A 4B3HA 4DYVA 3W2EA 4XOIA 3DYBA 1GV1A 1MDBA 1PHRA 2X9VA 2PYIA 1NC3A 5CCDA 1LJLA 2FPMA 4AMGA 4JEIA 5IYZB 3OOSA 2E55A 2E49A 5CG2A 3PUXA 5ETJA 1LZKA 2GK4A 1NAIA 4II2A 4FXOA 2EYUA 3AJ9A 4GOKA 1GPUA 1PJAA 1JEYB 1OY1A 1W0JD 2ZQ5A 3U3RA 4QXMA 4HB3A 4CMIB 1G3MA 2H51A 3BWVA 1KJNA 1T2EA 3RR2A 1V26A 4Q47A 5D7NA 4NSNA 4DDTA 1EVLA 3HNPA 4ND2A 4YRGA 3P4YA 1QH1A 1JTEA 4KXWA 1P9OA 1XZHA 3QLUA 1DAGA 1UK6A 4P4LA 3S7ZA 2ZWPA 1OFGA 2GFIA 4UM8B 4FGJA 2E4YA 1U2EA 4Q4JA 3CPEA 3QEMA 1SOAA 3GCDA 5FA8A 3RRBA 3TSAA 3QX8A 1QP4A 2A1UB 2HMVA 2HV8A 2H1FA 3EB9A 1DJNA 1P75A 1OXVA 1PP4A 2VK4A 3G85A 3H4TA 1L6RA 3M6LA 4OHFA 3RSFA 1LWNA 1NA5A 1OZGA 1IB0A 3MTJA 3NTRA 4MKHA 2MTBA 1H9BA 4TWAA 1YZYA 4JGIA 2ZVQX 2H0RA 5FO1A 2WMYA 2HCTA 4IKOA 4BU1A 5FBKA 4U2CA 4M1MA 2PAAA 3EN0A 2A88A 3HDYA 3C8HA 1XRLA 1E79A 1QFYA 4GUAA 3I12A 4M3NA 4ARZA 2J3QA 4BQIA 4YMGA 3N6VA 4M0LA 1RYHA 5L3QA 2XA2A 1YQTA 5EEGA 4U7DA 1Z8NA 2FEPA 2XKBA 3A1FA 2WWYA 2JZOA 1KXZA 1FUUA 2WF5A 4OI4A 4AK9A 3Q8MA 2MJLA 4NBUA 3ABIA 5DN6D 4FMDB 1ZY2A 2F9LA 5EG5A 1X2EA 3EQ9A 1BVHA 3GA7A 1I4TD 3I09A 1DIHA 3WLPA 3B3AA 5A6VA 3RAEC 3HWRA 3IEUA 1IJKA 3HJHA 3MS2A 1KOFA 1OVGA 1YQWA 3T15A 2NU7B 4EAQA 3E15A 3FZEA 3O75A 3PDJA 1TA9A 1G66A 3T1NA 1J0DA 2EZUA 3COSA 3EMBA 4WOKA 4OAQA 4NJEB 2QD3A 3WNVA 4E5NA 5LUAA 3TRHA 3DF7A 2AKEA 1C4WA 2HIAA 4HJRA 2XAAA 1ADYA 4ZVTA 1IQ0A 2I55A 4ECAA 4LF8B 1JI3A 1QJCA 4DDHA 3L8EA 4EQ6B 4J90A 5KO2A 3ZDBA 1C9NA 3FOFC 4PIPA 3HU3A 1OXUA 3N8GA 1RPJA 4MLDA 1PV2A 4BYMA 3KSUA 2BFMA 2GPSA 2HT6A 2VYND 1Z5VA 3NX4A 4N5LA 4B3BA 4BCCA 2PWPA 3WIBA 5B2ZA 3RTCA 4EUHA 1Z8HA 1NC1A 2IBMA 2JFGA 1O54A 3AVOA 4TV9F 2G9UA 3FPLA 2Y1KA 1VZ3A 4HYEA 4KXLA 4PX5A 1F2DA 4IMPA 2HUPA 1RRVA 3LP5A 1V7PC 2IYXA 1M1YA 4L8LA 1DS6A 4YPOA 3QU9A 4YT4A 5HJ7A 3DLIA 1MN6A 1JALA 1WNFA 1ZEJA 3AEUB 1XEFA 4OQXA 4GOMD 2HO5A 4KIUA 1IC6A 2H16A 5LMUB 4OQNA 4FOTA 4Z53A 3I6YA 3ZU2A 4WW0A 3H3XA 4M36A 3F7OA 3JAMA 4CMGA 4D80A 4DVGA 1OGJA 2NMVA 2CXUA 2RHTA 4O29A 5EKSA 5GIOE 1ORVA 5MDHA 3HV0A 4FHDA 4YRZA 1IYZA 1ZM4A 3RU9A 4LX0A 2YMQA 3WISA 3RANA 4EKYA 3T5MA 1NNSA 5DGHA 2HJVA 3RD5A 4OA8A 4QIHA 3BMNA 3KV3O 3HJGA 5E6UB 3DFUA 1KEPA 2ZJBA 1SUAA 3LGXA 1YOBA 2QZPA 3JVIA 5CH5A 1DTWA 2GCOA 3NWOA 4WCVA 2W6CX 3DMTA 4V0RA 5E3JA 4ITVA 3A6GA 5DHTA 1MRZA 2VHXA 4PNPA 1SCDA 5DTMA 3GV0A 1UFRA 4E5KA 2FPSA 5CEEA 5I9LA 2V55B 5EZ6B 1FOEB 3ESAA 3ESDA 2H0AA 1BGVA 1JP7A 1AKTA 2DMRA 4G1CA 4XJVA 2ERYA 1Q20A 5IM5A 5ILQA 3UC9A 4DOMA 5JSQA 1WMSA 3L93A 3DLHA 1E3JA 4V0SA 3B70A 5AVWA 4Q3NA 3UT5A 2CL6X 5JALA 3SN6A 2VXYA 1NXOA 1EWRA 3D1LA 1R4MA 5JPDA 4L78A 1YCDA 4C88A 1FYVA 3GLIA 1N2OA 2II6A 1QAQA 4DJTA 1V4BA 1WDKA 1KVRA 3ZHTA 3DWFA 1FP4B 3HB7A 5CJ2A 4DUGA 4MCJA 1A98A 3U5ZB 4RZHA 4S1WA 2RARA 2P3QA 1S2NA 1U8YA 4DPLA 4WTOA 3UNXA 4C07A 2XB2A 1CUZA 1ZH0A 1CETA 4JKYA 4R05A 3VVMA 2ZW9A 3JQRA 4AY4A 4BLUA 4EI7A 1H4QA 2R65A 1UWKA 2RHLA 3DKKA 4XEHA 5BV1A 5JBQA 4NU6A 4RDHA 3ICCA 3E7WA 4YRBA 2A92A 5JJBA 3UMJA 3HBLA 3EF0A 3AF6A 1Q1EA 2QLFA 3AESA 4LKOA 5DYYA 4U0JA 4DC1A 4TYYA 3GJ0A 5FOUA 1K8XB 2ODNA 4OQDA 3PQ6A 5EP4A 1K3UB 4PAMA 5F2NA 2Z2ZA 2Y1XA 2LTAA 3BUSA 4KQFA 2VNIA 3SJZA 4TLLB 1PG0A 1WUJS 1WHSB 4TMTA 2DHEA 3V2GA 1M7HA 2NWQA 4FLFA 4WY2A 1RBYA 4B48A 4N41A 1BMQA 4C7OA 1Z2DA 4UM9D 3HKEA 3CSDA 1OHHA 5AM0A 3RK4A 3ANLA 1L5RA 2HF9A 2XBUA 3H13A 4LTDA 4BBZA 4DZTA 2QZZA 4UNSA 1I0LA 1JDPA 1MOPA 5CEJA 5F2EA 2DT5A 4OG2A 3L4KA 3E0XA 2WVJA 4KXYA 1JTFA 2FSFA 4BFTA 2C95A 4OIMA 4B40A 2KWIA 5C81A 3T3PB 3KTDA 2JFNA 3WYAA 2PSFA 1YVRA 3DOCA 2A57A 1YMVA 4XWYA 5AKGA 4Q9IA 2ZYIA 3JPWA 3MT8A 1SVUA 1XKQA 1N77A 3OU2A 5EHZA 1P62B 2C5BA 3NI2A 2QSYA 5K8JB 4GSKA 3JQCA 3PT5A 2KMLA 3S7TA 4PC1A 1NX9A 3OUUA 4UUQA 2DPMA 4CG0A 3CPJB 1Z68A 2AV6A 4KSCA 4W9NC 1A5SB 1PJRA 1VFPA 3O82A 3E7FA 4N18A 2C2HA 3B85A 2PRYA 4HLDA 5ABPA 1MAVA 1RJDA 2OZPA 3M5PA 2UVDA 4QPPA 4YRPA 1XPUA 2DECA 2RKOA 3GLHB 4NZ9A 5D85A 4Y2QA 4G0XA 4J0GA 5J4KA 1ZESA 2NPIA 3F96A 3M4XA 2O2CA 3BJIC 4J0FA 5IG2A 1GNQA 4NEQA 1I51A 1YTLA 2CXSA 4MINA 1THMA 4P0QB 4AS3A 1P0QA 4B9AA 4FMBB 4RORA 4UEQA 1WHTB 3GEDA 3H83A 4AJHA 3RSQA 5KYUB 3DF9A 4FE4A 5LQNA 2NSJA 1G4AE 1P5HA 4JNCA 4HQNA 4HZIA 1QFJA 3DH0A 3GW8A 3IFSA 4L27A 4OJTA 5CP8A 1PT7A 4C4TA 2E0IA 4RADA 1WY7A 2WAAA 4K5QA 1OFUA 4TMYA 1GPJA 1TOAA 2C9DA 3MUNA 5T3YA 2OOSA 4ZJUA 3PKJA 1DPFA 3JQFA 5C80A 4CLHA 2Q4BA 3USZA 1KVTA 2PDAA 4RACA 1H3EA 2BHNA 4YCDA 2H7CA 2XWPA 2IHVA 2QQEA 5EGSA 4OK5A 3A3OA 4TUYF 1BDIA 4GWKA 2WE7A 5DMHA 5KTKA 4IQ4A 4E13A 2X8BA 4E94A 4UCFA 1B0PA 3D2AA 3HG7A 3OZRA 1L1FA 4AJNA 1TKCA 3WWCA 1QCDA 1CERA 2YRWA 2VDVE 3DE7X 3DE2X 3A4TA 4H16A 1HE8B 2YWRA 1P6QA 3KETA 3RC8A 3GLHE 4UUMA 3K7EA 4M9XA 4C43A 1RIIA 3DMHA 4Y2XA 4ZCLA 1SIWA 5CLQA 5TR9A 2DFVA 4KR9A 4WBSA 3KDSE 3FHJA 3LG2A 2FEAA 3TQOA 2APJA 5FBHA 1JSXA 3REGA 2G70A 1F06A 2WIGA 4RSGA 4E07A 5J4HA 2OBMA 1OH6A 3HM9A 3H1TA 4QBTA 1BKSB 2YDXA 3CLSC 5U4QA 3JATA 1J42A 2COEA 4UNQA 4Q66C 5FJJA 4CVNA 4TL6A 1A8QA 4PR0A 1IZ0A 4U7WA 4ZT5A 4UASA 1X7YB 1L4EA 3NT4A 4DABA 4F6CA 5K3EA 1I3LA 3QUBA 1Y1QA 3IMGA 2J6IA 3GO4A 4LV8B 3U16A 9MHTA 4L85A 4J4BA 2D62A 3T7TA 1KY2A 1TEXA 3S8MA 1VIVA 3NNNA 4E2ZA 4KNWA 3LA6A 9ATCA 4YAJA 4RENA 1Y6RA 4YP9A 1OH8A 4FOSA 4KO3S 2CL5A 4KXQA 1E0KA 1UC5B 3ZLVA 1VMDA 2PRZA 2QN7A 4BKRA 5T7BA 4DMUB 3FPFA 4AYXA 5HSGA 3H2JA 1X9GA 2VVTA 3T3GA 5FFMA 3PA6A 1Z0UA 3IP9A 4S05A 1DJQA 3FE2A 3KQTA 5CNIA 4CKEB 2AN9A 3HRHA 3DD1A 3HWWA 4I9GA 5F78A 4LYYA 1M1XB 1LC3A 2RH5A 5AVRA 4W1QA 3ZY4A 4EHAA 1TI7A 3PIIA 4WUTA 2HWYA 6CHYA 3RIEA 1VE3A 3QWFA 3N5KA 4N0DA 3ZQKA 2C4KA 2HLNA 3A10A 5K0CA 1Y81A 4HJXA 2Q3JA 4MI3A 3ZWWA 5ICSA 5J58A 3V4PB 4LMRA 2Q5FA 2F48A 4F8JA 1SHLA 1UBUS 1Z34A 2HSGA 2WU0A 3EGCA 3L7DA 1S4QA 1I6LA 3FDZA 3M83A 1BWQA 3ORFA 4IXWA 2ZAYA 4MUBA 4NNOA 3L9WA 3LDGA 1DO0A 1QTRA 3CRQA 5FV4A 1U28A 4KITB 1TVKA 3I64A 1UPTA 4AD8A 2FLWA 4HUTA 1UMDA 3DONA 5KOHA 3KTAB 3IMKA 4HDAA 5EPUA 3ZJYA 3UMRA 1ZKDA 1CU1A 1E7WA 1QCZA 2NZ8A 1VECA 5L3RA 2Q4OA 2X5XA 2EG5A 4I55A 1NZDA 1FSFA 3PU6A 1R27A 4OGWA 1AS0A 1GQQA 2WHPA 4HUQB 3VR2A 4CM8B 3TAHA 2ATCA 3JQAA 1FYWA 3SEQA 3AIKA 1SG9A 3DYVA 1ORHA 3QXHA 1Y1PA 4FFMA 2SKEA 4PYOA 4EGSA 5A2QA 3BIWA 3VR6H 3UOWA 4Z4IA 3SQLA 1SUCA 4E31A 5J59A 3COVA 3UXEA 3JD4A 4NFHA 2G1PA 1AQUA 1VI2A 4LC1A 4GIBA 1I4WA 4YJ2F 1V16B 3T1YB 2CVOA 1EFAA 1PJ3A 3IXQA 3MWFA 6REQA 3P2JA 1C8LA 3HXQA 3NTXA 3D2LA 4TYMA 3L4JA 1QVRA 3K1JA 3F73A 3SZGA 4JUDX 1OE0A 2PU7A 2PL5A 3KPUA 4BGIA 2XZOA 2PT7A 2HA3A 3II6X 5CK5A 3KKZA 1MUUA 5KB3A 5A6SB 3KHSA 1ORIA 1TLLA 2IXTA 3AVWA 3B6EA 2DUNA 4OHKA 1KI3A 1MO5A 5FKJA 5JYCA 1IZ7A 1H2WA 1R0SA 1JEQA 2JNWA 2Q6VA 2VJAA 2GCGA 3IAFA 3IP1A 3NHYA 4N01A 3IUMA 3SE0A 5FUQA 1P0MA 3S2EA 5KU7A 5ALWA 4O4IB 1N4AA 1CTQA 4A0RA 5J3JA 6NULA 1BMFA 5LNK6 2IHNA 1QHFA 3EXFA 3N2ZB 3OEWA 1CQZA 2JFWA 3BULA 4BQRA 4D42A 7REQB 5A71A 3LX5A 3G9XA 2YN4A 4X91A 3R9XB 2FWPA 2R7KA 4DM3A 4WE3A 5U9CA 2IDKA 1N33B 3P27A 1Q1ZA 3MJCA 3R77A 2ZJZA 4TS4A 4CEHA 4UD6A 1Y9JA 2H1IA 2Z04A 5DXAA 2WU1A 2PXHA 3LX6A 5A05A 1HMPA 5AI8A 2JVKA 5AXCA 3E9DA 4D0NA 4DYHA 2YWGA 4AF8A 1KJ8A 3ZIDA 4URVR 2A0YA 1RQ7A 3SZRA 3TQTA 2WTUA 4GD3Q 3ZLJA 1T25A 3RH0A 2D0OB 2GA9A 1WAMA 1GEEA 4F2GA 3FFTA 3OZAA 3SQDA 3H1PA 4IZIA 1FFAA 1O0CA 1LV8A 2HR1A 1HV8A 2WHXA 3OHPA 3JQGB 1PWZA 1XZIA 1A2BA 5JSYA 3DVQX 4CGZA 4XWWA 3BXGA 3DV9A 1MW9X 2I7VA 3FX2A 3JY6A 3BREA 3VTFA 4EZBA 4DA8A 3EVCA 2PKXA 1JEAA 2MSLA 1Z5PA 3B7WA 3FUWA 4K2HA 5DHFA 4REQB 1ZINA 1FCJA 2DHRA 3IBTA 2KHZA 4PO3X 1WKCA 4Y6PA 1CEEA 2Q2QA 2VRNA 1G8JA 3CCBA 3EQ2A 1X3SA 3ENZA 1ZM3A 4NS4A 4YT5A 1ZW1A 4IFEA 4ER3A 1RXCA 1VSQA 5F7OA 1P73A 3ES9A 3QW2A 4KE6A 4URYR 5B58C 3PIRA 1Z08A 3E8XA 5JO0A 2AXPA 1PIWA 3BCUA 4TL7A 4CM3A 1IHUA 4DMFA 1PR4A 1I6MA 2VF8A 4FW8A 1GGEA 1RAIA 1YRAA 3ORSA 3ZQUA 4Y9SA 4YJ3F 2D0DA 3SBOA 3SZUA 2ILTA 4JLOA 4WLOA 2IOFA 1WUHS 3H7IA 3W1VA 1G5HA 1PGNA 4FT4A 2CXXA 2GX6A 5K0SA 3KEMA 3VJLA 1RMTA 5AKJA 4DDUA 1E2JA 2QRGA 1NXWA 2XQKA 1CFZA 1VBMA 3L1HA 2NO0A 3I1FA 3LPCA 1EFUA 2IOFK 3USCS 4AU1A 5LQDA 1AQIA 1EUYA 4LXUA 3V6MA 3UMCA 2I3GA 3P5BA 5BUQA 4LPSA 3I83A 5IYZA 5EP2A 3NHFA 4DDWA 3QWBA 4OFBA 1LGYA 3A9VA 1JEYA 1NQTA 2CMFA 1CQIB 5T4HA 1ZD8A 5JRDS 4CMIA 4I5IA 5KX5F 4TTSA 3ZGNA 4W5OA 3THYB 4RFLA 1QPBA 1UBRS 1ZSYA 4E5SA 4LJ5A 5FBQB 1ZXBA 2GAAA 4PPNA 4ENTA 4ZK6A 3MFYA 1YCHA 5C1BA 4ZV9A 1UCFA 2AW3A 4QVKA 1BWPA 1VRCA 4JN6B 1Z83A 2OM2A 5FT9A 3RVMA 3K1YA 2C2KA 2V65A 3KR2A 4WA7A 1IXZA 4MO2A 4ZT3A 3R3HA 4EY5A 3JR3A 4Y6GB 3D6NB 4J8PA 1UJBA 2OLEA 1JHOA 4ARBA 2A1UA 3CT4A 1O87A 2P8JA 3ASUA 4DQDA 4E33A 4Z54A 4KIJA 4TWJA 4XPIB 3S1LA 4XB1A 2P9EA 1CDZA 2WA2A 4M54A 5T5QA 3F49S 1WTCA 1L7AA 1ZCAA 1ZICA 1JYSA 3DB1A 4MR7B 1EHIA 5ES3A 3HKDA 1T5IA 1Z07A 3AU9A 1YIDA 1E6LA 5HM8A 5AQEA 1CZNA 2WIFA 2XUIA 1QGAA 4D7AA 1RXVA 2HDWA 1OC2A 4C6RA 2RONA 2PX4A 1YRBA 5HP4A 4M76B 3KEQA 1YHYA 4I9UA 1NQOA 3TCNA 3SHVA 4R01A 4LPKA 1T6ZA 2Q1WA 3OZFA 4DDMA 4UNRA 4LWOA 2NU7A 1L7DA 2GD2A 2PVSA 3DC7A 4S1OA 1IHXA 4NJEA 5I9NA 4F4UA 1MB4A 1IHOA 5JU6A 3KEGA 1D2CA 3R7WB 4R6XA 4HD8A 3A9TA 6GPBA 4KBYA 3Q3CA 1HDIA 1ULTA 3URKA 3WLJA 3ZHSA 4CN9A 5C52B 4H3SA 2GAFA 4K1LA 4HDSB 1K6XA 5DGCA 4DLNA 3JQFC 3S1AB 2VJMB 3B20A 3MMSA 4MGZR 2EF1A 2EBWA 4Q05A 2CF5A 2Q6LA 1I2DA 2SBTA 2QM7A 2VRCD 5CA1B 1NWCA 1TEVA 5EHQA 4RKRA 4XDYA 1P74A 2RJ3A 2RG1A 2WR8A 4NU0A 3NWBA 4L0CA 5BQPA 4CQJA 4XYBA 1PJZA 1XL1A 2ZE6A 1T1IA 1JG3A 1YDHA 4F5DA 1UKYA 4TQGA 4G5HA 1QYDA 3PVSA 3IPXA 3L0BA 4LDQA 3VR6D 2CCJA 2G9ZA 2IUFA 3WFZA 5J43A 2BKUA 4UCQA 2VAPA 2IYAA 2FK8A 1MLDA 4FYPA 4GOLD 1KOJA 3PNSA 5A02A 3DW3X 2R8OA 5EE0A 3VOTA 1GAJA 2Q5JA 3WIDA 2YWJA 3NANA 4O3FA 2IZOA 4LJ4A 1ODTC 5CURA 3N76A 4EABA 4QO8A 3UXHA 3H5RA 3KKQA 3O1LA 1NRWA 2AOTB 1Y34E 3NXKA 4RO0A 5E6UA 1KMHB 4CNBA 1JJFA 5AJHA 1UXHA 2R6HA 4XFJA 1SU6A 4Y6RA 2GSWA 2Y68A 3I2GA 2DR3A 1W2WB 2QL5A 2ATIA 3QFSA 1XQVA 1X1RA 2YN0A 1PS8A 1QVVA 2E4WA 1D2MA 3NBMA 1FVOA 3OCWA 4GG1A 3KXIA 5DBOA 2QBYB 1QV9A 3PRKE 1AKUA 2C9CA 2PIAA 3IHLA 5EJ2A 3SS7X 1F8XA 2HDNB 3C6XA 4HQ6A 5LM3A 5IANA 3TUJC 4CKXA 4M46A 1KAGA 4EA9A 1PN3A 2OGWA 4QUJA 4YO8A 4HNAB 1TX4B 2P2YA 1NXSA 4M9SA 2HD4A 2BL4A 2WV9A 2EEPA 2I33A 3HMKA 3KLPX 2C31A 2CV0A 3CONA 3KU1A 4QUGA 4Y2RA 3RW9A 3H87A 1FP4A 1GG2A 2RH9B 3CJRA 3SSOA 1M76A 3SMQA 4Q7JB 3L01A 2WHRA 1N2CB 2FFHA 4GZMA 1GEGA 5AWFC 2I2AA 3V8VA 4B4UA 4OUKX 4DAOA 3L46A 1OB5A 5E9AA 1P2TA 3CISA 2XRYA 3QKSB 3FMVA 4FHEA 3KVOA 3QLEA 3UFXB 3G23A 1IXYA 4HH1A 3R7SA 3RNLA 1L0BA 3Q7SA 3EZXA 3IOEA 4NV3A 3U62A 3R5TA 1OX6A 2VNKA 3ZS9A 1TQ4A 2R1VB 4I8IA 1NBHA 2BFFB 4JEHA 4PGFA 1MENA 4RPLA 1JG2A 1H6DA 3U80A 3WNBA 1PKXA 3L0YA 1QZTA 1U28C 4LOKA 3AV3A 2YFYA 4OJQA 3KFLA 3U3OA 5CLJA 2C7RA 1XZ8A 3R41A 2HA4A 3CV3A 1MMFB 1D09A 2J4DA 4QWMA 1AZSC 1F20A 2RGGA 1U6JA 2I2CA 3H3FA 5B7PA 1VG8A 3Q8KA 1UMBB 4ASUA 1FX1A 1K0FA 1WHSA 2EQBA 2GPNA 3G1UA 2TMKA 2UUPA 1UJ6A 4LQLA 4HVTA 3BXXA 2HIHA 1Q3KA 3KPJA 3SS9X 2AYYA 3KQUA 3T4XA 4HZGA 4Q9HA 4IIYA 4Z8XA 3QGMA 2V0CA 2WTBA 4CCSA 1YU9A 2OORC 2J5RA 1N2CE 1L4YA 1U3UA 2OCPA 3K9GA 4D4HA 3UKJA 4DJEC 3ASYA 1GUBA 3IKVA 2P91A 1WD5A 3HB0A 4E4TA 2QUJA 2YMLA 2XA1A 3QLVC 3OX3A 5L4LA 4H9GA 3OPVA 2WT9A 4HNQA 4YXWD 2Z57A 1PL0A 2C5SA 3P96A 3GLVA 3G9TA 5BP7A 1W1WA 3B89A 2BJVA 3AY6A 1Z4KA 3T5GA 1G5PA 1KFEB 1KRWA 2PRIA 3KCNA 3ZE1B 1O3YA 4DSZA 1IMOA 2PZEA 4GM4A 4JVNA 1YQUA 4G26A 2GWRA 5BYJA 3E9ZA 3ZE0B 3WLMA 2FEKA 5JQGF 1G63A 2X0NA 5K05A 4KI7A 4QT4A 3MJRA 3EZ9A 1E0JA 3EDYA 2WICA 3WYDA 4BQOA 5I7FA 3MF4A 4N3GA 3UQYS 2R4QA 1ZI8A 1ISRA 2A5LA 2B7BA 1XLTA 2VEDA 5JE8A 1H2RS 3ACDA 2A84A 3TTSA 3FRJA 1W8DA 2G72A 3WY9A 3GLHA 2CXQA 4EYOA 5LZ8A 3N8KA 1EZ4A 1FL9A 3KR0A 2VBCA 1SZDA 2HSEA 5A3SA 4DVJA 5LOVA 1NJFA 2QMZA 3LNCA 5KYUA 1CBUA 3HCEA 1NM5A 3PC3A 3MGGA 3QM1A 3MAAC 4BO4A 4BV3A 4CF3A 4DA0A 5IZ4A 4IDEA 4LA4A 1HF3A 1PYGA 1ZU4A 3AB7A 1ZEMA 2L18A 4UVGA 3BRSA 3VKVA 5CB6A 2GLUA 1MH9A 4KXVA 1I3NA 1VPEA 1J8DA 3IILA 3DOUA 4UHDA 4WT7A 4XGQA 4C06A 2DWUA 1QVZA 5C35A 5K51A 4BGDA 2VP2A 3L40A 3QE3A 4IMIB 3W2IA 2ZSDA 3QVJA 4C2AA 1GTSA 1NG1A 4E5DA 2GCIA 2POQX 2PYZA 4ZDWA 4C4OA 3F4LA 4C7VA 2E82A 3BT7A 4BNHA 1I0IA 1JWBB 3D3WB 1OASA 4JQZA 4XE5A 4DIFA 1ETHA 5CB4B 4N5HX 4H7DA 3U4IA 5AKIA 3ZU4A 4CM4B 1Y6GA 1JHQA 4OUDA 4H4DA 3DBVO 3J80A 2VUUA 3T1HB 4O0LA 3UV6A 1XTQA 5SICE 1KFJB 1W47A 2CLIB 2XADA 4S2UA 4UHHA 4S1TA 3G17A 3NDIA 1T2UA 3ZJTA 1M2GA 3QYAA 1UBMS 1GARA 1RAHA 1S2OA 1QFMA 1GLNA 1U99A 4JQOA 5AW0A 4MQBA 2WM9B 3OQMA 4LG1A 2Z9CA 1O89A 2XEXA 3QPCA 3ZGYA 3A11A 3OZXA 4I1OA 2G5TA 5FOWA 3VA7A 2DEUA 2W4QA 4XYGA 5JEDA 1S3SA 2MYTA 1GXSB 1WXHA 2AOUB 4XUCA 4KHZA 3ZGOA 1AS2A 5KQSA 4ZCTA 3NC4A 3BCRA 3BB3A 4R2HA 1OH5A 4FK8A 1VCIA 2G28A 1P4RA 3QA3E 2DUWA 3SYNA 3IAS6 1X7YA 4PSKA 5BV0A 3U7RA 4FIZA 1SG0A 5KYGA 2KLBA 4DPMA 1G9SA 3UB4A 2AH5A 2BGLA 3LTNC 2PS1A 4TMWA 1G59A 2D5BA 1A04A 1TW3A 3EPLA 1U90A 6ABPA 3WYGA 1FMJA 4OMFG 1L6IA 3T4UA 4HBGA 4MIYA 2QN6A 2LUOA 5E4JA 3DPUA 1QLJA 1Z5GA 2CUKA 1SVWA 5AP9A 2I1LA 3VH2A 3AW9A 1JLMA 1IM5A 4BV8A 3DZBA 3AO0B 4KO4S 1P7VA 1LLFA 3ZCPA 2Q9BA 3BZUA 4NV1A 3KT0A 2I03A 4K9NA 1W1UA 3P26A 2I6QA 3HY6A 1CY0A 1ZWLA 1SOVA 3QLJA 1JBQA 4RKFA 4ZPJA 2QSJA 3E3MA 1YZVA 3OTWA 2D06A 1VYTA 3JZDA 2GBCA 2I66A 4DIKA 1YUNA 3Q40A 5KQPA 4PM4A 1P0PA 4PHFA 2ZBRA 2GCNA 2PUDA 2O19A 4EG1A 2PL3A 3HTXA 2C20A 5FWDA 1PBTA 2G76A 2NXWA 2F1JA 1OCEA 3KE8A 4PFJA 1E2UA 2VA9A 2BISA 3C3WA 3AGPA 3K0AA 4IHKA 1IMJA 4P5DA 4YI5A 3WLQA 2DOKA 1PK7A 3B3QA 1DL5A 1AHHA 3S8YA 4RIIA 2XTAA 3AI7A 4KWIA 4UEKA 3V8BA 3ZDRA 1K92A 4CETA 3QOWA 2J3MA 4WL0A 2I67A 3R20A 3FBGA 3IBFA 5D00A 3HCFA 1P7WA 5I4CA 3KTAA 3ER6A 3LVFO 1LBSA 1L8LA 5CVEA 3WKDA 121PA 2PO7A 4RTLA 3WWYA 2JJ1A 3V5NA 5B6PA 3L92A 3DL7A 2FPGB 2X0JA 4FJ1A 3RIGA 2H4FA 4PPQA 2OG2A 2QAJA 3AKDA 3N2KB 1V95A 4WNCA 5AOCA 2C54A 3T7JA 4CM8A 1E3WB 1OZAA 2QUAA 2TRSB 4IZHA 4HGRA 4Y9TA 1S4MA 5KSPA 3O8OB 1SC4A 3QKWA 5BQ5A 5ITVA 1NN1A 1A0OA 3SHOA 4MWSA 2C3MA 5A3VA 4ZT6A 3DHYA 2GVZC 3AFNA 4NAVA 2C1ZA 2JIQA 3ICPA 4TTPA 1IVYA 4P0PB 3F46A 1XI2A 3FFBA 2ZTHA 2K2QB 2X9QA 4WEOA 4BBPA 2ZI7A 2PXCA 2V4MA 3HCWA 4HXYA 5G40A 4P38A 4CTOA 3KEOA 3AP3A 1P2VA 5DSTA 3CX7A 4P3PA 1SO8A 3IQGX 4BEJA 4I0WB 3I4CA 2ONYA 4HNSA 2ILVA 4QU0A 1OXTA 3RS7A 3F0TA 4JLUA 4C21A 2CL0X 1T0HB 3N0VA 3OCVA 5B4UA 3O38A 2IHZA 1GGKA 3K72B 3TXYA 1P5FA 3EIFA 4QOEA 4YAFA 2EQAA 5A6SA 3E05A 1FNBA 1D8AA 1Q7EA 2VA8A 3RK1A 3AYXB 2I6UA 1IOWA 4RLFA 1DJPA 2R47A 4LSGA 5DLDA 5JC1A 3D0RA 1V2HE 2BM8A 2I76A 2RGAA 3GLSA 2FQYA 4O4IA 4RHTA 1GG5A 2BEJA 2D13A 2PVCA 3HUEA 2RHBA 3ECSA 3FB1A 4MWGA 1N3YA 2O0MA 4O33A 4OHUA 5AI6A 5H3LA 7REQA 5F51A 3R9XA 1YAHA 4NYJQ 2EBFX 2BN4A 4B7CA 5BORA 1ZHOA 9GPBA 3BE5A 5DM2A 3AOGA 2QL6A 3ZIAD 4JB0A 3CNEA 5BNZA 4LXXA 1VG0B 3JQ8B 3PGKA 4LQCA 4V38A 5HILA 3ZXXA 1C1DB 1QIJA 1XP8A 4HWOA 4XUEA 3D7SA 2JJ2A 1KH3A 1WW3A 4C22A 4DREA 4LRYA 3V3TA 2FCAA 2ECOA 3GJ6A 4L4UA 1OSNA 3WVNA 4ATNA 4KFRA 3SX2A 2QW1A 2ZRKA 2UYQA 3AHEA 1NXVA 2Z0MA 5FA6A 4LFBB 1GKIA 2VYCA 3DEFA 1D2GA 3UK1A 4CKBA 4Q37A 3CKKA 3CSSA 1HEUA 3R6DA 2I8CA 4ZJYA 3GMIA 3UICA 3AF3A 2WRZA 2A9FA 1K63A 5EESA 5G02A 4IR7A 3G88A 5LQCA 1I01A 3M2PA 4TXLA 1KOGA 3OPNA 1FY2A 1A9XA 2AJ8A 1PRYA 1UDAA 2O2GA 2QRUA 3L6BA 3P9KA 4O63O 4REQA 3UO8B 2XVMA 2A3RA 2PWZA 3CW2A 4JMLA 3ADCA 1G2OA 1RYYA 2B7CA 2J3JA 2XUDA 3L7OA 3OT1B 2E3JA 3E9QA 4FLEA 3PEUA 5AKHA 1X7WB 1FSPA 1VLMA 2EJBA 2EEZA 5LDGA 3BICA 4JXXA 4QEZA 4EX7A 3K5WA 4GXRA 3WSTA 1IWOA 1RZVA 1A5TA 2CB9A 3GRPA 3SSAA 3THXA 4QYXA 4B8ZA 3OLWA 2FW6A 4BFZA 4E88A 3BJZA 3ETNA 2CT8A 1ORRA 2PX2A 3G3EA 3QUTA 4IEIA 4S35A 1A9SA 3DVAB 3S5UA 3V1UA 3WK8A 4X1KB 3RVLA 1SOMA 1PUIA 2OZVA 2WZDA 1JEJA 2HJ9A 2EBHX 4U2FA 2W8BA 4ALIA 4EM6A 4RV9A 2WPDA 5TQ2B 5CBPB 4Z9BA 4YRAA 5C1IA 2QTWB 3OCXA 2C5EA 1UKEA 3R3ZA 4OB6A 4EOGA 1R1DA 3QIAA 4FDVA 4LQ4A 5ENDA 5BSMA 3V7WA 1LDYA 3UT0A 1AGYA 4P3OA 3VOAA 3HKBB 1BS9A 1TK3A 2OO3A 4OFWA 2J3LA 2QRLA 5AM4A 3VHLB 4LKRA 3PI7A 4WRRA 4BMZA 4NMHA 5LDDC 1ZNWA 3RGGA 1RI1A 1JPJA 1CZOA 1I1QB 4LFCB 3ZCSA 3H9GA 1G8SA 1XCGB 2CDBA 3V4LA 4RMJA 5A5GA 5FUYA 4MPJA 1Z7YA 2XLCA 4OI2A 5LL6P 1XJCA 2YV1A 4RMIA 4M83A 4AWXA 5K3BA 3NRCA 3TNJA 5HJ5A 5BSVA 2JLZA 3PSAA 3QMVA 1R5NA 5FV7A 4MR9B 2TMGA 4X60A 1DAOA 3INGA 1EVEA 1KZHA 3W5BA 4E12A 2JKYA 3GQVA 3PEEA 1C4OA 2WJJA 3L9XA 2LCFA 3A7DA 2ZDHA 4NBTA 3OWHA 3TBFA 4ZO7A 4XPIA 1JR4A 2V7GA 2YHSA 4Q6BA 5ULLA 3UOAB 4JGBA 4B76A 6YASA 2RGNC 3C5HA 3MT7A 5JCOA 1MB0A 2YJ3A 2IRWA 3R09A 1B0ZA 4QD3A 2PVPA 1YNOA 1TZMA 4MR7A 3ZWBA 3H8JA 1E9CA 3IV6A 5H80A 3STUA 2XUQA 4YJKA 1OU0A 3ZU6A 2B5OA 1Z0AA 2LDBA 4IM7A 1Q57A 3IDSA 1C9MA 1XLTC 3X1XA 1O9BA 4YRRA 3DUWA 5BWOA 4BHTA 4F4FA 2EVWX 3DZIA 2D2IA 1E5TA 1M8GA 2LD4A 2X58A 5JRJA 3RO7A 3ZWOA 4AF6A 3IHWA 1T8UA 4JT2A 2FSVA 4ZMSA 1GR1A 4UPDA 3RKSA 4PV7A 4MQ5A 2XZLA 1EUZA 1FSSA 4C0WA 3EXG1 1YAJA 4X41A 2NYAA 3AUYA 1QDLB 1C7QA 2QIPA 2JA2A 3GJTA 4GLJA 2HQSA 3HRKA 3P0HA 4JSYA 5CEFA 2LXNA 2AHRA 3DTNA 4CJXA 5KTYA 3L06A 3X44A 3R7WA 2A78A 4IL5A 4U8GA 4K9DA 4R9NA 2Z3VA 3LT1A 3KAKA 4OYHA 4ZIRB 3QK7A 1MR3F 4HDSA 2GLXA 4C5AA 5HHTA 1HDYA 1UBGA 2W2PA 3MQFA 3S1AA 3W6PA 4EVIA 3U6BA 2QN2A 4CT0A 4GX5A 3W5SA 3TG2A 3GRCA 3UJPA 3ABRB 2FWIA 4Z99A 3TL6A 2V59A 4BLWA 4KQ9A 3RVJA 5CA1A 1XMOB 2MSWA 1U9ZA 4M0UA 5DRTA 2ZFUA 1Z4LA 5IF3A 4EPTA 5FYQA 3H5WA 3L5KA 4Z9AA 3LLSA 3WAKA 3D5EA 2RB5A 4AFNA 4JENA 1Y8CA 4OIFA 3BDAA 3R1IA 3OLCX 4M1QA 3TTXA 4P3YA 3TEMA 4EX6A 1ICIA 2D0IA 4K2AA 4NATA 5GJCA 2QUHA 1U4OA 2CNOA 3TZCA 3EC2A 3CZMA 3LGSA 3K1TA 4JHXA 3WWDA 4FP9A 4P2GA 4BUCA 4BUZA 4D6XA 2B94A 3HCCA 2GKGA 3QEOA 3UG7A 1C4XA