1CR1A

Crystal structure of the helicase domain of the gene 4 protein of bacteriophage t7: complex with dttp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
277
structure length
245
Chain Sequence
MRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTGVVLVVICHLKTDLRGSGALRQLSDTIIALERNQLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the helicase domain from the replicative helicase-primase of bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transferase
molecule keywords DNA PRIMASE/HELICASE
total genus 78
structure length 245
sequence length 277
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1999-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03796 DnaB_C DnaB-like helicase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cr1A00
5L3VA 4LBYA 4LC1A 2ZR9A 3UXMA 4RVCA 4XOIA 3WBJA 3A1WA 5LD2B 1MRSA 4UNPA 1M7GA 1G9XA 3ZQ6A 4MDFA 3LLUA 3I4LA 4BFVA 2FA9A 2F6RA 4PO9A 3CRMA 1YRBA 4B6EA 4OYHA 3OIVA 1E9DA 1FTSA 1T8TA 2REBA 2TMKA 4NU0A 1SULA 1SVWA 3RS0A 3B2EA 2OT3B 4JYCA 2KI5A 1F48A 2P5SA 1R8SA 1T0HB 2ZE8A 4PPNA 4G5SA 4ASUD 3B9QA 4OKSA 4KCGA 2O8DB 4UQOA 3FKQA 2JLVA 1TTTA 3K0EA 3U60B 3QKSA 1P75A 5FTMA 2DB3A 4KFTA 4HAVA 4BFUA 3BFKA 3C16C 2DY1A 1IOZA 2E1RA 4JVMA 5KNBA 1X8LA 3F0TA 4QNMA 5JEDA 1R0YA 3VR1A 1E2MA 2GCPA 5FPSA 2UZIR 4DCNA 2PLFA 3A37A 2G3YA 4HAUA 2OE2A 4LWZA 3WBKA 4BZXA 2FFQA 2EFHB 5GVRA 4PAQA 1DO2A 3KXKA 4EQ6A 1YR6A 1RJ9B 3FHOA 1TU3A 1XF9A 4URZR 3PENA 1J7KA 1ZBDA 4X8LA 4YMUA 2O8EB 2H57A 4AKIA 1NNEA 3BGWA 3AVUA 5JFGA 4EPYA 5EUQB 3EX7C 2FPKA 2V8OA 1J8MF 3CF2A 2V4ZA 4MRNA 1NSFA 2GXUA 2QBYB 1WMSA 4QRHA 4I81A 1HT1E 5JBQA 2VBCA 2LKDA 3FMIA 4QBGB 4IW3B 1SXJE 2J0SA 5GJBA 4YMVA 3LQQA 1FNNA 3AVPA 3BK7A 3I5XA 5FOSA 1JR3E 4YMTA 1VCOA 4OL0A 1W0JA 2JAQA 5HZKA 5AUOB 1W0KD 3AF1A 4TYPA 2VSOA 1CR0A 1KO8A 4BLSA 3FFBA 5AWFC 1OHHD 1F2UA 1NL3A 2ZI6A 1IBRA 1PZNA 1XJCA 3A6PC 1E0KA 2O8FB 1NVWQ 4S2EA 3KKQA 1KIMA 4N1AA 1D2NA 2A5DA 4CF7A 1UKEA 4TMKA 2WJIA 2ZAOA 1ZJ6A 2FSHA 3SHWA 2IS1A 4GNKA 1Z0JA 2JEOA 4LGMA 2V7QA 3GQBA 4MKHA 4HLCA 3AUYA 4PHHA 3OEEA 1NBMA 2HEIA 2CL0X 3Q5DA 2OCBA 4KJZA 3AVWA 1CEEA 1NSTA 2FE4A 4NYMR 4OQMA 2KWIA 4FCVA 1BIFA 4G5GA 1S96A 3O8BA 2Q9CA 5JI2E 2GVZC 3FFAA 1G41A 4DLTA 5JLJA 1N6PA 4LYFA 1UBFA 2F43B 3BE4A 4V0KA 4C0SA 1KK3A 3SNHA 2QN6A 4Y0AA 3IBYA 2R62A 1E2EA 1KK1A 4QJ5A 3MAAC 3FKSD 5HR5A 4D4MA 2J45A 1U99A 3HDTA 4AURA 2J87A 1ZC4A 1KDTA 2ZJYA 4Q7MB 2ZI7A 3GJ4A 3W6NA 1JNYA 4ZIRB 2QA5A 3B1WA 2KBFA 3L2OB 3S1AA 4ILEA 4DVGA 4DB2A 1ZM9A 5EE1A 3RRZA 4A8JB 1ZW6A 4D4LA 2GZHA 3RAPR 3QNUA 5JJIA 2LKCA 1KI8A 2ODNA 1GKYA 5JCPA 2ZI4A 4B6FA 1K5DA 1KAGA 3EZ9A 2ZR0A 4A0HA 5AJVB 4Q1DA 1WE2A 4C7OB 2BOVA 1W44A 1NN1A 2DFLA 2ZUBA 4Q47A 4A6PA 2WKQA 3PUXA 2RGDA 2DFNA 1E1QD 1OPXA 1QHHB 1AQYA 1EG7A 3EZFA 1G3QA 2OFXA 3AQ4A 1E9AA 2G0TA 2XTZA 3NBZC 2C78A 5F9HA 1NLFA 2CEAA 1E99A 4DT1A 1TPZA 2X8AA 1TQ4A 1UJ2A 2IYRA 3WYFA 5JWRA 2J7PD 2ZRKA 4LZZA 5P21A 2D06A 5K8LA 1CULC 2UZ3A 2VHTA 1IJFA 1P73A 2GKSA 4D0NA 2JATA 1PLJA 1T5IA 4JLJA 1MO4A 1U9IA 2XNDA 2WOOA 4DEYA 5ELXA 4GP7A 3GMTA 3ND9A 2O8CB 1E9RA 4Q4AB 2ZRDA 3NTUA 4QGFA 5HE9A 1W5SA 4LYHA 4HYYA 4WA7A 4XD7D 5DHFA 2J0VA 1TF2A 1G8GA 2WAYA 1T3LA 4GZLA 4M21A 1E2QA 1DAFA 2PH1A 4TLCA 1GKIA 5FBVB 5L3QA 4RD3A 1XTSA 2C96A 1S2MA 3W3ZB 2ZVPX 2G88A 4TQ9A 5KPDA 3FHCB 1LFDB 1QDEA 1VHTA 4EPRA 3TAHA 4FI3C 4Q9JA 1P3JA 3W90A 4KFRA 3D3QA 1ZCAA 3RYTC 5CYPA 5B58C 4Z1MD 4UKDA 4QBFA 1L4YA 1N2CE 1A1VA 4NCJA 2FG5A 1KO7A 3C8UA 1F2UB 4XSGA 3WY9A 1CXZA 3WMEA 5EUMA 1DAGA 3RC3A 3U4QB 2HDNB 2I1QA 3L0IB 4YXWD 2O8FA 4CT5A 1HV8A 4JBWA 5C46F 2H92A 5BW8A 3PITA 2JIZA 2QMHA 3PIRA 4JKIA 1RRGA 3K1JA 3KB1A 3VU9B 1T4GA 5GADl 3Q3JB 5BN5A 4NE2A 4ZDWA 3GFTA 2VPPA 3GLGE 4YQFA 1OFIA 1S3SA 1H65A 3DMDA 4ZDIA 1XEXB 2MMCA 1KZGB 1OT3A 1FUUA 2ZS8A 1NBME 1OXTA 2IT1A 3CF6R 4DLSA 4I4LA 3IBGA 3HU3A 4PAOA 2EU8A 3QQ5A 4D82A 4EDHA 5DO9A 2CXXA 2OBLA 2DYKA 4O25A 2BEKA 1UDXA 3AF2A 4A15A 3KQUA 2V9PA 4PC7A 1JJVA 2PJZA 2PT7A 5DYGA 1UKZA 3LXRA 4B73A 3R9IA 3HP1A 1XFAA 4QHTA 4A36A 1GSIA 1L8QA 1R2QA 1UBGA 1P9NA 4M4SA 4OI2A 2GRJA 2J46A 2W00A 5GJVC 4LJ9A 1C4OA 5LB2A 3BWDD 3R8FA 1P5ZB 1XU4A 1E1QA 4I99A 1KY2A 4PQYA 1DTSA 4FWIB 4H9GA 3SJZA 4BE7B 2YZ2A 3ADKA 2WMOB 4GSYA 1PLKA 4RCZA 1Z28A 4EPXA 5IK2A 1LS1A 3CIOA 5FUXA 1G1MA 4HLDA 3SU8A 1E2JA 2DFKB 4DLZA 4AG6A 1SVIA 3VKWA 1E2IA 1MR3F 4EFLA 1DOAA 3AKCA 1J2JA 1SHZA 4BPBA 1CP2A 1LY1A 1R0WA 3Q5EA 2O5VA 1OH6A 4IDHA 3K9HA 3V4FA 4B2LA 2RGAA 3IPXA 4EJSC 4KU4A 3NKVA 2HT6A 2GJ9A 4BASA 1L7VC 3THWB 4CEHB 4OQFA 4LV6A 1G291 5JECA 1ZNWA 3IUYA 2CHQA 4NDZA 3W5JA 2J1LA 5HE8A 1TEVA 1JBKA 2QRZA 4XD7A 4PO1A 2AFHE 3U44A 4CT4B 2C77A 2HLDA 1AS0A 1D5CA 3LLMA 4RFVA 2IEYA 5KPJA 1EFUA 1YR8A 1US8A 1X1SA 5M04A 2IX3A 1G6OA 2ZE5A 1XTQA 2D2FA 2ODEA 2F43A 1NRJB 521PA 1AKYA 4DLYA 4TLEA 4C0HA 4RD6A 3ZVRA 3OF5A 1M1YE 3R20A 4OHWA 1JR6A 4NYIR 5JS7A 4Z1MA 4DLRA 4URXR 1E0JA 4C4PA 2YOGA 5KNDA 1RRCA 1VG9B 2REOA 3DPUA 3KX2A 3K70B 2N42A 1M74A 4G01B 3OEHD 4XH9B 3TQFA 5AJWA 2O52A 2GBLA 2VP5A 2DHRA 3UMSA 1E4VA 3QVUA 3QXJA 4A4DA 3FOZA 2AKYA 1M6NA 2O8DA 3U3JA 1CS4C 1ZUHA 4V03A 2J59A 4P33A 1X1RA 2P6RA 2JDID 2YC2C 4YDSA 2IYQA 4URVR 2RGCA 1ZM2A 4C7OA 3VAAA 2VP2A 3RC8A 3FMFA 1KZ7B 1COWA 4LCBA 2XNSA 3K0CA 1S9DA 4JKYA 2JLRA 4GP6A 4FCTA 1TADA 1VG8A 2IHYA 2ZR7A 4DWJA 4IXMA 4Q4LA 1W0JD 3A4LA 1P72A 2EQBA 2GJ8A 2RGXA 2C04A 3UWKA 2B8TA 2XJ9A 3SQXA 4EAQA 2HXSA 4XTCS 2ZM5A 1XJQA 3TK1A 4Q1BA 1ZIPA 1RRFA 5AR1A 4PO8A 2E9SA 3I62A 2R8RA 4DT1B 4R2HA 1OH5A 3DHWC 3H1TA 4J0QA 4XVRA 2QMOA 4LJ7A 4V02A 1YJ5A 2G83A 4Q9KA 4DDWA 4ZCMA 4NPHA 3EAQA 2ZRLA 5CYOA 4DJTA 1ZYUA 2ZRPA 2JLSA 3C5CA 4Q1EA 1W7AA 5F3WB 4HDCA 2BCJQ 4JZKA 3QY0A 2MSCB 2BCGY 4WXPA 5G40A 1XPOA 3NDBB 5HTKA 4W9MC 1ZRHA 4MYCA 2QTVB 3SFZA 3W34A 4LX0A 1CU1A 2XX3A 3SFVA 2P65A 1GG2A 1CTQA 3CRVA 5DLQC 5IK2D 2LCFA 4PX9A 3U7FB 1XPRA 2NMVA 2IXFA 3MWKA 3QVVA 4M1MA 3KJIA 3RWMB 2HXYA 5EXSA 1JPJA 2C8VA 2OZEA 2BM1A 2B21A 5FBRB 4Z51A 3B7GA 1DAHA 3UATA 1GITA 4L9SA 4AIIA 3ND8A 1VCMA 2ONKA 4K8OA 4R71A 1OXVA 5AK0A 4BLOA 3U61B 2RGGA 3X1ZA 5AJZA 3GLFB 2XNDD 1ESMA 2QQ0A 3MJHA 4JYBA 1HTWA 2NZ8A 4G3XA 3FPAA 1WCV1 4EKDA 2IWHA 3QPWA 5B57C 2FPLA 1I2MA 2Q3MA 4FMDF 2D74A 4L9WA 3UKDA 3GLFE 3KXLA 3Q72A 1OFUX 3LW8A 5CM8B 4TL6A 2GETA 2ODBA 5H8WA 1K5GA 1V5WA 2QGNA 5KDOA 2ZSFA 1XD9A 2Z4RA 3Q7QA 1KO1A 2YWEA 1TMKA 1QHYA 2OUKA 2GEVA 3EIHA 1E2GA 2YKGA 3UPUA 1W49A 1Q44A 4RD2A 3M6AA 1NN5A 3P1JA 3MD0A 2AN9A 1XEXA 4D81A 3TUZC 3ADDA 1E1RD 1GL7A 1ZAKA 2OCPA 3Q7PA 1GRRA 1LF5A 1UBEA 3K0FA 2V1XA 2V6IA 3GLIE 4OHYA 2X19A 4A8JA 3IKJA 1Z22A 2CNWD 2NOAA 2G6BA 1E96A 2BJWA 3LH5A 3P32A 4FIDA 4IRUB 4AYXA 4EJSB 1Q3TA 4C0KA 1N6OA 5HPYB 3LY5A 4GI7A 3FMPB 2CHVA 2QE7D 2WPDA 5B2ZA 4LJ4A 5JCZA 1HH4A 3FGNA 4LY6A 3VQTA 3SJCA 2HYIC 2BKUA 1OFHA 1RYHA 2ZREA 1QBKC 4JL8A 1D2MA 2Z4SA 2N46A 2OSBA 2G0NA 1COWD 1PLLA 1IONA 3LWNA 2OO7A 2ZJ8A 1YE8A 4B33A 4Q66C 4LJ5A 2ZRGA 5DNYB 2MSEB 4KO8A 1G8FA 2CK3A 4P4SA 3NC1C 4TMZA 2Y8EA 1XRJA 1SXJA 2RMKA 2ZTSA 3QKRB 2ZRIA 3THXB 3CPHA 4BFWA 3AP2A 1FFHA 2OXRA 3KTAA 3L0SA 3U6BA 1ODFA 1AS2A 4ZPXA 2IWRA 1WQ1R 4Q02A 3VHXA 2ZJAA 121PA 3AM1A 1FX0A 1JXMA 1K6MA 4R2IA 1TQDA 1Z0AA 1Q3HA 1WRBA 3LDAA 5KSPA 3EW9A 4F92B 1Z8FA 2NG1A 4LPSA 2Z6VA 1IJEA 2OILA 2V7QD 1D8TA 2ZAMA 2Q3FA 2XAUA 3D31A 1Z0DA 3F3YA 3THWA 1Z63A 3QI2A 4GL2A 2AFIE 2IYYA 2ZUCA 3JVVA 4RKEA 2CDNA 3U44B 2RGEA 4GOJA 3PEUA 1RIFA 5CLLA 4X8HA 4TL8A 3VR5A 3FE2A 3T1OA 2EW1A 2ANCA 1N6HA 2GJKA 4NTZA 3ZD6A 1Z6YA 2NGRA 3IDQA 1XCMA 4TLDA 1GNPA 1KSFX 2ZI5A 1Z2AA 2WVJA 4MITA 1OIVA 4Q18A 2P3SA 2WSSD 2HCBA 4A92A 1XEFA 1IN7A 1Z06A 3N2IA 4TMTA 8OHMA 2AKAB 5FOVA 3NEYA 2XXAA 3I8XA 1F6BA 1G4AE 2DR3A 2F3TA 3I92A 4ZCLA 3U4QA 2FU5C 3GLHB 3UG7A 2O8BA 3BFXA 1FTNA 5FBLB 4Q03A 3VHLB 4KI0A 4QM7A 5DIFA 4UXJA 1NVVR 2HLDD 2JJ2D 1LTQA 1U81A 2PMKA 1E9EA 2QTHA 2G77B 5H68A 1MH1A 3B60A 621PA 1I4LD 4ESHA 5E4FA 2DWPA 2WICA 5JWHA 4FMDB 4B71A 1G3MA 2ZSAA 3U3OA 3PV0A 3CH5A 2IW3A 3C4JA 2GXAA 5BQ5A 3MWLA 3T34A 3P4YA 3QBVA 2P6NA 5DISB 2WJHA 1NG9A 4FMCB 5TV2A 4BRUA 3SJBA 4OQNA 4IDNA 2X2EA 5AJXA 1OLOA 1OSNA 3OIUA 3ZVMA 1KDPA 4N0DA 4B3BA 2FNAA 3TNFA 4XIGS 3GPLA 4F38A 4GZMA 2AWNA 2R65A 1SGWA 3K70D 3EZ6A 1AA9A 3I73A 4URYR 1FOEB 1S8FA 2JDIA 5J4LA 1D9ZA 3RS4A 4KHZA 4C0AC 1VYUA 2R6FA 3EASA 3IIJA 2WJYA 4TQUS 1ZNZA 1W4CA 1XP8A 2CVHA 4P3YA 1D6JA 2BDTA 3LFUA 2C9OA 4NH0A 3DVLA 1ETUA 1YZQA 3AVXA 4XWKA 4NONA 2FF7A 2HF9A 2WV9A 5A5GA 3UK6A 1NY6A 1UADA 4JSYA 4AKHA 4TMXA 2GESA 1UBCA 4O0MA 3C41J 5FI1B 4Q4JA 4D6PA 1CRQA 2GAOA 3CZPA 4HLUA 5SZHB 4O3MA 4RFSB 5EZ6B 4BZPA 3A1VA 4CZ2A 3LXXA 5HCNA 3JVUA 1DARA 2BBTA 2ZYVX 1EESA 4JS0A 1M7BA 4MGZR 2GF9A 3LVRE 4QOSA 5CIQA 3GJ0A 1YQTA 5JWOA 1QHGA 4HLQB 3ICEA 1ZP6A 3C15C 1IN6A 1YHNA 3SQWA 3ZVNA 1GNRA 3RLFA 1HUQA 1Y3AA 2WAXA 5F2EA 1NMYA 4FMBB 5BYKA 3V00A 3KTAB 2VEDA 2AXNA 1XD8A 4RZ2A 4EIWA 4KLZA 1KHTA 4IXNA 3D7MA 4DC9A 4N3NA 2H18A 1MABA 3RDPA 5J4YA 3RS3A 4QBHA 1R5BA 5FH9A 3H86A 1TX4B 4RCYA 4D26A 4V0OA 1P9RA 1DO0A 2FH5B 1TEXA 3CUEF 3KQHA 2FMXA 2VSFA 3QUSA 1XXHA 3KJEA 3TAUA 3AGQA 4CEIA 1R6BX 1G7CA 2NO9A 4C9BA 3K09C 1DG3A 1ONBA 3VMFA 3ZYCA 1NVUQ 5EZ5A 1UDWA 5BYJA 3K0FB 2YJTD 3WP0A 4NKRA 1FP6A 1MOZA 3CX6A 4E07A 5JS8A 2FSGA 3KKOA 4R98A 4B35A 1BYIA 4JVNA 4YC7A 3T15A 2XXAB 4OQXA 1WDTA 4OI0A 4KSBA 1NG1A 1NN3A 2CCJA 2G1KA 4A8JC 2W6ID 4EFNA 1ZIOA 1MO5A 2YWFA 1FP7A 2IS6A 3GLHA 4WIAA 1G8YA 1HE8B 2Q21A 3NHBA 1KGDA 1SXJC 3P26A 4Q01A 1RZ3A 4PQRA 2WJJA 1EFRA 1QHIA 3SDZA 3OEED 2Q9BA 1W46A 1E1RA 1OJLA 1P62B 4BLTA 1XZPA 1BO6A 2OM2A 2QP3A 3OFND 2IYSA 3OIYA 4HI0E 2CMKA 4KITB 1WXQA 1T8UA 2IEZA 1ZNYA 4LUCA 3RS5A 2VP4A 1A5TA 5DN6D 2VQSA 1S1CA 2OLJA 2JLUA 2GNOA 3B1YA 3PCRB 3PUWA 1FX0B 1YRAA 2IUTA 3T5DA 1XZQA 2P6UA 4B43A 1E0SA 2IYXA 2ZSDA 4DUGD 2FV8A 3D6TB 1KJYA 3AKYA 1EK0A 1YZNA 2QGZA 2CHGA 1OE0A 1ZD1A 3BH6A 4HAZA 2FFBA 4LHXA 2JLZA 1GDDA 2O8EA 2GHIA 5CB6A 5KU1A 1X6VA 2CK3D 1ZVQA 2OBNA 5CK5A 3GFOA 3TVTA 3WP1B 1Z6GA 2I3BA 1T91A 2XOKA 2B7CA 2ZE7A 4LBVA 5H1YA 4Z54A 5JRJA 4IEIA 4LPKA 3AF3A 5D3MB 4LBZA 2QBYA 3PEYA 1N0WA 1OKKA 2ZJOA 1NLYA 3VNVA 4W5WA 1LW7A 1XCPA 1DBSA 5JZVA 4JVLA 2F1IA 3RSOA 5E3HA 1MRNA 2K5UA 1QVAA 4UJ3A 4A9AA 3PUVA 3GLFA 1XJ0A 2DPXA 5EXTA 4G5QA 1W2HA 3EIEA 1BYUA 2PLRA 3IIMA 1KNQA 1DAKA 3PUZA 5G41A 2ORVA 1W36C 2PJRA 3QSYA 1CJKC 2G9NA 4DCTA 4EPVA 1AZTA 1IY1A 3LBHA 4PC1A 1I4DD 1Z83A 4BQSA 2GXQA 2A78A 3TW8B 4LHZA 3HR8A 3AUXA 1E2DA 4O2LA 2OFWA 2EFEB 2AL7A 3T12A 1JEEA 1R0ZA 4TZ0A 1GRQA 5AUQA 4NHOA 1OYWA 2GAAA 3N70A 3MSXA 4RSGA 5JJLA 2O0HA 3ZQJA 4Q21A 4LHVA 4LYJA 4XVQA 2XSZA 1XPUA 2QY9A 4HUQA 4TL9A 5L3RA 1N6NA 4CYMA 3J81k 2C03A 2WSSA 4B76A 3TQCA 1R7RA 5B64A 5JI3E 1Y63A 3H0KA 4BLPA 2ZITA 3QOFA 3AEZA 2ZRJA 4MH0R 1EX7A 3VTKA 3P4XA 3FMOB 1OXXK 1ESNA 1IM2A 3L8YA 1J99A 2Z43A 2YYZA 4B3DA 1E4YA 1NMXA 1C1YA 5TARA 1AZSC 3GLGB 2QNRA 1W0KA 3A4NA 4C2TA 1R5NA 1AM4D 4G5RA 5FTLA 1KI4A 1YZUA 4DCUA 4I1SA 2H8KA 3CX7A 4IFBA 4A1FA 4M22A 3A58B 4IOKA 3K70C 4MKGA 2RGBA 1ZUIA 2IYWA 4PHTA 4C30A 4BFTA 3DM5A 1GNQA 3AVQA 4OJQA 1OIXA 3B82A 2AK2A 3A1UA 3EZ2A 4E22A 1W48A 4R7ZA 4NBSA 1LVGA 2ZRFA 5CDFE 3KFVA 4TSFD 1NF3A 3I61A 3CX8A 1GWNA 2QP4A 1VTKA 1N6LA 4BGDA 4Q4JB 1Z0FA 4ARZB 1CRPA 4HEJA 4CRWB 2H5EA 4Q48A 2EFGA 5DN6A 4RFSA 2XZLA 4IVQA 1E2KA 3X1DA 1FQJA 2OLKA 3CW2A 2EWVA 4DLWA 5FUWA 2FEMA 3FDIA 1X3SA 3CM0A 3NWJA 3LV8A 4GMXA 2YV5A 2Z5FA 2ZRBA 1U98A 2R6DA 4UNQA 2CCKA 2PCJA 3WNCA 3QG1A 1EWRA 3I3SR 3EPKA 3SHFA 1VG1A 3DZ8A 5CIWA 4CDGA 2H7VA 2VP0A 1CJTC 4TYQA 3W6OA 4TTRA 1HY3A 3HR7A 4DEXA 4TYYA 1KK0A 3SE0A 2PL3A 4F4JA 3RWOA 2O8CA 3EA5A 2QU8A 1E94E 2F1RA 2C98A 3ZVLA 1HQYE 4F7WA 1OW3B 4D2IA 2W83A 5EE3A 4CEIB 2PZEA 4PPQA 3QXSA 1Z0KA 2FN4A 3LW7A 3M1IA 4HLUC 2WKRA 3BJIC 3OESA 3ZZUA 5GVSA 2ASEA 3AVTA 2D2EA 4M1OA 5FFMA 4MRSA 4ZCIA 4WOPA 5KNCA 3DKVA 3I32A 5JHGB 3L0PA 2C5LA 3IHLA 2NO6A 4RD4A 3DOEA 4E09A 3QE0A 3PJRA 1NIJA 2OAQ1 4OQLA 3AF0A 4PPFA 2W0MA 5TB5A 3E2IA 3ZS8A 1YU9A 2VP6A 1P2TA 4AKEA 3U3KA 1UEJA 3VR2A 1U0JA 1KOFA 2BBSA 1CKEA 2WPDD 4TZ6A 5FOUA 2ZI3A 5J5CA 5EE0A 3WNDA 1IY2A 3THYB 2ZYWX 1HE1C 2DFTA 2XEXA 2OXCA 2Q9AA 1SXJD 5TMPA 3KQNA 5BWMA 4TTQA 2YNMA 2OG2A 1II0A 4QNRA 4XWAA 4JLAA 1VKJA 2ZANA 1CR1A 1G20E 3ONWA 2J3EA 1KJZA 2RHDA 1CR4A 3GP8A 1R5OA 4PZLA 1S9HA 5KDDA 4HUQB 3IO3A 2FWRA 3MLEA 1NVVQ 4LJ8A 5FPYA 1L2TA 1Z6XA 3BOSA 3KB2A 1Q1BA 4LDJA 2ZJBA 3ZGXA 2QP9X 4Q1CA 1CJUC 1KSGA 2CBZA 2I4IA 2JA1A 1WBBA 1EFCA 2Q0HA 3G5UA 4RZ3A 4Y0VA 1EGAA 4PC6A 3KQLA 1R10A 3CNLA 1EFRD 4KODA 3VX3A 2UVQA 4P4TA 4B2PA 1P9WA 4IJMA 4PFSA 1M2OB 4KBFA 4TT3A 3T1VA 2VTKA 1KI6B 2WWXA 4QXAA 1E2FA 1MKYA 4LRWA 4KXFB 4QJ3A 4GFDA 3GJ5A 2QRNA 4B34A 4IOMA 1GFIA 2BBOA 1TL7C 5K8UA 3ZZ0A 3AP1A 4MDEA 3RS2A 1U8ZA 4JJKA 2ZJZA 4DUGA 4DZZA 4JVSB 1G3UA 5SZKB 4ARZA 1WBDA 1G4UR 3E70C 4PSAA 3HYRA 5LB4A 5CDFA 4HB4A 4M0LA 1E79A 1W1WA 2XTNA 5IDVA 3EPJA 5EE5B 3T61A 2JCSA 4AY2A 2JJ2A 2YVUA 4H1VA 1N6IA 1YZLA 3QEOA 3WRYC 4ASUA 3NBYC 4AYWA 4QGHA 2GZDA 2GXSA 1G19A 3DKPA 3BBPA 3F5FA 5KSZA 4IFEA 3FHTA 1GIAA 2GVDC 4TTPA 3FVQA 3H4MA 2GF0A 3T1QA 2BMEA 1P60A 5EP3A 5JHHB 4M9SA 4JIMA 1Q20A 3QF7A 1NKSA 3NBFA 1YZGA 4L8GA 3PXGA 4QJ4A 3LRPA 1CIPA 1N5KA 3K0SA 2ZROA 1TU4A 5DYIA 4HAYA 2BM0A 3BB3A 1NVXQ 2HJGA 1Z29A 2VF7A 2PT5A 2QAGB 4X8MA 5FL7D 2OFOA 2BJVA 1PJRA 2OCYC 1BS1A 5EP4A 5A4JA 2NPIA 3BH0A 1EX6A 2VA8A 2GCOA 4IEEA 3E1SA 3WMFA 3A4MA 3CRRA 4JBYA 1FMLA 5JMTA 3BXZA 1NKTA 2R6AA 5EXPA 4NL4H 4NCHA 1RRPA 4RZXA 1XWIA 3TR5A 4AD8A 5LPNA 2OCAA 4OK5A 3MGCA 3T35A 1CBUA 1IN5A 2WIBA 2X1VA 3NVAA 5BN3A 1GOTA 3SN6A 2A30A 2RB4A 3UG6A 3IILA 4BRWA 1A82A 2JLYA 4MRVA 2HT1A 1W47A 3T1TA 1IXRC 1OH8A 3MG9A 4PTLA 3SZRA 5LDDC 2OBMA 1KYIA 1VYTA 3EXAA 4DHEA 1FMJA 1Q1EA 3BRWD 4JSTA 1P2VA 3ZJYA 4B48A 4PSVA 3SBDA 1E32A 2JLWA 1GUAA 4HDQB 1W4BA 4LHWA 5E7IA 2XZPA 5H70A 4OHVA 2ODWA 2VHQA 4B2IA 2CNWA 2GWHA 2RH5A 1U8AA 3QKTA 2HV8A 3CKLA 4ESVA 1E9CA 1T3SA 2BVNA 3PEWA 1AGPA 1IQPA 1N0UA 2ATVA 4IDOA 1KTVA 2NO1A 1V43A 2BKEA 1XMJA 1JECA 3CNNA 4PZYA 4JLMA 3B5JA 3M0EA 5LBIA 3BB1A 1KKLA 3HWSA 3TR0A 4AG5A 3CH4B 2ERXA 4TN1A 2F1JA 4BLRA 2FDCA 2MMGA 4GDFA 2ZE6A 2W2TA 3QPVA 1IAQA 2QAJA 4IDPA 1PVOA 4F4CA 2FJUA 3PUYA 3R7WA 5FUYA 1KMQA 4PQFA 4OJKA 3B1VA 3FYHA 1OF1A 5KDLA 1XX6A 5GJCA 3K0AB 1I2DA 1SVKA 1KAOA 4JT4A 4IVPA 4A0RA 4DCVA 5FTKA 2IS4A 1HA3A 3EARA 4F93B 2BWJA 2EFDB 2KE5A 1UKYA 1EXMA 1P61B 3IEUA 2N1BA 2BMFA 2PBRA 3PR1A 4NCKA 1F2TB 3GEEA 2W6IA 3ZIAD 1OV4A 2ATXA 5CLQA 3U7GA 2IF0A 3SYKA 1JEDA 1T5LA 4PC3A 4QKQA 4C2UA 4Q1AA 3EA0A 5DH9A 1X8KA 2XITA 4PANA 1Z08A 3LX8A 3T06B 3HPRA 4DSTA 1U90A 4LSGA 5C2JB 5FOTA 4GOXA 3SC3A 3DOFA 3T5GA 1OYYA 3EWSA 1XMSA 4MKFA 3WYGA 2FSFA 3AP3A 1HURA 2DWOA 1W36B 4EPTA 3NHAA 3TE6A 3BD9A 1U0HC 1TNDA 3QXXA 4C3ZA 5AUNB 3K9LA 3GLGA 3LVQE 1PUJA 4W5JA 5CM9C 2PZFA 1T3HA 5KHOC 3KXIA 1SZPA 4WVFA 2V1UA 2P67A 3K9GA 2P2LA 3N5CA 2IF2A 1G7SA 4NP6A 1VCIA 1W4AA 3VR3A 2D7CA 3EC1A 2WWHA 4IOLA 2KB0A 3I72A 4WBSA 5HCIA 4CEJA 3NG1A 4NCNA 4L15A 4M1TA 3C14C 1GILA 3CWQA 4HZUB 4FN5A 1SHKA 1G5RA 2H17A 3LQRA 3RANA 1G7RA 4RD0A 1XD2A 2GBLC 1KI6A 2ZRHA 4PHFA 4EFMA 4YDHB 2PEZA 2AK3A 3OAAD 1KSJA 4P4SB 5DHAA 4US1R 1NI3A 1OH7A 2BMJA 1DVRA 4BEJA 1FQKA 4XTRA 2ONJA 3ETLA 421PA 1KO4A 3W8NA 3C5HA 3NDPA 5IHPA 5K8IA 1SXJB 3ZLJA 3R8CA 1Q0UA 3VFDA 4US0R 1QVRA 2PMDA 1P2SA 5JSZA 2E87A 3QKUA 4QG7A 3KL4A 4TLAA 1Z6AA 2ZYUX 3W8RA 4K81B 1CR2A 4LYAA 1XCGB 4DBLC 3B9PA 2QMEA 2WWWA 1M8PA 3X2SA 4V0LA 2V3CC 4M9QA 3O47A 2AWOA 3TRFA 4XWOA 4XSHA 5DE3A 3IO5A 1JR3D 4KFSA 4U02A 2QI9C 1QHXA 4YMWA 1DE0A 2QQEA 3CBQA 2FGKA 3NBXX 1G16A 2OAP1 3W3AA 2QTFA 3CB4A 4MGYR 3AKDA 3KFXA 4TMVA 1R8QA 5AUPB 2HF8A 1GP2A 3D8BA 4BFSA 1BOFA 1LNZA 3OE7D 5DI3B 2YOHA 4PR0A 3W6PA 2IA5A 3QKSB 5IRCD 3EZ7A 1A4RA 5KSYA 4DLUA 4ON9A 4LBWA 721PA 3AVVA 4WW0A 1Q21A 1JPNA 1IN4A 1AS3A 5FR1A 2CCGA 4BFXA 2CL6X 2QORA 1Z2CA 2YINC 5HKKA 2AR7A 4G0NA 4C0JA 3SOPA 2QAGA 4ACBA 2A9KA 4ZKEA 3CO5A 5FL3A 3SYNA 3QENA 1T9HA 1XTJA 3K0AA 4K46A 2VHJA 2ZS9A 3DZDA 2FX3A 4UXIA 1G8HA 3BFVA 3Q9LA 3CZQA 1GL6A 5CJ2A 1Z07A 5JRZA 3GLHE 1H8EA 4KSCA 4CIDA 1KO5A 2IYVA 4KYIB 3OHMA 5C1BA 4TSFA 1DAMA 2CJWB 3BERA 3AF4A 5GJWC 3RVBA 1BMFD 1JALA 4TQAA 1XDBA 5FUVA 2WWYA 3KKNA 4YLGA 4B3FX 2VIIA 4O2RA 2ZJ2A 1ZCBA 3GJ8A 3TIFA 3HPQA 1FPMA 2QUZA 2R2AA 3HU1A 3U3RA 3EPHA 1E2LA 1JXOA 2NIPA 3QXCA 5AJYA 4FINA 3WRXC 1GAJA 4QL3A 1S0UA 1Z0IA 4Q9IA 3IPYA 4PHGA 4G5OA 4ZDJA 4HSEA 4N0EA 4PAMA 2A5FA 3MUFA 3BAFA 3CR8A 1QG4A 3P20A 3RRYA 2C2HA 4BZQA 3VR4A 4NYJR 4HB3A 5C18A 1PV4A 2WWIA 2ECKA 1E0AA 3B1ZA 1VECA 1GRNA 2QPOA 1A7JA 2GJAA 2NO7A 3DM9B 3NXSA 4UNNA 3EG5A 1XTIA 3QIAA 2GZAA 1XD2B 3GJ6A 3I1FA 4KVAA 4M9ZA 3B85A 4Q00A 1N5JA 1J70A 3AV0B 1P6XA 1MO3A 4PZZA 1AKEA 1O87A 3Q85A 4KYUA 4HUTA 4OBEA 1HQCA 1YKSA 2QT1A 3KJHA 2SHKA 3WHKA 3ZD7A 1M34E 2CLSA 2BC9A 5FBQB 4FW9A 3PG5A 4A6XA 3AH8A 4E03A 1VHLA 2ZVQX 4KFUA 5FPTA 3RNLA 2QAGC 2GILA 4DRZA 4US2R 5CK4A 1ZM7A 2RGNC 2ORIA 4C0LA 5JSZB 1DAEA 3EC2A 1XNJA 4GOKA 2H16A 1B23P 3X1YA 4P4UA 4ZIRA 5B30A 2FOLA 3S1AB 221PA 3LX5A 3GJXC 2QPAA 1AGRA 3H84A 4L5BA 1MABB 1Z47A 4D80A 1TQ6A 3EWAA 1B0UA 2ZU6A 3X1WA 1LS6A 1SKYB 1VMAA 2B6HA 1IHUA 1SVMA 1NJFA 3EIQA 1DEKA 4DIEA 1RFLA 1XB2A 4HB0A 2XOKD 4B75A 4TWZA 2YWGA 5G3YA 2ZRAA 2IYTA 1MO6A 2LWIA 2ZSBA 4A0FA 3VNUA 4LK2A 4AC9A 2XJ4A 1N5LA 2WIAA 2JLXA 1L4UA 2IYZA 4B3XA 1WB9A 3U5ZB 4AKGA 2W2VA 1EWQA 3BC1A 5EJEA 4QBIA 1QHHA 2NTYC 4NZYA 3MJRA 3VR6A 5J4VA 2R9VA 3KQKA 1OXUA 2W6JA 5FPHA 4ZKDA 4YONB 1RYFA 3N2EA 3SS8A 3WYAA 5DSZA 3O8CA 1BH2A 3NEJA 3BIFA 2RKOA 3AGPA 4JLBA 4MUAA 3ASYA 4IOJA 3KUCA 3L8ZA 1II8B 1U9IC 1G18A 1N6KA 4I1VA 3REGA 3K53A 1BKDR 2J9RA 1XTRA 4PC2A 2JLQA 3TSZA 1BMFA 3PVSA 2ZRCA 1KMHB 4HAWA 4TT3D 6Q21A 1FW6A 4L4UA 4RY2A 5JJKA 2IL1A 3IIKA 4RZUA 2J7KA 1UPTA 2A2ZA 1IN8A 3DL0A 4PPGA 5FOWA 1KNXA 3FWYA 1Z3IX 4P0TA 4FXPA 2F9LA 2R6GA 1VYVA 2J0UA 3TUJC 1I4TD 4HATA 4JLNA 2OHFA 2AXPA 2GEUA 3SJAA 2QZ4A 3GD7A 2WKPA 1YZKA 2FSIA 4UJ5A 5TVKA 2CL7X 1RPZA 4DDUA 1Z6TA 1VIAA 2W2XA 2EWWA 2WWGA 3O8RA 3ZIAA 4TYNA 1NJGA 3IQXA 3SR0A 4V0MA 4AYTA 4JLVA 3OZXA 1GVNB 4DDVA 3TSWA 3K0CC 3AKEA 4QHYA 2WZQA 3PFIA 1G3IA 4II7A 4MYTA 2L0XA 4BEBA 3R7WB 1O3YA 2VLIA 5D3MA 3ECCA 1G6HA 1ZM3A 5FR2A 2J41A 5DI3A 3B13B 4URWR 1FNMA 1Z5ZA 2QENA 5BN4A 3VU9A 5IT5A 1CJMA 3PEVA 4JLOA 4U00A 4ERNA 3JZAA 3HYTA 2WTUA 1F60A 2ZYTX 1E2PA 2V54A 3OFNA 3K09A 2A5YB 1YZTA 5BXQC 1E69A 4MRRA 1RVDA 3A36A 4LV8B 4D0LB 4KV9A 2BEJA 1XTKA 5EQTA 4ZDKA 3TLXA 3GLIA 1JQJC 4FD2A 1H8HD 3DEFA 2VH5R 3VKGA 3LBIA 4LJYA 2C9CA 5FBWB 4F4IA 3KJGA 4A0GA 2GEDA 1IY0A 3B6EA 2EYQA 3FB4A 1AQUA 3L0OA 5KOYA 4A2PA 2AD5A 4DDTA 1TAGA 2B8WA 4MYHA 2IUUA 1G3RA 4Q7KA 1JJ7A 4RD1A 4DKXA 1N5IA 1ZD8A 3K9NA 3V9PA 1W5TA 4LJ6A 4PSKA 2D62A 2IXGA 3TSOA 3RSLA 3NIBA 3U2QA 4Q4HB 4Q19A 2CJWA 4WZAE 2QROA 1GM5A 1AN0A 1S4QA 3ICQB 2BV3A 2CLCX 3UMRA 4EPWA 4JL6A 3SYLA 2ZQ5A 5KYKA 1EFHA 2FFHA 3TUIC 1C9KA 5CJPA 4CEJB 2W6JD 4JJZA 1MT0A 1DELA 4POAA 2GK6A 1A2BA 1WP9A 2NQ2C 4QGGA 4KLNA 4JLKA 3NH6A 4HZUA 3CONA 2YOFA 4Q7LA 3MMPA 4QFMA 3M4YA 1KI3A 5CB8A 1DAIA 2G1JA 4H1UA 4AWXA 2IYLD 2WJGA 3CNOA 1ZC3A 4YXWA 2ZRMA 4Z8XA 2A7QA 5EXXA 4E5UA 4CEHA 4LC0A 3SI7A 1P2UA 4P31A 1S3GA 5EE9A 2RCNA 2Z83A 3GEIA 4GT1A 1TF5A 3B78A 3OE7A 1HYQA 2QG6A 4JMPA 1II8A 2F1HA 1U94A 3A1SA 1ZNXA 1US8B 4GBMA 1OB2A 4Q1FA 1X86B 1D9XA 2ZI9A 4BFYA 4G1UC 1KMHA 3TGPA 1DADA 1E3MA 3GCGA 3QXHA 3L82B 1YR7A 3UWOA 5L3SB 4B44A 3VKHA 5J4KA 3HU2A 1D2EA 5LD2C 5KO2A 1G8PA 5FOXA 4C0QC 1KJWA 2J0UB 3NC0C 1ZD9A 5FTNA 2XB2A 2P5TB 3RRNA 4UNSA 3QF4B 3REFA 4DB4A 4Q9HA 3MCAA 4LV5B 1QHNA 2YWHA 3CRQA 1QF9A 3K8YA 5TY0A 1QHSA 3IHWA 3WNBA 1TUIA 1ZUNB 1VIYA 3U6KA 1NP6A 4D4KA 2X2FA 4NYJQ 2C99A 3R9XA 5KUTA 3I5YA 2ZEJA 3CWZA 2NPFA 5G3ZA 1KI9A 2IS2A 1GKUB 3KZ1E 3IQWA 1AK2A 4OI4A 2EYUA 1Q1QA 3WMGA 2ZJ5A 3ZS9A 2VHCA 3CPJB 4I1UA 4BECA 3U3MA 2J5XA 2FFAA 4FMCF 2NZJA 2WM9B 5UKDA 1KI2A 4GRAA 1CF4A 2HUPA 1LB1B 3FKSA 2GTPA 5TXGA 1E79D 5KSOA 4D25A 4B74A 2AD1A 3RS7A 1ZMXA 2Q6TA 4HZIA 5ANRB 1KY3A 3GJ3A 3QBTA 3IGFA 3Q8XB 3OAAA 3THYA 2O0KA 1RJ9A 1SVOA 3CR7A 1F3OA 1Q22A 1NMZA 4WZBE 3E5HA 4OK6A 5SZJA 1JAIA 4U5XA 4URUR 2IBMA 1E9FA 4M53A 4UXHA 2WHXA 2EVWX 2PX0A 1E6CA 1QRAA 2WSMA 3LA6A 2WBLC 1QG2A 2FZ4A 4Q4HA 5J40A 1XMVA 4RJLA 1N6RA 1XEWX 2JGNA 2RAPA 2BBWA 1IXSB 2HYDA 4TMWA 1NN0A 2I1VB 4V0NA 1W2GA 2ZIAA 2C95A 4Q9LA 2X77A 3GFPA 4TL7A 3W5IA 1ZU4A 1DG1G 2UKDA 4MRPA 3TMKA 2A3RA 1CJVC 2R44A 4U7DA 2KSQA 4QHSA 5K8TA 2IXEA 1GTVA 5HZHA 5FL7A 5JEEA 1KDOA 3A1TA 2BIFA 2ORWA 1JR3A 3QPUA 1OFTA 1SVLA 1KI7A 4WZ6A 4B47A 4FCWA 1EFTA 2PZGA 5E7MA 3O8DA 1JQLB 4BWYA 5A0FA 3QEJA 4XJXA 1U0LA 2OESA 2WJVA 5C4GB 5J4HA 3OIWA 1ZU5A 1II9A 1SVSA 3ADBA 4R9UC 1RW4A 2GCNA 3HJNA 5D3QA 3P27A 3A8TA 1OKKD 1P7CA 2FEOA 3BB4A 5TDHA 4MUBA 2GJSA 5CITA 1VPLA 3QG5A 1KSHA 2FGJA 2IYUA 4EJSA 1G7TA 4M1YA 2JASA 1Q12A 3LD9A 3NH9A 2VF8A 4HB2A 2REXB 4LOAA 4I1OA 4S35A 3U7HB 2BHRA 2QL6A 4GPTA 2ERYA 2WMNB 1X8JA 1SQ5A 1Q1ZA 2ZETA 2O0JA 3AVOA 5F98A 4KVGA 5IF9A 2JJ8A 4MKIA 2Q3HA 4MQBA 1KDRA 1NBMD 2JIZD 3LAWA 3SBEA 1H8ED 4CW7A 2IUSA 2NO0A 1G64A 2B7BA 2VP9A 2F7SA 3FTQA 4C0BA 2D7DA 4MGKR 1T6NA 3KKPA 1UAAA 3ZH9B 4CGZA 3KKMA 1VG0B 4JL5A 4UNRA 4V0ME 1R0XA 4EUNA 4DSNA 3BH7A 1H8HA 2D3WA 3AB3A 3QKRA 3THXA 1JI0A 1W36D 1RC8A 4BUJA 4HAXA 1WF3A 1OB5A 2XZOA 3TKLA 2CVFA 1HEIA 1SKYE 3ZZTA 4PXAA 1UFQA 1NIPA 4M9XA 1E9BA 1RE0A 2YHSA 1TF7A 2CLDX 1ZINA 2F3RA 1N3BA 1E2HA 1XBTA 4NMMA 1Q57A 3THOA 4EQ6B 2ZU0C 4ZI3A 4DSUA 2MSDB 2GCOB 2RHMA 4JBXA 2J0QA 1LF0A 1OHHA 1UM8A 2OV2A 2ZPTX 4OHXA 3IEVA 2IC5A 2YC4C 3BS4A 1G21E 5EP2A 5G53C 2JJ1D 3KDSE 4Q7JB 2QPTA 1UF9A 1XEWY 4NYMQ 4DIDA 1W4RA 1S1MA 3BORA 3U7EB 2V6JA 2ZRNA 2B92A 4OHZA 4B3CA 3R9WA 4ITRC 4M8NE 1NLZA 3TBKA 4A82A 4Z8YA 2DBYA 3SEAA 1GL9B 2QMUA 2FZLA 2VSXA 5E95A 5L3SA 4AI6A 1IXZA 2QE7A 4IVRA 1OIWA 3MFYA 5L3QB 4NYIQ 2VYFA 3C7KA 4Q5IA 3CF0A 4D4JA 5FTJA 2O8BB 3RRMA 4IDQA 5DGXA 4CVNA 3GEHA 4JT2A 3JZMA 3QF4A 1SKQA 3DO6A 1U2RA 3G82C 2XGJA 2AHOA 4A2WA 2OEPA 1TUEA 2XSZD 4M1KA 4LI0A 4JLDA 3DMNA 1CLUA 2WWFA 3QJYA 4DXAA 1FUKA 1TQ2A 5FI0B 1QZXA 4DLVA 4P32A 1E98A 1G5PA 4IHQA 4ACAA 3B8HA 1UEIA 4QC2A 2ANBA 4HDOB 1WA5A 4W5HA 5E7JA 4DLXA 3LNCA 2F9MA 1J8YF 2R6CA 2VHUA 2PEYA 2VO1A 4BFZA 4AK9A 2QEQA 3ADCA 2DWQA 2ZS7A 1PUIA 4LHYA 3MRSA 3GLIB 3AVYA 1DS6A 1HT2E 3CLVA 1GZSA 4LJAA 1P4SA 3H2YA 4RKFA 3TJZA 1G17A 3TW4A 4KBGA 1E9SA 3X1XA 1E2NA 3OEHA 4M1SA 2PCLA 3EPLA 4ZI2A 3RABA 2CE7A 3RHFA 4X8OA 4B3GA 2ZSEA 3GJ7A 4WAUA 4FWTA 1F2TA 2V55B 4MA4A 3VX4A 2GDJA 3PQCA 2KJQA 3CPEA 3CRW1 5FPKA 1YR9A 1XXHE 4W7SA 3UANA 1VDZA 4DCSA 3V4RA 2QSYA 2IK8A 2QM8A 3MWJA 3LO5A 4M1WA 3G0HA 1G5TA 1J90A 2FPMA 5C4MA 4TLBA 4M2LA 2J7PA 1FZQA 2QT0A 1JB1A 4F91B 1FL9A 3WXMA 1LV7A 4JLPA 4QM6A 2QM7A 1K8RA 4XVUA 1ELOA 4ABYA 1NY5A 3ZDQA 2VL7A 1R4AA 2KBEA 3UMFA 3MWYW 2ZXUA 1UKVY 2WOJA 1JAHA 1XMIA 2AX4A 4YMSA 1YVDA 2H1LA 5SZIA 4IKEA 1AJEA 2XTMA 2PX3A 1KK2A 3L43A 2D4HA 2HJVA 2ZUDA 4MYUA 3W9YA 3KUDA 2QSZA 1OXSC 5EP1A 1T0JB 3B1XA 5KTYA 2A5JA 2CE2X 2JJ1A 4MGIR 5HKKD 2DCUA 4BLQA 2Z0MA 3TVDA 2RGNA 4OK3A 1KKMA 5F9FA 4WXRA 1DPFA 2GK7A 3F8TA 4QGAA 5L8VA 1M7HA 1ANKA 2W58A 4GMDA 1N0VC 4ZV4A 821PA 4NCIA 2GA8A 5DI9A 1VCNA 3TH5A 4ZO4A 3DDCA 1KI1A 4Q4AA 3WHLA 2BMDA 1MV5A 2VRWA 1ZM4A 2C9YA 5J47A 2F55A 2EFCB 2IHBA 2P0EA 3LBNA 2HCJB 1U8YA 4OI1A 1RKBA 2A5GA 4A2QA 4B32A 1F5NA 4D0GA 4DSOA 4TYWA 3UIEA 1XXHB 4KAXA 3I8SA 1A2KC 4L16A 3ASZA 1N25A 2XB4A 1AIPA 2W0SA
chains in the Genus database with same CATH superfamily
2AFHA 1IJKA 1K08A 3DZFA 3EVBA 2LXNA 1Y5NA 2ZR9A 3UXMA 3WSWA 5A1TA 1LBIA 4MQLA 1YE5A 1VI5A 1W75A 2YVAA 9MHTA 1A7AA 1XQ1A 4MDFA 3ZQ6A 4AZ0B 4HGYA 4XGQA 2DQZA 2F6RA 5H3HA 1V39A 2JFYA 4JC4A 1H9CA 1UC4B 1E0DA 2TMKA 5T3YA 3O31A 2B98A 2WZBA 4PYNA 2ACKA 5SYMA 2FMHA 3RYHA 1QIJA 1TGVA 4OXIA 1F48A 2P5SA 2WA2A 2ZE8A 1XQVA 2RI0A 4NENB 3FOEC 5J63A 4JV5B 4BKPA 1PT5A 1NVBA 5TR9A 3AIIA 4JR2A 3FIUA 3L7KA 1JWAB 1YXMA 2HQRA 3K2IA 2K6GA 3BFKA 3LOUA 3C16C 1RSZA 2AYZA 2HFJA 4HAVA 1QFSA 4JVMA 4MINA 4NFHA 4X7MA 3UK2A 2YICA 3WLEA 5CDHA 5KNBA 2IITA 3F0TA 2HNKA 1DWQA 1YK0A 5A5DA 4OYYA 2AV6A 3BL5A 3NTLA 1TMGE 3GAMA 2HMUA 4BAGA 2R84A 3U37A 1PFKA 1VFNA 1NVFA 2G3YA 3D6VA 2HM7A 4LWZA 4N40A 3WBKA 3HU5A 2EFHB 3GWZA 4YRAA 1DO2A 2B9VA 2JFWA 2JLAA 4DIKA 4EQ6A 3I64A 1RJ9B 5IP5A 2QV0A 4FGJA 3VU0A 3VU1A 4NJEA 3KV3O 1BX0A 1XF9A 2HSGA 1KRHA 1W88B 2Z6AA 3PENA 3B1KA 3WLIA 1J7KA 2ZYIA 3I76A 5LWHA 3ODPA 4AKIA 2O2DA 3A3YA 5KQMA 2WHPB 5JFGA 4L57A 2ZPAA 1C9DB 1X1BA 3CF2A 4BMCA 3ISVA 4GF5A 2QSJA 3TZ6A 2CVPA 1WMSA 3B48A 3JCZA 1GXSB 2G07A 2HMSA 4TRRA 5CNKA 3UAOA 4BO4A 3IA7A 4G1EB 3SR4A 2C97A 3EGCA 4WINA 4FQ8A 1X80B 2QU7A 4IW3B 2E1PA 1S2OA 2D5BA 2XI4A 5GJBA 3LQQA 3AVPA 3E0QA 3BK7A 5ALRA 3IKVA 5BT9A 3UOAB 2DPLA 3E7WA 3EPPA 5FYDA 4WJLA 5HZKA 1XNRB 4WKCA 1YA6A 3AF1A 2VSOA 1KO8A 4BNKA 5I51A 3BULA 5CLHA 2CLFB 2ZI6A 4LDRA 3ZK8A 3MTJA 2XYHA 3TQQA 5CT5A 1C1XB 1XJCA 3A6PC 3E1GA 4L8LA 1NDHA 5J2UB 1KIMA 4DPKA 2A5DA 4YJ2B 4CF7A 3K8ZA 1X92A 3LC2O 4TMKA 2JRCA 3TW0A 3R74A 3ANLA 1C7FA 1EWVA 1OGJA 2FWJA 2ZAOA 3Q3GE 3DLBA 5JDCA 2JI8A 1IZ8A 3GQBA 1BW9B 3AUYA 2XT6A 3OEEA 4K0RA 1RMYA 2HEIA 2OCBA 1A4IA 4RMJA 1SKAA 1CZRA 3M6MD 3AVWA 4NG4A 4P92A 1NSTA 1RM3A 3EDRA 1ZNQO 1UPUA 1X38A 3A1EA 5T4EA 1VLVA 2KWIA 2AMLA 5LCXA 2Y4NA 4C14A 4QD3A 3PA8A 5IEBA 3FGZA 2YUTA 3VH2A 3HGMA 5LZ7A 1RHJA 2FPXA 2F43B 1J33A 3OOWA 4BNTA 4RIIA 4JI5B 4G97A 3SNHA 2QN6A 1LLCA 5HIAA 4Y0AA 3W5DA 2JVIA 2R62A 4UAJA 1QQBA 1YNSA 1V1JA 3S28A 3FKSD 2P9CA 4I50A 5E4YA 3SIXA 3TQSA 1U99A 2IZ5A 2XDQA 3B1JA 1KRXA 1ZC4A 4Q7MB 4C78A 1WQ4A 4K2HA 1N2SA 3JWEA 4I14A 2QA5A 1ISRA 3B1WA 3L2OB 5CM2Z 3FGOA 3REOA 4DB2A 3GQVA 2QM3A 3F7TA 2IHUA 4MLPA 5DCLA 3IUEA 4QBKA 3EEQA 4F96A 1ND6A 5JJIA 3AY3A 4MUNA 1NZDA 1AHHA 1UWVA 5F52A 1KI8A 4CCYB 4CV2A 5JCPA 4G1CA 5JPDA 1K5DA 2IPMA 4IZOA 5SY4A 5AJVB 1RJDA 4Q1DA 1DKMA 1R4NA 1WE2A 1OFGA 4B4VA 4BLVA 2VDUE 4EBBA 1QYRA 1VBMA 1W44A 1JSXA 3GB9A 4MS4B 4OREX 5D8DA 3VC7A 5IX8A 1KOGA 2DFLA 3F8SA 3K9QO 2E4VA 1X7HA 3KOUA 1F5SA 1M1NA 4RDCA 4ROTA 1M2FA 1O58A 1CY7A 2EZTA 2ZJ0A 2OCGA 3GUCA 4K9DA 3ZCVA 3PT5A 4P83A 1TTPB 1RYDA 2DFNA 1E1QD 1VLLA 5BQXA 5ISMA 4MW9A 3ERCA 1PRYA 5BSHA 4GLOA 4EHNA 3AI1A 2KYRA 4QAQA 1HRKA 4F21A 4RTOA 3QPAA 3AQ4A 1E9AA 2HBYA 3NBZC 2Y66A 4GS5A 2ID8A 4NOMA 5CLFA 4LMAA 1BE8A 2CEAA 5IM5A 1TPZA 2X8AA 3IDOA 5EEGA 3E22A 2IYRA 5JWRA 3ROZA 2ZRKA 2PQ2A 3X2FA 1CULC 4NV0A 2CLIB 2VHTA 1JBQA 3HA2A 5EI5A 3VPDA 4EG7A 1A04A 4LEIA 4D0NA 3QUQA 1MG0A 1OLUA 3J7TA 1PLJA 2H8GA 1HO3A 2GB4A 4QELA 3NUGA 3IP6A 2WOOA 3QBEA 1ZKDA 1VZ2A 1T4CA 1IWBB 1X7WA 2BL4A 2ZRDA 4GWGA 2LV8A 3CVXA 2GLUA 4F8EA 2XQVA 4WA7A 4M60A 2WAYA 3VO9A 4DW8A 3CNBA 2DY0A 2CFCA 3KL2A 1P8JA 4R2JA 3B89A 3E5RA 3QLVA 4QEDA 1GKIA 4B46A 1EFKA 1CUDA 4LXIA 1XTSA 1S2MA 4L4ZA 2ZVPX 2AI2A 4PYMA 1TKBA 2BEVB 3Q0TA 4E1VA 1LFDB 1FSZA 1URPA 5G0SA 5IC6A 4E6PA 4EPRA 1LKZA 1R16A 2BLNA 3OHSX 1QAMA 5HF6A 4KFRA 4O4JB 1ZCAA 3GG2A 3UMGA 2XRYA 1R6AA 1VKRA 4QBFA 3DVRX 4YMGA 1R4ZA 1X9GA 4AQDA 1TT7A 1T2DA 3B6JA 4NCJA 3A3OA 4F11A 2FG5A 5K8VA 1ZOOA 1F2UB 2BFOA 3C8ZA 2B20A 3HUDA 4JDUA 3TX6A 3WMEA 3WY9A 4MR9B 1DAGA 4GMHA 1SVNA 2I1QA 3AHJA 3L0IB 3TXYA 3FHLA 5EMHA 5DM60 2O8FA 3DE2X 3U4HA 4CM8B 4A0QA 1HV8A 4JBWA 4Z2AA 2QD1A 5C46F 6ABPA 1D1PA 3PITA 3W5VA 2JIZA 4RGVA 5CVVA 3D81A 4A23A 5C3MA 2VQFB 1J00A 3PB3A 1WVGA 5A5VA 2J3MA 1T4GA 1M2WA 3R0XA 5GADl 4QFBA 4ZDWA 4HGQA 1JG1A 1J09A 3ORHA 5DMHA 3S2YA 4BQQA 2V0NA 2PR2A 2AEEA 1CHDA 1QCDA 4GVXA 3JQ7A 3DMDA 2YIMA 3ESCA 3FNQA 4YRZA 1KP2A 3DWGA 7YASA 4XDYA 1AF7A 4WLOA 5IS2A 5CLGA 3IALA 2DE0X 3IBGA 3HU3A 4I4LA 3ZK7A 4EM6A 1LC3A 1SC6A 3MS7A 3QQ5A 1GYRA 3JATA 4LN1A 4EDHA 1GZ4A 2DYKA 5AI8A 4D5GA 2NZ2A 3EH2A 1TO2E 2BZ0A 1GPUA 3RC9A 3H3FA 4HDSA 4PC7A 3L5KA 2PJZA 2PT7A 1V6SA 5CT6A 3WX0A 5JIBA 1NW3A 4B73A 2HA4A 1HPLA 2QTVA 2IU4A 4H3KB 4BO6A 4G63A 1DUVG 4M9RA 4QHTA 2JCBA 2A58A 1GSIA 2UYGA 2XYGA 3G2LA 3HXLA 3SX2A 2OO3A 4M4SA 3C3BA 4MVJP 4FB4A 3DEAA 5IKPA 1GTRA 3DFKA 2OL4A 4I4NA 1IK4A 2E18A 3MJTA 2CHUA 2RARA 4BNZA 1PZGA 5GJVC 3R7NA 1QVVA 1MB0A 1PQ4A 3AHCA 3BWDD 3OPXA 4OUKX 4WPGA 4JJ4A 2D00A 2GM9A 4KXNA 4Y2SA 3BGVA 1E1QA 4EW2A 1KY2A 5K3EA 1DTSA 2AC7A 4FWIB 4H9GA 2Z1MA 4BVGA 3UFXA 4BNUA 1GAQA 3ADKA 5T4FA 1IEWA 2WMOB 1O9GA 1JVSA 2I7XA 1G1MA 3GLVA 1ND5A 3SU8A 1AMUA 1ZRMA 1E2JA 1KYWA 2FXIA 3I01A 2C92A 3L9XA 3MD9A 4J4HA 1SVIA 4KQXA 1XVAA 4PIPA 3ONDA 4LVUA 3VKWA 4AG6A 5CLJA 1P5FA 2IJGX 3AKCA 4XCQA 1BXKA 3RWMB 4BPBA 2DQKA 4MWEA 4WDQA 1OH6A 2HIMA 4B2LA 1IZZA 4BMXA 2BTEA 1WQ3A 4KL8S 4Q3CA 3AU8A 2AJCA 4KU4A 3DFFA 2HV9A 2GJ9A 1L7VC 3DAYA 1V37A 3E9ZA 2AF3C 4OQFA 1EIZA 5IFKA 3IUYA 4LS3A 2B3TA 3IBTA 4NDZA 2CLHB 1LW6E 2LE0A 2QRZA 3BE8A 3QELA 2AFHE 4H7EA 4JUAA 2RHRA 2Y92A 3EVDA 4PO1A 4O63O 2HLDA 5K0BA 3H4VA 4LOHA 3QSGA 4BKOA 1DUIA 3R6GA 4J1TC 3ESQA 4EB3A 5ALMA 5D86A 2CFIA 2DTDA 3L93A 1X1SA 4DOMA 3U31A 5H4GA 5M04A 3QPCA 1V9SA 5A3QA 1OROA 2GCIA 2FTKE 521PA 3VYTB 1IHOA 4NIMA 4EA9A 4Z53A 4KQJA 1Y3IA 4R40A 1DKQA 4RD6A 3ZVRA 3ZUPA 4U6QA 2WU1A 5ITZB 1QFMA 1M34A 4NYIR 4URXR 4C2BA 2YOGA 1O0SA 1AH2A 1VG9B 1P4HA 4RC9A 1W5FA 1X15A 1M74A 2ZT7A 3HSSA 3WZ2A 2WUVA 1JQDA 3OEHD 3RYHB 3S7TA 2Y1XA 4FE3A 2O52A 2GBLA 2R25B 1E64A 2V5VA 1MGOA 4OJNA 3RIMA 2EW8A 4RHTA 1HWYA 4RPLA 3H5OA 4A4DA 4B85A 5I48A 1HXHA 1T0BA 3S3TA 3IELA 3PUJA 2O3RA 3E84A 3O9ZA 3O9MA 4FEEA 4ZCRA 1FSPA 3N7UA 2I6TA 1YQUA 1X1RA 2EAUA 2VDRB 3HHPA 3B6MA 1I13A 2CMFA 2NW6A 3C1OA 3DVAB 2IYQA 1VRCA 4P5DA 4RAQA 3PFGA 1D0VA 2PAAA 4URVR 4ZOLB 2GFQA 1CJSA 3ELDA 3GFGA 1GFSA 1PEYA 3ET4A 4IAOA 5H80A 1Y33E 3R9XB 3QYPA 1KZ7B 4LVCA 3R7BA 4O5OA 5I6DA 3DCJA 1L8AA 5K0JA 3MK31 2C57A 4KZKA 1GSHA 1OREA 4FCTA 4GP6A 3PUKA 2QQGA 4YFYA 1VG8A 3QWFA 4DWJA 4DFDA 1ZKMA 4IXMA 2XQKA 4Q4LA 1W0JD 5JZ9A 4PLYA 5BWMA 2XECA 3Q98A 5BSKA 3SSAA 3ZY2A 1ZIYA 4G9GA 1LD3A 2A4KA 4FBMA 4DA6A 1MBZA 4RH1A 2VOJA 3KZXA 1FX1A 3PE6A 3GUHA 1OQAA 2PZLA 4LGCA 5J1SB 4U0KA 3MGBA 2YYSA 3FSGD 4NQRA 2QIPA 3OOEA 3EAQA 4LJRA 3LC0A 2JIQA 4LWQA 2IODA 5SICE 1N8SA 2ZRPA 2JLSA 5F3WB 1KJQA 3PR3A 4UHFA 4HDCA 2BCJQ 4WLVA 5DM1A 4LFBB 2MSCB 2FWBA 1UQRA 4F3RA 1CP3A 4AMYA 3ZW7A 4UBOA 1AK1A 5HXAA 3I37X 2ZBPA 3W34A 1M6EX 4WFJA 2OCIA 2P65A 3BMQA 5DLQC 3DC7A 3K5WA 2HW8A 2G06A 3LF2A 3R3HA 2IBTA 1N2BA 5EG5A 3MIZA 3KR0A 4R81A 4M1MA 1YDEA 1RI2A 1WHSB 1USIA 5G0WA 2OZEA 2BP7A 1L5NA 3QVJA 3B7GA 4LKRA 3C98A 4FX2A 2AZDA 4AIIA 2X5JO 1L5MA 2NWQA 9ABPA 4K8OA 4R71A 3UJNA 2PD3A 2G8NA 2RGGA 3ZHVA 1BW9A 2YH2A 4C6RA 4L07A 2UZ0A 4Y1EA 4PQEA 3NVDA 3DBRB 2NZ8A 1ZLYA 3KNZA 4G3XA 2X7HA 4DR5B 4Z1OA 3T1HB 1AY0A 5K2MA 1MF7A 2B94A 2R7KA 2G5CA 4L9WA 2JD1A 1C3VA 3KXLA 4F72A 1QNFA 3UMMA 4X5OA 4DIOA 1RI4A 1T2VA 1PJ3A 5CM8B 3G68A 4QO8A 5C5DA 2ODBA 2L18A 1K5GA 1PQWA 1N9KA 1V5WA 4DCMA 4KXWA 5F12A 5KDOA 3INYA 2OYSA 4YPFA 2YWEA 3O5AA 3T0IA 4IJWA 3JD2A 1ZFNA 3DBVO 5HSGA 1VE1A 3UPUA 1Q44A 1SCQA 3AR4A 3M6AA 4RD2A 5EUCA 3OG9A 5AKLA 3X1MA 1PZEA 2HSJA 3VSAA 2AN9A 2J08A 2FPIA 1QQAA 1M33A 4TTIA 2I2BA 2XMGA 5T5QA 4X7PA 3PGKA 3ADDA 5EJGA 3FW1A 2WK1A 1E1RD 1Z2EA 1OI4A 3PGLA 3TXAA 1EVJA 1NKVA 1ZUWA 2VZEA 4YJ3F 3K0FA 4KI7A 3FUWA 1ZI9A 4P3OA 5EEHA 3P32A 3RADC 2DH6A 5FBKA 1E3QA 2BEUB 1Q3TA 4HDSB 1N6OA 3AX6A 2OP0A 4WSOA 4EL5A 5BV0A 1UZMA 4FX5A 4B82A 4D3DA 4Y9TA 1I8TA 3HBLA 3TCNA 3SBXA 5K3FA 5K51A 1HH4A 1U28A 3G0OA 1N5MA 3W5BA 3FJYA 4ZOLF 1BMTA 4AMVA 1D2MA 2N46A 3IOBA 4N54A 3TSAA 3TRDA 1FYDA 3PPYA 3RYFB 1M1NB 3ZCRA 1IONA 2VNKA 1YE8A 4D9EA 2QMYA 3AWDA 2Z8YA 2MSEB 3N2LA 4P4SA 1G8FA 4WZAA 4JUDX 3V7UA 2WILA 3OE1A 1HT0A 3QV2A 4WBNF 2VKQA 4KK3A 4IDBA 3HKBA 1DL5A 4G1VA 4GMGA 4OHBA 1P31A 2FMFA 2ZRIA 1NAIA 2II6A 3DA8A 3KO8A 5CR9A 3THXB 2UU9B 3K1YA 1TTQB 2FWAA 2IVFA 1JDZA 3KTAA 4KDRA 1ODFA 2HF2A 3HRKA 3IQEA 3V4VB 1C0IA 3SYMA 3PD0A 1Z4KA 2O7QA 3WS7A 1FX0A 1JXMA 4XYMA 1K6MA 2YVKA 4YMLA 3HXTA 3QYJA 5KTSA 4GM1A 1MUUA 2Z6VA 5JADA 1IJEA 2CW5A 4IF4A 4BP1A 1OGIA 3R0VA 2BFAA 5HEKA 1L5LA 1QGOA 2AFIE 1CQWA 3DNPA 4KNVA 3JVVA 2GZMA 1JDBC 4LRUA 4RKEA 2CDNA 3T3EA 4V1CA 5IJ9A 5JYDA 4ILKA 3T1OA 1CY4A 3IEPA 1M67A 2EW1A 3BREA 3ETNA 3F6BX 1Y1RA 3Q87B 4L0DA 2O0MA 2J0EA 4OTZA 5DNEA 3PL1A 3TW6A 1RWOA 4ZN6A 1VFPA 4M0MA 1LUAA 4DIUA 3DEHA 4UCQA 1S8OA 3UMJA 1KSFX 1YWGO 1Z2AA 1GQSA 3HGQA 1QR6A 2NVWA 3GA7A 4Q18A 2WTEA 5CT8A 1YZ3A 1C8BA 1SCKA 3GGSA 2HCBA 3L05A 5CAEB 3N2IA 2AKAB 2XXAA 1W29A 3I8XA 1YTUA 3I6ZA 4B3TB 1YR1A 2F3TA 3ELYA 5CH8A 2PV7A 4ARIA 3SC6A 1C50A 1DHTA 2FU5C 2ID4A 3GLHB 3ZHTA 3LBFA 1F8FA 5FBLB 3E7FA 4QM7A 2WAMA 5DIFA 3E05A 3K35A 4TQGA 2OORC 5FORA 4DV2B 4Z9YA 2QVLA 3Q5GA 2O1XA 4I08A 3B60A 3KXDA 5ALJA 3LL7A 621PA 1U2SA 3C1TA 3LY8A 1NR7A 2OKCA 4ESHA 3WLAA 2CSXA 2J8ZA 2WM2A 3SCZA 2DWPA 3ZJ5A 4DMKA 4LY3A 2WUFA 1ZCZA 3E82A 3PV0A 3PDJA 1IWOA 5AI6A 5TE9A 3ZGYA 2NV6A 3PPVA 3I4FA 5BQ5A 3ZWAA 2XNHA 1RNLA 4PYLA 5JAPA 4MVWA 4D96A 3IH5A 1BE1A 3CW9A 4WA8A 2H1CA 4FMCB 5TV2A 4YV0A 1UKCA 5A9RA 5HOQA 1NG9A 2P1RA 2GARA 2WTMA 3ESAA 1YRYE 1OC4A 4JIGA 4M7OA 5AJXA 1OLOA 2VNJA 1LBTA 1NWHA 3RTAA 1CUBA 1KOJA 2V97A 1SXPA 2FNAA 1O5IA 4W9NC 2DFPA 2HGSA 4GZMA 2XT0A 5ERXA 3V1TC 1SGWA 3EF3A 3EZ6A 4BGIA 1P5RA 1UK7A 3K70D 1L7NA 4J0JA 1H0KA 2DTXA 3H4IA 3HCWA 3WHIA 3VPAA 2FFJA 4HNUA 4KHZA 1U7HA 1EFVA 4EX7A 2X42A 5AI4A 2BGWA 1WXGA 5IBPA 2WJYA 1U0TA 4TQUS 2DBVO 1XP8A 2CVHA 4UDOA 3U80A 2YJNA 4P3YA 4LI3X 4MYRA 5BOVA 3GGCA 3GLFB 1GCIA 5CP8A 1MGPA 3MTGA 4JQSA 4AMUA 4ZEMA 5KYXA 5A02A 1E6KA 3NR2A 1D8AA 1PR4A 1Z5VA 4IIHA 4N8DA 4N6GA 3T7AA 5IYZA 5L9AA 1GTSA 1X7GA 1R37A 2AH5A 1UBCA 4ARUA 4Q4JA 4D6PA 2C4NA 3I1YA 3N0WA 1RYNA 3AFGA 1UPFA 3OM0A 4ENRA 1U7PA 2PBZA 1F06A 9ATCA 3HCBA 3LXXA 1JA0A 4MS1A 1SB9A 2FVYA 5HCNA 2WT9A 1VKOA 2BBTA 4GYWA 4OG2A 4UAGA 5FLXA 3KYDA 2ZWAA 4MGZR 1JDUA 5LM3A 1ZP6A 3GDHA 3GRFA 2XQIA 4TXMA 3SQWA 5LQDA 3ZVNA 1Y9DA 1W85A 1A71A 2HR1A 1QDUA 1JHUA 2PS0A 5TJ9A 4N48A 3R0IA 1ODIA 3F8WA 5BYKA 2HPAA 5J59A 5FQNA 4YUAA 1S3FA 2VJAA 4O4HA 3SHOA 3OQMA 4EIWA 4KLZA 3OJCA 5AOAA 3DAOA 4IXNA 4EW1A 1Z0ZA 1T13A 2RHBA 4QOHA 1GTZA 4TXHA 2RJ3A 4RVFA 5J4YA 2R8XA 3CEJA 1GZHB 4QBHA 4ZT3A 1U9YA 3C7AA 3PLRA 4YR7A 4RCYA 4CODB 1J22A 3K71B 1NAHA 3DPIA 2V6BA 4V0OA 1ODKA 2FH5B 1H3EA 1J0XO 4EYGA 1TEXA 1JIJA 3N8DA 3CLTD 1XXHA 4GEGA 3TAUA 5LJLA 1PTJA 2PKYX 2PRJA 4IHJF 4LE0A 2NO9A 4M86A 4JKOA 1FDIA 1H4TA 3GN1A 2O3UA 4C9BA 2A4MA 3DWFA 4Y7DA 5CEEA 1UDWA 3Q9NA 5BYJA 4EMSA 1DEOA 2YJTD 3K0FB 1HR0B 1A77A 4OIMA 2Q5QA 1MOZA 4KQCA 4ND3A 4RBNA 3HKEA 4DIFA 1RCTE 1HLDA 2ECOA 3KKOA 5THKA 4DWOA 2Q2OA 4B35A 5JQGF 1BYIA 1TMOA 4JVNA 5D3ZA 3U40A 1GV1A 4KUEA 3OZ7A 3T15A 4XB1A 3QEMB 4ZGGA 1Q0ZA 2CCJA 1MJHA 2G1KA 5K3FB 4K40A 1KIFA 5EGSA 5K6RA 1T8YA 1HMPA 4HZGA 2IS6A 3QRWA 1SUIA 4WIAA 2AMYA 4GPAA 3CGWA 2FSVA 3NHBA 2BISA 4Y1GA 3VOAA 2C54A 3NEPX 2O2ZA 3ETHA 1CETA 1OBVA 4WZZA 5EJ9A 1XG5A 4PQRA 3PJDA 2AFRA 1EFRA 1QHIA 4C03A 3SDZA 3CVWA 4RV5A 2RIPA 1WUTA 1G5FA 5IT4A 1P62B 2RONA 3GGJA 1BO6A 3OFND 3OIYA 4HI0E 2Q8PA 4Q9AA 1QH8A 1WXQA 3OLQA 1T8UA 4HMPA 3WL8A 3T1NA 4ESOA 4CG3A 1C1DB 3LG2A 5DN6D 1EZZA 4F2WA 2GNOA 3B1YA 3PCRB 4NZ9A 4LJLA 2O2IA 4EEZA 3JSXA 3NHLA 1WZCA 2C0CA 1WUKS 2PSJA 4WKBA 3T5DA 2P6UA 3BTUA 3KD2A 4DBLE 4CR8A 1JDPA 4DUGD 1HYHA 4ITUA 2G40A 3D6TB 2HA6A 4IIDA 3SYTA 4DSZA 3L1VA 4UD6A 1YZNA 1C0EA 2PUTA 5I3ZA 1CSEE 3HADA 4J91A 3TIGA 2FFBA 4PAGA 1SBHA 3G02A 5K45A 4XIJA 1V35A 1Y5LA 5CB6A 1IIRA 4O4LB 3GFOA 5IJ9B 4MJ7A 3EAFA 1Z6GA 3RRFA 3C3JA 2ZE7A 3JQAA 4JOQA 5H1YA 1U5BA 2H2WA 4LPKA 3RPEA 1QFZA 3T5BA 3HK2A 4Y18A 1WULS 3M5CA 4PLTA 1H05A 2H85A 1N0WA 1VJRA 1YMQA 2FF5A 4NQZA 2HOQA 1NBWB 4W5WA 1LW7A 2FW0A 3N2NA 4IQ0A 4MJ3A 3MQ4A 1QYCA 2R7NA 3RSOA 5EJ6A 1B8UA 1MRNA 2GEKA 4DDMA 5KKNB 1PFGA 1QVAA 1RWWA 2G76A 2PGDA 4H3HB 5BR7A 1JKIA 2P2NA 3V34A 1KVQA 2H0QA 2VJCA 5EXTA 3VV3A 3UQZA 4G5QA 1W36C 1ABEA 1Y9ZA 3IIMA 3JTMA 1DAKA 3OQ1A 3QSYA 1EG2A 3FZGA 5LP6F 4UQPA 1T0IA 3AXTA 1VPWA 1QIHA 4YPOA 1JT9A 4NEHB 3WK6A 3BWVA 5HZMA 3TW8B 3QOYA 1G5QA 3ZZMA 2WFZA 4AY6A 4O1MA 1QH1B 1U6KA 2DTEA 3AUXA 5FV7A 4O2LA 4GBED 2X0KA 1QH9A 1ITZA 2QZ9A 5F1OA 3S8MA 1UDRA 1DTWA 2Y1FA 3IQGX 1Q1AA 1XDWA 2PMWB 3KEQA 3T12A 4DGQA 1R1DA 1R0ZA 2PS9A 5AUQA 1OYWA 4L3VA 3GXBA 1ADCA 5JJLA 2MT9A 2O0HA 2RKBA 2XVYA 2YJ4A 2ZT8A 4LHVA 4NMLA 4CHTA 4GLJA 1O4WA 4HUQA 2JLZA 1CF9A 4CKXA 2YMLA 3IAEA 4DDHA 3NWPA 5IXJA 5EWJA 2PX2A 2IV2X 2ZIFA 1PS8A 4R3UC 1VJCA 2XUIA 2ZRJA 1IZ7A 1LDGA 1XR3A 3VTKA 2WYUA 5FUBA 2ADMA 4EL0A 3EQ2A 5G1OA 3FMOB 3WICA 1ESNA 1AKWA 1TYAE 3CEHA 1J99A 3L8YA 3DT8A 1NMXA 3R09A 2NM0A 4N7JA 1LNQA 1NHGA 1DQYA 5TARA 3PWTA 3GLGB 4QYIA 2QNRA 4B3MB 3G2IA 4MQFA 4EGAA 1BE6A 3FSGA 3KXPA 4JXZA 2QJOA 1KI4A 4YNBA 3ZLTA 5BORA 1YZUA 1DU4A 2X58A 4H4CA 3JU3A 1JIIA 2H2IA 3ZHCA 4EA6A 2EZUA 5JATA 3K70C 4MKGA 1NXPA 1XLUA 1XRRA 1MEEA 1WVIA 2JGIA 4C30A 2C42A 4BFTA 1KU6A 3UAVA 3DC2A 1OUMA 1GR0A 5DHQA 2QVYX 3PD1A 2H7XA 3ISTA 3MLBA 4OJQA 4CL3A 5TQ0A 4MB6A 4FFNA 5IVPA 1G2PA 3HVKA 4R7ZA 4NBSA 4F3NA 5CA1F 1EVYA 4UU1A 3KFVA 3K4PA 1Q74A 1NNSA 4M98A 1NF3A 5HDQA 4DMGA 2I55A 1KF0A 3R0ZA 1GWNA 1PG2A 1SG0A 1QZZA 2HRQA 5FADA 5KHLB 1CRPA 1G6Q1 4Y9SA 2WDPA 3F97A 3FDZB 2PJUA 3PZRA 1ZSNA 3NBMA 1V41E 2A9PA 3CUTA 3SC4A 5D2CA 1QJCA 1L4BA 3D59A 4KMRA 2GKOA 4MS1B 3SNKA 1AXEA 2ZSKA 3GCDA 3LT5A 2FEMA 2C5SA 1X3SA 1K2WA 1XV5A 4AJLA 3NWJA 3S68A 2HEGA 3A6EA 3LV8A 1IXYA 4AMBA 2Z5FA 2ZRBA 3OCJA 4F6RB 1PG0A 4UM5A 4QDKA 4PCAA 1T2CA 2DC1A 1CC1S 2CCKA 2X1MA 3MNFA 3QG1A 3TNDA 3X2EA 3RC2A 3ZY3A 1DLIA 1REQA 3I3SR 3NONA 4D6YA 5JZOA 3EPKA 1NQXA 4QQ8A 1UDBA 3DZ8A 2PIDA 2N1MA 3IUNA 5DM70 3V7WA 4M38A 4TTRA 5FP0A 3JQ8B 3CZ4A 3X0DA 1MENA 5C51B 1HY3A 1TFUA 1UAGA 3SE0A 3O95A 1AOXA 3WGQA 1VL1A 3QTBA 1KYZA 2H1SA 1E94E 2IY8A 3AI2A 3EXG2 1ZX1A 3HA3A 3U13A 4BNHA 3JVDA 3FF1A 2AF4C 5JD6A 1XQ6A 1HQYE 3ONNA 3WYDA 4F5DA 2NXNA 4J07A 5L6LB 4QTTB 1SCNE 1C9NA 2W83A 5ES3A 4PLVA 5EE3A 5DYNA 2A0KA 5EYPB 4KPFC 3ZV5A 4CEIB 1Z0KA 2FN4A 5J5AA 3TEFA 1KJNA 3MMNA 3WYNA 3AY6A 3W9UA 4D0SA 3T99A 3M83A 4GAEA 1YOVB 2ETXA 4BWGA 5GVSA 1RHKA 2BKXA 2PZBA 5FFMA 4WOPA 4Y6QA 1RPJA 2Q6IA 3H1FA 3IHLA 3OP1A 2NO6A 4MQUA 1NPDA 3DOEA 1T4BA 3LCVB 1NIJA 1TJNA 3CKKA 3PDHA 4F7DA 3TTYA 3PJRA 3AF0A 5E1OA 4J0DA 1YU9A 4HDMA 1ETHA 1P2TA 1XZ8A 1I4OA 5DMXA 1I94B 2VZLA 1EX9A 1A9XB 3LT0A 4RHUA 2ZI3A 2J3JA 1GUZA 5CVUA 2XBLA 1WSAA 3B3FA 3MN1A 3NOOA 4GLLA 2GCGA 1IY2A 2EBHX 4JT8A 5EE0A 4W5QA 1UMDB 1L5YA 2ZYWX 5LMCA 4IJQA 1HE1C 2XEXA 4DQLA 3AFOA 3UXYA 5ADUS 2JPDA 3PWZA 2YNMA 1VHQA 3ECSA 4BNFA 5GAJA 4RPHA 4XWAA 1DBQA 1VKJA 1G20E 2ZANA 4NV3A 5DGCA 3GP8A 1FJXA 3DTVA 3TQRA 1Z2NX 5KDDA 1PD0A 2FQYA 2FWRA 3MLEA 1UPAA 1L2TA 1VLJA 5FPYA 4KFCA 4JEMA 1FQOA 4MS3B 1OT5A 1ODLA 4LDJA 3ZGXA 2R1UA 4GMKA 4AVYA 2QP9X 3TSCA 4D4GA 1CJUC 2VTVA 1KSGA 2ILTA 3OZRA 1JDBB 2I4IA 2C4WA 3LTEA 4TUYB 2IXTA 4EJFA 2HSWA 4WACA 1PEAA 1U1DA 1EFCA 4AAYA 1L4KA 4JP3A 1XHEA 3AHGA 1TYZA 2N75A 3T5AA 4EG0A 2IDZA 3MJSA 1BMQA 2JH3A 2VUUA 1NF2A 1NFFA 2AE2A 2V58A 5IPFA 1ZESA 4PFSA 3PGMA 1E5LA 5LQAA 1A8HA 2A88A 1TAUA 2VTKA 1DLJA 1EBUA 1KI6B 2ADOA 1PDOA 4LECA 1E2FA 2BGRA 4R8MA 3TPZA 3W4IA 1BWSA 4LRWA 4KXFB 2VEOA 2XKAA 4JAVC 1IBMB 3KLPX 1RFGE 2GBCA 2CXOA 1DHRA 1ECCA 3LC7O 4BX9A 5LJIA 2VBGA 3ZCPA 1P80A 2X7XA 2DT8A 2CL5A 4FJ0A 3I5AA 1QPBA 4IOMA 2BBOA 2WD9A 3G2HA 5DCUA 1W85B 1G0NA 3Q8WA 1O2DA 1Y3HA 4Y7CA 1EKXA 1WXHA 4MDEA 2O3QA 2ZJZA 5IZCC 2RKWA 2Z9DA 2NU9B 4DZZA 1BDHA 1ZQ1A 5ICGA 1OC2A 3D7KA 1LCIA 5GV7A 3E70C 2OA0A 3K73O 4EEXA 1QIIA 3JPYA 4C5AA 1W1WA 2JHAA 1SUWA 1RM0A 2R1VA 3OT4A 3T61A 3H5RA 1X0VA 4J3FA 4RETA 2X1HA 5BY2A 4E14A 2BF7A 3GRYA 3SGLA 5I45A 1QH1A 5ITVA 3P0JA 5AM2A 3RF6A 4RZIA 4CDRA 1UJMA 4YQEA 5AK6A 4Q93A 2VYVA 4ML3A 1YA4A 2GXSA 2VUSA 4QNNA 5HWSA 4CL2A 5HKAA 1MD9A 3O4FA 5KSZA 4IFEA 5DT9A 4R05A 3FHTA 1T1SA 4MKXA 4TTPA 3AW9A 4FVTA 4QGBA 5GONA 2FX2A 2QX4A 2W5UA 4EP1A 1WZIA 4RK6A 5JJCA 1I7SB 4JWKA 1OY1A 1J49A 1KFKB 1WOMA 1YNOA 2CMDA 2G4VA 1E3DA 1MB4A 2QT9A 3FKJA 2OVBA 3JSAA 4HAIA 1NKSA 4LAFA 3NBFA 1KR2A 5A7FA 3ZWPA 1G59A 4B09A 3FCUB 4MLDA 2VATA 3RHSA 1GZVA 1T3ZA 4IIGA 1CUYA 1KMMA 2QPLA 2YY6A 3K0SA 4UUNA 3G6WA 1PFUA 1PGNA 2BM0A 2JF0A 2VF7A 5L6MB 2DUMA 1B74A 2Q4DA 2BJVA 2OCYC 3TYXA 5A4JA 5EP4A 5DBIA 5KWEA 4IIYA 2NXJA 2ZW9A 2V3VA 1K6XA 3QVXA 1Z5UA 2VH1A 1P8AA 3FBWA 2GWRA 4X3OA 3WMFA 3E1SA 3RSHA 3A4MA 3FM9A 5I8WA 5MN4A 1FMLA 2X1LA 4DNPA 3ONFA 1O95A 3AC0A 3N3AC 4HEQA 4X9XA 5EXEA 3ROKA 4JB3A 1VZ3A 4PZCA 4GRDA 1RRPA 4RZXA 5FIUA 4BP3A 1JLHA 4RZHA 5CEFA 1M83A 3TR5A 3IAM6 4DR6B 5ALLA 3R3VA 3H83A 4X1KA 4BO1A 1A5BB 2WIBA 1J5EB 4N01A 3DQPA 4ITVA 2WDZA 3M6WA 1ATIA 4JI0B 2FN8A 4NBUA 1BKSB 2VTEA 5IAGA 1A82A 2P90A 2OXIA 4MRVA 4WX2B 4HFJA 1DFHA 1RTTA 1IXRC 1ZHHA 2VYNA 3I0MA 3A6GA 5DASA 4PTLA 2GD0A 3ZBUA 4E2WA 2PUCA 5LDDC 1M6HA 4PYIA 3BRWD 1SZCA 1JTFA 5BRNA 3AR5A 3KSZO 1E32A 3K6RA 4PIVA 3IE0A 3N6VA 2JLWA 1GD1O 3TF5A 3NCTA 3R4VA 5E7IA 3TB6A 3WWZA 2XZPA 5CRIA 1AKNA 1BDMA 3RAGA 4MIEA 3GCZA 4B2IA 4ZI3A 3NHFA 2VYCA 5ALTA 5ECYA 5AKHA 2GWHA 2RH5A 1EE9A 4K1XA 2B69A 1T3SA 2BVNA 4E51A 1IQPA 2G72A 3EXHB 5HGXA 1KTVA 1ZWLA 4IDFA 1RRVA 3KQYA 3R6LA 3DVSX 3K2BA 2BKEA 3MGGA 1L5GB 2P9EA 3DAGA 1C2TA 3A0RB 2QYHA 4G25A 1TMYA 4UFPA 4KE8A 5U4QA 2FDCA 3GK3A 5JG7A 4QQKA 5AI0A 3P5BA 2W2MA 1B3RA 1I33A 4FLFA 2QAJA 1KBZA 4UTZA 3EBPA 2FJUA 5EYPA 3DCIA 3NKLA 2DU8A 5BYBA 10MHA 2DH5A 1DC4A 2F3QA 1C7RA 1RVV1 1YGYA 2QVZX 1YVRA 1CY0A 3FYHA 1OF1A 2XGSA 4F1WA 3RFUA 1PKXA 1I2DA 1J7JA 4HRYA 3BG5A 1W34A 2YHUA 4KH1A 5K9ZA 4UVGA 4ZXFA 1S2IA 2IS4A 3EARA 4ZI7F 4C4ZA 5ALFA 1QHFA 1X0XA 3MERA 4DILA 1JLMA 3MUOA 4F9EA 1UKYA 2NSHA 1P61B 3IEUA 2N1BA 4G84A 1WUHS 2PBRA 1C2YA 4NCKA 1F2TB 3SAJA 1OGYA 1NE2A 3U7GA 1QV7A 4A7PA 4C4OA 5KNLA 4FFLA 3PXXA 1Q91A 2XQGA