1CR1A

Crystal structure of the helicase domain of the gene 4 protein of bacteriophage t7: complex with dttp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
277
structure length
245
Chain Sequence
MRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTGVVLVVICHLKTDLRGSGALRQLSDTIIALERNQLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA PRIMASE/HELICASE
publication title Crystal structure of the helicase domain from the replicative helicase-primase of bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transferase
total genus 78
structure length 245
sequence length 277
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1999-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03796 DnaB_C DnaB-like helicase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cr1A00
2YV5A 3EW9A 1P2SA 1DELA 2H18A 2CLDX 3FB4A 2QMEA 1OXXK 1COWA 3EIEA 1L4UA 4ACBA 4GBMA 3KZ1E 1GUAA 1GAJA 3THXB 4C0QC 1IXRC 1Z29A 4IFBA 1KK1A 4PR0A 5E3HA 4MYCA 4NYMR 2Z4SA 1KY3A 4A8JA 1QHGA 2OBLA 1W0JD 4KSBA 2CL7X 1YRAA 2ODNA 1FQKA 2QMHA 4OQLA 3RNLA 3V4FA 4ILEA 1TQDA 3GJ4A 4CIDA 3H2YA 1QF9A 5G3YA 4G5OA 3NC0C 4MUBA 2FZLA 3MWLA 3E2IA 4JL8A 1E9RA 2EVWX 1BIFA 2QAGC 3ONWA 3PEWA 1R5OA 3KQKA 3SJZA 4OHXA 1GRNA 3RLFA 2IT1A 4DCUA 5TB5A 1FZQA 4POAA 5BW8A 3KKPA 1YE8A 1N0UA 4NHOA 2ZSEA 4Z54A 5KSPA 2ZJ2A 4Q4AB 3EZFA 3FVQA 3RS7A 1P2UA 1TADA 2CMKA 5H1YA 2I1QA 2R8RA 4NCKA 1HUQA 1ZUHA 1N25A 1XTSA 2C95A 4NDZA 521PA 2F3RA 4GMDA 2PJRA 2XTZA 3IIJA 2GK7A 1Y3AA 2WWGA 4DLWA 4A2PA 2MMCA 3BFVA 4V0KA 5E95A 4HZUB 2V3CC 4Q1BA 4ZIRB 4BASA 4NYIQ 1G3RA 3QF4A 5CM9C 1KMQA 4Q5IA 4JVMA 1XEXA 4XH9B 1VYTA 2H16A 3CF0A 3DHWC 4FMCB 1RZ3A 3BGWA 3VQTA 3U4QA 5EE3A 4B3CA 4GOXA 5KDLA 4B34A 3AVYA 1EFUA 3SHWA 3SJBA 3SQXA 2PZFA 1DEKA 2WSSD 3GLFA 3VKGA 1GL6A 3SR0A 2O0JA 3B2EA 4JLAA 1H8HD 2QRNA 1ANKA 2G77B 1N0WA 4DLSA 3OZXA 2HF8A 3NBYC 5L3QA 4QG7A 2REBA 1Z0IA 2CEAA 1E9EA 1JECA 5TXGA 1P3JA 5DN6A 1W0KD 4FMBB 3VHXA 4D82A 2I3BA 2B92A 4XJXA 1P60A 1WE2A 2R62A 4QHSA 1A2BA 1NKSA 1XDBA 2AXNA 2F9MA 2REXB 1WBDA 1TPZA 3AV0B 2OHFA 2VH5R 3SYLA 1PLKA 4HATA 4DDWA 3WHLA 2YWGA 2GNOA 1K8RA 3GEEA 3QXXA 3KJHA 1IQPA 1TL7C 4PAOA 2DHRA 1CR2A 2ZU0C 1SVOA 2AD5A 3SBDA 1OT3A 1RYHA 5A4JA 1DAKA 4EDHA 2IS1A 5DGXA 1YZKA 1Z6TA 2HJVA 4MKIA 4URWR 2RGXA 1VG8A 1YVDA 3GFPA 3GEHA 3EC1A 4X8HA 3BJIC 1G4AE 3AVPA 5KU1A 4RZXA 3PV0A 3BERA 2QBYB 1XD2B 4PQFA 5E7MA 5A0FA 1NVVQ 3KKOA 4LI0A 2G1KA 3CBQA 4OL0A 2J1LA 3SS8A 3U7FB 1TMKA 1BYUA 4IXMA 1KI2A 5AJZA 3GP8A 4L5BA 4R2HA 5KOYA 2D06A 2QORA 3U7HB 3VR5A 1E79D 1W49A 4UNSA 3QUSA 3VR2A 1Z83A 1E2NA 2CJWA 4F92B 2GXAA 1XCPA 2FFQA 1OHHD 1XJCA 2F1JA 1FX0B 1P9WA 2E1RA 2CHGA 4B71A 2XZPA 2P0EA 5L8VA 4LC0A 3A37A 2QGNA 4Q1AA 4Q7MB 5DI3B 3SI7A 4LGMA 2EFHB 4M1SA 5EP1A 1NY6A 1PJRA 2A78A 3KB2A 2XXAA 1R0ZA 4LJAA 1PLJA 2GHIA 3FMOB 3KUCA 3GFTA 4OYHA 4K8OA 3ZS8A 3EWAA 3U2QA 3I8XA 4MKHA 3NDBB 3KJGA 4IEIA 4KYUA 1G41A 3Q72A 1Z22A 1G8HA 4PO9A 2I1VB 2D7CA 5LB4A 4Z51A 1KK2A 1QHHB 3QOFA 2V6IA 2ZS9A 4WVFA 3RSLA 2YWHA 5B57C 3TR5A 4DSUA 4HYYA 3VR4A 3QJYA 1R5NA 1AQUA 4KBGA 4NCHA 4XD7D 4IDHA 4PC7A 1U81A 4EPRA 2ZUDA 4OI4A 1CR4A 1K6MA 2QAGA 4Q7JB 1OYYA 1XEWX 2FE4A 3IPYA 4TQ9A 4P3YA 4AURA 3DMNA 1QHXA 2F55A 4HAYA 4GDFA 5K8UA 4JKIA 1Z07A 3A4NA 4MYUA 4Q9IA 2ZRLA 1TQ4A 4LYAA 4NMMA 4BFYA 1E2IA 2J0UA 2KJQA 2YHSA 3BORA 4I1SA 5F9HA 5DHFA 3ICEA 4JLOA 2DFKB 1W4RA 3GJ0A 2ANBA 3HJNA 4P32A 1NN0A 4HB3A 4TMWA 1W4AA 2ZRDA 1NI3A 3FHTA 2WOOA 1E2DA 1Z0KA 3RRZA 5GADl 1CJUC 1G3QA 1IOZA 4MYTA 1C9KA 1COWD 1G17A 4P4SB 5LDDC 2LCFA 4RD0A 4C2UA 2ZTSA 2Q9AA 3OIWA 1TEXA 1OPXA 2NPIA 3K0FA 4TQAA 3TH5A 2IEZA 1MABA 3AVQA 4D4LA 1NLFA 3LLUA 1GL9B 1CJVC 1EK0A 2OCYC 3Q85A 5EXSA 5J40A 5G41A 4KITB 3RS5A 4WZ6A 3LO5A 1CF4A 1IN5A 3LWNA 4Q47A 4AK9A 1DADA 3AP3A 1YKSA 2G88A 1U0HC 1ZUNB 2HT1A 2IF0A 1NG9A 4EFMA 4F38A 3AP1A 3JZAA 4QBHA 2DY1A 3V4RA 2IYUA 4B47A 1IM2A 5H68A 1JPNA 3DVLA 2HLDA 2WWFA 1DOAA 3CNNA 3GJ8A 2XJ4A 4FIDA 5EP4A 4EPVA 1L7VC 2J59A 1CLUA 1MKYA 2JIZA 1Z6GA 2YC2C 3DZ8A 3C41J 1XP8A 1KHTA 1EFCA 1IAQA 1KI6B 2B6HA 1XPUA 1NMZA 2XEXA 2J3EA 2UZIR 4DXAA 2AFIE 4UJ3A 3MJHA 3QKRB 2IS6A 4ZCMA 3SYNA 4DHEA 1JBKA 2BMDA 1G16A 4QM7A 2VEDA 2R44A 2ZRHA 3QXHA 4M9XA 1XRJA 4Z8XA 5KNCA 1F60A 3UPUA 1EXMA 5JJIA 2BHRA 2PBRA 4RZ2A 4DVGA 2GCPA 1VHLA 2G3YA 3QQ5A 3S1AA 1KZGB 4GT1A 5CJ2A 3DDCA 2YOGA 3EASA 3FYHA 4IDOA 1AM4D 2GESA 2FFAA 3I92A 2ATXA 3IGFA 2VRWA 1LF0A 5KHOC 2VTKA 3R8FA 1LW7A 1ZINA 1Q3TA 3AQ4A 4GP6A 4A9AA 3CR7A 2IXGA 4IDNA 3X1ZA 5JSZA 2ZEJA 4URVR 3U3MA 2OT3B 4C2TA 2V8OA 4FWIB 2F1RA 1M7GA 1W4CA 4PQYA 1GFIA 3UMFA 4Y0VA 4URXR 3IPXA 3AVUA 4UNRA 1IY0A 1XD8A 721PA 5KDDA 1KI4A 2MSEB 2ZQ5A 1OF1A 1NLZA 2PT7A 2FEOA 4MRNA 4AYWA 4IDPA 2RGBA 2QNRA 4Z1MD 1E4YA 1QHSA 3NH6A 1RJ9A 5JMTA 2IYYA 1IY2A 5EE5B 1N6NA 1PLLA 1WCV1 3AF1A 1GRQA 3F5FA 4D4JA 4URYR 4B6FA 2PCLA 3QE0A 4RKFA 2VPPA 4YDHB 3WYFA 1N6LA 2VSFA 4QHYA 4AKHA 2MMGA 3CWZA 1EFHA 2OESA 1W5TA 3IBYA 2WM9B 2ZR7A 4BEJA 2WWXA 3LA6A 2QY9A 3LLMA 2IWHA 3VNUA 1FMJA 1SXJD 4NE2A 4Q7KA 2FPKA 2V7QA 1II8A 1KSGA 3O8DA 2P6RA 2C96A 2ZRPA 4LJ5A 4QOSA 4QHTA 4RSGA 3TSZA 3N2EA 3FHCB 2HYDA 4WZAE 3MGCA 1S8FA 4OKSA 1U8YA 1S1CA 2OFOA 4AKEA 1AKEA 4DUGA 3QF4B 1NMXA 5GVRA 1W36D 1XEXB 2D62A 4NBSA 2WKPA 4JMPA 4URZR 4JT4A 3U4QB 3TVDA 1J7KA 1G291 2YOFA 3EPJA 4KV9A 4P33A 1DAHA 3KFXA 1T8UA 1AZTA 3UG6A 4CEJA 5JBQA 3GLFB 1DVRA 2WWYA 4C9BA 3W3AA 4Q9LA 4CW7A 2A3RA 3ZZTA 1NJFA 3RANA 1LB1B 1XJQA 5C4GB 4HI0E 3NKVA 1KO8A 5CB6A 3A1WA 3NDPA 1XEWY 3WRXC 8OHMA 2AR7A 3AKEA 4U00A 1O3YA 3CKLA 3TQFA 1KI9A 1VTKA 5FPYA 1F2UB 2R2AA 4TL8A 4DJTA 1FTNA 1Z08A 5KPDA 1AZSC 3ZD7A 1KI1A 2IS2A 4HZIA 1QZXA 1OXUA 3EARA 4A15A 4I1VA 5HZHA 5HE8A 1FNMA 4JJKA 4R71A 2RGNA 3U60B 2FPMA 3FMIA 1D9XA 4A6PA 1OXSC 1G64A 1N5LA 3K9NA 3Q7QA 1G8GA 3AVOA 2DB3A 5KYKA 1TAGA 1SXJB 3MLEA 5FR2A 1F6BA 3RS0A 3K0AA 3J81k 2WJIA 4F4IA 1W48A 1WMSA 2GWHA 4LDJA 5JLJA 3TGPA 3HU3A 1MRNA 2ZROA 3I4LA 2GEUA 3ZQ6A 4DKXA 4IFEA 1G20E 2ONKA 2C9OA 3FHOA 3GLHE 1E0SA 3GLIA 1Q21A 3LXXA 1KKMA 1W36B 2GBLC 2XX3A 3FE2A 4TYWA 1SVMA 2OFWA 3D7MA 3TRFA 4GZMA 3BB1A 3CNLA 1Z0AA 1IXSB 4R7ZA 4FMCF 1U9IC 4DDVA 4TYNA 4PHGA 5FTJA 3O8CA 2ZS8A 2CCKA 2F43B 3WNDA 4KFTA 2C8VA 3L8ZA 1XPOA 1ZC3A 1UAAA 1GITA 3K1JA 2BMFA 1EESA 2JLXA 3QBVA 2IXFA 2ZRIA 2QG6A 3ZZUA 1II9A 4E07A 3VU9A 3A36A 2ZRBA 5GJWC 5JI2E 1W4BA 2X2FA 2REOA 2XXAB 3BE4A 1OFTA 2FOLA 1G7TA 3DL0A 3NBXX 4LHXA 4KJZA 1XF9A 2HJGA 2DYKA 2QGZA 2WICA 3QVUA 4GPTA 1RIFA 1J2JA 1CS4C 3BWDD 1EG7A 3TBKA 5EJEA 3RHFA 2R6CA 4TSFD 3B6EA 4TWZA 4HUQA 1KKLA 3DOFA 5K8TA 1MR3F 4Q9KA 2HLDD 2ZIAA 3GFOA 3I5XA 4D25A 4WXPA 1S3GA 5AJYA 3GLGA 4FD2A 1LVGA 1RVDA 5JS8A 1TU4A 3I32A 1H8EA 4H9GA 3CPHA 4US0R 1SZPA 1FOEB 1ONBA 2OG2A 2TMKA 3W90A 4JIMA 2FJUA 4GP7A 1XNJA 4LYHA 2QAGB 1D2NA 4UXIA 2OFXA 3C5CA 2OUKA 1E96A 1XXHE 5JWHA 4OJQA 4A36A 1A1VA 2J45A 1G7RA 3WNCA 4LY6A 2FSIA 3SNHA 3UMRA 2PH1A 4LPSA 4X8LA 5H8WA 1FNNA 3B1VA 4M1WA 1KI8A 3X1WA 4BRWA 5HKKA 3KB1A 4EPTA 2ZRKA 1Z0FA 4N1AA 1ZW6A 4HB0A 1W2GA 1E2JA 1GKIA 2O52A 4XTRA 2WJVA 1HA3A 3CNOA 4F4JA 3N70A 1Q1EA 1N6KA 5CIQA 5EUMA 2X2EA 1PUIA 2ODEA 5LPNA 4OQMA 3TR0A 2BKEA 2OM2A 2QT0A 2GEDA 4UNNA 4ZDJA 1CJTC 4GOJA 3MAAC 4O3MA 3IO5A 1XFAA 3ZYCA 5HPYB 5G40A 5JRJA 4DDUA 3KQLA 2WWIA 2ZRFA 1DE0A 4W9MC 1OV4A 2ZR0A 3CONA 3JZMA 4ZV4A 1FUUA 4F4CA 2JAQA 4A0FA 1C1YA 2Q9CA 2ZPTX 2X77A 1TF7A 2PCJA 3OEED 1J90A 4NPHA 5EXTA 1Q1QA 3U7EB 2JATA 1GTVA 2DWQA 1NN1A 2AX4A 2FF7A 2VP2A 4ZCLA 4OBEA 2CLSA 4C0JA 5EXPA 2J7PD 4TL6A 3RAPR 5C4MA 3PEVA 5AJVB 3IQWA 2XZOA 4PSKA 2WIAA 1HURA 4I99A 1MH1A 3T15A 2CLCX 1JAHA 1FUKA 1D8TA 2YWFA 3OIYA 5BN3A 1G5RA 3LV8A 3LH5A 4M1KA 3P4XA 2JLRA 2WVJA 2ZI4A 1JJ7A 5DISB 2ORWA 4RY2A 5AR1A 4CZ2A 1UJ2A 4MGIR 2W58A 4M2LA 1ZCAA 2YJTD 4A92A 3OEHD 4TMZA 1RRGA 3HR8A 4R2IA 1MO5A 3ZIAA 5AJWA 2FZ4A 3QPUA 2PEYA 1JEDA 1I4TD 2ORVA 1X1RA 2NZ8A 1X8LA 1DAEA 3S1AB 3MCAA 1SVLA 4ZI3A 1US8A 5JCPA 1JNYA 4Z8YA 4D0GA 3KXLA 1CR1A 1VIAA 1RYFA 3LAWA 1JXOA 5J4LA 2O8CB 1JR6A 3PEUA 4DSOA 1YHNA 2JASA 5JSZB 1YR6A 4M9SA 4M1OA 3FFBA 2XSZA 1SKYB 3CIOA 5FPSA 2ZI9A 2MSCB 2FPLA 4F93B 1GKYA 2GBLA 4LJYA 1OB5A 2CL6X 1RPZA 3UMSA 1XCMA 3K0EA 5BN4A 1M74A 1U9IA 2PX0A 2RCNA 5D3MA 3UANA 4B43A 4YMTA 3TKLA 1N0VC 1SVSA 3UIEA 3KKQA 3LNCA 1RRPA 1R8SA 2BDTA 2IYLD 3RYTC 4YXWD 3QY0A 5GJCA 3T1VA 2EYQA 4A2WA 2XGJA 2OAQ1 4KU4A 3T5GA 1MOZA 2ZITA 3HWSA 1VIYA 1HEIA 5CK4A 5DO9A 1BMFA 5BYKA 3QEJA 2ZETA 2C2HA 3CRRA 5EE0A 3CLVA 1ZNXA 4LOAA 3G82C 3U3OA 2BWJA 1E99A 2G1JA 5CLQA 2BOVA 1Z63A 1OIWA 3LY5A 1J70A 5C1BA 4Q4LA 3K70C 2W83A 3Q5EA 1GNRA 1EX6A 2QZ4A 5P21A 1VG1A 3DMDA 3TUZC 3E70C 1N6HA 4LWZA 1OFIA 4GMXA 2IF2A 2ZSDA 3CH5A 5B58C 2ATVA 4JLNA 4JVSB 3AKDA 5KUTA 5LD2C 2VYFA 1HE8B 2QTHA 2ZAOA 3AVWA 2P5TB 4N3NA 2C9YA 2YVUA 3FGNA 4QC2A 4LJ9A 3A1SA 3KXIA 2Q21A 4CEJB 3OFNA 1WQ1R 2OZEA 1HQYE 2NIPA 3EZ9A 1UBEA 621PA 1JR3A 1L2TA 5SZIA 1KSHA 2DPXA 3JVVA 4YMWA 2KI5A 1VCNA 2PT5A 3ASZA 1I2DA 4M53A 4PQRA 1CRPA 4MGYR 4B35A 2OCBA 4KODA 4LYFA 4LUCA 5L3SB 4MITA 5FFMA 3AH8A 1VCIA 2FG5A 1CR0A 3CWQA 2GZAA 4D4MA 3P32A 1E1QA 1HYQA 4MDEA 5FBQB 2AL7A 4D0NA 5HCNA 1DPFA 2JJ2A 4W5HA 3U44A 2VP9A 5KSOA 4RFSA 2QPOA 4XWOA 5IDVA 2G6BA 2Z6VA 4CT5A 2PMKA 1H8ED 4IVPA 1JAIA 5LBIA 4IVRA 1Z3IX 5JECA 5FUWA 2IBMA 1G18A 3W8RA 2ZSBA 4AG6A 3THWB 3KFVA 2BBSA 2AN9A 3EIHA 1OE0A 2AWNA 4ACAA 3UKDA 5AJXA 2QRZA 4PC3A 2CE2X 1ELOA 4ZKDA 3OAAA 3SU8A 2LWIA 1AGPA 2IWRA 4YMUA 4CYMA 1GVNB 1W1WA 1U8AA 4MYHA 4DLUA 3Q8XB 2QROA 4AKGA 2NO0A 1Q1BA 1GKUB 4BFWA 3GLIB 2ASEA 4KVAA 4J0QA 3TNFA 1AA9A 4NL4H 5HKKD 3U7GA 1GDDA 3B82A 2VHQA 3FPAA 5HTKA 3QIAA 3I3SR 5KTYA 2BBWA 1OYWA 1P73A 1TX4B 2FGKA 1AK2A 1GP2A 2WAXA 2W00A 1LF5A 1HT2E 1BO6A 3VU9B 1IY1A 2IUTA 2NPFA 1ZNZA 4DIDA 4AKIA 2X1VA 3NC1C 3DZDA 5B30A 4LV6A 3ADDA 3RRYA 4RD1A 2PMDA 4QGGA 2QL6A 2HV8A 2I4IA 5DYIA 1UKZA 4KVGA 1JPJA 3RABA 4ZDKA 1JQLB 3QG5A 2RHDA 1CJMA 3P20A 3G5UA 4A4DA 1D5CA 2ANCA 4HUQB 4HLUC 4YDSA 2VA8A 3CR8A 3IO3A 3GLGB 3MJRA 1UKEA 2QPAA 5GVSA 2FDCA 2A5FA 3E1SA 1G8PA 3JVUA 4GSYA 4NZYA 4QGFA 2JDIA 3PUZA 3X1YA 2GJAA 4JYCA 1YZLA 2O8DB 4UXJA 4WAUA 3UWOA 4EQ6A 2A30A 5HE9A 4Q7LA 1R0WA 3BXZA 5H70A 4AY2A 1BYIA 2QN6A 1Q22A 5FPHA 1CTQA 4DSNA 4QRHA 1KJYA 5FH9A 4M1TA 2PEZA 2JLQA 3CPJB 4Q48A 4Q1FA 3QKTA 4MRPA 1M7HA 2VLIA 3DM5A 3K9GA 4PX9A 5KNDA 2IYSA 2R6GA 1M8PA 2E87A 4P31A 3W3ZB 4DB2A 2AK3A 4M22A 1AJEA 1WXQA 1GSIA 3EPKA 2UKDA 4IEEA 1JR3E 4RJLA 3EPHA 1P5ZB 1YZGA 1GM5A 5D3QA 4NYJR 1A82A 1N5KA 1TQ6A 2BV3A 4D0LB 2RMKA 1KNQA 4G1UC 1ZRHA 1ZBDA 1R7RA 2FFHA 4B3XA 2J0SA 2QMUA 2PL3A 2CHQA 3ZS9A 1IJEA 2GZDA 4HAZA 2GF9A 2QE7D 4TMVA 1X3SA 1YRBA 2V4ZA 3U6BA 2QENA 4Q4HB 3R20A 4A1FA 1R2QA 2HDNB 1E9FA 2EU8A 4GI7A 3IIKA 3KKMA 4PAQA 1D6JA 2BIFA 3VX4A 2ZUBA 1P9RA 2O0HA 3CRMA 3QNUA 4W7SA 1OIXA 4HAXA 3L43A 3N2IA 1E2EA 4KAXA 1VMAA 1Y63A 1RE0A 2OV2A 4LHZA 3ND8A 1IJFA 1R6BX 4N0DA 5FI1B 4JZKA 4P4UA 1NRJB 1W44A 1BMFD 2C03A 4DLRA 4C7OA 1UF9A 3W6OA 5DYGA 2JLSA 2BC9A 5FL7A 2ODWA 2XTMA 2CXXA 5M04A 2W0SA 2FX3A 3BB4A 1E9DA 4EUNA 1XCGB 1KK3A 4LJ4A 4KO8A 3H1TA 3M1IA 2W6JA 1TU3A 3EIQA 3GJ3A 2R6AA 2NO9A 3EG5A 3RDPA 3PXGA 1GOTA 1HQCA 3SDZA 1ZU4A 2RGNC 1KYIA 4FI3C 4ZDIA 4Q19A 1X8JA 4DIEA 2HCJB 4NCJA 1PZNA 2YINC 4M4SA 4LHYA 2DFLA 4DC9A 1US8B 4LV5B 4F91B 2EFDB 4G3XA 3ZD6A 3T61A 2WPDA 5IHPA 1TQ2A 1XJ0A 3PUXA 3TIFA 1TUEA 3GJ7A 5SZHB 4JJZA 4PHFA 2IX3A 4UNPA 4DEXA 3OFND 4BPBA 4GRAA 3KTAB 5IF9A 5AWFC 1HV8A 2P5SA 5FOVA 4RZ3A 3SE0A 3TUIC 3P27A 3KKNA 3QXJA 4QBFA 4TTRA 3LRPA 2O8EB 3I72A 3TSOA 2HYIC 1N5IA 1P2TA 2C9CA 5JWOA 1DG1G 2C04A 2NG1A 4LBWA 3K09C 4ASUA 5JI3E 3CW2A 5FUYA 5KSZA 1S0UA 1QVAA 3DKVA 3LQQA 4H1VA 1XTKA 2Q0HA 3Q7PA 4MGKR 4QKQA 5K8LA 3LX8A 1KO1A 2FFBA 2WZQA 2VSXA 1U94A 3ZJYA 5TY0A 2ZI3A 2JJ2D 4CRWB 1N6IA 1K5DA 1F2TA 2KB0A 2CK3A 4DB4A 2OCAA 4LCBA 3Q3JB 3GLHA 1LV7A 5AK0A 4LJ7A 5UKDA 1L4YA 1LS6A 1G8YA 2BMEA 5SZJA 1T3LA 3LD9A 4OQFA 3ZGXA 3SHFA 2VP5A 3A8TA 3V00A 3LBIA 3IBGA 3W5IA 2FU5C 2ORIA 3OE7A 4A8JB 2MSDB 2Z5FA 4HLUA 3DO6A 1VDZA 3OAAD 5DN6D 1FW6A 2GZHA 5CJPA 1II0A 4M1YA 4JLJA 4NYJQ 2XB4A 1T8TA 1UDWA 2CCJA 1EGAA 3BH0A 4PHHA 1JJVA 1P72A 2RGDA 1AGRA 1KNXA 1NBMA 2IHYA 5FOSA 3T34A 1JEEA 2J46A 4CEIA 2FSGA 1N6OA 3GD7A 4A82A 2RH5A 3AUXA 1J8MF 2F1IA 1GNQA 4QL3A 1UM8A 3F3YA 3PQCA 1X8KA 4JYBA 3B1XA 2Q3HA 4M21A 4TT3A 5F2EA 1E3MA 821PA 4KI0A 1A4RA 4YC7A 2OILA 3PVSA 2H57A 4JL6A 4PZLA 2NOAA 4OHYA 2P6UA 3RC8A 3TW4A 1GRRA 4Q02A 1QG2A 5FUXA 2ZUCA 5IK2A 2ZSFA 4CT4B 3MFYA 1MRSA 1GZSA 4I4LA 2HXSA 3THYA 1DARA 1SQ5A 5FTMA 1DG3A 1ESNA 3QPVA 5DE3A 1ZCBA 1UPTA 1Z06A 4U5XA 4CEHA 1SVKA 2IYVA 2VHTA 3IDQA 4V0OA 4LHWA 4MKFA 2D2FA 4I1OA 4V0NA 1XXHA 2GAOA 4K81B 3ADBA 3EWSA 3BFKA 3MWKA 1EFRA 4V0ME 2GKSA 4OI0A 4I81A 2DFNA 2JLWA 1ODFA 6Q21A 4BEBA 2PZGA 4MRSA 3LDAA 1H65A 2ZI5A 3WRYC 4TYQA 1SKQA 5IT5A 4C3ZA 1E69A 2FA9A 4UNQA 4XTCS 1YZNA 2WWWA 2CVHA 1NVUQ 3ND9A 1QBKC 3QEOA 5L3QB 3I5YA 2E9SA 3BB3A 1CRQA 4TLBA 4O0MA 4QM6A 3L2OB 2L0XA 2Z0MA 4MRRA 3I8SA 1ZM9A 1U90A 5AUPB 4CGZA 4HSEA 4A2QA 3EA0A 2R9VA 1XU4A 2IYRA 3KXKA 1G3MA 2D74A 2QMOA 1KY2A 4JT2A 1SVIA 2QI9C 3MWYW 4AD8A 2IEYA 1NJGA 3K70D 4JLVA 4B32A 1Q44A 1RW4A 2QQ0A 4WIAA 3WBKA 2WSMA 4DT1A 1MV5A 1S96A 1IBRA 2XNDA 2PJZA 2ZYWX 1TF5A 3LVQE 1E9CA 2RGGA 4TQUS 3AEZA 3NH9A 2AXPA 3WMGA 4HZUA 1ZYUA 3NEJA 4ZIRA 3EAQA 4PTLA 5BXQC 3WP0A 2GVDC 5TVKA 3TQCA 2XB2A 3A6PC 2QSYA 4DCTA 2EQBA 2P67A 2LKDA 1YZTA 2ERYA 3LVRE 1E4VA 4HAUA 5CYOA 2N1BA 4DCVA 2A9KA 4EPWA 2WTUA 4LBZA 2YOHA 4AG5A 2F7SA 2WIBA 2WJGA 3IILA 3BBPA 5AUNB 1SHZA 4GFDA 3WMEA 2WMNB 2XNSA 1CBUA 2CJWB 4PPGA 5BN5A 3FMPB 1T5IA 2B8WA 3K09A 1GNPA 4L15A 2W2XA 1G8FA 1U2RA 3WHKA 3B1ZA 1VHTA 2KBFA 3AKCA 3K9HA 4E09A 4KLNA 1CIPA 2AWOA 3OHMA 4DCSA 1YQTA 1X6VA 3B60A 1PUJA 1ZAKA 4HB2A 2FN4A 1NBME 4A0RA 1T91A 4AI6A 1KDRA 1LS1A 2WOJA 3L0SA 1CU1A 2AKAB 1NVWQ 2W6JD 2RB4A 1KTVA 2GCOA 3U3KA 3NBZC 2ZVPX 3D31A 4TLCA 4C30A 2WJHA 2ZE6A 1B23P 1OH8A 2OO7A 3AB3A 3GCGA 4EFNA 1KDPA 1V43A 4HLCA 1S9HA 5C46F 1YZQA 1UKYA 1UADA 1Z5ZA 3K70B 2WPDD 2O0KA 2JIZD 1T5LA 1E1RA 1XD2A 4ABYA 5TDHA 4ARZA 3BAFA 1NLYA 2IUUA 2C77A 1N6PA 4M8NE 4BUJA 4TLEA 1G21E 1G3UA 1KDTA 1V5WA 3PITA 3TE6A 3D8BA 1G5PA 3UK6A 2EFCB 4TMXA 1ZD1A 3RWOA 4AIIA 3FFAA 3GQBA 5FL3A 1XWIA 4FINA 5LD2B 5DNYB 4JVNA 2H1LA 1L8QA 5DLQC 4L9SA 4PZYA 3NBFA 3B5JA 4ASUD 3T06B 4EPYA 2BEJA 3VR3A 1ZIOA 2W6IA 4Y0AA 2J0UB 4F7WA 3BIFA 1BH2A 3OIUA 3IEUA 3K9LA 1H8HA 1XTRA 1YR8A 5DI3A 3T1TA 2QA5A 1AIPA 1OH7A 5BQ5A 4ZI2A 3SEAA 2ZREA 4KLZA 1P4SA 2V9PA 3ECCA 3OESA 2DR3A 2VQSA 5A5GA 4C7OB 1FP6A 3CRW1 3HYRA 4CVNA 5CB8A 4W5JA 4O25A 1J8YF 3RS3A 1BKDR 1SVWA 3R7WA 1CEEA 3EPLA 4JBXA 1KI3A 3V9PA 3K0FB 1MABB 3PENA 1YZUA 2UZ3A 4B33A 3OE7D 4L8GA 2ZYTX 4ZPXA 1QHHA 1XD9A 3U3JA 3QKSA 4ITRC 4QBGB 2P65A 2Y8EA 2ZRJA 4WOPA 4MH0R 3F8TA 2VBCA 2RGAA 1ZMXA 4YQFA 1O87A 3CZPA 4YONB 3WMFA 1SULA 4Q4JA 3MD0A 3AVXA 1IN7A 2GTPA 3CH4B 1JQJC 1Z2AA 2EFEB 3P4YA 3EXAA 3NHBA 1WB9A 4EKDA 4DSTA 1NSTA 2IL1A 2YYZA 3B13B 1E2GA 1W2HA 4BFXA 2VO1A 4TT3D 1M2OB 1ZD8A 5DI9A 1A7JA 1UEIA 5J4HA 3C14C 3R9WA 4B48A 1TEVA 3QXCA 4OHVA 5EQTA 4BECA 2GA8A 1KO5A 2O8BA 2R65A 2KSQA 1LNZA 2GXSA 2VIIA 4PC2A 5JJLA 1Q3HA 2V7QD 3CRQA 4Q03A 4GL2A 1E79A 5IK2D 4KXFB 2D3WA 2PLFA 3ADKA 3DM9B 4LRWA 1GWNA 2C5LA 2GJ8A 1WP9A 4B3FX 3Q5DA 5KO2A 4LBYA 1IN8A 4L16A 4DUGD 2XITA 3IHLA 3VTKA 3ICQB 1IHUA 3U6KA 5FR1A 5DHAA 1IONA 4DEYA 1XMJA 5J5CA 1JALA 3B8HA 3UATA 1EFRD 3VNVA 1F2TB 2IYWA 4V02A 4PC1A 5JEEA 2CNWA 3GLHB 1W46A 1EFTA 4LX0A 3KUDA 3KQHA 2AHOA 3SYKA 3ZVLA 4BQSA 2CE7A 2H17A 2YKGA 1E2LA 1Q12A 2HT6A 4BLRA 1DAGA 4II7A 2VP4A 2FSHA 4RD2A 1OLOA 2GJSA 1SXJC 2BMJA 4EPXA 2CL0X 3C8UA 2VF8A 5CK5A 2IK8A 3DOEA 4O2RA 4TZ0A 3H0KA 4ZO4A 2ZJOA 4MA4A 1G6HA 2WHXA 1RJ9B 1BOFA 3RRMA 1DTSA 1MT0A 2GK6A 3EC2A 4UJ5A 5DSZA 1Q0UA 2X19A 3ZH9B 3WYAA 1G5TA 4B2PA 4CEIB 4LZZA 3U3RA 1GL7A 4IOMA 5FBWB 1I4DD 1ZM7A 3CX8A 4CDGA 2QP4A 1W36C 4P4TA 3THOA 4E03A 3R9XA 1DAIA 1QRAA 1XBTA 2ECKA 3FKSA 2CCGA 3MMPA 4OHWA 3FOZA 4XWAA 2WKQA 3IHWA 2DFTA 1E9AA 3P26A 1XTJA 1NY5A 4PSAA 5HZKA 2QTFA 2GDJA 3AF4A 3ZZ0A 4D80A 1HT1E 2B8TA 1II8B 4IRUB 1G6OA 1NG1A 1EWQA 2ZJ5A 4B6EA 3PFIA 3N5CA 3PEYA 2QTVB 5KNBA 4XVQA 3SOPA 3TSWA 2IHBA 3G0HA 1KJWA 3LBNA 4CEHB 2ZI6A 1GG2A 3SZRA 2OLKA 5CDFE 2ZJBA 3NWJA 3GPLA 1N6RA 1Z0DA 3Q9LA 1WDTA 2BEKA 4Q00A 2OEPA 3CPEA 1XXHB 5HCIA 5LB2A 3W6NA 2QPTA 5JHHB 1ZNYA 1KO7A 1XZPA 3SC3A 2YWEA 2V1XA 3B7GA 4AWXA 3TLXA 2EWWA 1OXTA 2DWOA 5TARA 3FKQA 3K0CC 5FBRB 5EP2A 3ZVRA 2FEMA 4KFSA 4NU0A 3D3QA 3QVVA 1E9BA 4Q21A 2W2VA 2O8FA 4IDQA 4X8MA 2AK2A 4HAVA 2B7BA 1Z2CA 1DO2A 4B2LA 3ADCA 1CJKC 1AS0A 1GILA 4G0NA 4HLQB 4QJ5A 5GJVC 4MKGA 4KSCA 1R5BA 2WKRA 1ETUA 2J5XA 2RAPA 3O8BA 1NVXQ 4JLDA 1A5TA 2VP0A 4Q1CA 3NXSA 1OIVA 1R8QA 2Q9BA 1AQYA 2IXEA 4YMSA 1E1RD 4DT1B 4OK5A 3BS4A 1OH5A 5IRCD 1W5SA 121PA 5J4VA 3TAHA 2G83A 2IA5A 3X2SA 2KE5A 1NMYA 2LKCA 4JBYA 4UXHA 1NF3A 3T5DA 5J47A 1XPRA 4IOLA 5JHGB 3K0AB 3LW7A 2SHKA 1M1YE 1NKTA 3TVTA 2OSBA 5JS7A 5FOWA 2BBOA 1E94E 4PPNA 1U98A 4KFUA 4G5SA 1XTIA 1WF3A 1UDXA 1W47A 2W6ID 4M1MA 1E2HA 2F6RA 3M0EA 4M9ZA 4RD3A 4DLYA 2FSFA 2RGCA 2J41A 3GJ6A 3O8RA 3BD9A 1D2EA 2GVZC 3WBJA 1VCMA 3C16C 4PANA 4C0SA 4GNKA 5G3ZA 4LV8B 2RKOA 4BLPA 2Q3FA 1PV4A 3REGA 3FDIA 3U5ZB 3I62A 1SGWA 1WBBA 2XAUA 2NTYC 3NTUA 4EJSC 4TYYA 1ZD9A 1OKKA 3L8YA 4Z1MA 1NSFA 2ZVQX 3ASYA 3RS2A 2GF0A 3IKJA 2N46A 4TTPA 1F2UA 1I2MA 3C15C 1QHYA 4PO1A 2FGJA 3RRNA 1Z28A 3CO5A 4U7DA 2WV9A 3FMFA 3TW8B 3B1YA 1VECA 3EA5A 1NP6A 1YJ5A 4BE7B 2FMXA 2ZRCA 4RFVA 4PC6A 3M6AA 4QBIA 2CDNA 1VCOA 2GCOB 1OFUX 4LSGA 3VR1A 2H92A 4HDOB 4ZDWA 1MO4A 3F0TA 4RCZA 5FUVA 2EYUA 4IKEA 1ZUIA 2AKYA 2XOKA 4JKYA 3H4MA 4NCNA 1SXJA 1VKJA 4W5WA 1OJLA 2VHUA 3A1VA 3REFA 5GJBA 1ZNWA 1M6NA 2QEQA 4ARZB 2FWRA 1DAFA 2ZU6A 4Q18A 1KSJA 5KDOA 1RRCA 4D26A 1NL3A 4IJMA 3IIMA 4FMDF 1E2KA 2IW3A 3QENA 4LYJA 1Z6YA 1OFHA 2DCUA 2ZRAA 3SN6A 4BLQA 5JZVA 2NQ2C 3PJRA 4NYMQ 2BM1A 3BFXA 3EZ7A 2BVNA 3ZIAD 2F43A 2OBNA 4ESHA 1KJZA 4A0GA 2HEIA 3AKYA 5EUQB 1ZM2A 4DZZA 3KX2A 2DBYA 1KMHA 2HF9A 1ZM4A 2WJYA 2XZLA 4R9UC 2ONJA 5F9FA 5E7JA 4B3GA 1XTQA 5E7IA 3QF7A 4TZ6A 2NZJA 2CNWD 2EW1A 2VL7A 1E2PA 2QQEA 4LC1A 4B44A 2XSZD 3OF5A 1N3BA 1CP2A 4A0HA 4B74A 3HU2A 1E0AA 3UG7A 5DIFA 3NEYA 3R7WB 3WP1B 4IXNA 1AS2A 2R6DA 3A58B 3KQNA 2RGEA 2OXRA 4PO8A 4E22A 2ZRGA 4BLOA 3CUEF 2YC4C 3W5JA 4GOKA 2HXYA 2ZRMA 3QKSB 3VFDA 2H7VA 2GILA 1TTTA 2H5EA 3K0CA 1Z0JA 4PPFA 4P0TA 2RHMA 4AYTA 5C18A 5L3VA 1XZQA 4IOJA 3ZDQA 4Q4JB 2BKUA 1VYUA 4M0LA 3L0OA 4HEJA 1OW3B 3CX6A 2JA1A 4C4PA 4NKRA 3UXMA 3T12A 1XB2A 3L0IB 1NNEA 2VSOA 2JLUA 2V1UA 2BJVA 2OAP1 3FKSD 5CM8B 2Q3MA 3B78A 5E4FA 4G5QA 4JBWA 5JRZA 1E2MA 3I73A 5JFGA 3CF6R 1FQJA 4DCNA 1Z8FA 4RKEA 3B9QA 4JSTA 2O8BB 4V0MA 1NIPA 5KSYA 4URUR 4LPKA 2ZE5A 4RD6A 1M7BA 3QKUA 3ZLJA 3AUYA 5EP3A 4DRZA 3GLFE 4Q9HA 4US2R 2IYXA 1JXMA 4Q01A 1KIMA 3C4JA 1DS6A 3TMKA 3AP2A 1QG4A 5EZ6B 3A4LA 4RZUA 2Z43A 2OLJA 4BFVA 4DLXA 5K8IA 2F9LA 1P9NA 2B7CA 1FTSA 2A5GA 3GEIA 4BZPA 2WBLC 1X1SA 4FW9A 4XSGA 2OXCA 1T3HA 3M4YA 2IS4A 2NO7A 4S2EA 4TTQA 4WXRA 2GXUA 3LQRA 1JR3D 1WRBA 2ZRNA 2PZEA 4AC9A 2YZ2A 3HU1A 1U0JA 4TSFA 1IN6A 4Q1EA 2V55B 4B75A 1C4OA 3B85A 4KCGA 5D3MB 2QU8A 5BWMA 4Q1DA 5TMPA 1HH4A 1R0XA 4EJSA 1JI0A 1SXJE 4OJKA 2WWHA 1FP7A 1E1QD 5AUOB 3D6TB 4L9WA 4IW3B 4X8OA 3H84A 3LW8A 1RFLA 4TN1A 1G4UR 3QBTA 1Z6AA 2A5YB 3VKWA 4AYXA 2JJ8A 4BZXA 1E2QA 4TYPA 5FOTA 1BS1A 1UKVY 1UFQA 4JLBA 2BCGY 1YR7A 3CB4A 1KGDA 2EFGA 2YNMA 4RVCA 1E32A 2JEOA 2QUZA 1S3SA 3HPQA 4TMKA 3SQWA 5HR5A 3X1XA 1P7CA 1WA5A 1U0LA 1J99A 1XMVA 1UBGA 2BCJQ 3CRVA 4ZKEA 2AFHE 3RC3A 4BLTA 2JLZA 2QP9X 4G01B 2O8CA 3HP1A 5ANRB 3WNBA 1QHIA 3B9PA 2QM7A 3EZ2A 2GETA 1NN5A 3VHLB 4PZZA 4B76A 3T1OA 2A5JA 3DPUA 2J87A 3LFUA 4K46A 4C0KA 1G7CA 4ZCIA 4UQOA 4ESVA 1G7SA 2G9NA 1CULC 3W8NA 4XVUA 3NIBA 3AF3A 3VX3A 3BRWD 1OKKD 4DLTA 3EX7C 1ZIPA 2ZJYA 1S4QA 1AS3A 4TLAA 1RRFA 2J0QA 3MRSA 2V6JA 4MGZR 5FBLB 2ZI7A 2VF7A 4C0LA 2O8FB 1UEJA 3IUYA 1ZP6A 2ZS7A 3OEEA 4NH0A 1R10A 2ZR9A 2ZJAA 4IOKA 4PPQA 4XVRA 4DLVA 1JB1A 1QDEA 1S9DA 1T6NA 4WBSA 3PUVA 3R8CA 4B2IA 4KYIB 2J7PA 2O5VA 1W7AA 3THXA 1MO6A 1I4LD 4QGAA 2BM0A 4N0EA 3IEVA 2XOKD 1DAMA 4HAWA 1OXVA 2J0VA 3U44B 1P61B 1UBCA 4RFSB 4RCYA 3VAAA 4JLPA 4QXAA 1M34E 2C98A 4PAMA 3KJIA 4R98A 4XIGS 3W6PA 2NMVA 2JDID 3CF2A 1AKYA 4MDFA 2C78A 1E6CA 2IUSA 5FPKA 4HB4A 3OEHA 4XWKA 2HUPA 1S2MA 2IYTA 1VPLA 1VG9B 5FOXA 3E5HA 4V03A 1KDOA 1NN3A 2F3TA 2GEVA 4OQNA 5JWRA 2VHJA 1U8ZA 1HE1C 2VP6A 1E2FA 3PUYA 3RWMB 5FPTA 3K53A 4MRVA 2OCPA 4NCIA 4G5GA 4NONA 3KL4A 3BOSA 2A7QA 1KO4A 4HDCA 5L3RA 1G3IA 3MSXA 1CXZA 1QVRA 4LK2A 3AGPA 4ERNA 1FFHA 2H8KA 2ZAMA 3NHAA 1XEFA 3SJAA 4QGHA 5FTLA 2JLVA 1G19A 1XMIA 4OQXA 3DEFA 3PCRB 4Q4AA 2A2ZA 4B3BA 4OK6A 1S1MA 1XX6A 3NVAA 4LHVA 3QI2A 2GJKA 1ZVQA 4TL7A 2ZM5A 4CF7A 1G9XA 1P75A 4JVLA 5B2ZA 2D7DA 1KSFX 4FMDB 4UKDA 2JJ1A 1YR9A 2V54A 5L3SA 1DBSA 1P2VA 3CM0A 1T3SA 1LTQA 3OIVA 4YLGA 3TAUA 1TF2A 3HDTA 1G1MA 1KK0A 4HDQB 3TUJC 3WXMA 5G53C 4PSVA 5DH9A 2C99A 4YXWA 2BBTA 1ZU5A 4KFRA 5SZKB 3EZ6A 5FBVB 4LBVA 5JJKA 1E0JA 4QFMA 2ZSAA 4EIWA 2P2LA 2IC5A 2JGNA 1F3OA 4JLMA 5AUQA 1Q57A 4QJ4A 3K0SA 1KAGA 1B0UA 5EE9A 2Z83A 1D9ZA 1UBFA 3THWA 1OSNA 3FTQA 1TUIA 4O2LA 3SFZA 3X1DA 221PA 1P62B 3BH6A 2VHCA 1RKBA 3KDSE 4WW0A 4BWYA 4C0AC 1W0JA 3W9YA 2UVQA 1LFDB 4TL9A 3R9IA 3LBHA 1PVOA 3RVBA 4GZLA 4KBFA 5FL7D 4IVQA 1Q20A 2D4HA 5ELXA 3NG1A 3PIRA 4BFUA 1N2CE 1Z6XA 2P3SA 2AD1A 4DWJA 4US1R 4XSHA 1SKYE 4EQ6B 2GAAA 2R6FA 4NP6A 3I1FA 3KQUA 3BC1A 1Q1ZA 5F98A 3L82B 4HLDA 2Z4RA 3CZQA 1R4AA 4C0BA 5CITA 4RD4A 1XMSA 2GXQA 4I1UA 4QNMA 4BLSA 3MUFA 1A2KC 1Z47A 2J7KA 1KMHB 1MO3A 5B64A 3AM1A 5CIWA 1ESMA 2QBYA 2CBZA 3UWKA 4TMTA 4PFSA 4QNRA 3RS4A 2G0TA 2G0NA 4BZQA 4FWTA 4EFLA 2CHVA 1HTWA 2ZJ8A 1N5JA 3T35A 3WYGA 1FL9A 4D81A 4H1UA 1K5GA 5JCZA 1OH6A 1E98A 3GMTA 4QJ3A 2ZJZA 1FPMA 2FNAA 2B21A 3LXRA 3VR6A 2HCBA 5J4KA 4A8JC 3P1JA 4EAQA 1FX0A 2WSSA 1D2MA 4JLKA 4B73A 4BFTA 3A4MA 2KWIA 2O8DA 3K8YA 3HR7A 1KOFA 2ODBA 2CVFA 3AF0A 2NO6A 4D4KA 3A1UA 2CK3D 2FH5B 3B1WA 2OBMA 2GCNA 2QSZA 3GJXC 4Q9JA 5CDFA 3VMFA 2WJJA 3U61B 3C7KA 4MUAA 1W0KA 4PXAA 1F5NA 4G5RA 2ZYVX 3SJCA 3QSYA 2WMOB 3ETLA 4WZBE 2GJ9A 1U99A 4FN5A 3RSOA 3IQXA 1HY3A 4WA7A 2N42A 1ZJ6A 1ZC4A 3PR1A 5F3WB 2OE2A 1TNDA 2JLYA 3QPWA 2ERXA 5CLLA 4A6XA 3GJ5A 2W2TA 1NBMD 1OB2A 4DDTA 3TJZA 1IN4A 5J4YA 4V0LA 4M9QA 4OI2A 5JEDA 4JSYA 2QP3A 1EWRA 4FCVA 4OK3A 3C5HA 4FCTA 1VG0B 5CYPA 2PX3A 2J9RA 3ZVNA 4DLZA 3AF2A 3QG1A 1E0KA 2ZYUX 1DO0A 4D6PA 1IXZA 2ZE7A 3AGQA 3BK7A 4Q4HA 1ZM3A 3CX7A 1T0HB 3T1QA 2ZANA 1NIJA 4BFSA 2Q6TA 5FOUA 1CKEA 4JS0A 3ZQJA 4HUTA 3FWYA 5EE1A 1KZ7B 4D2IA 4LJ6A 1T4GA 1VYVA 4S35A 2X8AA 2IYQA 1RC8A 4L4UA 1OHHA 4EJSB 3HYTA 4YMVA 2QM8A 1LY1A 3H86A 4P4SA 1E9SA 3MG9A 3A1TA 2WAYA 5FTNA 4IHQA 4NYIR 3AVVA 4Q66C 4C0HA 1GIAA 4TLDA 5TV2A 3O47A 3QXSA 3AVTA 2DWPA 4OHZA 2JCSA 4PHTA 3W34A 4BRUA 2XJ9A 3KJEA 3GLIE 5FI0B 3HPRA 3PUWA 4BFZA 4KHZA 4BGDA 421PA 2P6NA 1T9HA 3LX5A 1F48A 3BH7A 3L0PA 3PG5A 2A5DA 2XTNA 2F1HA 1YU9A 5KPJA 1EX7A 2K5UA 4OI1A 4ON9A 2BJWA 5BYJA 4NTZA 1R0YA 1KI6A 1KI7A 1P6XA 4XD7A 4E5UA 5EZ5A 2KBEA 3MWJA 5C2JB 2IYZA 3KTAA 2D2EA 2GRJA 2W0MA 4FCWA 4MQBA 3QKRA 1QHNA 4B3DA 2EWVA 2QT1A 4XOIA 2O8EA 1AN0A 2XNDD 2NGRA 2JJ1D 1KAOA 2FV8A 3TK1A 2NO1A 2QE7A 3SFVA 1FMLA 5FTKA 4DBLC 3GLGE 3WY9A 2QAJA 1T0JB 4LJ8A 3ZVMA 2PLRA 4JL5A 3SBEA 2ZE8A 3I61A 5EXXA 3THYB 2ZXUA 4FXPA 4U02A 1X86B 3VKHA 1SHKA 3DKPA 1NVVR
chains in the Genus database with same CATH superfamily
2WSYB 1TK3A 3B2NA 3UA3A 5HGJA 1P2SA 3DR3A 2DTEA 3FB4A 2R7NA 2QMEA 3MUNA 1C8BA 4K8RB 1S2NA 3RB8A 1KWGA 1GAJA 3THXB 3VGJA 1IXRC 1XZAA 4BBPA 5JH7B 3HB7A 4LGYA 1KK1A 3ZV4A 5E3HA 1KDZA 5KQSA 2ZIGA 1I3OA 2OGSA 3I5UA 2WTEA 2OENG 2AH5A 3G2HA 1O96B 3KUUA 1W0JD 3GEGA 4C89A 4QGSA 2ODNA 3QPAA 3OWHA 3RJTA 4EABA 4ILEA 2YV1A 4FDLA 3U4AA 2XCTB 4J43A 5E0KB 1QF9A 3U4CA 1Z5GA 2GHTA 1SAYA 3MW8A 2PBZA 4GI3A 2VNSA 2EVWX 2WRZA 2ASVA 5D7BA 1BIFA 2QAGC 3UB2A 3EEQA 3N8DA 3ZI7A 3PEWA 3ZXUB 4CM3A 4BE4A 1R5OA 3KQKA 1K4MA 4OHXA 4R2LA 2Q1SA 2IT1A 5BNWA 1WW2A 1A9YA 3ADPA 4R8VA 4MVJH 2WFLB 3DULA 3FETA 2J32A 3K5IA 1ZSVA 4HH1A 4POAA 4UU8A 4YX9A 4LVOA 4RETA 3ICCA 4PV7A 1T3TA 4NHOA 3LUBA 3WLHA 5SYAA 2JLCA 5KSPA 3I2KA 5ALXA 1V8DA 3WLFA 2YZGA 3PQFA 2FVYA 3K2IA 3RS7A 3V4VB 3VH3A 2CMKA 4A6DA 3D3EA 2I1QA 3PX7A 3NIFB 1L7DA 3EIXA 3TOXA 1I1QB 1K7CA 1N25A 5E9QA 2W6OA 3JRXA 1D0IA 2XUIA 3A70A 2J09A 3IIJA 4FS3A 4ZARA 5KI6A 5JNVA 3I04A 4DLWA 4B0OA 4HGOA 2C2ZA 1KEEA 5DV9A 4ZALA 3KZXA 4BASA 4ZAYA 4BKPA 4BUZA 4U0KA 4HGZA 3QF4A 5LP6B 4Q5IA 1U3FA 3AJ9A 3T1NA 2F3PA 1UR5A 1K98A 4YI3A 3HUEA 5REQA 1RZ3A 3AR7A 5EE3A 4GOXA 4FPXA 3AVYA 2CFIA 2QMYA 3CZMA 4XDHA 2PZFA 1DEKA 1NU8A 2TMDA 5DYTA 4O2BA 2O0JA 1IPHA 3B2EA 1LX7A 1Z5PA 1DBPA 1G8MA 2QDXA 1H8HD 3N75A 3PU6A 4IJQA 3B20A 2G77B 3GFGA 4NABA 4F1JA 5A4FS 1K6EA 4QTUB 4DLSA 3MAJA 4DMLA 2HF8A 4YPOA 1JWLA 1SCNE 5JS1A 1JHQA 4DQVA 4PCVA 1Z0IA 3KWMA 3Q7IA 5TXGA 4CM9A 1TW2A 1W0KD 1E8MA 4YLEA 3ZLUA 1GO2A 5KMGA 4JR2A 4XJXA 2ATIA 2R62A 4MZXA 5FWYB 5J9FA 4GU5A 3WLNA 1BN7A 4WINA 5BQPA 1LH0A 2BLNA 2OHFA 3TQTA 4A16A 2D5BA 2W6NA 2HDOA 3DYVA 3RSGA 1CF2O 5KYVA 3OQHA 1KEZA 2HNAA 2YWGA 1NRIA 1NV8A 4FFSA 4KO2S 1IQPA 2FB9A 4B4OA 4DWWA 1BW9A 2AD5A 3BWBA 2EF1A 2IS1A 2RH9B 5DNVA 1UDCA 2JRLA 2RGXA 3HB0A 1VG8A 3IHTA 1E5VA 4KTTE 3WLMA 3TB6A 4XVCA 4IYJA 2O07A 1XFDA 3GFPA 1HNZB 2EOAA 4HVAA 2IUFA 2BEVA 3KD3A 4PW0A 1ZMTA 4FK8A 4JNKA 4UCFA 3ANYB 1D8AA 2NX2A 3V4ZA 3W2FA 4TWAA 1G4AE 4AJOA 1EDOA 3EG9B 4L4YA 4JWTA 5AIBA 1U11A 1L5SA 2OCIA 4NBUA 3BERA 3KSRA 4PLFA 4PQFA 5GM2A 1T3GA 5D6OA 3DE1X 4LI0A 3E1KA 5CX4A 3CBQA 3U7FB 4BLUA 4W1PA 1C7IA 1UAYA 1CUGA 5LMNB 1LI7A 1J1ZA 1EFPA 1FBTA 2YHIA 5KOYA 2PUGA 3Q7RA 5A5FA 3EQ2A 2I22A 2QORA 3GQBB 3H5NA 3LT4A 1W49A 4FP9A 5BRJA 3MOIA 4I55F 1DXQA 3ROPA 2AT1A 4B3HA 2NXEA 3VR2A 4AJ4A 5CW1A 2QX8A 4F92B 2GXAA 4DM4A 4U9UA 1ILEA 3FZEA 5KINB 1XCPA 3GT4A 5ADWA 2F1JA 2HRRA 2NZUG 1P9WA 1XTZA 3DBLA 3RAJA 3ZCPA 4G5FA 1KEPA 1AT1A 2JIBA 5CT8A 1VGQA 1DCKA 2LIPA 4ND4A 4IDEA 2K7FA 4H3VA 5K3SA 4OIFA 2IIVA 1WQ4A 2EFHB 1NVBA 3VAZA 4EQZA 2PT9A 3BULA 5AHXA 4CIYA 2SKEA 1GVHA 3OZIA 4DCGA 2NVUA 3ORRA 4P08A 3V2HA 4MB2A 4WWHA 1LI5A 5TSDA 1PLJA 2QXYA 2GHIA 4D3DA 3KUCA 3QWIA 3GFTA 2XBUA 4K8OA 3L84A 3ZEAA 1MB9A 2YL2A 3FOAA 1JZQA 3I8XA 4MKHA 3E2PA 4R7GA 3KJGA 2W70A 3PXAA 3Q72A 2PKRA 4PO9A 1G8HA 4H77A 3O2QB 2C8LA 1MX3A 1VLJA 3KEGA 3A27A 5JD3A 1BD4A 2QRLA 3IQIX 1K4YA 5ALTA 4N48A 3R6TA 1WBJB 3A9TA 3KWFA 1JHPA 4X7MA 1XCBA 2XRFA 3V2IA 2O2DA 3MCUA 4KBGA 3ILHA 4NCHA 4UEWA 1M2JA 3GF4A 3IPAA 1XALA 1Z4KA 1QRSA 3ZDCA 2F64A 2HZBA 5EIAA 2ZUDA 2PX6A 4Q7JB 5AI4A 1EFLA 3BUSA 4TXLA 1OYYA 2DHCA 5KNLA 2G9ZA 4GSLA 4H3HB 2DUUA 3HTXA 1QHXA 1IVNA 3EGIA 2CNBA 3V2GA 4DY4A 3S99A 1ULAA 1Z07A 5K8UA 4MYUA 1QQAA 4WLEA 4ZEXA 2M1XA 4DG5A 4NMMA 2I0FA 5IVHA 1ULBA 3GCXA 1AD2A 1E2IA 2J0UA 2YHSA 4I1SA 4O5OA 4XIFA 3ICEA 4JLOA 2DFKB 2R7KA 1D1QA 1ZMBA 3LUAA 2IELA 2YWJA 3PQ8A 1N8TA 5D87A 1DX6A 3MJCA 1CQWA 1NI3A 1YZ3A 1E2DA 4N03A 4C43A 4PLWA 3GI1A 3KR1A 4RGQA 3X44A 4N3AA 3OZFA 3RRZA 5GADl 5SICE 4JYPA 2MT9A 5E6SB 1CJUC 4DIUA 1IOZA 1XDDA 4P4SB 5KBYA 4RD0A 5KWJA 3LPCA 2Q9AA 4DQKA 1OPXA 2C3PA 3K0FA 1XMXA 3OURA 3CUTA 2A6PA 4XGIA 2BGIA 1CY0A 1FS5A 5DM4A 4U3JB 4Z0HO 1V5EA 2OCYC 1GZ6A 1GZHB 3IOCA 5EXSA 3Q12A 4JJGA 4REQA 3MLBA 5TEWA 3W04A 1FFBA 3LO5A 1KZ1A 2XUKA 5BSRA 2H4ZA 1IN5A 2EX0A 1PYGA 5BSEA 3W5AA 3LT2A 4LYGA 1FIUA 5FUQA 1SHUX 4PY2A 4ZA2A 4HNHA 3ESCA 3ZWWA 3ED1A 1WXWA 4PICA 3AP1A 3G9ZA 2BRUC 1MDFA 3KSUA 1GLVA 4HTFA 4TKUA 1XQWA 4HNQA 2SCUB 3DFMA 3EXG2 3TQRA 2HLDA 2Q99A 1DOAA 5JXHA 4MHSA 1Z0SA 2XJ4A 4G84A 4PINA 4YASA 5EL0A 4EPVA 2C3MA 1U4NA 2DUWA 4C3UA 3IVRA 3AL3A 4C21A 1CLUA 5K3FA 3SQOA 3NUZA 4EY6A 4KEAA 3JQAB 4O1IA 3BMOA 1SQ6A 2ZWVA 3M4ZA 3DZ8A 1DDOA 3ONVA 4HNAA 1U9YA 4BLWA 1XP8A 1HDYA 1KI6B 3TRJA 2AKEA 1THGA 2B6HA 2P77A 4XUEA 4E1VA 2FZVA 2XEXA 2QPLA 4JUAA 3IODA 4BE9A 2G9VA 2YN0A 3T9EA 1DL5A 3ILXA 2I2WA 3MJHA 3TFQA 4NOMA 1CVLA 3QKRB 5DU2A 4CQJA 1R0BA 4K5QA 1ECLA 1V3TA 3SYNA 1XA3A 2G5GX 4QWMA 3NRBA 4BS9A 1NXXA 2BMDA 4QM7A 1G16A 3JPWA 5L6LB 3ZDAA 2R44A 5ALMA 2ZRHA 3QXHA 3SBXA 3WSWA 4ZK6A 4S05A 1F60A 4R8RA 3UPUA 4GAEA 4DVGA 3VISA 1R4MA 2GCPA 3CUVA 1H2HA 5B1DA 3VO8A 1SCBA 2CDRA 3QQ5A 3B48A 3C6QA 2FXIA 4FUTA 4IDOA 4XAQA 5E2IA 3EF3A 2FFAA 1KH2A 3HU5A 5DB4A 3H19A 2HREA 4UDOA 5E3JA 2VRWA 3ZU6A 2HW8A 4BNJA 1YUMA 3V1TC 4CDNA 1XNQB 2BSAA 3L7CA 3IYLW 4A9AA 3CE9A 3X1ZA 2FEPA 5AJHA 3U3MA 4URVR 5ITWA 1BS9A 1IQUA 4UPVA 4PQYA 4HNUA 2V0GA 1GFIA 1PQWA 3IV7A 5TQVA 2D2IA 3UMFA 1AUQA 4URXR 2BAGA 2BE7A 3AVUA 4EHBA 3U16A 1O6GA 3OHSX 1XD8A 721PA 1YQWA 3GRPA 3PIIA 2ZQ5A 3E84A 4OQDA 3AR6A 3ZTTA 5JAQA 4KXLA 1L3CA 2AI1A 9ATCA 4IDPA 4TS1A 4CM9D 4LXGA 1LLQA 1OI3A 4ML3A 4FYYA 1YA8A 4JUFA 3L5KA 3R5SA 4UULA 4MYRA 3GOHA 1NV9A 3AINA 3PE6A 5AKGA 4BBJA 3RC1A 3AKZA 2J3KA 3RI3A 3A25A 5BQFA 5PGMA 1DQRA 1IY2A 3UJ9A 2GEBA 1RCTE 3AF1A 3D8NA 4WKNA 3EGDA 5FXMA 1NVGA 2PCLA 4YUYA 3QE0A 1DJNA 2VPPA 4C3VA 4NNPA 1N6LA 1FF9A 2G6TA 1YVPA 3IQEA 3V7NA 1G63A 4YJGB 3WJAA 5EHIA 3NV7A 1V16A 2VF5X 2OESA 1W5TA 2Q8QA 4MUFA 1JLLB 3V5NA 2OVBA 1E3SA 2WM9B 1UWLA 3WLJA 2X7JA 3M1YA 5EG5A 1DCTA 2A14A 2WYVA 2IWHA 4EY4A 3O73A 5J2UB 4OLFA 3V1UA 4OHBA 3VNUA 2OORC 1XHFA 3P97A 4NE2A 4MUKA 3DDUA 2XMGA 5TGTA 4I5IA 2Y76A 3AJRA 4BV2A 2YN4A 1NATA 1NJ1A 4X60A 3HCCA 5JMPA 4EUHA 4MKRA 2EKPA 4JB3A 3LJKA 3MGCA 3K30A 1YVUA 1S8FA 4ZU1X 3F4KA 1XOIA 3DE4X 3R8XA 1QVZA 4GGOA 3L5OA 4QPDA 2Z1DA 5AT1A 1W36D 1XEXB 1B4DA 1ZXXA 5AVTA 1GCOA 1SIWA 2NXNA 3CF4G 4NBSA 4JMPA 3VR2D 2HMUA 4BDTA 3U4QB 3DLAA 4Z3OA 1KORA 2A0KA 4KV9A 4LN1A 3K05A 3ZH2A 3KFXA 4TWRA 4BOYA 1AZTA 4YAUA 1X7XA 3GLFB 4C9BA 2D1TA 2X5NA 4IP0A 1DIBA 2XE8A 3QV2A 4AY6A 3MHPA 4OYRA 5C32A 2YVKA 1FMFA 4OQEA 4EZEA 5JH7F 2HU5A 4GS5A 3UJNA 2POCA 1UMBA 3O4VA 4MP8A 3QYFA 4A10A 1M76A 2GYYA 1XEWY 1CQZA 3VHXB 1M1XB 3PGMA 8OHMA 1V41E 1NNSA 1O3YA 1VPVA 2R8OA 3CZCA 3FPKA 4U00A 3EJ6A 1Q0LA 2F62A 4RMJA 3JU3A 1DAPA 2C7VA 3EGXA 1WF6A 4OP2A 3NTQA 3PLNA 2VQFB 4RMHA 3O94A 4Q3DA 4RO0A 1B1AA 1G59A 2V3VA 1M8KA 1X9HA 5C5CA 4HZIA 2X1MA 3WIVA 4ZVMA 4JJKA 5I5EA 2Q7XA 3L46A 1ORHA 4B46A 3PDWA 1U7TA 3UA4A 1H4VB 2FPMA 1GAQA 5G1NA 3KDPA 1GPYA 2Q5JA 4KB5A 5CX1A 4A6PA 1IHDA 5JAPA 3FTEA 1ABEA 4N5DA 1G8GA 2R8XA 1ABFA 1WLSA 5L3ZA 4B3IA 5KYKA 4P54A 1S7GA 3JATB 2WJIA 4F4IA 1YCFA 4UM8B 1W48A 1RI4A 1WMSA 1HL3A 4M55A 3L6UA 1EH5A 3FBTA 4G25A 4J0KA 4EHJA 1DRWA 1Z2EA 4LDJA 3AFOA 3TGPA 3J80A 4YY3B 1PZMA 1TJYA 1WDLA 2ZROA 2DOKA 2V4UA 1RHMA 3KHKA 2OO5C 3OU6A 3HBNA 2Q49A 3ETHA 3LCCA 1G6KA 3GEMA 5HF6A 2C9OA 3GLHE 4CTKA 1E0SA 1Q21A 3ZE7A 4BGEA 2HLHA 1J7JA 1FFEA 2IDKA 4YCDA 1JEAA 4C4AA 3JWJA 1N77A 2RHGB 3H2KA 3TRFA 3CLRC 4TS4A 1FNSA 2RHWA 2K2WA 1Y6QA 4FYJA 4ZT4A 4O4JB 3AR2A 4AZ0B 4DDVA 5K4HA 5FTJA 3QBDA 4J1TC 2DGDA 5ALPA 3RTCA 1X0XA 3SD7A 1UAAA 4Y2QA 4Y1FA 1XKLA 1X70A 3I9OA 3K1JA 3QBVA 2AMJA 3NHYA 3IDSA 2ZRIA 4ZQHA 3SHQA 5TLSA 1II9A 2ENUA 4UHFA 3AEKA 2XYPA 3A36A 1REQA 1KVRA 3A2MA 2ZRBA 4ZC8A 1W1UA 5CVVA 5K09A 5DNEA 5JI2E 3QY9A 5HILA 3I09A 2XXAB 4RIHA 4U7TB 3PLAE 4MW1A 1G7TA 3DL0A 3HVHA 3NBXX 3QE9Y 1DHTA 2QGZA 5B3JA 1L4GA 3B3AA 4B80A 2V5UA 3T6KA 4ND7A 4FVTA 3TZEA 4UOEA 4L0MA 5EJEA 3HFRA 5ALVA 1HWYA 4Z9BA 2XGGA 1KKLA 1S8OA 3DOFA 4HUQA 4V39A 2HLDD 3UT5A 3GFOA 4WXPA 1MD9A 5AJYA 4EARA 4F71A 5IXJA 3KJNA 3DZBA 2ZIZA 3I32A 1H8EA 1SZPA 4BNDB 1H4SA 3HO8A 1IG0A 1GD1O 3ICPA 1ONBA 1UBMS 3KJZA 5AM3A 2QVXX 4N5MA 5ELMA 3W90A 2HBRA 2J4DA 2WMYA 2FJUA 3QU4A 4GP7A 4LDAA 1KETA 1D2NA 1F4VA 5IKOA 1Z74A 2PZAA 3AM3A 3R3VA 2HMVA 3V7WA 3C5CA 3NO4A 4QGBA 2AN4A 3QUAA 5CJJA 2JA2A 4M8IA 2I2BA 4A36A 1A1VA 1NXQA 5ALQA 3W5BA 3PS9A 4JSRA 2QX4A 3N3BC 4RDHA 1SC3A 1THTA 2CN1A 3WRVA 2JI9A 4IGKA 4QEKA 1M34B 2GCIA 5HUHA 2GO1A 4X8LA 2XADA 5IAEA 1R4NA 1W76A 4M1WA 3X1WA 3AR9A 1WWKA 3LT1A 1JX6A 1ZESA 4XDGA 2C83A 2IOYA 1HDGO 3IMGA 3IT1A 5C8YA 4V2IA 3TKYA 4HB0A 4IMRA 1VIVA 2P27A 3KAKA 4PX2A 1HX7A 4D9FA 4RKYA 2WJVA 3CX3A 4FYMA 1Y82A 1ZONA 3P0IA 3TEFA 1VL6A 4Y1GA 5EUMA 4J7UA 4O02B 1KAEA 5LPNA 4RV9A 5JVDF 4QAQA 4D43A 2ODPA 1N2OA 4YAGA 1IWBB 2I71A 2QT0A 1CEQA 2GEDA 3BIWA 3COWA 2PY6A 4YAEA 4E6PA 7REQA 1T4DA 3MAAC 4G0WA 3DV0B 5EVCA 4LY9A 3N8HA 4NK5A 1G4HA 1VPTA 2V7XA 4COOA 4KZPA 1YOVB 1OV4A 3DMPA 3OLVA 1T9CA 3WRYA 3JZMA 3M5WA 1DMRA 2RGWA 4F4CA 4A0FA 2OD7A 1C1YA 1NI5A 5B3LA 1JSZA 2Q9CA 2X77A 1TF7A 1QZUA 2RK6A 1LTHR 1Q1QA 2JATA 1R12A 3F3KA 1HTTA 5ARCA 2Y1LA 1N3IA 2NVWA 4AMZA 2R2GA 2YY5A 4ZCLA 1BRTA 5CVTA 1P33A 5C7YA 5EXPA 3RAPR 1ZOLA 2XZOA 5AJVB 2UUOA 1OU0A 1EXWA 2WIAA 1B2LA 3Q9NA 4GR9A 4Q6WA 4X1IA 4GHWA 2G07A 3CJTA 1TMOA 4O4IF 2MDTA 3E3AA 2J0EA 1JAHA 2Q2OA 1EXVA 3OIYA 1DC6A 1F20A 5BN3A 2VSQA 1J0BA 2QX6A 3FF4A 3P4XA 4GG1A 1ISHA 2Y1FA 1EHCA 1T8WA 2ZI4A 5K7SA 5AR1A 3W2GA 4CZ2A 5J23A 1ZCJA 4DQXA 2PXCA 4JI6B 3GGJA 4MVJF 3B1KA 4M76B 3PWKA 5FAKA 3GA7A 4LYYA 2VEOA 4R2IA 3ZIAA 3QNWA 1WUYA 1NJ8A 2A57A 3QPUA 2JI4A 5FWXB 2PD6A 4HVLA 1BCRB 1JEDA 4RHCA 1U5AA 3U9TA 4A1OA 2NZ8A 4B6JA 3RKRA 3B52X 1DAEA 1UXGA 1XN1A 3MCAA 1FLVA 2XQGA 1SVLA 5JXGA 1Z3CA 1GPNA 2PRKA 4IFIA 5DNWA 3GJSA 4TKMA 3OCZA 1DWPA 3PD7A 4G2TA 3U9SA 3KXLA 4YT4A 1B15A 1VIAA 1KWKA 4RMGA 5J4LA 1XZHA 2OK7A 2IPNA 4CCSA 4LVNA 4DSOA 1YHNA 3QLTA 3EGCA 2RCYA 4ENVA 2XUHA 4OM8A 2MYPA 2YY6A 5A05A 1ZXBA 3OHPA 4R0MA 5JSZB 1SKYB 2O3SA 1NQWA 4EY5A 1HMYA 3LOQA 4FOTA 3MINA 5IAGA 3UHPA 5CFLA 2GBLA 4HGRA 4MR9B 2ETXA 2H2GA 1K6XA 4WNAA 1RPZA 3UMSA 3K0EA 5BN4A 1H9CA 1M74A 3A6JA 3JTEA 2RCNA 4AZSA 2ETVA 2R68A 3R5KA 5E9JA 4P6VF 4AQYB 5JQGB 1NULA 3UIEA 4B7CA 1VIDA 3LNCA 1Y6JA 2BDTA 2C29D 2IOFK 2IYLD 2JAUA 3AG6A 2DAPA 3JALB 3TNJA 2WD8A 5B55A 3C1UA 1OTXA 5GJCA 5CDYA 1Q7GA 2EYQA 5KTMA 1TJ3A 1PNQA 2OAQ1 2VDWB 3ILYA 4UBJA 4Y2UA 5DP1A 4ERXA 3T5GA 2JBWA 4EW3A 3ZDZB 2I4RA 1VIYA 1MQSA 1E8DA 3IQHX 3P94A 5CK4A 3WLTA 4BL5A 4Z4EA 3CT4A 5BYKA 1HZZA 3QEJA 1HLDA 1XRSB 2XCIA 2ZETA 3CRRA 3JWGA 3K2BA 3N53A 3AEUB 5FFFA 3KSAC 4Q3OA 4D9GA 5FB3A 3S2FA 4G0OA 3IMEA 1J0XO 1T9DA 4GEGA 1VRWA 2JD0A 2ZPAA 6YASA 5T4EA 4UQLA 5AO9A 4J7AA 4UD6A 4LRXA 1NW4A 2XGMA 4KRGA 1GNRA 1PWXA 3H3FA 2QZ4A 1KOLA 2G4LA 4EJ0A 1QKIA 2H2IA 3E70C 1V4VA 4Y6PA 4IQGA 4XARA 4LWZA 1F51E 3WV5A 2B20A 1YACA 4JVSB 1TGYA 3NM6B 1UK9A 4NZMA 1CE8A 1YIAA 2Y1EA 4IO1A 4IX1A 1VKZA 4MWDA 5KUTA 4WZBB 3D7KA 1Y8ZA 1F5SA 2P30A 4IG9A 4ZZIA 2JK1A 4AICA 4U8HA 3SF0A 2C9YA 2XOXA 4YFYA 1JSXA 3E2MA 3PGXA 1HDRA 1BOOA 4HH4A 2YFHA 1U3GA 3H2BA 3OFNA 2RAUA 3UH1A 3GAAA 1OC4A 3G17A 3UC5A 2WTNA 1FRZA 3EZ9A 1T8SA 4RELA 4YJ3A 5J5VA 2X4IA 2PKQP 5H0IA 5DX1A 3SS7X 2RG1A 4GPAA 3MM4A 1Z56C 4R1OA 5A71A 3ZWVA 4ETWA 3NGMA 5F64A 4B35A 3IE1A 1CRPA 4YGXB 1CZUA 1LDBA 2GGSA 3PKZA 4LUCA 5L3SB 1LPPA 5FFMA 1T1IA 5E0OA 4C2BA 1K88A 3PHLA 4K3UA 4NBVA 3P32A 2HADA 3QPCA 1Q0SA 3S2UA 4LQ4A 3V8QA 5FBQB 1Q77A 1M10A 3GLSA 1FLNA 3G88A 3C4VA 1PD1A 1QCCA 1VCHA 3TRIA 5LJIA 3U44A 2I4LA 3V1LA 5L4SA 3NDRA 4WN3A 3AV3A 1VL8A 5D86A 4B40A 2PMKA 1H8ED 3VTZA 4DVJA 2FPPB 4OAPA 2QM0A 5LBIA 2NU7A 2FPXA 3GPIA 3HSSA 3EOZA 3IJRA 3I6QA 1TYBE 2QZ9A 5ALLA 4B85A 4AG6A 4J1SA 1WXFA 2AWNA 4L5YA 5K0CA 1N9ZA 3GARA 4MV9A 4D8VA 4GZ5A 2GFIA 3A9SA 5EZSA 4H4DA 1GVNB 3CTPA 3HLYA 1U8AA 1K7EB 2BJHA 2DPMA 3UV3A 1O1YA 4CM7A 4AKGA 1NVEA 1U0NA 4QATA 3RFTA 3MJFA 4KGDA 1ZSNA 3TNFA 5A2QA 1A96A 3U5ZB 3L8FA 1EIZA 3IR7A 2FPOA 3FCYA 3FPAA 5DXAA 3TSYA 2VXOA 4CI0B 4L7VA 2VZ0A 1PEDA 3HKBB 4O1HA 2GN9A 3I3SR 3GVIA 2J6HA 4DWOA 3I53A 3KQMA 1P73A 1TMYA 3QLUC 1TX4B 1NP7A 3T0GA 2XWJI 1G5HA 4LAFA 2NP7A 1H93A 3FR7A 3CINA 1SCUA 3I2JA 1QIGA 2OV3A 2X1VA 4M6WA 1M0SA 2WW8A 5B30A 3WS7A 5SY6A 2L82A 3CLSC 4IIJA 2VT2A 1H2AS 3PQ5A 3RRYA 2ECPA 1Y4ZA 4LHSA 1B42A 4RTRA 3IOYA 1UKZA 4KVGA 4MWOA 1HETA 5IH7A 3G2NA 4PNZA 5ESDA 3ZDBA 3RAEC 2PL9A 5JDIA 3RABA 3K20A 4F9TA 4ZDKA 4ZMRA 4CCAA 2C4WA 5AK5A 1CJMA 2YRWA 3G5UA 2XDAA 4RHTA 1PR3A 2BMVA 4QECA 3KCQA 4NQRA 2O1EA 5BVGB 1DFHA 3WKEA 5FI5A 2VA8A 1AK9A 3OF2A 4H27A 3O9MA 4R2JA 2CKDA 5GVSA 1I32A 3E1SA 3JVUA 4K88A 4NZYA 3U0BA 4QGFA 1C4WA 1UOEA 2JDIA 1NASA 3WG9A 2FP4B 1VE1A 3X1YA 1A9SA 1OYOA 4EAAA 1PGJA 3BTUA 3F9IA 3HA2A 4E6EA 4WAUA 1DWOA 3IT2A 3KKZA 4RW0A 5K3CA 4IUYA 4XR9A 5CLIA 3VU8A 1VE6A 2ZQYA 7MHTA 4OP1A 5EMKA 3A4IA 1PYDA 4NJEB 2BW0A 1SC9A 2PMFA 5BR1A 2FLWA 3BHNA 4Q7LA 4DA8A 1WTCA 2P62A 1BYIA 5FPHA 4I66A 1CTQA 4QRHA 1RXSA 3W5UA 2JLQA 3CPJB 4QD3A 1JAZA 4D3SA 8LDHA 1A97A 4L8FA 2YW2A 4Q48A 3ABQB 1EYZA 3DLBA 3QKTA 1YD7A 2VLIA 4KE6A 3TQQA 5KNDA 4J4BA 4AS1A 2IYSA 1M8PA 2E87A 2AK3A 3NNNA 2ZVDA 4BMXA 2PANA 3FPEA 2Z9CA 3JS5A 4RJLA 3EPHA 2LDBA 4JOCA 4EDFA 1WXXA 3HCNA 3UF0A 3ER8A 2V98A 4NYJR 4DABA 3C7AA 3GD5A 1P5RA 2IY7A 3SLGA 3NYRA 3PFBA 1AB5A 1Q19A 1KNQA 2XE6A 2JJYA 3O7WA 3ONDA 4G1UC 1R7RA 1RYZA 2NT4A 2QSUA 3JQ8A 2ZB2A 4ZVNA 3CMMA 3R40A 2B7LA 3ZE1B 2FZWA 4EHHA 1CUXA 2P3LA 4YPFA 4PYIA 2GF9A 3COPA 4G23A 2FUG6 3O3CA 4TMVA 4JQYA 2UU9B 3U6BA 2QENA 4PFQA 1F12A 2C9DA 1N92A 2F17A 1VXOA 3D8RA 4RSMA 5CDGA 3T1YB 4DMGA 2HDNB 1YS4A 2JJMA 5FWNA 1FVHA 3KKMA 4UC0A 4WKPA 2Z2XA 4GEKA 2O0HA 4JLWA 4YWHA 3MRXA 1TCCA 4I3FA 1L4HA 2PWPA 2VYVA 3AEXA 4JT8A 2HPVA 4W6QA 5FI1B 3ZE0B 5KX5A 2OOKA 4P4UA 1RYBA 3ZHCA 2FZCA 4GE0A 2JLSA 5ADVA 2DZDA 5FL7A 3QUQA 2BI8A 2XTMA 3CGWA 1PG2A 1D7OA 3PD1A 4Z99A 5M04A 4BKOA 3BB4A 1DXOA 5JH7A 1IEWA 1O5IA 4KG7A 4OAQA 2WY2D 5JSUA 3LA8A 2GYUA 2W6JA 2WU4A 1XRMA 4ZO8A 3EIQA 3GJ3A 1MNAA 3EG5A 4WGFA 1QH1B 1GOTA 1RWQA 1GNTA 3RDPA 1KYIA 2QW8A 4DIEA 4Z4QA 2GN0A 2GHQA 3H9QA 5DYNA 3SQMA 1ENPA 3WKDA 1QIHA 4LHYA 2AJ8A 2OBBA 3HADA 1UMCA 3EXHC 1DEOA 2CFOA 4LV5B 1QO7A 3KPUA 1DG9A 2GYWA 2WPDA 4FEAA 1XJ0A 1PJZA 3B5IA 3ABOB 3LUGA 2EV9A 2GDZA 3KXDA 3GJ7A 2JK0A 2I3GA 3ANTA 2CVOA 3AUFA 3Q0EA 4UNPA 2YBEA 4LYDA 2F67A 2PFGA 1WNFA 4FNOA 4HN4B 5AICA 4FS8A 5DHQA 3OFND 4IXDA 5TQ0A 3WNVA 4QPZA 2VZEA 2BH9A 2OK8A 5IF9A 3B7WA 1HV8A 3O3NB 5KB3A 2HRZA 3L7NA 3MWDA 5J1SB 3KKNA 3QVOA 5JSFA 3H2JA 3OC6A 2O8EB 5H02A 3BXXA 5CFPA 2C9CA 5JWOA 1DG1G 4CF3A 4LBWA 3V7UA 3CZ9A 3QYJA 5JI3E 4ARBA 5FUYA 2W6QA 1QVAA 1X7ZA 1C14A 1LCIA 2VT7A 4MGKR 1C29B 2QW0X 3LX8A 2FFBA 3USCS 2WZQA 3IFSA 1FA9A 1M0WA 2MYNA 5FEUA 2WNHA 3Q3HA 5TY0A 4CRWB 1LBTA 1QJ4A 1S2OA 4BJ5A 4QUAA 2CK3A 2NZ2A 3SYRA 4XB2A 1ISFA 3OM1A 2AG5A 3RE1A 3GLHA 1LV7A 1XVLA 1RKUA 3BJMA 3GA0A 3T7EA 3PFKA 1KBQA 4JXXA 1L4YA 1LS6A 4IIGA 1D2HA 1O2DA 3I9FA 3RYHB 1K3TA 1XUOA 2VHEA 1T3LA 2G4VA 1RI1A 1N2ZA 4JC5A 3F2VA 1JU4A 2CMGA 3V00A 1VB5A 1F4PA 1V8BA 3L9WA 3W5IA 2CBXA 3OE7A 4A8JB 4W6ZA 3DO6A 4XRRA 5DN6D 4HGPA 1SQGA 2GZHA 1FW6A 5HG0A 1II0A 2H31A 2XQVA 2Z9BA 3OCYA 4JLJA 3UHOA 4NYJQ 5K20A 5L7WA 1GT91 3BSYA 1UDWA 2CCJA 1ZW1A 2ZBVA 3NRJA 4PHHA 4HAIA 2RGDA 1KNXA 1NBMA 3LBAA 5FOSA 3TTWA 2J46A 3PUJA 4KKXB 4CEIA 4P4GA 2FSGA 1N6OA 2YV2A 3GD7A 1SB8A 5E2AA 3AY3A 4ZZ3A 5TF0A 5HCUA 1RQ7A 1P29A 2YASA 1YMUA 4YMLA 2P79A 3QGMA 3ZCQA 4C6RA 2O0LA 2F1IA 4EHFA 5BSUA 1NNUA 3O0TA 4O6VA 1UM8A 4R0NA 1HDEA 4ZYXA 2EFYA 2H08A 2VDOB 2AMFA 1K7YA 2VCHA 3EC7A 4JL6A 4TUYA 2JKVA 3U7QB 2NOAA 2HAEA 3OZRA 2VPWA 2CXRA 1JU3A 2PS0A 1RSZA 4NJMB 1JU9A 1KMCA 4Q02A 3ZK7A 2P9GA 4I9FA 1NX9A 5JNUA 1BAPA 2JIDA 3ODGA 4I4LA 1FRQA 3BEDA 4OXIA 1M0TA 4UTPA 1DARA 1SQ5A 5FTMA 5GONF 4C6SA 4CE6A 1Z06A 3Q15C 3C5WP 3PNLA 4LHEA 2VHTA 3PPWA 4V0OA 1QIKA 2O9JA 4YECA 1L5WA 1TYCA 5DRTA 4ZVKA 3RK4A 1YXMA 3MMXA 5JQGF 1HYEA 2GAOA 1X80A 4K81B 4RK6A 3ADBA 1JEYB 3FROA 3WFZA 1RP1A 3L18A 4OXYA 5FNVF 3S28A 3N8GA 3UUWA 4F21A 4ZMBA 4I81A 1PL0A 4Q12A 1O96A 2C7PA 4ZODA 1WDMA 3H5RA 1MAHA 1X74A 3EB9A 4LY3A 3AR5A 4J1NA 3VI4B 1Q6YA 3CS3A 1F6WA 2CYAA 4J75A 3S2ZA 2QT9A 1V1MA 3FCOA 4FKMA 3LDAA 1M2VA 2ACWA 3VC1A 3WRYC 4EJFA 4XTCS 5E9WA 1ZBQA 3WYDA 3JXEA 1D0VA 3JYNA 2GPAA 4CETA 3ND9A 4PVCA 1PFKA 1QLWA 4IYRA 1L7RA 1TLFA 4OSEA 1CRQA 5EIOA 3ESDA 5B4UA 3L2OB 4HDKB 1XLTC 4ZPJA 5JRDS 1PR2A 2PJUA 1GPMA 2WA1A 1U90A 3L0BA 3RIGA 4HNTA 3UENA 4ER3A 3LVFO 1FP2A 4OV6B 1OI7A 1TW3A 3V7FA 4A2QA 4E30A 2R9VA 5ADHA 3BMCB 1P2FA 2I6UA 1KP3A 3M9XA 4F46A 5C3MA 4X54A 2IYRA 5T6MA 5ALHA 1G3MA 1GYRA 2D74A 2QMOA 4BU0A 5CNKA 4LRYA 5KNDD 3IUSA 3CURA 3DTVB 3SYTA 4AD8A 1NJGA 3H13A 3H2ZA 4M7PA 1QFYA 1RWVA 3SYMA 1XP5A 5AKHA 5BV1A 3EF0A 2GX6A 1RNLA 2IHZA 1FU8A 1GR1A 3RODA 1TF5A 3LVQE 1VL1A 4RDCA 5IJAA 4C3OB 1E9CA 1EWTA 2RGGA 2RJ3A 3HCEA 4Z2AA 8ATCA 1OBHA 4TQGA 2QJRA 4ZQFA 4U5QA 5LP6A 3KLMX 2HM7A 3HO1A 3TQCA 1FYVA 4FIZA 5IEJA 4EENA 2FPGA 2Y1XA 4G0QA 2EQBA 1F8GA 2L2QA 3IPLA 1RI3A 3EULA 5C53B 3Q8MA 2ERYA 1NM5C 4HAUA 1ULZA 5HKAA 1RQXA 1RHRA 3EJWA 1DIAA 4ILKA 4M9UA 4F3KA 2AFIB 1R8JA 2VSYA 2WTUA 3TKAA 3AHJA 4MGEA 3GA5A 2WIBA 1R5JA 2QN3A 3ITEA 1RWBA 2GD0A 1YJAA 1D4ZA 3FUCA 2IOQA 1S7CA 4YP1A 3RVOA 1PT5A 2B1QA 4PPGA 2VYVD 2D8MA 3PC8A 3OJXA 1QR2A 2B8WA 1CUUA 4HN9A 4EF4A 3GPCA 1B93A 4H7DA 4OSPA 4EATA 2W2XA 7YASA 4MV3A 1U2RA 1PS0A 4E09A 4E1BA 2J33A 2HUNA 2ICAA 4DTIA 4EGQA 1KQFA 1U0FA 2HIHA 1X6VA 1RWKA 3HR4A 4HB2A 3W8EA 3ENZA 5BSTA 2EXXA 4QYXA 2MR6A 1T91A 1L5VA 4TKLA 4AI6A 1KDRA 3L0SA 2WHEA 4YHBA 1T4MA 3LRTA 3RFCA 2P4QA 2WAAA 1DHRA 2ABWA 4ZYUA 2IDJA 2W6JD 2RB4A 5ISMA 3WQHA 1BJTA 4YVFA 2HEGA 4MTLA 3U3KA 3H11B 4O08A 4TRMA 5JISA 2ZVPX 1F17A 3D31A 4YRPA 4C30A 4IPTA 5B4TA 1OH8A 2Q3LA 1AKWA 3QELB 2O14A 2A67A 4EFNA 2QLNA 1C1XB 2QTAA 1V43A 2I80A 4FKBA 4QASA 1KYZA 5IUJC 3K70B 2WPDD 3Q3EA 3TDNA 1P6QA 1K6JA 3TTXA 1WZEA 4ABYA 1EUDA 2TMGA 2V0NA 3HN2A 2C77A 4LMRA 1N6PA 4BUJA 5EJFA 3QLVA 3G59A 1G3UA 2JVKA 1LLDA 3F4LA 3TE6A 3BG5A 3PDJA 3ZQ4A 4AJIA 4IJ5A 1O03A 4U2GA 1ZD1A 3R8FA 3FFAA 1Q2UA 3GQBA 3M1AA 1XWIA 3CNQS 5EIEA 3CA8A 3FNEA 5DLQC 1GDTA 3QX3A 1VLQA 4KXQA 4LSWA 1C9DB 2P4EA 3B5JA 4MP6A 2PG3A 2KM1A 3TD9A 3TTUA 1JQBA