3C6YA

Hnl from hevea brasiliensis to atomic resolution
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Hydroxynitrilase
publication title Atomic resolution crystal structures and quantum chemistry meet to reveal subtleties of hydroxynitrile lyase catalysis
pubmed doi rcsb
source organism Hevea brasiliensis
total genus 94
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c6yA00
4E14A 3M3DA 5A6VA 1QIHA 2RONA 1XZHA 2QVBA 4AZ0A 4Q82A 1RWQA 4BYMA 4UBLA 1XROA 2XUAA 5AKKA 4W1SA 4B81A 1CRLA 2H9YA 3EQ8A 3WK4A 4LXIA 4WY8A 1LPBB 5I7UA 4UBNA 1CV2A 1BCSA 4W63A 2ACKA 5ALSA 3C70A 1N5RA 5FDFA 1C4XA 1G4HA 7YASA 2QM0A 1JJIA 3I2KA 3E0XA 4UFPA 3QPCA 4Y7DA 1A7UA 2H7XA 5E2IA 4JNCA 3G9TA 5CT6A 3FYUC 3BWXA 1AKNA 1Q83A 4C4YA 3FYUA 2HA0A 4J0HA 4EY5A 1AZWA 1U2EA 5A62A 1EX9A 1J2EA 5AI5A 3WL7A 1F0NA 1JU3A 1R4ZA 4XWGA 4G4JA 4F0JA 1QO7A 1QIKA 5AM2A 5AOAA 4QDXA 1M33A 2I78A 2PU7A 3MVEA 2VAXA 2QS9A 4W9RA 3G0BA 2JGLA 5FKJA 3G02A 1R9NA 3EQ7A 5JZ9A 5FPQA 2WKWA 1QZ3A 1ZGCA 5AKIA 4QZVA 1O6FA 5LLSA 3TJMA 4MQMA 4HVTA 3I2JA 2QXUA 3ED1A 3DJYA 4G4GA 2WUGA 5FP0A 1O6GA 3ESCA 4PO3X 3O9VA 5AM1A 5FV4A 4J3JA 4J0CA 4Y2JA 3BJMA 3DOIA 4J7AA 3I6YA 4G4IA 3BE8A 4LYDA 1JMKC 5K3FB 4BE9A 5JALA 3V1NA 1NX9A 1QFSA 3F96A 1IUNA 2XUHA 2XMZA 3D5EA 4Q3OA 4DM7A 4XX1A 2QRUA 5HF8A 4X95A 4M0EA 2O2IA 3F9CA 3BIXA 3HSSA 5E4TA 3DQZA 4G9EA 1WPRA 4WFKA 3WK5A 1CUSA 2WU3A 3EF3A 1HDEA 1XRNA 1JFRA 4V2IA 2C58A 2XQKA 3WIOA 1VLQA 4RPCA 1C7JA 3OM8A 4WCVA 3AINA 3O0DA 4U2GA 5T4FA 4KEAA 2V9ZA 4BATA 1TRHA 1BCRA 2DHDA 5IKXA 2I03A 3PICA 5HK9A 3K6KA 5J3JA 1IVYA 1ISPA 2Z5GA 1SFRA 3WK9A 2BGNA 3ESAA 1U65A 1UOPA 2XUIA 2AJBA 3H1AA 4P9NA 3FAKA 4QWMA 4QDUA 1GZ7A 1GQRA 1MPXA 5KWIA 4J0JA 1LPSA 1JMYA 2XMBA 4AX4A 5JATA 5SYMA 1QTIA 3K9BA 4FBLA 3WWOA 3LP5A 3QBJA 2OGTA 1N8SA 3D59A 1YCDA 5EHXA 3WZMA 1QLWA 1E89A 4FMPA 5AKHA 4DGQA 3W2TA 1PJAA 3BDIA 3HRHA 1F6WA 1JKMA 3B12A 1JJFA 2GBGA 1MAHA 1BE0A 1LBTA 4OB6A 4OU4A 4C89A 2ZYSA 1Q84A 4QDZA 1GKKA 1GPNA 1ZD2P 4FKBA 1IUPA 5LZ9A 4J0KA 2HDWA 3DKKA 4JEIA 3L1JA 3BJRA 3ZLUA 1JJBA 3LIIA 4JYPA 1WPXA 4OYLA 3PDCA 4Y9SA 3WLAA 3WWPA 4GBGA 4AO8A 4EUSA 5ALRA 1P0IA 4J0GA 5A7FA 2W6CX 4WFIA 1X2BA 2B20A 1TCAA 4QDTA 1XRRA 3TEJA 3A70A 5JAHA 3W05A 5LKAA 1DWQA 4G1FA 5LZ7A 1CUHA 2ROQA 4W1QA 4H7HA 3A6ZA 3WMRA 3VKFA 3WJ1A 1OXMA 3C5WP 4G8CA 1VE7A 4HS9A 3PI6A 2HU8A 1MX1A 1SOMA 4QLAA 3I2IA 4BCBA 4BCDA 5JZBA 1EHYA 2WFLB 1A8SA 2Q0XA 2WU4A 2RGUA 4ITVA 4H7JA 1VA4A 2WTNA 3VVLA 5A7HA 2WUDA 3A2NA 2GYVA 3E3AA 3SK0A 4X6UA 2WUFA 1EDDA 5HKAA 1XQYA 1C7IA 3H17A 3PUIA 3D3NA 1K6EA 4Z49A 4F60A 4BRZA 4DIUA 5K3EA 4UBMA 3X3HA 3C8DA 5E4YA 2XUGA 3DNMA 1WHTA 5ALYA 1LBSA 3PFCA 4KAAA 2Y2UA 4ZI5A 1ZGBA 3UUFA 5AKLA 4U2DA 2C5FA 2QOEA 1JU4A 5AOCA 1UK9A 5K5EA 3F67A 5D3KA 2H1IA 2OXEA 1F8UA 1UZAA 1DX6A 1WB5A 1W76A 4PV7A 5C7YA 2DQZA 3EIOA 1R88A 5C81A 4ZWNA 2XUKA 1MX9A 1IMJA 1VOTA 3DYVA 3ANSA 2XLCA 4OPMA 1HPLA 1NU6A 2XMGA 3M81A 5FXMA 5JANA 2CUTA 3W9UA 1MX5A 1MU0A 5AKXA 2AJLI 1VKHA 4EB0A 4DNOA 4UPDA 4CG3A 4EHBA 2JGFA 3ESDA 1YS1X 3HI4A 4FBMA 4KJXA 5ALKA 1YB7A 3IVMA 1MN6A 3H2HA 4EY4A 1DINA 4KAFA 4GDMA 1FFBA 1CUFA 1ODSA 2VQ6A 1R1DA 2XQJA 5C8VA 1CQZA 2CKMA 1DU4A 3TGLA 4ZREA 5FUMA 4CG1A 2Z8ZA 4B7ZA 3WYDA 3D2BA 5KWJA 5AH0A 4G5XA 1DWOA 2HL6A 2YXPX 4H0CA 4H18A 4UFNA 2WFLA 1H22A 5C8XA 2WIGA 2OLEA 4QDOA 4H7DA 4Y2QA 4MEBA 1J07A 2P8SA 3QMWA 4N8DA 2Y6VA 3DL4A 1XZMA 2FUKA 3BDVA 5A7GA 1Q0ZA 1EB9A 3STYA 2BCEA 2XUQA 4RE6A 5A2GA 4EBBA 4TPKA 5AM0A 5HZGA 5K3DA 1XZJA 4OUKX 5AI0A 1A8UA 2UZ0A 2V96A 2JGJA 2WG2A 4N8SA 2HM7A 3GBSA 5FOQA 5YASA 2HA6A 4FOLA 5LYYA 3SX4A 4P93A 2ONCA 4IH1A 2BJHA 3STXA 5C8ZA 3I2GA 1UK8A 1CUJA 4GHWA 4AZ3A 1QGED 3W9BA 1CUVA 2BFNA 1QIMA 5EI5A 3STTA 3WWDA 5EHQA 3MUOA 5DYTA 4AQDA 1CLEA 1F0PA 5HK8A 3AUKA 4CFSA 5AO9A 1ORWA 2QUAA 4OU5A 5D6OA 3S2ZA 1QFMA 3LIPA 1L7QA 1H2ZA 4BZZA 4NZZA 3I2FA 2GZRA 2QMQA 3H2JA 1E8DA 1WM1A 1CUZA 3RM3A 5AP9A 3A2MA 4BVJA 3OTQA 1ODCA 1FFCA 2GYWA 3GELA 1CUYA 3R3VA 1HBJA 2WHPB 3QPAA 5JYCA 5CH5A 3CN7A 2PPLA 2WJ6A 4I19A 4UHEA 4BDSA 1XLVA 1XFDA 3A2LA 1XRQA 4Q05A 1LGYA 2WM2A 3O4IA 3U0VA 1L7AA 3FLEA 4GXNA 3R3UA 4IH9A 2Z3ZA 2XUPA 5LKRA 3VJKA 3BF7A 1W6RA 3G7NA 2PVSA 1BEZA 1YS2X 3WA7A 5AM3A 4PNZA 4OB7A 4J0DA 3MUNA 4H7IA 5D3ZA 2W22A 2XE4A 2ACEA 4NS4A 1HL7A 5AI9A 1I6WA 1VXRA 4U2BA 4BC1A 2XMCA 2IX9A 3GROA 4ROTA 4FTWA 4PSUA 4MEAA 4WFJA 4U2FA 3B3QA 5F4ZA 4RE5A 3NGMA 5KREA 3FVRA 2B9VA 1BEEA 3D7RA 1CIJA 3QPDA 2ZSHA 4XVCA 3CCBA 2R8BA 2RHTA 2ZYIA 5BV7A 1DQZA 3Q8WA 5AICA 3I6ZA 3KWJA 1FJ2A 4KE6A 4FLEA 4QA9A 1TCBA 5AKEA 4RNCA 3WJ2A 4YASA 4G9GA 4I3FA 3KDAA 4UHFA 3IURA 1T4MA 4BB0A 1PV1A 1DWPA 3LCRA 5JD5A 1USWA 2QJRA 2XUJA 4BP9A 1MO2A 1WOMA 3FSGA 3PF9A 4FDMA 4QWWA 2PX6A 5IVKA 2LIPA 5ALPA 4A5SA 1H23A 1CUCA 2PSFA 2HA3A 2J3DA 4AXBA 5AK6A 5DNUA 4Y2UA 4HXGA 2WHPA 4OSEA 5H3HA 1UK6A 5JADA 1LPOA 2FJ0A 3T52A 3WL6A 1EA5A 4FNGA 4ZGBA 4F5ZA 5CW2A 5DWDA 3L1HA 4BCCA 4HZGA 5ALLA 1DTEA 4HXEB 5ISMA 4GWLA 3QMVA 1UT6A 5ALNA 4K5QA 2QT9A 1QONA 1SC9A 5ALWA 5LIPA 5JAUA 5ALIA 4UHDA 4BVLA 3CN9A 4Y2YA 2PSHA 1UFOA 1UOOA 1XQWA 4BP8A 1MNAA 3KOOA 4KE8A 4UBKA 5CT5A 1YA4A 1ZJ5A 4CCYB 4BAGA 4KAJA 1DQYA 1FFEA 2VTVA 2C0QA 2HA7A 4UHHA 1RP1A 4AMZA 4YX9A 3MGAA 2H7CA 3WIBA 5ALHA 3V9AA 2O7RA 1ACLA 1U8EA 5HF6A 1E66A 1P0MA 3P2MA 4K2AA 3AZOA 3CCCA 2OCIA 2V97A 1AGYA 5ALEA 3OURA 1Y7HA 1J1IA 5HF9A 1EVQA 3H18A 3RK4A 2VA9A 3KWFA 4L72A 4OYYA 3I28A 4EY7A 4E46A 3EBLA 2ZJ7A 3G0DA 1NU8A 2JEZA 2OQIA 4X94A 4B9EA 2QXTA 5DNWA 3VISA 3ZPXA 4AN1A 1TIBA 4GI1A 3ILSA 4IO0A 4LKOA 1VA5A 5JARA 1YB6A 1GQSA 3ICVA 4JUIA 3ZLTA 5JZSA 1XZLA 4I4CA 3HJUA 1QJ4A 4C6HA 4OD0A 4QLOA 5LZ4A 4O08A 2HFKA 4ARAA 4HXFB 3QH4A 2EEPA 3W04A 3C8HA 5LP1A 3QITA 2GZSA 4LXGA 4B84A 3QM1A 3B5EA 5CT9A 1XZAA 3ESBA 1YA8A 1K8QA 1IZ8A 2C0PA 2OGSA 4M0MA 4C87A 4PSCA 2CEKA 1BN6A 3H2GA 5ALUA 3O4GA 3GUUA 3HEAA 2BAGA 2XMQA 5CRIA 3AIOA 4K6HA 4XJVA 4Y2SA 3E4DA 4PSDA 4BAZA 3IULA 2RHWA 3WWCA 3AJAA 5AHXA 1WCYA 1TQHA 1CUDA 3R3YA 4HRXA 2CJPA 1XQVA 4CCYA 1XLUA 3IUNA 1CEXA 2XQGA 4B0OA 1XZFA 2V98A 3R0VA 3AZQA 3HACA 2XMDA 3IDAA 1ZD4A 3V48A 2XUOA 3DLTA 3WZLA 3PUHA 5EHZA 1TCCA 5ALFA 4TVKA 3IB3A 3JW8A 4ZRDA 3FSGD 5EGNA 1ZD3A 4BRSA 1CUUA 3AIKA 1RYYA 2XDWA 4DSZA 4Y2VA 3TRDA 4LIPD 5AK4A 2HA5A 3DOHA 4KRXA 1HLGA 5ALTA 4MWSA 1W4LA 4BDTA 1LPAB 1CQWA 2PM8A 1UK7A 2OAGA 3V1MA 2GBFA 2OAEA 4FFVA 4G8BA 3WK7A 1ZD5A 4CIAA 2XT0A 3H1BA 4L3WA 3JYHA 3F98A 4M0FA 3IA2A 5D7BA 1XZEA 2Z8XA 5HCUA 3DKRA 2BUCA 5KBYA 4QEKA 3YASA 4PF1A 3PFBA 1XZKA 5ALOA 1XKTA 4WDRA 4CCWA 1KEZA 5HFAA 3OPMA 3VJLA 4TGLA 3FBWA 2Y2VA 4DNQA 1ZIXA 5CH3A 1ZIYA 1OCEA 5DNVA 5AM4A 1A8QA 1XLWA 3DEAA 3I1IA 1MT3A 3K2IA 1K5PA 5BOVA 1OILA 2ZJ6A 4PW0A 5AKJA 3D2AA 4OB8A 1ODTC 1CUBA 3WA6A 1AQLA 2ZSIA 1QIGA 3WL5A 4ZV9A 3H0CA 1UWCA 3VXKA 2QZPA 3LLCA 5AKGA 1IZ7A 3JWEA 2WIFA 1BU8A 1S8OA 1LZKA 2AJ8A 1K4YA 2WILA 4BZWA 1ZICA 1XQXA 4C88A 4IQ4A 4X92A 1AC5A 2VT6A 2XB6A 4BTVA 2PU5A 2AXEA 1XZCA 1GPLA 1X70A 2HFJA 3ANTA 2Y1KA 1LZLA 1CFJA 4EY8A 2CZQA 3CXUA 5HQ3A 1MAAA 2J4CA 3VVMA 3G8YA 4X7BA 3FNBA 1B41A 5ALZA 1E8NA 1EK2A 2VT7A 3AZPA 1A88A 3ZI7A 4UFOA 4ARBA 2EDAA 4AO6A 2QUBA 4WDQA 1DT5A 1WB6A 1FSSA 4YPVA 1GT6A 5FLKA 2WLSA 1H2WA 1P0PA 3I1YA 3GFFA 3C6XA 3OOSA 5ALQA 4LYEA 3BIWA 3OG9A 2VF2A 5EIEA 4HTAA 2VSQA 4GEGA 4AN0A 2C7BA 4Y2XA 4DTCA 1ETHA 3D0KA 2I3DA 4FNMA 2DHCA 4L9AA 3IBTA 2WHRA 1DT3A 2D5LA 2G4LA 4CI9A 5JIBA 5AOBA 4JYMA 1EXWA 2BKLA 1CUWA 1CPYA 4FHZA 4IH4A 4MJ3A 3N0TA 1UOQA 3W06A 4KYVA 5IVIA 1N1MA 2XI4A 3GZJA 3U1TA 4B9AA 4X85A 2G5TA 5JAOA 4J0IA 4B80A 2HRRA 3OC0A 3SWWA 1K63A 2ZJFA 2I3ZA 3HC7A 1XRMA 1Y7IA 5SYNA 4X90A 3C6YA 2XMSA 2J4FA 4Y2RA 2OCKA 3QMMA 5BWBA 1CVLA 4DMKA 3WKDA 4C4ZA 2WUEA 2WJ3A 4QNNA 3NUZA 4GLBA 4CG2A 2QR5A 2XLBA 3C43A 3G0CA 3HYSA 3G0IA 5LZ5A 1XZBA 4N5HX 3H2KA 3WK6A 3O4HA 3WQHA 3GA7A 4GW3A 1E8MA 2ZVDA 3WKAA 4MYDA 2XUDA 2FX5A 4H7EA 5CT4A 1R3DA 4E15A 1JT2A 2IITA 3RKSA 1QIJA 3Q0TA 4DMFA 1H2XA 4BTLA 4AMYA 2JBWA 3H2IA 3WKEA 3FLBA 3UMJA 4DMCA 5ALVA 4X6XA 4UHCA 1T2NA 2J3QA 2WFMA 1HKHA 5CBKA 2PSDA 1P0QA 1XKLA 4P08A 2X76A 1QTRA 2VEOA 2XMRA 1U4NA 2Z3WA 2R11A 4EA6A 5AK5A 1KU6A 3STUA 1KU0A 2HU5A 4MXDA 1YAHA 1CR6A 1PFQA 3HLKA 4X97A 4ETWA 3S8YA 4AO7A 1YASA 5AK3A 3FCYA 1LLFA 1ZOIA 2OCGA 3O9MA 2XQIA 5E4JA 1E3QA 4FLMA 2WSLA 5AIBA 1QE3A 2G63A 4DYHA 5EIHA 5K3AA 4H7FA 1ZJ4A 3FLAA 3DL7A 2HRQA 3M83A 1N5MA 5AI4A 2B61A 4UUQA 1W75A 3PE6A 5HF5A 4BC0A 4X3CA 5ALDA 2OQVA 2VJAA 1LPMA 3WKCA 3AILA 4BVKA 4LHEA 4A16A 3STVA 3DD5A 3R41A 1UXOA 1XZDA 3D4LA 2PL5A 2HIHA 1R50A 3ICWA 2PKYX 3V1KA 2O2HA 2CBGA 5CTAA 3NOXA 2WJ4A 3N2ZB 1EDBA 2JGKA 3E1GA 1LNSA 2JGEA 4GECA 4BAUA 3C45A 2BUBA 5K3BA 2VAVA 3G9XA 1YSCA 4Q3LA 4FWBA 3BL8A 5CH8A 1QIDA 1VJ5A 3WK8A 1CUGA 2BUAA 2EDCA 4KR0A 1AUOA 5AKZA 4B83A 3KD2A 1LPNA 1DX4A 2ZYRA 2PSEA 1XRLA 3R3ZA 1BROA 2B4KA 1EINA 1MJ5A 4LXHA 4INZA 4H7KA 4KRYA 1VZ2A 4UHBA 1Y37A 2JGIA 3C87A 3KSRA 2YH2A 6YASA 5K3CA 2AJCA 2WHQA 1MNQA 3C6ZA 4HAIA 2XUFA 4W1RA 2E3JA 3IUJA 1EDEA 3H19A 4KE7A 3LS2A 2DQYA 4FLFA 3FWHA 3EQ9A 1QIFA 3IIIA 4IHAA 1XZIA 1GGVA 3BXPA 1BN7A 4F21A 3WKBA 2JGMA 4NVRA 1VXOA 2VATA 2OCLA 2WG0A 3IUMA 1X2EA 1D07A 3D2CA 5T4BA 4C4XA 3PF8A 1QOZA 5AI8A 5DJ5A 4HRYA 5K3FA 2GYUA 2O7VA 1W52X 1J06A 1VE6A 3I6MA 1MTZA 2NW6A 3VJMA 2VJCA 4X6YA 3WL8A 1EK1A 4UBJA 4P92A 1CUXA 1VZ3A 4OCZA 1BS9A 4B6GA 4N5IX 5FRDA 5ALXA 2H7YA 2ES4A 5EFZA 5IVHA 1HQDA 3DS8A 2XQFA 4Q34A 4DSAA 4K6KA 2O2GA 2HA4A 2IIVA 5DYWA 1YR2A 2CB9A 2WIJA 1TAHA 2G5PA 2WFZA 5T4HA 3ZWQA 4E11A 5A71A 3QVMA 3DCNA 2X8BA 4ZV7A 4N8EA 1TKRA 4B82A 3HZOA 1EI9A 2DR0A 3WI7A 2C5GA 4JH0A 4S0XA 2HU7A 2BGRA 1G5FA 3QYJA 3VDXA 5LZ2A 4G8DA 3F8SA 1CUIA 1UKCA 5AM5A 4PQEA 1AX9A 4QE3A 5LZ8A 3O4JA 3C5VA 5CXXA 3SC2A 1W1IA 1GXSA 3FOBA 4RGYA 3O95A 2PBLA 5AIAA 3FYTA 1GPKA 1ORVA 5AJHA 5HQ3B 2DFPA 4U2EA 4UBOA 2Y6UA 1EB8A 5IVDA 4Y2TA 4FFWA 2JEYA 1ZI8A 2WTMA 4UBIA 1CUAA 2YASA 2VJBA 2QJWA 2HADA 2QTBA 5FPPA 1B6GA 1XRPA 4C01A 1R9MA 1LPPA 4X71A 2VJDA 3FCXA 4BBZA 5JD6A 3WWEA 2PSJA 3ZLVA 2RIPA 4B0PA 5IH7A 2RI6A 1WHSA 1SCIA 2K2QB 3T4UA 3V1LA 1IUOA 1ZI6A 2GBCA 5ESRA 1THTA 3G0GA 5HKBA 2D0DA 3BF8A 4WY5A 4MQLA 3DYIA 4K6GA 1XZGA 2HHAA 1CUEA 1G42A 3DDUA 2DHEA 1FFAA 4MYSA 4Q1VA 4YK7A 5CXUA 4ZXFA 3NWOA 1GKLA 1Z68A 3R3XA 4WJLA 5CURA 2CMFA 2JIDA 2PUHA 4B85A 4DMHA 3I2HA 2DSNA 1THGA 2WIKA 2DCMA 4Q3KA 1SCKA 5HFNA 5ALGA 2QKYA 2WQZA 3RLIA 5I9IA 3L1IA 4J03A 1E5TA 1ACJA 5JAPA 2OGZA 5I8PA 2FJPA 1UKBA 3HABA 4DNFA 4EZIA 2ECFA 1TK3A 1Q0RA 4KACA 1UKAA 1QIEA 3AIMA 4DNPA 5EIAA 2JF0A 2YYSA 5T4EA 2C4HA 3FYUB 3WYNA 3ZV7A 1L7RA 4A23A 3G9UA 2ORYA 3R40A 3G9ZA 5ALJA 4NMWA 1FFDA 4BE4A 2PUJA 2OPHA 5ALMA 1AMNA 3KXPA 4H35A 4KE9A 3M82A 5DLPA 3R3WA 3IUQA 2GBIA 1QO9A 5DTIA 5CMLA 5EHNA 2OG1A 2HA2A 3FVTA 4AB1A 3H04A 4MWTA 2WG1A 1JI3A 2X5XA 3AFIA 1QIIA 2WIDA 4Y2PA 1G66A 5DTJA 4X91A 5JASA 3RARA 3QZUA 4W1PA 4XIIA 1ZI9A 4D9JA 3HXKA 3F97A 3STWA 1BRTA 2RAUA 4X93A 1EH5A 1YAJA 5AI6A 1EVEA 5BWCA 1H2YA 4EY6A 1SCQA 5JD4A 4X00A 3UUEA 4CIBA 5CT8A 5AKYA 4H77A 1WB4A 2ZYHA 4DLNA 1AURA 5DYYA 4U2CA 3C6BA 2AJDA 4L0CA
chains in the Genus database with same CATH superfamily
1N7HA 2J7KA 4I4TA 2AI3A 4DY6A 4WK0B 4IZIA 1YR7A 2F3SA 3SC6A 2I76A 5A6VA 1QIHA 2RONA 3GDFA 4G0YA 3EF0A 4TTIA 5HIAA 1L7DA 2RMKA 2TS1A 4QYWA 4AZ0A 1ZU5A 1FLNA 2RAFA 4NJEA 4Q82A 4NH0A 4YP6A 3L0SA 2Q9CA 4Q48A 2FU5C 2ZRLA 5DPMA 1RRMA 2XUZA 5F52A 3CR7A 1UZLA 3G2LA 3QWHA 4OGKA 1MQAA 4OP3A 3WIDA 4D5EA 1XROA 5J4VA 5AKKA 1TK9A 5JSFA 2IKSA 5CX4A 1JDPA 1YL5A 2P4SA 4PFJA 5AVYA 4B81A 1QU3A 3VZSA 3I34X 1WQ4A 3DO8A 1ENOA 2H9YA 3G68A 5FTKA 2BC9A 1M54A 4WWHA 1YR3A 3C98A 4R6WA 1MUUA 2O0JA 1L7XA 4FVTA 4IYRA 3SQLA 4EO9A 4UBNA 5JYBA 1JDTA 1VM6A 4XVRA 2QE6A 4YCNA 4GPAA 3TKLA 2NPOA 1J8QA 3TIXB 3ZV4A 3ST7A 4C07A 4J9UE 4PLZA 5HSGA 4TOIA 2PJDA 4G97A 5ALSA 1N92A 2Y1GA 1N5RA 1NMQA 2I2FA 3UNXA 5FDFA 5JQWA 1HV8A 4NRDA 5K8IA 3N6RA 4G1VA 2O2YA 3LDAA 2VJPA 5B1SA 4ER6A 1XMQB 1ZLXA 2CLDX 3I64A 4PFQA 3DBRB 1AGNA 2GFIA 1C7EA 4C9BA 2JAUA 3I2KA 4PO9A 4COKA 5A4DA 4PONA 4UM8B 2WICA 4Y7DA 2R6FA 5E2IA 1R6DA 5EMNA 1J2RA 2Q07A 2X22A 3PQ2A 4QREA 4H1WA 3GJZA 1V7PC 1CY2A 4PLFA 1L7BA 1C0PA 5FJIA 3U1VA 2IUEA 4JLPA 3G6KA 4NNOA 4YJ3A 1OXBB 3BWXA 3WLQA 1IY1A 3BGOS 1VCOA 2GHIA 2VN8A 4OKNA 3OA0A 3U19A 3BIJA 4RQBA 2GHRA 4B3XA 1RZVA 4IOMA 4Y3UA 1AZWA 1NVMB 4LJSA 4ABYA 5M7EA 3K5IA 2A9RA 2JJ1D 4J4HA 2PRYA 1EX9A 1J2EA 3GIDA 4PHHA 1CRPA 4YCCA 4YTEA 4R2JA 5HUQA 4K8OA 1J5EB 1N5OX 2Z4TA 1OC4A 3DLAA 4O29A 4XWGA 1V1MA 1XEXB 1R8SA 3L46A 5LQUA 1ZONA 2OB1A 2GXUA 4XCQA 1P75A 4F0JA 4D7AA 2E5LB 1HORA 4IFBA 4P54A 4CKZA 4EQ6B 1C1DB 2AYYA 2WT4A 4O4HB 2OHXA 2KBFA 3PG5A 3ROMA 1ZQ1A 3EFOA 3KZNA 3ZX5A 4LE0A 4H1UA 5JWHA 3BMCB 2ZU6A 2QN7A 2GNOA 2BEVB 2PS1A 2VSFA 2YZ2A 3U7JA 4E51A 7GPBA 1FDSA 4I7EA 4P38A 5CM8B 3DNPA 3VPBA 2CFIA 1R9NA 13PKA 3TIIA 2C3YA 1ZBQA 2ZTVA 3QLUC 3BMOB 1SVNA 4I50A 4PS1A 4R1QA 1KA9H 4RPLA 4YQYA 5FPQA 4EPXA 4F9TA 2XSZD 3F4LA 5C2JB 2W8BA 4TMXA 1O6FA 3QLUA 3R5XA 3TJMA 3PGXA 4BNDB 1JQKA 3DP7A 3LHKA 3VC3A 4CMKA 5KYUB 5BQFA 1MR3F 4Q4AA 5K0GA 3ED1A 5K2MA 2BL4A 3TM5A 1DC6A 2WEKA 1R0XA 1H6CA 3JQ8B 4GSLA 2VDRB 4LI0A 4WBSA 5K0LA 1O6GA 2V1XA 4BMPB 2QQEA 4L73A 3UAYA 3WSVA 2XH8A 4BRWA 1E0AA 3BRQA 2V65A 1GPJA 3W2FA 3K1AB 3HCNA 2X1MA 4W5HA 5FLYA 5IPFA 3NLLA 1BDHA 3LPNA 4CQMD 1KTVA 2NUAA 2Q50A 3DOCA 3CC8A 4TPKA 5F7XA 2WQ6A 1AXRA 5LU9A 4V39A 4FWTA 2GCNA 4CMIA 2J07A 1EGQA 3SYKA 1FYEA 3TNJA 3RUHA 1VG1A 3LMKA 1Y5LA 4S0ZA 1ND6A 3D5TA 5B30A 3USCS 4G4IA 5B53A 1W49A 3WRXC 2Y1DA 3MTJA 4MH0R 2UKDA 1ESMA 4GR9A 2XIQA 5JDCC 4YCDA 1M0TA 1X9IA 3IP6A 2L18A 3EUEA 3SZRA 3WRXA 3ZU2A 1QFSA 4JJ6A 4ZRMA 5DASA 5E7JA 1CNFA 1E1KA 3NV9A 3EVGA 4IDAA 2I34A 5KX5A 1ICEA 3GPIA 3HCDA 2V3VA 3FNGA 3MRSA 3PVCA 4DXAA 4Q3OA 4HFJA 1AO0A 3FWZA 4XQ9A 3T7RA 4KQGA 3VUFA 4WCFB 3AYZB 3E8SA 3TECE 1KYVA 2FY8A 3ZBUA 3HJHA 1T8UA 4M0EA 2W4QA 1WXQA 4N39A 4ZQHA 5FA8A 1K7SN 2GN6A 4JBXA 3GLGE 1O6ZA 4GGOA 1UJ5A 3ZVKA 4UW9A 1LC3A 4D3SA 1D8TA 2PBRA 1CULC 4HH0A 2A5YB 2OHOA 2IS2A 4L28A 4NCHA 3ADBA 2VQSA 5IT9A 1Y3FE 1BKYA 3ZDZB 5E4TA 3CXRA 5FFFA 1LB1B 3VU3A 2JFWA 3RYCA 1E62A 3VNBA 4MQBA 4WFKA 3EAQA 1X9GA 3A6HA 3EXIB 2JRCA 4AJJA 4E1AA 3KE9A 1L8OA 1EGMB 1CUSA 3AONB 1BVRA 3L0PA 4RS3A 4LDRA 3W6NA 2X15A 1EEXB 1R6BX 2WU3A 4JJ4A 4P83A 3EF3A 1R0KA 2F55A 2GJAA 2Y1LA 4LA4A 2J3KA 1VL0A 1OYYA 4NHOA 3GA5A 1O4WA 4CMJA 2VK8A 1KEEB 5KVSA 2O20A 3CX8A 4MZXA 3WIOA 3EDOA 2OL4A 4LRTB 1L9XA 2OK7A 2OP1A 4RPCA 1X7GA 3ZWBA 4L4UA 1NJ2A 5TSDA 1NKSA 3JQ6A 4ZZ1A 1Y3BE 5C1BA 3OM8A 4WCVA 3O4VA 1NQAO 1RQRA 3O0DA 3RYIB 4C6TA 1GTRA 1UUFA 3KR1A 2AFIA 4LRSB 3ZWNA 4KEAA 4YMUA 3OQOA 2JAOA 1Y48E 1MGPA 2VZ8A 4V0MA 4BATA 4DQ0A 5BW8A 2DHDA 1AOXA 2C9BA 3FRIA 3ZJ4A 3IV6A 4DA4A 1C7ZA 1CR0A 3EMBA 1KGSA 1NNLA 1NXWA 5K1ZA 4JJIA 3HGMA 3BXHA 3MCWA 5LN1A 1XAIA 1HZZA 3RBZA 4BFTA 1E6UA 3KKQA 4PE5B 4P0PB 4RVCA 1V37A 5DIZA 1ADJA 2ZE6A 2ZAMA 2DUUA 5SZHB 1IVYA 3WFIA 3GT7A 1I2MA 1J49A 4CF5A 5J3JA 1NVVQ 3PEUA 2B6HA 2C9YA 1Q20A 4L8GA 1K3FA 3D4NA 1YO6A 4CI0B 1KP3A 3FDIA 4GKBA 1CF2O 1EXVA 1N25A 5L40A 1HRDA 1D1QA 1UXIA 4RFLA 1RLMA 3IMKA 1T4CA 2QT1A 2BGKA 3ZEAA 5MN6A 1VL5A 2GPTA 2YBEA 1XAJA 2B2XA 1H85A 2F3UA 2RHRA 4RNDB 2M6LA 3IB6A 3RVQA 4KR2A 2Y8EA 3R9XB 3MTAA 1WA5A 1S7GA 4QWMA 5KWVA 1TYZA 3G2KA 1QYXA 2IYPA 3N28A 4PPFA 1GQRA 1WS6A 2VBGA 4R6XA 5CYPA 2WOJA 2ZT6A 4HTFB 4EHKA 3ZCXA 1MPXA 2UUOA 1OV6A 2IODA 3TPZA 4JU8A 3DO6A 4OBWA 5IZCC 2C3PA 4IHQA 2W9XA 1N2XA 1KI2A 2ZWIA 1Z37A 3A06A 3LQRA 4JBNA 2XBUA 1JHDA 4DRYA 4KTVE 1B0ZA 3IDSA 4NOLA 4UU7A 2JVKA 5SYMA 3K0KA 1ZGAA 3NEJA 3CJTA 4WZ6A 5IZCA 4RBNA 3BRWA 3SNHA 4MMZB 1NLFA 2AVNA 1Y3CE 4NNJA 4AJHA 3AM1A 2FSUA 1GZ6A 1UDAA 2YWBA 4KO2S 1VLLA 1F0YA 1SRQA 3O8OA 1R0BA 3BUSA 1W2GA 4XR4A 3TZCA 3LO5A 2A59A 3NAMA 3E8MA 5F64A 1HXHA 1K3TA 3HJRA 2NV6A 3KZVA 3R4CA 2XZDA 4IOJA 3RVRA 2Y1EA 3I8SA 1E79A 2EJCA 1K98A 1JIVA 4Y9DA 1U7UA 3LVRE 4R1OA 4URVR 3NI2A 1ZGGA 3K09C 4D4HA 1NXOA 4WEOA 1QTQA 1PVOA 1NW6A 3BDIA 3GQBB 4MRMB 2GXQA 3L6BA 4KGZA 1F6WA 1JKMA 1NR1A 1JJFA 3B12A 3ZG6A 5CD9A 2GBGA 1HFKA 2OZVA 3OMWA 4B32A 3TLGA 4EELA 1YJCA 4S04A 1BC5A 4BGEA 2IHBA 1QGUA 3PIRA 2X9GA 3ER6A 4OB6A 4W9NC 4F5EA 2FG5A 3C3PA 4B17A 1BS2A 1LC0A 1EAMA 2CLLB 5JYEA 3K9FC 4F06A 3COWA 4PYIA 4Z3DA 4DT1B 4QEDA 2RBKA 3QVVA 4KN6A 5FQNA 5CIYA 4JX9A 3PEYA 3WX0A 5KSYA 2O8EA 2IXGA 1M1XB 1KKUA 2QTVA 1HNNA 3A11A 1XSEA 2JKVA 3ZWVA 5MN5A 3T3DA 2O06A 1J24A 4TUYF 2HDWA 1CYEA 1PR2A 1D6MA 4O4LA 3NWPA 2AQHA 1JQAA 2ZIXA 3I5XA 1MJGM 2XOXA 4HDRB 2ZM6B 1IZ9A 3BJRA 3ZLUA 2A0XA 3GVCA 3FPBA 4AQ7A 3I9JA 3BB3A 1WU7A 4OA8A 4JYPA 4I1IA 1BIFA 3MJFA 4PIMA 4NBLA 3FYHA 4XLTA 5E7IA 3ZTTA 3MCUA 1UJ2A 4GNRA 2MDTA 2EBUA 1GZ4A 4D6PA 1CJSA 3O5AA 4OYLA 4TS4A 3FIJA 5KOIA 1L5OA 3RC7A 1M74A 1RXUA 1IAVA 1W85A 4GBGA 1KBOA 1E2DA 2OFPA 3K96A 2GS9A 1G63A 2Q4EA 3AM4A 3FETA 4YAKA 1Z6QA 5CDSA 4URXR 3HCCA 3RADC 3VKWA 2ODBA 2GM3A 4KXXA 3HUFA 5K0JA 1JVNA 3I73A 3HR7A 4J0GA 5D1HA 3L4BC 5ESWA 2NTNA 4FU0A 4M9CA 4JS0A 7AT1A 1IZ0A 2AFHB 4BMXA 2B20A 4B4OA 2P4HX 4OQQA 1EWRA 3L4BA 3WC4A 1QWOA 4V1CI 2BFMA 3G8BA 5TLSA 5H80A 2R65A 2IXDA 3MQFA 3NANA 2OEPA 3HDGA 4EJ0A 3A37A 3KEGA 2ROQA 1RFGE 1XI2A 4H7HA 5JAIA 1ZAYA 2X8AA 1MOSA 3QPUA 4L7VA 2BOVA 2FFHA 3OM9A 1QB7A 3UW1A 1U0BB 2HU2A 4QTUB 4A2PA 4CKCA 2X13A 2IFTA 2HX1A 1UMBA 5AUNB 5DNCA 3Q98A 4G8CA 1PK8A 1LCIA 1IJBA 3Q85A 1T9KA 2ZBRA 3PI6A 3VQTA 2HV8A 3ZY6A 1JIKA 4BIMA 3MXTA 4QLAA 5TMEA 3SHVA 3CKLA 1QG0A 2W2PA 4NP6A 3VO1A 4J7XA 4BCBA 1VB5A 5IJWA 3H3XA 1L7EA 2CMDA 1TVMA 2CFSA 2CC2A 2X9NA 3JWHA 1A8SA 4A5OA 2ZIWB 5J63A 3KXIA 3CA8A 4A27A 2PH5A 3N0RA 5CA1B 3KOUA 3ND7A 4FOOA 4R9VA 5H8WA 1K75A 3V7UA 2R8EA 4QUHA 1EUDA 3E5NA 1UM9B 5A7HA 3NVKI 1CETA 3DE5X 2FP4A 3LY8A 3PRHA 4U2KA 2RGAA 1CVIA 2BHLA 2ZAYA 4X6UA 2WMYA 2PH1A 3CLTD 3DMTC 1RQLA 1TUGA 4INOA 4JBYA 5DHTA 3TKAA 5HE9A 4EKYA 5JMTA 1JZSA 4QGGA 1TT7A 5DI9A 1Z33A 2FUCA 2Q2WA 3DMTA 3I1JA 1QNFA 1Q11A 1YDFA 5BW4A 4IXTA 1NLMA 3NTRA 3ILYA 4R1TA 1FRNA 4BRZA 1EE9A 2A33A 4UBMA 3UMSA 2HMVA 3HRKA 2NOAA 3ZQUA 5TS3A 4M83A 2Q6IA 5IARA 4BWYA 3IXQA 4GSKA 1MQSA 4KAAA 4ZAGA 4IAOA 2CY0A 3D3EA 4Z1MA 4A36A 3VPSA 2JLXA 4ZO9A 3EGIA 4B33A 3ES9A 3KYCB 1RC1A 4E5YA 1UBKS 3FJYA 1CB7A 3AF5A 1L6RA 3EG5A 1ML4A 2QOEA 4REOA 1JU4A 3RT9A 1N1DA 2XRZA 3QVXA 4OQFA 5T6MA 3TUZC 2QV0A 3TCKA 3VU9B 1G8MA 5JMWA 1Q7CA 4LMRA 4URYR 5IXJA 1EVJA 5K5EA 4FHGA 1KC1A 4AJ1A 1AMOA 2ZJ5A 3TOCA 3LTNC 2OXEA 2FSGA 3EB9A 5L51A 4CL3A 1VBMA 4I81A 1DX6A 3S1AA 3U40A 4BKMA 4CPDA 1PE0A 2YWFA 1BRMA 1E6EA 1WMBA 4HN4B 3OJEA 4ER3A 4MCIA 2DQZA 4IQGA 2B8EA 4Y1RA 3L49A 4UDXX 5BW5A 3PS9A 4LOIA 4UVHA 4YJGA 1MORA 1QDEA 1NRIA 2YVLA 4BNZA 4EKEA 5LXTB 4IM7A 2V3CC 1NC1A 2GASA 2HWYA 3B5JA 3Q3HA 4ZWNA 4A2QA 5TX7A 4B5LA 2IHTA 2X19A 1W1UA 3CR8A 3EIQA 1AK9A 3KPYA 4B8WA 4CL0A 2XCRB 1VOTA 4K6CA 3MJVA 2B25A 2YJNA 4IILA 3ANSA 5CLIA 3OQHA 1CEQA 2BJWA 1Z4OA 2I8CA 1VL6A 3GZ4A 4J1NA 3SOPA 5L4SA 4M46A 2DT5A 5FXMA 4S1PA 1BJKA 5JANA 4PXSA 5BVHA 5FWYA 2XXJA 4IXDA 5DYIA 3T06B 1T1EA 1E0SA 7MHTA 2CUTA 3A25A 3FKJA 3OTIA 3R8FA 2OUIA 5F51A 3TRKA 3M5CA 2Z30A 1MX5A 4LV6A 5IMBA 1CP3A 3THWA 2AJLI 1IN1A 1E0KA 1FDRA 2X8JB 3K9WA 2GXAA 4IJ6A 4EB0A 3KYIB 4OGWA 3GLQA 3EPJA 1AS3A 3S28A 2HNAA 2MINA 3FBTA 4MTCA 2KLHA 1HKUA 2AOVA 4XM2A 3JASA 3PHIA 4IGIA 1F1BA 2R8YA 1TQ6A 3W4JA 3EVFA 1N8NA 3HI4A 4L57A 4LBVA 5ALKA 2PQ2A 5CCEA 1SVUA 3WTCA 4P7GA 1XNHA 3PQ5A 1U99A 3BICA 4EK9A 3DEKA 3EJ6A 3U81A 1K97A 4QQFA 1DINA 3LAWA 3AGQA 3LY7A 4GE0A 1VGQA 1DAIA 1GQQA 2Z57A 4QU9A 3B6IA 3KL2A 3C3EA 1ISSA 3LTEA 4AX8A 4CKWB 2PGNA 1T2EA 1UIRA 2P4QA 4OAPA 5KOYA 4MVCA 3NB0A 2DTXA 1RWXA 3B2QA 3BA6A 5I7AA 2YWCA 4UU8A 4PZUA 2C94A 3T3HA 1R1DA 2R86A 1LTQA 2VYCA 4ND8A 1KO8A 1ISHA 4JQYA 1CQZA 4QNRA 4RIIA 4CTMA 5I7WA 3HY4A 3U7QB 3GEDA 1RXCA 3I9NA 2IYFA 2E4XA 4UM5A 3K4QA 4RENA 1LJUA 1OWNA 2Z5FA 1QGDA 1XMSA 3JATB 3K94A 4FR2A 4KDCA 1T13A 4PZAA 5F1OA 1DWOA 3P4YA 1KOLA 4UFNA 5HOQA 1RKBA 4AT1A 1THMA 1XL1A 1NLYA 4OQ4A 2WIGA 1AV7A 2B8JA 1D2HA 2I99A 2TMYA 4LEIA 4XD7D 1R6TA 4KR9A 3DB1A 2WMOB 1NXQA 1ZOSA 3ET5A 2VHUA 1YRBA 2BM0A 2AF3C 4EA8A 3A9UA 3B53X 3X2EA 1KMHA 1X38A 4V1CB 1J07A 4EHJA 2V9PA 2P8SA 4QAJA 5KS2A 4DDMA 2A5FA 3T34A 3Q2OA 3HXMA 1E3TA 1GAEO 1VSTA 3PR2B 1KK3A 2FUKA 2JW5A 2NVUB 5L7WA 3TK1A 1WMEA 1MRNA 1W34A 1N3LA 1UBGA 2GCGA 4UM9D 1R7RA 3I42A 4S1WA 5KYVA 2BCEA 3RANA 2XUQA 3VU0A 1ORIA 5JQGB 1TZJA 4ARUA 2OOKA 2ANBA 2H92A 2I4MA 3T8YA 2E82A 4IEIA 5HZGA 1ZM2A 5HGJA 3Q8KA 2OSBA 3L1UA 4Q9LA 2QZSA 1I32A 3UJAA 2RHCA 4O02B 4J16C 5G3ZA 4HLCA 5AI0A 1XCOA 1SXJC 4N40A 2V96A 2Y67A 3GW8A 1SQ5A 1AQYA 2JGJA 4N8SA 5CX1B 2J5KA 2GAOA 3JVIA 1A8HA 4YRRA 1SXJA 4YAIA 3INNA 1ZH0A 2ZDHA 1V2HE 4FOLA 4FN5A 1F2UB 1L1FA 5LMZA 1NULA 4XWTA 5G0WA 5JXIA 2GN0A 3UKDA 3OFJA 3AY0A 1DZIA 1L5NA 5EJMA 3EVEA 2QY9A 2VCYA 3OWOA 1D5CA 2RC6A 4KMSA 3OEEA 5B57C 5JXHA 5C8ZA 4CTKA 1G5TA 1YDMA 3OZFA 2PVCA 1VRVA 3I2GA 3QELA 4R71A 2ZRFA 2WE7A 1CUJA 3BD9A 4FC7A 1EGVB 2AH5A 2VAWA 4GHWA 3P2JA 3T0IA 3VPGA 3QK7A 2QLTA 4OHBA 4CT0A 1HNXB 1QGED 4O2BF 2X40A 3VX3A 3W9BA 2R6AA 4D4IA 1FP4A 1RKXA 2M2IA 4HDNB 5ERGB 3PJRA 3OP4A 1QIMA 4MPJA 4PZPA 4YJDA 5I9BA 3R9IA 4HHEA 3LXRA 1JR3E 4OUDB 1QP4A 4MVJP 4KYTA 5EI5A 3IPYA 1EFHA 2GVZC 3ULKA 3WOVA 4D8TA 2CLHB 5KMGB 3DWGA 5EHQA 3T5CA 4A82A 1TGVA 3L93A 1N3BA 5C0OE 1IZYA 3PQFA 2R25B 3OEWA 4CMHA 3EDQA 4EEXA 5M29A 4H60A 5LP6C 1CJBA 1OTHA 4QRDA 4C0LA 4JWKA 4QL3A 4OFXA 5DYTA 5E1BA 1CLEA 1S4MA 4PYQA 1CWUA 1B7GO 2CFTA 2ZRHA 1F0PA 4MR9A 4OXIA 4DRXB 3SJBA 4ID3A 1ORDA 5B36A 4YDQA 1SUSA 5LP6A 1KBZA 1SY7A 4CFSA 1ZSNA 5JV5A 3QUQA 4FYJA 2NVOA 5T41A 4GPBA 5KTMA 4IOLA 3OE5A 3BDAA 2C7RA 4OU5A 1ATZA 1ZBDA 4EY3A 4JLNA 3VR1A 2H4WA 2HCBA 3K0FB 4MWEA 7REQB 1OFTA 1QFMA 4M1OA 4AP5A 1XHEA 2I22A 3PD0A 1L7QA 3OLVA 1E9EA 4DG5A 1BD3A 3V4ZA 3OG9A 5COQA 1KY5A 1FXWA 3S3TA 2R5WA 3GFPA 4E6PA 5EP1A 4D4MA 2GZRA 5EL0A 5F2NA 3VTKA 4EF5A 4N4AA 4FI3C 4LV5B 1WM1A 4D9IA 3MJSA 2Q5IA 4HH3C 2G9NA 3E5RA 5CLLA 3JX9A 1CEEA 3O4FA 2WYVA 1QAQA 4BVJA 4FZVA 1ODCA 3ZWCA 1KYTA 2GYWA 3WMFA 1IN7A 3LHDA 5IRCD 2XA9A 1DB3A 1WDLA 2B5OA 4IUDS 2A6PA 5A2QA 4BZPA 1YI8A 2ASVA 4BMZA 1Q0PA 4BFUA 2G09A 2ZTSA 2I8AA 3N0WA 4H27A 3ENZA 3TOSA 4R16A 2C03A 1EFVA 2CEAA 5JYCA 2RKWA 2WNSA 3L1KA 1UP7A 3LP6A 4JKIA 5KTYA 1IU9A 3QRWA 2HXSA 4KH0A 2Z4SA 4M99A 4DV5B 2X86A 1E2NA 4GO1A 3H8WA 4M1TA 5BSVA 2HXGA 1EJ0A 4H17A 1BCRB 4BDSA 1J0BA 2RGXA 4EBFA 3GWGA 4MVJD 3AEYA 4RTSA 1U31A 3THXB 3LFUA 2Z56A 5FI3A 1VCHA 4MCJA 3K53A 3O4IA 4Z7JA 4H59A 1SXIA 1L7AA 3KWMA 4EHHA 3L7LA 4RMNA 1CS4C 2FG7C 2P9JA 1S8NA 2XYGA 3PFGA 5JAMA 4RFSB 1KGDA 2CL6X 2W2KB 4IDQA 2Q2QA 2XUPA 1IPEA 3QFFA 5DP1A 5E6SB 5A9SB 4LF4B 4GSYA 2HOQA 1H3EA 1W6RA 4AKEA 3JYOA 5LJLA 3QVTA 4HWPA 1G98A 4IDCA 4EW1A 2GCIA 3D7MA 1MA0A 4GZMA 1S2NA 4Y1EA 1IEWA 4OB7A 4IDHA 1E64A 4YYZA 1SIUA 5NLLA 3V6MA 4D41A 1MBZA 2GEKA 3FB4A 1Z5GA 1RZUA 1OY1A 2JCSA 5CFNA 5TT1A 4AG5A 3KLBA 3LDGA 4GLLA 1TADA 1AGXA 2AMJA 1U2TA 4H7IA 1UDXA 3BX1A 1QKKA 3TI9A 5DM70 5FNVB 3W8DA 4P4SA 4PO8A 2DFLA 3ZU4A 4BO5A 4EVSA 1MTOA 3L06A 2YXEA 2QTAA 1Q21A 3S29A 1OFHA 2DUMA 2JJ8A 1CDOA 1VXRA 2AQIA 1DBWA 2R1ZA 3HKBA 4BC1A 2XMCA 2YMQA 3EFEA 4OGFA 3Q7EA 4UCWA 4PSUA 1UBHS 1VKOA 3EH1A 3EWAA 3GJ4A 4LQDA 3MWGA 5M5BA 1U2QA 2YVQA 4FJ1A 3B3QA 4L0QA 4PBSA 1JP7A 1G1AA 1Z9BA 2JFUA 4I55F 2ZIFA 2FTKE 5FL3A 4CODB 5DHQA 3DE7X 4FZJA 1PV2A 3LZ6A 1XNQB 5F9HA 5G1PA 3P2EA 3WJAA 4Z8XA 1HLDA 3FFTA 1UADA 3VZPA 4A6DA 4JP3A 2B9VA 4B6EA 2XVAA 3TTWA 1ONBA 3VNVA 4HDOB 3RHFA 3VR5D 4PLPA 5IG2A 2A0FA 2G36A 1SMKA 1FQJA 3OAAD 1A2BA 3BBLA 2G0TA 4PQYA 4Q03A 1YRYE 2QXYA 3S1SA 2DTEA 2DT8A 5IKMA 4YPFA 5TF4A 3TZKA 4MS3A 2FW8A 2ZYIA 2ENUA 1X1BA 2X23A 1BXKA 5BN3A 3VSBA 1C0LA 4K9OA 5AICA 1ZK4A 4QO8A 2D1TA 1Z5NA 5BWOA 4KK4A 5EIFA 1JDUA 4CN9A 1G5RA 1M8GA 1RJFA 1YRWA 4NENA 3PQ6A 3WS7A 3SF0A 4Q1BA 1OVMA 2VHXA 2VUIB 1E0DA 2PHZA 5GP1A 3SQNA 3MINA 3TDNA 2DLCX 3ABZA 4O2AA 4QYIA 3MT9A 3ZWDA 1A4UA 1D0SA 2QJFA 3P0HA 3TZHA 2MIIA 3HZHA 3GPLA 1ZK3A 2IXTA 3RS8A 3ZCQA 5KAMA 1J9EA 2Y99A 1G0NA 1USWA 3IDFA 2FWJA 4JOSA 1T8WA 4HATA 4BO6A 2QLJA 4NICA 5I5GA 2CYAA 3ER9A 3WJ7A 3PF9A 2FZVA 3SEQA 1S2IA 2WMNB 2PX6A 3K0CC 1SU8A 2DBVO 1YUNA 5AVOA 1RT9A 2FN8A 5GONA 4Q66C 4WXPA 5BSWA 2VHZA 2VNIA 3LSTA 2ECKA 3HHPA 1GNRA 4HWGA 4KBGA 4RKFA 2VHJA 3K0CA 1M67A 1LWNA 3ROFA 1B26A 1MVNA 3ECSA 1ZRMA 4GYWA 4BPRA 3M6FA 2WK1A 1Y34E 1XTZA 3A36A 4CQLB 1ECLA 2PT7A 4RGBA 1UBJS 1ISGA 1CVRA 1P3Y1 1FNCA 3LA6A 5IN4A 1UK6A 1RLOA 3LQKA 4P7FA 4X1YB 1ILEA 2ZUDA 1P2FA 4TQUS 1W4AA 3T52A 3WL6A 1U2PA 2KMLA 4PXYA 4F5ZA 1HMPA 2AZDA 4WZBA 2Q5JA 2CJWB 3RTAA 3L1HA 2Z2JA 1KDVA 1SKAA 3JQAB 3OZ7A 4JYZA 5LUAA 2PD4A 4NCBA 2I9PA 1U7HA 4IDEA 3QTBA 5JBNA 2QRKA 2O8FA 5EWJA 3D6NB 4GWLA 4NG4A 4LQLA 2XVYA 1GVHA 3QMVA 4M0UA 1VSUA 2QE7A 4DKJA 3DVSX 1RRKA 2H2AA 3VV3A 2UVDA 3DMDA 4PLYA 4BUCA 1RPTA 2QT9A 4KWHA 4ND4A 5FLEX 3DEZA 2B4TO 1MB0A 2AQKA 1T9AA 5EHIA 5WRFA 3SQOA 4CM8A 3CG4A 1GZ5A 2G9VA 2B7LA 1GDTA 1XZNA 1U7PA 1WZNA 2UYHA 1AK2A 3ZWYA 2IS1A 3MRXA 4M87A 2W2LD 1F9EA 3GJRA 3U7IA 5F9FA 2H2GA 2PAAA 3D8HA 4ZCSA 3NKFA 4LZZA 2RGDA 4NCXA 2ZDQA 1I3LA 1T8TA 1YZUA 3QFTA 3SS7X 5K01A 1QF6A 2WD7B 1XQWA 3CS3A 3HH8A 4OHOA 3SYMA 4C4AA 1P77A 5JHHB 2XXBA 1MNAA 4RK4A 4WOBA 1H9CA 2W00A 2HJWA 5A02A 3WYEA 3G59A 4KQXA 3GCGA 3TSWA 4TSRA 4D9MA 4CDNA 1Q12A 4E13A 4TKVA 5BV8A 1U5AA 1PR9A 1P4HA 4BAGA 3AG5A 4D57A 1SQSA 2CF5A 2Y4OA 3HU3A 4TXJA 1RXYA 1RP1A 2NSJA 3R7SA 3CLSD 5E4FA 4D4JA 3R0ZA 1AZSC 1Z13A 2NVWA 3B1FA 3H86A 5ALHA 3WNCA 4R1MA 2A9JA 1E7YA 1O94A 1W44A 3DE1X 1HETA 2AA3A 1E66A 4JKOA 1ZS9A 2ZITA 2D3TA 2OCDA 1VJDA 3IH5A 3B1YA 3I58A 4A91A 4EITA 3BT7A 3F6RA 2OCIA 5EINA 5LYJA 3ZTYA 3QBTA 2R7AA 3QBVA 3SY8A 3FY4A 1AGYA 2RBEA 5ALEA 1JG3A 3R7BA 1KI6B 1O0CA 3DMHA 4G5RA 5CK5A 2Q1YA 2BEJA 2FFRA 3GOQA 4YUYA 3GLRA 3BZUA 4L3VA 3RTBA 4M6WA 1RVDA 2BZ1A 2EP8A 1E1CB 3H18A 3QXJA 4GPD1 4YMSA 1Z45A 2XT6A 4XEUA 3SJUA 2NT4A 5CLFA 3RJTA 2VA9A 4OXRA 3HO1A 2A9QA 3NC0C 1DP4A 3NOQA 2XIJA 3HJNA 2AEJA 2CWDA 1USGA 3I28A 4ZJYA 3W5AA 1KF0A 1MDBA 3C3DA 4GIBA 4WV3A 3AY3A 4IV8A 1ECGA 2HDOA 3NTXA 5T3YA 1KJIA 1SHUX 1DIRA 3IR5A 3G0DA 4BXOA 2CXTA 2ZBDA 4YECA 2DX7A 1X7HA 2EFEB 5ICFA 4AYTA 2MYNA 1AHHA 4G2NA 4XQEA 3ZPXA 1QFXA 4R9NA 5B4TA 4D4KA 4ZU6X 4FR5A 3I32A 3KPVA 3ZH2A 5IJ9A 3LKBA 3M4NA 4NNPA 3L7CA 3PLNA 3H16A 3WHPA 4XH9B 4LFBB 3CZPA 4REMA 5L3VA 2O54A 3PXCX 5KNDD 3T3NA 2GN1A 2M1XA 4HQOA 4LJAA 4UZSA 3ZW9A 4H3HB 3LX5A 5P21A 2E37A 1FU8A 4FUTA 4PIVA 1YB6A 5HMMA 3MC1A 4AY6A 3P9IA 1R6XA 3ILXA 4JK3A 4YO8A 2E1PA 1GQSA 4TT8A 3R5SA 3ETHA 3ZLTA 3OT4A 5EA2A 4BB6A 4DLBA 5FUQA 3WLIA 1JDVA 4FMBB 1TX4B 3ZK8A 3HJUA 2O2CA 1QJ4A 4C6HA 1T6XA 1CJCA 2IXAA 3GLIE 2G9QA 4OH1A 4QLOA 4D0RA 3RG2A 1KZGB 1G6KA 5C8DA 3GDHA 3DVAA 4ZDIA 2V7PA 4HXFB 3QH4A 3UA3A 4UM7A 4IEFB 4YAJA 2EEPA 3EWSA 5EZSA 2YQZA 3WVNA 4EMTA 4NPAA 5DW0A 1DS6A 3W04A 5KOHB 1DEOA 4JI5B 5AFSA 1DG9A 2VTBA 1M76A 1OJLA 5LP1A 4IJVA 3MCTA 3GPCA 4B84A 4BV8A 3LLSA 4RDHA 3DCYA 4HWTA 4BGIA 1GSAA 3R7AA 2FN9A 1LKZA 4KU4A 2DWQA 2YXLA 3BZBA 4M0MA 5U9CA 2ZYWX 2YQ5A 3O21A 1JTVA 2QV7A 1F8XA 3CEMA 4LOKA 3WGNA 1B15A 1BXRA 2GPBA 1G7TA 2BZSA 2PMDA 3D7NA 2J48A 5ALUA 1EFUA 2GGSA 2W0SA 3HFSA 3O4GA 4ZAVA 3WDSA 2XYPA 3GMTA 2ISCA 4NU0A 3TVDA 1YTUA 4PYNA 4A0GA 2H4YA 3OPYI 2K2WA 1PJZA 1UR5A 2C88A 1QP0A 4QOEA 4DDWA 2AT1A 1SO8A 3RROA 1A3CA 3O93A 2Y0EA 3GLKA 3LP8A 3HKEA 4H3SA 4HO1X 4Y2SA 4DM3A 4BAZA 1N2JA 1M6VA 1Z0IA 4F8EA 1QP8A 5JTTA 3VSAA 4W7IA 4RWEA 1E2KA 2AN9A 2H1CA 1LVHA 2PJZA 2F1HA 2RHWA 3CPEA 1G16A 3IULA 5LCXA 5JAZA 5K4GA 3JAMA 3GUHA 4RTKA 3OE1A 3MT7A 1E7MA 4HNAA 3NBYC 5C7OO 2C54A 1TQHA 4JI4B 1OLXB 1AZTA 4HRXA 1ML3A 3W8EA 2I62A 3WG9A 3FMGA 3JQCA 2O8BA 2VBFA 3ONWA 4RIEA 2EG5A 4WI1A 1DV1A 5D87A 4GKAA 4CCYA 4MWZA 4YXWD 3ZDAA 3VMFA 3QG5A 1Y7PA 1JMVA 3KT0A 4GC5A 4HEA1 4YMHA 1KZ7B 1MRZA 4MKZA 4XJXA 5M34A 4GX0A 4EI8A 3OUZA 4OIMA 1TD1A 4R0VA 2XMDA 2FPGB 3DL0A 2QF7A 4DGSA 4E6EA 3PGMA 4HQNA 3K8OE 5BV2P 3P20A 3NAQA 5A03A 1BW9A 1H0RA 3WZLA 1O0BA 5EHZA 2R97A 1TCCA 3DNFA 2YL2A 2OD2A 1P5HA 3DJFA 4TVKA 2R1TB 3L6EA 1PVVA 1RYEA 2XR1A 4KTTE 1V3UA 3R6GA 2CYBA 3M7IA 1IN6A 4ZRDA 5ICSA 2N1MA 4DSOA 1NPDA 3PEVA 1N78A 3W4KA 4KLRA 3GZTB 3AEKA 2J1LA 3VZCA 4TM8A 4TZ0A 1A8PA 1M2NA 3GF4A 2XYQA 1FNBA 3HYRA 4J1QA 5FT9A 5K0BA 1BU5A 4JLSA 2VR1A 1L8QA 2HEIA 3E22A 1FP2A 2WZDA 5DBOA 5TEWA 4A8JC 4C20A 3O8RA 2ZSJA 3E2IA 1L4KA 3DHVA 2NTVA 1LJLA 5DOZA 3UCXA 2ZSBA 4FKZA 1M1YA 4RM2A 2PX2A 4CQNA 4A8JA 2YYZA 5TQ0B 1T5SA 3H9QA 1F51E 3WL3A 4MWSA 4EYQA 2VI5A 1W4LA 4GDFA 3FBGA 2OSVA 1RXIA 1V4BA 2Y0BA 2FX2A 3DAHA 1Q7BA 2FWPA 3CRZA 3LLVA 4WNYA 1CQWA 4NPHA 4YAFA 5LUBA 1A1SA 3V1MA 1RCUA 1ZXBA 4ACAA 4FFVA 1RSZA 5JEEA 2BM1A 4DYDA 1I1OA 3AESB 1KAQA 2QTMA 2YDXA 5J2TA 1CYDA 4LJ4A 4OIFA 2ESRA 4AG6A 4PSKA 4GOKA 2JBAA 5C37A 2XT0A 3HUEA 4RFVA 3H1BA 1U5BB 3JYHA 3PX7A 1XO1A 2QPOA 3M4YA 4M0FA 4CTOA 2MSKA 1QRUA 1KAMA 1U2SA 1JDJA 4RK6A 3SXUB 3PU6A 4J1TC 4LJ7A 5D7BA 1C8VB 2C4TA 2PO7A 3MSCA 4J9VA 2QRVB 1VTKA 1YZFA 3DKRA 3EZGA 3N07A 4HQ6A 3T5TA 3HXLA 4G5FA 3TSYA 4DEXA 4XW2A 4QEKA 1OX6A 2R6R1 3EW9A 2XRYA 3M9LA 3FKSA 4PPNA 4RKRA 5A3VA 3YASA 1KTIA 2TMKA 1HE8B 1Q92A 5ALOA 3HXOA 2AG0A 3KKLA 1B73A 1SG9A 1HFEL 1LNZA 3DZIA 3LT4A 3NTLA 4WKPA 1KEZA 1EFPB 3CTMA 3IFSA 3WZMA 9ATCA 3B20A 3C7DB 1B93A 1RI2A 4UMEA 4F3YA 4MKFA 3DTTA 1K0UA 1ZCFA 2IVFA 2PCJA 2W2MA 5K9ZA 2JIMA 3AB7A 2HEGA 3OPMA 4RC9A 4BNXA 1T4BA 1D7OA 2C2XA 3VJLA 4EABA 4TGLA 4F97A 1ZN7A 2Y2VA 3KDSE 4RK5A 1ZIXA 4NBKA 4BNYA 1EM8A 4L78A 4BX8A 3F5SA 3A9SA 2O3QA 3E1KA 3HN7A 3IIEA 1J70A 2ZB2A 1J7JA 3C2QA 4QIHA 1NXVA 4PU0A 1POXA 4YQZA 2VC2B 2XTJA 2YV5A 1E59A 4KSCA 3RT1A 3MAJA 3SEFA 2VDWA 3ILHA 2I8LA 1XLWA 3HPQA 4KVAA 1IOLA 2AN3A 3A3KA 4C0QC 1L8LA 1GNQA 4MV9A 1V7QA 2CCGA 2WA2A 1HEYA 1PWYE 4HUQB 3QSYA 2DWUA 2Y9PB 1WV1A 2HCTA 4TKUA 3JD3A 3ZYZA 2B35A 4B4DA 4RGVA 1OILA 2W2XA 1Q17A 3FHTA 3JD0A 2ZJ6A 3ONNA 4DA0A 3DV9A 3E61A 4ZJZA 4RJTA 3UCEA 1TIPA 3TLCA 5CB6A 3EPHA 3BA1A 2WU0A 1Y1TA 4F4FA 3ZHYA 4HAXA 2I29A 4UQPA 2ZSIA 5JAQA 1G64A 3R76A 3WL5A 4ZV9A 4C7VA 2QZPA 4IDFA 4RVGA 4B3JA 3KQQA 1VBNA 4GM4A 3DFMA 2O2DA 4ZT7A 1V25A 2XYHA 4R1LA 3Q6MA 1V9CA 1BU8A 1LZKA 3EVDA 2WZCA 3QU7A 1PL8A 3QVJA 4H4EA 2ZSDA 3SKYA 4L22A 2ZROA 1PYOA 4A0HA 4IQ4A 3GFGA 2ZJAA 2XBLA 1TGYA 4K9DA 4FSHA 2A1UB 5AVWA 3IKLA 4R7ZA 2ARKA 2DWOA 4P0TA 4L74A 2B7CA 3D3WA 2E1RA 1T2DA 2Z83A 4V38A 3Q3CA 3J81k 1GCAA 4RH1A 1AKUA 1WCV1 2PU5A 1J9ZA 3N7UA 4H1VA 3FGPA 2IDMA 3CSDA 1PQYA 4KRFA 1EZ4A 4AWAA 3OPYB 4MMXB 1MIOB 2XKJE 2QIOA 1LZLA 2QENA 1CKEA 2BHRA 2ZAOA 3LYHA 4EY8A 1I1NA 3T41A 5JJBA 4DA8A 1U63A 1UC5B 5EZ5A 1N9GB 1Q6YA 3G8YA 3LX8A 2QLBA 1R3UA 3FNBA 4MIEA 1S1CA 1T3GA 2FR8C 1DXYA 3QXGA 4UE3S 1GNVA 5FIUA 3ZW7A 2WAOA 5FUVA 1E8NA 1EK2A 1BD4A 1A88A 3HVKA 2FR8A 3ZI7A 1GYRA 3GJYA 1RHJA 4ARBA 2EDAA 3EWIA 3V7NA 3LQQA 1XELA 4C78A 5ARBA 1IJFA 3A3YA 3M6AA 4KNWA 3ICQB 2O5VA 4J49A 5HM8A 4WL0A 1WB6A 2PKEA 4G0ZA 1SUEA 2PUFA 1TT5A 3P4XA 1Z8NA 3CONA 1XQ9A 2DUWA 5DT2A 1FSSA 4YPVA 1SA0B 3R5KA 3KZCA 2XGSA 2HQBA 1QVVA 1KVQA 5FLKA 1EJ2A 3JWPA 2O7NA 1HT1E 1KFJB 2WLSA 1ADGA 3PITA 4FWIB 5A5GA 4URUR 2YHSA 2XWSA 5LBUA 3I1YA 2V7EA 3U3RA 3EZ9A 3ZI4A 4H6PA 4BJHB 3RHSA 5CYGA 1X80A 2IWHA 2R8XA 1GZVA 4TL7A 4YUVA 4LNUB 4AZVA 4M0DA 4CDGA 4ARZA 3BB4A 3VMMA 3GLHB 3VM6A 1PWHA 4N3NA 1T3SA 4YA6A 1N4AA 1RKUA 3D8BA 3PX3A 2VSQA 3EUWA 3MOIA 3EXEA 1UXHA 2C7BA 4Y2XA 1IATA 2ZT8A 1Q22A 3BMNB 2EBWA 2QUJA 3D0KA 2G88A 4JITA 1KH2A 2Z6QA 3CB2A 5ICEA 4KZPA 4R2HA 2HLDD 1TECE 2DHCA 4J43A 3Q7IA 2AUMA 4KR3A 1T5LA 4BLTA 4C14A 2D5LA 1U0HC 3T5AA 1GFIA 1FX0B 2FW6A 2GZMA 4EL5A 10MHA 2QYSA 4JI0B 4C0HA 1JA9A 2GK3A 3ROQA 4X60A 2SECE 1JFLA 4E2WA 5F1KA 1VRCA 3EA0A 1EXWA 2JFQA 3AVVA 2BKLA 4JBLA 3LPAA 1G60A 4UDOA 2P1DA 1PGJA 1GTG1 2PV7A 3H05A 4DREA 1WZIA 4EPTA 5KYKA 4MVJM 1HYHA 5E8RA 3AEUB 1HGXA 3IEVA 4NBSA 2QRZA 2CGEA 1YC5A 4TT3D 1UOQA 1TF2A 3FYDA 3PC8C 4MIYA 3E8XA 4NI5A 3TW6A 4C5BA 4KYVA 2CHVA 4W9MC 1MAUA 1L5YA 4XVQA 4TUYA 3GZJA 3LQFA 3U1TA 2G5TA 2GBLC 3RJ9A 3IP7A 5BNTA 1V8DA 4L0MA 3HZRA 1K7EB 3P9CA 4LBWA 2QTRA 2GBLA 1HOTA 1VBKA 3PLRA 5B58T 3TW4A 1PGNA 2R44A 3PTAA 1BWSA 1HDZA 2EKLA 2WWXA 3ZGVA 3KPWA 3C6YA 4BYGA 2ZRNA 3C3AA 4ZZ3A 4DXHA 3L0ZA 1OKKA 1M7BA 1NLUA 1MH9A 5HKOA 4TROA 2FUG1 3C6QA 1WKCA 3ZBQA 4CHTA 3UMMA 3D6JA 4CEJA 2X8LA 4Q00A 5DBEX 3O03A 4PAGA 3HB1A 2E48A 3GVIA 5BQXA 2VAMA 3NM4A 4MAMA 2A94A 3NUZA 2YTZA 1MW8X 4CLRA 1VSQA 1NY5A 3GJ3A 3VOTA 4DADA 5EE9A 4EB8A 4LOLA 1JW9B 1N5JA 4YJFB 3HYSA 2IPAB 4ZT5A 1XNJA 5LZ5A 1N2CB 3QKIA 3Q12A 4UVGA 1RYBA 4KYIB 3WQHA 1KZ6A 2WA1A 3A9VA 2AG5A 3HY3A 4N82A 1I7LA 1I4LD 2ADFA 5F35A 1XXHB 1KHHA 3OHPA 4A8PA 1ZSVA 1E2PA 3O3CA 4YJHA 4MYDA 1ATIA 4H7EA 4HNVA 3THYB 3DR5A 2HPAA 1Y9AA 2IHNA 1C3EA 1W30A 1RYHA 3IPLA 4HX2A 5F1PA 5IMSA 3ZKWB 4YWJA 1AXEA 4DC0A 3W5VA 3R6DA 3MS7A 5GJBA 4FIDA 4KFTA 1DAHA 2FSVC 2POQX 1OXKB 4M54A 1H2XA 4POAA 2ZRJA 2NAFA 3PEFA 2ZWOA 4EJ6A 3AERB 1MMFB 1QX3A 5B1HA 4A0FA 3U16A 3D0RA 1MENA 2OZLB 2ORWA 2NQTA 3AKEA 5HILA 3WMWA 3H2IA 4EVIA 3ISTA 4I6EA 4ZYWA 3ZJ5A 3R4VA 2G1JA 1DV2A 4QJ5A 4UMDA 1QV6A 4DMCA 3NBKA 1QH1A 4N54A 3B3FA 4PZ9A 1UJNA 2ID8A 2WWGA 2EKBA 4IVNA 1IC6A 1DCTA 1YOBA 1KQ3A 4I5FA 3UT0A 4MZDA 1E2MA 4BV2A 3QXSA 2JKYA 3CUEF 3D54D 1UQTA 1XDSA 3B3JA 2O8CA 1XKLA 4OP1A 2Q6TA 3DAPA 2VNJA 4QHTA 2DBZA 3KCQA 1A9ZA 4CU5A 3T7DA 1PUJA 4HJXA 4JL5A 1FC0A 4BNMA 5BRNA 3ORQA 1UJBA 1EIWA 3P9RA 2GJ9A 3ITDA 4ON9A 2IUYA 1JG1A 4C5AA 1QQAA 3PT9A 1TO2E 2CVPA 1P72A 2QAGC 3G3EA 1NYRA 2WPDA 2J7PD 3K0EA 4X7RA 3Q8LA 3LWBA 3BE4A 5F7ZA 3FMVA 2XE8A 3UWMA 4X65B 2BE9A 1LK5A 1RE1A 3G7SA 4NAUA 4OHRA 2QAGA 1GGNA 5DE3A 1NUTA 3W1WA 3AM3A 6NULA 1T1GA 2D59A 3OE7A 1JHRA 1KIMA 1M1ZA 3MTQA 3OZUA 3MWEA 2WAXA 4J2TA 4CLDA 2PUAA 1XCJA 3HLKA 4A0QA 4Q39A 2IH4A 4AS1A 4MUEA 2HQRA 4BMSA 4DJ5X 1AO3A 1O5OA 1K8XB 2NUTB 4RS4A 5AXAA 4WACA 4FYHA 1WZCA 1NQUA 4UTRA 3TSCA 1VE3A 3GD7A 3QVLA 4WUVA 3M8KA 1HURA 1UMCB 2OCGA 1Y63A 3ND5A 4OEHA 4TMYA 3D3KA 1W88A 5HWSA 2XQIA 1M2OB 1PYGA 1UPXA 1VGRA 3DBHA 2C7GA 4HSEA 5GV8A 1QRTA 4ODIA 1E3QA 3GYBA 4DS3A 4Q7EA 2WSLA 1RTTA 1IB0A 1NVWQ 3BK7A 4DYHA 3IHKA 4BFWA 5IBRA 4TLAA 2X8WA 2AMFA 3PPIA 4Q4HB 4OOFA 1FTYA 1QUEA 1A7KA 3DT8A 4LKRA 2CLSA 5J2UB 2CVQA 4AN4A 2RG1A 4DWWA 4ZIRA 5K6AC 2HRQA 1Z6PA 1N5MA 3EARA 4TV9F 2J0EA 4MGYR 1XHFA 3E48A 1M8FA 3U4IA 5K6AA 4PSAA 2B61A 3OOJA 4OF4A 4UUQA 3RTCA 2W6MA 5EGSA 4Y9TA 3BPSA 1Z6XA 1AKQA 4HDKA 4JUBA 2F8TA 4X3CA 4Q1DA 3BWCA 1KQPA 1HQYE 3NRBA 4M7OA 5ALDA 1TF7A 1UC9A 4L4YA 3SFTA 3PXDA 4KPYA 4DB2A 1H05A 5BSEA 2JLAA 3IALA 5DI3B 4TMWA 2LKDA 5ITZB 3ITNA 1QQ7A 4LHEA 2W83A 3HNPA 4A16A 5JSQA 3STVA 1X1QA 1EG2A 1UXOA 1XZDA 1XTKA 1JHOA 3LZDA 3KQPA 4QQ8A 1O5IA 2Q6VA 3IE1A 2CKDA 1C4WA 1G1MA 2H51A 4FGZA 1XCLA 1V5WA 2JLCA 2PL5A 2PWYA 3DZKA 5EP2A 2CDBA 5HKAA 2E85A 1D2RA 4BASA 5AXBA 2D1SA 4ZDKA 2LRHA 4MRVA 5C32A 2I80A 4WZAA 3ZD6A 2CBGA 2X42A 2FN4A 1G6OA 2WJ4A 1F12A 1QO0D 1PEAA 3JZIA 3N2ZB 4F45A 4OM8A 2IELA 1UFRA 1Z82A 2PL1A 3K1YA 3LL4A 1JR3D 5IU6A 3ELWA 1SEVA 5BSFA 5IN5A 2HO4A 1EUCA 1QR6A 1PDVA 4GECA 1NHWA 1F3OA 1F2TB 4BAUA 2RBGA 4KPUA 4WASA 2BUBA 1TAQA 1T10A 3TW8A 5CFPA 3LT0A 1EFRD 3FZEA 2DQKA 3G9XA 3T7CA 3VNUA 3BOSA 4YRBA 1SUAA 3VU1A 4Q3LA 4GXTA 1HX7A 3GT3A 3SX2A 4ESHA 1E4EB 1FFGA 5CH8A 2PY6A 5TQ2A 4DMRA 1NURA 4NBRA 3QE2A 4QOHA 2Y0CA 1ESCA 2LCQA 3GP5A 4O4IF 4O5OA 3GRCA 4NBUA 4D9EA 4B83A 3A1FA 1N34B 3A6GA 1X74A 4P31A 1GDDA 1I2AA 2Q3JA 3UA4A 3JCZA 3OT1B 2PSEA 4TV8B 3R3ZA 4DFDA 1Z18A 3I0MA 4JA2A 4N5LA 5I8WA 4D3XA 3CKMA 3UQYS 2Y4NA 2QMOA 4OHKA 4IINA 1GTVA 2BFDB 4PAWA 4INZA 1Y8ZA 4JGIA 3AXSA 3ZZUA 3W6OA 1BA3A 2WHYA 1XD2A 3IOMA 4KRYA 1HTBA 4X8OA 1Z4JA 1EBUA 3ZUGA 4CIDA 4ZCIA 1GRNA 1UWVA 3CHYA 2ALJA 2JGIA 2BR5A 2X0RA 3FMIA 4Q4LA 1P33A 3RWBA 3SVTA 3ZU5A 2JIZA 4NMMA 4KQEA 2PCLA 1J39A 1GPYA 1T0PA 1SVIA 1UWKA 2B98A 3RABA 2PXAA 3M9WA 4J7UA 1WSBA 2YJGA 4JUCA 4PYJA 4EX6A 1ZRSA 3HLTA 3ONVA 3RBXA 1XF9A 3RC9A 3V4FA 1P9WA 3N2KA 4EYEA 1IZZA 3G85A 1UF9A 4MITA 1CY4A 1L4UA 2C96A 4ZQGA 5EXXA 4EB3A 5G3YA 3U3DA 1YVPA 2W71A 1KMMA 4LHWA 3BKWA 3L02A 1NUSA 3FCCA 4XSGA 3JPWA 4YAOA 1V71A 3AVPA 3V80A 2IUFA 5TEVA 3FWHA 4IP0A 4XDZA 2Y0PA 3RV3A 1ZNYA 3BXPA 1U9IC 3O82A 5CM2Z 5PGMA 1X8KA 2RCYA 1D2MA 2V4MA 4EDFA 1T2UA 1RHKA 1CCWA 4MB0A 2F43A 5G1OA 1U9IA 4PLCA 1RAFA 2VYNA 4JLKA 2X2PA 1BHJA 1G6HA 1MO6A 4OBBA 1ZNWA 4ZXPA 1BEUB 4FGWA 5DTRA 4O3FA 1D07A 5DVZA 2OA0A 3KXDA 3T9EA 3EQ6A 1VYVA 1SWWA 3PF8A 4OLFA 5JRDS 3L1VA 1T2AA 5DJ5A 4CIBA 5FX2A 2GYUA 2VF5X 1YIAA 4GGPA 2Z1NA 4RH3A 3MWDB 4AKTA 2NUBA 1NY6A 4CMEC 3UHJA 2JPDA 5IM4A 3OQVA 5KNCD 1GT91 2RHDA 3M6MD 5HPYB 2ZSEA 2BTQB 2NZ2A 2W6ID 1Z5PA 1PVDA 2XWPA 2H4HA 3EMDA 3KWLA 4J75A 3P26A 4LYFA 3LKVA 2BMJA 3TXYA 4EECA 1VE6A 1HDYA 3BWYA 3I6MA 2LKCA 3GPDG 3JY6A 4RY9A 1NSFA 5NULA 2AS0A 1OBOA 2MR6A 1H4SA 4BKUA 4JY7A 5IDXA 3KE8A 4X6YA 4OHUA 3WL8A 1EK1A 4BGUA 3DD1A 2MWMA 4TN5A 4KHPB 2W2VA 2G71A 3RODA 4GVXA 3OPNA 5C4IA 5BSHA 3A0RB 2PD6A 1CS0A 2BFWA 3F6PA 3NJ4A 2OYRA 4XE5A 4NWIA 3WDMA 1NAHA 1X87A 4D4LA 1Y9DA 3KS9A 3JYPA 2DPHA 1DADA 1FSFA 3S2YA 1VECA 4DAEA 1TW2A 4C08A 5M04A 4J4TA 1KR2A 2XF8A 4CKEA 1P2SA 1G8FA 4HR7A 5IVHA 4BQEA 1DFIA 3DS8A 3EEIA 3VH4A 1F6BA 5DGDA 2CMKA 1TO6A 2XT9A 2IIVA 2KWIA 3K70D 4JI2B 3IKTA 4YY3B 3W9YA 1RQPA 1Y3IA 3MJCA 1IBCA 3E84A 5T4HA 3R7WB 3C0KA 3KRTA 3OBBA 1OWMA 3TE7A 3WGYA 2ZQYA 3QLEA 3QVMA 3QVOA 3V4PB 4D0SA 1ZN9A 2VK4A 1EX7A 3HDTA 3OZRA 4JJEA 1MB2A 4ZV7A 2DKNA 3VTZA 3TF5A 3KT3A 3N2YA 1C14A 2CUKA 4DABA 1PRYA 1EI9A 2DR0A 3GNLA 3PQ4A 5DH9A 4DUGA 4CJXA 4Y6PA 4NBWA 1UDCA 2P5UA 3HB4X 4A2WA 4JH0A 3RCBA 4S1TA 3MAGA 1GUBA 1T5DX 4HAVA 1TW3A 1KEWA 1YHNA 2PL3A 2JLRA 3DMYA 4W7HA 2IE8A 4HNSA 3D1LA 5A6SB 4RSGA 4TT3A 3S0JA 3VPHA 3DZBA 4JT4A 5LZ2A 1XA3A 4G8DA 3GUCA 1G3QA 4NZNA 4AG3A 1ZJWA 2RGWA 1C4KA 4ZARA 4F93B 5EUBA 3VC1A 5LB2A 3MRVA 2OO7A 5EZ6B 3WFJA 2XW6A 1PD0A 1RYFA 3HV0A 4QFDA 3RFTA 4EKDA 3KJZA 3IDQA 5FBZA 1EFAA 1XB2A 4QE3A 4D3DA 1Z6ZA 3AUJB 5A0FA 5KNLA 2QZ4A 4G0UA 5E6UB 3AVXA 5FNZA 3F49S 3KOXA 5I7EA 3CVJA 4I5EA 4TYQA 4GKKB 2OUKA 1XJWA 3PEEA 1JQBA 3CRMA 3HEMA 3M5WA 2WJIA 2V4ZA 4KW7A 3QJ5A 1OXSC 2V7BA 3QP9A 3BGSA 1PX0A 1YDEA 2X5NA 5AJHA 5BSMA 4BN0A 4D42A 4J6FA 1NF2A 2DFPA 3I8OA 5CB4A 1U8UA 2IZ0A 1D6NA 2NXNA 2B4YA 1OWOA 3PJDA 4U2EA 5HG0A 3QEAZ 2Y6UA 1XDBA 1QYIA 3BXEA 4S24A 1H69A 5F5NA 1QKIA 1Y6GA 4D9CA 1A5AB 3IAS6 4FFWA 3NCHA 2G67A 4DIEA 1BNCA 1ZI8A 1NOIA 3INRA 4Y0AA 5B1EA 1Z0AA 4MB2A 2PLFA 1CUAA 1V3TA 3HV2A 1GJRA 5DT9A 4R9SA 4NXMB 1V6SA 5A5FA 5EWLB 3G49A 2H57A 2VJBA 5CDTA 5SY6A 4QDJA 1U1FA 4EB6B 4GPZA 1YKGA 4P3OA 2ZYTX 1BFKA 4GP6A 4K9SA 1I1HA 4NK5A 3BSYA 3FZQA 1XRPA 3UHFA 5I7FA 4C0AC 2GZ2A 1FDTA 4QU0A 2G8LA 1JGTA 1LRJA 1VMDA 3FCXA 3KB2A 2P3SA 4BBZA 3WWEA 5JD6A 3D4OA 1RHUA 5EZQA 4JAVC 5BMVF 1O9BA 2QYHA 4W7SA 3U4AA 1Y33E 2PAFA 4QBHA 1WHSA 1XXLA 3JVDA 5E2AA 4F4HA 2PMKA 2CB0A 4ZOLF 3VR4D 1YF3A 1OASA 1R2QA 2R48A 3T4UA 1T5OA 4ZGGA 3A4IA 5C46F 1IUOA 2AC7A 3MS4A 1JDZA 2BSXA 4O1MA 1VL8A 2GBCA 1O58A 1Y8RB 1THTA 2ZFUA 3I72A 1NBME 3G0GA 2YHIB 2WMDA 3BD8A 3GP3A 5HKBA 4HAWA 2BGWA 1K7CA 3BF8A 4DSUA 2PGIA 3EZXA 4F96A 1BDJA 2X2OA 5DSTA 1JYSA 4EJFA 4EYGA 1YFZA 4J7CA 1AKRA 3ZQ4A 3RRBA 4Z86A 5CNMA 1BQ3A 3FR8A 4YGYA 3BC1A 5AJXA 1PU2A 4R98A 3UENA 1ZQ9A 2RKBA 2HLHA 2EV9A 3FHLA 2MCFA 4N7MA 3M6UA 2WOOA 3PPYA 2EIXA 1DCKA 2ZB8A 1JEYB 4NH4A 2GRJA 2W2NA 5DHAA 2C4VA 3ESZA 1HYBA 5ESXA 2RC5A 3L0OA 4MYSA 3RS3A 3T1VA 4I2NA 1PEYA 4YK7A 1FOEB 3GI1A 1EZZA 4MA5A 2O7SA 5CXUA 5HTOA 1DRVA 1GKLA 3NWOA 3QYPA 1EDOA 3R3XA 3MJDA 2D2XA 2UZ3A 4KC0A 4V3BA 2IZ6A 2FSFA 2Q62A 3LXXA 5ALJA 5PNTA 3ERCA 2C5BA 5J58A 3I2HA 4IFEA 1RI4A 5G4LA 1KI7A 4IGKA 3BE6A 3KLNA 3UAWA 5K8JB 3AUFA 2WIKA 3IAM1 2PZFA 2IW1A 2DCMA 3OM1A 1SCKA 4FNOA 2F7SA 4E08A 2UUCB 3AR4A 1XMVA 3NOOA 3HYCA 3M34A 2WV7A 1W5FA 2G0NA 5EKUA 2VT2A 1XU7A 2CFRA 2W48A 5LQNA 2W6PA 4M9QA 2H1SA 2R2GA 3ZHOA 2AX3A 4DV0B 3HBAA 3RLIA 1CE8B 1JWLA 3H5LA 2HBZA 3O1HB 1QHEA 1T6NA 3G1UA 3KUUA 3BN3A 1ACJA 1VYUA 3NHZA 1T1JA 2ON6A 4FILA 1P6QA 1TM5E 2CLOB 2K6GA 2J3HA 4Y1FA 1PTJC 5A4AA 2VXYA 3N6XA 4U7TB 4EHNA 2VRNA 3QW2A 4ALMA 5I8PA 2JJYA 4Q9AA 4EZIA 3E7DA 2FOIA 5REQB 3M49A 1IQPA 1PTJA 2ETXA 2ECFA 4RETA 3L8CA 2IV2X 4L4RA 4PANA 2VJMA 3OQJA 1HQCA 1Q0RA 5EKXA 1NW4A 4ECAA 1Z16A 2A8YA 1QAMA 3AIMA 3VNQA 1OREA 1EEHA 5EIAA 5KAPA 3RVBA 4KKXB 1M2EA 2C4HA 2VZ0A 3LDHA 2DMRA 2YNMC 5JCJD 4PHFA 3W5HA 1I5OA 1U8YA 3WYNA 3ZV7A 4TKZA 4LC0A 4LFCB 2I65A 2QN1A 3G9UA 1V8FA 2ZXEA 1PS8A 1KKLA 2OXRA 3IUEA 2IT1A 1IBSA 3BRSA 3HKCB 1FFDA 2YNMA 3LDFA 4MUYA 4NMWA 4ZEXA 5IAKA 4AYXA 4BE4A 1KQFA 1TJYA 2PUJA 5IH3A 4MYHA 4QRHA 1IDN1 3GVHA 4RPKA 2OZKA 1IQUA 3OIVA 2IUUA 3ON5A 4CM3A 5IJ0B 3B2NA 1HZJA 4IJWA 4II2A 4TVOA 4CFYA 5K8LA 2MR5A 3MZ0A 4IRUB 1AMUA 1CZOA 3ZE6A 1UDRA 3ZS8A 4F4IA 5K3OA 1H1DA 1GU0A 2B99A 3KAPA 2Z5VA 3M82A 2IDZA 3NIWA 1O4VA 3H8VA 5DLPA 2PKQP 1V16B 3B82A 3KG2A 4YV2A 3GP8A 5DGHA 1F8GA 2P6UA 4KDFA 5AW2A 3DTVD 1NVDA 3W3ZB 3NX4A 4RU1A 4NCJA 3UJ3X 4I1RA 3VFDA 1Z0UA 1G3UA 2EWWA 4ZAWA 4EKIA 1WW3A 1XRJA 3FVTA 2FDXA 4OLJA 5AUPB 2X4DA 4ZO7A 2H5JA 3LYUA 4MWTA 2JFBA 4TQ9A 1DLIA 1A5BB 2DGDA 5EJ9A 1I7PA 4OHCA 1BYIA 2C42A 3EC1A