3C6YA

Hnl from hevea brasiliensis to atomic resolution
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
256
structure length
256
Chain Sequence
AFAHFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroxynitrilase
publication title Atomic resolution crystal structures and quantum chemistry meet to reveal subtleties of hydroxynitrile lyase catalysis
pubmed doi rcsb
source organism Hevea brasiliensis
molecule tags Lyase
total genus 94
structure length 256
sequence length 256
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c6yA00
2RONA 4DMHA 2CBGA 5HCUA 4HZGA 4IH1A 1F8UA 4BAZA 4AN0A 1DU4A 1L7RA 1AZWA 4P08A 3EF3A 4AXBA 4H77A 4IH9A 4B82A 4X92A 2CB9A 1G42A 2QR5A 4UHEA 3DJYA 1J06A 1VZ2A 3FOBA 3WL6A 3R41A 3V1NA 2WSLA 2PSJA 3E1GA 3V1LA 2DHDA 1CLEA 4BRSA 2ZYRA 1WPXA 5CT8A 1A8UA 4CIAA 1MX5A 2VT6A 2WIGA 2GYUA 3KXPA 4DSAA 3WA6A 2CMFA 5K3AA 1BU8A 3Q8WA 2DHEA 4KRYA 4G8BA 2C7BA 1QIGA 3QH4A 3BIXA 3D0KA 4Y2TA 1UK7A 5HFNA 1IVYA 3WK8A 1XZJA 2HRQA 5LZ8A 3DS8A 3W9UA 5EGNA 5AI4A 5JYCA 2DR0A 4C87A 2DFPA 1AURA 2XMSA 4J0IA 5LYYA 4Z49A 3WWCA 5ALSA 4K2AA 5AI9A 2V96A 5I7UA 5ALLA 5AP9A 4DSZA 4V2IA 4UBKA 1WPRA 1K8QA 2VJAA 2PSFA 3FWHA 5FOQA 1W6RA 5C8ZA 3RM3A 3E4DA 4BP8A 1XKLA 1DX6A 3FLBA 4INZA 3HSSA 4CG1A 1DWOA 5CT9A 4ZI5A 4J0CA 2JGMA 2WUGA 3E0XA 3PFBA 4BC1A 3NWOA 5LKAA 1UFOA 5IKXA 5FKJA 3S8YA 2HU7A 3I6ZA 5AOBA 1AUOA 5EHZA 4KJXA 1R50A 4X7BA 4KRXA 5LP1A 1Y7HA 2OGZA 4AQDA 3WYDA 3BDVA 1LPAB 2Y1KA 4Y2VA 3VISA 3B3QA 3B5EA 1XRMA 5KREA 1SCKA 3GA7A 3VDXA 2EEPA 1XZHA 3ZLTA 2QOEA 1ORVA 5HK8A 5AKIA 2OCLA 5ALKA 5ALXA 3BF8A 3D7RA 5AM4A 1VJ5A 3D59A 1XZAA 3R3WA 3WJ1A 4C4ZA 3G9TA 5CXUA 3PFCA 3EQ7A 1XZKA 1AMNA 2HU8A 4FWBA 2HRRA 1WB6A 3L1IA 4BATA 3M82A 4X97A 3FYUC 5AKKA 4PNZA 2HADA 4IQ4A 2OCGA 2XLCA 3IULA 4UUQA 1P0QA 2JEYA 5CT5A 1XQWA 1CUEA 1WHTA 1Z68A 3R3ZA 2GBIA 2HA7A 2X5XA 2I3DA 5BWCA 5EIEA 2LIPA 1GZ7A 4W1PA 2B20A 4BZZA 2EDCA 4AB1A 5AI8A 3OPMA 3HEAA 1VE6A 1EXWA 3GELA 1XRNA 1MU0A 1R9MA 2BJHA 4ZREA 4EBBA 5AHXA 5HFAA 1XZBA 2ZYIA 2C5GA 5ALVA 2H7CA 4J7AA 4QDUA 4QLAA 3H04A 3EQ8A 5CXXA 3WWDA 1ZD4A 4L72A 3ZPXA 5AIAA 4LHEA 5CTAA 1QOZA 3AZPA 3V1MA 1J1IA 3H2KA 4RE5A 5KWIA 3M83A 2P8SA 1FFDA 4Q3LA 3H2HA 2R11A 4BCDA 3F67A 3R0VA 5CURA 4H7IA 1EX9A 2XQGA 3LCRA 4OYLA 2HM7A 1CUXA 1ZGBA 4BB0A 1XRQA 3WZMA 1E89A 4UBMA 1DINA 4ZXFA 2WFZA 1CEXA 4AN1A 2AJ8A 1YA8A 4OB7A 3T4UA 1R3DA 2VQ6A 5AKGA 2GYWA 3KD2A 3MUOA 1U4NA 4WFIA 3I2KA 3O4IA 3JWEA 4GDMA 4M0FA 1FFCA 3LLCA 3HXKA 2C4HA 3BJMA 4OB8A 2WTMA 3G0DA 2DQYA 2DQZA 5FPQA 2C0QA 3WZLA 5JD5A 4RE6A 5CRIA 1CR6A 5DNUA 5CBKA 2E3JA 2WJ3A 1YAJA 1THGA 4HAIA 2XUGA 4XVCA 2H7YA 1LBTA 4JEIA 4J0HA 3WYNA 4ZRDA 4WJLA 3QPCA 1G4HA 3D5EA 4KR0A 1CUFA 3CXUA 4ZGBA 3WL7A 2DSNA 4H7EA 5ALRA 3ZLUA 4KAAA 4OYYA 3JYHA 3SX4A 1RWQA 3WLAA 2I3ZA 3VJMA 2O7VA 3VVLA 4MXDA 2WUFA 2IX9A 1MTZA 1LLFA 4H18A 2JF0A 4BP9A 5IVDA 2ZYSA 2WJ4A 5I8PA 1C7JA 1MX9A 1JJFA 5JATA 1VXOA 4H7JA 1AC5A 4L0CA 5K3FB 2ZJFA 2OQVA 3HABA 4BBZA 4B7ZA 5AKYA 2DHCA 4HTAA 4BCCA 1GPLA 1Y7IA 1TKRA 3HC7A 1TIBA 5E4YA 5ALGA 4BE9A 4HVTA 2XUAA 3DQZA 3KDAA 1YAHA 3S2ZA 7YASA 2FX5A 1YR2A 4X93A 5ALTA 3HYSA 5K5EA 1XZGA 5FUMA 5E4TA 1QTRA 4K6GA 4FFWA 4X6YA 1YS1X 3ICVA 1CUVA 4FOLA 1LBSA 2WIKA 1JT2A 3R40A 1BN6A 3C45A 3LP5A 3R3UA 3A2NA 1NU8A 5EHNA 3WWPA 3ESDA 1UZAA 5FPPA 3I6MA 2QVBA 2JGFA 4UHFA 3L1JA 1QIKA 5EHQA 3QMMA 4JNCA 2VSQA 2ONCA 2RIPA 1K5PA 3NUZA 4Q3OA 2QTBA 3U1TA 5AI5A 5HQ3A 5AK6A 1XRRA 3CN7A 2GBCA 3WA7A 4Y2XA 1SC9A 4YX9A 1PV1A 4Q1VA 4FDMA 3K9BA 1XQVA 1LPPA 3F97A 3NGMA 2OPHA 4DNPA 2OXEA 1ZJ5A 4X6XA 5AM2A 1ETHA 3QZUA 1YCDA 2WG0A 1DWPA 4G4IA 2PM8A 3RARA 4N8SA 3K2IA 1R9NA 4MWTA 3G0BA 5K3FA 1EVQA 4MWSA 3AZQA 1CRLA 1MPXA 2B9VA 2PUHA 5CT6A 5AM5A 1QIDA 4ZWNA 3G0IA 1BROA 5A7GA 4DMCA 1ODTC 2VJCA 4OD0A 1VKHA 3BE8A 2XUJA 4K5QA 1MAAA 2YXPX 4J0KA 4M0MA 4AO6A 3ED1A 2XUFA 4H7FA 4H7HA 4XX1A 1JU4A 2XMZA 4C89A 1BRTA 2H9YA 2Y6UA 4LXHA 3DKRA 1GQRA 4AO7A 5LKRA 1DT3A 3N2ZB 1EI9A 1F0NA 1F0PA 3EQ9A 1LNSA 1CQWA 2OQIA 4Y2UA 4MEBA 4J3JA 2WIJA 3STTA 5ALFA 5HKAA 5K3EA 2Y6VA 2ZYHA 1USWA 4G1FA 3DL7A 5EI5A 3RKSA 3YASA 3WL5A 1NU6A 2JBWA 3OOSA 2HU5A 1H2WA 3DNMA 5D3ZA 1QFMA 1R88A 2JGIA 2G5TA 3H2JA 4KAJA 5KWJA 3I2HA 5YASA 4BRZA 3I1YA 3G9UA 5ALYA 1ZI8A 3TRDA 3AUKA 5JZSA 2AXEA 5LZ4A 1WHSA 1XZDA 3IDAA 4HRXA 1QONA 1XZFA 5CW2A 2XMQA 5AKLA 3WI7A 3VJLA 4MYDA 3HI4A 5BOVA 4B6GA 4FBLA 3STXA 4WCVA 2RI6A 4BVKA 1BCSA 1L7QA 1RP1A 2VA9A 5E2IA 1ZD2P 4UHHA 2J4CA 5DTJA 5K3BA 1MO2A 3AFIA 4N8EA 3SWWA 1IMJA 2K2QB 4GWLA 3D4LA 3VKFA 4J0GA 5SYMA 3QITA 5EIAA 4FTWA 3DL4A 4HRYA 3QYJA 3WKBA 4L9AA 3DYVA 3O9VA 1EH5A 2WTNA 1YA4A 2VJDA 3PUHA 2J4FA 3TJMA 1CUAA 4B0PA 1XLUA 1XQXA 3IBTA 1XLVA 1LGYA 2Z8ZA 2BGNA 4YASA 4K6KA 2WG2A 4FMPA 4MQMA 3O95A 2YYSA 5D3KA 3G02A 1E3QA 4QNNA 4QWMA 5C7YA 2QRUA 4Y2RA 4QA9A 2J3QA 2DCMA 1LZKA 1VXRA 3SK0A 4Y2SA 1Q0RA 1D07A 1LPBB 4Y2QA 2QJRA 1CV2A 3WK5A 2UZ0A 3D2BA 3F8SA 4QEKA 2VT7A 4U2BA 1MJ5A 2D0DA 4D9JA 4S0XA 1ZICA 3A70A 1J07A 3QM1A 3TEJA 3DDUA 4TVKA 5CH5A 3G9ZA 5DNWA 2ROQA 1GXSA 1A8QA 1YB7A 1QLWA 4B0OA 4UPDA 4GW3A 1WB5A 2RHTA 3QPDA 2XQKA 1K63A 4KACA 2RAUA 1TCAA 3PUIA 4CIBA 5CH3A 3WWEA 4FKBA 4DGQA 1BEEA 3STYA 4DNFA 3P2MA 3IIIA 3BIWA 2QJWA 1EA5A 1O6GA 3AIKA 5FV4A 2J3DA 2XQFA 3PE6A 5LZ9A 5AK5A 1X70A 3LS2A 3FSGD 1E8MA 1O6FA 1DX4A 1ZI9A 5LLSA 4CI9A 2WQZA 4AZ3A 1K6EA 1TRHA 5AK3A 5ALHA 2XQJA 1LPMA 1MN6A 2XB6A 3ICWA 1CUGA 4OPMA 3MGAA 3FSGA 4A23A 1UK6A 4HXEB 5AI0A 1SFRA 3AINA 1G66A 2OCIA 3DLTA 5HK9A 4P92A 4KE9A 3C5WP 1ZD3A 2BKLA 5ALNA 3O0DA 4F0JA 2G5PA 5AH0A 4DNOA 2PSHA 4H0CA 4Q05A 3FVRA 3I2JA 3ZI7A 5BWBA 4XJVA 2XMBA 2W22A 4EHBA 3FCYA 2HL6A 3FLEA 5JALA 1AKNA 5JADA 4H35A 1W75A 1E8NA 4U2DA 1KU0A 1ORWA 3C87A 3AZOA 2ZSHA 3DD5A 4CCWA 3BXPA 2VJBA 5IVIA 4BYMA 4ETWA 5JAUA 4X3CA 1I6WA 3BF7A 4GI1A 1AX9A 4U2GA 4Y7DA 2XUKA 2XUHA 5ALMA 1MT3A 2ACKA 1PFQA 3O4JA 4BTLA 1OILA 5BV7A 2WHRA 1W1IA 4LKOA 2C5FA 4UBJA 1EDDA 3KWFA 5K3DA 5HF8A 3WKCA 4A16A 4OB6A 3WQHA 1JU3A 4PQEA 1G5FA 4FNGA 5AO9A 4DMFA 2QZPA 3C6XA 4CFSA 3Q0TA 4BCBA 4BZWA 5JASA 3T52A 4X95A 3F96A 1LPOA 1QZ3A 3W04A 4CCYB 1CUUA 1WM1A 3M81A 2OLEA 3VXKA 2QT9A 5CMLA 1MNQA 2QUAA 4OU5A 4QDTA 1BCRA 1GGVA 2NW6A 1QTIA 2WUDA 1XFDA 5ALQA 1HLGA 5DYTA 4OCZA 1BS9A 2B61A 5ALOA 2ACEA 1EDEA 2PBLA 3FAKA 3E3AA 3GZJA 3WK7A 2G4LA 2QXUA 2GBGA 4QDZA 4LYDA 5JIBA 5HF5A 1OCEA 4KE8A 4EY7A 1HL7A 4FBMA 2C0PA 1EVEA 1WOMA 4GECA 2WIDA 1MAHA 1CUIA 2Z3ZA 2ORYA 2EDAA 4DMKA 1TK3A 1UOOA 3HLKA 1XZEA 2AJCA 3C5VA 5JD6A 3A6ZA 3UMJA 2BCEA 3NOXA 4Q34A 1FFEA 3IUQA 5AM0A 1P0PA 4DNQA 5T4BA 2WKWA 1LPSA 1QJ4A 1BE0A 4LXIA 3DCNA 5JZ9A 4H7KA 2JEZA 2XUOA 3PDCA 3IA2A 2XUPA 1BEZA 2R8BA 1SCIA 4RPCA 1UKBA 2HA4A 4NVRA 3C70A 5E4JA 3I2IA 1GT6A 1QIEA 4U2FA 5DTIA 3AIMA 4J0JA 3I28A 1DWQA 2OG1A 1MNAA 5JARA 1LZLA 2WLSA 1YS2X 5JAPA 3STWA 1ZGCA 2QS9A 2OGSA 2CEKA 5ALZA 2OAEA 4CCYA 4B83A 1U65A 4C01A 2JGKA 2OAGA 5AKEA 2QUBA 1JMYA 4W1RA 4Y2YA 2PX6A 1UKCA 3V9AA 3ESAA 1NX9A 2ECFA 4FLFA 4ARAA 4WDQA 2YASA 4H7DA 2JGJA 2QM0A 2VTVA 2PSEA 1Q83A 1F6WA 3WKEA 1W76A 2QXTA 4G5XA 4PV7A 1H2XA 3UUFA 4BVJA 2VAXA 1U8EA 2D5LA 3DYIA 4BAUA 4PSUA 4E46A 3H18A 1Q84A 4KEAA 3FYTA 4PO3X 4UBOA 1C7IA 4GXNA 4PF1A 5DYYA 5HZGA 2WILA 4GBGA 5AJHA 4B9EA 1CPYA 5AM3A 3AIOA 1N8SA 1EINA 3HRHA 2WFLB 3BL8A 3IUMA 5FP0A 4JH0A 4X91A 5A2GA 2HA2A 1SOMA 4QDXA 3WWOA 5I9IA 2HHAA 3CN9A 5IVHA 3IUJA 4FLMA 2XQIA 1IUPA 1WB4A 4C88A 4MQLA 4UBLA 4YK7A 2WJ6A 4ROTA 5A6VA 4Q82A 1Y37A 5DLPA 4E14A 2Y2UA 1E5TA 2GZSA 3FBWA 3GUUA 1CUSA 1FFBA 5DNVA 4X90A 3V1KA 4CG3A 4ZV7A 3UUEA 5ISMA 3F9CA 5AIBA 1JI3A 4FLEA 4X94A 5AKZA 1HQDA 1H2ZA 4UBIA 4AX4A 5J3JA 1JJBA 1QIHA 2ZJ7A 4DIUA 1A8SA 1UKAA 4NZZA 4WY5A 3PF8A 4AMZA 2VEOA 3DEAA 5A62A 4BAGA 4EUSA 1HDEA 1GQSA 2PU7A 1CUCA 4DM7A 3IURA 1VA4A 5AICA 4WFKA 4QZVA 2XMRA 4X6UA 1QE3A 2CZQA 1U2EA 2V9ZA 2WU3A 5AOCA 2BFNA 1IUOA 1QGED 4L3WA 4HXGA 2XMCA 4UBNA 2HA0A 3KOOA 2XLBA 6YASA 4N8DA 3C6YA 1XRPA 1N5MA 2YH2A 3LIIA 2HDWA 4Y9SA 2HA3A 4WY8A 5IH7A 2WFLA 4AMYA 3WIBA 1R1DA 3VVMA 1QO7A 2OGTA 4I19A 4MJ3A 3RLIA 4B9AA 1UK9A 4P9NA 3I2FA 3A2MA 3MVEA 2AJLI 4UHDA 4Y2PA 4J0DA 1QFSA 4K6HA 1W52X 1XZLA 2XUDA 4ITVA 3QVMA 2AJDA 1P0MA 1QO9A 4LYEA 4LIPD 3K6KA 3U0VA 2FJPA 3IVMA 2Z3WA 1HBJA 2XMGA 4X71A 2WUEA 1E66A 4DLNA 5D6OA 1H2YA 5CT4A 5LZ7A 3KSRA 4IO0A 1ODCA 3OG9A 4G9GA 1K4YA 5FLKA 3ZWQA 2XDWA 5DYWA 1VE7A 1FJ2A 1ZIYA 3BDIA 2BAGA 4U2EA 1EB8A 2JIDA 2O2GA 4KE7A 1TAHA 1CUJA 5AM1A 4KAFA 5K3CA 3BJRA 5T4HA 2VF2A 3IB3A 1N1MA 4OUKX 1EDBA 4PSDA 3DKKA 4NS4A 2XE4A 1EB9A 3ZV7A 1ACJA 2PPLA 5IVKA 2H7XA 3HZOA 3D3NA 4EY4A 2BGRA 4ZV9A 3L1HA 1FSSA 1WCYA 4OU4A 1JJIA 2V98A 3BWXA 1X2BA 3GROA 1AQLA 2VATA 4IHAA 3VJKA 4KE6A 4Y2JA 2I03A 1W4LA 3W05A 3O4GA 4UFOA 1ACLA 1H23A 3H1BA 3AJAA 4C4YA 5AK4A 2HA6A 1CQZA 2HFJA 4XWGA 1TQHA 1CUWA 2CJPA 1THTA 2FUKA 5AKJA 5ALDA 1BN7A 1ZD5A 2WHQA 4U2CA 1EHYA 1X2EA 5AI6A 3I1IA 1XLWA 3W06A 1T4MA 1GKKA 2WFMA 4B85A 1B41A 3ESBA 3G7NA 4QE3A 3FCXA 5ALUA 3FYUB 3X3HA 5AKHA 3M3DA 4KYVA 5JD4A 3ANTA 5FRDA 5A71A 4QLOA 3N0TA 2PU5A 4OSEA 3AILA 3WL8A 4I4CA 2X8BA 3B12A 5LZ5A 4JUIA 5FDFA 4X00A 5SYNA 3RK4A 3I6YA 5FXMA 2QKYA 4EB0A 4WFJA 2CKMA 3R3YA 1CUZA 3WIOA 1UOPA 1CUYA 2BUAA 1ZIXA 3CCBA 3FNBA 2QMQA 2H1IA 4LXGA 4N5HX 1IZ8A 3CCCA 2I78A 2VAVA 3H2IA 4FFVA 3QMVA 2HA5A 1GPKA 1HKHA 2BUBA 4G8DA 1EK1A 1EK2A 5C8XA 3ANSA 4UHBA 4J03A 2WHPB 5KBYA 2GZRA 1C4XA 1R4ZA 3C8HA 2WU4A 1GPNA 2WIFA 3D2AA 1JFRA 3C8DA 4G8CA 5JZBA 3ZLVA 1XRLA 4CG2A 4BTVA 4UFNA 2XI4A 2RHWA 4O08A 2G63A 3PI6A 4QDOA 5ALWA 2XUQA 5ALJA 2GYVA 1DT5A 3PICA 1A7UA 2AJBA 4EY5A 4MEAA 4BC0A 3G0CA 3DOHA 4PSCA 3D2CA 4TPKA 5D7BA 1VA5A 3KWJA 4EY8A 1AGYA 3EBLA 3FYUA 3EIOA 1UT6A 5HF6A 3WJ2A 3TGLA 1YSCA 3WKAA 1TCBA 2WM2A 4JYMA 1CVLA 5C81A 2PSDA 4C4XA 4FHZA 5C8VA 2BUCA 5HQ3B 4P93A 1JKMA 1XZCA 2HFKA 3H19A 1UXOA 2JGEA 1UWCA 3GBSA 3W9BA 4C6HA 4IH4A 4DTCA 4GLBA 5AKXA 5JAHA 1H22A 1GKLA 4W1QA 2GBFA 3R3VA 4ARBA 2CUTA 4X85A 4W9RA 1XQYA 3OC0A 3H17A 5EIHA 1XZIA 3IUNA 1CFJA 3LIPA 1ISPA 5A7FA 5AOAA 4UFPA 1T2NA 4NMWA 1P0IA 1VZ3A 4G4GA 1MX1A 1RYYA 3H1AA 1KEZA 3H2GA 2Q0XA 1OXMA 4QWWA 4B81A 2V97A 2PKYX 3QPAA 4B80A 4Q3KA 5JAOA 5T4FA 1QIMA 1IUNA 4YPVA 4FNMA 2WHPA 5CH8A 5H3HA 1YB6A 2FJ0A 1SCQA 1IZ7A 3V48A 2WG1A 1ODSA 1KU6A 2PUJA 3F98A 3GFFA 1UK8A 5LIPA 4F5ZA 1QIJA 5JANA 1PJAA 2IITA 3R3XA 4DYHA 2ZVDA 3WK9A 3H0CA 4JYPA 4HS9A 2W6CX 4AO8A 4BVLA 1VLQA 2PVSA 3OM8A 2IIVA 1S8OA 3O4HA 3QBJA 4G4JA 1LPNA 2B4KA 2XMDA 1YASA 2XT0A 3QMWA 4HXFB 4MYSA 1Q0ZA 4AZ0A 1E8DA 4I3FA 2O2HA 4A5SA 5HF9A 3DOIA 2ZJ6A 4EY6A 1XKTA 1ZJ4A 3OTQA 1CIJA 2Z8XA 1QIFA 4E15A 1TCCA 4EA6A 5LZ2A 3OURA 5ALIA 4PW0A 4BDSA 2C58A 1M33A 5ALPA 2ZSIA 1UOQA 1B6GA 4XIIA 2OCKA 3WMRA 3C43A 3WKDA 1A88A 4G9EA 5ESRA 4W63A 3G9XA 3W2TA 3JW8A 1CUHA 4M0EA 3WK4A 2XUIA 5A7HA 4E11A 4TGLA 3WK6A 1ZI6A 2RGUA 1XZMA 2HIHA 3I2GA 3A2LA 3STVA 1DQYA 3O9MA 1QIIA 3C6BA 2O7RA 4BDTA 5F4ZA 1L7AA 1CUDA 3STUA 2PL5A 5HKBA 4GEGA 4W1SA 3HACA 3G0GA 3FLAA 4BE4A 1JMKC 1DTEA 4UHCA 5EHXA 3ESCA 1DQZA 4RGYA 1J2EA 1N5RA 2O2IA 3G8YA 5DJ5A 5EFZA 3SC2A 3FVTA 5ALEA 4B84A 4N5IX 3C6ZA 2X76A 3PF9A 5DWDA 2Z5GA 1VOTA 4F21A 3MUNA 3HJUA 4F60A 1ZOIA 5T4EA 1XROA 3ILSA 4WDRA 2Y2VA 1HPLA 4RNCA 1CUBA 4EZIA 1FFAA 2JGLA 4GHWA 2ES4A
chains in the Genus database with same CATH superfamily
3GRZA 1OXUA 2QPAA 2QZZA 2RONA 4QBKA 4CMIA 4DDVA 3O75A 1G20B 1HLFA 2CBGA 4YR7A 1FU7A 1H6AA 1TUEA 2ODNA 4IH1A 1RM5A 2AMFA 1Q12A 3LCJA 3O4FA 2J59A 4IV5A 4FZVA 5AW6A 1A50B 4Q03A 2IHJA 3F7MA 5EUMA 5F5LA 4CMEC 1KI3A 4ZT5A 3O8CA 1HRDA 2NSDA 2I9KA 2P7IA 3ZU2A 2AMYA 1B7GO 3AHJA 5A0FA 1IYZA 4GC9A 2Q45A 3GQVA 2P3LA 1F5NA 2YW9A 4X92A 1FDOA 1T4CA 2R60A 3NBMA 4RK5A 1G42A 4D9KA 1X7HA 3HU2A 5JWHA 5ELMA 3WGVA 2GH1A 2G7ZA 3UWOA 3M4NA 3GEGA 3QV1A 5LMUB 3VR5D 5HBGA 4RY2A 2BE9A 2RI1A 1PJ3A 2FKNA 2AR7A 3HEBA 3L6OO 2I7CA 3QVUA 4F46A 1OHHA 5ED4A 5CBPA 1KK2A 3V1LA 2RJ3A 1O5TA 1YU9A 4CF4A 2FWMX 4QFCA 1WPXA 1O89A 1A8UA 2MMCA 4MROA 1NC3A 3TQHA 4FOSA 4A2WA 1E5DA 4BKUA 3VYSB 3KXPA 1G21A 3DQPA 4CDGA 1RHKA 5KVSA 5JUWA 2MSKA 1PZEA 3VV2A 3HFSA 1ZMRA 5DM2A 3EGCA 1D04A 3ZIUA 1DO2A 4JS0A 3Q8WA 3KQMA 1V25A 5JHGB 2O2DA 1TJ5A 3DTVD 3JWJA 1DGQA 1TUBA 3NAMA 3Q5DA 4BNJA 1CJCA 1O6BA 1V95A 2C1XA 2BLNA 1AUPA 3TW8B 2VP6A 4D43A 3WDLA 3SHFA 1N3LA 1GR1A 1QIGA 1RWPA 3AIIA 3KZVA 4EKNB 4K9QA 4BVEA 2IE8A 3D0KA 4PQFA 1NUSA 3GH3A 4Q4JA 2OBXA 1IVYA 3G9QA 3WK8A 1XZJA 1U3DA 3QVJA 3ABQB 4Q4AA 4TLLB 3IJ5A 3R75A 2BDUA 3WO0A 5EGNA 5HMMA 4C3VA 5LP6F 1PJ4A 3WVNA 1L7NA 1OTHA 4CT5A 1WXXA 3V97A 1I4WA 4CL8A 5BP7A 1DC8A 3RS7A 4ESOA 3DA8A 3QOXA 2DR0A 2VI5A 4LECA 5I4CA 5KPJA 1Y8RB 4IY1A 4J0IA 4O2BF 1CSEE 5JNUA 4DR4B 3WMFA 1KVSA 1M72A 1U2SA 3EXEA 4OA5A 2P75A 1PJSA 5KTTA 5HJ2A 5CG2A 5K0JA 3WP0A 3ZCTA 5A02A 3DPSA 2X1HA 2X0EA 2D74A 3QUQA 2C00A 4LYFA 2W2LA 3DDWA 4Q3EA 2VJMB 4EYSA 3HR7A 2W58A 1UC9A 1YR1A 3MJ4A 2WWHA 4BZQA 2P1RA 3C16C 4MITA 4UBKA 1K8QA 1RW4A 2MYNA 1NBEA 2VJAA 3FOAA 4OQ4A 1OA1A 4AYXA 5JYEA 3MPUA 3KVNA 2ACVA 1TJNA 2OFPA 1P5FA 3U3KA 4C04A 4ZGGA 3OE7A 4WNCA 3VPAA 2Z2ZA 2A5LA 3I3OA 3KLPX 4EEXA 5BPFA 4QODA 1DBRA 5KTKA 4INZA 3G2OA 3ACCA 4XWKA 4M88A 4DRXB 4L85A 4WWHA 3U7IA 1XK7A 1DWOA 3TLMA 4WBNF 3HKDB 3OU7A 1Y3IA 3C97A 4CCSA 2CL0X 4HX9A 3UGQA 4E5UA 2P41A 4EHAA 2V4UA 4GKBA 1XD2A 4J0CA 1CDZA 3HO8A 3LDFA 3ROTA 3E0XA 3PFBA 3PL1A 2FZWA 4BC1A 4F6RB 1VTKA 2AOWA 4P36A 3IHTA 3QU7A 3WGIA 2HPHA 5DV9A 4TRMA 1B73A 1SXJD 3LBIA 5EKTA 3IKVA 1K06A 1GZUA 1R00A 5EQFA 3UHFA 4DQLA 5CDYA 2ODBA 4GYJA 4WK6A 1AUOA 5MGBA 1W34A 3WQQA 1ZM2A 4M46A 4OX9Y 4X7BA 5DVZA 1T0JB 4JCCA 1YTUA 3ORQA 2QL6A 3NKFA 2AEJA 3EZ7A 4LPSA 2FX2A 3PFGA 3SYTA 1Y7HA 4DQKA 1T9GS 2CZCA 2ZAMA 4AUKA 4IDBA 3LCVB 1IC6A 3N7UA 1LPAB 1SQ5A 3C3YA 1KAHA 5LR6A 3MS4A 2O5CA 3LF2A 2WYOA 4UM9D 2ZVJA 2Y0DA 4Y0VA 3AHDA 2JHPA 1F6BA 5B1HA 3SEQA 3PC8C 1IN7A 3B5EA 3LECA 3O3NB 5DNDA 3R7LA 3WHPA 3R7DA 2FSGA 3E4CA 4GMHA 1XRMA 1JEQA 2H1FA 1R8XA 4UNPA 1P3Y1 1QMPA 1SEVA 3WLPA 1EUCA 5IX8A 3AOEC 3M5PA 1QZXA 3N8KA 4UNNA 4MGYR 1GU1A 2RHDA 4KBFA 3ZLTA 1WUHS 1U98A 3L8ZA 4CF5A 1ORVA 1ULUA 3MBIA 2RHCA 1NBWB 3FB1A 1KVUA 1S9DA 2ZI4A 5I4BA 2OCLA 4TZ6A 4R7GA 4BPRA 1T1RA 3PK0A 3HSKA 4KFTA 3KVVA 4MO2A 3PB3A 5E3JA 4ABYA 1MGPA 2JNWA 1VSTA 1P2GA 1KWGA 3D59A 4WX2B 2C7RA 1M1XB 3LDHA 2FEOA 2A3RA 3TRHA 4CM9D 4JT9A 1BA3A 3G9TA 3UMGA 1M1ZA 4MULA 1PZMA 3FPHA 3L4SO 1IY2A 4FZ5A 3EQ7A 4D0GA 5DNCA 2GN9A 1AMNA 3VYUB 4XIFA 3BIOA 1W88B 4WBSA 3NTLA 5TARA 1WB6A 2X8AA 4JL6A 3FYDA 1J8DA 2ZUBA 1EZ4A 3F4KA 1TCVA 2ZG6A 2PR7A 2NQTA 3R7AA 5KVVA 5TB5A 2QV7A 5CNKA 5ELXA 2GVNA 2P3QA 2W4QA 2ZB4A 4LK2A 4X64B 3TIFA 4BO4A 3PYXA 1PT7A 3ZS8A 3VRHA 3CUSA 3R9KA 5KQPA 3T0FA 2CV1A 2QL5A 1E96A 3OWOA 3VAAA 3IJEB 4Q37A 5LUAA 3K1YA 1CRWG 4QQKA 4X1KA 4RSMA 1ZKDA 4LDRA 1K2VN 4QYWA 1JQDA 1P0QA 2O7QA 4J8PA 4QXMA 2IH5A 2JEYA 4WZBB 4C4OA 1E1DA 2B78A 3BMCA 1N8KA 4RLQA 2WSIA 4BNMA 4XUEA 5CTJA 4E5MA 4NJEA 2W2NA 3JZDA 4HCJA 1CUEA 1WHTA 1GTMA 2GVDC 2Q8QA 2LUOA 3I9V1 4KR7A 3D31A 2GBIA 2HA7A 2I3DA 5BWCA 3OWHA 5EIEA 1S3IA 3LNCA 2LIPA 4BPBA 2B20A 6CHYA 1YVDA 2QZJA 1FTGA 2EDCA 4RD0A 1JEOA 1PGNA 3L05A 1Z6GA 1YVRA 1M2OA 1UDWA 1VE6A 4I55A 4BLPA 1EXWA 1YIAA 4UEJA 4XLLA 3L43A 3ROFA 2CK3D 3PJRA 2H92A 1EX7A 2O3SA 1T9HA 3E70C 3FMVA 4O4JA 2XA9A 5L7YA 4ZREA 1KGSA 1MU0A 1R9MA 2GNAA 2HDHA 3C0KA 4JJGA 2ZI5A 1KGDA 4JX8A 4MARA 5F73A 2P2GA 4O4IB 3KWLA 3C3DA 2VWHA 5ALVA 3MJFA 4G81A 2FFBA 2B4QA 1OASA 2QYTA 3IALA 1SD5A 2VDOB 2J9XB 3BH6A 1YDHA 1MB2A 2QPOA 3WGUA 2Q1SA 3K9QO 5DK4A 3PKJA 1Q1ZA 1C7EA 2Q5QA 3FSJX 3RU9A 1OF1A 5MHTA 3ODPA 4QLAA 3ABIA 4U02A 4CUKA 5CK5A 4YO8A 5CXXA 2CHEA 3WWDA 3BGOS 5FI0B 2V1XA 2IE0A 3MGKA 4LX8A 5D6NA 3G5TA 4PPYA 1DAMA 3A1FA 5JCJA 4NG5A 3RIEA 1XD9A 5ER6A 3DVQX 4XDHA 1OX4A 3PHBE 5KIAA 1D8TA 4RTKA 3E58A 3O3CA 4IIJA 3TQSA 4EG3A 1RRKA 3ZPXA 3GBPA 4LHEA 2R3SA 4NZOA 3RS2A 3U3ZA 1P7YA 5IBPA 2EYQA 2IU4A 4CF6A 1JHYA 3KFLA 1KO8A 2VHTA 4YIHA 3DGFC 1Y1SA 3BXXA 2DLNA 3GF4A 3GGDA 4LYHA 1SUSA 2QG9A 3VDRA 3QW4B 2GCGA 1ESDA 3A26A 1FYWA 4BCDA 2ORED 4MS3B 4RO0A 4FGLA 1SUDA 4Y6RA 4ZQGA 2RH8A 4CQMB 1CJVC 2APJA 3ZE6A 1CCWA 5ANRB 4BP1A 3KC2A 3KKKA 3U5TA 3BMNB 2XQGA 2HM7A 1K2WA 3DVAB 4KQ6A 1M2KA 1JIUA 3KQHA 1U28C 3LHIA 1ZJYA 1XRQA 2WOOA 3WZMA 2DFKB 3T35A 1O94A 4J49A 2J9RA 3G2MA 2Y1XA 2GPTA 5K6RA 4DR6B 1NVFA 1IRIA 4KQFA 1QXSA 3L93A 3D7SA 4FJ2A 4JELA 4MH0R 1D0VA 4S1PA 4GXQA 3PZBA 4OB7A 3V7UA 2XVYA 3GVIA 3T4UA 5FBHA 5HM6A 2JZNA 1RD4A 1HE4A 2GYWA 4LVNA 3WGHA 3KD2A 1WDWB 3MUOA 1ECCA 1U4NA 4WFIA 4R1TA 5DDIP 3I2KA 4DPLA 1WUTA 1XCLA 1FFCA 1CNMA 4GKKB 2X9LA 5JNLA 1YF3A 3U3JA 1HNWB 2Q5IA 4RBNA 2BZSA 4A9AA 4CL3A 3BJMA 4U7JA 3UGJA 5HNKA 2YYYA 3IQIX 3DE2X 1RU3A 1TMGE 2QP9X 4UC0A 1DEHA 1U02A 5JO9A 3UHAA 4ZYUA 1U0EA 2DQZA 1P18A 1KZGB 2J5XA 1SIWA 4HGYA 3T5AA 2C0QA 2FAXA 3VPSA 3WZLA 1PL8A 2JI8A 4D3FA 3HJAA 3HP4A 3W5SA 2OP1A 4FU0A 5AUPB 3JQPA 1BX1A 5ENZA 1NE7A 4GR4A 4LTDA 2QLJA 4MVJH 3AF5A 3L9XA 4JDPA 3ZE0B 4YJDA 5LD2B 3UN1A 5JC8A 4V1CA 1SCBA 3I9OA 2GI4A 5BOSB 4WXPA 3B2NA 4TVSA 2QW0X 3BM5A 2HMTA 1IPEA 1I51A 5CBKA 2E3JA 2OB1A 2WJ3A 1N6LA 1YE8A 2ZUSA 4HAIA 2XUGA 4S1NA 3KVRA 4JLPA 2P65A 3QPBA 4JEIA 4O29A 4J0HA 1HEUA 2HV8A 2WFAA 1GTRA 3HZRA 2L0XA 3LRXA 4L4RA 4CKCA 2W6QA 1SBQA 3DEFA 3CF4A 4WJLA 4OK5A 2YHUA 2JI9A 2PH7A 5B2ZA 3L3BA 1GFWA 2PD4A 3D5EA 3K5HA 4JA2A 4P3OA 2SCUB 3V8MA 1LC0A 1CUFA 3CXUA 1ZGGA 2R1VB 3ZHXA 2D2VA 2XITA 4ZGBA 4BLVA 1P73A 2HJRA 4PG7A 4WHMA 1KEEA 2RK4A 3GRVA 1LTQA 1CE8B 4JI0B 1CKEA 2CB0A 4LUCA 1N4DA 4PC7A 4Y6PA 2Z58A 1C0EA 1RWQA 1Z8DA 3WLAA 2I3ZA 3NGLA 1KY2A 1ZNWA 2O7VA 1BKDR 5FCDA 4DABA 4EPXA 3HTXA 5DCYA 2H4JA 1KC3A 4LZPA 3VVLA 3UICA 2H1HA 1BMTA 1E58A 4WE3A 1NF3A 2WUFA 4J9UE 4PBRA 4WXMA 2XWSA 2IX9A 3B89A 2H3EA 3O7WA 4IVPA 1YBAA 1MTZA 4G0XA 2NYUA 2XTZA 4EMUA 5C5IA 3K4QA 3RDPA 4N0MA 4EKIA 3QYFA 4BY9E 1DG3A 3ECSA 4BU0A 3H2BA 1KEPA 2R1TA 1K9SA 5I8PA 1NMSA 3GN1A 1MX9A 4TL6A 4B6PA 1G2QA 3PDHA 3ZDRA 3GJ7A 4IAOA 3CRQA 1VXOA 4C2BA 3TVTA 4KVGA 1AC5A 4ZZ3A 1JZTA 4YAJA 4LXYA 5IABA 2OQVA 2IOHA 3VPBA 3DONA 4RQBA 4K9DA 5EEHA 1EDZA 2C4WA 4DCNA 1H42A 2G04A 2LW7A 2E5LB 2GASA 4F6CA 4ARIA 3OF3A 2B99A 4D25A 3PPVA 4B48A 2DHCA 3T5GA 1T0BA 4HTAA 2QE7D 3RK0A 3QOYA 3ZD7A 1GNQA 3OCUA 1LQUA 5FFFA 1O1YA 3OQ1A 2EATA 1QZTA 1HDOA 5J2UA 1U4OA 1DPFA 3URMA 1QK4A 3HC7A 1TIBA 5HGXA 3DCJA 1IY9A 1JX6A 4TWBA 3VGPA 3SXJA 1BDBA 5FD8A 3FNRA 2X9NA 3MLAA 2FYTA 2J67A 1OFUX 1YAHA 3RJ5A 1RQGA 3F71A 4GNRA 1CZOA 2AEFA 2QIOA 3QELA 1AUQA 3W4JA 5JSZA 3O94A 9LDTA 4XGRA 5ALTA 4RTLA 2WAMA 5HX7A 3HYSA 4QYTA 1ZUIA 2XDQA 3IHLA 2PXXA 5E4TA 4QATA 1QC5A 4M1EA 1S3FA 1DXYA 3NUGA 2EJUA 4N12A 4FFWA 3EMDA 4R1PA 1KOJA 4X6YA 5KSWB 2PD3A 4BQRA 4H1TA 3LLVA 3ED5A 4YGYA 1Y9EA 2HJWA 1MZVA 4G0VA 2AK2A 2EKPA 2R47A 3EXFA 1A9ZA 2ZT7A 4TL7A 3TW6A 5BNIA 3R40A 4IBOA 5C1OA 3BKXA 2A7QA 3G2LA 1R4NB 2QVZX 3KNZA 4IS2A 1AS2A 2E21A 4G5GA 2G28A 2RH5A 3KKLA 1VB5A 1RWWA 4Q4DA 2BF7A 2ZR7A 3WBBA 1QP4A 1NU8A 4ND7A 1R6UA 3NI2A 4I6GA 5EHNA 4H0NA 2VNIA 4X85A 5J43A 2ZR8A 4L7VA 3ESDA 1DV1A 1DLJA 4BNLA 1W85B 3F6YA 2SECE 2QVBA 3OZRA 3PC6A 3OIGA 1MOPA 2D1YA 2EZ8A 2UKDA 3OI7A 5A0TA 2H2HA 2JGFA 3OECA 4MQFA 2G67A 4KWCA 3P2IA 6REQB 2B6HA 2UVQA 1SUCA 2VDPB 1VL6A 2CLLB 3ZXIA 4PGMA 3VJRA 2JIMA 2X5OA 2P40A 4OMCA 4LEIA 4J1SA 2SNIE 4E6PA 3D6MA 3SKXA 3K7EA 2DPHA 3OP4A 3IUEA 2P4SA 3IT2A 4JP2A 5EHGA 3AWIA 3VR6H 2EBUA 1UF9A 2LP4Y 4JLWA 3ZV6A 4P3PA 1A8IA 2FMFA 1QH8B 2HAEA 4K8RB 4J16C 2BFFB 1OFVA 2W6ID 1CVIA 3KXLA 1IK4A 10MHA 2J48A 2QI9F 2LCQA 1V16B 1TO6A 2FP3A 1VM6A 3OLZA 2CMGA 5AK6A 3TNYA 1II0A 4A2CA 1SBHA 5LPNA 2ZXUA 1KHHA 3Q72A 3X0DA 4IYRA 2H63A 4GYWA 5GTDA 3QVGB 2ZUEA 4EJSB 2PNJA 5E1DA 4YI3A 2XBLA 1DZ3A 1FTNA 2OKCA 3EA0A 3F97A 2NZ8A 3RRNA 3B5JA 5A4DA 3FPKA 1F1BA 2AUMA 4MQBA 2OCAA 1E6WA 3MRTA 4AJLA 4DAEA 3BFKA 3KP1A 3KDPA 1CC1S 1VKOA 3P0IA 4LOKA 1SBIA 4DLAA 4HNAB 4IXTA 5IC4A 1YRBA 2ZYUX 3Q5EA 3DF7A 4N8SA 1NW4A 1PG0A 2JBAA 3QVLA 5LA6F 3T34A 1L8OA 3PFIA 1WRBA 2V8OA 4K7JA 4O4LF 1R9NA 2ZWPA 4C4SA 1KI9A 3F7OA 3M6VA 1FSFA 2OWEA 3UAYA 3FN4A 3AU9A 4R5MA 1UWKA 2DPLA 4XOUA 4PFJA 3R7WB 4UPVA 4X3OA 2PUHA 1G8PA 3CZMA 3RFCA 4YJ3B 5CM8B 4PLFA 5AM5A 2VYVD 1MIOB 3KQSA 1F9EA 4KTTE 1W5TA 1D1SA 5EVCA 4ZWNA 5LBIA 2FW1A 1BROA 3A05A 5A7GA 4BWYA 1P7WA 3SR4A 3DTVB 1K27A 4DMCA 2FW8A 2H4HA 4XTRA 4EFDA 1J23A 1BOFA 1WP4A 3MWGA 1SZJG 2WTBA 3P5SA 1SQGA 2VJCA 1H0RA 3F2VA 4WI1A 5EZYA 4UTNA 4HAWA 1F9AA 3RABA 5JSHA 4A10A 3BE8A 3LYUA 4AY2A 2V4MA 4K5QA 3T6KA 2NTJA 2ZS8A 3F8WA 2CV0A 1OC2A 5LVAA 4AO6A 3EPJA 3GLHB 3WDSA 1G8GA 3ED1A 3ITDA 2UU9B 2IXDA 4XX1A 4H7HA 2HHHB 5B3JC 1OU0A 1EFPA 3WXBA 4KOAA 2GPSA 1E3SA 4PSAA 4WLFA 4AZSA 1D6MA 1V9CA 2Q99A 3K0FA 5GM1A 2YWBA 1UPBA 4YAUA 2CFSA 2IU3A 1NBHA 1OXBB 1WCV1 3NH9A 2YJ3A 4WK2B 3UMVA 3PPXA 3WYGA 4C89A 2Y6UA 2O8DB 4N49A 1IOWA 4OLBA 4Y6SA 2B2XA 4NV1A 1Z36A 4HAVA 3GBVA 3TLBA 4LXHA 2GJ8A 2KYRA 5K0CA 1FDVA 3DMHA 1HE1C 4BMPB 2ZBEA 5AQ1A 1H4TA 1L4BA 1GQRA 5LQSA 3RWMB 2FF7A 4HJRA 4AO7A 1GGMA 3VR3A 1P33A 1C0PA 2OBMA 3A10A 4GF5A 3R5XA 4P38A 3V34A 1GFSA 4DXHA 2DT8A 1XEXB 2EFDB 5HIAA 3TGWA 1L4HA 1LNSA 1BXKA 1AKRA 2PGLA 2ZEJA 1SU8A 4TLEA 3T54A 3ULKA 5JJKA 2C88A 4RYLA 1Q1BA 4MEBA 4C0AC 2G4VA 2CV2A 1HYGA 2DTEA 4FYMA 3CEMA 4M6WB 2QD2A 4MGEA 2C96A 5ALFA 4W6ZA 3BTOA 4EJ2A 4LV5B 1M0SA 1CDEA 1W4BA 1MO3A 4EUHA 2ONZA 4PLTA 4PR0A 5K3EA 2IC5A 5FWYA 4NXNB 5H0IA 4JQZA 3MCZA 1GAJA 5A1JA 4D8VA 5GVRA 3B1FA 2CCGA 2AZTA 5BT8A 5J4YA 2HC9A 4PPQA 3QUTA 1L5KA 2H31A 3GZ4A 3DL7A 3FTDA 4GNKA 4FWIB 3JQAA 3CRRA 2BFCB 3TKAA 3ZWAA 4RIHA 1INLA 1M5TA 4MW5A 3RKSA 4QTUB 4XYLA 3VKGA 1TK9A 1U94A 2ZIWB 4HNRA 5JCZA 3KOWA 1D8AA 4V2UA 3WL5A 1T3SA 1Z4JA 2C2ZA 2DLDA 4PZPA 2IZ0A 1KI8A 2LCIA 3W3AH 1EE9A 1UQUA 2ZBUA 4OI1A 3SSNA 1QU2A 3MTJA 1RJ9A 2B30A 4H6VA 2PKEA 2JBWA 4RSRA 5FORA 1L5FA 3OOSA 5C8YB 2HU5A 1ILEA 3WOHA 3DNMA 3SDBA 2XHEA 4HDOB 1YOBA 2P0EA 2JK0A 4POOA 1DFGA 2JGIA 1NF8A 5CJPA 5AIAA 1SEPA 1WV0A 3GGOA 1C3XA 3IPCA 5AVJA 4BNYA 3LUKA 3FDFA 3MNFA 4WERA 3SX0A 4V03A 4BRZA 4LN1A 5F98A 3U81A 3HR4A 4OJTA 3AUKA 3H16A 3GVPA 3PNSA 2QHXA 3H0KA 4HYQA 2AOTA 1ZH8A 5BMVF 1CQIA 2DB3A 5LBTA 5KB3A 3LNTA 5LZ4A 3RUAA 4XKJA 2JGDA 4I4IA 1DKQA 2GZ2A 2JKYA 1QE5A 4Q9HA 4N18A 4WNYA 5B2FA 1QVZA 4XQEA 1JAXA 1KJ9A 2C9ZA 2OM6A 3FA2A 3CLUD 1XZFA 4LS3A 2XMQA 4UKDA 3KKNA 4LQDA 4NOKA 4V0LA 3V8NA 3W9YA 4N6OA 4BE7B 1TQ4A 3DG9A 3E61A 4PBTA 2VSXA 1KPIA 1PN3A 2HD4A 2H8KA 2QRGA 2WU0A 3DBHA 4H6WA 4MYDA 3SCZA 5ARBA 5K0FA 1B26A 3TI9A 4HX5A 3D43A 3UKOA 4J4HA 4B6GA 1A5BB 1C4OA 3STXA 3OOJA 4C7OB 3JVIA 2A0KA 4IGEA 1FNDA 1G3UA 1NVAA 1K7XB 1M2VA 4NYJR 3TSCA 3HB9A 3PE4A 4EMBA 4IOMA 4OLJA 3PCRB 2YRWA 3TTYA 2H54A 3GAFA 5JH7B 1HT0A 4TM7A 3PI7A 5ITSA 5JRJA 1OYWA 3R9WA 3CPEA 5E2IA 4IDDA 3U17A 5EUQB 4B3HA 1DPGA 1LDMA 2HKIA 1ZJJA 3EGXB 4UHHA 1H2AS 2J4CA 2R8PA 1UINA 3EDMA 4C5AA 5DTJA 1M6NA 5NULA 4ZOLB 3K1AB 1A98A 3CZRA 2PBZA 4KW7A 4F1KA 4H0FA 4YV1A 4N8EA 4C3ZA 1KC1A 4XWTA 1YNOA 4FYYA 4J6FA 4KI0A 3SWWA 1WCIA 1JR2A 1JU9A 2ZQYA 1Q7RA 2YNMC 3F4BA 1IMJA 4TSFD 3GUVA 2GPBA 2PUGA 3MINA 4G9BA 3FVWA 1V26A 4W5JA 4E7PA 2D0IA 3FTFA 4AY3A 3TRKA 1EP9A 2N9UA 1ORHA 4YB8A 1WF6A 1Z06A 2O59A 3LT0A 3MGGA 3ZWVA 4TROA 1P9RA 3E1KA 4EG4A 3TOCA 3VPFA 3DL4A 4AZ3B 4ZAZA 3GAAA 4L9AA 4QUEA 3BGDA 3QSGA 5J5CA 4DCSA 4CF7A 4MVJA 5LWHA 4BVGA 2WTNA 3BXEA 1YA4A 1Z6YA 2FGKA 1IBRA 3IBYA 2H2DA 4R84A 4XGIA 3PUHA 2HMVA 2J4FA 2ZATA 1PFKA 4QTZA 2J0SA 2J0UB 3DDCA 2G7MC 3DEJA 4B0PA 1R8YA 2JFVA 4MS1B 4WLVA 3B51X 4RZHA 3OOEA 1JYEA 3IBTA 3OIDA 4OQMA 3IUYA 5EYPA 3KTDA 4JJAA 4EWLA 2GAAA 1H5QA 5KHOC 5LOVF 4RJKA 2H4YA 4ZVOA 3ZZMA 3M4YA 1A9QA 1T9AA 2UVPA 2FPSA 3LUFA 4PR3A 1YK1A 2XOXA 3S1AA 1YOVA 3NORA 4Q47A 4ZO4A 1KFKB 4D41A 1XJCA 4CIDA 4TX1A 2G9RA 4W8GA 4FMPA 1VKRA 1X7ZB 4MQMA 5CVEA 3CH6A 4G0YA 3HMQA 3K8OE 2ZYTX 1AZTA 4G85A 4RKWA 4XGKA 3V4FA 4JFRA 1NI4B 1QANA 1V96A 3O95A 4KIJA 1IDN1 2XCSB 1SPBS 1LC3A 1YI0A 3FMPB 3L7OA 2I7DA 2XJ9A 1TT5B 1NONA 1QZZA 1KMQA 3E05A 4QNNA 5FBQB 3D3JA 5U1PA 4Z2AA 4QUKA 4V0OA 2IYFA 4JT8A 3UAZA 4RCZA 2LKDA 2J3QA 1TAUA 1ODJA 5PNTA 3BBPA 3Q9NA 2COEA 4HUQA 3ZHSA 1P5JA 1LLCA 4Y2SA 2GKOA 1Q0RA 5K7SA 1D07A 1X8XA 4IFIA 2QD5A 2QL9A 4Y2QA 4RZSA 2CT8A 1S5PA 3AFOA 1WTAA 1A8PA 2UZ0A 3SQDA 3WLNA 3OHMA 2QR3A 1KZ9A 2Z98A 5CEJA 4B6EA 4K03A 2HNAA 5AVVA 1IXYA 1GAQA 4QYSA 1FYXA 2P9BA 4CM4A 5C9ZA 5BW6B 3HGMA 1YT5A 5IU6A 5JCOA 2OQRA 4O4HF 1N5JA 3FMGA 1K9VF 3NV7A 4S0XA 3WRYA 5ITVA 4EB6A 2V7WA 4MAAA 2E4AA 3A70A 5CEEA 4P0QB 3A3YA 1KH3A 2GWRA 4WNIA 2Y8EA 4KMRA 2G1AA 1OLXB 3QM1A 3V2IA 2EF1A 1VI6A 3DDUA 3TEJA 2P4EA 4TVKA 5CH5A 1EFLA 4TUYB 2ROQA 1V3VA 2F1HA 2YZ2A 3CTMA 1A8QA 4XQ9A 4I1RA 4O2AB 1CVRA 1MC8A 1GN9A 4YQYA 1HDZA 2HF2A 3PXDA 4RVSA 3A7DA 1ICEA 1C3EA 2BE7A 3ESQA 3KKQA 3IDQA 5L3VA 3G17A 2DFLA 3JASA 3JARA 5FWAA 3T7IA 3VAZA 3CBGA 1QPZA 3HS3A 1WB5A 1PNQA 1SELA 2RHTA 3VYWA 3QPDA 2O2JA 1LD3A 2WIBA 1V71A 3DE5X 1W2GA 4GZ5A 4KACA 4MWCA 1J9EA 1TCAA 4CKZA 4PC3A 2BFOA 2RJNA 4CIBA 2YJNA 4MW0A 4WVLA 4BNIA 3L7YA 3CKYA 3OY2A 2GBPA 5K8JB 2FOIA 4S24A 4FKBA 4Z8YA 4DGQA 3FZQA 1W25A 3MQFA 1I33A 2EWWA 5KQMA 1XMQB 2FPPB 1K8RA 3STYA 4FOTA 4DNFA 4ZCIA 3GFRA 3KOMA 3IIIA 1LQTA 1KQNA 5C5DA 2BGUA 2HN9A 2XBUA 1FXUA 2EC5A 3BIWA 3JQFA 2HLPA 3KXIA 1LF0A 1XEWX 5CU7A 3AIKA 4TTPA 5DN6D 3AMVA 1EFAA 3RYIB 1W8IA 2OHIA 4IUYA 3P9CA 1P91A 4XFJA 2B7LA 3BFVA 5FTNA 1M8KA 1KSJA 2DETA 5DGCA 1WMFA 2H6EA 5AK5A 1NFFA 2BEUB 1KJJA 3MFYA 3NU1A 1KBZA 1O6FA 3EFBA 1ZI9A 4P7KA 5DSZA 5J5AA 3NBKA 4CI9A 1KZ7B 5BN5A 3R2JA 1E2PA 4L76A 3RG8A 1TRHA 1YR7A 1X8KA 3MUEA 1TQ6A 3TEMA 3A1TA 2WP8J 3TINA 3AJDA 2DU8A 1MN6A 4J2HA 4OGWA 5E8JA 3ICWA 4KQJA 2FR8A 3NHSA 5C0OE 2OFFA 4BN4A 1COZA 3AHGA 4Z99A 3ZDYB 1G1AA 1UK6A 2NADA 1PJRA 2W2XA 4P3YA 3OF5A 3C74A 3EUFA 1CX9B 4DB2A 2OCIA 3DLTA 1E61A 1SJ9A 5LYJA 1Q0PA 3C5WP 2R7MA 3B48A 2BKLA 2HSJA 1RHQA 1U0SY 2YN4A 3EXHA 3LG2A 4COOA 1T5IA 1JG1A 5CDSA 1FDSA 3Q15C 4JDUA 4YJGA 1RRFA 4DNOA 3U7HB 4BB6A 3ZI7A 3FVRA 2QQGA 4GYYA 3TLJA 5BWBA 3GQBA 2Z43A 4JUAA 2XMBA 4L9RA 2ZTUA 1JG2A 3SR0A 1PD1A 3HRIA 3ORRA 3RK1A 3DVRX 3BWYA 2D00A 2HLDD 4NTZA 1SIOA 3R8CA 1NWCA 3VR6A 2DBZA 1EGVB 2QENA 2QDXA 1QPGA 1AKNA 3KOXA 1UP6A 3N70A 4BFVA 5FFNA 1JKIA 1W75A 1BD4A 1E8NA 5C4GB 4U9UA 1RWMA 1KU0A 2BFBA 2CGEA 3OZEA 1VJ0A 1W5SA 2OMEA 2W48A 2AXNA 4BFXA 4CCWA 2JH9A 3NW9A 4HWOA 4ZOQI 3NHJA 4ND2A 2PDAA 3MELA 1E3MA 1B8NA 2Q27A 3JVUA 4X3CA 2H0AA 3DOJA 2AA3A 1FE8A 4FHFA 1TGYA 1GILA 5A06A 1DJOA 5JD3A 4LGYA 3J7AC 3RV3A 4AJKA 5REQB 1MC4A 2C98A 3D1VA 4IDCA 3FPCA 2IBSA 1OLSB 2CN1A 2IP2A 2P9QA 3BF7A 5H7XA 2O23A 3QG5A 2C5LA 3HVUA 4G36A 4YJHB 4BFUA 3RHSA 2YMMA 4ESEA 5EMNA 5J4HA 2Z2YA 4RJLA 2DPYA 4MW9A 2CNDA 1PFQA 2XRFA 2WNSA 1DZIA 1YQGA 1ZY2A 2JKZA 4DYVA 5JS7A 1N36B 3ZUPA 2HCFA 3GEHA 4R41A 4NYIQ 4IINA 4HPJB 4U8HA 3RE1A 2JFZA 1BS1A 2G3YA 2AOXA 3KBBA 1XUOA 2OOSA 2VKQA 2JH8A 5TQJA 1ZONA 5BV7A 2F17A 1PD0A 4CMKA 2O8EA 3DUFB 3OEEA 1EXNA 2RHRA 1NUHA 2WHRA 3E3LA 3ZU3A 5LD2C 4X54A 4AY5A 4UBJA 5EP4A 1EDDA 2C2HA 3KWFA 1G5QA 4B34A 2NYVA 4J7XA 2P62A 4CG0A 4KDEA 4C4TA 4E0BA 4X20A 2COKA 3VKHA 5KAPA 3PD0A 3OZXA 2IDZA 1RLOA 4IMJB 2E18A 1JTFA 1GYQA 1G5FA 2I62A 4QU0A 5KQLA 1IN4A 1SVIA 1Y4AE 3VX3A 3EEYA 5E6SB 3BK2A 1ZN7A 3OE5A 5EP1A 2EU8A 4DMFA 1QRDA 3JTEA 2YW2A 1FIUA 5TSDA 4CFSA 1GUBA 1I3NA 3JD3A 4KGXA 3NHWA 5HIIA 4RM3A 1X7GA 3FTPA 4N48A 2HEIA 3T52A 4X95A 2VTBB 3WGMA 1ZCZA 4P22A 5K4GA 3F96A 4JI7B 1VE3A 1LPOA 3C8MA 3IMGA 1NTOA 4ID9A 4DLYA 5FNVF 1Q0QA 4NU5A 1VG0B 5TPWA 1CS4C 2AQIA 2E4ZA 1KS9A 4FOOA 1FDWA 1YQXA 1E1KA 3ONVA 3ETNA 5JCPA 4WVFA 3M81A 3AM4A 1IBMB 1UMKA 1LDGA 1Q7TA 3TTUA 3VXKA 5A4AA 3AKDA 3Q11A 4Q4HB 2OY0A 2FPUA 4V02A 5SZKB 3SS8A 3WHKA 4CLHA 1KR5A 3CH5A 4Q1FA 3OU6A 4CNBA 1ZC3A 1BO6A 4BJ5A 3F5FA 4LF8B 1QTIA 2WUDA 3BGWA 3DFIA 3GY0A 4HG2A 2I1QA 2PWPA 5KYYB 1WNTA 3F1LA 4E5PA 1ONNA 2O20A 2INGX 4UHJA 1JWBB 4QJ4A 1FYDA 3Q7PA 1KBQA 2OBLA 2XT9A 1BS9A 2B7CA 2FG6C 2QZ4A 4ZAVA 1G5HA 5KYVA 3WWYA 2GKGA 1VIYA 4M1MA 4CGZA 1UADA 5FI3A 1ONSA 1U2DA 1Z0JA 4ZIRB 2FGJA 2NO4A 3CKMA 3OPVA 5SV2A 4F5WA 3U3XA 5JIBA 4G89A 5HF5A 3EVFA 2HMUA 2ZU6A 3FPAA 4WZAB 4FI3C 1JVBA 1K92A 5KHAA 4EY7A 5HJEA 3O8OB 1GZ3A 3HCFA 5EZ6B 2JLXA 1QQTA 3LYLA 4DEXA 1TVEA 1E1MA 3HGTA 3W3AA 1EVEA 3E27A 2JCBA 5J2TA 1WOMA 4GECA 3BCSA 1QUEA 1I4DD 4DL9A 2YZKA 1BQEA 3H97A 4DLTA 1FPMA 1JDPA 1NXQA 1T8PA 1NR5A 4GX5A 3ZDAA 2NGRA 3KG2A 1QHYA 2PRKA 3SBXA 4K9MA 1ESCA 4DC1A 1CR4A 4JD5A 2ZUVA 3HLKA 1ZPDA 4PX5A 2I7TA 4MV6A 4PYRA 3K5WA 2AJCA 1QF7A 3C1TA 3U7FB 3C5VA 1C1HA 1EP2B 1WIWA 3C6KA 1VL1A 2HREA 5AQEA 2YWJA 5L6MB 4Z2YA 2ID7A 4ZO9A 1Y1RA 2BCEA 4R9NA 3GRAA 1V5IA 4QG3A 2OBFA 4Q34A 4E5SA 2KLBA 2J6HA 1EAMA 1GTVA 1ZG3A 1P0PA 4YQEA 1E99A 3OQIB 4CR8A 1OIXA 2Y66A 2C4NA 4JLVA 5T4BA 5DRTA 4X8MA 4F2WA 3M1LA 1P6UA 3EASA 3DCNA 1E4VA 1QQ6A 1YE5A 2JGRA 1DKRA 3DE6X 4FGWA 4HDNA 3RJTA 1G19A 2R7LA 4LRQA 3KQQA 4HQKA 2XUOA 1UZLA 2ZTSA 3AJEA 2XUPA 4KNVA 3TPZA 3WOVA 3HE3A 4Q7EA 3OEWA 4ZQIA 2C07A 1UKBA 2NN3C 3DZJA 3P7MA 4B4DA 4BWVA 5HW0A 4OKSA 3TSZA 4XUGB 3N2GB 1JBKA 2G36A 3OEHA 2J3JA 1PL7A 3I2IA 1GTSA 3THOA 2DECA 1OH8A 4NCNA 221PA 3NKVA 4LY3A 1GT6A 2C8KA 2XTNA 2Z4TA 1P9NA 2W4MA 4DSOA 4LHYA 1FUKA 1J33A 3ID6C 3CF4G 3ZU4A 4J0JA 5AYVA 4DQVA 3M5CA 2WTEA 4ZCLA 3UAXA 1ISMA 4BN5A 2J6IA 2JLSA 3LKDA 4L5AA 1VMDA 3C6QA 4BKOA 4UJ3A 2PZJA 2XZOA 2CXNA 2OG1A 4P4UA 1LZLA 1FYVA 1GNLA 2WLSA 3STWA 5LMCA 2VFAA 1ZSNA 2C5HA 1OC4A 1ISHA 2AR9A 3SEZA 2CEKA 4RSGA 2B92A 3RR2A 4F71A 5A5DA 1OXSC 4QYIA 5DHFA 3I9KA 3RAPR 1W0KA 3IMEA 5IDXA 1N5DA 5FNZA 1F4VA 1NNLA 4EA8A 4EA7A 4V38A 1OWPA 5H9WA 3PPYA 4MVJI 1DJNA 1QQ7A 3JQ7A 1JMYA 4EJMA 5LFAA 4EJSC 4Z4IA 1MH9A 3N8HA 5EGSA 2GERA 3RBVA 1QH1A 2PX4A 2IY8A 4UM5A 4Y2YA 4LWQA 4A8HA 2OC4A 2PX6A 4U5QA 5LQAA 1I6KA 5K6TA 2R6DA 4RFSA 3I5YA 3ENNA 4H60A 4PSVA 3MTBA 1S8NA 2JGJA 4NCAA 1SUBA 2QM0A 4JL8A 5JXIA 1DCFA 4D02A 1WZUA 1XXHA 3ENQA 2V1UA 3HXLA 3PQDA 1O08A 4GE0A 3X1DA 4BGUA 3AM1A 2AQ8A 1NVBA 5B4UA 2D6FA 4PLGA 4TLCA 4PG4A 4Z1MA 3IIJA 4NWIA 3FCCA 5MGNA 1XTKA 1U3UA 3IX7A 4NBSA 4JBYA 4OKIA 1F12A 5TF4A 2CLHB 1USKA 4OQNA 4AS1A 1Y8AA 4H6XA 2AQKA 4R2JA 3AVVA 2X23A 4YRQA 2ZPTX 4PV7A 3R6LA 2NSHA 3ZLBA 3BYZA 1M9NA 4UMDA 5TVGA 3RIHA 1EXVA 3D6FA 3GMTA 3AUSA 3L6CA 1E64A 3FJYA 1PTKA 1S89A 1U8EA 1DAHA 2JIPA 5JEDA 2HJSA 3DYIA 4F1WA 5CLLA 2GCOB 5CP8A 4BAUA 4KB5A 2RH9B 4BVHA 1Z16A 3DKIA 5L3SA 4RQTA 4ZC8A 2OE2A 3E18A 4MRMB 2WAAA 1TADA 1TCUA 3LKBA 5HPYB 2Y1LA 4BKQA 4CN9A 3FDZA 5JQGF 1WB9A 1Y3CE 4UBOA 1Z15A 3DC2A 1E3EA 4WK0B 1C7IA 4ENQA 3RYCA 1WZEA 1J70A 1A4IA 1SRQA 1XB2A 5DYYA 4GBGA 3E9YA 1SY7A 3W8FA 3KYCA 3WJ7A 1SBZA 4H6PA 5LXTF 1CPYA 4J94A 2ZZNA 5I9LA 3G6WA 1T3HA 1XHFA 3BTUA 3F1KA 2BI4A 2CLFB 3U2QA 1E9FA 4FE4A 1YZHA 2RGYA 1GADO 3HGQA 1JTVA 1VLHA 3AIOA 3WLTA 1NVUQ 1EINA 4JJ4A 4GI5A 3HRHA 5H5JA 3L4KA 4NPHA 3G8DA 2BHLA 2BDTA 1A96A 2MIIA 3RUFA 3HDHA 2ODQA 3E81A 5I47A 3AEUA 3ZHRA 3ZVKA 4KV7A 3LZCA 5J40A 1CY8A 4B31A 4MKRA 2BIFA 3HV2A 2JBHA 3ZJUA 2I71A 3S7TA 1E2BA 2BLLA 3F73A 3F6EX 1X7XA 4YBZA 1NX6A 3BHMA 4HYEA 3AO0B 3RU3A 3ZYZA 3RHTA 5BUQA 3TTVA 4C6TB 5IVHA 3QFSA 4K9KA 2IGBA 3JZMA 3W34A 1VSVA 16PKA 5IC5A 4ENRA 3ER8A 4CLOB 4YCCA 3OJ0A 3SX2A 3Q7TA 5E9QA 1G21E 1Z56C 3WJAA 1RNLA 1BGVA 1T5TA 2OXIA 2WJ6A 3M89A 3DDNA 5JRDS 3QVOA 3DLHA 1VDMA 3H4IA 5FV7A 4BKPA 3UH0A 2YMPA 5DLPA 5C80A 1FFHA 1JLSA 2Y2UA 4EKEA 1I94B 1XKXA 2IU0A 5BR4A 3I39X 4X90A 1HQKA 3OJLA 3V1KA 1ZN9A 2VF8A 3SHVA 3E8MA 5LQDA 1TFRA 2Y1DA 2A0WA 3AETB 5AIBA 4FLEA 2XGMA 5DGTA 2DVMA 4N82A 3RUHA 1BJKA 3SP1A 4QXOA 5INTA 3Q8LA 4OKNA 3CX3A 3FJOA 3U3MA 4JKYA 5IZ4A 2JFPA 1QOPB 1PTJC 2OTCA 2BSQA 5FWXA 5J3JA 1BTOA 1JJBA 3I37X 3I0NA 2P91A 4YMGA 2R6FA 1DIOB 1CTQA 2PGAA 5BWOA 1KYQA 1SNYA 3CNOA 3P9XA 4Q01A 1VLJA 1O9BA 3DHWC 4GXRA 1A8SA 3DC7A 3MW8A 4GD3Q 3QEAZ 5FBKA 3W5BA 1XVTA 1Y4SA 4HMQA 3F2IA 1GTG1 1OFIA 3RUPA 3DYBA 4G65A 4YJFA 4U7DA 3CR7A 4C0WA 4G5OA 3LDAA 3DEAA 4YMVA 1XEFA 2WLTA 1D5WA 2O2CA 2JG3A 3K4PA 3L6UA 3RW9A 3VH2A 2XA1A 3CLSC 2I33A 4EI8A 2XXAB 5C2JB 4ZJPA 3D5QA 4LY6A 3FHOA 5DBGA 2G9UA 1S9HA 4DM7A 2UV8A 2C3YA 3OFSA 3QIAA 3AHCA 5H4HA 1SVMA 3UGKA 3RANA 2XCUA 1F2VA 2E4WA 3NLLA 1TVKB 3ZG6A 3X1ZA 4J4BA 5D7NA 1GPYA 5JE8A 3GFVA 2M9MA 1Z0AA 1NP7A 1PFWA 1QE3A 2EZUA 1DXHA 1TD9A 1N3BA 2DX7A 1PI3A 1VSQA 2XOKA 3LFUA 3WLKX 4DCCA 3TM4A 4BFYA 2NU7A 2QUZA 4REOA 5FPTA 2BFNA 4Z7OB 2ZETA 4KR6A 1IUOA 1DJQA 1EUZA 1I32A 1FRZA 1QGED 3BVPA 3CWCA 2F43B 1FPQA 4P3NA 1I4LD 2GDJA 5KC9A 1DDIA 1RS0A 3QKRA 2WB4A 3E0QA 3OQBA 3AFHA 3GRRA 4OAQA 1M1NB 4R3NA 1T3ZA 4UBNA 1JQAA 4X41A 3UNXA 1ZS9A 2X4DA 4ZPJA 1PJ2A 2XLBA 3JQRA 4CKYA 2GF9A 1AV7A 1GGHA 1RZUA 1QHNA 3C6YA 2P6RA 1WVIA 5DTMA 1N5MA 2YH2A 1KRHA 1RAEA 3B53X 2P9EA 3REQA 2SKDA 4Y9SA 4R98A 1PUIA 3IEIA 4Q66C 2HA3A 5CFZA 3OZVA 2Y76A 2HTFA 3N0VA 5DGDA 2PX0A 1XTBA 3EODA 4HXYA 2XKBA 4HTFA 2C95A 1A9RA 2PLNA 1X0XA 4NHEA 3T9AA 3WYEA 4F4CA 5IG2A 7MHTA 1WVMA 1YBFA 2XECA 3B36A 3WIBA 1LBQA 2QT1A 3OOWA 3N2LA 3GK3A 5FLYA 3M2TA 3V55A 4EVSA 3EC7A 3K73O 3TQTA 1TJ4A 1DUIA 2C4MA 1NW7A 1RZRA 1YS4A 3HWRA 1OI3A 2OGTA 3FF1A 3LPLA 2CHUA 4MJ3A 4LDZA 4YRIA 1M6VB 1UK9A 2UVDA 4R7ZA 5T8KC 4DR1B 1QRTA 3EZFA 3A2MA 5T6MA 2DULA 2J9ZB 3PIIA 3LT2A 3EMKA 1WWKA 4PZAA 1NPDA 1XF9A 4HNHA 4G84A 4Y2PA 1P4RA 2CXTA 4Z8XA 4P84A 1VJTA 2PVCA 3A4YA 2C57A 3WL4A 1ISRA 4J0DA 1QFSA 1IB0A 5TGTA 3K0KA 4K6HA 3TDKA 3EZXA 1W96A 2F7SA 2NG1A 1FTSA 2PXHA 3FZYA 4GICA 4RESA 3TD6A 3ZWOA 2B8NA 4D8XA 2WA1A 3QVMA 2O3UA 4KWTA 1P0MA 3O8RA 1RYHA 1QVVA 2W2LD 1YNSA 5DULA 2HRBA 3NFRA 1TT7A 4MINA 1ES9A 1UUFA 5B6JA 1K68A 2AJTA 3BWEA 2LR0A 2IXGA 3U0VA 4M98A 1SZDA 1HYEA 2R25B 3CMCO 1OI7A 2H16A 4N39A 3OE7D 3QHQA 1AKYA 3OE1A 3JYNA 4JC8A 4DLWA 3UWKA 2IJGX 1RC1A 4P58A 5F3DA 5LP6A 1CQPA 2IPXA 2PVPA 4CIXA 3I61A 5D6OA 2OILA 3T1VA 5E6UB 3THWB 3CE9A 2PS0A 2A0YA 3NASA 3RTBA 5IBCA 3ZY2A 3VX4A 3MCTA 1L5HB 4EG8A 1OYYA 3IUPA 1U8TA 4MW4A 3SZ3A 5TPZA 4O2BA 4N3BA 4IICA 5CX1B 4F9TA 1V8FA 2II6A 1PS0A 5HG0A 4X66B 1U63A 4WY2A 2JHCA 1TA9A 4FFRA 1V7CA 4YFYA 5C8DA 1F2TB 3RTGA 5DYWA 3WIUA 3IR6A 3Q40A 2X14A 4JSTA 1B4DA 1JR3A 2EP8A 1O4VA 2PT6A 4RW0A 4ER6A 5EE0A 3GP5A 1SOVA 4NR0A 4N7RA 2WMDA 4BNDB 1AVTA 3RSCA 2JS7A 3TTTA 2HOQA 3HUFA 3NFYA 3ECAA 3ROQA 3AKZA 2JIDA 3QHPA 4FSDA 3EIHA 4KE7A 1LVUA 3BD7A 4HF7A 4WOCA 3KQWA 2PH3A 1CUJA 1YJBA 4HQ6A 3DV0B 3N2KB 4CM6A 3NBUA 1FRQA 4Y0NA 1QR6A 2J3KA 3FE2A 2XCLA 3BJRA 1VHJA 4UUNA 1V8ZA 4EGCB 3BUSA 4PAGA 4R1LA 3KELA 4WBNA 4GPZA 4BS9A 4RV4A 3E3MA 3NXSA 1DAEA 5DHPA 1HFWA 1GG8A 3CT6A 3E82A 3R24A 4GL2A 1E2GA 2R7KA 1P4AA 3TQFA 1OH7A 1XYVA 3EGVA 4WESA 4MAFA 3TIVA 3E9ZA 1NRWA 3B13B 4JT4A 3TE6A 3JQGA 4HLDA 3URKA 2F3QA 2M2IA 1SN7A 3G79A 4KGDA 1N2SA 1Y6QA 5KOYA 3IOMA 1ACJA 3OTOB 1JLLB 2PPLA 4MZXA 5FUXA 4R8RA 1LBIA 4TYQA 1UPCA 4LNUA 5ICSA 5J4KA 5JSFA 2CYBA 3B1YA 4L22A 2ZZKA 4MA5A 1T2CA 2EJVA 3P0JA 3Q7QA 5H82A 3HPRA 1TMOA 4CNQA 1UT5A 4HRVA 1N4AA 4ESVA 4ETMA 4MRPA 1ZW1A 1K3TA 1KJNA 1RHUA 1XTPA 2HO5A 1KBOA 4HC4A 1X1DA 1UDRA 3Q1LA 3JD4A 1ZNQO 1XZNA 3GJ5A 4TV9A 3ZGXA 4DR3B 2F8TA 1F8GA 3A1VA 3IEKA 4P5EA 1FVHA 3NEAA 4GMGA 4D4IA 3HWX1 4MVJG 3S70A 4GKJB 3DPIA 2VDRB 2FDCA 3ZD8A 1JQ5A 2EGGA 2PV7A 4TXNA 1XTQA 2I4TA 1Z17A 1JJIA 5AW3A 2ZT8A 1SBCA 4XQ0A 3A1EA 1H1DA 3ROXA 3ZN2A 4M3NA 3Q2OA 1X2BA 3GROA 2GF0A 3A1NA 3MT9A 1CXZA 3OIFA 5TF0A 2VATA 3SI7A 3V7FA 2PZ8A 13PKA 2CLOB 3VJKA 3GRPA 5BYJA 2JFYA 2I03A 2ORVA 4Y2JA 5KU7A 3O4GA 1AY0A 4GLOA 4PO9A 1GEEA 3AJAA 3LPDA 3UKDA 4C4YA 3QLUC 3EZYA 3NCTA 3I5AA 3GGJA 2ENUA 3S99A 4CKEA 4PRKA 6ABPA 2IY9A 4QXQA 1EHIA 1CRQA 1TQHA 3B6JA 2B94A 2NX2A 5DP2A 3K6SB 2FB9A 2F4VB 2A57A 1H2EA 2D62A 2JHGA 3AEYA 2OT3B 3AEQA 3NTVA 4MKZA 4AUEA 4CGYA 3UJ6A 3BK7A 1NVMB 3WYCA 2HTEA 3ZJ4A 1Y6FA 2C8JA 3THSA 3VNAA 1UMDB 1NY5A 2AN3A 4ZV4A 5L3QA 1BFKA 1PDOA 2AOUA 1T3LA 2BRUA 2ZSAA 1J24A 3R0IA 4G1VA 4XGNA 4J1TC 3WGYA 3KALA 3Q2IA 4MS4A 3ZQKA 2VDNB 1JE1A 1RIIA 1XC7A 4Q39A 1R6VA 4U2CA 4BEJA 1H3NA 1YA6A 4WCFA 4AM8A 4ZTZB 1Z4QA 4M4SA 4TKZA 1IBSA 1OVGA 2R48A 1XJQA 4LJYA 3CZ4A 4RVCA 4BXOA 1ZKMA 2RBEA 3WXMA 1LK5A 2MINB 3W06A 5MFZA 1UC8A 3A4NA 2WFMA 1VQ1A 2ZRCA 5BPHA 2IZZA 4B85A 5KYKA 3STHA 4ZCMA 4KI7A 4PXYA 5A3RA 3ZIAA 2YCLA 4EJ6A 1GAXA 2EFYA 1S8AA 1SCUB 1M6EX 4AT1A 5K99A 1O5OA 2RARA 3LBFA 5LN1A 3FCXA 2QZ9A 1AE1A 3VKUA 3GB9A 3X3HA 1HKUA 3N75A 3BZBA 5AW4A 3M3DA 4I5FA 1UCFA 4JOBA 5CYPA 3EHDA 1I3KA 5K0EA 5FRDA 1LTKA 3BHIA 3PGKA 1C29B 2BFPA 2VHWA 3BGIA 3THYB 4IV8A 4MP3A 4BASA 4PO1A 1WEKA 2D2IA 2ZXEA 2I91A 1X1TA 4LBZA 4EJ0A 1V1RA 4BNVA 2HJVA 4IQ8A 4RYDA 3AY7A 3LX8A 4JMPA 2YMQA 3FLMA 1EJBA 4TS9A 5JCJD 1IIRA 1S7CA 4N7MA 1AT1A 3GLIA 5UKDA 1GU0A 2ATXA 2QTRA 1EWKA 4QOEA 1DRVA 1Z0ZA 1VDZA 1XP8A 3B12A 4IHJB 1KRWA 2OK7A 1U0TA 3JPWA 1L5WA 2WSSA 5FDFA 1NW5A 1ST2A 3RK4A 5CG1A 1I1NA 3QVTA 5FUYA 1EVLA 2BR4A 4OXXA 3RVSA 2QKYA 3IVCA 2GA8A 4Y6QA 3V8RA 2WKSA 1W5AA 4OP3A 2ZWMA 4W8OA 2NXCA 1CUZA 1JILA 5DEIA 5HGJA 3RF7A 1GPDG 4HDKA 4KH1A 5CFOA 1UOPA 2VT3A 1CUYA 2M1ZA 1ZIXA 3EYAA 4M60A 3FNBA 2I0FA 2O1SA 2YOGA 3U3RA 2G1JA 4PTZA 5AHOA 3TJRA 3E7XA 3G89A 5LM3A 4WSOA 5TQ0A 4N5HX 1O94D 3L6RA 5TMDA 4XCXA 2BMWA 3H13A 4ZHQB 3NTRA 3B9RA 1RWNA 3NYQA 4B33A 2AX3A 2WKPA 2Z57A 3GC6A 1F3OA 1E2KA 2I4RA 1QORA 5EERA 3WNBA 1C3VA 4DCVA 1E5XA 4AZWA 1NYLA 5DM4A 2CYCA 2O8FB 3RYFA 1YJXA 2NXWA 1NDQA 5TE9A 1QV6A 1WF3A 1WG8A 4YBRA 1VCHA 3B60A 1LNQA 4HAZA 1ADBA 1M7GA 2H1WA 2X2FA 4RK0A 1KQPA 2ZI3A 5F2NA 5GJBA 3ZWYA 1ZCJA 3A9CA 4C43A 1GPKA 1WXWA 5K01A 1TB4A 3Q88A 4I5GA 2AW5A 4TMZA 5EE1A 5G4KA 2PN1A 2YVLA 3KTAA 4G8DA 1EK1A 4E1AA 4DDUA 2B5OA 5IZCC 1Z18A 4UHBA 5FUVA 3SHTA 5KSOA 1C4XA 4ECAA 1P0CA 2RH4A 2BKAA 3DMNA 3FOFC 2A94A 3C8HA 2X42A 2FMTA 2ETXA 4MUFA 3C4VA 1HM5A 2P69A 2VK4A 4D4JA 5IYZB 1C30B 1HO3A 2HSWA 4QVKA 3BRSA 3IQZA 1PNOA 3OFKA 4R8KA 1GUAA 1JRLA 4F04A 4PGHA 1GZVA 3I0ZA 4C0XA 1XRLA 3PGVA 3EF1A 1YZQA 3K8QA 4L5CA 3EVBA 3CVVA 2HIAA 3DBLB 3CF6R 2FEKA 3OX4A 3UT5B 1ZIOA 3SYRA 4D9EA 4HDSA 3ZW9A 4EHIA 1PYOA 1WDKA 2H08A 2GYVA 2ZRGA 4B74A 3DJFA 2I67A 3IP5A 3PD7A 3BSYA 3WGZA 1P5HA 3FCSB 4KYTA 1C3OB 3TR6A 1A3CA 1W581 3Q12A 2ZU0C 3QUSA 2W4IA 4I1IA 2W6JA 2B83A 3G0CA 4G2NA 4EI7A 2QTAA 3LY9A 5REQA 4MR8B 2C99A 4Y2HA 2NZYA 3TL3A 2X7XA 1MRZA 1T8WA 3OJOA 2QTVA 4PSCA 4M55A 3UXMA 4FZ3A 2YFHA 2CE2X 4BNFA 1TPYA 1PQUA 3IP8A 5FA6A 5CNIA 4IEEA 2F48A 1N6NA 2BFWA 2JLAA 3FYUA 2QX4A 3EIOA 4JHXA 3WJ2A 2A1TS 2WPDA 3QF4B 4DG9A 3IPRA 3OMWA 4LMPA 2OPBA 1LX7A 3L07A 3OIYA 2F1OA 2JGLA 3L7DA 4ZCPA 3VV3A 4KLZA 1FLAA 1UPTA 3UA4A 4LF7B 2G9QA 4L7QA 1NV8A 1VBNA 2GXSA 3EA5A 3VO2A 2A84A 1W2WB 1QJCA 2LDBA 3QW2A 4GZ3A 4QOSA 4RK1A 2CJYA 2ISCA 2QVCA 4KXFB 1DRWA 1Z34A 4JFAA 1XZCA 5LNK6 1RBZA 3W6OA 4HLNA 1YHYA 2D54A 2B1GA 5HQTA 1G8KA 1LLQA 3HDYA 4UDXX 2VQFB 2VDWA 1MO4A 3U6BA 3J81A 1GGNA 2IDMA 3LUBA 2JGEA 3QU2A 1AQ6A 4Z9FA 1UWCA 4CMGA 2BT4A 2FHSA 2Y93A 5BV1A 1A95A 3KEQA 5IP5A 4GP7A 3W90A 4C6HA 3H3XA 4PPGA 5FT9A 2WM9B 3SJAA 4GLBA 2HNBA 5F33A 2O4CA 3QQPA 4P53A 4BJ6A 4Q1EA 4WZ6A 5JAHA 4S2EA 1H22A 1P2UA 1U1EA 5KJ1A 3LOQA 2H4XA 2GBFA 3FPSA 2ALJA 3R3VA 1PW5A 5CVVA 3QVWA 4ARBA 4B1FA 3TLGB 5KNCH 2UYHA 2X4IA 3OC0A 3PZRA 3IPXA 4OGKA 4OHCA 4QFDA 3RS3A 5CB8A 3T41A 5FB3A 1ZH2A 1CFJA 1RJFA 1JPNA 4BGVA 2G07A 1MB9A 4DLKA 5CCEA 2DFTA 3GGCA 3RTDA 1N8NA 1U2GC 1LA2A 3LBYA 4M1QA 4NMWA 5EIXA 4RVHA 4CEHB 3TQIA 4RFLA 4OOFA 1IPHA 1UP7A 1SA0A 1LDBA 5LJIA 3FW1A 3GJ0A 3GT4A 1AXGA 4G4GA 5AJUA 5AVWA 1SUFA 3ZZ1A 5EWLB 4HEA6 3IL2A 1N6IA 4DB4A 3MS2A 2MSCB 4JBGA 4US1R 4KAXA 3PVZA 1A5TA 5DMXA 4EOGA 1TZJA 3H2GA 3LHDA 4QWWA 1MAWA 1E9RA 2V97A 5KCMA 2PKYX 3E2MA 4DSTA 4D9NA 2QWXA 2IH4A 3A6EA 3LC2O 2ZFUA 3TW4A 3MHTA 4ZN6A 2VZEA 3EXG1 1WUKS 4Q3KA 1CHNA 1JH9A 2YOHA 4RK7A 2A5GA 1KYZA 3HJGA 2ZUFA 1J1ZA 3E3NA 1IUNA 2IK8A 1B16A 2MSEB 5I01A 1P1KA 5ITZB 2A9OA 4DVJA 1DKNA 1PHPA 1YB6A 4B6OA 4E94A 2NVBA 3G85A 1FA9A 5HIMA 5EAIA 1NBAA 5GONB 3V48A 1JHPA 2D5CA 2OP0A 5A4MS 3NJ8A 2FCAA 5JS2A 5JV5A 1KU6A 4R7TA 2O14A 2PUJA 4L1KA 5TEVA 5CB0A 4JI5B 4LF5B 4G09A 3QOFA 1Z35A 4JLSA 2I6FA 4RGQA 3FRIA 4MV4A 3A31A 2YJTD 3EAFA 4AQYB 4P54A 1PJAA 3EWSA 1KR2A 1AN0A 1U81A 3O2SB 3OTHA 1CY0A 2X8LA 4B5KA 2G0AA 1V45E 2Z2KA 3N59A 2CVHA 3DBVO 3ZLJA 1CR1A 5E6RA 3ZYCA 2PUDA 4HS9A 2FA9A 2FN9A 2PX2A 2UUOA 3CLHA 4A0FA 1LWNA 4ZCQA 2H2FA 2VHXA 2IW3A 3BXGA 4XEUA 2ZAIA 1V3UA 4Z9YA 2PGDA 2W6MA 1GGFA 3ZY4A 5KQRA 3CNEA 3N05A 4LJ5A 1FC0A 2IYSA 3N39C 2OA0A 3SMQA 8OHMA 3N8IA 4LVOA 1QRRA 2IIVA 4DDHA 4JZKA 2BVNA 4IHQA 3THXB 3U56A 2YX1A 3FY4A 4CMIB 2Y68A 2NUAA 1Y1KE 1YKSA 4PAMA 4BGEA 3U6KA 2IA5A 4JLUA 1Y4ZA 2IUEA 2V7UA 3L8HA 4B2IA 5JXWA 1MJFA 2X8JA 2UZ1A 3UJ3X 2Z6VA 3EC1A 3W6ZA 3SNKA 1NAIA 3M9XA 1QKIA 3FOCA 1Q0ZA 2Q6VA 1HYQA 4I3FA 3MILA 4YGXB 1D1TA 3UV3A 2O2HA 4A5SA 1RI3A 5DM0A 2FQXA 1YK0A 2IIPA 3C3AA 4C0SA 3DOIA 3PPIA 4WKOA 4QELA 6LDHA 2FRDA 1T4CB 1U5BA 2FZVA 4G2TA 1BSVA 2IWRA 3ZHVA 4EAAA 5K8TA 2OYCA 1L5ZA 1O2DA 4YROA 1RQ7A 3OTQA 3FKSA 4C76A 3F90A 1F8YA 3CS3A 2EFEB 3DXYA 1GCOA 3F7NA 4IIHA 1V9LA 5CBPB 1RXUA 5J4LA 3H5WA 1L7PA 1PAUA 2PKQO 2W6ZA 3EK2A 3ER6A 4FCVA 4HLQB 1TCCA 4GOXA 4DLVA 1QAOA 3IIKA 3HYRA 3OURA 5ALIA 1TAGA 1OQAA 1O95A 4A6DA 1IN8A 1E3IA 3MJVA 2QTCA 4B75A 5K0ZA 3I3SR 1GQOA 1L6RA 1Z7YA 4UDNA 5M34A 2A9FA 2BGMA 1V1MA 2R6JA 1M33A 3TECE 2XD9A 4LI0A 1KI1A 1VYVA 1RYDA 4FX2A 1CIPA 1B6GA 3AUXA 1EGHA 5K6AC 2IHZA 3TUIC 4X1IA 1I36A 1PUJA 3C43A 4DLPA 1P75A 1E0KA 4TTVA 4BGDA 1TOAA 3TOXA 1RRCA