1TIKA

Crystal structure of acyl carrier protein phosphodiesterase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
203
structure length
203
Chain Sequence
b'SLSKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALRPSDAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVSAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein phosphodiesterase
molecule tags Hydrolase
source organism Escherichia coli
publication title CRYSTAL STRUCTURE OF ACYL CARRIER PROTEIN PHOSPHODIESTERASE
rcsb
total genus 74
structure length 203
sequence length 203
ec nomenclature ec 3.1.4.14: [Acyl-carrier-protein] phosphodiesterase.
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tikA00
2R97A 3HR4A 3OWXA 4OXXA 3W78A 4BMOB 1CZUA 1AKTA 1YCGA 2V9CA 4QOHA 5F4BA 4C0XA 3GAMA 2R96A 4DIKA 1AHNA 5LJIA 5EA2A 3P0RA 2XOEA 4QOIA 3K1YA 3OX1A 1XYYA 1FUEA 1XT6A 2RG1A 4GQIA 3R6WA 2FDXA 4FX2A 2FOXA 4LAFA 2QMZA 4QODA 5FUQA 4S24A 3W7AA 2FCRA 3OX2A 4YAUA 3OVMA 4C0WA 1CZHA 5B3LA 2HPVA 2BPOA 3ESXA 2KLBA 4XDHA 1XI2A 2OHHA 1WSWA 3KEGA 4YALA 1C7FA 1TLLA 2HNBA 1ZWKA 1FLVA 1FTGA 1FX1A 1OBVA 1QHEA 2Q62A 1AKUA 2FX2A 4PU0A 3S2YA 1RLJA 2FLVA 4U7HA 1KBOA 3EDOA 3KAPA 3NHPA 3G5MA 3FNIA 3GFSA 1GG5A 2W5UA 4QOJA 3LT5A 3QFCA 4N82A 2M6SA 1T5BA 3K20A 4C14A 5LLDA 1C7EA 2BN4A 2QR2A 4FGJA 5NLLA 1FLAA 1D03A 2HNAA 1YCHA 3UXEA 4LTDA 4N9QA 4GR9A 1NNI1 4NLLA 3GFRA 1AKRA 1XYVA 1CZRA 3F6SA 3NHRA 1FLNA 2V5VA 2D5IA 2QX9A 1RCFA 5LBUA 1BVYF 3NFRA 1VMEA 1H69A 4YAOA 1AG9A 1FLDA 2X2OA 3F6RA 3FJOA 3NHLA 3GFQA 1CZKA 1J8QA 2QX8A 2AMJA 3N3AC 3NLLA 3OJWA 5BUCA 2ZKIA 4QOFA 2QX6A 1AKQA 3NHYA 5EMNA 3NHFA 2MWMA 3L9XA 5F12A 2M6RA 1F4PA 3EYWA 4Y7CA 3QE2A 4BMPB 6NULA 3NHSA 3TE7A 3SVLA 1ZX1A 4HS4A 5TGZA 2A5LA 3OWHA 1YOBA 4C76A 3ES9A 2QWXA 1J9GA 3JSXA 1B1CA 2V5UA 4M0CA 4F8YA 5JROA 1D04A 2Z9BA 1YCFA 4YQEA 4CF6A 3KLBA 3HA2A 4PTZA 2ARKA 1T0IA 2Q9UA 3LCMA 4CETA 5LVAA 4FGKA 1X77A 4FGLA 1RTTA 2QMYA 5B3KA 3ESZA 4U7FA 3B6KA 5F51A 1AZLA 3F2VA 3N39C 3OJXA 2MTBA 3O73A 4XDGA 3U7IA 1J9ZA 1CZNA 1V4BA 2Z9DA 3F90A 2FVXA 3FVWA 1KBQA 3B6MA 3TEMA 5LJLA 4U7GA 4ZVKA 1YDGA 4DY4A 2BF4A 4R81A 4ICIA 2FZVA 1AKWA 1DX9A 1OFVA 3O2NA 5ULLA 5EAIA 4YAFA 2Z9CA 2N1MA 3NHJA 1OBOA 3W77A 4LA4A 4H6PA 1D4AA 2BMVA 4QOGA 5NULA 3NHUA 1I1OA 4Y9UA 2FZ5A 1DXQA 1E5DA 2X2PA 1FVXA 2MOKA 1CZOA 4ESEA 4GI5A 2MT9A 3TZBA 5LBTA 4QOEA 3D7NA 3U7RA 3UXHA 1RLIA 3W79A 1YKGA 2GSWA 3B6IA 3HLYA 4HEQA 1J9EA 3OX3A 4H2DA 2OHJA 3FW1A 3N3BC 1AMOA 1WSBA 3KAQA 3L9WA 3RPEA 1H66A 1AKVA 1YRHA 1CZLA 3FX2A 2KQUA 2Z98A 3NHWA 1BU5A 1QRDA 2WC1A 4YAWA 3ZHOA 1SQSA 5A4KA 4N65A 3QFRA 4LTMA 5FA6A 1TIKA 1ZWLA 2BZSA 2OHIA 4LTNA 4D02A 4ZVNA 2OYSA 1SG0A 3NHKA 4DILA 4ZVMA 4ZVLA 3B6JA 2F1OA 4Y9RA 1QBGA 1JA1A 2QX4A 5FX2A 5LMCA 2FAXA 1QR2A 1JA0A 4NULA 4PTYA 2XODA 4J8PA 2B3DA 1DXOA 3ESYA
chains in the Genus database with same CATH superfamily
4ND7A 1T9KA 1BWSA 3TVYA 5LQMA 5ALGA 5JSYA 4CL0A 5CA0F 1GU1A 2V9CA 1V5FA 1H93A 2O6HA 2VRNA 2D1FA 3AEQB 3D6UA 1BW9A 2GRJA 3K9CA 2ZSUA 3LOUA 4N5LA 4PBRA 5I8ZA 3ZN2A 5KNDH 3AR3A 3BILA 1M1NB 4IHAA 2W8BA 4IM7A 3H1TA 4ZO7A 1U2RA 1L5GB 1L5KA 4BVBA 2VQEB 1E0AA 3D7SA 4X6YA 3NP9A 1ZMRA 2IY8A 1HY3A 1OOEA 1E3MA 1A98A 1PL6A 3VPGA 4F9EA 3C7KA 1U2QA 3H9UA 3IE0A 3MWDB 4JT9A 4OPMA 4UXJA 4YALA 5KYUA 2H07A 1UAYA 2IBSA 4PZUA 3WRWA 1ML3A 2X2FA 1STOA 2IK8A 1QGYA 2QYSA 3I61A 3AESA 1Z2NX 2CK3D 2VHEA 1DC8A 2QTFA 4FSXA 1H9AA 1BC5A 3FYDA 3RSOA 3GZJA 4LSMA 2F2TA 5FAKA 4WLEA 4C14A 2HWUA 4I08A 4TYQA 1V2HE 1ZU5A 2FX3A 4BEWA 1QX3A 1AS3A 3DOEA 4C2BA 2IS2A 2XYHA 2PH7A 3EDQA 4MHTA 1AF7A 2EARA 1EE9A 1PBTA 3KTDA 5C9ZA 2CWWA 1HOTA 2ANBA 2VSYA 2QD5A 3A14A 5LBUA 3F8TA 2GCNA 2G6TA 4RCZA 3STYA 4B3HA 4Q3AA 4F4CA 4DLNA 4GP7A 2AYYA 5JAMA 3QNUA 4I6JA 2A88A 2IYXA 5LOVF 4X8LA 4YJHB 2L19A 4UHFA 4IHJB 3Q8XB 3RAFC 2NW6A 4H9GA 3JY6A 4C6TB 5L3SA 1KIMA 1XE3A 3ETCA 3O5AA 4D6XA 4E1VA 3MD0A 2O1XA 3K0SA 5IG2A 2PUCA 5HEKA 2INGX 1PWHA 3B8HA 2C96A 4XCQA 2G76A 4LV6A 1XZKA 1LUAA 3FLAA 5CM8B 1ST2A 3KJGA 2HCBA 2AOVA 5D5HA 4YEDA 4GRAA 2WW8A 2ZVQX 1KO5A 2YXDA 3IO3A 1TXGA 2VHUA 1P0MA 1ADJA 1FNNA 3IP3A 3C8HA 4I4CA 2GNAA 4M8KA 4M1MA 4XAQA 3UGJA 1OSNA 1AK1A 2C95A 3PFHA 4UTPA 1R00A 1S0UA 1GZ3A 3GVIA 1HEIA 3E82A 5F9MA 5HM8A 4X90A 4IXTA 2RC5A 1RPTA 1RPJA 2Z9CA 3BRQA 4MB0A 3R7FA 3STVA 1NW3A 2NADA 3VR4A 3HB1A 2GZ1A 4KI0A 5JWRA 2EJTA 5B4VA 4GM0A 4BNDB 4BGDA 4NTZA 2WSSD 4GXRA 3L8CA 1AMUA 3ITKA 3P9SA 4XUDA 5TX7A 3T4XA 5I9BA 1RYYA 2I2WA 1LK7A 3B6IA 2IU6A 3HCPA 3B51X 2NSHA 3HNRA 4JI3B 4CL3A 4CR6A 4PG4A 1SZJG 2AJDA 4M22A 1U1GA 4J0DA 1U8UA 4LGMA 4OQDA 2OBYA 3UPTA 2FG5A 4YAWA 2B61A 4PSVA 3RG2A 1WDLA 3OAAD 4EJ6A 4HNUA 1JLLA 1LFAA 2NX2A 5FHQA 3QUSA 2C0PA 2J59A 3MQFA 3Q2KA 1GLVA 4BFWA 3KR9A 4C03A 1ECLA 4TRJA 1IN7A 2YWBA 1KFJB 3B6JA 3ZDFA 1RWXA 5THQA 2CNKA 3I9JA 3S8YA 3NBMA 4Y0VA 1OJ7A 2GJ8A 3IQZA 3DH0A 4KO3S 4TYWA 2O8NA 2HIGA 1P73A 1CVIA 4Q05A 4ZDJA 4F6RA 2HQ1A 2I3DA 5ILOA 3WKAA 1P8JA 2CJFA 4OOEA 3F98A 4MV7A 4QXAA 4U9HS 1BKDR 2QN9A 1DAEA 4X6LA 4CT0A 5CCXA 3JWHA 1FSPA 4PAOA 5DNWA 1WZEA 4TTAA 1PDWA 1OIWA 2GDJA 2GD6A 3Q4GA 2FU5C 3EE6A 3RRYA 3H7AA 1LI4A 5IDWA 2NZUG 1QRSA 1ZOOA 4UNRA 4IZOA 1RDFA 3HYTA 1GCAA 3NAGA 5JNVA 3ZY6A 2H0RA 3R5XA 4MYCA 1N5OX 5FBZA 1IVNA 1L9KA 1P2SA 1QFZA 3DHNA 1O6CA 4UUPA 1JLHA 2G40A 4DQXA 4N48A 3E7XA 3MGCA 4BIMA 5CW2A 4GE0A 1VSVA 1DXHA 5B7QA 2VQDA 2PMFA 3HYRA 4M55A 4MW5A 2VDKB 3DB2A 3NATA 4OKSA 1A9RA 2C31A 3CB4A 4TKVB 2VYNA 4HYEA 1QQTA 1VDZA 5GONF 3E53A 4P8RA 4CZ2A 2C4UA 4BTEA 3D7LA 1CEQA 3PJGA 1ZVJA 4YMHA 1T0JB 3DVLA 1MVOA 1A82A 5JD4A 2BH2A 5L3QB 1ZGJA 1MOPA 3EBOA 4ZYWA 3QI7A 4MQFA 3TMKA 4A16A 3U2QA 4UCXA 4UZFA 3SX4A 3X2FA 1BS9A 2FUEA 4ZAFA 2PFSA 1E2MA 1L7EA 2G7ZA 1ZLXA 3PJFA 5IK2A 1DKQA 4RLSA 4JI2B 1TQ8A 4ZWNA 5K1ZA 3D31A 1G21E 4FHGA 5LA6F 3E15A 3PDIB 4PHHA 1WKBA 2V74B 3P2EA 5ICGA 3RRJA 1I10A 1J5PA 1XDBA 5FOVA 1XTQA 4Y9TA 1ZNYA 3CWZA 1YACA 1T1SA 3L92A 3V7UA 3AR9A 1JLKA 1YHYA 2ZUUA 2RB4A 3GHYA 4XCXA 3F73A 2I55A 3JYQA 5DYNA 3RSZA 2XT9A 1M67A 1Z16A 2H4XA 3TMYA 2JPDA 1QLHA 1G55A 3FYSA 1V6SA 3HBLA 4O4HB 5ALKA 3V8VA 1SXIA 2XB8A 1JU9A 1PHRA 2CZQA 4F1WA 4NV3A 5FQNA 4PQEA 5ILQA 4COOA 3H6GA 1CTQA 2EBWA 3HXQA 4JSTA 3R76A 2R6AA 4MLCA 3ZDEA 1P4RA 2RIRA 4J91A 4MR7A 1S5PA 2IDKA 2DHQA 4K9SA 4LQCA 1ZL2A 4QYSA 4NYJR 2RMKA 3JARA 1CEEA 3MGKA 4KSBA 1A9YA 3FG9A 2W11A 1VIYA 4KMMA 4LCEA 4RL4A 1DINA 1YH3A 2B8TA 3AF0A 1N5LA 2PSEA 2E6UX 1AQ6A 2WP0A 3DOIA 4X54A 4EUNA 1PQUA 5IASA 3I2JA 2RKWA 2GNPA 3ROQA 1VLQA 4LV5B 3G23A 4A8JA 4B6RA 5A6SA 5BQ3A 5KCMA 3V1NA 4HPXB 3THSA 1EH5A 1JN0A 2MINA 3R5FA 4TLCA 2Y92A 1BE1A 2SBTA 3SZUA 1B0AA 4EHBA 1V47A 3FOAA 1O94C 3QVGA 3EGWA 4HYTA 3LECA 1U98A 4BGVA 4Z1MA 2LKCA 2PL9A 2YN0A 4U7PB 1T1RA 1VP9A 4TZ0A 1T5LA 2WG2A 1L7AA 1EDBA 1QAMA 2BWJA 2MR5A 3NCTA 1VZ3A 3PCTA 4I4IA 3QX7A 3B3AA 4ESHA 4RF2A 8ATCA 5AJXA 2BFWA 1K68A 3TTWA 1DQNA 3AVUA 3LY5A 5LSAA 2BF7A 1MIHA 4ZU1X 5A9RA 1J1IA 4US0R 1URPA 2DTEA 3N6VA 4INJA 2H1FA 2NG1A 4V0OA 4KSYA 3VGPA 4C3VA 4HH3C 1ZCBA 2GH1A 1ACLA 1RIFA 2BGKA 2HU7A 4IOMA 2GXSA 4H15A 2CV2A 2COEA 1NIJA 4I7EA 1G60A 4KUHA 1B00A 4AJ4A 4U7DA 1MJ5A 1O9GA 2NGRA 1P17A 2PUTA 3M49A 5HKAA 2P69A 4MKHA 1KI2A 2OUIA 4IIEA 5CJJA 1VJGA 3PR2B 1O97C 2CXTA 3PITA 4TT8A 3IUMA 2I7XA 1FQOA 4LZWA 2GEKA 2G5GX 4RBNA 4YBRA 4ZI5A 2IOHA 3H5WA 3KTAB 1RKVA 4EHHA 3RU3A 4AMVA 5J4HA 1HTBA 1TT5A 1XR3A 3SMQA 1TYEB 5K4HA 2G08A 4XD2A 3ZUGA 1JZQA 5DHSA 3DL2A 3ORSA 3QE4A 5GJCA 3O3MB 5BMOA 1SIWA 3U7GA 4N5MA 3UB2A 1F9AA 2DFVA 4X0EA 2WSSA 4R1LA 3U3DA 4GWKA 1Q44A 5JJIA 3UM9A 4ZGGA 3ZWCA 3D2BA 2W6JA 4Q9IA 4X45A 3GLGB 3LE8A 3W9BA 2NO5A 3ZI0A 2PIDA 3QGMA 4MVJG 4Y7DA 3NLLA 3V2UA 2WB4A 4BLUA 4WAUA 5E4TA 2QP4A 3D6FA 2O48X 2J7PA 1B0UA 4RFLA 4YXWD 1FA9A 3IAEA 2G72A 4Z53A 16PKA 3HXTA 1EWRA 1RQXA 3AQIA 3O31A 1IE3A 2I78A 2QS9A 1OHHD 1REQA 3QYAA 1QAOA 4Q1CA 4DEVA 1TUEA 2WU1A 4P4GA 3T1OA 5KTNA 4FFDA 2XCIA 2I7TA 2JL1A 4NARA 1PV2A 3G5TA 1ISIA 1Y4UA 1U7OA 4J7XA 4JSYA 2ATCA 3MCAA 4K26A 4R6WA 3UZUA 4CKBB 1N8NA 3ICWA 3CX7A 3GGGA 3GT7A 4O4HA 1YF3A 4DE5A 4IWNA 5CEFA 3GFGA 1ONSA 4R9RA 1ZVMA 2IVFA 3FKSD 3GGCA 4DMCA 1M0EA 4ZVKA 3WXMA 2GD2A 3DDUA 1DAKA 4GQAA 4NESA 2HAEA 1UBJS 4KYTA 5AUQA 3R9WA 3ZBUA 1HH4A 1Z4OA 4MV9A 3KSBC 4IF4A 2BMVA 4W8HA 3DZGA 3C5VA 2QBYB 3N8GA 4A26A 3FFWA 3VZRA 1JMYA 1NBEA 1VJ0A 5C7IO 2BGGA 3INYA 5LIPA 2IDMA 5DP2A 1NNUA 1X94A 3A1TA 2VJQA 7ADHA 1U65A 2ORYA 4AZVA 1KGDA 1H6BA 3UAVA 2QYHA 4PS0A 2JA2A 2VOEA 3DXYA 3IAM1 3G8DA 5KMGA 4K0RA 5TT1A 4YRQA 2PQ0A 2WAXA 3DZIA 3LZ6A 2FFBA 2Z8YM 4A6PA 5BN1A 5ITWA 4LJ7A 1H6DA 1Z8HA 2CK3A 3LPMA 1SXJE 1XHEA 1SXHA 1ZWLA 2QPLA 4MQ4A 1IRXA 2R84A 2ZYGA 4PPQA 5E6UA 1IVYA 3O6VA 1GT91 3F1KA 5A2QA 1YJAA 2PR7A 3GVXA 4B3IA 4YAGA 5K3CA 5AW4A 2QM0A 1HYEA 5LFAA 2O8VA 5HYVA 2ILTA 1DCKA 4E5KA 4B3TB 1IG3A 2H52A 4NDNE 4ZCPA 1EFPB 3QKRA 2B21A 1JJAA 3ANNA 4G65A 3UMFA 4O2BF 4U63A 4B17A 3K70C 3LJKA 1BTOA 2I80A 3BGVA 3GF4A 3JASA 5B1IA 1YZFA 4NBTA 3CRZA 5KOJB 1Z6ZA 2AN3A 5FV4A 5JDIC 3BMOB 1K7SN 2WF7A 1MH1A 3H8VA 1ZRSA 3IEUA 1HDRA 2BFCB 1PRYA 1QH0A 2DQYA 1TQ6A 1V16B 3FNFA 4GPD1 4K8RB 4KUEA 2I5PO 3RC3A 1U5AA 4IJVA 2Q7OE 1TLLA 3I6IA 1ZN8A 3L7OA 3ZDZB 1HZJA 3CUEF 5L9AA 2FLVA 5IT0A 4V24A 1NUHA 3ZHTA 4QDKA 2AMFA 1IM5A 3F1LA 4ID3A 3RTAA 3P45A 2IP4A 1MT3A 3PNQA 3I8SA 4BNYA 1BQ3A 3A2NA 4JI8B 4FCTA 1XEWY 1RI4A 1P29A 1JG3A 4E5VA 3IDOA 4P98A 2PUBA 3WLAA 2OA0A 4LG1A 1KSFX 2ZRFA 3EVCA 3EGEA 4I5DA 2IEAA 5TPWB 4G41A 3WHIA 1ADGA 4GQBA 1H65A 1HDXA 1ZK4A 2FTKE 5EG5A 4CFYA 1QMPA 2VZEA 3K0KA 4B6PA 4KKVA 2JCYA 5G3ZA 3VI4B 5EPOA 3RO7A 1Z6GA 1EBFA 2EFDB 5A9SB 3IE2A 4R83A 1Z5WA 4HGYA 4AYXA 3TAHA 2OM6A 1NYRA 1Y7TA 2KYRA 1KH3A 3IVCA 3EYAA 3GLSA 4HNQA 4YQFA 1FFXB 1GTVA 4DJEC 4WOBA 2ZB8A 1UZLA 4MEAA 4JC0A 4IEEA 1LLDA 2QZSA 3HY6A 3ISJA 5B37A 1Q16A 2I6UA 2IHUA 3OEHA 2OV6A 4QQRA 3DEAA 5I7SA 2QU7A 2O8BB 3QMWA 4X1YA 1KDZA 1VPTA 5BVGB 5GY7A 5HFJA 1SVKA 4B80A 3KLPX 3INGA 4J1SA 3B1FA 2VBCA 4MR8B 3ZDAA 1RYDA 4EEXA 1YTUA 2FVXA 3V8MA 3T7KA 1G8PA 4DLLA 2WABA 5AXCA 1XKQA 1KVQA 2DUUA 2O5CA 1IUOA 4LGYA 1K8QA 4Q4AA 3LO5A 3EFOB 1J8YF 1RBZA 2RHHA 4ZEOA 1K7EB 1OBOA 3TECE 3RUCA 5FPSA 2A7QA 1PT7A 1CQXA 4W7SA 4BCBA 1EXMA 1X8KA 1X19A 1F38A 2FZ5A 2VP6A 5IT5A 4CEHA 1JJVA 2P5TB 4NYIQ 1A4IA 4HRYA 2ZTLA 2OQIA 2QE7A 2VPIA 4G84A 3V32A 1Y9DA 2GBIA 4BX9A 4DXAA 1UM9B 2IKQA 1KOLA 1FRQA 1B0ZA 2VDWA 3K05A 3GVPA 4LBVA 2D3WA 4UNPA 4V39A 2VTDA 4E0BA 4LDJA 2AWNA 3MBIA 4DM3A 4RU1A 5G4LA 1QH8B 2MMGA 1KDTA 4X6UA 3K6SA 1C9NA 3NTOA 5TSDA 1K8RA 4KXFB 3B89A 3I3SR 1LRJA 3I1FA 3ORRA 4JHLA 4CKXA 2I3ZA 2NPOA 5ALOA 1EHIA 3AHGA 5EMJA 4B5KA 1JBQA 4WPGA 4Y2SA 1GL7A 3L93A 3HJGA 3S40A 4N7MA 4BZQA 3VMFA 2HZ7A 2PQMA 3E3LA 4DL9A 1Z8DA 5DTJA 1GZSA 1TU3A 2QL7A 5DNVA 3ZGNA 1P1JA 4P92A 3UJAA 1RS0A 5EKSA 3T7EA 3FDXA 3WIVA 2ZYSA 3ED5A 4LF6B 2WK1A 4UM7A 4DIMA 2F59A 5AI4A 1ETHA 1OFUX 2OGTA 2ZYHA 3WADA 5HMMA 5TARA 2PZBA 4RK7A 5B3AA 5LJIA 1WDMA 3BSWA 1E20A 1Z5GA 2OAQ1 3H05A 4FDVA 3V9PA 5GAJA 3DUFB 2NUPB 5K4AA 3GRPA 3R3VA 1L7BA 2GCEA 1VMAA 2YBEA 1X8XA 3PDCA 3PWTA 1PK9A 4FFPA 2QLJA 3DVAB 5T6MA 5B58C 5LPNA 2NTEA 1D4OA 3AL3A 3TLJA 2X5OA 5LKRA 1KRXA 2FW0A 3L1HA 4H1HA 3TINA 1K1EA 1DEAA 1ID1A 1J2EA 2BJHA 3G79A 3NTRA 4MMXB 1M34A 1WUHS 3TH5A 4X9XA 2K2QB 1XTBA 1WSWA 1Y9EA 2Z30A 2NTVA 3TLXA 4ZN6A 1RACA 1JLRA 4BN4A 4TS1A 5JCJA 3WS7A 1V8OA 2R79A 4QJ3A 4EO7A 1AKUA 1U28A 1IXRC 2O3TA 3BGWA 3DOHA 2XSZD 4B32A 1A04A 1NP6A 1RI3A 2ZWPA 1QH1B 2E1RA 4MJXA 3DMFA 4NENB 3RBVA 3STUA 5KNBH 2PG3A 3IUYA 2OG2A 3TLGB 5L6MB 1E3DA 1YGPA 3LQKA 2JAQA 4PYLA 3Q0EA 3I1IA 2JCBA 1ZCJA 3E2MA 1MB3A 2AQ8A 5MGNA 2AKEA 4I8DA 4YAIA 4L9SA 3CFYA 3EHDA 2P8JA 1QOZA 2H5JA 4GLOA 2IYUA 4JLMA 2G06A 3CX6A 4WBSA 3TKAA 1OI3A 2W2VA 3WMGA 3RR2A 3LG2A 2LE0A 4IX1A 1ETUA 2FQXA 4DPKA 2MWMA 1ZL0A 5B2ZA 1J20A 4PG5A 5KU1A 3ZIAA 4DEYA 4N0EA 3ZLJA 2WG1A 4LXTA 2YOHA 1VGRA 4CM4B 5HCNA 4YJFA 1GPH1 3W3AD 1W44A 1C7QA 1UWVA 3Q8WA 2DYKA 4FNAA 1ZUIA 4QTUB 2PFGA 4OHXA 3HA2A 2XTMA 4V0ME 4M0DA 5FWNA 1U0RA 4E15A 3RIXA 1LSOA 1E1RD 1N6KA 2R6JA 4JP2A 4M53A 3GP5A 1JR3D 4FMDB 2VP3A 1V4BA 4BGIA 4E07A 1M1YE 5AUOB 5HUHA 4TQAA 1XK6A 3QJGA 4HNTA 4R2IA 4M0PA 2IXTA 2RBEA 3JALA 4TMKA 4TXHA 4YPFA 4MGZR 5TC4A 4P93A 5LP6B 1LWOA 3EXFB 3GWZA 2V7EA 2AI3A 1IH8A 5L95A 1VL0A 1L7NA 3NDJA 1T36B 4KN5A 1GDTA 4DM7A 5JSKA 2PZJA 2MOKA 2A67A 1KE1A 2YJ6A 4C2AA 5D1NA 1XAJA 5FLYA 1IK6A 2J85A 3OCYA 4FLFA 3KXDA 3DZFA 2ZREA 3EWNA 5JAUA 3OURA 1F0PA 4I5FA 4CV2A 4Z3KA 3EQ7A 1NKTA 1A5BB 1X3LA 1CKEA 3IRUA 5TMBA 1KPHA 1F8UA 2ZITA 2P75A 1V5WA 2A92A 5BNFA 4NK4A 4PSAA 2NVUB 2VXCA 1YB4A 1QBKC 4OHPA 3WLQA 4CUZA 4N65A 5J5CA 2C4HA 1MO5A 3MF4A 1Q0RA 1IG0A 2FR0A 3UB4A 1D09A 3D6MA 5AW8A 1CETA 1VKJA 1AURA 9ATCA 1SBZA 2RCNA 4D5EA 1CJSA 5JZMA 3IV7A 2ZRHA 2ZZNA 4CF3A 2X0FA 4O2BA 1GSAA 5CBPB 5JZOA 1O8CA 3BB4A 1JAYA 1SUBA 2FMFA 3T8YA 3VZCA 3RVPA 1LNSA 3DBHA 4XEHA 3EGVA 4V02A 5CXSA 3W2TA 4C3UA 4BFLA 5DBHX 3TIIA 1S4MA 2HX1A 1Y6FA 1UPCA 2CJPA 2OV1A 5K8CA 1FC0A 4F3TA 4EGSA 1KI1A 2FXVA 2JAOA 2GBLC 2VPWA 3RIYA 4DQUA 3T5DA 3CR7A 4TYYA 3LPCA 2B78A 2EL9A 1B93A 1FS5A 1NBHA 3REOA 4ZI3A 4BV2A 1ZS9A 1XXHB 5DLDA 3R24A 4MLPA 5DEIA 5BV1A 1G5QA 1X2EA 2D13A 3FPLA 3TW4A 4OU5A 5DCUA 1IEVA 3N6XA 1YQWA 3DKKA 3EFBA 1ZQ1A 2R6GA 1X1EA 3ONNA 1TCBA 1WKCA 2BKXA 2QXYA 4DNXA 3ZHBA 5DV9A 5KSWB 1DRVA 1FU7A 1C2TA 2AKAB 4XQEA 2PANA 2RGWA 3R4CA 4BRUA 2ZSBA 4EVIA 1H5QA 4YJ2F 3PKZA 2WFMA 3PR3A 5G0VA 3SS7X 2GXUA 2C5HA 1YUBA 2YY6A 1JQ5A 3DFKA 4HFNA 4PQYA 4Q18A 4TKUA 2ZROA 2ZU6A 4ZODA 4US2R 3L0CA 3T5CA 4ER5A 2VKQA 3NT4A 1OBCA 2D2EA 2Y0EA 4A27A 5HVNA 4YI3A 1VPVA 4X1OA 2J9ZB 1C4KA 4U8GA 1WR8A 2RSLA 4LF8B 1IHOA 4JASB 2M1ZA 4EO4A 1ECBA 2ZE8A 3KKQA 3PGLA 5CA1F 2PZEA 1GPLA 1WCYA 3GNSA 3REGA 1C50A 2Q6LA 4YAKA 4IFBA 1FW8A 4JMPA 3ZBTA 2JLUA 3DEFA 3HDJA 3QBTA 2XITA 5B53A 4C4ZA 3IVAA 5IJ0A 3FROA 3ZLBA 2UZ1A 3HB9A 1EM8A 1TRKA 2X1LA 2YWRA 4PPGA 5ALWA 1NPYA 2YVUA 4AWAA 2W00A 5LVAA 1FTSA 3UWSA 1LTKA 4PCAA 3I4LA 3WWEA 1J2YA 3ZCVA 5T41A 1VBNA 3N2GB 2OECA 3WV5A 2GCOA 4K87A 1NXXA 1HLGA 3NIWA 1O1YA 2CVHA 1C30B 5F2EA 5LJLA 1BZYA 3LDFA 3KKKA 2WJPA 4G1CA 5EESA 4GL4A 1G7RA 4UQPA 4QKQA 1X1RA 1CJMA 1J0XO 2EW2A 1A9OA 3L0IB 4MRMA 3NH9A 4PS1A 4PNZA 4RA9B 4ECEA 4CM4A 1E1LA 1GGJA 1ZISA 2FDRA 4KYVA 5TPZA 3QEKA 2ZAGA 5NULA 3TM4A 2C57A 4Y9UA 4JKIA 4F5ZA 2A35A 3B3JA 2PJUA 3PQ6A 4V0MA 3IC5A 2GAIA 4PE5B 2HT6A 2OV3A 5MN5A 5IBQA 4YS6A 3UOGA 3TFOA 4JI5B 1NW8A 4GPBA 4DLVA 4PPNA 1XAHA 4FFNA 1PUIA 5AJWA 1VLLA 3HCDA 3K72B 5KDLA 3DMYA 3KAQA 1DLJA 1QUEA 4G4GA 5LLTA 4PW0A 3EY9A 1GNSA 2YCLA 2J9YB 2PBZA 3CLUC 1N2CE 4JDUA 4LYHA 4WJZA 4A1OA 3V2GA 4LKOA 4B33A 5C31A 2WSMA 1XCLA 2PYIA 2ZR7A 3UXYA 1R8YA 2RFLA 3WIBA 2QZZA 5FBKA 3U9TA 1QVRA 1XEAA 5D3MA 4D02A 1O87A 1Z6PA 2NZ2A 2CDAA 3OZGA 1Q50A 2N46A 1QH1A 4OJMX 4NENA 5JG7A 1QHFA 2R00C 1TJ3A 3KQMA 2A3RA 3UW1A 3AG5A 2TMKA 2X1VA 3TG8A 1P5ZB 2Z1DA 5BW6B 1PJTA 1JWBB 1U7PA 4HDAA 3RG8A 3BMOA 4PC2A 3KLOA 4LF9B 4Z9AA 4GL2A 1Z7YA 4F6LA 1KMMA 2JLBA 2VBIA 3LYAA 3DF7A 5YASA 4EI8A 4DV7B 1JW9B 3PXAA 3DVAA 1FUYB 3A2MA 3GT4A 4KH0A 3U1BA 1EWTA 2AZMA 2J4FA 5HZHA 4M7RA 3DYIA 3EUAA 3WI7A 5LQUA 5MDHA 1U3WA 4QO8A 3FMPB 3PCRB 1EIZA 5BR4A 5DISB 4LFCB 1XCOA 3NXSA 5JZSA 3ZK9A 1GDHA 3MAJA 4IIVA 4H3HB 5SICE 1DT5A 1UANA 2X9QA 2EX4A 4CM9D 4F91B 4QTTB 1K8YB 4GNKA 4R2JA 2PKCA 3O4RA 1JDBB 3HCBA 5G4KB 2XWJI 5DYGA 4FHCA 5DM70 3HSYA 4NBKA 3LUAA 1WETA 3SQMA 3GRFA 5BN3A 1LKZA 4LZLA 2QTLA 2A57A 3HR7A 1VXRA 2H16A 4BQFA 4LNHA 4HNVA 1C3JA 3H1FA 1YSCA 3D4PA 1DDIA 4FGJA 3AJAA 1A9ZA 1JKFA 5KNLA 4TTPA 3E22B 4WXRA 1UBNA 1KK0A 3M3PA 3PUYA 3SGLA 2Q4EA 3B1JA 4EY7A 3O2JA 5U4QA 3F7NA 1A3CA 2WZQA 3OO1A 4XGKA 3ZY2A 1BIFA 5TQVA 1HR0B 1T6NA 3RRNA 1QGUB 1BXGB 2ZJ4A 3RSLA 3BH7A 3ASUA 2H57A 1NI4A 4XB6B 3VMMA 2N47A 3CXRA 2ZBEA 2PKQO 2QN7A 4H35A 4NH4A 2BM1A 3O1LA 4LCBA 4MWBA 2J5KA 2J41A 2YXNA 3FPFA 3LXMA 3MB5A 2Z5FA 4FS8A 4JKYA 5I7AA 4AMYA 2FEMA 1EVJA 1IUKA 2Z4SA 5EE5B 5DM60 4EBFA 1ZNZA 4QPNA 1OV4A 4L8FA 2PXXA 5IFLA 3FSRA 4JBNA 1FJGB 2Q5JA 2RHLA 3HYLA 3CIOA 1E32A 3DAFA 3G6WA 5K01A 1S2IA 4BVLA 5H9WA 3IAS6 1TM1E 2OHVA 4X3OA 1Y1PA 4UULA 1EB9A 1YR6A 2W2NA 2ZSAA 1FMCA 2VXBA 4JS0A 2FN4A 4UBMA 1REQB 2XCTB 1H8HA 3OIGA 4XM0A 5JHGB 2J67A 2GKOA 1WVGA 3M2TA 4IXWA 4MS4A 5EE9A 4QJ5A 3ZCTA 2O59A 2ZOSA 4PR0A 5HGXA 4ICIA 3M5PA 2JI8A 4BCCA 4D4JA 1XD2B 5D51S 2H51A 3K9FC 3CXUA 3VBCA 1OT5A 1I2AA 4CKYA 3F6PA 4URYR 3ZZTA 1CY6A 4YX9A 4PHGA 4RXUA 2CFSA 4KHZA 3CEHA 5JD3A 9MHTA 4JKOA 1OV6A 4MDEA 1G16A 1MJHA 4XLTA 2RGNC 1F0KA 1WXHA 4NJMB 4Y18A 1T6XA 4CV3A 2W48A 2ODBA 4URXR 5HS4A 1EIWA 2QY9A 2BW0A 3HA5A 1FMJA 2GM4A 2Q9AA 3BJMA 3GARA 3GFOA 1Y1SA 4IAOA 4JWKA 4MUKA 3TB6A 3SM3A 1DKLA 1W85B 2RAFA 1CUCA 1L7VC 1DEKA 1M54A 3CNEA 3FSEA 3L4BC 3NIGB 2VPYA 1DMRA 4H1VA 4RKRA 5D84A 4AY4A 1NXTA 2PM8A 4NDAA 3CX3A 3QVVA 1ZD2P 4EQ6A 1W34A 4KO2S 3SX2A 3UMJA 2O0HA 1I4DD 3T7DA 4XGNA 5BYBA 4BUZA 5HG0A 1YRLA 5EWJB 2E1PA 4I4LA 4DQDA 1KSHA 1U0JA 4JD5A 1WXFA 2GVDC 3L6DA 4RGVA 2WE7A 4BQEA 2PAFA 1QRUA 2G1PA 1JH8A 3F3MA 1NXVA 4IJ6A 5EMMA 1Z6YA 2Z1NA 4IFTA 3G2MA 2X0EA 2AE1A 3TRDA 4B7AA 4C0XA 1BE0A 1FS4A 3ZE8A 2ZBQA 1I9GA 1O4WA 5I4KA 4TZTA 3VISA 4E51A 4ETWA 3SK0A 1FQJA 2H9YA 3HKDA 4FFOA 2F1KA 4QUGA 5JRJA 2DKOA 5H02A 3NVKI 4KLCA 4DRYA 3AM5A 4BO3A 3TL3A 3H4IA 1L1FA 4NU6A 2HB6A 5C7YA 3K1AA 3UFBA 1SCJA 5LXTA 4D45A 2HSEA 2V7XA 3GA5A 4KH1A 4RWZA 2X9LA 2Q62A 2GZHA 1MCZA 4IMPA 4MO2A 3DCIA 2ET6A 1Z5VA 2IZOA 2VYCA 3E03A 2GVNA 4KW7A 2B36A 2FF5A 3K8ZA 3OKFA 3PEUA 3T4EA 4G0VA 1JKJB 4JAVC 2ZBFA 1HE8B 5E9WA 1TQ4A 2JLSA 2P4HX 4MQUA 3BN3A 3C3BA 3JQQA 5CB4A 2YL2A 4DB2A 4L3WA 1Y37A 4YIHA 1NRJB 4GEGA 2C7OA 4HS9A 2IX3A 2GNOA 2PRKA 3EZ2A 3DZJA 4PNPA 1OH6A 1O0CA 1PR2A 2E85A 3CF4A 3NHLA 3NCHA 3R7DA 1HE2A 3MIIA 2I4IA 4J07A 1U99A 3AOEA 2UYYA 2B25A 4PX9A 2ZWIA 3WK7A 4N41A 4MR7B 4U8HA 2BFNA 3MOGA 5CDUA 2J6HA 2GZRA 3A4TA 4RQUA 4WTOA 1JEEA 5CAEB 1GA4A 2G1UA 3CB2A 3VH2A 1ST3A 2ZRGA 3B52X 3INTA 4X71A 5LZ5A 4LXIA 4TV9A 4G0QA 4KV9A 2REOA 1SR8A 2FW6A 4ZQFA 3TJZA 2VWHA 5IBRA 1TJ5A 3KS9A 2ZS9A 5C1DA 2VDRB 2IYOA 2PVPA 3HWX1 4BGUA 5I5EA 1BDHA 3FWHA 4HVLA 4AQ7A 1CJCA 2NO7A 1T29A 3CVUA 4LZOA 3GB9A 4AY5A 2YN4A 4ZALA 2HD4A 3NHUA 2C4MA 4ZMRA 1QO9A 3D02A 1SOUA 2XCUA 2G70A 4JB2A 4N6OA 1MEOA 3DXFA 3NDBB 2FPIA 1KY3A 5AK5A 4A2WA 5I7OA 4LVOA 4QA9A 2HV9A 3G2NA 1YK1A 1YQXA 4DC1A 4LGVA 2IGTA 5BW5A 5K8IA 1KZYC 1D2MA 2IIPA 2YFYA 3C1AA 1T15A 1T8SA 4G63A 1PSZA 3I4FA 2VA9A 5KYVA 1XWFA 4KAXA 3J7AC 3IUEA 2WUWE 4RK0A 3SQNA 4IY1A 4HV4A 2PRYA 3W1VA 3BERA 5JDCA 4GMDA 1GZ5A 3GC6A 4MCJA 1VFPA 1AKYA 3C3CA 4QWMA 5LMCA 3LA8A 3PWKA 1LRKA 5F3RA 3PQ2A 1KEUA 1PWXA 2H0AA 4NULA 4ZOLA 4ENWA 3B53X 2W70A 5DK6A 5AUPB 2DTXA 4LJLA 1WB9A 4KX5A 3IP1A 1GGFA 4RD0A 2M6LA 3BD6A 5BYKA 5EFZA 3AEUB 3VX3A 1PT8A 1UBUS 2DWCA 1PSDA 4IIBA 4GBGA 2R1ZA 3S1LA 1RWQA 1R5NA 2EJWA 3AR2A 3COWA 5B1YA 2ZUVA 4GUAA 4LYDA 2H17A 4EECA 1JMVA 4HNHA 1NUSA 2ORIA 3D1VA 3OI7A 3PIIA 4F4IA 4AZ0A 2J07A 1B4DA 2ZK7A 2PX5A 2HADA 3HPRA 1KAQA 1IZ7A 1Z4LA 1XOIA 4K1LA 5EZYA 2B82A 4BOYA 1Q15A 4LDZA 2HJRA 2VATA 2B1RA 4C04A 3BB3A 1T36A 1XNGA 2AS0A 2IZ1A 4UASA 1SCBA 4XJSA 4F1KA 4F8YA 1Y5LA 4R98A 2A1TR 1QE5A 4Q01A 1QDUA 3QFCA 4NBUA 3F8WA 3LXXA 4G9BA 4PCVA 1VKHA 1FZTA 1I3LA 3AFHA 1N1DA 2QVGA 2PJDA 5LA6B 2PK3A 3OZEA 4WY5A 1M2VB 3SSNA 3UJ8A 3VRHA 1SVNA 3Q0TA 1XTRA 2JK0A 1Q11A 3AI7A 3SZ3A 1J06A 4EA7A 1DQSA 3K96A 1T9ZA 2BMEA 3DF9A 3MK31 3VHLB 1MF7A 5J4KA 8MHTA 3G9TA 4UUMA 1DFGA 3ZE7A 4CWAA 3PNVA 3GCZA 4BNJA 2V58A 5HDBB 4YT5A 2Z2XA 1XDGA 2G0NA 4EB3A 5A1JA 4G5GA 4XIGS 1IXSB 4Q3DA 2GETA 1LI7A 1D7OA 1H2AS 1ZEJA 2QUZA 3DBIA 3H16A 4NDZA 2JCSA 1E0DA 4TXMA 1ZU4A 4KCGA 5DWDA 2I65A 3LL7A 4INPA 3SC4A 1WY7A 5B7GA 3DW3X 5AI0A 1T0IA 5FWAA 1JTFA 4IEFB 3WB2A 1JT2A 2IPNA 2R65A 2VTKA 3PE6A 3H2JA 1CSEE 4DA8A 2AGVA 3GPDG 4ZRNA 2D74A 2Y1EA 4ZVRA 2VTEA 3GFPA 3STWA 2G1JA 3OH8A 2ISQA 1D4AA 3O4VA 4GEKA 4C4PA 4BWYA 2DC1A 1Y8RA 1Y9JA 2EU8A 3C3EA 3F5MA 3OE1A 3R0ZA 3LA6A 6Q21A 4N40A 2JBHA 3AI1A 4GI5A 4EGFA 1CUWA 1UC5B 4R3UC 3WLTA 1MB2A 2EQ5A 2IUYA 4ZU3A 2GSWA 4KBGA 2NO9A 5AVKA 1ENYA 3TL2A 1TCCA 1G18A 3C3XA 2NOAA 4P2BA 1B2RA 3EIUA 3GUUA 4R84A 4EY5A 1NV9A 1QYIA 1EJ2A 2EX0A 1DTSA 3H65A 5JXIA 5K3FA 1PJSA 3ZVLA 3G2KA 1OZFA 1T3HA 1ZN2A 2GKGA 5JZ9A 2YVLA 2HA0A 4GZ5A 3VPFA 4C0LA 5C34B 5IH3A 2OHIA 3PEVA 4TKLA 4I99A 5HCIA 1IN5A 2P9TA 4CDRA 3SLGA 2GWHA 4QZVA 2DX7A 4F86A 3OEED 2DHEA 2C4WA 1QJ4A 1R8QA 4KXQA 3V4FA 2PLNA 1M1YB 4RWEA 3N59A 3IE1A 2YZGA 5H83A 3RUFA 3R3YA 1XRNA 2X58A 4TTVA 4B8ZA 5AESA 4EJ2A 4FJ2A 3TUZC 2ZAIA 4HAIA 3AP2A 1Q0QA 2O2GA 2HU2A 4GT1A 4TPKA 3DWIA 1BX3A 2FR8C 3ENVA 4GP6A 3ZE0B 3ZY4A 4EL5A 3CLKA 1AHNA 4IIXA 2HMUA 1CQWA 3OE4A 3FBTA 2Q6IA 2B69A 3ZHVA 1YNOA 4EPRA 4WKPA 5AKIA 4ENTA 4HX5A 2W6ZA 3X1YA 2H92A 5K0LA 3PGJA 1E7QA 3TRHA 1XZAA 3Q9SA 2V6GA 3DONA 1ULHA 1C3VA 1R9JA 1VYTA 1IFXA 2ZP1A 1WZ2A 4F6RB 4NAUA 5AKLA 2HNBA 3WZMA 4O4HF 1RCUA 4MWOA 4J1TA 1WNFA 1Y7HA 4G37A 4ND2A 4ENPA 3KU4A 3GFSA 4KQ6A 3FLEA 1PKEA 4JT4A 1VYUA 2ASVA 1Q7GA 3TXAA 3D54D 4EPXA 2R751 3UY4A 1VBKA 3QUAA 1U1DA 3NYRA 1R5BA 3EHEA 5IKEA 3I73A 3L04A 5FH9A 3ADBA 5DXAA 4ETIA 2PRIA 2WOOA 1Q0HA 4RLQA 2VXOA 2Y0CA 1AQLA 1KO1A 1JALA 3BE8A 3HBAA 3QLEA 2P2SA 2CFRA 3ZKWB 2QMOA 3NTVA 5BVGA 4Y2PA 1W25A 2ZRLA 4JOSA 3LX6A 5A3VA 1GEEA 5AYVA 1ZGHA 2BGMA 3D7MA 4IO0A 5KU7A 3R7SA 1CPYA 2PSHA 3IUSA 5IJ9A 2AMYA 2JLVA 4RK1A 1E5XA 3IA2A 5IXYA 5JBNA 1EWKA 1V7ZA 2R5WA 1E1QA 1ODKA 4QULA 4O2AB 2QLFA 1E1KA 1O94D 3U4GA 4CTKA 2G3YA 1GRNA 3ZDYB 1KA9H 2WWHA 1N5KA 3ZLTA 2TYSB 1NJ6A 2PV7A 5ALRA 3KZKA 3ICPA 1J4AA 5I7WA 5B1HA 4JWTA 3L4JA 3CS3A 2P30A 3BD7A 4M0KA 1KU6A 5KWVA 2ZIWB 3EVTA 2MMCA 2JHCA 2C84A 5LXTF 3HKBA 3M89A 2CHEA 2MSEB 1KEZA 4RVUA 4LECA 4J43A 3V9AA 2H06A 1RHMA 2FEPA 1JLSA 5DYIA 1TCVA 3AKZA 5JXJA 4WCFA 5HQ3A 3H97A 3NAQA 1Z06A 2YMLA 3GEGA 4QOGA 5AQEA 5JZBA 4L8YA 3U4HA 4NNOA 3G1TA 4PF1A 2FMIA 5FR1A 1O08A 5EJ5A 5DGHA 1SVUA 3EC1A 1NYTA 1AB6A 1AGXA 2G7MC 4DADA 1G3UA 4CE6A 3Q7IA 2FPWA 4NZMA 1PL7A 2FWPA 2MYUA 3IEKA 1JHUA 1PJ4A 1Q0UA 1DDGA 1NLZA 1UMDB 3BXGA 3MJFA 2NU9B 1H66A 5FI3A 3TZQA 3JRWA 4PAGA 1NN1A 3PNYA 1MO2A 1LB1B 3KG2A 2HW8A 1Z13A 3U80A 4J2TA 5K5EA 3C74A 4O1IA 5AW0A 1GD1O 3EF0A 3V6MA 1FRFS 2IXEA 5DN9A 3UJBA 4BPRA 4E5UA 3C97A 3I12A 1X87A 5EZ5A 2QX4A 1UR5A 4TLDA 1O96B 1XP8A 4MV4A 5H70A 2V6JA 1X13A 3WAGA 2GCIA 1Y8CA 1A2OA 4L51A 1K4YA 1I6KA 2R97A 3OF2A 2PPLA 2Q3MA 1EVIA 3HDTA 4TWJA 1J1UA 3MTEA 4MVXA 1S7GA 1P1BA 2R96A 4L28A 1PBNA 3KR1A 4OYLA 1MU0A 1E2EA 2WJVA 3ETJA 3NBYC 4Q6WA 3UO8B 4JLNA 3F46A 4OFWA 4C0HA 3H9CA 2DXIA 3HZHA 2Y99A 3L40A 2E18A 3VOTA 1IY9A 3CGWA 4G4IA 1TQ2A 3GGPA 3NTQA 4XDZA 4AI6A 1L5FA 2O7SA 2RGGA 3COYA 3LBHA 4DQ0A 4NV0A 2DHDA 3OM9A 3CUTA 2C98A 4CV1A 1B8UA 4U2KA 4R2XA 1W5EA 3CVVA 4C7OB 1LDMA 3TSOA 5TIIA 4GPEA 2X6QA 3P71T 4KQWA 4RVOA 1Z33A 3TS1A 3S81A 3VPAA 2XCOA 3SYRA 3A3NA 1S2OA 2HTFA 1GU0A 2ZIXA 1MDBA 3G0CA 5KJ6A 2CL5A 2H6EA 3NHRA 2V5VA 1WBJB 1WZCA 2VPZA 2XA1A 1O8BA 3IAUA 1XJCA 2GK4A 3KB1A 4WE3A 5IAJA 3HUFA 3N76A 3A4MA 3SOZA 3GFQA 4PYRA 4Q6BA 5K7SA 2HDNB 3H19A 4A2PA 4B2PA 4QDZA 4YGXB 2FPMA 1HDCA 1ZIOA 5C4MA 3ILHA 2QRLA 1N2HA 4C6TA 1EWQA 2Y67A 5FYQA 1UPBA 1RQLA 2VZ9A 1EFHA 1YL6A 3N7UA 2A0WA 5CT4A 5EWLB 1MR3F 3E61A 1J0EA 3NFYA 2ORED 4RV5A 5GONA 2HOQA 1Z74A 2RH5A 4F9FA 3HLKA 3FVVA 2HSZA 4PX5A 1IEQA 4QELA 1I2CA 1U31A 3SOPA 4B3FX 2M98A 2WMNB 5IUNC 5JEEA 2CVZA 1DFHA 4P32A 3DAOA 4RIIA 2A0YA 3CINA 4BKQA 1GKIA 4ON9A 3KKOA 1A96A 1TEXA 2Z2ZA 3FR8A 4ZT3A 4P7BA 1PNOA 3ECAA 1Y0BA 4YCLA 4L6IA 1COZA 1GPMA 1P0QA 3FCAA 3G89A 3HJHA 5EAIA 4KBYA 4JEIA 2PNFA 1WUTA 5CFOA 2VQFB 3HU3A 5F7ZA 1RBQA 2IPXA 4GFDA 3KHUA 4M1SA 4KWIA 3PLAE 1V8FA 1Z0SA 3EVEA 3NWBA 1I4WA 2GN4A 4YMVA 3PQ4A 1OLXA 2EKLA 2YRWA 2C88A 2H65A 4GLFA 4LHEA 4OA8A 3X1DA 4Z7OB 4MMZB 4AKHA 4CCYA 3LPNA 5EHXA 1ZH2A 2WSLA 4EKIA 5FA8A 1O4VA 4REQB 3EC7A 3GROA 2Y0BA 1DIAA 2IHYA 1J9EA 1XZEA 3LO8A 3OU6A 1Q19A 2W4IA 3HEAA 3RWBA 4EFKA 5IMSA 3H87A 2WWRA 2LVBA 2BJWA 2XDAA 3P9CA 2VAPA 1UZMA 1O6BA 2Q50A 3BA1A 1TA0A 3I5AA 1M6NA 2EF0A 3LP5A 3MJRA 4FI3F 4NICA 2PX4A 1PNTA 1UDAA 1F14A 1SQSA 1NUAA 2XJ9A 2ID9A 4I5GA 1BA2A 2QNRA 1XELA 3L7JA 1XQVA 5FTJA 3PA8A 3R5JA 5KVSA 5KZMB 1X1BA 3BGOS 5AW7A 1OB2A 4DCCA 4QTZA 2OLEA 3OCCA 3P0JA 2CBZA 4F45A 1G2PA 2YFQA 1X1SA 1JVSA 2H1WA 3L46A 3NUQA 3OTGA 1FFYA 1EDOA 4DJ5X 4UMVA 2GPSA 2OK8A 2QRPA 2FZLA 1R6BX 2FEAA 2C7RA 1Y8ZA 5D6OA 1TPYA 1RC0A 3ZHZA 5H81A 3KR2A 1KZHA 3P9ZA 3P9IA 4J9UE 1GGMA 4W63A 3MTJA 3C8ZA 3PX7A 4DJDC 3N86A 1NTRA 2WZCA 2Z2KA 5T4EA 5IT9A 1N3IA 3T99A 1T4DA 2DB3A 1X80B 2XUJA 3DT6A 1ML4A 2YIDA 1WM1A 4A6EA 1HLPA 1W5TA 4KDEA 2P5SA 2NQTA 4EJFA 4C7KA 1SCIA 2DT5A 1J99A 3WK4A 2V4UA 2G4VA 1E8MA 2RK4A 4PAWA 2APJA 3OLXA 1F4LA 4KE9A 2PVCA 3IR5A 1VIMA 4MCAA 1GTZA 1S8FA 3NPAA 4YQYA 1G3IA 3SI7A 2CXXA 1ENPA 3RTDA 1WY5A 4LHVA 2X6RA 1QLWA 3O8OA 1C9EA 1SKYE 4QNMA 1UJBA 1UUFA 3PPXA 1E3EA 1UBSB 1TEZA 4CF4A 3VKWA 4WK0B 3RFTA 3KQQA 2HHLA 3LY7A 2RI6A 5JE8A 1QYRA 5JTTA 1GTRA 3AINA 3SBOA 4CPDA 4EZBA 4KIWA 1LJLA 3E58A 4BNVA 1GT6A 2H1HA 3R6LA 1VYVA 3G17A 5BSHA 5LU8A 1TM2A 4IIJB 4M6WB 1QYCA 1ARZA 1OXKB 3L1KA 3STTA 1AZWA 2P2DA 3AERA 3PNOA 4TSFD 4XYGA 4LJ9A 4UJ3A 4TL7A 3MTAA 3BXFA 3R23A 3QH4A 3M6FA 4O29A 2OFOA 4HBGA 4PYQA 3NEYA 3AM4A 4R2KA 2QPTA 1DAPA 2IS1A 3V80A 4BEJA 2P6OA 1V8BA 3H0CA 3D6NB 1I7PA 1E1CB 1A9XA 2I2AA 5I9IA 3B85A 4GMHA 3D4NA 3PD0A 3HVJA 2C9ZA 4ZOCA 3UKJA 3PNKA 2GCPA 2FQ1A 4II3A 1FL9A 3GEHA 1LGYA 2O7RA 4Q7KA 1PFKA 1PJ3A 2GBPA 3PPIA 4PGFA 3EZ9A 4D2IA 1KORA 1XO1A 3IELA 4II7A 3FHLA 4RZ2A 5FOQA 2YUIA 3H5LA 4CXMA 4R1PA 3PJRA 1M2JA 2A4MA 3MRSA 3KZOA 3WGZA 3JS5A 1IAQA 5DOVA 2WFZA 4DDTA 2W6OA 3WDMA 1P9OA 1FQKA 1NQWA 1AT1A 4MWTA 2XECA 2HIMA 2FSPA 4MQ5A 2I1VB 3AUKA 3IV9A 4ZOAA 5AKGA 3SC2B 2R7KA 2WUEA 4M1QA 4OXRA 1K0UA 1K8ZB 3GCDA 3NC4A 2VOJA 1KJ9A 1L8OA 2X13A 2ZRAA 3I5MA 4LCJA 4PQGA 4R5MA 4LXXA 4B35A 4FWBA 3HCWA 5LLSA 3U9LA 2P35A 1E69A 4ZIRA 2CZCA 4JR1A 1ISMA 1NP7A 2HK9A 3NIFB 5A4AA 2H1RA 4EA8A 1J22A 3HYNA 1FU8A 1NAHA 3D59A 3MJCA 5KVQA 4BEVA 4DSTA 5JJ5A 3TCKA 2O2JA 1GPJA 2YC2C 5HKLA 3ZE1B 1P9RA 3DR5A 3MOIA 4JLPA 3SZMA 3RU2A 1E92A 1G4UR 4I9UA 1UDXA 2WTUA 2R2AA 2GO1A 2SCUB 3PHIA 4YR7A 1W52X 4X6XA 2AJ8A 2Q2NA 2R11A 4N5IX 2WIKA 2FUNB 3GGOA 3HP4A 1PFGA 2QLNA 1JLLB 1YJBA 4G86A 3C8MA 1OR8A 2G82A 4WW0A 2BGLA 3A4VA 3VOBA 1YFZA 2QW8A 3HN2A 4EDHA 5ENDA 4RGYA 1SCAA 4KGVA 1FNCA 4K6GA 3OLVA 5FNVB 3NT2A 4DA4A 1T2AA 3DDSA 1SZCA 3GFBA 4BP3A 3STXA 4AG6A 3I05A 2ZYIA 4MEBA 5COBA 1MVLA 4ZEMA 2H9AA 3CTPA 4Q4HB 7REQB 1NVEA 2ZBDA 5EE3A 2X4GA 4LC9A 5JLJA 3IULA 3FETA 3RYIB 4ZQCB 3NBQA 1YS6A 3GBVA 4XM2A 3PGKA 2BTEA 1RLJA 2Q4OA 3T1QA 5MHTA 3W4JA 1SHLA 3VNRA 1OA0A 3SVTA 2PZFA 2F3QA 1C3OA 1NY6A 5CT6A 3ZWDA 3AF4A 1IM8A 3WB1A 3S5UA 4MCIA 1LPBB 5E7MA 1AUQA 1DB3A 3QVLA 3N70A 5DRTA 1I6LA 1XL1A 4L15A 1SUWA 2F00A 3NU1A 4OQFA 3RT7A 4DEXA 3SDSA 1W6RA 2BOVA 1PS0A 2OCBA 2Z57A 2ZBVA 1YL5A 2GRAA 3C41J 1K5DA 1WUJS 1MV8A 3RH0A 3VDXA 4TKZA 1PHPA 1W8DA 1Z0KA 1VE5A 4J4HA 3G02A 3I9FA 4ITVA 1T13A 2XD4A 4OI4A 5DX1A 2BBOA 5L4SA 4OQXA 1OX4B 4QNRA 1DPFA 2DQSA 3GLHA 1PFVA 1TVKB 3ZI4A 5HF6A 2TMDA 3ZXUB 5J47A 5E9JA 2D1RA 1H9BA 2NUTB 4OV6B 3C4VA 3JV7A 2CT8A 2PS9A 5LB4A 2HV8A 3GYBA 1BCSB 1B1CA 3Q72A 4ZRMA 4D98A 4GSKA 3O9ZA 4UDOA 2OD9A 4BXOA 3S2ZA 2Q9UA 5BVHB 4XH9B 1G5PA 3BYZA 1GRRA 4YJ2A 1CJTC 3N39C 4EY3A 1FJXA 3PT9A 3JWGA 2R8RA 1GPYA 1Q84A 2P0EA 5F1OA 4JYBA 2YHUA 2EWWA 5KVAA 3KYDA 1UDCA 2O1WA 2GAAA 3H11A 5FAXA 1KZGB 4IXDA 3ITEA 1MXFA 1Z6XA 5TGDA 3RTGA 4DCVA 1PW5A 1THGA 3OQPA 4A15A 4UHDA 2PUDA 1VKRA 1R16A 1XZPA 1RJFA 1YZTA 3DXZA 3L41A 3OD5A 3QX9A 4FC7A 4KQCA 2C58A 4OLJA 3P52A 4GX2A 5IF9A 3QSGA 4QAQA 5U1PA 3R74A 1QO0D 2HRRA 3PFBA 5EGNA 1S9HA 2FEXA 4FNGA 1CNFA 3D8SA 4E14A 2HUPA 3VKUA 1T0HB 3MWGA 1JGTA 4CR8A 5C53B 5T6BA 4BQPA 1N75A 2KHZA 3FWPA 2BRUA 3AIKA 3L84A 1ACMA 5AJVB 2KI5A 1I01A 5CR9A 2WC1A 1J2JA 3LYLA 1NQAO 2B1JA 2C8LA 3HFGA 2AFHA 3AHEA 1E9BA 2RI1A 1EFKA 1ZNXA 1LY1A 2AC7A 3CN9A 4JJ4A 4X94A 3WSWA 5KJ1A 4WT7A 2MSLA 4URHA 5EHNA 1H22A 3PC4A 3WLIA 4G8CA 4AWBA 4D9FA 3JXEA 4RKYA 4TM7A 1U4NA 1RZVA 5J9FA 3EEIA 5LQRA 2PE5A 5I7HA 1VB3A 3JD3A 1BQEA 4OD0A 5IHXA 1KHTA 4OHMA 3EUFA 4WGGA 1XQ9A 5B7NA 4BV9A 1W73A 3A1WA 3KJQA 3CISA 2O50A 5K0SA 2JS7A 2POCA 2ZJZA 4LOJA 3QVJA 4MPPA 2R2GA 2UVQA 4BWVA 2X2EA 3PC6A 3ZDXB 2PLAA 3K71B 1LDBA 4BVAA 1DHRA 3QNWA 4DDWA 3G2PA 1OASA 3GJ7A 3TR0A 2XCSB 4S2UA 3CVYA 2SCUA 3NVMB 2B34A 4LAFA 3UAXA 3V4ZA 1LDEA 1SUDA 2O4CA 3KSUA 3E84A 3B1ZA 3UT6A 3FOEC 3JR7A 4NEGA 4Z4CA 4EFDA 1E2KA 1IHUA 1V3UA 2JJ1D 2VJDA 1AS2A 5AM5A 4Z4EA 5DTQA 4YWJA 2XNCA 5IC6A 2DQKA 2XTNA 3FZQA 1U2TA 2R1VA 1J56A 5DE3A 4KYUA 4M1ZA 3P4UA 4RANA 1A9PA 2R8BA 3PXXA 5J2UB 1JWLA 1TMKA 2WKRA 3O2SB 3OCXA 3N5CA 3ICQB 5LZ2A 1E6KA 3RAEC 2E2WA 4FBLA 1Z7WA 5CVEA 2HEIA 4LTDA 4M60A 3K2IA 5E7IA 1JHRA 4L6CA 5EHQA 4CLOB 1WCV1 2AOTB 2LKDA 1LPOA 3VZPA 4PYMA 2FRDA 2OV8A 4RF4A 5FPHA 3V2IA 4TSKA 1PFUA 4IDPA 3DOCA 1QAQA 2OKCA 2I91A 1FLDA 3I9NA 1AO0A 3RBAA 4GVLA 1J8QA 3U4QB 3NBKA 3M4JA 2EC5A 5E9QA 5BR8B 4OQZA 4I5IA 1PZEA 4JELA 2OMKA 1M66A 1FP1D 1Y9ZA 3B48A 1XRRA 5D1HA 1LNQA 2GF0A 3KOUA 4MV1A 3WC4A 1A4RA 1US8B 1MC1A 1ZUHA 1ULSA 1RAAA 1JDNA 1XDDA 3JD0A 3QXSA 2XMSA 4FE4A 4P31A 3H2YA 5EQTA 3W04A 3N2YA 3OZRA 4BDTA 4F8EA 3BWVA 4OBBA 3B36A 3SHFA 2GTPA 2O0KA 3L8YA 3NTXA 4ZAZA 3T0GA 5EZ6B 1N7JA 4TV8F 3RS5A 3I0NA 3ZWKA 4QASA 3VZDA 4K86A 4YCDA 3PXGA 3VU0A 1GGEA 2QORA 3PB3A 3ER8A 2R48A 1YQUA 2W9XA 4Q9AA 3L7DA 3W6PA 4OUKX 4M9CA 3ZK8A 2ZYTX 5IJ0B 1FP2A 2XI4A 4N12A 1O9HA 1WE2A 3WLMA 5KSOA 2I1LA 1FJ2A 3WSVA 4E7PA 4GOOD 5C4IA 2JGIA 4MWGA 3RUHA 3OECA 3TZCA 2XVXA 3X43A 1JNYA 3UYKA 4I36A 4X91A 4TRNA 4HR7A 4YXFA 1Z5OA 4PZAA 2HFKA 1T0BA 4EGJA 2K2WA 3W3AA 3OU2A 1NR1A 3HNPA 1QP8A 4JB3A 5AO9A 5I7EA 4PWZA 2O3QA 2VZLA 3QENA 4H27A 2ID8A 2YUTA 3CNNA 4N18A 4NC9A 4NFYA 4P6VF 5EOVA 3SU8A 5C5CA 1E1RA 4FOTA 3ABIA 1E5TA 3H2GA 3K32A 4MLZA 5C81A 5CU7A 5BXQC 3ANMA 3WMXA 2V7PA 3H5NA 5BRNA 4ODIA 1WU8A 2AJBA 4PPYA 1V6AA 3GEIA 5COQA 4HQ0A 2VDPB 4D1YA 4EF4A 1N6HA 2X9GA 2H4FA 1ESEA 2CY0A 3JQCA 2BM0A 5EZQA 4KK4A 4RLHA 5FLKA 2EXXA 2P4SA 5TEWA 5A03A 2NXWA 3NJRA 2HIAA 3O8BA 4ZDKA 4L8GA 4FOSA 2OXIA 4DLXA 1N2XA 1SBHA 4KQHA 3W9UA 1QVVA 4GGPA 3WV4A 5JC1A 3JZFA 3BFPA 5HF5A 1A2KC 2GM9A 2ZYWX 4ARIA 5KQRA 2COKA 2RG1A 3FDFA 3L06A 5SY4A 3OOHA 4OYRA 4FXOA 3T5PA 2FKAA 1W0JA 2AV6A 1UMCB 4M54A 2DLNA 3T3EA 1W2GA 4QGSA 3ZJ4A 2I54A 3M83A 4DUYB 4MI9A 5EFOA 4Z9XA 3K09A 1E63A 1LPMA 3JAWA 1D5WA 3QVOA 3HK2A 1WOMA 4R0MA 4DLZA 3V7YA 4F21A 4K9QA 1X86B 2CLCX 3REQB 2QMEA 2J3JA 5ARCA 4PRKA 5EWMA 1EINA 3ULKA 1XBTA 3KKNA 4RJIA 3UHOA 2YXPX 3CUWA 1EPUA 1PT6A 4J2HA 1SQ5A 2R6R1 2C2GA 4LC1A 5JSUA 2PY6A 4WXHA 1IVSA 1G6KA 3ANTA 4MX8A 3BMXA 5IX8A 3FHCB 1DU4A 3K5IA 3QFFA 1P74A 4HAWA 1W4CA 2PZLA 4RMHA 4QDUA 4AJOA 3JX9A 4H3SA 2IPOA 4MH0R 1B23P 1Y3AA 3JD1A 1B8VA 1E2HA 2ZAYA 1JQ3A 4NP6A 2OCXA 3A6ZA 4I6GA 4XQ9A 5FO0A 2EKDA 2H4YA 3ZCXA 1CQIB 1FVHA 1LC3A 3Q7TA 4F96A 1E2BA 3PI6A 2D0PB 3R3WA 4DTIA 1EVLA 2HH9A 2ZR9A 3A7DA 1VRCA 1SUSA 1KQGA 1YIDA 1YB6A 1ZCFA 3R4VA 3QUCA 3TLBA 3LCJA 2PT6A 5IAEA 1ZXLA 4IGAA 5I4BA 1PU2A 2XF2A 4UZSA 4MRAA 2P7HA 3H18A 4S35A 3RIMA 3UMYA 2CBXA 3FTCA 4AUMA 1RWPA 1X7GA 4PY2A 3MLBA 5CT5A 1JAHA 1EP9A 2QN6A 2J3LA 4AO8A 4P3KA 2QMYA 4F92B 5B3KA 1E3IA 2ZJ6A 3BTOA 2QOEA 3PC2A 2QUAA 4V2IA 1R6DA 1DVRA 1XMIA 5EWLA 4QJBA 5TXGA 3PEWA 2H2WA 2UDPA 4C7BA 5TQJA 3DZCA 3ZNPA 4TYNA 2QL6A 3A9CA 1NQXA 2XNSA 1MV5A 1AKWA 2ZIFA 2ZVDA 1GG8A 4FWIB 4PZCA 2YYAA 1NLYA 5U4XA 2JCVA 3KJZA 1TB4A 5CDTA 1HG0A 3KUCA 1SQGA 2VSOA 1CUJA 4WCFB 4NZPA 1WZNA 2G80A 4Y1FA 2VAWA 2DPGA 1U4SA 3D6JA 3FUCA 4FFBB 4EYEA 1C1HA 4ZYUA 4DR2B 4Z2AA 3T61A 4AXBA 1YKGA 1KQOA 2LP4Y 3QBDA 1LPSA 3ABOB 3MMZA 3W3ZB 2XWPA 3FZYA 4JQOA 5D6NA 5IF3A 2EV9A 1QPGA 3RPEA 4HB0A 3EB9A 1I7SB 1USUA 4H7DA 4S0XA 4ZQGA 4OMUA 3T38A 5JXHA 2Q0QA 3OLYA 2OBXA 3BMNA 5F1KA 5JDCC 1EQ2A 1YS2X 2BFFB 4RMNA 5HS6A 1DJNA 3AUYA 3NNDA 4LTNA 3SEQA 4D6YA 4D9BA 4F0JA 1UOOA 4P4UA 5JS8A 3G82C 5LC1A 4Y6RA 4B43A 5J2UA 4BP1A 4R51A 1ZBQA 4N4AA 1NJSA 3AIIA 3AY7A 3JQ9A 2C9DA 1RTKA 2I4TA 1QZ3A 2ZDGA 3HCEA 3WO0A 3OZWA 1Z73A 1C8BA 3CLHA 3D0KA 2JAHA 3L0OA 3IS3A 4Q12A 3HDVA 3LHKA 4PX2A 1GQFA 1FDSA 3AP1A 1GFWA 4QTXA 4J3JA 4RGQA 3S2GA 1G19A 2ID4A 2Z3VA 3SN6A 4DCOA 3OTHA 1E18A 1KMQA 1IBMB 3L77A 4BY9E 2FMKA 1F2TA 2BGJA 1RLUA 4X1IB 3S6JA 5MF6A 2EVWX 1IDN1 2WU8A 3SSMA 4UC0A 2PIAA 4FOLA 1NXOA 2QI9C 1V8PA 1JVNA 4OHZA 2HMVA 3RVNA 3ZHYA 2RHRA 2OP0A 3D1LA 1V1RA 3NANA 1NV8A 4W99A 2NZWA 3V8RA 4L0QA 5ER6A 3UUEA 5A06A 1ZIXA 3U6KA 2C2XA 2I29A 1XTVA 1BMDA 4LK3A 5DW0A 3B5JA 4KR7A 3SHOA 3THOA 4UKDA 1YONA 3OQHA 5A2GA 5BWNA 4BFXA 3AJ8A 5BN5A 1GGVA 3OICA 2J45A 2QRVB 4YHBA 3THXA 1LPPA 3A1NA 3AV3A 3FCEA 1S02A 2O2EA 2ORWA 1YBAA 2NYRA 5GINE 2VDWB 1HDIA 1U3TA 5LDGA 1ESCA 1W4ZA 3AO0B 3AHFA 3L7MA 3SBDA 5KC9A 2D2IA 4YMSA 3L49A 4MR9B 3UATA 1EZ4A 4CM9A 4IQGA 1H69A 2TMGA 4GVPA 4JVOA 4RZXA 4P7GA 2QGFA 1AXEA 2BBWA 3HDYA 1ZQ9A 3MVEA 4XIIA 4QSHA 4PLPA 2UYCA 1XVIA 4QM6A 4G1MB 1QQAA 5BORA 1J09A 2ZTVA 2PSSA 3K9QO 4ZVOA 1CRWG 1H94A 1QVWA 4P08A 3PWSA 1WP4A 5HQ3B 3MUEA 3DBVO 5JS7A 3MJHA 4PXYA 6ABPA 1Q17A 5EP4A 4QDOA 2G5TA 2P11A 4YAJA 3R7WB 5HXAA 2IUTA 4MAMA 2OL4A 5IARA 4A2CA 1ENOA 3UUFA 5KWSA 3I01A 3AL2A 3AFIA 5CFPA 3KQOA 3GVCA 2VHZA 1DO8A 5DHTA 1R4ZA 5A7FA 1Q7TA 2BL4A 3KU1A 4B2IA 5AI6A 4BNUA 2AK3A 3BWXA 5J2TF 1YRBA 2K7ZA 4JLUA 1DBVO 3N2EA 3VUEA 3E05A 3JZMA 4X24A 3ENQA 4U00A 1LQ2A 4XW2A 4AMUA 4WN3A 4DY4A 3AEXA 2W42A 4NYIR 2X5JO 3MPOA 5I9TA 1KP2A 2I6XA 4C3ZA 4JJGA 3WKDA 4HH4A 1XQXA 2O1EA 1MD9A 3KQYA 4ZARA 2RK3A 5ADWA 1DLIA 3N07A 3X1XA 4J94A 3IPYA 2DLDA 2GZSA 2I62A 1XPRA 2H4ZA 3IILA 3LP8A 4QREA 3TZBA 3TGPA 2HUNA 3LVQE 1K8XB 3EF1A 4AJIA 4LOIA 5IJXA 2F6RA 2H2HA 3RVBA 4L73A 4U2BA 2HC9A 2EFJA 1QGAA 4OI2A 4V0RA 3VU3A 5L7WA 3CTMA 2XNDD 3D0OA 3TNFA 2B98A 2GHIA 2AEEA 1JIVA 2FFAA 1EM6A 2XUIA 3K7EA 3L18A 2ONKA 3M2PA 2Q0HA 4NZNA 5KJCA 4OH7A 4ZVNA 3FR7A 3AZOA 4UHKA 2HSDA 1GPNA 4V0SA 4XYBA 4CL2A 5A4FS 1LA2A 2FMHA 1E62A 1JA1A 2WJZB 3TQQA 3ETLA 2HDOA 4YRIA 4DBLE 3BXEA 4NZZA 3BXPA 5D87A 1KMNA 2OCYC 5DH9A 2X14A 4P54A 1CV2A 4KQ1A 1M73E 4ILEA 1EAYA 3Q11A 5AHWA 2AG1A 2V7QA 3FDJA 3NDPA 3ZU3A 1XKTA 5EJ8A 4LFBB 2XE7A 3PFKA 5TGTA 3KUDA 5EIXA 1FUIA 3SKVA 5CITA 1CQZA 4P36A 4EO9A 1ONNA 4MQLA 2A86A 2WWWA 3EBPA 2Y1LA 1XXLA 3VR5H 4W9NC 2JHPA 1XSEA 3Q2OA 3RFVA 5C1PA 4RTOA 3PV0A 2B1IA 4S24A 4QHSA 1KDYA 5LZ9A 3KXIA 3KTAA 1U3GA 5IYZB 1L5OA 4D4KA 4F84A 1ZRNA 2CCKA 1XZBA 3OPYB 5FCDA 5C8YA 2X42A 3VH1A 4D5GA 2X41A 3RSHA 1MX9A 5JNLA 2DT8A 4AT1A 2PKWA 1Z4NA 2EBFX 2QZ9A 2RJOA 3OQVA 4M98A 4R7GA 3V3KA 2B4QA 2WD9A 4I9GA 3G8CA 3ZQ4A 4E4YA 3JQFA 2XR1A 3DOUA 1WMDA 3LDAA 3W79A 5BPHA 2R8EA 1ZM9A 5A9TA 3GT0A 1HQYE 2G17A 4IOKA 4R41A 2CUTA 4C4OA 5LLDA 1O94A 1YJ8A 3BJRA 4LRXA 4N8SA 3OPYI 1DRKA 4YFYA 4ZT4A 4O4JA 5CJPA 1YZHA 3JYOA 2OHFA 1GSHA 4PFSA 4DUZB 4H08A 3PQ8A 3QK7A 1RBYA 2M1XA 4HQNA 4RMIA 1ZJZA 4C7JA 1CZRA 2HMYB 3QXCA 4K28A 4NCXA 3MWYW 4O2AF 4DCSA 1P4AA 1BVYF 1PE0A 1VJ5A 2JC3A 4L0DA 2BTQB 2F3PA 1ORHA 1CY0A 2ZE6A 4HQFA 3EGCA 4DT1B 4EGQA 3F3YA 4FGUA 3DVQX 3H9BA 2PD6A 4PYNA 1SKQA 3BORA 4L74A 3GDGA 4NOJA 4DA0A 1SBYA 5HIKA 4HS4A 1R6UA 1M6WA 1O97D 4I55B 4LW8A 4RGBA 4EJMA 3FOZA 1YV9A 1B6TA 1KJQA 4MWSA 3TZ6A 4FYVA 4ZANA 5I7UA 1C4XA 4JUBA 3ZEAA 1MO6A 1UQTA 4U02A 1E9AA 2FRVA 1RJEA 2O0MA 3AR4A 4G5YA 3SYLA 1P4GA 3TSYA 3ZHQA 2GILA 4FKMA 5AOVA 4LXQA 3ZD9A 1HRKA 2ZRCA 2CNBA 1V11A 2BT4A 4BQRA 1GCUA 1YZNA 1EG7A 2X5XA 4TLAA 3X3HA 4KNYA 1N9KA 1KDOA 1QHHA 4I3FA 3AIOA 2AC2A 4AK9A 5AM2A 2VJMA 4EFLA 3O3OB 2JFOA 1KQPA 1EX9A 3LQRA 2V0NA 1QG2A 1E4EA 1PTJA 5A7GA 4HX9A 4J76A 1EE1A 1ZI8A 3LGAA 1T6ZA 3TGWA 4GPTA 3T9CA 3ZDRA 5FLXA 4QXQA 1L7OA 2RIPA 7MHTA 4BNMA 5EPEA 2HYIC 1Y34E 4UUQA 3TXXA 2EZ4A 3L7KA 1BEEA 3C6KA 2IIQA 4GKKB 3KC2A 2A9RA 1E0KA 5LD2B 4MS3A 4PPFA 1UFKA 5DF1A 3VC1A 3T1NA 1WMBA 2AFRA 2DOKA 1KK1A 2PTGA 4AKEA 2KE5A 4F4HA 5JSFA 4JJKA 1QCZA 4ZTUB 5FORA 3DBRB 1G7CA 4LDAA 1L5HB 5BSWA 3GGDA 3K31A 4G0XA 4R16A 3ITNA 1TTPB 3LLVA 4U5XA 1GV1A 1T4MA 3AHIA 2D4HA 4OAQA 4GXQA 3QRWA 1R9GA 3LQYA 5HNKA 5IZ4A 2AXEA 4HB4A 3OIWA 3IR6A 1E3JA 5BNWA 4C7MA 1SU7A 1OLSB 3M1AA 1KPIA 4L72A 4ZAVA 4Q7MB 4CM8B 5DNUA 2H2GA 4KG7A 3RC2A 1VPLA 1N2JA 1L7MA 1SBTA 3NETA 5JPDA 1XKLA 3DE2X 4OGLA 1QF9A 3JQGA 3BB1A 1E3WB 3N2IA 4WBXC 2OENG 2VJCA 1KEKA 3O92A 4XDHA 4L78A 4TXJA 2O14A 5LUBA 1LBHA 4UBKA 5JRDS 4KXLA 3KXKA 3K1AB 2DPHA 5H3HA 1VCIA 4CMEC 3PWZA 2VXYA 3HFRA 1KI3A 3JQGB 4YBZA 3RYTC 2IQ5A 4MKFA 5ALLA 5F23A 2ZTUA 4M9QA 1H6CA 1HT0A 1Y42X 4URZR 1YDMA 2XVYA 1WBDA 3VSEA 4ZXFA 1E1MA 4H77A 1TECE 1IOVA 1RBMA 2V7GA 4MW6A 4MS3B 4PXSA 5D3QA 3PEEA 3OJFA 1B6RA 5A6SB 4A8JB 1ESMA 1QWOA 3RANA 3GRRA 2OO3A 3ODPA 1EXWA 3GR6A 2FPIB 3W8RA 2D5IA 1RWWA 3KKPA 5IHPA 1A4UA 4L07A 2XRYA 1RRMA 3CSDA 3TLMA 5LOVA 1K86A 3OZFA 4B4OA 1KKUA 1A5SB 3U1TA 5FULA 2XXBA 5JNSA 3NOOA 1R66A 2HA4A 4XWTA 5KKNB 1RJ9A 2ST1A 3GRUA 3PS9A 1YHNA 2PLRA 3QQ5A 4YASA 4IVQA 4WLVA 3VKVA 2E82A 4PRZA 3QU2A 1W2HA 1W93A 5EUBA 1AU9A 3JSXA 4IIJA 1NX6A 3T9DA 2EHDA 2YMQA 1OROA 3BIWA 3ZXYA 2R6HA 4K05A 5D01A 5DJ5A 5TDHA 5LOVB 2AN1A 4MQFB 4G25A 5JHHB 2OAP1 2Z83A 1YASA 2H2IA 3WL6A 4IKOA 3V4VB 1WMAA 1B74A 4WA8A 1NRWA 3SP1A 3BWBA 3IHTA 2XB4A 2N3ZA 1EVEA 3I0ZA 4OU4A 1EQAA 2XE6A 2F9LA 3BVPA 1W0JD 4R1TA 3OP4A 2WJJA 4DNFA 4ZEVA 3VR2D 4WOJA 4LWOA 2N1MA 3CO0S 3M6XA 3AKCA 4CCAA 3KTFA 4D41A 1XKXA 2BRUC 2GBLA 2VRWA 2Z4RA 5H4GA 2VCEA 1WTCA 1KYIA 5AVXA 3FTEA 2MDTA 4P22A 2CXOA 4CHTA 1QP0A 2IC5A 3FDZA 1GTL1 3ZTYA 1N6LA 3CLTD 3OMWA 2JIZD 4V3CA 4L22A 1NHGA 3O26A 2I71A 2EFCB 1E6EA 2J0UB 3FLMA 4TL6A 1KZ7B 3UAWA 1LLFA 1LV8A 1T3SA 2O20A 3E1GA 3EGXB 2O2YA 4NVRA 4D96A 4M49A 3NZEA 4ZC1A 3ZJUA 1V3QE 1OKKA 1ULAA 5AXBA 1QYDA 2XDYA 2W6JD 4BLRA 5A4KA 2CL6X 3BA6A 3TZLA 5K3EA 2X3YA 3DV9A 2PSFA 2PFKA 2CE7A 5KHLB 4H3VA 5F33A 3WKCA 3X1JA 3F7TA 4HRVA 1ZOLA 2OLKA 5HIMA 4PZPA 3ZCRA 2R1TB 1P2FA 1UBGA 4P3XA 3UUWA 2DQ4A 2EYUA 3L8EA 2ZDQA 4NU0A 4QUDA 4WNAA 4B2LA 5JH7F 1DFIA 1CS0A 4KV7A 5JSZA 1PYDA 2GFIA 3F6CA 4OHBA 3UA4A 4QM7A 1ABFA 1L4HA 2J3HA 5FPKA 3NHZA 2BHNA 2WYIA 4D0SA 5KYNA 1U1CA 2P62A 5EJFA 1YVEI 1BEUB 3EDCA 1C2YA 2IW3A 1R0YA 1VB5A 5FF9A 2GI4A 2GWRA 4FOPA 4TTIA 3TIGA 1D8TA 1YJCA 1S2GA 2F9FA 2XA2A 3DEYX 2PH3A 3U7JA 2IZ6A 3DTVA 4U2EA 1T2NA 1C7FA 3C6ZA 2KW5A 2F9MA 3C3WA 4X93A 3CIFA 5HIAA 3PNPA 1XTTA 3FNIA 2H2FA 3SF8B 4P5PA 2ZANA 3P32A 3TLCA 1Z68A 1KMHB 4Q9KA 2ANCA 3A11A 5DCYA 1L2TA 4PLTA 1OUMA 1NX9A 1NN0A 1QORA 2X8BA 1II8B 1R18A 1ZAKA 4TTQA 3MILA 4X97A 1JG6A 2PO7A 3AEQA 3DR3A 2OXEA 3BQNB 2CUNA 1E5VA 4YV0A 3PDUA 3N53A 1PQPA 4OHYA 3F71A 1DT3A 5JV5A 1Y3FE 4BNDA 5FOWA 2FWBA 3TLYA 2Y71A 1G4HA 2XGSA 4KZPA 1M6VB 5EEHA 5LYJB 3NALA 2XRZA 1U0NA 2AMJA 5GONB 1JPUA 2YWFA 1T9BA 1G6Q1 1DELA 4QPPA 2JI9A 5HFAA 3P2KA 4Q93A 4Q1AA 5BN4A 2HRZA 2XCLA 5EHIA 1C7ZA 1PGNA 3ET5A 2VT7A 1VJTA 3EC2A 4U7WA 4MS4B 4PG7A 4DTCA 1IBCA 3P9PA 1NR7A 4G81A 4IQFA 3ZIUA 4B6FA 2ZYUX 1F0YA 4L6AA 4XVQA 4IMJB 1QV7A 2VJNA 3KZVA 4E4RA 1LK5A 1P18A 1VSQA 4I9HA 4QGHA 3A3OA 4UUOA 1GPBA 1UXGA 2Q21A 2Z6QA 2XZOA 4DV1B 2BGNA 4C06A 2AD5A 2OOSA 3AEYA 5ENVA 4MRVA 3EPPA 3NONA 4NBNA 4AROA 1TZKA 2MJLA 2FZVA 1G9SA 4W5JA 3MBOA 4X61A 5E7QA 3R9KA 4YRMA 2VSQA 5TF4A 4XJXA 2ZRNA 2KX7A 2LUOA 4BO1A 1CERA 1BDMA 2ZU0C 3KOMA 4RA9A 1RHRA 3WGMA 4ALNA 2VK1A 1VPEA 2A78A 1VL2A 2WJYA 3AM1A 5H5JA 1CYEA 3NYIA 1FJHA 1QGUA 3A1FA 4PLGA 5LBIA 4LWQA 3NWPA 5ERXA 1EHCA 4I2VA 1MB0A 1KSJA 2DAPA 5DLEA 1X1QA 5IYZA 2UUAB 1YQGA 3SR0A 1JQDA 4DB4A 2RGEA 1TC2A 1G3MA 1LRLA 3S8MA 3M4ZA 2AA3A 2Q28A 1UODA 3IKTA 2CDRA 2OKGA 3BE6A 3UMSA 4AN4A 1QP4A 3PC3A 4YRJA 4EG6A 3A26A 3RODA 4PN7A 4B6GA 3MCWA 4HWRA 1AQJA 4S0ZA 5B6JA 1XG5A 3ENZA 4E70A 3E9NA 4OAPA 1Y1TA 1L4EA 8GPBA 4D44A 1QR2A 2XF8A 4KXUA 2FNAA 1GITA 1NC3A 2V03A 1N9GA 1NBMA 3FSGA 3P20A 3H86A 4P3PA 4UU0A 5EE1A 5IZCC 1KK3A 2ZSDA 4W9MC 3KZXA 4Q02A 5HRCA 3H9EO 4EG5A 4M87A 2AVDA 4QOHA 1IY2A 5IJWA 5JYDA 2V3VA 4ENQA 4LMAA 4Z3OA 1SB8A 2AI2A 2QSJA 3KJIA 4OYYA 3QWBA 5H7XA 3Q3IA 1ULTA 3PDJA 5AHXA 3RSGA 3DP7A 4GSYA 2YINC 3Q3JB 5K05A 2C97A 3EOZA 2OCDA 4ZCIA 2IF2A 3MFYA 4KODA 3ZDCA 3W7AA 1HA3A 2BVNA 4RORA 4L2IB 3CX8A 4FFWA 1CUZA 4KTVE 3PVZA 3W5SA 1QE3A 4ZCSA 1GSOA 4R8KA 1GHTA 5I8PA 3DV0A 1QHEA 1YA4A 2I1WA 3B60A 4XIJA 2C1ZA 3EDOA 1RWOA 4UATA 2H4HA 1IM2A 4FD2A 4FP9A 4EGCB 3HCRA 4IDFA 3KM0A 1R37A 3ZV6A 2F3UA 1PQWA 3RLFA 2RHCA 2YWJA 5IC4A 3BMNB 3O21A 1NNSA 1U3VA 2FWIA 4UEJA 3S1AA 4X66B 1NVVQ 2Y0DA 2O3UA 1I4LD 1UT8A 4B87A 1G8GA 1SHJA 5EIFA 2FJPA 5T4FA 2QXTA 2B4RO 2GD0A 5AKYA 1X8LA 1XZMA 3FJOA 4JR0A 2P91A 2UXBB 1A1SA 1ODJA 3DKPA 3JWPA 1SXJB 2QD2A 5CUQA 4CIBA 4LNUA 3B1YA 3IAFA 1F17A 2CSUA 1H2EA 1OAOC 1EK1A 4PM4A 3TE7A 4RZ3A 1T2FA 3VHRA 3ELYA 2W2KA 1J9GA 1A50B 1NU6A 2OZVA 4RF3A 1NVKA 3H1AA 3O74A 4JLWA 1RADA 4LYYA 2CXSA 1JAZA 4B4UA 4CG1A 1V0JA 1FYEA 1JJIA 3EEBA 1H0HA 3B6KA 4MV6A 4HNSA 3SSOA 3HYCA 1CZNA 2G6BA 3FVWA 1L1EA 3HLTA 3KZNA 4I1YA 3S7ZA 4FMPA 3ZV5A 2W2LA 3GLHE 4BBAA 3F7MA 3DO6A 3W5CA 1YS1X 1QIGA 4BNZA 4N0PA 4CVNA 1COWD 1Z0FA 5ALUA 1TF7A 3NHJA 1GAXA 2OWEA 2V3WA 1P19A 3CRRA 1EFUA 5JOQA 2QTTA 5G0UA 4MITA 4EVQA 3K5PA 2IUEA 3CSSA 4DMHA 1CZOA 4N0DA 3OJOA 3A6HA 3ESAA 3FFTA 3UGKA 5JEDA 1JDZA 4ABTA 2VLIA 3NGXA 4RDIA 3ZE9A 3OQJA 3THYB 2D0IA 4IZHA 2A5FA 4W9RA 3WMWA 1GZDA 3FMOB 2SKCA 3U4IA 1WUKS 4EOGA 4Y2TA 2BI8A 1QFMA 1BOFA 3GJZA 2C7PA 2V3CC 1UT5A 1W29A 2WF5A 2GERA