1TIKA

Crystal structure of acyl carrier protein phosphodiesterase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
203
structure length
203
Chain Sequence
SLSKVLVLKSSILAGYSQSNQLSDYFVEQWREKHSADEITVRDLAANPIPVLDGELVGALRPSDAPLTPRQQEALALSDELIAELKAHDVIVIAAPMYNFNISTQLKNYFDLVARAGVTFRYTENGPEGLVTGKKAIVITSRGGIHKDGPTDLVTPYLSTFLGFIGITDVKFVFAEGIAYGPEMAAKAQSDAKAAIDSIVSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Acyl carrier protein phosphodiesterase
publication title CRYSTAL STRUCTURE OF ACYL CARRIER PROTEIN PHOSPHODIESTERASE
rcsb
source organism Escherichia coli
total genus 74
structure length 203
sequence length 203
ec nomenclature ec 3.1.4.14: [Acyl-carrier-protein] phosphodiesterase.
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1tikA00
3NHRA 3GFRA 3LT5A 5A4KA 1CZLA 3NHYA 1CZKA 1FLDA 4ZVLA 4FGLA 4QOFA 4Y9UA 4Y9RA 1KBQA 4D02A 3O2NA 4XDHA 3OX2A 1YKGA 2BPOA 4QODA 3KEGA 4PTYA 3TE7A 2B3DA 1AG9A 3O73A 4U7HA 1WSBA 3NHLA 3OWXA 2BF4A 1CZNA 4ZVNA 2M6RA 3R6WA 5LMCA 1H69A 2X2PA 3UXHA 3UXEA 3F6SA 2QX4A 4PTZA 1RLIA 4QOIA 4YQEA 5NULA 5LBTA 3L9XA 2KQUA 2QX9A 5EAIA 3W77A 4HS4A 2RG1A 4YAOA 3FNIA 5ULLA 5JROA 2V5UA 1YCGA 4BMOB 4ESEA 4QOEA 4N9QA 1DXOA 2MOKA 2QX8A 2FZ5A 3W78A 4PU0A 3K1YA 4FGJA 2KLBA 1D4AA 1AKWA 4C76A 1FUEA 2V5VA 4C0XA 1QR2A 4BMPB 2FX2A 3GFSA 3NLLA 4YAFA 3TEMA 1FX1A 4M0CA 1AHNA 3OX1A 2QMZA 5LJLA 4HEQA 3NHWA 4ZVKA 4OXXA 1XYVA 4U7FA 3OX3A 3NFRA 5B3LA 3QE2A 1WSWA 2FOXA 3KAQA 1T5BA 4R81A 2N1MA 4LTDA 4DIKA 4C0WA 5FUQA 1E5DA 2MWMA 1RTTA 1AKQA 1CZRA 3KLBA 1V4BA 3NHKA 4F8YA 2FZVA 3FX2A 1YRHA 1C7FA 1AKVA 4ZVMA 4GI5A 4ICIA 1B1CA 1QHEA 4LA4A 6NULA 2WC1A 3GAMA 3K20A 2F1OA 2FAXA 3HA2A 1J8QA 4FGKA 4LTNA 4S24A 1XI2A 1C7EA 2Z98A 1FLAA 3HR4A 3NHPA 2HNBA 1AZLA 4GR9A 1FTGA 3RPEA 5TGZA 2QMYA 3NHUA 2D5IA 3ESZA 5EA2A 1YOBA 1D03A 2FCRA 4GQIA 1ZWLA 1BU5A 1CZHA 1OBOA 1FLVA 2OHHA 1ZWKA 1AKRA 3P0RA 3NHFA 2AMJA 5LLDA 3GFQA 5LJIA 4QOHA 4J8PA 3FVWA 1J9ZA 3HLYA 5B3KA 2HNAA 1BVYF 2X2OA 3N39C 4YAUA 4QOGA 1AKUA 1ZX1A 5F51A 2Q9UA 1XT6A 3FJOA 2FDXA 4CETA 1YCFA 1OFVA 3ZHOA 2BMVA 4U7GA 5NLLA 2W5UA 1QBGA 4Y7CA 3TZBA 4N65A 2QR2A 3W7AA 1CZOA 4C14A 2ZKIA 4DILA 2QX6A 4LTMA 3S2YA 4CF6A 2BN4A 3EDOA 3N3AC 4NULA 3F2VA 5BUCA 2OHJA 5EMNA 4LAFA 1YCHA 1D04A 3OJWA 2FVXA 1RCFA 2R96A 2Z9DA 3B6IA 3KAPA 1I1OA 3EYWA 1FVXA 4YALA 4N82A 3W79A 2ARKA 2R97A 4FX2A 1AMOA 3SVLA 3ESYA 4H6PA 5LBUA 1T0IA 2MT9A 4H2DA 1JA0A 2OHIA 1J9GA 3OVMA 1H66A 2A5LA 1TLLA 3FW1A 3QFCA 3ESXA 2XOEA 2M6SA 5LVAA 1QRDA 1JA1A 1OBVA 2QWXA 2MTBA 3F90A 4NLLA 1YDGA 5FA6A 1DX9A 1CZUA 1DXQA 3NHSA 3JSXA 1NNI1 1FLNA 3D7NA 3ES9A 2XODA 1X77A 2V9CA 1TIKA 5F4BA 2HPVA 2FLVA 3B6MA 4QOJA 2OYSA 2Z9CA 5F12A 1RLJA 3G5MA 3QFRA 1GG5A 3NHJA 1J9EA 3B6KA 2Q62A 3OWHA 1SQSA 2Z9BA 5FX2A 3N3BC 4XDGA 3B6JA 3F6RA 1SG0A 3OJXA 1XYYA 1KBOA 1AKTA 2BZSA 3U7RA 3L9WA 3LCMA 3U7IA 4YAWA 2GSWA 1F4PA 1VMEA 4DY4A
chains in the Genus database with same CATH superfamily
2REBA 1EQAA 3SM3A 3VXKA 2ZQ5A 3BN3A 3ZHBA 5GONB 3E9MA 2PJUA 5B58C 4WTOA 3LY9A 5DBFA 5FYDA 3MHTA 2R85A 4ARCA 3GZTB 2WYHA 3AJEA 5A4KA 1K8QA 4UTZA 1WD7A 3UJDA 3V3TA 4JLUA 2G83A 5AJXA 3FOFC 3EZ7A 1J2EA 2RGCA 2PZ8A 1SOAA 3E1GA 3PXAA 1AHPA 4Y2GA 3FY4A 3QBJA 2V6GA 4ZA2A 4QXAA 1FUKA 2QRHA 3OESA 1H4TA 4JI8B 3IP5A 1Q11A 4Q4HB 2QZPA 4QDKA 1BTOA 4BGUA 1O0BA 2B4RO 1J2JA 3JZMA 1ZMBA 1GR0A 3KXDA 4BNTA 3X44A 4CU2A 1QTIA 1DWQA 3CGGA 5FI5A 5TEVA 3TDNA 2WEKA 4BKOA 4XRGA 5JRDS 1WL8A 5ERGB 2VF4X 2YOGA 3PV0A 2J0SA 5TJHA 5LLSA 2VYVA 2H9AA 3RFFA 3MFYA 3HWX1 3CCCA 1JEEA 3NKVA 4IKEA 4KYUA 1KDZA 1CNEA 3WK8A 3Q1KA 1R9JA 2IZ1A 4Z1MD 2D74A 4WESB 2JBAA 3CH7A 4F4IA 4R5MA 4LF9B 2JLVA 2X19A 4GZMA 4Q4AB 1VL2A 2V7QD 2BMFA 1QV7A 4CGYA 3F71A 2HJGA 2VLBA 2QUZA 2ZRGA 2D2VA 3KJGA 4HNSA 1WUJS 4Y9DA 3DVQX 2H59A 4MGYR 2VCEA 1P1KA 4RFSB 1LVGA 5LDGA 4BMSA 1EFDN 2P1DA 3A2KA 1Y9JA 3HDVA 3UXYA 2A78A 2OCIA 5BQOA 4LUCA 4B8YA 4BOYA 4ER0A 3LFTA 1KI4A 3W06A 3CGWA 3LCCA 4GNKA 1DKOA 3KPVA 1V7ZA 2PKEA 2Y1EA 3R74A 4UD2A 1CT9A 4WBNB 5ENZA 4PRZA 1HT0A 3F6SA 2YWFA 4K2AA 5JCJA 1ZD3A 2C0PA 3P4UA 4GVPA 4GVLA 1Z8FA 1UOQA 1BDBA 1WUKS 3A32A 3BG5A 1XXHE 1KP3A 2JGLA 1X1DA 4TROA 5KEIA 1AH2A 1F1BA 1XDZA 3JQRA 2DFLA 3E9NA 3GB9A 8GPBA 1YS9A 1XRSB 2CJYA 1CQIA 3PLNA 4CL2A 4RJLA 5LBTA 2X5JO 5TX7A 1CERA 4KSCA 2CBGA 2B25A 2HGSA 4MV5A 2DLDA 4YAOA 1PR1A 3FNIA 4RQTA 1JQ5A 4TQ9A 1N2GA 1YZVA 1M6HA 1WS6A 2G40A 3NGLA 3H8SA 3Q4GA 2YDXA 4AWXA 5HF5A 1GU0A 5KYWA 5GADl 5HZHA 2NUTA 2NTNA 4W5HA 1PR3A 1XD9A 1TMOA 2IS6A 4S04A 2JAHA 4O2AB 3GUYA 2HHHB 3KPWA 1QG0A 5D7BA 3VO8A 1VPVA 1REQB 3IDSA 3BH0A 3HCBA 4QGFA 4WVFA 5DHRA 1WBBA 3GL9A 1TD1A 4ND1A 4ZJYA 5CW2A 3O5AA 3TCKA 5UKDA 3ACBA 1SU8A 5IAJA 1KRHA 3GUUA 3WIBA 4F2WA 5LFAA 3W90A 1YBVA 1D6NA 1V47A 1E61A 2VUSA 4WY2A 4K5QA 4Q3LA 1NBOA 3J80A 2QYHA 3Q3VA 1UMDA 3N2KB 4WNCA 1HK7A 1R37A 2BCJQ 1XRRA 1C7JA 1J09A 1W2HA 1X7GA 3E9EA 2HJWA 4HY3A 4D0GA 2DOKA 2HYDA 1PEYA 4IHAA 4RVNA 2A35A 4HEA6 5IJ9A 4BKQA 2C2BA 4OGWA 3E84A 3R20A 2Z5VA 2B8EA 4L1KA 3NLLA 4NABA 2JIDA 1BGXT 3N0WA 4TL7A 4GSLA 3RWOA 3TEMA 4RESA 4JI4B 4DQ0A 1U31A 1BGWA 1CR6A 1ZBQA 4TKVB 5K0LA 4JBIA 1AXRA 2J7PA 2JLYA 4KYVA 3FLMA 3RJMA 4B82A 1NF2A 5T4EA 3N2IA 3I4FA 3MUNA 1XVVA 2F3UA 3DE0X 2PR2A 1QQ6A 1WXGA 1GXSB 1S8OA 2POQX 3AW9A 2GILA 4G5RA 4EJSC 3VX3A 4X6LA 3FUCA 2QXUA 1FRNA 1NUAA 1JKMA 4OY3A 3RKSA 4IVPA 4A0QA 4ZZ2A 1ZM7A 4AKGA 3SQXA 4IW3B 4YAEA 2EIXA 3OEEA 3D02A 4C7JA 3NHZA 1ZBDA 3K0EA 3MLAA 4WHMA 2FOXA 4LHYA 4ZOCA 1L5KA 3W2GA 4BGIA 2XGJA 1Z45A 4FGWA 3TZQA 1M66A 3KR0A 1RJEA 2C7VA 2WLTA 4ZHQB 5AVZA 3A7DA 1JQKA 1I2AA 2B9VA 4QHTA 4BFTA 5I6DA 2YS7A 4ENQA 2AOUA 2RIRA 1PNQA 2NP6A 2OZKA 1JQJC 2CXHA 1KRXA 1CW2B 2WHYA 1EH5A 1JSCA 2H5LA 4PV7A 1Z08A 5BOSA 1T5IA 3IEKA 3WKCA 5JAOA 3AINA 1C3OA 1QH1B 3FNBA 1X7WB 2QAJA 3PIIA 1TAQA 3FB4A 5ALHA 2FA9A 3THWB 4KN5A 3AKCA 2CCJA 3I6IA 1WM1A 1LF5A 3B8EA 3ZEAA 3BBPA 4IIJB 2I67A 1BH2A 5JQWA 2WJYA 5AM5A 3P8ZA 4GYJA 2A59A 3NIDB 2VWQA 1BAPA 2RE8A 4JEUA 4YVFA 1PR4A 1X8LA 4L27A 1WB6A 4F38A 2VYND 1G3QA 5L7YA 4HV4A 1B0UA 1W5BA 2F3TA 1L8QA 3HA2A 4KO1S 4PZLA 5KSOA 1AMUA 3J81k 2QBYA 3UJCA 2H5IA 1RAFA 2BFBB 3T3GA 4BTEA 2Q8PA 5IDYA 1QSGA 4U5XA 2C29D 2KJQA 2Q4RA 1YXMA 4DMMA 2I2FA 3EUEA 4OTZA 1ES9A 3TRIA 4KWHA 3F9RA 1SJ9A 2DLNA 2ZBGA 4H7HA 5DIZA 1A72A 2IXTA 3OJEA 3O1JC 4UBIA 3ZHSA 3UTCA 4E6EA 1AZLA 5EESA 1GTZA 2B8WA 2JIRA 3CISA 3DCJA 3QYPA 1X9GA 4FYPA 3JAKB 2AEJA 3EG9B 1GPMA 1E2NA 1ZLYA 4HS9A 4PR3A 5FDFA 3JYOA 3GGPA 3IMCA 4TLBA 3AHHA 4I2VA 2PVSA 3DMPA 1JKJA 1AKNA 1ORTA 1XQ1A 3WQHA 1A1SA 2WIAA 1BCRB 4TKZA 2ID9A 4RD0A 1B74A 3DQPA 4MRAA 3FZNA 4CCYB 2Y4NA 4DXDA 4ETMA 4CR8A 4OK3A 5C0OE 2WYWA 1QIEA 1TD9A 3WXMA 2GSDA 4YMUA 4R2HA 3PHLA 3SC2B 3FSRA 4CQMD 1D2NA 3I62A 3A36A 2WZBA 2WD7A 3BH6A 2CHFA 3FMVA 5CCBA 2VTDA 2MSNA 3PGXA 4NBSA 3DEYX 3G9ZA 4IAOA 2CMKA 4CBVA 1PQ4A 2FRXA 2Q6IA 4XIJA 3IAS1 5AHWA 3RG8A 4DIOA 1EPUA 4IUDS 3RIYA 2C83A 2FMUA 1BWSA 3LOUA 2EZUA 3FVWA 2RK6A 2Q4OA 2Z5GA 5IJAA 1IULA 3UAYA 6GPBA 1E6EA 3JWEA 1UPBA 1J9ZA 3NOXA 4BWVA 2WZDA 5KQSA 5B3KA 3RC8A 2IEGA 3TQHA 4C4OA 5JNLA 1X8JA 1IWOA 1SOMA 3B7WA 4ZFNA 4HAYA 1WO8A 4H59A 2F1JA 2MYNA 2P9CA 3IDOA 2NTYC 5IDQA 4ZVPA 3PX7A 3A6JA 4GOXA 4P31A 4B48A 4UQPA 1E4EB 1E2DA 3E5HA 4LJ9A 4ZMRA 4YT4A 3H1AA 1A04A 1L7OA 1ZX1A 1I5OA 1G98A 1LNZA 2C4UA 3AM4A 3R76A 1JAYA 2O2EA 4XWWA 3PR3A 2I4NA 1EWTA 3L93A 4HDRA 2XE4A 2CJWB 4NOLA 4XVHA 5F77A 3FPHA 1XA3A 5B3AA 3RBZA 2IFTA 1XA0A 2I3BA 3BWEA 4MUKA 4A6DA 4L95C 2CGEA 2MSEB 5CG2A 3OFKA 2FV8A 3OIUA 1JZSA 1MLDA 3GLIA 1RQLA 1WUTA 4QXOA 5DK4A 1A98A 3VSBA 4I6GA 1BU8A 4X90A 2KW5A 2FEKA 2ZRNA 3HR8A 1VSVA 1CS0B 1WULS 1NTOA 3KTAB 4Z9FA 3KFVA 4FEGA 1GVNB 2PRSA 3I09A 2INGX 4M9UA 4NBRA 1YQXA 2E6UX 1QHSA 3ZE7A 2XNDD 4AY5A 1ZR4A 2NUBA 2ZTLA 2CKDA 1EXVA 3OIVA 2WWRA 4XYEA 2GLTA 2JAPA 2ZRIA 4LZOA 4JNKA 1F17A 3EJ6A 4R8VA 1FVOA 4QRHA 4P2BA 3LDUA 5CITA 1MO4A 4EJMA 1F8UA 4BX2A 2BFPA 4EMSA 4U2CA 3IKJA 4B75A 4AKSA 1NE7A 1XL0A 1ADBA 2LGJA 3DONA 1GPYA 3AJAA 4K40A 4HVCA 2HWKA 4BTVA 3GROA 3WK4A 3UUGA 4MIOA 3C3CA 1K2VN 1KK0A 1WEKA 2WNSA 2Z2YA 2PFGA 3KNZA 3DAOA 1K9SA 1Y6ZA 4RE6A 3AEUB 4QXMA 2IS1A 3ZDXB 4XQ9A 3F2VA 2C8LA 3M4ZA 2BV3A 3PRYA 1NFFA 5D6NA 1SCBA 3QVMA 4MVWA 4BMYA 1LK0A 3CLTC 5FULA 5IAKA 3BQMB 3O0DA 1MU0A 3FJ1A 8ATCA 4A7PA 4D9EA 3I1YA 1SZDA 2X6QA 1U8ZA 2XB4A 3D9QX 4G5YA 4LAFA 2F9LA 4C03A 4H0FA 4DJTA 3B5IA 4PLPA 4JVLA 4G4IA 1GY8A 3ZJUA 1RCFA 3T0IA 2C82A 2W6OA 2YVAA 4RDHA 1Q7GA 3B13B 5J2TB 3EIOA 1IY2A 3H97A 5DP2A 1HNXB 1FVXA 3A4NA 4YALA 2J6CA 4KQ6A 2AJTA 1XDUA 1W25A 5KVCA 1N1MA 2R8PA 2WUEA 1U94A 3DBRA 3EIUA 3QLVA 4TWBA 5JSFA 3WADA 3EC1A 4PF1A 4TXJA 1KI3A 2B6HA 5CB8A 2AXNA 1FL9A 3ICPA 2GEDA 3SFZA 2PS1A 1WQ3A 1CF2O 2C4KA 4IIHA 5JLJA 2IZ0A 2G7MC 3PC4A 4NBLA 3WMFA 4XASA 3DFIA 2XZPA 1FVHA 3LQKA 2IC5A 4RH0A 1QZXA 4DG8A 4DN6A 1IXZA 1PJRA 3GT7A 2J46A 1YZYA 2SCUB 1UK7A 1RBMA 1QUEA 1TCCA 4H1TA 5LOVB 3N7TA 2ECOA 3A9RA 4PC1A 3TTWA 3QYFA 5E4YA 3UGKA 3ZLBA 3OFND 4UTOA 1Z29A 1U65A 2XAUA 2YWDA 3L6CA 3LNCA 3MS2A 3Q8XB 4CMEC 3EX7C 1TEXA 2HSEA 4KUEA 1UM9A 1H0KA 3HZZA 4LRWA 2MU1A 3F90A 1W44A 2X3FA 3NEJA 4OSEA 3REQA 2A0KA 4RJTA 2EF1A 2G72A 2PNFA 4E5MA 4HEHA 4RD6A 3TIXB 3CLUD 4I1SA 3QKTA 1SCKA 3HWRA 3QVOA 5HDBB 3ZZNA 2RG7A 4Z7QB 4L7VA 2ECFA 4XYBA 2W90A 4GSKA 4MQBA 4ONEA 3SG0A 4LG1A 1SG9A 4P54A 5TQVA 3IAM6 4EPRA 4M0KA 3WK5A 3PHHA 1VE5A 4MGEA 3HADA 4KACA 4R1MA 3DTVB 1E7SA 5JD5A 4OATA 3E9DA 1OXTA 3D7LA 3VU0A 4GL2A 2AG0A 2CV0A 3R9XA 1GU1A 5G4KB 3PQ3A 4JLDA 3AHCA 4XGRA 4BNNA 4GDFA 1GQSA 3ADKA 4OFWA 4JEIA 3KWJA 3VYTB 2QLLA 2GJ8A 3IT1A 4KAJA 3ZHTA 4BV2A 3KQWA 4HBZA 3A6PC 2XE6A 3PC8C 1NLUA 1X7YA 1ZNZA 5KWSA 3Q5DA 1JALA 2XTMA 1RJDA 3EWNA 3O4VA 5JC8A 4HQLA 3K6SB 3AJ8A 2IJGX 2ZB2A 5EIOA 1JEOA 3A1FA 1HR0B 3NDRA 3S6JA 1H2XA 2C4WA 3VZDA 4ESOA 2OFPA 4KLZA 4LI3X 2CXRA 3B12A 2AKAB 4NHOA 4PQYA 2JFZA 3HXPA 5JQGF 1UQRA 3GJ6A 4E3WA 3DZIA 5EL0A 4BLVA 1NUHA 2YFKA 4LYFA 2W6QA 4DIEA 2IPNA 1XCPA 1H6CA 1OSNA 2VA8A 3ZHZA 2JB9A 4BBJA 5I3CA 2BMWA 3PDWA 5D8DA 4WZAB 1KYWA 1JW9B 1MC1A 4MVYA 2Z04A 1BFUA 1S5PA 1V6AA 1LK7A 3NALA 4X1YB 1UXGA 3FTCA 3V4VB 1A2BA 4B17A 1Z0SA 4A8HA 5FQOA 3W9SA 4E09A 4MV1A 4CIYA 4D0NA 1XTTA 2OSBA 3QKIA 1FYFA 2PFSA 3L8DA 4LXHA 1XZKA 1ODTC 4MX8A 3R3WA 2XDQB 4UMVA 5A7GA 2IWRA 4FIZA 1WXIA 4LF4B 2XBMA 3IUMA 3RS3A 3A4YA 1RWWA 2V7EA 1E2UA 2XRYA 4GWGA 5DBOA 4BNJA 3IPYA 4IFIA 3U56A 2QRUA 4NBWA 2IIVA 4YAWA 1QF7A 1TPYA 3PICA 1GPUA 1JEYB 4B9AA 4DNFA 2EDAA 4RQBA 3WTCA 5CVVA 1PS9A 2C8KA 3KHTA 2DQ4A 3ZD7A 2L17A 2ZRPA 3F97A 2ZYWX 4OQNA 2YCBA 3OPVA 3ZY5A 1TNDA 2C5BA 1KIFA 2V7UA 3FTQA 5BN3B 5C34B 4DZTA 2FUNB 1C3EA 1LPSA 1QS0B 1WDWB 3L7BA 1M8JA 3I30X 3ET4A 4Q4CA 1P29A 2QTCA 1VFNA 3T7EA 1G63A 2XCSB 1RQ7A 3AB7A 4D02A 2ZVQX 3VPBA 3TUZC 2A5GA 4R7TA 3T41A 1QOPB 1C4WA 2X22A 3K9HA 2GAJA 4BB6A 1DG3A 1TQ6A 2P6OA 1PZEA 3E23A 1G6HA 3L4KA 1P4GA 4HSGA 1VDMA 2OVBA 1QH0A 2E3JA 1U2QA 1SHLA 5B7PA 3T3PB 4CZ2A 3DEFA 4QNNA 3AIKA 4BQFA 4EJSA 2J67A 3L4BA 2X0JA 4HBGA 2YOFA 5JSZA 3EPJA 3W6PA 1SOWA 1MJGA 1UEJA 1P6QA 4DMGA 2VK8A 1XVAA 3GHHA 4U0KA 2ADOA 3BFXA 3N0XA 1SVKA 5AI5A 3FPEA 4GP7A 4N5HX 3X2FA 1UXKA 3QELB 4QQNA 4D99A 2RJNA 2CDCA 2AOWA 5TJ9A 3WGMA 4F21A 4HQKA 4B1FA 4CCWA 4KK3A 5D84A 1UT5A 4P4SB 3RASA 3VH4A 3GN2A 1ZU5A 5AKIA 1DDIA 3F2IA 3LC7O 3RRJA 3NCHA 5CBPA 1SWVA 5BT9A 5H83A 2QXTA 1P7YA 1VG0B 2OB1A 1UXIA 2BWJA 3UXEA 1FVFA 3LCUA 1Z4IA 1HTWA 2FZLA 4H3HB 4MKHA 4YJ3B 4WFKA 3GDWA 2BEUB 3WGZA 4ZJUA 5HUJA 2RHGB 5K1ZA 3L40A 3G2QA 4XAQA 1V8ZA 3AFHA 4HSEA 1YS6A 2AKYA 2CJFA 2V5AA 2XHZA 3EFOA 3OZGA 2R8YA 3NAQA 1NRWA 2NO0A 4B43A 4RFVA 3IUJA 3KXKA 4J49A 1JIKA 1QYRA 3DEAA 4NV1A 1YR1A 1O96A 1SOUA 2KS6A 2FF5A 3O1HB 4TVOA 1RFLA 3AUYA 3E7XA 3WYBA 1UJNA 3FPAA 4YRKA 1PFYA 1RYHA 4LJLA 3O6VA 2FPRA 2ILTA 1UAGA 2GDJA 2M1ZA 5FTWA 4RNDB 2P1ZA 2WOOA 2Q3LA 3UMCA 3I34X 4BMOB 2X58A 1VGVA 4FGZA 2EJUA 4TYMA 3AOEC 4L22A 1N6NA 1OAAA 3ADCA 2O57A 1ADYA 3HDYA 1G3IA 1WMAA 3CY6A 4TV9A 1Q74A 1I4WA 3AY6A 5TVKA 4AJ4A 4B3GA 1PWZA 1P81A 3ACDA 3ESCA 2BZ1A 2OUKA 1X9IA 1FYEA 3QXJA 4AJNA 1NQWA 5I47A 5E8RA 3ZU6A 4ARZB 1UZLA 4IJUA 4TRRA 2QX8A 1K66A 1Z4PX 2FFRA 1CNFA 3NGMA 3PFCA 4HRXA 4JNCA 4F3KA 1GSIA 1W6RA 1Z82A 2L18A 2Q4BA 4FCTA 3OQ6A 4F5DA 1DBPA 2BFCA 1QC5A 3ESAA 4J75A 3CF4A 4MMYB 2ZS8A 1CY8A 4H1UA 1BYUA 2JAXA 4HDMB 4JR0A 2YHSA 4Y0NA 5DXJA 4ETNA 2Z6AA 3HLTA 4G5SA 4ISBA 3ZJTA 3IURA 5KYXA 3MNFA 4PYRA 4TSFA 4MPRA 2WWHA 2P3SA 4TKLA 4RAQA 2NMVA 2UDPA 2VNKA 4JOCA 1XAIA 3EE6A 5EP3A 2VWGA 3SM9A 4KQCA 1FW8A 2RHLA 3GWZA 1YI0A 2PVCA 1X1TA 2Z4RA 1U1GA 3GFTA 5DLEA 3AZPA 4FWIB 5L95A 3IJEB 2O3JA 1UINA 5ALTA 3THYA 1ZGHA 4AMYA 4B81A 3QTTA 5E1MA 3OFSA 5FPQA 3KETA 1MOQA 2GN4A 3AR2A 1GL3A 4D4KA 2UYOA 4MIYA 5ALUA 5IYZF 3YASA 4Y2VA 1Z12A 4D7AA 1A2OA 1SWWA 5CA1A 5AXBA 2F64A 1X2BA 3F67A 4JC0A 1OVGA 2IDZA 2IUTA 2RC6A 2VYFA 3LYAA 4EI9A 4ENUA 2IGTA 3N8DA 4R9SA 1CLUA 3ZU2A 4AICA 3HBJA 1L7MA 1E2EA 4TWIA 2XUJA 2R5FA 4P4LA 2R00C 2HSZA 2F8LA 3KUCA 3RSGA 2BFAA 2DQKA 3B36A 2V3VA 4O4JF 3U4QB 1ECCA 3KD3A 2TSYB 2WTNA 1G42A 2VTBB 2XYGA 3DPSA 2FSVC 2Q21A 4ZU6X 2BCEA 2NSYA 3V42A 5AUOB 4YUYA 2YNMC 4EBFA 2DUNA 4JL8A 2D1TA 2Q4DA 4O0MA 3QJYA 2W2KB 1ZJ6A 1XEWX 1T8UA 2E49A 3PX2A 2J9FB 2X0DA 3PSHA 4DR1B 4HX2A 4O4IF 1A8PA 4P58A 2P3QA 2V6BA 1NAIA 3OCYA 4N3BA 4UVGA 3UN1A 4KTVE 1PSDA 4QFMA 3U4DA 3CW8X 1IRIA 3U3RA 4BEWA 3P26A 5KWIA 2WT8A 1ULHA 4RC9A 4AD8A 2XMCA 5EXXA 2QN9A 1Q0SA 2J31A 5E7MA 3WWOA 4CV0A 1WLSA 1NULA 3STXA 3UJ3X 2R7AA 4G5HA 4ROTA 5I9MA 1QJ4A 2N42A 5EJ7A 4D8XA 4WA7A 4P84A 1OIVA 2X6RA 3B70A 3IJRA 1C0IA 4IDPA 2H2AA 2VHZA 1PO7A 3GFVA 4XARA 2DLCX 3NBUA 4WLVA 5HJEA 4HB3A 3KKKA 2ZYGA 3G2HA 3WP1B 1ZMRA 1TGVA 1VRVA 1DTEA 3T7DA 5LQRA 3X1XA 2BBSA 1PJ4A 1QGED 2ONZA 4YMTA 4FU0A 1US8B 1EJ0A 3KFXA 1IONA 1NZDA 1TU0A 3PHIA 4O2BA 5G02A 5CDYA 2FE1A 1JF8A 3BICA 1AK9A 1DJLA 2GPBA 2OM6A 4UU1A 5CIYA 2NPIA 1CJTC 1SURA 3ORFA 4D3XA 5SICE 2GZ2A 1T13A 1ZIPA 3B48A 4WKCA 4BCBA 2XXAB 4WMLA 3P5BA 1Z2EA 4GR9A 4LE0A 1NJFA 4IFTA 2AL7A 4UREA 3AEKA 3GF4A 2BMDA 4KIUA 4PX3A 4TTSA 5D1NA 5EXEA 5ALFA 2O06A 4QBHA 1RBYA 5E6UB 3KTOA 4IPTA 1FQOA 2DPGA 5I7OA 1N8SA 2Q8QA 2QMYA 2RDMA 1B0PA 3NHUA 1IQPA 4H35A 2GKOA 2BSXA 2IZ6A 2C9DA 3AV0B 1B41A 3EA0A 4KO2S 3ZCRA 1YIOA 5DBHX 3A2MA 1PUIA 1CUEA 1GJRA 3AKZA 1DQZA 1P4AA 3DOCA 4RZ2A 3WWEA 3Q6NA 1SIWA 1DZIA 4OHUA 3K9LA 1JI0A 3G68A 4O1HA 1KPHA 2IT1A 4WFQA 2O0HA 1Z38A 5T6BA 3NC0C 3TO5A 2H00A 1L7EA 4K6CA 1TF2A 1ACLA 1IDN1 3A1EA 3T38A 2PAAA 2VH2A 2C5LA 3TDMA 4V0KA 1DEKA 1G9XA 3E9ZA 3NYIA 5LJIA 1P45A 7ABPA 5DLPA 1OJLA 2A1UB 1IBCA 3EW7A 3OIYA 2QD4A 1FP6A 4ZRDA 3UFBA 2QRJA 4GWKA 4KVAA 5CT4A 4JUAA 3P19A 2WV9A 3IAUA 4IIJF 2QUJA 2WNIA 3A31A 4H27A 4NH4A 1LW7A 3ZLVA 1MB3A 2VRBA 5AKJA 1LBHA 1RNLA 4YV1A 2V7QA 3UT0A 4HLNA 3J7AC 3G5LA 1QTQA 5IC4A 3KQQA 3CPHA 4C78A 2BTQB 2I8AA 3GLKA 1BVYF 1A0OA 3K9QO 1LBQA 2ACWA 2DGDA 4J94A 4Q34A 4RVOA 3EZFA 1ZONA 1U0OC 5JYEA 2ZRCA 3WNZA 2ZJAA 5KKAA 1AKUA 1I80A 2CHEA 2L2QA 4D9GA 1LU9A 1Z74A 1RPNA 4KQGA 1IMJA 2GJKA 3HGMA 3SYKA 2QLNA 5KOYA 5KKNB 1QHFA 3QPAA 3C3DA 2XZTA 4XM1A 4CM7A 1NC3A 2GTPA 3IFSA 1W87A 2NO5A 4DUYB 1C8LA 3T06B 4FYMA 1OFTA 2GCOB 3VNUA 1MIHA 4S0XA 1PD0A 3HBLA 2YRWA 3SQNA 4F9TA 3HBFA 3PWTA 4HG2A 1MMFB 3G0IA 4FLMA 4RUKA 1UK8A 4BU1A 4BB9A 5A03A 4L4SA 3AVVA 4N76A 1HYGA 1YCFA 4RJ2A 3OPYA 3C3KA 1R0BA 2HRCA 4MYRA 2R6HA 4EQ6B 4C7VA 2ZSEA 5ERXA 2AZ4A 5ALQA 3F73A 3HO8A 1XTBA 2NW6A 2D1YA 4YRBA 4XDYA 3HU5A 2KHZA 4R40A 4UHHA 4PSKA 3WSVA 4N18A 4W4TA 4MKRA 1JG1A 3D6AA 2IZ7A 3TMYA 3AEQB 4IHJA 4RADA 2ODBA 2PUHA 3M82A 1NV9A 3DNPA 1D09A 1IAQA 3LGAA 4BNDB 2X0KA 1YONA 2GUGA 5KTOA 1UXOA 3EYAA 3LPLA 3FPBA 2JFOA 4O59O 1NWCA 1BWQA 3NT2A 2VR1A 4NCNA 2PUAA 2GD0A 2UXBB 2HWWA 4IDEA 3EQ6A 4TRJA 1V0JA 3OOHA 5EYPA 5H16A 5DJ5A 4X64B 4BE7B 4PNEA 2R7NA 1XVLA 3ESRA 4Q3OA 3GNSA 4RTMA 3Q9NA 3DLPX 1QMGA 1PRYA 1E2PA 3DMFA 3DVAA 1X94A 4M6WB 5FV4A 4PIPA 3I0NA 3K8ZA 4U8GA 4MROA 5JAQA 5BUCA 4JR1A 1R0LA 3N58A 1IVYA 2ZR9A 4OB6A 1Z6GA 3Q2OA 5JNSA 2F4VB 3UZUA 2FR8C 2C7OA 5FQNA 5ED0A 1S9DA 4QOSA 1XDBA 5IK2A 3B60A 4LX8A 3TZKA 3WKAA 4E15A 2W22A 3BMCA 2PMKA 5FH9A 4DUZB 3WQQA 1FMFA 3HU2A 4ZV7A 4JJAA 2ZUUA 5H68A 1PR0A 2BLLA 3S7ZA 2XNSA 3WDLA 2XTZA 1LVHA 3O3NB 5HBGA 2YBDA 2H0AA 4QD3A 2W58A 1M34E 3TZCA 2OTCA 4RS3A 3RIEA 3OETA 3OTHA 1EUZA 3KL2A 4LJ5A 4HDQB 1GGKA 3ESQA 3H2KA 3P2OA 4JOQA 1LSJA 2GI4A 3N2GA 3QVLA 4WXMA 1EZ1A 1DP4A 2E4VA 3ML1A 4GMXA 3UWOA 3EISA 4MQ4A 3ASVA 3T9DA 1NKSA 2WJWA 2ZBPA 2GF9A 1ADCA 3AY3A 1NX9A 1YS7A 2HT6A 2XBUA 3G17A 3W4IA 3WR5A 1I3OA 5C51B 1JU4A 2E37A 3ROKA 3UCXA 4BFXA 1CYDA 3R0QA 1DIHA 1C7QA 4UHKA 5TEWA 4DKJA 4RZSA 1ZZEA 2ZM6B 3BD7A 2RHBA 4MW5A 5T64A 4EF6A 5LQUA 4JHXA 3RUCA 1CS4C 1F06A 2OV3A 5LP6B 4BKRA 1DS6A 2KB0A 4C5AA 2HU5A 1IZ9A 3F6YA 3KPUA 4R1QA 3IELA 4X54A 3NKFA 1TLLA 2I4MA 3LY8A 3TXAA 4JXZA 2R84A 1VHJA 2WM9B 1W4BA 3D6HA 4TSKA 4L51A 1VOTA 4C05A 1JVBA 5D5QA 4QU5A 1WW2A 4HMQA 2QWXA 1M7HA 3KYDA 4NLLA 3ZBTA 1DCMA 1T4GA 2C88A 1N2IA 3B8HA 4YIKA 2JIOA 4DG9A 3EVTA 3AF2A 1B00A 1JMVA 4L72A 4B47A 2J30A 2C3PA 2AMFA 3U4MA 4R9RA 4BQQA 2OORA 3WYFA 3MJTA 1FQJA 4I19A 3NHSA 3CCFA 4CHGA 3CB4A 3C5CA 4DBVO 1NNI1 2QM3A 2JLSA 3H5VA 3PCXA 4D9JA 3DEZA 1ZUD1 4GOOD 2R7KA 2W6PA 3PVCA 1CG6A 1W35A 1OWPA 3A4IA 1JTFA 2WIJA 5GJWC 3RRFA 1UEIA 1UZMA 5EZYF 4MITA 4C07A 1VFPA 5ALDA 4ACBA 5E8JA 1FFEA 1SELA 2NZUG 3ZWOA 1S2GA 2OYSA 3EVDA 3K0FA 3EG5A 3SKVA 4FMDB 3QUCA 1AV7A 3RT7A 2ZUTA 1AE1A 1JP7A 2QP4A 3U5TA 4UUMA 4A3SA 2FK8A 1DMSA 3QG1A 2ATVA 5DNCA 3NVDA 3AY0A 1K89A 5F2EA 2B1RA 3I6QA 1OBFO 3OJ0A 1V8PA 4XVCA 1S7CA 1W0JA 4CXMA 5LSAA 4L2IB 4XOUA 1QNFA 1T1JA 1GUFA 3D3EA 1TB4A 3D3QA 1C50A 1ESZA 2CK3A 3I23A 3ZXSA 5BWLA 1NNEA 3C5WP 1T25A 3T5PA 5ISMA 3HSSA 2ZR8A 1N5LA 1CUUA 2AQKA 1ZI6A 2JKYA 2C57A 1Y4AE 2F3RA 4UM9D 1K3TA 3QVVA 4O29A 3B6JA 2YXBA 3F6RA 5ER6A 5K3CA 1OCEA 1ZM9A 3AX6A 4O5AA 5E1OA 1I30A 4I4TF 4EZIA 1XYYA 2OESA 1EDEA 3T7KA 5JUWA 3GT0A 1U0SY 2AB0A 3FWYA 4CMCA 1FFAA 1EUCA 4Q9NA 2ODWA 3CO0S 2JIBA 3TTXA 2AR9A 4CKXA 2NOAA 4OGKA 2FPPA 3WICA 1HKHA 3AUTA 1EFCA 2NUPA 4BO1A 1JFVA 2H2WA 4IXMA 4KMSA 2BYTA 3TMKA 2ZJ0A 3KXLA 4FYVA 4X41A 3ADBA 1QHHA 1Z68A 2H52A 2JGMA 3IAEA 1NVBA 4R1OA 3LUKA 1U0GA 4K0RA 1K1EA 2YMQA 5DNDA 1Y7LA 2YXPX 3SBOA 2AUNA 2PE5A 5FUWA 2OBXA 1ZNXA 5ICEA 2PH7A 2GHIA 3LX6A 2EBFX 2X2EA 3R7AA 1CZKA 1KO5A 3AERA 4ZVLA 3MCTA 4QOFA 1Z7YA 1X1RA 1SZJG 4XJVA 1KE2A 1RXWA 4LI0A 2FHSA 2E4XA 1Y34E 4I14A 1UUFA 2PL9A 2EU8A 4Y9TA 1HM5A 4DMUB 3WMEA 3T5MA 1NW6A 3PFBA 3WWDA 5KNDA 1EP2B 3D6VA 1GQ2A 3JWPA 1CVLA 1JZQA 3BSFA 4B9EA 1F5NA 1HDYA 4JLAA 1K7CA 3GG9A 5JRJA 5CMLA 5LYJF 1J99A 1G5PA 4BMZA 3JTMA 4YRZA 1OQAA 5HQ3A 3RC7A 1BA3A 3VUFA 5I7FA 3K71B 2I7TA 3HYNA 5E1DA 4BVBA 3BD6A 4KPUA 1E9AA 3QI7A 3GDGA 5DHQA 2Q7XA 1QDUA 3JARB 4ITRC 5AW5A 1KMQA 3M6UA 2C4MA 2OM2A 2VJMA 4KNWA 3AM1A 1ID8A 1IVNA 1KOFA 1JA9A 2GHQA 5EQJB 2XNDA 4MS3A 2W8ZA 1LLCA 5G2OA 3IUPA 2OHGA 1RI3A 1SXGA 1QQ7A 3EVNA 3ZLUA 3AYXB 1N9GA 2XMZA 2XKJE 1SO8A 3DBHB 1VHQA 4NWIA 5G1NA 3GUHA 4DV4B 4HN2A 4YHHB 4CF7A 3L7NA 3SHQA 3C1UA 1DHRA 4F84A 1M67A 1MFZA 2GZ3A 4IH4A 4F7WA 2NN3C 4RVCA 4ALNA 2ETVA 4RV4A 3R6WA 3SZRA 3D0RA 4MPJA 1YVDA 2GZ1A 5HX7A 3L84A 3N2NA 4M8IA 1W73A 2XCIA 3GFPA 3RV3A 2R48A 2GJAA 3OTOB 3U7GA 1YBMA 3AFGA 4WOKA 3HNPA 3SXUA 1AXEA 3SSAA 1CJBA 2LNDA 3LVQE 1TYCA 3TAXA 2IEIA 3M6XA 1LPAB 4G65A 2Q2OA 5NULA 1S1MA 4YCCA 4GRAA 4U1RA 1NAHA 5DP1A 3WZLA 1INLA 3ROGA 5B7QA 5IT5A 1F7UA 5JXGA 2YW2A 1Q20A 2J8ZA 4W9NA 3WL6A 3LMKA 4BMVA 3DE2X 3EXFB 2M9MA 5TF4A 2IUSA 3VR4D 4D98A 1O94C 4PYIA 4ZDIA 3ZXXA 5JROA 4QUHA 3H5WA 3TI9A 1TUBB 4WNAB 1PJZA 4KPFC 1YCGA 5K8LA 2AQIA 3CMCO 4OB7A 2QTVA 3H5IA 3V4ZA 5P8WA 3E9RA 2G09A 4K6MA 4WKGA 2MINB 4MCJA 3ZBPA 4HGQA 1XZPA 3MJHA 4YUXA 1TT5A 1TUGA 2W2LD 4HZGA 3NNDA 2VQFB 1XTSA 4AUEA 1MCZA 2DEUA 4HMOA 3TSWA 1PZFA 4WT7A 5CH8A 4KPYA 4R8RA 5C7YA 4KPGA 4CIDA 3LQ1A 1H3EA 1CUBA 3OUZA 1BHO1 2E89A 5LQDA 4ZCMA 1RKVA 2O5EA 3PXXA 4C5BA 1SU4A 3H75A 3DG9A 4BO3A 5IM4F 2P9YA 3F5DA 2F59A 2JARA 2BFEA 3OZXA 2H11A 4QYSA 5EJAA 2ZRAA 5BSMA 2WF5A 1EX6A 3ORSA 1EVJA 5DTIA 4FYHA 4C0XA 4OUDA 3COPA 1U4SA 3KRTA 4DR2B 4QDZA 4JCCA 5KQPA 1CNMA 4WVLA 3I5YA 1TOAA 4JB2A 1EP1B 4UNNA 4WX2B 2AC2A 1P2FA 2DE0X 1RIFA 3D4LA 4XCVA 3M49A 3FBWA 2HREA 2QY9A 3OFNA 4M99A 5KTTA 3EVZA 3QFHA 1T5LA 3LXUX 2DTDA 4YAFA 2ZZKA 1FX1A 3NBFA 1Y37A 4MWSA 4QQFA 2RHJA 3RVQA 1AHNA 2Q6OA 1RQNA 5D3ZA 5C8YA 1A9ZA 3UUEA 1PGPA 3ZWMA 1NXWA 1WF3A 5L40A 2QRVA 2ZYHA 1VBMA 4FR5A 3UWPA 3WXBA 3CB2A 4HRVA 1U3TA 2PR7A 2PM8A 3TD9A 4DV7B 2H57A 1WXXA 3IJPA 4LHVA 1H8HA 2AFHA 2BOVA 2VTKA 3RU2A 2PWAA 2W4IA 4AI6A 2VZ8A 5JSQA 3KDAA 3PI6A 1H2YA 4OXRA 4XTCS 5BWCA 4K9OA 2B4YA 6AT1A 2BRUC 2Q5CA 2X0IA 1UMBB 3TLJA 2W8BB 3T7TA 2O8EA 1GCIA 3FCXA 2WKPA 2FDRA 2W93A 4UNRA 2Y76A 2FZCA 4L02A 4CQLA 1IHUA 5B3LA 4YDQA 1U9ZA 4ZI2A 2DTXA 3GJ8A 1DKUA 1JWAB 1N6OA 1YRAA 2I2XB 3R0ZA 4G23A 4L8LA 3OZWA 4B09A 4KR3A 2OVFA 3E6AA 2BSQA 3D54D 2D1QA 4JL5A 3ZVRA 4PY2A 4IRXA 4M7RA 3LVRE 1HTBA 2BFOA 1LS6A 2A1TS 3HGQA 2A8YA 3A6KA 1G60A 3RTGA 5TQ2A 3U4IA 2I91A 1BN6A 1E99A 1TYEB 3V1MA 3HKDA 3TD6A 3EQZA 1D2AA 4FKZA 3GHYA 5A62A 4MW6A 1XROA 4CWAA 2R0QC 1ZOPA 3PDHA 2XT9A 1C4OA 1VKRA 2Q1XA 2QROA 4DLWA 4F4HA 3ASZA 1JFFA 4K9DA 3E9QA 3DPUA 3KQVA 4P08A 2G0AA 3X1JA 1C8BA 1ELOA 3OQHA 4YT8A 1ULAA 1E9EA 3F47A 1XKTA 1J8DA 2J07A 4DA8A 1PGOA 3OZVA 1W7AA 4RIFA 3NTUA 1QJCA 1MHPA 1YBAA 3DAHA 2WC1A 3TECE 5KVQA 5B4UA 3V8BA 2B7BA 3DLCA 1W5TA 4MQ6A 1GP2A 4OPMA 4D6YA 4DREA 2ZCVA 3FVVA 2VRCD 3U3DA 1CUYA 4WQMA 4DV2B 1JIUA 3WYAA 3GOQA 5T7BA 3KZOA 1P2GA 1XI2A 2XQFA 3IMEA 4OQQA 3R7NA 3RUAA 1E8NA 2PUGA 3TBFA 1DTSA 2JH8A 1C81A 5IDWA 5IVPA 4CIVA 2Y1WA 3C3JA 4I4CA 4IHQA 3GV0A 4H3VA 1T91A 3R9KA 1SQGA 2QVYX 4JT2A 2E5LB 1NJSA 2DMRA 2PNJA 3KTDA 3N5KA 3ORRA 1BD3A 2JAUA 1IXKA 3FPGA 4NYIQ 1QV9A 4O4LA 2F17A 4FOLA 3FYCA 4U7JA 4XB2A 4AFNA 2DR0A 4XGNA 1MX9A 2IEYA 3O82A 2VBCA 4FCWA 1WHSB 2ZETA 4ZHSA 5FLXA 1F48A 3SE0A 1JMKC 1P7CA 3AF0A 3CR3C 1J0XO 2AH5A 4WLFA 2E4AA 4YI3A 3V4OA 4CNQA 4E2ZA 2KLHA 3WKDA 2P4SA 4BX9A 3LZCA 4FHCA 4MRNA 4D9HA 1VJ0A 2O8BB 1P31A 3BJZA 2FR8A 1QKKA 2C0QA 1NMQA 1VRWA 1EEXB 2D7CA 2JS7A 3Q72A 2BUCA 5EWLB 3ZZMA 4EA7A 2YJ3A 1PEDA 3HXLA 4JN6B 2QUBA 3LOQA 4PTLA 4OLFA 2FDCA 3SSMA 4R01A 1M1YA 1H22A 2YHIA 4L4YA 4IJQA 3K5WA 5A4IS 1EDZA 1L8LA 4TLMB 4AS2A 4EB3A 2EYQA 1XKXA 2I34A 4JK3A 5ALPA 1VE9A 4HUJA 4L4ZA 2OCDA 1N36B 2OCAA 3B7PA 3OE1A 1OH6A 3JD4A 3PQEA 4XYGA 2FPLA 4M98A 1USWA 2LKDA 2GA8A 5FL7D 5HQTA 3TYXA 5LWHA 3V8NA 2XA1A 3QA9A 3ZHUA 1WTAA 4MS4A 2XECA 2UKDA 2JGDA 2CDAA 4ZI7A 5BPHA 3CNNA 1KSJA 1D8TA 1J2RA 4PX9A 4UW9A 1EHCA 4FS8A 2Y0PA 4GBED 4IRMA 5PGMA 5SYMA 2GH1A 3M4YA 1QO9A 5MFPA 4KHZA 1HZZA 5HM8A 2ODPA 1DBVO 3HXTA 3KKPA 1G291 5LNK1 4G36A 1QANA 3NZEA 2HJVA 3A9CA 1HRKA 4J90A 3OJFA 2XUKA 4J16A 4ODIA 4QOGA 4UULA 1KDYA 4D9KA 2VKQA 1PJTA 1GFIA 2PXHA 1UK9A 2VFAA 2NO9A 4M0UA 2EL9A 4Q93A 4R9VA 4CMKA 3PEEA 1ZGJA 4K8OA 1B2LA 1JILA 2B7CA 3RBVA 3STHA 4FHEA 2ZFUA 5HMMA 4BC0A 3JQDA 4ZALA 1K88A 1RABA 3FROA 4DLUA 4KXVA 2GLXA 2J87A 1DQPA 1JEAA 3EGXA 1ZZGA 4I9NA 1PJLA 1UFKA 4J2HA 5CFNA 4NJOA 1KYTA 1QHXA 1RQ2A 3MWYW 2C03A 2XCQA 3AFNA 3EH2A 1GKYA 3I1FA 3OQJA 1DXYA 5MN4A 1FDUA 4KSBA 4ZZ3A 3GZ4A 3A6ZA 4MUAA 5CLFA 3KQNA 4BRZA 2P91A 1D1QA 3KIPA 4XYLA 4NBVA 1Z4NA 3OHSX 4MZDA 3UV7A 4D9FA 1BEEA 1PVVA 1V5WA 2EQ5A 5KPDA 3U17A 2RHWA 4FLEA 3LKDA 1IBKB 1UPTA 2Z95A 3Q12A 2RH9B 2QR2A 3TLMA 3ZDQA 4DA9A 1A7UA 4A27A 1T2FA 3EIEA 3V34A 3ZD9A 1GSAA 5TIIA 1AN9A 4D2IA 2EQAA 3IPLA 4KQXA 5KYKA 2A92A 1FMJA 4EPVA 1F14A 4F85A 1U2DC 4YPOA 3ZTTA 1E1MA 1USGA 3HNOA 2J5RA 2DR3A 2JHCA 4LY9A 4QTTB 3WWZA 1G66A 3Q1LA 5ALLA 1S6YA 4CV2A 1PEAA 4ZYTA 3E7DA 4J3JA 2DCMA 3HXOA 2QJRA 4C7OA 4WI1A 1EJBA 1XFDA 1ZSYA 1PT8A 3HFGA 4ZVRA 1EXWA 5B4TA 3HBAA 1UKVY 2ZI4A 3QW2A 4WECA 1FUYB 2IEDA 3SYRA 5HRAA 4X8HA 2D7DA 1BHJA 1Y6RA 1N2OA 3D8NA 3STYA 1WAMA 4MR7B 3UAGA 3OT1A 4NZPA 1RKXA 5EJ8A 2QN8A 2D00A 5C7OO 1JHAA 1NI3A 3DA8A 2OEPA 4WFJA 1N92A 2DHDA 5LQAA 3VH3A 4J6FA 4ASUD 5D5PA 3TSZA 2X7HA 2MJLA 3ZKWA 1QDEA 5DK6A 3WC4A 3GLTA 4EBBA 4QNMA 1YK1A 4RK5A 1SBQA 4IIXA 1U7HA 1EX7A 3DZJA 2JEZA 4R8MA 5C5CA 2V59A 3BB3A 2AFHE 1XJWA 3ADOA 3D6TB 3QBDA 4QYIB 4QWWA 2WSMA 1L5VA 1ZK4A 2QAGC 5IF3A 2B8JA 1RAAA 3QPUA 1P1JA 3EPLA 1JKFA 2J4DA 1DAIA 1OX4B 2P2ZA 3KKEA 3PDIA 3W2IA 3SVLA 3ESYA 1EG7A 1QWOA 2HM7A 3IQGX 4LYHA 5FL3A 1LJUA 3SZ3A 1J90A 3TSAA 1HQYE 3VJMA 3IKTA 1ACMA 3BL8A 3D8BA 2FOLA 2XQKA 5KQRA 1CY6A 2OQRA 3MGBA 3HRIA 1RBQA 2BW0A 1GSHA 1N2HA 1P60A 4J9UE 4UUPA 1SB9A 4R2XA 1E9FA 5DEIA 2GN8A 1Q50A 5J5AA 5TF0A 3DMHA 3KLPX 1Q0QA 2IBMA 2IHZA 4GVXA 4HDNA 4KZKA 4UASA 4Q9IA 3MELA 1IB0A 3WFZA 2OAP1 4GSYA 1QVAA 4E51A 1H66A 4ZVVA 1L9KA 4WXYB 5C1BA 3QU4A 2DHCA 2M6SA 2WUDA 2PS3A 4QPDA 3AW8A 2VAPA 1W4RA 2Y77A 3G1UA 1RWPA 5JG7A 4C4PA 2ORED 4JI2B 5HK8A 4IJ5A 4L15A 2ETXA 2ORVA 2GM5A 2WVHA 1SC3A 4V0LA 2QLTA 3ILVA 1OYYA 4K88A 5AMXA 1YBFA 1NDHA 2J3DA 2V74B 3FIUA 4RVGA 4YJFB 2I4RA 4G4GA 4LDZA 1M8PA 2BI4A 3GJQA 4FHFA 2ATEA 1B2RA 2BZ0A 5F7ZA 1R6DA 5JZSA 3NOQA 3U39A 4DARA 1S3IA 3P9RA 2ZJOA 4DR5B 1RWKA 1X0XA 3HDTA 3QZUA 1QCCA 4JODA 4QJ5A 5EGSA 4N54A 3C8MA 5K8CA 2D0OB 1ZGGA 3EWSA 4TV8A 4H4DA 3KQLA 1HT3A 4X91A 3JTEA 1S2DA 1HDCA 4X24A 1DRJA 3GUCA 3H2YA 1XXHB 3I9FA 3LC0A 4S35A 1P6XA 2V6IA 4DCSA 5F12A 2PA3A 3EARA 4M0DA 2R68A 5B64A 3INYA 1XU9A 4TQUS 1IC6A 2H9YA 4X3CA 2ZTSA 5FP0A 5K0ZA 1COWD 3ZDDA 4EARA 3OP4A 1KQGA 1ABFA 5A06A 3DW3X 4UTNA 4DA6A 3EVCA 2A94A 1EVYA 3EZ6A 1GSOA 1SQ5A 2NO6A 2PGOA 1P7VA 2I2CA 3DYBA 3O2QB 4LC1A 4OJQA 1WB9A 4PFJA 4PSVA 4ZU1X 2Z2JA 3PR1A 4XEUA 3CLRD 3IAXA 3HV0A 3MBOA 5C1DA 5BVGB 5EJ9A 2FEXA 4N12A 1EFTA 1TTQB 1ZA2A 2I76A 3G0BA 4Z86A 2OD9A 1Y82A 1JHYA 2WBLC 2YX1A 2AS0A 4EW6A 1H3FA 1N0VC 2WJJA 3DFKA 3ENZA 4L50A 3ZOKA 2XUDA 4BNFA 2DBRA 1E0DA 6REQA 2BISA 1M1YE 2C1EA 4TYWA 1T8WA 3MWEA 2IIQA 1GEEA 4BO7A 5ITVA 1MHTA 2Q5JA 3M4NA 4MLPA 1A7AA 1LRKA 2IYPA 2J3JA 3MG9A 4X8OA 3ZXIA 1BC5A 4MWOA 5IUKC 5TB5A 3HZOA 4R2WA 2BGNA 5FI0B 2NU8B 3NTOA 3UICA 3HE3A 1IU9A 3LCMA 3AFOA 2BEWB 3U7IA 4YP7A 3KB6A 1F8XA 1UADA 1NRJB 2XWPA 4TTJA 4A8JC 1PJCA 2JLBA 1C2YA 3BIXA 4MPPA 4MYTA 5ECGC 5AQEA 4MRMB 3A3KA 4BEVA 4Q39A 1CUWA 5K3SA 4YDSA 2JIPA 2OP0A 1TCBA 3RANA 2PWPA 2GR9A 1PK9A 4DY4A 1Z0IA 1ND5A 4U7PB 1DEHA 5JI2E 4YR9A 4E4TA 3H5LA 2FSGA 3SC6A 4FFRA 2ZIXB 3NHRA 3Q7RA 4QSMA 4KH1A 4YJGA 4CEJA 1Z15A 3LLMA 4I1VA 3LT5A 1GT91 5BPFA 3DO8A 3UYKA 4D8WA 1WMEA 2UZAA 3U44B 1VJDA 1YVUA 3A4VA 5CFMA 3I05A 1YUNA 2XDYA 1Y7IA 5CLLA 1OGJA 5AHOA 3H1FA 3KDSE 1IK4A 1U8AA 1W8DA 2LWIA 4KN8A 4X1KA 4R5HA 2UVDA 1IY0A 3D7SA 3GMDA 3LLSA 2W9XA 4RHUA 3T4XA 3CRMA 3V8VA 5ICSA 4HADA 3JQBC 3W9YA 1YKGA 2WAAA 3N8GA 1KOGA 3G1WA 2HGZA 2D5LA 1A8SA 4FJ1A 3M0EA 1HFWA 2Q8NA 4ERNA 5DYWA 1GGJA 3MRSA 3H2SA 2X7XA 5FPPA 2ZRJA 3K05A 3KXPA 4CODB 3KBOA 3UKJA 1PUXA 5FFFA 2I65A 3N87A 4JVSB 4MB0A 1TQ2A 4BCDA 1O9GA 1PK7A 2D2IA 2VJYA 3OPYI 4BFVA 3KFLA 5LU8A 3E1KA 1KMCA 1W4AA 1XE3A 2BEVB 3ZDBA 5LDDC 4BNHA 1YB2A 3NHLA 4DQVA 1N2ZA 1NKTA 1P5RA 1T6XA 2YYSA 3I83A 2C9BA 2VQ3A 5DNWA 5KI6A 3UHAA 3S2UA 4RXUA 1HSOA 1V3QE 1BQ3A 1JEDA 1Y3DE 1Z35A 3GGDA 3HN2A 2XRZA 4YRDA 5AOCA 1QIMA 4KR7A 1C8KA 3PXDA 4JU9A 5AKKA 4JV5B 2JLQA 4Q21A 4PGFA 1UDRA 4L5BA 3FJYA 4MOWA 1RXYA 1FXUA 2X2PA 4DM4A 5BUZA 2X40A 2W4QA 4DDHA 5LIRA 1WG8A 1JKIA 2MIIA 3PZRA 5ARCA 3LFUA 1QRAA 3C3EA 4I46A 2UYHA 2PZLA 1MGPA 5IN5A 2FPGB 2ASEA 2BUAA 3CUKA 2WHPA 2R6CA 3RIGA 2RHTA 3QVGA 2ZSDA 1NV8A 2IYQA 3KT6A 3TZEA 1OBHA 1G4UR 1R74A 1RRGA 2VAWA 2YJ5A 4ZOLA 1E92A 2GTIA 3W3AD 4B85A 1JHQA 4LK2A 5EAIA 4Y9SA 2Z2IA 3H4TA 5JSKA 1YE3A 2QU7A 4YS6A 3T7IA 3C14C 5KNBD 1S3SA 2RG1A 3OT4A 1XO1A 5FO0A 1X80A 4AX8A 4BKUA 1K7SN 2C31A 2Z8XA 3HCWA 4Y8VA 2OA0A 4BHTA 3M1LA 4ZTBA 1SCJA 1EMDA 1T0BA 5I01A 2EWWA 2WLSA 5TLSA 1XX6A 3FZEA 3SYMA 3GGSA 1W30A 2IQIA 4RK0A 1XDWA 3BXPA 2WJ4A 3PQCA 3MTAA 4MV6A 2BGTA 2HXGA 3ANNA 2P4HX 3F1LA 4V0SA 3LPNA 4BFSA 4BN4A 2C59A 1KZYC 3I5AA 4IIDA 1EJ6A 4BV3A 1N34B 2LIVA 1XZFA 3SJCA 5JHGB 1WABA 3F5MA 3JD1A 2GXQA 3EGCA 1ZQ1A 4HLDA 4EPXA 4JUFA 4Z0NA 1HEYA 1I2BA 1U5BA 2ZVJA 1AGYA 5JW6A 4Y6LA 1DWPA 2CVZA 3PJFA 3ETLA 4KXMA 4P36A 1PJQA 4PU0A 4GPIB 1TUEA 3MJ4A 4Q15A 2ILVA 3FHJA 2PDAA 3PFFA 3EEFA 5LDHA 3KU4A 5BSHA 1C7IA 3BTUA 4JJ4A 1NE2A 1NSYA 1U8UA 1E1QD 2HXYA 2PO7A 1NG9A 1QIKA 1PIWA 1MRSA 1USIA 1HDEA 4PPGA 3MJDA 4UTPA 1X38A 4J0DA 2BM1A 4ENSA 3C6QA 1G20A 2OLEA 2FW8A 3IBFA 3M2TA 2DBQA 4AQDA 3VSCA 4EEXA 3HUFA 4MRRA 4LF8B 4NOMA 1MRNA 1HYQA 2X14A 5JAZA 4QYMA 4IQ8A 4TT8A 4AKHA 1QO0A 2JBAB 2NYUA 3DHVA 4GYYA 1ULUA 1XJCA 2GDZA 3URKA 1UMCA 4KO4S 1XN1A 2ZYIA 3PJGA 4H7IA 5DN6A 5BSEA 5AJHA 3IKVA 3FTFA 2IS2A 1AO3A 1PJ3A 3OZSA 3PTLA 3L04A 4IH9A 2CXNA 3U9SA 4ARAA 3CLVA 3SVZA 4FNMA 4ESVA 1QP0A 1X7DA 1NVMB 2Q2QA 2ZTHA 3VZQA 1BOOA 2I6SA 1VPLA 3BILA 1E7QA 1Q17A 4XUEA 2WSSA 1SBHA 1IL0A 1N8NA 2JGAA 2FP4A 1L5NA 4DGQA 2UVPA 2ZG6A 3IIEA 5JCXA 5LPNA 3PXUA 2EBHX 3PLAE 3JPWA 5H7XA 2V54A 4WD3A 1Q0HA 1PT9A 4L07A 4WSOA 4LWPA 1N0UA 5TPWA 4P98A 3K30A 1NQAO 1CQIB 3L43A 4OMUA 1E5DA 3M1IA 1XLWA 4QFDA 3CSDA 3PSAA 4RYDA 1LBTA 4OHWA 1ORIA 3F1KA 1IHPA 3FYSA 2Q3HA 1HF3A 2BC9A 3AR5A 1XZDA 2YFYA 2WKSA 4Z7NB 5TY0A 3ZCUA 3QHPA 4DNOA 1K98A 2A14A 2PL1A 3E05A 1PX0A 5L7TA 1RKQA 5M3BA 2NUTB 1F5SA 5K3EA 3BM5A 4JWKA 1T9ZA 2O6LA 2ZB4A 5EE0A 3T5DA 4HVLA 4PZCA 1FBNA 3RFTA 3B5JA 5BSRA 3WMXA 4I1PA 1OLSA 5J2UA 2G4LA 2GPWA 2OLKA 1GDHA 1TJ3A 4TXHA 5CB4B 2PGNA 2P2DA 2V97A 3WGHA 2K5UA 1BVHA 4D43A 3LHKA 1NW4A 1QQBA 1X92A 4I4IA 2FEAA 2GNPA 4LTNA 1UWVA 4NQZA 3LL7A 3K0CC 3RVKA 3JXEA 1Q0UA 2NV0A 3PPVA 4HJXA 4TMVA 1UMDB 3DDUA 4HEA1 4F1KA 5KJ1A 4M37A 5G0SA 3W7VA 5KWEA 3ZCXA 2P2GA 4GZ5A 4EHKA 3LPAA 1HA3A 4NP6A 1EAYA 1RAIA 1Z8HA 2O8CB 1X1QA 2Q5QA 1E3SA 3BIFA 4WK2B 3ENWA 5SZIA 4OF4A 5IJ9B 3K96A 1NZJA 1SVNA 1Y5RA 3A0RB 1TTPB 4ZO6A 3UMBA 4CM8A 4YLEA 4G84A 2CLOB 5JXJA 3DHNA 4L0CA 4PZUA 3E2MA 3K8YA 3ZWCA 4F3TA 1PNTA 3IP6A 1ZGAA 4ESHA 2FUG6 3OKFA 4X00A 3RTDA 4ZREA 4BE4A 2GETA 4MUIA 3O3MB 5HTKA 3O84A 5K3OA 2WZCA 1MQSA 2L0XA 4REQA 2QN3A 4CTMA 3GA0A 3JW8A 4G2NA 2QUHA 5CFRA 2PFKA 1T10A 2YZ2A 2GD2A 2Z2ZA 2Q3BA 5AK4A 1EFAA 2J3MA 1QFSA 3ZGYA 4JSYA 1WVMA 1DJQA 4I50F 5EFOA 1O6GA 3T0GA 5I5GA 5CFOA 2OZPA 3FKQA 4NJEA 1TFUA 3RRZA 4FDLA 4DIDA 2QTWB 1D5CA 2AOXA 2VXCA 3FAZA 3GLRA 1YE8A 4CI9A 3ZCPA 3DMGA 4H3KB 5BW8A 2X1LA 3I01M 4PQGA 5FWAA 1L7RA 1PYDA 5KJ6A 2Q29A 1OV6A 2ENWA 2I7XA 2OBBA 2PBRA 2QG4A 4MP6A 3RD5A 1KVUA 2AOUB 3I6YA 4PNZA 1NMYA 4B0PA 4A82A 4M7WA 1BXGA 3HRKA 4N5NA 3GJTA 1OROA 3SHTA 1CTQA 2J3LA 3GEMA 5DT2A 5FEMA 5LIPA 1NX6A 3CF4G 1ACJA 3N39C 1C3OB 1Y3BE 3HFSA 4PINA 2WY2D 1LI7A 2PLWA 3WGNA 4JC4A 1Y1SA 1I1HA 1H3NA 1O5TA 2VT6A 3V2UA 1C9KA 2ANCA 3PS9A 1N0HA 2WDZA 4B40A 1FS4A 3W9UA 4ATNA 3ICWA 1BXKA 2ZJ2A 3OUTA 1R6BX 1HDZA 1A8UA 3LOPA 4PR0A 4JMPA 3S99A 4G3XA 5HIIA 1F4VA 4XQCA 3ZDRA 3VV3A 5JJLA 2C2OA 2YV4A 5DU2A 4YP1A 1EVQA 1PT7A 4BVKA 3GLGA 2HFJA 1EKXA 3PBKA 2H5EA 3T3DA 1QGZA 3CBQA 4WEOA 3P32A 5T5QA 3DCNA 2YC4C 1M1UA 3F8TA 3FLBA 3MOSA 1HG1A 1SBYA 2R6R1 4MVJE 2F4NA 1D4FA 2V98A 5DNYB 1SIBE 3TZBA 4N65A 1CVIA 2YZGA 1TM1E 1W0KD 2C2KA 2XGMA 4MUFA 5DFAA 1RP1A 5FLEX 3V4SA 1H9BA 3BSYA 1XR3A 3AM5A 3AIIA 1HI9A 3VPSA 3CJQA 5I9LA 3WWYA 2V7GA 3C16C 4BL5A 3WNQA 1VE7A 2XF2A 1VCNA 1MIOB 1X6VA 1L4EA 4Y6GB 2R6JA 5AIBA 4LMRA 5EIXA 1P3Y1 5EP2A 4E6PA 5FF9A 4JLSA 4ED9A 3B9RA 4TYNA 3VYWA 4DIMA 4PWZA 2Z8ZA 5DBEX 3V46A 5KB3A 2W2OA 3QY0A 3WJ1A 4NMMA 4KQJA 2A5YB 1KTVA 1VPEA 4IS2A 4BLSA 1CJCA 1Z4LA 7AT1A 5B1HA 4FYJA 4UCWA 1ZH0A 1YS2X 2WD7B 4ZEWA 2FKNA 4KKVA 2B98A 4RTSA 3HCNA 3KWMA 1G20E 5GINE 1V16A 1GKKA 3DOJA 2KSQA 3BWBA 2Q3EA 3SE7A 4GMKA 1Z22A 1PV1A 3VBCA 1NVVQ 4RJKA 2GUWA 4INZA 3R5FA 4W5RA 2JJ2D 5J1SB 1NR5A 1RYEA 2BI7A 2EW2A 3QVWA 1G8MA 2B78A 2IE8A 2YWCA 2I1LA 1ABBA 2OZEA 2H7VA 1D04A 1IG3A 2B82A 2FVXA 3EEQA 4PPQA 4M49A 1ZISA 3B6IA 4JJ8A 5K6AC 4BZQA 4A8JA 2G1PA 1CRPA 4KDRA 4ABYA 4BNUA 2A9FA 4RDIA 3A37A 1KR2A 3RTAA 1Q7TA 2ZWIA 3PNQA 4QVKA 2Z57A 2I3AA 3FKSD 1SFRA 2GERA 3VKHA 4R83A 1BQEA 1AMOA 1DJMA 3HB9A 1TADA 1P5ZB 1T0PA 1X7ZA 3VO9A 4ZCIA 2JF0A 2JAOA 1A96A 3FNEA 3GJSA 3O74A 3W9BA 4D1YA 3SF8A 4ZD6A 4WPGA 2C2WA 3EXEA 4MA5A 1ZHOA 3PVSA 4FSXA 4JLJA 3C8ZA 1Y48E 3LL4A 2Z1NA 4PNPA 5KUTA 1DINA 4QUGA 4WAUA 2GAOA 4RY2A 2G9NA 1KMIY 3WIUA 1L5ZA 1RM3A 1B3BA 3R5XA 2EEPA 1HLFA 4G26A 2XWBF 4IP0A 4LVCA 4M60A 3PXGA 4LE2A 3ZLTA 4D3ZA 3DD5A 4F7DA 3FW1A 4YRRA 4U2FA 3UMMA 3ESXA 4AG3A 4A0RA 3HDGA 3R6LA 1JPJA 3IYLW 4BKPA 4BGEA 2I2BA 1V4NA 2BONA 3ZC3A 3ONWA 1OBVA 1UJCA 1JHMA 3EK2A 1YOVB 2ZPTX 4B7CA 2A9QA 3P4YA 2KM1A 4K6KA 3RR2A 1OE0A 4W5OA 4NKRA 1DX9A 2B2NA 1MO5A 3INGA 5MGBA 3K31A 1FB5A 2C9ZA 2VHVA 2R8RA 4BWFB 3VZSA 5JH7A 4OX9Y 4BPRA 2DU8A 5REQA 1BMQA 5BV0A 3VMMA 3VPXA 1LPNA 1RWOA 3HZHA 2AW5A 3PCRB 4ZEXA 2GKSA 3WLTA 3JSXA 2NVUB 3ZQJA 3LYLA 5K45A 2CT8A 5L4LA 3UOAB 2REXB 2XF8A 3LTNC 4IV0A 4AXBA 2PL5A 2VZ0A 2VRCA 3COZA 1DV2A 1N78A 1IOZA 2ORYA 4JD5A 2IIPA 4IZIA 2C9CA 4POAA 4FDAA 3KB2A 3P2JA 3EN0A 3OIDA 4RF4A 2X8AA 1PN3A 4TS1A 1OFGA 5FNVA 3JATA 3K32A 1SRRA 4DSOA 4G8BA 2EFCB 1U98A 4ZPJA 5GPBA 4H16A 3B1FA 4M21A 1R0YA 1JG4A 1X0VA 3FYUB 5DW0A 4LDRA 5HNKA 2HA2A 1VJGA 3QVKA 3NHJA 3C8DA 1XU7A 4LZPA 5IC6A 3NIBA 1ESDA 3EF0A 3FPJA 3DWEX 1CR0A 1VSQA 3GVPA 3QU5A 1L5LA 3TG2A 2ZYSA 1JSLA 1U0EA 5B5SA 1Q95A 1U28A 4EDFA 3U4GA 2ZSBA 5J4LA 4G24A 3CVXA 1AN0A 1SKYE 5SYNA 1OLUA 4LZLA 3PD7A 1ISRA 2FUCA 2C04A 221PA 1EESA 1VZ3A 3K9CA 1P9NA 2K2WA 2ZLBA 3CZCA 4UFOA 5SY6A 2G5TA 2J4CA 4GXTA 4RBNA 1XZCA 2GPAA 3LO5A 3T4PA 3ZQ6A 3FB1A 1WNFA 4WERA 2DUWA 1QK4A 3Q6MA 1WBDA 2UXCB 4H3SA 2R2GA 3WJ7A 5AOBA 4LZWA 3R0XA 3K6KA 3PJEA 1WZCA 4R9NA 3HJFA 1O6ZA 3SHVA 1AKTA 1Q91A 3SLKA 3VH1A 5CLJA 3K2IA 3A4MA 3R7WB 4OHZA 1N9ZA 3AEYA 4L0QA 4MHOA 4UXIA 4FI3C 4KN6A 4UUBA 2DH5A 2O7SA 3KALA 5HCNA 1HYEA 2BJVA 2HBYA 2LRHA 4I08A 1NBIA 1NRXA 1TI7A 4KXYA 1J33A 4YNBA 5EIFA 1LX6A 3X1YA 3IUNA 1AVTA 1UIMA 3RI3A 1LPPA 1JNYA 3RSCA 4EDHA 4OLAA 3C6KA 4KC0A 3DKIA 4N6NA 5MHTA 1MVNA 3HI4A 5KTSA 4N8EA 2PCJA 1Y6QA 4P80A 5AM2A 4AY2A 2JLUA 1YR6A 4ZODA 3SF0A 1DRUA 5EWJA 2I03A 1N2CA 3AL0C 1UM9B 5E6SA 3D3KA 3TQTA 5A1TA 3HO6A 2ZPAA 1DG9A 1A5AB 3ETEA 4J1TC 4OM7A 2QK4A 4G1VA 4V0NA 3AL3A 3GA7A 3WLRA 3IAM1 5E1BA 1KSGA 4AL4A 2EKBA 5AKYA 4XM2A 2PD4A 3LWDA 3LYUA 1DADA 1R0ZA 5HEKA 1E7RA 1Q1QA 2W42A 4GIBA 2DPXA 3DLAA 3EMBA 1W0CA 3PYMA 3NC1C 5KQGA 1KBQA 4RL6A 2OO5C 3SJ7A 4AK9A 2BTEA 3EPPA 1U11A 4IGIA 3B89A 3L07A 4PYJA 2J4FA 1UC8A 3FG9A 3IAAA 3ITDA 5BSKA 2G76A 2WA1A 5KYTA 3NFYA 4EPYA 2ZJ7A 1A4XA 3GLGE 3M5PA 4ZYVA 3R9XB 4XLZA 1NY5A 5J4HA 2QR3A 3PDCA 3DKRA 4B31A 1KKLA 3NM6B 1Y8RA 2B1QA 4FYYA 4A10A 1ZJ5A 2Q50A 1TZKA 8LDHA 3BD9A 3JCZA 4LSZA 3AI3A 5EPOA 1P0IA 3V2IA 1X7YB 4YWJA 3TE7A 5TMBA 1ESCA 3HKBA 2O7NA 3BIJA 1PBNA 3DB1A 3M4XA 5EQFA 5JU6A 1DB3A 1MENA 1TVMA 5EHNA 2CLSA 1NW5A 1OGIA 1M8GA 2BGIA 2OBFA 1PCXA 1HE5A 4S1NA 4H7EA 5DRTA 5A3JA 5AI6A 4LPKA 3ZV4A 1VG8A 3C39A 4YT5A 1STOA 2FW6A 5COAA 1FDRA 1FOEB 4TZKA 3RLIA 4RSGA 1CZNA 3R3JA 4BB0A 7MHTA 1EU1A 1GR1A 3DOHA 4XJTA 2P1RA 4MEAA 1QU3A 1NXOA 1X74A 2DHRA 1T35A 2IYWA 2PLAA 2YBEA 3PRHA 5LQNA 1QIFA 2EFJA 4TTTS 721PA 3KQSA 1VIMA 1VGQA 2JD2A 3V8MA 3NDBB 3L1KA 1XAGA 4Z6KA 4QOIA 4ZT3A 3GCGA 3S1SA 1E0JA 3MXOA 3RYCA 3T7RA 2FQYA 2DF8A 2XGOA 1M2HA 2HD4A 3WKEA 1C9JA 3ABZA 4MP3A 1SQ6A 2FEWB 4HS4A 5C52B 5ESWA 2O8FA 3PUXA 5EY5B 4EFDA 5DX1A 4ASUA 4YRPA 3WFIA 1YJCA 2VDQB 3FTPA 3TAHA 4A1OA 4F4UA 1TUIA 2QPTA 4PC2A 4CFYA 5D3QA 3RSFA 2YQZA 4W5TA 3KVNA 2QNRA 3L0SA 1FP7A 4PXYA 2E1RA 2L69A 1GYQA 1T1GA 2Q6VA 3CNQS 1H8ED 4F60A 4LNAA 3ILYA 2WWGA 4ESEA 4JBXA 4MDHA 3IPRA 4RY8A 4HTAA 4WUTA 2ST1A 4GPTA 2JK1A 4MGHA 1R4NB 3K1AA 4GE3A 2PMBA 4MDFA 1Q19A 2ZBFA 2P2YA 4LSMA 2FG5A 2WRZA 2PZGA 1XV5A 4LNUA 5ALYA 2QTHA 3MJEA 4D3DA 3OZTA 4X20A 1TEZA 2O7QA 1C5KA 1HFJA 2D1FA 3RK4A 1SG6A 2FW7A 4DB2A 1L7QA 3OZAA 4DSUA 5B30A 5HW0A 3MD9A 4KR9A 3JQGA 3NR2A 4TMWA 3F96A 3SIWA 4CF4A 2XUZA 2ODNA 1AU9A 4EGAA 4Y6RA 5TMEA 1MB4A 3H0EA 2WU8A 5AI4A 4IL5A 3DOIA 3E5NA 2Q1SA 1UPAA 2VBFA 2D2XA 3FPCA 4QM7A 1YVRA 1DQYA 3FMGA 3VOTA 5DBGA 4NZYA 1W1IA 4O8ZA 1FRZA 2XQIA 1SIUA 3EULA 4CEIA 3RUHA 4EJSB 1UJ5A 1AKYA 2EG5A 1M0WA 5CP8A 3CF2A 2FVYA 2I8LA 4J9VA 4BO5A 3PE3A 1VMDA 2PH3A 2OBYA 3OE7D 1RXUA 3HJUA 3QUTA 3F7MA 2CC2A 1GZ4A 4LV5B 1UPXA 1RQPA 2VDOB 4IIYA 1OOEA 2DHQA 5KJFA 4AVYA 1XKLA 1XXLA 2F62A 1F6WA 2OGWA 3KUUA 2J3IA 1GAWA 4HZUA 3TZHA 2DWUA 3MHPA 1G8FA 3UJPA 5C8DA 3Q3EA 1OHHD 1DKNA 2LR0A 2VSYA 4YXWD 4P93A 1SUIA 5EUBA 4Z4CA 1CEQA 3I0MA 2ZUFA 1RCUA 3HPRA 5CBPB 5G4LA 1U2SA 4PYKA 3RVRA 2XXBA 2RH5A 2GBGA 4BFZA 1FXWA 2B21A 2CLHB 3DXYA 1U7ZA 3ZVMA 4KN9S 5SZJA 1T4MA 3RC2A 2UZ4A 3MGAA 4X1OA 1OH8A 4P4TA 3L3BA 3M7IA 1YI8A 3EEYA 3EFOB 2QTGA 2QUKA 2VJCA 4ZCQA 3N2ZB 1N3YA 2VSXA 2J41A 3U7JA 4LZZA 4LEIA 1YQDA 5K0NA 1COWA 5A9TA 3LBIA 1O96B 1JAZA 1SBIA 3I58A 3KLBA 1H4VB 2XNKA 1W5SA 5CEJA 5CRIA 1P2VA 4IIUA 3VX4A 2WG0A 3CX7A 4O3MA 1HC7A 1X9HA 4PZZA 2K6GA 1LZKA 2VHEA 3PK0A 2HMYB 3CNOA 3FX2A 4LJ7A 2PSSA 1G7TA 4MUMA 1P9RA 1W4CA 3GJ3A 3NM4A 3RYIA 4QO7A 2EX1A 3KQHA 4PCAA 5C3UA 1NBWB 3ROPA 1GGHA 3Q7QA 1WCIB 2IQ5A 3KT8A 1VM6A 1ZN8A 4OQZA 4AX4A 1BDJA 2QG9A 4TV9B 5DE3A 4GKVA 5ALMA 2VQEB 2Q5HA 4GW3A 5CT9A 2OXTA 4MWCA 5GVSA 3EIWA 4MIEA 2QUIA 1ZQ9A 1GTSA 4ZYWA 1Y6FA 1OLOA 3COJA 4Q3KA 3G2OA 1U81A 5C5DA 2UXDB 3GP8A 1ML3A 2F00A 3BFKA 1WCV1 2PYDA 2BFCB 3W7BA 1QC5B 1VJTA 4NL4H 2VJBA 3VHQA 3ZZUA 3TIVA 3B1VA 3BPSA 4B7ZA 3ETGA 4C0JA 1PL6A 2NPFA 3GPBA 3REFA 4DAEA 1CFZA 2PPVA 1XDGA 2QI9C 3IBTA 3DB2A 4DMKA 4L28A 1T0UA 1UBNA 1GCOA 1Y80A 1N57A 2QVCA 3M6LA 5L6LB 3W5AA 4DR4B 2JGKA 4JVOA 2YWBA 3O95A 3TAUA 7REQA 1WSDA 4L5JA 1X8XA 121PA 3LUBA 2VSNA 3ZJYA 3WLQA 2IU4A 5C7LO 5KCZA 1FP2A 3N0RA 5HPYB 1N2CE 2XQVA 2OOKA 2YUTA 4OKSA 3SPXA 3W2EA 3THYB 4MMXB 1MR3F 4OXYA 4Q02A 2WWFA 4YCJA 3H84A 2WD9A 4S1PA 5EKUA 1K68A 4HDSA 4YRCA 1F0KA 3N2LA 3AGPA 4HO1X 2Q99A 4JI3B 1W5AA 5DYIA 5CA1B 4QA9A 1IEVA 3QTBA 3TLAA 3KBBA 4W63A 3P4XA 5JAUA 1M34B 1XTQA 4F12A 3B7GA 5TGTA 2RKBA 2I71A 4DG5A 3O3CA 4RCYA 4LDNA 5EUCA 1P4SA 3IT2A 1FUIA 2CFSA 1D6SA 2NZWA 3TTSA 3NH9A 4P3OA 2P6UA 3ED1A 1FFCA 4P81A 4TUYA 1SKUA 5FOXA 3ENKA 2XUGA 1BKYA 2XQGA 4MCHA 2QTZA 4J8PA 5GV8A 1UJ6A 3BWCA 1ECGA 3TXXA 1VA4A 3KVRA 4ND6A 2YRFA 4OIMA 2JHAA 1XJ5A 2FZWA 3NTVA 3QHQA 4P3YA 4YBZA 2GZMA 1G8PA 4K9KA 4XJXA 5DZSA 2N75A 1MRZA 4A0HA 5BV7A 3EZGA 1MPTA 2FPKA 3H04A 1HQCA 4OJKA 4OXIA 4A0FA 5CB4F 1P0MA 3W1EA 1UKBA 1DAHA 1RP7A 1I3NA 1Y3HA 2WZQA 3K1JA 1Z06A 5DSTA 1TK9A 2O2GA 4AJKA 1WXFA 4F92B 3AU8A 3VZBA 1RWMA 4EAQA 5DISB 2IEZA 3M6FA 3TKLA 3UQZA 1U2RA 1T3LA 3HUEA 4TZ0A 4F45A 2DPHA 5TQ0B 4QQ8A 2YYYA 5JISA 4KR6A 1GQFA 2FFAA 3QLTA 3WLFA 4CUJA 1PW5A 5LQJA 1D6JA 1K0UA 4BNVA 1LLFA 4F2HA 3MPOA 3IQXA 3TW6A 3OQVA 2O0KA 2PRKA 4CETA 2PANA 2V6JA 2ZU6A 1RM0A 3F49S 4DS3A 1NVXQ 3AFMA 5I4IA 1I4OA 2XDAA 4O2BB 1HLDA 5JNUA 2C5HA 3NDIA 3P9QA 1DRKA 4H1WA 1VCMA 3ZGNA 4F4JA 2NNWB 4LOKA 2BR5A 1EFKA 2HEGA 2V8BA 1U6IA 2ZRMA 2XV1A 4ITUA 1QLHA 2XT0A 1L0BA 3V8PA 1RPAA 3AEKB 3GJRA 4LYYA 5HHTA 4WACA 4MUNA 1Z0AA 4JJ7A 2NTVA 4RVSA 4TMXA 4Q9KA 4K6HA 2IHKA 5G3YA 4DPLA 2AZXA 2X3UA 1ZXBA 3OICA 2VC2B 5T4BA 4LV8B 2E85A 2P65A 4W5JA 1V96A 3T9FA 1E89A 1SCUA 2C42A 4HWKA 4MS1A 1U3WA 1W581 1P9LA 3UWDA 2IYAA 3C1OA 4MICA 1UC9A 2CJPA 3I1IA 2O20A 4LTMA 5BSGA 2G1AA 3Q8WA 3PL1A 4H1VA 4C4YA 5IDVA 1OXKB 4RAOA 4PC6A 2YJTD 1GZ6A 2XT6A 5FBKA 4CKCA 4PN7A 1SVOA 4KNYA 3EDOA 3R8XA 3I39X 4EUFA 4F4CA 4YUAA 1E1QA 2CFRA 4DV5B 1QE5A 1KJIA 2LDXA 5DNVA 1TPZA 2DJIA 5ECYA 1L9XA 4E11A 1R5BA 2IVZA 4YDRA 4DOMA 1G9TA 1RRCA 5FR1A 3GMIA 3OUUA 1ZEJA 4WKPA 4FYWA 2XJ4A 1PEKE 4ZP1A 5FWDA 1IUKA 3WNBA 3EC7A 1BXRA 4EYKA 4PONA 1T8TA 4C0SA 3UYLA 5AOVA 3PRKE 2EL7A 3OMLA 4INJA 4IZ6A 1THZA 2FN4A 3C43A 1GCUA 4S1OA 4Q9LA 5IBPA 3RSSA 4B3BA 1IZYA 3Q98A 1FJGB 3IP8A 4OK5A 4WNIA 4G8JA 4ZK6A 1AIPA 3H9CA 3FFWA 2VJKA 4ZQBA 4AZ0A 4TTAA 3QVJA 5BNZA 2J1LA 2CB0A 3BQNB 5H02A 3T9EA 4N82A 4CR6A 5C8ZA 4CKBA 2DETA 4WXRA 4FXOA 2PUJA 4TKMA 2PMDA 4JI1B 1A8HA 5JALA 1Q12A 2RHCA 3RB8A 2GBLA 3TOZA 1UR5A 4QDXA 4WBSA 4L78A 2GZRA 3HBNA 5DCWA 3WX0A 1JXQA 2QN1A 4ZVTA 1IZ8A 4P0QB 3GPIA 3P9KA 4Q18A 4J1TA 5BWNA 2ZT5A 1WHTA 1E20A 1NM5A 3ZBUA 1U0BB 1JEQA 4AP6A 2PBZA 1WCXA 2ZXUA 4CLRA 2VJAA 3D5EA 4XUDA 4C0AC 3UHJA 2PRZA 1HY3A 2DKNA 5DM60 3IHTA 2E18A 1DKLA 1IMOA 2I22A 3OPYB 1NVEA 2YJZA 2JVKA 4KQWA 4BS9A 4ZOAA 4HXGA 4TLLB 4XIIA 3PLRA 4AP9A 3OOSA 3A2LA 4HZIA 1BN7A 4NEGA 2PKQO 4PE5B 2OAQ1 3DM5A 3U60B 2ZSHA 1RHRA 4MDYA 3VKVA 3I61A 4YASA 2DC1A 4GLLA 2AWOA 2HTFA 2XHEA 1R1DA 1LDYA 3HDHA 4DADA 2H3HA 5BMVF 3ZE1B 1I2MA 4UAJA 3ZTWA 2GF2A 4EHJA 3DVLA 2H4ZA 1GFWA 2AN4A 3ICOA 4HDKB 4IHJB 5ILQA 4LF7B 1Q14A 1R0CA 2D3TA 4A6PA 3IIKA 5G0TA 5BO5A 1E5QA 1Q3KA 2ZANA 1XWWA 3NIFB 4MYCA 3P9CA 1WDMA 4PYQA 3TJZA 4ZT6A 4BMNA 4ZV4A 3E48A 3TTUA 1E9SA 3BRSA 3DV9A 4K6OA 3UTDA 4E5VA 5EYPB 2IOFK 2QW1A 3ME5A 2XB2A 1Q1EA 3UUFA 1M6VA 2JRCA 3A6FA 3QMWA 3GC6A 4QJ3A 3DVAB 3B6MA 1RPZA 4BEBA 1GZHB 1EP3B 4RK7A 3O9ZA 4UVEA 1ISMA 3EA5A 4RW0A 5AT1A 3ZK9A 3V1KA 3MCWA 3PXEA 3QX9A 3T5AA 1JN0A 1ULSA 4YAGA 4FNGA 3UVEA 3OA2A 1D1SA 2ZT8A 3KKQA 1WTCA 4RL4A 4PCUA 4TN5A 2VZEA 2C2ZA 2OCBA 3EGDA 3JQCA 3KR1A 4KUHA 2RGNC 5BNFA 3TE6A 1C3VA 4I9FA 2PUEA 3CX4A 4OJMX 3ZD8A 4LQCA 1J9EA 2IP2A 5A5GA 3TLYA 2HJSA 3RS2A 5J4KA 1JECA 1FFXB 1SVIA 1KRWA 3OWHA 1E8DA 1DIOB 3D3JA 2I4OA 4XFDA 5TE9A 1U7XA 5FX2A 3L7KA 5CDSA 5C1OA 4KREA 5JYBA 5LQCA 1JAHA 4F56A 2FP3A 4QPPA 1Z75A 2BEJA 4REMA 5EIEA 3FNFA 4Z4FA 4DL9A 2XUIA 4MJXA 1CQPA 3JVEA