4WEQA

Crystal structure of nadph-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with nadp and sulfate
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
316
structure length
316
Chain Sequence
KSPVIVDLKFIPEEVEAALAGAFPGREVIDLADPAHQERDLSGIDYAVVWKSAPDLFSRAPDLKVVFSGGAGVDHVLTLPGLPDVPLVRFVDRTLTTRMSEWVMMQCLLHLRQHRAYEALAKKHEWRDLSQPEAADVTVGIMGMGVLGQDAARKLAAMGFKVIGWSRSKRVIEGVETYDAAGLDAFLGRTDFLVGLLPLTPDTRGIFNAALFAKLSRNGPFGAPVFINAGRGGSQVEADILECLDSGVLGGASLDVFEREPLSPESRFWDMPNVYVTPHVAASSDVRALFVHVEHQIARFESGLPLEHVVDKVAGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent dehydrogenase
publication title Structural, Biochemical, and Evolutionary Characterizations of Glyoxylate/Hydroxypyruvate Reductases Show Their Division into Two Distinct Subfamilies.
pubmed doi rcsb
source organism Rhizobium meliloti
molecule tags Oxidoreductase
total genus 101
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.79: Glyoxylate reductase (NADP(+)).
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4weqA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4weqA01
3PIDA 3AI2A 4JBGA 3UXYA 3HE3A 4CM9A 4PGFA 5JNLA 1R16A 4CMBA 1NPTO 4LRSB 5JAZA 2YUTA 3AFMA 4NU5A 5DZSA 3SBOA 2FPGA 1RWBA 4NHEA 4BUCA 1PJBA 2DPGA 4BNVA 5LC1A 3IJRA 3C1OA 3JQGB 2UDPA 4J16A 4XYBA 4FJ2A 1PJ3A 3H3FA 4XDYA 3RFVA 4Q3BA 1HF3A 1Z7EA 4W99A 3DTYA 3H7AA 1WW8A 4R3WA 3I6QA 1BVRA 1C0KA 5JY6A 2P68A 1HSZA 2OMEA 4B3IA 5DOVA 4D42A 4CM8A 4K1LA 3B1FA 3SEFA 2J5QA 1CJCA 1EBUA 1JAXA 4YCAA 3OICA 2Q1WA 3TZ6A 1ENPA 4A10A 2HSDA 3PK0A 4PLWA 1PSDA 2X5KO 1BW9A 2IYPA 1ZFNA 3GPDG 3LYLA 4IJKA 4QX6A 3RJ5A 3VDRA 4RVHA 1J5PA 5BSEA 3INGA 2JCXA 5J23A 3ROKA 2V6BA 4IBOA 1JKIA 1OC2A 1CWUA 3KXDA 3DBHA 1QYVA 2W98A 4NK4A 5A06A 4YT2A 2JAHA 4IQ8A 4J1NA 4ALLA 1C0IA 4OH1A 4EUHA 3ZWBA 4BV8A 3H4VA 3NX4A 4WE3A 1SC6A 1JQBA 1NXQA 3JTMA 2D59A 3WJAA 3GDOA 3ADPA 1DXYA 8LDHA 4RLSA 3OIDA 3AOGA 3PDUA 1WMAA 3FNHA 4LN1A 1PGOA 4R4JA 1FDVA 4K6CA 1W4ZA 2YZ7A 4J49A 4F6CA 3JV7A 4FSHA 5CHEA 1UXGA 4Q3CA 1G6KA 5HWSA 3UAGA 2PKQP 4HUJA 2GZ2A 1XG5A 5C37A 5GZ3A 1GEEA 2P4HX 3GEGA 1UJMA 1W0CA 5CPFA 5ES3A 3INRA 4OM8A 1U3VA 5AYVA 2VNAA 1A71A 4E3ZA 4PZEA 4QEDA 3STHA 4CMGA 2ZB4A 3VHRA 2GO1A 3ZU5A 3RU9A 4II2A 5C7LO 3RI3A 4CJXA 1HWYA 4BGVA 2QZ9A 2AXQA 1T2EA 5F3RA 2WDZA 4CV0A 3QW2A 1C1DA 1YVEI 3GAZA 2YW9A 4XGKA 4I5DA 1UXKA 1DIRA 4BV9A 3AJRA 5JDIA 1ZSVA 4PG4A 4M86A 2Y1GA 3MJEA 2OGUA 1PGQA 3C1TA 4RO0A 5COAA 1LSSA 3H9JA 4P38A 4DYVA 4RV9A 3RU7A 4ZQGA 3L4SO 4OMUA 3TOZA 4EJMA 5BNTA 3NRCA 3VOSA 4TVBA 4ZRNA 3RC9A 4CM6A 5DP1A 3AU8A 3RC7A 4IMPA 3CXRA 3OFSA 2FR0A 2GLXA 1SCUA 2X0NA 4I5EA 3KO8A 5L4LA 5LDHA 2YV2A 3EVTA 2A92A 3V1TC 3LZ6A 4IDAA 4YTEA 4OYRA 4JK3A 4G81A 3QWFA 2PWZA 4B7CA 4HV4A 4QO8A 1WXDA 1GDHA 3NT4A 5K9ZA 1ZKMA 3JQEA 4Q3AA 2AMFA 5TF4A 1MFZA 1V0JA 2WWRA 5A9TA 4QSMA 3U4CA 4RQUA 3EDMA 1E6UA 3UN1A 4JROA 1GZ6A 3DHEA 3F5QA 1I0ZA 1PR9A 1ZH8A 4RL6A 2X9VA 4XEHA 2Z95A 3VH3A 4XB1A 5DBGA 1NQTA 4IDCA 4TROA 3KSDO 3GPIA 3DAGA 3H5RA 2P5UA 2CF5A 1E3WA 2WYUA 4J2HA 4PFJA 1ML3A 1N92A 1E1NA 3TZHA 1BGVA 2WM3A 4IQ0A 4BQRA 3AM4A 1K0UA 3ZWAA 1XKQA 2IDZA 2ZCUA 5DP2A 1SOVA 2NADA 2C59A 4E2WA 2BF7A 1I36A 1VJ1A 5COQA 5T6BA 4LVUA 3ZW9A 5JW6A 2C20A 2R00C 2AQ8A 1HLDA 1BG6A 4QFCA 1DRUA 4JX8A 1NHGA 4E31A 3FHLA 5TGDA 3AUTA 4EYEA 1CRWG 1QMGA 2B4RO 1MX3A 4UEOA 4A7PA 5C3MA 5IZ4A 2YDYA 5MDHA 5TLSA 3MTGA 1T2AA 1P1KA 4FFMA 3HDYA 5IZCC 1GPJA 3SX2A 4CODB 3MZ0A 3LC7O 4GVXA 1O6ZA 1PJQA 2GASA 4JQCA 4LK3A 2I65A 3PTZA 4D46A 3ZN2A 1WZEA 5L53A 3LT4A 4IJVA 4O6VA 2FR1A 5ENVA 3AUUA 1DPGA 3DBLB 4OAQA 5BSHA 1Z75A 5BNIA 4YJGA 2DUWA 3KLMX 4NJMA 4RZIA 4XGIA 2FRDA 3ZWWA 3WLFA 2FPPA 1XDWA 4A0SA 4D7AA 2ZYGA 3WDSA 5T8KC 1B7GO 2CDBA 1E0DA 5JMWA 3LT2A 2ZTLA 1H9AA 1OMOA 1UAYA 3OJEA 4UVIA 3DXFA 2PTGA 3GGPA 1E3SA 1DB3A 3H9EO 3JYNA 5A4DA 4CLOA 3OQ1A 3ZWYA 1E3JA 1GCOA 4BNKA 1WVGA 1PTJA 1KVUA 4PG6A 4DBVO 1A72A 3OECA 1E77A 3L6DA 1PWXA 5JO0A 1UZNA 3DBRB 1MC4A 3A14A 2H5LA 1X14A 2LDBA 3HDQA 1HDOA 2VN8A 2B35A 5JCJA 1H9BA 2OP0A 1LEHA 4BNIA 1U5AA 3E82A 3K6JA 2P4QA 1E5QA 4TRRA 3IKTA 1ZNQO 2B4TO 5TJHA 1AXGA 2FMUA 1CEQA 2C2YA 2BGKA 3KTDA 5H83A 2IE0A 3VZRA 4TRMA 1LDYA 3WIEA 4AJIA 3IUPA 3C24A 3TFQA 1T2CA 3VVBA 2WE7A 1IZ0A 2H63A 3PWSA 3SVTA 1DHRA 4DQUA 4BGIA 4DIFA 1IZ9A 1U3UA 2DBZA 3K96A 2OORA 4K26A 2YHIB 2PKRA 4ID9A 5KWEA 4DYDA 3OH8A 4PG8A 3M2PA 1S6YA 3GGGA 2GYYA 1ADCA 2NACA 5EPOA 4CQMA 5JY1A 5TSDA 1BXZA 4CMIA 1H6AA 1KEVA 2VCYA 4RORA 3GDGA 5B4TA 1HZJA 1OC4A 3ZZNA 4J6FA 1P45A 3WB9A 4BKPA 1A9ZA 3D4PA 2FZEA 2GN9A 2ZJ1A 4RLHA 1YONA 4DMLA 1MUUA 1N9GB 1GQQA 1B0AA 1V6AA 4N54A 1U2DA 1Z73A 1RM3A 4FW8A 5EMHA 3KRTA 3NT2A 2G76A 3DZGA 1BRMA 1V35A 3QVXA 2DQ4A 3WGIA 1YBVA 3ZHBA 5JC1A 1QP8A 2OUIA 2O3QA 1K89A 2X58A 2QIOA 1R15A 1JKJA 2VOJA 3R3JA 1R0SA 4MKXA 1PEDA 3Q1LA 1PQWA 1TI7A 2YV1A 4UEJA 2CF6A 1NR1A 4D41A 5TRTA 1HDYA 3WGHA 2Y0CA 5IDQA 1UDAA 3SJ7A 4GX5A 1X13A 5FI3A 3VKVA 5C5IA 3TNLA 3BIOA 4MIEA 3ENNA 1QYXA 3JQ7A 3P5SA 3WYCA 2F1KA 3LT1A 5ER6A 5IXYA 1Q7BA 2DFDA 4P4NA 3UF0A 2NLOA 3OJ0A 5TJ9A 1VL0A 2JAPA 3MCVA 2XXBA 1UH5A 2RH8A 3V8BA 5JBIA 3HDJA 2JL1A 1SMKA 2VHZA 4HNGA 1YGYA 3OEWA 3F1LA 5AXAA 2VRCD 1XIVA 4D0RA 2DUUA 2VWQA 5AQ1A 1P44A 4CQLA 3GN1A 2H9IA 4A03A 5ICSA 3WOHA 1YH3A 1B15A 1EE9A 5CP8A 3JQFC 3L9WA 1U28A 4KUHA 3BMOB 5G4KB 5KNLA 5LCXA 2VYND 4MVJH 3ZH2A 3U3XA 1B2LA 4KQXA 4GPD1 3ZWNA 2HMUA 3O9ZA 5T64A 1BVUA 4BVAA 3IP3A 5DCYA 1O95A 3RWBA 2VQ3A 1VPDA 4ESOA 4WLNA 4IXTA 4E4YA 1HTBA 2DPHA 3FTPA 4P22A 2J3KA 3L9XA 1A7AA 1PZFA 4P4LA 4NBWA 2CZCA 2QQ5A 1E3IA 2E48A 2HKIA 3VTZA 3WICA 4CUJA 2ZB8A 1E7SA 2O3UA 3DOJA 1PS9A 3VH2A 3I5MA 3CUKA 3RD5A 1NAIA 3JQGA 4UUPA 1ULSA 4TKMA 3JD3A 1Y7TA 2I99A 3ZU3A 3ULKA 5CG2A 4BO3A 1Y1PA 3E8XA 3AWDA 1DC3A 3PHIA 1SPXA 1H2BA 2IRWA 4CLRB 1E1LA 3D3EA 4YRAA 1T4BA 4LMPA 2B37A 3OIGA 3HB5X 1YE3A 5A03A 4YAEA 1E7MA 5G0UA 3E9MA 1HDXA 3WJ7A 3M1LA 4W9NC 1ISGA 5A9RA 3I9NA 3WMXA 1PL7A 3OBBA 4CM3A 4QTZA 3CIFA 4JGBA 7ADHA 4JCOA 1OAAA 1LI4A 1HYGA 2F00A 1K2WA 5L45A 3TFOA 5IXSA 3KUXA 1FK8A 1N2SA 4BO2A 3GAFA 1RPNA 4I5GA 4R9SA 4GX0A 4TSKA 1MC5A 1BDBA 5CDTA 4CMEA 4QXMA 2HDHA 1UR5A 3DZJA 1RYDA 3RUAA 1S7CA 5CDYA 1PJTA 1ADFA 1IHYA 1DC6A 1N7HA 3BMQB 3KSUA 3U9LA 4MO2A 4J3FA 4N5MA 4OSPA 1PL6A 2J3HA 1L1FA 3R0IA 3G79A 2UUPA 3TL3A 1EVIA 3E03A 4BO7A 1K6XA 1B14A 2SCUA 5A9SB 2WYVA 4YQYA 1EEHA 4CM5A 1PR3A 3HJAA 2A4KA 4PRKA 4QO7A 1YO6A 2IZ1A 1EE2A 2Q2WA 2VTDA 3B6ZA 2HJRA 2HK8A 3ANLA 4J4BA 1WP4A 4J1TA 3K8ZA 4MPDA 2OHXA 1PJCA 2RHRA 4BNYA 3EHEA 1ZBQA 4KZPA 3JCZA 2I5PO 3S8MA 4N7RA 4BIIA 4K6FA 4J9UE 1M66A 3D4OA 3PYXA 1KVTA 2E82A 4R3NA 3CEAA 4WJZA 4L0QA 3GG2A 4N5LA 1IPFA 1WMBA 4BQPA 1NWHA 2X86A 2A35A 1VJ0A 4FB5A 6ADHA 3U62A 5ENDA 4L76A 1A7KA 2Y66A 4GGOA 4E5KA 1T4DA 3K2EA 4YACA 4ZQHA 4XJTA 4IPTA 1GV1A 2C5AA 1BWSA 2CVOA 3ASUA 3RBZA 4U5QA 2CY0A 1F8GA 2IZ0A 1D1TA 2P5YA 5KCZA 4FJ1A 3JQ8A 2Q50A 4MKRA 3RQSA 1NR7A 3TDKA 3WFIA 5B37A 1PJLA 2CDCA 1GD1O 1GCUA 2HCTA 4RPLA 3HZZA 4UVEA 3OQBA 4YB8A 2W4QA 1FDUA 3EC7A 4KTTE 1NQOA 2IYOA 3AI1A 3ZV3A 4L74A 1KS9A 4XR4A 3PFFA 4GX1A 4E32A 1HE5A 5BR7A 2RCYA 3I9LA 3S55A 1YJQA 3L4BA 1EDZA 2YHUA 1KEPA 1UP6A 3PJFA 4Q9NA 3UVEA 3BTSA 3Q2IA 4P8RA 4PLFA 5JO9A 4HFJA 3V2UA 2QRKA 3HHPA 4CMJA 5K0ZA 2HUNA 5GMOA 4ILKA 3BA1A 5CEEA 1ZZEA 4ROSA 2WTBA 3VKUA 2EF1A 4ITUA 2EEZA 1JLLA 4NFYA 1BDMA 3CE6A 3FRJA 3IOYA 4CR7A 1OZAA 4IGFA 1I2BA 4HX5A 3DB2A 2ZQZA 4AICA 4NK5A 1C0PA 1NHWA 2PZJA 1XLTA 4GWKA 1HE2A 3JD4A 4GWGA 3N74A 3WGZA 2CD9A 2PFGA 5U4QA 4M54A 1D1SA 4HFNA 2QYSA 4ALNA 3O8QB 1TB4A 3W8FA 4AJJA 2B5VA 4C7KA 4CLEA 1PS0A 4GAEA 3NDJA 4RVUA 1EQUA 3RUFA 1B26A 4XYGA 3P2OA 3DBLA 4E13A 4TZKA 4BNXA 1H94A 3RFTA 4TVOA 2PGLA 4GLOA 4D3DA 1ZK3A 3VAZA 2Y05A 3NKLA 5CG1A 5KVQA 2RHCA 4XRRA 4TQGA 2V6MA 4FR5A 4O0LA 1P9LA 3ONDA 5JFOA 1N5DA 2O4UX 4FPXA 4DPLA 1K3TA 3VTFA 4YRBA 1J49A 2BI8A 3HQ4O 4D45A 1P1IA 4WCFC 1U4OA 3ZV4A 1OFGA 1Y9AA 3JYOA 3RVDA 4EITA 2YYYA 2G82A 1O8CA 1A27A 2OP1A 3BYZA 4DBZA 1K6IA 1XU9A 1ZSNA 1GQYA 3MJVA 3Q9UA 4YJFB 3DWFA 3W6UA 5A3VA 1IHXA 3DBRA 5IFLA 3DBVO 1WNTA 2D0IA 4RPJA 2HMWA 3GT0A 3GEDA 4YBZA 3JQAB 5K6AA 4AJEA 1GAEO 2NVUB 1LBEA 1M6HA 3HNPA 4M55A 2W2LA 5T67A 4IM7A 4CR6A 4MINA 4RVSA 3AOEA 2J5KA 1N1EA 2GRAA 3LC1O 3QJ5A 3KZVA 3PFWO 1ENOA 4YT5A 3L07A 4I8XA 2GDZA 3WNVA 4WLEA 4BNJA 4CM9D 2B69A 1QRRA 4ZQBA 3H9GA 2WYWA 4DIOA 2J3JA 2NU8A 3ICCA 5EQDA 4OL9A 2BFMA 4OXNA 2C82A 4BOYA 4ZQFA 2Q45A 4WPGA 2IXBA 3PQEA 3GOHA 4HP8A 5HRUA 1DIGA 2X6TA 4XKJA 2E6UX 3E5MA 4YR9A 4LW8A 3KBOA 1I32A 1O0SA 3GVPA 4BKOA 1PWZA 4JP3A 4UVGA 3CZRA 5JYEA 3D3WB 1F12A 1DIAA 3FSRA 1ZCJA 3PHLA 1M6WA 1P31A 3NGXA 2VUUA 2E37A 4M49A 1PZEA 2C54A 5IF3A 3UICA 3EW7A 2X4GA 3F1KA 1M76A 3I3OA 3DAFA 4NBRA 2YFQA 1BXKA 1LSUA 3GVHA 3EUWA 5JMPA 1KC1A 3UFXA 5B4UA 1U7HA 1E7YA 4XR9A 3RBXA 3F47A 3F3SA 4L8VA 1LC0A 3GLQA 2W8ZA 3CSDA 2PZKA 3MEQA 3EMKA 1EUDA 3P7MA 3PLNA 4H15A 1NM5A 2DKNA 4KWHA 3W8EA 3WQQA 3DZFA 5JXWA 2OBNA 2JJYA 4XQEA 3H2SA 4DPMA 2UUOA 1CDOA 3LK7A 3KYCB 1ISHA 1R4MB 3MJTA 4BKRA 1G0OA 5JDIC 1U2GA 3CINA 2Y0DA 1MFPA 5DNAA 1DAPA 1NBOA 4OOFA 3W4JA 1AXEA 2UV8A 3MTJA 5FYDA 1YB4A 2WMDA 1XELA 4ND3A 5IN4A 4ONEA 3IL2A 3Q9NA 4JP2A 2EJWA 3QLJA 2X9NA 5JDCC 3FCOA 3BMNB 4FOSA 3BMOA 5G4KA 4GGPA 1H6BA 4PVDA 2DT5A 4M1QA 3D5QA 3OHSX 2WD8A 4EGFA 5AXCA 1NYTA 2X5JO 4KUGA 3HB4X 4GBJA 1T1SA 3U0BA 3I9KA 1OBFO 1TVEA 3ONFA 2V6GA 4XCVA 4NIMA 4A27A 3JYQA 4Z0TA 3ZHYA 1T25A 2Q49A 3DMTA 1Z82A 3BHJA 4MVJM 4EUEA 4I08A 3ZV6A 3F6YA 1NNUA 5H82A 2X0JA 1D4FA 4J7XA 5U1PA 3H5NA 2BGLA 1QV7A 3VZSA 2O23A 3AUAA 5ITVA 3WR5A 2Y67A 4I1IA 2DBRA 2GUGA 3WGYA 3DHYA 3WSWA 3V1YA 3O38A 5AOVA 3WGOA 1YQXA 4Q39A 5G2OA 4GKBA 4IGEA 1WDKA 1OI7A 1VJTA 2V6FA 3JYLA 4Q3NA 3S1LA 3ZNPA 5GY7A 4IZIA 4CLRA 1XGKA 4WGGA 1ZK1A 2GZ3A 2VT3A 2EGGA 1ID1A 3OEYA 2IEBA 3IKVA 1FF9A 1MXHA 4RZHA 1U5CA 1QLJA 1XR3A 3GMDA 5JYDA 4R69A 3IUSA 5TX7A 4WK6A 4CL8A 2HMTA 2NUAA 3CMCO 1J6UA 3GVCA 4E0BA 4Z9FA 2AG8A 1Z7BA 5JC8A 4S1VA 1WDMA 5B1YA 2VNSA 5BSGA 5G4LA 3GG9A 4YAGA 2JCVA 1FDTA 1RYEA 3FWNA 4NBTA 1XA0A 2NVWA 1Z45A 1UUFA 4ZD6A 4Y67A 2A94A 3K73O 3PZBA 2JHFA 1EDOA 4MVJG 4PZDA 4W4TA 5U9CA 1LRLA 4Z9YA 4DREA 5HM8A 3BMQA 1G0NA 1XYGA 4FFNA 1XU7A 4YPOA 4Y8VA 3ROPA 1P1FA 2X0RA 4BNTA 5H81A 2EIHA 2B36A 4B4VA 1N8KA 4BO6A 4MP3A 2Q46A 3OP4A 5A9SA 3UUWA 1W6UA 1T2DA 4DQVA 2PH3A 1FJHA 1O94A 2DFVA 4LSWA 3ZHZA 2FN7A 1GL3A 1YQGA 1ENYA 1LU9A 4I9NA 3GK3A 3KM0A 3ETDA 1FXSA 3BHMA 3E1KA 3IIEA 1WDLA 3H3JA 4Y98A 3QY9A 3ANMA 4HNHA 1D8AA 2PD3A 1LSJA 5L3ZA 3QVOA 4TRJA 2X22A 3TZQA 4OO3A 1YJ8A 1HSOA 1HE4A 3B1KA 3JQBA 5FEUA 5BT9A 1CF2O 2QG4A 3GN2A 3ROQA 3KOUA 1CIVA 4RDIA 1Y8RB 3I1JA 4FD3A 1YL6A 4DLAA 1A9YA 3ZWMA 2G0TA 4ZN6A 5FWNA 3FR7A 3PQFA 2HJSA 4W6ZA 3ETEA 2FWMX 2NU7A 1NFRA 3JSAA 1GZ3A 2W2KB 4II3A 3F46A 4FFRA 4PLPA 4IY1A 4RJTA 1D3AA 3KYDB 5KOIA 4XQCA 4NBVA 2D3TA 2ZTUA 4XJSA 3SLKA 3SC6A 4AVYA 4CM4A 5IAAA 2NVBA 2CVZA 5I9LA 3O4RA 3PHGA 5JCJD 1ZXLA 3DR3A 1HYEA 1TLTA 3FPLA 1LRJA 2XXJA 4M8SA 4J0FA 1X7GA 4DRYA 1DRVA 4CLHA 2AQIA 5ADHA 1H6DA 3BHIA 4BNUA 3R1IA 3MWDB 1Q0LA 2VHVA 3GRPA 5DDIP 3GFBA 2FR8A 4O1MA 2EKLA 5L95A 2O3TA 4PLVA 1E7WA 3Q6IA 4MVJA 1R66A 2OFPA 5T8KA 5THQA 4CMKA 1NFQA 4NG5A 2TMGA 4OXYA 3DZKA 5CFZA 1PZHA 1UZLA 4ZQEA 5KVVA 4XD2A 4AFNA 4PLGA 3FNEA 4WCFB 4WEOA 3FNGA 5BQFA 1UDBA 2EERA 2PD4A 1DHTA 3VVCA 3LC2O 1I2ZA 5EIOA 4YDRA 1QYWA 4J90A 5EJ2A 2BD0A 4DIBA 1HDGO 2D4AA 3G0OA 2JFFA 4XIJA 4QECA 5JAQA 3L6EA 1KY5A 3I6IA 4DLLA 5DBIA 1F14A 1LTHR 3O26A 4JN6B 4BS9A 1F8FA 4KOAA 1ZJZA 2Y1DA 4BNMA 1E6EA 3INTA 4BB6A 3VPSA 4R51A 4BO0A 2CVQA 2XAAA 2GD1O 5JAMA 1B8UA 4MVJI 3DC2A 4CM8B 3FBTA 1AN9A 4E6PA 3RUEA 3OETA 4IUYA 1HLPA 2I67A 4DLBA 5KJEA 2VWGA 3LT0A 2I9PA 3PHHA 3C1AA 4HFRA 2PZLA 3GVIA 3Q0EA 3ZHXA 2DVMA 2Q1SA 4BB5A 1W73A 1V3VA 1Y5RA 1BHSA 1JA9A 3MOGA 5AXDA 1J0XO 3ZW8A 3SC4A 2EV9A 2VWHA 4IDBA 1KVQA 4DTIA 4YJFA 1NVTA 2RAFA 3I23A 2HQ1A 1VSUA 4XQ9A 4MVJE 1B8VA 5KJCA 3VPGA 4GL4A 1D7OA 1Q7GA 2QX7A 2BFAA 3JQAA 1ONPA 2E49A 3W6ZA 4CV1A 3ANNA 1DFIA 4L4RA 2NVUA 5I7FA 1H2HA 1N7GA 2GPTA 2QW8A 5DCUA 4WOKA 4R1UA 2DC1A 2VYVA 1DJNA 4FGSA 3QE3A 4N5NA 3I52A 4UUNA 1PZGA 3ETGA 3SXPA 2UYYA 3JD1A 1TA4A 3AM5A 3PVZA 4NQZA 4NR0A 4J7CA 1R37A 4B3JA 1KBZA 1LJ8A 1AUPA 4PRLA 1KEUA 4TKLA 5THKA 3EZYA 1DJQA 4CMAA 2O50A 3KETA 5L4NA 5ITWA 1ORRA 4LCJA 4D3SA 3BAZA 4NH4A 4Z0HO 2FHSA 3MWEB 4CUZA 5KVCA 3ZU2A 4W7HA 4FQ8A 2J5RA 2AE2A 4CMEC 3D3WA 1MLDA 3WLEA 2VHYA 2Z1MA 1U8FO 4P4GA 5KJ6A 1EVZA 3C85A 5EL0A 2YDXA 4H3VA 3RKUA 1ZJYA 4B4OA 4K9DA 4IS2A 5L40A 4OJNA 2HK7A 3U09A 5L7TA 1ZO8A 1A4UA 3DOCA 1HZZA 1ISMA 1LC3A 1PQUA 4IIUA 4RVGA 4EJ0A 3HWRA 1ENZA 1PGNA 2DU8A 4UVHA 1G1AA 1Y9EA 4GLLA 5MGBA 2BFPA 2FSSA 5A04A 3OF2A 2NU9A 4PIVA 1P33A 3TZCA 1ZMTA 3PYLA 1HEUA 4FBGA 4ALKA 2OOSA 4IDDA 4R68A 3OJLA 3PWZA 4RVFA 3U5TA 1ZMOA 4RDHA 2NV6A 4ZA2A 2BGMA 2VT2A 2VWPA 5DULA 3RJ9A 4EUFA 1R4MA 4XX0A 3G3EA 5ER9A 1VC2A 1R4NB 3JQ9C 3ASVA 1V3UA 3RAJA 3PGJA 3QWHA 1X0VA 4XDZA 4XGNA 1DDOA 2ZTVA 1JWBB 4U7WA 3OA2A 2O2YA 1E5LA 1Q0HA 2O48X 2OL4A 3X2FA 1C0LA 3UHAA 5CAEA 4RPKA 1MA0A 1DIBA 4OSOA 2POQX 4IDFA 2Y68A 3NAQA 4RCVA 1NASA 4WLUA 3BMNA 2O3SA 1EUCA 4IJWA 3LLSA 2CSUA 4JNKA 4NU6A 1LXCA 2CMDA 2YY7A 4J4HA 3GHYA 1V9LA 1SO8A 5I7EA 1ZEJA 3LU1A 1EFLA 3UCFA 3C8MA 1E92A 1FDSA 5FFFA 1AHHA 2Q4BA 3N7UA 3WYBA 1EQ2A 4J91A 4ZGWA 3KV3O 5EESA 2AG5A 5L7WA 2ZTMA 2G1UA 4B7XA 2PH5A 4XRGA 4H16A 4NDNE 3I9OA 1SBYA 3L4BC 3ZDFA 4Z0PA 3FD8A 3FR8A 4ZHSA 1XQ6A 2EW8A 3TWOA 3K5PA 4J0EA 2FP4A 5JE8A 5T57A 1WZIA 4Z3KA 3I9MA 5F1PA 5A1TA 1FDWA 4RQTA 2I3GA 2Y1FA 3GVXA 2DBQA 5FI5A 1NQ5A 3PP8A 4LISA 4IINA 2Y99A 1HRDA 3WWYA 3UKOA 1JWAB 3TF5A 2D1YA 3UW3A 1GV0A 1UDCA 2Y1OA 4DA9A 4HADA 4LGVA 3UCXA 4PLZA 3B20A 4BO4A 4MOWA 4F45A 3AY3A 4A2CA 4CMHA 3AM3A 4JBIA 1EMDA 4OXKA 4WCDA 2EXXA 2OO5A 3W4KA 1KY4A 1VKOA 3LF1A 4GMGA 4OHUA 4CLDA 1QXSA 5F1KA 4B8ZA 4YEDA 4INAA 2JCYA 1KEWA 4BGEA 4AJ2A 4PLTA 1E1KA 2Z1NA 2ZCVA 5DCWA 4U6SA 5JPIA 4DPKA 1LQUA 2C0CA 3FI9A 1P0CA 5JCXA 4OKNA 4BMSA 4BNGA 4LRTB 4D43A 1ARZA 2ZYDA 3FF4A 2RIRA 4I5FA 3COSA 4GSKA 1HE3A 1EVJA 2WSBA 4KDFA 1YDEA 4GKVA 5AXBA 2CNBA 3EY4A 1I8TA 2VOEA 2D5AA 1PJ2A 1TT5B 4S3MA 1XSEA 1GY8A 2BHLA 1RM5A 4L9RA 4UEKA 5I8WA 4KTVE 4J2OA 3PIIA 1HETA 3QA9A 5G0SA 3RROA 5KKCA 1XQ1A 2CDAA 3D64A 3MJSA 2ZB7A 5T5QA 5TNXA 4Q3DA 2DM6A 4BMNA 4CMIB 1ZVMA 1J4AA 2EKQA 4B3HA 1KVRA 1MB4A 2BRUA 1ZW1A 2UVDA 1VE9A 3ICPA 3V2GA 3ITDA 4AL4A 2VZ8A 4BNHA 4WNCA 1V3TA 1B3BA 4IQGA 4JJIA 2ZQYA 1EVYA 2NTJA 1Y8RA 3IAHA 4WKGA 1HL3A 1QKIA 2C5EA 2QHXA 4OGWA 4PG5A 4Y6RA 5CDUA 1XEAA 1WLYA 4IDGA 5A5EA 1AHIA 1C1XB 1ZUD1 3HSKA 1EBFA 4TZTA 4XZ3A 3PWKA 3QWIA 3SLGA 9LDBA 3G17A 2EW2A 3GR6A 4IDEA 1HXHA 3QSGA 1NTOA 3KYDA 4R01A 4A26A 5G0WA 4YJHB 1C3VA 4PLYA 1EUZA 1IB6A 1YBMA 2ZJ0A 1IUKA 4D44A 2HMSA 1ADGA 1VL6A 3VPFA 2W2LD 3RKRA 1MG5A 1IOLA 4JLWA 4L4SA 2DLDA 5KJ1A 1I01A 6LDHA 3H6KA 2J3IA 2O2SA 1ONOA 2GNAA 5HS6A 3AK4A 3IQDB 3ORFA 3ZGYA 2ZK7A 3NTRA 4EZBA 1PJ4A 1PGJA 3IJPA 4Y6PA 3EK2A 1JVBA 4G65A 3LQFA 2NQ8A 4ND5A 4R41A 1Y8QB 3WBFA 4EEXA 3UCEA 4OOEA 1P1JA 2YHIA 4FIZA 4WCFA 1H93A 4Q3EA 3H8VA 3H9QA 4GMFA 2HRZA 1PJSA 1QYDA 4OIMA 3VDQA 1HKUA 2EHDA 1BMDA 3F5SA 4YT8A 1YB5A 4JBHA 4G5HA 3S2IA 2B83A 4NJOA 4U0KA 1T26A 3QRWA 4IS3A 4QUKA 4Y6SA 7MDHA 3QIVA 1YXMA 5I9MA 1YBAA 2PGJA 5TQVA 4E5MA 3FPCA 1N9GA 4YAIA 4Z6KA 2O4CA 3VC7A 4BMVA 5JS6A 2X7HA 1WPQA 1YOVB 3EAGA 2FZWA 3WS7A 1VSVA 1GFSA 2VUSA 3PJGA 2YFHA 1LLDA 1F06A 2XF8A 1GQ2A 4F6LA 3GY0A 5JSFA 3JD0A 1P77A 4J1SA 3VPXA 1PQPA 1Y81A 3F4LA 2FPIA 3FNFA 3U49A 4WLOA 2DBVO 1GPDG 1I2CA 4ZU3A 4L4XA 4RPGA 4FFLA 3WNQA 2G5CA 4NNJA 4TMFA 1NWCA 2B0JA 3C7AA 4O63O 3DFUA 4J9VA 3NT5A 4JJGA 4GX2A 2C7GA 4W82A 1L7DA 1E7QA 3OIFA 4OQZA 3FTNA 3ZNNA 3RUDA 3QWAA 1BXGB 1ZK2A 2AA3A 2HRBA 3WYEA 4KUEA 2BKAA 4YVFA 1KETA 1YL7A 4IMRA 2JHGA 3DMTC 3WGGA 1LDBA 1O89A 3PJEA 3GFGA 3U4DA 2D2IA 1DBVO 3BXXA 4YJDA 1SZJG 1SAYA 3A06A 3FBGA 3GNSA 3NGLA 3G49A 4J7UA 4WASA 1P3DA 2YQ5A 2IEDA 5CDGA 4RF4A 4M87A 4YAJA 3DL2A 1Z6ZA 1ZSYA 5KKAA 1ZK4A 5COBA 4MVJF 3O03A 1KERA 1VL8A 3JD2A 3BTOA 4HBGA 5IDXA 1YQDA 1JTVA 1LLQA 3GMSA 1X1TA 3H2ZA 3PHJA 4G2NA 4U0JA 1I3KA 3KB6A 5F21A 2X5OA 1CYDA 4AJ4A 1GADO 3CMMA 1UXJA 2X9GA 4GQAA 2VHWA 2GSDA 3PQDA 4UVDA 1O9BA 3IS3A 5B12A 4CL3A 3D7LA 4BL5A 3DFZA 4UREA 4XYLA 2P9GA 2Y1CA 4MJLA 1GR0A 1IULA 2BH9A 1GYRA 3PJDA 3KYBA 3TSCA 4PVCA 1F17A 2I6TA 3K31A 4CV2A 1KC3A 1HDZA 4RVDA 4BNLA 3E18A 3S2EA 3L6OO 2X0IA 3BTUA 4R54A 3RBVA 2CFCA 1BSVA 3ZWCA 2ZYAA 1MP0A 2NTNA 1H6CA 4DL9A 1IY8A 1FMCA 4C4OA 3K92A 4XIYA 5JDCA 5DBFA 4UUOA 2EKPA 4B4UA 4ALJA 1DO8A 1GU7A 3WBBA 1LA2A 3JQCA 3S2FA 4D0SA 1UZMA 1PGPA 1EZ4A 1ZIDA 1DIHA 1SEPA 3JQ8B 3NDRA 2HLPA 1JW9B 2VUTA 1H5QA 3DEYX 1I3MA 5AVOA 1NPYA 4Z3DA 1Z74A 3QVSA 3P2YA 2VRBA 1UXIA 4A73A 1LRKA 2WD7B 1B16A 4E12A 2AEMA 3ZWVA 1NP3A 1GUZA 3KLPX 4LSMA 4URFA 3VZPA 1HYHA 1I30A 2C07A 3I9JA 2Q2QA 4YYZA 3MJCA 3U4IA 1R6DA 1Y5MA 3C7CB 3E6AA 4B7UA 5B4VA 3A1NA 1R4NA 1PX0A 5BSFA 1PL8A 2JFGA 3JQBC 3HFSA 2HMVA 2G17A 3TZKA 4ALMA 1M2WA 3GDFA 3DAPA 3WQRA 1Q0QA 1IYZA 4DC1A 2B4QA 4PCVA 5GZ6A 4LMRA 5I7VA 1GEGA 3OJOA 3RC1A 4EW6A 1LDNA 2DTDA 1HDCA 2ZB3A 2DTEA 4R9RA 3RUIA 3CZMA 4ALIA 4IJUA 2NQTA 2D8AA 4NZ9A 2Z5LA 3DZBA 4M89A 1IPEA 1DC4A 5A02A 3B70A 5A5FA 4B4WA 3GZNB 2E4AA 1JN0A 3L77A 2Q1TA 5EQFA 4F46A 3PDJA 4I9UA 3OA0A 3H65A 4MP8A 4O5OA 4BGUA 3IMFA 4KWIA 3WGTA 4CPDA 4YT4A 1Y6JA 2ILTA 5GZ1A 4R1SA 5EINA 5I8ZA 1C14A 2NM0A 3W4IA 3LLVA 4AJNA 3EGOA 3TJRA 2IXAA 4ND4A 3E9QA 4BNWA 4GSLA 2R00A 3OM9A 3BMCB 4XA8A 4DC0A 3DTTA 1LLCA 1NX6A 3HADA 3TPCA 3Q3CA 3VH4A 4XYMA 1U7TA 3NTOA 3L0DA 4YRDA 1ISJA 3PGXA 4CLXA 5ILOA 4U6QA 1ISFA 5IZCA 1E6WA 1JU9A 1U8XX 8ADHA 4B79A 2H6EA 4HWKA 4K28A 4KDEA 4PLHA 3FWZA 3RASA 4B8WA 4IIVA 4C7JA 3WX0A 3U4HA 3NJ4A 3UGKA 1UXHA 3OJFA 5DF1A 3ZNQA 3NDIA 1GYQA 1UP7A 1JAYA 5TC4A 3S2GA 2D5CA 3BZUA 4PG7A 4E21A 5DT9A 4E30A 4DMMA 3EYWA 1PU2A 3PXXA 4GVLA 2OXIA 2TMDA 4Y9DA 1UAGA 2GCGA 3RUHA 4MVJD 1PS8A 3RFXA 2B5WA 3Q2KA 5JAIA 2VZ0A 1K6JA 2NU6A 2O3RA 1KVSA 2HAEA 4JIGA 4AJHA 3LF2A 5G0TA 1RKXA 3ST7A 4CQMD 2GN4A 1XHLA 3ZU4A 3PYMA 4UULA 3T4EA 4AJPA 2PA3A 4BO1A 2BFOA 3LSYA 4NPCA 4PLCA 5TS3A 4NI5A 2WEKA 1VI2A 2PKQO 5A05A 3OMLA 3VPHA 4E2YA 3I4CA 4EBFA 4W7IA 1YWGO 2AHRA 2ET6A 3T4XA 2QYTA 4BNZA 2PNFA 4WUVA 3DQPA 3O8QA 1TT5A 2PV7A 3AFNA 2ZKLA 4MIOA 4MVJP 3M6IA 1I3LA 3TRIA 1CQIA 4ZJUA 4D79A 1QSGA 1Q7CA 3LVFO 1X0XA 3M1AA 2VHXA 1MXFA 3D4NA 4DVJA 5IDWA 3T7CA 1EK6A 4IZHA 1GTMA 2NWQA 2P91A 4MDHA 3WWZA 3GRKA 1U1IA 4UAGA 5F5LA 1U4SA 1BW9B 1YKFA 3ZI0A 1F0YA 4NMHA 3QHAA 4WNIA 5HTOA 3PPIA 3T7EA 1QV6A 3BTVA 3DDNA 3JQ6A 2GERA 3N58A 3DBHB 1XWFA 1I33A 1MV8A 3HN7A 4J43A 2AEJA 3RCBA 3V1UA 5FF9A 4JJFA 1WAMA 2P9EA 5HS4A 1HT0A 1AGNA 3RIHA 4MIYA 1C1XA 2GGSA 1K5HA 2V7PA 1E3LA 1ZXBA 1LSOA 2EP7A 2W90A 2YV3A 4HFMA 2YJZA 3ZWOA 4KP7A 2EWMA 1SOWA 4FFPA 2FSVA 3K30A 5LDGA 1M75A 2RH4A 3TOXA 1NQAO 3VZQA 1IE3A 1B3RA 3SJUA 2BELA 4CMCA 2XOXA 4ND2A 4YJHA 5CDSA 4WOJA 4UUMA 4A5OA 2GN6A 3DZIA 5EN4A 3G1UA 3JQAD 1H0KA 5C7OO 4XQGA 2Q99A 5KIAA 1RJWA 4MKZA 4E5YA 3R3SA 2JD0A 4OQYA 3WGQA 4D3FA 2VYVD 1Q1NA 2VRCA 1LX6A 4ZVVA 1LLUA 4RF3A 2Q4EA 1I10A 2PD6A 1CETA 3GQVA 1EK5A 4PZCA 1LDMA 4F3YA 3PRJA 4BKUA 3NTQA 1I3NA 2IODA 2I3AA 1LDEA 4IXWA 3TQHA 3DOOA 3GNTA 3UH1A 2GF2A 1KIFA 2JD1A 2UAGA 2EG9A 3NYWA 2VYNA 3JYPA 3UOGA 2A9FA 3GEMA 3D1LA 3OSUA 4R1TA 1C1DB 2ZIZA 2HO5A 1Y8QA 3C7DB 3DONA 2PK3A 2XPCA 5KTKA 1X1EA 1UP4A 5F1OA 2PY6A 1DOHA 1VLLA 1DLIA 3GZ4A 2HU2A 3TN7A 2LDXA 3E48A 5IJZA 1YL5A 3C3XA 4RF5A 2GZ1A 4AG3A 1VRWA 4R5HA 5TT0A 3KEQA 3WFJA 2BMAA 3R6DA 2DTXA 3JQFA 4QQRA 4QT0A 4R16A 2C7VA 5ICMA 2FY8A 4CV3A 1QR6A 4FC7A 1YOVA 1VM6A 3ADOA 3AY7A 2Q3EA 5L7YA 3NJ8A 1GUYA 5IDYA 1R0LA 1MGOA 4ZRMA 1X7HA 3WTCA 2JD2A 2Q1UA 4I9HA 2PLAA 1E7RA 3GA0A 3RC2A 4YA6A 4XB2A 1ZK0A 1CQJA 3V5NA 4OKIA 4ZICA 2CUKA 2OBYA 1ISIA 2IZZA 1T1RA 3QVTA 3ZV5A 3A4VA 3ONEA 1SB9A 4FS3A 3V2HA 1JKFA 1QLHA 5I7SA 4RF2A 5L51A 4O59O 1Q2XA 3KYCA 1E3WB 1OOEA 5DOZA 2I76A 3QP9A 1VKNA 4AJKA 3ZWXA 1P1RA 2X8LA 3GH3A 1BXGA 2O7QA 3ENKA 3LDHA 3DHNA 1LUAA 4DUPA 4YXFA 3GUCA 1RM0A 2AW5A 3H9UA 3QQPA 3ROMA 4DWVA 1IL0A 4AJLA 5KVSA 3GUYA 4FC6A 4CM7A 3AUSA 3IDSA 3F4BA 1YDWA 2J6IA 2RBEA 4FOOA 4KMSA 1KYQA 2R6JA 4KQWA 4NFHA 2AQHA 3CPSA 4W9NA 9LDTA 4E2ZA 4HXYA 3RSHA 5F5NA 3F9IA 1ADBA 1CERA 4BO5A 1GYPA 1V8BA 4FJ0A 1I24A 3PI7A 1NFFA 3WIDA 1RM4A 5L9AA 4AJ1A 4CM1A 1A4IA 2V65A 3K2BA 4WLVA 4L75A 5JLAA 4BNFA 2EP5A 1EFKA 4CR8A 1SNYA 2X1HA 3FN4A 4YAKA 4WEQA 5A3JA 3K9QO 3B1JA 1SB8A 1NVMB 3EVNA 4YJGB 4NJMB 3M2TA 1GUFA 4E33A 1NVGA 4BHTA 1YRLA 3JQ9A 3I83A 4J1QA 5HA5A 3CKYA 3HUDA 3Q11A 1LNQA 4E5NA 4TWRA 4CLOB 3AI3A 5CEFA 1T24A 4L73A 4CUKA 5I9NA 3ZWPA 5TIIA 1HDRA 1DAOA 5ILGA 3WXBA 1I5RA 1ULUA 3WMWA 3GHHA 3HG7A 3HDHA 1R0KA 4J4TA 2Y93A 5L4SA 2R2GA 1TEHA 2AE1A 2O3JA 3QV1A 3WQSB 1U3WA 3CH6A 2YQ4A 4CM4B 2HK9A 1TT7A 4FN4A 3AW9A 2AEFA 2Y1EA 1QG6A 2AQKA 3A9WA 1GZ4A 4FDAA 2QRJA 3GC6A 1X7DA 3TL2A 3D5TA 4BO8A 2WD7A 3GF4A 2C29D 2QZZA 4XYEA 4E5PA 4FGWA 2P2SA 3DMYA 3ZNOA 2X23A 3RUCA 4YWJA 4ND1A 3I4FA 4E2XA 5DN9A 4DXHA 2I66A 2WJPA 3X2EA 4Z9XA 3GGOA 3HFGA 4GI2A 3ABIA 3OQ6A 4EDFA 2PR2A 3P19A 2EGHA 1DFGA 5EERA 1ONNA 3AU9A 4AJOA 4EJ6A 1X15A 4FCCA 2VZ9A 1PIWA 3GNQA 4EI2A 3DZHA 2NNLD 1TXGA 1DLJA 3PZRA 3A28A 3H5AA 4X54A 4CQMB 1DEHA 1E1MA 1A5ZA 2P9CA 1DSSG 1L7EA 3JQDA 1YS4A 1QYCA 2GN8A 2O7SA 3EZLA 3KHUA 4LCEA 1NPDA 4RGBA 3HN2A 3W1VA 2J8ZA 5BNFA 4MP6A 4RPHA 1LDGA 1LQTA 3PLRA 2Q2VA 4N18A 5K6AC 3GZNA 2QRLA 1M67A 3MOIA 4R5MA 1MG0A 3KVOA 2Y0EA 3KSZO 1DC5A 3NUGA 4FFOA 1P0FA 3AOEC 1O5IA 1KOLA 1JVSA 4LVCA 1R12A 2BLLA 3DO5A 4XWYA 3NV9A 2GR9A 3WSVA 5IG2A 1QORA 1YB1A 2NSDA 4R1NA 5C7IO 4HY3A 4BO9A 3BMCA 3NEPX 4NFSA 1AE1A 2JFHA 5KJFA 3WG9A 2W2KA 4WECA 2FOIA 1U9JA 4BNNA 3QVWA 5CEJA 4WLFA 1XCBA 3CTMA 1P1HA 1BTOA 4HKTA 1B8PA 4NBUA 2NTVA 4U8GA 5CPBA 3VH1A 5G0VA 3W8DA 2H1SA 4DGSA 3E9NA 3JQ7B 1ZEMA 2PZMA 2DAPA 3G1TA 1W8DA 1E3EA 2ZATA 2PGDA 2BI7A 4BKQA 3AY6A 5HBRA 3WTBA 3QWBA 4H7PA 1N1GA 1T2FA 2VTEA 3IP1A 3ON5A 1JDJA 3KEOA 1DFHA 2EJVA 3IC5A 4EEZA 1DRWA 2OZPA 1NAHA 2JKVA 4CQLB 4GH5A 3ZCXA 5IN5A 1P74A 1U3TA 3D0OA 1WWKA 3E5RA 2WE8A 2C2XA 4JXKA 5TT1A 4QFDA 4TRNA 4YQZA 1SEVA 4DQXA 3PEFA 3MJ4A 4PN3A 3ITKA
chains in the Genus database with same CATH superfamily
3AXTA 3HJGA 1OGIA 3UXYA 1UEXC 1WMEA 4LI3X 1NPTO 1TO2E 1Z13A 3DM9B 3P0IA 3QOFA 1OHHD 1NMYA 3TLGB 1RWOA 4PF1A 1NN5A 1E5DA 1RWBA 1VSQA 2MR6A 1ZINA 4NHEA 2BH2A 3DKRA 4AULA 1FP6A 2HBZA 1VFPA 3OZIA 3Q7QA 4L5AA 1HUQA 5LC1A 2O0KA 2FSHA 1OWNA 2W6ZA 3JQGB 3B1YA 2GFIA 3TBKA 3H3FA 4XDYA 5HW0A 4KAJA 2IUFA 1Z7EA 4F5WA 4YO7A 2C2HA 4W99A 2JJ1A 4DUYB 1WW8A 3I6QA 3N8NA 5KYWB 1BVRA 4QBFA 2HBYA 1E9SA 3RU3A 3ND5A 1OLSA 2G4LA 2GMWA 2HQRA 2OPBA 2X1VA 3B9BA 2BGTA 3T54A 1GARA 3WGVA 4B3IA 4GP7A 2AK3A 3HRHA 1ZOPA 3B1FA 1OLUA 3GCZA 2J5QA 4CDGA 3SKVA 3U6BA 3TXXA 2XMCA 3UHFA 3EGXA 3INYA 2A1UB 3F98A 5JSHA 2REOA 2AI2A 4M1EA 3WE7A 1ZFNA 2NO1A 3JQRA 3VDRA 3CUWA 3P9YA 4JCCA 1I6MA 4FCTA 4PWYA 3AEXA 5CYGA 1YR3A 2QNRA 4Q19A 2PFSA 2L69A 1EFCA 3RUPA 2JGIA 2DJ5A 3A6KA 2FEAA 4MGIR 5DYWA 4NK4A 2FPLA 4OI2A 3S70A 1E4EB 4YT2A 4IQ8A 1WU7A 2H1LA 3CWQA 3SY8A 1ORWA 1C0IA 2OG2A 4L0CA 1YQWA 4OH1A 4WKCA 1K08A 5IBRA 2HUPA 4PPFA 2ZUUA 4BV8A 3H4VA 5JQGB 3JTMA 1JQBA 1JR3E 3Q3VA 1NUPA 2CN1A 2EVWX 4G89A 1UOPA 3OOJA 3ADPA 3I4LA 4RD4A 1VHJA 5IJ9A 2V1UA 4EAAA 3HJBA 3OIDA 3PDUA 3L1UA 1VA5A 1MJ5A 3FNHA 1J20A 1OYWA 5KYKA 1FDVA 3NHAA 2YZ7A 3S29A 1EG2A 2J4CA 2BCJQ 3V7FA 4BMCA 1QFZA 3JV7A 4QAJA 4XX0B 1UXGA 1RNLA 4LHZA 2PUAA 4O8CA 2P4EA 5J58A 5GJCA 4LJ8A 2ENUA 1JQEA 4HUJA 1D5WA 1XG5A 2GZ2A 4ZREA 1FFAA 1GEEA 3SJBA 3BD6A 1UJMA 4HF7A 3HO8A 1U8EA 2BCEA 2DB3A 1E2DA 3INRA 2QUJA 3R6LA 2VNAA 1A71A 1VCOA 2GYUA 3BWVA 5CXSA 3EH1A 1DKNA 1TGYA 3WO0A 3R0ZA 4CMGA 2ZB4A 2V4UA 3JVDA 3KQVA 2FZ5A 3VHRA 3U4QB 2JIBA 1AKRA 1VMIA 1V96A 1ISPA 1V7QA 3UKJA 1BQ4A 1OTHA 1QZTA 1T2EA 2AXQA 2WDZA 3G5AA 3SCZA 3QFSA 4UHEA 3CVXA 1UMBA 4UUAA 4KAXA 4I5DA 5I9IA 1LF5A 5JDIA 3CU5A 2ZI9A 1UQTA 1E2PA 3GLFB 3OWOA 3DVQX 4QDXA 1J0BA 2JLZA 1ZSVA 4UAVA 2VRNA 1N6LA 3C1TA 3X1KA 5AH0A 3J7AC 2GZAA 3BD9A 3H9JA 3HUUA 3VU3A 1NMEA 3ZGNA 4KX3A 4UOZA 4RV9A 5A5DA 2P7IA 4R31A 3L4SO 3ZE2B 1ZESA 1OH5A 1SU6A 1ZC3A 2GAJA 4DEVA 1Y3IA 4YMIA 3TM4A 2Z08A 3RC7A 3T5GA 3JVEA 1SHKA 1V7PC 1RQ2A 2D0OB 2GLXA 2X0NA 3M5WA 3B1VA 1N4AA 3HKDB 1M34A 4XLTA 4AUEA 4MHOA 3V1TC 1D7AA 2XLCA 3LZ6A 4IDAA 3TQCA 3S81A 5CB4B 4OYRA 4WESB 4EA8A 2F1OA 4G1BA 2JBAA 1R6BX 4G81A 3AT1A 1NLUA 2PWZA 1W5AA 1JALA 5KAMA 4UPEA 3BJIC 2HA6A 2E85A 4G0WA 1U7OA 3ADCA 1XAHA 3I1YA 4P4TA 2Z9BA 1UFRA 3GRYA 5K9ZA 2N3ZA 4ZOBA 1ZOOA 1PG5A 3TKAA 4X66B 4OTZA 5A9TA 1QAOA 1Z6AA 5FBQB 4QSMA 2Q7XA 4RQUA 3EDMA 4RAQA 1GUAA 2BKLA 3KD2A 4DG8A 3U9SA 3SIRA 4YUVA 4JROA 1FA9A 5LLTA 4A8JB 3AVXA 3F5QA 1I0ZA 5EMLA 3RV4A 3WZLA 1YRBA 1ZH8A 2EZ9A 3R5KA 4RL6A 9ATCA 1KZGB 1X92A 1NQTA 4IDCA 4BFCA 4ARCA 1QU2A 3AHFA 2ERCA 2G1PA 3KSDO 3GPIA 3IO3A 3WNQA 2C5LA 2AC7A 2J9FA 5EKSA 5K0BA 1ML3A 3BIFA 2H1WA 2JHAA 1SZCA 4TV8A 4QARA 3ABZA 5FOXA 1U6JA 2XUGA 5BV8A 4QG3A 2WG1A 4OBEA 4ZVSA 4IQ0A 4C6SA 2QM3A 4M8LA 4CKWB 1NLZA 3V8PA 1W2GA 3RGGA 4X7MA 2PUDA 4YMGA 5DP2A 5EXDA 5B3LA 4M36A 1Y3CE 1XYYA 2NXCA 1SU7A 1KAMA 2XKJE 5T6BA 1OX5A 1S2NA 3GCWA 3IHWA 3VYSB 3A2MA 2KMLA 4H6XA 1F0KA 4KGZA 3V7NA 5JW6A 3CSSA 4IIGA 1NF2A 2IYVA 4RCZA 4E94A 3JWIA 1N2XA 3WIUA 3TPFA 4URXR 3EZ2A 1M72A 3I3SR 3AUTA 1T8YA 2B61A 4NP6A 1QMGA 5AQEA 3R20A 3SX4A 3ZTWA 4QBGB 4A7PA 1KWKA 3F6RA 4L85A 2QZJA 2BOVA 3MTGA 1ZD8A 4P6VF 2VJBA 4OXRA 3NM5A 3PR3A 3PEEA 2GETA 3RK0A 1PJQA 4F4UA 5JS8A 4NABA 3ZN2A 3K0SA 3FTEA 3LT4A 4IJVA 5ENVA 2FR1A 4LJ7A 3IRVA 4O4IA 4KYTA 1PD1A 1L7BA 2HRCA 3UMJA 5AHXA 5BUCA 5BSHA 5BNIA 3L5KA 4ERNA 4RZIA 1N5KA 5K3FB 3ZWWA 2FPPA 4A0SA 1QQ5A 3VNSA 1NN0A 3NWOA 4US2R 3IPRA 5T8KC 1A69A 4X5OA 2CDBA 1B73A 1IXKA 3LT2A 1H9AA 2FAXA 2IXDA 4JUBA 1EEXB 1UAYA 2ECOA 3USCS 4DLXA 2YVUA 2C4TA 4UVIA 1G8PA 1Q7TA 3BIWA 4IIEA 3H9EO 1DC8A 1B6RA 3TLKA 2IE8A 4CLOA 3OQ1A 1UPFA 2I7CA 2PRJA 2I91A 1F48A 2PGAA 3PQ3A 1O4VA 1U2QA 1PTJA 2JGRA 2XNDD 4L95C 3ZK7A 3UT0A 3S1AA 1UMKA 4AT1A 1QP0A 2VJPA 3QXHA 2IHKA 5B4UA 2X9QA 3OECA 1DWQA 1RWWA 3C3EA 4Y6LA 1ORHA 1ZISA 3I32A 3QNWA 1Y8ZA 1LBSA 3L6RA 4TKUA 2FLVA 2W6MA 3ZIUA 4ND8A 1CBUA 5EIHA 5KHLB 5KYVA 3I73A 2R68A 4C2UA 2XWBF 1OPXA 1EFUA 5AKLA 1H9BA 1KI2A 4ZYYA 3M5DA 1WMDA 5EWJA 1ESCA 3BWYA 3FGOA 1HFEL 4EA7A 4PNHA 4TRRA 3TVYA 1FYVA 1RPZA 4HXFB 3W5HA 3T1TA 1FOEB 5BN5B 4WW0A 4ZHQB 4LGCA 4HMQA 1Y8AA 5I7HA 3AB8A 1WOMA 5JYCA 1NVXQ 2BGKA 3EW9A 3KTDA 3BE8A 4G09A 3VR6D 5C5DA 1OIWA 2AMLA 1JG2A 4IMIB 3WIEA 3ZK8A 3NFYA 3C24A 1MVLA 2XB8A 4NE7A 1IZ0A 3PWSA 1ZGHA 3IBFA 1P0PA 4XVQA 3GLHA 4O29A 3EBLA 5LJIA 5DT2A 3SMVA 3HTXA 4BGIA 1J8MF 2A1IA 4U2DA 4NCXA 1V2HE 1BGWA 2VATA 1H1TA 1QO9A 2W2NA 3ABQB 4I1OA 4LX8A 4Y30A 5AM1A 3QSYA 1XQWA 2H59A 5KWEA 4DYDA 1VLQA 3OH8A 1E2UA 1PSZA 1TL7C 1YR1A 3CZQA 3LKZA 3NHZA 5FAXA 1IIRA 5DCLA 3G6KA 4WKBA 2NACA 2NYVA 4CQMA 5TSDA 5CMLA 1T5BA 1H6AA 3GZJA 5E8JA 5ELLA 3U26A 2C03A 3WRVA 5M04A 3IAAA 4QUHA 3GDGA 1JTFA 4NV1A 3ZZNA 2N42A 3R0VA 4YECA 1LQ2A 3O75A 4BKPA 2GN9A 4ODIA 2OZVA 1PR6A 3KOWA 2XLBA 3O3NB 1GQQA 3EVAA 3KXPA 4G41A 3C45A 1B0AA 5HF6A 2IX3A 1GU1A 4N54A 5K05A 1U2DA 3CF4G 4NPAA 3KRTA 2FF7A 3NT2A 3PDIA 4UM5A 5IEJA 4HAUA 5CIQA 1IN4A 3KP1A 1SUSA 1QTIA 2OUIA 2O3QA 5HJ7A 3ZVKA 1NQWA 4KMOA 1K89A 2ZBEA 4IIBA 4X63A 3SF8A 2CEAA 2AX3A 2J5BA 3QZUA 2BN4A 4C04A 5B57C 3BERA 3Q1LA 4Q34A 1HDYA 4XD7A 2V03A 1PNQA 1RKUA 5EPUA 2B21A 3SJ7A 5IT0A 1UWCA 1WPRA 1X13A 1I6KA 5HIIA 3SLRA 4E03A 1AQYA 1TUIA 3EOBI 4JMLA 4OLHA 1WXFA 4MCHA 4GOMD 3VX4A 4NENA 5ALVA 1T3TA 4CI9A 4BXOB 1SBZA 3H5IA 3N2LA 1UAAA 1US8A 4P4NA 1OXTA 1V5FA 1G21E 1NDUA 3OJ0A 5TJ9A 3LPCA 4QLBA 3UOWA 3WL6A 5C8VA 3V8BA 2RH8A 5KOHB 5IP5A 1SMKA 3SQNA 1YGYA 3WWEA 2JFQA 3KTFA 1E9AA 4OQLA 4GGMX 1U1DA 3LBHA 3HEAA 4A03A 1G19A 2OBBA 3WOHA 1AK9A 3Q9SA 2EFGA 3S27A 2B1JA 4BV3A 1DG9A 3ZJ4A 1U7XA 1N57A 5G4KB 1ECCA 2DFKB 3BFVA 3WB2A 4RIGA 4XUDA 2BHSA 5FI0B 6GPBA 3M33A 4KQXA 2OSBA 5IPFA 1A9TA 2M6LA 4QG7A 2OZEA 2PJUA 3O9ZA 5T64A 5TY0A 4BVEA 3I8OA 4J0CA 1O95A 4JQZA 2YNMA 5DCYA 4NCHA 1TM7E 4P82A 1HZZC 1U8CB 3L93A 2QLTA 4IAOA 4IXTA 2VDKB 4OFZA 4E4YA 1E2FA 2OECA 1HTBA 2WIBA 2Y27A 4ZJPA 2GN1A 4MA0A 4WK0B 3GJ4A 3L6UA 2ECQA 4HQRA 4P4LA 2H65A 4NBWA 3UANA 1XHEA 4CHGA 2ZB8A 4RTMA 3MIZA 1CEEA 1BEZA 3DOJA 3VH2A 2MOKA 3I5MA 1XC7A 3RD5A 5EKDA 3WP1B 3FTQA 1GQOA 4OHCA 5FA8A 2DYKA 4E5VA 2HYIC 1CD5A 4ZO4A 4UUPA 2IHUA 3PFBA 3PGA1 1YR7A 2XUHA 1I94B 1Q0RA 3FCEA 4MWOA 3BK1A 4MWZA 4OP1A 1A8PA 4BO3A 4RTLA 3TLEA 3AWDA 3W8RA 1NUUA 1P29A 3EBPA 1SPXA 2G40A 2G28A 4AKIA 3BH0A 1E1LA 1QH8A 5F52A 4RZQA 1GN9A 1GZ5A 2P4UA 2Q9UA 1JHRA 1W30A 4P5PA 4AYWA 3HVRA 2PMWB 1QNFA 4MRPA 4UMFA 4JEUA 1ZHHA 2JEZA 2Q3JA 3RNLA 3I9NA 3WIOA 10MHA 1ULZA 2ZITA 3OBBA 9MHTA 2ZR7A 1U6IA 4JCOA 3WP0A 3O2QB 1OAAA 1K5PA 4W9RA 1HYGA 3UB4A 3THWA 4B3TB 5HFJA 5KI6A 1QPZA 1CHNA 2R97A 5IXSA 5DISB 1N2SA 4ENQA 4BO2A 2J09A 1RHQA 2ZXUA 4H1HA 3F78A 5IVKA 2ATIA 4G07A 1PHPA 4GX0A 4TSKA 1MC5A 3KT8A 4WZZA 3NANA 2DT8A 2GI4A 4YRGA 1YK1A 4EGJA 2ZTSA 1UR5A 3S28A 4K9QA 2W6PA 3W7BA 3DZJA 1NVVQ 2CLCX 4B74A 5EEGA 3NKVA 2OZLA 3E0QA 2PU7A 2HDWA 3CZ4A 3DL7A 5DM2A 3VX3A 3GGCA 2OD9A 3BXOA 3SF0A 1F8XA 3FFAA 5HQTA 1V16B 3KSUA 4CZ2A 4DMRA 1KPGA 4J29A 4M1SA 3FNBA 4OGGA 4MO2A 2RAPA 2QTMA 2GLTA 3MUNA 4J3FA 4N5MA 1PL6A 1F9AA 1IN1A 3CS3A 1YHYA 1GRQA 1OFTA 1L8AA 3LBNA 3VJKA 2CDNA 4B7AA 1EVIA 3NM4A 4LNAA 1B14A 1XCPA 3EQ9A 4YQYA 4PCUA 4HEJA 3AFIA 1Q22A 2G1JA 5KS2A 3MHPA 3AX6A 3PPWA 5DX1A 4PRKA 1U0NA 2R4QA 3BEDA 2O06A 2Y6VA 2W2QA 1YO6A 4FHCA 5BWNA 5EJ9A 1JHXA 2PQ6A 4NOJA 5E2BA 2XECA 3B6ZA 2HJRA 5DI3B 1TMKA 3ANLA 4KG7A 1KDOA 1QHXA 2GB4A 3K8ZA 1H2ZA 1F51E 4UHHA 4EX7A 4J94A 3SZUA 1GU0A 3EA5A 4KZPA 1Z16A 1A8IA 1ZCZA 2FQQA 1VGRA 1TJ3A 3K70C 4TMYA 3N6VA 4JUIA 4EW3A 4YDHB 5A6SA 5K3SA 1YZQA 2GVDC 3H5TA 2PKEA 1L4EA 4ENWA 2YRWA 3GG2A 3ZR4B 3TINA 1XF9A 3M9WA 3VR4D 1RZUA 3T06B 1CE8B 4CL0A 2P0YA 4A2QA 5IABA 2X86A 2XZLA 4I9GA 4RQBA 1N2ZA 4RSMA 3OKFA 4FB5A 3M6FA 2X6RA 1SELA 2X9LA 4H4EA 3V32A 2IA5A 5EHXA 3U62A 2BT4A 2PS0A 4GIBA 4Y0NA 1YCGA 4GGOA 1CUXA 1RJ9A 5C35A 1NBMA 2HTFA 4YACA 3CN7A 3P2JA 1P72A 3FOZA 5FLYA 4GVPA 4MUBA 4V02A 4GU5A 4LPSA 3FMOB 3RBZA 3OD5A 3QKRB 2QTZA 1BXRA 3DDOA 2VXYA 2P5YA 4FJ1A 3E3AA 4V0NA 4Q03A 1OLOA 3W5AA 4Q9IA 3K70D 1USKA 2H7CA 3O74A 1PJLA 3K0AB 4BFSA 4LMAA 5IJXA 3E3OA 2WQ7A 1GCUA 3VU0A 1G2QA 2VDLB 1P9OA 2YRFA 3C97A 2BJVA 4UVEA 4H18A 1Z62A 4BE7B 1JLSA 4TYNA 1SUEA 3HV2A 2PSSA 4F12A 5KWSA 2A14A 2C9ZA 4TN1A 4GP9A 2DPYA 1KS9A 4E32A 1HE5A 2BRUC 2C1ZA 3C5CA 1AF4A 3EE6A 1H5UA 1NXWA 4MUIA 2R0QC 1T1EA 2AZMA 4JUFA 3EPHA 1PVOA 1EHIA 3MF4A 1ZM4A 4PHTA 4C0XA 2VT6A 4MQMA 1WUIS 1IK4A 1X3LA 3D6MA 3K4PA 3V2UA 2B2CA 3HHPA 4ZAXA 5K0ZA 2IC5A 2B5OA 2Z8ZA 4IFTA 5GMOA 4ROSA 2HLDA 2EF1A 1VLJA 4ITUA 4NCNA 3ED5A 4KZKA 2EEZA 2FFBA 1JE0A 1G3IA 1PSWA 4M1TA 1KQNA 1SBIA 2HMAA 1AQJA 1AD2A 2B1GA 1A8QA 2VVTA 2XV1A 3A2KA 3ER8A 4MYRA 1I2BA 1MMFB 4UPDA 3ROZA 2IGTA 5K8TA 3L7YA 5FWXB 4LXUA 3THSA 1BE8A 2DLCX 3NVKI 1XLTA 2RDMA 1W4CA 3TPZA 5CT4A 3TQOA 2PPVA 4HDKB 1YRHA 3T7TA 1TVKB 4B8YA 1QQ6A 1VECA 2VP5A 3NOVA 4TQ9A 2AVNA 4O08A 1HTTA 5DYNA 3GLGB 1QE0A 3U44A 2BY4A 3FUVA 3F8TA 4AJJA 4D99A 1FX1A 4D9EA 4CLEA 3SC3A 4U7HA 1BJTA 1QGOA 1J0AA 4GAEA 3WWDA 2HO4A 4DR2B 3Q15C 5LUAA 2GRUA 2VTKA 3W05A 4R40A 3RUFA 1CLUA 1B26A 2Q4OA 2IF0A 4XYGA 1E8MA 2IS6A 4BFYA 4TZKA 3GLVA 1H94A 1MNAA 3CBQA 3O6VA 4I1RA 4YRCA 3EFEA 5ECWA 4LTNA 1FRFS 2WLTA 2AFIB 2WSSA 4MR9B 4D6PA 2PX6A 5HIMA 1Y5LA 2MDTA 5DMHA 4ZT2A 4IYRA 1PG2A 2WAAA 1GZSA 4F3RA 1NT4A 4FR5A 3DMFA 5THXA 2R66A 3A11A 3C41J 1QK4A 1ZD2P 3PA8A 5EXXA 5CB6A 5JFOA 3K6SB 2JG3A 3S5JA 5C18A 4DPLA 4NECA 4MVXA 3L7LA 1KO1A 4ITVA 3VTFA 5JTTA 5MN4A 3T3HA 1HQKA 1CDZA 1Y1QA 2Q5CA 3L0BA 4O8ZA 3VR4H 4WCFC 4D45A 1RBZA 421PA 1CJVC 2Q0QA 3VO8A 2OP1A 4AM8A 3B9RA 5G02A 4S04A 1WW3A 5DXJA 3U39A 1VJDA 1FDOA 2OBFA 1WD5A 1SM4A 1IHXA 3DBRA 4FNGA 2DFNA 4RPJA 2HMWA 1RLJA 3GT0A 5FPYA 3GEDA 3WLRA 4YBZA 3ZE6A 4R71A 3EZGA 5K6AA 4BB9A 1J8FA 4Z2YA 1DAKA 4M55A 1QR2A 1CNMA 2RKWA 2W2LA 5EKXA 2WTMA 1EWVA 1GKUB 3OIUA 1ZOIA 3AOEA 1VKRA 1NYQA 2Z83A 1TRKA 3D8NA 4J76A 4TSFD 4CQNA 3RB8A 5B6IA 3LC1O 2BW0A 4YT5A 1JEYB 3D6UA 3N53A 3EASA 1L1EA 4YGYA 3L07A 1WVMA 3IP9A 4I8XA 4MWSA 5IJAA 3A9TA 3UENA 1PUIA 4KN6A 5FUBA 4JKOA 3IQEA 4ISBA 3WNDA 2J3JA 1WLSA 4FNAA 5HRAA 5F3DA 1NW5A 3DCYA 1KYYA 3EDRA 1QDUA 2AC2A 2YW2A 3B6MA 3HM2A 4OL9A 5FUYA 3T5CA 4ACAA 1JDZA 3L0CA 4LJLA 5H0IA 1DBRA 4OXNA 2C82A 5JWRA 4K5QA 2H48A 5AHKA 1VLMA 1H2YA 3FW1A 4KIFA 3P0FA 3VHXA 5D85A 3TZBA 2Q45A 4WPGA 4DAOA 4Y2VA 3LLMA 5HRUA 3HZHA 3I2IA 4PC1A 1FFSA 4XKJA 2JB9A 3E5MA 3U4GA 4YR9A 1E2LA 3KBOA 4KQ2A 3GVPA 3D59A 2PT5A 2HU8A 3O4FA 3HRKA 1ZKDA 2GJKA 3WKEA 1A82A 3IPAA 1Z88A 2D1FA 4LF7B 5JYEA 5A4FS 4WY2A 3LUGA 5FPKA 4N12A 1C4KA 3E27A 1D09A 3PWTA 1DADA 5SICE 5GTDA 2CXHA 4HQFA 1XJQA 3OOHA 3UJ3X 3ZG6A 4MB2A 2REQA 3WK8A 4HDNA 4M49A 1SXJD 2C54A 2OCXA 3I04A 4IQFA 1X70A 1RLTA 1SIOA 1W5FA 1CPYA 2G80A 2AUNA 4K2AA 5HCUA 4BMDA 4WJKB 4NBRA 1R18A 1OIVA 2BMVA 3RVLA 1JUDA 3CM0A 2ZRAA 2BP7B 1FFCA 2G72A 4JQYA 1EVKA 4JLDA 4N47A 1KC1A 3QK7A 3UFXA 1SBQA 4EIWA 2G3YA 5F12A 4BMYA 4DABA 2VLIA 4XR9A 5BV0A 3RBXA 1ETHA 3EGDA 4RKEA 2AL7A 4AKEA 2VPWA 4J3NA 7MHTA 1JA0A 3MEQA 1BN7A 3MWKA 3QKUA 4Q18A 1NZDA 1K7YA 1QIEA 2JJYA 4XQEA 3D9QX 3PFNA 3RVBA 1NI4A 3Q7PA 1J0CA 3WC4A 3KYCB 1ISHA 1CRQA 1R4MB 3D8RA 3MJTA 3PC8C 1G0OA 1OA0A 1EHCA 3SFVA 1FQOA 1J70A 2ZSIA 2ZS9A 2K4MA 1MFPA 2JLQA 2TMYA 2AUMA 4INPA 3SYLA 3W3AH 3LUDA 2GZDA 2Z2IA 4OOFA 3UAOA 4K0KB 2QD5A 3UJBA 5B58C 2F55A 2OV4A 2UV8A 4NLLA 1OVMA 5CAEB 1XELA 3WDMA 2APJA 1VXOA 3I1FA 4DOMA 4P7GA 4YR7A 2WIFA 2VJMB 2ETXA 2IKSA 3DP9A 2EJWA 3DF9A 4RKFA 2G9UA 3EN0A 1Z6TA 3ILHA 3DR5A 4KXVA 4MYDA 4RKWA 3FZNA 4QDZA 3PKJA 1FP2A 2HWKA 3C6XA 4M1QA 7REQA 3DKVA 4QUEA 4HTFB 1V5GA 2GYWA 2X5JO 3HI6A 4P83A 5AXCA 2PXAA 3ERCA 4URYR 1QHNA 4WH0A 3HKBB 1OBFO 3KBBA 4JGIA 5LWHA 4TTQA 1CZUA 1SC4A 2XODA 2X6QA 3H1TA 1XTUA 3L0OA 2VP2A 1OKKD 2QP4A 4HAVA 4F2GA 3QYJA 2Q5EA 1BMFD 1SULA 4X0EA 1M6EX 1VPLA 2HU7A 1MV5A 3BHJA 1MJHA 4MVJM 3DOUA 4EUEA 3K0EA 4IOLA 1XDDA 3PEVA 4ER6A 2X0JA 1D4FA 2XCLA 1JNYA 4J7XA 4OHBA 4EDHA 3VZSA 1QV7A 1ZIOA 3FGNA 1VE7A 2O23A 2XDYA 2WUEA 1LBHA 4KJXA 4M1WA 1M1YA 2Q3HA 5FD8A 3WNZA 2JIOA 2Z5VA 4JLBA 3WR5A 1O3YA 1FSGA 2BE9A 2DBRA 3IOCA 3OEEA 3FF1A 2F2TA 3BGOS 4HNRA 4NNPA 4E6EA 3OTQA 2C2MA 1P4HA 3FETA 5AOVA 3EVFA 3FOAA 1I4OA 4K9PA 4HQKA 4LY0A 4GKBA 3WGOA 1SQ5A 4GEGA 4W5NA 4L6CA 3IPLA 3ZJYA 3AR8A 3HCNA 3LX6A 3S1LA 2RONA 2NSHA 1VDMA 1VIMA 1JLHA 2VJDA 5GY7A 4CG1A 2X8AA 2HWYA 2G09A 4GR5A 1PW5A 1N1MA 4IZIA 3VPGA 4CLRA 2IZ7A 3MBIA 1VMKA 5LM3A 2IYLD 2ZIXA 2EGGA 4US0R 1ST2A 1ID1A 1TZBA 3ZZ1A 3EFOB 3H11B 3OEYA 4RESA 3T9CA 3ZTTA 1DBSA 3H1AA 4WXEA 2CXUA 3BKWA 3LQ2A 1XPRA 1MXHA 1T0JB 5B3JC 1T8SA 1VP9A 1XRPA 2W6QA 3IUSA 5TX7A 4WK6A 5J2TF 5E95A 3T6KA 4CL8A 4LYFA 2AH5A 4JUAA 4RM3A 1J6UA 1H1LB 3PHBE 2RHTA 2C1XA 2CKDA 3OZXA 4LY3A 2P78A 1Z22A 4Z54A 5A62A 4W9MC 3KR9A 2P6NA 5JANA 2DQYA 1YVPA 3L41A 1RYEA 3EY9A 3Q0TA 1IXYA 2NVWA 2QSZA 2VAVA 2P67A 5CBKA 4WXPA 1T91A 4D82A 4PZDA 4RHYA 4MVJG 1P6XA 5BYBA 4LHYA 2WYIA 5U9CA 1PFUA 1LRLA 1S1MA 3D7RA 2C7BA 3RQIA 5BVHA 3BMQA 5D6NA 5B7PA 3EEIA 1E63A 2V4MA 2ZYSA 1KDVA 3TQSA 4YPOA 3X1DA 3GXBA 1G8MA 3ROPA 3E8SA 5JS7A 3FY4A 4HRXA 4I36A 2EIHA 5TQJA 1XBTA 2DX7A 2PAFA 3AEKA 4C01A 3VNRA 3W8NA 3HMQA 4HNVA 2G67A 5HK9A 3BH7A 3L1KA 1QVAA 1FJHA 1GLGA 5JI2E 1J1ZA 1D04A 1T9BA 5F98A 2FN7A 1GL3A 4AJ9A 3QH4A 3DEZA 4G8DA 1LU9A 4I9NA 5CT5A 4F72A 3KM0A 1ZH4A 2XCIA 3CCCA 3E1KA 2OFXA 2QLNA 4PO9A 3S8EA 1PEKE 1ZZGA 4RTRA 2PD3A 4J0IA 4TRJA 4H1WA 1TYZA 3TZQA 4OO3A 5BSVA 4NDZA 1ECLA 3X1XA 1HSOA 3KPWA 3B1KA 6ABPA 1CF2O 3SHWA 1F8UA 3GN2A 3D2BA 5GAJA 1AO3A 1CIVA 2PKXA 2QYHA 3GXOA 3KOUA 3N8GA 1JA1A 1Y8RB 4IL5A 1SIUA 3I1JA 4MKGA 4P2BA 1BJRE 1J7KA 4IV8A 1A9YA 5DTJA 3ZWMA 4DLAA 2G0TA 4GRIA 3B9PA 5EP4A 4PQYA 3U60B 2CCKA 3DMGA 1G6HA 4XWOA 4GXQA 1QHGA 1U81A 1VE6A 4J75A 3EVDA 1N3IA 3CZCA 1XAJA 2FWMX 2JFXA 2NU7A 1NFRA 2W2KB 3RS5A 1Z36A 4MI1A 1FX0B 3LT5A 4PLPA 4IY1A 1IM8A 4MQFB 4N41A 4ZARA 3KYDB 5KOIA 3SLKA 2ZTUA 4OBXA 2ANBA 4XJSA 5F2KA 1RXWA 4OHPA 2QJTA 3CXUA 1BQEA 1LPOA 1Z2AA 5GM1A 5BXYA 5FTKA 2XMRA 5HGXA 4ENVA 1B0UA 2NVBA 1PV4A 1ZJ5A 2XNDA 2CVZA 1CY4A 5I9LA 3O4RA 3PHGA 4HC4A 1Z38A 3TKLA 1DTWA 1ZXLA 1Q6YA 5JCJD 1TLTA 2WVHA 5AM5A 2J41A 2XXJA 2JC3A 2ZW9A 4KPUA 4PO1A 2CLLB 3UMBA 2CV1A 4PZYA 4J0FA 5A5GA 1X7GA 2VJAA 3O8NA 4DRYA 3AR3A 1RW4A 4FYYA 2VSXA 2AQIA 3SU8A 1WX1A 1AK1A 4WFQA 4CLHA 4IDPA 5ADHA 5IBQA 4KPYA 1I4WA 3E7PA 4DCNA 3RVSA 2C31A 2B8NA 3BH6A 1HA3A 3GFBA 4QUDA 1E9DA 3P9RA 1R4ZA 3VDNB 4IEFB 5T8KA 5THQA 1KZ6A 2HXSA 3UJ7A 1OBOA 4M2LA 4IR7A 4CF5A 4CMKA 1CCWA 3ZDXB 1KDPA 2IHTA 2D4HA 2QTCA 3C5EA 2FPSA 5KAPA 3VM6A 1JI3A 3FWPA 2VH1A 1QTNA 2BFCA 5CFZA 1N7IA 4HDSA 4ML3A 3UBMA 4C0HA 4AFNA 3GRFA 2XZOA 3OQOA 3DVLA 4PLGA 3FNEA 2GT1A 3BN3A 4FZRA 3BXFA 3VPCA 3FNGA 5BQFA 1BKSB 2PD4A 4GLBA 4AY5A 5AI5A 2PZAA 3EPKA 4RY0A 4YDRA 3NHWA 1QYWA 4PSVA 1ESZA 4F6RA 1ECJA 5IT4A 3JYHA 3G0OA 2EW1A 5KDDA 3THXA 3LHKA 2HF7A 4XIJA 1FP4B 2RJOA 4EF4A 4BATA 2CC2A 4JOQA 1ESMA 1R0WA 3I6IA 4FOLA 4K9RA 3UJPA 4ARBA 2I1QA 4NXMB 2YFYA 4JN6B 2AJLI 2VP6A 2MJLA 4QJ5A 1ZJZA 2Y1DA 1D2EA 2QQEA 4BNMA 3INTA 5BWLA 1FXWA 4AQDA 4BB6A 4RANA 2XCSB 1P0QA 4O1HA 1KRWA 3G23A 2COEA 4MUJA 2GLUA 5H3LA 2AN9A 3HB7A 1LPMA 3L7DA 2G77B 1XZHA 2II6A 2R8ZA 3F2IA 4G0XA 4LMBA 3VR1A 4TM8A 3C0KA 3DC2A 4FYPA 1KU6A 2W2XA 1AN9A 2E4YA 1GL9B 4LJ9A 3RUEA 3OETA 3V4OA 2BEJA 3NHLA 2MTBA 1ZVJA 5AKKA 1RBQA 5KDOA 2AG0A 4AN1A 2ZYUX 3JWHA 1U63A 4J03A 4UNQA 3MLAA 4DLYA 3ZOKA 3CVUA 1SBTA 3PHHA 4G24A 3A1EA 3MSCA 2PZLA 1JMVA 4LSZA 5HCNA 3ZHXA 2Q1SA 3KNZA 4BB5A 2XYQA 2UUBB 1L6RA 2ZT5A 1YSCA 1R8XA 5G41A 5KYYA 3VUFA 1Y5RA 5ED4A 4EY5A 3IA7A 3MOGA 4UD6A 1QX3A 1J0XO 1KDTA 5AHWA 3H19A 1H0RA 3F6EX 5C1BA 5JTUA 1SOMA 1XLVA 1NLYA 4XJVA 5E1DA 3TAUA 2EV9A 3X1YA 1SHJA 4BBPA 4IDBA 4KPEC 1OXUA 3HYRA 3LL7A 3SHOA 1WULS 3WK5A 2G9QA 4YJFA 1NVTA 3LPNA 2RAFA 5J4KA 1EDBA 3E9RA 4KN9S 2Q5HA 2VDQB 3UNXA 4BFZA 1W5EA 4DZTA 5LP6B 1WXIA 2I55A 1QIDA 5C1IA 3P9IA 4Q3KA 1DFIA 4L4RA 4M38A 1H2HA 2RFLA 1N7GA 3M4ZA 4LYHA 3CR7A 1NW9B 4DKJA 1FQJA 2DC1A 2DY1A 1N9KA 2WHQA 4IRMA 5L3SA 1DJNA 3GJXC 1N2CA 5TQ0B 4AF8A 1F6DA 2BUBA 2XJ4A 4F97A 4FTWA 1CB7A 4I81A 5LA6B 3B60A 3PR2B 1PZGA 4TS3A 2IWHA 1CRZA 3SXPA 3JD1A 1QH1A 3KKNA 3QVVA 2HNAA 4NU8X 1R37A 1UPUA 1DNPA 2OFFA 5C1OA 1ZGGA 1SQGA 4N3GA 4EGAA 4YMTA 2Z2KA 3A6PC 1UC8A 2IHYA 4KR3A 3I01A 2Q5FA 3G7UA 2FWAA 3EZYA 4OHKA 2GK7A 4CMAA 3ECSA 3SHFA 4LCJA 3RS4A 4EMTA 4IUCS 4D3SA 3CF6R 1XF1A 2VBIA 3L1VA 2J0UA 4CI0B 5C53B 1SBHA 5EC8A 1W36B 3MQ4A 2NZYA 3GJ8A 3BAZA 3BL6A 1ZUNB 1ZC4A 1A9OA 4QATA 1Z2CA 2Q1XA 2FHSA 3SSAA 4D8VA 3T12A 3MWEB 3OU6A 3DMNA 1H66A 3AHDA 4Z0NA 2DQZA 4M99A 2ZJOA 4EHDA 1ZMXA 3KKQA 2M98A 4FUTA 3LECA 3JWJA 3AEQA 1E9RA 1QUFA 1OH6A 1O9HA 4O3FA 1IY9A 5IH3A 1EA5A 4B2LA 3PC4A 4F4JA 3HA7A 3WLEA 4MUGA 4NH0A 2VHYA 3RSGA 2Z1MA 2A5GA 3WK4A 4HEA1 1SURA 4L8GA 3C85A 4QE3A 5BR4A 5KJ6A 4EO4A 1Y42X 1KYVA 4GXRA 5HEKA 1OZGA 3E9CA 1CR1A 4NX2A 3HA5A 1ESDA 1FMFA 2XNHA 4IS2A 4HQ0A 4K9DA 4WI1A 5LN1A 4OJNA 5JBQA 4UHCA 2HK7A 3A26A 3TW4A 3C3PA 1Z0KA 3FXAA 1A3CA 1OXBB 4NJEB 4P92A 3LIIA 2AF3C 1ZO8A 3KWJA 4HB4A 4RY2A 2JLWA 2OV2A 1N2JA 3M49A 3LH5A 1EM8A 3G9TA 1HZZA 4RVGA 2ZUTA 4C76A 2GRJA 3AY0A 4EJ0A 5K03A 3GARA 2XVYA 2NXNA 3KFVA 3K6KA 3LD9A 3QY0A 3M82A 3ZHUA 1A7UA 1TTPB 2PUVA 1KFEB 2VRWA 1I7NA 4LDAA 1WUKS 1QGAA 2KLHA 3L1HA 4U2KA 4DLPA 5AUOB 4D81A 2ZYHA 2ZR8A 3FUWA 3PYLA 1HEUA 4EYOA 1VZ2A 2OOSA 2H8KA 1Z39A 3DFIA 4IDDA 3OJLA 4H4DA 4IGAA 4MTCA 4R68A 1Q15A 3U5TA 1RZVA 4H17A 4QOJA 4OI0A 4ZVRA 4WY5A 2VQSA 4RFSA 3RJ9A 2B1QA 3EZNA 3K09C 1Z2EA 5DULA 3TE7A 1JMYA 3WRYA 4GLFA 4TYWA 2ZYWX 4MV4A 1AQ6A 3ASVA 1FPMA 5J43A 2P3QA 3DNPA 1X0VA 3LMKA 4XDZA 1JDUA 2MSCB 1JWBB 2IH5A 3OA2A 1KEZA 1II0A 3K0KA 1E5LA 2X8JB 3JWGA 1NW4A 3EXIA 3NWJA 4NMMA 5CW1A 1CUGA 4P3XA 2FSPA 5DHTA 5AM0A 5IEBA 1DQSA 3VO9A 3NAQA 4O33A 4R83A 5AVRA 4O2AA 4ZHQF 3FHJA 1KEEB 1ABFA 3LXXA 3PRYA 4PHCA 2F48A 3OM8A 3Q85A 4IJWA 2WOOA 3C3YA 2BBOA 1IQPA 1J8DA 3IH5A 4K1XA 1Y1RA 3T4UA 4KN8A 3ML1A 2FPXA 1JRLA 1OBVA 4QBKA 5C1PA 1KKUA 3GHYA 3P9KA 3KU4A 2R5NA 4RTKA 4MEAA 5EE0A 2VBCA 1W8IA 1UBCA 2GK4A 1CUIA 2XYGA 3A6EA 2GZSA 2HQBA 3EZ6A 1EFLA 4H77A 3M6LA 4WOBA 3VJRA 4HWRA 4DM7A 2YS7A 3TTTA 3H97A 4G9GA 3COZA 4LYEA 5FFFA 3RJMA 1KIMA 2HDNB 1H8HD 1TEXA 2CXOA 2R4TA 4DG5A 3NS7A 3NJRA 1DTSA 1DMSA 1JHVA 1O57A 4ZGWA 2IFTA 3HB9A 2AG5A 3SGLA 4XRGA 3I2YX 1UBHS 2CXPA 5EE9A 2YJNA 3TS1A 4NL4H 1U2RA 1VYTA 1NVKA 4BGDA 5JQWA 3QNUA 2Z4TA 1DEOA 4MRRA 1VG8A 3IUQA 3VR4A 4EG4A 4LFCB 5DV9A 1J97A 4XTRA 3TWOA 3ZY4A 5L6MB 2XMGA 5F1PA 2PRYA 3NWEA 4J0JA 4KV9A 3WLKX 3GWZA 1N6IA 3OQHA 3CVWA 4DR1B 4HO1X 4ENUA 4LISA 4FGLA 2Y99A 1HRDA 2J67A 4ZMSA 4E22A 2JLXA 4NXNB 5DGCA 1P2GA 3ELWA 3K53A 1GFIA 3RFFA 2HI0A 3AEYA 3PPYA 4BNDB 4GOXA 1L7MA 1ML4A 2YCBA 1XMXA 2OVFA 3K0FA 3TF5A 1B43A 1GV0A 1UDCA 2BDTA 4DA9A 3UCXA 4HGNA 3B20A 1AURA 1JJIA 1YI1A 1UPTA 3FFWA 4PQRA 3IUEA 1B74A 4ZOLF 3GZTB 1ZUWA 5F7XA 2PPLA 1KY4A 4LHWA 3HPQA 3KJZA 4L8FA 2Q6KA 1QXSA 5CRIA 3G2OA 2PBLA 1MC8A 4ROTA 1E0KA 3FVRA 2HDOA 4AZ3B 2JCYA 4Y2UA 1OLXB 1VI6A 1JFRA 3N6XA 2FE4A 1T4MA 4P3KA 5D3QA 1G17A 1T8PA 5GONA 3RYHA 4AJ2A 3F5MA 1E1KA 3JPWA 2Z1NA 4LSGA 1TMOA 1ABEA 3VYTB 4C5AA 2VQFB 2XUAA 4U6SA 4DPKA 2JFVA 4QGHA 3FI9A 2MSNA 3DCNA 1P0CA 5D5QA 5JIBA 3MTDA 3WHIA 1X94A 3BSYA 4BYGA 4P98A 5FO1A 2F6RA 2WZQA 2PUBA 1UBSB 2XSZD 4FD2A 4QELA 1Q7RA 3TTUA 2QR3A 2QTHA 5H4HA 1HE3A 4F60A 3CNNA 3BHNA 1ZM7A 4X91A 1I8TA 1UFOA 3O3CA 2D5AA 1W44A 1E6CA 4G23A 4WUTA 3TBH