4WEQA

Crystal structure of nadph-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with nadp and sulfate
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
316
structure length
316
Chain Sequence
b'KSPVIVDLKFIPEEVEAALAGAFPGREVIDLADPAHQERDLSGIDYAVVWKSAPDLFSRAPDLKVVFSGGAGVDHVLTLPGLPDVPLVRFVDRTLTTRMSEWVMMQCLLHLRQHRAYEALAKKHEWRDLSQPEAADVTVGIMGMGVLGQDAARKLAAMGFKVIGWSRSKRVIEGVETYDAAGLDAFLGRTDFLVGLLPLTPDTRGIFNAALFAKLSRNGPFGAPVFINAGRGGSQVEADILECLDSGVLGGASLDVFEREPLSPESRFWDMPNVYVTPHVAASSDVRALFVHVEHQIARFESGLPLEHVVDKVAGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent dehydrogenase
publication title Structural, Biochemical, and Evolutionary Characterizations of Glyoxylate/Hydroxypyruvate Reductases Show Their Division into Two Distinct Subfamilies.
pubmed doi rcsb
source organism Rhizobium meliloti
molecule tags Oxidoreductase
total genus 101
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.79: Glyoxylate reductase (NADP(+)).
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4weqA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4weqA01
3JQCA 5L40A 4XJSA 1EUDA 4R69A 4IXWA 2P5YA 5AXBA 4R9SA 3VOSA 1EBFA 2C20A 4CMKA 1NWHA 3VPSA 1KC1A 4DQXA 4Z6KA 2NVUA 4I9NA 2OP0A 3WLEA 3DFUA 1AXEA 4E5MA 5TNXA 4J7UA 4H16A 2NWQA 4PLZA 2BGKA 4LGVA 4CM9D 1X1TA 4E13A 4OMUA 4ALLA 5KJ1A 3PGJA 2IE0A 1NPTO 2O7SA 4JQCA 4L4XA 5FWNA 3L07A 1DHRA 5KVCA 3AOEC 2EGGA 3GZ4A 4N54A 2UYYA 1WLYA 3D3EA 3QHAA 2JKVA 1EDOA 4II3A 1MV8A 3W4JA 3PWZA 2I65A 2WJPA 4ALKA 3IP1A 4J7XA 4CUZA 4WE3A 1DOHA 1FDWA 1MUUA 4RLSA 4R3WA 5G0TA 1U3WA 5TIIA 5ILOA 1E6UA 1SEVA 1L7DA 2H6EA 4FFNA 1ZK2A 2ZKLA 1R0KA 4LISA 4PLCA 2EJWA 1IULA 1UZNA 4GVLA 3EAGA 3OH8A 4J1TA 1LDNA 3T7CA 2O50A 4A0SA 2JFFA 1R15A 1GUZA 3WQRA 3WBFA 3EZLA 3GY0A 4TWRA 3GLQA 2AEFA 4ZQBA 4BV9A 4KUGA 2P68A 2I3GA 2PD3A 3ADOA 4U6SA 4E21A 1UDCA 1R66A 3WMXA 3FNGA 2WMDA 1EVYA 2IRWA 4HUJA 3LF1A 3O8QA 4A73A 5EJ2A 1J49A 4BMVA 1JN0A 5JAMA 3DWFA 1AUPA 3VVBA 1U9JA 3VVCA 2UUOA 2QYSA 3PRJA 3VH1A 3GUCA 4D45A 3HSKA 4NNJA 2WE8A 2QYTA 4P8RA 2YY7A 5DNAA 2POQX 2BI8A 3ITDA 1MFZA 2O2YA 3R1IA 2VWHA 1LDMA 2P91A 4I9UA 4OIMA 4R4JA 5B12A 4XIYA 3H8VA 2Q99A 3RVDA 1JAYA 3WR5A 4IDDA 1XYGA 4TZTA 4CV3A 2NVUB 1ZKMA 1I24A 3QWIA 1VJ1A 2Y1EA 1KS9A 2Z5LA 3H5AA 1TI7A 3WWZA 4ZQGA 1ONNA 2PZKA 2AA3A 3K96A 1DO8A 4D3SA 3UCXA 1PZHA 3KBOA 4NBVA 4ZICA 3ST7A 2DPGA 4BKPA 1ISIA 3F1KA 1WZIA 1N2SA 4ZA2A 4YTEA 1XR3A 4JXKA 2DQ4A 2W8ZA 3UGKA 4P4NA 3PJGA 1CRWG 1NFFA 2DPHA 5B37A 1GADO 1DC4A 3H9UA 4QQRA 3I4FA 2I66A 1UP6A 2PH5A 3I6IA 1SZJG 3DHNA 4JBHA 9LDTA 5MGBA 2C59A 2IYPA 4B7XA 1YB4A 5T57A 1E3SA 4DC1A 2FHSA 5I8ZA 5JC1A 3VDQA 3FR7A 1QSGA 2JL1A 4CL3A 1E3LA 4CL8A 1RM5A 4LN1A 5JPIA 4RF2A 4J9VA 3K30A 4BIIA 2Q1TA 3OIGA 3RJ9A 3ZDFA 4BO7A 3KOUA 3JQBA 3KSZO 1NQOA 2Q46A 3K31A 1YQXA 1EUZA 2BH9A 2NNLD 3D7LA 3RCBA 2HMVA 4Y6SA 3HDJA 1NTOA 2EV9A 1Y8RB 4BNVA 4FJ2A 1YGYA 3VDRA 4N5MA 2D5AA 4C4OA 1O9BA 2RBEA 3RQSA 3O8QB 3W6ZA 1LDGA 1Y81A 1Q0HA 5CAEA 1SB8A 4L4SA 2WYWA 1PWZA 3JYOA 4GKBA 3C85A 1IYZA 5A9SA 3OJFA 1I33A 2O3SA 2E37A 3DMTC 1I3LA 2Y0CA 1KC3A 1YJ8A 4PG7A 4ZQEA 2IXBA 4KWHA 3I6QA 4CLRA 5L7WA 5EN4A 2Q4BA 2OO5A 1OBFO 3P19A 5GZ6A 3ETEA 2NVWA 1MFPA 1NP3A 1PJ4A 2HLPA 1VL8A 3WSVA 2B36A 1DAPA 1QP8A 5IDWA 1I36A 3ZWPA 3TFOA 5COAA 5DN9A 2OBYA 4TVOA 1GUFA 2HMSA 2QIOA 2RAFA 4RZIA 5EL0A 4AJJA 1Q7GA 2YFQA 4MVJH 1E1NA 4CMGA 5KOIA 5BT9A 4XYBA 4ALJA 4E4YA 2WWRA 1T26A 3K8ZA 4RGBA 4U5QA 3RC9A 2VHVA 2RH8A 2AE1A 5JYEA 1C3VA 1DBVO 4XJTA 3QLJA 3WQQA 1YBAA 4N7RA 1U3UA 1Y7TA 3QJ5A 3AK4A 3R3JA 4MVJA 3E9MA 4YT2A 4ZD6A 3TZHA 3LLVA 4WLNA 1ZXLA 5CDYA 3OIFA 3GHYA 4OKNA 4CLXA 3VH3A 3AWDA 3F3SA 2Z95A 2J5QA 3PZBA 3WNVA 3GAFA 4Z9YA 3H6KA 4KTTE 3L77A 4CUJA 1U5CA 3LT0A 1P45A 1VSUA 1R16A 1PJ3A 3IIEA 1FDSA 3KLMX 3QVTA 1EZ4A 3L6EA 3PPIA 1LEHA 1P77A 5KJCA 1XIVA 2O3QA 1TVEA 4YJFA 4WK6A 4XZ3A 4Y9DA 4PLYA 5JW6A 2C2XA 2SCUA 3I9KA 1UP4A 2DU8A 1ORRA 4JNKA 4BMSA 2GNAA 4Y8VA 4BO6A 5A9SB 4CQMA 1R4MA 1PIWA 1QG6A 2GLXA 3L6OO 4M86A 4CLDA 3FI9A 4J4BA 2FZEA 5L4SA 4OM8A 3VH4A 5TX7A 1ZK0A 4FFRA 1NM5A 1E3JA 2DBZA 3O26A 4CLRB 4GX2A 2HDHA 4D46A 3W8EA 5JC8A 5G4LA 1DC5A 4CV1A 4ND1A 3S2IA 1O8CA 1RM3A 1DFIA 4EJMA 2ZIZA 1P31A 1I2CA 4RVHA 3L0DA 5H81A 4WOKA 3TZQA 3CH6A 1PGPA 3GVXA 4G65A 4OXYA 4R3NA 4GI2A 3EDMA 4JLWA 5JCXA 4BB6A 3TQHA 2FRDA 1I8TA 3VKUA 4IDCA 5TC4A 4BO8A 4GX1A 4G5HA 3ZWAA 1O94A 4IDBA 3KTDA 2GRAA 2WSBA 1LC3A 2B4TO 4DBZA 5F5NA 4TSKA 1IZ9A 3TL2A 4LMPA 2H63A 1Q2XA 1U4OA 3C1OA 3KV3O 1NYTA 1P1HA 5G4KA 2QX7A 4MO2A 1PQWA 5KCZA 1KETA 1K6JA 3JTMA 1O0SA 4CODB 4W4TA 4UEJA 1UUFA 3Q9NA 5CPFA 2CMDA 1HYHA 1QXSA 5L45A 3HADA 2GN8A 1PQUA 5DOVA 4BS9A 4O59O 2G1UA 3HDYA 2IYOA 3ITKA 3ONFA 4RPJA 3W4KA 3BHMA 4RVSA 2VUSA 4KP7A 1A9ZA 3FF4A 4I08A 3SJUA 1CERA 2B83A 3K2EA 3JQFA 5GZ1A 1CYDA 1T24A 4J90A 3MJSA 4BNKA 2W2LA 4XB1A 4X54A 5F1KA 4BO1A 2AMFA 1C0LA 3G79A 1D8AA 5DDIP 2EWMA 1Q7BA 3GEDA 4CM5A 4GQAA 3DR3A 4YJFB 3DXFA 1NBOA 2GD1O 4AJ1A 4L9RA 4YJHA 4IJKA 4BNNA 5L95A 3B1KA 3GFBA 3IJPA 5LDGA 5L53A 4UEOA 2YHIA 3ROMA 3N74A 4QFCA 4CM7A 1UDBA 4NFSA 4CQMB 3SX2A 1R4MB 3U4IA 4LSMA 1HT0A 1EK6A 3ZWNA 4BL5A 2X5OA 4IY1A 1S7CA 4JIGA 3DHYA 4C7KA 4R68A 3JQBC 5EQDA 4J7CA 4BGIA 1M66A 5JMWA 1AHIA 1VL6A 2FR8A 4BVAA 2VHZA 1QYCA 3DBRA 3H4VA 4E2ZA 3IUPA 3ZW9A 3AUSA 1E7RA 3IKVA 3SLGA 4E32A 2PTGA 2W98A 1C14A 3QQPA 4CMCA 3N7UA 2RCYA 2V6MA 3EYWA 5G2OA 2DTDA 2FPPA 3LC2O 1WMBA 1U1IA 2QG4A 2TMGA 5U4QA 4CLEA 2O48X 1OAAA 1RYDA 1ZZEA 2PGLA 1HE3A 2EG9A 4FGWA 1MXHA 4GH5A 4AJIA 1QORA 1VE9A 5G4KB 1NQ5A 3D5QA 5HTOA 1CEQA 1R37A 1RPNA 3ICCA 3L6DA 3JQ9A 1NAHA 1EBUA 1GZ4A 1SB9A 2WYVA 5THQA 4YXFA 5K6AC 3WICA 1GPDG 2J3HA 2Q4EA 4OOEA 4LSWA 1KY5A 4R16A 3VZQA 4D43A 1BXGA 3TF5A 3IS3A 3MJCA 4GLOA 4URFA 3AI3A 2G5CA 1T2DA 4NBRA 1BRMA 1FF9A 2GR9A 4NBTA 3FHLA 3AI2A 4R41A 4WCFA 2YJZA 5ITWA 3ZU3A 2BFPA 4IQ0A 3I4CA 1XU7A 4FDAA 3VTZA 4YQZA 3RC7A 3LC1O 1DPGA 3ZNPA 4R1SA 4YJHB 4JROA 4A10A 5A05A 5FF9A 3OJEA 3KRTA 7MDHA 2PR2A 5IN5A 4FC7A 2H1SA 3G1TA 3OECA 3PJDA 3NTQA 2TMDA 1M6WA 4NU6A 1H6CA 1LSUA 4CQMD 1RYEA 4GL4A 1PZFA 3MTGA 2ZK7A 1H6AA 1YB5A 2CVOA 3JYLA 2GF2A 3ROQA 1LRJA 4E33A 1Z73A 3H2SA 4CM8A 5ER9A 5I7SA 4XQGA 5GY7A 5KNLA 2PGDA 2PV7A 2A92A 3DBRB 3ZWYA 2DTXA 2VNAA 1GV1A 1UXHA 4CM9A 4JX8A 3EW7A 4HX5A 2VYVD 1HSZA 2AQKA 2X4GA 3ZV6A 3KETA 2Y67A 3WWYA 3JD0A 4ROSA 4DUPA 3C7DB 3GPDG 2QQ5A 4DGSA 1VJTA 4UVIA 1EE9A 3IP3A 2VNSA 5LCXA 5JCJA 3HJAA 3F4BA 4TKMA 3IL2A 1OC2A 4BNZA 3T4EA 1WNTA 3OFSA 5ENVA 4DIBA 1KIFA 1BGVA 3U4CA 5DP2A 5KJEA 1CF2O 4BNHA 1W4ZA 2A35A 4XYEA 4ZQHA 5L7YA 4E2WA 4F6CA 2YV3A 3OJ0A 3TL3A 2FPGA 2GERA 3QP9A 4CM4A 1ZMOA 1HDZA 2UDPA 4FBGA 2DAPA 2D2IA 4WLVA 1D1SA 2Q3EA 1ISHA 1YL5A 4PLPA 2NADA 5ES3A 5J23A 1PGOA 3GEMA 3AW9A 4W99A 1MG5A 4WCFB 2CUKA 4BO4A 5AXDA 2CDBA 3PWKA 4JK3A 1I3MA 4FFPA 2OFPA 1PZEA 2VYND 1TT5A 3D64A 4PLGA 4Y6RA 2Q1SA 2O3JA 1Y8QA 2W2LD 3QVXA 1SPXA 4ALIA 2H9IA 4I8XA 1N5DA 1NASA 4MVJE 3W8DA 3RU9A 3V8BA 4IBOA 1PS9A 3IDSA 1VC2A 1DHTA 1BTOA 4FFLA 4WPGA 3DC2A 4WEOA 3IQDB 4YJGA 3RU7A 3DZGA 2X23A 1LA2A 3NT4A 3OSUA 2X58A 2AEMA 3MWDB 2IODA 4RPHA 5HBRA 4AJ4A 3PHIA 1E1KA 1R0SA 3NV9A 2Y0EA 4CM8B 1JAXA 3KO8A 3MJVA 3U3XA 1HL3A 5ER6A 3WG9A 3R3SA 3JQFC 2VUTA 3WSWA 2PA3A 4E5NA 3K6JA 2X9VA 1LNQA 5CEEA 1X0VA 1Z7EA 3PI7A 4L75A 1H2BA 3DOJA 4EBFA 1R4NA 2HRBA 3RAJA 5JLAA 2LDXA 2NTVA 3IMFA 2BKAA 4QO8A 4YAEA 1JWAB 9LDBA 1PTJA 4CMBA 4KDEA 4BO5A 2IXAA 4E0BA 2Y66A 1PL6A 3WGYA 3NYWA 1A27A 3I9MA 4TRNA 1E7SA 1DLIA 3DZJA 3QWAA 1NQAO 3GMSA 4BO3A 2XPCA 2Q1UA 1VRWA 4CMAA 3WGQA 2NSDA 2E82A 2FSSA 2P9CA 2XXJA 5G0UA 3IKTA 3SEFA 5ICSA 3PJEA 2VUUA 5F1OA 2JD2A 1DB3A 4J43A 4UAGA 3WOHA 1ML3A 4XGIA 1SBYA 2G17A 3RUFA 3RFVA 3RUEA 1O95A 4KQXA 5JO0A 4PZEA 4TRRA 2AXQA 4YYZA 1E92A 2HSDA 3ZU2A 2YHUA 2G82A 2JD0A 3MEQA 3F5SA 4B4VA 1Z6ZA 3UW3A 1FK8A 3C24A 2CDCA 5TJ9A 1YL7A 3JV7A 4BNXA 1YB1A 1T2EA 1DJQA 3OHSX 4XWYA 4PG4A 3AI1A 1FDUA 5EPOA 1TT5B 4MVJM 1GR0A 3ZV4A 2J3JA 2PKQP 2O3TA 2EP7A 1Y8QB 5IXSA 1M2WA 2JAHA 3VZRA 3U5TA 1I32A 3JQ9C 3W8FA 2YDYA 1GZ6A 3AY3A 4R5HA 1NFRA 1LDEA 4ZN6A 2NV6A 1YH3A 3RKUA 3ZZNA 2PLAA 4YJGB 5JY6A 1DIRA 2RHRA 1FDVA 2WE7A 3PFWO 1JA9A 5HRUA 5DCYA 1Z82A 4W7HA 1K2WA 4MKRA 4A03A 4A5OA 3TOZA 4DMMA 4WUVA 2PWZA 2D5CA 4WCFC 5TS3A 1HYGA 5DZSA 4PN3A 4R54A 2Y0DA 3JD2A 2VZ8A 2B0JA 3I23A 1ZH8A 2R2GA 3ENNA 3FN4A 4CLOB 1R4NB 3AU8A 1HYEA 1ZJZA 3I9OA 1A72A 2JJYA 3VHRA 1ENPA 3B6ZA 4QSMA 3M2TA 3DAPA 4J0FA 4E2XA 4I1IA 3C1TA 3SBOA 4O1MA 2FOIA 1I2BA 2I9PA 3I1JA 4HNGA 2Y68A 2NU8A 3CE6A 4BNFA 2Q50A 4TROA 5JCJD 3H3FA 4OL9A 3R6DA 3QVOA 1BW9A 3I3OA 2GZ1A 3JYQA 4FQ8A 4H7PA 4D3FA 1E5LA 5IN4A 2O2SA 5JNLA 1BDBA 4BUCA 4QT0A 1M6HA 4OGWA 4XYLA 4L8VA 2XXBA 3OJLA 2C5EA 2QRLA 4YQYA 5A9RA 5BR7A 1HDOA 1B3RA 2DM6A 3GDFA 4AJEA 3CMMA 4I5GA 4PLVA 3PZRA 2GGSA 5AXAA 5KVQA 3LT4A 5H82A 2HMWA 2NACA 3BTUA 3U09A 4J1QA 4XGKA 1UZLA 3H5NA 4P38A 3BYZA 2IZZA 4MPDA 1DFGA 4RQTA 4O63O 1EMDA 3ZI0A 1Y8RA 3WGGA 4B79A 5IJZA 4KOAA 3UUWA 3UICA 3ONDA 2EW8A 5IDXA 1QLHA 4BO2A 6ADHA 4E5KA 1OMOA 1HZJA 1RM4A 3WTCA 1D7OA 4XQCA 3D4NA 1P1FA 1YWGO 3DZIA 1YXMA 2CY0A 3G0OA 3HFSA 3LVFO 4FCCA 4RLHA 3FD8A 4FFMA 3ZWMA 4AJ2A 3RUAA 3F4LA 4AJHA 1PR3A 4ND3A 1BWSA 3S1LA 4I5EA 3S55A 3KEQA 1GU7A 3F47A 3OP4A 1KEPA 1YDWA 4JBIA 2GSDA 2ZYGA 3PQEA 4WEQA 1GEGA 3WMWA 5EMHA 3Q9UA 3ZWWA 4QECA 1JTVA 3DBVO 3GG2A 3ANLA 2QZ9A 1AHHA 2BFAA 4D44A 2RH4A 2B35A 4NFYA 2OZPA 2Z1NA 2ZQZA 4PLTA 4CR8A 2FR1A 4MVJI 2DKNA 3GRKA 1X7GA 3I83A 4IUYA 1LQTA 2Q2VA 2B4RO 1WWKA 2X0NA 5A3VA 5A3JA 1GL3A 3AM5A 1P1IA 1IL0A 1ZFNA 5CP8A 3F1LA 2PY6A 3UKOA 1BW9B 3ASVA 3FPCA 2VTEA 3HB5X 1Y6JA 2AHRA 2EKPA 2GN6A 4DQUA 4E2YA 2CD9A 3MJTA 4ND5A 1YOVA 4YRBA 4J4TA 2YZ7A 1ZSNA 2E49A 3GG9A 2V6GA 1GQQA 3DEYX 3NJ4A 3UF0A 1IZ0A 4GX5A 3LLSA 1ZCJA 4XR9A 5CPBA 3WB9A 1VI2A 1XKQA 1DIAA 3FSRA 4IDGA 2JFHA 4YAJA 2A4KA 3C1AA 2P5UA 3Q11A 4DIOA 4PG8A 5CFZA 1CQIA 2QHXA 4L74A 3ROKA 3ZN2A 4XQEA 3AFMA 2CNBA 1KVRA 1NNUA 4DYDA 4WJZA 2E6UX 1E7MA 4JGBA 1A4IA 2FPIA 4XIJA 1D4FA 4ONEA 1FXSA 2DTEA 1VJ0A 1Q7CA 1JDJA 4J6FA 3LT2A 4M49A 3KYDA 4BNTA 4IQ8A 4XRRA 1ZEMA 5HA5A 1BXZA 4J2HA 4HV4A 3KYCA 5ENDA 5EIOA 1Q0QA 4IPTA 3MTJA 1ADBA 3UHAA 4D42A 3WS7A 3F9IA 4H15A 4K1LA 4RCVA 4EITA 4YT8A 2HO5A 2PK3A 1GV0A 4YCAA 5BSFA 1WDKA 5K6AA 3HDQA 4M55A 2W90A 1ONOA 5IXYA 2DBVO 4UREA 1V3UA 1XWFA 4YA6A 1ARZA 2ZCUA 4KMSA 1PQPA 5BNTA 4RF3A 4UEKA 1G1AA 3PLNA 1LDYA 3HN2A 4OSPA 1ZK1A 2EERA 1ENZA 4BGVA 4FR5A 4LVCA 1E6EA 1YVEI 2UAGA 1YOVB 2DUUA 4ND2A 3AU9A 4EEXA 2DUWA 3ZV5A 4Q3BA 1PGQA 2UUPA 5DBIA 5IG2A 3H65A 1H93A 3MJEA 3NGLA 3OICA 1Z75A 4P4LA 5DULA 3ZGYA 2Y1GA 4BNGA 8ADHA 3VH2A 1BHSA 2JCXA 4MDHA 3VC7A 4DPMA 1J0XO 3JCZA 3K9QO 4CR7A 4AJKA 1YS4A 3KVOA 4FSHA 1PJBA 1HWYA 2WD8A 4LMRA 5JDIC 4PFJA 5FFFA 4K9DA 2ZB7A 1GY8A 3GGOA 1UAYA 1PJSA 3CIFA 1N7GA 4QFDA 1Y5MA 4R1NA 3ZNOA 2V65A 1Q0LA 1WZEA 3AUAA 1M75A 1Z7BA 4M87A 4ALMA 3VKVA 3IJRA 2WM3A 4ID9A 1ZXBA 1BVUA 3RI3A 2DFVA 3BHJA 1TA4A 3IOYA 3KYDB 3QW2A 3T4XA 1C0PA 3WYEA 3VPGA 4NZ9A 4A2CA 2Y1DA 2HAEA 1QYDA 3KYCB 1HDCA 3G3EA 1LSOA 6LDHA 5EINA 3RUDA 1VKNA 5IDQA 4J4HA 5F1PA 1T25A 4NDNE 2O4UX 3O03A 1GQYA 4ZQFA 3GAZA 2GPTA 1B15A 4E31A 1NWCA 4W9NC 5TRTA 4CPDA 2VYVA 4RDHA 4RZHA 4D7AA 3HNPA 4WLOA 4EYEA 4B7UA 2YQ5A 1P1KA 2CVQA 4RF4A 4RPLA 3I9NA 2F1KA 4HXYA 3E5RA 1BVRA 3GF4A 2B37A 4J0EA 3K5PA 4F46A 1HE2A 3JYNA 4JJGA 3RWBA 2P4QA 4L73A 1BG6A 1GQ2A 1TXGA 1P9LA 1YQDA 4N18A 1A71A 1MC5A 4H3VA 3VZPA 1NAIA 4XD2A 1T2FA 1YDEA 1N9GB 1H6BA 4E12A 4NI5A 5F21A 1EFKA 1U2GA 4RPGA 2NVBA 4XGNA 1PL8A 2VTDA 4YAIA 3F6YA 3QVSA 4JCOA 1L7EA 3SC6A 1A9YA 2AG5A 1QRRA 2PNFA 2NU9A 5IAAA 3KHUA 3GHHA 3OEWA 4Q3EA 3GGPA 2DT5A 3IAHA 3ORFA 1A7KA 2ZB4A 3ZHBA 2VYNA 2P9GA 2HJRA 4BO0A 4D41A 3RD5A 1UH5A 2B5VA 1UZMA 4WGGA 4RDIA 4RQUA 1G6KA 3RFTA 1CWUA 1ISJA 3WGTA 5AVOA 1CIVA 1P3DA 3TFQA 1N1GA 3ZV3A 2OHXA 5CEFA 4AJNA 1WW8A 1X0XA 2HMTA 2X8LA 1T2CA 3SVTA 3BIOA 1EQ2A 1PGJA 1XLTA 4KUHA 3M6IA 3NUGA 1B2LA 4BKQA 1T4BA 1PEDA 2E48A 4CJXA 1I30A 4TRMA 5JDCA 2O7QA 2J3IA 3TNLA 3AFNA 3QWHA 1Y1PA 1I10A 4J3FA 3FCOA 3NEPX 3AUUA 1O5IA 4BV8A 2Y99A 5AYVA 3W1VA 1H2HA 1ZO8A 3ZW8A 2XOXA 2X22A 3PFFA 4EUFA 3WNQA 4W82A 2FN7A 2NTNA 4BNUA 1K5HA 5TQVA 1IE3A 3JQDA 3ON5A 3PQFA 1P1JA 4HP8A 1KVSA 1GYPA 5HM8A 1QV7A 4AICA 2CSUA 3G49A 4IGEA 2B5WA 4GPD1 5DCUA 3SLKA 3L9XA 2J5KA 3TJRA 4GX0A 5CEJA 2FZWA 5G0SA 5KKCA 3PIDA 1NXQA 3RASA 4CQLA 2OBNA 5C7IO 3UCFA 2YFHA 1D1TA 4BNWA 1T1SA 3E82A 3KSUA 4CV0A 7ADHA 3WQSB 4TKLA 3JQAB 5IDYA 3DBHA 1FMCA 1SOWA 3PVZA 1S6YA 2FWMX 1AXGA 5A5FA 1HDGO 1RM0A 2X1HA 4DLBA 4YWJA 4LW8A 2LDBA 4ITUA 3PGXA 1GUYA 2AEJA 2GO1A 1QYWA 4I5FA 5KVVA 3NJ8A 5T67A 3EY4A 4IDFA 4PCVA 3TRIA 4WNIA 2ET6A 1W6UA 3DDNA 3A14A 1MP0A 3LZ6A 2VWQA 3EZYA 3LDHA 4D0SA 2RIRA 2PKQO 1KY4A 3WBBA 3DHEA 3ZNQA 4BKRA 3WGOA 1MGOA 4HFJA 1E1LA 5IZCA 2I99A 2I67A 5T8KA 5A04A 2BGMA 5B4VA 4DXHA 4QTZA 5C7OO 3QRWA 2ZB8A 3FTPA 2HJSA 3CKYA 3JQGA 4JP3A 4ESOA 2D1YA 2WD7A 4ZRMA 3FPLA 2RHCA 3DTYA 3QIVA 1ZW1A 4K6FA 4Q39A 3BMCA 3LYLA 1JW9B 4M54A 3X2FA 2DC1A 4PIVA 3OQBA 1JU9A 4HADA 3GDOA 3UN1A 4NR0A 2OUIA 1V8BA 1ZEJA 1W73A 1WDMA 3STHA 1ISMA 3I9LA 5TF4A 4XDYA 4ND4A 2WDZA 4U6QA 3P2OA 2VOJA 2ZYAA 1U7HA 1DC6A 2R00A 3GVHA 5I8WA 4S3MA 3FRJA 4AJOA 4Z9FA 3WIEA 4DQVA 1E3IA 3HB4X 2P9EA 1BDMA 1NVMB 1QV6A 3GVCA 3HFGA 2CF5A 3LQFA 1E0DA 5ADHA 3QSGA 4OXKA 3ZU4A 2UVDA 3JQEA 4RPKA 3EK2A 4NFHA 1XGKA 2BMAA 2VHYA 2WTBA 1MA0A 4CQLB 3PP8A 2EGHA 3F5QA 1ZSVA 4YRAA 4M8SA 4EGFA 5TSDA 1SO8A 5JFOA 4QO7A 1G0NA 2JFGA 4PG6A 3WGIA 3DBHB 3T7EA 5F3RA 2PH3A 3DONA 3RKRA 4UUOA 4ZU3A 3JQAD 4UVHA 1ADCA 1E7YA 4Z3DA 4FOOA 4EUHA 4PZCA 3S8MA 1HE5A 1M67A 2R6JA 3AJRA 1JLLA 3BTVA 1J5PA 1I3NA 1HXHA 4NK4A 5AQ1A 5DBFA 5G0WA 3P2YA 4FOSA 1SCUA 2QZZA 4OJNA 1EE2A 4AJLA 4OKIA 4E6PA 1B14A 3AM4A 4Z0HO 4B3HA 5ILGA 3WX0A 3NDJA 1LDBA 5COQA 4GLLA 1VSVA 5FEUA 3KEOA 2GN9A 4YDRA 2B69A 3JD3A 5CDSA 3ASUA 4GSLA 4TMFA 4CMHA 1ISGA 3EC7A 3V2HA 2C7GA 3MOIA 3RSHA 4J2OA 2GZ3A 4IMPA 4PLFA 4HBGA 1F8FA 1K3TA 2UV8A 3JQGB 3K2BA 4DRYA 2WD7B 2C07A 4YB8A 3R0IA 3BMCB 1E5QA 3ZWVA 4WLEA 1H9BA 1IPEA 3KM0A 3NKLA 3ENKA 1B7GO 1FJHA 4GGOA 4OHUA 5A5EA 3QE3A 3GN2A 3U0BA 5I7EA 2IEBA 5LC1A 4W7IA 4WASA 4N5NA 4ZVVA 1C0IA 2IZ0A 4LRTB 4CUKA 3JYPA 4CLOA 2AW5A 4U8GA 4FGSA 4HY3A 1DRVA 1ZUD1 5T6BA 2EKLA 4XCVA 5JBIA 4CMEA 2V7PA 1ZMTA 1ULUA 3BA1A 4FJ1A 4HKTA 3FNFA 1GAEO 5C3MA 1OOEA 1DRUA 3ZHXA 3PHGA 5L4NA 5JDCC 2GCGA 3OIDA 2BELA 2C29D 3H2ZA 4YRDA 2D0IA 3U62A 5L4LA 5A4DA 4MP8A 1MLDA 4JJIA 4AVYA 1PJTA 3JQ8A 1Y9AA 4OSOA 4RL6A 4B7CA 3OMLA 4DBVO 5FI5A 1A4UA 1VM6A 4DL9A 4BQPA 1V9LA 1X13A 3GOHA 4Z0PA 5GMOA 4RVDA 3F46A 4YVFA 1NX6A 2GN4A 2ZTLA 4KUEA 1ID1A 2V6BA 5DP1A 2BHLA 4YT5A 4CR6A 3CXRA 3ZWCA 4U0KA 3NDIA 3RUIA 4TRJA 2BRUA 1HE4A 3BAZA 5JO9A 3MCVA 1PX0A 4NH4A 1ULSA 3W4IA 3PTZA 3N58A 1GCOA 4IJWA 3COSA 3RIHA 3NTRA 2Y93A 2EEZA 2IEDA 3RBZA 1K6IA 1KERA 3CEAA 5HS6A 4G2NA 4MKZA 1U2DA 3NX4A 3TZ6A 3QWFA 5B1YA 1Z74A 2HQ1A 1D3AA 3CZRA 3KB6A 5BQFA 2HK8A 1A7AA 3INRA 4IINA 2C7VA 2DBQA 4FJ0A 4DPKA 4XYMA 1KEVA 4TQGA 5I9LA 1PL7A 1MC4A 3PYXA 1U8XX 2ZJ0A 2D4AA 1I0ZA 3P7MA 4J1NA 4JN6B 3VTFA 4CMIA 4IJVA 4D79A 1HKUA 5JS6A 3Q1LA 2C5AA 4OXNA 4ZRNA 2P4HX 5A9TA 3BMNA 2NU6A 3B1FA 5BNFA 3U9LA 1LSJA 2OORA 4EZBA 2D59A 3D5TA 3GK3A 3V2GA 4P22A 4BKOA 5IZCC 5T8KC 2W4QA 4GMFA 1EQUA 2G76A 4FFOA 4MJLA 2X9GA 3VPHA 4MVJP 2DBRA 4MOWA 1HSOA 4GWGA 1ADGA 1CQJA 1IHYA 5JDIA 2VQ3A 1HEUA 3QA9A 4YR9A 2VN8A 2Q2QA 3JQ8B 3BMQA 5KWEA 1U7TA 1TT7A 4TZKA 1DXYA 3FBGA 1DJNA 4G81A 3WDSA 1RWBA 4XQ9A 2J5RA 4WOJA 3Q2KA 1EUCA 1P0CA 2EIHA 3WLFA 1LRKA 5KIAA 2R00C 4IIVA 4RVGA 1XQ6A 1XDWA 3PJFA 1VL0A 5ICMA 1HRDA 2C0CA 3WJ7A 4LCJA 1JVBA 3ZWOA 1ZK3A 2QRJA 4D3DA 3L9WA 3DFZA 4BNIA 4IS3A 4R5MA 1UP7A 3B1JA 3DB2A 4IXTA 1F8GA 3V1TC 1LLQA 3CSDA 5TT1A 4W9NA 4E5YA 3DZFA 2VZ0A 3FR8A 3CMCO 4N5LA 1O6ZA 3BTSA 1UXKA 2VT2A 1MXFA 1YQGA 3D3WB 4F3YA 3DOOA 2XF8A 1HLPA 1IUKA 1UR5A 1RKXA 3DZBA 3O9ZA 4K6CA 4CLHA 1ONPA 2FP4A 4AL4A 3GQVA 5BSHA 1XSEA 4QX6A 3TZKA 4INAA 2PZMA 5TLSA 1GYRA 3QV1A 4YPOA 4RO0A 1GTMA 4CV2A 3VAZA 1LBEA 3ABIA 3O4RA 2OXIA 2PZLA 2JHFA 3VPXA 4GWKA 3WIDA 3MJ4A 3RC1A 1F17A 5DBGA 1QYXA 2NQTA 4CMIB 1SEPA 2Y05A 1HTBA 5JAZA 4KDFA 4RJTA 1NPDA 5DF1A 2PD4A 1HDRA 4XA8A 3HUDA 3M2PA 1GEEA 4CMJA 1OFGA 2IZ1A 1T1RA 1EK5A 2YYYA 2OMEA 3BMNB 3M1AA 4M1QA 4YJDA 1SMKA 1LLCA 3B20A 1PS8A 3CZMA 3H7AA 2VHWA 4E30A 4DPLA 2EKQA 3KZVA 3ZH2A 1XA0A 1YL6A 1NPYA 3TOXA 4GKVA 3LT1A 1JVSA 1E1MA 1X7DA 2D3TA 5L51A 1LLUA 3PDUA 3S2EA 3DO5A 2O3RA 1PJQA 2Q1WA 2VT3A 3VZSA 1ZNQO 3BMQB 4DIFA 2Q49A 4IDEA 2HKIA 5EESA 1OZAA 1E6WA 2NM0A 3BMOA 4QEDA 5TT0A 3E1KA 3PHHA 1NVGA 4NIMA 2PGJA 4CMEC 3V5NA 3E48A 4KQWA 4CM1A 4MVJG 4OAQA 3JSAA 1BXKA 4XYGA 1TEHA 5CG1A 1DRWA 3DBLA 3FBTA 3OJOA 4HFNA 1IPFA 1GZ3A 1GYQA 4EJ6A 4F6LA 3KXDA 3GPIA 2D8AA 1DIBA 4NPCA 1SNYA 3HQ4O 5JXWA 5C5IA 2J8ZA 2FR0A 4PRKA 4WCDA 1GPJA 1EVIA 3GUYA 4EDFA 4MP3A 4B4WA 3NGXA 3H5RA 1B8VA 3E5MA 1JQBA 4K26A 2CF6A 1LLDA 1R12A 3TWOA 1PJ2A 2ZCVA 3HDHA 3LSYA 4FN4A 3HWRA 3UXYA 2DLDA 1XG5A 2B4QA 4OYRA 3ANNA 4E3ZA 1EVJA 4BOYA 3PDJA 4P4GA 3PQDA 1V3VA 1LSSA 4PVCA 2C82A 4IJUA 4S1VA 4B3IA 3DL2A 1KVQA 3H3JA 1EDZA 1YONA 2HU2A 3ANMA 1RJWA 4OH1A 4DMLA 4UUPA 1NR7A 3GC6A 3A9WA 1NHWA 5T5QA 4YEDA 1E3WA 3TSCA 2VWGA 5EQFA 1B26A 4PLHA 3HN7A 1KEUA 1ADFA 1PWXA 3OQ1A 4WLUA 1J6UA 1ZBQA 3ADPA 3TZCA 5CG2A 1GCUA 4XKJA 3SC4A 4EI2A 1LRLA 5IZ4A 5L9AA 4IM7A 3ROPA 3AY6A 1YE3A 5I9NA 5DOZA 2ZTMA 4EUEA 2VRCA 2HMUA 3GN1A 3GZNA 1U8FO 4B3JA 2X7HA 1HETA 4YACA 3GDGA 3K92A 4II2A 2Y1FA 4DLLA 4DA9A 1GFSA 4PVDA 4DREA 4YBZA 1N9GA 2EP5A 3BMOB 1VLLA 3BTOA 1KVTA 3PEFA 5L3ZA 3MOGA 4I5DA 5T64A 3WTBA 1ISFA 4GBJA 4A27A 4A26A 2V6FA 3IC5A 3UH1A 1NR1A 5U9CA 2IDZA 3OQ6A 3GR6A 4AJPA 4Y98A 5LDHA 3AUTA 1XELA 4KZPA 3PHLA 1GD1O 1LUAA 2X0RA 2XAAA 2X5KO 3SJ7A 3DBLB 2A94A 3OF2A 4J9UE 2C54A 1LI4A 4UUMA 3RROA 1JKIA 4IQGA 3CINA 3U4HA 4B8WA 1I01A 2X86A 5HWSA 1EVZA 3UOGA 3INGA 4J49A 3UFXA 4XR4A 1B0AA 3BXXA 5BSEA 3PWSA 3EMKA 2VWPA 2JAPA 2AE2A 3ETDA 4NJOA 4JP2A 2FY8A 4FC6A 4DC0A 1QR6A 4UULA 5MDHA 1SAYA 4AFNA 4AG3A 1I5RA 1WXDA 4R51A 2OOSA 1YKFA 1OC4A 2OP1A 1PJLA 5C37A 1VPDA 4OOFA 2DVMA 1UXGA 3JD4A 3C3XA 4OQYA 4WKGA 4XEHA 2PD6A 4IZIA 4HNHA 1B8PA 1E7WA 4M89A 2NTJA 4A7PA 5BNIA 1MG0A 2FMUA 1E3WB 4O5OA 5L7TA 4GAEA 2CZCA 1P44A 1WMAA 4J91A 1VKOA 2VCYA 5CHEA 3ICPA 3KYBA 5CDUA 1B8UA 3FNHA 1O89A 8LDHA 3GZNB 3M1LA 2I6TA 3V1YA 2EXXA 5I7FA 2EHDA 3ETGA 4Y6PA 5JYDA 4DWVA 3UAGA 4CM3A 4BNLA 3DQPA 4B4UA 3I52A 3JQAA 3QWBA 4PLWA 2JD1A 3WGHA 1E3EA 1JKFA 4FW8A 3DZHA 3GMDA 4L76A 3D1LA 1BSVA 1LXCA 3DAFA 1BMDA 4MP6A 3ZWXA 2VHXA 3VPFA 1ZVMA 1C1XA 1AGNA 1U5AA 4GMGA 4HFMA 1NVTA 1H94A 1DDOA 5CDGA 2YDXA 1DFHA 2NQ8A 1YO6A 1DIHA 1AE1A 1U3TA 1U28A 3H9GA 5JY1A 2PKRA 3GA0A 3PHJA 4UVEA 4Q3AA 4L4RA 4D0RA 2AQIA 4FIZA 2CVZA 3SXPA 4LVUA 2DFDA 3GVIA 3L4BA 5IFLA 5A06A 4Y67A 2P2SA 5JMPA 2CDAA 4Q3NA 3ZNNA 3NAQA 1XQ1A 3KUXA 4XB2A 1U3VA 4ILKA 1K0UA 2BFMA 2FSVA 2X6TA 3NT2A 2I5PO 4EEZA 3OBBA 4RV9A 1U4SA 3DMYA 4B4OA 1KVUA 1V6AA 3L4SO 3C7AA 5IF3A 4YAKA 3KSDO 5DT9A 4IZHA 2HCTA 3EGOA 3G17A 1W0CA 2QRKA 3HZZA 2VRBA 3GEGA 5THKA 4B8ZA 4HFRA 3C8MA 4NQZA 1PGNA 1I3KA 3ULKA 2HK9A 3S2GA 3NDRA 1F14A 2PFGA 4MIYA 3NRCA 3I5MA 1TLTA 1UDAA 1E7QA 3GRPA 2YV2A 1WPQA 1YRLA 4MIEA 1P74A 1W8DA 2ZTVA 1HDYA 4Z0TA 5H83A 4Q3DA 3E8XA 4Z3KA 3TDKA 4ZGWA 3DOCA 2AQ8A 5AOVA 2BF7A 4MKXA 1LC0A 2VRCD 4XRGA 3E03A 3LF2A 4R1TA 2EJVA 4NBUA 3ZHYA 4ALNA 4YT4A 1XHLA 1K6XA 3MWEB 1C0KA 1F06A 3GNQA 5KVSA 1XU9A 3QVWA 2J6IA 2YV1A 2F00A 2VOEA 3C7CB 2ZATA 4RVFA 4OO3A 4E5PA 4NMHA 5KKAA 2GUGA 5COBA 4GVXA 1C1XB 1LX6A 1Y9EA 2EW2A 1UXJA 2X9NA 5A02A 5KTKA 4Q3CA 4WECA 4DLAA 4PZDA 1H6DA 4F45A 1Z45A 4GSKA 3HG7A 3RC2A 3O38A 3WGZA 4NK5A 2ZB3A 4Z9XA 1E77A 3ZU5A 3AY7A 3G1UA 4RF5A 1DEHA 2Q2WA 2HK7A 4MVJD 3TPCA 2GZ2A 3LC7O 4HWKA 4EW6A 3UVEA 1XCBA 1V3TA 1L1FA 3OETA 5TGDA 5G0VA 3ONEA 5CDTA 1ZIDA 1AN9A 2BD0A 3U4DA 3Q0EA 1CJCA 5AXCA 2PZJA 3FTNA 3RUHA 4J1SA 2CFCA 3B70A 4UVGA 5F5LA 2X5JO 3RBXA 1P33A 4BNJA 1QKIA 3BHIA 1XEAA 5JAIA 3RJ5A 2Q45A 1IB6A 2C2YA 3WXBA 4O0LA 5JAQA 3V2UA 4GGPA 1HZZA 2YHIB 5EERA 3WJAA 3FWZA 4BHTA 3BZUA 4IGFA 5A03A 3KLPX 2GASA 4BGUA 3OA2A 2Z1MA 4CM6A 2NUAA 1LU9A 3E9QA 1N1EA 1X1EA 3DZKA 4W6ZA 3AOEA 3H9JA 1M76A 3D4OA 3E18A 1G0OA 3IUSA 1WVGA 1X7HA 3OA0A 3W6UA 3V1UA 1OI7A 4Q9NA 2ILTA 4BB5A 2ZTUA 1FDTA 3WYCA 2NLOA 4KTVE 2O23A 3DAGA 3JQ6A 5DCWA 3JQ7A 1QMGA 1LQUA 1QLJA 2GDZA 4MIOA 3MZ0A 3OEYA 4J16A 4O6VA 5U1PA 3WFIA 5I7VA 2YW9A 2WYUA 3CUKA 2Y1OA 1UXIA 1LTHR 1YBMA 4IIUA 1P0FA 1Y5RA 2W2KA 3Q3CA 4NHEA 5HS4A 4JBGA 2GYYA 3D0OA 4OQZA 3CTMA 4DVJA 2O4CA 4IDAA 1ZSYA 3NT5A 3A1NA 1IY8A 3A4VA 4EJ0A 3HE3A 2WEKA 4R1UA 2JCVA 4RORA 5B4TA 1PZGA 4NJMA 4R9RA 4DTIA 3INTA 1HF3A 2O3UA 3GVPA 4BNYA 2ZYDA 3RUCA 3PYMA 4WLFA 1N92A 1SC6A 3A28A 3E9NA 5TJHA 4BKUA 1BXGB 1YJQA 1QYVA 1R6DA 4ZHSA 1NQTA 1DIGA 1GDHA 3RBVA 4RVUA 3DTTA 4K28A 4BNMA 3FNEA 1HDXA 2JCYA 2BLLA 1CDOA 3OM9A 1C1DA 2I3AA 4XDZA 3ZCXA 3I9JA 3ZHZA 1I2ZA 1T4DA 4R01A 5GZ3A 1DAOA 2HUNA 1H5QA 2BI7A 4IMRA 1DLJA 3L4BC 4PG5A 3ZWBA 1PJCA 2VZ9A 5K9ZA 1V0JA 2Y1CA 3Q6IA 3EVTA 5FYDA 3LU1A 4TVBA 5A1TA 4LK3A 1CETA 4MVJF 2YQ4A 1KYQA 2OGUA 1WP4A 1P1RA 2BGLA 2I76A 4MINA 4DYVA 1UJMA 1EEHA 1F0YA 2QW8A 3GFGA 1K89A 1F12A 3K73O 4I9HA 1PSDA 2ZJ1A 4BGEA 4FPXA 2E4AA 4LCEA 3TN7A 4UUNA 1ZK4A 3HHPA 1LJ8A 5I9MA 4NG5A 3H9QA 2H5LA 1N7HA 1UAGA 1V35A 2NU7A 3AM3A 5C7LO 1JWBB 2OL4A 5FI3A 1PU2A 1SOVA 3JQ7B 2G0TA 3EHEA 1EFLA 1ENYA 3PYLA 3EVNA 3GH3A 3GGGA 4BQRA 1H0KA 4C7JA 4FS3A 4BMNA 3RFXA 5JE8A 3LK7A 3JD1A 4YAGA 3AOGA 5KJFA 1KOLA 3WYBA 4UVDA 4PRLA 1ENOA 4QXMA 5BSGA 2W2KB 3H9EO 1WDLA 4QUKA 1J4AA 2ZQYA 2AQHA 3E6AA 4L0QA 1X15A 3FWNA 3Q2IA 4ZJUA 1HLDA 1B3BA 1PR9A 3UCEA 1H9AA 1Q1NA 1T2AA 2X0JA 1MB4A 2A9FA 3U49A 4FB5A 3PXXA 2YUTA 4U0JA 3A06A 4NJMB 1ZJYA 3EUWA 3PLRA 5B4UA 3D3WA 4KWIA 4LRSB 4CM4B 1YBVA 1DSSG 5K0ZA 1A5ZA 1IHXA 4IS2A 3DMTA 2BFOA 4NU5A 4WNCA 3WFJA 1NHGA 1NFQA 1N8KA 3GNSA 2J3KA 4BO9A 3PIIA 3QY9A 1TB4A 3D4PA 1C1DB 1MX3A 3PK0A 3S2FA 4JJFA 1KBZA 3NTOA 3CPSA 3GNTA 1JKJA 1R0LA 3P5SA 1PS0A 1DC3A 1WAMA 5ITVA 4PGFA 2JHGA 5JSFA 2HRZA 1KEWA 4U7WA 1IOLA 1B16A 3GT0A 2EF1A 4XX0A 5KJ6A 2X0IA 3X2EA 1X14A 2AG8A 4NBWA 4FD3A
chains in the Genus database with same CATH superfamily
2A59A 3JQCA 2HJHA 1VGQA 2AXEA 3V7FA 1U0JA 3VOSA 1TLLA 2XUPA 4YRMA 3L6CA 2HNBA 2A4MA 1D4AA 1NWHA 3UJ7A 3COPA 4DQXA 3EFEA 4LZLA 1N0WA 5BN4B 1ZI8A 2HF8A 1NN0A 1AXEA 3DW1X 1RPJA 1JEOA 4MV6A 5C4GB 5TNXA 4J7UA 2EZ8A 3RF6A 4H16A 1LBHA 2RJOA 3U3ZA 4A0QA 4BC0A 4ZI3A 5JZOA 1N1MA 1OU0A 5AKYA 4E13A 2A5GA 3H83A 1FC0A 1HTWA 5DNVA 2O8BA 1HZZC 4W9MC 2O7SA 2I80A 3KXKA 2DMRA 2HBRA 1M6NA 2JFPA 2OAQ1 2Z5FA 1EWTA 1GLGA 1JEYA 4S1PA 3GZ4A 4MUHA 2VATA 3QKIA 4N54A 3UV7A 4FM9A 3ROGA 5FQNA 4DY6A 4DSUA 4II3A 2Q3LA 5DIFA 4DLPA 4FE3A 1QZZA 1L3BA 1SHKA 2RHOA 2XCUA 3RPEA 3ZKAA 4ALKA 1I7SB 4M0PA 3DLTA 5ALPA 5CB4B 1ZD9A 5K4HA 4WXPA 1AB5A 4CUZA 1AOXA 3IODA 3QPVA 4U7JA 4ZT7A 3ODPA 4RWEA 3VX3A 2IXFA 3TDMA 4RFSA 3SYTA 3ERCA 1S2NA 2YUIA 3CGWA 4OP2A 2D00A 2MHCA 1L7DA 3AERA 3N07A 1E69A 3BXHA 5JARA 3EIUA 2Q07A 2ZKLA 1Y3IA 4N12A 3WJ2A 3W5DA 3HVUA 4GVLA 3OT5A 1PWEA 1UZNA 2NP7A 3AKDA 3OH8A 3TH5A 2CFOA 3P94A 4A0SA 1KYTA 5G41A 3HCNA 3BJRA 1BDJA 3M5PA 1GUZA 1VLMA 1WU7A 3Q7TA 3LLCA 1TW2A 3WBFA 3EZLA 4RPCA 1PFUA 1N36B 3A2KA 2AEFA 5E7JA 1KDPA 2VUHB 1E4OA 2PD3A 2Q0QA 4FFBB 4NBSA 4BV9A 5LQJA 1Z22A 3C98A 2XIQA 2WHXA 3WMXA 5DGTA 3HJUA 1YS6A 1MO4A 3O8QA 2QVCA 3BSYA 5EJ2A 1UJCA 1C0EA 1C7FA 5JS8A 2KQUA 4JLBA 4OM7A 3VVBA 1CK4A 3GEEA 3UA4A 1YULA 4XX0B 1E4YA 3U60B 3AJDA 3HBMA 4N7BA 4LC1A 4KU4A 4KXVA 5DNAA 4Y1EA 1C7EA 1YE5A 3LCJA 4JH0A 3H16A 4OI4A 4PYQA 1MFZA 1J20A 3NCTA 3ELDA 1G38A 2IIVA 1GNPA 1R5JA 2VWHA 3ACCA 2P91A 5B12A 1YZNA 4PU0A 2AJLI 2YN4A 3VGPA 1T2NA 3E7PA 3TLAA 4F9GA 2H2WA 3QOXA 3QXHA 3F3MA 3VR5H 2BHSA 2ES4A 4OB6A 5EG5A 5C5EA 2J87A 1IN1A 3CX7A 3DP9A 5ALSA 4Z53A 1KKLA 2Z5LA 4KHPB 1MQSA 1ZIYA 5KREA 2AIRA 1CY7A 2JJ2A 3WWZA 3KVRA 2AA3A 1N4DA 3N8IA 4RA6B 3ESRA 3VOTA 1LK0A 1S02A 3T34A 3UCXA 5BMOA 1S8FA 4LF7B 4ZQIA 2H1RA 1HEIA 3UJAA 2DPGA 4RXTA 2HV8A 4BKPA 2OD7A 3RHTA 4BMOB 4D98A 2FWBA 1PBTA 2ADMA 4JXKA 5AH0A 1BQ4A 1XTBA 2LWIA 2W8ZA 3IEVA 2KE5A 3UGKA 5BW5A 2DPHA 5B37A 1HX7A 1GADO 4NXMB 2OQ2A 2I66A 2E1RA 1MR3F 2PKYX 1H0SA 1I4LD 3I6IA 9LDTA 4CKEA 4JZYA 2D0OB 4HLNA 3T3NA 4CF4A 2BGNA 1SUSA 1E3SA 1N25A 4ZDWA 4M1WA 2R6ZA 3NFYA 4TYMA 5BYBA 1KY2A 5JC1A 2JLVA 4RFSB 3FR7A 3KQKA 3FA2A 1Y9DA 1D2HA 3C3AA 3C5HA 2E85A 3AERB 2FE1A 4CL8A 1RM5A 4LN1A 5JPIA 1PTJC 3VOAA 4I7EA 4JNCA 3R5HA 4EGJA 4UEWA 3I37X 4LOLA 3VDMA 3ZHQA 3E1GA 4YMIA 1D2MA 1YVPA 4GR4A 1G5FA 3ANYB 1IUPA 1EVKA 1UDWA 3C8HA 1OBOA 3OIGA 2IV3A 3VU3A 1PKEA 4BP3A 1SKQA 4HSGA 5EJGA 4UOEA 1WO8A 3K31A 4Q7LA 3LH5A 2NNLD 1GAQA 1DO0A 1FW8A 3EEOA 5E9JA 3KR0A 5DE3A 2EV9A 1X1RA 3LWBA 4JLUA 4WZAB 4CI0B 4G56A 2QM8A 3PDCA 4OFBA 2D5AA 3TD6A 5K0BA 2ECQA 1TIPA 3O8QB 4GZMA 4OHVA 1Y81A 2WJHA 3F2IA 5F2OA 2YMMA 5CAEA 3GLFE 2WYWA 3WLMA 2CV0A 4PAMA 3C4VA 3PL1A 1Q15A 3VJKA 1XYYA 3NWOA 5TQ2A 1I33A 2E37A 1SKYB 2Y0CA 4UBLA 2R5FA 4XLZA 1JYFA 1GRVA 2B94A 3WQBA 3EZGA 1RZRA 4FGKA 1H2AS 1UC4B 5CA1F 5DH9A 1BKSB 4X1IA 2Q4BA 1ETHA 3LIIA 3ZDZB 1PYOA 3P19A 2FGJA 4PBRA 1XTIA 2LVBA 3ETEA 3P71T 5LM3A 1J2EA 1KDTA 1ZZGA 3A0UA 3HJNA 2HLPA 3CF6R 3ESBA 1XD9A 2QDXA 1P80A 2VTVA 1GTVA 5F4ZA 2ZRMA 3WSVA 1GPYA 5JAOA 4Q5IA 1QTNA 1I36A 3PDIA 1PHRA 4KXFB 5IH3A 4LE0A 2PWAA 4CKYA 1K9SA 2QU7A 1DQSA 3VR2A 4Q4DA 1G63A 1LBIA 1GUFA 2HMSA 2QIOA 3EH1A 3L7LA 4GO1A 4RZIA 4TVOA 5EL0A 3IBGA 1YD7A 3EJ6A 5HIIA 4PC2A 1E1NA 2CEAA 3EFOB 3TXYA 4CMGA 5DRTA 4E4YA 5EZQA 3SD7A 2HC9A 1GTZA 2PZBA 3P0RA 4BVHA 1IBLB 5CUQA 3DOIA 4QAQA 4ENQA 2VHVA 2F3UA 2RH8A 3ACBA 2YCBA 3P9RA 1CY0A 4XOIA 1C3VA 3KKEA 4XJTA 1MOPA 5IKEA 4UBNA 1OTYA 1YBAA 1RXEA 1U3UA 1PAUA 1UC8A 1Y7TA 1RS0A 1Z8NA 2RC6A 3QJ5A 4Y18A 3THRA 4NYIQ 4DLUA 1DCTA 2FWPA 4MW1A 1WZ2A 1OZGA 4K6GA 4ENSA 1G3QA 2YVUA 3TI9A 3MVEA 3R0XA 4NCIA 4GZ5A 4DM3A 1Y8AA 1FTSA 3NTLA 2C4UA 1U7WA 1FDOA 1XQYA 2YL2A 2ODAA 3WNVA 3GAFA 4HRVA 3W06A 1A9XB 2WSSA 3LT0A 2ANCA 2P3OA 1R16A 2YOFA 1XZFA 3ZBUA 5B6IA 3IMEA 1GRNA 3RAFC 1AQIA 3KLMX 2HRQA 2O20A 3ES9A 2E21A 2EQBA 1EZ4A 2DH5A 3OFJA 3GUUA 1OLSB 3E5HA 1N6OA 4PSUA 1W7AA 1D7AA 2PS3A 4RMNA 1G60A 5D51S 3VJRA 3S6JA 4Y9DA 4XZ3A 5CAEB 4PLYA 3BULA 3Q88A 5K09A 2B7LA 2QQFA 3FTDA 4M9RA 2DU8A 4RGVA 4CBVA 4BMSA 2OGTA 2IYNA 4CQMA 1OVMA 3WWOA 5TQ2B 3L6OO 4IRMA 1A5SB 4CLDA 1SCQA 4BU1A 1V7CA 3H1TA 2AJTA 2IOFK 3EG5A 3IPAA 5SZHB 4A0HA 4D9HA 4J1TC 4ZYUA 1ILEA 3VKGA 3W2FA 1PT9A 4PC1A 1RKBA 2UZ0A 5LR6A 3D6MA 5LUAA 3HXPA 1YZUA 4GX2A 4X1IB 5MN6A 5JC8A 4KLRA 4DUYB 3AH8A 5TR9A 3T1HB 4FEGA 1O8CA 2JLAA 4N7JA 1FS5A 3WLJA 3ZZ1A 4EI8A 3ZEAA 1DFIA 4EJMA 2QQEA 4RY9A 3L0DA 1SCKA 3H5OA 1ZESA 3QPBA 4ZMSA 1NOJA 3PDIB 2O2XA 2C5SA 3GVXA 4OXYA 4GI2A 1U0NA 1CNFA 3C3EA 3EDMA 3LY5A 1TRHA 2WV7A 4JLWA 3TXAA 3CLUD 5DKFA 4FDLA 3MERA 3CA8A 3WLLA 5LQAA 1GHTA 1G8KA 1KZ1A 3KTDA 4FX2A 1LC3A 2B4TO 5LQMA 3EUAA 2RCNA 3TL2A 5I48A 4Y2QA 1DU4A 1ZIXA 2QLJA 1QH0A 2K87A 3AHFA 3KALA 5LXTA 4NU8X 1MZPA 1DS6A 2FTKE 3PQCA 3C1OA 1DX6A 2G7MC 4IAOA 3DAYA 1QLWA 1A95A 3NBUA 3QFSA 3QKUA 2A0FA 2WHPA 4FEAA 4HAWA 4JZKA 3VSBA 2XJ9A 4W5QA 5JAUA 4HX9A 2RAVA 3JVIA 3QJGA 4M1OA 1QAQA 3M83A 3WISA 1U2RA 4L5BA 4QQKA 3KT3A 3ORHA 4UEJA 1AZSC 3DE6X 1A96A 3AVPA 3Q9NA 5CRIA 4KAJA 1XAHA 1HYHA 1YZ3A 2CMDA 2GN8A 3QITA 5EFOA 2O6LA 3CLUC 3UIEA 4GPBA 2NTEA 2O8VA 2ZPAA 4H60A 4P3NA 2IYOA 4MR9A 5AKEA 4H2DA 4EEKA 2HADA 4JIMA 1J2UA 1JAIA 2P9ZA 2V59A 4YLGA 3AKZA 3IQGX 4IOMA 4KP7A 3SJUA 1B42A 1FOEB 2Q4TA 3PNVA 1HY3A 2B83A 3K2EA 4I08A 4EZEA 1QBKC 5JWRA 3AEKA 1BVYF 1PYGA 2K5UA 2ZZKA 2W2LA 1N6IA 4A1OA 1TK2A 1C0LA 4UDXX 2H51A 2EWMA 1Q7BA 3LUGA 4TVKA 4CM5A 4EFKA 5LKRA 2E4UA 3HJRA 3F74A 3L1IA 3SF0A 3FBWA 4HYEA 4BB9A 3U7RA 3E05A 4AZSA 4HDSA 2H57A 3NHUA 3A11A 1RPAA 3N74A 3KJEA 3CNEA 4CQMB 4PN3A 1Z2PX 1NUUA 1P7PA 4Q48A 2X5OA 2CYCA 1KMNA 4IY1A 3UZUA 2GB4A 2XW6A 1II0A 1XK7A 6CHYA 2DLNA 3AF3A 4C7KA 3AF1A 4FT2A 1FFYA 2IEAA 2GJ4A 4R68A 2FK7A 5EQDA 2Q3BA 2ZIAA 3IKJA 2LW7A 1M66A 3QU7A 5J2UB 1U2QA 4DR1B 1KR2A 1QYCA 3DBRA 3DEIA 3G02A 3ZW9A 3PKJA 1B43A 4U2FA 3IKVA 3SLGA 2A57A 3PF8A 3W3AD 5EIEA 2WM8A 4M83A 2B92A 4IIDA 3O1HB 4TS4A 3CX6A 2A1UB 2IPOA 2QRHA 3N7UA 4Q0MA 3KR2A 3UJ6A 2VDKB 4MLZA 1Z7GA 1YJBA 2C31A 1WMBA 3GGJA 1VFPA 5U4QA 2O48X 1CY2A 4X1YA 1EFTA 4Y7DA 1MXHA 5MFPA 4I1VA 3I6ZA 4GI5A 1WMFA 3P9KA 4N6OA 4QHTA 3PC8A 1N3IA 1NMSA 1VMAA 4HNSA 1R37A 3UAXA 3ICCA 3I39X 4OTZA 4RFLA 2IDKA 2RGCA 4F1JA 1W8IA 1NAHA 4BUJA 2PEYA 2QR2A 4GXTA 4LOHA 2A0WA 5KTSA 2BSAA 4RD0A 5K3AA 3T95A 4M1ZA 3NU1A 4N3AA 4TXLA 5JFTA 4LSWA 4D43A 1IVSA 4IEFB 4UHEA 4EG8A 1BMFD 3G9TA 3MJCA 4MR9B 4GLOA 4N65A 2AUMA 4G8BA 4YQEA 2IH2A 4NBRA 4XPIA 2HUPA 1FF9A 3FDIA 1MBZA 1T3HA 3KOYA 4IMIB 4QNRA 5B3AA 4CDRA 3PSAA 3CT6A 2OAGA 4YCSA 2CXTA 5ITWA 5AK5A 3TTTA 1WUIS 4RE6A 3AEKB 4RBNA 1IN5A 4ILEA 3P2KA 4ASUA 5FAKA 4Q3KA 1T8TA 2XEXA 2WKRA 4NESA 1DPGA 1IVYA 3ZNPA 3GUHA 1YZLA 4MCHA 1MIOA 4RTPA 3RS0A 2HA0A 5FF9A 3LBAA 4U7DA 1CR2A 4Z0TA 5IN5A 2R86A 4HDSB 4R71A 4I6GA 4FC7A 2H1SA 3H0KA 2NZVG 4B35A 3NTQA 2TMDA 3SWWA 4LZOA 3A27A 1H6CA 4ABYA 2F59A 4RADA 3KJNA 4BFCA 1KKUA 4BQIA 2JF0A 4MGYR 4S05A 2W2NA 2WJ6A 2GF2A 4MARA 3TINA 4CCYB 4E33A 3EXIA 3H2SA 1Y98A 1KI9A 3USCS 3ZY4A 1CUDA 3T9CA 4B34A 1H3FA 4XQGA 4WD3A 2CHGA 3L40A 3RS9A 1K3UB 3M6MD 5JS7A 4JJ6A 2PV7A 5KNLA 3DBRB 3EOZA 5EXXA 3ZHTA 1OH8A 2VNAA 4KMOA 1P39A 4CM9A 4JX8A 3AZQA 4D4MA 2IYFA 2VYVD 5KZMB 3NH6A 3OKPA 2I6SA 3G23A 1PSWA 3ZV6A 2ZZNA 2C2GA 4OHCA 4Q9AA 2GKGA 2ZRDA 4DHEA 1P6XA 4ROSA 4DUPA 2JLQA 4CG2A 3NHYA 4DGSA 2IHTA 5LDDC 1VJTA 1JT2A 4TTJA 3V7WA 1QPZA 4KFTA 4H31A 5JCJA 2R97A 2ZXFA 3F4BA 1EK1A 5DGDA 1EE1A 1ATZA 2ONYA 1NIPA 1OC2A 3A10A 4X1YB 5ECGC 4BNZA 1WNTA 1NM5C 1EBBA 4DA4A 1F6BA 1T5LA 4FNOA 3FWPA 3U4CA 3L4EA 5DP2A 4RTRA 4CTOA 4DLYA 2QRMA 4PNEA 1TQ2A 3N8KA 1K8RA 3LCRA 4L78A 4ZAYA 3L93A 3X1JA 2A35A 4ZQHA 4BNHA 3U1BA 1KHHA 5L7YA 2XWPA 2UZ4A 1KXJA 5AKKA 2WY2D 1TAGA 4C78A 3BJZA 2PTHA 2GFQA 1NONA 2FPGA 4K9MA 1G2PA 2I3BA 2BTQB 3QP9A 4DUGA 2XYVA 5GADl 4FBGA 1N8TA 4CCAA 1RLUA 2FRDC 2JGNA 4PLPA 5J23A 4TN5A 3FTCA 1FA9A 2DY1A 2QAIA 4DBLE 3H1EA 1T9CA 2BUCA 4JK3A 3KKKA 5BR1A 4M9SA 1PZEA 2VYND 1J07A 4F84A 3ED1A 4V3CA 5HP4A 2O2HA 5FEMA 4YAOA 1R00A 2WJ3A 1EFVA 2O3JA 1XCMA 3UUGA 2H9IA 4Q05A 4B74A 1A0OA 1MIOB 1NASA 3L1VA 3RU9A 3V8BA 1VRVA 1E79A 1TAUA 4FFLA 3DC2A 5HIKA 3RU7A 5BV1A 1ORDA 3DZGA 3X1DA 2HEIA 2JFQA 4M0DA 1VCHA 3CR8A 4MWOA 2X58A 2YIJA 1TRKA 2YWGA 5HBRA 2PX4A 1CEXA 1T1IA 1E1KA 3ELBA 2WU3A 1X8JA 2VP4A 2WTMA 4QLBA 1GZDA 4KAXA 3ZH9B 1NMYA 3C3PA 3EXIB 5PGMA 5EJIA 3TRKA 1AA6A 4UHHA 2CEKA 2C98A 3UC5A 3BERA 2GARA 1JVNA 1JQJC 2GTHA 2ZJ3A 4I6JA 5I5GA 4JY7A 1OA1A 1TF5A 1I4OA 3QX8A 2COKA 5IKXA 1BROA 3PI7A 1F8XA 1L5NA 3A58B 4XVCA 1UQTA 2QMYA 4II7A 2JFNA 2HRBA 2PYZA 5EKUA 4ARAA 4LBVA 1AV6A 2LDXA 3IMFA 2W4MA 1JWAB 3F67A 3IBFA 4R2XA 3DUFA 3NALA 4M0MA 2AD1A 1O54A 1D6NA 4CMBA 2BMFA 5AHXA 2CNWD 4KDEA 2IXAA 4E0BA 3CY6A 1MOSA 3I01A 1A27A 3I9MA 3WGYA 3VC1A 3I28A 4B76A 3U7GA 2O7RA 1XP8A 3QWAA 1RC8A 4Q7QA 4BO3A 2JGEA 2Q1UA 1VRWA 1HNZB 3AR9A 1KOFA 1X86B 2FSSA 3DO6A 4B2PA 4H1VA 3JR3A 5L3VA 4R8LA 2QMQA 3BA6A 4NARA 2F4NA 4R2LA 4UAGA 4CL0A 3HO1A 4GP7A 4UBKA 3RUEA 4JUAA 4KQXA 5AVXA 1T0PA 1ZU5A 2YIMA 2IH4A 1JJFA 3IVGA 3KE8A 1E92A 1UFKA 2HSDA 4IQFA 1E64A 4K6MA 4AY3A 2PXCA 1KP2A 2V74B 5K3EA 5JROA 1UPCA 2YWEA 5B7PA 2GPNA 1OFUX 2FPGB 3ZK8A 1E9EA 2L42A 4ZAWA 1FK8A 4HEA6 1G8HA 4UC0A 5JD5A 2O5CA 3C24A 3H97A 2ZRNA 1YL7A 3MWJA 3GJYA 3B7WA 4XWYA 3OHSX 5EZYF 5IXJA 2JIZD 2I9KA 5B3JC 1QO7A 3SBEA 3I8XA 3T61A 1EXMA 2F3TA 1CVIA 4N3NA 3A6HA 3OHPA 1NMEA 2VDQB 2FUCA 1F4LA 4IG9A 4GM4A 1F6WA 2QF7A 1EFVB 4PAQA 3OTGA 1RI4A 3VZRA 3U5TA 5BRJA 4TXJA 4JI5B 1VA4A 4DG9A 1NFRA 3BB1A 5FOTA 3WLHA 5CB6A 5D1HA 4DIEA 3UBMA 1QU3A 1Y63A 1NKVA 3HVKA 2PLAA 2XTNA 1Y7PA 3T06B 5ELXA 3KCQA 4B4KA 4UCQA 4LBWA 2X15A 1AHNA 3D8NA 3MFYA 2QVLA 3IAM6 3PFWO 4BX2A 3IIJA 3VOBA 4PM4A 3JQRA 2BKUA 1E2PA 4A03A 3HRKA 3PCXA 4QRHA 1GXSA 3EFBA 4Q6BA 4DMCA 2VF5X 3NBFA 5SY6A 5EVCA 4JUDX 3ZLTA 3D8TA 3GCZA 3DFMA 1I6MA 4KVFA 5DZSA 1O96A 2Y0DA 1W0JD 4KLZA 4O4JF 5FNVA 5IYZA 1ZH8A 1RRFA 5BSTA 1Z4PX 3AU8A 1HYEA 4O4LA 4L5JA 3VHRA 4J0HA 4TSFD 2YZNA 4TQAA 3M2TA 4HXGA 2ODNA 4QD3A 2WAAA 4EK9A 3DAPA 4AULA 5C9ZA 3L7JA 2V6IA 3PGMA 5DIZA 4E2XA 5B36A 4B40A 2FOIA 4NCHA 3ZC3A 1HC7A 4FP9A 5ALNA 3Q0IA 2B3TA 5E3JA 3TEFA 1XFAA 2C5LA 2OCYC 1VLHA 4MQ4A 1WW2A 2XQIA 2Y8EA 2Q6OA 1W36B 2PL9A 1P4JA 4TROA 1UT5A 5E1MA 4HEQA 2CVPA 3V32A 3JYQA 4JGGA 1XRJA 4Y6OA 1E5LA 5DW0A 2P3LA 3PVCA 3KKOA 1GRRA 4BUCA 3G89A 4X3OA 4H0NA 2HDWA 3L8FA 4OHXA 3URMA 2OWDA 4V0MA 2D7CA 1RYFA 2VLIA 2QRLA 2VP2A 1JR2A 1FYFA 2JGFA 3BBPA 2B0CA 4K9RA 1XVIA 2HJGA 3REOA 3R3WA 2IYEA 3WL8A 4YROA 1W6RA 4AJEA 4JEMA 4GYWA 1N6PA 3IHTA 5CNKA 1OH6A 5AXAA 2Z09A 1J7JA 2V7QD 1P60A 3JSXA 2PKCA 2GPSA 1FLVA 1FDIA 4P5EA 4J1QA 5IBRA 3ETCA 1JNXX 1UZLA 4WV3A 3UWSA 4E1BA 9GPBA 5GOTA 3WKCA 3X1YA 3QH4A 1DFGA 2GF9A 5H3CA 4O63O 4DE5A 1RT9A 4ZWNA 2L17A 1NV9A 2DH6A 4G67A 2Q27A 4B79A 4ZCPA 3UUWA 5HUQA 3ZLJA 4BMPB 3RVKA 3ONDA 2FV8A 1L7RA 3OZGA 3MW8A 2ATVA 4YQFA 1RM4A 3KPJA 4XQCA 2FW1A 1YNOA 1HQYE 3EFHA 2CY0A 3LX8A 4Z1MD 3HFSA 4URXR 1HFJA 1TM5E 2ZBUA 3UJBA 1SXJD 1AKQA 4FCCA 2ODEA 2GILA 3LNCA 1QDLB 4FFMA 4GP9A 4RLHA 1M8GA 3RUAA 1DG1G 2YMLA 3F4LA 1LVGA 4KVZA 5CVCA 3R7LA 3SNHA 3AVVA 3KZOA 4ND3A 1BWSA 4L7QA 2D1FA 2XWBF 3IURA 1GXSB 3OCXA 3OP4A 5FQOA 3S55A 4N9QA 4X00A 4QASA 1E61A 1ODJA 3A4YA 3DTVA 5ALKA 1GEGA 1OB2A 4AZWA 3VBCA 5EKTA 5AOAA 3DBVO 2OMKA 5FNVB 5IYZB 5E6UA 3OIUA 1HOTA 3QLTA 3O0TA 2NQ2C 4O4LB 4MUKA 5K3FA 4NFYA 2OZPA 3SVZA 1RVDA 2GNOA 2JIDA 5DM4A 5BN3A 5E0OA 2C3UA 5A4IS 1QDEA 4KW7A 4JI4B 2FR1A 4MVJI 2DKNA 1J1IA 1VXOA 2DFPA 4KWTA 4N7MA 4MS1A 4TT8A 1NY5A 2B4RO 1KRWA 1TD9A 5BRAA 2BZGA 2BGJA 4LF8B 1IL0A 2W70A 3F1LA 3UKOA 3ASVA 1AKMA 2H59A 2XUFA 4JA0A 2VTEA 3HB5X 3QBJA 1BQ3A 1Y6JA 2EKPA 4HGYA 4O2RA 3EF1A 2OILA 3MJTA 2OCLA 1YOVA 1JHYA 4ND5A 3EYAA 3OIYA 3NETA 2HI0A 3RS4A 3THOA 3ILXA 2ZR7A 1O95D 1H1TA 3GG9A 1GQQA 4PFKA 1Y1LA 3LQYA 1MNAA 4MQ6A 4P2GA 2IDMA 3TB4A 2JGAA 1XKQA 1DIAA 3FSRA 4A8TA 1JFFA 2FXVA 1DGQA 5F7ZA 2JFHA 1XOIA 3SSAA 5JR3A 4TS9A 2C03A 2ONJA 1FSPA 4ZEVA 2E89A 4HQOA 1FFWA 1G2OA 3QVLA 4JJ8A 1CRZA 1QK5A 5AKZA 5B1SA 3TG8A 1QUEA 1UEXC 1XTVA 3GAMA 3LQ2A 4R05A 3ZYCA 1U4NA 2R6GA 2RK3A 4P82A 4XQEA 3AFMA 2CNBA 2GXUA 5JMOA 1NNUA 4DYDA 5LVAA 1TKCA 3LD9A 2GESA 3N2NA 1H4SA 4DM7A 3R9WA 2JVJA 1E7MA 1E2MA 4IX9A 3OE5A 2FPIA 2ABWA 1M3SA 3QKTA 3QYPA 3MF4A 1O95C 5HK9A 1ONSA 1Q7CA 1NUSA 2QL6A 3R6GA 1IQPA 4Q4JA 2BFFA 1IY0A 2J4CA 2FP4B 3NAMA 4KX3A 4D4IA 4A5SA 3CJQA 4J2HA 2POCA 3VUFA 3SLRA 4HV4A 2PVPA 5ENDA 4D9BA 2HIMA 4NDZA 5D85A 2H7XA 3WKEA 1NVBA 1FJ2A 2G9ZA 1SUFA 4Q9LA 3AVQA 4ZOAA 3ESZA 4HDKA 4IPTA 3RVSA 1ADBA 1Y7LA 4RFVA 3UHAA 3W77A 2Z2ZA 5SY4A 5KQSA 2AX4A 3WS7A 3DTVB 3R0ZA 3HMKA 1XYVA 4LYGA 4K1LA 5EHIA 3C6XA 1IUOA 5EWJA 3CM0A 1U8AA 2BFBB 1JSZA 4UE2A 4EITA 2H0RA 1QQBA 1YMUA 5GONA 2BFCA 2PK3A 3M4JA 3QEBZ 2A14A 2CLHB 4XB6B 3DMHA 3ISTA 3KHTA 3RYCB 4GOND 5K6AA 3UUFA 1T0JB 4DB2A 3U26A 4Q21A 3NYRA 3G2HA 4GLFA 2AYYA 4ZARA 5BN3B 5IXYA 2DBVO 4UFPA 2VR1A 5BSVA 3A6DA 5F12A 4WA7A 1J8FA 1DEAA 4EGQA 2PUHA 4KMSA 2FUNB 2GAFA 2ZDQA 4LDAA 3A1VA 2YWHA 4MS1B 2EFHB 1U2PA 5A0TA 2YOGA 2V3WA 3HN2A 1ZMBA 1QM5A 2WA2A 3VZDA 3KQNA 3OZDA 3QFFA 3V4VB 2CFTA 3AJEA 4DNFA 4LVCA 4ARUA 1E6EA 1ULBA 2R96A 1G6HA 4M0CA 4RCZA 4B6GA 4CYMA 1AGXA 1GQOA 1YOVB 1AZWA 2DUUA 2GFIA 3GXBA 5AW9A 3T7TA 3BWBA 3UHPA 4FSXA 3GBPA 3H84A 4NH0A 1ODFA 3YASA 3CX3A 4NQRA 1L7VC 1PGQA 1LPSA 4DRXB 3H65A 1H93A 3NGLA 1RHRA 2XZPA 4DLVA 4EYGA 8ADHA 1OLXA 3DYBA 4PYIA 5BMVA 2P78A 1JFFB 1WW3A 2JCXA 3LCVB 4HNRA 3VC7A 5C7YA 3DLAA 1GKLA 1HRKA 4C0LA 4D9CA 4OFWA 4IHJA 1SQ0A 3JCZA 4J3JA 3DHWC 3MINA 4WZBA 1TYBE 4AMGA 4CR7A 5TVKA 3TSZA 1XKLA 2A7XA 2G5PA 1X9GA 2C57A 1HWYA 3H4TA 3KVOA 2C9MA 3ODGA 4MPPA 1WJGA 4PFJA 4RHTA 4K9DA 5HZKA 4CEJA 1GJRA 3ZNOA 1UAYA 1PJSA 3CIFA 2JI8A 1Y5MA 4RTQA 1KSGA 3IX7A 3SC2A 5F76A 3AUAA 3DNFA 4H3SA 4N5DA 4K6OA 3VKVA 5B7NA 4FK8A 1DZ3A 2OCPA 3I34X 2WM3A 2FRXA 1K27A 1ZXBA 3WA6A 3RI3A 4Q4JB 1WETA 1ZRMA 2XB6A 3ABRB 2H4ZA 2BFFB 2P2NA 1NJSA 2QN1A 4P08A 3MM4A 1XDUA 3WMRA 4G36A 3RIXA 2BW0A 4JS0A 3AI7A 4RH1A 3CLKA 3G3EA 1TM1E 2EL9A 1JSRA 4QGHA 3SY8A 2ARKA 5EINA 5EWMA 3RUDA 4HDKB 3B53X 1XI2A 1N1DA 3RARA 2XUIA 3TO5A 2P3QA 5ECYA 2FGKA 1LNZA 2C5GA 1JEQA 3ETJA 4RQAA 1Z5OA 3EWAA 1PSZA 3E4DA 4L3WA 4NE7A 1Y82A 5AHRA 3E7DA 2V0CA 4KO4S 5REQA 1L5SA 2Z9BA 1SCJA 2BFCB 4W9NC 5GONB 2R8ZA 1A98A 2XXAA 4TTRA 2WVJA 3ET4A 1N3BA 1XZIA 2YQ5A 1P1KA 2H7VA 2GBPA 2ID9A 3QVMA 1JIKA 4HXYA 1SHTX 2DPMA 3GEHA 3I05A 2WJZB 3K1AA 4FDMA 4U4AA 4Q02A 5E3HA 5HFAA 1I6WA 2V5UA 4J0EA 3K5PA 4KR0A 5DT2A 4N9WA 3WADA 1GPBA 3HR7A 3RRJA 3RWBA 3CRMA 2C95A 1P9LA 4UAVA 1VBFA 2PZFA 3GGCA 3LGSA 3INYA 5DTQA 1PEAA 1MC5A 3IJEB 1IK6A 2E5WA 4H3VA 2WR8A 1TL7C 4XWAA 1KJJA 3QEKA 1N9GB 1JA0A 1RTKA 4E12A 4NI5A 3E9RA 5F21A 3M70A 4B6FA 2YTZA 3JW8A 2NVBA 1NX9A 4XGNA 5KU1A 4RJKA 1Y8CA 5FOXA 1T3TA 5T4BA 3F6YA 1FRZA 3ZS8A 4YAIA 5KSYA 4MLPA 1IFXA 1OLXB 1H05A 1QRRA 5BMVB 4MUMA 4EPVA 1FUUA 1JG4A 1PEYA 3CO0S 2NU9A 4JP5A 2CFIA 5KTMA 2ISSD 2RIPA 3NMUF 4IHJB 1KJZA 2DT5A 3MINB 1C81A 4WZBB 4Y9SA 1WL8A 3ORFA 3K0HA 2YS7A 3TR6A 3WLQA 5BW4A 1FVFA 2P9GA 4NX2A 2HJRA 2RB5A 4BO0A 3RD5A 4CEJB 1CY8A 1NJ8A 2B5VA 1NBIA 2GVDC 4MDFA 2DHCA 3L43A 1CWUA 3KLOA 3WGTA 1AXRA 3SC2B 4LX8A 1JF8A 3K0CC 2V5VA 4NICA 5AVOA 5JNSA 1P3DA 1T5OA 1ZWKA 1N1GA 5JCOC 2QUIA 2DHQA 1DOZA 1OUMA 4QEKA 4AJNA 3WGUA 5FADA 4D82A 4V0ME 2FFJA 1EQ2A 1PGJA 3M6IA 1ZITA 1EVEA 4CW7A 1EJ0A 1RJ9B 1T9BA 2GA8A 5ULLA 3HYNA 2O7QA 1ZJWA 4ZPJA 3AUUA 4ARVA 2WDPA 2IYYA 4JI1B 1JEQB 2IYWA 3LXXA 1H2HA 1ZO8A 1KI4A 1H66A 1IK4A 3QOYA 2XOXA 4G1CA 1Y34E 4JB0A 5REQB 1Z13A 2H07A 4LJYA 1O3YA 1ZG3A 5FWYB 2XVAA 1PE0A 1XDSA 3IP9A 5THXA 4W82A 2FN7A 4R0NA 4DXDA 1K5HA 1M7GA 4KQGA 5TQVA 5E4JA 3W8NA 5I51A 1IE3A 1Z2EA 3VUEA 1QCCA 4C0WA 1KVSA 1YUMA 3VQTA 1XVTA 3K1AB 4KE7A 4EF6A 4ZHQF 2CSUA 3T0IA 3LL4A 3PU6A 4JI8B 2PAAA 4IGEA 4Y2GA 4GPD1 3SLKA 4TKZA 1P73A 1ODLA 2LGJA 4MHSA 3R3ZA 1QTIA 4AWXA 3IPYA 3PIDA 4QBTA 4CQLA 2PKEA 3K70C 3ZVKA 3NRBA 5C7IO 1QFXA 3ZE6A 5CXUA 2I6QA 3IHWA 4IWXA 2K2WA 4HPJB 4TKLA 3JQAB 1T8SA 1P7ZA 5IDYA 2Y77A 4HN9A 1DARA 1FMCA 2RHMA 5AK0A 1QX3A 1I3CA 1VHWA 1S6YA 1VG0B 1TFUA 1MD9A 1MJGM 1V43A 2AI3A 1QGED 2I4MA 2ZAGA 5A5FA 1CUCA 5B1EA 2YCLA 1FMLA 3QXXA 4YWJA 3T3DA 1KDOA 1QJCA 5JJBA 3MIZA 1SD2A 2NAFA 3HP7A 3LUCA 3PGXA 5IP5A 2NU9B 4TWZA 4FHEA 1G8MA 1CQPA 4AO8A 3ABZA 4L8GA 1RFGE 4WNIA 3KQQA 3LZCA 2JG3A 1U3GA 3DDNA 1CUVA 3KDAA 5D1NA 3LWZA 4D8YA 3C39A 1IZYA 2B6NA 3GFFA 2VWQA 3MC1A 2CE2X 2QTCA 2ZJ4A 2C00A 3EZYA 3MTQA 4JOQA 4D0SA 1FNCA 4EYKA 5HJ7A 3I9FA 3AP3A 4FYMA 4EELA 3WBBA 3ZNQA 2WIGA 1ZHOA 2FQQA 3BEOA 3DO8A 3QA3E 3A3OA 4I3GA 5FUQA 4LAFA 5T8KA 3UT0A 5IFKA 3AZOA 4OQNA 4JXZA 2W48A 3W2TA 4Z4FA 3QRWA 1SKBA 2HJSA 1EINA 2A5LA 1HK7A 2O1XA 1IRIA 1P9WA 2VKTA 4IHAA 4UNNA 2Q62A 4JP3A 4XGRA 1IOVA 2WD7A 1JAHA 4ZRMA 4G4IA 1CJUC 3DTYA 3TEMA 2AZDA 4WBNF 1ZW1A 2R6R1 2PRYA 4QAJA 4YJ2F 3T3HA 3BF7A 4CCSA 1N6HA 3B8EA 5FUWA 3SZUA 4M54A 3X2FA 2DC1A 2WD9A 3KDSE 5BUQA 4OY3A 4XASA 3SSMA 3RV3A 3ROXA 3SBDA 3LL7A 4NR0A 3WRVA 4P3YA 3T5AA 3L7CA 1J9EA 1A88A 4AY4A 4PXYA 4MB0A 1XAIA 5C8ZA 1A5TA 1U80A 2VOJA 3GVHA 3RK1A 1DC6A 2CW5A 3KUDA 4S3MA 1VI5A 2WIFA 4G0ZA 5DSXA 2PL5A 1ZD5A 2J1LA 3O74A 4FMDB 2CNKA 5LIRA 4D1YA 2QPLA 4UTOA 5J5AA 4IFEA 1TM4E 3TLBA 3JQEA 4AECA 1IN7A 1PV2A 4MGKR 3EK2A 1FFEA 4G5RA 2WTBA 1X80B 4CQLB 2O9JA 2J07A 5AP9A 4IR7A 2OYCA 2A0XA 3IEIA 1O4VA 1LTKA 4M8SA 4FLMA 1XCJA 3UT5B 3VHLB 4EGFA 5JFOA 1SO8A 2FX5A 4HD8A 3KCNA 2FW7A 4PG6A 4WIAA 4D4GA 4GGMX 3G7NA 3T7EA 3PICA 1FMFA 1QHGA 3AKYA 3W9SA 2J0EA 5WRFA 3KSAC 2NSJA 3W8FA 3RC8A 4K81B 2A5DA 2P8JA 1D0IA 4F6RB 1E9SA 4EUHA 1JAZA 2H0QA 2G1JA 4NONA 5AW8A 4C0AC 2JGKA 3L5KA 5CB0A 2P65A 2K6GA 1QVRA 4XM2A 5IVDA 1OSNA 1J5PA 2R87A 1JWLA 4PRZA 1MX9A 5J4YA 1SBZA 2FSHA 2ORWA 3KG2A 3IAFA 1M0WA 3T3EA 4M0FA 4OKIA 2YRFA 4XDGA 2XKAA 1Y4UA 1M10A 1I4DD 1VZ3A 4IKEA 1GCIA 4Z0HO 4B3HA 2AWOA 1H2ZA 2C88A 2COEA 4RL4A 4JJKA 4R8VA 3JR7A 2CLFB 2ZRKA 3EVBA 4B82A 4RV4A 1VSVA 3BD9A 3KEOA 3KOMA 4A82A 3JD3A 3ZHSA 3OD5A 1XMXA 4GSLA 3U19A 1BCRB 3TKAA 4F2GA 1Z3CA 6YASA 1ISGA 1H0RA 4KCGA 4B3SB 5IT5A 1CHNA 2XA9A 2PT5A 4D8TA 1RKQA 1SUAA 1X1DA 1K3TA 2IBMA 3QTTA 4D8UA 3BRSA 5SZKB 1L3IA 2MSCB 2WD7B 3OCVA 2GS9A 3DEZA 2VXOA 4CIBA 3H86A 2DERA 3PXUA 3C74A 1Q2UA 4QOEA 2OD9A 2L19A 1KMMA 2ZUWA 3S28A 5BYAA 4OHUA 3ENKA 1FJHA 1XNGA 4QGGA 3FJYA 4HL6A 1QHNA 4A8JC 4J0IA 5H8WA 2GNPA 4AO7A 4O8CA 4BPBA 4MCIA 2OYRA 4UATA 4N5NA 2WT8A 4RVOA 4ZVVA 3K72B 5JSZA 3LPMA 3QM1A 2WPDA 3MUNA 5CNIA 4HK4A 2AW5A 3N7AA 4U8GA 2AMJA 1DRVA 5T6BA 3UWDA 5DN6D 2VUIB 1LW6E 4FD2A 4L5YA 1XJWA 5HDQA 1TYEB 1V1RA 3K9GA 1IJEA 1V48A 2V7PA 4Q82A 4Y2VA 5JU6A 3ETNA 1XLTC 4Q03A 4U63A 13PKA 4HKTA 2DPLA 1GAEO 4V2UA 5C3MA 5LYJA 3O21A 5FBRB 5FV4A 1PLJA 3AR3A 2J3LA 3TLXA 2C29D 3AO0B 1M34A 1PFQA 2H1IA 2QN8A 3HSYA 5A4DA 2VJMB 3KUUA 1V11A 4JJIA 3SR0A 1P5ZB 3HCPA 4AVYA 2ZE5A 1NZFA 4RL6A 2XYGA 2GAIA 1WTAA 3B1XA 4DHWA 2I7CA 2FEKA 2ZUCA 1P5FA 3KD2A 3RSZA 4AG5A 1MPTA 4AZ3B 3P32A 5FI5A 4L16A 2IHNA 2FA9A 4JYPA 1Q12A 1RQLA 3M9WA 4DNPA 1YKSA 2YJ4A 4BQPA 4OX9B 3GOHA 5GMOA 1MOQA 4YP7A 2OKCA 3F46A 1RZVA 2DBYA 3G9UA 2FFHA 3JZAA 9ABPA 3VYRB 1E1QA 1ZR2A 1T3LA 4GECA 1ID1A 4KBFA 1XKXA 2D2XA 4PHHA 4L5IA 3ZIAD 4UU0A 4P32A 1ZINA 2O8EA 1U5BB 4G4SP 1G5IA 3K9HA 3ZWCA 1RI1A 4C7OB 1OIVA 2PEZA 1YACA 4WOPA 4LZNA 3BAZA 3V80A 4D6XA 1C30A 1PX0A 4J29A 3S7ZA 3PTZA 1HLFA 3T7AA 3U0VA 2OGWA 2QRNA 4EMTA 5F77A 1OV4A 4IJWA 3HU1A