4WEQA

Crystal structure of nadph-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with nadp and sulfate
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
316
structure length
316
Chain Sequence
KSPVIVDLKFIPEEVEAALAGAFPGREVIDLADPAHQERDLSGIDYAVVWKSAPDLFSRAPDLKVVFSGGAGVDHVLTLPGLPDVPLVRFVDRTLTTRMSEWVMMQCLLHLRQHRAYEALAKKHEWRDLSQPEAADVTVGIMGMGVLGQDAARKLAAMGFKVIGWSRSKRVIEGVETYDAAGLDAFLGRTDFLVGLLPLTPDTRGIFNAALFAKLSRNGPFGAPVFINAGRGGSQVEADILECLDSGVLGGASLDVFEREPLSPESRFWDMPNVYVTPHVAASSDVRALFVHVEHQIARFESGLPLEHVVDKVAGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NAD-dependent dehydrogenase
publication title Structural, Biochemical, and Evolutionary Characterizations of Glyoxylate/Hydroxypyruvate Reductases Show Their Division into Two Distinct Subfamilies.
pubmed doi rcsb
source organism Rhizobium meliloti
total genus 101
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.79: Glyoxylate reductase (NADP(+)).
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4weqA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4weqA01
4IDFA 4QTZA 3Q11A 1SNYA 4HADA 4MP6A 4CM9A 3Q6IA 1LRKA 2CD9A 1B0AA 4KTVE 2JD1A 1EDZA 5IG2A 4JK3A 4F3YA 4YAEA 4Q3CA 1LQTA 2R6JA 2CMDA 1I2ZA 3GY0A 3PWKA 1JWBB 5CEJA 1YBAA 5TSDA 3QW2A 1GQ2A 1VL8A 2GZ3A 1P44A 4LK3A 3D5QA 3K73O 4XB1A 4E12A 1NPDA 5KVCA 4DIOA 1PJSA 3AI3A 1MFZA 2EV9A 4QECA 4I5GA 1UZLA 2QRLA 1ADGA 2WYUA 1H6CA 2B5WA 3GG9A 1VPDA 1B3BA 2D1YA 3P7MA 3QP9A 4NFSA 4D44A 3E48A 4FC6A 2VHZA 1PR3A 5CEEA 2G17A 3JSAA 3KUXA 1R37A 5TT0A 3NDRA 1YO6A 3ZWPA 1B2LA 4BKQA 4JCOA 1PZGA 5A03A 1LSUA 1UZMA 1F12A 3VH4A 5EPOA 1IOLA 1TT5B 3WIDA 4FB5A 1PL8A 5JSFA 2EKPA 5C5IA 4XX0A 4A73A 1EMDA 4CM1A 4CLEA 3HQ4O 1TVEA 4GH5A 4BKUA 4ZICA 1E6EA 3ICCA 4L4XA 3RU9A 5HM8A 3M2TA 4WLVA 4YWJA 3G17A 2I6TA 1TT5A 1ZMOA 4NFHA 2V6FA 2C54A 3C3XA 3AFNA 5B1YA 1QYDA 3KBOA 3G3EA 2XXBA 1J6UA 5I7FA 2QRKA 1HF3A 1V3UA 3MWDB 3PIDA 2VT2A 4QT0A 1H2BA 3A1NA 4GLOA 4CMAA 1YS4A 4FFPA 2C59A 4CODB 5JC8A 4HNGA 2WYWA 2FMUA 1IPFA 3KHUA 2X86A 4BNYA 1PTJA 4MO2A 5JXWA 4LVUA 4TMFA 1LDYA 3LVFO 4FFNA 2VTDA 1YBVA 1I2BA 1P1JA 5C3MA 3DDNA 1KC1A 3IMFA 4XGKA 5T5QA 3WYBA 1ADFA 1PGNA 2V6MA 4RVUA 5DULA 1LU9A 4AJNA 1U2GA 2QZZA 2JFHA 2ZTVA 3F5QA 4C7JA 5DCUA 4QX6A 4KZPA 3ASUA 4GWGA 4EYEA 5TF4A 3DMTC 1P77A 3DTTA 4W9NA 1CJCA 2VOJA 3NGXA 2H5LA 3TN7A 2FWMX 2ZQYA 5LCXA 3GEDA 1MX3A 1PIWA 4TVBA 3NRCA 1QYVA 3AY3A 1N2SA 3LC1O 5CG2A 3TZKA 2YYYA 4GSLA 1HDRA 4IDBA 2NLOA 4J49A 4M49A 1I3NA 4I9HA 1B8PA 4MVJF 5EERA 1L7EA 4RLSA 4ALKA 5JDIC 1OBFO 3EVNA 3KLPX 3GF4A 1JAXA 1I30A 3PLRA 3L9WA 1C0KA 1LSSA 4GVLA 3HSKA 5TGDA 2BMAA 5CG1A 4PG6A 2ZTLA 1I33A 2OO5A 4BO1A 3UCXA 3ROPA 1NPTO 5DBIA 2B36A 4JJIA 2NU7A 4ROSA 3UXYA 3TSCA 1CF2O 4PGFA 1QMGA 2C5AA 3LU1A 4MIEA 5TC4A 1CYDA 5I8WA 2UYYA 3AM4A 4CMGA 1JN0A 3RC7A 2PV7A 1WMBA 2DTEA 1PX0A 1NHGA 1PZHA 2DPGA 4KOAA 1A7KA 1FF9A 5TJHA 1JVSA 3ETGA 1JKFA 5JCJD 3BMNB 1L1FA 2DM6A 4Y8VA 4OHUA 4DREA 3TF5A 3WYCA 1ZCJA 3WIEA 2B4RO 4H7PA 4IZHA 1BW9A 5CDSA 1E7RA 4BOYA 2CNBA 2R2GA 2VRCA 1PU2A 4JBIA 4RVFA 4YRBA 4J9UE 3KTDA 3NDJA 1ZSYA 5IXYA 1O6ZA 1NFQA 5AYVA 4RORA 4YBZA 5JMPA 3NKLA 3S8MA 1DC5A 1VLLA 2EF1A 2Y1GA 3NTQA 1LQUA 3IQDB 4ZQFA 1ZSVA 2AEMA 3LK7A 3RUEA 4J2HA 4H15A 4W4TA 1YH3A 2NQ8A 3DO5A 1U8XX 2PD3A 1YXMA 2FZWA 2BD0A 3HG7A 3V2HA 1AXEA 2GN4A 3JV7A 2GDZA 4D46A 3NJ4A 4EUEA 3I83A 2RAFA 2ZCUA 4I1IA 4QUKA 3DWFA 3ZNPA 3ANMA 3DBVO 4CQMD 1QYWA 4JIGA 4O0LA 4I9NA 2C0CA 4R5MA 1LUAA 4DIBA 4R68A 1FK8A 4WK6A 3U4DA 3GUYA 4NJMB 3H5NA 1K0UA 3EDMA 3KXDA 4O6VA 1HZJA 3TWOA 2HMUA 3OQ6A 4CUZA 1WLYA 5GMOA 4XR9A 1OI7A 1W73A 2Y93A 3MCVA 5BT9A 5FFFA 1PJ2A 4R3NA 4NJMA 4OXYA 1DEHA 1DJQA 2QYTA 3I1JA 4AVYA 1YL7A 3RD5A 3WMXA 4PRLA 4PLVA 1IHXA 3U4IA 2PGLA 2NU8A 3IOYA 1JAYA 3FPCA 4FFRA 3S1LA 3COSA 2O23A 3EGOA 1KEVA 3CMCO 4J1SA 4BO9A 1GZ4A 2DC1A 3GN2A 5A9TA 3WWYA 3SJUA 4CM5A 1DAPA 3B70A 4W99A 2PA3A 2DUUA 3OF2A 4LCEA 1ISFA 4XRGA 5A06A 1GYPA 3SC6A 2OP1A 5IF3A 4BNWA 1V6AA 3CPSA 4EJ6A 4AJJA 1DIBA 1NWCA 3S55A 4EEXA 3UCFA 1R16A 5ICMA 1P9LA 1VJ1A 1AGNA 4IUYA 2B35A 4IBOA 4OQZA 4WE3A 3I52A 3QVXA 1DXYA 2G1UA 4DWVA 2RHCA 5IZ4A 2HKIA 2Q45A 3AK4A 3GVCA 4N5NA 4TRNA 2OL4A 2F00A 3K30A 4YRDA 4CR8A 4ZU3A 4Q39A 4PLGA 1UR5A 2HU2A 1QLJA 1GCOA 1YOVA 1N9GB 1EQ2A 5DBGA 4BV9A 4D3DA 2H9IA 4ZD6A 5TNXA 3VZPA 1GQQA 1IL0A 1N92A 3UFXA 1LLDA 4P38A 4B3HA 1TB4A 1CQIA 1N9GA 1QR6A 2VTEA 5DCWA 1JW9B 3AM3A 1LLCA 3KYDA 3JD2A 2D5CA 3ULKA 1PGPA 1BG6A 4U6SA 1AUPA 5I7EA 2NADA 3GR6A 2AG8A 4RVGA 1ISMA 4BKPA 3P19A 4UEJA 5DOZA 4CV3A 1Y8QB 2C07A 4L9RA 3OH8A 4XRRA 1LRJA 4BL5A 1B8VA 4CLDA 3B1FA 2Q1WA 4Q3BA 3HUDA 2ZB8A 5EESA 1LLQA 1A4UA 1YDEA 1XEAA 3PDUA 1Y8QA 1ZVMA 1UXJA 3CEAA 1GY8A 4NG5A 4MVJG 4QFDA 5TX7A 3IKVA 2HMTA 3K92A 1GU7A 1ISHA 3JQ7A 4I08A 4AJ4A 2Y0CA 4E33A 1JDJA 2OMEA 1WPQA 2DT5A 4J0FA 2O48X 4OL9A 4RLHA 1MFPA 1FMCA 4B79A 1C1XB 3ROQA 3OBBA 1MXHA 5FF9A 3ZWVA 4Z9FA 3ZWYA 4GQAA 3OIFA 2HDHA 4EZBA 4FBGA 3RUCA 4YCAA 3AOEC 1C1XA 1R6DA 1X0VA 3L77A 4CLRB 1K3TA 1EVYA 4TRRA 5CDYA 2ZB3A 3PFWO 4UUPA 3NT2A 4PZDA 2NV6A 5TT1A 3FF4A 6LDHA 2HO5A 3H6KA 2VYNA 4E13A 4M86A 1DLIA 3KOUA 3FTPA 4CLRA 3RC1A 1H93A 1U5AA 5JW6A 3GNQA 2BI8A 2AQ8A 1PJBA 3BZUA 1HE4A 3D0OA 3JTMA 4A26A 4E2ZA 2OFPA 4D0RA 3L6OO 1GPDG 3QV1A 3C1OA 1LA2A 2D5AA 3GDOA 1ZEJA 1XQ6A 3K6JA 2NU6A 4TZTA 2B69A 4URFA 3DZFA 4JJFA 2YV2A 3DZBA 3L4SO 2X9NA 3TNLA 1YB4A 4FN4A 3HNPA 3F4BA 4GGPA 2GSDA 5I7SA 5KTKA 5C7OO 1K2WA 3WTBA 3NV9A 2CVOA 1G0OA 4R16A 5A4DA 1HDGO 2OGUA 1F14A 3VZQA 2NVUB 2FR0A 4XEHA 1HYGA 1U7TA 1H6AA 1ZSNA 5B37A 1T2FA 2VCYA 1JA9A 4BNZA 1A27A 4I5FA 1E7MA 4O5OA 1EDOA 5BR7A 5TIIA 1EVIA 3I9OA 2IZ0A 4BGIA 1T2AA 1U7HA 4KDFA 3WNQA 2X4GA 1IY8A 2EWMA 5FEUA 1F06A 3MJCA 3D3EA 4OXNA 3GNSA 4CLOB 2UV8A 3JQAB 1PGQA 2EW8A 3WSWA 2EG9A 4ZHSA 2WM3A 1KVQA 1IE3A 5KJ6A 3HHPA 3HJAA 4IJWA 1PL7A 4PLFA 2DLDA 4KQXA 4L4SA 3G1TA 3A14A 1YGYA 3ADOA 3TL2A 4PVDA 4FS3A 4TKLA 3JQAA 2WE8A 3E9MA 4R9SA 2OOSA 4G81A 5CP8A 3W8DA 3WYEA 1WDLA 1ZXBA 4XQEA 1EUZA 4XA8A 1LLUA 3E6AA 3ORFA 2PTGA 4LSMA 5HBRA 4FW8A 4FFOA 2O2SA 4E5KA 4Y98A 2Y1FA 2GCGA 2OBYA 3A06A 3GGOA 3M1LA 4MVJD 4BVAA 4HFJA 2Q2WA 3ANLA 3I6QA 3GVHA 2EJWA 4OXKA 4CQLB 3C24A 5U4QA 2WMDA 3RFTA 3E82A 4DLLA 2GF2A 1DIAA 3DHNA 3WLEA 4ND2A 2CZCA 1HSOA 1HRDA 1ZIDA 1C0PA 4A27A 4YJGB 2W2KB 4CQLA 4UVDA 1CEQA 4J1TA 2YUTA 4WCFC 3NJ8A 4U8GA 4KTTE 5JAMA 3PZRA 3GEMA 3AUTA 4N5LA 1XSEA 5JE8A 2BFOA 2VHXA 1C14A 4PLPA 4J9VA 1OFGA 4ZQHA 5KVVA 3KSZO 3HN7A 3DMYA 4XYBA 4OQYA 5KWEA 1GYQA 4BMVA 2LDBA 4RV9A 2B4TO 1MP0A 5L4LA 4NK4A 3DEYX 1PJ3A 4IQGA 2CVZA 4L75A 2Q4BA 2NNLD 1N5DA 4FFMA 2FY8A 2ZCVA 3V5NA 1ZK1A 2VWPA 3FNFA 1NTOA 2HK7A 4R54A 2YDXA 3DBHB 4WUVA 5ENDA 4Y9DA 4Z6KA 5JY1A 4P4NA 3DZIA 2DVMA 3BYZA 1B8UA 1DC4A 5JS6A 3FI9A 4RF2A 1O89A 4IDDA 1EK5A 4LVCA 4DYDA 1X7HA 3GPIA 3L07A 2QRJA 3MEQA 4OSOA 1G6KA 3U09A 4FOSA 5KIAA 4JNKA 1UXGA 4INAA 4BQPA 3RBZA 1HYHA 3QWHA 3RI3A 2XOXA 4RL6A 1PGJA 2Y0EA 3I9LA 4PG7A 1E5QA 3DBRA 1UJMA 2YDYA 4OAQA 4JP3A 2PGDA 1UXKA 5I7VA 3DR3A 1DAOA 2O3TA 3R1IA 5HA5A 5IAAA 1E92A 2E6UX 1IZ0A 3UGKA 1NP3A 3U0BA 4ZQEA 4ZA2A 4BNUA 5G0UA 1XLTA 1ISGA 2YJZA 3ROKA 4DPMA 4E3ZA 1Y8RB 2Q1UA 3PXXA 1IULA 2VUTA 3O38A 5IN4A 3NT5A 4U7WA 4J3FA 3RUAA 1GCUA 4FGWA 2CSUA 3VPGA 1SOVA 4NPCA 1PQWA 3X2FA 1Y8RA 1BTOA 2BELA 1R4MB 1EBUA 3UHAA 3D3WA 4YJFB 3LF2A 2YQ4A 4D42A 2IODA 3F46A 4MIOA 4IDEA 1Z45A 2JD2A 5EN4A 4RPGA 1W8DA 5COAA 1R4MA 2IE0A 4PIVA 3CUKA 1G0NA 1EZ4A 2J6IA 3ONDA 4RCVA 4TROA 3MZ0A 3ZWAA 4RZIA 3KV3O 4MKZA 3RAJA 4W7IA 5AXDA 4HFNA 4II3A 3WX0A 3L4BC 1U3VA 5A9SA 1IZ9A 2VWHA 2GNAA 5JAZA 2PKQP 2ZTUA 3FNGA 1SO8A 3GMSA 3IAHA 3E1KA 4WLEA 4ALLA 3TPCA 3GVPA 4AJLA 3WFJA 4XZ3A 4LRTB 3DBLB 3W6UA 3E5MA 4BGVA 5I9LA 1I10A 2Y68A 4L0QA 1UP7A 4WEQA 4D41A 5GY7A 1NNUA 4GL4A 1LX6A 1X15A 2GPTA 1PZEA 3F1LA 4NBTA 1XU9A 4E4YA 4HXYA 4PFJA 3AU9A 3DBLA 1NFFA 1H2HA 1N8KA 4BGEA 4M54A 4OO3A 2FSVA 4RVDA 3RUDA 3QVWA 7MDHA 4G2NA 5FI5A 4EJMA 4R69A 5JDCC 1BXGB 2Y05A 5FWNA 1OZAA 3M2PA 4B7UA 4R1TA 1HWYA 5C7LO 1LI4A 2HSDA 3JQFA 3DB2A 2X5OA 3L9XA 4FIZA 3JQBA 3TFQA 3WWZA 1BXGA 4EBFA 5L9AA 3C7DB 2B83A 5BSGA 4CL8A 3UICA 3KM0A 1Q0LA 3BTUA 3ZV4A 1ARZA 1DHTA 1E3IA 1U1IA 2C20A 3TDKA 1ISJA 1J49A 4CMBA 4DQVA 3WGTA 1U28A 4PZEA 3ONEA 4IGEA 3ZDFA 4RQTA 2W2LA 1Z74A 3GC6A 4E2YA 3ASVA 2V6GA 1FDWA 4F45A 1OOEA 3JYOA 1KERA 4DQXA 2F1KA 4LMPA 2DAPA 3ZI0A 2P5YA 1EK6A 4IIVA 2EGHA 5H83A 1EUDA 1P33A 4J4HA 5KKAA 4AJHA 4RQUA 4GMGA 3LDHA 2UVDA 4BNXA 4ZRNA 2V7PA 5DCYA 1YL6A 3BMQB 4IJKA 2CVQA 2HMWA 4O59O 3WFIA 3RUIA 4CV0A 3VVBA 1U9JA 3GGGA 4YT4A 1ORRA 1KEWA 1NR7A 3CH6A 5JCJA 1KVRA 1D4FA 1NHWA 5CPBA 3I4FA 5HS6A 2ZATA 4CMEC 3PHLA 2JKVA 4WPGA 1DJNA 1GEGA 1UP6A 3RWBA 2UUOA 2QG4A 3FR7A 5F5NA 2EJVA 4AJ2A 1D1TA 3HZZA 1UH5A 1V3TA 1SOWA 3ENNA 4L76A 1T2DA 5DOVA 4JROA 4BO6A 3TFOA 3KEOA 2IDZA 3Q9NA 4Z0TA 1J4AA 3ST7A 4QEDA 1DO8A 1EEHA 2EP7A 2HMSA 5ILOA 1H9BA 3LYLA 4ID9A 2NSDA 4B3IA 4CQMB 3H5AA 3WQRA 2X9VA 1C0IA 3ABIA 1IHYA 4CUKA 1CIVA 1PJ4A 1T1RA 2B0JA 3A9WA 4DC1A 4UULA 4YAGA 4EITA 3AI2A 1HZZA 4CQMA 2JAPA 3FSRA 2WE7A 2I76A 4H3VA 2J5QA 2ZJ0A 2D3TA 3BHMA 3GAFA 4W6ZA 1YONA 2P91A 2X6TA 4HNHA 3K8ZA 4JBHA 3PWSA 4JJGA 5CFZA 1H94A 2NQTA 1LNQA 1T4BA 1O95A 4QXMA 2Z1MA 4CM9D 2E37A 1DHRA 3RBVA 3SXPA 3ZU2A 1I32A 3G79A 1O0SA 4MDHA 3CKYA 1SB9A 3PVZA 1ML3A 2X1HA 4CR7A 3SVTA 1X14A 2NM0A 1PR9A 3KO8A 1Z7EA 3O9ZA 4IZIA 2HJRA 4J2OA 3DOOA 4CV2A 1A5ZA 3BHJA 2PNFA 3U5TA 1GTMA 3VOSA 1I24A 5KCZA 3PHJA 3UCEA 2WEKA 3MJTA 3I9MA 1I2CA 3QIVA 2JJYA 5KVSA 4YT5A 1RWBA 3VAZA 5IDYA 3BAZA 3JQ9A 3HB4X 2ET6A 3MJEA 4HBGA 4R1NA 4PLZA 2D8AA 4IDAA 5COBA 2HLPA 2PKQO 1XQ1A 4BO7A 1EE9A 3VKVA 3IS3A 1C0LA 1X7DA 4BS9A 5KJCA 4Y6SA 1PGOA 3MJSA 3WICA 5DNAA 1HXHA 2ZK7A 3QVOA 1B26A 4D79A 1PJLA 1E5LA 2D4AA 2J3HA 2CF6A 1LDNA 3BMNA 4B4UA 5ITWA 4Q3AA 2AQKA 1XR3A 1GZ3A 2OP0A 4YAIA 3JYLA 1Z7BA 4IXWA 1DPGA 2EHDA 3ITKA 3OMLA 5AOVA 3DHYA 3IC5A 2BGMA 2BI7A 3I9KA 2O4UX 5FYDA 1HEUA 5IZCA 3BMCB 1B16A 4J16A 1OC2A 3ONFA 1LEHA 1E6UA 2X23A 3G0OA 2QQ5A 3LSYA 1Y5MA 3DFUA 2OXIA 3BMCA 1NFRA 5U9CA 2QHXA 1O5IA 3RKRA 4EGFA 3V1TC 1MLDA 1QKIA 1ZEMA 3KZVA 1PS8A 4E21A 4Y6PA 3RJ5A 4IGFA 5KNLA 1R4NB 3VH2A 4BKOA 1PJQA 1ZH8A 2IEDA 4OGWA 1WDMA 3WJAA 2YZ7A 5DDIP 1ZK2A 2H1SA 3ZV3A 4RPJA 2R00A 2DBZA 3FBGA 1GPJA 4S3MA 3VKUA 1A71A 1NQTA 2G0TA 5IDXA 4WOKA 5IDQA 5L7WA 4WCFB 3GVIA 1DFGA 3EC7A 4QQRA 2I5PO 5A3JA 4XR4A 2RH8A 1E1KA 4EEZA 5AXBA 3OA0A 4DMMA 1U3UA 5G0VA 1XIVA 4HX5A 5K6AC 2BFPA 4YEDA 3EUWA 3GZ4A 3WGZA 3RJ9A 1NXQA 4XQCA 1UZNA 2PFGA 2WSBA 3RC2A 3SJ7A 2HRBA 3PPIA 3GFGA 3RU7A 1GUYA 2HAEA 4YA6A 2WTBA 1TI7A 3S2IA 3ZH2A 4ND4A 1SB8A 1HDCA 1YRLA 2PZKA 2Y1DA 3M6IA 4QO7A 3HDQA 1BXZA 3OP4A 4BNFA 4DIFA 7ADHA 1RM0A 1M6WA 1T24A 3GUCA 4NK5A 3RUFA 4RF3A 3W4IA 4XYEA 2B4QA 4R51A 5BSHA 3IP1A 1UDCA 3DZHA 1IPEA 1I0ZA 3T7CA 3MOIA 5IJZA 3F5SA 1B14A 4OOEA 4IJVA 3RFVA 3TOZA 4A0SA 4PN3A 3W6ZA 3A28A 1GZ6A 8ADHA 4WLUA 1V8BA 4E5NA 2CF5A 1CETA 1SBYA 3QSGA 4JQCA 2PGJA 4YACA 5F21A 4MVJE 1X13A 1F8GA 2QYSA 3VZSA 4XYMA 4WLFA 2FSSA 2IZ1A 1N1EA 1E7YA 3HB5X 3KYCB 2Q99A 3H8VA 3W1VA 2AE2A 2DFDA 1U5CA 1KOLA 2FPGA 3VDRA 2H6EA 3GFBA 1WVGA 3VHRA 1ENYA 2Q49A 3ZWOA 2P9EA 1DSSG 3E9NA 1QRRA 4ZJUA 4NH4A 4H16A 3STHA 5H82A 3ZV5A 3IUSA 2QX7A 3F47A 1DIRA 3GRPA 4B3JA 1OMOA 1ULSA 1LJ8A 1B3RA 1XU7A 2X0RA 4C7KA 5KJFA 3NT4A 2AEJA 4IQ0A 4WNCA 3UN1A 1K6XA 3QJ5A 3ZCXA 3T7EA 1E6WA 4NBRA 4G5HA 4HV4A 3NDIA 4KUGA 3PDJA 5F3RA 4NFYA 4BV8A 1QXSA 3IL2A 4LN1A 4N5MA 5A02A 2VN8A 1ZKMA 2E48A 3ZHZA 1P1IA 1QP8A 5C7IO 5MGBA 4BNMA 4PG8A 3WSVA 4CLHA 3ZU5A 2FPIA 3PJEA 3ZWWA 4DBVO 4NBUA 5T8KA 2HCTA 3UW3A 4Q3EA 4RO0A 4ALJA 1W4ZA 3K2EA 1V35A 4R1SA 1T4DA 3E9QA 3GVXA 3PHGA 1DRVA 4K6CA 3BXXA 1S7CA 3QRWA 3ZN2A 1GADO 5A3VA 1VI2A 2VHWA 2Q4EA 3ON5A 4EUHA 3OSUA 3L6EA 4MKXA 1GR0A 1KY4A 3HDJA 1H6BA 3RC9A 2J3JA 4CM4B 4K1LA 1FXSA 2P9GA 3EHEA 3BMOB 5CDGA 3E8XA 4MVJA 1TLTA 1CDOA 1YDWA 3EW7A 3CMMA 2AMFA 1M67A 3BIOA 4J7XA 2D0IA 4MP8A 1AN9A 4B8WA 4IMRA 4II2A 1G1AA 1IUKA 2JFFA 4JP2A 4WECA 5JYEA 1QORA 3LT4A 3BMOA 2VNAA 4L4RA 4NMHA 4HWKA 1UP4A 2OBNA 2YHUA 3R3SA 5EIOA 4Z3KA 3E18A 5I9MA 2CDAA 4BB6A 1Y1PA 1N7HA 4HP8A 2JCVA 4W9NC 3G1UA 1DIHA 2YFHA 5JNLA 2PR2A 1T2EA 2HK9A 4NQZA 5F1KA 2WD7B 2ZTMA 5ENVA 4J4TA 4UVIA 3OEYA 3JQCA 3NGLA 3KRTA 3RBXA 3INRA 4MIYA 4HFRA 3HDYA 4GAEA 3QWFA 4LRSB 5T57A 1P0FA 1EFKA 3KEQA 2VUSA 2RH4A 3AI1A 1YB1A 1NQOA 4NZ9A 1BVRA 2V65A 1EVZA 3DAFA 1Q1NA 4XQGA 4F6LA 3C1TA 4J43A 4RPLA 3PK0A 4N18A 4EI2A 3VTZA 4BNVA 1NAIA 3VDQA 4HUJA 1ADBA 4EDFA 1MB4A 4XDZA 2PD4A 1TT7A 3D4NA 1GYRA 2XPCA 2FZEA 3INTA 1R0SA 3RROA 4J6FA 2NVUA 3VH3A 1ZJZA 1R12A 1ZXLA 4J1QA 1VSUA 1WW8A 2C2YA 2NWQA 3FNEA 3HWRA 4RVHA 4GKVA 4BNTA 2OHXA 3ENKA 5FI3A 3AUSA 4MOWA 5LC1A 4I5DA 4TSKA 5KJ1A 3GDGA 4Z9XA 2FR8A 4Z3DA 1GFSA 3KLMX 3ZWBA 3LT1A 4XD2A 3WGOA 2WYVA 4CLOA 2GLXA 4X54A 3KYBA 2WJPA 2AEFA 5IN5A 2AQIA 4ND3A 1GEEA 1YJ8A 3ICPA 4XCVA 5F1PA 5K9ZA 3EK2A 1P3DA 4N54A 3UAGA 1IYZA 4IQ8A 1D1SA 3GN1A 3O03A 4OKIA 1I3MA 2I99A 3HDHA 1NYTA 4A2CA 4XIYA 4CMEA 2CDBA 3GHHA 3WOHA 2WDZA 3W4KA 4BO3A 2HRZA 1CERA 4J0EA 1QLHA 5G2OA 5JBIA 3C85A 3EZLA 3EVTA 4RDIA 3ZW8A 3B6ZA 1SPXA 3GQVA 4N7RA 4L8VA 4I9UA 1VL0A 4R9RA 5CEFA 3I23A 1DOHA 3FWNA 3Q2KA 1QSGA 2QZ9A 1HDYA 3ZU4A 3WMWA 2D59A 1KEUA 2BGKA 3F6YA 3H2ZA 3MWEB 4CMIB 1GUZA 3GH3A 3W4JA 4HKTA 1Z75A 5HWSA 1JU9A 3WBBA 4TQGA 3PGJA 4E31A 2BHLA 2XF8A 3FNHA 2IYPA 5DT9A 3O26A 1LBEA 1LRLA 4CMIA 5JAIA 1Y6JA 1PSDA 2ZB7A 4GSKA 3QHAA 3DMTA 3GRKA 2W2KA 3H5RA 1XYGA 4YJGA 3WR5A 3SEFA 3ZWCA 5L53A 1ZK3A 4UVGA 3JQDA 5DN9A 4ITUA 2VYVD 1E3WB 1NAHA 2I65A 4MINA 1KC3A 4XDYA 4IM7A 4KMSA 2RIRA 3F1KA 1GL3A 1LSJA 1PWXA 1WZEA 3H3JA 3JQ6A 3R3JA 4IDCA 4J91A 5TJ9A 3X2EA 5JDIA 2H63A 2P4HX 3AM5A 4I8XA 4BO2A 4I5EA 2X8LA 3RKUA 3S2EA 2HUNA 3B1KA 3H9JA 5H81A 3DBHA 1NQ5A 1FDTA 3C7CB 4XYGA 1AXGA 3PLNA 4GI2A 2C2XA 4MVJI 3Q9UA 1ZNQO 1X0XA 4FPXA 2NTNA 1DDOA 4FDAA 4KWHA 5A5FA 3S2GA 4GX1A 1P1RA 3F9IA 3UUWA 1QYCA 1B15A 1C1DB 1PZFA 4FJ1A 4CMJA 4WASA 5B4VA 1BHSA 3P5SA 2DPHA 5CAEA 4GPD1 4XJTA 3QVSA 3HN2A 5K0ZA 2W90A 2AHRA 5I8ZA 3WGQA 4UAGA 1UDBA 1C1DA 1JQBA 1NVGA 1FDVA 4AL4A 1ULUA 1Q0HA 4ILKA 3AJRA 2TMDA 3DFZA 4MP3A 4YAJA 1RM5A 1LTHR 1DFHA 5BNIA 4FCCA 4GX0A 4B8ZA 3GLQA 1MXFA 3I9NA 5B4TA 5JCXA 5JYDA 5L7YA 4NR0A 1F0YA 1Q7BA 1ZBQA 4DUPA 3INGA 4DYVA 4LSWA 1Y5RA 3MJVA 4RVSA 5AXCA 2A9FA 2FHSA 4YTEA 2DKNA 5BNTA 4E2WA 1VKNA 3IJRA 1M76A 4NU5A 3BA1A 1KIFA 1P1FA 4BO5A 2C7GA 1K5HA 3PWZA 1O94A 8LDHA 4LMRA 2I9PA 4YJFA 2NVWA 1P31A 1EBFA 1MG5A 1XHLA 3V2GA 2BFAA 1T26A 1D3AA 3I4CA 2XAAA 2DUWA 2ZKLA 2I67A 4J7CA 3Q2IA 3FD8A 1U3TA 4DLAA 1A7AA 1XGKA 3DZKA 3IDSA 3MTGA 4PLCA 1E7SA 3CXRA 1BRMA 2X5JO 3E03A 2C29D 1E3LA 4JXKA 1KVSA 4PZCA 4IY1A 2FP4A 4FSHA 2P4QA 1YQGA 1SZJG 3LC2O 4FD3A 4PLWA 4EW6A 3GOHA 3ZHYA 1RM3A 3ZGYA 2P9CA 4R1UA 1PJCA 1VKOA 3PQFA 3L0DA 3W8EA 5JO0A 2UDPA 4E30A 5T64A 3JD3A 3TZCA 4YPOA 1X7GA 5BQFA 3CE6A 4BQRA 1D8AA 1MGOA 1NR1A 2BH9A 2EKQA 4IS3A 3R6DA 4L74A 4DTIA 2BKAA 1Y7TA 4LCJA 4OOFA 3IP3A 3DL2A 2GGSA 2A92A 4OH1A 3U4HA 4J7UA 1P1KA 2Q46A 1I36A 1O9BA 3NEPX 4JBGA 4M87A 2PZLA 5CPFA 1WDKA 2PZJA 3RFXA 1OC4A 4P4LA 3IIEA 3UF0A 4AJEA 3NYWA 1V9LA 1CRWG 3BTSA 1YJQA 5A5EA 3PIIA 1U2DA 3D4PA 3FPLA 5CDTA 2VRBA 1S6YA 3AOGA 2JAHA 3C1AA 3M1AA 3UOGA 2DBQA 4M1QA 1E77A 4W82A 4YJDA 4J90A 2Q2VA 1VC2A 5CHEA 1DC6A 2EERA 5G4KB 5HS4A 4AICA 4UEOA 1BXKA 3AY6A 4ONEA 1H0KA 2Z95A 3OA2A 4M55A 1FDUA 3HFSA 4DGSA 2UUPA 2XXJA 5IDWA 3UVEA 5G4KA 3OQBA 4AFNA 1XELA 3ADPA 5TRTA 4FFLA 2AG5A 1KBZA 1KS9A 3K5PA 2DQ4A 1JLLA 4KUEA 3RASA 1UAYA 1SMKA 3W8FA 1LDBA 3PP8A 4P8RA 2X0JA 3T4EA 5I9NA 5TS3A 1MC5A 1U4OA 3QA9A 4TZKA 3AUAA 2PY6A 3BMQA 2OORA 3AW9A 4DC0A 3DAPA 1RYEA 5J23A 2HK8A 3PTZA 4CM8B 3DHEA 2OUIA 4PLHA 3CIFA 4D0SA 3H65A 2ZYAA 5LDGA 2Y1OA 3WS7A 5G0TA 4E5YA 1ENZA 3WGHA 4XJSA 2GD1O 4CM8A 1HDZA 2CFCA 4YT2A 4AG3A 3BTVA 3H9GA 1ZO8A 5ADHA 3CINA 3EY4A 1DRWA 2Q3EA 2RBEA 2X0IA 2O4CA 3SBOA 1WAMA 4YYZA 1ZZEA 3JYNA 1GD1O 4U6QA 4NIMA 3KVOA 2Y1CA 1FDSA 4IJUA 1E3EA 1V0JA 2VHYA 4F6CA 5A1TA 5KJEA 4R5HA 1I01A 3DONA 1N1GA 1UAGA 3H9UA 1ZFNA 4BNLA 4GX5A 5DP1A 1PS0A 4FQ8A 3LLVA 3AOEA 4BNKA 3KETA 1K6JA 1H6DA 2PH3A 1SEVA 5ICSA 4S1VA 5THKA 3HADA 4XB2A 2B37A 1EFLA 2P68A 4NBWA 1U8FO 4D7AA 3TRIA 2ZIZA 5LDHA 4RF4A 1VSVA 2AXQA 2VWGA 3AY7A 4YT8A 3DQPA 4PG4A 5JY6A 3V1UA 4XKJA 1PS9A 6ADHA 1ZK4A 3ZHXA 5DP2A 4CPDA 2PZMA 1ZJYA 3V1YA 9LDBA 4GBJA 3GGPA 4KWIA 4QSMA 3TJRA 3VVCA 4FR5A 3WXBA 2VT3A 4D3SA 2GYYA 1A9YA 4UEKA 1QG6A 1TA4A 4E0BA 3JYPA 4O1MA 4WCDA 4ALNA 1W0CA 4BGUA 3LQFA 1RKXA 4BIIA 3MTJA 2O7SA 1U3WA 2C82A 3H2SA 3FRJA 1NVTA 5DBFA 4CMCA 3PJFA 2CY0A 3C8MA 4ALMA 4AJKA 3QLJA 1AHIA 1X1EA 4A5OA 1HE3A 1QV7A 1M6HA 5B4UA 4JLWA 3VPFA 3RQSA 2J5RA 2Q2QA 5L4NA 5U1PA 3DAGA 4UUMA 1QYXA 1HE5A 3OJOA 1ISIA 2W2LD 4GWKA 1ENOA 4CM6A 4DRYA 1Q7GA 4E5PA 1VRWA 3H4VA 3T4XA 5ER6A 1GUFA 1B7GO 1LSOA 3D5TA 3SLKA 4P4GA 1JWAB 1Z82A 3WLFA 4BO8A 2AW5A 3NTRA 2EP5A 1V3VA 4BHTA 1Y9EA 1ADCA 1CQJA 1EE2A 3N58A 1E1LA 2NTVA 3UH1A 3JCZA 3U3XA 4B4WA 4CV1A 3AWDA 3LT2A 2Y1EA 2X7HA 5G4LA 3RVDA 3OECA 4YB8A 5AVOA 3IUPA 4RF5A 2Y99A 1BW9B 2G5CA 4UVEA 3EZYA 1T2CA 4DQUA 4IS2A 1HKUA 2A35A 4U0JA 1MA0A 2PKRA 1UUFA 2AQHA 4JN6B 3VZRA 1BWSA 3GT0A 1KY5A 1U4SA 5KVQA 5EQFA 4WEOA 1Z73A 3HFGA 3F4LA 3AFMA 1EQUA 1ONPA 3I6IA 4DBZA 2PH5A 1Q7CA 1XA0A 1MG0A 1LDMA 4ZGWA 1A9ZA 3DOJA 1LC0A 1X1TA 5JC1A 3OQ1A 5BSEA 4NBVA 2GUGA 5GZ6A 4XWYA 4CMHA 2DTDA 3ZWNA 4IMPA 2E82A 3KSUA 4WGGA 1AHHA 5DZSA 1E7WA 4DMLA 4JX8A 3NX4A 4BKRA 2IZZA 3Q0EA 3CZRA 4PG5A 2O3RA 1BVUA 2Z1NA 2JCYA 2HMVA 2X9GA 4GLLA 1R4NA 1M66A 2O2YA 2GZ2A 1VM6A 2GN6A 2YV3A 3PYMA 1PJTA 2VZ8A 3GPDG 5F1OA 2YY7A 4CUJA 1P45A 3H9QA 4WNIA 2DU8A 4YRAA 3GEGA 5JFOA 4UREA 4TKMA 4WCFA 1C3VA 5TQVA 1PWZA 4FJ2A 2EKLA 1A4IA 2YHIB 3FR8A 3ZWMA 1W6UA 4Q3DA 2QW8A 4UVHA 1Q2XA 5HTOA 1HYEA 2WWRA 3H3FA 4PLYA 4BNGA 1KETA 5G0WA 5L51A 5L95A 4Z0HO 2YW9A 4RZHA 3PQDA 1E7QA 1ZUD1 2QIOA 1DLJA 4OMUA 1HE2A 2YHIA 5T6BA 4RGBA 2Y66A 5ER9A 1LXCA 4Y6RA 4B4OA 4E2XA 2JHFA 2Y67A 3D64A 3WJ7A 5ILGA 2AA3A 1XCBA 1UXHA 3LF1A 1MV8A 2NVBA 3Q3CA 1SC6A 4R3WA 3OHSX 3V2UA 1NWHA 3A4VA 3TZ6A 5EL0A 2G82A 3EYWA 5L3ZA 2EIHA 2E49A 1GV0A 2PD6A 3IJPA 1GDHA 2DBVO 2P5UA 3I9JA 3SX2A 4BNIA 5TLSA 3JQFC 4L73A 4G65A 5G0SA 1HLPA 2POQX 3JQBC 4MPDA 4W7HA 4AJ1A 5ES3A 3ANNA 3JD4A 3MOGA 3QVTA 4GKBA 5ITVA 4PCVA 4HY3A 4DLBA 4QFCA 3DXFA 1XG5A 4GX2A 1RYDA 2VOEA 3KYCA 4K28A 1IB6A 5KOIA 1YOVB 1HTBA 2VRCD 1LC3A 3NTOA 3I5MA 5EQDA 2EEZA 5EMHA 1T1SA 4FGSA 2DFVA 3VPXA 4PLTA 4KP7A 4RJTA 1VJ0A 2VWQA 1N7GA 2EXXA 1UXIA 3OETA 4DA9A 3LZ6A 3ZW9A 3ZNQA 1EUCA 4AJOA 2D2IA 2J8ZA 2AE1A 4Z0PA 1SEPA 2GZ1A 3JD0A 2ZQZA 3KYDB 3OIGA 1JTVA 1HLDA 5DF1A 3WQQA 3I3OA 1M2WA 1J5PA 3ROMA 1P1HA 2O7QA 3U4CA 5THQA 4YVFA 1TXGA 4WLOA 2DTXA 3FCOA 5A04A 1HL3A 2ILTA 5MDHA 1R0KA 3U62A 1I3LA 3OM9A 5EINA 4GGOA 4XGIA 2CDCA 2B5VA 1ZK0A 2JL1A 2X0NA 1D7OA 3JQ8B 3OJ0A 1VE9A 3VC7A 1E0DA 1JVBA 4XYLA 4LISA 4TWRA 1DRUA 4NDNE 4OSPA 2FPPA 4RPHA 3IKTA 3GA0A 4A03A 5A05A 1KYQA 1BMDA 5L7TA 4AJIA 2GR9A 1BDMA 4NHEA 1YBMA 2VUUA 3JQ7B 5F5LA 4NJOA 1I8TA 3CZMA 3JQ8A 1TEHA 1WNTA 3L4BA 4J4BA 4CM3A 3PEFA 1HDOA 3CTMA 3QWBA 3WGGA 4EJ0A 3JD1A 2GN8A 4NI5A 5JPIA 4IIUA 4CM4A 1ONOA 3MJ4A 4R41A 2IRWA 4U0KA 3EMKA 1GV1A 3GZNB 4OJNA 4BMNA 2YV1A 4ZVVA 1NQAO 3V8BA 2FN7A 4QO8A 3ZNOA 1VL6A 2BLLA 4WJZA 2C7VA 4PVCA 1BSVA 1CWUA 1H9AA 2W98A 3PYLA 3QWAA 1PQUA 3U9LA 4BNNA 4F46A 4OM8A 5JAQA 5A9RA 3WB9A 3QE3A 3GZNA 4HFMA 5T67A 1ZW1A 2VHVA 2BFMA 4A7PA 1I3KA 4DPLA 3RIHA 5JDCA 3VPSA 3GNTA 4WOJA 1J0XO 2WD7A 3PGXA 3O8QB 1YWGO 2VZ0A 4C4OA 3OJFA 3OFSA 4D45A 2VYVA 1YKFA 3NUGA 1E3JA 3WNVA 4YAKA 3N7UA 3LC7O 3KSDO 4BNHA 1GQYA 3O8QA 3AU8A 3WGYA 3ZZNA 4UUOA 4CM7A 3P2YA 3B1JA 2JHGA 3TQHA 2I66A 2O3SA 2Z5LA 3TZHA 2EGGA 3D4OA 4MJLA 2X58A 3H7AA 3VH1A 2O3UA 4K6FA 3VTFA 9LDTA 3DC2A 1SAYA 3JQ9C 4ND5A 4BNJA 1NASA 1NM5A 4BUCA 1YL5A 4CL3A 2VNSA 4OYRA 2CUKA 4ZRMA 3SLGA 4Q9NA 1YQXA 1NPYA 3S2FA 5BSFA 2GRAA 5HRUA 1WP4A 2FRDA 4CJXA 3JYQA 2YFQA 2RCYA 2BRUA 3TZQA 1JKIA 1HSZA 4ZQGA 3ZNNA 3Q1LA 3AUUA 4J1NA 2GERA 3WDSA 1VJTA 4WKGA 4R01A 4Q3NA 3R0IA 4O63O 1Y81A 1Q0QA 4XQ9A 5IZCC 3FBTA 4E32A 2VQ3A 1M75A 3GDFA 4MVJM 1DBVO 1NX6A 3KB6A 1RJWA 3P2OA 3DZJA 1WXDA 2PLAA 3PHIA 1F17A 3DZGA 4M89A 4TRJA 5JMWA 3ETDA 2YQ5A 2E4AA 4MKRA 4YR9A 2IEBA 5GZ3A 2NACA 1RPNA 3JQEA 4TVOA 2NUAA 2PK3A 3K31A 1GAEO 3PQEA 3F3SA 3PJGA 2JCXA 2X5KO 3HE3A 4DPKA 3K2BA 2SCUA 4KUHA 4WLNA 2J3IA 4NNJA 5L4SA 1YB5A 2O3JA 2P2SA 1UDAA 1MUUA 2J5KA 4IINA 4YJHB 1O8CA 2A94A 2R00C 3OICA 4FC7A 4XIJA 1E1MA 1H5QA 2VYND 1LDEA 3RUHA 5KKCA 3ZV6A 2OZPA 1AE1A 4RDHA 3LLSA 4LW8A 4D43A 3RSHA 3E5RA 4DXHA 3PYXA 4K26A 1K89A 1YVEI 2A4KA 4YJHA 4AJPA 3PI7A 4BB5A 4PRKA 4CMKA 3WTCA 2FOIA 2JD0A 3ITDA 4B4VA 3OEWA 3GMDA 4OKNA 3ETEA 2GN9A 4R4JA 4MVJH 1FJHA 2WD8A 4ALIA 2Y0DA 2ZB4A 5B12A 2I3AA 1E3WA 4LGVA 4YXFA 2RHRA 3GHYA 1DFIA 3N74A 1XKQA 3WG9A 1BGVA 4EUFA 1JKJA 2O50A 4YDRA 3U49A 1BDBA 3FN4A 1ENPA 4E6PA 1K6IA 3NAQA 3BTOA 3D1LA 4Z9YA 4GVXA 3SC4A 3L6DA 3LT0A 3K96A 3QQPA 3O4RA 4XGNA 3G49A 5COQA 1DB3A 1PL6A 4K9DA 1F8FA 1HDXA 4KDEA 1P0CA 4KQWA 3BHIA 3DTYA 4BMSA 3OIDA 2I3GA 2FR1A 2VZ9A 1Z6ZA 5AXAA 4Y67A 3C7AA 4P22A 3DBRB 1E3SA 4DL9A 4JGBA 1NVMB 5EJ2A 1PQPA 3TOXA 4NU6A 3DOCA 1HETA 3ZU3A 3WBFA 2JFGA 4B7XA 2EW2A 2ZYDA 2DBRA 1WMAA 4ND1A 5IXSA 3RCBA 3GG2A 3OJEA 4U5QA 1ONNA 4DVJA 1NBOA 2O3QA 3JQAD 3PRJA 4IPTA 2LDXA 2IXBA 2ZJ1A 2Q50A 1SCUA 5JLAA 3TL3A 4CR6A 2J3KA 1YE3A 4IDGA 4ZN6A 1KVTA 1I5RA 1T25A 5IFLA 1XWFA 2GO1A 5BNFA 4CLXA 5C37A 3ZHBA 2TMGA 1HT0A 2NU9A 3D3WB 3UKOA 1KVUA 2Q1SA 4FOOA 1LDGA 2NTJA 5CDUA 1ID1A 2W8ZA 4FJ0A 4ESOA 3ZWXA 3PHHA 1R0LA 2IYOA 2C5EA 3H9EO 4MVJP 3K9QO 2GASA 2HQ1A 1XDWA 4ZQBA 1DC3A 1PEDA 3QWIA 2BF7A 1R66A 4YQZA 5T8KC 1MC4A 4A10A 3VPHA 3WQSB 2PWZA 2HJSA 4IXTA 3EAGA 3CSDA 1YQDA 2ZYGA 3PZBA 4BO0A 4BO4A 3OJLA 3JQGB 1KEPA 4E5MA 3QY9A 4RPKA 5A9SB 1EVJA 1WZIA 3FHLA 3B20A 4OIMA 5AQ1A 1Y9AA 4YQYA 2BGLA 1ZMTA 1A72A 4D3FA 3JQGA 1WWKA 3PFFA 3GK3A 5L45A 5GZ1A 2G76A 3FWZA 5K6AA 1QV6A 1P74A 2V6BA 5JO9A 2UAGA 2X22A 1L7DA 3PJDA 2Q1TA 3FTNA 3D7LA 4M8SA 1DIGA 1R15A 1OAAA 4B7CA 3WGIA 4TRMA 2W4QA 1E1NA 1RM4A 3GAZA 4GMFA 4UUNA 2IXAA 5L40A
chains in the Genus database with same CATH superfamily
1RIIA 4F5ZA 3AHHA 1X8JA 3Q11A 1SNYA 4AKGA 1WF6A 2P5TB 1YDHA 1I7DA 3RTEA 4NLLA 1FSPA 1B0AA 1KPHA 4K6MA 3GQBB 3LFTA 4IMIB 1ZR2A 2ZDGA 3GRCA 4JK3A 1M83A 1LQTA 5LQJA 2R6JA 1PE0A 1ZOOA 2ZW9A 4HDAA 1E8NA 2PL9A 1HORA 3PWKA 4P93A 4QYIB 4RZQA 2OBLA 1KAQA 3ODGA 2R5FA 5IT0A 1GQ2A 1CJVC 1D4OA 2FN8A 1P44A 2ZIVB 3NKVA 3D5QA 4FYIA 4BN0A 1BCRB 1WUYA 3G89A 4DIOA 1G38A 3P45A 1RKQA 5BMVB 1XVLA 4BE4A 4BX9A 1PJSA 2BHSA 3AI3A 4RHFA 1CZHA 1GZUA 2C2ZA 2C9MA 3ML1A 3GCGA 1NBMD 3MSCA 3L7KA 2P3SA 1J0AA 1H6CA 3K1AA 2B5WA 2GB4A 3DEZA 4EUNA 3O82A 3HZRA 3K0CC 4NFSA 4G1UC 3EHDA 2XXAB 4FC6A 4OBXA 2ZTSA 3MS2A 4WTOA 5DSZA 2VHZA 1EM6A 3ODPA 2G17A 4KAFA 1JSRA 4HYQA 4DB4A 3S7TA 2CZGA 2PGAA 2CV1A 1LSUA 4JYPA 1VBMA 4JP8A 1UZMA 3EFBA 2YJNA 1IJKA 4V0QA 1F12A 4BIIA 4JI2B 2QTFA 3PIRA 5JSFA 3WIDA 2IV3A 3MLEA 4WZBA 1KF0A 3G0GA 121PA 3OQOA 4A3SA 4HR7A 1V1RB 1YCFA 3ND6A 4XD7A 1JA1A 3WZ2A 1S7GA 4GH5A 3EUFA 3WLNA 3AF5A 2XB4A 1WB9A 2FMHA 4GS5A 4ZAFA 2O8FA 3HDVA 1LPNA 4WLVA 4B6QA 5IAEA 1FYDA 1JDBC 1TT5A 1SQ0A 2PRZA 3BB3A 3FPSA 3HJTA 4OGFA 4DKXA 1UJ4A 1QYDA 5AJYA 3Q7TA 4YUXA 4CWAA 4U8HA 2NO9A 3G3EA 2V1UA 2XXBA 3KOOA 3PX3A 2QAJA 1U9IC 2F8LA 2PRSA 1O08A 4HNVA 3NM6B 5IYZF 1HF3A 1V3UA 3HXPA 4LGMA 2VT2A 4OAOA 1J20A 1YS4A 2C59A 2ZI7A 4CODB 3M82A 3H5OA 4HNGA 4Y2RA 4R1OA 1PHRA 1LK7A 4C3ZA 1XX6A 3ZUPA 3Q5GA 1NNEA 1ODCA 3GRRA 3GGCA 3W5AA 1PFWA 4MW5A 1PTJA 2RMKA 4MO2A 4BNYA 1E6CA 1WM1A 2XTJA 4LVUA 3T7KA 1SQGA 4RD1A 5PGMA 3DQQA 1V37A 1NJGA 3E5NA 4KC0A 1YBVA 3HCFA 1DXQA 1MHPA 2AN9A 3WYBA 3NBZC 4GIBA 4Z1MD 2QMUA 1ADFA 2V6MA 3L7BA 4GE3A 2B1IA 1C7QA 1X1DA 5K0JA 5DULA 1FOEB 1LU9A 1LZKA 2QTGA 5JWHA 1X6VA 3VHLB 2GM9A 1W0JA 3L8DA 4ENUA 2JFHA 1UCFA 3F5QA 2AZDA 3HA7A 5HCIA 4QX6A 2X3FA 4IIGA 3L43A 4OIFA 1WY5A 1XAJA 4HH1A 1PK7A 3T0FA 1P77A 1EAMA 2EX1A 3NORA 1PTKA 1AKWA 5M7EA 1EXVA 3NGXA 4HWSA 1FRFS 5F73A 4LPKA 1WXWA 1XEFA 3TN7A 1QFXA 4N0EA 2QLLA 2YWFA 5LCXA 2O57A 5FUYA 3NRCA 1QYVA 5FCDA 1N2SA 1ZH2A 2JARA 1SFRA 2XYPA 2DH6A 2YYYA 3PC7A 4G1MB 3NUZA 2IBTA 5FNZA 4QLBA 4OA5A 4NV3A 1HDRA 4EJ2A 2NLOA 1GFZA 2DG2A 4M49A 2WOOA 1I3NA 4I9HA 3ZCPA 1B8PA 1MQ8B 1UWKA 2LKCA 3CW8X 1OFIA 4HJXA 3KB8A 3EVNA 4NCKA 5EERA 2NO1A 5C1PA 1GNQA 1Q74A 5J1TB 4K9PA 4OGKA 1JAXA 1I30A 1CRLA 1NZFA 3B1ZA 4RMJA 3D7RA 1NN3A 1L7OA 1NOJA 2WJ4A 1YI0A 2WOJA 4KXVA 3T1YB 1UZAA 3GIDA 3GWZA 5K6TA 4HUQB 4AYWA 2X5NA 3FCSB 4YP0A 1GNLA 1FU7A 1DG3A 2HWUA 2ZTLA 4L2IB 4WKOA 4ZOLB 3EAFA 4WI1A 2WF8A 2C9BA 3WBKA 1XRNA 2OO5A 4MRRA 4X45A 1NPTO 3LBAA 5CTJA 4JJIA 1HRKA 3DKKA 4KIUA 3FKJA 4ROSA 2HU8A 3L6BA 5A3QA 4NOLA 1QMGA 3LU1A 3NXSA 4GUDA 4HGQA 2ZLBA 2UYYA 5EMNA 1BOFA 1JN0A 3RC7A 5FV7A 1EJBA 4MI9A 1NHGA 3G2QA 2WWGA 3OQIA 1A7KA 3Q2OA 3VPAA 5JYCA 1UM9B 3VNVA 1LQ2A 4U7HA 4LRYA 5HE8A 1YNOA 3L02A 5DM2A 1L1FA 4ZHQF 1JFRA 1JFFB 3W3AD 3W7VA 3IP7A 2DM6A 3D2CA 4DREA 1JIUA 4Y6GB 3WYCA 1MMFB 5F5XA 1ONSA 2NUTB 5TPZD 3BXFA 4IZHA 1A2KC 3M6XA 3O2SB 5LBUA 2NAFA 1Q22A 1E7RA 3BCSA 1RBZA 1PU2A 2CNBA 4MWTA 1L4UA 2FPXA 5BORA 4J9UE 3FHTA 2EJTA 3NDJA 3LX4A 2AD5A 4IDQA 2WQ7A 4L28A 2HQBA 2JFPA 3BIFA 2NSJA 2IVFA 3NKLA 4D3YA 3N6VA 2HO4A 1K7XB 2VJKA 3AR3A 1D1PA 2XIQA 2JDIA 3EIQA 3HBLA 3K71B 2JLCA 3IQDB 2HH9A 3B8HA 1ZSVA 4ZQFA 3IDZA 1IJBA 1T36A 3PXCX 1OXSC 3WLRA 1T6YA 3ZJTA 1YH3A 2PL1A 4KRFA 3DT6A 3DO5A 5C8YA 4Z0NA 3DAOA 4HDSA 2FZWA 2VR1A 3HG7A 1OGIA 4KRGA 2GN4A 3V2HA 4D46A 5AVQA 3E05A 1KE1A 3BGDA 4I1IA 5MFPA 3DWFA 1A1VA 1OU4A 1B0PA 4EP1A 1GVNB 1QYWA 4JIGA 2I7VA 4QARA 4RSGA 4I9NA 4R5MA 4U7FA 4M22A 3OZCA 4HNUA 2AF4C 1UQTA 3U4DA 3S6JA 4HMPA 1KGSA 1C80A 1CY4A 1G3UA 4Y1RB 5AI9A 1D7AA 1GTVA 3DT8A 1EP2B 3KXDA 3FJ1A 4UASA 5JJIA 1O95D 3OQ6A 1E69A 4MI1A 1MBZA 2VF7A 2Z58A 4JASB 1E2EA 4UAVA 4XR9A 5IBRA 3CC8A 3I8OA 3NHWA 5D1NA 5BT9A 4NJMA 2I22A 3VC1A 1NJFA 5K01A 1C9JA 3T34A 1DJQA 1I7QB 3JAMA 4H31A 1P39A 3KQUA 3MERA 4LY9A 3RVSA 3WMXA 3OKCA 1T8WA 5DIZA 4N6OA 2C9DA 1J0EA 3U4IA 4K46A 1FDIA 3DLHA 5EJ5A 1W581 3LIPA 1DT3A 1GZ5A 4YRRA 1LPSA 1Z4PX 2DC1A 4HLQB 3FH0A 3QE4A 4LJLA 3VNBA 3HKBB 2JH3A 3QFHA 2V9PA 3K9WA 3WWYA 5FBLB 1KO5A 3SJUA 4HX9A 4OCZA 4CM5A 3WLOA 2HADA 2PA3A 1RQPA 1LCIA 2DUUA 2P9ZA 2DWUA 4LHWA 4MK4A 1B00A 1E1DA 5ILQA 2IXGA 2ONKA 1A8QA 2SICE 1UMDA 4LCEA 4XRGA 4P7GA 1NW3A 1GYPA 2BM8A 4M0PA 3SC6A 2OP1A 4HH3C 1V8ZA 3QIAA 1YQEA 3AGQA 4BNWA 4WK4B 3W9SA 5IC5A 3Q41A 3L4JA 1GZ7A 2AX4A 3IA2A 4AJJA 4MNTA 1CY0A 1SXJD 2MMCA 3OE1A 5TQ0A 1TMKA 4DG9A 4RTPA 4S04A 1ZAKA 2IYWA 1R16A 1JPVA 4Q3KA 4QBKA 3GXBA 5ICMA 5H0IA 3L7DA 1M2NA 1X86B 4LYFA 3Q3EA 2ZCJA 1FVHA 2HHHB 2F3PA 1T9GR 2PDAA 3ILSA 3I52A 5I9BA 1DXYA 1QTNA 3UGJA 2H3HA 4A0GA 2RHCA 1U1CA 2HKIA 3T9FA 5K99A 4NABA 4N5NA 1Q5PA 2R6GA 3A1SA 2Z8XA 4TRNA 4YRDA 2V8BA 1TZ2A 4ZU3A 5IUKC 4Q39A 4YP5A 3RLIA 3UAVA 3FWYA 1YOVA 3LUHA 1V9CA 3WGVA 5KYXB 1JUDA 4O29A 1EQ2A 3ADKA 2QTAA 4D3DA 4MQEB 4ZD6A 3MGGA 2FPOA 4KQ9A 5TNXA 3U81A 3UMFA 5TV2A 1QBGA 2GAOA 1TU3A 1VBKA 4D98A 2IYAA 3GL9A 1ANKA 2V8OA 5A4KA 1N92A 3UFXA 1LLDA 3LBHA 4P38A 4B3HA 3D7KA 1CQIA 2HF7A 1JMKC 2AFIA 2VTEA 1JW9B 2CFSA 2GBGA 3KYDA 4YUZA 5FA6A 2YY6A 5DTMA 2D5CA 3ULKA 3AHIA 4JUDX 4U6SA 3GUZA 3QOYA 1ZH0A 2ZS8A 3GR6A 5F9HA 4RVGA 1J0BA 4BKPA 4UEJA 5DOZA 1Y8QB 3PD1A 2BTOA 2B8WA 1LRJA 3GOQA 4B6JA 4BL5A 2OUKA 2R7AA 4Q16A 3P2MA 5BOSA 5IHXA 2QTMA 4Q3BA 2Q1WA 3BXOA 5LPNA 3HUDA 1A5TA 5J2UF 4H6XA 3U56A 1V5GA 2ZB8A 1FP2A 3EY9A 1A4UA 3QGMA 1O54A 3FVRA 5DLQC 3PDUA 1V48A 1PW5A 4UE2A 1ZVMA 5KINB 4B9AA 2XUPA 4NG5A 3KPUA 1Q16A 3O8OA 3D1VA 4MVJG 2MYTA 5TX7A 4D9EA 5I7HA 3ITNA 1ZCBA 3O0TA 5MF6A 5SZKB 1ISHA 1SBTA 1Z83A 4I08A 1FXWF 3RS7A 4J0FA 1R9JA 1X9IA 1CIPA 3DE1X 2UVQA 3OBBA 4AKSA 1MXHA 3QFCA 3UMRA 3V00A 3JAWB 4GQAA 4Q15A 4R0NA 5DLDA 5ICCA 4PTYA 4XUEA 4EZBA 3UV7A 3A2NA 3NC0C 4OBBA 1R6DA 4FYWA 1T3ZA 1K3TA 4FI3F 1EVYA 4BWGA 2YQZA 2ZB3A 4LXXA 1T3HA 4MMYB 4IR7A 4XARA 3ZHTA 621PA 3I9FA 2NV6A 1XC7A 5TT1A 3HJUA 5F9FA 1QANA 3SC3A 4MWOA 3RT7A 4NS4A 3H6KA 2VYNA 1NZJA 3KKPA 3T5GA 1KDTA 2MMGA 6Q21A 2YMQA 1MAUA 4CN8A 5BWOA 1AQUA 1GKYA 2FSGA 2G83A 5CB4F 1H93A 5BYBA 2W48A 2HM7A 3GNQA 3HFJA 3UXEA 2AQ8A 4EA8A 3BZUA 3VYSB 1YC2A 3OZAA 1IN5A 3P9SA 4REQA 3ZDQA 3PNMA 4WBNB 2XNDD 3L6OO 1Y1LA 4JZYA 4TGLA 4Q9HA 3QV1A 4F56A 2D5AA 3GDOA 2PSJA 3GA5A 3K6JA 4KLAA 1D9ZA 4FX5A 2NPOA 2YL2A 4HK4A 4JLMA 4O2AA 4WQMA 1EVEA 3R5HA 1PLKA 2ZQ5A 2R1TA 2YV2A 3BKXA 4EO9A 1RQ2A 2X9NA 1FYFA 1UFKA 4B3CA 5I5GA 3HNPA 3IP5A 5JJ5A 3JWPA 4G86A 4GGPA 4C89A 4DYHA 2WJ3A 4HDKB 2O0KA 1IBMB 4NAVA 3KTAB 2HF9A 4ETMA 3GLGB 2QRZA 3AP1A 4DQKA 5C7OO 1QOZA 1M0WA 2OK8A 3E22A 5A4DA 3CBGA 1Z17A 5EYPB 1PT7A 1C3JA 4MQ5A 2WU4A 1HFKA 2GVZC 2DLNA 5AM4A 1POWA 1HYGA 1RABA 1ZSNA 3QMMA 5ISMA 1YS2X 3AEKA 3BQ9A 2C2OA 4KLNA 3DLIA 2XVAA 5EI5A 2VCYA 4W5OA 1H69A 4TLLB 1XPUA 4I5FA 4O5OA 1EDOA 3NVKI 1HYQA 4FTWA 5BR7A 2W2OA 1EVIA 2ECPA 2NN3C 5CJJA 1U1DA 4GRDA 2RDMA 4U7JA 4LI0A 4M98A 2VHQA 3RREA 3WNQA 1HNXB 3BGVA 4FFWA 5LZ9A 4O3MA 2QROA 2FLWA 1CEEA 1SG9A 2UV8A 1PGQA 4ZHSA 2PE5A 3ETLA 4AUMA 4N1AA 5BQPA 3QKRB 2WRZA 1VHDA 4IJWA 4PLFA 3UAOA 4L4SA 1EWKA 2OQIA 3JPYA 1YGYA 3ABQB 3GFRA 5LP6C 4PVDA 1UWCA 1U0SY 2WD9A 2PIDA 3PFCA 4O2BF 5JANA 3K4PA 4RHCA 4E2FA 1EHYA 4P2BA 3FYDA 3H99A 1G9XA 4BCBA 1Z5NA 2R8OA 2VDVE 3G2HA 3HJFA 1I1NA 1ZXBA 2BHRA 4QHSA 5KWIA 2VJQA 2HRCA 2W6QA 1Y6RA 5HBRA 4FFOA 5BOVA 4BFYA 2PANA 2C5LA 2ZI6A 1UZUA 1AQJA 2GCGA 1L5QA 2G09A 3GGOA 4MVJD 4O4HF 4C0HA 4G0VA 4DV6B 4NCAA 1RZRD 1SC9A 2I33A 4I8DA 5FBKA 1CUGA 5LVAA 1NXVA 4G09A 3AEZA 5DYWA 2Q2WA 5EXDA 3VUFA 1IK6A 1YHZA 4GEKA 4TWJA 2YWDA 3TRJA 3ANLA 1VLHA 3IUBA 4NCJA 2IS4A 2HSJA 2GD0A 4NZOA 3ISVA 4JITA 1HT2E 1FX0B 2NQ2C 2VHJA 4OXKA 1S3SA 5KZMB 3C3EA 1PEYA 4DLLA 3FM9A 3E82A 4QQKA 1DIAA 4HSEA 5FLKA 3WLEA 2V96A 4UHCA 2WUGA 1HRDA 4PINA 3AVWA 2YIMA 2J31A 2IHVA 3IAFA 2Z5GA 5H3CA 4CQLA 3G85A 3LIIA 4DM7A 2NVOA 1G5PA 1QRDA 4WCFC 3NJ8A 2JRLA 2AC4A 2VA8A 1LH0A 1QGDA 3HXMA 2RJNA 2O7RA 3LG2A 4N5LA 4OB6A 4W8GA 5FQNA 4PLPA 3BL5A 5KVVA 1MN6A 1QGAA 2VS1A 4FFDA 3OO1A 5JJKA 3WGJA 2RD2A 2VJBA 3KVRA 4Z4CA 1IZZA 2JZOA 1GYQA 5IJAA 1UBLS 1BNCA 2GCNA 3SS7X 2CV0A 1MP0A 3B3JA 3E3AA 3EIEA 4EGSA 4F84A 1QGUB 2XYVA 1PO7A 2KM1A 3FUWA 3OZ7A 3ZCVA 1B6TA 2H59A 5EJ9A 4B3XA 2V7BA 3FX2A 1VJDA 1VGQA 1L3IA 2ZCVA 3V5NA 1VG0B 2QX6A 4QT4A 2VWPA 3B6KA 4TS1A 4DDUA 2CKMA 4Z6KA 3DBHB 3N07A 4WUVA 4KPYA 1AGRA 1PNVA 2Q6OA 4LQDA 5GPBA 4OI1A 1VJCA 4XQ0A 5HK8A 4DAEA 4EKGA 4S12A 1U11A 3EVFA 9GPBA 3D7MA 1CQZA 2XNSA 4RF2A 1O89A 2XECA 3LA6A 4NWIA 4TS4A 5FR1A 2RAVA 4RXMA 1EK5A 1MJHA 5D5QA 2D74A 3A05A 5A4MS 3SICE 2EG5A 1WD5A 1BD4A 2YZ2A 4QUEA 1G6KA 3U09A 4KDCA 1QBKC 3TG8A 3FAKA 3C7TA 1VPTA 3CEJA 5K2OA 4PW0A 5DE3A 4XASA 4JV5B 2PWAA 3PL1A 2Q8PA 3BB4A 3SEZA 4RL6A 3WV4A 3H1PA 5EE1A 4H7FA 1YFZA 4V38A 3E61A 4JU8A 1F7UA 2SHKA 2YDYA 4OAQA 3E3LA 4B45A 1H9CA 4QG3A 1DAOA 3FKQA 3FPBA 4OQ4A 2E6UX 3QFTA 4MS3A 3UGKA 2MCFA 2QSYA 5H59A 4ZA2A 2RGXA 3ZCQA 1JVNA 1NC1A 1ISGA 1NY6A 5K0LA 3ROKA 5CH5A 3TINA 2XZDA 5JEEA 5L8VA 3C15C 1IULA 2VUTA 3GIWA 5IN4A 3C1UA 4KREA 1SHZA 1E2BA 3B7WA 3DYVA 3O7MA 2ZUEA 4CT0A 3A7EA 3KJZA 1IN8A 3RNOA 1Y8RA 1SBQA 4NATA 3DEAA 1K4MA 2BELA 1R4MB 3L7AA 2WT8A 2JLXA 2ZYHA 2GBIA 3HA2A 3FYSA 3D3WA 1H8ED 4YJFB 2XDQB 5EP3A 4TYPA 3WGUA 2X3UA 3HJNA 4LIPD 3GFOA 4C14A 3F8SA 5B3AA 5IVHA 2IU6A 4D2IA 5IM4F 2EFHB 1QHXA 3LM8A 2I55A 1S2MA 5GINE 1M2FA 1Y9DA 4U2BA 4F1JA 1YA6A 4C2UA 2ZBPA 3ZWAA 4RZIA 4Y18A 1O5TA 1S2GA 3T95A 4HNRA 4MW7A 4II3A 5JRJA 2FCAA 5TGTA 1I7PA 5J3JA 2I6XA 3L4BC 1YJBA 2VWHA 3A1UA 2E5LB 4ZVOA 4LMAA 3TLJA 1GRNA 2XV1A 3M8KA 1MQAA 5E3IA 3I2HA 5C53B 3GVPA 4LGYA 3FNQA 3W6UA 3EWSA 3T3DA 3QBTA 5I9LA 1P1CA 1JWLA 5LXTA 2Y68A 4MWDA 4L0QA 1AKNA 2HA3A 4GL4A 2GPTA 1OASA 3LPLA 3WK9A 3JXEA 4RV5A 3VSAA 3AU9A 4NE2A 1ISPA 1H2HA 1N8KA 3F6BX 3KKKA 1VCIA 2B99A 4M54A 3EDYA 1LKZA 4N82A 4OO3A 3HB1A 4FWIB 5B7PA 4IFEA 2GBFA 3RUDA 5J1SB 2NPIA 1N2GA 3HYRA 1P6UA 4YRPA 3OKAA 4JT8A 1E8DA 1KHHA 2WG1A 5FI5A 6NULA 4R69A 5H3HA 2C2BA 221PA 1OLXA 1JG7A 3ZI4A 4EECA 2BMEA 3PC2A 2ZE6A 5D84A 7GPBA 5FWNA 4EVIA 1OZAA 3EMBA 2LV8A 3IOBA 5CGZA 2GRJA 3AF4A 3GQBA 4N7MA 1ZG3A 1LI4A 1S0UA 4HQ6A 5EVJA 3QUTA 4MIKA 5MGNA 1Z6QA 4QYIA 2W6CX 2OXTA 2DLCX 4L9SA 3GJ8A 3WWZA 5L9AA 5M2QA 2EQBA 3IOMA 2RGAA 3ZV4A 2P35A 1ZGJA 5BQXA 1U1IA 3DGFC 1T10A 5KQLA 4B3RB 1ISJA 3QPDA 1J49A 3EEYA 4Q1AA 4M7OA 2YOFA 1YB6A 4OAPA 3A3PA 2JLZA 1KI9A 1XL1A 3ZHRA 1Z25A 3IE1A 1QRTA 3FOBA 4ENVA 1UM8A 4K9QA 1T3LA 2A5DA 4EI7A 1O4VA 3TKLA 4IHAA 4R8RA 2P9JA 1PSZA 2XXAA 4LV5B 1J1UA 3ORHA 2GPSA 3FMGA 5H83A 1EUDA 4ZOBA 4AJHA 3B60A 4PCLA 1GNVA 2HCFA 4NAHA 4RQUA 2YNMA 3LDHA 3M6UA 1TDJA 4BNXA 2FRDC 4ZRNA 1CR0A 2V7PA 4MA0A 1VJ5A 3P9IA 4N6NA 2CVQA 2WA2A 3EGVA 1MW8X 2YUIA 5GIPE 2QKYA 1POXA 2WJIA 3H5WA 4LSZA 1XTVA 3VVBA 4YT4A 5AOCA 3W5BA 1KEWA 3NVDA 1EK2A 1RRKA 4Q7MB 2P27A 2F1IA 2PH7A 2EBFX 5JCJA 1KVRA 1XTBA 1QUEA 3H87A 5HKBA 5E38A 2RCNA 2P78A 2OG1A 3UC5A 1G3IA 4GZ6A 3KSBC 5LB2A 3ZW7A 1EFPB 3RS3A 3V8NA 4N0MA 2JKVA 3GDWA 5JSHA 1GEGA 4G4GA 1IC6A 3M6MD 1QF6A 3GRFA 2QG4A 3C6MA 1DG1G 2EJVA 3FR7A 2GF9A 3CKMA 1D1TA 1RTTA 2YW2A 3NTXA 2JKYA 1DKMA 1UH5A 2ZRAA 1V3TA 1R3UA 3ENNA 4PZLA 5IEJA 2PKWA 4BJ3A 2R8YA 3DLPX 4BO6A 3EIHA 4P08A 3IEXA 1JXAA 2FUNB 1PZXA 5DWQA 3CISA 5JQWA 1T5BA 4MB0A 1GPKA 4QEDA 1USGA 3COZA 5ILOA 4F8YA 2FUG1 2XWJI 4IIHA 4FYHA 1A95A 2G63A 2G88A 1RVV1 2NSDA 2BAGA 3B1YA 4HLDA 2CD7A 4MCJA 1CDDA 4UZEA 3H5AA 1JL3A 1T9AA 1EGVB 2GJKA 3F7TA 3TCKA 1OXBB 2H5EA 4RHYA 4P7BA 5C35A 1CIVA 1CBUA 5H16A 2YRFA 2IOHA 2J0VA 3SHOA 1UFRA 3REQB 4EITA 3QLUC 1AK9A 4D9BA 1TA9A 2QYOA 4DT1B 4FE7A 3FTCA 2J46A 3UGQA 4X63A 5H70A 4ZREA 3BHMA 4W6ZA 1GPMA 1A0OA 1J2RA 2N75A 2X6TA 1JDNA 2J9RA 1M2OB 3E84A 3K8ZA 4O1HA 2ZIFA 1AKMA 1ICIA 2OTCA 3PWSA 5FD8A 4PQGA 1H94A 2O8BB 4BVJA 1N5IA 3E7DA 4FR2A 1W5AA 3FDFA 3RU2A 4JJKA 1F2UB 3VC2A 5JRZA 1U3FA 4CTOA 5KTPA 3K9FC 4CM9D 1KJYA 4DUGA 3SXPA 2EFYA 1CNMA 1TO6A 1A82A 1W75A 3EDOA 3RFCA 1Z6AA 2ECKA 5HIMA 2HTFA 3WWEA 1FW6A 2DUMA 3L7OA 2IHYA 1YZ3A 4FGZA 5CU7A 3WYDA 2HF8A 3ZEIA 4H1VA 4ZQIA 1N6IA 4ARZB 2H1IA 2FFRA 3X1YA 3GARA 2IH5A 5EUQB 2P69A 3P26A 1SM4A 3ESBA 1ICEA 4XFDA 1SQFA 4IZIA 3RHSA 1ISSA 1LWOA 3WHKA 5HTKA 1KIAA 1LI7A 1N9ZA 3BHJA 1SXHA 1W46A 4KQMA 1E8MA 1Z0DA 2OXEA 2PNFA 3NH6A 2Z3ZA 4MQUA 2DKFA 5LA6A 3FE2A 3VOSA 4NQRA 5KNBH 3CUYA 4GWLA 2Q5QA 4BMCA 1SXJB 4RADA 2O59A 3MYRA 1V8FA 2FJUA 3HEMA 4YT5A 5JHGB 1TM3E 4I6GA 4IRXA 1ORDA 4JENA 2BH2A 2O8CB 5IDYA 3BAZA 4L2IA 4MKGA 3ZXXA 2ZYIA 1CJSA 2PKXA 3EMVA 3QJYA 4G8BA 4LOKA 4S35A 1SVUA 4PLZA 4D02A 2DHCA 3EBOA 1LV7A 2FZKA 1JHYA 1D2CA 1EE9A 1UQUA 3IS3A 2PWBA 2CT8A 1Z4NA 3U7HB 4BQFA 4MVCA 2PGOA 2WZCA 3S27A 4Y6SA 1PGOA 2DRIA 2B8TA 2HBZA 2PS0A 4OATA 3S7ZA 4G67A 4A16A 1FYXA 2OGWA 2ZK7A 1BYUA 1V4NA 3O4JA 3QVOA 2ZJAA 1E2HA 4EHLA 4IDNA 2BFWA 2J3HA 4MJXA 3Q85A 3WB1A 3NJRA 1LDNA 4YC7A 3W5IA 2GN0A 4B5LA 3B2EA 2JK0A 3AVTA 5EKSA 1RYFA 1E4OA 5FNVB 2BUCA 1XR3A 5AJUA 2Y1XA 1G1MA 1PYOA 2NUTA 6AT1A 1ZUHA 3N39C 1DPGA 3OMLA 4BZZA 1IK4A 1W36D 2PUAA 3IC5A 2RGEA 1FSSA 4RY0A 4WY8A 4DMGA 5CB6A 4ZAYA 1E1YA 3HR7A 4HWTA 5LKAA 3PXGA 2FFJA 5JJBA 2P5SA 1KIMA 1L5OA 1BH2A 2ZUUA 3C43A 4J16A 3ONFA 2F4NA 3C3AA 1BVHA 5KTOA 1W96A 3BRQA 3RAEC 2PYIA 1JMVA 3G0OA 1PK8A 2OD7A 4JP5A 1Y4UA 2XRFA 3V8MA 4UNNA 1KZ7B 2F62A 4DJJA 2JAWA 4ECAA 3AESB 1L4BA 3FMOB 1O5IA 4FI3C 2A5GA 4KQKA 3RKRA 3RSFA 3OZBA 1PT5A 3MQFA 5EFZA 1TUBA 3DGEC 1Y1SA 1Z22A 2R84A 5F9MA 5GM2A 2EP8A 3RJ5A 1R4NB 1SIUA 3VH2A 4TSRA 3HPQA 3EZGA 3V97A 4BKOA 3PNKA 1K3FA 3UAXA 3GPCA 2JGMA 3WJAA 4C7BA 2YZ7A 3OCYA 1AUOA 3DF7A 1SXGA 4MQLA 3ZV3A 2W9XA 1M1YB 5E7QA 3FHCB 4BEBA 1P62B 1DIOB 1GPJA 1QIIA 1SVKA 2C3YA 3C5WP 3EXHC 4KK3A 4W1PA 2LTAA 3LWZA 4HNQA 1NQTA 1WCV1 5BW6B 4WOKA 5IDQA 4Q3OA 5BV0A 2V5AA 2ESRA 3KHSA 3WO1A 1DFGA 4EPXA 3EC7A 5A3SA 2I5PO 1PVDA 4PN7A 4XR4A 2YHSA 4MWGA 4B3MB 3IH5A 4HZIA 1HQCA 1Q2UA 1U3UA 3KCQA 1XIVA 3VV3A 4DMMA 2OMKA 2BFPA 5K6AC 3ZWKA 3MBIA 4LF8B 2BGIA 3N2EA 4PV7A 1NR5A 1WSWA 3KYJB 4AMGA 4DA8A 2JASA 3RU7A 4DG8A 3BBLA 3P0HA 1CR2A 1V8PA 5E4TA 4HI0E 1J97A 1GPYA 3WLMA 4CRWB 1UKAA 4ZDKA 1TI7A 2C4KA 2EFCB 5AI8A 2BGGA 2FQXA 3NCHA 4QO7A 4ZDWA 2Y1DA 2A8YA 4RPIA 3F7OA 3OP4A 4HRAA 1GHTA 1DAMA 2I4TA 4E08A 4CG2A 3JQPA 4FBMA 1GKKA 3UWSA 5K05A 3TRDA 2XODA 1OR8A 4R8MA 1FX1A 1G291 1T24A 3MGCA 3PQ8A 4RF3A 5CVJA 3W4IA 4R51A 1JQDA 1KI8A 2A2ZA 2BFFA 4OGGA 4ZV9A 2AUMA 2FK7A 1UDCA 2IPNA 3DZHA 1YIDA 3D8RA 3O4FA 4HQRA 4OQLA 2IITA 3T7CA 3B2NA 5HQTA 1GTG1 5IH3A 3F5SA 3LHSA 5JU6A 4IJVA 3WJ2A 2J08A 2R6ZA 1WETA 4CTNA 3A28A 1Y6QA 2KW5A 3HN6A 4E5NA 1F2VA 1Q77A 1SBYA 4RCYA 1AS3A 5F21A 3G2OA 3TIGA 5L3QA 3G59A 1NLFA 1SY7A 3VZSA 1DZ3A 1J7JA 1PLJA 2FSSA 4WGFA 4WLFA 1RMTA 5KYUB 2O8DB 3UJPA 3VV2A 2ZRIA 5I4BA 2R1VA 1YKSA 3CXUA 3ZTWA 3LQYA 1KP2A 4W5HA 2V7QA 4XAQA 4QDXA 4X20B 3QFSA 4P31A 4QA9A 2DFDA 3PUHA 5ALQA 4O4JB 1CZKA 5JFTA 3GFBA 5ESDA 1WVGA 2BDTA 3GGJA 4QEKA 1II9A 2P9EA 3HV0A 1AKQA 5K0SA 5KQMA 1DSSG 1DVRA 2NPFA 4DSOA 3E9NA 3ICOA 1CNEA 3TAHA 4G9GA 3L5OA 2IZ6A 4H16A 5H82A 1Y3FE 3RRFA 3VNUA 3AVYA 3WQHA 3I5UA 2FN9A 4TTTS 1MAAA 3GRPA 5E9QA 5KYXA 3RF6A 3SJAA 1T4CA 3TUZC 3RV3A 4ZFNA 2QL5A 4KJZA 4WNCA 1YHYA 3TAXA 1JRLA 5EZYA 1FYVA 2KE5A 3TLEA 2KPOA 2FVYA 4OXQA 3T7EA 3FVWA 2JNWA 5CT9A 1WO8A 3TD6A 4YK7A 1A69A 3ROZA 2YWJA 3NLLA 5F3RA 3RJMA 1U8TA 3VPCA 2ZBRA 2PT5A 2WNSA 3ELBA 2A0UA 3I01M 4HVAA 1V5FA 5BYJA 1IM8A 1F38A 1N6PA 3OX4A 4L6IA 4WOCA 3SYMA 4BNMA 5MGBA 4KHPB 3FGPA 1R6BX 3IIIA 5FUXA 1E4YA 1VFPA 3ABOB 3O3CA 4Y2SA 5DCLA 3ZWWA 1AKTA 3I58A 4YRSA 3Q12A 3ZHCA 3K4QA 3G6KA 1YR2A 2BUAA 5KTNA 3U7RA 3MT0A 3CEPB 1J8VA 4KXXA 3GVXA 3EDRA 4HX2A 4BV2A 5C46F 2P3OA 4MW2A 1GADO 5A3VA 1VI2A 2VHWA 2Q4EA 3PXDA 3WQBA 5A7FA 4JC5A 3HM9A 2O2HA 3L6EA 3UYLA 3GLFE 2WINI 4IP0A 1H6BA 1YS7A 1T29A 5CM2Z 4Z99A 4TUYA 1U2SA 2OYRA 5ICGA 2J3JA 2AD1A 1FXSA 2E1PA 1QS0A 2P9GA 3BMOB 3G0BA 5CCEA 2JVIA 2ZBVA 1YS6A 4OK5A 3UZUA 4JXZA 1G7SA 1TLTA 4WNAA 5KHAA 5AFSA 2YXDA 4Y2PA 2AMFA 3SR3A 1WKVA 3CCFA 1OH5A 5EVCA 3V1KA 1V45E 4AM8A 4II2A 4EYGA 3EPKA 2XB2A 4U63A 5FI1B 4JP2A 4RD0A 4MRMB 1FMFA 5C52B 3G82C 1CVRA 2W5UA 2C0PA 4RD6A 2N9UA 2VNAA 2JFUA 3A3YA 4WDRA 5GJCA 4F4IA 3UJNA 3SZLA 2OBNA 3R3SA 4FMCF 4UBOA 5EIOA 3EA4A 5JCOC 1RMYA 5I9MA 4C3VA 2YXBA 4EF4A 4HP8A 4H77A 2BMVA 1A8UA 2YFHA 3EDCA 4YAWA 4NQZA 3I04M 3OMWA 5E6SA 3IKJA 3DAYA 1G8MA 1J42A 2AOTB 1H22A 1IEVA 1YFLA 3VKHA 4DR1B 4J4TA 4UVIA 3JQCA 2BT4A 3LDAA 1ZOPA 2XQIA 2C03A 2VSQA 2XR1A 2ZDQA 5JNTA 4AS1A 3ZCRA 2H1WA 4HFRA 3ZGVA 4I9GA 4CGYA 5E2AA 3T7DA 1YZGA 1DAEA 3BDAA 3O74A 3M83A 4KI0A 3WNZA 1XDBA 4QQ8A 4EEKA 3A58B 4P1ZA 4E5DA 4WBNA 2RH4A 4EHJA 3VR3D 5I9TA 4DAOA 5DRTA 1U04A 1ZOLA 1NQOA 1BVRA 2V65A 4H0FA 3VVLA 5LP1A 3VYVA 1Q1NA 4OHOA 3QOWA 1SUIA 2G4CA 2DCMA 1K8RA 1E5XA 1KSGA 4GI7A 3A9TA 4AIIA 3LPDA 3VSEA 4H4CA 1JXQA 4Q4JB 3OX2A 3VTZA 2EU8A 4HDKA 1TD9A 5ERYA 3RRZA 2G71A 4LY0A 1SH7A 3HWSA 3KTAA 3UXHA 3UUEA 4EDFA 1J5XA 4ZEWA 4JWKA 1AMUA 4XDZA 4P81A 4PXYA 4M7RA 3RBAA 1A9XB 5F7OA 3INTA 1WULS 3RROA 4AY3A 2FZEA 5EYPA 1R0SA 3ILVA 3U7EB 5JSZB 4DCGA 4M0DA 4PHTA 1JXMA 1DCMA 3F71A 1OWPA 1XFAA 4J1QA 4ZIRB 2Q21A 1KMHB 2G36A 5ADWA 1WW8A 3FNEA 4RVHA 4DADA 4GKVA 4L8LA 2HTEA 5EQJB 1T3GA 5KQPA 4W5NA 1ORHA 3ENKA 5LC1A 1ZDMA 4GPAA 4I5DA 4TSKA 2B78A 4KPEC 4A8JA 3JATB 4Z9XA 5IAKA 3IQFA 2ACEA 1QNFA 5LQDA 3MXOA 4HAVA 4OQDA 5JYBA 4PTLA 4XD2A 2EKDA 2X41A 4XLZA 3RS0A 4L51A 2BM1A 4ISCA 4EI9A 4JU9A 2QDKA 2QVXX 2WJPA 2AEFA 3I8XA 5TPWA 2QLFA 1E79A 3T3MB 2GBCA 4IFBA 2VLIA 1J1IA 4RFVA 1C7FA 1P29A 5AO9A 4NENB 3ICPA 3L8EA 3QKRA 4UXHA 4BTVA 2HA7A 3OZIA 4ICIA 4NRDA 1NYQA 4WOBA 1W4BA 3O03A 3RODA 3VR6A 5DKFA 4M9RA 1I3MA 1W52X 4A2CA 1JSZA 2CDBA 3QNWA 1FRNA 3KQYA 2QXTA 4DLKA 3RIMA 2ENWA 4S1NA 4YUWA 2UXDB 2BP7B 3C85A 1QHNA 3FVTA 1QKJA 1YK0A 4PZ9A 2NUAB 1AQ6A 3C70A 4F46A 1FNNA 1Y82A 2Q5HA 1R18A 3B6ZA 1T5LA 3VZCA 5LMCA 2HV9A 5EKXA 2NZJA 4I9UA 1VL0A 3TZBA 4JXJA 2SCUB 2P79A 1EWRA 3HY3A 1DQRA 4L5JA 1PV2A 1DOHA 1OWLA 1AF4A 1NLMA 3GGSA 1SPBS 1HDYA 3RARA 3REOA 4Z4EA 3WMWA 3QUSA 1AA6A 1KEUA 4P3OA 3OZFA 2BGKA 3F6YA 2JFOA 2EKZA 2Q4DA 3CSUA 4GNRA 5F7JA 3WKAA 3WRVA 4DMKA 3W4JA 1Q0TA 4E1BA 1D6SA 3D6JA 1JU9A 4RHXA 5SZIA 1BXRB 1FX0A 1FFDA 1PJRA 1Q7EA 4M0EA 1KR5A 1JR3A 2BHLA 2XF8A 4B5KA 4Q1CA 2VZLA 3ANXA 1SG6A 1LRLA 4LBZA 5JAIA 1Y6JA 1L1EA 3WKEA 2ZB7A 2HJGA 5ULLA 3QHAA 5SYMA 3DMTA 4JAVC 1RLOA 1XYGA 2CYCA 4YJ3A 1GUBA 2BDUA 3B48A 4EG5A 3ZOZA 3SEFA 4MVXA 4BFSA 1VIDA 5EKTA 2A88A 2VDKB 2DFLA 4CKWB 5KYNA 1NW8A 1ZK3A 3NOOA 3HJCA 3JQDA 3ES9A 3ED5A 2VYVD 1MVOA 1NAHA 3R24A 1UAAA 1TYAE 5JXGA 4UFPA 3ERCA 1C50A 2ADFA 2QV0A 5JD5A 2HD4A 3JRWA 4QU0A 4XFJA 1U0FA 1GL3A 2EDAA 1WZEA 2Y0BA 3HCRA 4WMLA 3TCNA 3KU4A 1CR6A 4IDCA 5B1IA 5TJ9A 3V46A 4B40A 1S2IA 2J0UA 3H2IA 3KSAC 1QGUA 3IESA 5D5PA 4B84A 1B42A 2HSGA 1SG0A 4I5EA 4MUGA 2JCBA 2HUNA 3R3ZA 2AC7A 4UHEA 1L5ZA 3H9JA 1URPA 5A6SA 3IIJA 3Q9SA 3DBHA 3SYRA 1NQ5A 3ZI7A 4JBNA 2GM4A 4AAYA 4KRYA 2ZSFA 3C7CB 3RVJA 1DPFA 1WHSA 2JJ2A 4QVGA 4YBRA 2Z2KA 3B3QA 4MYHA 1DKLA 3MBOA 3Q9UA 4KGZA 1T8YA 4LOHA 1D5WA 3OPMA 4ID3A 2VLBA 4QBIA 2B8EA 5CAEB 1M6NA 3ZBTA 2AK2A 1JBQA 1EFDN 2A7XA 2E87A 2QR5A 3I53A 3PFBA 2WHQA 2IEZA 2ZE5A 4JOQA 2CGEA 2PNJA 4RA6B 3E27A 2QGZA 3FFWA 3PUJA 4MDFA 1Y42X 4FJ1A 2XUZA 4WASA 4KIGA 2O5EA 1BHSA 3DM5A 3C3PA 4R8VA 2DPHA 4A1FA 4C0SA 4XJTA 4IUCS 2W90A 1ESNA 2JS7A 3PX2A 4C7OA 5HBGA 1C1DA 2VVTA 1M72A 3K6KA 4LZZA 2QTHA 3U2QA 4AL4A 1Q0HA 4ILKA 2WAYA 4YAJA 1RM5A 1LVUA 4FCCA 3FHOA 1IXZA 1MXFA 4B8ZA 1PDOA 5ERGB 1Y98A 3C41J 3MXTA 1Q7BA 1GOTA 1MHTA 4MVWA 1KK2A 2FGJA