1BVHA

Solution structure of a low molecular weight protein tyrosine phosphatase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
157
structure length
157
Chain Sequence
AEQVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACID PHOSPHATASE
publication title Solution structure of a low molecular weight protein tyrosine phosphatase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 21
structure length 157
sequence length 157
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1994-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bvhA00
5EWMA 3ILHA 5DGCA 1USGA 2TMYA 5KWSA 2QVCA 2PUAA 1CHNA 1J56A 3HK2A 3FFTA 4ETNA 2QSJA 1DBPA 1HEYA 1URPA 3EODA 4GPAA 4FE4A 2A9PA 4IRXA 2E4ZA 4P1ZA 3LUJA 4F12A 2CD7A 3NHMA 1JHZA 1JFSA 3TB6A 3LKBA 3OMWA 4XASA 2R47A 4E7OA 1JLKA 2IDMA 1A2OA 5JNRA 2JK1A 4RK6A 1M5TA 3LUFA 3O1JC 4MQEA 4Q7EA 4Z4IA 4OLAA 3P9YA 2H0AA 1NXXA 5JNSA 3CFYA 4IMJB 3LUGA 1PHRA 1AB5A 3EULA 5TE9A 2GBPA 3F6CA 4EYKA 5E3JA 1YS6A 4MS1A 3N75A 3Q7TA 4YCSA 4WZZA 5TQ2B 3F7NA 5TQJA 3KYIB 3Q9SA 3LUHA 4MLDA 3CU5A 4Y9TA 4NV3A 4NCAA 1LBIA 3HO1A 1DRJA 3QEMA 1W25A 1P6UA 2FLKA 1M5UA 2PUEA 4QPJC 1Z2EA 2ZWMA 1Z2DA 1EHCA 2GWRA 3HUUA 5DLEA 3H1EA 1D5WA 4IMIB 4P98A 1Z15A 3QLVC 3N8IA 4RS3A 4WWHA 1OXBB 1B00A 2HQRA 2PJUA 4HNRA 2NT4A 4KV7A 1M2EA 2E4WA 4MR8A 4OTZA 4GNRA 3HDVA 2E4YA 3M6MD 3I45A 1GCAA 4L85A 4W5TA 5JNVA 1JYEA 2WWVD 4RK4A 5IEJA 4L4UA 3RVRA 1KRWA 4LE2A 1DP4A 3IPCA 4HNSA 3JVIA 1YTUA 4KMRA 2N9UA 2MSLA 4F06A 2BGGA 1YMUA 3H5OA 2LIVA 3HZHA 1S8NA 4S05A 3O1IC 1QQAA 3NHZA 3RVOA 4KK4A 4N76A 1MAVA 3EGCA 4EYGA 3D02A 4EVQA 5IUNC 5KQLA 3IPAA 3HUTA 2F8TA 2OQRA 4RWEA 1DC7A 3ROTA 3DBIA 3CS3A 4YLEA 4FE7A 5KC8A 4MQFB 1DCFA 4Z99A 5JNTA 2VYCA 4ZYLA 1I3CA 1BDHA 3MIZA 1JFTA 1GLGA 1PNTA 3FFWA 1BDIA 2A9QA 5TPWB 5IULC 1FSPA 3RVPA 3HEBA 3D8UA 4D6XA 4NICA 4KRFA 1ISSA 2DRIA 1ZY2A 2RGYA 1F51E 1XHFA 1R8JA 4LE0A 1JDPA 4MS3B 3CKMA 2PE5A 3A0RB 2HPHA 2IPAB 2AYXA 3VNBA 1NTRA 1JL3A 4YR7A 3FGZA 3LUKA 4RK0A 3T38A 1ZITA 1APBA 1E6LA 2PLNA 2FVYA 2IOYA 1IIBA 2OENG 5FWYB 3TX6A 4W5NA 1VKRA 3IP9A 2PAFA 3N0RA 5TQ2A 1TVMA 3O74A 4RU1A 1GUDA 2PUFA 1DCMA 3OM1A 1DJMA 4F3TA 3L49A 3NNSA 1MVOA 1E2BA 3NNNA 3S99A 2W42A 2AYZA 4QYMA 5EWJB 1ZH2A 1PEYA 1JH9A 3DLHA 1KRXA 3NBMA 3W9SA 3MM4A 4O5AA 3H5WA 2B4AA 2RJOA 3FFXA 3HJFA 2YHBA 5FBHA 1ZGGA 4G0ZA 4LZLA 3CG4A 4KPYA 3N6VA 2FW0A 3HDGA 1FQWA 4G0OA 3M9XA 4Z9BA 3Q15C 4OATA 4OG2A 3L6UA 1OXKB 1VRVA 1DBWA 3H1FA 4YGXB 4EVSA 4OLBA 1GUBA 4RY9A 5JNUA 3KJXA 3HV2A 3G85A 1U0SY 3LTEA 2ID9A 2GI4A 1UDRA 3HVRA 1NXPA 2E4XA 2MSWA 3MMNA 4MS4B 3H5VA 3URMA 2H3HA 4Z4EA 2J48A 3DZDA 3QEKA 3A3KA 3RVJA 2R4QA 5D2CA 3GWGA 5ABPA 1TMYA 5ED4A 2FQXA 1C0EA 5B3JC 4YP9A 5KQGA 5GOTA 4W5RA 2FEKA 3OO0A 1YK0A 4RZSA 2P4UA 4MQFA 4ZPJA 2CHEA 5KI6A 1L5ZA 1FFWA 1L5YA 5GQSA 3H6GA 4OBBA 3C6QA 2PL1A 4B09A 4M88A 2FN9A 5TPWA 1D1PA 3QLUC 1WETA 9ABPA 3LOPA 4MS3A 5TPZD 3RVNA 3CRNA 3RVLA 3GBPA 3CTPA 2QW1A 6CHYA 1YS7A 2WB4A 3C97A 1PEAA 2FQWA 4LX8A 3BILA 4QYWA 1KMIY 2WRZA 4PZ0A 3CZ5A 1D4ZA 5FWYA 3HS3A 4ML3A 4WT7A 1ABEA 3RVKA 4LRQA 1Z12A 2VK2A 4D74A 1ZAYA 4DN6A 2LUOA 1DC8A 2FSPA 1LJUA 3SQNA 2NT3A 5HSGA 2QZJA 1ABFA 2X7XA 2QU7A 3I42A 3N0WA 3N53A 4UHKA 5T3YA 4F8JA 3OQMA 5EWJA 1EAYA 1RPJA 1NY5A 1YVUA 3MA0A 5FWXB 3OQOA 2FLWA 3EQZA 2GKGA 3QLTA 2FN8A 2FMFA 4YO7A 3RVSA 2FMHA 4EYQA 4W5QA 3KLOA 3R0JA 4LDZA 4MPTA 5JS2A 3TO5A 2HSGA 3F73A 4EVRA 4HYEA 3MF4A 1EWTA 3A0UA 1USKA 5EWLB 1CEYA 2RJNA 4JOQA 3Q7RA 1U2QA 3CZCA 5BRAA 2IPMA 3KCNA 5DKFA 5IEBA 3H6HA 4IF4A 1BVHA 4MS4A 1RZRD 4RKQA 2PMCA 3BREA 1U2PA 2R48A 1A04A 3OLWA 3QK7A 2L18A 3SAJA 2JBAB 3C3KA 4RXTA 4JAVC 4XAQA 4RY0A 5IC5A 1SXGA 7ABPA 3GYBA 1QP7A 1RXIA 4G0MA 4KZKA 4RDCA 4EGSA 3RVQA 1U8TA 3CHYA 2L19A 3MQ4A 4DQDA 1NXOA 3E61A 2VUHB 3ILYA 6ABPA 2E4UA 3TD9A 3QELB 2MYPA 5CNKA 1Z25A 4ETMA 2NUBA 4HNQA 1SD5A 3H5IA 4MR9B 2M1ZA 4Z4CA 3H75A 3LMKA 4RSMA 2FTKE 2JVKA 4PYRA 4XARA 2IKSA 4QICA 1TM2A 4TN5A 3I09A 3G1WA 4H3KB 4UHJA 3GL9A 1T34A 4MGEA 2HQBA 3MYYA 1JBEA 4PEVA 3BRSA 2MYNA 2M98A 3SY8A 4RY8A 4NCBA 3VNAA 3IP7A 1PNRA 1XWWA 1MIHA 1USIA 1CYEA 3JVDA 1U04A 4D6YA 1YK1A 3NNDA 3QX8A 2IYNA 3SG0A 2B1JA 5FBKA 5KQPA 4FB4A 5JS1A 2QV0A 1NXVA 3OMXA 2L17A 3FMVA 2FMKA 4MAAA 1ZH4A 1BDJA 1F4VA 1EWKA 1QO0D 2JCGA 3N0XA 1FFSA 2HJ9A 3E3MA 3C3WA 2JVIA 4KVFA 4RV5A 5TQ0B 2WJAA 4ZJPA 3OQNA 4CBVA 2KYRA 5FWXA 5C5EA 3LFTA 4RK5A 4N47A 5JNWA 1QP4A 4XFKA 4KNYA 3I5AA 3KG2A 1DZ3A 1MB3A 1VPWA 2I6FA 4G97A 4MYRA 4KREA 4TLMB 4TLLB 5I4CA 3ROFA 2F8SA 4E7PA 3OLVA 5T7BA 3HM9A 3QX9A 2PUGA 3JS5A 4MLCA 5EWLA 3RQIA 3B2NA 5IX8A 8ABPA 2LP4Y 1D2AA 1NXTA 3KTOA 1K68A 2WJWA 4H60A 3OLYA 2FQYA 3T6KA 1DRKA 1BA2A 3O2JA 2NZUG 2JBAA 3O1HB 1E6MA 1Z17A 1SXIA 1RXEA 3EQ2A 4YWHA 2JRLA 3O2QB 3UK0A 2FEWB 3CG0A 3UKJA 1VLZA 2PUCA 1E6KA 2YHAA 4JASB 4Z0NA 2P9HA 4YRZA 3BRQA 2V0NA 4MRMB 2WMYA 3DLBA 3LUCA 1Z18A 4NQRA 3QLVA 4PE5B 4O1HA 1Z26A 1MB0A 5BRJA 1QPZA 3KHTA 3QELA 2A9OA 4MR7B 2MSKA 4XLTA 5HQJA 4MR9A 3LUDA 5DCLA 1QNLA 3CLKA 4Q6BA 5HM6A 1ZN2A 1NXWA 3A10A 2PL9A 5CHYA 1W9HA 4IILA 3O75A 5IUJC 1NXSA 4Z4GA 1DG9A 4N0QA 2QVGA 3M9WA 3GV0A 2IPLA 4JB0A 5TPZA 1ZVVA 2NZVG 2QR3A 2WY2D 2QXYA 1JYFA 2ZAYA 4EY3A 2R25B 1Z16A 1SXHA 1JFVA 3RH0A 3Q7SA 5C5CA 2XDYA 4G0PA 4ETIA 4PICA 4WUTA 3KSMA 3SM9A 3EDCA 1LJLA 1H9CA 4EUKA 4JA2A 1JWLA 4G0YA 4RKRA 1QKKA 5TQ0A 3GA5A 1Y1LA 4S04A 4KFCA 1AB6A 4W5OA 3K4HA 2O20A 4WXEA 5CNIA 3OLZA 3SNKA 3TMYA 3JTEA 1SRRA 5HKOA 3F6PA 4G0XA 1A0OA 3KYJB 5KQMA 4KQCA 1QP0A 3DGEC 5EWMB 3HSYA 3O2SB 3RVMA 1K66A 3IP6A 3H5TA 1LK0A 2MYTA 1DBQA 1ZGZA 3KS9A 1TJYA 4YV7A 3OM0A 3OO1A 5PNTA 5BQ3A 4JB2A 1YIOA 2VUIB 4RXMA 4KK3A 1P6QA 4N03A 3BBLA 5CNMA 3CNBA 4N0PA 1QQBA 2JB9A 4KQ9A 3KKEA 1RZRA 2JVJA 3GRCA 4JP1A 4Z4FA 3DGFC 1YMVA 2IPNA 4Z9AA 4EYOA 3OLXA 1EFAA 2GX6A 2RDMA 1JDNA 1JX6A 1KGSA 3EJWA 4MRMA 5BR1A 2PKXA 4WXMA 1C4WA 3HCWA 4XXHA 3FDFA 4MR7A 4MQEB 3LUAA 2A9RA 3GT7A 2FKAA 3LKVA 3IP5A 4LDAA 1JF8A 2CWDA 2CHFA 4N41A 1BAPA 4IGAA 3EAFA 3GBVA 1ZESA 5CNJA 3O21A 3Q41A 4RK7A 3KLNA 4LE1A 4O1IA 1P2FA 4DADA 2LPMA 4MS1B 5IBQA 2PUBA 1M2FA 2FXIA 4RK1A 5DTEA 1ZDMA 3H1GA 3HXMA 2PUDA 1LBHA 4ZMRA 1ZHHA 4TMYA 1NATA 3T95A 1EWVA 1TLFA 1RNLA 3IDOA 3QEMB 2LBPA 2FEPA 4ZMSA 2L2QA 2E4VA 2FMIA 1FFGA 3JY6A 1DCKA 1ISRA 1P8AA 5B3JA 1Z13A 1GCGA 2MYUA 3UUGA 4G86A 5IUKC 4F11A 1PUXA 1QO0A 2Q5CA 3C3MA 3JPWA 3JPYA 4MR8B 5F64A 3T8YA 4Z4HA 4G0QA 4RXUA 3H5LA 2HQOA 1D1QA 4YS6A 1XHEA 2ID7A 3QLUA 4Q6WA 5KC9A 4H3HB 1QMPA 3K9CA
chains in the Genus database with same CATH superfamily
1TXGA 4NOKA 1L7NA 2JKVA 2Z3VA 2PYIA 2WUGA 1G7RA 2YZKA 3CKLA 3DBHB 3ZXYA 4NARA 4CKEB 5ICCA 1CCWA 4OOFA 2C0PA 3N1UA 2HA6A 1I3NA 3GCDA 1J2YA 2NSLA 3HR7A 3M1LA 3UYLA 2JCXA 3ONFA 1HEYA 1SOWA 4C4XA 3O82A 4TWRA 4RPJA 1J1UA 1A4XA 1ML4A 2H4JA 4H6WA 2VBFA 1UKEA 3IT0A 2QMUA 3UV3A 4BBAA 3CZ9A 1JHZA 4IICA 3RSSA 1ZZGA 5DYYA 3OICA 5A05A 4RLSA 1Q7CA 5T8KA 1LVHA 3T7TA 1T4MA 1XXLA 1M6VB 4A3SA 4LJ4A 1Z2NX 2WLTA 2HV9A 1NQWA 3KT6A 3L6EA 2IXDA 4Q7EA 1CUWA 1RPAA 3L6OO 4DY4A 3U6KA 4UHBA 2ZFUA 3GGGA 5G1NA 1RI4A 1LQTA 1SUWA 3PI6A 1HLGA 1GA1A 4XCVA 2O23A 1CUBA 2C2OA 4OQXA 5TE9A 4EPRA 5BQXA 3AOEC 3GLQA 1UBFA 4M8LA 4F7DA 1LPBB 2FNAA 3TIVA 2C98A 1JG3A 2A2ZA 2ZBEA 3M89A 4P3YA 3FDJA 2CSXA 4MX8A 4B9EA 4INPA 3CVOA 3NVMB 4K9QA 2WU3A 1SCDA 4D6PA 2DSNA 2JASA 2XUDA 4X20B 4ZCLA 1GL9B 1Z2EA 4U9IS 1Y9JA 4ZTBA 4DXDA 1FDTA 3H1EA 3IOCA 4CLEA 2P8SA 2C9OA 1NW9B 2CJWB 1SG6A 1ZD5A 3D2CA 4R8RA 3H2IA 1KFEB 1OLUA 4KKXB 1QYCA 3CVYA 3GLIB 1P7ZA 4CV2A 2WAMA 3B60A 1ZJ5A 2GR9A 4HDOB 5K0FA 4JVSB 3DMHA 2JHGA 1VE1A 3ZLJA 4BTVA 2Y77A 1EWYA 2B8JA 1O87A 2PX8A 3AVQA 4LXTA 4RUKA 4F6RA 2IOFA 1X7ZA 2Q41A 4PQYA 2BTQB 2G28A 3HDYA 3L8CA 5EGNA 2H4ZA 1PGPA 2ZRDA 1DQPA 1UM8A 3CPHA 1AGPA 4BLUA 3A37A 1WTCA 5D1NA 3BMNB 1TYCA 1DAFA 2V7WA 5EFOA 3ZEAA 1R8YA 2RHGB 3DVAB 3PHBE 1J8DA 2O8EA 3AF4A 3RS9A 1NC3A 1KXJA 3KQMA 4L4YA 2VJNA 4QUJA 4OQFA 4CU5A 1Q11A 3M33A 4URFA 3DBOB 4KK4A 4XDYA 1M73E 4F4DA 3HDTA 1CF2O 3ZY6A 3FKSA 3G8AA 4K9LA 4EFNA 1XCMA 3QKUA 3BB4A 1OU0A 1VHJA 3HGMA 1DC7A 2ZTVA 4ZEMA 1T4BA 2XZTA 3RYHB 1DAMA 1YRWA 3VVLA 5JNTA 2K2QB 1WUTA 4NPCA 1O08A 1FFXB 1AIPA 2WG2A 3Q2KA 4IIXA 5MGNA 5TPWB 3ICEA 2E5FA 2WE8A 4I1IA 3EMDA 3ZZUA 2B7CA 2HBYA 2QRUA 5BOVA 5KNDH 2XF2A 3RYIB 1BXKA 5JYEA 2NZYA 2Z5LA 1DUVG 2OBLA 2CNLA 4N5DA 3WK7A 1VYUA 3DOJA 4MW5A 3JAWB 4YR7A 4LY9A 4H4EA 2J3QA 3L0ZA 2P91A 4MARA 4AYTA 1LZLA 4M0DA 5H7XA 1GT6A 3ZU2A 4CCYB 4WOJA 4ERXA 1QGUB 4DR5B 4PN3A 1EP3B 5AVWA 2G4VA 1FYWA 1AXRA 3AY7A 4KXNA 3WLIA 1BE8A 4BV8A 3HN7A 3IVXA 1QVRA 1RP1A 3AJEA 2CXSA 3DS8A 1M2OB 2NVOA 1XPOA 3A1NA 4BB9A 3FOEC 2AOTA 1ECFA 3ASVA 2NZXA 4KQWA 4TRRA 3MJVA 4P4SB 3OJ0A 2F7SA 1CIJA 3QG1A 3QOXA 2JKZA 5G3ZA 1C1DB 1G8PA 1I0LA 1K8QA 3DAHA 3MIIA 4B75A 4D25A 2ZJ7A 1DOAA 3WLHA 4KAJA 3PB3A 1XC7A 4WOCA 4OG2A 3N7UA 4JXXA 1QZXA 2P30A 2ZJZA 4EVSA 3LL7A 4ZYWA 4Y6QA 1X9HA 1PYGA 5B64A 3DWIA 4F91B 5JSUA 3OH8A 3DAFA 2ID9A 1WCXA 4OYRA 16PKA 4PBSA 4ER7A 4XGQA 1AQNA 3KETA 4W8OA 1LBEA 5GJCA 3MXOA 4QGAA 4DLXA 1WF6A 5FBZA 4Z4EA 1JPNA 3RNLA 3EEFA 3QEKA 2HDOA 1HSOA 1OLXA 3I6MA 5TMEA 1AKMA 3NMUF 5EUCA 3MVEA 4E31A 5EJGA 4I4TF 4ZAXA 4PFQA 2G5GX 4QPDA 5LD2B 1E6WA 4NCJA 5D5QA 2CZGA 3KC2A 1H2XA 3OE4A 2FZ5A 5IW8A 4II7A 3UAVA 2YBDA 1T5IA 1UPBA 1SBZA 4FCVA 1NI3A 2D2IA 5I7FA 3AM5A 3FUTA 3L0CA 1YZVA 1VRWA 5DM60 1QCCA 1YOVA 3H9BA 3SJ7A 2QSYA 3ZJTA 5EP3A 3T7SA 2BEWB 1TU4A 4JGBA 2RHLA 3NHWA 2BMFA 1WD5A 1HZZA 1IJEA 3P0FA 3VA7A 2NU6A 4LSGA 1VPEA 3CRZA 1CHDA 1EFPB 1X74A 5EKXA 2DZDA 3V8RA 3VR4A 5A06A 2WYVA 4EHKA 2PV0A 1JRLA 2ZB7A 3B6IA 3BILA 3UWSA 1IY9A 3LT0A 4CHGA 2WJPA 4AY2A 1T8SA 4HH0A 1FP6A 1TCAA 3D9QX 2QE7A 2A59A 1WU8A 1Y5NA 4HL6A 1YB1A 3F47A 3GAZA 1K97A 3CLSC 4MKRA 2OOSA 2X7XA 2C82A 2PT6A 3TIFA 2GZ2A 3QBEA 4JC4A 3VOTA 2HU2A 4X61A 3PNSA 4I4IA 1EDZA 4OXNA 3TVDA 5LXTA 4HVCA 4MWZA 2H8GA 3A3NA 4MV9A 2EKDA 3MA0A 2J46A 2O8BB 3DSRA 3O83A 3ZE2B 3H7AA 1VE3A 4F3NA 5E3HA 2VHTA 1JFTA 4BXOB 4UATA 2ZJ0A 3P27A 3AGQA 5BWOA 3Q3JB 1J42A 3TO5A 4JIMA 1VE6A 2D74A 5IT4A 1RU3A 2WHEA 1OWOA 4UTRA 5F76A 3TWOA 3W2FA 1OREA 1NLZA 4HEA6 3X43A 5CJ2A 3DE0X 4DZTA 6ADHA 2R44A 3CRVA 2Z04A 1G16A 2B9EA 3A31A 2NXWA 4FNAA 4GAEA 4KFTA 4KXFB 1H2ZA 1XQVA 3RT1A 4YJ3A 1FXWF 5FORA 1R88A 4A15A 1U2PA 2FEXA 4U4AA 3LOQA 3QK7A 1Y4SA 4JUAA 3EWNA 1NJ8A 3LWBA 3KYDB 1OYOA 4N54A 3EDOA 2ZETA 4G0MA 4O29A 5EPUA 5IT9A 2X8LA 3KSDO 3N76A 2XYVA 5AKIA 1B8PA 3CZQA 2W98A 1U7UA 2L19A 4B40A 4C4YA 5KYWA 1C8VB 3VAYA 2VO1A 4D4GA 5ULLA 1WL8A 1K7SN 2BFNA 4IYRA 1JAIA 4KZPA 4O2AA 3RSHA 1PLKA 5K0LA 1LTKA 2RGEA 3OZCA 5IH7A 3CSSA 2CK3D 4TXLA 2R85A 1IHPA 2XSZD 3A05A 4GOND 3WICA 4UHCA 4YMUA 4TN5A 3SX2A 1WY7A 4K9KA 1FJXA 3CX7A 4W1RA 1WU7A 1XMVA 1CNEA 3BQNB 3KVYA 4H7EA 1ODKA 4Q1VA 1T34A 3OA2A 5ALIA 4PX9A 1XZPA 4NHOA 2JHCA 3HHPA 1EVEA 1H9BA 4YHBA 3I1FA 1ZI6A 2ST1A 4OQPA 5AW7A 1LPOA 1G38A 3GDHA 4JKOA 4BLWA 1U04A 2FHSA 2IEZA 4FD2A 2NTYC 4ZO7A 5EE3A 2IOHA 4AC9A 5KAMA 2PPLA 4EF5A 2EP7A 4FHEA 4CDNA 3BUSA 1BDJA 1NVGA 4HQLA 3E3MA 1YJQA 4KVGA 2XE7A 4QX6A 4UOEA 2XCLA 4TSFA 4A0QA 1U7OA 3IELA 1RE1A 4RV5A 3BJIC 2CXQA 1NQVA 3THSA 4KRGA 1ODTC 1P7YA 2VDQB 3FH0A 3MERA 4IX9A 1SOVA 4J0KA 4F9TA 2HSJA 2OCXA 2OCIA 1HE3A 2XTMA 3QFCA 4MV3A 1JJIA 3GLSA 1JMKC 4MK4A 4XFKA 3PFHA 1Q7EA 4OHYA 1QOPB 2BV3A 2P6NA 1MB3A 3BE8A 2I6FA 2WG0A 1KFBB 2JGLA 3NFRA 1FLVA 2QKYA 3NOVA 1DEKA 4K6HA 4ZCMA 3CNNA 2GWHA 2P4QA 1Z8HA 1QTRA 2O6HA 3EZLA 3FY4A 4ZAGA 3KTOA 1NF8A 4L57A 3SBXA 1XNJA 4RMGA 3R2JA 1BFUA 5AVUA 4I99A 1MJGA 4J03A 5C8VA 4IG4A 5K3OA 3F8SA 1FLAA 4K1XA 4K9MA 2FPGA 2DHRA 5TF4A 1GNVA 1KAGA 1YHZA 4D42A 2MR5A 4A5OA 1DWPA 2HPVA 4COKA 4AP6A 3NDBB 2WSLA 2P35A 3CG0A 3F98A 1ORTA 2FZWA 2PZLA 4MVCA 3HYSA 1HLFA 5CVCA 3HJUA 1GZ5A 4EJSC 3SBOA 3ASZA 1SC3A 4I66A 3ELUA 3SKYA 2VXYA 4GHWA 2FWIA 4ZGBA 5KYUB 4M3NA 3GRZA 1RKUA 3FMGA 1G2OA 2BHTA 1J33A 2RHRA 3FN4A 4I4LA 4WKPA 4Y67A 4C07A 4OHXA 2R1VA 2D3WA 4ESEA 3H6KA 4L28A 8MHTA 1TTQB 2ZREA 3HKBB 4IJVA 1QNLA 4WOKA 2PS3A 4S2UA 3DCJA 3VNSA 2YKGA 4EEKA 1KDPA 4CI9A 1G41A 2GBLA 5IUJC 4ENWA 4G5SA 4DQLA 2RGWA 4QT4A 4GKAA 1RI1A 1Y1PA 4RQUA 2Z0MA 3G2PA 3QVOA 1GAQA 5EERA 2ZRPA 3AUFA 4CQMD 1L4NA 4JS0A 3LA6A 3PWKA 2C03A 2HRZA 4HDAA 3FROA 1Z36A 2HJWA 4PYJA 2I4NA 1B0ZA 1FNBA 4ZQBA 4EMTA 4X45A 4YRBA 5AXDA 1ZWKA 5EEHA 1DKNA 4YAFA 4UMEA 1OZAA 2C9DA 3HNPA 4JA2A 5H68A 1T4CB 1YXMA 3O8DA 5DF1A 3I34X 4W5OA 1OFIA 4ZVSA 3MAAC 3GGJA 1WW8A 1SQ6A 4DG8A 4EKNB 1NMEA 2BF7A 5CNIA 4E13A 5AVQA 5KYTA 4OK3A 3GVPA 2G40A 4I4NA 3F6PA 3GT3A 2D1TA 2W2LD 2PZGA 1R64A 4P84A 1QP0A 2H2AA 3SGLA 4BFCA 2QM7A 4KLRA 5EL0A 2CMFA 5DYWA 2XF8A 4BEVA 1L4YA 1ZGZA 2R7AA 1TM3E 4ZQHA 4B73A 4UNRA 5J4YA 4JEMA 3B6EA 1FUYB 1G3IA 1H22A 4OK6A 4PX3A 2YV3A 5BQ3A 4JLMA 1YQXA 4OBXA 4EY4A 2XQVA 1QR2A 1TKBA 4KGZA 2QU8A 1Z4NA 3NT5A 1XEWY 4GOXA 1JQKA 3U49A 3WGTA 2IBSA 5HE8A 3BMQB 3WWEA 2HWYA 4OLJA 2JVJA 5E9QA 3M34A 3DNPA 3ME5A 4JP1A 4LBZA 4OJKA 3W3AD 3L6CA 4NPHA 3CC8A 5E7MA 3DMRA 1OC4A 2FDCA 3OEWA 3K9WA 4OI4A 1RLOA 3EJWA 4UHFA 5DGIA 3I01A 3GFQA 4FOTA 2XWJI 3L4JA 1FVOA 3A06A 2O3UA 1ONOA 1KK0A 1XVAA 2CY0A 2J59A 2JFVA 1SXJE 1Y8RA 3H19A 4GG1A 4NNOA 1Y1RA 3FCSB 3B6MA 1DE0A 4US1R 1O0SA 2P4HX 3VTFA 1KARA 4N41A 1LA2A 1ENYA 1FMJA 2PBZA 2UUOA 1O97C 3EAFA 4IGAA 5DI9A 5EJMA 1JIVA 1KU6A 2KSQA 1GXSA 4R9NA 3GFFA 1ZX1A 2FMUA 4AJLA 3D64A 3FZNA 4A7PA 2X0JA 3SKVA 4YCMA 9LDBA 2Z2ZA 4Q47A 3EY9A 2LPMA 4DADA 4DUGD 5AI0A 1ZSNA 1OR8A 4FIDA 1ZDMA 4N0DA 4XIFA 4OYLA 3FCCA 2XQKA 3O91A 3IP8A 4KSYA 5T4HA 5JFOA 3GAAA 4W5WA 1XRPA 3W8FA 3H9EO 3EF1A 2GPAA 4EOGA 3LK7A 1JZSA 4QEZA 1F2TA 3OJXA 3WK8A 2I6SA 1U7DA 2JZNA 1PR5A 4JLWA 4WASA 2JAHA 4DCMA 4F92B 1XNQB 3KDPA 3KQNA 2BCJQ 4BCBA 4F11A 3NAQA 4YLGA 2WPDD 1KQNA 1XDBA 3JPWA 2A1UB 4L8GA 4RE6A 3RD5A 4DLSA 1XG5A 3RJZA 1G63A 1B1AA 2NPIA 4ECEA 4MV5A 3U5ZB 4I5FA 4U9UA 1E4EB 1XL1A 1I10A 3BWYA 3QPVA 1LDBA 2BUBA 4S35A 1P3JA 4B3IA 1AKUA 2PY6A 2OGSA 4MWCA 4Q6WA 1FVFA 2EFEB 4DR4B 2ZS8A 5J1TB 1UC4B 4BEJA 2OHXA 2ZUTA 5AM5A 1A9XB 2NV2B 3EK2A 3RS2A 4CGZA 5SY6A 2UDPA 1NUTA 4EQ6B 2Z8YM 3GN1A 3C4VA 2RGBA 3HCFA 4GNKA 4K87A 4HDQB 2GZDA 3FCAA 4QYSA 2IYVA 3OCXA 4H6VA 3TPCA 3FSGD 4ETNA 3R75A 4C1BA 2ZRMA 5BSHA 1S7GA 3MWEA 4XIGS 4JI4B 2WZBA 4HDKB 2A57A 5EMKA 3DOIA 1VI6A 5F3DA 3VBCA 5IC6A 3VPHA 4KR3A 2E4ZA 2HHAA 4DE5A 2XUAA 1SC9A 1ULUA 5T4BA 5C4IA 1LQ2A 5D84A 3UG6A 5IVDA 5C35A 5CDSA 2I4IA 3PT9A 3RT7A 2MT9A 2YV1A 4Y0NA 1I30A 3PQEA 2FK7A 1GCUA 4BO9A 4TWIA 1A2OA 5LJLA 1X7XB 2XUQA 3DVQX 1FUUA 3EXAA 4FMDB 4L4SA 1G2QA 1RAEA 3KTAB 4EFDA 4Z7QB 2VSYA 3V3KA 3FPBA 2H0RA 3RK4A 4RTSA 3PWTA 2H0AA 3EYAA 1LLFA 5K05A 2VTEA 1IEVA 4E46A 5ERGB 1WULS 4EYKA 3TFWA 1PCXA 3P45A 4UUAA 1A8UA 3F7TA 2V1UA 1LX7A 1GZ3A 4R5HA 1S2OA 1THGA 3Q7TA 1J8MF 3O94A 3N7AA 4NBUA 3KE8A 4WRRA 5JXGA 4X7BA 5EIXA 3VSAA 1DRJA 2OESA 3CO5A 4FYVA 721PA 5HGXA 3DOHA 4CV3A 1QUEA 1DL5A 2IX9A 4I3HA 3AM4A 2BEVA 2I9PA 1E0KA 4PYQA 4YO8A 2Z8ZA 3TB4A 4DSUA 5J2TB 4JQSA 3CW2A 4B0PA 2H59A 2Y8EA 1P72A 1T9CA 3BDIA 3OPMA 3KEFA 4XIYA 5DLDA 1R10A 1YO6A 3LWNA 4NDZA 2ZAOA 1CNFA 3FI9A 3WRVA 4F84A 4KV7A 3HJRA 4ZN6A 2HO5A 4V02A 3GGDA 1J20A 3QTLA 1V8OA 4HBZA 3NAGA 3PT5A 1P1IA 2E4YA 4U3JA 2UUPA 5LVAA 1SBIA 3PJGA 5LBUA 3ENVA 2ET6A 2J5BA 3TSOA 3M49A 5GV7A 3PKIA 1R0KA 3OPYA 4JR2A 1DP4A 5D7NA 1NF3A 2FRDA 2XX3A 3HO8A 4G63A 2P9FA 3CE6A 5EEGA 3Q3CA 3ZDZB 1UEIA 2XZPA 2QB5A 4XOIA 3C14C 2QD2A 3UBTA 4U02A 3QFSA 4BU1A 1R4MA 4QXMA 4IZIA 4P82A 5EXPA 5HOEA 1JEQA 3LI2A 4QD3A 2BN4A 4YRRA 3RVOA 1NY6A 2RC6A 4PLWA 1S5PA 4O02B 4RF4A 4X97A 1MMFB 3B1FA 3LC1O 2GTIA 4PC1A 5DXFA 4A1FA 2C7RA 5B1DA 4DM3A 2PGJA 1A4UA 2QX7A 3NOOA 4FOSA 1O8BA 1Y4UA 3KZMA 2PN1A 1SCBA 1U5BA 2R6AA 4OKNA 5GGXA 1WQ4A 1Z74A 1PNTA 1UJ2A 2QMEA 3MIZA 4R1MA 1BTOA 1DFIA 4FMCB 3RVPA 3V9PA 1T0PA 1Z0JA 3ILVA 4KRFA 2XNKA 2FCRA 2ZYWX 1WZ2A 5IT0A 1RJ9A 1BMDA 2I2FA 2VHYA 2QJOA 4KR7A 3FMOB 3M8KA 2GRUA 2HPHA 3PDIA 5JXWA 2ORVA 4D82A 1HR0B 3O8QB 2VSXA 1XQ9A 1CJSA 7YASA 1CUDA 1J2UA 2OV4A 2VK8A 1EI9A 3FE2A 1D1TA 2NYAA 2IOYA 4QRHA 1DBVO 2XMDA 1WM1A 4GEKA 2PAFA 3S1AA 3N0RA 1F8YA 1H1TA 1T13A 2HHLA 1PO7A 4Q48A 1IL0A 2QYSA 1DT3A 5DN9A 3IPRA 4YRSA 2W6PA 3INTA 4C87A 1AZTA 1SHLA 4NBVA 5ALHA 3RAEC 3R0ZA 4Q7LA 1JW9B 3GPBA 5JCOA 3ROGA 1HBJA 1JJAA 1OVMA 1U8UA 2OILA 2RBKA 4UNNA 4YJHA 3AX6A 3RROA 3UBMA 5LB4A 1AA6A 2C4UA 1KRXA 3I5YA 3WWYA 4YQFA 2IYLD 3O93A 1QLWA 2SECE 1G4HA 1KYIA 1N2HA 2SNIE 4DIBA 4DG9A 1S3SA 1UKAA 1EB9A 3GRRA 3HDGA 1P29A 2QZZA 3JD4A 2VDUE 2ZKLA 3L6UA 2VDOB 3OFNA 5CBPB 2XZLA 5CFMA 3AERA 3FHJA 4OUDB 3OX3A 4H1VA 1A27A 1ZMXA 4XX0A 1PV2A 1SZJG 3E3NA 5EYPB 4BNHA 4BVGA 4EJFA 4YBZA 1VLLA 4MEAA 4NY1A 4ZQGA 3ZGVA 2WTMA 5F78A 1DELA 3DOUA 3IUYA 5E6UA 1ZIYA 3PICA 2AOWA 3NHFA 4UHHA 5LQRA 4HNGA 4ISBA 2PGNA 4K26A 3TEJA 2GPTA 2WUEA 1ECGA 5L4SA 5ED4A 1OXUA 2P9CA 1C0EA 2TYSB 2WICA 2RKBA 1B4DA 3I4FA 3N8NA 2FSGA 3THYB 1ZAKA 3RHFA 2F1IA 2H1VA 4JJ4A 4NZOA 4ZPJA 2PKYX 5LP6C 4CUKA 4KIJA 5A7GA 2A92A 2W43A 2HK6A 5FWNA 2X7JA 1DRUA 3PUKA 4P93A 4BLOA 1A8IA 4NV1A 4NXNB 2IYAA 1UXHA 3KNZA 3G1UA 1M7HA 1D1PA 4TZTA 4BE7B 3KSAC 4UD2A 1N5JA 2EKLA 5I9SA 4LJLA 3RRMA 3ZW8A 5KU1A 2EF0A 1Q0TA 1Q5PA 3CPSA 1ZM9A 1VI2A 1TC2A 1VLQA 3IDQA 1D6NA 3VYVA 4EBFA 3C45A 4RNCA 4J94A 6LDHA 4QNMA 3IOYA 1SBTA 5A5DA 5L45A 4JQOA 1RJWA 1O03A 4RO0A 1S01A 3WZLA 3ZKWB 2H6EA 2FHPA 3LPDA 3A8TA 2AJLI 5F7ZA 2RB5A 2X41A 4PFSA 5FJJA 3WGIA 4X8MA 4TV8B 4M1SA 4BECA 1RXUA 1N5KA 3RARA 3T94A 4QC2A 3CW9A 2LUOA 5C52B 1F0PA 2AWOA 4IGFA 3EPHA 1PLJA 1Z0UA 2QU7A 1UL1X 1S7CA 1UFRA 3DKVA 4UHKA 3RNOA 4EW6A 1CDOA 4R1SA 1V7PC 4Y9RA 1V48A 4MHOA 3CVUA 1KWGA 3LC0A 4Q4LA 5BR4A 3O8LA 2YYAA 2H85A 5DX0A 4AURA 2XE6A 2KLBA 4L27A 1OBCA 2V7QD 3L7AA 3FWHA 1CFZA 4CM3A 4EYQA 4OFZA 4NOJA 1S2MA 2F90A 1LC0A 1NJ2A 1CPYA 1KO8A 3HJGA 2WKSA 1R0XA 1V35A 1Z7GA 1MDBA 3NGMA 2D5LA 2F6RA 2JAWA 3MF4A 3PCTA 4UFNA 3T4XA 4C0KA 3L4BA 4KO8A 3O0DA 1E3WA 5JO0A 3RTBA 4CCSA 1C41A 1FJHA 1WLYA 4D3DA 1BD3A 1L8LA 2G5PA 3VNVA 3H6HA 1HYQA 3BOSA 1E2DA 4PSUA 2AVNA 3P0JA 1KEPA 1AHHA 2R1ZA 1M7BA 1DRWA 1G0OA 2HREA 3KRTA 1WEKA 5FLYA 1IUPA 1N0VC 4N3BA 4KO1S 4BNYA 3CRMA 3FDIA 4GPZA 4C7VA 1L8QA 4JHXA 4BP9A 2V65A 1DWOA 2OMKA 4BZPA 2ZU0C 3OU2A 3F5FA 4F2WA 1YA6A 3WHPA 1SQFA 1ZD4A 2ODPA 1OAAA 5LKRA 3WIEA 3ASUA 1SRQA 2RCNA 4A8HA 4XRRA 2YWJA 2GCNA 5IK2D 1Y5LA 3GRKA 3K53A 2UZ1B 2OD2A 4PCAA 5BSTA 2J0UB 3JZIA 4DL9A 2OLKA 4GI2A 5ALYA 4ICIA 1UZLA 4BNLA 3C3XA 2YIDA 2GD1O 1NPYA 3OESA 1G18A 4XI9A 3AQIA 4E14A 4GL2A 1UXKA 4DCPA 2IS2A 4B6PA 3MYRA 2F3QA 4HKTA 1EBFA 1WCYA 2M98A 1M76A 2QTCA 2IX3A 3EGXB 3JR7A 3I2IA 4MO9A 1CYEA 1JHXA 1EDEA 4JROA 4MRVA 2C9BA 2CVHA 3PDHA 2IYNA 3AI1A 3T7IA 1FFAA 3T7DA 2V6FA 3IH5A 3ZLTA 1BN6A 2QLBA 5KBYA 2OBNA 1LLQA 2VTVA 2AEJA 3GH3A 2GFHA 1DPGA 3MILA 2H2DA 4DILA 4EX7A 1VHTA 3HCNA 2LTAA 5ER6A 2ATIA 1UXIA 3WISA 2ZAIA 3TW0A 1LQUA 4ZVPA 3PD7A 4G5RA 4C7OB 3GW8A 5BVHB 4IDEA 1KS9A 1VG8A 4YRDA 4ZDWA 1GPAA 1I36A 1GM5A 1EFUA 4KYIB 2DR3A 2VTBB 1ZKDA 4C2AA 3D3JA 4LJ5A 1A8QA 5M3BA 1E59A 3W8NA 4NBKA 4TLMB 3LLVA 2QM3A 3DD5A 3QVKA 5T7BA 3TIIA 3O47A 2B8WA 4DM4A 3J7AC 5EWLA 3BD8A 4FKMA 3SN6A 3EW9A 3EQ7A 1NZFA 2GM5A 1JWBB 3VTKA 4WKCA 3EFOA 4ZAZA 1L1FA 4B48A 5A0TA 3V4SA 1JP7A 3B70A 2JJ2D 4DCGA 2H31A 1F06A 1G21A 1DOZA 2XUZA 3GJ4A 3SIRA 2JAOA 3W9BA 3N3AC 1NI4A 3FB1A 3ZE1B 1WV1A 4OI0A 1S0UA 3IMCA 1LDNA 1JDZA 3TAXA 4DDWA 4NULA 2Q3CA 4FHDA 4HZUB 4IGIA 4QRDA 2P68A 1G0NA 3D81A 3KR0A 1FVHA 3N87A 3O1HB 1NAIA 2HDWA 2YWBA 3OC6A 2VJLA 3T9FA 3WGGA 5ADHA 4RTJA 1FXSA 1R5JA 2RG7A 4DLNA 1OGYA 2PM8A 2QTGA 4IM7A 3DDOA 5DTMA 3SQMA 3DWEX 4RTMA 1IZ7A 5PGMA 3MD9A 3K2IA 4EDHA 1TADA 1MDFA 3QLVA 5FTNA 2WIDA 4ND4A 4Y1FA 1Z75A 4FQ8A 1MB0A 4OU5A 1O2DA 5ELMA 1SHTX 3DHYA 3SE7A 2ROQA 1QOQB 2OYCA 3DB1A 3B1VA 3UCXA 4DAEA 3JQGB 3SFVA 5HM6A 4MJLA 3T7RA 2PSJA 3VSCA 3L02A 4DABA 3MTBA 1YDGA 3OCCA 1UBRS 2E2WA 3FW1A 3PEFA 5L7TA 2BGWA 2HA0A 2PMDA 1K86A 1H3FA 3DUWA 1ZU4A 1SUDA 1GYPA 4JLNA 5DBGA 4E6EA 1DZIA 1H0RA 1I4LD 1JGTA 3P32A 2HL6A 2IH4A 3SSOA 4NZ9A 2WD7A 1ID8A 2I3GA 3L0BA 2G08A 2IE8A 4MDYA 4REOA 3K6SB 1Y3IA 3DF7A 2HMSA 4WN9B 4YMWA 2GVDC 1Z5OA 4QOGA 3TQRA 2XXAB 3WMFA 2DMRA 1TKAA 4KBFA 1G21E 5K1ZA 3IV9A 1X8JA 3NR2A 1HLPA 2WJ4A 1B6TA 4MW2A 3UUFA 3DTVB 1LJLA 3IUQA 3KLPX 1VL0A 2BGUA 3OZBA 4ZOLF 2Q4BA 4EUKA 2VEDA 1GGEA 4QXQA 1N57A 2YWRA 1A76A 4FW9A 5CTJA 5BT8A 2B69A 1GYQA 1FTQA 2BGJA 2EDCA 2RGDA 1XKLA 1XU9A 2RB4A 1HNXB 4P36A 5AKKA 2YXNA 3F6BX 2W2KA 4LHWA 4TKLA 1X1CA 2R2AA 4BQIA 5KOHB 3UUEA 2AEEA 5M7EA 3E82A 1H6BA 3AEQA 1DC6A 1HYHA 4MSUA 1CVIA 4D41A 1XNGA 2DU8A 1RLJA 2H18A 3TSWA 1VPVA 1U81A 3IC5A 5BR8B 2XZOA 1L9XA 5EAIA 4KMOA 2ZAMA 3O3OB 1R1DA 4IOMA 3GPIA 3IJRA 1ILEA 4M1WA 1R00A 4FGLA 4WKOA 5CYOA 2ZYTX 3TLCA 1K5PA 4AK9A 1E18A 2ARKA 4Q82A 2ANCA 1EFTA 1V1MA 1GGVA 3PE6A 2WF7A 3KKEA 1GGHA 4MH0R 2R8YA 4UU8A 3OCWA 3NEAA 4X91A 3RM3A 4GVXA 3KIPA 4FXPA 4TXJA 2XMSA 4HHEA 4WMLA 3OU6A 2JAQA 2P9BA 3KFVA 3QKRA 4ZHQA 5F9HA 2HW8A 2R60A 5KTMA 3OLCX 3NGXA 3IV7A 4K9RA 1MRSA 2BGRA 1ODSA 2I7DA 5IRCD 3AKEA 3IAS1 1L5WA 3JATA 4L15A 1TJ5A 2X3FA 3PR3A 1SUAA 2DBYA 1FTYA 3H97A 2CBZA 5EQTA 3EVZA 5B6PA 1ESEA 3K16A 1ZJZA 2ZRLA 5DM1A 1VMDA 4R8SA 2PEZA 5JHGB 3Q41A 2PZ8A 3OQPA 4FEGA 5FWDA 1H23A 4MUFA 1O6FA 2NXEA 3C5EA 3N8GA 4EYSA 1G6KA 3T3GA 4TM8A 2CK3A 3OKFA 4M53A 1RYDA 3DDZX 3O7WA 2Z83A 5D86A 4BGEA 4E2XA 3I6YA 4GYKA 1YQWA 1I7LA 4TMYA 1VCNA 5KCZA 3IAAA 4GPEA 2Z9BA 1I6LA 2XE8A 3WSVA 1JR3E 4EKDA 5BWCA 4EABA 2C1XA 3B3QA 5LZ8A 4D4LA 1VIYA 4LXXA 1GPLA 1Z13A 4FZRA 3L8YA 4LW8A 3ONNA 1EP1B 5IXJA 3QPBA 4M8SA 1JAHA 4K6MA 4QJ3A 8OHMA 2O2DA 3NGLA 1OLUB 4KXXA 4D9NA 1PGOA 4IRMA 2H1OA 3G59A 4A03A 4WA7A 4OQZA 2ODAA 4QOJA 1SXPA 2YY5A 5K3DA 1CD5A 5HIIA 4J3FA 3TKLA 5ALKA 1L5RA 4F6RB 1Q1QA 3ISJA 1O7JA 2PRIA 1JHAA 1X7ZB 3OQBA 4KXVA 4YAIA 5IBCA 4MPPA 4BKQA 1II9A 4CUZA 1Y5RA 4L78A 3S1SA 5A3SA 3UEOA 3VDMA 2H29A 3SZ3A 3EQ6A 2EERA 3AHHA 3RDPA 3TGLA 1D9ZA 1W2WB 4WCDA 2J3MA 2O8EB 2XY4A 1QGAA 4H7KA 5SY9A 1F0KA 3GJXC 3MMPA 1W4ZA 5TT1A 1QH8A 4G5QA 1PHPA 4MIOA 1URPA 4R2WA 4YNBA 1N33B 5I9NA 5IM5A 4LKRA 1V4NA 1AU9A 3NKFA 4P38A 5HF5A 3BGVA 3IRUA 4H9GA 1MVLA 1KNQA 3E7FA 3S2ZA 3K92A 4GEGA 4ZCRA 3H8JA 4OJTA 3RSCA 3AYZB 3Q6MA 5B53A 5EZQA 4MP6A 1P0CA 1AUPA 1EJ0A 1UOPA 3R23A 3VR6D 2ZVPX 1QGED 4MQEA 2CXNA 5CB6A 3IP3A 1R9MA 3G8CA 5KKNB 3KKOA 4Z4IA 1FMLA 1JN0A 1UK9A 1BU8A 5KCMA 1C3EA 1NDUA 4IMJB 4PLFA 1WUKS 421PA 3LBHA 1UPTA 2VF8A 4E88A 3S8EA 2WWFA 4LY3A 1T3SA 1YULA 2QY6A 3GJ7A 1Z8FA 5HFJA 4C3VA 1XNRB 3KJIA 5EHZA 1DHTA 3K4QA 3HNOA 1IXSB 1J07A 1RE0A 1T5LA 3COZA 3SEFA 3ZD9A 1HDGO 3W77A 1OH6A 3TGWA 2QV7A 1JNYA 3QPCA 1N2JA 3FSJX 4CQMA 3MWDA 3OZDA 2AOTB 3ABSB 2O07A 2FPPA 2FOXA 4S1OA 2WYOA 3PDCA 1S2LA 2UV8A 4DA7A 1B0UA 3HBMA 3PJDA 3R3HA 4TYMA 4DJEC 3TFOA 1SKMA 5ARBA 2YNMA 3GUHA 4J76A 4DNPA 1PT8A 4DCCA 2NT4A 2QUBA 2YJ4A 5GIOE 1IJFA 3JQFA 4HD8A 1HT3A 3ERCA 3PQ5A 4HXFB 1LY1A 1FW8A 1TZ2A 2X23A 3MB8A 4B3FX 4PO8A 4E4TA 1W49A 2ZJ2A 3ESBA 3ZHRA 2J0QA 1HX7A 1EINA 3MJDA 1T5OA 2VXCA 5H81A 1H65A 1PL7A 2WFMA 2W2LA 2VNJA 3L6RA 1Q1NA 1BKSB 1D1SA 2HJGA 5B1IA 2G82A 2HBRA 2JLRA 2OVBA 1K06A 1OLXB 2H17A 2X2OA 1B41A 3LJKA 2C54A 3AFGA 3P2YA 4TV9F 3SJAA 1VRCA 3DKRA 4DCJA 3EGCA 3VGPA 5ALPA 2ABWA 1CZRA 2HA4A 1DSSG 3OY2A 5EINA 2HB6A 2AXPA 1Z5UA 1JR2A 3MK31 2OLEA 3CZMA 6NULA 1VJDA 3D6NB 2QX6A 3TCKA 2EJUA 3OA0A 4FKZA 4PZZA 2YFQA 3KAPA 1T9ZA 2Y66A 5JTTA 5C3MA 1GLGA 1BDIA 5JCXA 1YOVB 4RMHA 1OXSC 2OFPA 4LQ4A 3RAPR 4BZZA 1ZNXA 3W3AA 1SVOA 2F8LA 1V5WA 1ISSA 1SELA 2BFPA 1W2HA 1K4YA 2A1IA 3RI3A 1L3BA 2C9CA 3I5XA 2IWRA 2GXAA 1M2HA 2NU6B 2E87A 4HNUA 5KU7A 4WNYA 3R0IA 2DBQA 2UYYA 5JY6A 3TMKA 4BO4A 2O8FA 4G5OA 1XTVA 2J41A 4O63O 4WBXC 4R2KA 4OA8A 3MWLA 2F1OA 3F67A 3QVLA 2PLWA 3IP1A 4L0CA 3S5JA 1N8SA 1BA3A 1GFWA 3ITDA 4IO0A 2F62A 4OHVA 1ZIXA 2FWBA 2A58A 3P20A 4IX1A 4JLAA 4FOLA 3T1QA 4EW2A 2QIPA 3QNUA 3Q1KA 5HDBB 3NNNA 1T35A 2G1JA 3ILSA 1E6CA 4O0MA 2Y1XA 1GSOA 4PGFA 2QN8A 2W6JD 1DI0A 4ZVUA 4BO0A 5LXTB 2OCGA 4G36A 2A7XA 3MM4A 1PQ4A 2B4AA 2YDYA 3BKWA 3CNLA 4IF6A 1GG9A 4BX0A 3HJFA 5K6RA 4LZLA 1U4OA 4DIFA 3CG4A 5H1YA 2H9IA 4AZSA 4BRZA 4Z9BA 4KX5A 3H9GA 3QPDA 1A82A 1G55A 3GYGA 3CZPA 4RW0A 3I53A 4B3HA 2WPDA 2FPKA 4M0KA 4CIBA 1Q6ZA 1SVLA 1Z5GA 4HEJA 2LVBA 5DJ5A 2GSWA 3U3OA 4U2KA 4RSRA 1FVXA 1OROA 4MVJD 1P4JA 5JCPA 1GAJA 2HK7A 5IBRA 4F4IA 3PGKA 2H65A 1W4LA 2XWSA 2ZZKA 3FUCA 4FMBB 3DMYA 1IPHA 2NTNA 4FGJA 4MWTA 4YJ3B 3EZ7A 2OCDA 3HU5A 4P5DA 4B5LA 1YZNA 1CUVA 1E8NA 3C43A 1LDMA 5FBWB 4CXMA 2H4HA 5ABPA 3R09A 4NYMQ 3PE3A 3LOUA 1JQ5A 2X4DA 2XJ4A 3HI6A 3UHAA 1TJNA 4EGQA 1ENOA 1ZS9A 1YIDA 3S0JA 2CL5A 4K6FA 1V6AA 4B2LA 1Z35A 2FEKA 5KYWB 3FSGA 3WYGA 3E03A 5COAA 1IWPB 1CJCA 2GJ8A 4UM7A 4O2AB 1PNQA 1ZCAA 3D3EA 1Z9BA 4EG6A 1E1RD 1MV5A 4BU0A 2QDKA 5C37A 4N48A 4UMFA 3OFVA 1K63A 1Q15A 5DN6A 5CH5A 3T3HA 2DWUA 2DQYA 4B3MB 1E1YA 1VL8A 5DCYA 3E9DA 3HMQA 1T25A 4YCDA 4EF4A 3LC7O 1ZUIA 3PC3A 1P7CA 4P34A 4RVHA 4DMKA 4AS3A 1TL7C 1UIRA 3RJTA 4FEAA 4LTDA 3V4LA 3PFIA 5H4GA 1PEAA 1UADA 2DPHA 1KOLA 3SR4A 4PZ0A 3NX4A 4B85A 4EHLA 1GD1O 2IEBA 2W6QA 2QENA 5DP1A 3GGSA 1QMGA 5E4TA 3T12A 5KX5F 1K2VN 3T7EA 4DQXA 5BORA 4LFAB 1JZTA 4PV7A 1Q2XA 3U4CA 1HFEL 2AXNA 3AY3A 1K9VF 4ZI5A 3V34A 3WTCA 2G63A 3SDZA 2WU0A 5AM0A 2IUEA 4P3NA 2OGUA 2W0SA 5I4IA 2FPUA 1ACLA 3ADOA 3NQ41 1JLHA 2HXGA 5FNZA 1NLYA 5TGDA 1YVUA 3I6IA 2B4YA 2VHQA 3N0VA 2FXVA 4V1CA 3M0EA 5JADA 1SVKA 3N74A 4B32A 1K5DA 2B35A 2FZLA 5F1PA 3DJFA 2GEKA 2HHCA 4HQFA 3LDAA 1DLJA 3TLKA 2VAXA 3PV0A 5AHWA 1P80A 2O6LA 3BHIA 3KKPA 3S27A 1OJ7A 3HCPA 1VCHA 2J07A 2PQ6A 3KQYA 1MABA 3CZCA 4GYJA 2AC7A 3AUSA 3F3SA 3KCNA 5H5JA 3GEIA 4IF4A 1WNFA 1WUYA 4MVJF 4RHTA 2QVYX 1H4TA 1E3JA 5TX7A 2WA2A 3LBAA 5JSYA 3H87A 4DNFA 5CH8A 3KALA 3OECA 2FPGB 2DPXA 1FDVA 2V6BA 3FF4A 1FP1D 3IUMA 2PT5A 3OLWA 2L18A 3O4GA 3K8ZA 1BHJA 2P3LA 3SAJA 4A6XA 7ABPA 2Q3MA 3CVXA 1Y6QA 5FBLB 1ZN7A 5I6DA 3UW1A 1KZ7B 2G76A 4C2BA 1EU1A 4G5HA 5C5DA 3CHYA 1B2LA 5FL7A 2B9VA 5CXQA 1EWRA 3SD7A 3ZQKA 4JC0A 3DXYA 2VUHB 4LF8B 3V8QA 1QK5A 4CR8A 4K6OA 4PM4A 2ZITA 5J4VA 1LV8A 2AEFA 2R1VB 4WXPA 5AI9A 1GO2A 1QIMA 1K6MA 1SOUA 2Y1FA 1PD1A 4ETWA 4PPNA 2IE0A 4URYR 3HXOA 1UIMA 4B4VA 3MCTA 4PYRA 1LF5A 4ARBA 2NVWA 1ATIA 4QICA 4UUMA 2CKMA 3JX9A 1VG1A 3MLEA 2IRWA 3NBUA 2XQFA 4FVTA 1IHOA 5DISB 1G7CA 1LU9A 1ONSA 1ULSA 1PW5A 1KDOA 2HQBA 3JW8A 4MGEA 1U2DC 4C4SA 4R54A 4EL0A 2JIMA 5H9VA 3N39C 3NC1C 4FJ1A 4QUGA 3G2JA 5K8VA 1HI9A 3IP7A 4R84A 4C08A 4CM9D 2BRUC 1CSEE 1M1YA 2JI6A 3I62A 3DZGA 1ZOOA 4ZT2A 1VJ0A 1SEVA 5FOWA 2B1JA 4PSDA 2WUDA 3RU7A 1T5HX 3EPPA 1PR0A 3O4VA 2JZOA 4RH0A 3RBZA 5JSZA 1J1IA 3GFGA 2HJ9A 1RBYA 1Y7HA 3C7CB 2P5SA 4D7AA 2I7XA 1CEXA 4MKXA 1NUUA 4MMZB 4O4JA 1GTJ1 4EY6A 2AI1A 1ZUHA 1E64A 3A4TA 4WXYB 5G0SA 2Q8QA 4JR0A 1U8XX 3EVNA 3JAKA 3PIRA 4H3VA 4WLNA 3VR5D 4OQYA 1BXRA 3FJ1A 4RACA 4P3KA 5AMXA 4IUCS 5DT2A 4ENVA 4A10A 2IUUA 2ADMA 3ZVKA 5JPCA 2E48A 1YASA 2C20A 3KJNA 4M1ZA 4DS3A 4YIHA 1GKLA 2DTDA 1X9GA 2Y0EA 4WEOA 2CXXA 2GEUA 5FB3A 2C3PA 3T34A 1BS1A 3WFJA 2VJYA 3B8EA 4BNJA 1OLSA 1ZOLA 1T8UA 1O5TA 1PX2A 1CK4A 4B3XA 2GAFA 3HQ4O 1ZCZA 3I9NA 3PZRA 3UMCA 1VBNA 2FQYA 1ZEMA 2FWRA 1ORVA 4OHRA 1RYYA 3SXPA 5M5BA 5EXDA 3C6ZA 3CB4A 2ZTHA 2OSVA 1JEDA 1SG0A 4ZO6A 4OKSA 4I6EA 1TEHA 1Z17A 4IOLA 2H00A 1K5GA 1LI7A 1M1YE 4HCJA 3KKQA 3QY9A 2PUCA 5A2QA 2Q5EA 1N7GA 3GZJA 4MJ3A 4OHPA 3UQYS 1HT2E 2O2EA 2XB8A 4JYBA 1OUMA 2PS1A 4B3JA 1Y8RB 2ORWA 3LIIA 4XLTA 4DUYB 3RJ9A 5ICSA 2OUIA 3CLKA 4YTEA 1IPEA 2J7KA 5FNVF 1IQ0A 1GXSB 3OLQA 1ZEJA 2P6MA 1R0BA 3EZXA 4JC5A 1U8FO 3GEMA 3ND8A 4C6HA 4ZIRA 1MXFA 3NDPA 4DB4A 1JLLA 2OCYC 2F1JA 1WDLA 3KR1A 4X1IA 3PX7A 2J0EA 2VLIA 2AHOA 4JMPA 1Q17A 1KZHA 3KQKA 1I5OA 2GJAA 3R3ZA 4IIJF 3R9WA 1L4UA 1ZMOA 3F46A 4HQKA 3WE7A 3PYLA 1W9MA 4EY3A 4QFDA 3WLPA 1D5CA 4LYFA 1TQ2A 4N65A 3FHLA 4ZC1A 2QGNA 1Z34A 4ER6A 1W1UA 1LSSA 3IPYA 3F7OA 1F2TB 2VYQA 3ONDA 4QBGB 4AXXA 1Z07A 5T6BA 4HGZA 3UCEA 4ZKDA 2JKYA 3ZI0A 4Z1MD 1QWSA 3SQDA 1H4QA 4MITA 3DCIA 5ER9A 4FS3A 1ADYA 4B6GA 1H69A 3PD0A 2ZTUA 3BF7A 1ZOSA 1QVWA 2B78A 1L7BA 2Q29A 5JROA 4U2CA 3UV6A 1UT8A 2JFXA 1H8ED 1MV8A 1Z4KA 3GUZA 5LWHA 4QYXA 2C94A 2YRWA 3CCBA 2GT1A 2JATA 3A6ZA 3PQ3A 3SNKA 3W8DA 1N2EA 4B3RB 4NLLA 1BU5A 3A14A 3WS7A 5I8PA 3H9QA 5JALA 3OCVA 4DR6B 3QUQA 1PT5A 1MGOA 1ZMTA 2QI9F 2V7QA 3I37X 3IE1A 4ED9A 5HHTA 2B7LA 2PEYA 2YX1A 3DW3X 4NBSA 4IYJA 1YVDA 5JS7A 4HFNA 5JG7A 1KJIA 1JVSA 2DGDA 3VYWA 3BGOS 1T2UA 3X1KA 4QPNA 1EQ2A 3OM0A 5DNUA 3AEUA 2QUIA 4EENA 1ISIA 2AS0A 3AF1A 3LHSA 1AY0A 1YIOA 2MWMA 2H4YA 4INOA 1NVKA 1NBAA 1LGYA 4WA8A 3SZGA 4D3FA 4AJEA 2VNSA 3U09A 4O4LF 4BVEA 1E94E 5KVCA 4ZI7A 1WDTA 2FOLA 1RSZA 4OHCA 1HC7A 2F9LA 1QVVA 3MTEA 4KKVA 5AVKA 2P9GA 4KQGA 4TWAA 5CMLA 3EBPA 1SC1A 2H1WA 2VPTA 2XT0A 4Z9AA 1PS0A 3JQ9A 2R86A 1NOKA 2JLQA 4MRMA 1T5BA 3T1VA 5CCBA 3R7LA 3WV4A 4LA4A 5KNBD 6PFKA 4OREX 3K9FC 1J0DA 4PBTA 3E3AA 3R3SA 5BYKA 3NPMA 2Q4TA 2XNHA 4GS5A 3GCGA 1SWWA 4BV9A 3QEAZ 1XMQB 2C5LA 2C2YA 4FYKA 4ITVA 4KJZA 1ZU5A 1OHHA 5IK2A 5FV7A 3MJ4A 4ZYXA 3AFNA 1P5HA 3LT2A 2DY0A 1PT9A 2C92A 4MIKA 1H42A 1YT5A 2ADFA 1GGJA 2FSHA 1C80A 2WU1A 5F12A 5CDFA 4YCLA 4ND1A 4D2IA 1A8PA 3IEXA 4PSAA 1E7SA 4MP3A 3GZNA 4DARA 2DUUA 3LY7A 3EVBA 3OBIA 4A23A 5EHNA 2YS7A 4JUFA 2BI8A 3RUHA 3NBQA 5T57A 2HT6A 5LD2C 2BEVB 3OFSA 2GUGA 2C4HA 2MYUA 3R3JA 4N7JA 3LGXA 4RZQA 3PL5A 5ECDA 5B58T 3THXA 1QJ4A 1SVMA 5IMBA 2X2FA 5LM3A 1TPYA 1SEPA 4PYOA 3EASA 4PAOA 4QARA 5ALNA 2YZ7A 3RS8A 1I7DA 3AR5A 2W4MA 3K8OE 4INZA 4J0HA 4DR3B 1YJBA 4GUAA 4E5MA 4YV0A 2XUKA 1M0SA 4RESA 1SY7A 2V4ZA 4Z9XA 5CA0A 2R96A 1Q1GA 1QSGA 4HSGA 2OA0A 4D9EA 5MGBA 4KU4A 3T9BA 1MIOA 3OPYB 1GPWB 4LOAA 3M5PA 5ALQA 3V2HA 2TMYA 3RCBA 2O4CA 4NOLA 3TYXA 4MRRA 3UIEA 1DKMA 4HZGA 3R74A 3VSBA 4X3OA 1R4MB 2D5AA 4RIEA 4JBXA 1JEQB 4YPFA 1J23A 3PLAE 2QOEA 3L7YA 2FX5A 1EFRD 2OL4A 3HB4X 3W4KA 2JANA 1Q20A 1ZINA 4R9VA 2JJ2A 5CDFE 1WOYA 1NHWA 4I55A 5CPBA 1AA9A 1KL7A 4R4JA 4P1ZA 1BG6A 1CP2A 2CD7A 5A6SA 2VKQA 1U5BB 1LRJA 1IZ9A 3FM9A 2DFPA 1RRGA 2JFBA 2C29D 3FPCA 4MPJA 4M1KA 1KVUA 3R3VA 4LUCA 3ROZA 4X3CA 2QT1A 3BICA 4QTZA 4LVNA 3ZWMA 1LWNA 1CUUA 2AGVA 2WSIA 1SU7A 2XUJA 5HK8A 1RJ9B 1TKCA 1U0TA 3WXBA 2D3TA 1VKNA 3FNGA 3PDIB 1RFLA 1QPGA 1TJPB 2I0FA 1R6AA 2A78A 1QX4A 4J0QA 4BBPA 1ZM4A 4P0TA 3KPUA 7MHTA 3F4KA 3IBSA 4DWVA 3H2SA 2ODQA 2UXCB 4A0GA 2WIAA 4OA5A 4UEKA 3MSCA 2AK2A 4DDHA 4UAGA 1JHRA 1ST2A 4WOPA 4PLVA 4FU0A 3S1AB 1UMBA 2YINC 4Q00A 3HA2A 4RVDA 1BWSA 1CRLA 2CHVA 4HY3A 5ADVA 1EXNA 3JWEA 1E60A 2DFKB 3QBVA 4ZICA 2VR1A 3DZBA 1OX6A 3DZCA 2QX4A 2VQFB 1IVYA 5K3SA 2DX7A 2G4LA 3OTOB 4YJHB 3PGXA 1XDUA 2C4KA 4KH1A 3FNQA 2A84A 3PRJA 3MJCA 3OEYA 4C29A 3JYLA 1OBVA 4MO2A 4PXSA 3TZQA 1KI2A 4MW6A 2VDKB 4A6EA 4R0MA 1B00A 1U2TA 2CHQA 5DXAA 4HQ0A 3SQOA 1UODA 4M8KA 4YMIA 5LMNB 2ZSAA 1X1QA 1X1BA 1W48A 3AERB 4Z51A 1XAIA 1WBBA 3AJDA 4UHEA 4PO9A 5LUBA 1ID1A 3CUKA 2J6CA 1JYEA 4MJXA 4XX0B 5TV2A 4H18A 1B23P 3EA4A 2WZQA 4HLUC 4JJ7A 3JQBA 2HF2A 1YKGA 5L95A 2FFRA 3K0EA 4J1TC 5E6UB 1YL5A 1YS4A 4F5DA 4BTLA 2QBYA 4Q9DA 4IWYA 4LJ8A 3HZHA 3PIIA 1F2DA 2V9PA 3H2ZA 1MT0A 3CH5A 4N76A 1MAVA 3N2IA 2WP8J 2C7OA 2IYSA 4D56A 3X1WA 1U5CA 2QN3A 3ACDA 3U16A 1DJLA 2ZDQA 2PUWA 3F97A 3PLRA 4PX2A 6YASA 2QRPA 2WWIA 3ZBQA 1VFNA 1J97A 3EVEA 4E15A 1C50A 2ZVQX 4H0CA 1OKKD 1CE8A 1RMQA 4AXBA 2DHEA 2HGZA 1HRKA 4U6SA 1JSLA 1JXQA 1P81A 4NBRA 4OMCA 3TRHA 4RWZA 3GJ3A 4RD2A 5BOSA 1R8JA 3QEOA 2NW6A 3ENNA 4S1NA 5FTKA 1SHUX 1J5XA 2YIVX 3AM3A 2CMHA 3ANSA 1P4HA 2YJGA 2W6IA 4KWCA 5CCEA 2A0XA 5HVNA 1JL3A 3L8ZA 1LK5A 3T38A 3ELDA 1ZGBA 3E81A 4MGYR 1JA9A 5HUQA 1P33A 1Z0KA 3DXXA 1H2WA 2GN2A 2R8ZA 3QI7A 5U9CA 4RELA 1QG0A 4L22A 5DGXA 9MHTA 1Y4DE 2PWYA 3OOEA 4J91A 3O74A 4RANA 4K81B 4R69A 1KIFA 1T3ZA 2BMEA 3OM1A 4NJMA 3TPFA 2G9VA 2DXIA 3ZZNA 1DQNA 1N8NA 5JZOA 3I9KA 3LPCA 4QM6A 2F3TA 3RC2A 2F4NA 2Q9CA 1OZ0A 4RVGA 2ERYA 5CYFA 3U7RA 1I94B 3O92A 4LHXA 3TDNA 1DBRA 1U7WA 4FI3C 3F8WA 3OWHA 1D3AA 1EPUA 1Y80A 4NNPA 1KC3A 2RHCA 4OV6B 4GR9A 1UMDA 1A5AB 3GF4A 4V0KA 4O33A 1SR8A 1DUSA 3S2SA 2VCHA 1GNPA 1D04A 3U4IA 2Z5VA 5FA8A 4DIOA 1E3WB 1JZQA 2WHRA 1YS2X 3LTNC 2C57A 3GUCA 4PYNA 4U9HS 2PGDA 4W9NA 3ZHZA 5BXYA 1Z88A 1ZCFA 2FB9A 3C8UA 3ODPA 1UFKA 4HH1A 1YSCA 4EG1A 5ELLA 3DO5A 4FLFA 4FT4A 3G2KA 1QF6A 1XU4A 3WYEA 1T3LA 1TAQA 2HADA 3R77A 5JFGA 3L7NA 4E08A 5L53A 3WGMA 3L82B 4CIVA 1XRNA 3BIFA 2R62A 4P31A 3U9SA 4ARSA 1MZPA 1DHRA 1X0VA 5ALTA 1KS2A 4BNUA 2P5TB 1ISHA 1G1MA 3I2GA 4JZKA 1DAGA 1GKYA 2ERCA 3S8MA 4Y2RA 5KI6A 2JGIA 1CUIA 5GQSA 4UNQA 2BZGA 2P3OA 4BGIA 2X8JA 3C1AA 2H06A 1N3LA 5D6NA 1PFQA 3MT0A 4R3UC 5IAJA 4FWIB 2Q2OA 3AVOA 1JLRA 1T29A 5BSKA 3KPVA 3MJSA 2QP3A 3BTVA 1QV9A 3VR6A 1Q1AA 4HADA 3E9ZA 4CU2A 1Z73A 1SM4A 2V03A 1OAOA 2XIQA 3CNQS 3MT9A 1YC2A 1SZPA 1D4ZA 5IM4A 5CG2A 1JI0A 4IXDA 2BTOA 5DBOA 2W9XA 2AMFA 1QC5A 4BKPA 4AKGA 3DEHA 2NO9A 4ZOCA 3GCZA 3KUDA 3UJ3X 3EARA 1WMAA 5HSGA 1N9GA 2AN5A 3DL2A 4I9UA 1JU4A 1VHWA 4P81A 4Q7QA 2YCLA 5GMOA 4KP7A 2HU5A 3LD9A 1NFFA 3BGDA 1QHYA 3CIFA 1RHKA 4LMRA 4QJBA 4D45A 4DA0A 1E2HA 3A7EA 3QA9A 3K0CC 1BQ3A 3B1KA 3COYA 1YJ5A 5CW1A 1Q0ZA 4MPTA 2X4LA 5DHFA 4I5DA 4XDGA 5LKAA 4UJ3A 3C4QA 2I2XB 1Z22A 4XX1A 5EWLB 1CEYA 3TQFA 1UOEA 4OL0A 4M0CA 2I8AA 5FD8A 1KAMA 2A3RA 3EFOB 5F5NA 3CRQA 3EXG2 3VPCA 4YDQA 5IYZF 3GDFA 1HOTA 3QWBA 4K28A 1G21B 3VKUA 4EK9A 1GGFA 1LBQA 3G5MA 2NU9A 3MTIA 4G4SP 2W2QA 2WSYB 1NI4B 2O2XA 2YQZA 3KKNA 4FBLA 2QUKA 4OGWA 5K20A 1U7PA 4ZHSA 4NG4A 3SLRA 1A5SB 1V9CA 1MA3A 1TLTA 4CF4A 2I8CA 1C0KA 1NA5A 3CNEA 2ZJ8A 3PK0A 4NYJR 3RV3A 3TN7A 3CN7A 4K9DA 5EPOA 4BMZA 1O89A 1QORA 1WKCA 5BSMA 4RDCA 5D1HA 5LYJF 2LDBA 2ZWIA 4H16A 1J2TA 3QQPA 3ESZA 4IIVA 2I1WA 1AZWA 2E4UA 1CDZA 5EESA 1N36B 1E0DA 4O1MA 2QR2A 1XRLA 4GWKA 2M1ZA 1P4AA 1DTEA 1TCVA 1WV0A 2HF9A 2JF0A 3UICA 3ZV5A 1KY5A 5C8YF 2R00A 4ON9A 3GDWA 2QE6A 5EZYF 1IQRA 2BGNA 4U0JA 1N75A 5TY0A 3EA0A 3JYPA 2D1FA 2FSFA 5JJKA 4I2VA 3D0KA 2YXEA 2Y2VA 4GLLA 4UEWA 4E30A 1A8HA 1GGKA 3H99A 1SQGA 3D8RA 3AW8A 3AKZA 4J6EA 4Q3EA 1Y9ZA 1I51A 1Q21A 4LF5B 1MIHA 1PQPA 4X8OA 4IDAA 5CVVA 3QKIA 2DTXA 2WD7B 4ZCPA 5IVHA 7ADHA 1JFFA 2VYND 1YK1A 2Y1KA 3H05A 1D2MA 4MUXA 4R31A 2IGTA 5HE9A 3G1TA 3WLQA 5DM0A 4JGGA 1JHPA 4OJYA 2VZEA 4TSRA 1EFHA 3NTUA 2D7DA 1HQKA 1YTLA 2OHJA 3SEAA 2ORYA 3C3WA 1C9EA 4BN5A 1TD9A 2O06A 2PNFA 4HEHA 4KW7A 5DX8A 3RG2A 3JD1A 3E1KA 1DAHA 3LHKA 4Y6PA 4D43A 1ZR2A 4CQJA 4RK5A 3WO0A 1X39A 2W2KB 1E7MA 2W6JA 3TEFA 4CTOA 1FB5A 4JVOA 1FXUA 4FDAA 2YFYA 3IDFA 3AEQB 5K01A 5F7OA 2PUGA 2ECQA 1KI8A 3GHYA 3RUPA 3VJLA 1P5RA 3DEFA 1WP4A 4KVAA 4HJXA 1I6MA 2BKLA 2VATA 5D7BA 3E05A 4QBKA 1NOIA 4L5BA 5AOVA 4RPKA 5BSFA 3QLEA 3V6MA 3U1VA 3TAHA 3OZEA 4IIHA 4RFVA 3ZVNA 1EWQA 3TW6A 1DIGA 3P7MA 5LOVF 2FJUA 4AP9A 2YN0A 2XXJA 3GIDA 2C1EA 1WXXA 2EF1A 4DLYA 1V1MB 2AOVA 3HV0A 3MFQA 1QO9A 1GLVA 2VT7A 3WG9A 4BUCA 1W5SA 2Z4TA 1ITZA 3CQ9A 4GKBA 4MYHA 5FA6A 3TL3A 1M74A 1WD7A 2HM7A 2OHFA 3CKKA 3ED1A 3QKRB 4JASB 4TTRA 3L4SO 2Y9MB 2XYQA 4DCNA 5B1YA 2FKNA 3KOZA 4NQRA 1Z18A 5EP4A 4AY6A 3HTXA 1AQUA 3IXLA 3L05A 3QFHA 1MH1A 2GEDA 3JATB 1I2CA 3ZD6A 1GIAA 3LUDA 4KQJA 5E95A 3CKYA 1YRBA 3NHSA 4QU5A 1IXZA 1B3BA 2H1LA 2G8LA 3O75A 3QBDA 3ZK9A 1EVIA 2GEBA 1E1RA 5JD4A 1CU1A 4DIUA 1J39A 3Q3VA 4PO3X 3QVTA 5CR9A 1DMRA 5EIHA 4D9HA 3G23A 3GVIA 3UO8B 2QR3A 3IUEA 4Q3KA 2R25B 3ADKA 5HPYB 1TRKA 4UAVA 4EGAA 1JFVA 3RH0A 2P9ZA 4AMYA 3AHIA 3KSMA 1YRLA 3UMBA 1HWYA 4AO7A 1X15A 4OHMA 1FUKA 2PTHA 2W48A 4Y6SA 3UB3A 3WQSB 1WWKA 1YFKA 3SQWA 3REFA 1IY8A 1KAQA 1AKQA 1VKHA 2R8OA 3NWJA 1N5LA 2UKDA 3VBEA 1CR6A 1XTKA 3QX3A 3K09A 1YRHA 4POAA 1JG2A 1AH2A 3JTEA 4JLSA 3BD9A 1WXDA 4HF7A 3KYJB 1UAAA 3CBQA 3A2KA 3LS2A 1E3SA 4NC9A 3GEHA 4R8KA 2OZEA 1G42A 2CFRA 2FPOA 4YQEA 5TS2A 2DTEA 4R9UC 1GDDA 4N3AA 4KQ2A 2I87A 2HIMA 3ES9A 3MTGA 1BCRA 3ENQA 5HJ5A 3KS9A 4UDNA 1X6VA 5JI2E 4LYHA 4QXAA 5SZIA 5CFOA 3FVTA 1QH8B 2NQ2C 3INYA 3ZS9A 5HMMA 1XVLA 3ROMA 5A4KA 2QY9A 3TXAA 1L7RA 3S68A 1OWLA 2EATA 4UUQA 4IHJF 3X2SA 4O4HF 1DKQA 2YVLA 1ZBDA 4KQ9A 3BSSA 2PXCA 1QZUA 4Z4FA 1HMYA 3OT1A 4DB2A 4IVNA 2IPNA 3EOBI 4KN9S 3V2IA 1TZBA 3WADA 5IWAB 1YIAA 1E1NA 2HF8A 4LJ7A 4WXMA 4Q9LA 4R83A 5KTOA 5J40A 5BN3B 4A8TA 2QXTA 4I2NA 2CSUA 4MQEB 4FW8A 3UK7A 4C2TA 1H94A 4I9NA 3BH6A 4YPVA 1Q0RA 2WF5A 8ATCA 3P2JA 1E61A 1VSBA 5AI4A 1ZA2A 5KEIA 2VWPA 4X63A 4J4TA 1XA4A 1IYZA 1J90A 1NWCA 1X14A 2OZPA 3EOAI 5F9FA 2I3DA 4ZQCB 4LYJA 3X3HA 3I2HA 4LPKA 4KPGA 3RUAA 2VPWA 4PWYA 5JS8A 4O2LA 1FUIA 1TC1A 1DT5A 4CL8A 3ZNNA 3DMPA 4RD3A 4BEWA 2OECA 1PJQA 3CX4A 1HO3A 4IZ6A 3QOYA 4JBGA 3WAKA 4WVLA 3MWDB 4CM9A 4CQMB 1ZRHA 1FF9A 2VXBA 3F6RA 3H1AA 3M83A 4OGGA 4Y2TA 4D3SA 3IAHA 2FPPB 1MX3A 1NDHA 4XCQA 4B7XA 1JTEA 2ZUWA 1MOQA 3UAGA 3F3YA 1Y8CA 2XUIA 4KNWA 5IUKC 4M0LA 3BKXA 1W19A 3G13A 4JI6B 1GUAA 3UMMA 1E9VA 1KP3A 1NRJB 3OM8A 3SEQA 1W0JA 2WYUA 3OHPA 4ZTZB 3C3MA 1EK5A 3ETDA 3H4VA 4WKGA 1EG7A 2BGMA 3WMWA 5F3RA 1UWLA 2HQOA 1PQWA 1D7AA 1U7TA 4TXHA 3VR5A 4GGOA 1IQUA 4Z0HO 2AZTA 5JH7F 1S2GA 4AMBA 2WAAA 1XCPA 3WP0A 2XWQA 3DVLA 2EW2A 3INRA 4R05A 2E18A 5DYTA 1B26A 4LCJA 5LQSA 1JS1X 5FHRA 2JDID 2D8MA 1N6HA 2PWBA 1XLVA 3EPRA 5FUMA 1V1RA 5DEOA 4YP6A 1XB2A 4II2A 2HIAA 2WDZA 2K87A 3FFTA 2UYQA 2WZCA 4KWIA 3MGAA 4QOHA 2LV8A 2PQMA 1KI7A 1QZ3A 2EFHB 1DWQA 1K8YB 1U65A 2X1MA 3A9VA 3PF9A 4FDTA 4IRXA 4HDNA 1E2NA 3FJOA 1SQ0A 3GGOA 4OHZA 4KVZA 4GLJA 3QMPA 5J5CA 3GJTA 3ER6A 4G41A 4PLPA 2O8VA 4DLWA 5AK0A 1L9KA 3TB6A 2PL3A 1HKHA 4CDRA 1WXGA 5KAPA 2POCA 2CV0A 3L1IA 5A6VA 3N86A 2ATCA 3EDMA 1HDYA 1ZC3A 2PS0A 2EW8A 2X19A 3NRCA 1P3DA 1B1CA 3OTWA 1YDFA 3F4LA 1I33A 4CMAA 5DHQA 4C0JA 1B0AA 4ONEA 2HU8A 4OVKA 2SKDA 1DPFA 2O8FB 3IEPA 3Q9NA 1M67A 2GBPA 3UT6A 4Z54A 1L5OA 2GNPA 4MS1A 1QKIA 4QTYA 1WY5A 3WJ2A 5JNLA 2GBGA 4YRNA 2ZUCA 3UZUA 5C1BA 2WIFA 1GZ4A 3EGIA 3KO8A 3D43A 4G25A 4NCAA 1L2TA 3HO1A 1DAOA 4RV9A 4V38A 3H17A 3NT4A 4XQGA 1CW2B 1UBKS 3UC5A 3DQZA 5ITZB 1XP8A 1R66A 4E1BA 2PD4A 1NR5A 3QYJA 5LUAA 4P98A 1Q77A 5BMVA 2IV2X 1N5DA 5FOQA 2JI9A 2BYTA 4RS3A 4BNVA 5JAOA 2RGRA 4Y2HA 1EFKA 3AVPA 4HAOA 1RJEA 4M9ZA 1I1NA 4Q9AA 4M86A 3TVYA 1P1HA 2Q7DA 2VAMA 3FOBA 3SXJA 4LZWA 1C4OA 1JG4A 1FYDA 4KH0A 4MCJA 2C95A 4BZQA 5LQAA 1RWNA 3C3DA 3EQ8A 2W6OA 4DC9A 3AJAA 2RC5A 4KAAA 1H8EA 1KI3A 3HSKA 3VDNB 3W05A 4NSNA 2WF8A 5CTAA 5K0CA 1KRWA 4PZUA 1U80A 3EGEA 4KGDA 1KNXA 5CPFA 3JVIA 2PH3A 2X1VA 3DBRA 7AT1A 1SFRA 1XTIA 2DPYA 2VCYA 1RADA 3MSXA 2BW0A 2VNKA 1WSWA 4CFZA 4DLAA 4Q01A 2WM8A 3NATA 1XQ6A 3GAMA 5FTJA 4AN1A 1GU0A 3JU3A 1S8AA 3NC4A 4JR1A 4MUJA 2J9RA 3UWOA 2HHHB 1I6KA 2DB3A 1AX9A 1W85A 2XXBA 1JEOA 4HWSA 5AIAA 4JLJA 4MIYA 5BWNA 4S0ZA 5KC8A 5TB5A 4IL5A 1DCFA 1OAKA 1LPNA 2I6TA 3QA3E 1U9IA 1F12A 3ANXA 5EIOA 1SMKA 1K7YA 2EL9A 3ILXA 4A8JA 2B36A 4Q5IA 1FRZA 2I7CA 3RU9A 1OTYA 2PJZA 2BAGA 1NMSA 4AZ0A 1O9HA 3CVJA 3BCUA 1Q3KA 1W44A 1NJ1A 3I92A 2AFIA 4OLHA 1ORWA 3E7XA 3MTQA 2ZWPA 2CJYA 4G56A 5COQA 4LVUA 7REQA 3L0SA 4RTQA 2EJCA 3IBCA 4ZZIA 1BEUB 1NM5A 8LDHA 4BAUA 4L5YA 1OBHA 1FFBA 5IKOA 4BPRA 1YQTA 2YN2A 3K9BA 5C1IA 2ZYIA 4UEQA 5HFAA 2ZSDA 2MR6A 3HBNA 3FAKA 4WL0A 1CP3A 4HDCA 1L4KA 4FOPA 5JSQA 1FW6A 1NN5A 4A36A 1BHO1 4B4KA 4Y2XA 3BIXA 3MJTA 3DL4A 2AYZA 4ER5A 4PLYA 1KZ9A 1GHTA 2D6FA 4URUR 3IVCA 2VUTA 2C7QA 4V1CB 1H5UA 4N6NA 1ZGGA 2IEAA 2O5RA 1QGDA 3N6VA 3HB7A 2WHXA 4G0OA 1BOFA 2R79A 3B53X 3H1FA 4N7MA 4BJ1A 1JSXA 4BFVA 2I7VA 1QF9A 3FPGA 2VZ9A 4QOIA 4MI9A 3ITEA 3B89A 1MABB 4YPOA 4NF2A 4PO1A 2YJTD 4B3BA 1R2QA 4R2MA 4PWZA 1LD3A 1QR6A 1E6UA 1XEAA 3L46A 1OWPA 1WABA 3OZIA 3PX2A 5LIRA 1N1MA 4GRIA 5HIJA 2Q4EA 3EPLA 1U8AA 4PRZA 1VMKA 2C2GA 1NZDA 4MWEA 4LMPA 1CZLA 5F4BA 3QUTA 3B20A 3JZAA 3NIDB 3OE7D 4GLOA 3V32A 4QFMA 3C8DA 3RE1A 1F1BA 2OG1A 2GAAA 1A69A 2ZROA 1IUOA 1EFRA 3D3WA 4UUOA 2PFSA 1R6XA 2DCUA 1DBSA 2P4UA 3UWMA 3Q1LA 2VNAA 5IDWA 1HT0A 2NQTA 3H6GA 2FPSA 2QTRA 2C5EA 4E3WA 3VV3A 4BVHA 2ZYRA 1SUIA 1X1TA 3ICWA 4KIWA 3UTDA 1Z4QA 2QPLA 2ZBRA 3HY3A 4MVJP 1F6WA 2YZ2A 1ISPA 3ZCQA 1BZYA 1W581 4BP1A 1FNNA 4I50A 4UXJA 4DIKA 1W88A 3Q72A 3RV4A 3W04A 3FCEA 1SHJA 3LUBA 4AG5A 4URVR 3UATA 1P9LA 1ULZA 4YRCA 1G7SA 4L08A 4MUNA 1QUFA 1IBKB 3BZBA 5LA6F 1M1YB 4E3ZA 1O54A 1P4SA 4UULA 1RTTA 1DJPA 4CPDA 4DLUA 5JHHB 1Z7BA 2GD2A 1KI1A 3LZDA 3D7NA 3OT5A 4A6PA 3TMAA 4HXYA 1JKJA 5ALXA 3AL0C 1KF0A 5JSZB 4TS3A 1UAGA 5K3FA 5K3BA 2UZAA 3WLEA 3HBLA 3VZCA 4BFZA 3KZ1E 3I42A 2JGNA 3OD5A 5F2NA 2R6FA 4O4JB 5EFZA 4BASA 4YMSA 4D0LB 2PIAA 4S12A 3P94A 4L72A 3A7DA 3JAKB 3FDXA 3IMFA 4KE6A 1Q19A 2GARA 4OM8A 4RFSA 4LXYA 4IPTA 2AUNA 1BXRB 1LS6A 1XD2A 2GRJA 4JOCA 4KIFA 3FAZA 1TO6A 1J09A 3FWPA 1Y3BE 2QEQA 2VP9A 4LC1A 2EQ5A 1H4VB 1WR8A 3AB3A 4OCZA 1U1EA 2XRZA 2H92A 2ZCJA 3QEBZ 3UOGA 1ZM3A 5K8JB 1USKA 2BGLA 5JJBA 1P61B 2C84A 4P3OA 5LCXA 2I71A 3R9XA 3HL4A 2J45A 5BRAA 4CMHA 1OLSB 3WGKA 2OVFA 5IEBA 3PCRB 4I9GA 3UUWA 4TKMA 2W2TA 1SH7A 2GM9A 3AF0A 3HFSA 1VOTA 1W30A 1W8IA 3B9BA 3PSAA 2V7XA 1SKUA 5DI3A 5DO9A 5LNK1 4AMZA 1KEKA 4RTPA 3LZ6A 2QPTA 2APJA 4JBYA 4IQ8A 1B8UA 3U19A 1MX5A 1R4ZA 3GEBA 1RXIA 4D3YA 4G8CA 1B76A 5A5EA 3FCUB 5AD1A 1G9TA 3MCVA 1SOMA 5EJ8A 5KYYA 2YOGA 1C0IA 3L5OA 3PNMA 4HGPA 3F5SA 3WK5A 4BQEA 6REQA 3AF3A 1GP2A 5HKAA 4R1QA 2D4AA 2CFSA 1Y1TA 4QHYA 2B99A 2XJ9A 4BJHB 3M4YA 4XYLA 4HR7A 1S3GA 3QKSA 4FEYA 1C3OB 4UTZA 4RM2A 3H75A 4JEHA 4RSMA 1EG2A 2JH9A 1RHJA 5IN5A 1MC8A 1OKKA 2OCLA 1ZGCA 2JCVA 3WI7A 3C3YA 3NWOA 1Z4IA 1J5PA 2J31