1BVHA

Solution structure of a low molecular weight protein tyrosine phosphatase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
157
structure length
157
Chain Sequence
AEQVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ACID PHOSPHATASE
publication title Solution structure of a low molecular weight protein tyrosine phosphatase.
pubmed doi rcsb
source organism Bos taurus
total genus 21
structure length 157
sequence length 157
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1994-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bvhA00
1FFSA 4MR8B 3B2NA 5JS1A 3QELB 3HCWA 5PNTA 1ABFA 4F12A 2FSPA 1BA2A 4IRXA 3Q9SA 1U0SY 5HKOA 1EWTA 2FXIA 1JH9A 5JNRA 2NZUG 3QX9A 3NHMA 2L2QA 1SD5A 3CU5A 1URPA 1DCMA 2FMIA 1BVHA 5F64A 5KQPA 2M1ZA 4PYRA 2ID9A 3C3WA 3GRCA 2MYUA 3RVOA 3SM9A 3SG0A 2FN8A 4RWEA 3I09A 3O1HB 4KPYA 4O5AA 5TQ0B 2FTKE 1ZH4A 1LK0A 4IGAA 2HSGA 3EGCA 4MR7B 3IP6A 4PEVA 3TB6A 3HEBA 3NHZA 5FWYB 4N0PA 3HO1A 2E4XA 2H3HA 2KYRA 5GOTA 1XWWA 1QNLA 3I5AA 4Z4EA 1RNLA 1E6KA 2A9OA 2CHEA 3IP7A 3MYYA 4YP9A 2R25B 4EY3A 5HSGA 4MR9B 1ZN2A 1MB3A 5KWSA 4ZMSA 3LUJA 3OLVA 3DGFC 2VK2A 3OLWA 5FBKA 5DCLA 4Z0NA 5C5EA 4O1IA 2CHFA 3LUCA 2FKAA 3BBLA 3MF4A 2E4VA 4XLTA 1TVMA 2QXYA 3GL9A 4RXMA 5EWJB 5JNSA 2A9PA 2P9HA 4MAAA 4YCSA 3QEKA 5JNTA 4YR7A 1FFWA 3OLZA 4MS1B 1LBIA 2PUFA 2L19A 3ROTA 4N0QA 3IPCA 2HPHA 2JVKA 4ETNA 3N53A 1P6QA 2FW0A 3RVRA 5B3JA 3H5IA 1JX6A 1LJUA 3CRNA 4D6YA 1DBWA 3F6CA 3O2SB 3GBVA 3OM0A 3QLVA 4QPJC 5TPZD 4W5QA 2JRLA 4G0ZA 3D02A 2YHBA 1DRKA 4N41A 1H9CA 1M2EA 3H75A 3QLUA 4RY8A 3IP5A 2J48A 3ILHA 3R0JA 4LE0A 4TLLB 4OG2A 4FE4A 4ZYLA 5TQ2B 4LE1A 1ISSA 3NNDA 3CZ5A 4RXUA 5C5CA 4RK1A 1PHRA 5BRAA 5DKFA 4E7OA 4WXEA 4Z4GA 4MGEA 4MR8A 4JP1A 2XDYA 4TN5A 3RVJA 3HDVA 4DADA 4XASA 1PNTA 4NCBA 1F4VA 2H0AA 3LUDA 3H1FA 4RK5A 3ILYA 3RVKA 1AB5A 1Z16A 3EQZA 3N0XA 3F73A 1A0OA 1NXWA 6ABPA 1XHEA 4MS3B 4UHJA 1W9HA 1NTRA 4O1HA 5ABPA 1Z15A 2VYCA 2QR3A 3HM9A 3VNBA 4WZZA 4Q7EA 3W9SA 1DZ3A 3A10A 3DGEC 3N0RA 1Z12A 5IUNC 4E7PA 5TQ0A 1CHNA 2QVGA 2LBPA 3IPAA 1RZRD 5KC8A 5FWYA 3N6VA 1KRWA 4IILA 1L5ZA 3VNAA 4LDAA 3BRSA 3KLOA 4HNRA 1Z2EA 1VRVA 2E4UA 1Z26A 3CKMA 3OLYA 1DBQA 1ZHHA 1M5TA 2CD7A 4G0QA 5KQMA 1APBA 5JNUA 1U04A 1FQWA 4JB2A 2LUOA 1C4WA 3EODA 3CNBA 1MB0A 3CZCA 2JVIA 4LE2A 2DRIA 4EVSA 3RH0A 4JA2A 1FFGA 5TPWB 1D5WA 4JB0A 3C97A 5EWJA 2WJWA 3MIZA 3TX6A 1AB6A 3H5WA 5EWLA 2E4ZA 4MQEB 1SXIA 1JFSA 3T95A 4PE5B 1NXPA 1RXEA 5DLEA 2GWRA 3CHYA 3SNKA 1QO0D 2NT4A 4ETMA 5B3JC 2M98A 3O1IC 1M5UA 2WWVD 3QLVC 5E3JA 1JWLA 4F11A 1BDIA 2IPLA 3A0RB 2JB9A 4HYEA 2FMKA 3HK2A 2LPMA 3GWGA 3QLUC 4Z9BA 4CBVA 3FDFA 1JL3A 4EYKA 2OQRA 3NNNA 5DTEA 2JK1A 1YK1A 1DP4A 1ZESA 1EWKA 4G0OA 3O74A 3C3MA 5TQ2A 4DQDA 1YMVA 1BDHA 1D1PA 1PEYA 1GUBA 2JBAB 5TQJA 4F06A 1OXBB 3DZDA 3HUUA 3F7NA 4EUKA 2GKGA 5I4CA 4YV7A 3H6HA 1JHZA 4Q6BA 4MYRA 5HM6A 1A04A 3HUTA 3LUKA 3I45A 3JVDA 3M9WA 3IP9A 2I6FA 4RY9A 1EHCA 3MM4A 3T8YA 2PL1A 3JTEA 2YHAA 4EYOA 4MS3A 3ROFA 4Z4IA 3FMVA 2IPMA 4RK4A 4XARA 4ZPJA 2QV0A 3K4HA 7ABPA 1JFVA 2WY2D 4G0YA 3H6GA 1L5YA 3KSMA 3LUHA 3FFXA 2PAFA 1CYEA 4H3KB 1K68A 1U2QA 4DN6A 1DRJA 2MSWA 1IIBA 1Z25A 8ABPA 3HSYA 2HQRA 2RJNA 1F51E 3A3KA 1YS7A 3O2JA 1SXHA 3GA5A 2MSLA 4P98A 5IEBA 4PICA 4MRMB 1NXXA 3GBPA 4OATA 5CNKA 4MLCA 1YIOA 4EGSA 2PUDA 2JCGA 1B00A 3HS3A 4KQCA 3HDGA 4GPAA 5CNIA 3EULA 1NY5A 2IOYA 3HVRA 1GLGA 2PJUA 3TD9A 4ZJPA 5TE9A 5TPWA 4RZSA 3RQIA 4LZLA 1SXGA 1XHFA 2IKSA 2RJOA 1GUDA 3JVIA 4RK6A 5T3YA 4MQEA 5JNWA 4W5OA 2P4UA 2IPAB 4Q6WA 2AYXA 4Z9AA 4YGXB 2E4YA 4G0PA 1USKA 4ETIA 3MA0A 3LOPA 2V0NA 3QELA 1CEYA 4MLDA 2WMYA 1USGA 3JS5A 1P2FA 4MQFB 4HNQA 4YLEA 2WJAA 3NNSA 4OLAA 1JDPA 1P6UA 3F6PA 3CTPA 4H60A 2NZVG 4RDCA 3RVSA 5IULC 4S04A 3P9YA 2VUHB 2LIVA 1Y1LA 1VPWA 3H1GA 1FSPA 2PL9A 1RZRA 4OLBA 3FFTA 3G1WA 1ZVVA 2FMFA 1VKRA 3DLBA 3M9XA 3QLTA 1S8NA 4WXMA 4KK4A 4KREA 3DLHA 4KK3A 3H5OA 3JY6A 1QPZA 1Z18A 4HNSA 1E6MA 4MR7A 4OBBA 2HQBA 1EAYA 3C3KA 2NT3A 3L49A 5D2CA 1JFTA 4G0XA 1E2BA 5EWMB 2GBPA 4N47A 3O2QB 4NCAA 4UHKA 2ID7A 3OO0A 2FEKA 3Q7SA 4W5RA 4MR9A 3C6QA 1YTUA 2R4QA 1DG9A 5FBHA 3LUAA 1QP4A 3TO5A 1KGSA 2A9QA 1NXVA 4WWHA 5IBQA 4IMIB 2FQYA 3KLNA 1PEAA 2MYTA 1QO0A 3KTOA 5IUKC 4RSMA 1DC8A 3EJWA 3H1EA 3KCNA 2RGYA 4MS1A 1MAVA 1JBEA 9ABPA 1EWVA 1TM2A 3MMNA 2B1JA 3UK0A 1DBPA 2QW1A 1DCKA 2N9UA 4LRQA 4RK7A 1JYEA 5CNMA 1KMIY 3D8UA 3TMYA 5DGCA 3OO1A 2QVCA 1J56A 4RS3A 4G97A 1OXKB 5IC5A 3S99A 5KQGA 2AYZA 1JLKA 3LUFA 4KMRA 4F8JA 4W5NA 1LJLA 4ML3A 4G0MA 3T6KA 4RV5A 3UKJA 4RXTA 5ED4A 3CLKA 3CS3A 3OQOA 2F8TA 2OENG 3Q41A 2TMYA 4RY0A 4IMJB 3UUGA 4D6XA 3OQNA 5KC9A 3H5VA 3LFTA 3FFWA 4KNYA 2E4WA 2GI4A 3JPYA 3OLXA 3SQNA 1TLFA 1ZDMA 4Z4HA 1QQAA 3LTEA 4WT7A 4MQFA 2FVYA 4OTZA 1EFAA 3O75A 2PUCA 2O20A 1QP7A 4Z4FA 2QSJA 4QICA 2HQOA 4KRFA 5GQSA 3EAFA 1NXOA 1DJMA 1GCAA 5JS2A 4FB4A 3OMWA 1SRRA 3KYJB 4QYMA 4RU1A 5BR1A 1NXSA 1ISRA 2R47A 1TJYA 5CNJA 3KG2A 4TMYA 1A2OA 4KQ9A 5FWXB 1HEYA 1DC7A 1GCGA 4N03A 4PZ0A 4L4UA 2FN9A 3BREA 3OMXA 4GNRA 4MS4B 4MPTA 1M2FA 1YMUA 2FMHA 3N0WA 5CHYA 5EWMA 3GV0A 3E61A 1E6LA 4RKRA 5TPZA 3RVMA 2ZWMA 5KQLA 1LBHA 3NBMA 3QEMB 3T38A 5BQ3A 3SY8A 3E3MA 3BRQA 4IF4A 2B4AA 3EQ2A 2CWDA 1JF8A 4KV7A 3RVLA 2FLWA 3QX8A 1ZAYA 3KHTA 5EWLB 4EVRA 1QP0A 2FLKA 3L6UA 2IYNA 4RKQA 1P8AA 4Z4CA 3HZHA 3HV2A 2R48A 3KKEA 4M88A 2PE5A 1TMYA 2JVJA 4WUTA 4Y9TA 4FE7A 1T34A 4TLMB 4NV3A 2F8SA 1R8JA 3FGZA 1C0EA 4KFCA 4LX8A 2RDMA 3QK7A 3A0UA 4EVQA 4YS6A 3SAJA 4F3TA 1ZY2A 2W42A 3H5LA 2BGGA 1ZH2A 2L18A 2NUBA 4B09A 2HJ9A 1D1QA 2FEWB 3RVNA 3Q7TA 3O1JC 1ZITA 4G86A 2X7XA 3G85A 4YRZA 1W25A 1DCFA 1D4ZA 1USIA 4D74A 3HXMA 2PUAA 1MVOA 5HQJA 4YO7A 3CG0A 2A9RA 4KZKA 5T7BA 1UDRA 2JBAA 3OQMA 3IDOA 1D2AA 4JOQA 2WRZA 3O21A 1NATA 2ZAYA 4XFKA 5BRJA 3CFYA 2PUGA 1Z13A 3KJXA 4H3HB 3LUGA 5IUJC 3DBIA 2MSKA 3BILA 1KRXA 1JDNA 1YS6A 1YVUA 2VUIB 4KVFA 4RK0A 1PUXA 4EYQA 5IX8A 4QYWA 2PUBA 4N76A 3LMKA 1NXTA 3M6MD 4NQRA 3H5TA 2FQXA 4LDZA 1PNRA 3N8IA 1Z2DA 4Z99A 2QZJA 2L17A 3LKBA 1K66A 1ZGZA 5FWXA 3Q7RA 4YWHA 3KS9A 1I3CA 4P1ZA 2WB4A 1QQBA 3N75A 4MS4A 4XAQA 2MYPA 2MYNA 1ABEA 1U2PA 2PMCA 5IEJA 1U8TA 1Z17A 4MRMA 4JASB 2IPNA 3I42A 6CHYA 2Q5CA 1JYFA 3QEMA 4XXHA 3RVPA 1BDJA 3OM1A 1QKKA 4W5TA 4S05A 1YK0A 3HJFA 1ZGGA 1RXIA 2IDMA 3JPWA 2FEPA 3K9CA 1QMPA 5JNVA 3EDCA 4EYGA 4JAVC 2LP4Y 1VLZA 3GYBA 1WETA 4ZMRA 3MQ4A 2PUEA 3LKVA 4NICA 1BAPA 4L85A 2PLNA 2PKXA 3KYIB 2FQWA 2GX6A 5KI6A 3URMA 3Q15C 1RPJA 2QU7A 3RVQA 1MIHA 3CG4A 3GT7A
chains in the Genus database with same CATH superfamily
4MR8B 2Z9BA 3KR1A 5K09A 3AGPA 4V3BA 2QRZA 4C05A 4B9EA 2H18A 2EGHA 2GRUA 4ARAA 4KN9S 1H8HA 3B38A 5DE3A 4R2KA 4KHZA 5CBKA 2L2QA 3L1JA 2JCBA 2GEDA 2Y6UA 3L7MA 2BJWA 1MU0A 3ZE9A 2O2HA 4C6TA 3ZCUA 3AKYA 3MJHA 4ZC1A 3EQ9A 2LDBA 4PBRA 4DQVA 5C1DA 3SE7A 5COBA 3BWXA 2PGJA 4KRXA 4L8VA 2R8RA 2DFTA 3TFWA 3KQMA 1FMTA 4IR7A 2ET6A 3HNRA 1LK0A 1DUSA 3EGCA 3H8VA 4UNSA 2MINA 3GGGA 3G79A 3L7OA 2Y9PB 3TM5A 1WB4A 2FB9A 2K2WA 2Q5HA 5DYIA 1RNLA 5CCEA 4FYWA 3NAMA 1F12A 2HYDA 4GX2A 4YP9A 3WLAA 4YBRA 2BYTA 1JSLA 2YV4A 2LNDA 3BH0A 5KYWB 4MCAA 3ZYZA 2A88A 3OLVA 1U2RA 4WNCA 4O1IA 3F46A 4EHFA 1Y4UA 4KXUA 1QCZA 5BUZA 1H93A 1NUAA 3QWAA 1U28C 2H08A 4R2MA 2ZSEA 4DY6A 5EN4A 1BXRA 3WB2A 1SPBS 3H86A 1U2GC 3GAAA 3NC4A 4HAZA 4EHAA 2XTAA 3V1UA 3NGXA 2YY6A 3H2YA 4GECA 1YR3A 1XLVA 3I9KA 3PHIA 4KQIA 4L15A 4WOKA 5H0IA 5K8LA 3DFIA 4IH9A 5C53B 3V8MA 1YU6A 1ZONA 3WHKA 1L1FA 1AF7A 3OU6A 4B46A 4UU0A 1JIIA 4WFIA 3FY4A 1XQVA 4YP6A 1HZJA 4D6YA 1CRLA 2XWSA 3N5CA 5JJCA 3NO4A 3N70A 1ZUHA 1QWOA 2EX1A 2IHZA 3T9EA 3EVDA 3D1JA 5KNCD 1ZLXA 3DB2A 2IJGX 2TECE 1X77A 4FZRA 4A10A 4GPIB 2Y0EA 2LD4A 4IQ4A 2X5XA 4S1WA 4C4ZA 1DEXA 1VKHA 1UKBA 2IFTA 2XDWA 3DOUA 3KZNA 1TUEA 4KO3S 3RRZA 5DSXA 1MR3F 1QGZA 4XPZA 3D7RA 1Z6AA 2RAFA 4OQ4A 3H9EO 4WXEA 5DWQA 4C7VA 4KQGA 4J0FA 3T4PA 1DEHA 2FNAA 1OSNA 2H0AA 2HLDA 3EH1A 4EEZA 5BSRA 1RI5A 3ILYA 3E4CA 4UUOA 2Q6OA 4B6FA 4QVGA 3QI2A 4RVHA 3C3DA 5JO0A 5T3UA 3G0IA 3EXHC 4AQYB 2YYZA 2VHQA 4UHJA 3N28A 2WR8A 5KKNB 3TX2A 3HB5X 4FCCA 5JXGA 3ZV6A 1GSAA 2D59A 2R6JA 3B52X 3DGEC 4M3NA 3DFKA 4WLFA 5B30A 1OZGA 3FTDA 2VDWB 2LBPA 1SPXA 3I5XA 2GEBA 2PWPA 4KJZA 4MO9A 4Y2JA 4ZO9A 6GPBA 3L8CA 3O5AA 5JI2E 4IDPA 1F2DA 1O58A 4EX6A 1XIVA 5HWSA 1ZC3A 3NUQA 3KLOA 5TRTA 1U7DA 1Z5WA 1ZHHA 4HGZA 3F7OA 1C4WA 3FWHA 1MB0A 4TQGA 2WTNA 3OM9A 3FPAA 4QKQA 1U0TA 3HMKA 5HFNA 1ONNA 2ZCVA 1Y9EA 2AQKA 4OXRA 5A62A 4EGCB 1OFGA 1UPAA 3KSUA 5SY4A 1ZGBA 2GVZC 2ZBGA 3FJYA 3UOGA 1AB6A 4AD8A 3FN4A 2VQFB 2QD2A 4S0XA 1CJSA 1UC9A 2YICA 2NVBA 1F38A 1F9AA 1JZTA 1OROA 3PXDA 4NBVA 4XEUA 1CY2A 1U8CB 4PIVA 1E2NA 3CHYA 1QB7A 2NSLA 4IZ6A 5BOSA 3DL4A 1QFXA 2EOAA 2M98A 2WTMA 3O1IC 4ZCRA 1HPLA 4BLPA 4DV1B 3AM1A 1RQLA 4OYRA 4JLOA 3WFZA 4NNOA 2G6BA 3MFQA 2JB9A 3PITA 4B47A 1A9YA 1RHQA 2C9ZA 3P97A 4ED9A 5IT5A 1T9DA 2XA1A 1E8NA 1E32A 2P9ZA 2VTDA 1GL7A 1KR2A 4QLOA 1MJ5A 1RWNA 1U7WA 4M37A 4YASA 1O96B 3GFFA 3U4DA 5I9LA 4OHFA 5JUWA 1JFFB 5LZ9A 1YDFA 3QBJA 4RC9A 4KG7A 4O0MA 3NPAA 4UZSA 1YMVA 2GLUA 4MJXA 4AF8A 3GPCA 1Z7EA 3V4SA 1LVHA 1DDIA 1A77A 4QVKA 1OH7A 4MYSA 1OFUA 4MUNA 1SUCA 4Q9JA 4YV7A 2PCJA 3HLKA 3UWPA 4FYPA 3AV0B 5K3DA 4LNHA 1QF7A 1XVAA 3B1KA 4YAWA 4PCVA 4LOAA 5IARA 4RQBA 1J0XO 1E9DA 1FMFA 1X1CA 3WMRA 5L3SA 3U81A 4ZZ2A 4HB3A 4JLWA 3VGPA 1VMDA 5CFLA 1J99A 1T25A 4CMIB 5IJZA 1ZVJA 2RH4A 1C7FA 3R4VA 1EGHA 4LTDA 2I2FA 2YZGA 4RADA 4F1WA 1E0JA 5AESA 4F04A 1GZ4A 3I34X 1JFVA 4WDQA 2PWAA 5AIAA 5J40A 3EUEA 3K72B 3LUHA 1K88A 4HDQB 1CUIA 2FN7A 2RBGA 4H3KB 1U2QA 4QQRA 2H65A 1DQPA 4IX9A 4BLVA 4DN6A 2GPNA 3ST7A 1EFKA 5LP6F 1P1RA 3KLMX 1IM5A 3O2JA 3LG2A 4TYPA 2XE8A 3UB4A 3E2PA 3GJXC 3IOEA 3GZJA 3K0CC 2RCYA 2BKEA 4IRUB 1N7GA 2D1TA 4P98A 1JR3D 4PICA 5DDIP 2JD2A 5DP1A 3D43A 1J07A 1HT3A 2YXDA 1E1RA 1UR5A 2RMKA 1HQDA 2D00A 4ISBA 5KOHA 2J3HA 4HX5A 3I30X 2B6NA 1NW7A 1SOAA 4OY3A 4Q18A 4O2AA 1E18A 2EWVA 2PX4A 4QOEA 3TLAA 4AXXA 3W6OA 4A8PA 3DT9A 1GLGA 3CMMA 1KAGA 1ZEMA 3TD9A 2WVJA 1NVEA 1Y6GA 3RQIA 2HMYB 1D9XA 1PHPA 2FEXA 2G6TA 1XHFA 3JVIA 1TD1A 3TKAA 3I9NA 4IV8A 1EFVB 4B4OA 4MDEA 4NE9A 3HCDA 2PMDA 4CF5A 4CMKA 5KWVA 2QD4A 4A82A 2VO1A 4ZTUB 2VYVA 1DAKA 3LOPA 4POOA 5HZGA 2D5CA 1AHHA 5BSEA 1XDDA 2FG5A 4DE5A 3FW1A 2HCRA 1RXUA 4G1CA 1Q7CA 1CRZA 2FFHA 4BEBA 1ZD2P 3ZE0B 2HSEA 4L8GA 1TU3A 1V2HE 1ZWKA 4P81A 3R8XA 1BU8A 5CU7A 5FOUA 2Z5FA 4BRSA 2Z8ZA 1VKRA 4M8NE 1JHRA 1UFOA 4RMNA 3LBAA 4HDRB 4U3JA 1FFCA 5BV1A 1HTTA 4XLZA 2YYYA 1NDHA 2HDNB 1O5TA 3H5OA 4MUFA 3JY6A 4ZAWA 1E60A 1V0JA 1W88B 1QR6A 4DQ0A 1E4EB 2WWRA 4CLOB 4FIZA 1ODLA 5E95A 2EGGA 4JI2B 4ITRC 2ZSUA 4G0XA 1T5OA 2GN0A 1NZDA 3DE7X 3FZQA 3L1HA 4QBHA 4XWAA 5C7LO 3NMUF 3E9ZA 2OD2A 4AJ9A 1ZVMA 4ESHA 1Q0TA 2FF7A 2G82A 3BULA 3KAKA 2QENA 3LXMA 4GE0A 4GX1A 3UMSA 3WIBA 1QLJA 4KO2S 4KE6A 5FPYA 2J6CA 4A0SA 1C81A 2JHPA 3SICE 3F9IA 3G0CA 3R8CA 1L4MA 3IB6A 2MU1A 3UHPA 4NCHA 2WE7A 2Y4OA 4K26A 4GZLA 4KPUB 2ECPA 3CLRD 4CTMA 2J3JA 2E89A 4BNZA 4UPEA 1RRMA 3AEKA 4EF5A 4PPYA 4MPRA 2F8LA 3W8DA 4D4JA 3K1ZA 2Y3IA 3W6NA 3VX3A 3JYLA 1GLNA 1ZC4A 2OBFA 3HBLA 1RABA 2YJNA 2GYVA 4FFVA 3GN2A 3AL2A 4KAAA 5EIBC 9ABPA 4JJIA 3C6MA 3X1MA 5KYXB 2DETA 3K0EA 2ENUA 4P82A 4P4SB 4RVFA 3UA3A 1EFTA 2MSCB 3TMYA 1WCXA 2WILA 3M5DA 5CT6A 1WBJB 2Z98A 5BRNA 2QP4A 2Q4OA 4R3NA 4Q9DA 4NTZA 2GCEA 4RETA 2CHUA 2CXPA 1E1LA 3H3JA 4RIHA 3RQSA 3SKVA 4E5NA 5KQGA 4WECA 3AKEA 3O82A 5B12A 4AROA 2XRFA 4M1ZA 2HXSA 4JGBA 5MFZA 3WX0A 2X6RA 4FW9A 2ODWA 5GZ1A 2G72A 3DCYA 4I9FA 1GCOA 2JK0A 1W5TA 4X7BA 4N5HX 1VJGA 3H5VA 3U3DA 1PEKE 5FOVA 3VFDA 4UEKA 3WC4A 3MC1A 5A04A 3OLXA 4QEZA 3R3YA 2P2NA 3LCJA 4IQFA 5JMPA 5L51A 3HN6A 1IMJA 1OBHA 2IYQA 2W2NA 3D2AA 3RYIA 2D0PB 2G1UA 3BXPA 4D8WA 3ZLBA 1QK4A 2WP0A 3AF2A 3JD1A 1EEHA 1OI4A 4YUVA 2O59A 4RD3A 3W8RA 5BQXA 1I7NA 1RRFA 3T0GA 3N86A 2HQOA 2B8NA 1KJ9A 2ACKA 1NOIA 4CG1A 5KMGB 1JJFA 2D3TA 2EVWX 3ER9A 1LBQA 1R0KA 1NXSA 3IO3A 4AZ0A 2JGKA 1KFKB 1UOEA 2XUDA 1G20B 1TU0A 4R8SA 4OHYA 3OETA 1M8JA 4IAOA 3R23A 2RGNC 4EENA 5DHAA 1LCIA 3EZGA 3JWGA 1QZ3A 4L4UA 4O59O 3VNSA 4M0LA 2CBZA 4GD3Q 3UJHA 5IVPA 1NYQA 1U0HC 2AC4A 1GPLA 4AAYA 3OIDA 1FNSA 4LOIA 4FDAA 3NBZC 3C7CB 2DULA 1QH1A 2WJPA 1SOUA 2ZWMA 3K1JA 5B3KA 3K53A 3FTQA 3NBMA 4EA7A 3AY3A 3WJ1A 3HEAA 3MB5A 1MBZA 2B8EA 3LLMA 3GLUA 5CX1A 3FYUB 4RA9B 2EYUA 2PH5A 1RHKA 2XITA 3GRPA 3UM9A 4CCYB 2ZANA 1ULTA 5CVDA 1O77A 4Z3KA 1KSFX 3EQ2A 3M1YA 4LTMA 1QMGA 4GRIA 5EHGA 4NYIQ 2JJ2A 2XCLA 3ZWWA 4UASA 3PC8A 3GCDA 4CMJA 5KJCA 1CY0A 3KYDA 2RB4A 1M9NA 2V5AA 2R9VA 3WIVA 1FDRA 5A3JA 2JLSA 5GWXA 4A15A 2NYRA 1PG0A 2AA3A 3T3HA 1Y7TA 3HV0A 4YQFA 5JJ5A 1LKZA 3CEPB 2I62A 3O7WA 3T94A 3UFBA 5ESDA 4D56A 3RIEA 1AHPA 3MGCA 1BQ3A 4HDSA 5LN1A 2F8SA 2O54A 1NZFA 1HV8A 1L7XA 2FSSA 1C3EA 1JU9A 2QTRA 1G5QA 2YZ2A 3OJEA 3MELA 4CG3A 4HNUA 2XBMA 2JH3A 5EJIA 2OD7A 5EIOA 2B34A 3HY4A 1R5BA 2EKLA 1RIIA 4YDHB 3SIWA 4C29A 2VA9A 4XUEA 5CXSA 3IVGA 2OBLA 3W5JA 1X14A 4MMZB 1DJOA 2ZDHA 1Z7BA 3F5DA 3NVAA 1C30B 3Q7TA 4JEMA 2IU0A 3K0AA 2ZRIA 4YK7A 1RQGA 4F45A 2E5LB 1EB9A 4L3WA 3DWIA 4OBEA 2P7IA 3NR2A 3C70A 3C3EA 1EJBA 3KU4A 3SIXA 3AUSA 4PVDA 1AUQA 3EZ2A 3TTUA 5IH3A 4AZWA 1R6VA 3SFVA 2XCIA 1KXJA 1D2AA 1OR8A 1ONPA 4E08A 1GXSA 2H63A 1X80B 3QKUA 3S5JA 4MI9A 3C6BA 4AB1A 4XFKA 1UJNA 1XD8A 2XCQA 1JYSA 3IQZA 1J33A 4LXYA 2H48A 1SBHA 4TMVA 1A4IA 3LUGA 1LC0A 5JCPA 4M1WA 1AS0A 1XNHA 4DKXA 3AEUA 4FFPA 3A1DA 4L02A 4DMGA 4N76A 2EFYA 5EEGA 1NI3A 2P91A 5FI3A 2RGEA 4TSFA 1DRVA 3H5TA 2EX0A 4TUYA 3P2YA 4PBTA 1PK8A 3ZJ4A 5AICA 3ORQA 3RSQA 4Z99A 3UPTA 4JJ7A 5DIZA 4HP8A 2QZJA 2FCAA 1CUYA 1QYCA 2BM8A 3I8OA 3IUNA 3TQQA 1YBAA 3DO5A 4PF1A 1M6WA 3UK2A 2WPDA 3H5AA 4H7JA 1U2EA 4XAQA 1JKIA 1ZA1A 4BNGA 1WVGA 3RIYA 1YJ8A 3QYPA 4F21A 3NAQA 2CNDA 1T0PA 3HKBB 3I42A 2VDUE 1EVZA 3CGGA 3KKLA 4U2GA 4XUGB 2Q5CA 3EN0A 2QP9X 1EVYA 1C1YA 2NSYA 3BE6A 2R11A 3OE5A 3QW2A 2DFKB 4YDRA 3ZLTA 6NULA 3PA6A 1PL7A 2IDMA 1V3QE 4IIUA 4OSEA 2QTFA 4KXXA 2PSEA 2PSJA 1P3Y1 1C4OA 2ETVA 1Q7RA 2BE9A 3ZU3A 5IJWA 4FONA 1YB5A 4IKEA 3GFGA 3I0MA 1X7WB 3J7AC 4IMRA 3DOHA 1QH9A 1O97C 2O4UX 2OL4A 2Q6KA 1EXVA 1C8LA 4RTSA 3B7WA 3A1TA 1H8ED 4FYIA 4F7DA 2CMFA 3VR5H 4TKVA 3TTVA 3Q3GE 1JU3A 4JUBA 5I3ZA 1DEOA 1ZNZA 3GRUA 3L18A 1AV6A 3INNA 4FC7A 2JLUA 3QUCA 2ECKA 1JHQA 1MOQA 3HJCA 3T35A 4EZBA 1B0PA 1ZX1A 2E6KA 5EJMA 2VPWA 3RG2A 2QA5A 5EFZA 2CT8A 3M33A 3BIFA 1Q3KA 4C2UA 3A28A 3RSFA 2MYUA 3G2IA 1Z6PA 3KPUA 5FD8A 2WJYA 3JSAA 3RVOA 4PLZA 4DWJA 1TD9A 3CE6A 2WJVA 4KR3A 4KPYA 2XGSA 3IIIA 1KORA 2X3UA 3IP6A 5H4GA 4I4IA 3WSWA 2YFHA 3OIYA 3T7KA 4GI2A 4EGJA 5I5EA 3ELBA 3K4QA 2LCFA 4IVQA 4IGKA 5T8KA 4H7EA 1UJCA 3P45A 4BCBA 3UT6A 4XVQA 2X9NA 3KOOA 2A9OA 1ADBA 1PJLA 1V39A 1VJCA 2ZS7A 3CLRC 2A3NA 4MUMA 4RIEA 3ENNA 3DXXA 5DHSA 5IAEA 1GM5A 2PQMA 3FX2A 3DL0A 4NZZA 1ZN2A 5FI5A 2QX9A 3LP8A 5FWNA 2HA6A 1RQRA 2GNOA 2ZJAA 1Z68A 3H5NA 5FTJA 3S28A 3EMDA 1K06A 5KEIA 2GPWA 3T61A 4DV4B 1I2DA 1RE0A 3B3FA 4DMFA 2E4VA 2IBTA 4H0CA 2QXYA 2P9GA 2RAUA 3ED1A 3REQA 1XJCA 2PGOA 3ETEA 2F43A 5KKAA 3AIOA 2ZR9A 4KIJA 1JA0A 3VSBA 2B4RO 4JYMA 1NOKA 2Y2VA 4BP1A 2BMAA 4UXJA 1M2GA 3WB1A 4AJPA 3WV5A 5JZ9A 3PHHA 4G84A 3ZNQA 1QVVA 3R7FA 2H59A 2ILVA 2HPHA 1C8VB 2ZR7A 4QXPA 5FUXA 1SIOA 4KLAA 4C6RA 5TLSA 1XFAA 3BXFA 2HGZA 3N0VA 3MOSA 4ZQFA 5HK9A 1IE3A 3IMGA 3JU3A 5IPFA 2HIAA 3F8WA 1UDCA 3O2SB 2RK4A 2AG0A 2XNJA 5CEEA 2G36A 5I7EA 1GZSA 4GI3A 1DRKA 1NOJA 1AKEA 2HDWA 2X15A 2C78A 2X9VA 2VXCA 4C7MA 4BO0A 2A0UA 1JU4A 4BUCA 5CFZA 1ECJA 1S9HA 4W6ZA 5GPBA 5EVJA 1MO3A 4PONA 1U90A 5D8DA 1AZLA 3A6HA 1RMQA 2AVDA 1NX6A 2EKDA 1BKSB 3KSAC 2JFXA 1LS6A 3CBQA 3R1IA 1SUEA 1EQUA 2P62A 4EA6A 1V7PC 3L6DA 2PG3A 1K08A 2DZDA 5JD6A 1HEUA 4LZNA 3SXPA 5D3QA 1QSGA 3ETGA 2G0AA 3Q5DA 4JCOA 2E9SA 4NHOA 4XVUA 4K9NA 4AYWA 4X1KB 4F96A 1UM9B 3G9ZA 1JHMA 4Y6LA 5EAIA 3VC7A 3WK7A 3F73A 5J5CA 1BE1A 4CF6A 5IJXA 2JH8A 1W87A 2QM3A 3REFA 1K8RA 1Z15A 2VNSA 4ENUA 1RYYA 3DAHA 1CJKC 3N0RA 2VTKA 4DCCA 2VHWA 1JJBA 4PRKA 1UXOA 4IUYA 1ZN7A 3LK6A 3CR7A 1BE8A 5L8VA 1CDZA 1V5GA 1ADFA 3PEWA 1IZ7A 1EGVB 2PXHA 1SUAA 3L82B 4DLPA 1H9BA 1K7SN 4DNOA 3BXEA 1X1DA 2NQTA 3AXTA 5AUNB 2G04A 2YINC 4N7RA 4IFBA 4RACA 2AMLA 5JZBA 2YASA 4OLJA 1Z26A 4PSDA 4J3FA 1C50A 4FMDF 2VA8A 4IO0A 2Y2UA 5D3MA 1A1VA 2P6PA 2RI6A 3EIUA 4LE2A 5EERA 3R3XA 1A8UA 1E99A 2GA8A 3G59A 1WD7A 1K6MA 2ZTSA 3MVEA 3ONEA 4UDXX 4X0EA 1HC7A 2E4AA 2P67A 4I4TA 4DGQA 2Y71A 4RTQA 1LLQA 4QATA 3WR5A 5TPWB 1TVCA 3JQ9C 3LHDA 3U0VA 1SZDA 1K75A 3BTSA 4R0VA 3V4ZA 1L5GB 2QAJA 4M60A 1PX2A 3PYXA 3UWMA 4WK0B 5CVVA 3RAFC 1Z33A 4Y1GA 3IAUA 1QB8A 3G9XA 3LSYA 2CJYA 2YDXA 5F2KA 4Y18A 5CM9C 4LFCB 4CLHA 5CLQA 3QYJA 3DC7A 1WHSB 2WUFA 5E7MA 3M6LA 3L0IB 2GTPA 2EFHB 4L3VA 4YMUA 2NT4A 2ZCJA 5J1SB 4F1KA 2I67A 4TVSA 4DLWA 3T9CA 3T4UA 4GXNA 1II8A 1FP7A 1KI7A 2OZPA 2DFPA 3ROXA 2W6PA 1P4AA 1QX3A 2D0OB 4TTAA 2IEZA 1P7CA 4EYKA 1UXKA 4V0KA 4XSHA 3K5WA 4I55A 1E5TA 2FN3A 3GLRA 3P5BA 1Y3AA 1YDGA 1W94A 3M0EA 1F4LA 1ZMXA 2AI1A 4Q4JB 1OYOA 2DOKA 3UMCA 2R7LA 5AM2A 2XVZA 1XLUA 5LZ7A 1XZ8A 4MXDA 4GMKA 1RQXA 3JSXA 4HPXB 3T52A 1UODA 4YXWA 3Q8XB 1EX7A 3W7VA 4DYVA 1EUDA 2D7CA 5K7SA 2C42A 2WF7A 1I33A 3LDGA 3DBLB 3OOSA 1ZNXA 4Q6BA 2D4HA 4X3CA 5A3VA 2JIDA 5CFMA 1ID1A 3UMVA 1H2RS 1OILA 1SC4A 4TROA 5AP9A 2FK7A 3WQHA 4B6RA 1AG9A 4D2IA 3JAMA 1ZQ1A 4D3SA 1VE1A 1W2GA 1NUSA 2ZDGA 3CO0S 3AHFA 4EPWA 2J32A 2JFBA 3VO8A 4CIYA 2IYLD 1CUZA 3ISTA 4TN1A 1HLPA 2FA9A 4INAA 4PFKA 5DTJA 2W6ZA 1YZHA 5FA8A 3U31A 3I9MA 3UJAA 2J0UA 2XWJI 1MO5A 3PC7A 4MUBA 3CEHA 1DRJA 4NKRA 1I0LA 3R7NA 3TQCA 4EZIA 1X15A 2YMMA 5LUAA 4D4GA 2G88A 4BX8A 2M6RA 1LDGA 1YB6A 3GQBB 2RH8A 2SHKA 5G4KA 3RSLA 1T35A 2GBIA 4B73A 3PNVA 4K05A 4PLTA 2ZM5A 3D5EA 2DG2A 3CM0A 1LPSA 3L07A 2AOTB 4LAFA 4X90A 5ANRB 4EBFA 1DS6A 3KQYA 3UFXA 1HKHA 1YAJA 4X8MA 4LHYA 3ZS8A 1L7OA 3DHNA 3QHQA 2CXXA 4EZEA 3DP7A 3DQPA 5ITWA 4EB6A 5TS3A 5HYVA 3PLRA 3A26A 1MHPA 3AR3A 3GGJA 4GZ3A 1BRTA 1G8SA 2VYQA 4FLMA 3M6AA 4OGGA 1K27A 3VOSA 4PWYA 1JEYA 3P4XA 5KVSA 1Y8RA 3ZLJA 1WSDA 2IZ5A 3MRSA 2GBCA 3QOFA 3ZD7A 3WGUA 3OI7A 1RXCA 1IJKA 1DUVG 1EHYA 2NV0A 7AT1A 3LHKA 1NZJA 1ZMOA 3LU1A 4Z9AA 4X20B 2P2GA 3LPCA 4DL9A 4IIBA 2B0CA 2IHUA 3L5OA 3RB8A 3GUCA 1W8IA 2WMYA 2YWJA 3JS5A 4HWSA 4DPLA 3E5NA 4HXEB 5J58A 1YB4A 1AGXA 3TTYA 3CY6A 2H92A 1JDPA 3PV0A 2NZVG 2QORA 1RC1A 1I1HA 4LXGA 1MF7A 3CEMA 4EHKA 2QZ4A 4FTWA 4X41A 2PL9A 4XQGA 1CVIA 2R8YA 3HBFA 3KFVA 4OUKX 3RT7A 3RSZA 1G66A 3FFTA 3PWSA 3H18A 3GLGA 3TGLA 2XRMA 4REOA 4A0QA 3IEUA 1G8MA 4DBLC 3CSDA 2DQSA 1NKVA 1GL3A 1ZUD1 2G9QA 3DF9A 3FVQA 2AKAB 3VA7A 3UMGA 4K9SA 5F35A 3NHJA 1S6YA 5AHOA 1KY3A 2Q3LA 4PX2A 2O8CB 2CKDA 5HBGA 1HZZA 1HYHA 1NUQA 2W22A 4CL0A 5GVSA 5GTDA 2ZBPA 3DR5A 4TL6A 3GH1A 3ENKA 1OC4A 1YI0A 4MI3A 2AIRA 2BEWA 4RM2A 1GNSA 4X84A 4HUTA 4Q47A 2GF2A 1AZWA 4PXYA 1PWYE 5H59A 4OKSA 2V7QA 3R5SA 4RVCA 4CTOA 2AJLI 4N6OA 1ZMRA 3TO5A 1VZ3A 4QRIA 1AY0A 2TS1A 3RSHA 4BPRA 2J87A 1NXVA 4HAWA 4U6SA 3DDHA 4JP3A 3EEBA 3HU2A 1IB6A 1OFHA 1DMRA 3ONFA 4HWGA 5H81A 3L8EA 5HNKA 2E85A 3N6XA 4RDIA 5HOEA 4BN4A 1U9IC 1R27A 4J2HA 2Q29A 3MMNA 1GAEO 1EDEA 4NMWA 1DBPA 1BYIA 4QVIA 4RK7A 2YW2A 1X7YA 1RYEA 4DCTA 3MWJA 1FTQA 2C2OA 3L0PA 2EQAA 4GPBA 2PS1A 1J56A 5AHKA 1EFRA 1TA4A 3H0CA 4X6YA 1ZH0A 4UE6A 3FUWA 2W6JD 1CV2A 4XA8A 5FXMA 4LVUA 4D9EA 3TLGA 5IJAA 2GEFA 1OXMA 4C0QC 1TZJA 3EOAI 3V97A 4HGQA 2DMRA 2F1IA 5EYPB 2G17A 2XE4A 2EJVA 2X4LA 4Q4AB 1OWPA 3D6AA 4W9NC 3OQNA 1OWOA 3S2GA 4KNYA 2OLEA 3PRJA 1W30A 2C7QA 1OH8A 4LGYA 3ANNA 3K5PA 4R16A 2PRIA 3LWBA 1N9ZA 4NMLA 5JFGA 4HF7A 4RD1A 3RTDA 4OFXA 4DIBA 3V3TA 4BVFA 5IK2D 1F2TA 2IH4A 2B61A 3PUZA 3RS0A 1IBMB 4X66B 1WQ4A 5IMSA 4KRFA 5G0TA 2XEDA 5GQSA 1UEXC 2AF4C 3CC8A 3EG9A 4ZOLA 1L4KA 3PT5A 3WBBA 3RC9A 5HTOA 2VUTA 5TMDA 1P1KA 2QOEA 2R47A 2V6FA 2ZJFA 2HMWA 4DCNA 3JALB 2DQ4A 1HEYA 4EBBA 1PWHA 5LC1A 5HW0A 4ZVUA 2ZE6A 4LOKA 2V6BA 3GV0A 2P1DA 3CJQA 1TZCA 1UIMA 3LS2A 4TS9A 5GM1A 4YNBA 1QRSA 2ST1A 1Z5ZA 5KQLA 1LBHA 1XZMA 5BN4B 2YFYA 3D1VA 1N5OX 2QYHA 5B2FA 5HHTA 1CUSA 3V7YA 1PR6A 1D7OA 5FOTA 3U44A 3GFPA 4Q39A 4EX7A 2A33A 3IJPA 3X2FA 1Q21A 2FWJA 3BRQA 3UG7A 3SXJA 1KZYC 4EITA 1FSFA 4MGKR 4Q1BA 3G82C 5E2BA 4EL5A 1RJ9B 2K5UA 1I24A 3HWSA 4ZYZA 2ZI9A 3E9MA 4B3FX 4BO6A 5EE3A 4I14A 1TUGA 3L6UA 2WWTA 1KS9A 3NYWA 1C1HA 4KN5A 1W85A 1E2KA 3BEDA 5KHAA 1IXSB 4KXFB 1A9OA 3LIIA 5KUTA 4IXDA 1QRTA 3D7KA 1PDVA 1WU8A 5TB5A 3JAWA 1QHGA 3BXHA 4UATA 2HM7A 1HYGA 1XDGA 2QLNA 3OU7A 1PS0A 2XWPA 4K6FA 4GH5A 4QRDA 1GRRA 5EP1A 5K3SA 5TJ9A 1XI2A 4OM8A 2PR7A 3STHA 3D8RA 3VU3A 5J23A 2G63A 1WKCA 5DPMA 1N6RA 1T4CA 2B2NA 4RELA 3SP1A 4B35A 2QTZA 4YCMA 1P81A 1DAEA 2FEWB 3DH0A 4CQMD 3IPLA 5I6DA 2GPJA 3T3DA 3AF4A 4Z9FA 3HMQA 4UARA 3V7UA 3ZHSA 2VP5A 3WLMA 2PUAA 3COPA 5WRFA 2G8NA 1ZRMA 3ZVLA 1TJNA 4EP1A 1O89A 4L7QA 5JR3A 4QL3A 1AKQA 2C2BA 2WM2A 5LMCA 2VP0A 2WF9A 5A6VA 5B7NA 5L7TA 3LF1A 3KTAA 4PGMA 1E4OA 2FUG6 1EM6A 5J2TB 3WA6A 5E38A 2V8BA 4JBIA 3GO4A 1U7XA 3NHRA 3EC2A 4HQOA 1KFEB 4NABA 3UENA 3JZMA 4E6PA 4G4JA 4JA0A 2C2WA 13PKA 1HMYA 2EG5A 2H85A 1EE2A 2OVBA 2YFKA 4K03A 4PGAA 5F76A 3I76A 1PJ8A 1YVDA 3F8TA 4QEDA 1N1DA 5FWDA 5BURA 2B5WA 5BWLA 1O1YA 1DKNA 4QGHA 2WFLA 1THZA 1D1TA 5J2TF 1UDAA 1ZJ4A 3EWIA 2HJHA 3PPVA 4J7AA 4FPXA 4P34A 3X44A 5LBTA 2A67A 1Y48E 4BFCA 2WB4A 2C0CA 3H5RA 4CLXA 3C8MA 1PE0A 4CKCA 1ULHA 1TAHA 1AQIA 4Y98A 2WU8A 1HBJA 4RHYA 1QWSA 5ICCA 1M7HA 1ESNA 2QXTA 2OFFA 1JBQA 4E51A 2BSQA 4RSHA 4KDEA 3I01M 5DLYA 4MKRA 2FCRA 1J1UA 2Q28A 4DSNA 1LUAA 1WOYA 2PFGA 1GZ5A 2QRVA 4D7AA 4YROA 3MWKA 4UE2A 5JH7B 1KAMA 2FEPA 3O3NB 2V7TA 3OZIA 3PF8A 3WGIA 4UBKA 5G1NA 4XVHA 2BE7A 1WM1A 3UAGA 3KQOA 4RHUA 1AKMA 1VLZA 1V1JA 2Q3HA 3IE2A 3IOCA 3PI7A 4LNUB 1MVNA 2YJGA 3QTLA 1TK3A 4ZMRA 3JWHA 1QV7A 4K1XA 4MUXA 3VQTA 1T9HA 2JFHA 2PHZA 3OIFA 4HAVA 4IZOA 5KI6A 4WBNA 3AOEA 3U2QA 2ZB7A 3AERB 4G5OA 3O8QB 3CG4A 1JQ5A 3U9LA 3ZV4A 3TIXB 1XHLA 5DM2A 3H9GA 2YWRA 1LDBA 5EP4A 1JAXA 5JADA 2J09A 1W49A 2C20A 3GBSA 4Z51A 4R41A 1BS1A 2H4HA 4V0NA 4UU1A 3NBAA 2J0SA 2QYOA 4IRXA 4YR9A 1BH2A 1U0SY 3QUTA 4QYIB 1Z08A 1ZS9A 1QG0A 1Y1QA 1K3FA 2NZUG 3WLHA 2VZ8A 5SZIA 1M7BA 5JNLA 3NOVA 2Z2IA 1T36B 1JG3A 2JJMA 2VCHA 1QRRA 3BRCA 3JQGA 1PBNA 1X7GA 4II7A 3UJ8A 4IY1A 5I7WA 2ZRDA 2ZB2A 4M8IA 5I01A 5KVAA 3JARA 4QLAA 2P1ZA 1E1MA 2FRDA 2QE7D 3RUEA 5TVKA 4V38A 2V7XA 3G2JA 4N0MA 3UMYA 3OPMA 1YMQA 4BMSA 3TB6A 4PEVA 1KK2A 3CZRA 5EXXA 4JI1B 4QOIA 3MAAC 3ZQJA 3WKAA 2OV2A 2RJ3A 1XP5A 3RBXA 1ZCFA 1DEAA 4YMIA 2OM2A 1KIAA 3G9UA 3MBKA 3PNOA 4OHKA 2A8YA 3OC0A 2A14A 1C9JA 1HT2E 1QP8A 1Y7IA 2AN1A 3ESCA 2KHZA 2OCPA 1FS6A 3QVTA 4RTLA 1EUZA 4JIMA 1OF1A 3N8NA 3LBYA 3AOGA 3OEED 3QMWA 1XCMA 2IEGA 5E8RA 3VHXA 2VF5X 3K30A 3RK0A 5K0BA 1Z6GA 3QVGA 1KWKA 3WJ2A 1PWZA 1X1SA 2P2ZA 2ZJ8A 4L6CA 2ZJOA 1POXA 1LZKA 2CCGA 2PQ6A 4ZVVA 4KR6A 4F4JA 5IXSA 1FX0A 1C9KA 1WRBA 1ZG3A 3AM3A 4JMPA 2NOAA 3AFOA 4KBGA 1C7JA 4ARZB 2L19A 2UUOA 1JEQB 1TTPB 1NKSA 5DCUA 5ULLA 2VDMB 4FEEA 4MCJA 1XMQB 3RVRA 1A97A 1SURA 1ZSNA 2HSJA 2IGBA 1YO6A 3O93A 4FFDA 1DBWA 3NFRA 1G41A 2CFTA 2W2LD 2X14A 1SG9A 3A4LA 1LC3A 1W47A 3N2KA 1I9CA 2C5BA 3SF0A 4QOGA 4Y6GB 3QNMA 4FE4A 1P9NA 2VSFA 2XD4A 3VR5D 4X94A 2Y93A 5EKDA 4M83A 2IY9A 3MK31 3TJZA 3IUQA 3V9PA 2A9VA 3CRQA 3FHLA 5F5NA 4KLCA 1QGUA 1SBNE 4ND1A 1K0FA 2PGAA 1PT9A 1YE3A 4TS3A 5CHEA 1E7SA 1PHRA 2XMQA 4KWEA 5DHRA 4BAUA 3O92A 3E48A 1TUIA 4IJVA 2D2IA 1MGOA 3FTPA 4OSPA 4Z54A 3LY9A 2ZIAA 1QC5A 3K0BA 2I7CA 2CXRA 2QXUA 2RARA 3K1TA 4H9GA 4OIMA 5AKZA 5ALRA 4NCBA 4F8YA 2W2QA 2Z6QA 3ONNA 3L40A 4IG9A 2R65A 3AR6A 3N0XA 4JOCA 4M0KA 1H0RA 4CIWA 1Q7GA 6ADHA 5KDDA 5KQRA 1A9XB 1XFDA 1LGYA 1NTRA 1U2DA 2AZDA 4GX5A 5KSWB 2PBLA 4UTOA 1P74A 3ZU5A 3CRW1 1CT9A 1AA6A 1X3SA 3KV3O 2R4TA 2OZLA 1SXJA 1K4MA 4QO7A 1A5BB 3AZQA 3V34A 4F5YA 5A1JA 4LF5B 4PLVA 4U7TB 3ISJA 1ZI9A 3ZR4B 1I36A 4AJHA 1GILA 2KS6A 3RFUA 3ESXA 4MEBA 4K6MA 2I7XA 2AW5A 2QSYA 1OAAA 4RTPA 3NM4A 4NG4A 5B64A 1DIGA 2J9RA 1UOQA 4KPGA 2FPLA 3D0RA 5FAKA 1A4XA 3AF0A 2PYZA 1O08A 3T5AA 3Q6MA 5FUMA 4NF2A 1VE5A 3OZXA 1YQTA 1FDOA 4JA2A 4P84A 4DHEA 5LBUA 2D74A 1VFNA 4PQGA 4PAWA 1WMSA 1TZMA 4YBZA 1EK1A 1U3WA 2V7BA 4L78A 5CLGA 1UK6A 3VR3D 3R6DA 4G1FA 2ZAOA 5T4BA 2G1PA 1KYVA 2DUNA 2QJTA 4BBZA 1RI1A 1SVKA 2AC2A 4Q3KA 2KJQA 2EFGA 4MB6A 4W5JA 5G02A 3ECAA 5GM2A 4O4JA 4E14A 5LMZA 4KPEC 1E0AA 3QE9Y 2PXAA 3WL5A 1E9AA 4ETMA 1HM5A 4GOJA 4DXDA 4ZARA 1RM4A 3AJEA 4KSYA 2ZRFA 2YMQA 4YA6A 3SC2A 5E3HA 1P3JA 1QYIA 2CLMB 4HYEA 1HGXA 5IKPA 2FMKA 2FUNB 1P80A 1Y8ZA 1SU8A 4Y0NA 3TRIA 3USZA 2IH2A 1USUA 2J0VA 3GB9A 1EA7A 3PFHA 3EPRA 1FFDA 1C3OA 3GG9A 5KJ6A 3ICEA 1TFRA 3JZFA 1C9EA 4G0OA 3Q3HA 3UVEA 1U9JA 1OQAA 4Q3EA 3Q4GA 3FPHA 4NFLA 3MJCA 5AKEA 5ETJA 2HR1A 3CXUA 2X41A 2QT0A 5EMNA 1B41A 3IOBA 3TYXA 1VJ0A 4PBSA 2I4OA 2IYXA 1HI9A 1NLFA 1PU2A 3U3ZA 4JI4B 1GPNA 1KEEA 2AS0A 1CW2B 1TAQA 1UFKA 1Q92A 5JJBA 2J3DA 2VP6A 2WNSA 1WVIA 3PL1A 4HYQA 4RY9A 3WDMA 3RVBA 1ILEA 4RMIA 2D0DA 2VP2A 1ZBDA 5B7QA 4GXQA 4M0PA 3ZBQA 3W3AA 5HRCA 1EPUA 2WLTA 3G2PA 2AJ8A 3KVOA 4CDGA 3ZWQA 2WY2D 2TMKA 3RD5A 3BGSA 3OTGA 1K6IA 3PXBA 3UB2A 4PYMA 1D6JA 1L4YA 4A23A 4A1FA 4LYGA 4OUDA 5JALA 2Q46A 4BXOB 3R5FA 3SWWA 3UJ9A 3WBKA 1SCUA 3LBHA 4BX9A 3VKHA 1XT6A 2RJNA 1DQSA 1SK8A 3WMEA 5BQFA 3MLEA 1DAHA 1L5NA 3GEEA 4QFBA 3C7KA 1RWPA 2EIHA 2V4MA 2HHLA 4KX5A 2EAUA 3LQRA 4QDOA 5CNKA 1PG5A 1R88A 2B30A 5J59A 4KIGA 5C34B 4L8YA 1Z4JA 2IP4A 4MVCA 4MICA 2XT6A 4YFVA 5DK6A 3EBLA 4P86A 4WZBA 2WFAA 721PA 2A1TR 3FNEA 2AGVA 3DWFA 4N65A 1KEZA 2HQSA 5FLEX 3AETB 2C04A 3HFRA 3SSOA 5IKMA 3VBEA 1C9YA 3ZCRA 1YVPA 2ISQA 4UUQA 2DWPA 3KQLA 3IALA 5ALUA 5IBRA 3DE3X 3KHUA 5ILQA 1CRPA 3KQHA 1G21A 3MRTA 4OI1A 4K8OA 4ARCA 1Z37A 1QRAA 2W8BB 1T8SA 1CR4A 4AZVA 2H1FA 2IPAB 4HCJA 3WGJA 2Q5JA 1BH6A 4MRNA 2R1TB 1AE1A 2NPFA 2V0NA 2Y1CA 1TT5B 2OUKA 4MLDA 3SHTA 4ER3A 2GGSA 2AR7A 2NXWA 1TVKA 3PIIA 3TMKA 4BWVA 1I3NA 1TQHA 2Q0XA 4H60A 1F3OA 4CMBA 4G81A 2FWPA 3UHAA 4QJBA 1VA4A 1OGJA 4P0QB 1IZ9A 4AG6A 4DSZA 4PINA 2O0JA 3NOXA 2W4IA 1ZVVA 2D62A 3MRVA 1YIAA 1Y81A 1O8CA 1RAIA 4FMCB 1SU6A 3ZXXA 4DG5A 5K9ZA 1DIBA 3COJA 2BEJA 1Z47A 5FBQB 2H17A 3U0BA 1QS0A 4DREA 2AJBA 4OBBA 4QPPA 1D5CA 4ER5A 3CUTA 4YDQA 3BTVA 2NV2B 1GUAA 5D84A 2DH5A 3I9JA 1E63A 2JEZA 1BHQ1 2ZYSA 3KCQA 3EXIB 2TMDA 1YDWA 1YR6A 1N2BA 4J43A 4QBKA 1HH4A 1XMSA 2AE2A 2G0NA 4IKOA 1BW9B 4M0CA 4I1SA 3UWSA 3FPCA 2R4QA 4X60A 1DG9A 1XZGA 2GCNA 5AI6A 3RHSA 2B36A 1KZ9A 5DHQA 4BO3A 5K8VA 2VDJA 3PUJA 1SBYA 1YBMA 2RAVA 3QOYA 4FYVA 1FS4A 3N7UA 4ZOBA 3RTBA 4DILA 5EHZA 2ZUCA 3HCBA 2MYTA 3VUFA 4K6OA 4UXIA 5DTMA 1M2JA 3CJRA 4YJHB 1V2GA 1AIPA 1MAVA 1JBEA 3ORFA 4A6XA 3H8SA 1NI4A 3OOWA 3AKZA 1J0EA 3IAS6 3U3JA 3B6ZA 3OHSX 4LYAA 4C01A 1D4FA 1CEQA 3A1SA 4NV0A 4WOCA 2OBYA 1NDUA 4WNAB 1I7SB 3IAM6 4KU4A 4Z7OB 1I8TA 4PGGA 1LSJA 4GC9A 3OZTA 3S1AA 1ICIA 1U1CA 4RVDA 4W7HA 1EWYA 2C58A 3AB3A 1FP6A 1M2VA 4D79A 2E0IA 1IAQA 2W90A 3M4XA 1SHLA 4O4IB 4LFAB 1KYIA 5K8JB 1AUVA 1T0HB 3DDCA 4ALNA 4Z1OA 4PQEA 1EVEA 2ACEA 3BCUA 4QPCA 4HB0A 4O2LA 3CX8A 3T99A 1Y9DA 1YB7A 1QHSA 1XRNA 4R2XA 3S55A 4AL4A 2DHDA 3HKEA 1VG1A 3IRVA 2GI4A 5BV0A 4QGGA 3JPYA 2B4KA 3P19A 1SN7A 3GRVA 2A5DA 3EH2A 5E1DA 3U39A 3U3XA 3UA4A 5JW6A 3DVAB 3QYAA 5KSOA 3GIWA 4BFTA 3HU5A 3Q3CA 4C14A 3AC0A 1LQ2A 3O03A 2AXNA 4O4IF 4B3MB 2DBYA 4KYVA 3PGA1 5H1YA 1QBKC 3R8FA 3G5MA 2QUZA 5ELMA 5K0GA 1E59A 1RPTA 1XQWA 3ZWMA 1DJMA 4PCAA 5AK3A 3Q3JB 3Q5GA 4UBIA 2A9FA 1G16A 3C85A 3KTDA 4FB4A 3KYJB 2O2JA 4RE5A 6Q21A 4KR2A 1FQKA 5HP4A 2ZUVA 2EKPA 2ZI4A 4DNQA 2OHIA 4QSHA 1GEGA 2XYQA 4L9AA 4Q1CA 1YI1A 4RV4A 5FO0A 2XPCA 3ONVA 3HCFA 1F6BA 1MD9A 2WU1A 2O1WA 4FB5A 1U6KA 5DN6A 1RTTA 1L7PA 2Q41A 2ZZNA 4YUZA 2CE2X 3DZKA 3NG1A 4Q19A 4XJTA 2AHRA 2E18A 3G2KA 5JMOA 1F0YA 2IXTA 4YMWA 5ES3A 3KOMA 3FIUA 2CFSA 5JAIA 3TCNA 1I3MA 3TZHA 5FADA 4D3FA 1GNVA 4C2BA 3RS5A 4YCDA 2H5EA 1YA6A 1L5FA 4Q1VA 1E6WA 1FQJA 4OMFG 9LDTA 3GHHA 2FWRA 4X54A 3ETHA 1RQNA 1U3DA 1E79A 4FYYA 1YZVA 1DPFA 2CCKA 1E2EA 4FOOA 4XQ9A 5ELLA 2ZJZA 3F67A 1V6SA 4FFBB 3HVHA 3IMFA 4EKIA 4G4GA 2UUPA 3R5TA 1FU4A 4L0DA 4JXXA 1YAHA 3PJRA 4F8EA 3ZQUA 1K4YA 5JE8A 4XQCA 1KAHA 4BRZA 2H7YA 4JMLA 3IUSA 2CSUA 2VNAA 2YJ5A 5COAA 1KOLA 1P2SA 1ZCZA 3OT1A 4TTQA 2O06A 2V6MA 1QANA 3KDSE 2UZIR 1NBMA 2EKZA 2XV1A 4E0BA 4NDZA 4QUHA 3ROEA 2DM6A 1HE1C 4B09A 5I7UA 5JD5A 1E1RD 3NEYA 1Q57A 2JAOA 1L7QA 3H9QA 1ZI8A 3DKIA 2VWGA 3N7AA 4MQ4A 2WIBA 4IEIA 4YGYA 1DCFA 2G80A 4KGZA 3CT6A 2W6IA 4QWWA 4YO7A 3L2OB 2NLOA 3C4JA 1UXGA 4MUHA 1UKYA 4D9MA 5M3BA 3Q7QA 1E58A 4U00A 2SKEA 3NKLA 2Q0QA 1R50A 1Y9JA 3RUHA 4AJKA 1SKMA 1RZ3A 4G1VA 2I6TA 4WHMA 1NU6A 2DPGA 2QN6A 3U1VA 2HSWA 2VYVD 3BJEA 1P1CA 3CMCO 3E9EA 3N2NA 5EIWA 1JA9A 2DHEA 1OC2A 3HL0A 3VRHA 4MKHA 5AI4A 2RE8A 1YD7A 4XWWA 3DEZA 1P72A 5IDYA 3DPIA 1RI2A 4TQUS 1Y42X 2CNKA 4GBED 1HA3A 3BSYA 4LNAA 3FUXA 3T3GA 2PJDA 3ZDZB 3S81A 5G2OA 3MEQA 1CERA 4WE3A 1SH7A 5AKLA 4JK3A 2UZ3A 2CV0A 4ND6A 1OFUX 2HJVA 5CD1A 4G65A 2FOIA 3BXGA 2R6HA 4M6WB 4K81B 5HF6A 5D3ZA 4MW6A 4YT4A 1WCIB 2ZS8A 2VBFA 4HVLA 2OTCA 1UPBA 4YRPA 2DKNA 5FA5A 1XJ5A 3BMCB 3PZBA 1SU7A 3IR5A 4H77A 4IEEA 2FPGB 5HEKA 5B2ZA 2CNWD 1DG1G 1L0BA 1YR2A 4C1NA 1U9CA 3OFNA 5IG2A 3UF0A 4DIMA 3PJGA 3QENA 2WK1A 4DR7B 1SFRA 2GB4A 3L02A 1YDMA 5DV9A 4HMOA 3TPCA 3LQYA 2DHQA 4WCVA 3G5AA 3HJHA 3QPVA 1CZRA 3NDPA 3GG2A 1L4FA 5JV5A 1UH5A 3MQ4A 1GAJA 2G08A 1YUNA 3P1JA 5B37A 2O8EA 4HFNA 2FPOA 2P0AA 3FWYA 1CZHA 2FQWA 2Q8NA 2IV3A 4ZO8A 3TEFA 1GT91 4LXXA 4BY9E 1EVLA 3GT7A 2CKMA 1NNSA 1YZ3A 2O3QA 4JOBA 4Q66C 1UFVA 3EXAA 1U0OC 3MOGA 2WOJA 4UULA 1KYTA 4WGGA 5PNTA 2C4WA 2O52A 4IFTA 5FH9A 4CR8A 1NHWA 1BA2A 4MAMA 5C8YF 5C35A 4RHXA 2WDZA 4FW8A 3M4ZA 4FXPA 1JH9A 3FCAA 2Y68A 4JBXA 1VMIA 2R00C 1BVHA 5A5FA 1XC7A 1E3IA 2GA9A 2ID9A 4JLDA 3RS4A 4B6SA 1K8XB 3AWDA 3IXQA 4XM1A 5E3IA 4BFWA 2H1CA 4U2CA 3N58A 2FTKE 4W1QA 5YASA 5M7EA 3AHHA 3D1LA 4US2R 2FPSA 4CQLB 2YZKA 1F8UA 2BWJA 3DE5X 4BAGA 1AXEA 3DDWA 4QDXA 3UC5A 4DIOA 3OJFA 2Z6VA 4BIMA 4M1OA 1XXLA 4G3XA 4ZV7A 3EEOA 1C0LA 3B89A 2YWXA 4L27A 4U7GA 1P4SA 1KZ1A 4H35A 4N48A 5KYNA 3OAAA 3THXB 2HJGA 1QVRA 3CKLA 2O3SA 4A8JA 3GROA 5FBWB 4ZTBA 5I9TA 5HSGA 4HX9A 5E9QA 5KWSA 5FBKA 1I2CA 3R3JA 5DCLA 4ECEA 2O0LA 3FJ1A 2VHZA 1DBRA 3GU3A 4PGFA 4KQWA 4LJYA 4C06A 4Q3NA 1IPHA 1U11A 2AT1A 2W98A 2A9PA 2ZRKA 5ALKA 2XGJA 2DBZA 1GTVA 1IBCA 4YCSA 3RS7A 1BTOA 2WF8A 3OLZA 4FHZA 2H2IA 3MERA 2OCAA 1CIVA 4CODB 4DLYA 2H1WA 4XWTA 3IPXA 4N0QA 3A9RA 4OB8A 2DR0A 3VKFA 4DCJA 1U0EA 2FW0A 4LW8A 4K6GA 4GPTA 2WD8A 4URFA 1H1LB 3JR3A 1MIOB 1JKJA 2E3JA 4YUYA 1P29A 1V48A 3SZLA 5CCBA 1TO1E 3ZJTA 2X0FA 1RR6A 3A6ZA 4E12A 1G8HA 3MQ2A 1XB2A 3TW8B 3PF9A 1FP4A 4ZAGA 5D6OA 3B20A 4TTIA 4OBWA 2QY9A 3V2UA 1WNTA 1TTQB 4FGSA 4HADA 1DTWB 1NURA 1YQQA 2JJ2D 3FSJX 4KR0A 4XRGA 1M0EA 2DLCX 4B3XA 4JP1A 2XDYA 2C88A 3IAAA 3T7TA 5LLDA 3QMMA 2RGDA 3PHLA 4BGVA 2ZWVA 3VAAA 5THKA 1GG5A 1Q14A 4ZO4A 1ZBQA 2VI5A 4OB7A 5EKTA 4JVSB 1PT8A 3WGVA 4LTNA 4FR5A 1FXWF 1E9EA 1VCHA 2ODAA 4TSKA 3L7NA 2XWBF 4REQA 4DIEA 4U63A 3RSOA 1JHDA 3MPOA 4AJIA 1CY6A 2DVMA 4WZZA 5IABA 3L0CA 2C98A 1D9ZA 3QUSA 3HUFA 1IWOA 3DL2A 1MAWA 2VXYA 5C81A 5H7XA 4Z0HO 2UZ4A 3WV4A 5TQ0A 3INYA 1TC1A 3IPAA 4BP8A 5C8VA 4NBKA 1FUUA 2NAFA 1S01A 4D45A 3TKYA 5DCWA 1LFDB 2FSIA 1MV8A 3TWOA 4S1PA 3FA2A 4FFLA 1U8YA 2C1XA 1L5ZA 5H82A 4O33A 5LIRA 3EY9A 2P3LA 1V4NA 1G55A 2PLWA 3CKMA 3OJOA 3OLYA 3X43A 3CVWA 2XSZD 2OVFA 1K8YB 3KJIA 4DSUA 3OURA 4BZWA 5JNUA 4B44A 1F8GA 4GYYA 3DTVA 5C8ZA 4COKA 5CB6A 3O95A 2O6LA 3WKDA 1Y82A 4YPVA 4F5DA 4I6EA 2XGMA 4QBIA 1LS1A 1Q22A 2WWWA 1B14A 3EDRA 4GBMA 1W4CA 2XE6A 1EFPA 2QLFA 4JLJA 4TSFD 1G3UA 4R2WA 3CLHA 1JFSA 3R7WB 3BB1A 4MVWA 4D0LB 4DTIA 4EABA 2EDCA 4H7KA 3Q10A 4LHEA 4TT8A 4N5IX 1HUQA 4PE5B 2WM9B 1M6YA 4XX1A 4TOIA 5DLEA 4LI3X 1BU5A 4PLYA 3OPXA 5B3JC 3DW3X 1FNDA 4UUMA 1F3LA 2OBBA 4CM5A 3KLPX 1X6VA 3A0RB 4JVMA 3VOTA 1JEJA 1SCDA 4DLSA 4R1TA 1GKIA 5DFAA 3LHIA 3WADA 3JATB 4J94A 4M9ZA 2V7VA 2JK1A 1LTKA 1MCZA 1TQ6A 3AP3A 3CONA 3M5PA 4L0QA 4DDKA 5T4HA 1Z9BA 4E31A 1ZK4A 2XMRA 1TU4A 2Q6VA 3VNRA 1JLMA 1TAGA 2M9MA 1G5TA 4GR4A 1CQPA 4M0EA 4NARA 3GN1A 5IT0A 4L7VA 2NVWA 2Q4DA 3DE0X 3DZCA 1MRZA 3GCGA 4V1CB 2JFZA 2WG0A 4Y7CA 3UATA 1HDEA 2NQ8A 3I45A 4ESOA 2V3WA 3R7SA 5ALEA 1EHCA 1XTZA 2CXNA 1QYRA 3LWNA 3E82A 1CNMA 2V54A 3TUJC 4LZOA 2WIDA 3UWDA 2NZJA 2VP4A 4TT3A 5FNZA 2IPMA 2QVXX 5FTNA 4FFOA 1THTA 3RAPR 4LF9B 4O2BA 3OEHA 2C82A 3CF4A 2IEAA 2WJJA 3KSMA 4HDNB 2R6R1 5JLJA 1XNJA 4IBOA 3S27A 4NXMB 4KAXA 1B6RA 2ORVA 1JMVA 1NVGA 4HFRA 4FYMA 8ABPA 2WD7A 3GP8A 2P3QA 2C7VA 1QYVA 1V1MA 1XXHA 5KHOC 1W7AA 3SR0A 1EDOA 2C3PA 4JUFA 5CFQA 1ZWLA 4QDKA 1DXOA 1R3UA 2H16A 2OHHA 3FVWA 3PKZA 2EHDA 4V39A 1G0OA 1IONA 3GGOA 1YIOA 4Q3DA 1IMOA 4V0RA 4LCEA 5A7GA 4J3NA 2HPAA 4RZQA 4KLZA 3OMLA 3G0BA 2FSGA 1YI8A 3V5NA 3PGKA 3RTCA 3T5DA 1H0KA 1NY5A 2BM9A 1OX4B 1XKQA 3PQCA 4R1SA 4R1MA 2IOYA 4X95A 4D96A 1N2CE 4DGSA 3R9IA 3T7JA 4FM9A 3E6AA 3Q9NA 2EF1A 4RZSA 5HCIA 6REQA 2JLWA 4RF2A 4DIFA 5JY6A 3VC1A 3A05A 4C4AA 3KSZO 5FLXA 3STUA 1GARA 1DEKA 1Q1BA 1OB2A 4BS9A 4L9WA 3MTJA 1XO1A 3OP4A 4EA9A 2IIPA 5BN1A 3AUYA 4M49A 4IDHA 2F9LA 4IJ6A 5IDQA 4CHTA 3UPUA 1KOFA 3DCIA 3OZVA 1GDHA 4KIFA 4WH0A 2X8WA 4W8GA 3U4AA 4BMDA 3O84A 3PDHA 5A0VA 1NN5A 2FHSA 2Y6VA 4O8ZA 2B94A 3VNVA 4Q7LA 1TLLA 2PXCA 5FPKA 2HUNA 3F97A 3PENA 4OREX 1FSPA 4HRXA 1AF4A 3LGAA 3BGDA 1HYEA 1AZSC 1GG8A 3VU9A 3IP1A 4U39A 2GLXA 3L6BA 1IG3A 5JECA 5KOIA 1ZZGA 4R05A 5GMOA 2HNKA 1AA9A 3T5MA 4LK3A 3DS8A 3L1VA 2HH9A 3IBYA 4URVR 1N2CA 5DK4A 1P0MA 4QXRA 3ZI4A 1N6HA 3ELWA 4WXRA 3ZWYA 4B9AA 3GVPA 1GADO 4EDFA 5HM8A 4DPKA 3G7SA 2D13A 3BFKA 2G1AA 3P32A 2CVZA 4R83A 4DCMA 5JEDA 2ZP1A 1GUZA 2VAWA 1KYQA 2C83A 4U0KA 4Z7QB 3I61A 3TD2A 3PC4A 2OK8A 1CNEA 2HREA 4HDOB 1XD2B 1R0BA 4BU1A 2JIQA 2HHAA 2IZ7A 4EJ2A 1WMDA 1NVXQ 4QD3A 2BCJQ 2QL5A 5JS6A 1XDBA 2EEZA 1F48A 3DTYA 4IHJF 4NZOA 1EEXB 4RM3A 4FI3F 3NHKA 2GHTA 4IMIB 3Q72A 1FS5A 5IHXA 3TSCA 1T3GA 3SLKA 2FR1A 1XEWY 3ICOA 5DJ5A 3FMFA 1F20A 2EBFX 2PRZA 3QV1A 4GP6A 1XAHA 4I3GA 2GASA 1NJGA 4GX0A 4MKIA 4OSOA 4UVGA 3LIPA 3V7WA 3WRVA 4XR9A 3SXUA 2RGBA 4OXKA 3PFBA 4B87A 3T1TA 3OIVA 1WXQA 3W3AH 4QEKA 5PGMA 6AT1A 2W4MA 3RC1A 3C39A 2GFHA 4G36A 3KWMA 4RS3A 3DFFA 3NIFB 4G97A 1N1GA 1AMNA 4MI6A 3HKDB 3F4KA 3LUFA 4JT9A 3S8EA 4GF5A 1CD5A 2BFAA 2VOJA 4KKXB 1VJTA 2UV8A 4UNPA 3E5HA 2AN4A 1IN7A 4LOHA 3O8NA 1V45E 1PZEA 2GCOB 4NYJR 4QPDA 5TGZA 3HUDA 1Q95A 1JXQA 2TMYA 3QEOA 1Q7EA 3LT4A 1O94C 4JB3A 1I5OA 4I08A 2E4WA 1LPOA 3CKYA 1NT4A 5GZ6A 1PLKA 1H05A 5KWIA 4D4IA 4R01A 2Q6IA 2X9LA 1I14A 3C5EA 4MW1A 1KMMA 4PS0A 1JDBB 1M34B 5A4KA 2PUCA 4AW9A 5AW6A 2YDYA 3I6QA 3NHFA 2OZVA 1KY2A 3ZGXA 3Q0IA 3QNUA 2YIMA 2UUCB 1NXOA 4JQCA 4WKCA 4BV2A 2ABWA 2IGTA 5AQEA 3HP7A 4WGFA 1Y6JA 5C7YA 2QQFA 1WUKS 5SICE 2GM4A 2OOSA 1QZUA 1Q17A 3V1YA 3H9JA 1Q1ZA 3UWKA 3GLIB 2CCJA 2V9ZA 2RKWA 1KEPA 1YOVA 1XU4A 2DQKA 3K0HA 3V8VA 1S7CA 3G8CA 4LIPD 2IYZA 3L0SA 2YXPX 5KWEA 3ZU2A 2FMHA 1M2NA 2V7PA 5LQRA 3QMVA 2C00A 4QQ8A 3ZW7A 4EG8A 1QH8B 2IHJA 2OB1A 2KM1A 3BG5A 1I3KA 4FHFA 3ZH2A 2FMUA 1MC5A 2VTBA 4DARA 2W83A 1EBUA 1ORVA 1DPGA 3S68A 1SM4A 3I32A 4LX0A 1JJVA 1O87A 2ZSKA 1VPTA 1NLZA 5FDFA 1NMZA 1QCDA 1J0CA 1RQ7A 1RWMA 3F3SA 3HFGA 1JF8A 3PUYA 4HQRA 4PTZA 2R4UA 3W4JA 3HDHA 1OZFA 2PLRA 2GPAA 5D7NA 5B1DA 2FLKA 1QP0A 3AX6A 2FPKA 3HVJA 1MX1A 2PE5A 1Q74A 1JHPA 2D2FA 4KQHA 3QWIA 4KVZA 3KK0A 3L0YA 1ESEA 4BDTA 5HQ3A 1UBEA 2PEZA 1ZN8A 1X8XA 3RFTA 1NF2A 2IUUA 1BKYA 2F9FA 1GN8A 3WMXA 1L8LA 2WWIA 4UHBA 2EYQA 1M0WA 3QE4A 3O4VA 3NZEA 2C3UA 1X3LA 3ANMA 3EVZA 5A6SB 2BGGA 1UMCA 2L18A 3JRNA 2CJPA 3JQ7B 1TXGA 3WSTA 1I2AA 1FJ2A 2WHYA 4JJFA 1D1QA 1OTXA 1SG6A 5EKXA 2NTVA 2B9EA 3GLIA 3TDKA 4R2LA 2O2SA 4QREA 2WUGA 1H2EA 5LFAA 1JIVA 4UNNA 4NVRA 4M9XA 3HXMA 1AGYA 4AMZA 2VWQA 2G76A 5G1OA 1E7YA 3FKQA 2G4CA 2WJGA 1UJBA 2CBXA 2J07A 2ZI6A 1MEJA 1WDTA 1CQWA 4R1QA 2BC9A 3F71A 3FB1A 2KLBA 2GYWA 3MWLA 1NVBA 1TI7A 3SI7A 1T0JB 3PNLA 1VDMA 4UNRA 4HO1X 5AJWA 3VR4A 2QKYA 1G6KA 3O73A 4OHZA 2MSKA 5IUJC 1IY2A 1JB1A 2I1LA 3L06A 5F9MA 3RBZA 3DLIA 3SR4A 4EF4A 4CM8A 1IQRA 1T5LA 1K7EB 3WGZA 1SA0B 3B5IA 1ENPA 3PHGA 3M6MD 1MQ9A 4N7BA 3FBWA 3GXBA 2ACWA 2Q3EA 2YVAA 3G0GA 4EQ6B 3H11B 1JLLB 3EGDA 4FZ5A 1EDDA 1Z2DA 4L74A 4N6GA 4PN7A 3AL0C 3LLVA 1DMSA 4Y0VA 4CM4A 1U28A 1K66A 1YS9A 5EMKA 1U2GA 3N75A 3WQSB 1TCCA 2JKVA 3FG9A 5JXJA 1K0UA 1U8UA 1FU7A 1FFAA 3KELA 1ABEA 2PMCA 4G5XA 2O5VA 3IYLW 1Q3HA 4R6WA 3U26A 4L5YA 1CIJA 4P3OA 2QQGA 3AR5A 1GV0A 1U1GA 1N2HA 2G9NA 3ZXUB 4CXMA 4QHTA 5JCOC 3SX2A 4W5TA 4A36A 3Q8WA 3SYLA 3WLPA 3AY0A 3JD2A 1YJAA 2J4CA 3MHPA 2BZ1A 4PX9A 4ZEOA 1IY0A 3RU7A 4DLXA 1EXDA 3FZEA 1SVOA 2NSDA 2V7WA 4HEA1 3W8FA 3BSWA 3RYCA 4DV6B 5LPNA 3K09C 5DLPA 1EFDN 3K6SB 1HDCA 2I4NA 1W8DA 2Q0HA 1EG2A 3H0EA 2XYHA 2WU4A 4F4UA 1HF3A 3PLAE 4FDMA 1E3LA 4V0LA 3AFGA 2JARA 2FPWA 3E84A 3EVCA 4S24A 1QR2A 1NC3A 3PJFA 3RVQA 4PC1A 2QEQA 4FVTA 5JPIA 4QASA 2C2KA 3DV2A 2IF2A 2PU7A 3PLNA 4FMBB 4I46A 2HU2A 1Z6YA 2HK7A 4A6DA 1HT0A 1Q83A 2VHEA 4G63A 1H1DA 4B79A 4ER0A 3CEJA 2WUDA 3KZMA 4HJXA 4BLWA 4BCCA 1URPA 3EXHA 1I4EB 5A9RA 4FMPA 4ZU1X 5JHHB 3KETA 1OB5A 3BMQA 3PUKA 4RGQA 4C5BA 1H3EA 2UYHA 3ZI7A 4NBTA 5FUVA 1L7BA 3BWDD 4HDRA 3RROA 3H9UA 4AO8A 2MHCA 3LX4A 8MHTA 1I13A 3O0TA 4HZUA 5EZYA 1E9CA 1W88A 3I72A 3LK7A 5KHLB 4GDFA 1E4EA 3LC1O 2KBEA 4KBYA 4X61A 2QTTA 5FWYB 3VR0A 4CG0A 2P68A 4CMCA 2PSHA 1E66A 3C3AA 3TQRA 1L9XA 2EFJA 1JG6A 2QRJA 3JAKB 4Q93A 2W6OA 4QA9A 4WESB 4Y8VA 5IF3A 3ZZ0A 5CDSA 4MCHA 1CG6A 4CKEA 3C3CA 1XDWA 1DC6A 3LQ4A 4EJFA 4MR9B 2CGEA 3W5UA 1IQUA 4Y2SA 3TBFA 2OC4A 2RK6A 3RK4A 3W06A 5JAUA 1SOWA 3UHFA 4RKYA 4EO7A 4FNGA 4KTTE 5A4IS 4Y6QA 3FUTA 4HH0A 1EVJA 1TTHA 2D5LA 2ZJBA 2DF8A 3GJ6A 5HILA 3WGLA 2K4MA 2LZ0A 1UPCA 4KMOA 1FFYA 3WK5A 5CLHA 1WU7A 5EJAA 4DIDA 1TEXA 2O1XA 1LDMA 2JGEA 3P0EA 1Y34E 4XE5A 3RYTC 4BZQA 5IJ0A 3HXOA 3KPWA 1BD4A 5ALVA 4H2DA 3TZBA 4GC5A 5CT4A 3UMBA 5KYXA 4TV8B 5KB3A 4P4SA 4QU5A 1IZ0A 2JS7A 3S70A 1E62A 2PMEA 1NMYA 2BKUA 2UVDA 3X1YA 4AG3A 4YB8A 4C3ZA 2DPMA 5C5DA 5CIYA 2JNWA 3LWDA 2ZBVA 2JRLA 2P8SA 3D3WB 4HK4A 1YZNA 1MTZA 5DB4A 2P9TA 1H94A 1MTOA 3KXDA 3R0QA 4ZI5A 1L5HA 3TRJA 3UK7A 3VXKA 4YYEA 1SEPA 1Q0HA 2R86A 4L2IB 1KEKA 1L1EA 5TQ2B 2PBFA 1LEHA 3CW8X 4ZN6A 1RLUA 2HRQA 2OK7A 3U4IA 3T7EA 2TRSB 1IU9A 1DNPA 3JWPA 4TV8F 3R5JA 5CW1A 3CXRA 2EZ4A 4UM9D 2IC5A 1RM3A 3H2HA 5FJJA 1OZ0A 2TSYB 3QPDA 4XGKA 2N47A 3V1MA 2I03A 4LECA 4MGEA 3AJ8A 4OX9B 2CVQA 2NWQA 2OWEA 2FZGA 5LB4A 3V4VB 4EMSA 2XF2A 4UBLA 3RJ5A 3JZAA 3WXBA 5KZMB 1PJQA 1MJNA 4Q15A 1QORA 1YSCA 1WPXA 1XQ1A 4XPIB 1NW9B 2XGOA 4QUDA 2FDRA 2XA9A 2FSHA 3A1CA 5EY5B 4EPVA 2PZFA 5EP2A 5G3YA 3MAGA 4C7KA 5BUSA 1GGEA 2GM3A 1Q3TA 3B1XA 3K16A 1X7XB 4RLHA 3DWGA 3VNBA 3W8EA 1JG4A 4Q1AA 2XKBA 5KMGA 2XXAB 2B3DA 1J2RA 1KJ8A 2QLLA 4PU0A 2ODNA 1X19A 3I23A 4BUZA 1V4VA 1MB9A 3G2MA 3ZVNA 4KO1S 2CC2A 4JBNA 1UPFA 1FCJA 2JFNA 3TTXA 4P80A 1T3ZA 1VZ2A 4UFPA 3KZCA 3HJUA 1RLOA 1U81A 5FOWA 2Y76A 5FLKA 1FYWA 1TMOA 2VBGA 3HKCB 4MW7A 5FX2A 4BQSA 3K0CA 2JIPA 3BIWA 4NECA 3UQZA 2E4UA 4U8HA 1U4NA 2Z4SA 5F1PA 5FWAA 5LQKA 2QAGC 5IMBA 3V1TC 1NYRA 1BS2A 4I1YA 5BR7A 3MGAA 4KNWA 2AI2A 2QF7A 4RCVA 4WZAB 1N4AA 4RA9A 2DRIA 4TLAA 5HZKA 4YALA 2BSXA 3BZWA 3TRKA 1LLDA 4RH3A 3GNLA 3B48A 2OLJA 2G28A 3BVPA 3G1UA 5EWJA 3RIHA 1GA1A 1NLUA 1SCAA 3AO0B 3D2CA 3V46A 4PG5A 2XNSA 1UC4B 1XVVA 3LLCA 4OHMA 4TTVA 4YJ3B 1Y6RA 1KDVA 1AKNA 3EQ7A 3T9FA 1M1ZA 3IIMA 3L0DA 4GGOA 1N5DA 3KWLA 5IXYA 4EY5A 4JUIA 1NN1A 5CIWA 1QO0D 2COEA 4YRRA 2M6LA 1JLRA 3JWIA 3Q12A 2VDNB 1UPXA 3AP2A 4YAJA 1FW6A 2JZCA 3FLMA 1Z4QA 1CDEA 4N3GA 2QWXA 5L6LB 2X0KA 1T1RA 3REOA 3RJTA 1T3SA 2J5KA 5JYCA 3N8GA 4FHCA 4U9HS 5EJ9A 1MH9A 1UJ5A 3FAKA 4FBMA 3JQBC 1GU7A 1XTTA 2PRKA 4D81A 3E35A 4G67A 2WNHA 3F6EX 2A0WA 2HK8A 5LA6F 1YK1A 4JFRA 4EUHA 1C30A 3N1UA 2M32A 3HYNA 1OREA 4FZJA 4RLFA 3G13A 2DPLA 3I6YA 3QVLA 3TR0A 3I5UA 1R9GA 1PEYA 5TQJA 2Z5VA 3A4YA 2EV9A 3DZDA 2OO5C 1QJ4A 2G5TA 3FUVA 3PGVA 5DM0A 2GKGA 1E7WA 1E7RA 2P75A 3IAXA 2V3VA 4PAQA 2ZTLA 1NG1A 1EP2B 4EB8A 2PR2A 2XQGA 4RVUA 4MYRA 1X80A 4EB0A 3ORYA 3G6KA 1NAIA 1L5OA 5DTQA 4JXJA 3C5HA 3KSRA 5LL6P 4PNPA 3UT0A 1L7NA 2JANA 4TKUA 2DSNA 1VSBA 2GUGA 2I76A 2RHBA 1KI3A 3DV9A 4MS3A 4Z4IA 4G5SA 1Z36A 3I37X 2D1SA 2OPBA 4C9BA 3QKTA 5JAQA 1VKOA 4H7HA 2HWWA 4S35A 1O6GA 4IZIA 1DAIA 4OL0A 2P5YA 1OT3A 3THWB 1UDBA 4KN6A 1BSVA 1ZZEA 4ROSA 3EZXA 1YZFA 1HOTA 1QQTA 1Z45A 2CFOA 5AHRA 1ODSA 2A1UB 3JD0A 3QXXA 4FINA 5T57A 1SXHA 2FSFA 1U98A 1IOVA 5IEBA 4B74A 4DQKA 4JQYA 3RKSA 2QROA 2WV7A 4ZMBA 3A1VA 4NDAA 3GBPA 1FXSA 3NATA 4MVJH 5KNCA 1I6KA 3HKBA 2L69A 2A7QA 3FDIA 3LRPA 4DDVA 3B51X 3DVQX 4KITB 2FQ1A 1IXRC 2YWBA 1YNOA 1BROA 3WAGA 4B84A 2PJUA 2OYCA 3RU9A 1PJ2A 3UTCA 2NVOA 3I8SA 2A78A 3ZJVA 5FNVB 1R4NA 2RGCA 2Z8YA 4R1UA 4HL6A 5JNWA 5JRZA 3F4LA 5T3YA 4BB6A 1QIGA 3ZOZA 3LPMA 2QPOA 2PLAA 4XX0B 2WF6A 3ZNOA 1W96A 2RGGA 4KVGA 2XE7A 4R7TA 1QVZA 2JFPA 3LNTA 3DSRA 3STXA 2ECQA 4DJAA 1XPOA 1L7RA 4R1LA 4IUBS 3H0KA 3LHSA 4ZAYA 2C0PA 2HF7A 3O3MB 1N2JA 5FNVF 5DBGA 1G4HA 4KQEA 1VE7A 1KK0A 2P1RA 1SY7A 1UOPA 1VCOA 1W93A 1Y1LA 2P3OA 2QRQA 3PGLA 5LBIA 1Z6ZA 2WUEA 2W11A 2OP0A 3AY7A 2I54A 3DMTC 2R60A 4IIJB 4KLRA 1U4OA 4KQ6A 1ISFA 2HWKA 3ADOA 3EOZA 2WYVA 4UU7A 2DJ5A 3CIFA 1A9ZA 4N1AA 1ETUA 1RWVA 3G2HA 2IHBA 4R9UC 5GINE 1WMAA 3R3VA 2RGNA 1P4GA 4AUNA 1XR3A 4LKOA 2VDQB 4I5EA 2AX3A 4J3JA