1BVHA

Solution structure of a low molecular weight protein tyrosine phosphatase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
157
structure length
157
Chain Sequence
AEQVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRAVSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSYDPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACID PHOSPHATASE
publication title Solution structure of a low molecular weight protein tyrosine phosphatase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 21
structure length 157
sequence length 157
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 1994-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bvhA00
4G0PA 3TO5A 4DADA 4MS1B 4MS3B 1JH9A 1USKA 8ABPA 1YMVA 3EODA 1DG9A 4KQ9A 5F64A 4QICA 2P9HA 4B09A 4YLEA 1BDHA 2L2QA 5BQ3A 5GOTA 4XLTA 3A3KA 4G0YA 3IDOA 2FSPA 1QO0D 1FFSA 3JPYA 4EYQA 5PNTA 2OQRA 2E4ZA 3LUDA 1JHZA 2FTKE 5ABPA 5JNTA 1AB6A 5TQJA 1QQBA 3A0UA 3GT7A 4NCBA 2JVJA 2IYNA 5CNIA 1K68A 2ID7A 3O75A 5JS1A 1MB0A 3BREA 3SM9A 1A2OA 4WWHA 9ABPA 1OXBB 3O1JC 2HSGA 1OXKB 4UHKA 2E4VA 4JAVC 2JBAA 4RK0A 2WJAA 3HM9A 3JPWA 5TQ0A 4S05A 2FQYA 1JFSA 3LUGA 4IGAA 5KI6A 2V0NA 4ZMSA 4LRQA 1M5TA 2WY2D 1PEAA 3DGFC 4RK5A 2JVIA 2I6FA 3CHYA 3QLUC 3DLHA 2VUHB 1CYEA 5JNSA 2ID9A 4XARA 5EWJA 2L18A 4HYEA 2QZJA 2X7XA 3B2NA 4G97A 2LIVA 1YMUA 3ILYA 2HJ9A 1JYEA 1K66A 3LKBA 4IMIB 3GV0A 3NHZA 4RY8A 2MYTA 3IPCA 2VYCA 4OATA 1W25A 2CHFA 3W9SA 1WETA 3F73A 3MA0A 3D8UA 3DGEC 3HCWA 1Z2DA 1GLGA 2PL1A 3I42A 2FMKA 3CU5A 2MSWA 1LBIA 3S99A 4Z4HA 2AYZA 5JNRA 1W9HA 3Q7SA 2QXYA 4YCSA 3EQZA 4LE1A 3OQMA 1DBPA 1NXWA 4P98A 3KG2A 4MAAA 4NCAA 4RK7A 5EWMA 2FEKA 2FMIA 2NZUG 2FMHA 3NHMA 4ZPJA 2M98A 2FXIA 3OMWA 3QEKA 2JVKA 1ZAYA 4RXTA 2FKAA 4OLAA 4FE4A 3O1HB 4JB2A 1SXIA 3HDGA 2P4UA 3QLVC 1GCGA 1SD5A 2MSKA 5IUNC 2L17A 1JDNA 4JASB 1LK0A 3OQNA 1QQAA 5HKOA 2RJOA 1Z26A 3LUKA 3HEBA 5C5EA 2IDMA 3RH0A 4MRMB 3M9XA 1XWWA 3LUJA 4O5AA 5IX8A 4JOQA 1ISSA 2CWDA 3N53A 4ETIA 3KLOA 4EY3A 1JFTA 3GBVA 3OO0A 1IIBA 1NTRA 3R0JA 3TB6A 1Z25A 3RVLA 3HXMA 3OLVA 3H1EA 3E3MA 3FGZA 3H5WA 5HQJA 4Z99A 1YS7A 2NT4A 3GA5A 3MM4A 1DCMA 3H5LA 5EWLA 3O74A 4KK3A 4F8JA 5KQPA 3N0RA 1KGSA 1D4ZA 2DRIA 2FVYA 1L5YA 3ROFA 3OMXA 7ABPA 3GRCA 3OLYA 5IEJA 5B3JA 3MQ4A 1NXSA 4D74A 1RZRA 2PUFA 2LUOA 2F8TA 3D02A 3HUUA 1JWLA 1M2FA 2PL9A 4PYRA 3HO1A 1EWKA 3O1IC 3RVOA 3LUAA 3DBIA 1E6KA 1P2FA 2NT3A 1D1PA 2AYXA 1R8JA 2VUIB 1NXPA 3CNBA 4RKQA 2B4AA 4OTZA 5C5CA 2FEWB 3Q7RA 1E6MA 1DP4A 2OENG 4RU1A 4RZSA 4IF4A 2MYPA 5B3JC 2H0AA 2JRLA 2IKSA 1P8AA 1D5WA 1Z2EA 4KNYA 2GBPA 3NNNA 2IPLA 4L85A 1QP0A 4WUTA 2IPNA 3H5IA 3IP7A 2FN8A 2JBAB 3N75A 1APBA 4H3HB 3IP9A 2MSLA 1SRRA 4KV7A 5TQ0B 2GWRA 1PHRA 2JB9A 1EHCA 1EWVA 2WWVD 1TLFA 3HVRA 4RWEA 2MYNA 1FQWA 4Z4GA 1DCKA 2NUBA 4G0QA 2XDYA 3LUHA 5EWJB 1QO0A 2PMCA 2FMFA 3DZDA 3HS3A 1DZ3A 2RJNA 5CNKA 1RPJA 3T95A 1F51E 1KMIY 1L5ZA 5DLEA 5E3JA 4KFCA 1QPZA 5TPZA 3A10A 1M2EA 4EYKA 4ETMA 1YIOA 4MQFA 3LKVA 3BBLA 2PUBA 1TJYA 3RVQA 4W5NA 6ABPA 4L4UA 1P6UA 1KRXA 1M5UA 4RS3A 1ZGZA 4MQEA 4QYWA 4Z9AA 3LTEA 4TN5A 4TLLB 1LBHA 2W42A 4NV3A 3H1FA 1AB5A 2LPMA 3H5VA 3FDFA 3HV2A 4EVSA 1MB3A 5HM6A 4G0OA 1DRJA 4N41A 5EWMB 3T38A 3QEMA 3SY8A 4RXMA 3JY6A 3FFXA 2PKXA 4W5QA 4FE7A 2QU7A 3FMVA 3QELA 3SAJA 4ZJPA 3I09A 3UUGA 1DC7A 1BDIA 3KKEA 3JS5A 5DKFA 3OQOA 1CEYA 4IILA 5TQ2A 3RVMA 4Z4IA 3T6KA 1VLZA 3H75A 3H6HA 4TMYA 3F6PA 3QK7A 4LZLA 1RXIA 1U04A 5CNJA 5KQMA 3F6CA 3L49A 3EQ2A 3OLXA 3OLWA 4RSMA 3O21A 4NQRA 3KYJB 3KJXA 3HK2A 3CFYA 4ETNA 4W5RA 5FBKA 5EWLB 2FN9A 3CKMA 2GI4A 3CZ5A 3RVNA 2A9PA 5KC9A 3M6MD 4ML3A 4Q6BA 4DQDA 4EGSA 1XHFA 4LDAA 4Z9BA 3SG0A 1YVUA 3HSYA 1U2PA 2JCGA 5JS2A 5BR1A 3TD9A 5DCLA 2BGGA 4H3KB 2QW1A 1DC8A 1VRVA 2ZWMA 4Z4EA 2E4YA 3FFWA 1ZGGA 4WT7A 5D2CA 4H60A 1VKRA 1B00A 2VK2A 3LFTA 4GNRA 4XFKA 4PZ0A 4MR7A 1BA2A 5IBQA 1A04A 4MR9A 3DLBA 4XXHA 4KVFA 1USIA 2QV0A 5TE9A 3KCNA 2M1ZA 1Z16A 5FWYA 3H5OA 5I4CA 5JNUA 1D2AA 3TX6A 1U0SY 3MMNA 2RDMA 3BRQA 4HNRA 4MPTA 4KZKA 1VPWA 3HJFA 1ZITA 3NNDA 5BRJA 3KS9A 4RK6A 4EVQA 1RXEA 2PUEA 1TMYA 3KSMA 3N0WA 2ZAYA 1E6LA 3CLKA 3CS3A 4G86A 4LE2A 1C0EA 2QVGA 3LOPA 3ILHA 3TMYA 4MS4A 1DRKA 3CG0A 3G85A 1J56A 3JTEA 2HQOA 3N6VA 5T3YA 4D6YA 4EYGA 1JLKA 2R48A 1PUXA 1LJLA 2E4WA 3N0XA 4RY0A 5KQGA 3OM0A 5FBHA 1EAYA 3NNSA 1RZRD 3H1GA 2R25B 3LUCA 1MVOA 4Q7EA 2JK1A 3BILA 3CZCA 4E7PA 3IPAA 1DBQA 3Q41A 5BRAA 4MQFB 3VNAA 1P6QA 4RKRA 1JFVA 2H3HA 3P9YA 4G0ZA 2KYRA 1PNTA 1BDJA 1BVHA 4LE0A 4YWHA 1JX6A 1E2BA 4MQEB 1NXOA 4JB0A 4RY9A 1T34A 4G0XA 4EYOA 4OLBA 2R47A 3O2JA 4Y9TA 1GCAA 2FQXA 5CHYA 4WXMA 2PUAA 3C3MA 1GUDA 2FLWA 4TLMB 1DJMA 1Z13A 3HDVA 1C4WA 2HQBA 4DN6A 3QEMB 4YGXB 5CNMA 4KMRA 4M88A 2PUGA 1ZHHA 3H6GA 4JA2A 5KWSA 3QELB 4YR7A 3K4HA 2GKGA 3RVPA 5IEBA 4F12A 3QX8A 3H5TA 2IOYA 2N9UA 2FW0A 1DBWA 1YS6A 1QP4A 2TMYA 1YK1A 5TQ2B 5ED4A 1NXXA 3NBMA 3KHTA 2QSJA 1Z12A 3JVDA 3Q7TA 4QPJC 2HQRA 5FWXA 5TPWA 3UK0A 2QVCA 2GX6A 1BAPA 4O1HA 4F11A 5GQSA 3I45A 2PUDA 3OO1A 4RV5A 4N0QA 5KQLA 1F4VA 5TPZD 4IMJB 2PE5A 4ZMRA 4PICA 1Y1LA 1JF8A 3EGCA 1ABEA 4RK1A 3QLUA 3GWGA 1LJUA 3EDCA 3GBPA 2IPMA 4OBBA 2B1JA 3JVIA 3C97A 3E61A 1ZH4A 4MS1A 4MGEA 4MS3A 1ZY2A 4NICA 3UKJA 4D6XA 4S04A 1XHEA 2CHEA 3C3KA 3CRNA 1TM2A 4HNSA 4MR8B 3RVJA 4CBVA 3K9CA 3N8IA 4YO7A 1NATA 2YHAA 3RVKA 3O2QB 2LBPA 1NXVA 4RDCA 2FLKA 4YRZA 2IPAB 4YV7A 2WB4A 4MYRA 4MR7B 1URPA 4MLDA 3GYBA 6CHYA 3EULA 4MR9B 2E4XA 3EJWA 4LDZA 3SQNA 1PNRA 1JBEA 4P1ZA 1FSPA 5FWYB 1USGA 3BRSA 2FQWA 4EUKA 4KK4A 3A0RB 5JNVA 1ZDMA 2QR3A 5KC8A 1QNLA 3M9WA 2J48A 2PUCA 3HZHA 3Q9SA 4MR8A 3QLVA 1ZH2A 4MLCA 1DCFA 4N47A 3VNBA 1S8NA 1SXHA 1NXTA 4PEVA 1U8TA 4MS4B 5JNWA 1H9CA 1RNLA 1ISRA 3QLTA 3QX9A 2LP4Y 4KQCA 4G0MA 1JL3A 2PAFA 4Z0NA 1TVMA 1YK0A 3LMKA 1FFWA 4RK4A 3KTOA 2E4UA 3C3WA 2RGYA 3G1WA 1EFAA 1ABFA 4N0PA 4LX8A 4YS6A 1U2QA 4EVRA 1MIHA 3MF4A 2A9OA 4N76A 1UDRA 4XAQA 2HPHA 4PE5B 1EWTA 4W5TA 3URMA 5IUKC 3IP5A 4ZYLA 1JDPA 2CD7A 2FEPA 3ROTA 2A9RA 2A9QA 1FFGA 5IC5A 1PEYA 4KRFA 1SXGA 3T8YA 2YHBA 2F8SA 3C6QA 5T7BA 2O20A 1NY5A 1Z18A 3OM1A 1ZN2A 4QYMA 3RVRA 4JP1A 4IRXA 4KPYA 1YTUA 3RQIA 5IUJC 4FB4A 3I5AA 4HNQA 1JYFA 1HEYA 1MAVA 3FFTA 1GUBA 2MYUA 2WMYA 1QMPA 3CG4A 2PJUA 3HUTA 4F3TA 3MIZA 3KYIB 4UHJA 2Q5CA 4Z4CA 4F06A 1ZESA 1CHNA 3MYYA 1QKKA 5IULC 3EAFA 1I3CA 4YP9A 1ZVVA 1Z15A 3GL9A 1A0OA 2WJWA 3IP6A 3L6UA 4MRMA 5DGCA 5TPWB 3SNKA 5FWXB 3LUFA 4GPAA 4Z4FA 4KREA 3RVSA 4RXUA 3OLZA 4XASA 4Q6WA 2NZVG 4OG2A 1QP7A 4W5OA 4N03A 2WRZA 4WXEA 4O1IA 5DTEA 5HSGA 4WZZA 3O2SB 3CTPA 3Q15C 3KLNA 2L19A 1D1QA 1KRWA 3F7NA 4E7OA 2PLNA 1Z17A 2R4QA
chains in the Genus database with same CATH superfamily
4IDAA 2V9PA 4DADA 3V4RA 4C0QC 3HWRA 5KTKA 4NF2A 2XMRA 4QGBA 5EMHA 2EEZA 2J6CA 2RH8A 3EVDA 4ZGGA 1RS0A 3NBQA 3AKYA 4P2GA 4L28A 2VTBB 1J39A 1YDMA 4HNGA 3H2SA 1TU4A 5GADl 3ZWQA 3RIYA 4KXLA 5B58C 3GLHB 1JH8A 1M2NA 1T4CA 4DBVO 4G26A 4LQCA 3SJUA 4IFBA 4ZYZA 1VCNA 3MTIA 4K9KA 4WNAB 5FUYA 2IEAA 3R3SA 1AKMA 1VDZA 1W1WA 2FPGB 3GLTA 2AOXA 3HCBA 3UT6A 4C7JA 4PZ9A 1G6HA 1U2SA 2CBZA 3PITA 1OXBB 3ZDFA 1Y1KE 3T3GA 2YHUA 2ZRKA 4IIYA 3PWKA 2OLJA 1X1AA 2A5YB 4JAVC 5TMDA 4CL8A 2WJAA 4PFKA 5ELMA 1MGOA 2C31A 1QM5A 2QZ9A 3G6WA 3ZE0B 3OECA 3ID6C 2QTVA 1LDEA 4UNIA 2HGZA 2FZ5A 4ZRDA 1HTBA 1A2KC 1PEAA 4CMIA 4XVHA 5FTNA 2R1ZA 2BBWA 1CYEA 2VJOA 3A6ZA 2EKPA 3AR6A 5EXEA 2EP8A 4HAOA 3IUSA 5IBCA 3PPWA 2EFEB 5KTYA 3DE0X 2B3DA 4PR3A 3V8RA 5HIAA 2LIVA 3OMLA 1GUFA 4NCNA 3LPLA 1N9GA 2Y6VA 1I14A 5F2KA 2VYCA 4YCDA 4U0JA 5ESDA 2B4RO 5I7AA 1JHOA 3DC7A 2GXQA 3F73A 3ICQB 3AIMA 1Z2DA 4O02B 5AJYA 5JWRA 3V7YA 1EQAA 1FNMA 1XLUA 3T15A 3OQ1A 2AYZA 4TTVA 4QX6A 2FJUA 4X8LA 2TECE 3QKRA 4TX1A 2R6ZA 1EFTA 2B8JA 3IAEA 1NXWA 3ENWA 5JNLA 1T5TA 2FGKA 3K0CC 4ZVSA 4AF7A 4NCAA 1OZ0A 1JKMA 1WPXA 2FMIA 3FLAA 4B5KA 1YQQA 4C4TA 3E22B 4LVNA 1I4TD 2JFGA 1IZ9A 3C6ZA 5KDLA 4CMEC 1Z2PX 3F5DA 4M3NA 4LNUA 4C0AC 4DC9A 1SUFA 3PFHA 2OWDA 4FYMA 4MUYA 4MRSA 1II0A 2WJ6A 5MN4A 3RE1A 1QQAA 4D99A 2XTAA 4BKQA 1AGYA 2FDRA 3DMRA 2D0IA 5HKKA 5DXJA 5KIAA 2WP8J 3ENQA 3MWYW 3LUKA 2MTBA 3HEBA 4L22A 5CHEA 5FEMA 4BN4A 4MRMB 1QVWA 1AKRA 1EE1A 1MO4A 4V03A 1AU9A 2JAQA 5CYFA 3KTAB 3QA9A 5LNK1 3JD3A 2BKLA 3BZWA 4L5JA 5IDVA 3SI7A 2PAAA 3VR5D 2OHFA 3C3BA 2CZCA 2ZOSA 3ZHXA 4BO8A 2XGGA 4X24A 3KALA 1KETA 1W2GA 2GEJA 3E0QA 3TTXA 3KQWA 5BMOA 4FHEA 3K0BA 2ZLBA 4LVCA 2J9XB 4UHHA 1E1RD 1U0EA 1XJ5A 1YGYA 2FR0A 5CX4A 1CB7A 4EMBA 2O8DA 2H59A 4WDRA 2P6UA 1FRNA 5HF9A 4CDRA 5F5LA 3WRVA 4DZRA 1W36B 3ZD6A 4I55B 4QXQA 2DFPA 3AUTA 1S9HA 2GN6A 3T1YB 4PSVA 1Z4MA 3WZLA 2A0YA 1RLIA 3GO4A 1R9NA 4NDZA 3GEHA 4DA0A 1QFMA 4AICA 1EWKA 3H42B 5DWDA 3RVOA 3ME5A 1GTL1 1KKUA 1QYXA 3DBIA 3RUFA 3D8HA 2FPOA 4KWCA 4QDTA 4V0OA 2OM6A 1FRFS 3R7WA 3SBEA 4IINA 2MR5A 3EHEA 3U7QB 2Y6UA 3A4MA 2IPOA 3ADOA 2D74A 1ISPA 1VBNA 3UK6A 1M76A 2XWSA 2PWPA 1K6JA 1YZ3A 2K2QB 1ZW1A 1NNLA 1SOUA 4LBZA 4YH1A 2VF8A 4G63A 3FLEA 3JATB 2Z2YA 2F62A 2Q3DA 3ICOA 4GLFA 4UMEA 3ULKA 1FMLA 3ET4A 3WI7A 4AZ0A 1RKVA 1I7QB 3KU1A 1FZTA 4DS3A 1S3SA 1N9ZA 2QU8A 1L5OA 4P58A 2R5WA 1MZVA 3MNFA 5KNBH 1APBA 4B3TB 2BKUA 2AG8A 2JKVA 1GU0A 1BHQ1 3MB5A 4HRYA 4WE3A 2PXXA 3UMRA 3UT0A 3IP9A 3FYTA 1NM5A 1Y42X 3WKAA 3ZD9A 4CKYA 5ANRB 1XVAA 2GWRA 4F56A 5IT0A 1PHRA 1ZCAA 1HLDA 4ZTUB 2J0EA 4HXGA 2AG1A 3JQGA 1WSBA 1HF3A 4BFCA 4CQLB 3O84A 1K63A 3G17A 4YJ2A 1W36D 5IYZF 4UZEA 4MKFA 4G5FA 1M2GA 2HI0A 4OXKA 4XDGA 2ZRAA 5DF1A 3NIWA 3Q1KA 5EWJB 5IVIA 3GEEA 3TLAA 3LXRA 3I9OA 5H5JA 1U94A 4J49A 1KMIY 3QG5A 4MWBA 1P72A 3UUFA 10MHA 1QH8A 5DYYA 3NHLA 3VH1A 5IKXA 3ZQKA 3QEOA 1NQTA 4MHSA 2D0OB 5B2EA 2BFAA 1XZCA 4P22A 1CEQA 1Y98A 2BHTA 1R12A 2FW8A 1P6UA 4JYMA 4KQGA 1R27A 4XYEA 4AKHA 3RT1A 4X1KA 4Y30A 3IVGA 4BXOA 3DSRA 1F6WA 3PKIA 4MQEA 3N5CA 3TQHA 1AUPA 1LBHA 3O8QB 1TCVA 4NV3A 5DOZA 2W43A 2IOHA 3T3NA 4FYPA 2DHQA 4PAWA 2YOHA 3CN9A 3BKXA 4N3BA 3A1WA 5JYCA 3E3AA 1DXHA 4F1JA 3ADCA 2ZE7A 5JJBA 4RDXA 2QTBA 1NQ5A 3MWKA 2GEVA 4E1VA 3OHPA 4YJFA 2C8LA 3B52X 1X2EA 2R1TA 5EIHA 3UFXA 2IV3A 1NVKA 1OHHD 1OWLA 2OFOA 4LZOA 1OLUB 4FKBA 4J6FA 4PX3A 4QBHA 1DI0A 1YRLA 4U02A 4YRNA 4ZJPA 1DC7A 4UCWA 5EJ9A 2IUTA 1P5HA 1N2JA 5DKFA 2EFHB 3VA7A 2YJ4A 1Q3TA 2O5RA 4KUHA 3GELA 2AN3A 3TE7A 4HX9A 3ZEIA 4BEBA 3FOFC 3WKEA 2HNKA 4F4UA 2GUWA 1LTKA 2ZQYA 1PJ2A 2GJ4A 2EKQA 3HB9A 1G20E 2GFHA 4GP7A 4H1TA 3AF1A 3NHFA 4TWIA 1QCDA 3B1WA 1ZHFA 3PBKA 4WRRA 1AIPA 4IVRA 1JAYA 4C78A 2QD2A 4D4LA 1P7PA 1WV1A 2ONCA 1CQIA 3DQZA 1WLYA 3VBCA 3BE6A 1DL5A 2GZHA 4BQRA 3D6JA 1YQEA 1K0FA 3FVRA 4PZLA 1VL8A 1U81A 1PT9A 4Z3OA 1VIYA 3FYDA 4NATA 4CTOA 3OOEA 5AK6A 3ER9A 4XSVA 1QJCA 1RP1A 2CCKA 1X74A 3UUWA 4DANA 1E3MA 3AR3A 1U0OC 4DR6B 2O1EA 2AMFA 5E7IA 4IQ4A 3GNSA 4UOQA 4B32A 1ZKDA 2XVMA 2W6QA 2YZMA 3TOXA 3GP8A 3BDIA 1WLSA 2JCGA 2QP3A 1B7GO 1PYDA 5JDCC 3T4XA 2CSXA 3MTJA 2BUCA 3QVJA 1YONA 4UD2A 3EIQA 4ZCIA 1EFDN 4OQMA 1EZ4A 1L1QA 4Q1EA 1UJBA 2B99A 4X85A 1F7VA 4C6HA 1RBZA 3AUSA 4S1OA 4U2DA 1JFRA 2O0LA 3TAHA 4NENA 4BUJA 4ALNA 3O8LA 3DLBA 5E4TA 3D7KA 5DM2A 5DBHX 1IVSA 1PR1A 2CNBA 2OZLA 2QLMA 4S1NA 4MA4A 4XCXA 1E63A 4UNSA 3K1JA 1VPWA 5HK9A 4OX9Y 3VPSA 3BULA 5JQGB 4LJ7A 3KSMA 2C99A 4GR5A 1EWQA 1CJMA 2D1FA 2ZRJA 3M5PA 5KHOC 2HTEA 3FNFA 2IIPA 5J23A 1D0SA 4L8FA 1SCJA 3HYCA 3RYIA 4N6OA 4DMHA 4P80A 4EW6A 5AK4A 1X77A 2OXTA 4Y2RA 1ZIYA 1PIWA 4HZIA 1D07A 3KQQA 4UTNA 5DHTA 5JQWA 2D2IA 4RY0A 5G41A 2CMDA 1RZRD 1FTNA 4A73A 3A2KA 5THXA 4A0QA 3DLAA 3ORSA 2IZ7A 3L7BA 1QIKA 5LYJF 4MQFB 3M6FA 3HNRA 4ZCRA 4MAFA 5KINB 1OAAA 4DAOA 2EHDA 4ZAXA 5KSYA 4ZT7A 1R4MB 3EEOA 5T3UA 1TEHA 2DH6A 2X0IA 4YRFA 1B6TA 2PX6A 3MD0A 3MJTA 3L02A 1F2TA 2QG9A 3DYVA 4K88A 2IZZA 3OIDA 3NUGA 1EJ6A 1HZZA 1MD9A 5ARCA 4ROTA 5BVGA 4OLBA 2XMPA 2HR1A 4QEKA 3IH5A 4RNDB 5ESWA 3PF9A 4UDOA 1ONSA 5E1BA 1OB5A 5CAEB 4FYKA 5CCDA 2OG2A 3IKJA 3ZE9A 4DN6A 1KAGA 1JR3A 2HA5A 5BV0A 1JAHA 5C9ZA 1KQPA 2VWPA 2F64A 2CW5A 3O4IA 3TSAA 2R9VA 1ZUIA 2GERA 2NUAA 1R18A 5C5IA 2X42A 3W77A 4LJLA 1Z73A 1EP3B 4V3BA 4A2QA 3H5TA 2PFSA 2V7UA 3MCAA 1R6DA 1YS6A 3AOEC 1E96A 3ESZA 3LQ4A 4FS3A 4KPFC 1NURA 4ADSG 3FBGA 4BZXA 3U44B 3K72B 2QSJA 3UK0A 2XA2A 3Q40A 1U98A 1SVLA 4XJSA 3TK1A 3G9TA 2FWNA 4X8MA 1MX9A 2AKAB 3NAMA 1YBVA 2PUDA 3V8NA 2NYRA 4YT5A 3A2NA 2UUCB 4UCQA 3UJCA 2WV9A 1TK3A 3WADA 3WR5A 5BQOA 4CLEA 1FW6A 3CSDA 3HKCA 1OXTA 1QWOA 1TC2A 1ZNXA 2QRVA 5KVCA 4A5SA 2QB5A 3OIWA 4QKQA 1PNVA 1Y4DE 3KYCA 2PRSA 4AZ3A 4NBTA 1NVBA 4Q0MA 1U8UA 4IUBS 5ICMA 2QPTA 3SLKA 2GO7A 5FOWA 1JKJA 2PRYA 2XQIA 1SUWA 4YUAA 3UGQA 4EW3A 2K7FA 1KAQA 4GVPA 1H0SA 3UMJA 3V5NA 3VNRA 1TZMA 4BFZA 3LC7O 1AUVA 4R68A 4HGRA 4I1UA 1M1ZA 3WTBA 4PLZA 4WKBA 4EOGA 4QUJA 2QMUA 1TUGA 3RFFA 2OZPA 1E3IA 2HBRA 2WSSA 3ECAA 4IQ8A 3M6UA 4DDMA 1OJ7A 2YN4A 3KQTA 4D0RA 1QX3A 2FQQA 1F3OA 4XFJA 2E4XA 5FR1A 2O8BA 4UDYX 2A7QA 3EYAA 1JBEA 4P1ZA 3VC2A 4F2PA 4IMPA 5BUCA 5FR2A 3VRHA 2AFIE 1SUSA 1GFZA 5EHZA 1PG0A 1UOPA 1PJQA 4P0PB 3GEBA 1T29A 2P9YA 2OEPA 1B8VA 3NWOA 3IUPA 5AESA 2V96A 2YXNA 4AJIA 5BN4A 3WQSB 4BB0A 2J3IA 3H2HA 2IF0A 1B3RA 3T3OA 2RKOA 3LY8A 3BE8A 4PEVA 3SBOA 1H9CA 2FEOA 2ZYHA 2JI7A 3EZ6A 3KZMA 2OGTA 3PYMA 4E14A 2JFZA 2Z2IA 3AJEA 4RORA 5I8PA 2B82A 3H4IA 3AI2A 4M46A 3DE6X 2EG9A 1RHMA 4IKOA 5GONF 2C4UA 1DFGA 3MMSA 3OSUA 3Q10A 2EQ5A 2JGKA 3I8OA 4RD3A 3S27A 3TW4A 1QHEA 3KU4A 1I13A 3G0DA 3ROKA 3S5JA 4HDCA 4IGFA 1BKYA 1HG1A 1C3OB 3SGLA 2ALJA 4DG5A 1RPZA 2NSJA 3THSA 3RADC 5FFMA 4Q48A 4P34A 1Q0PA 3LY7A 4R1TA 4TS9A 3CGWA 4R9NA 4YJ3F 1LXCA 1C9DB 1KEZA 4EF6A 5KZMB 2NP7A 4INAA 3BS4A 5C52B 5HJEA 4EX6A 2PQ2A 3EIEA 3AF0A 1JA9A 1OIXA 1GV1A 1GFSA 3RQIA 2ENWA 3MCUA 1CEEA 5KAPA 4EPXA 4YECA 1Y8QB 1D04A 4DCNA 2VDVE 4BO1A 2V7VA 4QPCA 5FBZA 2K7ZA 1WCXA 2WDPA 3TKLA 2G3YA 5DCWA 5DX0A 2PJUA 4WOJA 1J1UA 1ZJWA 5DTRA 2ILVA 4MWGA 4EJFA 3G2LA 4O33A 1N6NA 2CKMA 1WMAA 3ENNA 3I64A 4EJ6A 3MJFA 1EZZA 3ZX4A 2JG3A 2WWTA 4WFIA 3SZOA 1QKKA 2I2XB 1UOEA 4JVMA 1N1DA 1G18A 3Q2IA 4TXMA 4AIRA 4NMXB 5KYUA 4C7XA 2Y76A 4ECEA 2H29A 4KREA 1KDTA 4JLBA 1B14A 4O3MA 3C4JA 3CE9A 1NP6A 5CW1A 1GARA 2JAOA 1A50B 4LDPA 3W3AA 5K99A 1I5RA 4U4AA 4FYHA 1ZHOA 2QRKA 3RM3A 4E1AA 4F04A 5KYGA 5JU6A 4KWTA 5DHSA 1BCRB 5EI5A 3IERA 1VHLA 1Y3DE 1GRCA 1ZNQO 1NPTO 3W8EA 8ABPA 4JKOA 3AVQA 2Q2VA 3IDFA 3FPGA 5LVAA 5CJPA 2I33A 3FJ1A 4HWTA 4IICA 4J0EA 5CXUA 3WLLA 1QO0D 1I01A 1COWA 1G21E 1GQFA 2VAXA 4KIGA 5CYPA 2C58A 2QOEA 5FI0B 4E2ZA 4DMGA 1G1MA 1A98A 4Y1RB 2OQRA 1QQBA 1VMKA 2OMEA 1OWMA 3P2IA 1AB6A 5ENZA 4LJ4A 1BCSA 1IHYA 1NQXA 2P9QA 1E2QA 3B85A 4KBFA 4TYPA 5K3CA 3ZV3A 4BO3A 7REQA 4KQKA 2WBLC 4KFUA 1IMJA 1Y6RA 3HM2A 4E3WA 3GLRA 3U1BA 2JH3A 3GDOA 1WBDA 5KNBD 1NZJA 4F5YA 1Y89A 2AF3C 1WMBA 2B83A 1JFLA 2I62A 1T3GA 2Y1DA 4A2PA 3L8EA 3PR3A 1NONA 2AR0A 4CCSA 3WGKA 2QN9A 4DPMA 5DISB 1UIMA 2O54A 1BRTA 1IPHA 4HDSB 5M7EA 2VWGA 3LPMA 4IO1A 1T1JA 2V5UA 5L3VA 4NPHA 2H54A 1ORIA 2WVHA 2X58A 1GZSA 3R0IA 3KAJA 3LUGA 4QL3A 2V0NA 4RHEA 3VGJA 3INTA 1F14A 1UC9A 5LQAA 2UU9B 1ZVKA 5HCIA 1XXHA 3ZBQA 2RIRA 3K09C 5CB4A 3WS7A 1P0QA 5I9MA 3RVBA 4NZMA 1V96A 3EISA 2FZLA 2W2LA 4C4SA 3PGXA 3VAAA 1A4XA 2MT9A 5EVCA 3ROMA 4DM4A 2FFHA 3TF5A 3KPYA 3T0GA 3C1OA 5CH5A 2XUAA 4HGOA 2IXBA 1ECJA 2PEYA 3L1HA 4Y2VA 4UM9B 5AR1A 3AB3A 2OLEA 1IN6A 3BMNA 3E9DA 1YZHA 2E49A 1XDZA 4NCXA 3TLMA 3M3HA 4FE3A 4HG2A 2PL1A 2HWYA 2QT1A 3I42A 2R7LA 4KG7A 4COOA 9LDTA 5KTMA 1WB9A 2MSWA 2AEMA 5F3WB 2X0JA 1J2EA 1PJBA 4DSOA 5EIEA 3QOXA 5EIAA 3IX7A 1MQAA 1NJ2A 5KSPA 4HYQA 4JS0A 3G1TA 3H9GA 3RLIA 3WO0A 1HWYA 2FEKA 1N1MA 1U5AA 4ACBA 5K0CA 1JHRA 2J59A 3DR3A 4UCFA 2QJOA 3HBAA 4GOOD 5CEJA 1PT7A 3E1KA 1GQOA 1G3RA 1V9CA 3R7LA 4WN9A 3SIRA 1YRBA 4BNLA 3MT0A 2P4UA 3BTSA 4EQZA 5CFPA 1GCGA 1YZKA 2HJRA 1SELA 2LKCA 2V97A 3F90A 3HCPA 3PE3A 5HKOA 4JYAB 5F12A 4G5GA 2G40A 1UBFA 1LA2A 4MNTA 3X43A 3RH0A 2J67A 4B3IA 2BE7A 3C3AA 2ZJ3A 5BW8A 5JSFA 4NG5A 2O0HA 2QE6A 3ES9A 1ESCA 1PFGA 1YDFA 2ZCUA 3D0KA 1Z9BA 3FHLA 3P0RA 4P7FA 3WNVA 2J31A 1EP2B 4MQ6A 2ZBGA 3RHTA 3ZWKA 2BFEA 2NMVA 3BN3A 4BEJA 5IAEA 4UM9D 2WTMA 3TB6A 3RRNA 1WDMA 3PC8A 4TTPA 5DSZA 1YA4A 4IMRA 4YK7A 4JB3A 1JBQA 4QBKA 4OHUA 3L18A 4ZVNA 3BXPA 4KTVE 3RJZA 4KX3A 1H6BA 3C3XA 4DLBA 1UQRA 3IOBA 3MM4A 4R0MA 2W71A 1UUFA 1DT3A 4CMBA 2VDJA 3EGXB 2QPAA 4H77A 1N6KA 1VBMA 1W59A 2PGNA 2PSDA 2QRMA 3KR2A 4MV3A 3U13A 2D5AA 4QQRA 1PCXA 3NONA 2VP5A 1DBVO 2CVZA 3I72A 4AKGA 5B37A 5JWOA 2BBSA 1SB9A 2G88A 1KO8A 1EBBA 1F12A 3ZR4B 1WCIB 2Z5VA 3NOOA 4ASUA 4B0PA 2GM5A 2JCXA 5E9QA 3K9LA 5IDWA 1IXKA 3TW0A 5DEIA 1DKPA 5F3RA 1MQ9A 5AKIA 1L4LA 1TCAA 3ZDAA 1J09A 3L4JA 1IHDA 5J2UF 1G60A 2QBYA 4DA7A 2NVUA 1E77A 4GLLA 3EE6A 4HB4A 1AO3A 1KIAA 2ZRBA 4KHPB 5HBGA 2KW5A 2QUKA 2FPPA 3Q0IA 4ZI5A 3RPEA 3VH3A 4FXOA 4ZXPA 4FJ2A 4AQDA 1GRNA 2H1VA 4J7CA 4QYXA 1NUSA 2IPNA 2GDJA 1DUIA 4OB7A 3W6NA 2BE9A 1FSFA 2VKQA 3QHQA 2Z43A 1X86B 2I4IA 4IDQA 1PFUA 3M83A 3IL2A 3CQ9A 3HVIA 3PCXA 5BV8A 5G0WA 4B8YA 3FKJA 2VIIA 3FMPB 1NG9A 1VXOA 3HNOA 1T2DA 1Y9EA 5I48A 1T15A 3KBBA 4PWZA 2HT1A 4B3RB 3T7TA 1R74A 2ZUWA 3K8QA 1D6JA 1TA4A 2XDYA 1CQWA 1Y6JA 5IT4A 3VX3A 2ZJOA 1HNZB 1JPUA 2HB6A 3DMTC 3O3CA 1ZCBA 1TZCA 4YT8A 3AONB 4RZUA 1YCFA 2AOUB 1HR0B 2HD4A 1YI0A 1ZI6A 3KXPA 4FPXA 1J8MF 1EK1A 2O2JA 3LDFA 1ZVMA 2XMDA 4QPPA 2NV0A 5J5CA 4W5NA 1MV8A 2O3UA 2ID8A 2VTVA 3CH7A 5FPPA 1AHHA 3R7SA 3U81A 3VOBA 4DJFC 2WIJA 4AMVA 4QYWA 2PT6A 4RTSA 5FBVB 4KLCA 4BIIA 1FU7A 3DOUA 3GVHA 4GW3A 4J2OA 1DRJA 3KCQA 1V9LA 2XDQB 5A4AA 3TM5A 5A06A 1O97C 2YASA 1W49A 2I6SA 4ZVMA 2QNRA 1VSVA 2WVJA 4QG7A 1M83A 3NWBA 1Y5LA 4TV8F 5L7YA 3ZN2A 1S7CA 3AHIA 4ZXFA 1P4AA 1GA6A 3FUCA 4MGYR 2HPVA 4G5XA 4MIYA 1G8AA 1UAAA 5GV7A 3QXJA 1KJYA 3AFGA 2FF7A 4OQDA 4YPFA 3VO9A 4MQ4A 3GUUA 4CUJA 3TL2A 1QRDA 1X9GA 2DQ4A 2ZBFA 3H6HA 3JVVA 4J0QA 5EAIA 3CX6A 4BHTA 4DA9A 2ZJ8A 2C4WA 3AXTA 4QUAA 1JR3E 4YQYA 5TC4A 1NBME 2IIBA 1KYIA 3KKNA 4TKLA 5IFKA 4Y2JA 2JFWA 2XX3A 4XIGS 1PGOA 1IZ7A 4M0DA 3ZU2A 5A4JA 4W4TA 3RROA 3AESA 2IQ5A 3TCXB 1SU4A 4A1OA 3H8WA 1K5GA 2IEDA 4UNNA 2NAPA 2JRCA 2R68A 4YJKA 3L2OB 5I4KA 4CNQA 3NJRA 1N2OA 3N7AA 3H0EA 2IS2A 2HBQA 3C39A 3HC7A 1U99A 4DQDA 4EGSA 4JLJA 4LDAA 1VYTA 3TOZA 1CD5A 3EA4A 2AK2A 2G4CA 1BGVA 2HLNA 3FUXA 1PWEA 1I8TA 1KS2A 2VPXA 2ZSIA 3T7CA 1NMSA 1ZGGA 4P0QB 1M2WA 3R20A 3GFSA 4I4TA 1GNSA 1QH1A 5EXXA 4QOHA 4F92B 5HQ3A 3C5HA 3MPUA 3SE7A 1OZFA 3K2IA 4XXHA 5C8VA 5E6RB 1UJNA 2JEZA 5AW0A 5I9IA 3LBNA 5E4YA 3GQVA 5FF9A 8MHTA 4FDLA 4DSNA 1IN1A 2Y1LA 2QYOA 4WDQA 4X1YB 2VJMA 4D3DA 4DLUA 1T2FA 2DFDA 2IRWA 2ZAYA 3TFOA 3ON5A 1YA8A 3A36A 1P7VA 2C4NA 3I4FA 4NU0A 4BV9A 5FBWB 1JN0A 5CA0B 4BECA 2EJVA 3OAAA 1C0LA 3RRJA 2A7XA 3A32A 4E15A 4FCWA 1SK8A 3AOGA 1XR3A 1S96A 2EQAA 1UBNA 1LJLA 1X1CA 4ZT4A 4Q66C 5KBYA 1F60A 2PLRA 3QIAA 3KYDA 4G41A 3MHTA 1BFUA 3TUZC 3W5CA 3LUCA 5CYOA 3KJQA 1GV0A 2OZEA 1U1IA 1JJ7A 2PBRA 3ED5A 3T3PB 3I1JA 3S2IA 4MUBA 5DNYB 3IPAA 3WK6A 4CRWB 2J4CA 4NULA 4TKUA 3UJAA 1SU8A 3H99A 1IDOA 2Y2VA 3AHHA 1NLFA 4G1CA 4XTRA 2SICE 4PG7A 1OU4A 3OD5A 4LSGA 4UEJA 4RNCA 1T34A 1YC5A 1DAOA 1T6BY 2HUPA 2VHYA 3BSWA 3SJBA 3VYUB 1Q5PA 3RHZA 3F5FA 1SQGA 3FYHA 3G2QA 3ACDA 4LOAA 1GSHA 3G9XA 3V4SA 4FZ3A 1C4WA 1J21A 3MTQA 1RT9A 2R6AA 3WGHA 1C30B 3ZCVA 1E69A 3THXB 3WNQA 3ND5A 5FQOA 4ARUA 3H6GA 4QUDA 2PO5A 1CC1S 5DDIP 2V03A 1UMDA 4LNHA 4GSLA 4U6QA 4F12A 3ZVRA 1J1IA 1SXQA 4D5GA 5AVJA 4ALKA 1DS6A 1EWRA 3DMGA 1NW9B 1JPJA 2YYAA 3NBMA 2CXTA 4MVWA 5TQ2B 5KJEA 3T3IA 4AU1A 4C0JA 1EFHA 1Q50A 4C6SA 4W9MC 1U9JA 2ZVDA 4U7DA 1GPKA 1R6VA 1RADA 2RAFA 1USUA 5B57C 3N28A 3LCCA 5BSHA 1I4LD 4CF5A 2O6LA 2F2TA 5JH7B 1XU7A 2HSWA 2NIPA 3G2NA 1EUDA 3SC2A 3JYNA 3HFRA 2PE5A 1HG0A 4L07A 3T1HB 2HADA 2D5IA 2W2NA 4AO7A 3V32A 2VJPA 1FMTA 5TGDA 1M6VB 3BWMA 4URZR 2F1HA 1D4OA 1OLXB 1T36B 2GGSA 4R40A 4DCVA 5FUQA 3ZJTA 1QOPB 2XB9A 4M0LA 3KM0A 1WP4A 4HX5A 5GZ6A 2AVNA 1U5CA 4BLUA 3CMCO 3WLKX 4BQNA 1E3WB 1OROA 1GLNA 3L7NA 1KJNA 3KOWA 4KAFA 5IKOA 3BHJA 2QM8A 2WNSA 1ZJZA 1WUIS 4FHGA 2BR3A 1QU2A 3A27A 5F7OA 2YR0A 3QKIA 5T57A 1MJ5A 1XC7A 4O4LF 3WHPA 2YJ3A 4E70A 5C3MA 3COJA 1BWSA 1TPYA 4QM6A 3K0FA 2FW7A 2GHQA 1Y1PA 4J76A 4IS3A 3LBAA 3SZGA 1SUIA 3TQFA 4BWVA 1CQPA 1U3CA 1UZMA 2Z3WA 3K0CA 4LDZA 3A1UA 3E4CA 4NV1A 1L8AA 3R3VA 4Q15A 5L51A 3I5XA 1F8UA 1VJ0A 4OM8A 1PUIA 4NH0A 1USGA 4US0R 3WK7A 2IHNA 2MU1A 1NI5A 2VI5A 3QVGB 4IXMA 4R6WA 4HX2A 3B9BA 3OZRA 4P3KA 1QNLA 4CMEA 1AQ6A 4CM6A 1DEHA 1TUEA 3RG8A 4NESA 2QUZA 3DBRB 1EX6A 3X1JA 3F8SA 1TX4B 3MAGA 5JCJD 4LY0A 3QLTA 3E15A 4WLEA 4GI7A 3KEGA 1OWNA 2CXOA 2X2OA 1V4BA 3E9MA 3LDUA 4IV5A 4N49A 4REOA 3TNFA 1QGED 1VPVA 2E48A 5FLEX 1HYQA 2E4UA 3UJHA 4AY5A 5IJ9A 1RM5A 3GFBA 1J9ZA 3S55A 4N0PA 5K8VA 4JP3A 4GI5A 1V95A 1UFKA 4J43A 4JZYA 4C0KA 5CD9A 3FZNA 2NNLD 4W5TA 2WF5A 2X2FA 3LT5A 5L3QA 1G7CA 2REQA 2C82A 1H2YA 3QKSA 3PXBA 1U28C 3FYSA 3FD8A 4JLDA 4PO1A 2JLWA 1R6BX 3DDNA 4EG0A 4CKCB 3QIVA 3REFA 3SZUA 2YHBA 4Y2HA 3T8YA 3I3OA 1MDBA 4RVHA 1ZM2A 3TLEA 4XVUA 4PAOA 3O31A 4F6RA 4TKVA 3T3EA 3KZKA 1S3FA 4FWBA 2AX4A 4RETA 3SN6A 1A5TA 4KPYA 1SVNA 3IOCA 1FVFA 2Q9BA 4S1PA 2Q8PA 1IN4A 5F7JA 3VMMA 5IUJC 4QGSA 3M3DA 3T5TA 1JYFA 1SVSA 2IFTA 2D4HA 2X4IA 3PNOA 4PAGA 1CE8B 1VHWA 4MKGA 4EHNA 2EBUA 3CY6A 1XU4A 5H3HA 4NYJR 4YMUA 4XD7A 1DJQA 3BRCA 2H1HA 2XTJA 2D1RA 2ZWVA 3Q72A 4KO8A 4FDUA 4P86A 5AHWA 1Z08A 3KB1A 3KTFA 1R64A 3ZCXA 1UH5A 2I71A 2YS7A 2WPDD 1TD9A 4MARA 3EAFA 5IULC 1W76A 4O63O 1ACLA 1LD3A 5FWXB 1MJNA 2I1LA 3BJRA 2QPLA 4JFAA 4ZYVA 2C88A 3IB3A 1EG2A 4Q9HA 3MMXA 4NBSA 1UAGA 2QHXA 4TSFD 2BHNA 4WEQA 3CX3A 2Q7DA 4HQOA 3IAM6 3RKSA 2X23A 4PBRA 2OC9A 4QTYA 5B3LA 4ARCA 5IZCA 4WXEA 2E85A 3DKPA 2NO4A 2ACKA 3MJ4A 1TKAA 4KN8A 4XWWA 2H4YA 3K7EA 2HA7A 3BH6A 4R51A 1MH9A 3TR5A 2Q29A 3LCJA 3RG2A 5CXSA 3SEQA 3DB2A 5C51B 1U2TA 1E3TA 1SFRA 1NE7A 1X80A 1VSQA 3CLVA 3FAKA 3MERA 1OZGA 1MVLA 5ALEA 5K0SA 3BCSA 5H16A 3W4JA 5JAPA 2HRCA 1JA0A 3E84A 1EVEA 5C4GB 2JJQA 1QFJA 1UZLA 1YAJA 1L8LA 4FGKA 2W7TA 3HWSA 2SBTA 2C7BA 3RYCB 2FWIA 4OVKA 1SO8A 3GB9A 4P92A 1ZIXA 5HJ2A 2ZKLA 1XCLA 3KVRA 3GGJA 3ZHTA 3UQZA 5I7WA 1GGMA 1O94D 1GOTA 1N5IA 1WU8A 2PX4A 3DKKA 1ICEA 2AK3A 3M8KA 4OUDA 5CVCA 1J8QA 2CLIB 2JS7A 2XCTB 2AHOA 1AH2A 2XAUA 1ARZA 4QWWA 3O1JC 4DQ0A 4F3KA 2HSGA 3I01M 3SKXA 2HA4A 3H8SA 4ESOA 4KP7A 2GLUA 1GR1A 1IJFA 2W2KA 2WPNA 2GD1O 1Z6ZA 3DFKA 4RL4A 1Z3CA 4EUNA 3QU5A 1X38A 5CFLA 2BJWA 5GIOE 3PUKA 3BFPA 5FJJA 1DC4A 1Y6QA 3F9IA 3T3DA 4FCTA 4BUCA 3K71B 1XTBA 2WY2D 4DR4B 5ERGB 1QR2A 2ZAGA 4ARAA 4D79A 2NZ2A 1TEZA 3BZBA 3TTSA 3IDAA 2LGJA 5JNSA 1CUWA 1IUNA 2FYTA 4YO8A 3PHGA 1YKGA 2JGEA 4FR0A 1L5LA 2BJVA 3AO0B 3WAGA 3CX8A 3FPHA 3QQ5A 3B2NA 2E5WA 5EFOA 1HDZA 3WHKA 1A27A 4NAVA 4CCAA 5KJ1A 4L73A 2EF1A 4TMKA 4CM7A 3AERB 4UMDA 5H9VA 5K3FA 1PHPA 3T4UA 3U49A 5A2GA 4FDTA 4J16C 1KK1A 2OHHA 1XDGA 3GR6A 4PYMA 3RIEA 4ZICA 4OX9B 2WC1A 2TYSB 4AYWA 2G5GX 4LJ9A 5C3UA 2GAAA 1L7MA 4H6VA 3OURA 1BG6A 1NZDA 3KZCA 4ZZIA 2PZGA 1J97A 3BE5A 3SKVA 1CUIA 3HYTA 5ILOA 1FSSA 2PIDA 5E6UB 2H2IA 2OK7A 2WA1A 3C6YA 2IH2A 2VL7A 3HN2A 1ZOOA 1JQBA 2M98A 1QDLB 4X8HA 2BGKA 2A84A 1I3MA 3DYBA 3P4YA 2VAVA 2I1WA 1R37A 4L9AA 4YMHA 3WWCA 2FKAA 3J7TA 1JEYB 4D7AA 4K3VA 3WB2A 2DHRA 3V1YA 3FHJA 1QXSA 2ZYRA 1IEQA 3O83A 5DPMA 2BMJA 2X2PA 1Q0QA 1X1DA 3UKOA 2D59A 2J32A 1TTTA 2N46A 1JE0A 5DTQA 1N2GA 4LF5B 3PD7A 1DKUA 4MUMA 4YRSA 2V98A 4RIFA 5KTOA 4B3GA 3OTGA 3G89A 3OF3A 1W2HA 1Z7YA 4RVDA 4HEA6 4CZ2A 4E6PA 3WAJA 2WM3A 2NTEA 4D43A 2ZUEA 4P31A 1E2PA 1K8QA 3OTIA 3IKMB 1FMCA 3N53A 5TGZA 3LBYA 4LRTB 5KOJB 2NU9A 5BQFA 3ZWCA 2EV9A 4TS1A 2JIPA 1ZJJA 1P4RA 1WO8A 1QHGA 2YOFA 3QU4A 1D8AA 2YNMC 2REXB 3I2IA 2OV6A 2ZWAA 1AKYA 2YICA 3K5PA 4U7WA 1EZ1A 4H3VA 2NT4A 3V8EA 2AR9A 3PHLA 3FZYA 3Q7QA 2YRFA 1UBKS 2FSSA 3QITA 5KVVA 1XGKA 2F67A 2Y77A 3I6IA 4W8OA 1D4ZA 4XPZA 3BB4A 4KIFA 1IJEA 3NAZA 4K9QA 1PFKA 5EKDA 3WFJA 3RUHA 4GG1A 1KI1A 5JV5A 2Q3EA 4XVRA 5JJCA 5LN1A 4WKCA 1USVA 2WIKA 1HFJA 4NPCA 3TFWA 3IE0A 3TRHA 1X1SA 5F2OA 2RBKA 3I61A 2Q5QA 4M9SA 1YS2X 3CX4A 2Q5EA 1VIMA 4FT4A 3FSGA 1AUXA 1VG8A 3OTHA 3BQ9A 1R8JA 2CFRA 3CR8A 1KH1A 4RKQA 4E4TA 5C5CA 2YVAA 3JWPA 2FWBA 1T0JB 4BBZA 3GCXA 6ADHA 3A4YA 5B3JC 3VSAA 4B3MB 1Y9AA 3NTUA 1S4QA 4QUKA 2IBTA 2PM8A 3QLEA 2OQ2A 3MJSA 9GPBA 1I32A 1CQZA 3AX6A 3DAHA 3OZBA 3WRYA 4JT4A 1XA3A 4ZI2A 5C8XA 2P5SA 2WHPA 4E2FA 3JZAA 4K5QA 4BNKA 2ACWA 5HJ7A 3OPMA 1N7IA 2XKBA 3PWTA 4W6QA 2PKWA 4FQ8A 1SIUA 4N3GA 4KPUB 3SMVA 1TC1A 4GXTA 1XRLA 1G6OA 1MO5A 4B6OA 2NSDA 2X22A 4QIHA 1L9KA 1P31A 2NNWB 2X5JO 2Z3ZA 3EF1A 3H5NA 3GW8A 2XNDA 3H6KA 4UHFA 4K1XA 4TM7A 2NX2A 1E2UA 3H3XA 3RYFB 3X0DA 1GL6A 3B1FA 3NTOA 2PHZA 5H3CA 1F51E 1PJ8A 4HK4A 4B3HA 4U7FA 3GH3A 4ZEMA 3CJQA 1QPZA 3KC2A 3M4JA 4TL8A 1XTTA 2GEKA 2P4QA 1VTKA 4ZI7F 4A1FA 4O4IB 2NPIA 3DVLA 4O4HF 2BW0A 3IPYA 4TVSA 2B4QA 2VXBA 1GGJA 4B3JA 1JKFA 3CWQA 3ZVNA 4CF3A 1SG6A 2H85A 4GMXA 2G25A 3O94A 2D0DA 1E0SA 5FXMA 2X0FA 3QRWA 3HV0A 1ZXXA 3K9WA 1KDZA 3X2FA 4CEJA 1XG5A 3DEJA 1AB5A 1Q1GA 1R6AA 3JAWA 5BR8B 5CX1A 4C88A 4C0BA 2CL5A 3HP1A 1L7XA 4OYYA 1QYDA 4UATA 4HUQB 3FNIA 5KNCH 1FTWA 4A4DA 4BNMA 4PW0A 2IS6A 2X1HA 3BWYA 3GZNB 1ZD5A 5HOQA 1GIAA 4N01A 1XMOB 1V11B 5FTLA 1F17A 4O4JF 2XCRB 3AGQA 1VCOA 2XVZA 3FR8A 3PU6A 2ABWA 2VNAA 1UEXC 1XD2B 4G5QA 4PNPA 2ONJA 4F6CA 1JECA 2B7BA 4JC8A 1VL2A 1N2EA 1AX9A 1YB4A 1CU1A 1ZK4A 2NZ8A 2VRCD 3PJDA 3PQ5A 3V1UA 3BX1A 2HIHA 1PR5A 3BGWA 1T1GA 3V00A 1Y7LA 1I5OA 1SXJB 3I53A 5KQMA 5CXXA 1S1MA 2EZ9A 2Q9UA 1H1LA 2GLTA 3IIJA 1TW2A 4UVEA 2EP7A 1X7GA 2IX9A 1XZDA 5PGMA 4BP1A 2YJZA 4BRWA 3RJ5A 1DWOA 3ND7A 1OB2A 2ZIVB 1V1RB 3KJXA 4XLLA 3FCAA 3TIXB 3RS4A 1G8GA 1H65A 1FUIA 4P7GA 2G6BA 3VHXA 3VSBA 3G0CA 4PO8A 2Q3HA 4PHTA 5DK6A 2C77A 5LSAA 2VT3A 2WKSA 4IIDA 4DJ5X 1TU0A 2LCFA 5SICE 3UA3A 3UHAA 4FWIB 3NOQA 4I50B 1JR6A 3K32A 4UE6A 3TD2A 3IS3A 2W90A 3G79A 3GG9A 2PUJA 3M70A 3N8DA 4IF6A 1V45E 5SYMA 3LT0A 4GZ5A 3RTEA 3U7FB 1DC8A 3STTA 3BERA 3P9NA 3QFTA 2EBHX 2KMLA 2VK2A 3IQDB 3QXHA 3JQBA 4NOJA 2OHIA 1DPFA 1P1FA 1ZH8A 1C4KA 3Q87B 3RC3A 1A9YA 2MIIA 3OOYA 4IHJB 1CYDA 3HXPA 4UPEA 4RDHA 5DYWA 5KDDA 1J22A 2I55A 1UJ6A 2RFLA 5AK0A 2Q7OE 4CTJA 5FWYA 2GHIA 3HDHA 1PNQA 3EARA 3K2EA 4NJEB 3RUEA 1IU9A 2CNNA 5ISMA 2DUMA 1F8GA 1XZFA 1GZ4A 1LDMA 4EY5A 4NLLA 3WZ2A 3GIWA 4F8YA 4XYLA 5F23A 3GLFA 1RXEA 3KB6A 3UK1A 3NFYA 5H02A 3OZSA 4G86A 2C9BA 4OMDA 1UDBA 2XCSB 2QVGA 1Z5ZA 1KFKB 4U6SA 5CH3A 1HKHA 5JJLA 1YC2A 3D3KA 2J7PD 4OHVA 5CVJA 5DI3B 4AD8A 4KQJA 1YB7A 3C3DA 1QGUA 2WYWA 1PJCA 5B5SA 4UHCA 2I7XA 1UT8A 2ZIWB 2E4WA 4MKXA 1E79D 1B26A 1XU9A 1IG0A 3H8VA 1J42A 2ZBPA 3QVWA 3NNSA 1L5HA 3BAFA 3H1GA 5AH0A 4EI7A 2FZVA 2GDZA 4M9RA 3SXJA 4GYJA 1U8ZA 3P4UA 3FKSD 4HH1A 2PXCA 4U63A 2ZIXB 1GYRA 4GOXA 4KQHA 1IZYA 1U65A 2BP7B 3H2IA 1BU8A 1N2SA 4YP6A 5HMLA 1JFVA 4N5DA 3BCRA 1LFDB 1TT5A 1L1EA 2A0XA 3D2BA 3BJMA 4QEDA 1AXRA 1WW3A 4WOBA 3SF8B 1TT7A 2ENUA 5G40A 1ESMA 1OLSA 2YBEA 4H27A 4J03A 1ABBA 1H3EA 3RHFA 3P27A 1Z4IA 2B61A 3PXAA 4GQAA 4KN9S 3H0KA 4F1KA 1XWFA 5DP2A 4YUWA 4IJMA 2ZSBA 4J0IA 2FP3A 2ZI5A 1RHQA 1TQDA 1JLLB 2OHXA 2AN4A 2FPIB 3IPXA 1JPNA 1AS2A 1KAHA 1OV4A 1UF9A 1QGDA 2P5UA 4RPJA 3MQ2A 1O0BA 3HBNA 1T8WA 2WWXA 3NYRA 2I4TA 3HJHA 3TZBA 4BMCA 4OOFA 5KNLA 2WB2A 1WHTA 1ZUWA 3BEOA 3ZU4A 1E9CA 1PV1A 1XCMA 3QUAA 4INJA 4JI4B 1Z37A 2H9IA 5A4MS 2JLVA 4RMHA 1UOQA 1EUCA 4QFCA 1KP9A 1KWGA 1KIFA 4MP8A 1RYDA 3IP1A 1HEUA 3IQWA 4MX8A 4AJLA 3V46A 4NE9A 4AZWA 1EX7A 3W9BA 4HB2A 3HU5A 1RMQA 3CUKA 5BNWA 1SK9A 2VZ0A 1E3EA 5FLXA 4H0NA 1YHYA 2KWIA 2QYTA 1GNRA 1G7TA 3MINA 6REQA 3P2JA 4DVGA 1XZAA 3IMCA 3LZ6A 1U1DA 4JOBA 4BBAA 2N0SA 3OQBA 3L3BA 4OBWA 4OBBA 2ON6A 4MJXA 5LBTA 5A7GA 2ZUBA 2A0WA 3THYB 2JASA 3UUEA 3DM9B 1T8PA 1C3LA 1LF0A 2CHEA 1TM2A 3WV5A 2H11A 3TGWA 3L06A 5TNXA 4CT4B 2J3HA 2JCBA 2QSYA 3N8IA 3TZEA 4E4RA 4JL8A 2V7QD 5CT4A 2IU0A 3FFAA 5CITA 1KWKA 3NW9A 2EKLA 4PCLA 1L5SA 5EJMA 2PX8A 1DC6A 2FUG6 3HADA 3NPAA 3SZ3A 2GK3A 1DIAA 3ZH9B 3GY0A 2RHGB 3OUZA 1EVIA 2VSFA 2ZUCA 3GLHA 2J3JA 5EEHA 4Y2TA 1EIWA 1XJ0A 2FWPA 2O2YA 4WNAA 2ADOA 4CF7A 2Y27A 4IAOA 3OEHD 3PEFA 3A3PA 2A14A 3PQ2A 1VL5A 2QI9F 4LY9A 2IPXA 3AR5A 5D3MB 2FPGA 3VTZA 3SZLA 4B1FA 4B6RA 4DC0A 1X70A 5KU7A 4EUKA 2JATA 4C2UA 2Q3BA 1QHFA 3OPXA 4HPWA 4FSHA 3P52A 1Q17A 4XE5A 2IHJA 3NHYA 4FFVA 2R6JA 4NI5A 2W6JA 1QYIA 3I6BA 1VG0B 3S1SA 3D6NB 1RAEA 4N39A 2BR5A 2DFTA 1WW2A 4X7BA 3R9XB 5K05A 5TIIA 4U6NA 3RR2A 1E1NA 1T9GR 2XVYA 3NS7A 3N8GA 4L8WB 1CW2B 3B6KA 2P6MA 3BEDA 3QNUA 4JOSA 1TVMA 3GUHA 1RCFA 5B3KA 4OQEA 2W6CX 4HS4A 4RK4A 1FRQA 4QU8A 4NZPA 5A62A 2E7ZA 1AQLA 3I3SR 4DW8A 1MNQA 4YRKA 5BPFA 5CIYA 3B6IA 3W2IA 3V1NA 1PGQA 1X1BA 1JZTA 2YWHA 4LX0A 1KI3A 3URMA 3PTZA 3VV3A 2DUNA 3GJYA 4D3YA 1AE1A 2FG7C 2LZ0A 2WJZB 2WM9B 3DEYX 4BMOB 3CT4A 4UTPA 5JAZA 1E1RA 3WE7A 3N5KA 1Y7HA 1I3LA 4Z0TA 3V1LA 3B9RA 2O3JA 3OZAA 1PZXA 1E3SA 3W9UA 4WXRA 5ENVA 1ZN2A 1OQAA 1YKSA 1MO2A 3M7IA 1ODJA 4P33A 4RSHA 2G9QA 1L5FA 4IRXA 1VYVA 3E7FA 3BKWA 4WMLA 4XJXA 1T3HA 3Q6NA 5ALTA 2D13A 1PP4A 3E22A 3HKBB 1DEXA 3ZGYA 3UWKA 2O48X 3WISA 2EFDB 2D7JA 2QN2A 1KEEB 4HQKA 5JFGA 1U2EA 4WTOA 2NSYA 2O23A 5B1DA 3UNXA 4ED9A 1C9EA 4UHJA 4B43A 1H66A 2QJFA 4IR7A 4KQWA 5IWCA 5KWVA 2C9CA 1LEHA 4EI2A 4RVOA 3EBPA 1K86A 2POCA 3MS7A 5C0OE 4D46A 1O87A 4X6UA 5L4NA 1EUYA 1E61A 3N2LA 4JNCA 5JO0A 2WJWA 3P9PA 4MRMA 1QPBA 3KTAA 4EYEA 2OM2A 5K2MA 4GPAA 2VPTA 1Q16A 2CDNA 3AETA 3OPNA 5LQUA 5BURA 1MBZA 3EXHC 4TV9F 2C7RA 3IBTA 4YMLA 2NZVG 4KBYA 2OFFA 1M74A 5C8YF 1OX6A 2AS0A 1XQ9A 2A78A 2GVNA 2IYEA 5CUQA 4O1IA 3TEJA 2I3GA 4RSGA 2IW3A 1R0RE 2GBLA 3CXRA 3BJZA 4O25A 4LGVA 2IXAA 3O3OB 3OX3A 2O8FA 2ZBUA 3OICA 3AL3A 2EGUA 2G9UA 3ML1A 4ZU1X 3ANYB 4HFNA 4DYDA 5GGXA 4RPGA 1PK9A 4I55A 3UMBA 4XWAA 1E7MA 3HUEA 4R8MA 2ZSEA 1DG9A 1SKUA 5F64A 1U3WA 3DTYA 4JQOA 2DWCA 5DYNA 5F9MA 4B09A 4CL3A 3P71T 1XTPA 2CLEB 2PKRA 5AW1A 1Y81A 1Z56C 2IZ6A 2AMLA 4HQFA 3MSCA 1DWPA 3MIIA 1MEJA 3M2TA 2UXBB 2YJTD 1OSNA 4MJ7A 3U7QA 4WKOA 5EJ4A 3A58B 3TKAA 4RM3A 3RWOA 2C8VA 2UYQA 1WS6A 1XLWA 2A4MA 4FHDA 1NW7A 1SBNE 2AWNA 4POOA 1Z4QA 4D44A 1O94C 3JATA 4C43A 3RWMB 4OGGA 2WUDA 1LPAB 3CC8A 1TM3E 5EZYF 3TI7A 5MDHA 4IJWA 3C3YA 1ULHA 1MX1A 3HL0A 5CCEA 2OXIA 2FJPA 1QYCA 1SU7A 3HKEB 4FKZA 1DTWB 4L50A 4LXHA 4UBKA 1E5TA 4UE3S 1MXHA 3AF2A 4N8DA 4JI0B 2AZTA 4MV9A 3JPWA 2R0QC 1OHHA 2FHPA 1JFSA 4DV2B 2YV2A 3GC6A 2O2CA 2H18A 3NBKA 2D5CA 3VKVA 2REOA 2HJWA 4CQLA 3OI7A 3AVYA 1I51A 1M8FA 5CVUA 3ZTWA 1VP3A 2HA2A 3VKHA 2B2NA 4INOA 5EWJA 1E3LA 3X1XA 1AC5A 3IQFA 3WGZA 4CCYA 2PV7A 5J40A 1KFCB 4CIAA 1L3BA 5B1YA 3J81k 4IJ5A 4JODA 2XCLA 1K08A 4Q1BA 2BUBA 2V4MA 1RCUA 1AXEA 2GCOA 3W9SA 2XQKA 3DFFA 2XY4A 5IK2A 3WTCA 3CM0A 5BMVB 1UQTA 3D81A 4NMWA 2BDUA 2PA3A 5TMEA 3DOEA 1Z0KA 1NC3A 2P2CA 2PGAA 3DMNA 3OWOA 3O8QA 4NVRA 1N4AA 4GP6A 5KNCD 5H80A 5IBRA 1FUEA 1R5NA 3NP9A 2CNDA 4BV8A 1Z7BA 4X60A 1Z6AA 2IUEA 2OYSA 2GN2A 2NZUG 1Y9ZA 1UODA 1KHHA 5I7EA 4REMA 3SYRA 1UXKA 1AQIA 1SEVA 1V4VA 4R8LA 4WLNA 5BUQA 4JUIA 3IC5A 4EK9A 2ZJ4A 3BL6A 3OMWA 3P2MA 2CWWA 2WF6A 1P1RA 1C9YA 5GGYA 1OLUA 4R0VA 1D7AA 3QLVC 2ZAOA 1Z6XA 3R3UA 3TINA 2IF2A 3R0ZA 1VDMA 3PVCA 2C78A 4AAYA 4Y0AA 4IHQA 4QUHA 5C35A 5JW6A 4R2KA 1OIWA 3BGVA 3P0FA 4F91B 1J7KA 4LFBB 2HV9A 3IUYA 5COBA 4IFTA 5MFPA 3FTEA 1V8BA 2J3DA 1C9JA 4PV7A 1ISSA 2P77A 2DAPA 2PSHA 1LBSA 4EY3A 2OKCA 1XLTA 2GXUA 3DBVO 1A9ZA 2FMTA 3KJIA 4LVOA 3HXMA 4QDZA 3OCXA 2O14A 3OT1B 1RM4A 1RJDA 3AVVA 3RYHB 4J0JA 2ZTUA 3EDOA 3GJ0A 1V9SA 2WM8A 4RD1A 3QNWA 3SHQA 4E22A 1PQPA 4W99A 5ALGA 2OHOA 3VUFA 3HE3A 3WRXC 3ZDYB 2OBMA 3PA6A 4QG3A 4MA0A 3AVTA 2NW6A 3DM5A 3AFHA 3Q3CA 2VCYA 3NXSA 4TVBA 3RREA 5IEJA 1RZRA 5EN4A 3JV7A 2ZYIA 1Z7WA 1SC9A 4IJKA 4NK5A 1C7EA 2A33A 2WJGA 4KI0A 3QYAA 1ZO8A 1K89A 4DXHA 4R8RA 4OHMA 1YQWA 1P2TA 4LBYA 2DY0A 3WC4A 3LGXA 3PGKA 4E12A 1I6WA 1A7AA 5U4XA 4H15A 2FFBA 3L0SA 4JR2A 2PR7A 2PN1A 4CODB 1CVLA 2B4AA 4D3XA 1E6MA 1FDWA 3IIIA 1E89A 1UP6A 4M0MA 821PA 1CUHA 1IJKA 2N47A 2R4UA 2YKGA 1QV9A 2RMKA 1QH9A 2YS6A 4OPMA 5JQGA 5K4HA 3R9WA 2FP4B 5BQXA 4HVCA 2QUIA 1J06A 3LVFO 1N36B 4NU6A 1TYDE 4TMZA 2NU8B 3DE2X 1VJGA 5K3EA 3ADBA 2A57A 2JBAB 3EVFA 1SZCA 2WE8A 3CUSA 3GEDA 5JI2E 3VVLA 3HO8A 4L0DA 4M0PA 3P32A 1HDRA 3PNSA 4KV7A 2O8EB 1C81A 5HFNA 4MPJA 3I12A 3MYRA 5G02A 4G4IA 4JA0A 2V6GA 5TARA 2JFFA 5AM3A 1XN1A 4XSGA 1RQ7A 4QTXA 4Z9XA 4RWEA 1SC3A 1MAWA 3L5OA 2Z2XA 5AOAA 2RI6A 5A4FS 3FNRA 3F97A 5JZMA 1V48A 1ZEJA 3IO5A 1RPJA 4R0NA 1NQAO 2L69A 2O2EA 1PWXA 3BGDA 3NZEA 4H59A 4BZPA 2RK6A 3WGVA 1O54A 1V5WA 1LX6A 2B21A 2QG6A 2QQ5A 1SOWA 4IH4A 3EXG2 5LDGA 4MQFA 3N7TA 1Q2XA 4FWTA 3KUCA 2O4CA 5LP6C 3OCCA 6ABPA 3C1UA 1R4MA 3G9UA 4JHXA 2AUMA 4WBNB 1ZGZA 3HCOA 1Q57A 1IAVA 1E7SA 1EB9A 2AXNA 4IGEA 4Y7DA 3PV0A 3RS2A 1R16A 2NO1A 4WINA 5KTTA 3PLRA 3VSDA 1ZSVA 4WV3A 2G06A 2W2MA 4QOSA 4A0RA 3ZDCA 2P78A 3DTVD 4ECAA 2BPOA 2O06A 1Z6YA 2BEJA 2GOYA 4AF6A 5CAEA 5CDSA 1CG6A 7AT1A 2V7WA 3VYVA 1O9HA 4MVJF 4GFDA 4RXMA 3SQWA 2PKXA 3ZHOA 2HQSA 1T4BA 3A9CA 5T64A 2O3SA 4Z53A 2QU7A 5FB3A 5L6MB 3ICWA 3ZY5A 1ZH6A 1JHUA 1QIDA 1OWOA 3HLTA 2RBGA 3L6RA 5HJ5A 1D9ZA 3CBQA 3I09A 4XB1A 5JVDB 2NQ8A 3E27A 4JGIA 2OV4A 3DE4X 2HJVA 4PXYA 2GB4A 1SIOA 1U9IC 3P0IA 1KSJA 1PVVA 3G1UA 3KVNA 4LW8A 3U44A 1RAAA 4UQLA 3HEMA 5EHIA 1DKMA 1OA0A 1TMGE 1VLZA 3C8MA 3LO8A 4FDVA 4MYDA 4N3CA 3FGPA 2ZPTX 3EFHA 2IDZA 3WIUA 1HXHA 2BI4A 4JCOA 2LKDA 3GUVA 5TXGA 4B5LA 4URXR 5JMTA 3O8BA 2ODAA 4PFSA 2HFJA 3PCRB 3HCAA 3QBEA 2JIQA 5AVUA 5AKGA 1LSSA 3AVOA 3WMFA 4OJNA 4FGSA 1L4EA 2FWRA 5IW8A 2Q4OA 4EY8A 1BDBA 1OJLA 4PC6A 2P6PA 2B1GA 3LPAA 2EJUA 3ZZTA 4IUDS 3CZ5A 4KH0A 3GU3A 1X92A 4EATA 2WMNB 1YJ8A 2HHCA 3ZGOA 1FE8A 3G2KA 3N2KB 1BGXT 2ZU6A 3U26A 2G72A 3IUEA 1F0KA 1TYZA 4RE6A 1UXIA 1KZ6A 2DE0X 3LY9A 4PIMA 3DJYA 3N39C 4D82A 4HBZA 1BMFA 3F71A 1CHDA 1PDWA 4W7HA 1V43A 3ZHCA 2QMZA 1VKRA 1ZMOA 1V5IA 3E9CA 4MP6A 3UAOA 5JEDA 1J2TA 1YCGA 2XI4A 3HLKA 2UVPB 3MJHA 1GZ6A 4QDKA 4DM7A 3DAOA 1KS9A 3T5GA 1GL9B 1OBOA 1R66A 1P4JA 3GUZA 4PQFA 1USIA 1ZW6A 4HH4A 1HETA 4GUAA 5JASA 4RBNA 3FCXA 1T43A 2AL7A 4YRTA 2P2YA 4KZKA 1BJTA 1U0RA 1YZTA 2HX1A 3O2NA 3ONVA 4LBWA 2DR2A 4EVQA 2EZUA 3DZFA 4IPTA 1LI4A 1XRMA 1Q0SA 1XFDA 2R6GA 2VC2B 5DNDA 1SXJC 2FOLA 4AJHA 2Q62A 5EP3A 3WQQA 5IABA 3K6JA 1FX1A 2J9YB 4W9NC 4BO7A 3LFUA 3OC0A 4I9NA 1SY7A 1L6IA 1YZQA 2NTYC 4MWTA 3W8RA 1CCWA 5JIBA 2VEDA 2YY6A 1P29A 1SG9A 3G85A 1HE2A 4P54A 1FTGA 2I2WA 1XLVA 2M6KA 1OKKD 5K8TA 3T5PA 1SPXA 1OV6A 1RVDA 1XSEA 2C9MA 2P2SA 3E9ZA 4CN9A 4L6CA 3JAKB 4NQZA 2QEQA 3CIFA 2AQHA 5E7MA 1DC3A 2ZSJA 4AJOA 3C3EA 4GKJB 1TJ4A 1C3OA 3L05A 4D3ZA 3IV9A 4B3DA 4A23A 4X00A 1AZSC 1R4NB 2ZK7A 3BD9A 5CTAA 5TQVA 3WLQA 1N3IA 2AG5A 2A4KA 1F2UB 3NHKA 2IBMA 2VTEA 2JBHA 5JUWA 2PFKA 2O8CB 1W8DA 2G1JA 2BFOA 2VZLA 1O2DA 2FJ0A 2JAWA 2HEIA 3LGSA 3LS2A 4LE0A 1SEPA 4YP0A 4S24A 1NOKA 1BYUA 2M1XA 3LYAA 1A5BB 4JJ7A 4RPKA 4WASA 4Y9TA 2REBA 3ZHQA 3NIGB 3ONDA 1GGVA 2FCAA 2ZS7A 3A6DA 1GUDA 2H4XA 4JBLA 4ZK6A 5HXAA 1Y8QA 4MSUA 1TZJA 3E7XA 3R8XA 3BD6A 4DLPA 3ZNQA 1W4CA 5F4BA 1GNPA 1HY3A 4MRAA 2KQUA 4PZCA 3UO8B 1P19A 1W2WB 4XDZA 2ZZMA 4GX2A 5CCXA 2BFCB 5A05A 5KQSA 2W6PA 4BO0A 3S4YA 3I52A 4UZSA 2N9UA 1GZVA 2YC4C 2VEOA 4OBXA 3AJ9A 1ONNA 1ECBA 3HMQA 3WJ7A 3QEBZ 1DV2A 2FEXA 3N2YA 1AQNA 1THZA 4QPJC 1EDEA 5EZ5A 4ER7A 1G63A 4HFRA 5JCZA 2A9KA 5K7SA 5KNBA 2GX6A 1WY7A 2JDID 3CPJB 3COZA 3PVSA 4ZT6A 2GJKA 1XP5A 5JDIC 3OD1A 2V6MA 3AU8A 3H04A 2A9FA 3I9V6 1VM6A 2HF8A 5H70A 2OGZA 3ZU5A 3PI7A 4L8GA 4N9WA 4Z8YA 5KX5B 1Y1LA 1SHKA 1TZBA 4RK1A 4YMIA 3EC2A 4J0GA 5ESXA 1XVUA 1BCRA 1W5SA 4IYRA 2OTCA 3E05A 5AI9A 1O4WA 5T4EA 3VR4H 5KJ6A 2ATIA 1C1XB 4X3PA 5JY6A 3CRNA 3WP0A 1H6AA 5AJTA 3NP7A 1YZLA 3Q88A 4LJ8A 2XDAA 1P2DA 3LT2A 1K6IA 4J16A 4PWYA 5F35A 5FNVB 3C7CB 1CJVC 2OQIA 2IL1A 4JI5B 1MB9A 1CNFA 3OOHA 4Y1RA 3LT1A 2IITA 5DB4A 5L7TA 3MWJA 1KQOA 2IGTA 1WSWA 5HNKA 2A92A 3KSDO 4MR7B 1N8NA 1QP8A 2ETXA 4BGDA 3EZGA 3OZCA 5K8JB 2RC6A 4QTZA 2YWCA 2X9VA 4JBWA 5I9NA 2A8YA 4BTLA 2F55A 4ETWA 4KXYA 4EKDA 3V42A 2DQYA 2XJ9A 5KYKA 3BBPA 1EDOA 1K5HA 4QJ3A 2EARA 4HDSA 2XMCA 1JHAA 1KO4A 3V9AA 2JCVA 1U7XA 2K5UA 5BUSA 1OFIA 5JJ5A 1WDTA 1J7JA 4YP1A 4C07A 2X86A 1PZGA 4PTYA 2AXQA 2V6FA 4S3MA 4A6XA 1G38A 3EZYA 4DGQA 4RTLA 3LF1A 4FGLA 2Q5LA 2O1XA 3LMKA 4UUQA 1BMDA 2GAIA 2ZPAA 4PZEA 2QUHA 3RFXA 3DAGA 4KPGA 4NS1A 5FHQA 1SG0A 3A6FA 1INLA 3QI7A 5KNDH 1E20A 4B2IA 2H48A 2G8LA 4DCTA 4EJSB 4CE6A 4N7MA 2JAUA 2YNMA 3C3JA 3P26A 1E7QA 4XAQA 3U4HA 1V3VA 4I36A 3C6BA 2W93A 1YJ5A 2XGSA 4K1LA 3WK9A 3AMVA 3CTMA 3M5DA 1BQ4A 5AM5A 4KRFA 4M1OA 4CIYA 2PA0A 4DLVA 3L0BA 2IZ0A 3CLRC 4GQBA 2WWGA 2ZTMA 2WZBA 1JAIA 1GM5A 1QV6A 5HIIA 5HM8A 1RIFA 4U2CA 4BLSA 4X7PA 4WK4B 1E9DA 4DPKA 3E7PA 2FH5B 4S12A 4D4JA 5CBPA 5AXCA 1M5RA 4R54A 3NYQA 2IXDA 4RZ3A 3W7VA 5KOIA 3HRHA 1CQXA 2R85A 1GO2A 3LBHA 3R0QA 1M10A 3IR5A 1LWOA 1ORWA 2GH1A 4XH9B 5DJ5A 4F3TA 3IEPA 4NP6A 1HMPA 1M75A 4H35A 1FPMA 2C5EA 3T94A 3TAUA 4C1BA 3GRZA 4Q1CA 3W0LB 2JAXA 3CLTD 2AFIB 3KK0A 2WLTA 3Q0TA 1AN9A 2E37A 2DMRA 1Z15A 4H31A 1J0DA 1DVRA 4QHTA 4YFYA 3SNKA 3ZZUA 2Z95A 2EGHA 2DFNA 1PYOA 4Z4FA 4PNEA 4O8ZA 1CF9A 1K8YB 1IXRC 1KZ4A 1TFRA 1RJEA 2CY0A 3BMXA 3KJNA 1O4VA 2Q49A 2ZRLA 1XMXA 4IIGA 2W6ID 3GT3A 4X63A 5TSDA 2ATCA 1KYYA 3BXXA 1QCYA 5JYDA 3O2SB 4ZOBA 1JT2A 2DWUA 2Q4RA 4HP8A 3RUCA 3ZHSA 4YBZA 3HN7A 3EGXA 1WVGA 1Q7EA 4ZODA 5CVEA 1NLZA 4Q1VA 3G0GA 2D1YA 4D5EA 4V1CB 1VE7A 3OUUA 1J9GA 3K6RA 2AN5A 3EODA 5EZSA 1V1MB 4KQ9A 5U4QA 2P9HA 3NUZA 2A9JA 3GH1A 2WUFA 2CB9A 2PUFA 1TM5E 5A9RA 1WCIA 1PDVA 2OO3A 1KZHA 3H2GA 4QJ4A 1SZDA 4FONA 4KO1S 5JZSA 2WTAA 4CMIB 3GCWA 5CB0A 4P3PA 3H7AA 2IEZA 1GG9A 1C14A 3ISJA 3N2NA 4AJ4A 5B58T 4RZXA 4BPBA 1D0VA 3X44A 1DAPA 3K8OE 4FCVA 1M1UA 3TYXA 4MO2A 4YI5A 5A4IS 3ER6A 3DVQX 4LSZA 4XR4A 1U9YA 3BH7A 2O2IA 3GEMA 1UKVY 5CDFE 2AC2A 4YIHA 1LRLA 3L1VA 5FL3A 3C74A 3Q12A 2E4VA 2P4HX 5EHGA 5BWNA 2H1IA 1HH4A 1LTQA 2W0MA 3EA0A 5TT1A 1O5IA 1OY1A 5DXFA 4PYOA 4M9XA 2FXVA 3C7KA 3CSSA 4TMXA 3TLCA 2GSWA 4X64B 5KTPA 3LXXA 5CM9C 5AI4A 3OHMA 4D92A 3DGFC 4Q7JB 3TQQA 4AKTA 3PDWA 3W2TA 4DABA 1JQ5A 2UUBB 1EHYA 4YRIA 3RSQA 1EHIA 4JN6B 5TF4A 3LVQE 4MV7A 4U7JA 3PT5A 4IIJF 1U0JA 4JC4A 1DJOA 2Z09A 1YMUA 3DZCA 3VO8A 3I9KA 2AOUA 1MW9X 2D00A 1FS4A 1Y7TA 1WV0A 4GR9A 3NHZA 3TB4A 1GDHA 4BGEA 2BT4A 2JIBA 1NG1A 4X6LA 4PHGA 1PR3A 2YWJA 4JLNA 4I9HA 4XWOA 2X0DA 3PYLA 1XZQA 3CUVA 2CGEA 1H4TA 2V7GA 4GICA 3V80A 5JAHA 1FB5A 1UBCA 1JDVA 3DDSA 2JEOA 1XD8A 3E0XA 4PZZA 1TQ8A 3PC2A 4LE1A 1MAUA 2KJQA 4KEAA 4P98A 1NVAA 2XDQA 1E2DA 5DM60 2CJFA 3COSA 1I2BA 1N5LA 1G21B 1NDQA 1RQ2A 3ASUA 2FXIA 2XTNA 3DL4A 3M4NA 5BW5A 3ZDXB 2J85A 1XQ1A 3OIVA 2X41A 1RCTE 3C6MA 2JVKA 3PNMA 4QOEA 2JFXA 3SOZA 3SYMA 5A5DA 1Q7BA 3MK31 3Q8MA 1QFZA 1P6XA 3L7MA 2XCUA 1NVVQ 2DFLA 3AG5A 3B6ZA 4LQLA 1V8DA 4AWXA 4BNZA 2C5GA 2JGDB 2M6LA 5I9SA 1JDNA 1I1OA 1NW5A 1X1EA 4B82A 4Z4QA 3WO1A 1MNAA 8ADHA 3ZGZA 2HMSA 3MTAA 4JBYA 3H84A 2BR4A 1W581 4RF3A 4O5AA 4IXNA 4JOQA 3ZJYA 2HRRA 4U7HA 3D3NA 4OYLA 3B1YA 1B4DA 1N25A 1Z63A 1RBMA 4XWKA 1OH8A 1ONBA 1DFHA 1Y4UA 3FPFA 3EK2A 1W0JA 2F6RA 3GA7A 5FI1B 2CJWB 1J33A 3E3MA 3H5WA 3M33A 2ZXEA 3TVDA 4AZ0B 4HAUA 4XX0B 2KPOA 2X8AA 4RO0A 4C2AA 3OU2A 1P33A 5KQPA 1WKBA 4PU0A 2O5EA 1E18A 1H2HA 1PW7A 3SVZA 1PFQA 2OCPA 3OQIB 1E60A 4A6PA 4RUKA 3BH0A 1G2QA 1FDOA 1YZFA 4CWAA 1TECE 1G6KA 4PLYA 3GJTA 5GAJA 4JI2B 2C1XA 2O0KA 3A1TA 4ZOLF 4J07A 2H2FA 3JQGB 1Y9JA 2JJ1D 2CUNA 3TOVA 5CT5A 1SA0B 3HVKA 3GJXC 1XPOA 3LQFA 1P3JA 2B8WA 2JLCA 3I9NA 4QRIA 4ZDJA 4FC7A 2QLBA 2JFNA 4BJHB 1K8ZB 5E6RA 4OTZA 3F9RA 4Z0PA 6YASA 1TUIA 1XZPA 4JROA 4NBNA 2YIDA 2R00A 4IF4A 4ENWA 2CNWD 2A35A 4HCJA 2JLQA 2OFPA 2ZYUX 1D5WA 3EY9A 1HZJA 1P3DA 4X1YA 3UT5B 1NVTA 4Z1MD 4KMMA 1IE3A 1N77A 3H5IA 3MGGA 4UJ5A 4X1KB 1OGIA 5CA0A 3H83A 2W6ZA 3E9YA 3UWSA 3AM3A 4Z3KA 3K2QA 2GILA 3MJVA 1HDOA 1C4OA 4O2BF 1G4AE 1ESDA 5C80A 5B6PA 1O96B 3ABRB 2WWVD 1SKBA 3HJBA 2ASEA 2DH5A 3QWIA 5G1OA 1JG6A 1R9JA 1K8XB 1NI3A 3NU1A 3JZIA 1Y1TA 5TGTA 1RYNA 4QODA 2JJ8A 3KPJA 3MW8A 4NNJA 1NVUQ 3KJEA 4ZARA 1OLOA 1T25A 1RZVA 1XN4A 1OI2A 1S2DA 2I6GA 1NSYA 3LL4A 3O93A 1E4VA 3PUZA 3THWB 3D3EA 4ARIA 1KARA 4WI1A 3EDYA 4ETMA 3LKVA 1OYYA 1ORVA 2XD9A 3TKYA 4KSCA 4GC5A 3F6SA 4W63A 4J75A 4GU5A 3NPMA 1KMMA 4ZZ2A 2OKGA 2PX3A 5G0UA 1UBMS 2XYPA 4A82A 2WSLA 4TLLB 4TQUS 4YJDA 4KZPA 1DHRA 1KJZA 3UJ7A 5I7OA 3FVVA 1QVVA 1JEEA 1MC5A 1DT5A 1QE5A 1Y3HA 1XTQA 2JI8A 2QTGA 2C0CA 2YZ2A 8OHMA 1TAHA 5HRAA 4KW7A 1C30A 2FPWA 1U9ZA 2VH1A 1H5UA 2YWGA 2VLIA 4NBRA 1CJTC 5JMPA 1GGNA 1W73A 3LNCA 2A86A 1CF2O 3PLNA 3I9FA 3NIFB 4HLNA 4Q93A 4WEOA 5H0IA 4CM4B 5I7HA 2DBRA 2XQGA 2YDXA 2Z8YA 3ZLVA 1E9EA 2XXJA 4X0EA 5TQ2A 2I65A 1M0EA 3I9MA 1F9AA 4I0WB 4IOMA 2EZ4A 4M7RA 1ZXBA 1HX7A 1O7JA 1SKQA 1RXIA 2HREA 1RWWA 3WLEA 3ADDA 5JH7A 4YRQA 4WIAA 5JBQA 1YWGO 1GA1A 2VVTA 3EG9B 4KR9A 1Q3KA 3B7PA 5JD6A 2Q3MA 3ZCPA 1S2LA 2Y1FA 4BLOA 5K8UA 1FFEA 2NUPB 1XPUA 2JFUA 5JCJA 1XJWA 3T1TA 2H2DA 2FVXA 3JR7A 1AF4A 1M6VA 2OC4A 2Z4TA 4UBJA 1OLXA 1T36A 3GNLA 1ZONA 4F4HA 1THGA 3HA7A 3K70B 1TJ5A 4K81B 3W05A 3WIVA 5CG1A 4ML3A 2RGDA 5JRZA 1R8QA 3GMSA 2CLHB 1JAZA 1ZMXA 5IXYA 3V3KA 3AQ4A 3QMMA 5TDHA 1E3WA 3ZUPA 4EKNB 4EPYA 2D54A 3QVVA 5D00A 1XCOA 2C3PA 4XA8A 4KX5A 5F5NA 5GJWC 3LAWA 2VNJA 4QBTA 4GEKA 3SPXA 2CUZA 1Q0TA 3CX7A 5FAKA 3FW1A 2Y92A 4XFKA 2Z9DA 5A6SB 2HSZA 2VYVA 1OBFO 2RGNA 4FB5A 621PA 5SY6A 3VYWA 2HU5A 4DMMA 1BE1A 2XHEA 1FX0B 1ZK1A 4UM5A 1RR6A 1Z8FA 2UZ1B 3GNTA 2VQ3A 1IIRA 2VS1A 1Z4LA 3QW2A 4XJVA 2PYZA 1FXSA 1GZHB 2JW5A 3QVGA 3MLBA 4HNAB 1GEEA 2EVWX 2QT9A 5BY2A 3NNDA 2FI1A 1P2BA 1JLMA 2XRMA 4V0ME 5AW4A 3O4RA 5JCXA 4U8HA 4JT8