4RK6A

Crystal structure of laci family transcriptional regulator ccpa from weissella paramesenteroides, target efi-512926, with bound glucose
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
274
structure length
270
Chain Sequence
b'RVVGVVVPLIHTNFADEIIKGLYETTISSGYELLITYLDEDEDHQYQVFQTLLSRQVGAVFMLSLDIPSWMIDKLLEEQISVISLTALLSEQISAVTSNEFEMMNSIVDYLIDMGHKNIALVGDTKLTTNISSTRRTNFIKSMTDHNLAYENIFLYGNDHSYETGYTSVTTGYDINQLPFTAAIATADMVGQGLINAMSDHGKTVPEDLSIVTIDGLQQTEIARPKLTTVKQDFPEIGRIAMQLFLDSDEPQIIYIPTELIQRDSVLNLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-resistance amylase regulator
publication title Crystal structure of transcriptional regulator CCPA from Weissella paramesenteroides, Target EFI-512926
rcsb
source organism Weissella paramesenteroides atcc 33313
molecule tags Transcription regulator
total genus 82
structure length 270
sequence length 274
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk6A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4rk6A01
3LUDA 1NXTA 1JBEA 1NTRA 1DCMA 3LUJA 3N75A 3KYIB 4F12A 5HQJA 3RVLA 1ZH4A 3GT7A 4Q6WA 2Q5CA 4KFCA 4MGEA 2HQBA 4PE5B 1AB5A 2R4QA 3IPCA 3O2SB 4NQRA 5IX8A 2MSWA 3SY8A 2HSGA 1BDJA 2XDYA 4UHJA 3C6QA 3OLXA 4RK5A 1M5TA 1ABEA 3H5LA 5KQMA 4OG2A 4KV7A 5FBKA 4OLAA 2R48A 3F73A 3KLNA 3NNSA 3LUGA 2J48A 4Z0NA 1PNRA 1NXOA 1PUXA 2E4VA 3CNBA 3LUKA 4OBBA 2CHFA 1YK0A 3D8UA 4RKRA 5EWMA 1ZY2A 3BBLA 1QNLA 3SG0A 3TO5A 4FE4A 1M2EA 1ZDMA 4LE1A 2FQYA 5BRJA 4Z4FA 4N76A 3CHYA 2PAFA 4ZPJA 4Z4HA 4KVFA 1P2FA 1TVMA 2GI4A 5EWMB 1JFVA 2H0AA 3RVQA 1RXIA 1AB6A 2LUOA 2YHBA 3DBIA 1URPA 4QYMA 3OQMA 3T95A 3Q7TA 5JS1A 3SAJA 5KC9A 3TX6A 4EVQA 4RXUA 4KNYA 3QX8A 4JOQA 3CFYA 3H75A 5TQ0A 2JVKA 5TQJA 2IPLA 1QP0A 3DGEC 5KWSA 3M9WA 3OQNA 3OLVA 5DKFA 3IP6A 1P6UA 2HJ9A 1OXBB 4Z4CA 1NXWA 4G0PA 5JNVA 3NNNA 2E4XA 3CRNA 3F6CA 3NBMA 3Q7RA 4KK3A 2MSKA 5IEBA 2L2QA 2JK1A 2QXYA 4XASA 5DLEA 3KLOA 1DCKA 1JHZA 3RVOA 4XFKA 1BDHA 4HNRA 4F8JA 3LUAA 4N41A 1P6QA 3P9YA 4RWEA 1USKA 1SXGA 4IGAA 3O1JC 3RVNA 1KRWA 1A0OA 3G85A 3CTPA 2WJWA 1NXSA 1UDRA 4S04A 3CU5A 4GPAA 4ETMA 1JLKA 2KYRA 5IUNC 3QLVA 1ZH2A 4KQCA 1NATA 1EFAA 4F3TA 5CHYA 1YIOA 4QYWA 4JAVC 3A0RB 3KKEA 1GUBA 2YHAA 2B1JA 2NZVG 4W5OA 4WT7A 4YGXB 4YV7A 3GBPA 2FMIA 2FVYA 4IMJB 2BGGA 1KGSA 1DBPA 2FKAA 2RJOA 3EDCA 3HS3A 5FBHA 3DLHA 1MVOA 1JWLA 1XHFA 4YRZA 1FFGA 4Z99A 4DADA 4MLCA 3UUGA 1DJMA 2WWVD 3EQ2A 3C3MA 4RK7A 5HKOA 3RVSA 3FFTA 3MYYA 1U2QA 1JYFA 3N0RA 4Y9TA 1CEYA 3HSYA 1D1PA 1M2FA 2A9PA 2MYPA 3H1FA 3IP9A 3E3MA 3UK0A 2L19A 3KG2A 4UHKA 1NXXA 2AYXA 3FFWA 9ABPA 3CKMA 2WJAA 3IDOA 2QSJA 4XAQA 3GL9A 3H1EA 2E4UA 2P9HA 4NCAA 4KREA 4D6XA 1YK1A 5C5EA 1FQWA 4N03A 3C3KA 4WZZA 3EODA 3LUCA 3QELA 3GWGA 3KYJB 2JBAB 4LX8A 4OTZA 3T38A 4W5QA 5BQ3A 3GRCA 1EWKA 3JPYA 3Q41A 4G86A 4NCBA 1E6LA 2ZWMA 2IYNA 3H5WA 5KI6A 3ILYA 1EWTA 2W42A 4LE2A 4MS4A 3OLWA 4D74A 5JNWA 3HXMA 4PYRA 3GV0A 1RZRD 1LJUA 1GCAA 1Z13A 2PLNA 2RGYA 2TMYA 3QELB 2LP4Y 1YS7A 4HNQA 3ROFA 1PEAA 2V0NA 5TPZD 1D4ZA 5IC5A 4MQFA 2CD7A 3LFTA 1NY5A 2IDMA 4RXTA 3URMA 4MS4B 2PUDA 1CYEA 2O20A 3BREA 4OLBA 1MAVA 4IILA 4XXHA 1DRKA 2FSPA 4O1IA 2JVIA 5C5CA 3FMVA 3IPAA 4RY9A 2FMKA 1BAPA 1ZITA 1LJLA 4MQFB 4Z4IA 2QZJA 1JH9A 2FEPA 1E2BA 4QICA 4JB2A 3D02A 5IUJC 2N9UA 1GUDA 4YP9A 2IPNA 3HDVA 4LRQA 3H5TA 1F4VA 4G97A 1ZGGA 3N8IA 2QW1A 4G0MA 1K68A 4TN5A 5JS2A 2L17A 3RH0A 2FLWA 5T3YA 1FFWA 4LDAA 4KPYA 4NICA 3JVDA 1PHRA 2F8TA 4KRFA 2QVCA 1KRXA 4NV3A 5PNTA 3KSMA 3H6HA 1W9HA 3KTOA 2H3HA 2JB9A 4RK0A 3HJFA 1JDPA 2VUIB 3OLYA 1RPJA 1VRVA 1LK0A 3CLKA 5IEJA 4WXMA 1NXPA 3LKBA 1SRRA 1D2AA 1KMIY 3LUFA 5KC8A 3B2NA 2FTKE 3RQIA 1BVHA 3H5OA 1K66A 2QR3A 4Z9BA 4WXEA 1MB0A 5B3JA 1JX6A 5KQLA 3HZHA 1MIHA 4F06A 4YCSA 2E4WA 3NHMA 4ETNA 3K9CA 3CZ5A 3ILHA 5TQ0B 3QX9A 1TLFA 2CHEA 4H3HB 4YO7A 4EYQA 3SM9A 3R0JA 2DRIA 1RNLA 4XARA 3HM9A 4H60A 3K4HA 3VNBA 2NZUG 3Q9SA 1R8JA 3HV2A 1Z15A 3S99A 2L18A 1ZAYA 2FEKA 3IP7A 3OQOA 1ISSA 1YMVA 1BDIA 3T8YA 3HO1A 2A9OA 3EJWA 4MR7A 2WMYA 4ZYLA 4Z9AA 2E4ZA 3LTEA 4DQDA 3M9XA 4KK4A 1Z16A 1JFTA 2A9QA 3TB6A 4YLEA 2CWDA 2JCGA 1ZHHA 3HCWA 5TE9A 1U0SY 1Z25A 1H9CA 4N0PA 1QQBA 4YR7A 2ID9A 1DC7A 4MR7B 1MB3A 2IPMA 4EY3A 1GCGA 3O21A 1ZN2A 4HNSA 1DG9A 3RVKA 4O1HA 4KZKA 5D2CA 5T7BA 3Q7SA 3LOPA 3QLUA 3HVRA 1GLGA 4MRMA 3RVPA 5CNJA 5FWXA 4MQEA 3NHZA 2OQRA 4RV5A 3I09A 3OM0A 4IF4A 3C97A 3A3KA 2R47A 4L4UA 5JNSA 4TLMB 1T34A 1USGA 3HUTA 1DBWA 2AYZA 4MRMB 5JNUA 5FWXB 3SNKA 2A9RA 3HDGA 4MQEB 2VK2A 2FLKA 3C3WA 3FFXA 5IBQA 4EVRA 1FSPA 1ISRA 2M1ZA 4N0QA 1QMPA 5TQ2A 2PUCA 4RY0A 1E6MA 2MYNA 2MYUA 3OLZA 4G0XA 1Z26A 3QLTA 2I6FA 3TD9A 2NT3A 1XHEA 3F6PA 4O5AA 1U8TA 1QQAA 4EGSA 1U2PA 1E6KA 4IMIB 6ABPA 1Z12A 3LMKA 3QLVC 1DP4A 3EULA 3GBVA 4MS3A 5TQ2B 1U04A 2WY2D 5TPWA 3UKJA 5CNKA 2WB4A 1LBIA 3QEKA 4TLLB 2FXIA 3O1IC 2X7XA 4W5RA 3DGFC 3SQNA 3OO1A 3MQ4A 4RU1A 5CNMA 3EQZA 3I42A 3NNDA 2VYCA 3MM4A 3KS9A 5FWYB 4KQ9A 5TPWB 4FB4A 2HPHA 2IPAB 3GA5A 1RXEA 3RVJA 3GYBA 1QO0D 3JY6A 3OM1A 5IULC 1SXIA 3CG0A 3O2QB 1B00A 4RXMA 5I4CA 3VNAA 1QP7A 1S8NA 3F7NA 3O2JA 5GQSA 5EWJA 4RKQA 3I5AA 1F51E 3FGZA 1P8AA 1VLZA 1A2OA 4G0YA 4E7PA 2NUBA 4TMYA 2FN9A 1JF8A 6CHYA 5E3JA 4ML3A 4MAAA 2JVJA 3N0WA 1WETA 1EAYA 2PUAA 1LBHA 2LIVA 5EWJB 7ABPA 1Y1LA 2FMHA 5DTEA 4RK6A 4W5TA 1W25A 3CG4A 3O75A 5IUKC 4D6YA 3O1HB 5JNTA 4L85A 4CBVA 2PL1A 2PJUA 4JP1A 1ZESA 4KMRA 3A10A 1VPWA 2FW0A 3KCNA 3JVIA 5JNRA 3N0XA 4Z4GA 3BILA 1L5YA 3L49A 4JASB 2LBPA 4WWHA 3OMWA 4RK1A 5FWYA 3MA0A 1VKRA 4G0OA 1C0EA 4H3KB 2VUHB 3N6VA 3KJXA 3JTEA 1D1QA 2IOYA 1SXHA 1M5UA 1YMUA 1Z2DA 3E61A 3LUHA 4EYGA 2LPMA 3KHTA 1EWVA 1FFSA 4MPTA 4DN6A 4RY8A 4YWHA 5BR1A 1YTUA 4PZ0A 4G0ZA 1DRJA 2PE5A 2PUFA 5ED4A 2R25B 4RSMA 5CNIA 4ZJPA 3W9SA 3ROTA 3HK2A 2QV0A 4MR9A 3H1GA 2HQRA 4RK4A 3QEMA 3JS5A 5GOTA 4LE0A 3O74A 1JDNA 2PKXA 3A0UA 1PEYA 4QPJC 2F8SA 4W5NA 1RZRA 1TMYA 5HM6A 3MIZA 1YVUA 4MR9B 2PUEA 1D5WA 4G0QA 1J56A 3IP5A 3CZCA 3QEMB 3T6KA 3QK7A 4S05A 5TPZA 1DBQA 4MR8B 2PUBA 1ABFA 3RVMA 1Z17A 2HQOA 4F11A 1DCFA 1JYEA 2B4AA 4ETIA 3TMYA 3G1WA 1TJYA 1YS6A 4YS6A 3DZDA 4LZLA 2FQWA 3EGCA 3LKVA 4E7OA 2QVGA 1QPZA 3MMNA 1EHCA 2PMCA 4FE7A 2FEWB 4Z4EA 1Z2EA 2WRZA 3DLBA 1QO0A 1QP4A 5B3JC 3Q15C 1Z18A 2NT4A 4PEVA 3HEBA 1HEYA 1JL3A 4JB0A 4M88A 2GKGA 3OO0A 4LDZA 4PICA 4GNRA 2MSLA 2MYTA 3I45A 2GWRA 3CS3A 4EUKA 2PL9A 4Q7EA 4EYOA 5HSGA 1ZVVA 2JBAA 4JA2A 5EWLA 1QKKA 4RZSA 5DGCA 1CHNA 1OXKB 1TM2A 3L6UA 5DCLA 1DC8A 2E4YA 2RDMA 3BRSA 1BA2A 1IIBA 4P1ZA 3MF4A 3N53A 4N47A 3H5VA 1XWWA 2M98A 1C4WA 2FMFA 1JFSA 2FQXA 5EWLB 4B09A 4MS1A 1NXVA 4RS3A 4EYKA 2JRLA 2GBPA 4MLDA 2ID7A 2FN8A 2GX6A 4XLTA 2ZAYA 5KQPA 4OATA 4MS3B 5F64A 1DZ3A 2RJNA 3JPWA 1SD5A 4P98A 2IKSA 3H5IA 1I3CA 4HYEA 4IRXA 2OENG 3M6MD 3OMXA 4MR8A 1PNTA 4MS1B 3FDFA 3HUUA 5ABPA 2QU7A 5BRAA 4ZMSA 1A04A 4RDCA 8ABPA 3BRQA 3QLUC 1L5ZA 4WUTA 3H6GA 1USIA 4MYRA 4ZMRA 3EAFA 1APBA 4Q6BA 5KQGA 2PUGA 4EVSA 1ZGZA 2P4UA 3RVRA
chains in the Genus database with same CATH superfamily
3U7FB 3PI6A 2DTEA 3FI0A 4MTLA 1WA5A 1NJSA 3KYIB 2AD1A 4ZGGA 1ESZA 4UHEA 4EITA 3L1JA 4QUGA 4EF4A 4PE5B 3LA6A 3KFXA 3OA0A 4HLUC 3TNFA 3IPCA 2P4SA 2YWFA 1Z82A 3HBMA 2EQAA 5K8CA 4WCDA 3SY8A 3GVCA 3JALA 4PPQA 3T41A 2X9VA 1IZ8A 4PLWA 1X14A 4D3XA 1N8TA 3HU2A 3QW4B 2POQX 1JFFB 5CT5A 5KHAA 3HJUA 4EZEA 5DOVA 1EBFA 1XZEA 3CUEF 4I6GA 4RHEA 4TMKA 4CZ2A 2C04A 1CUUA 4HTFB 3P4XA 4UDNA 2VHVA 3U7JA 3CNBA 3TSOA 1H22A 2C4TA 2Q3LA 4RKRA 1R16A 2BIFA 4KODA 3SG0A 3T9EA 2ZR9A 3W7BA 2H4HA 1UBNA 2A88A 4GG1A 3PDHA 1SUWA 2QNRA 4LN1A 4PZAA 4PYOA 5L95A 2PU7A 2PBRA 2SICE 3HBLA 5G1OA 5ILOA 5ALIA 1RFGE 2PKRA 3AT1A 4B76A 3AI7A 5K0LA 3TPZA 1P72A 3FOFC 2FFRA 3JQDA 1VLMA 1PR9A 1RWQA 1W1IA 4H27A 3MS4A 4DLBA 3ASVA 3WLTA 4OQMA 4QYMA 3BGSA 4ZN6A 1O8CA 1XCLA 1WPXA 5MFZA 2FZGA 4EVQA 3KKQA 3LPCA 3MLAA 3DO6A 1XEXA 4KJXA 2A6PA 3A6ZA 1NLYA 1R6VA 4NDZA 4C4YA 3MUEA 4CN9A 2Z1NA 4D8TA 2IPLA 3OIUA 1YCGA 2OHIA 1FU8A 3N74A 4OHFA 3WWCA 1Q7RA 4URUR 1C7ZA 3VDQA 3M9WA 1DKRA 4DWJA 1KDOA 3CT6A 3VKFA 3KX2A 2PD3A 3D3WA 2O14A 3MJRA 4G0PA 3IBTA 3N8HA 4OXQA 3WQBA 1WXDA 2BMAA 3ETNA 5AHXA 4G89A 5BN4B 5IEBA 4AUKA 2R85A 2P27A 3GNLA 3KLOA 3VSDA 1Z2AA 4RTLA 1JR3A 4TSFD 4ZV7A 1UAAA 1J33A 3P9YA 2Q2QA 1US8A 3PTLA 1O87A 3FM9A 4KJZA 3GZNB 2Z6AA 1XVUA 1MENA 1PZEA 2II6A 1Z38A 1NMSA 2WJWA 1VSBA 3C6BA 4FMDF 2CJWB 3WY9A 3UOGA 2JZOA 2P35A 3AG5A 1G20E 1XJWA 4PC2A 4UTVA 3KOXA 4O1MA 1WQ3A 2R6JA 2DFTA 5H4HA 3IEIA 2DC1A 4A23A 3G2LA 4X1IB 5EY5B 2BFNA 4PX3A 1R64A 5BQ5A 1JWLA 4HWSA 4BKMA 2W6ZA 4LZZA 3HL0A 1Z4OA 5H1YA 1C1XA 2EBHX 3D6TB 3HJHA 4KVGA 3OVMA 3DYIA 3D1LA 4EO7A 4F97A 2W98A 1TTTA 4FFMA 2Y93A 4XX0B 4X6YA 1U2QA 3ZWPA 3FTPA 5THKA 3I30X 4U6NA 4GQIA 1A7JA 1QZZA 1Z4NA 1T26A 1NW3A 2WC1A 2Y1FA 3UT0A 1IBMB 3LT4A 3USCS 4MKHA 4NEQA 1E4EB 1ZK3A 3IJEB 4YP7A 1T36B 4EUEA 1KJJA 1V16B 1X8KA 2Q4RA 2UYGA 1NVBA 1JI3A 2WILA 3O4FA 4IDPA 4O4IF 4R1PA 3G1UA 3ANNA 5KNCH 3C5VA 3D8RA 5ITZA 1EX6A 3U7QA 2GZ3A 2IUEA 2A2ZA 3H1EA 3R41A 4JBHA 1NRWA 1PJZA 3ZGLA 4AWXA 4DJFC 2JLYA 3ERCA 4BFVA 1VPLA 4DMMA 2VYNA 4WZZA 3UNXA 1G7SA 3GRRA 2WF9A 3O90A 1KP3A 4RZHA 2X8WA 2M1XA 4OTZA 3R7WA 2J3MA 4LISA 4QXMA 1XL0A 5IDWA 1RM3A 2OV2A 3GJRA 2XGJA 4EA7A 4HMQA 3DHWC 1H5QA 4ND2A 4MS4A 2IDKA 3GPIA 3PVZA 4GXTA 2W42A 4XIFA 1LJUA 2UZAA 3OH8A 2AXPA 1GKYA 2CFRA 2VCYA 4OXXA 3ROFA 4CTNA 3EIEA 1RT9A 4S24A 2VF7A 1QKJA 1DKNA 3CLUD 3IRUA 1D4ZA 1YULA 2QGNA 3NALA 5AHRA 3ZZUA 4BDTA 1BNCA 2HA6A 1IPHA 1IN7A 4N6NA 3IAFA 1R18A 5C32A 4J2OA 3DZFA 1ZXBA 4NJMB 821PA 5ALWA 1LTQA 3TW8A 4PS1A 5TV2A 3FF4A 4MVCA 4NCKA 4WFJA 2YMPA 3O95A 4JB2A 3KXKA 5AK4A 3SI7A 1DOZA 1PSWA 2IPNA 2FZLA 3ZK8A 1KZ4A 4I4TA 1N78A 2D59A 2H11A 1N5OX 1UOPA 1K7SN 3VYTB 2WWWA 5L3ZA 3PR3A 4G0MA 4DPKA 1OIXA 1H8ED 1EFUA 3ZGZA 5HQ3A 1RM5A 4EKNB 2YY7A 3RYTC 1AN9A 3FCSB 3JR7A 4L5BA 5EHIA 1F14A 4M8LA 3U1BA 1HDOA 2ZJ3A 4CM9A 3VYVA 1J49A 2ZW9A 2CXHA 5HFNA 3N7TA 3F5QA 1GZHB 2G5GX 4GYYA 3G8CA 3E9DA 3PHGA 3C8HA 1XVTA 4LK3A 3AUJB 4YQFA 3BWCA 3GJ5A 2HB6A 1T6XA 4US2R 2IIVA 4JLJA 1Q84A 1YUNA 3WC4A 5CLFA 2JAHA 2GERA 4UULA 3FR8A 2DUWA 3KOUA 1RAFA 1VXRA 2PAAA 4ZKEA 4K88A 2FX3A 1Q95A 1RQPA 2YZMA 2EP5A 2ZAMA 1VBKA 4JKIA 4RL6A 4CKZA 4G8BA 2G67A 2BFEA 1I1QB 4DUGD 3TF5A 5DB4A 3SMQA 1AKVA 1QDLB 5CDHA 1CFJA 4HZIA 5B3JA 2WV9A 3U62A 1D4OA 2O8BA 3ZY3A 4QWMA 4HH3C 4QX6A 5FCDA 1YB7A 1NX9A 1UBCA 2R00A 4GR4A 2NW6A 4LKOA 5TSDA 2WOJA 5K8JB 1L7DA 2J0EA 4ARZA 4Q3AA 1X92A 1X7ZA 2JFVA 1GSOA 2P9GA 7MHTA 3DB1A 1GITA 4LY0A 5KUTA 2VEDA 1XRPA 1Z15A 1UAYA 2O7NA 4MGKR 2VP6A 2O1WA 4PYMA 2TMDA 1GU0A 4MAFA 4GSLA 3SHWA 5COQA 1EFKA 3P9PA 2BF4A 1OWMA 2O2GA 4BLTA 1D2HA 2CNWD 2AFIA 2ZPUA 5BSVA 1QB7A 2YVQA 2DFVA 4TYQA 1IZ7A 3OEEA 1OC2A 2SKEA 1I13A 3K9LA 4KFSA 1IUKA 3CCFA 4MWBA 1S2IA 3EIHA 3DDZX 1XUOA 4INPA 1Z7YA 2GN2A 3OTIA 2PZKA 3GFSA 4LZJA 1MB3A 5AVUA 2WJ4A 3U1VA 3G49A 1WU8A 1VGQA 3GVIA 4C7KA 2J3HA 2JL1A 2QRGA 3NM4A 5ALRA 5EKDA 1EVIA 3L7BA 5H3HA 2BM0A 3QSGA 4RS4A 3LP6A 2P6NA 3I9MA 3EW9A 4R83A 3T3MB 2M2IA 3V8MA 5T7BA 3WLRA 4D6PA 1W36D 2NO4A 5KCZA 5KVCA 4P4SA 3D6FA 5ERYA 2WJZB 1J00A 3HQ4O 3AEUA 3DH0A 1ENOA 4IF4A 1MW9X 4OMDA 5C3UA 2OPHA 1K92A 3P9RA 4TLMB 1VIYA 4A1FA 3G0OA 4CUKA 1QFYA 3SC4A 1GCIA 1BVHA 1XZQA 1Z06A 4ZVOA 3C24A 4EDHA 3OOEA 5E3IA 4HLUA 2I3ZA 4I9GA 3KEMA 5JNUA 1D1SA 1YDEA 2YZ7A 4W6ZA 4DG8A 4MQEB 4ITUA 4YRJA 3OA2A 1IWOA 5CUQA 3FFXA 5AOAA 1Z0ZA 1RJEA 2H2DA 1TT5B 4UBLA 3HP7A 4JGBA 5C31A 2GUGA 5JCOA 3EIWA 3C1UA 4QUEA 4PXAA 2MYNA 4PLGA 3U3MA 4Z3KA 1Z6TA 2E4AA 1UADA 2EKDA 4L5AA 1J0EA 4G41A 1M8PA 3K9BA 3NR2A 4ZOAA 3NAZA 4B75A 1U2PA 4EGSA 1T8SA 2WTNA 2CFOA 2XUQA 3GLQA 4ERXA 4V02A 3FRJA 4KXMA 5AXBA 4N48A 1PX0A 2FB9A 2VAPA 3L0DA 1NTOA 1R4MA 3B12A 2IF2A 4HRVA 2AG8A 3MQ4A 3UY4A 3MJCA 1AK1A 3UUWA 3RS7A 1XFDA 4KPGA 4M76B 4AF7A 1GKUB 2IHVA 2VC2B 4GBED 3FNGA 1A9ZA 2JGNA 1NPDA 5C3MA 2JH9A 3OPVA 1KJIA 4K2AA 4JUDX 1N6RA 1HA3A 2EX4A 2OLJA 1BCSB 1ZGCA 3HCAA 4GKAA 1JKMA 3TDKA 1IQ0A 1QO0D 5FLKA 1MIOA 1PV1A 1T1JA 5FI5A 3H7IA 4WSOA 3HUFA 5ULLA 1LDYA 3VNAA 3GH3A 3EXEA 1IOZA 1FXWA 2DP4E 3OQBA 4IHAA 1ISHA 5GQSA 4HH0A 3IHLA 1B4DA 1OBVA 2B6HA 1RTTA 2Q21A 3W2TA 2J5XA 1MGOA 2ZQ5A 4PFJA 4BFUA 2DERA 1MNAA 4XWGA 5FOWA 4C6HA 1C7QA 2QZ9A 3UGKA 3V55A 5BP7A 1NQOA 3K94A 1L5LA 3AVWA 2GTIA 5D1HA 2B20A 1SOUA 1AK9A 3BMQA 3KKNA 3L4BA 4HAWA 3JYQA 3AK4A 4JENA 3VC1A 4KTVE 2CLCX 1NMEA 4MWGA 4NBWA 3ZHUA 3GWZA 1KYTA 3HSSA 3SXUA 1VB5A 5DTJA 3K1JA 4GYWA 1EMDA 3SMVA 1V8ZA 1VL5A 3ENZA 4XGRA 2Y67A 3STYA 5D86A 2P9CA 2XZLA 2Z04A 2WD7A 4DCJA 1P0IA 3LHKA 4EGCB 1PQYA 3QLJA 4D9JA 3H9EO 1M2JA 1AOXA 3AP1A 3K9QO 3CKYA 3PPXA 4HQFA 4KXNA 4D8UA 4U5XA 4PLFA 3KUXA 1R0BA 2BFPA 4TT3A 1KNQA 1Q19A 1YZHA 4IUCS 4LFCB 2ZEJA 1Y81A 2OD9A 1HETA 3OJLA 1GT6A 2I65A 4UDYX 4NCNA 5DWQA 4ABTA 4YCDA 1CQJB 3DVAB 1XCBA 3EVZA 2L69A 4IDBA 1THGA 4P58A 4PPYA 3WGGA 3E2IA 4EEZA 1E0JA 3CKLA 4M1TA 1N2IA 1VHQA 2FH5B 2C5SA 3LC7O 4C7BA 1JLHA 5A0TA 3W2FA 3MTBA 4RKWA 4RNDB 4I36A 5LP6F 2HTEA 4FQ8A 1NUPA 4YWHA 3AB7A 4HY3A 1PSZA 3QBEA 4JYCA 2GZAA 2JFBA 3K5PA 5UKDA 5IKXA 5BMOA 1F4LA 4ALIA 4EJFA 1XP5A 1E2JA 3ROQA 4B84A 4WOCA 2AUNA 4O4HB 2QQ0A 4UAVA 3HK2A 1E6UA 1R2QA 2C0PA 4HP8A 3WGKA 4YB8A 3C48A 3PGJA 2ZVQX 4GXRA 4BEWA 1G66A 2V3WA 3M1AA 1JEEA 5TEVA 5CA1A 2YXPX 4OB6A 2IHJA 2PKXA 3TLZA 5KYWB 1HKUA 3K70B 4QYXA 4X6LA 2AGVA 3MIZA 5IJ9A 1M73E 1YRLA 3ETEA 4MR9B 3TBHA 1D7AA 2JAWA 2HAEA 5B1EA 1D2NA 1K9VF 3DEZA 3U7GA 1BW9A 4F3KA 1ZVMA 1ZK4A 3R3XA 3L40A 3A4NA 4CF4A 2N46A 4HMOA 3SX2A 3H4TA 3N2GB 4FHCA 2GM3A 2X2OA 1C1YA 3WHPA 3GCDA 5F7OA 1EVLA 1W35A 4EGAA 2I6UA 2JASA 3RUCA 5C9ZA 4CEIB 1YS6A 4UKDA 4WOJA 3PVSA 1NVVR 2WQ7A 3EGCA 3P2MA 3R1IA 1ML3A 3T5TA 1XU9A 3L6CA 5C35A 1Y1QA 2CDCA 2DETA 1SN7A 5CCXA 3MZ0A 1NC1A 5H5JA 3HKCB 1FDTA 3UAVA 3ZVNA 4LYEA 3IXQA 3UXEA 2DJIA 4ARAA 1N7JA 2AV6A 1ZR2A 2DWUA 3O6VA 1R10A 2A86A 4RSGA 2D1QA 4F6RA 2PX4A 1BROA 1UDAA 4GLOA 4MQMA 1WF3A 2PL9A 4F4JA 1OBFO 2B2XA 1G4UR 2ZITA 2QBYA 2XMCA 2WKSA 5LP6B 2FETA 4L9SA 4MV3A 5AKEA 1CB0A 4MGHA 4YP1A 1U2DC 2O0HA 1VLJA 1F5NA 1T1SA 3BRSA 1ISMA 3BD8A 1C29B 4MRAA 4YCCA 2JLWA 4N47A 5ER6A 4QQNA 2ZS8A 2ZUUA 2G76A 3GJTA 3HFSA 5F2NA 5C1DA 3HCOA 4MS1A 5ICGA 5JE8A 3FHJA 3ZZTA 2R7MA 4MWTA 1IEXA 3U3RA 1PBTA 3R9XA 3AONB 3GLSA 3KV1A 3L5OA 1JALA 1I3NA 2RJNA 3ONWA 4KXUA 1O3YA 5AYVA 3ROXA 3H5IA 4CHTA 3IVRA 3Q10A 3RV4A 2DWQA 2GCIA 5G02A 1PNTA 4LYJA 3FDFA 4ARUA 2J8ZA 3KYCB 1II0A 1J22A 4UBNA 4IRUB 4KR6A 4ECEA 1YBFA 1LY1A 1GAQA 2QVBA 2VZEA 3Q72A 5KOIA 3MD9A 3LCRA 4N5LA 3UKDA 3ZWWA 1G6HA 4Y2GA 1TMGE 5BUQA 3FUCA 3W4KA 2ZVDA 4KFTA 5B5SA 4EO9A 4G81A 2R87A 3COVA 2JIDA 3G2HA 4HKTA 1TYBE 1WMSA 3P2YA 4PS0A 3WP1B 2R4UA 4QVKA 2JIZD 2CV2A 3ZIUA 2GJ8A 3I1FA 2H4ZA 4RYLA 5DX0A 5DHSA 2VK8A 3PK0A 3RS0A 1RADA 4K6CA 4LMBA 1T0IA 3U26A 3EGEA 3BCUA 4RA6A 2H6EA 4IV8A 3LPNA 4CUJA 1D4AA 3OKCA 3A6FA 2J6BA 2KLBA 4KWHA 3GK3A 4LZWA 4Q4AA 3LZ6A 3W78A 4FWTA 3I62A 1SCUB 2GETA 3KSDO 2FN3A 1ZY2A 2HY7A 2NO1A 3BBLA 3KR1A 4K6GA 4ZAVA 5IAJA 1CS4C 3LFHA 4KE9A 4F4IA 2P2SA 4Z5XA 1I10A 2CXUA 4H0FA 2FQYA 1P81A 4CV2A 1XAHA 3EYAA 4AQDA 4N76A 2VRCA 1TW3A 1G5IA 5EFOA 1TU4A 2KJQA 4Z3DA 2GAAA 3AESA 2H0AA 1R8QA 4F5YA 2G71A 3RS3A 2LUOA 1N0IA 1URPA 2GPYA 2HLHA 2VDMB 3R3VA 4IJMA 5A71A 3Q6NA 3WHLA 4LCBA 3WYDA 1EDEA 5KC9A 3FBWA 3FD8A 4QXPA 2NTJA 3E3NA 4HS4A 4BTEA 1X1DA 1P4JA 4CFZA 1D6MA 4HGPA 2QY9A 2P2NA 4JOQA 4WOBA 5BW8A 2RG7A 3NTXA 4D80A 2IUUA 5EKSA 3H05A 5KNDA 4LY3A 2COKA 3FHTA 3IP6A 3N6XA 3SIXA 2BEWA 1JV2B 3B3FA 1ZM2A 4JLUA 2V7GA 4OGKA 1QYXA 4F91B 2LWIA 3RS5A 3KSZO 1W85B 4K46A 2XUOA 3LA8A 1JHZA 4IJ6A 3QY9A 3TAXA 3E9RA 4D25A 1NV8A 1OLUB 2FUCA 1N6KA 3I6YA 2W37A 1T5BA 2GD1O 2VQSA 2WHXA 4QNNA 1FTQA 4JYZA 1IMJA 2HA7A 4TXLA 2OD2A 5AR1A 1KI9A 1Z74A 3H2GA 1A5SB 3NIWA 2XPCA 5FAKA 4GPTA 1UDRA 4A27A 1A50B 3M9LA 4HWTA 4RF3A 5C34B 4DIFA 2A94A 4DKXA 2D1SA 2G9ZA 5BWCA 2PSFA 1VIAA 2GS9A 1BX1A 2ZLBA 4JJ4A 2OHFA 5B58T 5LLDA 5EXTA 1DG1G 3O5AA 1TGYA 2FYTA 3CUVA 3GCZA 3PF9A 2EDAA 5D3QA 2Z6QA 1OZ0A 3EDCA 4KUGA 3QEBZ 1T0PA 3MVEA 5T4FA 3GD7A 3H8WA 4DADA 4BMYA 4H1HA 3RU7A 2PSEA 4OHOA 1PK8A 1IHYA 2RAUA 3HLTA 1DO2A 2QXTA 1VL6A 1QTQA 3SZ3A 1EA5A 1MO2A 1VE9A 1ADJA 1GCUA 2BEVA 1NU6A 2DPMA 3AVPA 3E2PA 2AOTB 3VH3A 1WG8A 3AP3A 4MAMA 5GADl 4K6KA 4EYSA 5D3ZA 3BORA 5IVIA 5GONB 4IG4A 4QFDA 2Q0XA 3BK2A 3JAMA 3OLQA 2AMYA 2BLLA 2NP7A 1JH8A 2ZSEA 5CLJA 1QPGA 4EFNA 3I1JA 4RGBA 4YGYA 1Q0UA 4UM8B 4XB1A 1XO1A 1H2BA 5C5EA 1AVTA 1PX2A 5AKXA 5KYVA 4L3WA 5E4JA 1F0YA 2NU8A 3X1ZA 5K6RA 3QELA 4LCEA 3DEJA 2J7KA 3OHPA 4DUYB 5GY7A 3JV7A 4RANA 3FKSD 3GD5A 5C37A 2DHDA 4L0MA 1JQAA 1E20A 2VP3A 5AOBA 1E6LA 1AV6A 4R05A 1SXJE 1E5TA 4OQPA 3P4UA 5EJGA 4EHIA 5HRUA 3H1PA 2KB0A 4GE0A 4LE2A 2A78A 3R20A 3USZA 2PQ2A 1Y7HA 4F1WA 2BVNA 2ERCA 1XNRB 5KTMA 4DYVA 3OP1A 2RHTA 1ULAA 4QU9A 1N2CB 2G08A 5JVDA 1H3EA 2D0IA 5C8ZA 1DAHA 1M72A 2WA2A 3TOCA 4NJOA 3LXRA 3CQ9A 5EZ6B 1R6BX 4CM5A 5KJCA 4H08A 3M1YA 3ZGNA 3L7MA 4HAYA 1JRLA 2BGNA 3E9CA 4OIFA 2E7ZA 4YUVA 4BJHB 3RB8A 1U0JA 3GJ0A 1ILWA 4DIUA 1QGUA 2FQQA 1ZMOA 3FNHA 1AXGA 4MKZA 4LOHA 5D6OA 1E7YA 5ERXA 1H1DA 2HMUA 3L8HA 4E6EA 3I32A 2HWUA 2B8NA 2N9UA 2OBBA 1YRBA 4JJKA 4WBNB 3ZBTA 1RWNA 3ENVA 2FW8A 1L9XA 1XF9A 1NSTA 3CONA 4JROA 5BR7A 2AIRA 3S27A 3GPBA 4IVPA 3TLJA 3LYHA 1YA6A 3IURA 2E1PA 1PKXA 1SCIA 2DCUA 4LDAA 1SBZA 5IJXA 4BRZA 1KKUA 1YCHA 4GYKA 3T5GA 4XD2A 2OAGA 4IV0A 1KDPA 4YRFA 2AF3C 4B43A 2XE6A 5LDDC 4REMA 2EYQA 3W7VA 1T2FA 3KSMA 3UGTA 1QZTA 3GC6A 4XJVA 1L7OA 1DOAA 3FW1A 4BVKA 2XQGA 4H17A 3ZCXA 5FPKA 3JRXA 3OQIA 2GDJA 4P2BA 2VUIB 1J2TA 1OBCA 1IM2A 1T91A 2H4JA 1V1JA 2QN7A 3H6KA 3MTIA 4G1MB 4JBYA 2VPZA 3OUTA 2DUJA 1EP2B 4WXMA 1WUJS 4RL4A 4WHMA 1PBNA 5CB8A 4RW0A 2J0UB 5EJFA 4DG9A 2FTKE 1OI3A 2ODTX 3V3TA 2YV4A 2OFWA 1MPTA 2HV9A 3UJBA 1Z35A 3GN1A 3KDAA 3W6PA 5IG2A 1JPVA 4WERA 3CM0A 1M7GA 3CW8X 4D3DA 1GYQA 4OMCA 5JYEA 1EVQA 3ADCA 2XXAA 2RHWA 2QRVA 4JJIA 3SHOA 2WYUA 4MQLA 1LBEA 1B6SA 1TLFA 2J5BA 3QKSB 1KO7A 3VR5D 5DK4A 1YC2A 3LX6A 1Z0DA 4YCLA 3PC6A 5E2BA 2A92A 2QX6A 3TTYA 2YCLA 1R9JA 2XGMA 1XZIA 5FFFA 9GPBA 2OCBA 1T35A 2XVAA 3VNBA 3GHYA 3I34X 4JYAB 1GWNA 4DVGA 4O0LA 1M1NB 4NFLA 5BQPA 3TBFA 1E98A 2O4UX 4WCFC 2C2MA 2Q0QA 1ZG3A 1T4GA 1W59A 5ENVA 1AXEA 2FOXA 2HCRA 1JHMA 1U2DA 5DJ5A 5BSMA 4CT0A 1KWKA 2HK6A 4QTZA 3EJWA 1V25A 1RR6A 1QJ4A 4MI3A 5C8DA 5JARA 2VNSA 3O3CA 3E53A 2OYRA 1P9LA 4P5EA 3ODGA 3EZ6A 4KK4A 4LF8B 1J97A 2CJFA 3NWBA 2PKYX 3BEOA 5E7JA 3V4LA 4Y2VA 5DWVA 1F4PA 3HCEA 4OHYA 3D6AA 1NN0A 1BCRA 3KTAA 2XOXA 3MTAA 4YR7A 2UDPA 4GI3A 2UXDB 2I2XB 4AJHA 4AZWA 1FVFA 4IX9A 2P9BA 4L6AA 4OI1A 1OXSC 4G85A 4IHJA 2JIBA 4O25A 1Q0ZA 4IGKA 5EE5B 4GI1A 3WWYA 4X3OA 1Z7EA 5LA6F 3LXMA 1DG9A 3NGMA 3X0DA 1WB6A 1ZAKA 2XWPA 2Y0EA 4ZHQF 1NZJA 1DBRA 1L4EA 1L8OA 1AV7A 1VHLA 3BN3A 3T3GA 1U3FA 3DUFA 3QU5A 3WNVA 5EJ4A 1D1TA 1M34E 4EW3A 1NOKA 1QVZA 2DBRA 3HJNA 1GJRA 3EGXB 3FMPB 1GQOA 3QKWA 1CUXA 3NKFA 4HQOA 3ZV6A 3HXQA 3NHZA 4DQDA 3TNDA 2H8KA 3MBIA 5J2TA 2DM6A 4JUBA 5HBGA 3ND8A 4F1KA 3G2JA 5TNXA 1RRPA 1XWFA 2BE7A 2HEGA 2JZCA 2QOEA 2V6FA 3AI1A 2ODPA 4NE7A 2WSSA 3CLTD 4U9UA 3WMWA 3A7DA 2YHSA 3GEIA 4CDNA 1Q44A 4NG5A 1IEWA 4KR7A 1MZPA 4DEYA 5FJJA 4RTRA 4PLHA 4CIDA 1VCOA 2D00A 4Z54A 2GEFA 3TRIA 2M1ZA 4OXYA 4AY4A 3FTNA 3K0HA 4JP2A 3SDZA 2H1IA 4TTRA 3KQLA 3O8BA 1U8CB 4FLFA 2YXBA 4I55A 4JEUA 3W5AA 4NIMA 1DWQA 2DU8A 3KB1A 3WB9A 3ONFA 5B2EA 3AZOA 1SY7A 4O5AA 1BVRA 1U8TA 1GM5A 2E5WA 3CEMA 1QQAA 1P2SA 1A97A 4J9VA 2HXYA 4ZI5A 5MHTA 3VGJA 2WUWE 3L7CA 4MV8A 4AULA 2O1XA 3CWCA 4CFSA 4FGSA 2VKQA 5FUQA 4HNTA 1IWBB 1EK1A 2WB4A 3QEKA 4G5RA 4OMUA 2CLMB 2OBNA 4BOYA 2YJ4A 1G20A 1TIBA 5KYTA 2WSLA 4L9WA 4CTMA 1LPOA 4FC7A 3I42A 2FLVA 5FV7A 4NOMA 3VSBA 2GK6A 2ZVJA 4KQ9A 5TPWB 1G18A 2V74B 1T3ZA 2WD8A 4JLBA 4LQ4A 4OB8A 4EPRA 2IF0A 2B82A 3I39X 4X61A 4FJ1A 1YKFA 2W2VA 5L3SB 2X22A 2UYCA 2AJTA 2IYOA 4L4ZA 3MCUA 4B35A 4UHFA 2VZ8A 1QGDA 5K20A 1M2GA 4ZTBA 3TVTA 2YASA 1CR6A 1SZCA 3NTUA 4ZVPA 3QGMA 2Q3FA 3RGGA 2HREA 3NTOA 4JI5B 1M2KA 2QJOA 1XELA 3IUMA 1U7TA 3OQ1A 2JLRA 3CSDA 4EI2A 2X41A 2XVYA 3GAFA 1ZONA 3BL5A 5HRCA 2G88A 3P2OA 3W8DA 1XEAA 3FDIA 4B6FA 4GRDA 3K8QA 5TS2A 3ZJ4A 4BGDA 4J7UA 1YR9A 4ZT6A 3UPUA 2A9FA 4J6EA 4N9QA 4O33A 1FTGA 2ZP1A 2R1VB 1ONOA 3C70A 4JLKA 2D8MA 1JZTA 1TZKA 2HDHA 3O8OB 2AI1A 1EVJA 2W6QA 2LV8A 5CGQB 2XIJA 1JG4A 1LXCA 3OJXA 4OFXA 5T4EA 4ZI3A 1JS1X 3I64A 4N82A 2JD2A 4JASB 5BW4A 1FFBA 1G7RA 4I14A 3RYIA 3WYGA 1AQNA 3TPFA 4PQFA 2AYYA 1VJDA 2C98A 2J7PD 4G0OA 4N3BA 1P4RA 3N6VA 3OKPA 5TF0A 4A2QA 1DQRA 3TZHA 3FLAA 2G9RA 3GAAA 3LSTA 5A6SA 1M6EX 3QFFA 3O4IA 4XQ9A 4UHHA 3GGOA 4O4LF 1FX0A 4X9XA 4UU1A 3PXBA 3FPAA 2R62A 4KOAA 2P5UA 4F9FA 1GTSA 4L72A 4G9GA 5B7NA 3ZE9A 3OX3A 3M5CA 3B7WA 1ND5A 1MLDA 1FUKA 2YIJA 4IINA 4LZPA 2XUJA 3EXHC 1L4KA 5F3RA 4FFOA 2E18A 5JI3E 2CN1A 2QMQA 3UMSA 3GY0A 3M83A 4OHXA 5JSKA 2DYKA 3DONA 4LE0A 3SC3A 2RGNC 4KCGA 3N6RA 5REQB 1TNDA 4W5NA 1YZTA 1WBJB 4PY2A 3UQYS 5HM6A 1LBTA 3A9WA 2CWWA 4FU0A 4A8HA 2NSDA 1UEJA 1VJ5A 1RVV1 2IP4A 2FSVC 3DAOA 2K7ZA 1YKSA 3PYMA 4LHEA 5ENZA 5JZSA 1XPUA 3AM4A 3AVQA 4PXYA 2JH8A 2VP4A 4WKCA 2EJWA 3OZCA 1DTEA 3UXMA 3KQHA 1T9HA 5D7BA 4BX9A 4CU2A 5HOEA 3L7AA 3QVSA 4HJXA 2ZUBA 2OCLA 3T0GA 2VJMB 4JV5B 4P0TA 1FYVA 4RFVA 2XF2A 3UH1A 5CJ2A 3C8DA 3L6BA 5AI4A 1JXQA 4LYFA 5CDTA 1HMYA 2GKSA 2Q3MA 3EG9B 5FLEX 4TV8F 1OZHA 4Y6PA 2CB9A 2ZBPA 5IK2A 2CZCA 5BPHA 3NBAA 9MHTA 3ELDA 3PJFA 3MAGA 3KOWA 2FW7A 3QU9A 4FYJA 2FDCA 4YVFA 4PNPA 1H8HD 3SZLA 4BNIA 3O1LA 1VDMA 4JQOA 3ADDA 1OT3A 1IJEA 1PR3A 5I9BA 1IZ9A 4MCAA 5JMPA 4H2DA 3JQ7A 2ZSFA 3VMFA 1L4BA 3M6XA 2Z08A 1SQ0A 1E89A 2J41A 4AKTA 4BO9A 1O0BA 2IP2A 2MYTA 4YRCA 3SEZA 3W5IA 3CZ9A 3O2NA 1NN5A 5L9AA 1QB8A 1GPDG 2O8VA 4OHMA 2ZXEA 3GFQA 3FIUA 4H77A 4HDCA 2V6JA 3FGOA 3W5SA 1L1EA 2AKAB 5JHGB 2WF8A 3MOIA 2Q1UA 1TM2A 3QOYA 5BOSB 5EXEA 5HJ2A 5LYJB 1YH3A 2CXRA 1KO8A 1F2TA 1IZZA 4QFCA 2PY6A 1NLFA 1QHFA 3R8XA 4NU5A 1SWVA 3DSRA 2A0KA 2XCRB 3K5WA 4GGPA 4DA9A 3ZI0A 4LJ9A 4RHTA 4YACA 4FNMA 3VOTA 4Y2QA 1Z4JA 4WY2A 4BNKA 1VMKA 2MSDB 1EUDB 2BE9A 4MZXA 1BO6A 3AR9A 4GKJB 3CV3A 4G3XA 3JATA 4IRXA 2OAP1 4LRXA 3ROGA 5B30A 1QQ7A 5GWXA 3C7AA 1S0UA 2HKIA 4MR8A 2IUTA 1CUIA 2JFWA 2NSLA 2YXDA 3OZEA 4XD7D 5C2JB 2O59A 1QLJA 4LDQA 4X1KB 2NU9B 1L8XA 2DKFA 3B5JA 3AWDA 4F6LA 1USWA 1B8VA 2BGKA 4X1YA 4XVHA 1P18A 4PBTA 1PFYA 5BV2P 5D5PA 4WY8A 4IV5A 4MA0A 5HMLA 3WNDA 5JYCA 4AJOA 1V3UA 2OR3A 2Q3JA 4MVWA 3RVRA 3T3OA 1CEEA 1RXYA 2REQB 3IV7A 4Y1RB 3LUJA 5CTAA 5G0VA 3QVOA 2FG6C 5SZHB 4DJAA 2JD1A 3E9ZA 4GKKB 1SUEA 2VXBA 1U7WA 4CTJA 1PT9A 5BO5A 5GINE 2VTVA 4WCFA 2GVNA 1BDJA 1GL7A 1QG6A 3BXPA 2R8ZA 3OHSX 5F23A 1A98A 2HTFA 3ORRA 1C30A 2CVZA 2X9NA 1NSYA 2ALJA 2O57A 3AHGA 4IDEA 4KV7A 3ROMA 4BYMA 5CFRA 1F9EA 1XZPA 3NNSA 4TXNA 2QK4A 3HC7A 1NBIA 4UTNA 3WK7A 2FX2A 1NDUA 1VJTA 1QNLA 4KO3S 2FA9A 3BMCA 1OXMA 1HC7A 3H2KA 1LC3A 4LWZA 3G6WA 1TCUA 2JGFA 4U6SA 1NJ6A 3KB8A 1YB5A 4YAWA 2PMKA 5CFPA 4FUQA 4Z4HA 4RY2A 2O6HA 2Q50A 5EWMB 1OTYA 1XEWY 4YUWA 4CKEA 3K6RA 3DM5A 1T0JB 5EOVA 5JDIC 3WMEA 1JPUA 4TROA 1K4KA 1U0NA 5JXGA 1KOLA 3NDBB 2PJRA 4A6DA 1BFDA 1JG2A 3H4MA 1TI7A 3WK8A 4KNYA 1K63A 4EK9A 1V5FA 1RAEA 3TZKA 4ND4A 1NVWQ 1XAIA 4RMGA 3RREA 2C5FA 3PBKA 3EGVA 1GNQA 2ZSDA 3HVKA 5L40A 3DHYA 1K8QA 4B4OA 1RJDA 2JGLA 3WNBA 3GP3A 4TTPA 3R5SA 2DF8A 3I23A 1OBHA 3EASA 5JQGB 3IDQA 3Q7RA 2BJHA 5AIBA 2QN6A 2VHCA 2R3SA 4NYJQ 1XVIA 1U9IC 4KR9A 1LQ2A 2ZROA 3CNNA 3F2IA 4X3CA 5FTJA 2NV0A 4BFLA 4HAIA 3DVSX 3WJ2A 1BDHA 4N41A 2XUZA 2VSXA 1CW2B 3U37A 3TTWA 1NJ8A 3M81A 4DLWA 4FTWA 3SJZA 4M49A 1VC2A 3OHMA 1CNMA 1A0OA 2EGHA 4V0NA 5ECDA 3N5CA 3Q2IA 3TW4A 2WTUA 2JIOA 2PMEA 5PGMA 5E0KB 1AN0A 3JVVA 2HLNA 4IIVA 3LDGA 1M9NA 2PXXA 5I4IA 3I5YA 1EFAA 4LRUA 4QO8A 1Y3DE 2ZT7A 5L3QB 2GF9A 3TSWA 1KOJA 3CRVA 4ISCA 1J2YA 3E7FA 4QEZA 1Z0UA 2PUJA 2FMIA 1FP4B 5DHPA 4A0FA 4ER6A 2Y4NA 3DKVA 4M8SA 5ARCA 4B3MB 3A2NA 5CT6A 4M6WB 2J3KA 4DABA 1SNYA 2JKZA 3DLAA 1ORDA 4DM4A 1E0AA 3GDOA 2JKVA 4YJHA 4OK5A 2MIIA 1PDOA 5DEIA 3HGMA 2ZRCA 4UDOA 4J0JA 3ZWXA 2GD0A 1G8PA 4RFSA 2JAOA 1Y5MA 2CJXA 4JLMA 1G2QA 3GAZA 4NCXA 4RKEA 3PRHA 4EL0A 1TMKA 2H2WA 2G80A 2X14A 2GRAA 3DF9A 4QJ5A 3GCXA 1YIDA 1KEWA 3C7KA 5A7FA 9ABPA 4C1BA 2WJAA 1BWRA 1PGJA 3ZHVA 1GPLA 1SC3A 2CC2A 3AVTA 2AI3A 1YK1A 4Q1AA 1YKGA 1NN3A 3AX6A 3KHUA 4QFMA 3TIGA 3FLMA 2VSFA 1P60A 1ULBA 3OOHA 3WJ1A 2Q5OA 4L9RA 5DMHA 4LX8A 4BP3A 1RI1A 2Y1WA 4RIFA 5BQ3A 2B6NA 1EWKA 1E77A 1HSOA 3AINA 3EOAI 3G8DA 4CM7A 5JY1A 5KYUB 3JAWB 1C14A 1RMQA 3ZKWB 1WS6A 3BXHA 3OLWA 5CIYA 3D4LA 4BMNA 3CLUC 5AVXA 1RWOA 1WKBA 3HB9A 3DVQX 2F6RA 2GFQA 1T8UA 4QASA 5FOVA 1QBGA 3GLRA 3KT0A 1ZJ5A 2XUFA 5E7MA 2IHNA 4YRNA 4C76A 3NWJA 1J20A 2FRVA 1R3UA 5K7SA 1LZKA 2X42A 4Q5IA 1U5BB 1CYEA 1C0IA 2QJWA 3GJQA 4QGAA 1ZOIA 2ZI6A 4C30A 1DEKA 2Q2OA 4U02A 3TLCA 2OLEA 3GFVA 3SQMA 3VTFA 4CJXA 4Z4IA 1JW9B 5EMNA 3SK0A 4OYHA 1Y98A 2NXJA 1G21E 5AM1A 3JW8A 3D02A 3ICEA 1RYZA 2P4HX 3TVYA 1P9OA 1GAXA 2CK3A 3EXHA 4K0KB 3KAPA 1MO6A 2P8JA 3PS9A 4LRQA 2BKLA 2QD5A 5KVVA 4Z53A 4X71A 1WZCA 4G97A 4L4SA 5EESA 3RRJA 2P69A 2Y6UA 4Q3NA 3HXLA 4XR4A 4FN4A 3KC2A 4ND8B 1OYVA 1BC5A 1LS1A 3V1MA 2FLWA 1CUBA 3SHTA 1PZHA 2IU4A 2RGNA 4PFQA 5DHAA 3UAWA 4D26A 4EG3A 4F93B 5BW6B 4COOA 3QE3A 1XZKA 3KD3A 4AJJA 3VZQA 3KKLA 4K9LA 3FFBA 1WTAA 1JHDA 1ULZA 2XYVA 3G59A 4PR0A 2FSVA 4BB9A 2EG5A 4KO2S 2IXTA 3QUQA 5KOYA 4JYBA 1IATA 1P3JA 5EYPA 3FETA 5DM70 4KX3A 3D8TA 2XHZA 2IU0A 1FRQA 1QHSA 1ZK0A 1EVEA 4J1TC 1OCEA 3GVXA 3I72A 2V03A 3PGXA 4NJEA 1BSVA 1YT5A 2ZK7A 4N7RA 4ZQCB 3T15A 4P32A 3RSSA 5JROA 1J8MF 4KSBA 3TG8A 1NRXA 3LKBA 1LSOA 3AOEA 5KYKA 4N9WA 3QMWA 1RJWA 2EV9A 2QJRA 1W0KD 3UB2A 1EEXB 1I32A 1P4HA 2WEKA 4CL2A 2BBTA 1EUCA 4XQGA 4LWQA 2WNHA 5L4SA 1I24A 4D9FA 3IODA 2FN4A 1QH1B 1NIJA 1VCHA 1CY0A 1LBQA 3UWKA 3G3EA 4U2EA 3IILA 1YQXA 3DMNA 1AKNA 3MELA 5DYGA 1DINA 4ESHA 3FTDA 5JV5A 2OG2A 4X3PA 3OZDA 3HWWA 3KR2A 5E2IA 1DKLA 4OQQA 4Z7QB 4YH1A 2FZVA 5IYZF 2WVGA 2ID8A 2AEMA 2X4GA 3HM9A 4E4YA 1ESDA 1Q22A 3AV3A 2H1WA 2XNKA 2VZLA 3NO4A 5AVTA 2IWHA 5HGXA 5EIAA 1C9DB 3NDJA 4LXUA 3BK1A 4JUFA 5B1DA 5B57C 1JEAA 1RBYA 2D4AA 2W2LD 5FX2A 1PIWA 4N8DA 3T1QA 4PANA 5A5VA 3G0HA 1FRNA 1J8FA 3V48A 1US8B 2E4ZA 1L4LA 3CF0A 1I4LD 1V9LA 4LGYA 3CRZA 1SCKA 4Q9JA 1QBKC 2ZTSA 4AJ2A 5G3ZA 2WI8A 2F9MA 2J9FB 5AXDA 1SOMA 2QTMA 1EXNA 2XBUA 4R2KA 1KEPA 4PG8A 3M89A 1UP6A 2Z9DA 1IBKB 1Y8RA 2P8SA 3F4LA 2DR2A 3DXYA 1EFCA 1KYXA 1NBMD 1IWPB 4P3NA 1QG2A 1KXJA 2VYQA 3ZDRA 3CNOA 2VLBA 1UPXA 3I76A 4K1XA 3DNPA 4RSHA 4YBRA 4YY3B 1W36C 2I9KA 4BVBA 3MC1A 3KXLA 4FYWA 4NFYA 2WM3A 5LP6C 1FVXA 4DNFA 5H02A 1MOPA 4EHNA 3T7KA 2R6DA 2FPMA 5I4KA 3UANA 5EP2A 4WL0A 2IYYA 1HDZA 5DX8A 4O4IA 5A9TA 4ND5A 4TL8A 5CNJA 1HYGA 6Q21A 4TMXA 2IYUA 3HB4X 1DBIA 3KVVA 2VJNA 3VVBA 3KR0A 3WL6A 1Y80A 3ZWDA 4BRWA 5U1PA 3GLGA 1E0KA 4KR3A 1O5TA 2R96A 3C1AA 3LVQE 1BHO1 4YMUA 1M83A 1N57A 2GWHA 4RGYA 5AKGA 3VO9A 2HA2A 1IONA 3KB6A 2V5UA 1HDYA 3N70A 4C4SA 5FWXB 2VJLA 1AS0A 4X20A 2VSOA 3NOVA 4GPD1 4EVRA 2W2QA 3A1CA 4GDFA 3OZIA 3V32A 3WZ2A 5B53A 2ZXUA 1KBOA 4R9UC 3Q4GA 4ACBA 1CE8B 2GPBA 3A9UA 3PEUA 1E6MA 3H5RA 1IOWA 4W8GA 5SY6A 2BGLA 2XCUA 3QLTA 4HT3B 3TD9A 4IOJA 3OT4A 4L0DA 1R12A 4NMXB 1XRLA 3MCTA 1E1CB 1UAGA 1W1WA 1BN7A 5IFLA 4ZO7A 5JZBA 1CQZA 5A02A 4BQOA 3ZDCA 1W0JD 2CF6A 2AT1A 4ZAZA 1LBIA 4ZFNA 1LDEA 2X13A 2JLZA 3PRYA 3N2LA 2C5LA 1FP7A 3RADC 1LV8A 1COWD 1ENYA 4MRRA 1DGQA 3DT9A 4UE2A 3IV9A 2HMTA 4OBXA 2F9LA 4MUYA 3S2ZA 4JLPA 3EUWA 5C8XA 1F6WA 4PZDA 2I6XA 4A82A 4R1NA 4LJ4A 1DTWB 3RLFA 4B48A 5A4KA 2HUNA 4HWPA 3Q3CA 2F64A 3U4AA 5GAJA 2NP6A 1XZHA 3AHCA 3R6DA 4B3BA 4CI0B 2G1PA 3C2QA 1WHTA 5CYFA 5KWVA 4TSFA 3KKZA 2Y77A 3KJEA 2P9TA 5EEGA 4LECA 1A88A 1U9IA 4RUKA 2NAFA 1AQUA 3TIFA 3MWDA 1JZQA 1PYGA 1FRZA 4TYYA 1NF2A 3NBFA 4AZVA 2UUBB 2YN2A 1ZISA 5TGZA 5K1ZA 1OXVA 3SZMA 4UZFA 2H4FA 3UXYA 1TZMA 5EWJB 3V4ZA 4CXMA 3AY6A 4P34A 3PXAA 1V1RA 4OXRA 3CG4A 2VHTA 1XZCA 4E09A 2OXTA 1ITZA 4XYLA 1U3GA 4ITVA 1ODKA 4ENTA 1B16A 3JQAD 4TM8A 5CM9C 5CFLA 2NO9A 3CGWA 3NM5A 4RWZA 4TXMA 5FXMA 1EINA 3KQKA 1RXVA 4U7TB 3ECAA 4EOGA 3PNLA 4N3CA 4MHSA 3FCAA 3PJDA 5EQDA 3F97A 1MV8A 3N0XA 4FWBA 2VRNA 3G2QA 4DQ0A 1LWNA 4MNTA 2ESRA 3WQRA 3TB4A 3WWZA 5H9VA 1X70A 1G63A 3DMFA 1VPDA 3MA0A 2HU8A 3DDOA 4PLZA 4W5HA 5CPFA 3KE9A 4X6XA 4BJ6A 4HYQA 4CDMA 4DZZA 5U9CA 1IULA 1RQ7A 4YMHA 1E3DA 2C5GA 4PZUA 5HGJA 3ZDBA 1NI3A 2WUEA 4Q82A 1A4XA 2MSNA 2WWFA 5ISMA 4ZCPA 4FKBA 4A0QA 1A9PA 2ZXFA 2VTDA 4WNAA 4EFDA 1XDDA 1I5EA 4TS9A 4N7MA 4XSVA 3VR3D 2K2WA 2X6TA 5JS8A 1G5FA 4Q1BA 1JJAA 1EP1B 1YA8A 4GPZA 3WAGA 4AP9A 4R7GA 1F38A 4QG7A 1U28C 4EA6A 2VWQA 1U1IA 1F2UB 2EF1A 2LR0A 3RBZA 2OWDA 5AUQA 5CNIA 5TGDA 3AVXA 1JQBA 3GX1A 3KDPA 2HL6A 2QAJA 1G4AE 4KN5A 3O4VA 2HQRA 3AVOA 1K1EA 3EEQA 3TL2A 2BH2A 3W5UA 1X7ZB 3WGZA 4DWVA 2O3RA 3OD5A 2BZ1A 2Q7DA 4M0KA 5FRDA 3TL6A 4E08A 1C8VB 2BTOA 4MUMA 4DANA 4KQJA 1ZWKA 2WTBA 1KI6B 2BM8A 2BEUA 4UMFA 1NONA 2WK1A 4PO8A 4Y2PA 5HEKA 4TZTA 2IS6A 1D5WA 4KBFA 4WASA 5BR8B 5LZ4A 3E3AA 2IE0A 2F4VB 2OCPA 3FE2A 2Z09A 1TT7A 2W2KB 2I4TA 2O6LA 1JGTA 2OSVA 2AWNA 3FY4A 5HKAA 2QGZA 4WKNA 1JMKC 3FBGA 2XMZA 1E92A 5M34A 3FIJA 5HTKA 4KR0A 1IB0A 2ADOA 3RVBA 4E0BA 2BFBA 2FSFA 3GDGA 2F48A 3GP5A 4X93A 4G25A 4NDNE 5HFAA 4PYNA 3X3HA 5LWQA 4QJIA 1DFHA 2ZYIA 3C7TA 1RLOA 4HDOB 1I94B 3BWEA 1H65A 3MEQA 4JBGA 4CDGA 4EB3A 4QE3A 3U16A 2Q6OA 1Z18A 3ECSA 1FFXA 1YE5A 4KN8A 1WNTA 1N5DA 2LDBA 3WIBA 1H8EA 1WXIA 1CTQA 1D0SA 3E84A 3DW3X 4IY1A 3WYAA 4C2BA 5C8YF 4PICA 1UDBA 1YVEI 1IM5A 2FPRA 5KOJB 2P2CA 3I45A 3D3NA 4IIBA 5FNVB 3SM3A 1VYUA 3CS3A 2VRBA 3RIGA 4AX8A 1RWWA 3IUNA 3WVNA 5AK3A 3G5MA 3SQOA 3VDXA 4C7MA 2Z3ZA 1NJGA 2BT4A 5DLPA 1DV2A 4PRZA 4G4IA 1UC9A 4B46A 2PV7A 3DL7A 3QWIA 4TWBA 5LQKA 2QUZA 4RKFA 1DBSA 3IP3A 4R1SA 4XQEA 1FXUA 4XLZA 2PSSA 2BKUA 2Z98A 1JHVA 3C3DA 4EYKA 3ZU2A 3DOHA 2R8RA 2CJYA 3FWHA 2R5WA 1K88A 4W5WA 4J1TA 2JFZA 4C6TB 2IYLD 4DCSA 3FOZA 3TZ6A 4DB4A 1DZ3A 4I1OA 3UT5A 4GL4A 1EZ4A 2ONCA 5DP2A 1GGMA 1JUDA 1X8JA 2OLKA 3H1TA 2EKZA 1R4MB 3RKSA 4UFPA 1WB5A 1RJFA 4P81A 4ITRC 4EJ2A 2K4MA 3KP1A 4ZOLF 4ZMSA 3P19A 2AW3A 4ZK6A 2O48X 2BYTA 5ETJA 1W2HA 2DY0A 1L5ZA 3GMTA 1MU0A 3QLUC 2H7VA 4KLNA 2BC9A 2GAJA 1USIA 2AXNA 1FYWA 1M34A 2CNKA 2WG0A 3VZCA 1WW2A 4C5BA 1WMEA 2PUGA 2I4RA 5FOUA 1T5HX 3LUDA 3RG2A 5JXJA 3MLBA 3HB7A 1KYYA 1WKCA 4PYIA 3FVQA 4U2BA 3CR3C 3IVCA 4PXSA 4YUZA 1DAKA 1II8A 1UFOA 1F5SA 5FTNA 2C4HA 2ENWA 5EJ7A 1AB5A 3I9V1 1Y5IA 1MABA 4EUFA 2MSWA 4L8GA 4ZAGA 4C0KA 3K0AB 5BV1A 5JOQA 3HXKA 4UHJA 1XRQA 3EC2A 3EOBI 3F6SA 3R0XA 3HN2A 1IHUA 3QWHA 3P27A 4LC9A 2HADA 4EUHA 4OLAA 1BU8A 2ATCA 1VKOA 3DZBA 4ENVA 2IX9A 3LUGA 3ZWVA 1PUXA 1N6HA 2XLCA 1P62B 1YOVA 1BD4A 3IS3A 3AR3A 5D01A 5E1BA 1R0WA 3Q7EA 4PSKA 3WISA 4DHEA 1H2ZA 4WZ6A 1B14A 1TUBA 4B0OA 1ZDMA 2JIMA 5IZCC 2X6QA 4IDNA 1KOGA 1W1UA 4J4HA 1C7RA 3TFQA 2WD7B 1EESA 2NYUA 1QVVA 3A2LA 3AM5A 3CHYA 2OMKA 1RCTE 3GF4A 4Q4DA 4BE4A 2CDRA 2GBGA 1A69A 2FWAA 2ZREA 4HYYA 4JJ6A 5DH9A 5JMWA 4DJDC 1AB6A 1EAMA 1JWBB 4H3SA 2EFHB 5AXAA 4FOTA 5LP6A 2ZJ0A 3NRJA 1JNXX 1DXQA 3SAJA 3SHVA 3TX6A 2RI6A 3AU9A 4QXQA 1TTQB 2GJ4A 3QX8A 2BPOA 1J2UA 4X8HA 4Y9SA 1Q14A 3CFYA 3H75A 5KVAA 2JVKA 4BC0A 4BXOB 3P52A 4FMCF 4F56A 2OZKA 2PGLA 3H2BA 2BCEA 3NANA 1Y7PA 1QXSA 2V7VA 4G5QA 4M99A 2GAFA 3RU3A 4Z4CA 4AB1A 3PFBA 4M8NE 2VSQA 1ZJZA 2NACA 3LGAA 1ULHA 2YQ4A 3VR1A 3FOWA 1YZKA 4K9DA 4NRDA 1ACLA 1MTZA 1L8AA 3ML1A 2B21A 3RS4A 1TEVA 1CY1A 3A3PA 1G5TA 2CNBA 1A9YA 4AN1A 4F5DA 1NUTA 2TS1A 3L8CA 2ASVA 5TRTA 4AW9A 1E7QA 4FFLA 3MT9A 1RHQA 4NHEA 1M1YA 3MGAA 1HRDA 4OQXA 2ZTVA 4CMJA 4CLRA 4K8OA 4JEIA 1NNI1 4S04A 5ALDA 4CW7A 2RGUA 2AI2A 1XF1A 3NBZC 5EJ2A 4MUBA 4BNMA 3PLNA 2IYFA 1FMJA 1QIHA 1MJFA 2WYOA 1SO8A 3Q40A 4Q4HA 1AQ6A 2JEZA 5D87A 1YIOA 1NYRA 5FPHA 2F3SA 4TMFA 5THXA 5B58C 3DBRA 1XN4A 4AJ9A 5DNUA 1RHMA 3SOPA 2UZ3A 1RLMA 2AOUA 2JFYA 5HHTA 1GPAA 3RHTA 2WF7A 2JEOA 1WKVA 3O03A 4Z9FA 3KOZA 5E9QA 4G5OA 5FPSA 2E82A 2BJVA 1EPUA 1T2NA 4O2BF 5F1YA 1QCZA 1IDN1 2QUHA 3QZUA 1SR8A 4K5QA 1SOAA 2HU7A 5JYDA 4RK7A 1FU4A 2I7XA 2ZB3A 1BWSA 2QMYA 3GIWA 4KHZA 2YZNA 4RGVA 4W1RA 4X63A 5BYJA 4YHBA 1JLSA 2A1UB 3G8AA 4U0KA 4Y9TA 5F4ZA 5BW5A 1EH5A 5LC1A 4ZT7A 1HYEA 2CHQA 2HDWA 1DG3A 1JJBA 1MOZA 2QHXA 2R8YA 1WP4A 1ACMA 4FSXA 4MI1A 4CU5A 4BATA 1WF6A 1SU4A 3VZPA 1HT0A 2IA5A 1N5LA 2OO3A 3R76A 3UJ3X 5FI1B 4ZO8A 4ATNA 2ZETA 1Y1PA 2EW8A 3R44A 3S1LA 3GFGA 3TZCA 3UWDA 4C0XA 4F2GA 4H6VA 3WICA 2OP0A 3MS7A 5K3BA 2IXEA 3TMKA 2WZCA 3VR6H 2M6KA 4Y18A 3CVVA 2KE5A 3THXA 4LMRA 2V59A 3FHOA 3OFND 3SDBA 1E8NA 2QBYB 2XCOA 5LB4A 3EVFA 5TXGA 1VG8A 4WK2B 4XRGA 2B34A 2ZATA 1XMXA 4NZPA 4TXJA 2YYSA 1TCAA 3PCTA 3HXMA 3FAKA 1KPHA 2EERA 1YS2X 3EIOA 3FJOA 2PLNA 3VU9B 4ZQHA 1MH1A 1P2VA 4B83A 4Q47A 2MMCA 1GSHA 3SFZA 1KJ9A 5EXXA 1ADYA 2FPGA 5TPZD 3IUYA 3L07A 4MQFA 3R9XB 1I9CA 3FSGA 5H7XA 2XECA 4H31A 4RXTA 1L5GB 5KVSA 2O20A 1KMCA 3BREA 3I6ZA 5D8DA 4GO1A 3LOQA 1DJNA 1MAVA 5DHFA 3PHHA 4XXHA 4DEVA 1N2JA 4DR2B 4D0SA 4DCMA 1TJ3A 1TZJA 1NQTA 3G0DA 3QPUA 2RKOA 2YFKA 4Y6RA 4EHDA 1JLLB 1TB4A 3I3OA 4BMPB 3SF8A 1TCCA 3DV9A 1HF3A 4D96A 4ZCQA 1TOAA 3TUZC 1RWMA 1FDRA 3IAXA 1U28A 2FVXA 4IVNA 4IVRA 1ECLA 4L6CA 1UEIA 5ECGC 1E7RA 1CT9A 1HYQA 3N28A 2Q8PA 4BLPA 1GUDA 1P5RA 2RH5A 5H80A 1QVAA 3EVTA 3DZHA 3FH0A 3LWDA 4O2AF 5ADVA 1QR6A 3W3AD 3FTCA 2GAOA 5C7LO 4RTPA 3H8SA 3QG5A 5FL7D 2O3SA 4YREA 1YFLA 2P1RA 3GGCA 4R4JA 5DCYA 1M8JA 3NAMA 3W5CA 1FFWA 4RMNA 4GL2A 2X9QA 2JLCA 1JBKA 1EFHA 5HCUA 2I67A 2P41A 3F4KA 2PRKA 3Q5EA 2C3PA 3I6MA 4YCJA 2E85A 4IFTA 1ICIA 2TRSB 1N9GB 4A2PA 4AT1A 2A0WA 4PQGA 4YMIA 5A3SA 3IAAA 5L7TA 4P80A 4DILA 2E9SA 2Y9PB 1L7VC 3DR3A 4JJAA 4C4ZA 2CEKA 2FZKA 1VRVA 2PKEA 4IKOA 4P7KA 3EDRA 3I2GA 1KWGA 3ZBUA 1FTNA 3GT3A 5HIKA 1C2YA 2IXBA 1GKKA 1DI0A 4ALJA 3MHTA 3M4ZA 1BXRB 1E3IA 3B2NA 4MITA 3A3OA 4GICA 4K3VA 3PXEA 1ONPA 2NZYA 4EM6A 2WIGA 3OM9A 4PIVA 1E1NA 3FPKA 4PC3A 4PNZA 16PKA 1MIHA 1N3LA 1UDXA 3HZHA 3SHQA 2JS7A 5C1OA 4J2HA 1Y5RA 1QRDA 4WJZA 3ILHA 4GM1A 4HX5A 4CT5A 2WVAA 3HP1A 1C50A 3VKHA 3GCGA 3MWKA 4MVJE 4QGFA 3FROA 4JJGA 2HO4A 2F1KA 4FCCA 1LD3A 2BEWB 1U80A 2WUDA 2Y1EA 4OXKA 4RENA 2GK7A 3D0QA 3IR5A 4ZV9A 4AECA 5LU9A 4Q1FA 3LO5A 1OBOA 3TOXA 3GGGA 3GLHE 3BFVA 3PEVA 2FCAA 5JSUA 1ACJA 2FPWA 3EGDA 2WU0A 4TRNA 5KOHB 1N9KA 1T5OA 3T7TA 5JADA 2WSYB 3BSSA 1DAOA 2BKVA 2ZGVA 3G02A 1E2QA 3Q88A 2GNOA 1W88B 2UYYA 2ZSBA 3DXFA 4PR3A 2F3TA 2IYTA 3N87A 5EJ9A 2J9ZB 3IP1A 4YAOA 1Y9DA 2ZI3A 2JCGA 4IFBA 4BQPA 4DTCA 4FZVA 3UG6A 4BNDB 5B1YA 2DHQA 1WZ2A 1SK9A 2J3JA 3GVPA 1ISGA 1CY2A 3BDVA 5AVRA 3WGIA 4KNWA 4I4NA 4B82A 2IHZA 2DXIA 4YV0A 2YV5A 4KBYA 2FF5A 3PZBA 1SG6A 3BICA 1QDUA 3AHIA 4O1HA 5T5QA 4DXHA 1SD1A 1H0RA 3OPMA 4RH3A 3ZW9A 2XEXA 5FQOA 2GM9A 1IDOA 3QLUA 2GEKA 3BMXA 2GPWA 4MUIA 2LCQA 1R5BA 2XOKD 5M2QA 4OA5A 1QK5A 2NO0A 4FP9A 3OKFA 1YA4A 2JIZA 2DQKA 4JLVA 1LRLA 1XZ8A 2QT0A 3CLTC 5AK0A 4C7OB 1QIFA 3P9IA 1E60A 1LZLA 1R9GA 1CSEE 4JCCA 4W6QA 3W2EA 1R4ZA 1LQUA 4TN1A 1DBWA 3VO1A 4CIYA 2C2XA 2NOAA 4FDLA 4MRMB 4U00A 2WVJA 2GN8A 2XSZD 2PJZA 4B74A 4D46A 1LTHR 3AJEA 4HNAA 5HIMA 1YQWA 3TQTA 2RBEA 1PR6A 1XMIA 1U0LA 4CKBB 3T3NA 2BUCA 3U4IA 1ATZA 1FUUA 1IQPA 3GHHA 3MTEA 4NV0A 5HM8A 3WRYC 2O05A 4LYYA 5A5EA 1KH2A 1R0XA 2JK0A 3O73A 1T0HB 4KEAA 1Y4UA 2XGGA 1SC1A 1LH0A 2I7DA 1VE6A 3F6PA 2QUAA 4WLOA 5CXQA 2WFLB 2X0EA 3X1XA 1J42A 5IZCA 4FGUA 1Q3KA 2ORVA 4IZ6A 1Z12A 3AEKB 3SBDA 1XV5A 3HXPA 4L6IA 1WQ1R 2EQBA 2YC4C 3VYSB 1ZD1A 2G6BA 1YXMA 3CSUA 4UNNA 3O9VA 3ITKA 2GQ0A 3SQNA 1I7QB 2UYHA 1YZQA 2ZYVX 2HU2A 1XQXA 1VMIA 2OZLB 4KO1S 2JW5A 3RAGA 3DL4A 4JDUA 2W8ZA 1GZ5A 3MD0A 4GX1A 4NENB 4FT2A 1SUDA 1X86B 2EFGA 2V7XA 4XVQA 1GARA 2VYCA 4S1VA 1DWUA 5FR1A 1AUVA 3PR2B 4WOPA 5EP3A 2V0CA 3OEHD 4EVIA 3VDMA 1UMCB 4IJWA 4UW9A 1RXEA 3U7EB 1V2GA 1XTKA 2R7LA 3PFIA 4FYYA 2P6OA 4GZMA 5DLDA 5LB2A 5CFOA 4URZR 3O2QB 3ZDDA 3GG9A 3RCBA 3HI4A 2PRZA 4OHRA 4CM4B 3IHKA 1S89A 1U3CA 5DGDA 4XDHA 3AETA 5IBPA 4F45A 4DCCA 4DVJA 5CAEA 1PWHA 3ZK7A 4OCZA 1XYVA 4BBZA 2PQ6A 2YYYA 2AN5A 3L06A 3AF6A 1GTZA 1N2XA 1W6RA 4YWJA 3A6HA 4PGMA 4TMYA 4MJ7A 2EG9A 4PX5A 5DT2A 3SC6A 3TQIA 1FLAA 4TX1A 4MAAA 3WB2A 3N0WA 4MOWA 3RVDA 1ZH8A 5M7EA 2PUAA 2F43A 1NURA 3FA2A 5E9WA 2IT1A 4OQYA 2F67A 1TLLA 3C7DB 7ABPA 3UAYA 4FPXA 1Y1LA 2CYAA 4NH4A 2GDZA 3ZHCA 3TM5A 4UMDA 4HDMA 5H8WA 2AFRA 3COJA 2GFHA 5F51A 2DG2A 2FF7A 4JP3A 5FQNA 1AD2A 3PNKA 1S8OA 2ZS7A 3PUZA 2GUWA 5L51A 3DTYA 1QH8A 1Z2NX 2PZLA 1IHXA 4AF6A 2R8EA 4RK1A 3E7DA 3KZXA 5LN1A 2OQVA 4ZXPA 3AGPA 3O8DA 4ZK2A 4MVJI 3I2FA 5LZ8A 2NIPA 1K7YA 2FWJA 2GK3A 4UUPA 1H0SA 2IX3A 2OBFA 3I3SR 5GV7A 1FXSA 2IPXA 4MINA 3K31A 3UMRA 3E61A 5B2FA 2BKAA 1SUPA 3NRBA 3BH7A 3VKGA 3LLMA 1NYTA 1Q83A 2KBFA 3DZJA 3QENA 1CLEA 2ON6A 1XLTC 1GNPA 1I3LA 2NZWA 2WJGA 4NATA 4KAAA 3TQCA 4D4JA 2X6RA 1RPZA 5DBFA 2V8OA 4Y7DA 1RM4A 2HLDD 2OHJA 2YMQA 3ZQ4A 5ED4A 4HXYA 3H11B 3T7EA 1QHEA 1OLSB 1IB6A 2COEA 3BG5A 3GOQA 1GFIA 3PKZA 4AQYB 3NTVA 2J85A 4OLHA 2WFAA 2G7MC 3NHLA 2CUKA 3M7IA 4WY5A 4KAFA 4US1R 3FKSA 2YW2A 5E6UA 4OYLA 4BMSA 4MEJA 2UUOA 5BV0A 3L6OO 3A32A 3QYJA 1NDHA 4MULA 4OM8A 3WFZA 1WVMA 2CZQA 4J0DA 1UBLS 1OXXK 4YJ3B 1LLDA 1WSAA 1V6CA 3C8MA 1ZXLA 5ARBA 5I7EA 2IUSA 2RMKA 4OP3A 4Y67A 1GRNA 4K6FA 3S0JA 1CR1A 3O84A 1XPJA 3D8HA 1E3JA 1MXFA 4GR5A 4PSDA 4C22A 4QAQA 5LA6A 3VDNB 1EDBA 3K9GA 4ZHQA 2B36A 4JVMA 1H4TA 1O4VA 3DWIA 1SBTA 3IQWA 4QTUB 2WHYA 2XWJI 3KTAB 4BS9A 2B7CA 4PZ9A 1E3WB 2I29A 1TJYA 1YS4A 4TMZA 5JVDF 3WWDA 5LJIA 4DIOA 3H97A 4FFVA 1D2RA 1QOZA 4FONA 1XL1A 1UPTA 1CR0A 1Z45A 2D0DA 1FE8A 4YP0A 5DM1A 1NNSA 1KFJB 3KFVA 4CMHA 1UPAA 2X5NA 1G3QA 4J4TA 3PB3A 3IR6A 1XYYA 5CYOA 2X2EA 2NT4A 4QEDA 5EC8A 3D5QA 3TSYA 3UN1A 4TYPA 3WBJA 5AKHA 5BNIA 3VV2A 3DULA 5FUBA 5IC6A 4DM7A 1SOVA 1NJ1A 4LDZA 1N2GA 4GNRA 4JI0B 4DLUA 4MQBA 2GWRA 4B4DA 4NBNA 3JQ8A 3QE4A 2HDNB 3CURA 1K0UA 4FGKA 4XYMA 2VN8A 4HUQB 3ETDA 4X24A 1A9XB 1D2CA 2BOVA 2GAIA 1F6BA 2ZQZA 1K8YB 5KTYA 1B41A 3HFGA 4Y2HA 4ZDKA 4ZYXA 2RHDA 1O96A 5JXHA 2VJQA 1UBMS 3DAPA 2F1HA 1HTWA 4DV0B 4AY5A 2ZBUA 3EZXA 4K26A 3V4SA 3MCWA 1E5XA 1X13A 3D3QA 1B42A 3LT5A 4WLUA 3SIRA 1D3AA 2QQEA 2YWCA 5L7WA 1JECA 4GWKA 4OJQA 1FVOA 2EDCA 5EXDA 1WSWA 2ID7A 2UYOA 3SJCA 4AS2A 5KQPA 3AUKA 4NLLA 4NX2A 1B1CA 3OICA 3ZW8A 4ENPA 1NI5A 1HL7A 1G20B 2BHRA 3QE2A 4W8OA 1CEXA 5KKCA 4X44A 3LX4A 3WGNA 4FDAA 1UXGA 3HVJA 4TKVA 3VR5A 2RBKA 5JY6A 4DR7B 3EF1A 3PC7A 3EWNA 3I58A 3EXIB 4JCOA 1ZNYA 2WWTA 1MDBA 4MYRA 3SJ7A 1APBA 3S70A 1N3BA 2HWXA 2IH5A 1K6XA 4I19A 5GVSA 1K75A 1W4LA 1BMFD 1V6AA 1Y3CE 2C7VA 2DKNA 1V1MB 2QT1A 3DE7X 4FOSA 1PYOA 2OHXA 4KQ6A 3JR3A 3EWSA 3E03A 4LI3X 2QTBA 4QA9A 2PGNA 4V0RA 5E6SB 4Q1EA 1FNDA 3W06A 4XH9B 4LJRA 2R84A 1CU1A 4Z1MD 1C8LA 4QRDA 4L78A 5JEDA 4C4RA 2FWIA 1J8QA 1UXJA 3X2FA 3F9CA 3F73A 3B6JA 3OOWA 1R88A 2QJTA 4HYTA 2QAGB 4UASA 2JHCA 2QPTA 3TR0A 5K0FA 2A1TR 1Y8QA 5CFZA 4I1YA 1MTOA 3W3AH 4DB2A 2IEGA 2RI0A 4WKOA 1HE5A 4Q7JB 1HYBA 2JFPA 1ZD3A 4HSGA 4OI2A 3CVWA 1ZJ6A 1EYZA 2XB2A 2PH1A 1R37A 1UZAA 4IGFA 2OV4A 4RE6A 5CX1A 3RC9A 3S40A 3S6JA 3UJ7A 3ZHXA 4CMAA 2VT3A 4O4LA 4YDRA 1E8DA 1K7XB 4QOHA 1Z34A 3DBIA 5JDCC 2E89A 2HA0A 1ZZEA 3AEQB 3KJQA 4Z0HO 2WABA 3EFEA 3RYIB 5ICMA 3U4GA 4PHCA 3DLIA 2BMFA 1KORA 2ZOSA 4RXUA 1KFEB 4GSYA 3MTDA 2W8BB 1SOWA 2YVUA 2OO7A 1GTVA 4NBUA 1EKXA 2FG5A 2YRWA 3I9FA 4K1LA 4C3VA 4LC0A 1K3UB 4CTKA 3V4FA 3MINA 5F5XA 1YBVA 3LFUA 4EJMA 5J58A 4V1CI 4DA0A 5JWRA 2Q6TA 3N59A 3KEGA 1KI4A 1NAIA 1Z28A 2OQ2A 4DGQA 2I22A 4B6EA 3BAZA 4H35A 3A14A 4P35A 5JT1A 1HPLA 4M7PA 3RK1A 4EJ6A 4G1UC 2YIVX 4UNIA 2O8DA 1SHZA 1XTJA 3ZDAA 1GPYA 1LDBA 2Z3WA 4HNRA 3ABQB 4KYUA 3RYFB 3ZBPA 3WHIA 3WL4A 4F38A 1S3FA 3DMDA 2O7RA 3W05A 2Q6IA 2NAPA 2GEUA 2WSBA 1YUBA 3WWPA 1AO0A 4YASA 4PG7A 1U65A 2E5LB 3RVNA 4MB6A 3GUUA 1MT0A 1M6VB 4X8OA 1V7QA 3ZE1B 2RKBA 2OV3A 1X2BA 1C1DB 2GYWA 4ETMA 2J6HA 2KYRA 5I8PA 1I7SB 4HDKA 4Z2AA 1OI2A 5IXJA 5HYVA 1G5RA 2Q9AA 1GUBA 1L4FA 1JG6A 2YHAA 4IW3B 3RSFA 4TV8A 2NZVG 3VNQA 3SCZA 3LWBA 2VP0A 2XUIA 1BHSA 1FDVA 1UPFA 2R6AA 1U8FO 3FWKA 3B3JA 3QEOA 4WT7A 1Z7WA 4HADA 3GLUA 3ZGVA 3GIDA 3T34A 1OU4A 1C8BA 2BAGA 4I81A 2PRJA 1E58A 3JYPA 5FH9A 5JCXA 2WWVD 1GLNA 1C41A 1XTVA 1V11A 4IO1A 1RWKA 4DWOA 1W4CA 4U9HS 4Z6KA 2H2AA 3QEAZ 5AWFC 1FSSA 2GO7A 2P6MA 2QP3A 3OAAA 3CUWA 3NHRA 3E5HA 3ESYA 3K92A 4E6PA 4DDWA 4CQMD 5EG5A 5D84A 3RO7A 2A5DA 2WTEA 1GQ2A 3PWTA 1XQWA 3TE7A 3U4HA 1Z5WA 2L19A 2G7ZA 3I4LA 3KG2A 2Z2XA 4UHKA 2CFSA 2H1HA 1UF9A 5DBEX 1XTRA 3AR8A 4Y3UA 3FBTA 2I6QA 4G36A 4BKRA 4BQQA 3DFKA 1O6BA 3AVUA 3HHPA 3O8RA 4RVHA 3DTNA 2XF8A 1TGVA 2PZAA 5FULA 1UM9A 1H1LB 3M34A 3FWPA 4GAEA 1EFDN 1ESCA 2WG2A 1UDWA 2WYVA 3LUCA 3OTQA 1KI2A 2O0LA 4LJLA 1EA7A 1UKBA 1JNYA 5F1PA 1FPMA 1GQSA 2MR6A 2ZWMA 3DOEA 3E1GA 3GJ3A 3BERA 1F2TB 3ZWOA 1XRJA 4AFNA 2KI5A 1XK7A 3HFRA 1NW5A 2C58A 1QFMA 3E7XA 1GCAA 3G2OA 5LP1A 1ZGJA 1JIQA 4J29A 4HNQA 4NU6A 2V6MA 3G8BA 2R7AA 4ZU1X 4ZWNA 3VC7A 5A4JA 2XTAA 1N7HA 2W11A 4IXMA 4WACA 4JU9A 2PU5A 5GP1A 1PSDA 1TVKA 3V7WA 1NQVA 4W9MC 1HWYA 4GZ6A 4YONB 5HUHA 5DM60 4CWAA 4XTCS 5KIAA 2PLFA 1JSZA 4OY3A 2FSPA 3S4YA 2FPKA 2EARA 5CIQA 4TMTA 3FMVA 1GG9A 4FDVA 3T0IA 1XLTA 2OKGA 3OTGA 4FFBA 1HDCA 1S2MA 2C3OA 3EW7A 3W5JA 2FEPA 1P80A 4L5CA 5CRIA 1MC4A 3A4IA 3F74A 3FYDA 3ENNA 3O93A 2HZ7A 3OSUA 4C4OA 3DE6X 2MR5A 1RLTA 3DE1X 3HU1A 1GN8A 3G2MA 4XWTA 3AXSA 3SJBA 2VBFA 3BH6A 3GLFA 2P0YA 3V2GA 1ZKDA 3MCAA 3NC1C 4JMLA 2OYCA 3WSVA 1AMNA 1YIAA 1G38A 5CXSA 3WSWA 2OUKA 5LUBA 4Y9RA 4BMCA 2ZKIA 2O7SA 3T7AA 1GXSB 1HDIA 3AR6A 2XA2A 4QATA 3ZU5A 3PXDA 4C29A 4DDTA 5JJLA 5BUCA 1PG0A 4A15A 5ALJA 1Z6YA 2G5TA 4P3XA 3DPUA 4DA4A 1VZ2A 2BM9A 1D8TA 1RDFA 2XUGA 3L4EA 4LXHA 4M0MA 1CRWG 3H17A 2E87A 1J9EA 1KAMA 2WD9A 1NI4B 2ZRHA 4GMHA 4INOA 1XZNA 4B3FX 4F8YA 4B5LA 3EC1A 3SQXA 1WHSA 4J49A 1ODTC 1TADA 4BNFA 1R1DA