4P7KA

Rat comt in complex with sinefungin
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
219
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 74
structure length 219
sequence length 219
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4p7kA00
4O29A 3ME5A 3LCVB 3CJTA 4KW7A 5DXJA 4CKEA 1TPYA 3HP7A 1JG1A 1XDSA 3NWBA 5FHRA 5JUWA 5G02A 2Z6UA 1D2HA 1KXZA 1L3BA 2OY0A 4C4AA 2DPMA 1KR5A 2IGTA 1JG3A 1WXWA 4M38A 4RSRA 5E1BA 4AZSA 2I9KA 3EVAA 2OO3A 3HNRA 4HTFB 1X1DA 1I4WA 1V39A 2BM8A 1RI2A 2GPYA 2EFJA 1YB2A 3JWIA 4G56A 4R6XA 3VC2A 1XDUA 3B3GA 4FT2A 4U7PB 3EVGA 2O57A 3AY0A 3B7PA 3RODA 5E2AA 3D2LA 3JWJA 1VL5A 3RIEA 2OPBA 2NXJA 1F38A 1R18A 2GLUA 1QAMA 2IP2A 3JWHA 2V74B 4DM3A 2EJUA 1FBNA 1AQJA 4P7KA 2P7IA 1YUBA 3LCUA 1JQEA 2AR0A 2OZVA 1SUIA 3LDFA 5MHTA 1P91A 5M5BA 1L1EA 2H11A 3TKYA 1ZKDA 2H00A 2PSSA 4ISCA 3I64A 2ZBPA 3CKKA 3OZRA 4C05A 5T6BA 4E70A 3KQQA 1RI1A 3A7EA 1JTEA 2Z6AA 2Y1WA 3UJ6A 2GA9A 2OB1A 5GM1A 3PFGA 1ZG3A 4OA5A 2JJQA 2XVAA 3G7UA 3ANXA 4FT4A 1UIRA 1JG2A 5EG5A 2FPOA 5KQSA 3FPFA 3BWBA 3V97A 4FP9A 4DF3A 1YF3A 3UBTA 4E31A 3DR5A 2ZBQA 3DXYA 1WXXA 3B89A 1VQ1A 5FQNA 2NYUA 1FJXA 4HGZA 4YUZA 2BR3A 1RI5A 4XUCA 2PX5A 3OU2A 2PBFA 5BW5A 2G8NA 5LQCA 5HIJA 1G6Q1 1Z3CA 3BWCA 1VE3A 2O05A 3QV2A 4PYJA 3UJCA 5ERGB 2P8JA 3ELUA 4KDCA 3H2BA 5DPMA 2CL5A 2HWKA 2P41A 3CBGA 5DSTA 4C08A 2PT6A 4GQBA 2IIPA 3LX6A 4YUYA 4PIPA 4X41A 2P7HA 1VPTA 2ZIEA 3LECA 3CGGA 3PVCA 3GWZA 4LECA 1P39A 1R00A 3B5IA 3HCFA 1WG8A 2JHCA 3LL7A 3AXSA 3T0IA 3UJBA 5LSAA 4DZRA 2QY6A 5KVAA 3REOA 1NBIA 5CCXA 3NW9A 4HSGA 5HFJA 2N47A 3HCAA 3MGGA 1KPGA 1O9GA 5K01A 3GRUA 2O0LA 2ZBRA 2AS0A 2OYRA 3M6UA 2JH9A 5CM2Z 5DLYA 4AUKA 5GIPE 4ER7A 4OQDA 4HC4A 3G5LA 4PCLA 3HVHA 4RTRA 1QAQA 2PXAA 4MIKA 4BLWA 4RTQA 2G72A 5LQKA 4BLVA 1R8YA 5LQAA 4RVGA 4ER6A 4F86A 3DP7A 3SMQA 3IV6A 3VC1A 3CCFA 4PYKA 4E33A 3ELWA 1FPQA 1D2CA 3LCCA 2PKWA 3SSMA 3Q87B 3NVKI 2HNKA 3CVOA 5DTQA 4CWAA 5DXAA 3R24A 2VDUE 3FUVA 1D2GA 3MTEA 4KVZA 4IV8A 5C0OE 2C7OA 3HA7A 1TW2A 3FPJA 4AZTA 1N2XA 1FP1D 3AJDA 1KIAA 2Q41A 3K6RA 1DUSA 1JQ3A 2VS1A 4Z2YA 3G2OA 3QOWA 1ORHA 4DA4A 3HVJA 5LQJA 4LG1A 1KP9A 1XCLA 4R8SA 2JG3A 1AF7A 4QQKA 4RVFA 2XVMA 2ZTHA 2FK7A 3DXXA 2ADMA 4QDKA 3KHKA 2CWWA 5EZQA 4BP3A 5HOQA 2Z6QA 5EEHA 4DKJA 3LKZA 4RYLA 5CVUA 3EVFA 5IH3A 3NMUF 3CJQA 4P7GA 5DM4A 2YXDA 2BH2A 5HEKA 5GIOE 5HILA 1SG9A 4HRAA 3FTDA 2ERCA 3LBYA 3TR6A 3GRRA 2B3TA 3G2PA 3LHDA 4Y30A 4OBWA 5E1OA 1X1BA 4A6EA 1R74A 4FGZA 3Q7EA 2YR0A 2PV0A 5CUQA 3LPMA 1JQDA 3P9IA 3M70A 4XUEA 1Y8CA 2FHPA 3UWPA 4DCGA 3KR1A 3RW9A 4DCMA 1N7JA 3A27A 3NWEA 2NP6A 3SGLA 3FTFA 1X1CA 3TRKA 1RJFA 3TQSA 5EMKA 9MHTA 3FYCA 2ZLBA 10MHA 5E9JA 2IBSA 2GH1A 3M6XA 3EEYA 1TW3A 4EVIA 1MJFA 1L3IA 5HIKA 4AZWA 5DTMA 3IYLW 3KQVA 1EQAA 2LD4A 8MHTA 3OPNA 3SVZA 4P7FA 4C06A 1ZHFA 2OKCA 2NXNA 3PFHA 2VDVE 5DM2A 3HM2A 1XTPA 1QAOA 2B78A 3HTXA 4A6DA 2PXCA 2UYQA 2UZ4A 4OBXA 5DX8A 5EIWA 5LR6A 3ELYA 2OXTA 1XXLA 3HVIA 1VLMA 4OQEA 4FS8A 4IKPA 3GDHA 4GOOD 3PTAA 2G71A 5K0GA 2CKDA 2DULA 3UZUA 2PX2A 3P9NA 2A14A 4E2WA 1VP3A 1QZZA 1RJEA 2XYVA 1EIZA 4CXMA 1NW6A 4QPPA 4YV2A 2YX1A 1G55A 3DTNA 4GOND 4Y2HA 3UJ8A 3C3YA 3HCEA 4DMGA 3PT9A 4H0NA 5CVDA 2ZIFA 2K4MA 3C6MA 3FPHA 5HIMA 5F2NA 3LKDA 2YXEA 2ZWVA 3UA3A 3EGIA 4QQNA 1NV9A 3OU7A 5CIYA 3FTCA 3MTIA 1G38A 5EKXA 2GB4A 5CVEA 5CCBA 3GO4A 3G8AA 2VP3A 4X63A 5KQRA 2PLWA 3O7WA 2AOUB 4KIGA 5GINE 1Q0TA 4R8RA 3PX3A 2P3QA 4ZTBA 2AOUA 2QRVB 4F85A 1H1DA 4EK9A 3UA4A 1PJZA 2CMHA 1O9HA 3FUTA 3FZGA 3P2IA 1JR4A 4KRGA 1DL5A 1NBHA 2QRVA 3GU3A 3KR9A 4KIFA 2HV9A 3GIWA 4YV1A 4JXJA 1XVAA 1DCTA 2OBFA 5F2KA 2IH5A 3BGDA 4BY9E 1R8XA 3DH0A 3LBFA 3GRVA 3KU1A 2IPXA 5CD1A 4HH4A 4RTLA 4XCXA 2UYCA 5LQUA 3A25A 3B3JA 2B9EA 1M6EX 3CC8A 3EMDA 2IDJA 2WA1A 3U81A 1EAMA 3OE5A 4M37A 5EC8A 2P40A 3OZSA 1NW5A 3IEIA 1FP2A 5ICEA 5LQRA 2JH8A 4OX9Y 1T43A 4RTOA 3TOSA 4PYNA 2C7PA 4PYIA 5K0BA 2G1PA 1RI3A 2ZSUA 2EX4A 5DX1A 4YMHA 1AV6A 2EJTA 2I6GA 4EQZA 3MHTA 2FYTA 1M0EA 3X0DA 1SKMA 2QYOA 1WS6A 2NNWB 5KS2A 3BUSA 3QOXA 3FUUA 4GF5A 2AOVA 5HIIA 3R0QA 3PX2A 1NW8A 1SQFA 2P3LA 2EG5A 4PWYA 2HR1A 4RTPA 1YFLA 3I58A 4GOLD 4RX1A 3G2QA 1JSZA 2P3OA 3O4FA 4XUDA 2XBMA 3BXOA 2QM3A 3GNLA 5HZMA 2NXCA 5IKMA 4B17A 3ER9A 3KKZA 2PX4A 3NVMB 3EVEA 4PYMA 1L9KA 3FTEA 4RTNA 4K6MA 2BR4A 3IHTA 5LQNA 4PGGA 1VIDA 5FWAA 1EJ0A 2PVCA 3EMBA 4E32A 1G8AA 2XYQA 3GCZA 4L7VA 3G8BA 4R05A 4GC9A 4P58A 2UYOA 2IH4A 3KR2A 5JR3A 5K03A 3KQWA 3GJYA 3VSEA 2BR5A 2F8LA 3E05A 3A26A 3G5TA 5T67A 3S68A 1EJ6A 3I53A 4MTLA 1YZ3A 4GEKA 4PYQA 2AOTA 5FA5A 5ICFA 2R3SA 3FRHA 2AN3A 1N7IA 1ZGJA 3OE4A 5FUBA 5U4XA 4FR0A 5K0CA 2C7RA 1EG2A 1NW3A 1BKYA 5K09A 4PONA 4NECA 5FCDA 2V7EA 2IDKA 4QPNA 5EQJB 3I9FA 2ZCJA 4YUVA 2IFTA 5E9QA 5D1NA 1P1CA 3DUWA 3ID6C 3BT7A 2AN4A 3L8DA 3OFKA 2AOXA 7MHTA 3KQPA 3FUXA 3E7PA 4PYOA 5GP1A 3HCCA 4AX8A 4V0QA 5EZSA 2PT9A 3P9KA 3E8SA 5EMJA 3MQ2A 1UFKA 5DM1A 4CKCA 4UOEA 2IBTA 4MHTA 4PYLA 4GOMD 2FCAA 1F3LA 3AWIA 3DLIA 4QVGA 5DRYA 3LDUA 2C7QA 3UJAA 3DMFA 5EHGA 1ZGAA 4GC5A 4C07A 1L3CA 5GWXA 3TKAA 3C0KA 2I62A 1QYRA 4KWCA 3G89A 3GRZA 4MQ4A 2UYHA 2B25A 3MCZA 4ATNA 4AZVA 3EVZA 5GOZA 1BC5A 4RVDA 4HGYA 2NXEA 3TPZA 5FADA 4YUXA 3HCBA 5E1MA 2FRXA 3KQYA 1IM8A 4OA8A 5DX0A 5P8WA 3JWGA 1IY9A 5GM2A 2AVDA 2PWPA 4IWNA 1YZHA 4WVLA 5DM0A 4X60A 3WSTA 1KHHA 1R6AA 3KQTA 5EOVA 5K0EA 5EMLA 3ERCA 5FULA 4PNEA 4MWZA 3GRYA 3UJ7A 3KPVA 1NE2A 3R3HA 2ZULA 4CKBA 1XDZA 2OB2A 3BGVA 3DXZA 3MB5A 2HTEA 3SX0A 4HTFA 4E2XA 1YFJA 3M6VA 4EKGA 5DSXA 2ZZNA 1NKVA 2O06A 5FA8A 3THRA 4FSDA 1RJDA 4PINA 5K0LA 3KQOA 5BXYA 4V0RA 3T7SA 1BOOA 5EKUA 4EMSA 5BP7A 2BM9A 4M36A 3V8VA 5ICGA 3TM4A 1RJGA 4U7TB 5FQOA 2XYRA 4WXHA 5K0NA 5EHIA 4BLUA 2E5WA 2P35A 2H1RA 2ZW9A 5D1HA 3NDIA 5C1IA 5CVJA 4X1OA 3FPGA 3EGEA 3T7TA 3VYWA 4ER5A 3OU6A 1NW7A 3FPEA 3OZTA 3KR0A 2WK1A 2IH2A 1G8SA 5EIFA 1XCJA 3TMAA 1SUSA 4C03A 4YUWA 1SVUA 4LWOA 3KPUA 1O54A 5F2OA 3KPWA 4HG2A 1HNNA 4P7JA 4E2ZA 2ZVJA 3ER8A 4E2YA 1ZQ9A 2PY6A 3A7DA 3EVDA 2FK8A 4GUAA 2G70A 1JSXA 4BP1A 5B1SA 3HVKA 2PJDA 3EVCA 4RVHA 1KYZA 1WZNA 1G60A 2YTZA 2ZIGA 3HA5A 5DWQA 3LSTA 5C9ZA 3M4XA 1INLA 4ER3A 3DOUA 4RTKA 3C6KA 1VBFA 3NTVA 3P9CA 3AXTA 2NP7A 4C04A 3EEOA 3I5UA 3P2KA 3E23A 3HA3A 3TM5A 4F84A 4FZVA 5DT2A 2YUIA 2ZWAA 3MCTA 4EKIA 4PIMA 5KYGA 4RTMA 3DLCA 5FTWA 5E1DA 3SR4A 1XJ5A 2AOWA 3P97A 5EPEA 3TLJA 3PS9A 3R6TA 3T7RA 3BWYA 4GBED 3UJ9A 5ICCA 1IXKA 2QE6A 1WY7A 1JTFA 3P8ZA 4LWPA 5FHQA 2GAFA 2JHAA 3SM3A 2ZZMA 1NV8A 4POOA 3NDJA 4R6WA 4RTJA 2O07A 5BW4A 5E8RA 2PX8A 3LGAA 3C3PA 4QTUB 3OCJA 3SXJA 3F4KA 4ER0A 2I7CA 4RTSA 4RV9A 1NT2A 1KYWA 1PRYA 4QDJA 5K0JA 4CTKA 5K05A 1M6YA 2AZTA 3THSA 3UFBA 5DTRA 5E2BA 3OFJA 3G2MA 2AOTB 2YVLA 3GGDA 3BKWA 3M6WA 3A4TA 3NJRA 3ELDA 5E8JA 3TFWA 2ONZA 5K8VA 1JG4A 3BWMA 2AN5A 4QVKA 1AQIA 3B3FA 2YXLA 4CTJA 2PWYA 5H02A 3DULA 1KPIA 1RI4A 2ORED 1MHTA 1UWVA 3CJRA 1ORIA 3KQMA 1I1NA 2B2CA 3PLAE 1HMYA 2ONYA 2HMYB 3MERA 5EEGA 2VDWA 5E9WA 2PGXA 3SSNA 3FRIA 3FUWA 3G88A 1BHJA 1VP9A 3PB3A 3FYDA 2JHPA 3DMHA 3SSOA 1Q0SA 2WA2A 2Y1XA 3KPYA 3EPPA 3HCDA 1B42A 1X19A 3M33A 3DMGA 2ZFUA 3KQSA 2GS9A 3O31A 3P2EA 3BGIA 2KW5A 4E30A 4IV0A 2VZ9A 5K0FA 4DQ0A 4PCAA 4M7RA 5CVVA 3BKXA 3HEMA 3UJDA 2YQZA 1QANA 2PXXA 5FWDA 3BZBA 5EMMA 3MAGA 1X1AA 2CMGA 4YV0A 4X61A 2P1DA 2R6ZA 2ZZKA 1SQGA 3ORHA 5EVJA 3EVBA 4FSXA 3EGVA 3GXOA 1P1BA 3R9XB 1I9GA 4RWZA 5EGSA 1KPHA 4QTTB 5DRTA 4KDRA 5T64A 2BZGA 3KPJA 1U2ZA 1OR8A 4PGHA 4YMGA 3LDGA 2AVNA 3P71T 3K0BA 2ESRA
chains in the Genus database with same CATH superfamily
1XZMA 2GAAA 4CKEA 1ST3A 4LJLA 3WNQA 2XXJA 2ILTA 4ZHQF 3NWBA 3SK0A 1J70A 4MW4A 5JI3E 2O50A 1KXZA 2HU8A 4P4LA 3N5KA 2XH8A 2CDNA 4YAOA 3U0BA 3T4UA 2I87A 3KYCB 2OO3A 3LUHA 4BTEA 5JSFA 4QYSA 3WNVA 2XUGA 5AVXA 1JDZA 3GQBB 2VPQA 4YJFB 1WV0A 3ZWWA 2C4UA 3ENZA 2F3SA 2YIMA 2O57A 1ULSA 2C61A 3DZKA 3E7WA 3EVGA 3MPUA 4TL9A 4FC6A 3EH2A 1VL5A 2RAFA 5EWLB 1QTQA 1TO2E 5FPKA 1F38A 2C83A 2CB0A 2W98A 4U0KA 4WKGA 2V74B 1T4CB 5JATA 3LTNC 1FP7A 5E7QA 5SYMA 3WLRA 3GJTA 4JEHA 3LO8A 2OZVA 3OKFA 5CJ2A 1O6ZA 2J9ZB 5FLYA 3TQIA 2IXTA 2C8LA 4PRYA 3X43A 4RPGA 4ZI5A 1XZAA 1IN4A 2ZIWB 4LV6A 1MT0A 3DLAA 4CLXA 3LW7A 1P4GA 3Q4GA 2CLLB 3R7WB 2XTAA 4CIYA 1ZD1A 2IWRA 2CT8A 4QA9A 2B1JA 2V6IA 3SM9A 4NZ9A 1H2WA 2QZZA 4PO1A 4X45A 3CB2A 4WNCA 3IR6A 4DDKA 3LQFA 4B80A 3A9UA 2XQGA 3NHYA 4FT4A 4QECA 2QN7A 2WHYA 1NONA 2QAGB 1O94D 2ODQA 1FTWA 3ISVA 1NT4A 3DXYA 2DETA 1Z33A 2BHRA 4RCYA 3QMVA 3EX7C 3CZ9A 4RA6B 2PQ0A 4CMGA 3ETDA 2FMFA 1KZ7B 5H59A 1U1FA 2OQVA 4QLAA 4QHYA 1ULZA 4UVHA 5LP6B 1E58A 5TRTA 3O3NB 2RHDA 3TRDA 3KZOA 2CL5A 4TTIA 1VHTA 3RBAA 3NV7A 3IAAA 4LSWA 3LHSA 1RXWA 1RZUA 2VWPA 4CNBA 3CVWA 3HSYA 3V4RA 2RC6A 1V35A 1E63A 3F98A 5CD9A 1E6WA 3WWOA 1JWBB 2QRHA 1P39A 2FFRA 2EGGA 3BFPA 1H3NA 2ZYUX 4G4JA 3SKXA 3AXSA 1NGSA 3FPLA 2X9NA 4RH0A 1A9RA 3RVJA 4CR6A 3AI7A 4EWLA 5FWYA 2ID8A 3ICEA 5HFJA 1AM4D 2EKZA 3CLTC 3NIWA 3KOXA 3UJHA 3EEIA 2C2WA 3W3AD 5K01A 4B47A 2JI6A 2OYRA 1L5HA 1ZIOA 3V8EA 4K2HA 3WHLA 6REQA 3EIHA 1N1EA 3TMYA 3S8YA 2RJ3A 3I2FA 1E1KA 1TF5A 2VRBA 1Y9AA 3AP2A 3T1OA 4RTRA 4K05A 3PNVA 4ZO6A 4RTQA 2EJBA 2REOA 1FVXA 4KAJA 2IRWA 4Y2TA 4ZVUA 3DP7A 3PD0A 4DZTA 4DNPA 4E33A 4AJNA 1JSCA 2RHRA 2X0JA 1YL5A 5T8KC 3PQ2A 1BQ4A 1L7OA 3PCXA 1Y3BE 1ZCBA 2HNKA 5DGDA 3W8FA 1MB2A 2XNKA 3MD9A 4FEYA 4N0QA 5PNTA 3JATB 4L51A 4CEIB 3H0KA 3MTEA 4KVZA 4BNNA 1R9JA 4M1KA 3NONA 1VSTA 3FPJA 3EYAA 4KPUA 1JQ3A 1CUFA 1PZXA 1ORHA 3IE0A 3HVJA 4NLLA 5AVVA 2CVFA 5WRFA 1L0BA 3SIWA 4LDRA 3CX6A 4O6VA 4EHKA 3OY7A 4G0ZA 3K1AA 3ZU6A 1PT6A 2HO5A 3I1YA 1VBMA 3VKGA 1VLZA 5K3OA 4BFCA 3VVLA 1PG0A 3AQIA 1PJ4A 3BEOA 4RYLA 2OCGA 3NBYC 2XZPA 5DHQA 4LF7B 1D9XA 3QWAA 5ABPA 1SG9A 1II8B 4HRAA 1XWWA 3G2PA 3PUZA 3HU2A 4OBWA 1DZIA 1Y7HA 3Q7EA 1IY2A 1UT5A 1V4BA 2LZ0A 2OBLA 3PHGA 5CLGA 5LU8A 2JLUA 4I36A 1G21B 4FUTA 2PS0A 3CX7A 4KFUA 1YFZA 3HB0A 4MR8A 4J0JA 4U8GA 4DLSA 3NWEA 4F3TA 3D4PA 2AUTA 5LP1A 3TRKA 1XEFA 1KIMA 1KERA 3GLUA 4MLDA 4P31A 2HHHB 3RTCA 1D04A 5A5DA 4M8NE 3H18A 2REBA 5EXPA 3Q0TA 3C41J 2QTCA 2O2ZA 2R4QA 3KCNA 3QUTA 5HIKA 4NCAA 2R47A 3NHPA 1W34A 2OUKA 3ILSA 5SZJA 3DV0A 3REFA 4Q47A 2XSZA 1RC8A 1PL6A 3V4OA 1GG8A 3A3KA 1M74A 2MR5A 1FDRA 2YXNA 2UYQA 2V0GA 3A14A 2NIPA 1F6BA 3OX2A 8LDHA 3DBRB 3RJ5A 5FP0A 2C97A 4PLFA 1G1AA 5JWOA 5H8WA 3E3LA 4XGNA 3EXHC 4DLPA 1UEIA 5MFZA 1P1FA 3TLBA 1ZU5A 4Y2XA 2QT9A 1W93A 4TL7A 3ESAA 3X1ZA 4NXMB 1YMQA 3TJRA 1TA4A 3NT5A 2JLSA 3JQDA 1FA9A 3LPAA 3RTEA 4ZCQA 1VRVA 3MJTA 1SVWA 3FWZA 1KORA 4JYBA 5LUBA 2K4MA 5B57C 1J8FA 3E9NA 4L73A 4F5WA 1RM4A 1IPEA 3UA3A 1QIIA 2ZRNA 1G8JA 1JXMA 2XKBA 5KPDA 3QEMA 2A1TR 1TECE 4MARA 4FILA 3Q85A 1QGZA 3TVDA 1HT3A 3ACCA 4WOBA 1JQAA 4IOJA 4NNOA 3RS8A 4EO9A 3KEGA 4N82A 4X63A 1FFCA 4ZC8A 1L5KA 4D7AA 1YDWA 2Q6IA 4B4KA 2IYUA 4EZEA 1MAAA 4LHWA 1G8PA 3BD7A 3OTHA 3DB2A 7ADHA 5IXSA 5M2QA 4PWZA 4UAUA 1QP0A 1BW9B 4ENVA 1PR4A 4RVSA 5J4HA 3UUWA 2ZB8A 2CMHA 1IWOA 5AOCA 1GL6A 2WJ3A 2OCAA 721PA 5JAPA 1LU9A 2IPAB 3IQHX 1ML4A 4J2OA 1OU0A 4IR7A 1YUNA 4OLHA 2N0SA 3WGMA 3KL2A 1AXRA 3AK4A 4J1QA 2PL9A 3ZWQA 1DBRA 3DOFA 4HH4A 2YRFA 5A0FA 1U0OC 4PR3A 1QC5A 3AVOA 2DKNA 5JYBA 1PFVA 3L18A 4J0DA 4OM7A 1TVEA 1Y1PA 2C3YA 2LW7A 1QOPB 1UEXC 1X1QA 4PQYA 1A82A 1EWKA 1Q7RA 2NZVG 1U2TA 3KKKA 5LZ4A 2XCRB 3I01A 3KWMA 1QV7A 2PBZA 3NR2A 1VI6A 1WQ3A 3V8PA 5FYDA 3OFND 2R7MA 4Y6PA 5TQ0B 3ZXXA 3MTAA 5I7EA 4MDEA 1E79D 3RHZA 2ZR0A 1Z6PA 3TOCA 1FDOA 2A2ZA 1C1YA 5EE3A 1GFIA 4OIFA 3KD2A 3RGWS 1GGHA 4DMCA 4JROA 1NW8A 2JD1A 4KUEA 4OYHA 4DMHA 4ZT5A 3P9PA 1UT8A 2IEYA 1U81A 1NOJA 3SNHA 2I2BA 3MGBA 1FZQA 1BVUA 2C9ZA 2VJOA 4NENA 1J9EA 2XVXA 3TTYA 4ZZ0A 3CIOA 5GADl 3OQIA 3KSAC 2IDMA 3P9QA 3FTEA 1U5AA 2R79A 4EHJA 5JXWA 4FS3A 4UDOA 3ZE0B 3CH5A 3EMVA 5EHZA 5KYWA 2Y0EA 2Y77A 2ZU6A 3GZNB 3QNMA 4JBWA 4A9AA 4ZJZA 3EMKA 1GZHB 1MRNA 5FA6A 3VU9B 2VEDA 4AAYA 3REQB 4I1VA 1H4VB 4IM7A 3IL2A 4CN9A 2FWPA 5FWNA 5IFLA 3KR2A 1IPFA 1MQAA 3BHJA 1KO7A 4D02A 4MDYA 2A33A 2CBXA 4FDMA 3DQQA 4RJ2A 1OWPA 3EYWA 4ND7A 3AU9A 1MJGA 3FBGA 3VYWA 4OY3A 3KX2A 4JIGA 2G5CA 5JZSA 3FJ1A 3JASA 3KT8A 2QSZA 1JB1A 1C4XA 1EG2A 2WINI 2ZIAA 5A7GA 5K09A 5UKDA 2QMOA 2O4UX 1VPDA 3BB4A 4YCDA 1MVNA 3W5CA 1E0JA 2YY5A 3SBDA 3I3OA 1HOXA 3PXBA 4GVLA 3AFHA 3FIUA 1ZBQA 3GEBA 1OT3A 3JYHA 5ANRB 1Z8HA 5TT0A 3ZVLA 2WMNB 1N6PA 1P1CA 1TVKA 1XA0A 1SNYA 5ENVA 1CUIA 4D96A 3KQPA 3FY4A 5AVUA 1SC3A 1SD2A 2HLDD 2QTTA 2W6ID 4HEA1 2GN6A 2J4DA 2V8BA 3D4LA 1U0EA 5FI0B 4DT1A 1QHFA 4ZMSA 3O6VA 1M72A 4FHZA 2OCPA 2JLQA 3I0MA 1S02A 4C07A 4I9HA 1O8CA 2ZIZA 5GWXA 3SPXA 3STVA 3ZJYA 5KMGB 1PJ8A 3L1HA 4J0KA 2I1WA 1SVKA 1WZIA 3DEKA 2P2YA 4IH4A 4WLNA 3JQGA 4L5AA 4GR4A 4Y0NA 1C3LA 1DB3A 4JNKA 1SURA 1R1DA 1JMVA 1YVDA 1RPAA 4EG5A 1YE8A 4F4UA 2J3JA 1ARZA 2PCLA 2TS1A 5M3BA 1NUHA 1VSQA 4QLBA 4TRJA 4QYIA 1SOVA 1OYVA 5K3SA 3ZBTA 1R8SA 1TD1A 5THQA 2FEWB 3LXMA 1JSRA 2PN1A 2CK3A 3R3HA 4TPKA 1Z7GA 4URVR 3ROXA 3AZOA 5EUCA 3S81A 1HNZB 1YJ5A 2IU0A 3O4HA 2LNDA 4QUHA 2YS7A 4WK2B 4TV9B 2FUCA 5SY6A 4FOLA 1DAFA 3CU5A 3FVRA 1BCSA 1W88B 4PRKA 5H5JA 2HX1A 4DMLA 1SKQA 2XKJE 4V0RA 4RL6A 4JJZA 1LH0A 2VHJA 3QFFA 5AM5A 3P26A 1VMDA 3T9EA 4D6YA 4Q9DA 1CRLA 1GP2A 2XTJA 3EXEA 1F7VA 2FFAA 4JGGA 5DTIA 1H5NA 3K0AB 3H8VA 4RL4A 2ASEA 1RWMA 3OEED 1OMOA 5J4YA 2GASA 3KR0A 1TJ3A 4QVIA 5CURA 2IVZA 1JBKA 2VT2A 4S12A 3U9TA 3KDPA 4GWKA 3RUPA 2JGKA 4YUWA 5J58A 2EBWA 1GLVA 3O8QB 1NZJA 1RU3A 3A1UA 1VMIA 1ZJ6A 5FTJA 1OJ7A 3C7KA 2C20A 3OETA 3P9YA 4H1TA 1E92A 1KZ4A 4JBGA 4CMCA 4BP1A 5CDYA 1JSXA 2C7GA 1GVHA 1ZIXA 5L3ZA 4CLRB 2VCYA 2ENUA 2QKYA 1WCIA 5E3IA 3IPXA 4X62B 1GGEA 2XCLA 2QRMA 3HS3A 3NNDA 4J3JA 1UOQA 2AMVA 1F51E 3RS0A 2O2XA 4ZAWA 1VPEA 3JAWA 4KXYA 2L42A 1AB6A 4K3UA 4C6SA 3TM5A 2WZDA 1M0TA 4E51A 1ZKMA 2MMCA 3Q9SA 3ZE1B 4GGMX 4MHOA 4BN0A 4GPZA 4MWEA 1T2DA 1U90A 2HEIA 2YV3A 4BECA 4DLXA 2E4XA 4GD3Q 2IYWA 3NOOA 1E0DA 4G8JA 4KR9A 4B3RB 4ICIA 1BMDA 3LQ2A 1R0XA 3Q98A 2C9MA 3V42A 4LFCB 1C3OA 1OV6A 2EAUA 1N3LA 4N7MA 3QYAA 4DNOA 3WIUA 5FRDA 4HMPA 4NYIQ 5A7FA 2ONKA 3OJWA 4LQLA 1YOVB 4HO1X 3WISA 3FJOA 2VNHA 3STUA 2BFCA 2C29D 3R44A 5F1YA 1NFFA 1QTRA 2BFMA 4DGSA 1Q0UA 4JT9A 1GZ6A 2AJTA 1M1NB 2UZ3A 3GUHA 3W8EA 1ISGA 4FYVA 2AZTA 1KZ6A 4EYKA 3T7CA 3BKWA 4A2PA 2AKAB 3D3NA 1HE5A 3RCBA 2GYYA 4B6EA 5BQ3A 2XLBA 1NJ1A 2WUDA 1FVOA 4DJFC 2GCNA 2IV3A 2X5KO 1VG8A 2G9UA 3U44A 3AVTA 1NFRA 3EA0A 4N4AA 2I7VA 4UAGA 4IILA 4MMXB 2H4WA 3MTQA 4OGLA 4CHTA 4DCCA 2ORWA 2NG1A 4H17A 3UT5A 3AOEC 3GC6A 3V7NA 1KI9A 2D5BA 1GNTA 3BICA 3MUNA 1ZLYA 2RARA 2V0NA 1M8PA 2H16A 2HQRA 3DMHA 3F9RA 3K9HA 4NATA 5AKHA 3QV1A 3DHNA 3QLVA 5HW0A 1B8VA 3AESA 4C0JA 2AEFA 3FDZA 3KCQA 4PSKA 1R6TA 5AQ1A 1EUCA 4CN8A 2NT3A 3HJUA 5CVVA 4WECA 1M5TA 3BKXA 4UNSA 4XVHA 2C2ZA 2XCIA 4N8SA 2Y68A 5HE9A 3D59A 3KTAB 5D85A 4MMZB 3KTOA 3B78A 3IILA 2APJA 3JQBC 1JI3A 1E2JA 1JXAA 1HO3A 2EW8A 4IFIA 3PKZA 1REQB 2OZLB 3SNKA 4BMPB 4QUIA 1TFRA 2E87A 2FUNB 2Q9UA 3AZPA 4NCNA 4EO7A 2GJSA 3GGOA 3K31A 1E2MA 2I2DA 2VRNA 1YO6A 3DZ8A 2I6SA 3VAZA 8ABPA 3V3TA 2HK9A 1VECA 3C6BA 1KQFA 3RAPR 2W6ZA 4PHCA 4KQHA 1V0JA 3ZIAA 1OR8A 4Y2QA 2BKAA 5ADVA 4ENQA 1R9GA 4WK4B 4YRCA 2AVNA 1NP7A 2GTIA 4TQUS 5IK2A 3RV3A 1KEWA 5IPFA 5IKPA 3QJ5A 1Q22A 3D8SA 3D6AA 3ZGZA 4X00A 3HGQA 1R4AA 3DLHA 1QYDA 5KUTA 3EFEA 1N5RA 4KTTE 4ZMRA 1TE2A 2O1WA 2P79A 4LY6A 5FWXB 3F47A 4Q21A 1JKFA 1O4VA 4UZEA 4B45A 1NY5A 4LXGA 2BKUA 2BM8A 3GQVA 1FUKA 1PS8A 3K9NA 4G1VA 4UQPA 5HZHA 3EXFA 1GTMA 4M1MA 1KAMA 2F48A 3PC2A 4YJ3B 3IUQA 3GEMA 3NTQA 3K9GA 1K8RA 3ORFA 5D5HA 5DHPA 3SKVA 1TCCA 2F8TA 1GA1A 3C45A 3UV7A 2R00A 3CH4B 2LIPA 1TB4A 3K0CC 1JHXA 1FU7A 2WRZA 2BD0A 4J7CA 1HRDA 3AU8A 3MUFA 3UGKA 1XHLA 1EE1A 3JARB 1P91A 4MQLA 2WKSA 3WR5A 3OCWA 3RNLA 4IO0A 1AS0A 1LVGA 1NWHA 1T26A 3I5MA 1C0LA 3IMEA 4GLFA 1A5SB 1WB5A 5CEJA 3F5FA 3V4PB 1DAMA 3R7AA 2C7RA 4RY0A 1G2PA 1JP7A 3OZRA 3QNWA 1UMDA 2BGNA 3DKPA 1G5PA 2I5PO 2VNJA 2VQ3A 1ODTC 4IDEA 3O1HB 1J4AA 3TDMA 3CZQA 3W34A 1JFRA 1IBRA 2Y1KA 3A10A 4H2DA 4CMEC 1NVEA 4O1MA 1A96A 1Q21A 4L8WB 2Q2OA 1G66A 2EX0A 2LDBA 4LGCA 5IVDA 4A2QA 1Q11A 5I48A 1EUQA 4U6SA 2P2CA 3C3WA 1T9GR 3J7TA 1H2EA 1UJBA 4CM4B 2ZUFA 1Z8FA 5DULA 4F2GA 3JRXA 3VZSA 4IZIA 2QNRA 3FSRA 1M2VB 5BQ5A 1KARA 2ZRFA 4A03A 4MTCA 4UCFA 1IEVA 4KDCA 1GCGA 1GUDA 2OM6A 5BV7A 2HWKA 5H16A 3QENA 2EFDB 3EISA 1SCKA 2PT6A 4MRRA 2JZCA 3PI6A 3R6DA 1N4AA 3LX6A 2QVXX 2UUPA 3RT1A 1AN0A 2QAGC 1HG0A 2ZIEA 3FR8A 4FKMA 4LECA 3V32A 2NU9A 1Q1EA 2G36A 7AT1A 1KDOA 2JHCA 1ESEA 2NTJA 3PC4A 4NCJA 2XMZA 3T06B 4LYAA 2PK3A 1K89A 4EY8A 4UFPA 1CUJA 1QMGA 2A1UB 4REQA 1DOHA 4GZ5A 2MYNA 1TL7C 2N47A 5LP6C 5KWVA 4RKRA 4XIYA 2Q3EA 1O9GA 5A0VA 5FV4A 5DNVA 3ZOKA 1G291 4HNRA 4XD7A 2CXSA 2FMKA 2VTEA 2A9OA 4F21A 4O08A 3RK4A 1QK5A 2GXAA 4QEKA 5KC8A 3DQZA 1E1MA 2O2HA 1KO8A 3NV9A 1XZIA 3CW8X 2Q4EA 3NHSA 4X8MA 3F3SA 2XYHA 1F3OA 1HDOA 3WL5A 4ASUD 5B6PA 4CKYA 1GV0A 4L76A 1VGQA 1U28C 3JAKA 3KEQA 4RC9A 3K72B 3SLGA 3GLTA 3QHQA 3OIDA 3KOUA 4NF2A 5B3KA 3HVRA 1D2CA 2V1UA 2HIGA 1GZ5A 1XD9A 4B9EA 3T3MB 3W5UA 4CM1A 2FEKA 1FXUA 3ENNA 4FFSA 2YWDA 3FUVA 5KOYA 1HQKA 1YV9A 3Q5EA 2PV7A 1DRKA 3ROQA 2J3MA 2RGUA 4IV8A 2ZUBA 2OHFA 3RS5A 1V6AA 2JD2A 2VZLA 1V8FA 1YBFA 2OYCA 3U80A 5KINB 1NASA 3EWAA 3QOWA 4ZXFA 3RJZA 4ZI2A 2OZPA 1KP9A 1XCLA 4R8SA 5JQGA 2JBHA 1YCDA 5EESA 3CH6A 4FYYA 1E9BA 1KFJB 4R1TA 1KZHA 5JXHA 4N5LA 5HUQA 5IH3A 2JA2A 5IRCD 1M34E 1DO8A 1JE1A 4MOWA 1EHYA 1ADGA 5HEKA 5LVAA 3TTXA 2BMDA 2ERCA 4AKSA 1B43A 2ZRJA 5BQFA 2D1YA 3T4PA 3PXGA 1XN4A 1KGSA 2H1CA 3Q7RA 5JY6A 2W6JA 3M70A 1UBLS 4GRAA 1O94C 3GDOA 4G6ZA 4Z3DA 4DCMA 4RJIA 4MVWA 3IP9A 1U2DA 2YFHA 4EFKA 1GDTA 1T36B 4QODA 3P9SA 4DMKA 3FYCA 2OP1A 2BPOA 3E3NA 1U4OA 1K4YA 1MH1A 2OFPA 5A06A 2JLZA 2A9PA 1EQAA 3VR6A 3H05A 1W5TA 4NBVA 4WK0B 2XNHA 1IBLB 2B4KA 2XVZA 3H6KA 1OASA 4HQKA 4E12A 4MW1A 1MAUA 1T1IA 3I62A 2DUWA 2BZ1A 1E2DA 1EK1A 2HJGA 4LBWA 4F4HA 5LDDC 1Z6ZA 3RM3A 1QIGA 1L8XA 3BMCA 1QNFA 5DX8A 2YJZA 3VC3A 1P19A 1ZH6A 3DHVA 5LZ5A 5EJ4A 1W36D 1MB4A 2FUG6 4OHCA 2JJ1A 1T3GA 1NI4B 2FLKA 2GFQA 2IYVA 3ACBA 3IAS1 4GOOD 3G02A 1L8OA 3SZRA 1QPGA 1RBYA 2G5TA 3H19A 1ORWA 2PU5A 3TD2A 1XAHA 5CA1B 4CXMA 1FF9A 1RWQA 4PLHA 4X6UA 1ZOIA 5C52B 2RH8A 3ESBA 4MQMA 4NHOA 3V8NA 1XF9A 4H0NA 1X9IA 3C6MA 1U0HC 1NULA 1T3TA 1K5GA 3DBHB 4PF1A 3UG6A 1TUBB 5G4LA 3O4RA 1T35A 3DMRA 1VKJA 4WKBA 3IO3A 3RLIA 1MKYA 3CA8A 1NJ5A 5DP1A 2XQIA 4LPKA 4C29A 5G40A 5GINE 1X38A 3MXTA 5HDBB 2Q5JA 5LOVB 1AOXA 3BG5A 4ZTBA 3Q0EA 4GM1A 3M6AA 1PJZA 3QYFA 3FZGA 4PZEA 1YZGA 4QOSA 3U0VA 3EGXA 1RBZA 2WTMA 4YH1A 1JNYA 1D07A 4OLAA 1XVAA 2XB6A 3IELA 3LNTA 4EYQA 3IUBA 2CNKA 2RSLA 3DH0A 3CUVA 4U3JA 5A7HA 2QW8A 1K5HA 1A8HA 1MEOA 2Q50A 2VHXA 3MMSA 1L7VC 4GBMA 3NWOA 1S4MA 2HSEA 1K75A 2V6FA 4X64B 4OKSA 2GZSA 4CCSA 2C4VA 2IHUA 4X66B 2BKVA 4U9UA 3DE5X 1JALA 1UXIA 3O3OB 2JCGA 2PD3A 1EU1A 1TEXA 5EMNA 3U3RA 1YQEA 4Z1OA 2VI5A 2Q21A 3FKSA 1YI1A 3K1JA 1USKA 3GAFA 2PRYA 4ILEA 2NNWB 5JQGF 3X3HA 1NXWA 5G0WA 3PX2A 4JIMA 3W5IA 1NX9A 1ZM7A 2C31A 3PNBA 2C0PA 2NYVA 4AD8A 1ZD2P 3BE8A 2XBMA 4EW3A 5AUOB 1H69A 3CZRA 5T4BA 1V3VA 2Z3VA 3GJRA 3AKDA 3TOZA 3GLGE 3MBOA 3TW8B 1W36B 3U5ZB 3VOSA 1T5TA 1A8QA 4WOKA 5B6IA 1TC1A 5KKNB 2Q2NA 1QFJA 3FLEA 1FCJA 5F7ZA 2VJKA 1W581 3G0DA 1EBUA 1F2UA 2QM0A 4ITUA 4R1SA 5IUKC 1NAHA 3TZCA 3B8HA 2WZQA 4XB2A 2IH4A 2WWIA 1M1YA 5K03A 4MAMA 4YPOA 4DC0A 4TZ6A 2BRUA 3V4SA 1PSWA 4MUJA 1ESDA 4BNUA 2HSZA 3PQ6A 4RORA 5LZ7A 4XWWA 3MINA 1L7RA 3TFQA 1HSZA 5F1KA 1RXVA 2D6FA 4K9RA 5CAEB 1Y3DE 3KKEA 4FR0A 1CQXA 2VHEA 3AYZB 3B82A 5GONA 2HF7A 1DINA 2I54A 4PZ0A 4Q0MA 2ROQA 5DNAA 2AD1A 3QYPA 1NR5A 3FWKA 5JBQA 4RK7A 3ES9A 2NSHA 1OHHA 2HA3A 3ASYA 3BT7A 2POCA 3G2JA 3L8DA 2CHEA 3FUXA 2G1JA 5GP1A 5EZSA 4Q4CA 4R2WA 3IR5A 1BDBA 3V7WA 3VMMA 5ECDA 4PYLA 4YRRA 5AQEA 2REQA 4UXIA 3V46A 4JSYA 3F5QA 3TXYA 3LDUA 2HKIA 4YMTA 3DMFA 2C7QA 3C74A 1IFXA 4RHCA 1G19A 3L4EA 3AW8A 1KH2A 4N9QA 5HE8A 3MCZA 1DT3A 1VDZA 3KT6A 4WY2A 4AZVA 1KDTA 5K6AA 3K71B 3EIQA 2P77A 5THXA 2NXEA 1ZGHA 3MT9A 2XXAB 4BKQA 1EE2A 5K0ZA 3WGLA 5JJBA 4CLOB 2IS1A 1C0PA 4GLOA 4L8LA 3ORQA 3ROMA 4ZMBA 2YBDA 4JR1A 2BE7A 5GM2A 1G9SA 4EY3A 1UEJA 1P2DA 1YZHA 4JA2A 4X60A 3ZS8A 5J4VA 2UXBB 2NADA 2QVZX 4PHGA 1AKWA 2I55A 3KPVA 5AVYA 4CLHA 1WBJB 2IDZA 1P80A 1RIIA 3HRIA 2X8WA 4MR9A 2D1TA 3SX0A 1VE1A 2WAAA 1NKSA 4FFLA 4EA7A 3OSZA 3EF3A 1HM5A 1FVHA 1Z6GA 4JUCA 3SC3A 1LK7A 2BIFA 3OTQA 5JCJA 3C8HA 4YRJA 2ZZNA 2ZUEA 1U1IA 1DS6A 1A0OA 1OZHA 1P0IA 3FTPA 3GPBA 4CRWB 4Z4QA 4EVRA 1P7CA 1QGDA 4MI6A 4QQRA 3SF8B 4Z0NA 3T7SA 5KJ6A 3OQOA 1J5PA 1M6VA 4X54A 4Z9BA 5C31A 3TM4A 2R8EA 4JVNA 2VOEA 5I7AA 1R6UA 5ILGA 4CT4B 3KKQA 2P35A 1IRIA 2X5JO 3IIEA 1BGVA 3OIGA 3VDRA 4TS1A 1TQDA 2ID4A 1URPA 3FPGA 4HLNA 3BILA 1NPTO 5FFFA 1I33A 2H92A 5JD6A 2QQ0A 3CZPA 3MCUA 2HHLA 2VPIA 3GT4A 4XEHA 4WZAB 1EUDA 2P68A 1NUSA 2QTVB 3I0NA 3KPWA 4L74A 3U56A 3R0IA 1J8VA 4LJ9A 2OCYC 5F23A 4EGAA 1ZD5A 2BGWA 2YVQA 4N3NA 1YMVA 1ACMA 1U7WA 2G70A 4NFHA 5B1SA 3SX2A 3ZVKA 4CKWB 2VSFA 2IZ0A 3A32A 3D54D 3IPYA 4I4CA 2VTBB 1EYZA 1YT5A 4Z5XA 3A3NA 1ETHA 3C6KA 2RHTA 3U3XA 2WHPA 1E9DA 3F5MA 1LF0A 3R76A 2YDYA 3P2KA 4ZC1A 3SZMA 1E2EA 1OFUA 6Q21A 4Y2SA 2O3UA 2MSLA 1WXHA 3T3EA 3GGJA 3U7FB 2PAAA 3RAGA 3U7JA 3BQNB 2BONA 4RU1A 4PBSA 5GONF 3FF4A 3I9NA 1W9MA 1I7NA 3ZI7A 3DKKA 1BO6A 2IX3A 4EG1A 2FSUA 4V0OA 4MUKA 1FYFA 4Y3UA 3CKYA 3T1QA 1JJ7A 3OTOB 1SHLA 4EOGA 4NBLA 4D41A 4UVDA 3ST7A 4AG5A 4EGQA 4EJSA 1SZCA 4O3FA 2NZYA 2W48A 3OCJA 1P7PA 3PYMA 5F76A 2C88A 2H85A 1L8AA 3N8NA 5LU9A 1Q3HA 1NVVR 2GD6A 2XWPA 5LYJA 1PQUA 5I9SA 3GIDA 4XIGS 3SLKA 2FP3A 2JB9A 4NEGA 4TL8A 3EUWA 1TCAA 2YHSA 4JELA 3IKMB 4GMKA 3QVSA 2VQ6A 1DX4A 4BNDB 3KSMA 5BMVA 1XUOA 1M0WA 2Y1CA 3IV9A 1PV2A 2AQ8A 1DE0A 1HYEA 1QHIA 5TMDA 3WYEA 3H1EA 1K6XA 2PWYA 2WU4A 5B2FA 2PUBA 1M10A 2VT6A 121PA 4KQXA 4BU0A 1ORIA 2RC5A 4IL5A 2J09A 5TF4A 3ZGNA 5KZMB 3A1NA 3IT1A 1FDSA 2J9RA 2QTNA 4IDAA 2EZUA 1PE0A 5IKOA 4KVGA 4FQ5A 5AVWA 2XR1A 1NN1A 1Q0SA 2JCSA 1GG2A 2Y1XA 1G64A 3KPYA 1PNTA 1J0CA 4PRZA 2QRPA 2F3TA 2QPOA 3M33A 2ZFUA 3ZXUB 1U2PA 5K0FA 1JKMA 4W99A 2FDCA 3BK2A 2P2ZA 3QLUA 4NG5A 1L4BA 1TVCA 4C4ZA 4AMYA 1JV2B 1YBMA 1A88A 3LZ6A 4HB3A 5IN4A 3RKSA 4K6HA 4RCZA 3ZS9A 4U63A 4YT8A 2IY7A 4BX2A 4HN2A 1DG1G 1XIVA 3ESDA 3L7JA 2FQWA 2H5IA 1V1RB 3OOSA 4WUVA 2QX9A 3LUFA 1XAJA 4JH0A 4BDSA 4NBRA 2M2IA 3C8ZA 4MQEA 3R9XB 5EGSA 5F9MA 3BBLA 4U7DA 3G1WA 3RRJA 3BK7A 4ND8B 4M0DA 4TKUA 1SA0A 2AFHA 1GDDA 5HQJA 5BW8A 1K27A 2BEWB 2HREA 1QF9A 1FZTA 5ITWA 3ETLA 4H6VA 4M1QA 1BE8A 1RM5A 1YA6A 5A05A 4YS6A 4BS9A 1CQIA 1F20A 3COPA 3QPUA 1LVUA 1KJJA 1GU1A 3HBFA 1D2HA 1HFWA 1TRHA 4DQKA 2XQFA 3EXIB 5EXDA 3A2KA 1B6TA 3IT0A 2E5FA 4UUPA 4XLLA 1HFEL 3BCSA 1YVRA 3MXOA 4BO1A 4OI0A 2EFJA 3GEPA 5KYUB 2GF0A 4A4DA 2HK6A 3IKLA 4WXRA 3B6JA 3LUGA 4YONB 3WQHA 4M1OA 1SRQA 4F2HA 1KC1A 4HX2A 3PDUA 4ZRNA 4M7PA 4ZJYA 2DB3A 1A2OA 3UW1A 4M0PA 1GCOA 1R18A 5J47A 1VKOA 2IP2A 3ZV5A 4DM3A 1AHNA 4RNDB 1QSGA 3H16A 4BYMA 1DJPA 2FRDC 2TYSB 4G5QA 2VJLA 4WFKA 2ZT5A 3Q10A 5E9AA 5J5VA 5BYJA 3RS3A 3SZGA 1T6XA 4F5EA 2Z98A 5BN3A 4QDZA 1Y6JA 3HKCA 4X84A 4BLQA 1G4UR 1J33A 1NYRA 1CR4A 4GKJB 1CX9B 2IY9A 2RGGA 1R37A 1IOZA 1ATZA 4AQ7A 1CB0A 1NHGA 3NZEA 3KXKA 1DQYA 1MRSA 2A9KA 1FY2A 3LRXA 2D3TA 4XYBA 3DXFA 1POWA 5JD3A 2DTEA 1JEQB 2RHMA 3CUSA 3ANXA 3HZRA 4MDFA 1NJ6A 1ZH0A 1QB7A 2R8PA 2XUFA 2YZMA 4CL0A 5AVRA 4AF7A 4G5GA 1WUJS 1WEHA 2GF9A 5LYJF 1QGUB 1AXGA 1GPWB 1AUXA 2QL5A 3UCFA 3WXMA 4D4HA 2C4KA 5FQNA 3WOVA 1JB9A 3IVXA 2GO1A 3QG1A 2J3QA 1LLDA 4RS3A 5DWVA 2PBFA 5A5EA 5BMVF 1P60A 2O7VA 2W0SA 3OE7A 4JJGA 1GG5A 4F4FA 1KVUA 2NOAA 4BZZA 4ZHQB 4LDZA 2IITA 1PZHA 1CW2B 3M5WA 1G3UA 4NK4A 1RAGA 1Y6ZA 2Z83A 4I1IA 3PR2B 1DC5A 4FYKA 3HYCA 1E7RA 2DQYA 2IIPA 3H0EA 1TK2A 1ZX1A 1J09A 1AGPA 4MO9A 4DV6B 4XXHA 4FHFA 3LV8A 1WM1A 4JLBA 3EGWA 3KS9A 1C30A 1VPTA 2OXEA 1AA6A 2XOKA 1XPOA 1X15A 4TMYA 3U9SA 1RMYA 1E5VA 4B31A 4EA8A 5EINA 3SJBA 1XZBA 4EPWA 2QT1A 4YLGA 2PL1A 1RYYA 1JDNA 2C4NA 2IZ5A 2X58A 3WGQA 2Z9CA 5DO9A 3ZDDA 3E9YA 3PNQA 2VCEA 4E13A 2KX7A 1BFKA 1A4XA 1Z5UA 4L08A 4BMYA 1Q7EA 4PO3X 5I8PA 3L0CA 1BE0A 2KHZA 3QIAA 2W7TA 2J5KA 3K30A 4HPWA 4KRXA 4F45A 3JSAA 1SBQA 2BMJA 4EHAA 5CM2Z 1JGTA 3JQAD 1J23A 2DJ5A 3PKJA 4K0RA 4O8ZA 4K1LA 5CH3A 3K6JA 3T34A 4ER7A 1W2WB 5KYYA 2XRFA 4M1WA 4KAAA 3WIVA 2I3AA 1MVOA 3AVXA 1IVSA 3PXAA 1UBCA 3G5UA 1OA0A 2I4TA 1JU9A 4R4JA 5ECYA 2ACVA 3MLEA 2HA7A 4F86A 2F1OA 1KVRA 2K7FA 1X6VA 4QRIA 3TLMA 4GE0A 4AZ0A 1RXCA 1Z15A 3I1IA 4QWMA 4BBAA 2MYUA 2ODEA 4J9VA 4JYCA 5HM6A 2H08A 3QNUA 5FO1A 4ENPA 2VRCA 1NN0A 1DQRA 3CRQA 1EFVA 4AG3A 5BSGA 3L1JA 3R24A 2F43B 4KXXA 2JZNA 4HWGA 4ZYYA 1LJUA 3A6JA 3DPIA 4ZTZB 3IPAA 1JWLA 5FX2A 1Q1GA 1LQUA 1ZNQO 1BN7A 3CNQS 3AF4A 5B3AA 2Y76A 4BB0A 4RKWA 1EFLA 1KKMA 1J07A 2JJMA 2PR2A 3HB4X 1KMNA 1JDTA 1E6KA 5LQJA 4R5HA 3P9XA 4ZVTA 1OROA 3FFBA 1AF7A 3T0GA 1SVSA 4FYWA 5HOQA 1TPZA 1MAVA 1TKAA 2OV2A 4WVFA 1BH2A 3C7DB 2HL6A 2M6LA 3DYIA 4J9UE 2PR7A 5CVUA 2X6RA 4Z54A 3DFFA 1GNLA 3CJQA 3JX9A 3VX3A 1XTKA 1W9HA 3L8HA 3KT3A 5GIOE 3FTDA 3G0IA 3PWTA 4DQVA 2J6HA 4UNQA 4OOEA 1H4TA 3I4LA 2W5UA 1PF7E 2Q3FA 1EGVB 2EJWA 3PPIA 3A6EA 4C76A 2GXUA 4XUEA 3R4CA 5JSHA 1VRWA 2ZJ2A 3A27A 4WCDA 3QM1A 3LA8A 5CT5A 1KK1A 1VHLA 3TQSA 1W49A 3T5PA 3ECAA 9MHTA 2R6R1 5AI9A 1RKVA 4QXOA 3LUBA 1IN5A 2OO5C 3CN9A 2ADOA 4GECA 4PAQA 1UBFA 4RK1A 5G0VA 4B4OA 1GFSA 2OGZA 4AZWA 3U7IA 4DUZB 3IYLW 4BVFA 1MZPA 4BJ6A 2C84A 3SFVA 2RHBA 4FGLA 2YZKA 3BMQA 3CHYA 3H1GA 3TQCA 2OKCA 5HGXA 3OIYA 1RYZA 1NR1A 1FDWA 3HTXA 4IIYA 2ZTVA 4MV3A 3JQAB 3RQIA 2NO4A 5KPJA 1PUJA 3CRW1 3ANSA 4URUR 3IDOA 2FR0A 3LT5A 4Y67A 1UAGA 3B1FA 3TTWA 2QP9X 3GDHA 1MO6A 2EYQA 3T5GA 5EIBD 4RK0A 1LS1A 4ZQEA 1SXJA 1Y4DE 3C4JA 3D0KA 3LQYA 4LKRA 1TUEA 4XPIB 4H77A 3RBXA 1OQAA 5JBIA 4JASB 5FAKA 2P78A 4ZOBA 3FFWA 1TKCA 5AR1A 1L1FA 1SHUX 2EKBA 1G55A 5FNVA 2AMLA 4Q3CA 4JX8A 5IDXA 4HZUA 5F7JA 4LOKA 3C1OA 1DIRA 3QEMB 4IG4A 4TT3A 2CDBA 4B48A 5JZVA 4M53A 4PTZA 3CCBA 3VUFA 2WJYA 4C9BA 1SAYA 4Z1MD 1XBTA 1EP1B 1P61B 3A6FA 1IUOA 3HCNA 1JE0A 1N2OA 4XVQA 3TW6A 2ZTLA 5LNK1 3QA3E 1N0HA 2CFRA 2VDQB 3CLSD 5AXBA 4TOIA 5B7PA 2FDXA 5IF9A 5AD1A 2AK3A 2JGRA 4LV8B 1XKQA 1BVYF 1YZLA 2NZ8A 1NJFA 3NRCA 3OC0A 2WLSA 4A2WA 2O5CA 4OXRA 4F3NA 3OOEA 1DC6A 2QUJA 3N70A 4OK6A 1E6LA 2GN2A 2FFBA 5G4KA 4ETIA 3X1DA 4RMIA 1Y6RA 4D99A 1QC5B 2CLFB 2DJIA 5LDGA 4A36A 1RCFA 4JB2A 1BQEA 1M6EX 5FPPA 1JFFB 1GNVA 1DO2A 2VRWA 2Q3DA 4KNVA 5J2UB 5ER6A 3OZSA 4B3DA 1W19A 1NW5A 4HYTA 4H1UA 4QG7A 3UCXA 5ADUS 3WKCA 1P75A 1CY7A 1J9GA 1NE7A 13PKA 4PYNA 5K0BA 1ILEA 3VTFA 4I1OA 1H2YA 2I33A 4BFYA 5DTJA 3PC8C 3T7KA 4I1PA 1H0SA 3QOXA 4KJZA 4EUEA 2AOVA 3PLRA 4LAFA 1OLSA 3SSNA 4J43A 2QW1A 1HZZC 2P3LA 2PGJA 2R62A 3I8SA 4KN8A 3I3SR 1O4WA 1MOQA 1LNQA 4NENB 5DIZA 5DMHA 3L5OA 3WLFA 3UNXA 3S5JA 4GAEA 3WRXA 3OQIB 1P5ZB 3RU9A 1CRZA 1GVNB 5HRUA 4GOJA 1HLFA 4BIIA 1X86B 1C9DB 2A92A 4B0PA 6CHYA 5KYWB 4MWBA 4RTNA 5DOVA 4CIAA 1UKZA 1UP4A 2HRZA 3NP7A 1FW6A 4HCJA 1JMKC 2XIJA 3IHTA 3FZQA 1ZONA 1WVIA 2V5AA 3AHJA 4F4DA 4M54A 2GKOA 1MEJA 3AF5A 1CZNA 3HFJA 3IOCA 4GLBA 1U11A 4ILKA 4JCOA 2Q1YA 2W2TA 5DISB 3WIDA 4JV5B 5H4GA 2D0IA 2LCIA 2PSHA 3ESXA 4G07A 5B30A 2ID9A 1MAWA 1KJZA 2P9FA 3L7LA 3VPSA 1W2HA 5HUHA 1SC6A 3JW8A 1QKJA 3KUKA 4FFBA 3MMZA 3WZMA 1E3EA 3I53A 2OG2A 2AOTA 4ZDWA 2C2GA 4G5SA 3JASB 2WICA 4WA8A 4KQIA 2BEUA 1W36C 3FNRA 1OVMA 2E6KA 1FEZA 4MQUA 3TXXA 3MMNA 1PV1A 4P2GA 1DC7A 1LSUA 1W2GA 2JGEA 2OBNA 4H59A 2HD4A 2EJCA 2I3BA 2X1MA 2OQRA 1RWWA 2QYHA 1M67A 2FJ0A 3RVKA 1F12A 3ZHVA 5LFAA 3W5SA 3WKDA 1U3GA 3HB1A 1RQRA 2VAXA 5EERA 1TVKB 3THXB 3QVWA 2IP1A 2Q0SA 3PCRB 1R0BA 3QBTA 5CB4B 2ZCJA 4BAGA 2IFTA 4IV5A 4JKOA 3UKDA 4ZCTA 1V7QA 3G8DA 3LUDA 2SKDA 5HCNA 5I7SA 1H2AS 1F0YA 2VPYA 3OFKA 3CBQA 5DGIA 5DNWA 4B33A 2PGAA 4DT1B 3FMFA 3IDQA 5EMHA 4V0MA 5FNVF 4CFSA 1SC9A 1PZMA 2GTHA 4XASA 3W5JA 1TM7E 3R3JA 5BYKA 3KVNA 1XVIA 3MQ2A 4HLQB 4LS3A 3WDLA 4IHJB 3UICA 1EI9A 2R5NA 3SI7A 1EK0A 1WO8A 5CYFA 4JLUA 4EJMA 2CE2X 4CM8A 2CJPA 2YN0A 1Y6FA 3VTAA 4TZ0A 2RH9B 4MWSA 3TQQA 2F3UA 1IVYA 4CIXA 1N1MA 2FP4B 3ONFA 2KM1A 2PSFA 1GZ3A 5DU2A 5IUNC 1BC5A 3JQGB 3VZQA 5AW5A 1C9YA 1KKLA 3M5DA 1I0ZA 1RZ3A 3HCBA 4HDSB 2X2OA 1XKXA 4N01A 1QGED 2JLYA 4OA8A 4F4CA 3FA2A 1T8SA 4OSPA 1Z5PA 4Q24A 4W7HA 1G2IA 2Q3BA 4YDQA 2O54A 4QYIB 4EG0A 3LMKA 3DM5A 3T35A 2PWPA 4IWYA 3WADA 3DR3A 1Z0DA 5CYOA 1HGXA 3PSHA 2UUAB 2E37A 1WPRA 1UADA 1QZ3A 4YR9A 4RH3A 1F9AA 1XDZA 1QH0A 2OB2A 5ELMA 4B2PA 4YT2A 4YQEA 2FOXA 5IVPA 4RF2A 5K2OA 4MGZR 1USVA 5U9CA 1Q7BA 1MB9A 2IU3A 3SIPA 1Z25A 1BCSB 3L43A 4UCQA 4EL5A 1TQ4A 4W5RA 5D01A 2C78A 5DNDA 4KLZA 2WE7A 2WU1A 5I47A 3PZBA 3QKTA 1S8FA 3EFHA 1WTAA 1ZMOA 1RSZA 4E7OA 4X44A 2WVAA 2PIAA 5MGBA 2R44A 3EA5A 2C5SA 4ZZ3A 4Q7MB 1UWKA 1ZN2A 5FQOA 1OGJA 1GZUA 2XYRA 4WH0A 2CB9A 4LI3X 1PFKA 4KB5A 3MRSA 3VFDA 2HMSA 1YULA 2OCIA 3LXXA 1P2VA 3GT7A 1YB6A 1HFKA 1Y8QA 1UWCA 2V9PA 2ZYHA 3H3JA 3H9CA 4IEEA 1XTTA 2CLIB 4LMBA 1N2IA 4QBKA 4CF5A 4EHLA 5BUCA 5IKXA 4A27A 2IH2A 2V7QA 2FZGA 3QUBA 2GAIA 5I4IA 3GCWA 4KQ2A 4MUFA 3JQFA 1B1AA 4P4SB 2DKOA 5IC4A 5LZ8A 1AS3A 2OCDA 4E2YA 4L4UA 1CS0B 5B4VA 3AEYA 3V48A 1EE9A 2JS7A 2A35A 2FF7A 1WCIB 2RH4A 4GUAA 4HPJB 4HXFB 1YZVA 2ZIGA 3QKIA 4JEUA 4L1KA 4D5GA 4EB6A 3B6ZA 3LSTA 3M4XA 4PAOA 2HA2A 5AMXA 3OJXA 4CR7A 1ISMA 4O1HA 4FZJA 3RF7A 3A0UA 3H4MA 4JJEA 1CJCA 4BO4A 3ZJVA 3HA3A 3I9KA 3PFKA 3FLAA 3KVRA 4F96A 1EXMA 1YAJA 5IAAA 3GLFA 5CJPA 5L9AA 1Q50A 1E7SA 2VF8A 4IIHA 3A9RA 4P32A 3MGKA 1B6RA 2RJOA 3RG8A 4URZR 4DDTA 1QVVA 1Z0IA 1G41A 1XTRA 3TINA 5F9FA 4WQMA 4UMVA 1U0FA 1XQXA 1KI6A 5ARBA 3LYUA 1C3OB 3UH0A 2Q07A 2C58A 3R6TA 1CQZA 4IFBA 4IH1A 4ITVA 5ICCA 2ZTMA 2NUTB 4J0EA 4NC9A 5ENDA 3ZJ5A 5JZBA 1OSNA 2OMKA 5DYTA 1JZQA 3RANA 3MQ4A 5E4TA 4Q1CA 4RXUA 3ZW7A 5LN1A 1TMKA 4DLAA 3SM3A 3HKEB 4OCZA 4N65A 4XSGA 4YRIA 5ER9A 2ZJ0A 2BFCB 1OGYA 3LZCA 4L0QA 2AI1A 1W4AA 3RYHA 2Z2IA 4EDFA 1DIGA 3YASA 2DX7A 2A7QA 3F4KA 1A2BA 3N9IA 4LX8A 5E3HA 4ER0A 1Z34A 3O8RA 3PTLA 4YAEA 1HLPA 1GPAA 1KYWA 1WSAA 1LLCA 1ULHA 2OHOA 1I0IA 3GVCA 5C35A 3W78A 4KP7A 4WTOA 1XQ1A 4KFSA 1I36A 1Y37A 4NK5A 2NQTA 3GGDA 4JYPA 4TN5A 4EG3A 1QTNA 1UC4B 3UOWA 2CBGA 1GPLA 2WEKA 1BX1A 1RP7A 2V9CA 1HRKA 1E3JA 1KAHA 1YKGA 1OFGA 2ZTUA 2I4IA 4LJ8A 1MGOA 3ZWPA 1MC8A 2F62A 1Q0ZA 3ETCA 4G81A 1PTJC 1EX7A 4TWBA 3VOBA 5A4DA 2Z8YA 4HQ6A 1G6HA 4PTYA 4L0DA 3NEAA 4RCVA 4AF8A 5EEGA 4P9NA 1KYIA 3UC9A 3WLKX 4Z9FA 3QW4B 4O4HA 1RWKA 2OGWA 4GWGA 5ESWA 3FRIA 2O7NA 3G88A 3AESB 3K70D 3FDZB 5F1PA 4BLTA 5BVGA 1XEAA 1PWZA 1EUCB 2V59A 2IXAA 3FSGA 2A4MA 2W90A 2B4TO 3ZOZA 3U31A 5I01A 4UJ5A 1EDDA 1GR0A 3BSSA 4IV0A 4C5CA 1AN9A 4M7RA 1A9TA 8GPBA 3QUSA 4M0CA 3NBZC 1YC5A 2YQZA 5NULA 2HMTA 2C9BA 5EMMA 5BV0A 1X1AA 2CMGA 4NYMR 3TSAA 4P2BA 2O3RA 4E1VA 1YHYA 1FNSA 9ATCA 3T5TA 3MM4A 4NX2A 4DXAA 3O4VA 5I51A 4XUGB 2QPTA 4Q3KA 2CFTA 1RLIA 4NJMA 4XW2A 1CE8A 4BO3A 1HPLA 1BMTA 3K9CA 5KDLA 5A5GA 821PA 4M46A 1OTYA 2WJHA 1UANA 3KPJA 2MOKA 4V39A 1IZ7A 3H99A 4J6EA 1M34B 2YYYA 3RDPA 1FFSA 2BCGY 5ETJA 1RWOA 3P71T 3K0BA 3KALA 1RPJA 1J90A 3S8MA 3DW3X 3O1JC 2VG8A 1OLUA 1QH1B 2AUNA 4O4LF 3Q8KA 2B1IA 1B26A 2VHCA 2OY0A 1KMHB 4YK7A 5P21A 1KAEA 4C4AA 2G4LA 1JHVA 2PE5A 4B40A 5D5QA 1RT9A 2PYDA 3NYWA 4XD7D 1I4WA 1L5HB 2I1QA 3EXFB 4I6JA 5DWDA 4B4UA 5CITA 2QD2A 1I3CA 3WO0A 3F6EX 1QR2A 3QVJA 1E8NA 2EV9A 2ZYDA 1ZZGA 4U7PB 3PR1A 2B2XA 5ALGA 3S1AB 3JWJA 1D2RA 2VXOA 4JI4B 1N77A 4TVBA 2JAOA 3FWPA 2WIKA 3JWHA 2E49A 4I9UA 4OYLA 4XKJA 5DOZA 1XOIA 1JDPA 1ZK4A 4RIIA 1Z2AA 3WWYA 4OKIA 1YUBA 4FYPA 4U2GA 2NSYA 3GLIA 1SUIA 3ESQA 3LDFA 3VR6H 3NHWA 2ETVA 1EFRA 2VUIB 3M1IA 4UBJA 1Y63A 4M22A 3N76A 4N8EA 3GVHA 5KQGA 2PRSA 5DW3A 1NM5C 2G4VA 3MTJA 3CPSA 2IOFA 2JKZA 5CX1A 1Z4NA 4QDXA 3TQTA 3K70B 4KNWA 2CZGA 4OA5A 3ZWYA 1DQZA 4XE5A 1J21A 5H3CA 1ENOA 2JKYA 3OA2A 5EG5A 4WBSA 3HYTA 4F56A 3KQUA 2WSYB 3ER6A 4N39A 4DF3A 1YF3A 4M0UA 1IN7A 2VJCA 1ZEJA 3LP6A 4MUGA 1XP5A 4WA7A 1ZU4A 1HV8A 2GX6A 3IRVA 4M0FA 1EQUA 5CH8A 1CU1A 5FI3A 2CLKB 1K8XB 2O2JA 1FW8A 2YL2A 2VJBA 2BFFB 5EUBA 5BW5A 4WT7A 4D6XA 3N2ZB 4BUJA 3QUQA 2RAVA 2O05A 3QSGA 3QKSA 3HG7A 3CW2A 1QCZA 3P19A 4PAGA 4N12A 2PZJA 4WZBE 5KAMA 3VHLB 2EF1A 3G9XA 2ZRAA 4LX0A 3FNBA 4O4HF 4PZUA 4YJGB 2NU9B 5EJFA 1XD2A 3ANLA 2LGJA 4O4IA 3PVCA 2GPTA 3GROA 1ZM3A 3AVQA 3BD8A 1U31A 4LRWA 4NBUA 4IXNA 3VOTA 5FBVB 3VO2A 2RKBA 2YW2A 5HJ7A 3A6PC 4REQB 5AVTA 1C1XA 2V7UA 3AHHA 1X8JA 3ZHOA 4L4RA 5JWHA 3PC7A 3ISTA 1CR6A 5B6JA 2LKCA 1G7TA 5IJ0A 1B93A 1CDZA 1OGIA 5AKZA 3ZNOA 1X7WA 1QFMA 1MC5A 3GFRA 4K46A 4OH7A 3T3IA 4C4TA 4LXQA 2VDOB 4FI3F 4DC9A 1SPXA 3DUFA 3SS8A 3K35A 5EP4A 1OLOA 3LCJA 4PC1A 4UPDA 5CLIA 4DLRA 1SOMA 2O8NA 3A1WA 3WGJA 2G0NA 2V8OA 3EAQA 1VL6A 2JJ1D 3EC1A 3CLKA 3G5LA 4PHHA 4PXAA 5BNFA 1V37A 1QAQA 2HO4A 1RVV1 2BISA 4FBLA 2UVPA 2QUAA 5CK5A 3JAKB 4KV7A 4OQQA 1KNQA 1OLXB 1QIDA 4JEMA 1XWFA 2WUFA 1Z8DA 1OAOC 1O58A 1U2EA 4RMNA 2BMWA 4CT0A 4HT3B 2D1FA 5ALRA 3NVDA 3ZY2A 4BVHA 4YCLA 2FSSA 5FB3A 4Y2VA 1N8NA 1XXHE 4GEGA 1PR0A 3IUEA 2X4GA 3K9BA 3GLGB 2ZIXA 1XRLA 2Y4OA 3ASUA 3ZNQA 3RC3A 1VZ3A 1ONOA 5DTQA 2GPBA 2HWYA 3KUUA 5ALUA 4OHPA 5DXAA 3QX3A 1XRQA 1HT1E 2DFVA 2HW8A 3TD6A 1U7OA 2QMHA 1T5SA 3PHLA 1WCYA 3K1ZA 2V7BA 2V97A 1HBJA 2M6SA 3HKBA 1LEHA 2C7OA 2B9VA 3PX7A 4AZTA 1WU8A 1TZBA 2WG0A 4MVJA 5F5NA 4DKXA 1KJYA 4YJ2A 2WPDD 2J4CA 5JALA 5FLXA 2XEDA 4B7AA 2JG3A 1SVOA 1TCBA 2J6BA 2O6HA 3CISA 1T5DX 3H2SA 3HPRA 4Y7CA 2VF7A 3RQSA 1JU4A 1VCNA 3AUKA 3S2YA 1CLUA 3QF7A 4MDHA 1B2LA 1JKJB 2AHRA 3MIIA 3AONB 5JMOA 5ITVA 1MA3A 1TKRA 2QZSA 1Z17A 3BJEA 5EE9A 1YL6A 5MN4A 5EAIA 1I2MA 3W79A 3VHXA 3ZLVA 3KJQA 2XBUA 4V3CA 5C81A 3G79A 3EOZA 3JR3A 1JIXA 2XUHA 2YFKA 4ZI7A 4CYMA 2PMDA 4AYTA 2JGIA 4RXTA 3RFCA 2R8BA 4XSHA 3IOYA 3FKSD 5JVDA 4ARIA 3QGMA 1ORRA 5JISA 2EF0A 4Q9KA 2IS2A 3C70A 3RV4A 2FRVA 4Y6LA 1T91A 1NRXA 3U1TA 3BWVA 4NAVA 4LRSB 2KS6A 1Z36A 1KH3A 1P18A 3DSRA 4LJ6A 4O63O 8MHTA 3LYAA 3LUAA 5EHQA 1ZHFA 1X0XA 5KI6A 5AW4A 4EI2A 2ZYAA 1QRRA 3BMCB 5DM2A 1X7YA 4L0MA 3K53A 1TUGA 3BHNA 1UL1X 4CU5A 1BJKA 4R41A 3FMIA 1HDEA 2OHVA 2VDNB 1RABA 2DFTA 1F2TA 1GGVA 2HK7A 4B3HA 2O8FB 3WYGA 3LTEA 2AA3A 4GKBA 3VTZA 1R6XA 3T15A 5L3QA 1N6OA 3GEGA 5K0GA 3SR3A 3W1WA 4O4IF 2A14A 4OSOA 1KZ1A 1RJEA 2XYVA 4MKGA 1JXQA 1RJWA 5KC9A 1THTA 2PMEA 1I94B 3TX2A 2BGJA 1RQ7A 1U7UA 3GF4A 4N5DA 2N46A 1T0BA 2VP4A 1NJ2A 5DJ5A 1U0RA 1IQ0A 3TJZA 5JNRA 4Q4HA 4BC1A 5A04A 4CIBA 4YMLA 4IJKA 2VHUA 1R8JA 2X9GA 3D6JA 4QYTA 2R7KA 1KMQA 4IRUB 2J4FA 5AI5A 2WIJA 2FFQA 2C3OA 1COWA 3ED1A 2PLWA 5JANA 2UZAA 3VSCA 4KIGA 1FMCA 5JTTA 3M5PA 2H1WA 5THKA 1RAIA 4H7JA 3FN4A 4AB1A 3U7GA 1OHHD 1VRCA 2A86A 1RCTE 3EGXB 3QLTA 1YRHA 5JMTA 3R77A 2ZBVA 2O59A 2FEMA 2GEVA 4YMVA 3UMJA 2IH5A 4B79A 1K8QA 3QWIA 3QE3A 2WUVA 4TXJA 3IAM6 4QEZA 1IZ8A 3UF0A 4HRXA 4ZYUA 4J3FA 1CUAA 3OE5A 3BWXA 2DPLA 1RFLA 4I8XA 4NULA 4D97A 5BURA 5SYNA 2WTAA 1GG9A 5A62A 1NYQA 4G5FA 1AV6A 1RKXA 1J00A 2ZGVA 1UK9A 4G1FA 3ADCA 3H11A 2N42A 4ZEXA 4RETA 4LJ4A 4AY3A 4M87A 3QVGA 4C5BA 2SKCA 3G2NA 1DIHA 3HJHA 2ZSEA 4KQFA 1B6GA 1S2OA 3PUYA 2R7AA 1JHDA 2G25A 3OX1A 3QBDA 4EY5A 3LT1A 2IYEA 4UQOA 2BGKA 4TRRA 5DTEA 1BSVA 4IBOA 3ZHXA 2L69A 5HKLA 2QXTA 1PEKE 4CMBA 2Z4SA 2HHCA 3O21A 1KDRA 2IIQA 1ECFA 4UUQA 3QVKA 1R12A 4EJ6A 1N36B 4FMCB 1F2UB 2PVCA 1DFHA 1PWYE 3EMBA 2V3CC 4HX9A 4FFWA 3I73A 1FSZA 4RK6A 1KYXA 2JVKA 4GZMA 3WWDA 1IZYA 1ZH4A 1LNSA 3Q7PA 4R81A 1GTL1 3DE1X 3UM9A 1UCFA 3VRHA 5DB4A 3LCRA 3MINB 4PICA 2EW1A 5BXQC 3U5TA 1DBPA 1WVMA 3OBIA 3UHPA 4FNGA 3WQRA 1CERA 2YWFA 3HR4A 3NAMA 4J0HA 1Y80A 1WVGA 4J4BA 3JYQA 4K9OA 5FPSA 4X85A 4BAUA 5EIBC 1TU3A 2R2AA 2Q5OA 4BTLA 4EUFA 4ND1A 2XT0A 1CZUA 4PONA 5DE3A 2H6EA 4LK2A 4HAWA 3W2IA 1LC0A 3E82A 2GBLA 5T3UA 1PGQA 4DA0A 3CRZA 1A7JA 1KRHA 2QPAA 1NLZA 4GPTA 5JMPA 1R3UA 2IXFA 4J1TC 3WZ2A 2JAPA 4RPLA 1DEXA 4NCXA 4QD3A 2QBYA 3HCCA 2QQGA 1ULTA 3GLSA 1XP8A 2Q6KA 2ST1A 4DMMA 1NW9B 2WU0A 2YJGA 4EUNA 1T8WA 1BHO1 1CT9A 3C5CA 4CKCA 5KYTA 3I6YA 4MHTA 4QVGA 1OV4A 2QN3A 2GF2A 3OUZA 1Z28A 3CLSC 3GCDA 3UTDA 3UW3A 3OPYA 2JW5A 4H15A 2I3DA 5A0TA 1CULC 4XR9A 4BZWA 3LVBA 2QLTA 4UTVA 2LXNA 3PV0A 2R8YA 3EVZA 5MN5A 1D6SA 3E1GA 4D8XA 1IMJA 2P5UA 5DHUA 5DFAA 5CCEA 4QULA 4KK3A 5CH5A 2P9ZA 3BORA 1XROA 4AECA 3LRTA 4YY3B 4DMFA 4E3WA 5C2JB 1T3ZA 2XDQA 3AJEA 1TMOA 5F33A 4D3DA 5BWCA 1FFXA 5ISMA 2P9JA 4I1UA 5JJ5A 3GP8A 4G0VA 2K2QB 3W7VA 3WSTA 3VJLA 3MFYA 4DPKA 2CVPA 1QORA 1E89A 4MR9B 1XO1A 4B3FX 4P84A 1E9AA 1J20A 3O84A 2MSKA 3NHMA 4DG5A 4DSZA 4E2XA 3GUYA 3BRQA 4DAOA 2WNSA 5GVRA 1YFJA 4HDKA 4IYRA 3W9SA 2FUG1 4PU0A 4HD8A 3HWSA 4HLCA 4N6OA 4DSTA 1M6VB 3QY0A 4MP8A 3FMOB 3IP3A 4P5EA 3VAAA 1QLWA 3DHWC 3LG2A 1M54A 4M36A 2GFIA 3MPOA 4GKVA 4M6WA 5ICGA 4E5PA 2Y66A 4XRGA 1TGVA 5HQTA 2JEOA 2ZW9A 1DV2A 5HHTA 3RS2A 4AY5A 5JJCA 3T7TA 2WHRA 1QXSA 4R9NA 3OU6A 2DFNA 1W8DA 2ZRQA 1EUDB 3THWA 3KYDA 1UZLA 3O03A 3Q6MA 3ZZ1A 3OM8A 3E22A 4IJUA 1QG2A 4MITA 4OI2A 4C01A 1O54A 1IXSB 3NOVA 4URHA 3WNZA 4MPRA 3ONDA 1EFKA 1EPUA 4P3NA 2O3SA 1W4LA 3L82B 1ZQ9A 5CVCA 3GPIA 4K86A 1E4YA 2JFBA 2Z3ZA 3OO0A 2PJDA 3TNJA 4RVHA 1CK4A 1WZNA 1G60A 3N3AC 4G0UA 4URXR 3QTLA 4ZP1A 2WHPB 1NUTA 1RYBA 3T95A 2OBYA 3SYMA 5K4HA 4UDYX 4R2LA 2CY0A 2F2TA 2BFPA 3K73O 4PBTA 4WXEA 2GZ2A 2NP7A 3CNEA 4H1VA 3R2JA 3BDVA 4FZVA 1KY3A 3MSCA 4L28A 4E22A 2M1ZA 4RTMA 1XJWA 2CCGA 3SR4A 4DIUA 1QV6A 2JJYA 2RIRA 1JIKA 4CM5A 1YDHA 4YX9A 1P31A 2DUMA 4LF6B 3WLTA 2XLCA 4E03A 3PS9A 1ONSA 2FAXA 2UXCB 4EHIA 1ZCAA 3T4EA 3V1UA 3JZAA 5JRZA 1NDHA 4QO7A 3DKIA 5KJ1A 3AHIA 3P8ZA 3LDHA 1ATIA 3A1CA 1A76A 3ZY5A 4E11A 4V2IA 1OY1A 4Z51A 4X1IA 1MZVA 3JU3A 1PQYA 3PQ4A 5JROA 2WD7A 1I6WA 5KYKA 2XE8A 5T8KA 2WKPA 3U39A 5K0JA 1CQWA 4CTKA 1LY1A 2Q4RA 3GEEA 1KEKA 1K5PA 3P9RA 3DWIA 2FPUA 1BD4A 2WJ6A 2YVLA 3PHCA 4ZQFA 5KNDD 3MILA 1XI2A 3O2SB 4I2NA 4LJAA 4TN1A 2ZJFA 1EA7A 5ES3A 5L7YA 5H4HA 4YRSA 2WSSA 5EJIA 3SXUA 4KQ9A 3W5VA 3PRKE 1V8ZA 2GWHA 1CNFA 4MX8A 1YQUA 3IUPA 2V5VA 4RZ3A 2JIZA 1C9EA 1P5FA 3DJFA 2Y67A 1ILWA 1KIFA 1BYUA 4KIWA 2IV2X 1PFYA 2WPNA 2IELA 3HDGA 1JZSA 4O5OA 3ROFA 2OGSA 1UBUS 1R4ZA 2HRDA 3BH0A 3ZZNA 2AC2A 1GL9B 3HZZA 4W5WA 1AKTA 2WVGA 3MAAC 3W6NA 4E30A 2BUBA 3IP6A 2WDPA 3INTA 3OAAA 2H4JA 4II2A 3MW8A 4LKOA 3AB7A 3HEMA 4MUBA 2W37A 2QRKA 3I72A 3R40A 1E5LA 4X3OA 2QU7A 3EAFA 3WWCA 1N2JA 4HB0A 3O2JA 4GYWA 3ZY6A 1Z6QA 1Q2XA 2HA0A 1W4CA 2NUPA 3E5RA 3IMKA 4M1EA 3T9BA 2AQIA 4JBHA 1OI7A 1M2KA 4B6JA 1S8OA 4BPRA 5FUQA 2CSXA 3EJ6A 2YWRA 3Q15C 2WF8A 2WHEA 1ENPA 3QLVC 4TKUB 1SA0B 2AFHB 2XWJI 3O8OB 3GRAA 4KDRA 1H05A 1US8B 2XWSA 2XOKD 3A0RB 1U8EA 4ZANA 3NQ41 4V24A 1WUIS 4E4TA 2BY4A 1UP7A 2IYOA 2QX7A 1ICEA 2PG3A 2CDRA 2HWUA 3AY7A 3DTYA 4YAGA 4HFRA 5ALIA 5C8VA 2EVWX 4OQLA 2HBYA 2WW8A 3KM0A 2A0UA 4OGWA 1XCOA 4IGKA 4IP0A 4QJ3A 4Z7JA 1EUYA 2RDMA 5KOHA 4AS2A 2D5CA 3BIFA 4E5NA 3B38A 1CBUA 4HB2A 4BVLA 4AZSA 2J5QA 1YQGA 4UVIA 3UXHA 3W7AA 4BKOA 1CJMA 5BN1A 1NQVA 1X1DA 2ZPTX 5CBKA 3VYVA 1NUPA 6YASA 1WCXA 3EXHA 5JT1A 4QBTA 2HCTA 4GSLA 4L27A 5IAEA 4CCAA 2CLOB 4EBBA 2Q1UA 5C3MA 1E64A 3L9XA 4C7MA 4D9GA 1ZBDA 3SFTA 3EDQA 3RODA 5HR5A 1ZL0A 4Y9TA 1OD6A 1AGNA 3DLTA 2NXJA 5F51A 2FZCA 2GLUA 5FUXA 1KE1A 4H3SA 4RPCA 2I66A 3MJSA 5BN3B 4LISA 3NU1A 4MVJP 3LCUA 4ZT7A 1JQEA 2P9CA 2C9CA 3HKCB 5LB2A 4OFXA 5IDQA 1JAHA 1ZC4A 4PG7A 1GNPA 2ORYA 2DPGA 3EIXA 4G0PA 4GL4A 2YICA 3SOPA 4LRTB 1SVNA 4DV7B 4MYUA 1OE0A 4AW9A 1U8CB 3NUZA 1MV5A 2VEOA 5BYBA 3L6EA 4XQ9A 1CUVA 3NFYA 3TRHA 5T6BA 1DPFA 2W71A 2R00C 2XD4A 1N2BA 1RI1A 1JEJA 3HY3A 2AQKA 3PGA1 4LHSA 3H4IA 1ZS9A 2XCOA 1QDLB 4KGDA 3FKQA 2J0UA 3I9OA 1L7NA 1ZG3A 2CEAA 1U5BA 4DVGA 4F6RB 3PNKA 1XPRA 1ZA1A 3BWBA 3UVEA 1KK0A 2B8NA 1XQ9A 2YYZA 4LOHA 3KC2A 4GWLA 4PSAA 2QTHA 2RHHA 1PFQA 2FQQA 2PSDA 1VQ1A 2WIBA 3DPSA 2ZSFA 1M8JA 3RYIA 3RC8A 4E5YA 2A5YB 2X13A 2Z2KA 3BX1A 3NPMA 5BRJA 4PYRA 1EVQA 3EG9A 2Z1NA 2GZHA 1B2RA 1G6Q1 3EK2A 4FCTA 4GMDA 5EIOA 3WJAA 2WTUA 1D6MA 4DR1B 1SU7A 3ZCQA 1JLSA 3ELUA 3IDZA 2IYRA 4J75A 2ZJZA 3PK0A 2BZSA 1FSPA 3FROA 4GPEA 4KH1A 3DOEA 1IIRA 4L02A 1C30B 1YCFA 4HNSA 4HDRB 1PR6A 1A77A 3SYLA 1DMSA 3NYQA 2WJGA 2F9FA 1TKBA 2ZRLA 3KHSA 5F1OA 2G9VA 4EA9A 1VYUA 1NBWB 2QS9A 1E94E 4R2IA 3V8RA 1NRWA 1J6UA 1JAIA 2QY6A 2VIIA 2VYVA 3LD9A 2FPKA 3N53A 2EDCA 3DC2A 3OVMA 3X1KA 4A5SA 1TLTA 2FPPA 2V7VA 4I8DA 4BQNA 3EQ6A 1G5IA 2NYAA 1IRXA 1L5MA 2E89A 4H35A 2GK3A 3D7LA 3LUPA 4G5RA 4Q6WA 2ZBRA 1DC4A 3PQEA 3QFTA 4L75A 1GPH1 1E9SA 1SVIA 1KY2A 3DHEA 5KYYB 1S01A 4YXWA 4BMSA 2P62A 3GARA 2FH5B 1OYWA 3OWOA 1ZUNB 1SXJD 4Q4AA 5JYEA 4BYGA 1V5IA 1HDRA 4D81A 1R8YA 3NXSA 4L8VA 2W4QA 2X76A 3PFFA 1UFQA 4AZ0B 4ER6A 1RADA 3WGTA 2V0CA 1RXYA 4BKMA 4OLJA 1CJUC 3R7SA 3VC1A 1TRKA 3BTUA 2AHOA 1UC5B 3HN7A 1WV1A 2BFOA 2BFWA 2QLBA 1GZSA 3F9CA 5K6RA 4TT3D 3ZU5A 1IM2A 1CC1S 4PLWA 1MDBA 1H93A 3ICPA 2VDUE 2MIIA 2ZBGA 3LT2A 4XWAA 2JIRA 4DV5B 4XJSA 2FMXA 5KQLA 5DYIA 1RQLA 2X0DA 2AXPA 4HZIA 4RLSA 4CV1A 1JL3A 4LQ4A 3WJ7A 2KI5A 3WNCA 4CV3A 5C18A 4DMUB 1N2XA 1HDYA 3OJCA 1G3IA 2PKCA 2PLFA 3ILHA 3NKFA 2B6NA 4KE6A 1W1UA 2QQ5A 4ABTA 2QBYB 3DVLA 4LG1A 4N1AA 4OQZA 3ZD6A 1AZWA