4P7KA

Rat comt in complex with sinefungin
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
219
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
total genus 74
structure length 219
sequence length 219
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4p7kA00
3OPNA 4E2WA 4ER6A 5FTWA 5IKMA 2I7CA 5E1OA 2AVNA 3E7PA 3FRIA 3KPJA 3C0KA 5K0JA 3EVAA 4M36A 4QVKA 3VC1A 1PRYA 2NP7A 3KHKA 3MGGA 1R00A 3GRYA 5E2AA 4P7KA 3I58A 3RIEA 5GOZA 3TKYA 3M6UA 4FSDA 1M6YA 1VP9A 1WG8A 4CTKA 5EIWA 3GCZA 4DF3A 1FPQA 3G5LA 3V8VA 3CCFA 1FJXA 1N7IA 4PWYA 5FQOA 2AN3A 3TM4A 3NVMB 4WXHA 3R6TA 2Q41A 1RI2A 3M6VA 3P9KA 4OQDA 5D1NA 2QM3A 3BKWA 1FP2A 4HSGA 5FA8A 4C08A 4U7TB 2ZVJA 4PYOA 3KR2A 1P1CA 4POOA 2OZVA 3MHTA 1G8AA 3DXYA 5DM4A 5EZQA 2PGXA 2ZW9A 3CBGA 5BW4A 5E1BA 2B78A 1AQJA 2VS1A 4C06A 4C04A 4X41A 1UWVA 2PX5A 3UBTA 4R6XA 4WVLA 4HH4A 3UJBA 1WXWA 1QANA 2FK8A 3BT7A 1EJ0A 4KW7A 5ICCA 5FQNA 3LHDA 2BR5A 3FTFA 1SG9A 5LQCA 2FYTA 2OB2A 1ZQ9A 4E32A 4A6DA 2GA9A 5DLYA 2NXEA 3ER8A 2IIPA 2NP6A 4E2ZA 5EMMA 2BM8A 2P35A 1N2XA 2K4MA 3LECA 3LDGA 2ZLBA 4M37A 4EKGA 2PX8A 4PGHA 3P97A 5FADA 4UOEA 3PB3A 1AV6A 4PINA 3CVOA 3PX3A 5K0CA 2UZ4A 5LSAA 1JG2A 1RI5A 1L3CA 2PKWA 1ZHFA 5KYGA 5T6BA 1YUBA 2P8JA 3KR9A 3MTIA 3TRKA 2PBFA 1SKMA 4RTJA 1G38A 3KQQA 5E1MA 3AY0A 3MAGA 2YTZA 2P40A 3SM3A 4QDKA 5K0FA 3A25A 1XDZA 3DTNA 3G88A 4RV9A 1D2GA 2PJDA 4MQ4A 4RSRA 4ATNA 2JHPA 2WA1A 1Z3CA 3FPFA 3UJ8A 4BP1A 4E30A 4B17A 2YXLA 1BC5A 1G8SA 1IM8A 5FA5A 1JR4A 2JHCA 3R0QA 3B89A 4P7GA 3UJ9A 4PGGA 3KQOA 3P9NA 1YF3A 3KU1A 4XUDA 3EVDA 2VDWA 3LCUA 3P2KA 5JUWA 4RTNA 3R9XB 3LX6A 2GS9A 4FZVA 5P8WA 3EEYA 2ZZMA 2YXEA 5KS2A 4EVIA 4FS8A 2P3OA 3SX0A 3NMUF 3G2QA 1RJDA 5K09A 3PLAE 2PY6A 1YZ3A 3KQVA 4KWCA 4QVGA 2IP2A 2BR4A 2CMGA 3GIWA 2GB4A 5EEHA 5K0BA 2ZULA 2XBMA 3KPYA 3LKDA 3OZRA 4FP9A 5K0EA 4DCGA 5DX1A 4PONA 5K0NA 3DLIA 2UYHA 4OX9Y 3KQMA 4EMSA 5DT2A 3OCJA 1L1EA 3PVCA 4RTQA 5EKUA 3VYWA 2AVDA 3ELWA 1ZGJA 2AOWA 2P3LA 2V74B 3C3PA 4YV0A 2IBTA 1NW6A 4CKBA 5EMLA 3UJCA 2YUIA 5LQNA 3CKKA 1G6Q1 5E8RA 4QPNA 3HCAA 3FPHA 3B5IA 2PLWA 3BKXA 3KQPA 3LKZA 5K0LA 5H02A 2AOUA 3B3JA 5FHRA 3P71T 3ERCA 1D2HA 3GDHA 3G2OA 3QOWA 2GH1A 3GU3A 5EMKA 1Q0TA 2GAFA 3PS9A 1NBIA 1G55A 2P1DA 2Y1WA 3HVJA 1SQFA 5ICEA 3GNLA 2O06A 3PT9A 4C03A 5ICGA 4OA5A 4RTKA 1R8XA 4DZRA 3EVBA 4QTUB 1P39A 3KR1A 4RVFA 5DTQA 1RJGA 3O7WA 5M5BA 3P8ZA 3KQSA 3FPGA 2XYQA 4PYJA 3KPWA 5KQRA 2G70A 3DP7A 2B2CA 5CM2Z 2O05A 3TKAA 3FYDA 3DR5A 3TM5A 4KIGA 3NW9A 1N7JA 2NXNA 3HA5A 3MB5A 1KPIA 2AS0A 2B9EA 4HRAA 4RYLA 1VP3A 3T0IA 2YVLA 3LL7A 2B3TA 2ORED 3AXSA 3DMGA 2PXXA 3NWEA 5EQJB 10MHA 1SUIA 2QE6A 2ZIEA 3D2LA 3EVFA 5F2KA 3BGIA 3PX2A 4GC5A 3UJ6A 2FRXA 3LSTA 5GINE 2NXCA 4E33A 2AOXA 2G72A 3ME5A 1WXXA 4ER7A 3IEIA 4YUYA 2VP3A 1EG2A 4E31A 1P91A 3SVZA 3GRRA 3PFHA 1VIDA 3M33A 3LCVB 5HIIA 5IH3A 2VDUE 1PJZA 4GOLD 1I9GA 2H1RA 2ONYA 2WK1A 2QY6A 3OFJA 4RX1A 3AWIA 5FCDA 2IH2A 4RTLA 5LQUA 2HWKA 3WSTA 1VPTA 1I4WA 4BY9E 3BUSA 3JWIA 1JG3A 1FP1D 1L3BA 2IGTA 2PSSA 2P7HA 3HM2A 1RJFA 3HVKA 3I5UA 4FGZA 3E05A 4FR0A 1JTFA 1H1DA 2OB1A 1JSZA 2P7IA 4IWNA 4L7VA 5F2OA 4GOMD 1VL5A 3FUUA 5DTMA 2EJTA 5E9JA 3RODA 5GP1A 1NW8A 5GWXA 1ORIA 5U4XA 2Z6AA 2ZZNA 2FK7A 1X19A 2I62A 2JH8A 5DM1A 4AZWA 3DXXA 1TPYA 3NTVA 5DSXA 4FT4A 2AR0A 3AXTA 5C1IA 2FPOA 1IY9A 1NT2A 3Q87B 3L8DA 2OO3A 5DX0A 5B1SA 1VBFA 2AZTA 4PYQA 2WA2A 1SUSA 3HP7A 4X61A 2XYRA 1NV8A 1OR8A 4BLUA 5BW5A 3ER9A 4BP3A 4LWPA 3FTCA 1HMYA 4V0QA 4Z2YA 1EAMA 3B3GA 1INLA 4F85A 3UJDA 1KYWA 2I6GA 2YX1A 4G56A 5C0OE 1O9GA 2CL5A 3V97A 4K6MA 2NNWB 1RI3A 4XUCA 4DCMA 3NVKI 2G71A 5E9QA 4P58A 1DL5A 4GOOD 1EQAA 4QDJA 1XDSA 2IFTA 5EEGA 4F84A 3X0DA 2UYQA 4YV1A 5HILA 5EPEA 4CTJA 2CWWA 3G8BA 3GO4A 3A27A 3QOXA 1X1AA 1HNNA 3KR0A 3P2IA 2H11A 4P7FA 2IDJA 3M70A 1T43A 3MQ2A 3QV2A 4C05A 1ORHA 4PYMA 5FHQA 3SXJA 2AOVA 4E2YA 4YUZA 4LECA 1R6AA 4HGYA 2PT9A 4XUEA 4AZTA 4DMGA 2AOTB 2G8NA 4PYNA 3I9FA 4KRGA 5G02A 5HIMA 5GIPE 3DXZA 2H00A 1X1CA 3HCBA 4RVHA 2CKDA 2E5WA 4DA4A 2NYUA 4GOND 3JWHA 1BKYA 2ZTHA 5EOVA 4CXMA 4MWZA 1F38A 5EC8A 5FWAA 1JSXA 3HNRA 5EZSA 3DH0A 1Y8CA 3HVHA 3B7PA 1XCJA 2DPMA 1KHHA 2ZBQA 1DUSA 4MIKA 1V39A 1IXKA 2ZWVA 4LG1A 2IBSA 1M6EX 4QPPA 4R8SA 4AUKA 1XVAA 5LQJA 3HVIA 2C7RA 2JG3A 3HCCA 5T67A 1BOOA 1NW3A 1ZG3A 2OBFA 3A26A 3LBYA 5EMJA 1X1DA 2I9KA 4V0RA 1SQGA 4X63A 1P1BA 3UZUA 1JQ3A 4OBXA 5F2NA 4Y2HA 3RW9A 2OYRA 5EIFA 5HOQA 5CVUA 3HCEA 3BZBA 4KDRA 2HMYB 4ISCA 3UJAA 3T7RA 2QRVB 1RI4A 3FUWA 1SVUA 3TFWA 3TLJA 3OE4A 3SR4A 3U81A 4PIMA 4GQBA 1O54A 2C7OA 2KW5A 3TQSA 1WY7A 3TPZA 5GM2A 2PV0A 3HA3A 1QZZA 3ELUA 5DSTA 4IV0A 1G60A 1NBHA 3LBFA 2ERCA 2OXTA 4EQZA 3BWBA 2PX4A 3EVCA 4E2XA 2Z6UA 4AX8A 1EJ6A 3GRVA 3GJYA 1XXLA 3EVZA 1YFLA 2FHPA 3CJTA 3FYCA 3K0BA 3GWZA 4ER0A 1WZNA 1XDUA 1RJEA 3EPPA 3KQYA 1KP9A 2BZGA 3AJDA 4H0NA 5DM0A 3VSEA 4CKCA 4EK9A 1KPGA 3EMBA 4KVZA 3DMFA 2F8LA 2PX2A 3G8AA 2G1PA 5BP7A 2ZZKA 5FUBA 4GUAA 3UFBA 2NXJA 3OE5A 5T64A 3BWMA 3IYLW 4U7PB 1XCLA 3BGDA 3FTEA 2EJUA 1R8YA 2ZBRA 2PXAA 3K6RA 3NDJA 3P9CA 3DULA 4AZSA 5DXJA 1ZGAA 3BWCA 4FSXA 3CJQA 1R74A 4YV2A 3DOUA 3OZSA 2OY0A 2YQZA 4A6EA 3TMAA 5K8VA 1AF7A 1Q0SA 2Z6QA 3ELDA 3ID6C 3P2EA 4R6WA 4OBWA 1D2CA 2ZIGA 5CVJA 4RTRA 3GRZA 3G7UA 2PXCA 1NKVA 4PYIA 2P3QA 3CJRA 4QQNA 4YMGA 4RTSA 5E9WA 4XCXA 2FCAA 5KQSA 1M0EA 1TW2A 5CVEA 2ESRA 3VC2A 3KQTA 5E2BA 5DTRA 5K03A 8MHTA 3NJRA 1QAQA 3T7SA 3E8SA 1R18A 3M4XA 3PFGA 5HIKA 5ICFA 3G2PA 4M7RA 3S68A 2XVMA 1I1NA 3G5TA 3G89A 4YUWA 2IPXA 5K01A 2IH4A 4CWAA 2YXDA 3BXOA 4X1OA 2VDVE 5GIOE 3UJ7A 4NECA 4RTMA 1VLMA 5K0GA 3KPVA 2YR0A 2GLUA 1JG4A 1F3LA 2ADMA 3ELYA 2ZSUA 3A7EA 1NE2A 5KVAA 3KPUA 2BR3A 4ZTBA 4YUVA 3A4TA 2LD4A 4JXJA 4RTOA 4RWZA 3TOSA 3JWJA 4HTFA 4IKPA 2HR1A 3M6WA 2ZWAA 4DQ0A 3PTAA 1DCTA 2AOTA 5E8JA 1KXZA 1UFKA 2PWYA 3ANXA 5CVVA 4ER3A 1QAOA 2V7EA 3E23A 4BLWA 4KDCA 5LQRA 5LR6A 4ER5A 1KPHA 2R3SA 1EIZA 4QTTB 3MCZA 2DULA 2GPYA 2BH2A 3THSA 1NW5A 5DPMA 3C6KA 1QAMA 3F4KA 5K05A 5MHTA 3OU6A 4GEKA 3SSNA 5HIJA 3MCTA 3ORHA 1FBNA 2EG5A 4PNEA 1JTEA 9MHTA 2O57A 4PYLA 2PVCA 3IV6A 4RVDA 3KKZA 3M6XA 3MTEA 2EX4A 4C4AA 4FT2A 2B25A 2PT6A 3OU7A 3R24A 1B42A 4DKJA 3NWBA 5EVJA 4QQKA 2P41A 2Y1XA 5CD1A 1RI1A 3R3HA 3DLCA 3MERA 3LPMA 2ZBPA 2ZIFA 5DWQA 2HNKA 3FRHA 3HCDA 3OFKA 3EMDA 5DM2A 3FUXA 3EGVA 4DM3A 4PYKA 3P9IA 4AZVA 5DRTA 5DRYA 3DUWA 5EKXA 5EHIA 5ERGB 3GRUA 3HEMA 3LGAA 3FTDA 5LQAA 1L9KA 2AN4A 2AN5A 2OKCA 3KQWA 2A14A 3G2MA 1WS6A 4GBED 4HG2A 3CC8A 4O29A 1YB2A 4YMHA 3I53A 2IDKA 1VQ1A 4X60A 3B3FA 5CUQA 3SSOA 1KIAA 3UWPA 2ZCJA 3I64A 3Q7EA 3REOA 1ZKDA 3EEOA 4PIPA 5EGSA 1VE3A 3CGGA 4P7JA 5C9ZA 1UIRA 2IH5A 3FZGA 2VZ9A 5EHGA 5CVDA 3HTXA 2O07A 1MHTA 5CCBA 3EGEA 2JJQA 3TR6A 3EGIA 3C6MA 3BGVA 3H2BA 2UYOA 3HA7A 2R6ZA 2C7QA 1YFJA 4RVGA 4OA8A 2UYCA 2EFJA 5DXAA 5FULA 1QYRA 3O31A 3THRA 3OZTA 5HEKA 1TW3A 2AOUB 5JR3A 3O4FA 3HCFA 4GF5A 4IV8A 4PCAA 3BWYA 2HV9A 3C3YA 4PCLA 3FUVA 3DMHA 3GXOA 4YUXA 3IHTA 4Y30A 4MTLA 2QYOA 5CIYA 3EVGA 4LWOA 3SSMA 3JWGA 3NDIA 3FUTA 4R05A 4EKIA 4HC4A 3SGLA 1JG1A 1MJFA 1L3IA 2CMHA 2ZFUA 5D1HA 5GM1A 4C07A 1XJ5A 3EVEA 1AQIA 2XVAA 1YZHA 2JHAA 4MHTA 3T7TA 1KR5A 2OPBA 4CKEA 1JQDA 1X1BA 3OU2A 2JH9A 3GGDA 2XYVA 5EG5A 2N47A 4R8RA 1O9HA 2O0LA 3LDUA 4M38A 1NW7A 2QRVA 2PWPA 2C7PA 3FPEA 5FWDA 4OQEA 3FPJA 5BXYA 5LQKA 3LDFA 4E70A 4F86A 4BLVA 4HGZA 5E1DA 4RTPA 4HTFB 1NV9A 1BHJA 5HFJA 3LCCA 4GC9A 1JQEA 5CCXA 4KIFA 3SMQA 5HZMA 1XTPA 3UA3A 3A7DA 2BM9A 7MHTA 2HTEA 5DX8A 2ONZA 3UA4A 1U2ZA 1KYZA
chains in the Genus database with same CATH superfamily
3VC3A 5CH3A 1MO2A 2PMKA 1Y6RA 4NJMA 5AK3A 2AF4C 4ARZA 3ZTWA 4U8GA 4ZK2A 2QI9F 1A9YA 1HFKA 2RARA 2GPAA 3WL7A 1XMPA 4YT5A 3D0KA 4P7KA 1E7QA 1ZR2A 1HE2A 1TAHA 2C7GA 1QOPB 3A9CA 3C14C 5A7GA 1ZOPA 2NX2A 5AK6A 1MH9A 4DF3A 1OF1A 2ASEA 3LA6A 1S8AA 5DVZA 4RBNA 1UBKS 5FEUA 5CDUA 1D6SA 1XWFA 3E2MA 2B1IA 2K6GA 5AICA 2JFXA 2PBZA 2O2GA 3MWFA 4UC0A 1VMAA 3VKUA 5D3KA 2V7QA 3A05A 1XQ6A 1FVOA 3KYCB 2I1WA 4PXSA 1IE3A 1JPJA 3IVRA 5AK4A 1B8UA 2OZVA 3TX6A 4BFZA 4RDXA 4OGWA 4YMLA 5EZQA 1KZ4A 2IEBA 2BEVB 3CBGA 3R5KA 2C97A 5AVZA 2B78A 4JFAA 5AVQA 1OI4A 1W19A 1L4YA 3V8MA 2X6TA 2Z30A 1T1JA 3ZGZA 1NUAA 2GKGA 4PAOA 1AURA 1ZK0A 4Z0PA 4Z4IA 5JNWA 1TJYA 4IS2A 2OB2A 2YWDA 3L40A 4FQ7A 2O48X 3MOIA 1KTIA 3C3MA 1Y4AE 1C0KA 1YZVA 1QLHA 1V4NA 3QE3A 4P36A 5AJXA 5FPTA 1NC1A 2EGGA 2H0QA 4LMPA 4NL4H 2O2EA 3PRYA 5A05A 3QVJA 4BVEA 3LC7O 4D02A 1U8EA 1MQ9A 4RYDA 3W6UA 4Q9NA 1H65A 3NIGB 2PX8A 3K94A 2B8TA 3QFRA 3NNSA 1DWQA 3MGAA 1KEUA 2JARA 3CVOA 1J5XA 1K6EA 3GLFE 1TXGA 3WY9A 3C8ZA 4DLVA 1UZUA 1RBZA 4G9BA 1AGPA 1YUBA 5TE9A 3KR9A 5ILGA 3G0IA 1VPLA 1DC6A 2IYVA 2PN1A 4HK4A 4TZ6A 1IONA 1K5GA 1YULA 4N5MA 4YPOA 5LYJA 4P53A 4GFDA 3BYZA 4R2JA 3BFKA 5C3UA 4AO8A 1VFNA 4BBJA 1OFTA 1ESMA 4YO8A 3FUCA 2XUPA 5AI9A 1K7XB 2O9JA 1UR5A 1WKCA 2XNCA 3VVLA 1ID1A 1WAMA 3QFFA 5L4SA 1Q0UA 3PC8A 4CEHB 4A0HA 3NEPX 2ZYTX 3P2KA 1T3LA 5G4LA 1T5BA 1RZUA 1R12A 1TYDE 1UKEA 3FZQA 3UG6A 2OAP1 3GT7A 5KS2A 3PHCA 5F21A 1HTTA 4FS8A 5B7NA 5BY2A 3LY8A 5CT4A 4KWCA 1DWOA 2PH7A 3TNLA 2X2EA 2GN2A 1UIMA 3UW1A 4Q37A 1VGRA 4ME6A 3G85A 2OV4A 5HSGA 5IJ0A 1L0BA 2C4TA 3K5HA 5CDYA 4MCHA 3HL0A 3II6X 2VYVD 2WYWA 1GPJA 3B1KA 2NUAA 3TR0A 4ZT7A 5FOXA 5FIUA 1ZGJA 2P3LA 1P6UA 1RE0A 2DCMA 4JVNA 4PXAA 4DLPA 4IGIA 3LUAA 1OXBB 3ESXA 2P9JA 3CU5A 4O4HA 5FUMA 3IX7A 2W2KB 2PQ0A 4D9MA 1XZAA 3UHFA 3JQRA 3P71T 4IJUA 1OC2A 1OFHA 1M6VA 1VE7A 1Q0TA 2EGUA 5TS3A 3UC5A 2AKYA 2R7NA 4YJ3F 1TU4A 2SKDA 1R0KA 5EESA 4ZZ0A 1T9AA 1KVTA 2Q5JA 3LCJA 2II6A 5INTA 2AFIB 4G0UA 1SY7A 1P39A 1K5PA 3WOHA 2XYPA 4FM9A 3F6PA 1WKVA 2VYCA 2WFAA 4ND8B 4DSNA 5SY6A 2PRYA 1Y1SA 3RYHA 2R6HA 4HHEA 4JB3A 3VKHA 4W5OA 3PWSA 1RWNA 4LNUA 4Q82A 5CCDA 4TUYB 2PHZA 4S05A 4O02B 2ZIZA 1AIPA 3QLJA 4KXFB 4V24A 4GDFA 4KHZA 5A1JA 3G0BA 4V3CA 4LX8A 5I7EA 1ZUHA 3AXSA 4RMHA 1M6NA 2LTAA 3QYPA 1Y5IA 3OCZA 1G2OA 1VL8A 3ZV3A 4URVR 1VB3A 1PZXA 4G65A 3BGIA 4HDNA 1U2EA 4F2HA 5BRJA 1PLJA 3ASZA 5J5VA 4BC1A 2G72A 2G63A 5DTIA 4DQVA 4ZYUA 2BTQA 1WUHS 2MSWA 3M7IA 1NZJA 2VDKB 2QV0A 3K96A 4Q1BA 3DVRX 2YYYA 4I5FA 5IH3A 3TO5A 3OZAA 4BAZA 2BEWB 2WTEA 1YIDA 1Z8DA 1JB9A 3ZBTA 3G0HA 3A1WA 3OF3A 5K8LA 2X1MA 1P1KA 5FCDA 3GT3A 1CFZA 1X7XB 4JB2A 3WWDA 1UJ5A 4IXTA 4EI9A 5JQWA 4EAQA 3BUSA 1Z15A 4WBNA 3FBGA 3EZ7A 4J2HA 4IOJA 4Y6SA 2YXBA 1CQXA 1F9EA 5G53C 2FDCA 2G9VA 3U7FB 3NIDB 4QOEA 3AGQA 1LQUA 4D5EA 1QGUA 2R1TA 1NMXA 1JSRA 1JZSA 1IPHA 2O1XA 3PD7A 4YCJA 3D81A 2BDEA 3HXLA 1XZGA 4GX1A 5GWXA 1M9NA 1O1YA 3VJLA 2FX2A 2JH8A 1L5ZA 1O96B 3N74A 3TQRA 4A8HA 4BGEA 4NG4A 1GPYA 3AUXA 4IVPA 3B1XA 2ENWA 2FFAA 1Q0QA 4PYQA 1B7GO 1QF7A 3L7NA 4FB5A 2PAFA 2YZKA 1T1RA 1T2AA 3ROEA 4BO4A 4CKXA 4G9GA 5TARA 3K35A 3ZV5A 1OIWA 3FTCA 3VH2A 1H8EA 4JR0A 1CRQA 1H66A 1RM0A 2OZKA 2XF2A 2VH5R 3IB3A 4ITUA 4MVWA 3UJDA 5ITWA 2QM0A 2CL5A 1RR6A 1TNDA 3LO5A 3GPLA 5I4BA 3GPIA 3V1LA 2VZLA 3DV0B 1FS5A 3KAJA 2IV2X 1A3CA 1LNZA 2CCGA 4J90A 5EPEA 1GFSA 1V5WA 1YVUA 1AZSC 2YOGA 2ZPAA 1UZLA 3PEFA 5EJMA 5IAGA 3WLHA 2AE2A 1QO9A 2FCRA 1RLOA 4CMHA 4JCCA 2DZDA 2AUMA 4G86A 5GV7A 5CBPB 4B32A 1N36B 2O0MA 4V0MA 4AZTA 1T8YA 1Y7TA 2NLOA 3ES9A 3LZ6A 4O4HF 4ZARA 4PEVA 3ZDRA 4KMRA 2WHPB 1BQ4A 1THTA 1GA6A 1AKWA 4WBSA 4BLQA 2X0JA 4C6TA 1RM5A 3T34A 3V4FA 2XQJA 4L4UA 4HLDA 2GX6A 3OCCA 1WDWB 3WK7A 1C4OA 3IRVA 5IAEA 4AUNA 2QLNA 1J6UA 3RB8A 3HB7A 2A30A 3BDIA 1L4MA 1NU8A 4YA6A 4KI0A 4QQRA 3W79A 2J31A 2NYUA 1QZ3A 2PD6A 4HGQA 5JNSA 4MVJP 3UY4A 5L8VA 1TFUA 1E58A 1G20A 1ZIYA 4JXKA 1NSFA 5F35A 2A78A 5JSKA 5HE8A 1UMBA 1JVNA 4H3KB 3AUFA 2EP7A 1N8SA 3RS0A 3KEOA 4MA4A 3LBYA 1UC4B 3C3DA 2UZIR 1X1DA 3GLVA 1VE9A 3PZBA 3SM9A 5BNWA 5JFTA 4X65B 5BYJA 2W43A 3QFSA 2WV9A 1ZIPA 1WXQA 4CM1A 4AD8A 2OYRA 1IHYA 3DBIA 2XEXA 4BQQA 5IWCA 1JW9B 4PZ9A 1SQ5A 3BH0A 2AK3A 4G0OA 4MUIA 1JJFA 5G1OA 3N0VA 3GEGA 4I3HA 1QH8B 4N7JA 3WTBA 1VBKA 4OP2A 1Z2DA 3ORQA 3IXQA 3O8DA 1RYBA 4KFSA 3RTCA 3CVJA 2FEAA 2FPSA 2W71A 3ILHA 4JJAA 4JLJA 1FFSA 3ELUA 1Z0AA 4A03A 1AA9A 3RVOA 3SK0A 4PHGA 1OKKA 4MKHA 4ND3A 4KDFA 5EQDA 1BJTA 3TLXA 3GJYA 5DFAA 3J7TA 3RTGA 1LC0A 4UM7A 4KYVA 1KNQA 2IYOA 1WZNA 3OEWA 1GKUB 3VR4A 5B7PA 2XIJA 5H7XA 1UPUA 2G82A 2NZYA 3NIFB 4ZVPA 2HREA 3DEIA 3LTNC 1UC5B 4YXWA 1MEEA 1MIOA 1TM3E 1BCSA 4L7QA 5E6RA 2BUBA 2GBGA 1PG0A 4UARA 3ZDQA 3PUWA 1P6XA 3D1VA 4KR9A 5IFLA 1Y42X 3D5TA 1XCLA 3T0GA 4IQ0A 4WEQA 2W2LD 4L95C 3NDJA 5A0TA 4GLFA 1VI2A 2PD3A 5I8WA 1GG2A 2JK1A 2QRPA 2DFLA 4UQOA 1QHNA 3BE8A 4GMFA 3B2NA 3IP7A 3FNEA 4BV8A 1KORA 1C0EA 1SZPA 4JIGA 3ID6C 1PTKA 1PT8A 1YDWA 2QENA 2Y0PA 2ZIGA 1MC5A 1IG0A 3DAPA 2ZSAA 4IIJB 3ZW7A 1B8VA 3CRRA 4YS6A 5E9WA 4ZYVA 3FNBA 2O5EA 1QXSA 5ALXA 3C3CA 3TNJA 3VMMA 4B40A 3RHTA 3U4QB 2VWHA 2FZKA 4TSFD 2FN9A 4RKWA 4WUTA 5EWLA 4AS2A 2IYNA 4F2DA 1U2RA 3M4XA 4CCYB 3VR1A 3KK0A 5EUQB 1F2VA 4ESVA 4EKEA 1QVRA 4O1IA 1JHMA 3ETLA 2VPQA 1VKZA 3GG9A 3IT0A 3I1JA 3LQ2A 3G89A 1NI4B 4LC0A 4JSRA 5HKLA 1SOUA 1CY6A 2J30A 1ZUWA 2PT7A 1QG2A 3KJXA 3NTQA 1SUPA 1V3VA 1XLTC 3GQBB 1VLMA 2HEGA 3LHSA 3LYAA 3EXG2 1P1HA 3HH8A 3T3OA 2ARKA 1ST2A 5KVAA 2XMCA 4DBZA 1JHYA 2BR3A 3KS9A 5TB5A 3TJZA 4BBPA 4OMUA 2FSVC 3TSOA 5JCZA 4KR7A 2B4YA 1WR8A 2J9FB 1ANKA 1HY3A 1OYYA 3JWJA 4HTFA 1L9XA 4NH0A 3PXXA 4GR4A 2D00A 4B84A 4JB8A 4FYMA 4GYYA 2UYGA 4FMDF 1ZVJA 4BKMA 4OREX 4X44A 5ELMA 3X2SA 4EL0A 1MKYA 4ED9A 1G8PA 1GNPA 1ECJA 2JNWA 3GJRA 3H97A 4I1UA 4DUGD 4ZC1A 1GVHA 2ZVDA 3QUSA 3ZH2A 2NSYA 3DDHA 4IO0A 1JYSA 2D4HA 2QQEA 3S2EA 5KHOC 4C4OA 3PC3A 1DEXA 2IXEA 3BVPA 3KKOA 3M5PA 4H7EA 4C76A 1NXOA 4DHEA 4MYUA 4QLBA 2GXAA 3BGWA 3ESCA 1TF5A 3RVPA 5CT9A 2H16A 4AURA 2J6CA 3LXRA 3A9VA 3BH6A 5DYGA 5K51A 4GYJA 3S70A 1XFAA 1E9SA 1TTPB 1ISHA 3NAMA 4BN0A 1HTWA 2REQB 3M83A 2P41A 4AZ0A 3PTLA 2GZSA 1RI1A 2QW0X 3NHAA 4RK0A 4RJKA 3UNXA 2DBYA 4GGOA 3NU1A 1GNTA 3L4KA 2D2IA 1MRNA 3C74A 4UEKA 5DLQC 1N5OX 4R69A 4LK3A 3WZLA 1X39A 3DE5X 4LNAA 1S9DA 1BN7A 4GMHA 5E4YA 5M04A 3Q8MA 2BFNA 2XZLA 4HDNB 3EULA 3FUXA 5A4IS 3I9MA 3CBQA 3JQCA 3JVIA 3LBNA 1P29A 3Q6IA 4RACA 3ZK7A 4KBGA 4GP9A 3WWZA 1ODSA 1UOPA 2FMKA 3TH5A 4TXJA 1ZM3A 3O2QB 4JEHA 3GT4A 3P20A 1JLRA 1R6XA 2IKSA 2YQ5A 5HJ5A 3EJ6A 2GQ0A 1FQKA 3EF3A 3Q12A 3V8RA 1AOXA 3I64A 1W581 4DLWA 3EEOA 1LK0A 2XMRA 1XZBA 3GI1A 3LY7A 4UVEA 4G4JA 1MX5A 1ZH2A 1U9ZA 2QMQA 3AJRA 3EGEA 1JX6A 1FRVA 5B4TA 1ZK4A 5DE3A 4X1IB 5CNJA 1BU5A 3UMJA 4PGFA 4HY3A 3HA7A 4DEVA 5I6DA 4J1QA 3L4EA 4C7BA 5JPIA 1Z5VA 4OA8A 4A0RA 2NSHA 4K86A 2PPLA 3AV3A 3TWOA 1Z8FA 3BORA 2AOUB 2WIBA 5JR3A 4V38A 3WDLA 2H7YA 1UWKA 5FUWA 4KXMA 4I2NA 1L5KA 1X1QA 2OESA 2DQZA 5G0TA 4D9EA 1SCUA 2Q8PA 1MVNA 4DDUA 1VHLA 4HC4A 2QGFA 2X86A 1LW7A 2A88A 3DEFA 5LDGA 2A94A 2ZUTA 4DUYB 4M7OA 3K9FC 1S01A 1IPEA 1NG9A 3P5BA 1XEFA 5JCJD 3FYTA 2OPBA 3F8TA 4JOQA 3TXXA 1NJ8A 1Z29A 4HFJA 4J91A 4FNMA 3OHPA 4G37A 2L19A 5LP6B 3KVYA 4IXWA 1PL0A 2PZJA 4L0DA 1U8TA 3OWHA 3OY2A 5M7EA 1HE3A 2PBRA 4ZV9A 5K6AA 1KOLA 4FR2A 3NT4A 1AGRA 1SIOA 5ALPA 1TQ8A 1ZI6A 2H7XA 3HJAA 5AFSA 1I7DA 1D9XA 2QORA 3S99A 2J9YB 1G64A 4AJKA 3GQVA 3A7DA 3FGNA 3KZMA 1ZVKA 1JKFA 2DOKA 2HTEA 2ZSHA 3DM9B 1G4AE 3O9MA 4B9EA 4EA8A 1FFYA 5KBYA 1P3JA 1RYFA 4QUJA 3EZ6A 3D1LA 4R2XA 4CGYA 1LK7A 3KPJA 1KK1A 3FETA 1JHRA 4Q4LA 3NVAA 5J2UB 2X22A 3L1UA 1CF4A 1XMJA 4AJHA 1Y1KE 3M6UA 5B5SA 1A8IA 4TVBA 1H2EA 4HAVA 1U28C 5L9AA 3U4QA 1T8RA 3GW8A 4P2GA 1RPTA 2F8TA 4WXHA 4NEQA 3WFJA 2Q41A 2Q0HA 4TKVB 3P9KA 2C82A 2E9SA 4DLNA 2CXQA 1FP2A 2APJA 3TZBA 4OM7A 4II3A 2WICA 2CYBA 2EFEB 2J4CA 4HEA6 2BFMA 1CNEA 3UCFA 1C1YA 1T25A 2VUHB 2NU9B 2AI2A 4MO2A 2AXQA 3B70A 4C06A 4QQ8A 4O4JB 3UOWA 4P84A 1FUKA 1PNOA 3OQJA 1CW2B 1U9IC 4OGLA 4QU5A 1NVEA 5MF6A 1LV8A 1Y1LA 5FKJA 1T1SA 2VUSA 3BT7A 3KWMA 1BH6A 4EB6A 5FV4A 2CB9A 4AKTA 4W5NA 1J90A 1N6OA 2PG3A 3BB3A 1PHPA 3H2YA 3RIHA 3IT2A 4FWTA 1OH5A 3GDOA 2AXPA 1C9DB 1VHWA 2R4TA 3T7JA 3EXIA 4YRTA 3B3QA 1FNSA 4LXUA 1EWQA 5G1PA 1SURA 5FLEX 5TEWA 1KEEA 2ZLBA 4KWIA 5BYBA 1EP9A 5FADA 3HU2A 4EKGA 4ZYZA 1QGUB 1NN0A 4IW3B 5FI5A 1L3CA 1HL3A 3OUUA 4DV1B 2RHMA 3OM1A 4A36A 4GM4A 4XX1A 5DCUA 1BEZA 3JU3A 4RNDB 1J0XO 1G38A 4FHDA 2YTZA 4FW8A 2NMVA 2PFKA 1YKSA 5ECGC 1GPKA 3IAAA 2JGRA 2XOXA 4YRFA 2VF2A 2C5GA 3GJTA 4MQ4A 2CLHB 3L0OA 2JHPA 1JA1A 2WA1A 1M2OB 4EY6A 1JEJA 1KO7A 2CF5A 3SQXA 1F8YA 4N0EA 1Y4DE 2VA9A 1HOTA 3MRSA 3N2EA 1FTWA 1SQ6A 1C30B 2FFJA 3KXDA 3ZXXA 4CR6A 4BE7B 3EIHA 1CPYA 1G4HA 4NOMA 3G0OA 3Q7QA 2JKZA 2VP4A 4FZVA 4IMIB 4D26A 1NUSA 5ELLA 1NI4A 3TRFA 4EENA 2OECA 1J00A 5ALYA 4XJSA 2ZJBA 3WWCA 3AK4A 4QVGA 3C1TA 4UDNA 3C3KA 2DTEA 5JIBA 4IAOA 1FYWA 1T4CA 1RD4A 1M33A 2OCKA 5D84A 1ZJWA 3LKDA 3A0RB 5DLDA 5REQA 3CF6R 1KEKA 3EOZA 4TWZA 1OXXK 1P31A 4Q21A 2Q5FA 2QU8A 3IUSA 3KOUA 4HNTA 3KV1A 1LBIA 1MGOA 4XD7A 5HQ3B 3NHSA 3OM0A 1NW6A 3KKKA 3OQVA 1UEXC 1V6SA 2GILA 3AM4A 3D5EA 2XXBA 5E8RA 4HL6A 3HCAA 4QPNA 1UJBA 4KMSA 3K0CA 1QQ7A 3C70A 4KZKA 1RLIA 2QN6A 1ICEA 2IHKA 4ZRDA 2O3SA 4XVHA 3AMVA 3MLAA 3PQ6A 1DLIA 4Y6RA 1A2BA 3KUUA 2JJYA 4DVJA 2QG4A 1U8XX 3CUVA 4FZJA 1SQFA 3L79A 3PT9A 2O06A 2ORVA 3R5SA 4MAAA 3VAZA 1H5NA 1Z68A 2JRCA 1SEPA 3P9PA 4CG3A 4YY3B 1SG0A 2NZ8A 5A03A 3CLSD 4FCTA 4P0PB 4I4IA 3FSGA 3GOHA 2JRLA 4PVCA 2GCNA 2HB6A 3KQSA 3P8ZA 3I73A 2X0EA 1H42A 3WADA 4TMXA 5U9CA 1RVDA 3ZE8A 4XGRA 1SUWA 1U0OC 2HU8A 1M1UA 1DAPA 1EM6A 5AHKA 1Z5WA 4QDOA 4RLQA 4EO9A 1PLKA 4D8VA 2EARA 3X2FA 1IY1A 5B30A 2GARA 1W1UA 1VP3A 3TZHA 2WMOB 2ZJ1A 2V7VA 2ZYVX 2JC3A 2QQGA 2MTBA 2DSNA 3AJEA 2CT8A 1F9AA 4FX5A 4MI1A 1UZMA 1RCTE 1LWNA 2WIFA 5HR5A 1ZM4A 1RFGE 1C7ZA 3AESB 2NXCA 3VHXB 1E1MA 1J0CA 1HSZA 2XUQA 2EWMA 4D4GA 4HRYA 2V4ZA 1DRUA 5DGHA 5MN4A 3GMSA 4J0EA 1VE1A 2UYYA 3AFOA 3EE6A 4MS3A 5AKGA 4YUAA 3BH7A 1ZD5A 1EFRD 1GLVA 3LCMA 4MA5A 4PY2A 5I9TA 1VSUA 4HLQB 1PJZA 5KVCA 4RM3A 5EN4A 2X14A 1SUBA 5I47A 4WASA 1VSBA 1BW9B 1Z74A 3F9CA 3O3NB 2PH5A 3PEUA 1JALA 1QHEA 3X1WA 1ZD2P 3BD7A 1L3BA 4AG6A 1EJBA 4LJ5A 4DYVA 4U7DA 3FB1A 3QUAA 1V9LA 3E05A 1NQ5A 4JITA 2OB1A 3RAEC 4A10A 1VPEA 4K26A 1U2DA 3ESDA 4D9BA 2A57A 4TSKA 3IDQA 5EE9A 1E9EA 1SHJA 4BJ6A 1BWQA 2CLCX 3G9ZA 3NOXA 3DEZA 1DDOA 3GFVA 2Z6AA 1P60A 3AX6A 3L07A 4DADA 1NF9A 4UAGA 1UKBA 2C7VA 5CNMA 3K1TA 5KTNA 3HP7A 4DZZA 1BS1A 4K9QA 4ASUD 3CN7A 4HVAA 1X94A 4H08A 4BLUA 4OFZA 3VQTA 4I1RA 5FI1B 4YCMA 2XE8A 1U3CA 1XELA 3HWX1 1BVYF 4C4TA 5BMVA 2KMLA 3DXFA 3B5EA 4NENB 4RMGA 1ZISA 4Q9HA 5AOCA 1KRXA 1VJ1A 2O4CA 2AH5A 3R5JA 1CUIA 4DDHA 4S1TA 4OLJA 1WW2A 1EX9A 1C8BA 4F5WA 3X0DA 1W4BA 1T8UA 2OLJA 1NXPA 3GO4A 1RHUA 2J8ZA 5JI3E 2WWXA 2Q7XA 3OWXA 3IILA 3VNBA 1P2SA 2AFHA 3DOEA 1R6AA 2AZ4A 4AQYB 4XB1A 2XZTA 1KFJB 4GBMA 4NH4A 4DLSA 1FQOA 1WU8A 2I99A 4LE0A 1PNTA 2WDZA 4X20A 5KYXB 1V7QA 4CJXA 2A5GA 3RYFB 1MH1A 1ULAA 2C4NA 2PO7A 1N0WA 1NBMD 1V7ZA 4LXYA 3SZGA 1C5KA 3DZDA 4DQUA 1CE8B 3BMOA 4Z99A 3O26A 1ENYA 5TV2A 1BS2A 1Q0ZA 2YMQA 4M1SA 2OGUA 3EEFA 5JJLA 1BKYA 1KMCA 1PR1A 1LI4A 2DT5A 2ZTHA 1J7JA 5F7JA 4D0NA 5TX7A 4F3NA 5JFGA 3HVHA 2CHVA 1DG9A 3L4BA 2AJ8A 3W34A 1CQIB 2IBSA 1GTG1 4GRDA 4MR9A 4P3PA 3AHCA 5LQJA 3W5AA 1CHNA 5IJXA 1RWOA 1OT5A 2NSJA 1BOOA 2JFUA 3HVUA 2IS4A 4RVOA 5IKOA 2WIAA 1I2BA 4QRIA 1Q1AA 3H6HA 2CXSA 4JC5A 3HXQA 2JCSA 1UBLS 4OV6B 3ICWA 5ECWA 4N48A 4LNUB 3OKAA 1HT0A 1T4CB 2LUOA 1P17A 1IEQA 2X9NA 2G88A 2Y1DA 3O47A 4AM8A 1I30A 3BSWA 1LPAB 1B16A 3DAGA 3GA5A 3V2HA 3RYCA 1MV5A 2PZ8A 1RI4A 2BY4A 2HLHA 4LY6A 2GT1A 3IBFA 1R0ZA 1W5BA 3IHWA 5GJCA 4QQFA 1FMLA 2JGNA 5EHZA 1ISPA 4RLFA 2PV0A 1UC9A 3QPAA 2GZRA 4M98A 5GM2A 2W4IA 3O4VA 4FHZA 3OM8A 1S2IA 4NE2A 3RASA 2PX4A 1RWQA 2Z6UA 1C7IA 1N3YA 2W83A 4EG0A 3AL0C 3IQGX 1V8ZA 3H13A 2J1LA 3L0YA 1X15A 2VAPA 3EISA 3P2JA 4MS1B 1YCHA 2IZZA 1I3KA 2BZGA 3AJDA 5IYZF 1DO0A 3QTLA 4XRRA 3MVEA 4ZYXA 2VHXA 3JAKB 2PMFA 4ZDJA 2GJKA 1Q1NA 2H1VA 2PUEA 1P19A 1CUXA 3PKZA 4W1SA 2G3YA 2X8WA 1IVNA 4MJ7A 3JQEA 1EFHA 1FYFA 3I1FA 3P9CA 4JJ7A 1KRWA 1MV8A 2D2VA 4A4DA 3EZ9A 3AI2A 4YV2A 1AKVA 3KSDO 3JV7A 5HUHA 2DJ5A 5EA2A 5K8VA 1Q0SA 4H18A 2Z6QA 1AGNA 3R5XA 4BX0A 3P2EA 1IG3A 3I8SA 1P61B 1OX4A 1OA0A 1V3QE 2AMYA 3VPGA 3VTFA 5KTYA 4BEVA 5L95A 3UB3A 4ZD6A 2P9EA 3WRXC 3Q9NA 5LQMA 2FCAA 2O3TA 4LBZA 3HJUA 3SS9X 2JBAB 4J43A 3WHKA 5ICMA 4UU1A 2I4LA 2VJNA 3P0EA 2HPVA 4LV6A 4NZPA 5C7YA 1PYOA 2RJ3A 2FZLA 3LX5A 4DCJA 4P1ZA 3JQGA 3VOBA 1ID8A 2NV6A 2XVMA 1LSUA 1W7AA 4XJVA 3BE6A 4TMYA 4DJ5X 3VO9A 4DXHA 2R8XA 3A3KA 5DHAA 4ZCSA 2RDMA 4CWAA 5D3MB 1P4SA 3NANA 4KQCA 4UBNA 4OUDA 3WGOA 4E3WA 5K0GA 3VYUB 3ZHOA 3DV9A 2O1EA 1JG4A 1F3LA 2BPOA 1ODIA 2JF0A 2O2ZA 4HYEA 2HA3A 1KFCB 4Z4GA 4C5AA 4NMLA 4TLMB 1N2HA 2L18A 1ZH0A 4PM4A 3SYNA 2BKXA 3PHLA 3T61A 2I34A 1ODCA 1QGOA 1XU7A 1DCTA 2AOTA 4B7UA 1UFKA 4MEAA 2EOAA 5G40A 4N3CA 4A73A 1VKRA 3H2HA 2GBIA 4MCJA 4ZVQA 1XJWA 4TZ0A 3TVYA 4ER5A 4JX8A 3CB4A 3H8SA 2GPYA 2IYWA 2O7VA 1QRTA 5GPBA 2VK2A 4UTVA 1B74A 1MC8A 2D1QA 2AWNA 3GGSA 3TZLA 1YASA 3WMRA 1Q0RA 2EF1A 1E1QD 1ZUNB 4LXGA 4OKNA 2NSDA 4RZSA 2VDWB 2IZ6A 2PVCA 2OA0A 3RABA 4GR5A 4N6NA 5T4EA 3PF8A 3J7AC 2ZG6A 4ABTA 3NHPA 3TOCA 3ZDZB 3IBSA 1VIMA 5ALZA 1PT7A 4KE8A 4QPCA 4JLSA 5EAIA 3UMYA 3GNQA 1EDZA 2ZIVB 5CYPA 4QNNA 4QOIA 1LSSA 1MOZA 4EPRA 4EX6A 5JU6A 3TRHA 1I3CA 3SHOA 1OV6A 3BL6A 3KOXA 3SMQA 2CLOB 4JJ6A 1OLUA 5E38A 3RREA 3FRHA 2FPPA 4DZTA 5LD2C 2O20A 1NUUA 1WHSB 5FLKA 4R9RA 4CPDA 3AFGA 4JI6B 4L8LA 5K45A 2A5DA 4NAVA 5KIAA 1IOVA 3P9IA 1MA3A 2VN8A 5G0WA 2I33A 3G8DA 4BIIA 1KY3A 2C95A 4H6VA 4IFBA 1XQVA 3QU2A 4EA9A 1BCRB 1J0BA 2POQX 4PLWA 3SYKA 1ZIDA 2EFGA 4PLZA 5IAJA 1FDRA 4EFDA 1YUMA 1A4RA 3PR2B 2H1HA 1AN9A 4EBBA 3QELB 2B36A 3LQ1A 2Q6IA 1XA0A 4RPCA 2L82A 4CF6A 3L43A 2OCGA 4FD2A 3EGXA 2BZ0A 3E7DA 5F77A 5J47A 1TCVA 2BDTA 1GITA 2BGTA 2YXPX 4E4TA 5B1EA 521PA 1GFZA 3ESBA 4I6GA 2EFJA 1W1WA 1SA0A 4LVNA 1J07A 5E7QA 1IUNA 1TW3A 4MWDA 3V8EA 4OHCA 2QL9A 1QLJA 1X7YB 1PO7A 1YU6A 3TSAA 4D3YA 2XMBA 1NUTA 13PKA 1VSVA 2RBKA 2X8BA 2VZ0A 3JRXA 1XI2A 2HHLA 5EZ5A 1E62A 1B23P 1FFXB 2A5LA 3GCGA 4L16A 5BT9A 4BO0A 1XMOB 1SR8A 4B8ZA 1YVPA 3L2OB 2WVHA 3D2CA 4ZT5A 3ZU3A 3H9CA 1E1RA 4RF4A 3IQDB 3K5IA 4IINA 2J59A 4ACAA 2GA8A 2WT8A 3NTLA 4RD1A 1LF5A 4NICA 4URWR 4ZALA 4OHYA 1JIVA 3KHUA 1NPYA 1R0SA 3LWBA 1QP0A 1D8AA 3B36A 3W06A 4F04A 4QXPA 2B21A 3N7TA 3OPXA 4H7KA 4NJOA 3T5PA 1OH8A 3E3LA 3G9TA 2ZXFA 3M2PA 8LDHA 1E32A 2QLTA 4Y2VA 2CMDA 1ULSA 1DCFA 1QSGA 5L3ZA 1MGPA 2A7XA 4G5RA 1RWWA 5E1DA 4O4LA 4DSOA 2I6SA 1Y1TA 2HL6A 4WXRA 5HFJA 4BJ3A 1BJRE 3LC2O 2GFQA 1N9GA 2Z1MA 1G6KA 1P1FA 3QU5A 4TOIA 3SAJA 3W7AA 4CI9A 4REQA 4ZVLA 5HZMA 3EUAA 3SYRA 1O96A 1QTIA 1NJSA 3REQA 5MFZA 1A1SA 3NYIA 1WM1A 4YLGA 3C2QA 1BSVA 2X1HA 5A4MS 3NYWA 4BWGA 5KYUB 4O08A 1BX1A 1DXOA 2QAIA 2AVNA 3E7PA 4U9HS 5FTMA 4D0GA 5K0JA 1HV8A 5EYPA 3LYLA 2VF8A 3L7AA 3O3MB 1U0FA 4QVKA 5E2AA 2DPYA 4KQFA 3SJBA 4NBVA 1AH2A 3W8NA 5E2IA 5J63A 1FJXA 4LAFA 1XTRA 3GY0A 4Q7LA 4WTOA 4N6GA 4CN8A 5JH7B 1T2UA 1KYQA 3R6TA 1ADGA 4IHJF 5ER9A 3HJCA 4QUAA 2AJTA 4K5QA 2IYAA 2AL7A 2P2CA 4P4SA 2FWJA 1G0NA 4J0GA 2PGNA 3KVRA 1P1CA 2HA2A 1CUFA 3CX7A 3SR0A 4AN1A 2H7VA 3LL4A 1FBTA 4HAWA 4Y2QA 2QR2A 3FZNA 3G82C 3N86A 4WV3A 3U4HA 4F3YA 4GZ6A 1P2VA 1H9CA 2IQIA 2OP0A 3TZCA 2CVHA 3V4OA 1Z18A 3STYA 2TSYB 5HFNA 1BEUB 2QVZX 1V47A 1BIFA 1MB4A 2JBAA 2LXNA 1LV7A 3D3WA 2FWBA 3NEAA 3OJCA 4FUTA 4RO0A 3U26A 1GHTA 2OHFA 3OZXA 3NFYA 3CE9A 1U11A 1BVRA 1UM9A 3TIGA 1N5JA 5ICCA 1TT5B 4UHCA 2X2FA 2BR5A 2GN0A 3PX7A 2DHCA 1PG5A 1T2CA 1XHLA 2H4JA 1DCKA 1D0VA 2CLLB 2HQBA 1SVSA 3HYLA 3EGCA 3PR1A 3WRVA 4F91B 5TVKA 3T3NA 1PQYA 4M6WA 2IHUA 4E32A 1SKUA 3DUFA 2Q5LA 2PX6A 4JHLA 4TQAA 1GA1A 4RPGA 1RYNA 4PRLA 3FKJA 4XKJA 2JIPA 4MUNA 4RZUA 3SHTA 2F8SA 2AXNA 1NMQA 2MT9A 1QWSA 4II7A 5A6VA 2PUVA 1EX7A 2HWWA 4V0NA 3GGPA 1TK3A 4V0KA 4P83A 1XGKA 3E22B 1V2GA 1KJQA 4FYKA 2CXRA 4TL7A 5FOVA 1ZHFA 4PN3A 3GCXA 5T6BA 1KAHA 2IGBA 4WXEA 3UT0A 1F48A 1Q84A 2NZXA 2G5PA 4U2CA 3AY0A 2VJDA 3NYRA 2YYSA 3CXUA 4RV9A 5TJ9A 2QTVA 2XQFA 1FFGA 3KQUA 3I2GA 4GPAA 2JZOA 2GN4A 2EBHX 5DYYA 4G07A 4B17A 4PBRA 2O5RA 1YE3A 2C5BA 2YXLA 3KZOA 1IM8A 5FA5A 3ZK9A 3J80A 1EVJA 1O9BA 5AI0A 1KJNA 4QBTA 3AERB 4JJZA 4DDKA 1IEWA 2OZLA 4HXYA 1UBFA 1G42A 4D9FA 3RCBA 1R8QA 4RKYA 4BX8A 4GRIA 3U1VA 1E5TA 1TUIA 3RPEA 3BIJA 4KGXA 4BNDA 5BRAA 3I52A 4BEWA 4JBXA 3IE2A 2ZM6B 3L0DA 1PDOA 4RKQA 3DFUA 4KKXB 1D4FA 3GQBA 4TYMA 1YGYA 3GBSA 3IUYA 1FDSA 2I7VA 4TWJA 3LNTA 4BGDA 2AG0A 2EIHA 3JATA 1ISIA 4Q48A 1N5KA 2CVQA 1Q1ZA 2XZDA 3LM8A 1B76A 2W70A 2BUAA 4KFUA 1PEYA 1Y3AA 4OX9Y 1K68A 1I7LA 2VLBA 4JKIA 4DSZA 5BV7A 4NARA 4CKBA 3DCYA 2AUNA 5AJUA 3AI7A 4I4TA 1EFAA 2YUIA 4BNVA 2AG5A 5GONA 4B4KA 4OQLA 4IVNA 5CPBA 2RK3A 1MF7A 1AUVA 3QKSB 5KMGB 1KEWA 3NLLA 2NYAA 5ADHA 1NFQA 4X1YA 2ZYAA 4KIJA 1VG9B 1O94C 3GU3A 1VL2A 3NH9A 4WE3A 4IO1A 2XXAB 2QRMA 3N5KA 3RFXA 2IS1A 2C2XA 4OVKA 2PUHA 3DE2X 3V4RA 4IVRA 5CA0F 4DG5A 4QJ5A 2WU1A 4R2HA 1ZEMA 1EB8A 2VP9A 3KR1A 1RJGA 1I3MA 1IULA 2I91A 2XH8A 2E1PA 1T8TA 1EWTA 3C5CA 4D43A 2ZUEA 4R8MA 3QNMA 5A06A 1UDCA 5HQJA 2PM8A 4C43A 1AZTA 2ID8A 4RVUA 3JQ6A 2I8AA 1L7NA 3IALA 3HFJA 1IU9A 3MXOA 3T0IA 1LRLA 2ORED 4XCQA 3BQNB 2YFQA 1M1NA 1JDSA 2WF7A 4BQFA 2QIOA 2C8LA 3EQ7A 3HN2A 4IX1A 4Q1VA 2RJNA 2G9NA 2HH9A 4N1AA 5GINE 2I1VB 1KDZA 3LS2A 3EFEA 4I50A 1BMFD 4ER7A 1BFDA 1G21B 4WK6A 4A8PA 1YS2X 4LSMA 3GMIA 3KSAC 3WJ1A 2HSGA 1SVIA 1G3QA 2P9TA 2VXCA 5TEVA 4YRAA 4ROSA 9LDTA 1FPMA 4YRJA 1WW3A 5C51B 3L01A 4RX1A 2V0NA 1FUIA 4Q7QA 1KP2A 2FPIA 3IKVA 2HWKA 4FEAA 4QARA 4WNAB 3R7BA 1WZCA 2BKLA 4A15A 4NULA 3HP1A 4KQ6A 1XZQA 1ZWLA 1NSYA 2G25A 2P1ZA 5ALIA 1DAMA 1D5CA 1T5LA 3DFFA 5DK4A 5AR1A 3ZWVA 4ZOAA 1Z56C 5KYYA 1IBMB 2ZWMA 3FUUA 5K8TA 1NVBA 4ZJYA 5JTTA 1GCOA 2XLBA 5GP1A 3ICVA 1NT4A 1WUKS 1Z88A 3A10A 3RUPA 3YASA 4OM8A 1X19A 2RGNA 1OWPA 2C5SA 3DXXA 3K2EA 4XQEA 4DRXA 2HK9A 4EHNA 4H3SA 2ADFA 1T15A 4TQ9A 5CB8A 2M6RA 3BSFA 1YFKA 4YQYA 3C6BA 4LRYA 1N2EA 4YECA 4G4GA 2F48A 3ESAA 5J43A 1UJMA 4KWHA 4COKA 3IFSA 5KNBH 1P4RA 1Q1BA 4BP3A 3ZGVA 2GYWA 4YRBA 1MX1A 2Y68A 5TRTA 1AT1A 1DOZA 2H54A 5I7VA 4KREA 2WOOA 4NYJR 2XUIA 4S35A 1RQRA 1NPTO 2QTTA 4JEIA 3O1LA 1MHPA 2BFBB 3ZEAA 1SOWA 1WJGA 2Q3BA 3OMWA 4K6MA 4NDAA 3V97A 5JAMA 1MW9X 2QTMA 4NV3A 1IBLB 4MARA 1E6UA 3AB8A 2IFTA 5BVHA 5JAUA 5EE3A 2LP4Y 2PDAA 4YV1A 1E1QA 4WNCA 3ZG6A 2M1XA 2RBEA 2ZCUA 1KZGB 2QVBA 3IMGA 3QOXA 1KU0A 5DXFA 2P27A 3VTAA 3VH4A 3DZFA 3HQ4O 5CGZA 4DJJA 4HUTA 5HZHA 1PK9A 1KJ8A 3RSOA 5B57C 3O8CA 2AOVA 4RJ2A 2CHGA 1M34E 4LECA 4AXBA 5JD6A 3ADCA 2PT9A 3QVUA 4KAJA 2MSLA 1SCBA 1XAGA 2Z4TA 2A9QA 2RGXA 1FXWF 1NQVA 2PX3A 2XA2A 3WLJA 1NJ2A 1HDEA 1TQDA 4OIMA 3ZS9A 3IEUA 4Y9UA 3NG1A 3RF6A 3UPUA 3AEUA 2QYTA 4G4SO 1NWCA 4I9FA 4BHTA 3HEAA 2P0YA 3NNDA 4BMXA 2HHAA 2PYZA 4MWZA 2OHJA 5DMHA 2FUCA 5C80A 5ALHA 2NAPA 3HNRA 2IPLA 1E9AA 1H6BA 1N2SA 2ZBQA 4KFTA 1QF6A 4F8JA 2MINB 1YHYA 3DBRB 3V1KA 3I2YX 3DC2A 5AKZA 1VM6A 4N7RA 4J6EA 5IN5A 1JHPA 4FR5A 1ZG3A 1IN6A 2V7TA 3FR8A 3N8GA 1T9CA 5C8YB 2QUKA 4KU4A 3T99A 3VR3A 1DRVA 2VTVA 1JQ3A 4D57A 4MQBA 4XM2A 3DHYA 4RV4A 2G1UA 3UFXA 1B3BA 1XK7A 2NZJA 4JOSA 4JP3A 4PPGA 3OIGA 3UJAA 4GR9A 3STUA 1BMDA 1TVEA 5EVCA 3M4JA 3C8DA 4RNCA 3KZVA 4C2AA 5JH7F 4RQUA 2OFPA 3BEDA 3LZDA 4B6RA 4TT3D 1TC1A 1JEYB 3G1WA 2QRHA 2X3YA 4MV1A 3PQEA 2A86A 1NBHA 2R87A 3GBVA 4Y2SA 2IWRA 5J2TB 4M89A 3O1JC 3Q3CA 1DO8A 3RYIB 2GVZC 1AN0A 1U8YA 1N6RA 1BCRA 2Q0QA 3P52A 4MP3A 2FHPA 2CMKA 2IOQA 4JS0A 4UFNA 4M6WB 3T38A 4DABA 4G8BA 3D7RA 1TLLA 1F7UA 2RHRA 4WN3A 3NJ4A 2OCIA 2XD9A 4BFUA 4L4RA 1FUUA 4PG6A 2ZUDA 4PU0A 4YGYA 5DNUA 2F8LA 4BECA 1V41E 1MNAA 3WXMA 4B80A 5JOQA 1EBBA 3HWRA 4GUAA 4RAOA 4V0OA 3T5BA 2CFSA 1B26A 4D82A 3IYLW 1XIVA 4ZJUA 1Y6JA 5HGXA 3GEEA 5JRJA 2IYXA 4XGKA 1NQTA 2D0PB 2PMDA 4AZSA 1RM4A 1XVTA 3KU4A 4U3JB 5ADWA 5LUAA 3PYXA 3OZSA 3DHVA 3Q3IA 5C34B 4FFDA 1GAWA 4OK3A 4V3BA 3VDRA 1CJUC 5J4HA 1ESNA 4DR3B 1VKJA 2B2NA 2WTAA 3PUYA 1SAYA 3TTSA 4DYHA 1GNQA 4PGAA 1YCFA 4YJFA 3A2MA 4I36A 1E0JA 2BDUA 2NOAA 3AKEA 1QVZA 1U7UA 4MVJE 3M3DA 1Q6ZA 4Q6WA 5AI4A 1LNQA 1T13A 4B5KA 4KEAA 1Q20A 3A1CA 5DTRA 4HGRA 2ZYSA 2E4YA 1B1AA 1CLEA 2H1SA 2P9CA 2XNHA 2WKPA 1DXYA 1T0JB 1U2DC 2C2OA 3WSVA 5J1TB 1A2QA 3G5TA 4ZQHA 3LLSA 3ECCA 3K09A 4Q4HB 1QQ5A 5CJJA 5B6IA 2O3QA 4HZUA 3PDJA 1BXKA 2F1RA 2V58A 3EIOA 2P6OA 4KPUA 4J76A 5F2EA 3S2UA 1T9ZA 3BGSA 5CYFA 1SCJA 1B73A 3RROA 3SEZA 2GBLC 2W7TA 3AP1A 3MTGA 3CUUA 1H1TA 2B1RA 3OIVA 2ZSUA 1LY1A 1NE2A 3A7EA 3F96A 3L6OO 1FS6A 4I6EA 3TE6A 3WZMA 1LGYA 2NG1A 3WGLA 1J8MF 3BULA 1NBMA 3HXOA 1FU8A 3PD1A 2POCA 4IKPA 2KX7A 5FBVB 5AP9A 2HR1A 3M6WA 1E2UA 1B0UA 1I6LA 1TCAA 2Z3VA 2UUPA 1IZZA 3HBNA 4KV9A 4WACA 4POAA 4XM0A 2PK3A 5D51S 3VDNB 4ER3A 1ZDMA 3Q7PA 4KDCA 3HUUA 1FRQA 3LDHA 1XMXA 3QKSA 4YRRA 4D9NA 1C7EA 5BWLA 1XZIA 1HEYA 1EIZA 2EQAA 1UMDA 3S8EA 1RAHA 3H17A 3IMCA 2BH2A 2CE7A 3AT1A 1EAYA 4E5UA 1YIAA 1GQ2A 1RHJA 2NO0A 1L7AA 5AKKA 1MB2A 2P30A 1E66A 2YV2A 4KQKA 2CBGA 3FH0A 2JHGA 5B3KA 1G5PA 4LSGA 1T5SA 3ORHA 5TT0A 3LVFO 3VAYA 4CV1A 4RC9A 4FMDB 5FRDA 1F14A 3RWBA 1GUDA 4PYLA 1PR4A 3QYJA 4UHDA 3W8FA 4BQSA 4UTNA 3M1LA 4BV9A 2B69A 3ECSA 1DTWA 2DWUA 1M2KA 1SIUA 4OMDA 1QE0A 4UTZA 1ZRSA 2HJVA 1PZMA 3QHPA 4QQKA 3OZBA 2Q4RA 3QF4A 4J16A 4KBFA 4EW6A 4NKRA 3ZYCA 3MERA 3GJ6A 2HCJB 5ENZA 2XKKA 5IM4A 4FKMA 4RVCA 3W2HA 1P80A 3JZDA 3JVUA 5DIZA 5LOVB 4BNJA 3TGLA 3CTPA 2PUJA 1DSSG 1U0HC 1HDYA 1PR6A 2C8VA 4EHJA 5DRYA 5T4BA 5L3SA 4X54A 3L1JA 1R66A 4RZIA 4EIWA 5JT1A 3B1JA 1KKLA 3DZ8A 3KQWA 2R8BA 4GBED 4GPIB 1KDYA 1T4DA 3S2FA 4A9AA 4F12A 4O29A 4E15A 1I4TD 4FYWA 2F43B 2Q28A 3JQ8A 1W4LA 5AW6A 1R9NA 2PZEA 4OHWA 5EHNA 1TQHA 3REGA 3KXPA 5BXQC 1CUVA 1MEOA 3TS1A 3WA7A 1TGVA 3CF2A 1QHYA 3M5DA 2EWWA 4P7JA 4WZBA 3RG2A 3SBXA 3UW3A 7ABPA 1G19A 4ZT4A 4GICA 3L05A 2Q1YA 4O4LF 3WLNA 1MHTA 2VVTA 1U9JA 1QG0A 3I9V1 4MIYA 4Q1AA 4BKQA 4RWEA 1DMSA 5E6UB 4PLYA 5CT8A 4OSPA 3O74A 3URKA 5DBGA 3EVTA 5DXAA 4YROA 1U1CA 3EIFA 1H2AS 3V2GA 4BVBA 2OOSA 3L84A 1JIJA 4XWOA 2JJ8A 3VHQA 5LVAA 3BHJA 4J7XA 2DLCX 1IBSA 1MZPA 2H59A 2XUFA 4ZCQA 2V7BA 2CNNA 5K3BA 1E2QA 2OG2A 1ZL0A 4B75A 3R4CA 4RA6B 1ZU4A 4Z7JA 5JVDB 2PVSA 3DL2A 3SGLA 4I19A 1JHDA 1V25A 2IEDA 3BIOA 3PT5A 4QGBA 4OSOA 1OX5A 1I2AA 3FSGD 3LT5A 3TOVA 4EJ2A 4PN7A 5DN9A 1F6BA 1ZLYA 2H5JA 5IP5A 4BQIA 4P6VF 2RGAA 4EHBA 2QM7A 1K8QA 1OCEA 1TD9A 1Z25A 3MFQA 4H16A 3JATB 4IGKA 3RC3A 2WINI 1DC7A 1CC1S 1L1QA 4F60A 3MAJA 1ECLA 3KXLA 1H9BA 1QGAA 1N92A 2A9OA 2REXB 3ZOKA 2RHCA 3RLFA 4Y2TA 4F96A 5DYNA 2IL1A 1O4VA 2ORYA 2WHYA 4HP8A 4NQRA 1JI0A 4BBZA 1Y34E 3OBIA 5LB2A 4FKZA 1Z13A 3UA3A 3WVNA 2BW0A 1SKYE 2NTNA 3ZWWA 3QLVA 1ISMA 2ONZA 2RAUA 3QI7A 2FPGA 5DU2A 2MR6A 3OPNA 5AKLA 2PCLA 1UBUS 3NBAA 2FR0A 5THXA 2AC7A 1YI8A 2JLBA 2MSEB 3NT2A 4U2GA 1IN1A 1KOJA 1IDOA 4HDKA 3UKJA 3BAZA 3AVVA 2BGRA 3DKRA 3G5AA 3I9LA 5ALJA 2Z4RA 3WC4A 4CG0A 1CYDA 4MR9B 2RH4A 1XTQA 4ZKEA 1Q3TA 3SC4A 2PGOA 1MG5A 1GCGA 1MO3A 1VJRA 1XA3A 2DFPA 4FMBB 1DC5A 4EQ6B 4OOFA 4US0R 4Z1MD 4J4BA 1V3UA 3Q15C 1G8AA 1SCKA 2WM2A 4WMLA 5I45A 2Q21A 4LE2A 5IEBA 1ECPA 1UDRA 1Q5PA 2VDRB 1WV0A 3DQQA 3OP1A 3W4IA 1QH8A 2C9MA 2F3SA 4Q7EA 1TJ5A 2W2MA 1ZAKA 3B48A 3AUTA 5FTKA 3S27A 4LYAA 1NUPA 2ZJ4A 3GF4A 2GN8A 2FEXA 1QX4A 1MTZA 1DOHA 1ZGGA 2OBNA 3KDSE 1FNCA 4K9PA 3CRNA 4Y9SA 5D7NA 4BMCA 1XLVA 3FYSA 2YIVX 1W8DA 2AFVA 3HACA 5KTTA 5AIBA 4YJ3B 1OXKB 3ZU5A 5BNIA 5AW3A 5LMNB 1ECCA 4HN9A 1E2HA 5DLYA 1OAAA 1E3EA 5AVRA 3B85A 4LRTB 4TV9F 3UWDA 2NP6A 1YXMA 4HCJA 1VLHA 4YJHA 1TUBA 2OFWA 5TLSA 3LECA 2WFZA 5DIFA 1BGVA 4OHRA 4B83A 1GQRA 2AQKA 2X4GA 4DUZB 2XRZA 1PUXA 3GFSA 3OKPA 3PB3A 4JT2A 4LTNA 3AZOA 4ZVRA 1BHSA 4R01A 3SR3A 3JVVA 1LLDA 3PE3A 4C7MA 4DLZA 3L6BA 4CUZA 4Q16A 2HU7A 5HF6A 1GQYA 2P4QA 5K99A 2NIPA 4LDRA 1J1UA 1T3HA 2ZRCA 2I1QA 2R2AA 1IXRC 1P5ZB 1HKUA 1PNQA 4H0FA 3TBKA 3DTNA 1T9KA 3GLKA 1HA3A 2H18A 4URUR 3WQSB 2X0IA 2UVPB 4X95A 3ZQKA 1AKQA 1WXFA 1QOQB 1XRLA 4WDQA 3TJRA 4BP1A 5CB6A 1FFBA 4G0ZA 4EOGA 5J4VA 4ZDWA 1XD2A 2Q9BA 5AD1A 4I5EA 5BN1A 5KTSA 2JIQA 3QBVA 5CYOA 1NPDA 2Q6TA 3MPUA 3N59A 3MK31 4M1TA 5AJYA 3D02A 4L5JA 1N5LA 1T2FA 3L77A 4QJIA 3KAQA 2HBQA 4DYDA 3TLKA 3H4MA 5FXMA 4EVIA 4XCVA 4JZYA 1QKJA 2P3OA 3AF2A 1OAOA 3D7KA 3EXEA 4B6OA 7AT1A 2E4WA 4K3VA 4E07A 2F43A 1UKZA 3EB9A 4LSZA 1I0LA 1K9SA 3BMQB 5ALNA 5B6PA 5FPKA 2O5CA 4E13A 1PS0A 3RS4A 3K0SA 2KLHA 3IV9A 3F1LA 2AJDA 2Q4TA 1BDBA 3LLUA 4H59A 4U0JA 2ZEJA 3V2UA 1W6RA 5JXJA 4OTZA 1L5HB 3UXYA 3E8MA 3PJEA 3CGWA 5C18A 4EDHA 4Q9IA 4JKYA 2PWAA 4HUJA 1GNLA 2AOUA 3FIJA 2ACVA 2OC9A 4ZKDA 4TVSA 4L50A 3GDHA 4QE3A 5COBA 1N5RA 5WRFA 2QEQA 4HMPA 2R8YA 4G6ZA 4WXYB 3ZHBA 2GH1A 2IYQA 3ZXIA 3MQFA 1I51A 4BN5A 1QIDA 2P5TB 1C0IA 1DFHA 2WLSA 5AKHA 3R7WB 1KVRA 3N6XA 4TV9B 2HTFA 4YI5A 1SXPA 3HBAA 2P6PA 3B6IA 3LVQE 1H23A 1JJ7A 1Y1RA 2CZCA 3U7IA 2EZ9A 3Q7TA 1L5MA 3W5BA 1GZVA 1O2DA 5BN5A 4TXHA 3T4UA 1GM5A 1O4WA 1V4BA 5C8YA 4F7DA 1LJUA 1CY7A 3MCUA 4C2BA 3OTIA 3K8ZA 5JNTA 4GXQA 5CDGA 1ND5A 3ZZNA 1FK8A 5BWMA 4L4XA 4DPMA 3R6WA 1E3TA 2BI7A 2ZJ0A 1RJWA 3B1WA 1NVAA 4KUHA 3VOAA 5EZ6B 5HTOA 1W88B 4JBIA 1SUIA 1WHSA 1Q7BA 4ZEOA 3E9EA 3EAFA 3PU6A 4HFRA 1QIKA 2Z2YA 1BRMA 2H4YA 1HQCA 1LLQA 3GDGA 3UANA 3DKKA 1JEYA 1MXFA 1QIEA 5DO9A 3BF7A 1EK0A 5IK2D 5MN5A 3NHYA 4HJRA 3MWJA 4FNAA 2DT8A 5C8ZA 2NYRA 1QPBA 2V7PA 5HQTA 3DMDA 5ILQA 1NQUA 2YS7A 3H5TA 3N0XA 1NLYA 3N2NA 3PFWO 1ZKMA 3M9LA 3EEIA 3EXAA 3K0HA 4O3FA 4Y3UA 3H05A 5ALTA 4DDTA 1EGVB 1XVIA 3WBFA 1C29B 1JQ5A 1OOEA 1WZUA 2C1XA 3A6KA 3B6ZA 2HWXA 3CSSA 2PS9A 4K46A 5D00A 4GZ3A 1VC2A 3WLLA 1ZUNA 3OZEA 5BORA 5HHTA 2IGTA 1FXWA 1H5QA 2DCUA 3ETNA 3BXPA 4GAEA 5H3LA 4BMYA 2DGDA 3DPSA 2ECOA 1T5HX 1E89A 1RWBA 3LH5A 4UM9B 1TM4E 1W5SA 1Y33E 4LOIA 1FFCA 1Y1QA 2QOEA 3BL8A 5K4AA 4V02A 3R7FA 1RWMA 4BNWA 5CXQA 1OU0A 2AF3C 3PGA1 4ZQGA 3NWPA 1XFDA 2ETVA 1FJ2A 5U4XA 4QT4A 2FR8C 3L1KA 5IKEA 2F1OA 2FW6A 3OQIA 1I4OA 4TYPA 2O8VA 3HPQA 1SUSA 2HSWA 2BGKA 1Z6QA 3RD5A 2GCIA 2JAPA 4NZNA 3STHA 1QNLA 3ZWAA 5ALRA 4EY8A 2WZDA 3PC7A 4UMFA 4UMEA 1RXWA 5K2MA 4LJ4A 2HLPA 4G56A 5U1PA 3EHDA 2K5UA 4B45A 4WRRA 2NNWB 4JD5A 5HG0A 2HA4A 1WY5A 2G71A 10MHA 1BROA 1N2GA 1XDSA 4EQ6A 1S1MA 3EXIB 2M9MA 5EEGA 4Y6LA 1TJ4A 4CRWB 2HUPA 3MXTA 2NVWA 2QVYX 4YCCA 2W6ID 1UFVA 4D44A 5A7FA 4EY4A 4OHPA 2MYPA 5BR4A 2HPAA 1JVBA 4AP9A 5EP1A 1QYDA 2IOHA 3QBEA 5B4VA 4BFVA 1H2ZA 1PR5A 4HS9A 4RM2A 4KR3A 4KE6A 4L8YA 1Z0IA 3PUVA 3ET5A 4L75A 4BO8A 1KH3A 3QKRA 1BDIA 3CW2A 1A7UA 2P2GA 3FHLA 2EG9A 1JDZA 3FPLA 2W2QA 1Z4PX 2VXYA 4G0QA 5GIPE 2EW8A 3F67A 3RSZA 2RCNA 3GBPA 1S3FA 4I5IA 2DVMA 1Z37A 3M49A 3IBGA 4OU4A 1MEJA 1W73A 5E9AA 2XV1A 5FYDA 3OECA 3SMVA 1Q1GA 3QUBA 1MAUA 2QRKA 1DKRA 1SO8A 1AMOA 5BQPA 4QFBA 2ST1A 4YAUA 1CUUA 1I80A 2CXHA 4OYLA 4EHAA 5FWAA 3D7NA 5EZSA 1Y8CA 4WY2A 2YYZA 2L42A 3H5AA 1V39A 4MIKA 1ZJJA 1YDFA 2VF5X 4MLDA 1GSAA 3I8OA 4K9SA 4DANA 5C8DA 1DRWA 1FLNA 4KO8A 2JG3A 4RFSB 1GAQA 2BFFB 2OBFA 3T54A 4RZ2A 3V9AA 3ANMA 5CFOA 1TUEA 1TF2A 2XNDA 4GE0A 2QN9A 4TXNA 1P5JA 1AUOA 3AFIA 3CPJB 3JQAD 3FNQA 1QFYA 3IDOA 4GZ5A 4ZOLA 5JATA 3NDRA 3RW9A 5EIFA 1UK7A 2WJPA 1TKCA 4PZZA 4OUKX 4U4AA 3RHZA 3SFTA 3FYHA 3ZE7A 4ENTA 1BWRA 1V4VA 4Q24A 4NZ9A 1SVUA 2C9YA 2PEZA 1MFPA 3FDIA 4GH5A 4Q0MA 1PT5A 2J6IA 2OXFA 3NYQA 4N39A 4PIMA 1C41A 1OBCA 4EA6A 1GUAA 2RFLA 2J0EA 1OY1A 1TTHA 2Y67A 3D3WB 1IBKB 1QV9A 4GOXA 4IIFA 1PWHA 3IOCA 3RU9A 1AD2A 2WT4A 3P0FA 2FLVA 4J2OA 4LZNA 4ZO9A 1IXYA 2AHOA 1ZRMA 2C42A 1DAHA 1RKUA 1VMEA 3RM3A 1D9ZA 2NU6A 4IHQA 4F3KA 4RW0A 3JQ8B 3ANSA 2ZROA 4KQWA 3NHFA 3RS7A 2BZSA 3TEJA 3QXCA 2YV5A 1RSZA 2IW1A 2UZ1A 3DG9A 4WLEA 3VVBA 5CFRA 1KEPA 3RJTA 4Q12A 2PX2A 1WF6A 3V6MA 3WXBA 4WZBB 5H5JA 5DHPA 4LFAB 2Y1KA 3WNDA 2JEOA 4FC7A 1UDAA 2M32A 3G68A 3OPYA 3TKLA 3E22A 3C5WP 4ARIA 5F64A 2XQKA 4CCWA 5IRCD 1OKKD 2NN3C 3DULA 1UPAA 1PVOA 2G83A 3V1UA 3JVDA 1ZIOA 1LA2A 1M7BA 1XXHE 3IO5A 3GLIA 2CHQA 1PFYA 1SVWA 3ISVA 4MGKR 4PZ0A 2JGLA 4YRIA 3SIXA 2VHVA 5C5CA 4NEGA 4JK3A 3GZJA 4ON9A 4RTSA 2G6BA 4TPKA 1NX6A 4D42A 1XP5A 4YN3A 1D0IA 3VC2A 3FNIA 1U04A 1UFOA 2E4VA 3DEYX 2JI6A 4PG8A 5JVDA 4O2BA 2GF9A 1QB8A 5IASA 2Z57A 4JT4A 3WGMA 2K7FA 2DUNA 3CZ5A 1J2RA 3FZYA 3MINB 4EPTA 4YUWA 3ETCA 2G07A 3K09C 2IH4A 4E5VA 4P3NA 1VKOA 3KYDB 3IBCA 4GXRA 3AVOA 2E4AA 1RYHA 4HQRA 5DGCA 1JYFA 4YREA 3UJ3X 2JI7A 1QYWA 2IHBA 1DBPA 1O95C 3DTTA 3TVDA 5IN4A 3FROA 3ABIA 2K87A 4I8DA 1QE3A 4LZAA 2Q2WA 3WIOA 4JXJA 4Z53A 4HNAB 1CRWG 2WWGA 3C43A 2H85A 3WMXA 5TQ2A 5L3QA 1UBJS 4L9WA 1RRPA 5JEDA 4LDPA 3AB7A 1X2EA 4US1R 3BD6A 3DJFA 1YE8A 2V54A 2W2PA 3EUEA 6REQB 3ZQ6A 4BLWA 1MD9A 1LPOA 1NFRA 3LFUA 4K6FA 3FOAA 3Q5DA 5C1BA 4BVGA 5JSHA 4QECA 3S81A 4HAYA 2VJKA 3KLOA 2E82A 2Z6VA 4KL8S 4YLYA 5CAEB 5CLQA 5KVVA 5IS2A 1XRQA 2XXAA 4OAQA 1L5OA 4CF3A 5SYNA 3RUEA 3O8QA 3QSGA 5GQSA 4IIDA 5IF9A 1RQXA 2QN2A 3BE4A 4PNEA 4RIFA 5IMSA 5IXYA 2YHAA 1ETUA 4H9GA 3JRNA 3LFTA 4P33A 3IV6A 3SEAA 3ROMA 1B6RA 1T9GS 3M6XA 3P4YA 1NNI1 4RK7A 5TVGA 1VMIA 3KO8A 4GLBA 4X1KB 1NGSA 3C15C 2RK4A 2EQBA 3NV7A 4FT2A 2GPNA 5EWMB 2FHSA 4MICA 4QU9A 4N49A 1H8ED 1XD8A 4ZDKA 2JANA 3EF0A 1C2TA 3FHJA 3H5VA 4UE3S 2ZB3A 2DFDA 3NTUA 2DR0A 2IPOA 3UEOA 3FCUB 2B3DA 1CY2A 2ZBPA 2WQ7A 5H4HA 5JMPA 1P72A 2X76A 1SRQA 1VG0B 1R0XA 3CEHA 4NCJA 2C0CA 1E3LA 1UQTA 3CKYA 1B6TA 3G2NA 2PTGA 3FDJA 3FMPB 5BWBA 4ETNA 3FTDA 3JWEA 4DS3A 4IL5A 1C0PA 1QC5B 2G7ZA 4HGPA 4NYMR 1YB2A 2VP2A 5K3DA 1CF2O 4KVFA 1VQ1A 4L22A 3SIRA 1YS9A 4KKVA 1Y9EA 2OV1A 2P79A 3S6JA 5IU6A 4IDHA 1PN3A 3I5AA 1I2DA 1TZCA 5DN6D 3CLUD 4MCAA 1GTRA 2EFYA 1FW6A 1JFFA 9MHTA 1RWPA 1YQUA 3ILXA 3PUIA 5EHGA 3T35A 3PEYA 3B9BA 4I46A 5HBRA 4BB5A 3O38A 5EJ7A 2O54A 4DBLC 3OCXA 3QVSA 2OUIA 3SNKA 1ZOLA 5IAKA 3VA7A 1Q7RA 4ZTUB 3WGIA 1E0KA 2NUTA 4J4TA 1WO8A 3RNOA 1RWKA 5DCLA 5ETJA 2BMEA 4P0TA 5FULA 1HZZA 2QAJA 1J0DA 1QFMA 5E6SA 4KX3A 4IV8A 4IZHA 4PCLA 1HT3A 2HV9A 5DOZA 4DNXA 4BUCA 3KSRA 1G5IA 3CISA 3M4NA 4CM5A 1SXJD 4OQQA 3ZI7A 4BLOA 3NHWA 4L5CA 3GJXC 1IJBA 1T2NA 3SX2A 3PIRA 3U7QA 1H5UA 3OX4A 4RFLA 3TLBA 4ND7A 2FWRA 1K7FB 1DO2A 1MB0A 3GZ4A 1TYAE 1U2GC 1DINA 4IYRA 4L4YA 4KXWA 5DISB 2XVAA 3J81k 2JHAA 3RUCA 2OBBA 4NBNA 1HQKA 1J56A 1C8LA 3OU2A 3PQDA 3KZNA 1RPAA 1R10A 1TYZA 1JBKA 4RZHA 4CKCB 3UUWA 2XB2A 1NLFA 2FVXA 3H2KA 3K32A 3W3AA 1GZ6A 2ECQA 1NHGA 2CE2X 2WWIA 3GFPA 3IUMA 1KZ7B 5FL7A 3RC2A 3GB9A 3AC0A 3K0EA 3R23A 4ILEA 3FPJA 2W42A 1PL8A 1XNQB 4EUHA 1NIJA 3VKFA 1W0JD 3MMZA 1JQEA 2YIMA 3QJ5A 1G0OA 4C6TB 1NN3A 3VU1A 3CMMA 5L53A 1RAAA 3MTQA 3EBOA 3ZGYA 2NTEA 2EYUA 1XZJA 2PS1A 3FTFA 3UTDA 5LB4A 2YWGA 4CDRA 1R64A 4CI0B 2VF4X 3U49A 3ZKWB 4EEXA 3LQFA 1R37A 4UXIA 1R00A 3LIIA 3FD8A 4LC1A 1XXHB 1YS7A 3I34X 3WLRA 1GL3A 4X3CA 2MU1A 3L6DA 4I08A 2PUGA 1P0QA 1VJ0A 3G5LA 5A3VA 1U0BB 2OO5C 1IDN1 1YCGA 1K8RA 1QV6A 3NWOA 1B8PA 1QFJA 3M1AA 4LBYA 3EQ9A 2PU5A 1NVUQ 3OFND 5I7HA 2AQHA 2Q2NA 4LMRA 3O2SB 3R1IA 4BNYA 3WS7A 4TYNA 2Q5HA 1CJVC 4CF7A 2YVUA 4J8PA 8OHMA 1UMKA 4CF5A 3OCWA 3GGCA 4XB2A 3QMVA 1QO7A 1Y7LA 4EJSB 1Q3KA 1XQ1A 1QMPA 3KEGA 1J8YF 3DDWA 1UWVA 5LOVA 1G7SA 3OKCA 2CL7X 1TYCA 1UM8A 5CJ2A 3LUBA 3TL2A 1A8SA 5LU8A 1U0LA 621PA 4RD4A 1QVVA 4CMBA 5LYJF 4WZAE 2PL1A 4PC6A 2WKRA 1WB9A 3D8UA 3TEMA 5BYKA 3BB4A 4J3JA 3Q3JB 2BLLA 4WGFA 4P32A 5LZ7A 1OLOA 1OWNA 4LFCB 4EPVA 1OB5A 4URZR 3R7NA 4QYTA 1STOA 3F7MA 1YB1A 4ZPJA 5JAPA 1UBTS 1E5XA 3T0FA 1EVZA 1W4ZA 1NNLA 4UNPA 3HV0A 4EMUA 2K4MA 2PRSA 4G1CA 5KO2A 1ZINA 4HEA1 4M1EA 2V9PA 3F3YA 4N8DA 3HK2A 1Y7IA 4IP0A 5AW8A 4DILA 1EE1A 1UBCA 4AJJA 5FFFA 4B31A 2JEYA 2Y6VA 3KUCA 1RHMA 1C50A 2IYFA 1PK8A 4X1IA 3VR6H 3EMVA 3H5WA 2AMFA 2PBFA 3G8CA 4QYIA 4WNIA 4XIGS 3MB8A 4UDYX 4DJTA 4EG8A 4EYSA 3DE0X 2VYFA 3O2NA 3PNOA 3L1IA 5JS8A 3AHGA 5KTOA 4CU2A 3WYGA 2QG9A 1GU7A 1FTQA 1II9A 3HO8A 3JW8A 1M2FA 1I3LA 3KEFA 1WMDA 4Y1RA 3VR0A 3WAJA 1QTQA 2WAXA 1GTZA 3G0DA 3INGA 4P7GA 3JYOA 3HBLA 4ECAA 1N2CA 2XMSA 3JTMA 4LCEA 2DLDA 4KNVA 1YI0A 5FNVA 4OI0A 1CKEA 1P9NA 3IMFA 3SC2A 2DKNA 1NKTA 3IAS6 3K1AA 2NQ8A 4H3VA 2DUUA 4I6JA 4N0MA 4QXQA 4ZAGA 4H77A 2R62A 2PY6A 1I3NA 4FGWA 4R1QA 1M34A 2IP2A 4M3NA 4WOJA 3BJIC 1F2TA 2D1FA 5AMXA 2D2EA 4DL9A 5C8YF 5FD8A 2VT6A 2WD8A 4M0DA 2WW8A 5EIXA 4DCTA 1YQEA 5T6MA 4B7ZA 3TFOA 4JLNA 3MS7A 2DHRA 4PRZA 5FTNA 5IM5A 5C32A 5LZ4A 4EMSA 4DCVA 1THZA 3OCJA 421PA 3UUEA 3AEZA 2HA5A 3REFA 4AKGA 4L08A 2AOWA 2EAUA 3C3PA 4F1JA 5K9ZA 4RIHA 4KR2A 5GONF 1N6HA 4O3MA 1W9HA 2QPOA 2UAGA 3I01A 4OGGA 3I9KA 2IY7A 4O8ZA 5EE5B 3CZQA 1O6FA 3KT8A 4PLGA 4BP9A 1FIUA 1H4TA 2A2ZA 1LUAA 2FW8A 3FSEA 2BWJA 2I54A 2KBEA 1QCZA 2E6UX 3QWHA 4XEHA 3UWSA 1NBIA 1X7WA 3DL0A 1VHJA 3W8RA 5JBQA 5KJ6A 1OPRA 1NYRA 3ZD8A 1CUHA 4FBLA 4URHA 2YH2A 2C4HA 2A7QA 4N40A 2CSXA 1WUJS 1AB6A 1XLWA 1WPRA 2GSDA 3KTOA 1WCV1 3RHSA 3DKIA 3TLGB 2ODPA 2EBFX 4WY8A 5BSMA 3L04A 2AFRA 4ZCTA 3N1UA 3OT4A 1HQDA 1HK7A 1RJ9A 1OJ7A 2X5KO 4C30A 1XQWA 4YBRA 4B35A 3MGKA 5E6SB 5NLLA 1SUAA 3T3EA 4COOA 4FE3A 5I7SA 2JJ2A 2PUAA 5JMOA 3HCPA 4ZVUA 3OPMA 5K7SA 2WVAA 1U4NA 5EJEA 1KI7A 3CA8A 3HZZA 3WBBA 4GC5A 3VNAA 2LR0A 5AHXA 4EY3A 2V97A 3PNYA 3RBZA 4NFYA 3EDMA 3RS8A 1UQRA 4UBIA 4IH1A 2H2HA 4UUBA 4RUKA 3N3BC 3SS7X 3WB1A 3X3HA 4Z0TA 4JXZA 4BNLA 1GAXA 4KJXA 1BXRA 1ZMTA 1HRKA 1LPMA 3B6KA 4DA0A 1WHTA 2H2DA 2J9XB 1MRSA 4PWZA 3E1KA 4LUCA 4BJ5A 1OLSA 4QGFA 4E5MA 5LQUA 4KHPB 4EYGA