4P7KA

Rat comt in complex with sinefungin
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
219
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping the conformational space accessible to catechol-O-methyltransferase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
total genus 74
structure length 219
sequence length 219
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4p7kA00
3ID6C 1P1CA 3NDJA 2PY6A 3B3FA 5FADA 4UOEA 3O31A 1WZNA 5CIYA 1SUSA 2PVCA 2C7OA 3SSOA 1RJEA 4RTNA 1ZKDA 2EFJA 2PSSA 4RVFA 5IKMA 7MHTA 4MHTA 3PFHA 1X1AA 4RVGA 5MHTA 2YQZA 2GLUA 4LECA 2B78A 5CVEA 5EMLA 2IH5A 3NWBA 1MHTA 5K03A 3EGIA 3Q7EA 2ZZNA 1O9HA 1RI3A 5K0FA 4HSGA 4RTSA 5CVDA 4QDKA 4P7FA 3HNRA 1F38A 4CKCA 5K0GA 3CCFA 4C07A 1P1BA 3H2BA 4HG2A 3QOWA 3KR2A 5BW5A 1I1NA 5DM1A 5T6BA 3UFBA 2C7PA 2BH2A 2Y1XA 4GF5A 1XTPA 1X19A 3FZGA 5DLYA 1NW7A 3KHKA 4R05A 3X0DA 4AZSA 2PT6A 3FPEA 3HCAA 1NW5A 3I9FA 2ZCJA 2JH9A 1VLMA 3DLIA 1JQDA 1R00A 2HTEA 3DXZA 1T43A 3GRYA 2NXJA 4GQBA 5HILA 3A25A 4QVKA 3VC1A 3AWIA 4P7GA 1Q0SA 5DM2A 2NNWB 4OX9Y 4FT2A 5M5BA 4YV0A 3P2EA 2ZZKA 5EG5A 1JTFA 4GUAA 4PWYA 5G02A 2P3LA 3T7TA 4V0RA 2P1DA 2G1PA 3FUXA 1XCJA 1EAMA 2QM3A 4KIGA 4XUEA 2G72A 2XVMA 5DX0A 5EC8A 2FK8A 3HM2A 3UA4A 4BLVA 4CTKA 3LDFA 3AJDA 3V8VA 4IKPA 3T0IA 5CCBA 3R9XB 1TW3A 1SQGA 4OBWA 1ZGJA 2ONZA 1EQAA 2O07A 4HTFA 2AVNA 2BR4A 3GDHA 3M6WA 4HGZA 5EMKA 5KVAA 4RTOA 5EGSA 2BZGA 2ZULA 3P8ZA 3GRUA 3P71T 2A14A 3P9IA 2ORED 3KPVA 3LKZA 1YZHA 3QV2A 2PBFA 3G7UA 4QTUB 4RWZA 4ZTBA 4E70A 2PXCA 4Z2YA 4ER0A 3GXOA 2IBSA 4RTRA 1XCLA 4E2YA 1L9KA 3ELDA 2IIPA 3B7PA 3EMBA 1JG3A 1V39A 3SGLA 3UJBA 5D1HA 5EKXA 4HH4A 5KYGA 2IP2A 3EVBA 5LQCA 3TM4A 2JH8A 3GGDA 3QOXA 2EX4A 3FUTA 1HNNA 3G8AA 5E8RA 1TW2A 2FCAA 3HA3A 3MTIA 3MTEA 5LQRA 5FA5A 3LBYA 4ISCA 2GPYA 2OPBA 3KQTA 3I53A 3NVMB 3TLJA 3HEMA 4C06A 5CCXA 2C7QA 2NP6A 3PT9A 4PYQA 3THRA 3C0KA 4DF3A 1RI4A 1R18A 1KHHA 3E7PA 4PNEA 2HMYB 3KKZA 5EHIA 4OQEA 2ZIGA 4EKIA 3KR1A 4X41A 5EKUA 3M6VA 2GAFA 3OE4A 1WY7A 3T7RA 1WXWA 2OO3A 2FPOA 2VDWA 2YXEA 2GB4A 3MERA 2OYRA 4DZRA 2AZTA 3DOUA 3DUWA 2P41A 4U7PB 1YUBA 3SXJA 3ELWA 3MAGA 3FPGA 2HNKA 4MWZA 3REOA 4KDRA 4KRGA 3GIWA 1XJ5A 4XUDA 2ZLBA 2FK7A 1G60A 5K05A 5LQNA 1YF3A 1XDSA 2YVLA 1L3CA 3G5LA 1RJDA 1NE2A 2JJQA 5LQUA 2BR5A 5K0LA 2AOTB 4CKEA 3A4TA 4PYJA 3HVKA 1BKYA 3FTDA 4CTJA 2YUIA 3JWIA 4FZVA 5EVJA 1Z3CA 3P9KA 2AN4A 5E2BA 2P35A 3P2IA 4PYNA 4GOOD 1WXXA 5DM0A 5HIMA 1JG2A 3MHTA 2N47A 1JQ3A 5KS2A 3R0QA 5FWDA 4QTTB 3OPNA 1ZGAA 1WS6A 4CKBA 1RJFA 1O54A 3CC8A 2NXNA 5K09A 3VC2A 3T7SA 3GCZA 3OFJA 3HVJA 2NYUA 2PWPA 5E1MA 3AXSA 1G55A 1NBIA 5EIWA 3G88A 1VE3A 4ER3A 3GRVA 3BXOA 1DCTA 1KPGA 2AR0A 2IDKA 3ME5A 3ORHA 5EZSA 3UJCA 2Q41A 2CL5A 3GWZA 1VBFA 3LBFA 2GS9A 5JR3A 3EVGA 3SSNA 1EG2A 2UYCA 3DP7A 1AV6A 3Q87B 4RTMA 2QE6A 3FPFA 5HEKA 2ZWAA 1INLA 2O05A 3RODA 3FRIA 3GNLA 3A7DA 1UIRA 2Z6QA 4RTQA 1NW3A 1SQFA 3NW9A 4E2ZA 3JWHA 4PCLA 2CMHA 4PIMA 1JG4A 1YZ3A 2NP7A 8MHTA 4PYMA 2AN5A 3AXTA 3EVZA 2PKWA 4Y30A 4IV8A 2B3TA 3TOSA 1H1DA 2YR0A 3DMGA 2OB2A 3L8DA 4PIPA 4U7TB 1P39A 4XUCA 5K0BA 2OBFA 3O7WA 3SSMA 4X63A 2WA1A 3HCEA 5E2AA 1KR5A 3HTXA 1NW6A 5CM2Z 1KPHA 2O06A 3UJAA 5C9ZA 2I62A 2I7CA 3IV6A 2JHCA 2B9EA 3DXYA 3EEYA 3MQ2A 2GH1A 3I64A 5DX1A 3ER9A 1M6EX 1YFJA 2PLWA 2I9KA 5DTRA 4X60A 5E1DA 2OXTA 3NDIA 3A27A 3HCBA 4ATNA 5EEGA 5FQOA 5CVUA 5EIFA 4RYLA 2PX8A 1M0EA 1KYZA 3GJYA 4AZWA 1N7JA 5U4XA 3PS9A 3HA7A 5CVJA 3VYWA 3U81A 3EPPA 3MB5A 2JG3A 3C3YA 5CVVA 3UJ9A 4GC5A 5E8JA 4PGGA 2IFTA 2EJUA 5KQRA 3FYCA 2HR1A 3KQSA 4PGHA 3LDGA 1UWVA 2ZBPA 2ZIEA 5F2KA 3TQSA 4EQZA 2AOUA 3GU3A 3HVHA 5ICEA 3HA5A 2B2CA 2P3OA 3BZBA 3IHTA 5BXYA 5LQAA 4DMGA 4PCAA 3S68A 2ZW9A 5JUWA 4E2XA 4HRAA 5ICFA 2IH2A 2LD4A 1QANA 3CJRA 3PX2A 2P3QA 1FBNA 3KQVA 3IYLW 3MCTA 1D2CA 1PJZA 2YXDA 3OZRA 3TMAA 3SM3A 2WA2A 5DWQA 4BP3A 4YV2A 4V0QA 4O29A 5E9WA 5KQSA 4C05A 4E33A 1G6Q1 2FYTA 3TPZA 2YX1A 2PJDA 3BGIA 3PVCA 4DM3A 1SKMA 3WSTA 2AOXA 2Y1WA 3ELYA 5FCDA 1XXLA 2V7EA 2EJTA 5E9QA 3LCCA 2R6ZA 4FS8A 5EZQA 3GRZA 2UZ4A 1D2HA 2ZBQA 5GIOE 1KXZA 1ORIA 4PYKA 1FJXA 3ERCA 4H0NA 4P58A 1BOOA 4RV9A 4C08A 4NECA 2K4MA 5DX8A 5B1SA 1IY9A 1Q0TA 4FR0A 3PTAA 4MQ4A 3RIEA 2ZBRA 4YMGA 5EEHA 2FRXA 2XBMA 1FP1D 1DUSA 4G56A 5FULA 3CJQA 4PYIA 3O4FA 3EGVA 1R6AA 1QAOA 4FSXA 5HIIA 4YV1A 2OKCA 2G71A 1JQEA 2AN3A 1DL5A 2PXAA 2O57A 5EMJA 1KP9A 4M37A 2OY0A 1NKVA 5LQJA 5EMMA 1JSZA 4QPNA 3FTFA 2ZFUA 1AQJA 1I9GA 3KR0A 3SR4A 5DXAA 2NXEA 4GOLD 1P91A 3G8BA 1L3BA 4M38A 3D2LA 4E2WA 2R3SA 1VP3A 2CKDA 3ELUA 4MIKA 1ZHFA 1OR8A 3M6UA 5DPMA 2VP3A 3FTEA 3KPUA 1NBHA 2G70A 4WVLA 3UJ6A 1YB2A 4HTFB 4RTPA 3RW9A 1BHJA 2QY6A 4C04A 3OFKA 1B42A 4C03A 4QVGA 4HGYA 4PINA 5CUQA 4BP1A 2JHAA 1RI1A 3UZUA 2AOWA 3EVEA 4FGZA 1N7IA 1BC5A 1SVUA 2FHPA 3BWBA 3DMHA 5EOVA 3UWPA 4E32A 1VQ1A 1PRYA 2O0LA 4X61A 3TRKA 4GBED 4AZVA 5FQNA 3KQMA 5F2NA 5DM4A 3EVCA 1VP9A 3BGVA 3FYDA 3CKKA 5EHGA 2Z6AA 1EIZA 3LSTA 5EQJB 1L3IA 2I6GA 4P7JA 4ER5A 4PYOA 5EPEA 3LDUA 4QQNA 1X1DA 2AS0A 1XDUA 3CJTA 4R6WA 4DCMA 2ZWVA 1RI2A 2HWKA 3LECA 5H02A 2IPXA 3G2OA 3DH0A 3EVDA 2B25A 3OU2A 5HZMA 4K6MA 4B17A 4CXMA 2IGTA 3G2PA 3OE5A 4RSRA 5GINE 4F86A 4M36A 2IH4A 2H11A 4DCGA 3M33A 3C6MA 3PFGA 5HFJA 3C3PA 3LX6A 2ZVJA 4R8RA 5DTMA 3DLCA 3UJ7A 2ZTHA 5K0EA 3THSA 2H00A 3A26A 1JR4A 3KPWA 4JXJA 3FTCA 4KW7A 5K01A 4YUVA 3UBTA 2AOTA 5HOQA 2OZVA 3MCZA 3HVIA 2C7RA 1FP2A 3IEIA 4FSDA 1EJ0A 4IWNA 4X1OA 4QPPA 5DXJA 1NW8A 1QZZA 5CD1A 1FPQA 1ZG3A 3M70A 4GEKA 2NXCA 1UFKA 4MTLA 4XCXA 1XDZA 2UYQA 3F4KA 3LKDA 1JTEA 1EJ6A 2WK1A 3DMFA 5E9JA 1F3LA 4PYLA 2YTZA 4RTJA 2PXXA 3FUUA 5DT2A 5LSAA 3B5IA 1KIAA 1M6YA 2ONYA 2VDVE 3AY0A 1QAMA 4PONA 3BKWA 1TPYA 3FPJA 5DRTA 3PLAE 3NTVA 3B3GA 3P9NA 3OU7A 3CVOA 4RX1A 4P7KA 2XYVA 3E8SA 3E05A 3VSEA 3DTNA 3EGEA 3I58A 4EMSA 3OZSA 4WXHA 5FHRA 4RTKA 4L7VA 3LHDA 2P7HA 5P8WA 4ER6A 4QQKA 3SX0A 4F85A 3M6XA 5FHQA 5K0NA 1RI5A 1IM8A 2UYOA 4LWOA 4OA8A 2P40A 4Y2HA 4YUZA 4DQ0A 3BWMA 2BM8A 3KQYA 2E5WA 3R6TA 3B3JA 4EK9A 5K0CA 1X1BA 3LCVB 4GOMD 3P97A 4E31A 2QRVA 3HCFA 3OZTA 2H1RA 5GM2A 3TM5A 3G2QA 3PB3A 2BM9A 3LGAA 3R3HA 5HIJA 3LCUA 1NV8A 3KQOA 5DTQA 3BT7A 4RTLA 2PX2A 2PX4A 4A6EA 3DULA 2PV0A 3JWJA 2EG5A 3P9CA 5K8VA 4CWAA 1O9GA 10MHA 2F8LA 3I5UA 5FA8A 1QAQA 4RVHA 4DKJA 3NVKI 3KU1A 3TKYA 2XYRA 3KR9A 4KDCA 2AOUB 4ER7A 3B89A 3P2KA 1X1CA 5HIKA 9MHTA 3UA3A 4R6XA 3HCCA 4AZTA 4DA4A 1VL5A 4RVDA 3K6RA 4YMHA 1WG8A 1VPTA 3BWCA 3TFWA 3K0BA 4YUWA 3FUWA 1VIDA 2QRVB 1N2XA 5FWAA 2P8JA 4EVIA 2CMGA 3BGDA 2VZ9A 1JSXA 2XYQA 3NJRA 5ERGB 4POOA 1IXKA 1R74A 1RJGA 3FPHA 3GRRA 2ERCA 5GOZA 2OB1A 1KYWA 3CGGA 5ICGA 3LL7A 5E1OA 4BY9E 4YUXA 2G8NA 2GA9A 4KIFA 1JG1A 5C1IA 5ICCA 1I4WA 2CWWA 1ORHA 1U2ZA 4FT4A 3ER8A 3G5TA 1QYRA 4KVZA 2AOVA 3OCJA 3M4XA 4LG1A 2IDJA 1NT2A 1G8AA 4M7RA 3NWEA 3G89A 2ADMA 1AF7A 2DPMA 1XVAA 5K0JA 3EVAA 1KPIA 3KPYA 5LR6A 2ZSUA 3HP7A 3TKAA 4C4AA 3E23A 5GP1A 4BLUA 3NMUF 4OQDA 3KQPA 1G8SA 3UJ8A 2ZIFA 2JHPA 5FUBA 1R8XA 1SUIA 1HMYA 3EVFA 4IV0A 3LPMA 5DSXA 3FRHA 4GOND 2Z6UA 3KPJA 4OBXA 3A7EA 4R8SA 1MJFA 3JWGA 4A6DA 4BLWA 4E30A 3PX3A 2V74B 4LWPA 5BW4A 4AUKA 2AVDA 3FUVA 1D2GA 1Y8CA 2VDUE 3KQQA 4HC4A 5DSTA 3TR6A 3UJDA 3SMQA 1SG9A 4FP9A 2ESRA 5T64A 5BP7A 5GWXA 1L1EA 2KW5A 3EMDA 3EEOA 1NV9A 4YUYA 2XVAA 3BUSA 3DR5A 3DXXA 4GC9A 5T67A 5IH3A 2UYHA 3C6KA 5GM1A 2YXLA 3OU6A 4OA5A 2VS1A 2HV9A 5E1BA 5FTWA 2PX5A 3R24A 3BKXA 1R8YA 3G2MA 5D1NA 3SVZA 5LQKA 3GO4A 2DULA 2PGXA 3KQWA 5C0OE 4EKGA 2ZZMA 4QDJA 4F84A 1ZQ9A 2PT9A 2P7IA 3CBGA 1AQIA 3V97A 3MGGA 2BR3A 4AX8A 2IBTA 1YFLA 2PWYA 3BWYA 5GIPE 1G38A 2QYOA 3HCDA 5DRYA 3ANXA 5F2OA 4KWCA
chains in the Genus database with same CATH superfamily
1P5ZB 2C5SA 3WL8A 3E9DA 3NDJA 4A0QA 4QBHA 3PQ4A 3VVCA 1G5HA 1MXHA 1RJEA 1SOMA 3GZ4A 4QWMA 1C29B 3W5AA 1W8IA 2LGJA 4DG9A 5JS8A 5L3VA 5AWFC 1Z7BA 1IVYA 1BXGB 2C97A 3O74A 3C5VA 3W5IA 3PFHA 3OM9A 2PT5A 1T1EA 2ZR7A 3R5KA 5HDBB 2VO1A 1H22A 2HN9A 3DUFA 1TAQA 1X9HA 1SU6A 3A9CA 4RTSA 2Y68A 3USCS 3A6DA 3MUEA 4KL8S 1DOHA 2WEKA 4KXXA 3SYLA 3SEQA 3FFBA 3LXXA 2C3UA 2MU1A 1JQLB 4OG2A 2J5RA 2D2XA 4LDJA 4ETNA 4ADSG 2AYYA 3NR2A 5HZGA 4X6LA 1UKAA 1EUDA 2BELA 2WD8A 3R6DA 3WRVA 5ITZA 1MTZA 2NAFA 3LC2O 1J42A 5LOVA 1KEZA 4R2XA 3GVCA 1RQRA 5FLXA 2EC5A 3QHPA 4F5EA 2V7TA 3K4PA 1BXGA 5EP1A 1LS6A 1I3CA 2C94A 1EK5A 4R2WA 3UKJA 3AWIA 4NYIR 2X22A 5C53B 2C03A 3C8DA 1V11B 1U28C 4XB2A 3SZGA 3C2QA 2DF8A 1CS0B 3FPBA 1NFFA 5IBQA 1JTFA 4UD6A 4Y18A 2B2XA 2UZIR 2GKOA 3BB3A 3K0KA 4F45A 8OHMA 3W06A 5CLFA 4H59A 1XCJA 5D01A 4M46A 2A6PA 4XUEA 5E7JA 5HJ2A 3U3DA 4E3ZA 1IHOA 3UA4A 3V8QA 3OQ6A 3OHSX 1V6CA 4E46A 2R8XA 4RA6A 4QNMA 4U2GA 4BFSA 3C14C 5KHAA 3FYUB 2Z2KA 3PWKA 3GB9A 4HTFA 1P0FA 4TL9A 4BNNA 5AM1A 3GLHA 4MKFA 1U9YA 3HYSA 1X15A 1FSGA 4TL7A 3R3YA 3NT2A 1YZHA 2H2DA 3DBRB 2W9XA 1RWOA 1IAVA 5E3JA 2QUJA 4NX2A 3TQIA 1FVOA 3WGMA 2BFNA 4A91A 3B7PA 3GYBA 2R1VA 1NX6A 4DRXB 1JHXA 4F8JA 2VDOB 3OMXA 4LNHA 2W4IA 3D6FA 3H0CA 5CG1A 1GP2A 3EVBA 4ALMA 4CM1A 1OHHD 3LXMA 3VR2D 3P94A 4QU8A 3CKMA 3EIHA 3JZFA 5AM5A 1P2FA 4P2GA 4ZV9A 1IU9A 3NVMB 4C06A 3ENKA 1RCTE 2F9LA 3MJHA 5TT0A 5JOQA 2DFKB 3IMCA 4IICA 4DF3A 2GCOA 1OWMA 3V8EA 4AUEA 3ENQA 1DZIA 3E7PA 4LHXA 3CVUA 1PWZA 1VYVA 2H4YA 1TVEA 2ECFA 2FPWA 2ZIGA 3KKKA 1Z12A 3QE3A 1USIA 4BMOB 1ZSNA 3UCXA 1YTUA 4PSDA 4RGBA 2GAFA 1C81A 3MBIA 1XMXA 4HDQB 4CU2A 3P19A 4Q48A 1OI3A 2X14A 3ET5A 2EFHB 1HA3A 3TW0A 2PKQP 1HDGO 3BDVA 3MTAA 1FA9A 3RS0A 1S9HA 4CR6A 4UM9B 2GB4A 3KL2A 2DUWA 3ZVNA 1F9EA 3LUPA 4HADA 4CEHB 1ZN2A 2QLTA 2CXTA 2PVSA 2O8CB 1YFKA 3AF3A 3I05A 4WCFC 1M73E 1NNI1 2ZSAA 3V2IA 3ZGXA 1Q1EA 1P4AA 2GVDC 4RFSB 3JVUA 2W8ZA 2EF1A 4KDRA 1PTJC 4E5UA 1G60A 4TTSA 5H68A 2FVXA 5AK6A 1I1HA 1E77A 2R4UA 3T3DA 1XZCA 1FLNA 2H54A 3E3OA 5L3QB 3IKLA 5THXA 2ZBGA 5TQJA 4BX8A 2YINC 4B79A 1MF7A 2W11A 4MOWA 3ZI4A 3DEKA 3ROGA 2HEIA 2YOGA 2GERA 3IOMA 1QH1B 4UTOA 1ZH0A 1BDIA 1RXIA 3A04A 5H9VA 2JDIA 3P2IA 2CV2A 2LUOA 1ZRHA 5DM0A 1M2OA 1M5RA 4CZ2A 1GV1A 1MO5A 5B55A 4AJ4A 3RTDA 1CY4A 4GMKA 1WZEA 4UE2A 3TYXA 3VPSA 1HWYA 3OUZA 1UZNA 2P2CA 3TPCA 5IHXA 4IHAA 2BKAA 4F9TA 3GVXA 4W8OA 1T0PA 1ZOOA 3FVVA 4MS4B 3F7NA 3V1UA 1W36D 4XGRA 3A2KA 2QMHA 1JA0A 4JI8B 3CRNA 2JGDB 2YV1A 5HUJA 1X86B 1E1CA 2WG0A 4F4FA 3GC6A 3MTDA 4RJ2A 3CWZA 1TO2E 4DSNA 4TV9A 4WFKA 5I4CA 1Z33A 1TJ4A 2WV7A 4J90A 2WHEA 2J6IA 5DMXA 5FNVF 3MWEA 1KZ1A 2O8NA 2WD9A 3DP7A 2BFDB 1FTYA 4AS2A 3B2QA 3LZ6A 4N0EA 4CMBA 5HEKA 3CEJA 1PE0A 2IXGA 3LDHA 4C0QC 3WGJA 1G3MA 4H31A 1ABEA 3ZU2A 3T3PB 1SQFA 5B30A 3GUCA 2JFZA 2J5BA 3PICA 2AN5A 1PR1A 2QA5A 3E1GA 4LGMA 3LC0A 4MS4A 4IG9A 2JAQA 5IZCC 1XEXA 1GTSA 1AH2A 4AKIA 4U7TB 1HE2A 4F3NA 4F0JA 2JGDA 4EG1A 3H1BA 2WA1A 3HC7A 1KR5A 1N3YA 1ZGZA 3W5CA 1N5KA 4L9WA 3IV9A 4TROA 2P6OA 1OAKA 1QOPB 5AVVA 3HJHA 3COVA 5D7NA 2OYCA 3I9OA 2GH1A 3I6MA 4J0KA 2CHUA 3T9CA 4WFIA 1CR4A 1EVEA 4ONEA 4NZYA 3JQGA 1Y6ZA 2H8GA 2W6JD 2QPLA 1LPMA 2XHZA 2ZYRA 4PC3A 2GHTA 2O9JA 5EIBD 3RVKA 1SHZA 4CPDA 3U6KA 2EDAA 4NE9A 3WNZA 2CCKA 2CXOA 3Q7RA 5CVVA 1ZDMA 3KJHA 4R2IA 4UM7A 3GGCA 3O8OB 5DNEA 4DM7A 1P7PA 5B57C 2HDNB 2EP7A 2AZMA 3C3XA 1C7ZA 1OBFO 5C32A 5ES4B 1E61A 4EMUA 1CJKC 2JFFA 3EIOA 1RKBA 3GP5A 1FFDA 2W6ID 2J4CA 4EJSB 1XWIA 1IOZA 4WHMA 4B6QA 2UV8A 5CBPB 4Q7QA 4PCAA 4MUJA 2OMEA 1QC5A 1MN6A 4NULA 2AT1A 4XIJA 4EG5A 3AM3A 2FKAA 3MIIA 1N1EA 5DBIA 4B7XA 2E6UX 4CYMA 1YJCA 1WOMA 2C5GA 1PT9A 5JJ5A 4JWKA 2OFOA 4BP3A 1QJCA 4D25A 1QG2A 3E5RA 3GHHA 5DWQA 1SJ9A 4L22A 4RSHA 1KXJA 4V0QA 4CEHA 2A5GA 4OJQA 1RXYA 1G6Q1 1E7MA 3LY7A 3BGIA 3D8NA 3GT4A 1NMSA 2Q4RA 3JQ6A 1VHQA 4R9VA 4UUPA 4Q3LA 1VFPA 3WYDA 1AQ6A 3H97A 4Y1EA 3DD5A 4Y0AA 1DZ3A 2CV1A 1NXSA 1WULS 2C4UA 2D2FA 1MLDA 4YLEA 1IUPA 5COAA 3VR5A 1IDOA 4EABA 5LZ9A 3R9IA 3RSHA 3EPRA 3UUWA 4E22A 4E5MA 4DV3B 1ZXLA 2VI5A 2ODQA 2V8BA 3TSZA 3L3BA 1MIHA 3OI7A 1R10A 2D1TA 2ZYWX 3PWTA 2W93A 1GEEA 1FFGA 4FR0A 1LSJA 2O8FA 3BRQA 3RIEA 4EY4A 3F4BA 4QRIA 3R9KA 4FNMA 1F6DA 2D5BA 4BO3A 1TCCA 4DLBA 4E1VA 3G79A 2BUCA 4H7PA 1OFTA 1M6WA 5KDDA 4CMKA 2MIIA 1O77A 2Q46A 3BJEA 3RSCA 3GLFE 1QKJA 1DX4A 2BI4A 5CIQA 2R7LA 3STHA 3U3ZA 1IBRA 2H4FA 3DWIA 5AI9A 4GPZA 1YOVA 5HFNA 5BVHB 5DLPA 1CVIA 2CCJA 4XD2A 1HT3A 1VP3A 1CU1A 1QCCA 1ZHFA 1S8NA 4XLLA 3KFLA 3IR6A 3S1SA 2JZNA 1ULHA 2PSDA 5CGZA 4URUR 5U1PA 1WXGA 4QVGA 4LF5B 2N9UA 2UZ3A 2JHAA 4DDHA 4KXQA 2JB9A 3LS2A 1N7IA 4O0MA 4KUEA 4N54A 3B12A 3OICA 3LX8A 3W79A 2I1VB 2QLLA 3IJRA 4NV1A 4Y9DA 4X7BA 4DLLA 1KJWA 3P9QA 5HZKA 3U37A 4B3DA 5TQVA 1KKLA 1CB7A 3L0IB 2I6XA 5EQJB 2R6JA 16PKA 3QVGA 5EPEA 3CKYA 2RGNA 5LDDC 1A71A 3S70A 4DR3B 4DIBA 2BE7A 2JLVA 4DQUA 2ISQA 1PW5A 3M33A 1VMDA 3C3BA 4O25A 3HY6A 4TYQA 4D96A 2Q3DA 3LX6A 2ODEA 4OQMA 4ENPA 5JNRA 3HUFA 2EJVA 4KCGA 1K4KA 2WHPB 4ZPXA 3VZSA 5J43A 1RM4A 3QY9A 4A6PA 3WKBA 3EUFA 2G5GX 4PSCA 2ZROA 4FGJA 4IWNA 2VH2A 4GO1A 5LUBA 1D4FA 2RHMA 4WEOA 2C5EA 4JP1A 2VLBA 2NAPA 2C04A 4HAYA 2H16A 1BNCA 1PWYE 1YRBA 1XL0A 3RREA 1EX1A 3S1LA 1NJ2A 3AUAA 2A9KA 3CG4A 1WMSA 1U65A 4J3JA 4BQPA 2DBQA 1P7CA 4M9SA 4EUHA 2JANA 3PGLA 5GVSA 1AMUA 2Z8YM 5B6PA 5BURA 4BFUA 4AMYA 3BHMA 4BGVA 3K1TA 3R3WA 2FPKA 1ZPDA 2XUQA 5ALUA 3UMSA 4BWYA 4EF6A 1F0KA 3A36A 3IUNA 4PONA 1Z4PX 2GI4A 3FPJA 4I1IA 1GD1O 4N3GA 3VR0A 3PLAE 3RUEA 1Z62A 1SHUX 4XR9A 4PZ9A 1JFTA 4BNGA 2HGSA 4DTCA 3DBOB 5H3HA 2QRKA 3OZSA 5CH5A 1YO6A 1CSEE 3AF6A 3WJ2A 4ENWA 4HRXA 1SB8A 3CCBA 3ROKA 3EC2A 1YMVA 4UVEA 2CWDA 1W85B 3PQ8A 4D9MA 4HSEA 4Z3DA 3BULA 3KQYA 4EK9A 4WY8A 5FUYA 2BMFA 5AICA 4DWJA 1QH1A 1CUYA 1NM5C 4KVAA 4ZP1A 1PZHA 4RGVA 2H1OA 1CS0A 3H5NA 1GGFA 5H5JA 2ZIUB 4CMGA 3FVTA 3V00A 1KRHA 4AJOA 2JAHA 3P1JA 4OXYA 5E2IA 1PR9A 4MPJA 2QLNA 4WAUA 1RAFA 2PX4A 1YB1A 5IT5A 3B7GA 2IELA 3LCMA 2NO4A 1TAGA 3CRRA 4JQCA 3OPYA 3BK7A 5KPJA 4LDRA 5G1PA 2HX1A 1T4GA 4N1AA 1A9TA 1RWWA 3LLCA 4ZVTA 1C0PA 1IZ0A 4ZEWA 5HIKA 1SHKA 4QVIA 4YMHA 4RVDA 2JI7A 3VJLA 3BWCA 3FWPA 4EZBA 4ODIA 2P75A 4UTNA 3I0ZA 2GBLA 4MULA 1TC2A 5FWAA 3VR5D 1USKA 1R3UA 4NDAA 2AC4A 4URVR 1J0AA 4W9NC 5LCXA 2W58A 1KS9A 3CO5A 3ND9A 2BGGA 3NJRA 3G2HA 4D0GA 5JQGA 4J6FA 2GEDA 3HRIA 1ZW1A 1CHDA 2NUTB 4KDFA 4E09A 5AM4A 3ZJ5A 1KYWA 4WI1A 1KH1A 1Y3IA 2QTBA 3ZQ4A 5F52A 3WIBA 3LFTA 2QPTA 2G8NA 2PMEA 1LBHA 4MCHA 5FD8A 3JYNA 3AERB 2CWWA 4LYEA 5CU7A 1QYRA 3MWEB 2AOVA 4LDZA 4F7DA 3FNHA 1B2LA 1TQDA 3P2MA 2HTFA 1QV9A 2ERXA 2DPMA 5BORA 1XVAA 2I99A 3FFTA 2H59A 2YCBA 1JEAA 1GPNA 4YS6A 1X1RA 4HNGA 3FYSA 1TZJA 3FFXA 4K9LA 2C9MA 4YGXB 5DYTA 4CLOA 3JVIA 4BFLA 2HHJA 2PX6A 1N0UA 1EAYA 4Q1DA 1HMYA 4IQGA 1X7DA 3WLIA 1K66A 1G1AA 4GNRA 5AI0A 4E30A 2H4WA 4JMPA 4OI2A 2X4DA 1O0CA 5I45A 3T3IA 1OXKB 3EAQA 3X1KA 3AVUA 3OEWA 2DKOA 5FOTA 3LH5A 4C30A 4HC4A 4QJ3A 4PYRA 5EP4A 5GOTA 2BDEA 3NHSA 4TUYB 3SMQA 1N5MA 3WKAA 2Z2IA 3FX2A 3RE1A 4EVSA 2D6FA 3L1UA 2XV1A 1MBZA 4WZZA 2FQYA 5I7OA 3B3AA 5L3QA 1A82A 4TXMA 4N0PA 3WB9A 3DAOA 1T2EA 3W1WA 3DYBA 4JLDA 4P92A 2IHZA 3C6KA 4XJXA 3C7CB 3NRJA 4TKUB 3ZHUA 2FETA 5JYCA 3DW1X 4RNDB 1XN4A 1WSDA 1IUKA 2Z3ZA 1SEVA 4D7AA 3BSSA 2IYTA 2DULA 2MCFA 4DUGD 4O3MA 3R9WA 2IEIA 3QKUA 4O02B 4RJLA 1GZ5A 1AK2A 1XA4A 4TYMA 2Q5JA 3EDMA 3RU2A 2WF8A 2YHAA 1PFQA 4J1SA 1TECE 4M1OA 5KTTA 2CF5A 2D0DA 2D5LA 2D4AA 2VBIA 3VU1A 5B2EA 5F2OA 3EAFA 2J30A 2HT6A 1KSGA 4OYLA 4UEWA 5KQGA 2PY6A 2OC9A 2O3SA 3QKIA 1MMFB 1SCUB 4MWSA 5BRAA 1J2JA 2CE2X 2WKPA 5HQTA 1P6UA 4BNWA 1U7HA 4HDRB 3O9MA 3BQMB 4ZAFA 3AUFA 4JXKA 3G5AA 2C77A 4LXGA 5D6NA 1CIJA 2PL9A 3QXXA 3NVDA 4NNJA 1A77A 1A0OA 3JPWA 1U8UA 3NKFA 1RDFA 4R7ZA 4EHNA 2AC7A 1Q92A 2IXDA 4TTIA 3E9YA 4YRBA 4CKCA 3QHAA 3DONA 2Q7DA 5EE5B 1JLHA 3HGMA 4L08A 2IY9A 4QTXA 1ZD3A 2HJ9A 3R75A 3K8ZA 4LQCA 4DWOA 4CTOA 1Z75A 4CM7A 2FOXA 1Y7LA 2P30A 4W5QA 1RSZA 5KTPA 1EH5A 3KU4A 3W9UA 1RACA 4BZPA 4Q16A 2JI8A 4WUTA 2OO5A 5KNDA 1TYDE 2GMWA 2Q5QA 3RSZA 3SY8A 1R00A 5A3QA 2OILA 4QVKA 1Z63A 4TSFA 1P5FA 4CG1A 4R7GA 4CIDA 1CJVC 3MMZA 4FT2A 5G40A 3ZWVA 3DHNA 4FD3A 4ZREA 2P3LA 1ZLXA 1BE1A 3T7TA 3ZU3A 1SIWA 3D7MA 1E8MA 2D3TA 5CTAA 1IWOA 2SNIE 2OUKA 3AGPA 1E7WA 4JI5B 4B2IA 5BNTA 3K0SA 5BQFA 4DNPA 1M34E 4P9NA 5JU6A 3PXBA 2O8BA 4G0NA 3WV5A 3HM2A 4AD8A 3H99A 2CFIA 1LBTA 3T0IA 2H2FA 1ZNWA 2ZBUA 1BO6A 1W87A 2CJFA 2JD2A 2ZDQA 3CWCA 2C9OA 1UPTA 3LCRA 1FFAA 2BR4A 4XWYA 5LQMA 2XT9A 1IEQA 3PYMA 4ZHSA 4DJ5X 1H85A 1Q3HA 1TVCA 1UKYA 3KPVA 4Q1BA 5HIAA 3G7UA 3DSRA 3P27A 3J81A 3RJTA 1YIDA 1RZVA 4RJTA 2QTRA 5DE3A 4JYZA 4PR3A 1ZKMA 2I54A 1Z13A 1DEKA 4O4HF 1ZNQO 3GHYA 2QN8A 4Q4HA 2OVBA 4X6YA 1VYHA 1BHSA 2CLCX 2GLTA 2IW3A 2X7XA 3ON5A 4RC9A 3G8AA 1A69A 1M1UA 3EF3A 3RVDA 1OH5A 3FWKA 3ICOA 2JLCA 1X7XA 4O4HB 5D86A 4CF6A 1E79A 2DH6A 1PEDA 1M0TA 3PUWA 1AU9A 1OI7A 2CLIB 1W0CA 4DMHA 5ARCA 3PEWA 5E95A 4YRPA 3QKTA 1KBOA 1AKEA 1W581 2ZSDA 4KQEA 4S2EA 1L4MA 1SKAA 2ECQA 4ZCTA 5LIRA 2GASA 2BWJA 4BBAA 2FUG6 1F8UA 3EBLA 4HB2A 2FMUA 4RORA 1T26A 4TS1A 1J1UA 2QAIA 1OI2A 4U4AA 4UAJA 4J1QA 4Q4HB 1W8DA 1D0VA 3E5NA 4Y9UA 3FR7A 3HL0A 3RANA 4AP9A 4R81A 3MERA 2RKBA 6AT1A 1QOZA 2RH9B 3OP1A 4CT4B 1GQFA 3NJ8A 4P4TA 3DOUA 3DUWA 4Y2JA 4AU1A 4NWIA 1G41A 1VHJA 3OLCX 3VPDA 4A8JB 4U6SA 4CG0A 3BMNB 4MWZA 1D07A 2FSHA 1BWQA 2IOQA 3L0OA 2XGSA 2ZVDA 1S2NA 3FCUB 4LQ4A 3GQBB 5I7VA 2Z5LA 2I91A 2PBLA 1U8ZA 2CL0X 3EZXA 4GBMA 4MS1B 1SVSA 2RHOA 4QICA 1T25A 2NTEA 2GN6A 1CRQA 2MSKA 4YFVA 1UDAA 1EUCA 2EHDA 3AZQA 4ZAYA 4DRYA 5JRZA 1T2FA 1E8NA 1JDUA 1I2DA 4TZ6A 1YR2A 5JMTA 5FYDA 1LTKA 1Z2DA 4YLGA 1RU3A 4M4SA 4BKOA 1QG6A 4EB6A 2RC6A 3R7WA 4HFNA 3HADA 4S0XA 3LPNA 4DLXA 4YRKA 4TXNA 4I8DA 3PEEA 3IEKA 5M3BA 2CMDA 3HYNA 3QXGA 3NV7A 1Y3FE 4BQRA 4H7JA 3J81k 5IN5A 5AOBA 5GPBA 4Y3UA 2WM8A 4ZYTA 3V7FA 2P0YA 4HATA 4I4TF 3LQ1A 3VYRB 4PANA 2RD2A 4FDAA 4GICA 2JFQA 1U3WA 4J0JA 3SQLA 2G88A 1ODJA 1KAHA 4K6KA 4OMCA 2QQEA 2RH5A 3ORHA 4RO0A 4XAQA 5EWJA 3LUHA 3L7DA 3QA9A 3CPJB 3AY3A 3KEOA 5EXEA 4UBMA 5AW5A 4C20A 3E1KA 5LMNB 4ZN6A 3ZV3A 1CNFA 5BQOA 5FA6A 3OZWA 2F55A 1OYOA 2C5HA 3CLSD 4TKZA 2O59A 3SYKA 4MR8A 3DDWA 4XQ0A 1SCBA 1MOZA 1P80A 2Y92A 3CXUA 2QU7A 3FRIA 1IH8A 5LNK6 1E2NA 1RIIA 1KAGA 3S2GA 3SNHA 5AVTA 2F9FA 4EPXA 1UL1X 3FCAA 1XMSA 3HB4X 4PCLA 1U2DA 8MHTA 3HWSA 4IIXA 3DQQA 5G4KB 1Y80A 3NOXA 1BRTA 2QL9A 3FKSD 3GRPA 4IV8A 3T4UA 4QBTA 5CDTA 4JR1A 2FG6C 4Q9JA 3OLVA 2AEJA 1ODIA 2DAPA 2X4LA 2QMYA 3SQNA 2PUAA 3VQTA 5CM8B 5BWCA 5LXTA 1JQKA 3PQ3A 4FX5A 1FP6A 3IOYA 2SCUB 3QVSA 3WLRA 1PYGA 4S2UA 4FOOA 1S3GA 3ZDAA 3BS4A 3GNTA 3I64A 1ZMBA 3LNCA 4NZ9A 5JNSA 3NNNA 4KWIA 3WO0A 1O97C 4X60A 2HLDD 2RK3A 4ZVSA 4TVOA 4WESB 2V7PA 1A9ZA 3FFAA 5J58A 3W8RA 4JYBA 1JAZA 4E5DA 5FEMA 1JIXA 1L7MA 5KJEA 3MB5A 4QYWA 1W4LA 2ZI9A 4I4TB 2HK8A 2AJCA 3FVWA 2G0AA 1ZINA 1VFNA 1RHUA 2XYHA 3INYA 1NLYA 3L41A 4GR4A 4Q5IA 3CBQA 3I5MA 4GMHA 1A8IA 1FSSA 1X3SA 2GNPA 2JJYA 3G1WA 3GCDA 4TS9A 4AYXA 3QMMA 1W0KA 3K15A 1J21A 3GA0A 1CRWG 2SICE 3D2BA 3BBLA 1D2EA 1O1YA 1P61B 2FR8A 3D6AA 3L8HA 3MCTA 3SZOA 3VBCA 2FP4A 1IG3A 1C3LA 2XW6A 1V8FA 1QOQB 2HPAA 2WA2A 3FXAA 3NUGA 4LSGA 4PCUA 4R3WA 2EIHA 1YXMA 1MFZA 3F78A 3FTNA 3NIDB 4L4XA 4ZT2A 2PJDA 4IXTA 1P74A 1U6IA 1TADA 4XLZA 5BNIA 1X7ZA 1DKNA 1KJ8A 2Q3CA 2ATXA 2D1QA 2RGWA 3MUOA 1ANKA 3PC8A 4I50B 3CEMA 1TMOA 2ZEJA 3L6BA 5F64A 4BRSA 1S89A 1ZD5A 2CSUA 3DPIA 2C4HA 3LE8A 2GX6A 1V0JA 1JWLA 1Z0AA 3W4KA 1BOOA 2VRCA 1VG0B 2YJGA 1F51E 5FYQA 1UT5A 1PK9A 2ADOA 3PTAA 3I23A 1IUOA 1KC1A 3PXCX 3QPBA 1Y6QA 1YR7A 2BCEA 1CZOA 4BC0A 4JT9A 5ITZB 3ZCUA 4QNRA 4B5KA 2HADA 3VM6A 2A3RA 1WNFA 4GVXA 2XUOA 2G9ZA 2QJRA 1SA0A 3K1JA 4HFJA 4BJ3A 4G36A 2P4EA 5JAQA 2Y3IA 1DQZA 4LK3A 1JE0A 4BFCA 1UDRA 3U7IA 4ETIA 4UNRA 1W59A 1H2HA 2QNIA 3CLTD 3TG2A 4JLAA 2C4KA 2AA3A 2UVPA 1C0EA 1J99A 1NNLA 3LVRE 2IC5A 4A9AA 1ECFA 4KSYA 5K0TA 3ABSB 1RC8A 2Z0MA 2H1WA 4DMLA 3PNQA 3KP1A 4TTJA 3QJGA 3LW7A 3KM0A 4BVHA 2WFAA 1B42A 2GF2A 4L2IA 2IHNA 2XQGA 5SY6A 4FYJA 2C00A 1DV2A 1MQ9A 3UMRA 4AJNA 3A2NA 4KQMA 2QS9A 4HPXB 3H17A 4X61A 1YNSA 4Y2PA 1Z82A 2WOJA 2ZBDA 3N2YA 4II2A 3GLFA 1ZRNA 1AMNA 4C3ZA 4Q1AA 3FLEA 1Q1BA 4P7JA 3F8SA 4FN5A 4QQNA 4MDHA 1QVZA 2D3WA 3WYEA 5C46F 5LLDA 2ZWVA 2FW9A 1KYXA 4F6LA 3AK4A 4BVKA 4MWGA 3GZTB 5B3LA 1UBLS 2I4RA 4G1MB 4E0BA 4DDTA 1JAYA 3RBZA 1Y4SA 4DCJA 1A2OA 2DX7A 2KB0A 4KAXA 4PZZA 5L6LB 3FB1A 1MC5A 2H00A 3A26A 2N46A 4MW0A 3PNLA 3TIFA 2DPXA 3FTCA 4Q18A 4DNFA 2ZRAA 4Y6LA 4B8WA 1OKKA 4RKYA 4DLAA 2M32A 4CKEB 3BXZA 4KQKA 1BH2A 5KSPA 2HNBA 5K45A 1CUXA 4OJYA 1E2DA 4AAYA 1KDZA 3T3NA 3QNUA 3TTXA 1HLDA 2V55B 1KY5A 1EFRA 4I6GA 3AR2A 3PR1A 4GEKA 1Z0ZA 5DEIA 1GTJ1 4JZKA 5EIAA 2HV8A 4UU8A 2R6AA 5KNDH 4ND5A 1E0AA 2GPSA 2X2EA 3SS9X 1IHUA 1SPBS 2I4TA 4RD4A 3ZW8A 2D2EA 1YZGA 2BGUA 3R5TA 4CF4A 3QEKA 1N6HA 3JD3A 3Q1LA 1E7RA 1UANA 1PAUA 2O3UA 3ECCA 4V39A 1Z0FA 2PXXA 2J7PA 2HCBA 1Q22A 3AB7A 1HEUA 1MG5A 1MPXA 1KIAA 3I92A 3ZHCA 1WMDA 1PJ4A 4N3CA 4X7MA 2FWJA 3KTOA 4C0WA 5CP8A 4J94A 1LJLA 3HRKA 4R9SA 1P0QA 3KKLA 5KNCA 1S3SA 1ISGA 3P9NA 1OFUX 2Y1FA 4RK6A 1U0OC 1UWKA 3VSEA 1MRZA 4K3VA 1FJGB 4LY9A 3MJRA 2OO5C 1P1JA 3IC5A 3AL0C 3UPDA 2P5TB 3O5AA 5TGDA 3V3KA 3CF6R 1DTWB 2HEGA 2Q3HA 4Y2HA 4K86A 2D1FA 2E89A 3V46A 1B0ZA 1P4RA 4JI6B 5EWLB 4R1UA 4EJMA 2MSDB 4FOPA 1B2RA 1TOAA 1XC7A 3ELBA 3HCFA 4R9RA 4CF5A 1W44A 2PZGA 4MR9A 3A0UA 3LUCA 4WADA 4ZVMA 1G5FA 4BQEA 4CN8A 2A92A 2FPGA 5FBVB 2B3DA 1F5SA 1N3BA 2I6UA 2R2AA 3ISVA 3O4IA 3BT7A 4LOAA 2PX2A 1IL0A 4Q24A 2EGGA 3OIFA 1OSNA 1BH6A 2GZRA 2C88A 2H7VA 1KOLA 5BMVA 2F8LA 3AG6A 5A71A 4HQFA 1N8KA 4KGVA 4WN3A 5J2UF 1TFRA 2WJYA 4M9QA 4TYWA 1I7NA 2HJGA 2YWCA 4ER7A 3WO1A 3FMGA 3B89A 1U0FA 2A5YB 3KDPA 3M1AA 5A3RA 4B3GA 1WU7A 5IG2A 2DPHA 1EU1A 3PGVA 4U0JA 5AD1A 2CL6X 4I19A 1VL5A 3MG9A 4B2YA 3PNOA 4QQFA 1RWXA 2UUOA 3LUDA 2PZ8A 5BOSB 2B1QA 5IUNC 3FDIA 1FFCA 4JJ7A 1R7RA 4QA9A 2HF8A 5DK4A 1IIBA 5AVXA 1O94A 2XYQA 2Z2JA 1VKZA 4WA7A 3KB6A 3OTOB 2V6JA 2XCTB 2GM3A 1PJ8A 2XZLA 5DCUA 4MKXA 4YUXA 1CJTC 2GBFA 4AIIA 1C8VB 5EMHA 2BFCB 5C1IA 2H5LA 2WICA 5AKJA 1I4WA 2CYBA 5AK0A 1FFEA 3TOXA 3G5TA 3ZLJA 4OGFA 4LJRA 3K9BA 3ZTTA 2IOFA 1PQYA 3FBWA 1DRUA 1XZIA 2JFGA 4IHJB 1CC1S 1TCAA 3QSYA 3OZEA 4XJSA 2GFHA 4MMYB 1E0SA 5L4SA 4B4UA 4ZU3A 3VR3D 3TI9A 1XFAA 2K5UA 1SUIA 4XWTA 1T1JA 4B6JA 1N4AA 1R6BX 3FD8A 3UK7A 1Q0HA 1P31A 1ESEA 1V6SA 2GXQA 3D02A 4J7CA 4OIMA 2C2OA 3TMKA 4JLPA 3G0OA 4KOAA 3TCNA 2QRHA 2ZPUA 4PLVA 4Q4DA 4FWIB 5JFTA 3QPCA 1PJQA 4YCAA 2W4MA 2HHHB 4NMMA 3BK1A 4WASA 5TMPA 4PGFA 3PTLA 4H4CA 3NCHA 1QO0D 2HQSA 5LYJF 5AVWA 1UBCA 4F72A 5REQA 4WXRA 2L69A 1FYWA 4D8WA 1SWVA 4J0EA 2VS1A 2GT1A 2HV9A 3U62A 3A9WA 1ZITA 5KOJA 4GLJA 3LUFA 5BSUA 3PFCA 4OK3A 4P3NA 1P0MA 2PGXA 5FH9A 4TT3A 4N3BA 5K3FB 3PQ6A 3W2TA 5FV4A 3CBGA 1S4MA 4QO8A 4A82A 4AJLA 2YWHA 5ADUS 1ECLA 5JS7A 5J2UB 1Q6ZA 3B5EA 3ICPA 3D7NA 3IT3A 5JWOA 2ZWPA 3VZCA 3B13B 5BPFA 2Z4TA 3BORA 2DWQA 2Q5IA 3HACA 2Q27A 4YQYA 5JAOA 1PWEA 1JTVA 1PDOA 2B6HA 3UV7A 1PV4A 1KSJA 3JZAA 3LCJA 4J3FA 1O03A 3NVAA 3O38A 5J4VA 2OBNA 2J0VA 5JMOA 3CPHA 3CUEF 4FJ0A 3R0IA 4OHRA 1HDIA 3SE0A 5EJ5A 3BQ9A 4N0MA 1C4XA 3QFCA 2NYRA 3MSCA 3C3EA 3DZBA 4R16A 2CJXA 4EI9A 3WGVA 2O0MA 3D4OA 1A9XA 5C1BA 5A4MS 4WERA 4XUGB 4Z9XA 4Y1GA 4REOA 1CF2O 3P9ZA 3VU0A 1QVRA 5B7PA 1QRSA 3S81A 4B5LA 4EI8A 3BTVA 4YPVA 1CJMA 1H8ED 2I1WA 2QYHA 3C45A 4Y98A 4LDNA 3T99A 3VDNB 4CEIA 3LPCA 4KNYA 1XUOA 2QV0A 4JB2A 4XASA 1F0NA 3AKZA 4PQYA 4LZZA 1KO5A 4D9GA 4JP2A 3SS8A 3NYQA 1FDRA 4I1YA 4ZCIA 4Q4CA 4P35A 1B6RA 1YQEA 2A5LA 4JFAA 4L57A 1VOTA 3DLIA 4OHWA 1Z39A 4WZAB 3PXDA 4A73A 3TKLA 3FNFA 4OKNA 2WT4A 5FUVA 5CEFA 3A6PC 4BMYA 2CDAA 5CFRA 2TRSB 4F6CA 1CLEA 3T7CA 1GPBA 3U9LA 1KEPA 1TJYA 2G1PA 1EE1A 2XUHA 3WJ7A 3ZBPA 4XIYA 4MPPA 1GTL1 3UNXA 3ROFA 5CCBA 2AE2A 2R66A 1W6UA 3GT3A 1RBMA 2Y2VA 3E7XA 2QNRA 1KOGA 2EX1A 1Y9ZA 3OKAA 4NEQA 5AQEA 4DHEA 3R7FA 4XKJA 3GRUA 3PQDA 2CNWA 4NCKA 1XDDA 2WMOB 3F7OA 1DC6A 2O0HA 2PXCA 3A4LA 3L06A 4HH1A 3SC6A 1GILA 1UK8A 4NI5A 2BRUC 1M2NA 1DCMA 5JFOA 2LP4Y 2RONA 4P4SA 2VJNA 4HH4A 5H59A 3H2ZA 4ZC1A 2G5CA 1H0SA 3ZD8A 5E8RA 4BE7B 2EX4A 1DAGA 1HNNA 1JVSA 3HA3A 3M9XA 5T8KA 2AFVA 4H1TA 3EXIA 4MB2A 2B30A 3W5BA 2XDYA 4CQNA 4O5AA 1ORTA 1HY3A 1XSEA 2QN6A 1PS8A 4NG5A 3U4GA 2HA3A 1QGUA 2F64A 3B1VA 2B8JA 1M1ZA 2J3KA 3N2GA 2OT3B 2F43B 3VOBA 5KBYA 3EQZA 3I9V6 4K9RA 2JLQA 4MPTA 1I7QB 4Y2UA 3I2YX 3GFRA 3HNPA 1L7PA 1T3LA 2OHOA 3MTGA 1BFDA 4O4JF 1UT6A 2C3YA 2YH2A 5EUQB 5B3JA 3V3TA 2HFJA 4C08A 4CHGA 1RRCA 3CLSC 4PLCA 4ANFA 4CU5A 5I47A 3PD1A 3S99A 3LAWA 5BXQC 3I2IA 2CC2A 5I7HA 4GECA 1VL6A 2PGDA 3OBIA 4G1EB 4MROA 3RHSA 4B8ZA 1T6NA 4HLCA 4BN5A 1F7UA 4QXQA 2RH8A 4A4DA 2X4IA 3EG9B 1QF9A 2SKDA 4MVJI 4ZQFA 2B5OA 2JVJA 4JBWA 5LD2C 2QGZA 1L5MA 3BMOB 3K1AB 1NNSA 5KREA 5IFLA 3IESA 4R8LA 1YQXA 3NH6A 4MV5A 1U7DA 1UC4B 1OT3A 3HN6A 1K6XA 1IRXA 4EKYA 1RBQA 3H1FA 3TD9A 1Y3CE 3N70A 3LQFA 2E85A 3AETB 3DVQX 2VJLA 2WTUA 1MORA 2GFQA 5HIMA 1BGXT 2QTNA 1S02A 1XTUA 2PUTA 4A2PA 5KSYA 4QODA 3K6KA 3ZD7A 4HDAA 1ISPA 1DC7A 5FWDA 1E1LA 1KHTA 3OPNA 4P38A 3QV1A 5DFAA 3PG5A 4RA9B 1FRZA 2CHFA 4PX3A 4U39A 3TQFA 1JKJA 3KV1A 1BQEA 1KEVA 1SG6A 3NTRA 5TGZA 4J0CA 1K7EB 1Q7RA 4I36A 3SR3A 1V95A 4A26A 4D3FA 4Z7JA 1OC4A 1SVNA 5DTIA 3KFXA 4DCCA 3P9XA 4CN9A 2LIPA 2KHZA 1V5WA 1K5DA 3ROQA 1H2BA 1GAJA 4P33A 3UJCA 4AJ1A 4IDGA 1E4EA 1OT5A 3GJ5A 4MVWA 4M6WB 4UAUA 4D9HA 3I32A 4F5DA 3FWYA 3ZVMA 2DZDA 4IEEA 4Q93A 4D6PA 2VHJA 3FPFA 4R2LA 1PEAA 2IHBA 2NZXA 2GCIA 3H1TA 3VR5H 3HKEA 2Y77A 4OKIA 4DBLE 2VWHA 1DP4A 4HL6A 2X77A 1UJ4A 3B6MA 5BWLA 2D2VA 2FDCA 3ZLVA 4EI7A 1TYZA 3OLWA 1NJ5A 3B2EA 4LCJA 1H0KA 4LC1A 3CX4A 3CNQS 4RQBA 2ZTMA 3RU7A 3SHOA 4HWSA 3TOSA 4CR7A 1FUEA 4U0KA 3L8DA 2E87A 3ZWWA 2O2IA 1BN7A 4BQNA 4X5OA 2UUAB 4BO4A 3O4JA 4DN6A 1NW6A 4EX6A 1N8NA 1G21B 2O06A 3UJAA 1F4PA 1BA2A 1H8EA 1FNDA 1T8RA 2HRQA 1FMTA 3M6MD 1A04A 4QUJA 1VI2A 2P9EA 3TEFA 2VF4X 4KP7A 4YP6A 2YV3A 2HSGA 4UVGA 1O2DA 3JQDA 4FN4A 1J0DA 1W9HA 4K9MA 1Z5WA 1YE3A 1P9OA 2H1LA 5FOUA 4XD7D 4EMTA 4DQDA 1K9VF 3G82C 3FLMA 4A27A 3RUFA 1AS0A 3EH2A 4WOPA 1IUNA 3RV3A 4JJGA 3HA7A 4TZKA 3ZIUA 1P7WA 3IELA 4A2WA 4GOJA 2I2WA 4HDNB 3KQLA 1I4LD 3ZWQA 4UBJA 3TQQA 2XGJA 5F2KA 2BONA 3TQSA 1GGJA 1XYGA 3GN1A 1VL1A 2WKSA 1FMLA 4QPJC 2P3OA 2VJMA 3PNPA 1L7XA 4IPTA 4OBBA 2V7GA 3FTPA 1NYTA 2Z5VA 3OA0A 2W8BB 3AUTA 2XGMA 1VHLA 4F3YA 3KWLA 1SEPA 4ETWA 1U5BA 3EQ9A 1FBNA 1F4LA 3HYTA 4GWGA 2XB8A 4HEQA 4R1SA 4CM5A 1XMOB 1TO6A 1JAHA 1QYWA 4OK5A 5F35A 2QTLA 4QEDA 5C1OA 3FMIA 4G5RA 4O29A 4D9FA 4XIGS 5JI3E 1U80A 4OGKA 2E7ZA 3M5PA 4I3FA 1RFGE 2PT7A 1EVIA 1T8TA 1XD8A 1FRNA 1YRLA 5ALSA 2Y1WA 3X1XA 2GEFA 2EZ4A 4FVTA 5ALMA 4HVLA 4YRNA 5A3VA 2ENWA 1RXVA 2XXAA 3WLFA 1JLSA 3OWHA 4AWAA 4C2BA 1NVBA 1GPKA 1KJJA 3DVSX 4QKQA 1OE0A 3G1TA 5L4LA 2I67A 3Q8XB 4E5YA 5AJYA 2VNAA 3BIFA 3L6CA 4BZXA 1PS9A 2J6CA 3EZGA 5ARDA 1YKSA 2AZDA 4LJ7A 3X2EA 5JH7B 3NHPA 4C4ZA 2VJBA 1K6JA 4TXHA 5C8YB 5FULA 4QFCA 2RGXA 3CEPB 1NLUA 1QAOA 3EGVA 3A3NA 4FSXA 3ZU5A 5CB6A 1ZNZA 5F33A 5H4GA 1GN8A 4FGUA 5IWCA 2O57A 1KFKB 2XWBF 4RLFA 4G81A 3SIWA 4QZVA 3IRUA 1KE1A 2R1VB 3QNWA 1TTHA 2FN9A 2I3ZA 3CKLA 1CYDA 1QBKC 1W94A 3H65A 3KB1A 4N01A 5DHUA 2OYSA 5KKNB 2PUDA 1U9JA 1V1JA 1XTIA 1IIRA 2P3SA 2R3SA 2CKDA 3H3JA 3PV0A 3E3LA 5EZYF 5KB3A 2D62A 4MR7A 1A1SA 5DPMA 4V3CA 1NBHA 1L5HB 1Q2UA 3FSGA 5AW3A 3PHBE 1FFXA 2P79A 4FGKA 4MB0A 5IC5A 1L1QA 4L8WB 4KKXB 5IAKA 4PINA 1P1IA 4IS2A 4V38A 5CUQA 2ES4A 2VHQA 4QFMA 5AMXA 2WY2D 3UHOA 4CNQA 1J8VA 3KKPA 4OSOA 3MELA 3DMHA 5I9NA 1NUHA 1Z3IX 1MG0A 3HXLA 4M2LA 4JLMA 3QHQA 1P75A 3I4CA 2F48A 3SJUA 1ZVKA 4B4KA 3STTA 4TPKA 4PR0A 1AK1A 1TM7E 1CZUA 3RNOA 2Z6AA 1ADBA 3FYUA 3T1HB 1V5EA 1L3IA 2ZSJA 1X1DA 5CFMA 1TF2A 2NVOA 1UJCA 2WQZA 3GZNB 5DYNA 5BOVA 3G2OA 1XA3A 1V4BA 4CXMA 1M74A 3RVMA 2GD0A 3CH6A 4F4CA 4O8ZA 4NABA 2WF6A 9GPBA 3DCJA 3O8NA 2OL4A 5K0EA 3CSUA 2RE8A 1NXWA 5FDFA 1ZJJA 3KPWA 1IJEA 2GZ1A 4KXFB 2R2GA 1M0WA 1PQUA 2VDRB 3UWOA 3ZI7A 2HIAA 3DD1A 4C0HA 5HOQA 1UMBB 3H4TA 4I50F 2FPXA 5HWSA 1L7EA 2C7RA 2ZJ2A 4LJKA 2ZI6A 1O57A 2X5XA 3BBPA 3V4LA 3PQCA 3RAJA 5EESA 4BKUA 2CUZA 3DZDA 5CX4A 1E9AA 1XROA 5C18A 1T91A 3I72A 3HB9A 2RI0A 2PUJA 1OBCA 3DOOA 5KHOC 2I2AA 1QCDA 2E1PA 3KWFA 4KWHA 3IB3A 5AK3A 4CGYA 4EB8A 2VA8A 5JXHA 2KPOA 2A0KA 4RK7A 2GNAA 5TMDA 5FNVA 2PUBA 5BN3A 1F48A 2ONYA 5IS2A 1W4BA 1DMSA 2Q6VA 4YC7A 4MVJG 2QLMA 2LDXA 3OLQA 3K5WA 4DR6B 1JHPA 1HFKA 2P4UA 2XTJA 3CVOA 3HEBA 4GE0A 4GR5A 4L16A 1O95A 3DTNA 3I58A 3WMEA 2P1ZA 4RULA 2FDRA 3WHLA 2G07A 4J49A 3W3AH 2IWHA 1MH9A 1KZ9A 3IJEB 3PR3A 2PCLA 3TD2A 1V41E 1V8ZA 4JD5A 4YONB 3UH0A 2JEOA 5JV5A 3I2HA 4LWOA 4RMNA 4YJGA 2UXDB 3RS9A 1KO8A 5AHOA 3WGUA 2XKJE 3JAMA 1M6NA 2WF5A 5TB5A 4D97A 1BE0A 4FMDB 3ITKA 1HT2E 2ODWA 3IDFA 1S2LA 2YJ4A 1HDCA 1V1RB 5T6MA 5A3SA 3EUEA 5JCXA 4Z8YA 2QD1A 3T9FA 3AHGA 5BN3B 5M7EA 3KQOA 3L0SA 1KQPA 2L2QA 2ZKLA 2O50A 1J5PA 2DUNA 2I2FA 1MX1A 4A6EA 3DLBA 2WM3A 3Q5EA 1E2BA 2FHSA 1M2FA 1GZ6A 3TXAA 2K7ZA 1PJ2A 3ITNA 1AVTA 4TLDA 1JMYA 4U8GA 1O58A 1ILWA 1AN0A 4I5EA 4DBLC 3RVOA 4H27A 1D4OA 4E7OA 3VC7A 2MSCB 3FLAA 3QLUA 4WD3A 4CQJA 1KKMA 1QHYA 1HKUA 4PXSA 3BMCA 4PRYA 4B3TB 1GVHA 1TIBA 2B21A 1TVKA 2OBBA 2AUNA 1R9NA 3S5UA 4M83A 1KQ3A 1YJAA 4XX0B 4E6EA 5IDQA 3CSSA 1GGMA 3ND6A 1WF3A 1A9YA 3RIYA 2X1VA 3WQHA 4GSLA 3CNHA 4XSVA 4UVDA 1QRAA 4HPJB 1Q44A 4KO8A 1YS6A 3JY6A 2DHEA 1GGHA 3OIDA 3OOWA 5HQJA 4Z4HA 3GLIA 1QYIA 3C24A 1JG1A 3IAFA 4WGGA 3OPYB 3IPAA 4WH0A 1GA6A 1SHTX 2FEMA 1EJ2A 2IA5A 2JAXA 1A5BB 2I5PO 2JFXA 1GZUA 2MYPA 3B1ZA 3OCJA 2ZRNA 1GFSA 2H2GA 5FRDA 5EJGA 4UUMA 1GG5A 1WZCA 2IPNA 2RAFA 1HH4A 1V3QE 1XMPA 3KPYA 3PFBA 4LMAA 5CA0F 3TKAA 3CVJA 4ND8B 3TTSA 3E23A 4YYZA 4LC9A 2V45A 1BJKA 1NRWA 2IUEA 2DQZA 2ZJ5A 1NN0A 2JHPA 2H1IA 4U1RA 2Q7XA 4BEVA 3RWOA 4UQPA 3LPMA 5K6AC 2IIQA 2ZK7A 2CZCA 4EGJA 3JYHA 3CF4A 4DABA 4ZO8A 3A9VA 2JJ2A 1EWYA 2KS6A 3MMNA 5HPYB 5JCPA 3FSGD 4MKHA 3WQQA 4CCAA 4KMSA 4UDNA 3FUVA 4CMEA 5HF6A 1BTOA 1E2LA 2PSJA 3JQ9C 3RRJA 1M1YA 1I0LA 4DLSA 1GTG1 3ZWNA 4LX8A 4G01B 4DNXA 3QPUA 1T35A 1XXHA 4PNHA 2Q2QA 3R4CA 4ZQIA 5C2JB 1QR6A 5FTWA 3ZYZA 1YR9A 5LU9A 4LNUB 2CW5A 3QFHA 3BWEA 3JQGB 5HKBA 4D26A 3L8GA 4XVQA 3UT6A 5C0OE 2X5NA 1ZQ9A 1GVNB 1DDIA 1KBZA 3ZBQA 2L18A 3N58A 3TLCA 4YV0A 5HGXA 4TVBA 1RQLA 2JBAB 2VK1A 2X2PA 3H9QA 1OWOA 1NASA 5CB4A 4D0SA 5HM6A 2V3CC 1IC6A 8AT1A 4OJNA 3WDKA 1OXSC 5LU8A 1YRWA 1GU0A 4KJXA 1BN6A 4H35A 1L4LA 4MVYA 1I3MA 4Z0NA 2NV2B 4MRMA 1GR0A 1L8OA 3FRJA 1V3VA 3QWIA 5BT8A 1XXHE 5IKMA 1H2RS 4TLAA 2I29A 2ZJBA 1EMDA 2C83A 3FHJA 4E12A 2G5PA 1TK9A 2A0WA 1OXVA 2QTZA 2R6CA 2FGJA 1RXUA 4HQOA 2YQZA 3ZQJA 5JAPA 2IH5A 3AVTA 1VCMA 2GKSA 1GYRA 4LF4B 4WMLA 1RHRA 1XMIA 4BFZA 5F4BA 4FD2A 4TZTA 5CVDA 4K87A 3QQ5A 2Y6VA 4AC9A 1EP3B 2OUIA 4UMDA 5JSHA 5KVCA 3D4IA 3RH0A 1WB6A 5CBKA 4D4GA 1SN7A 4I4TA 4DCOA 1G20E 2E49A 5HJ7A 2FLKA 5IUJC 5EWLA 5HKOA 4RADA 2VTBB 1I7SB 4IDQA 3OZDA 3RT9A 3NS7A 2QIPA 3AY7A 1NW5A 4DDVA 1BMQA 1CDEA 2QUZA 3NHKA 1Z34A 1T43A 4BUCA 1KVQA 3H9BA 3UG7A 4JI1B 4P7GA 2ZAIA 3KVVA 1EKXA 4OX9Y 3VO9A 1ORRA 3DLTA 5I8PA 5M5BA 4CG3A 2FFHA 1B8PA 4UMEA 4NAVA 4V02A 5FBRB 4DR2B 3IURA 1BJTA 5ECYA 2FZ4A 1NOKA 1G8PA 3EXFA 3HB0A 3NGLA 4R69A 1HK7A 2A58A 4U6QA 3T7AA 1DTSA 1ECCA 1HE8B 1ZK2A 4IP0A 5DX0A 4BASA 5BWBA 4J6EA 2L17A 4Z9YA 3VBEA 3UPUA 4GOKA 4JBYA 5KX5A 2C7GA 4PFJA 3D3KA 1QIIA 2I1LA 1NIPA 4I55A 1MO3A 4QAQA 2PQ2A 2BL4A 3RAPR 4D3DA 4N9WA 5ALVA 2J6HA 521PA 5IJAA 5DVZA 4RY9A 2A14A 1QS0A 3LZCA 4GKAA 3OLZA 2HJSA 3AR4A 4HZIA 1X80A 3QKSA 3CT4A 3GXOA 2NZVG 1AKUA 3MW8A 1PGPA 3LT0A 3LHSA 2NSDA 2IDZA 3EIXA 3UFXA 4LI3X 2DXIA 2Q45A 1RYFA 1Z6XA 2M1XA 3DF7A 3LF1A 4PNPA 4DC9A 5C51B 5EINA 1GXSB 1SXJE 5ICFA 3S2UA 4DLWA 4Y2GA 1G7SA 3GP3A 3JV7A 3JU3A 2JKZA 3LBYA 1O8BA 2WTBA 2ZRIA 3PC4A 3REFA 3VHRA 3GEGA 1QIGA 2YHBA 1OJLA 1P2DA 4IIJA 2OFXA 3T94A 1PWHA 1LNQA 1OTXA 1RCFA 1PBNA 1Z38A 3KOWA 1BHO1 3OBBA 5J4YA 5LVAA 3A11A 3KKZA 2QRLA 3OQVA 4GYKA 2VP2A 2C20A 2WR8A 1JLMA 3PHJA 5EHIA 1IQ0A 5AOCA 4ZVOA 4UREA 3A8TA 4MAMA 1U6KA 1S6YA 3LWNA 4MV4A 3SD7A 4B4WA 4HUJA 3GRFA 3JALB 4RPIA 4S1OA 4W63A 4WLVA 2VXOA 2JLBA 3T61A 3NBUA 4IVPA 2C96A 4MJLA 3NWJA 1MGOA 4OV6B 1D6SA 2LCIA 4LZLA 5EUBA 4DZRA 5AVSA 2W6QA 2FSPA 2HPZA 2P9CA 2WUWE 1T36A 3MLEA 3MAGA 3AVPA 4IDHA 2ZI5A 5BSRA 2ID4A 1G8GA 4HTAA 1NVVQ 4MVJP 4PM4A 5KTYA 1AV6A 2VDMB 3TRDA 7MDHA 3FF1A 2A59A 4KR3A 2ZE5A 3V55A 3IQHX 3BH0A 4G8JA 5I5GA 1GFIA 1W75A 3FMVA 3Q40A 1FDSA 1JKXA 3MJFA 3A2LA 5E4YA 4YREA 2GF9A 4KPGA 2ATIA 3ZKWB 2FPLA 3HVKA 4PYJA 1XZDA 2JKVA 3UOGA 1XZGA 3O4GA 4QHYA 1NKTA 1TJNA 3EJ6A 5ITVA 1R0BA 4KR7A 1AUVA 4IGKA 1JG2A 3GLIE 2A9RA 2VNIA 5AXAA 1T3ZA 2ZETA 1XI2A 2X0NA 4HQRA 5KS2A 1IXYA 2W2PA 1DOZA 7AT1A 4LZWA 2BIFA 3IO5A 4MV8A 1J2RA 1QDEA 2PKEA 3OE1A 4QX6A 5A9TA 1NMZA 2BY4A 1AMOA 3M7IA 1G55A 1NBIA 2BEUA 1NN5A 1S7CA 2VUHB 3G8YA 3GJZA 3QVTA 1IEVA 1QPBA 2H5EA 4FCVA 4YMWA 3NIBA 1RHJA 3AJ8A 5JANA 1AZTA 2X6RA 3UMFA 5EZSA 1OA0A 1PNQA 1CUFA 1FLAA 1VG8A 3EGXB 3H9GA 4JEUA 1KDVA 5KWSA 3KLMX 4FNAA 1PGNA 3VR3A 1KEUA 1EG2A 4K8OA 4KFUA 2ZQ5A 3S55A 2BF4A 2BE9A 3WISA 1NX9A 1PK8A 3B70A 3JXEA 5IXYA 5KU1A 4EB0A 1HT1E 1YJQA 2BMJA 1C7IA 2OO7A 2XUJA 2D1RA 1UZLA 4XVUA 3G9XA 4LGVA 2HFKA 1HV8A 3ZDQA 4E21A 4GX2A 3GJ0A 4UHCA 4AJEA 1V1MA 4YH1A 1UBHS 2PKWA 3C5EA 3V4RA 1CS4C 2ZG6A 3C8ZA 4MQMA 4XUCA 4ZRNA 5T4BA 4BV2A 4KN6A 4UBLA 1E2FA 2QTVB 1DQRA 3DOEA 3ISJA 4B83A 4FZ5A 2F90A 1O89A 3M6FA 4X63A 2HSZA 2PUWA 4X92A 5E2AA 2VHEA 3VR4A 3U0BA 3D54D 5BV1A 3FJYA 2W43A 3K92A 2ZJ4A 5AW9A 4IJ5A 3TLBA 2Q4OA 4IIDA 4UUBA 4EFNA 4EKDA 1JEYA 4YRLA 1AO0A 2FFAA 4YB8A 3R7NA 1P1FA 4F9FA 1HNZB 3GG2A 2VVTA 3GJYA 3INGA 2Z1NA 3FVQA 5CAEB 4X3PA 2JRCA 5CVJA 5DF1A 3VYWA 3S40A 1P8AA 2YNMA 4OKSA 3UB4A 5CLJA 2EJUA 3OM8A 1RNLA 5CK4A 1CD5A 1DKPA 2JGMA 3N2IA 4OHUA 2ZOSA 3ZHXA 1XDWA 1ZVJA 4NYIQ 2IS2A 1VI6A 1MJGA 4G5GA 2FWNA 1ODFA 3REQB 2ZW9A 1FJHA 2KMLA 3DEIA 4QGFA 3EYWA 3T9AA 4YPFA 1Z6YA 2Y0CA 4B75A 5C37A 4UEJA 2CK3A 2OLJA 1QHIA 2JCYA 4LBYA 3V7UA 2HW8A 3EXG2 2J0QA 2TYSB 2B5VA 2CDBA 4BNUA 3RKSA 1C7EA 1JHYA 1NMXA 4G0VA 2P91A 1JJFA 4WIAA 2ZT5A 4IXWA 1X13A 4V2IA 5IAAA 2FEOA 7ADHA 6ABPA 1CJUC 5FI5A 3QYAA 3MWFA 1UZUA 4C0JA 1QZTA 4KR6A 3DB1A 3SQDA 4DCPA 2J45A 4RH3A 2BISA 1OX5A 3BRWD 2PGNA 3DVRX 1UADA 4M9CA 1CLUA 2OK7A 1UK7A 2B99A 2GPJA 3STYA 1YT5A 1PLJA 2WMNB 3GJ4A 1H3EA 3H3XA 1H2FA 2KLHA 2GTIA 1H4TA 3GCWA 4CCWA 2ZTSA 3SVLA 2ID7A 1FW6A 3U3XA 1P33A 2JASA 2G80A 1XTSA 3FMFA 3QE0A 4IIHA 4M0FA 2NADA 3I09A 5AXDA 3TQOA 1P7VA 3UJ3X 1Q0TA 4MQ4A 5EE9A 4W5OA 1ZQ1A 1K8XB 1SIUA 4BZZA 4CUJA 5CXQA 1A95A 1KFJB 5EIOA 2I7XA 2CXHA 2RGYA 3H4VA 4NRDA 4B84A 4ENQA 1EYZA 2OVFA 1T4CB 5EXTA 3UANA 2JW5A 1DL5A 4Q01A 4AWXA 2NO0A 2BJWA 3DAGA 1L4GA 3UAZA 4QPDA 3AYZB 3COSA 3ZJ4A 1E32A 4LOKA 5EMMA 221PA 2IJGX 1KI7A 2NYVA 1RRKA 2ZFUA 3TGWA 1ML3A 5JHGB 4DR7B 5HM8A 1EHIA 2JGEA 5EQTA 1C1XB 2HQOA 1YAHA 2JLRA 4GOLD 4OYRA 3SR4A 2PRIA 4B81A 1IPHA 1SCNE 4M38A 4B6FA 1OH8A 1B8VA 1XHFA 1DC8A 1JEEA 1LV7A 1TT5B 3O7MA 1IBSA 2G70A 4WQMA 1T0IA 4KFCA 4ZGGA 2HBRA 2BSQA 2XDQA 1CUZA 1MVLA 4YMIA 3W5SA 4C03A 2WFMA 4H0CA 1WD7A 3KTAA 1LV8A 4S1NA 3WNBA 4BP1A 4H6PA 3AJRA 4IH9A 4MI9A 1RI1A 4EJSA 3UMMA 5H7XA 3U26A 3FSEA 3QW2A 4UOQA 3K53A 1VHWA 4CM6A 3UWPA 2BFEA 3EEQA 1DFGA 1C7JA 1HLPA 3PP8A 3KOUA 4NG4A 4QM7A 3DBVO 3FYDA 5AVKA 4Y2VA 3U7FB 5CGQB 1O6FA 4LFAB 4L6IA 4TM7A 4UDXX 1GRNA 3ZTWA 4DS3A 1OAAA 3RGGA 4Y9TA 3T1VA 1PEYA 2G7MC 1NVXQ 2IPXA 2QGFA 4MUGA 3M49A 4ZOLB 3K73O 2IGTA 2RFLA 3I1IA 2JJMA 2R8EA 3HL4A 1T10A 4DT1B 2GCGA 1OAOA 3ER6A 1NQAO 2QD4A 3FWZA 3N75A 3GJRA 5DTMA 4CM9A 1TYEB 2WSBA 1S2GA 1GT6A 4TLLB 2RHJA 4JXJA 5K01A 1X1SA 1CT9A 2M98A 4LPKA 2APJA 2BRUA 1H3NA 2PANA 1ACMA 4MVJH 4RENA 5D3MB 5EQDA 2M6LA 2D7JA 3ZBTA 3W0LB 4ARSA 4ZWNA 3GLGB 3QYJA 4X24A 2W83A 5B1HA 4BMCA 1OFUA 3J7TA 3A1WA 2J7PD 4X1KB 3C7DB 1NG9A 4BV9A 1GNQA 1GEGA 3DEHA 2AL7A 1W4RA 1QX4A 1TF7A 2VAPA 4JSYA 1SU7A 4EIWA 2GM9A 1FP7A 2Z1MA 2ZT6A 4KX3A 3ILYA 1N92A 4P5EA 3X1ZA 1AA9A 4AKGA 3H86A 3TZCA 4MV6A 2B94A 1Z9BA 4D8UA 4P34A 1B0PA 3OESA 4YAGA 3FUUA 4FS3A 5LA6B 4M3NA 2ILTA 2HRRA 1KEKA 3OOEA 3AY0A 1UP6A 2TMKA 2VJMB 3IO3A 2Z43A 3A3YA 3K1AA 3A1VA 5TY0A 2H3HA 3NTVA 5TRTA 3RLIA 3ZWMA 2Z1DA 2ZJAA 4LRYA 3E05A 3GAFA 1V8OA 3UUGA 1FDTA 1ZU5A 1XQ9A 1T6BY 1XVTA 2V58A 4JP5A 1Z17A 4R1MA 5FORA 2X86A 3SX0A 1KDTA 1NYLA 3WHKA 5EZ6B 4EB3A 3TVTA 2YOHA 1U8TA 3AL2A 4HB4A 1V47A 4RK4A 1KO4A 1MOSA 2B4AA 1HSOA 1NDUA 4HQNA 2HK9A 4U7GA 5CYFA 5EXSA 2XEDA 4NYJR 1RLTA 1LLUA 1KY3A 1C1YA 3MBOA 3R8XA 3MT7A 4C2AA 5JBQA 5LP6A 1EESA 4PFKA 5GM2A 3ZLBA 1VMEA 3PQEA 4LJ9A 2X41A 3F90A 5HIJA 1P62B 2BFWA 5I4BA 3AI3A 3RAEC 1VLZA 1YFZA 3BRSA 3I1JA 2ZR0A 4WXEA 4KPEC 2B6NA 2QQ0A 4MHSA 1O9GA 4Y2XA 9LDBA 5JFGA 5A4IS 4I4IA 1ZHOA 3QXJA 2FU5C 2WG2A 2A1UB 2XRFA 3HHEA 3I73A 2FKNA 3NKVA 2ZCVA 2P4SA 3ENZA 4N9QA 5J1TB 2WTMA 1XFDA 2B92A 2EBUA 4R1OA 5HX7A 3RABA 1IM2A 4QAJA 2XZPA 1OGYA 3AM5A 3SEZA 2ETVA 2FSSA 2F1IA 4F4UA 3OJWA 3PGJA 2QJTA 2RHRA 1N2XA 4H7HA 4HYYA 5IABA 1YA8A 4BEJA 1D2RA 1P45A 4MEJA 4XA8A 2GESA 3MOIA 3N05A 1YDMA 1G16A 5AO9A 4XD7A 3RBVA 2FPGB 5BW8A 2QR5A 3BL8A 3GRRA 1XNQB 2DWCA 1V7QA 2V1UA 4CF7A 1HDRA 1N6KA 1UK9A 4XDHA 2VNSA 3SBXA 2FR0A 1N2OA 1VKOA 2Q2NA 2QZPA 3SHWA 3P4XA 3WAJA 1QCZA 5AXBA 4TQUS 2Z2XA 4C1NA 2P9HA 5BWOA 4OHCA 3RHZA 3OECA 3WYBA 2B83A 1MEJA 1Z0JA 1VM6A 4I8IA 4FB4A 4AL4A 4D80A 3T7KA 4MR8B 4X20A 1I6KA 3VAZA 2Q6KA 4TQ9A 5T3YA 3PIDA 5K3BA 4ACBA 1JIVA 5AXCA 1ZOIA 3EVAA 1E4YA 1NTRA 4OYHA 2NUAB 1OWNA 4NZMA 5LLSA 4AJPA 4C4AA 1LLDA 2DERA 2GBCA 3JR7A 3OTIA 3O8BA 3I5AA 4IXMA 4R54A 4BVJA 1GKYA 2ZIFA 4N7JA 1E6EA 1Q1GA 5FUBA 7REQB 1T5DX 4EPYA 1W1UA 4YT4A 2ZRQA 4DV2B 3OX4A 3CLRC 3LRXA 2PRJA 2V7VA 1RLJA 2CNKA 3I2KA 2MINA 3NDRA 4AUKA 4EW2A 1DX6A 5JCZA 3DT6A 2GZAA 4IUCS 1GPDG 2MWMA 3ONVA 2VRNA 2GF0A 2PTHA 1IBMB 3CW9A 3DOFA 1PG0A 3WBKA 4G4SP 5T67A 1M0SA 2R6HA 2V0CA 3FUCA 4XB6B 5L95A 3CX3A 2IOHA 2WJGA 4ZCSA 4EF5A 3LXUX 1YS2X 2IZ5A 1R66A 2V0NA 2AZ4A 1ZGBA 2G9RA 2YWJA 3OCVA 3UM9A 3HDHA 3SVZA 5LXTF 5IF3A 5JBNA 4DEXA 4K1XA 5HCUA 2DBRA 3V7YA 4ZV4A 4GYWA 4K9OA 1C3OB 5LKRA 4PO1A 1MX9A 3KXLA 3WYAA 1AV7A 3N2GB 1MDBA 4ALIA 3K9NA 3FBGA 3LPDA 5BV8A 3U1BA 3THXA 1OFVA 1QGED 3UW3A 1Q19A 3ANXA 3R0JA 3I04A 4KWCA 4C0XA 5HS4A 3VU9A 2FSVC 2C78A 1K3UB 4HGRA 3MRVA 2GAIA 3ZD6A 5A0TA 1ESDA 5LZ5A 4EPWA 1NPDA 1R0WA 2O5EA 3T15A 1X74A 4UM5A 5TVGA 4U7FA 3TVDA 2C7OA 5F23A 4P22A 1ZKDA 3C3CA 1UBKS 4GXRA 1E9EA 1LGYA 2DSTA 1Z56C 2PH3A 1Q0LA 1GAWA 4N3NA 3F8TA 5DHPA 3S2FA 1SO8A 3T5TA 3OCYA 4E08A 3ADDA 4WKBA 3OIVA 4Z49A 4DE5A 5JAIA 2PRYA 1U31A 5LL6P 1Z45A 2GHIA 2ZU0C 3T1TA 2XKKA 3CVVA 2ZZNA 4II3A 3T4PA 5DHTA 3LBHA 3KZXA 2O2YA 4JYPA 1MABA 4CIWA 1WUIS 4QDKA 2NWQA 4NE7A 1F38A 4OXIA 4PN7A 2PWBA 4U2DA 5H16A 5HXAA 3HUUA 2J0EA 3HJFA 1RHMA 2BYTA 1D9ZA 3O8OA 1V8DA 2CUTA 3N5KA 3ANTA 2EP8A 4MUKA 3E15A 4MRNA 2BH2A 3K0CC 1XLWA 5BR4A 1WW8A 3DWGA 3F47A 1O0SA 5HA5A 1IB6A 3PGA1 1S1CA 3D1VA 3C8MA 1S0UA 1JQDA 2GLXA 1I7LA 1N6RA 1Z2AA 3DXZA 3GRYA 3H16A 4RHUA 4TMVA 3W6UA 2CDNA 2XOKD 3AUKA 3M1LA 1YTLA 5ALJA 5COBA 3ORRA 5TNXA 5BWNA 1MT0A 3P2EA 5EG5A 3VDXA 2QKYA 4ESHA 1MC4A 3TEMA 4ZMBA 5JG7A 1AF4A 1SKQA 3PDIA 4J43A 2PH5A 1PLKA 1RJWA 2H4JA 2QG4A 1VSTA 4OX9B 1PHPA 4WLNA 2XVMA 4FIZA 3T3GA 3ZDBA 2FK8A 3R3VA 4LRWA 5FTMA 3AR9A 2XCSB 1RWMA 3DPUA 4ASUD 3SKVA 5D3KA 2FRDC 3ZE9A 1NXPA 3PRHA 2B37A 2EHJA 4RTOA 3PKZA 1MJGM 4G67A 3K2EA 4OOEA 5TPWA 2V9PA 4OCZA 2P2DA 2V7BA 3LKZA 2X8BA 5JNWA 2ZATA 1N8SA 3BM5A 4HJXA 4Z2YA 2PMKA 2JIPA 3L7CA 2HRCA 3QVMA 4RDCA 1V43A 2EL7A 1CY0A 3K4HA 1XU7A 4Y7DA 3VTFA 2OCBA 2ZPAA 3SEFA 1OBVA 5GONA 4DW8A 4H3KB 5KYGA 4I4LA 5I7SA 5J1SB 3IT0A 3T3MB 1I30A 3OEHD 2J3LA 1ZRSA 1UODA 2Z9DA 4R9NA 3UJNA 4ISCA 4C89A 2OPBA 2QM7A 4L78A 2MINB 3HEMA 4ZK6A 4IMIB 1EVJA 3V7NA 5BV0A 4S04A 1N5IA 2BMAA 4TXLA 3QGMA 4KE9A 5HKLA 1O96A 4QBIA 1KHHA 4TKVA 3OURA 3WK5A 2GJSA 1JJAA 3CUYA 4G0YA 4GFDA 5JCJD 1M7HA 2PPVA 3EMKA 1U0HC 3PLRA 5EKUA 5K8CA 2GO1A 1GU7A 1QK5A 1BQ3A 1KORA 4OFWA 1C1DB 1RQXA 4FWTA 4Q7LA 4KI7A 2ZP1A 2H2AA 3C6XA 2H4ZA 4ZI5A 3TNDA 4OQNA 4JLOA 3IIJA 1ZCJA 5LWQA 4A5SA 1G38A 3U60B 3QYFA 1DO0A 1IBLB 3R40A 1NMQA 4RH1A 4YRTA 5BSGA 1JPVA 4G97A 2OCIA 1P44A 5L40A 2CDRA 1XJ5A 2V4UA 3NEJA 3DZGA 1Z4KA 1PZEA 3IBCA 3QITA 3WGTA 5LQNA 2YZ7A 1XDSA 1O08A 3DE5X 2YVLA 2HU8A 3IDSA 3G5LA 3TW8A 2C31A 4H15A 1SR8A 4N5MA 4ZYLA 5FX2A 1U9IA 3D8UA 4TL6A 2PQ0A 2WSSA 4C7XA 3GJQA 5KAPA 1IYZA 1EXWA 5MN5A 1SVWA 3OZAA 1GPH1 1C1DA 1YS9A 1UMKA 3U3RA 1AKNA 4JLJA 5EVJA 1Z3CA 2OORA 3EGOA 2P35A 1EBUA 2PYZA 2PKRA 2DPYA 2OFWA 3URMA 2V96A 3Q9NA 2CLLB 1LNSA 3DE6X 3Q6NA 1C4WA 1YR6A 3F3KA 4QTTB 3H4MA 5BSTA 1PL0A 2H2WA 3CF4G 4OJTA 3GUUA 3HCOA 1G2OA 5K09A 1MO2A 1U0TA 2TECE 1I24A 3CLTC 3EZNA 3FDFA 3GCZA 3HQ4O 3PPVA 1J8QA 3CUSA 4P3KA 1YAJA 4YCMA 1FUUA 1DWPA 2X5KO 1XJQA 3HLKA 4MB6A 1KPGA 1NWHA 4MYTA 4ZVPA 3TW8B 1UDXA 3HG7A 2C2WA 3AILA 1ZJ4A 4CODB 2AMVA 4JI3B 4ZZ0A 1F6BA 5DN6D 1LUAA 4DMCA 2JNWA 4NXMB 4RCVA 1O97D 2QE6A 3V34A 1XQYA 2J0UB 4DIKA 4QXOA 4D9EA 1INLA 3RIMA 3I76A 2OAQ1 2A78A 3K35A 3T12A 2JI4A 2YOFA 2Q21A 3CUKA 3QFTA 4MRPA 2B61A 1I80A 2FX5A 3NDBB 1YE8A 1M66A 1HURA 4DNQA 2XH8A 1L5SA 1WU8A 5BN4A 2JFOA 4UZSA 1Z73A 1X70A 2HK7A 1K4YA 5HTOA 3PXEA 1DQNA 2JK0A 2PKYX 1NAHA 3E9ZA 1DKUA 3L4BA 4WZBA 3H6GA 1COWA 4DWWA 2WPDA 3RARA 4HXGA 2GEVA 5J2UA 5J2TB 4K2HA 3EZ9A 4XXHA 5GZ6A 1TCVA 4RSGA