1PWZA

Crystal structure of the haloalcohol dehalogenase hhec complexed with (r)-styrene oxide and chloride
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
252
structure length
252
Chain Sequence
STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERWPGMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords halohydrin dehalogenase
publication title Structure and Mechanism of a Bacterial Haloalcohol Dehalogenase: a new variation of the short-chain dehydrogenase/reductase fold without an NAD(P)H binding site
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Lyase
total genus 89
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pwzA00
1E1LA 4KUEA 4GPD1 1O5IA 3S2IA 2G5CA 1B26A 4E6PA 3QVWA 5L7WA 3WX0A 3O4RA 3LYLA 2VHYA 2YJZA 4JBGA 3DAFA 4NZ9A 3WGZA 4YT5A 4Z0PA 5CPBA 2NTJA 4BNKA 3IUSA 1Y9EA 3UW3A 2I3GA 1R4NA 1GUFA 1NQAO 5IG2A 3TNLA 3C7AA 4HBGA 3C24A 3V2UA 3TZQA 1OFGA 2RIRA 4D43A 5C7LO 3UN1A 3KETA 2X9GA 2SCUA 1AHIA 4ALKA 3TF5A 1K89A 5ADHA 1SOVA 3RASA 1GV1A 3E82A 5F3RA 1TXGA 5EPOA 4XGNA 3Q9NA 1PL7A 5TGDA 2RHCA 4B4UA 1X7DA 2YHIB 2EJVA 1YE3A 2Q1UA 4M54A 4BKPA 5CHEA 4ZRMA 3D5QA 4CM4B 4S3MA 2WYVA 2P91A 4ZA2A 4AJLA 4KTTE 3OJEA 1EEHA 3C1AA 1W6UA 2ILTA 2YDYA 4PCVA 5FF9A 4B8ZA 5HWSA 3ANMA 3NUGA 4N54A 3TZHA 3PFWO 1OI7A 2P68A 2ZYGA 3ZNQA 3H4VA 1A4IA 4CLEA 5I8WA 4B4VA 5GZ3A 2H6EA 3EAGA 3ZWAA 2BGKA 1DXYA 4MKXA 5C37A 1PQPA 5IZCC 1Z75A 2VRCD 1XKQA 2Q2VA 2QQ5A 2VRBA 4R1TA 4CUJA 1VL0A 2NU8A 1BHSA 2ZB8A 3QRWA 2B36A 2HQ1A 3A28A 1LU9A 2UDPA 3FN4A 3ST7A 5IZCA 1LQUA 4H7PA 1O94A 1WXDA 1Y8RA 2Y1FA 3F5SA 3SXPA 5B4UA 2AQIA 2DFDA 4IJVA 3VOSA 1LRJA 2ZTUA 1A7KA 1WMBA 4NJMB 1FK8A 1I2BA 2UV8A 1AN9A 4CQLA 2PZLA 3DZIA 2DT5A 3K96A 3VC7A 3BTVA 3FR8A 4FS3A 4YBZA 1ISIA 2W2KA 3CPSA 3DBVO 2D2IA 3NT4A 3AFMA 3WWZA 3KEOA 4OKIA 3ZWOA 3RUAA 3W8FA 5JMWA 4CR7A 5IDWA 2EP7A 3EW7A 1J5PA 5JC1A 1Q7CA 3PGJA 5HS6A 4U5QA 3KLMX 3ZV5A 4XWYA 4BGIA 4ZQFA 3PDUA 4UVGA 5EIOA 4QEDA 1LI4A 3GMSA 2Z5LA 3DOJA 4DC1A 2R2GA 4WNIA 4DYDA 4EUEA 4MO2A 1ORRA 1A9YA 1U7TA 3OF2A 5I7FA 5L51A 1SB8A 3CKYA 3ON5A 2HRBA 4ID9A 4Q3BA 1I33A 2HMVA 3TN7A 4RL6A 4RPLA 3V1UA 2YHIA 4BV9A 1EFKA 1JWBB 3ZWCA 3M1LA 3PK0A 4HNGA 4CM4A 5CDTA 2IRWA 1A7AA 1JTVA 4YR9A 4NBUA 3H7AA 3SC6A 4XDYA 3ZWXA 3UCEA 4CQMA 3K2EA 4GVXA 4QQRA 3F4BA 1B7GO 5COBA 4RGBA 3I52A 1DHRA 4FCCA 1C14A 1BMDA 5THKA 1EMDA 1YONA 5BNFA 3VVCA 4KQWA 4CM1A 3ENNA 1CQJA 1KEWA 4NHEA 3ZV4A 1Z7EA 3I5MA 4AVYA 4GX0A 3GVIA 3K92A 1ZKMA 3AWDA 2GPTA 1XSEA 4BQRA 5CEFA 3JD4A 3JQFC 1LLQA 1NYTA 1H6AA 2EWMA 4QO8A 4DPKA 4ROSA 3D3WB 5T5QA 1PSDA 4NJMA 3B70A 4KWIA 4MVJH 3W1VA 3VAZA 3KHUA 1W0CA 2F00A 3FNFA 1PS9A 5K6AC 2P9CA 4OXKA 3B1FA 4UEOA 1MP0A 1MX3A 3O8QB 4CPDA 1ADCA 4CL3A 4HX5A 4I9NA 4JGBA 5L4NA 2CF6A 2IZZA 2GERA 5K6AA 1OAAA 4CLXA 4E5YA 3GDGA 4MIYA 5I9NA 4KOAA 4GQAA 4I5DA 2OXIA 3WIDA 4YCAA 3QWIA 3ADPA 4D41A 1H6BA 1QLHA 3S8MA 1Z6ZA 3X2FA 3RUEA 2J5QA 4RVDA 3O03A 2OO5A 4HADA 2IXAA 3F9IA 4IS3A 4FFMA 1XU9A 4EEXA 5TJ9A 4RZHA 4F6CA 2PD6A 5G0VA 1TVEA 2O48X 4JJIA 2C54A 3ZHYA 5JAQA 2GASA 1M6HA 4RF5A 3CEAA 5U4QA 7ADHA 1CERA 1FMCA 2GYYA 4CLDA 4DVJA 4E2XA 1LDMA 1DJNA 3E8XA 2R00C 4Q3NA 4R1SA 4O6VA 3GVCA 1M66A 4S1VA 3AOGA 3KTDA 3TL2A 3JQAB 3GNTA 4TKLA 4DLBA 1LRKA 4Z3KA 4IDEA 3ZI0A 3RUHA 1Z7BA 1DDOA 4Y8VA 3KVOA 4QECA 4YA6A 1LX6A 4LMPA 3QA9A 1SNYA 1E3JA 5HRUA 3UICA 4IMPA 1DFHA 1J6UA 2V7PA 2XPCA 3PIIA 5T6BA 3RJ9A 1H0KA 1Y6JA 1XGKA 2O3RA 1GAEO 4PG6A 1SC6A 1ZK3A 1PJ4A 3DXFA 3AU8A 2G17A 3NX4A 3NTOA 4D0RA 1SZJG 1XR3A 2NNLD 4FC7A 1DC3A 2Q1TA 3QQPA 1GV0A 2QYTA 3WOHA 4ZU3A 3SLGA 4CV1A 2O4CA 4TVBA 2EV9A 2YHUA 5A5EA 2ZKLA 3DZFA 3D3WA 3LF2A 3ZWWA 4IQGA 5ER6A 1JN0A 4O5OA 4BO5A 4IINA 3EVTA 3KBOA 1U1IA 3PYXA 2OUIA 1OMOA 1BVUA 1TLTA 1ZSVA 2JFGA 2J3JA 2P4HX 4R01A 4BO7A 4ZGWA 2PV7A 2IYOA 2EXXA 5GZ6A 4J4BA 3DB2A 2Y1DA 4YXFA 1E3SA 2E82A 1PL6A 5A3VA 4CM6A 4L74A 3DHYA 1OOEA 1VLLA 4YWJA 3ZH2A 3PHJA 3RAJA 1HZJA 3VPSA 5IDXA 1C0KA 5TIIA 4GKBA 1GZ6A 3RBZA 3VDQA 1YDWA 5DP2A 5L53A 3M1AA 2PTGA 4ND3A 2EGGA 4OAQA 5ICSA 2XOXA 3DC2A 2GD1O 5TSDA 1PZGA 1VJ0A 1SB9A 3QE3A 3WYCA 1GCUA 3KSDO 1U8FO 2VYVA 4BMSA 1SOWA 3PQDA 2BD0A 3KM0A 4KQXA 1MFPA 1ZIDA 2IE0A 3C1OA 5T64A 2V6MA 3IJPA 1QORA 3L6EA 4I08A 3WLFA 1DIHA 1H94A 4BO0A 3ONEA 4FGWA 1YB1A 4XRGA 4OO3A 5FEUA 1K6XA 3NAQA 1GTMA 1NHWA 1GYPA 2BGLA 3IJRA 3V8BA 2NVWA 4LISA 4CMKA 3GNQA 3BIOA 3DHNA 3JQAA 3PJDA 1QSGA 3B6ZA 4DBVO 4TROA 2PD4A 4FW8A 1LSOA 2YY7A 1T26A 3HFGA 2P9GA 5FFFA 3HNPA 3VPGA 4PLHA 2AEFA 4MIEA 2CVOA 1P1IA 4E2WA 2J3IA 1AXGA 1H9AA 2Q99A 2E48A 4LW8A 5C7OO 1F06A 2BFOA 1U2DA 3OP4A 4B3IA 4CR6A 4ZN6A 2YDXA 5EMHA 4KUGA 5L45A 1B8VA 1ZUD1 2JD2A 2JHFA 1BGVA 4E0BA 3LC1O 1ZJYA 5JO9A 3FNEA 3HN2A 5DDIP 3WFIA 3G0OA 3GH3A 4HFNA 3FWZA 4NFHA 4DLLA 4OYRA 3CIFA 3JYOA 2OP1A 1Q0HA 1NFFA 3AUTA 1SO8A 2Y67A 4GAEA 3S2FA 3KUXA 5EQDA 4CMCA 5B4VA 2QRLA 1RM5A 3DAPA 2Z1NA 3H9GA 4PGFA 4JBHA 3F6YA 4RLSA 2JCVA 3A4VA 1R16A 5KWEA 3PJFA 2V6FA 4YAEA 2EKQA 2CDAA 1HYGA 5BR7A 2W98A 5KVVA 2I6TA 1U9JA 3GZ4A 3QVTA 4EJ0A 1JW9B 2NQ8A 3TZKA 1F12A 3ZNNA 2EGHA 1ONPA 4A27A 3UCXA 1YJQA 1H2BA 2H5LA 3E9MA 2QIOA 1NVMB 4MVJP 4W9NC 5CDUA 1LXCA 2ZYAA 1PS8A 1PTJA 5B4TA 2FZEA 2QRKA 3DOOA 5A03A 4JCOA 4EBFA 4W9NA 3WYBA 3ENKA 4J43A 4B8WA 2YFQA 1F8FA 3CH6A 1GFSA 3RI3A 3I83A 1XYGA 2VN8A 4GX1A 2ZIZA 4M49A 4BO4A 4E13A 3B1JA 4L76A 1BTOA 3OIDA 3T4EA 2A94A 2J5RA 1R15A 1UAGA 2ZB3A 1ZK1A 1YWGO 1VL6A 1DIAA 2VUUA 4ITUA 4ND2A 4Q3DA 1UP4A 3EZYA 4R68A 4YEDA 3TFOA 2J8ZA 3MCVA 1C1DB 3JYNA 4WK6A 5I7SA 3HUDA 4IUYA 4U6QA 2Y1EA 4XKJA 3ZU2A 1DLIA 3PGXA 1CQIA 1MXHA 3INTA 2DBVO 3WIEA 4AJHA 4IZIA 3TQHA 2FPPA 3FWNA 4J2HA 5T57A 2Q2QA 1EE9A 2E4AA 3NJ8A 1GCOA 3A06A 5JE8A 1FDVA 3LQFA 4XD2A 3W4IA 5F21A 1ISHA 1UZNA 2AQHA 4AJKA 1UR5A 3OETA 1D1TA 3MEQA 5KKAA 2R6JA 5DCUA 4ZJUA 4NFSA 1TA4A 4TRNA 3EUWA 2WMDA 3D1LA 1MA0A 3Q2KA 1EVZA 1O6ZA 1XEAA 3GFGA 3HB4X 3JQ8B 4Z0HO 2CF5A 3RC9A 2C29D 3L9WA 3DONA 3OA0A 1IYZA 4YACA 4CM5A 1UAYA 4RPGA 2FPIA 2GZ2A 1ZSYA 2PKQP 2GO1A 1YS4A 1YXMA 3WGTA 4A5OA 3GEMA 5DOVA 1WVGA 4OOFA 1RM4A 3CZRA 4DGSA 3EDMA 3OMLA 2X0IA 3GNSA 5TS3A 1YBMA 3RVDA 4CV3A 2GNAA 4J4TA 3LC7O 4WLEA 2JCXA 2X0RA 1NXQA 3NTQA 1IULA 2FN7A 3GR6A 2B35A 3DO5A 3HSKA 5C5IA 2GZ3A 4J9VA 1DJQA 2WWRA 1F17A 3GOHA 1ZZEA 4ND5A 5ENVA 4DA9A 5JDIA 4W6ZA 3RD5A 3T7CA 2RBEA 4R51A 4J1QA 4A10A 1H6DA 2Q4EA 2HUNA 1UZLA 4R16A 1WW8A 2Z1MA 3AU9A 5ER9A 2QZZA 3Q1LA 3TFQA 1Z73A 1KERA 5FI3A 3KSZO 1XQ1A 1ZXLA 4BNWA 2BF7A 3ZWBA 3TJRA 3WXBA 5KTKA 1A9ZA 4FJ0A 4HFJA 4FJ2A 4QX6A 1YBVA 4N5MA 3GY0A 1LUAA 4G2NA 2ET6A 2NSDA 3OJOA 3LU1A 4IQ0A 5F5LA 2ZTLA 1C1DA 3GA0A 3U4HA 4FJ1A 4OOEA 2OP0A 2Y0DA 4L8VA 3SEFA 3BHIA 5COQA 1T25A 3JQGA 3H6KA 3KO8A 5G0WA 3S2GA 3E5RA 4NR0A 1GDHA 4FFNA 4Q39A 1S7CA 1VI2A 2WYUA 1K2WA 3HDYA 3T7EA 4YJGB 1ARZA 2RCYA 5BSFA 3KYBA 2IZ1A 4AJNA 3OM9A 4R9SA 3H9QA 4J7UA 1CETA 1QYCA 2VQ3A 2ZJ0A 2FOIA 1DC4A 3JD0A 3C7CB 4NDNE 4F46A 4RDIA 3PHHA 1LDGA 2PY6A 1V3TA 1ID1A 4GMFA 4CM8A 4LCEA 3U0BA 1RYDA 2BFPA 1X1EA 1HETA 3VTFA 3WDSA 2HMSA 2JKVA 4N5NA 2EJWA 2I99A 7MDHA 2FRDA 3FBTA 2V6BA 4WLOA 1E3IA 5DT9A 4EJMA 3JQ7B 1KY4A 4PRKA 4FGSA 1RKXA 1R4MB 3DFUA 1RPNA 1VC2A 4KTVE 2ZQYA 1NM5A 1UZMA 2UUPA 3AW9A 3RC1A 3VPXA 1WZIA 2Y68A 2YYYA 3R3JA 4ZQHA 2D0IA 2P4QA 1PS0A 3FHLA 1T4DA 1T24A 2Q3EA 5C3MA 3G79A 1ZJZA 3L4BC 1PIWA 2UAGA 4ZQBA 4EGFA 5CDGA 2OOSA 5EJ2A 1NPYA 2O3TA 2DBQA 4YQZA 4OMUA 3L77A 1ENPA 3ROQA 1PQUA 1U4SA 2VWGA 3DQPA 2XXBA 1Y8QB 1K6JA 2PKRA 4MVJF 3VPHA 1ZK4A 2Q4BA 3QHAA 4YJFB 4IXWA 2JD0A 4OXNA 4R3WA 2WE7A 1J49A 1XG5A 5A3JA 4B3HA 2E49A 3GUCA 3D3EA 4R54A 2X9VA 4UEKA 1QG6A 2OORA 1Y1PA 5F1KA 1I2ZA 4XQCA 1Z45A 1HSZA 4XR4A 1Q7BA 4JX8A 3U5TA 2O3UA 4ALMA 4GKVA 3I4CA 4CMJA 4ZVVA 2WTBA 3OICA 5TQVA 2X1HA 3NYWA 3H5AA 1HDRA 2YV3A 4NPCA 4ND1A 4Z9FA 3AY7A 2W90A 4UVIA 2BHLA 1CJCA 2O2YA 2VOJA 2QW8A 2X86A 3QSGA 2CZCA 1UUFA 4HUJA 3DR3A 2J6IA 1R0LA 2CDCA 1SEVA 5H82A 3UCFA 1KVRA 1U7HA 3WGGA 4KMSA 2HK8A 4NFYA 2FR0A 3GVPA 4PLCA 2NU7A 1YQDA 3P2YA 5L7YA 3VZRA 3ZWNA 4BMNA 3MTJA 4BGUA 1XHLA 4GBJA 5KCZA 4AJ1A 4GSKA 3GHHA 5LC1A 4RPJA 5CP8A 3AK4A 3ANNA 4WLUA 3JQ7A 1NQTA 4A2CA 1YB4A 1W73A 3WQRA 1HTBA 1YDEA 5JFOA 1R4MA 4D42A 4O0LA 3P5SA 4KZPA 3MOGA 2Z95A 3INGA 2EF1A 4IGEA 3GF4A 4D0SA 1HWYA 3U4CA 1PR3A 2C20A 3RFXA 1CDOA 3ONDA 1YL6A 5GMOA 3G17A 4GX5A 5B37A 5JY6A 2VYVD 5A9SB 1LLCA 5L3ZA 4LVCA 1BDBA 1ZNQO 3MJSA 4WOJA 5KVSA 3UFXA 3N58A 3RU7A 4J7XA 4ONEA 1WZEA 1GEGA 4O63O 1ZXBA 5IDQA 2H63A 1E7RA 3PIDA 5F5NA 1ISGA 1XIVA 1P0FA 1E7QA 2HLPA 3PDJA 5IDYA 4YJFA 3MJTA 3JQAD 3NGXA 2C0CA 4CMAA 1IB6A 1EQ2A 3D5TA 1VJTA 4E12A 3ZZNA 4Q3EA 1WP4A 3H3JA 1GEEA 4F3YA 4GI2A 3QIVA 1GZ3A 1HDCA 3U9LA 4AL4A 3H65A 3G3EA 2NTNA 1I24A 1VKNA 4AICA 4OQYA 3W8DA 2OMEA 2PA3A 5CG2A 4AJIA 1IPEA 3WFJA 3RUIA 4C4OA 1X0VA 3BMOB 2YZ7A 2DKNA 4FQ8A 2YQ5A 2NVBA 3WSWA 1A27A 2PWZA 3NT2A 3RBVA 4DWVA 4RF3A 4Q3AA 4EITA 4DPLA 1BXGB 1LC0A 1B8UA 2DPGA 5AXDA 1P31A 1M2WA 1B2LA 4XCVA 3BMNB 4IS2A 1UXIA 4J16A 4AFNA 3GLQA 5JBIA 1HDXA 3VKVA 4E30A 1UXGA 1RM0A 3DTTA 2D4AA 3AUAA 2IXBA 5JLAA 2UUOA 5G4KB 4IPTA 1X1TA 3AY3A 1ZK2A 2FPGA 4BS9A 4BO3A 3V1TC 1I01A 2X0JA 1ZK0A 3CINA 5AVOA 3TDKA 2ZTMA 2AEJA 3IP3A 5IZ4A 1DB3A 1C3VA 3CTMA 3HFSA 1P1JA 2AMFA 5FI5A 4XQ9A 5AXCA 2VWQA 4O1MA 5A9SA 5HA5A 3IOYA 1E3WB 5JDCC 4F45A 1V35A 5EESA 4RPHA 3RFTA 4PG8A 1B3BA 3ZV3A 1GL3A 4E33A 4BB6A 4EYEA 4CODB 5CG1A 2JL1A 1I5RA 3OJFA 4IXTA 4B7XA 3U4IA 5K0ZA 3OA2A 4DBZA 4DTIA 2GN4A 2WD7B 3BA1A 1LC3A 2FWMX 4FC6A 3K6JA 5DULA 5AOVA 3O9ZA 1DBVO 3NRCA 4HNHA 1CYDA 1NBOA 2VT3A 1E3LA 2NWQA 4UULA 1HDYA 1M6WA 2FY8A 4FBGA 1I8TA 1ZEMA 1NR1A 1U5AA 3AM3A 1CRWG 3ZHXA 4E5MA 1E92A 4IIUA 4GH5A 4J91A 4L9RA 5T8KC 3V5NA 5CAEA 4DQXA 1ISFA 1XDWA 3GRKA 5B12A 3WTBA 1BXGA 1YBAA 3CZMA 1DSSG 1UH5A 1NPDA 2J3HA 3M2TA 4XJSA 3RUDA 3BMNA 4A7PA 5T8KA 1LDNA 1YQXA 3CUKA 1T2CA 2PZKA 4M55A 4D45A 1U28A 3JQFA 4CM9A 2QZ9A 3HHPA 1N2SA 4J0FA 1QRRA 1T2EA 4TMFA 4BMVA 3PP8A 4B79A 4DXHA 1E7SA 5ILOA 1PZHA 9LDTA 3AI3A 2W4QA 3GPDG 1NPTO 1RYEA 2NADA 4GGPA 4NQZA 3Q2IA 3JD1A 4D79A 2EHDA 5JCXA 2OHXA 4W4TA 4CV0A 4E31A 4JIGA 1I10A 1X7GA 2GN8A 4KP7A 3W4JA 3NDIA 4GWGA 2GUGA 1E3WA 5FYDA 4UREA 3I3OA 5A4DA 1V6AA 3PYMA 1ZMOA 2P2SA 3QLJA 5KIAA 3JYQA 3QWHA 3H9JA 2OZPA 2HAEA 4H16A 3FF4A 2Y1CA 5G0TA 2OFPA 3NEPX 1HE2A 1E5LA 3ETDA 2BFMA 4L4RA 1BXKA 3DMTC 3P2OA 4MVJA 2QRJA 3GAFA 1UJMA 4GLOA 4JN6B 3UGKA 1T2DA 2B4RO 5DCWA 1UXKA 5JPIA 4YAGA 2DUWA 2WD7A 2LDBA 4J1TA 3PFFA 1Y5RA 5DCYA 4MVJG 1W4ZA 1QV7A 2F1KA 3K2BA 4MPDA 4UUMA 2IDZA 3JQEA 4AG3A 3NTRA 3IIEA 2R00A 2X4GA 2YFHA 2JJYA 3HB5X 3Q6IA 3QWAA 1TT5B 1KBZA 3AOEC 3PJGA 4BIIA 5KOIA 1Z82A 3OJ0A 1XLTA 1XQ6A 3G49A 9LDBA 2CVQA 3DZKA 1NAIA 5H83A 1P44A 3KSUA 2QX7A 4E2YA 1IE3A 1OC4A 1Q7GA 3AOEA 2QG4A 4NBRA 5L4LA 4RPKA 1QMGA 3EY4A 3JYPA 3GK3A 1NFQA 4O59O 3U49A 5GY7A 4BKQA 2CY0A 3ZWMA 5CPFA 4R3NA 3I1JA 3QWBA 2C7GA 4OIMA 4TSKA 4WASA 4BUCA 1MFZA 4C7JA 3R0IA 3TOXA 4B4OA 3OQ1A 3BYZA 3ZWVA 1P9LA 3JQBC 3KZVA 4ESOA 5DBFA 3TPCA 1H93A 3O8QA 4QFDA 2WSBA 3DHEA 3AM5A 4PRLA 3E1KA 2HCTA 4MVJM 1E6UA 4R5HA 3JQBA 3WGHA 1NX6A 1RWBA 1AGNA 3JQCA 1N92A 1KETA 2AHRA 1P45A 1NVGA 4I8XA 1ISJA 3GRPA 4WCFB 4EDFA 3RU9A 1MB4A 3FD8A 5A02A 3GDFA 5CEEA 2J3KA 2HSDA 2AW5A 5J23A 1I3LA 3C7DB 1V8BA 3SC4A 3ULKA 2O4UX 1FDSA 2ZK7A 3BXXA 4BKOA 3ZDFA 3PQEA 2CUKA 4NU5A 3MJ4A 3KB6A 2G82A 3ETGA 4JBIA 1IUKA 2Y0EA 4L4XA 4LN1A 1KOLA 3PQFA 4WUVA 3ZCXA 2HJRA 2VHWA 2VUSA 4BNUA 4BVAA 5JXWA 1PJLA 4E5KA 5DP1A 4MDHA 1JVBA 4Z6KA 3VH4A 1DIBA 1ADBA 3KYCB 2V65A 1PGPA 3TSCA 4R1NA 3SLKA 2V6GA 3NT5A 4RVFA 4L73A 2VYNA 3HWRA 2JFHA 2ZB4A 3RUFA 1I3NA 4E21A 5L40A 4RQUA 2A35A 3WNQA 1DRUA 3QP9A 4IDBA 1WLYA 3C1TA 2CD9A 5KKCA 4UUNA 4D3SA 1L1FA 3LT4A 1LDYA 2GDZA 3RJ5A 2EEZA 3E48A 4MP3A 1I3MA 1MXFA 1PGJA 1EVJA 1YGYA 1I2CA 1BXZA 4J1SA 3E9QA 2VZ8A 5KVCA 2NVUB 4HV4A 3I9OA 2VTDA 5TRTA 1BG6A 3LC2O 4FOOA 2WDZA 2AE1A 3OQ6A 4YRDA 8LDHA 4BKUA 2X0NA 1U3VA 3VHRA 4FR5A 1KVUA 5TF4A 4PLYA 2X6TA 3DTYA 1E7WA 1T2AA 3ZW9A 1E7YA 2IZ0A 1KC1A 4BOYA 5JSFA 4YT4A 4TRJA 2Q46A 1DFIA 1U4OA 4AJPA 2Q49A 3IQDB 1U5CA 2IEDA 2RHRA 3VVBA 4DUPA 4WCFC 4I5GA 5EINA 4LCJA 3UH1A 3UF0A 1LDEA 1ULUA 5TT1A 4UVHA 2Q45A 4YPOA 4FD3A 4WCFA 3WJAA 3BHMA 2DPHA 5JAIA 4H3VA 5GZ1A 2EW2A 3ZNPA 5TJHA 3EMKA 4ZHSA 1O95A 4NBVA 4DL9A 1V0JA 3COSA 1O0SA 4Z9YA 1A5ZA 1TI7A 3WICA 3SJUA 1N9GB 1QV6A 1LSJA 3OBBA 1MV8A 1ENZA 4MVJE 3GC6A 4Z3DA 3GGGA 4PG4A 4OQZA 2X23A 2IEBA 1L7EA 4OKNA 5HM8A 3ICPA 4U6SA 3WJ7A 1JAYA 1SEPA 2Q1WA 2ZJ1A 3EC7A 3RUCA 3A14A 3QW2A 3E5MA 4WEOA 3VH2A 1ZMTA 4FFPA 1PJCA 2DAPA 1T1RA 3JQ6A 2TMDA 4TWRA 3D64A 3ITKA 3UHAA 2HKIA 3LLVA 4XRRA 1S6YA 2WEKA 1ZCJA 3NDJA 4P8RA 1B15A 1TEHA 2G76A 3K8ZA 4W7IA 4HFRA 4BNLA 2B37A 1LLDA 3WQSB 1Y7TA 3H5RA 1DLJA 2EKPA 1VL8A 5AYVA 3I9NA 5TX7A 3MJVA 3OSUA 1PWZA 2C07A 4L75A 4BNYA 1MLDA 3HDQA 1LJ8A 3H9UA 3RSHA 4E2ZA 4YB8A 3GN1A 3OECA 3WQQA 4XIJA 4IBOA 4YVFA 3V2HA 4JROA 3RFVA 3IL2A 1E77A 1OBFO 1YRLA 3ROMA 4MJLA 1E0DA 5JCJA 1EBFA 4NNJA 2PR2A 3VZQA 5DBGA 3WMXA 1ZVMA 2G1UA 2CFCA 2CMDA 3AJRA 2BKAA 4FSHA 1EDOA 1NNUA 3ASUA 3MWDB 1X7HA 2Q2WA 4KWHA 3SBOA 2W8ZA 1NQOA 1D4FA 3NV9A 2D59A 2GN9A 1CIVA 5U1PA 5L7TA 4U0JA 4BO6A 1F0YA 1YL7A 4MP6A 4RO0A 4ZQGA 5A9RA 4FIZA 1EBUA 3I6IA 4P4GA 4XQGA 5KJ1A 3WMWA 4WGGA 5A06A 3FNHA 2BMAA 4DMLA 1PJTA 2VUTA 5LDHA 1HYHA 1UP7A 2HK7A 1N9GA 2EKLA 1DPGA 4Y9DA 2PH5A 4C7KA 4EJ6A 5DN9A 4EUHA 1WDMA 3P19A 1YVEI 4LVUA 5JC8A 4PLFA 5EL0A 5CDYA 1PGNA 4OJNA 1HE3A 4RORA 3D7LA 1GU7A 1QP8A 5L95A 4E4YA 1AHHA 1GQ2A 3ZGYA 1KEPA 2W2LA 2XF8A 1JLLA 4CMEC 1AUPA 1F8GA 1NVTA 4R69A 3I6QA 2GN6A 4NJOA 4RVGA 4INAA 2Q1SA 2VNAA 1XA0A 2B69A 2WE8A 3BAZA 1ONNA 5A9TA 3N74A 3QV1A 4CMEA 1WWKA 3TWOA 1EUDA 2YUTA 1C0PA 4UEJA 3PHGA 4RVSA 3TL3A 3MJCA 3DZBA 3GVXA 3KXDA 4DQUA 4FOSA 3NJ4A 4E3ZA 4XQEA 3TRIA 4CM9D 1ENYA 1OZAA 4B7UA 3LSYA 1ENOA 1HKUA 4U8GA 3JYLA 3D4PA 4J90A 3JQ8A 1QYVA 3FPCA 3ONFA 4ND4A 1N7GA 3JSAA 2HDHA 1ULSA 4QO7A 4PZCA 5HS4A 3M6IA 4R1UA 1G0OA 1QLJA 5CFZA 1NFRA 3ZWPA 1QYXA 4NU6A 3E03A 3S55A 2PKQO 1K6IA 4J0EA 1I32A 4CLRB 1LNQA 4X54A 3K5PA 4HP8A 1X13A 4I9UA 4WE3A 5IXYA 3VTZA 2UVDA 4K6CA 3SX2A 2J5KA 1A4UA 2Y05A 4PVCA 4W7HA 2IODA 4ALLA 1GD1O 5G0SA 1KEVA 3JD3A 4Y98A 1EE2A 4D7AA 3GVHA 1TT7A 4YT8A 3K31A 4XYBA 4MVJD 2E37A 3WBBA 4NK5A 5G4LA 3WSVA 3L4BA 3PTZA 1DAOA 1DIGA 1YJ8A 4K26A 2FR1A 1ADFA 3BMCB 3BTOA 2D5CA 5LDGA 1XWFA 1HDOA 2AG8A 2HMWA 3LT2A 4IM7A 2PGJA 4PN3A 5IAAA 1LA2A 4AJ4A 3EVNA 1RM3A 3FCOA 4JK3A 4BNHA 5MGBA 1JWAB 3RROA 2P9EA 4B7CA 4PLWA 3HDJA 4RQTA 1CF2O 3A9WA 4HFMA 1WPQA 1HYEA 2NU9A 3F47A 1DHTA 2VT2A 3GQVA 4HY3A 1FJHA 3IC5A 4I5FA 1NQ5A 4G65A 1NAHA 2Y1GA 1NHGA 3QVXA 2DTEA 1NR7A 2I76A 2O50A 4CMBA 3AY6A 3JV7A 2ZCVA 5IF3A 3FI9A 4YJGA 3SJ7A 1DC5A 5JAMA 3AUUA 2DFVA 1ZBQA 5JNLA 4BNVA 2GCGA 3PJEA 3V2GA 3ADOA 4ZQEA 4BO9A 2PGDA 2HJSA 4W82A 2B4TO 2HK9A 4CMIB 3JQ9C 3KV3O 3FRJA 2Y1OA 1LTHR 4U0KA 5I7EA 3N7UA 3NDRA 5I8ZA 4BKRA 2BFAA 1YQGA 4P38A 1R37A 3JQ9A 5ITVA 1LBEA 2ZQZA 4GSLA 1LDBA 4IJWA 1Y8RB 4LMRA 2RAFA 3ZU3A 4CLRA 5ITWA 3HG7A 4GX2A 4UVDA 2YQ4A 2PH3A 1HE5A 1EK6A 4XDZA 3FTNA 4RVUA 4I9HA 2Y66A 1ZSNA 3HJAA 3AUSA 3Q0EA 1QYDA 2YV1A 3EK2A 5IN4A 2I67A 3F1LA 4UUOA 4BHTA 5EN4A 1PL8A 4Y6SA 1PX0A 2I66A 2W2KB 1BRMA 1FDWA 5B1YA 4DQVA 4Y6RA 1P1FA 3LVFO 1CWUA 3OEWA 1JA9A 1YL5A 1YO6A 2AEMA 2JD1A 3BMCA 4TRRA 2OL4A 1Y8QA 1QKIA 2EERA 4ZICA 5JYEA 3SVTA 4KDFA 1QR6A 2A92A 1WDLA 2CNBA 4IDFA 1MG0A 2VWPA 2I3AA 1PJSA 4WECA 2OBYA 5DOZA 3ETEA 2VYND 4OH1A 4GWKA 1VSVA 1IOLA 4J1NA 2DVMA 2EW8A 3WR5A 4M89A 3TZ6A 1M76A 4UAGA 4E32A 4QFCA 1JU9A 2DUUA 4JQCA 1MG5A 4PG7A 1MGOA 3CE6A 4YAIA 5DZSA 1EZ4A 4J2OA 5AXAA 1O8CA 3DWFA 4DPMA 3IP1A 3R1IA 1RJWA 3IS3A 4OM8A 1JDJA 2NLOA 3RQSA 3WGIA 1BWSA 2AXQA 1N8KA 2EG9A 4CQMB 3PWKA 3S2EA 2D3TA 3WTCA 2E6UX 4MVJI 3KEQA 2QHXA 1GQYA 4CMHA 2C2YA 3T4XA 4A26A 2BLLA 1GPDG 4J49A 1I3KA 4NI5A 2NTVA 4WLNA 1E1NA 2JFFA 2VHVA 4CMIA 1GYQA 4XX0A 4RCVA 4IJUA 1QXSA 4N7RA 4CLOB 2B4QA 3F5QA 4CM7A 1Y9AA 2BI7A 1Q0LA 2DBRA 2PK3A 2RH8A 1PQWA 1GQQA 4RVHA 2B5VA 1GUYA 1WDKA 1OC2A 3Q9UA 4IMRA 1UXHA 4WNCA 1HL3A 3DBHB 4NMHA 5A1TA 3VZSA 3D0OA 4AJOA 4YTEA 4XR9A 4K1LA 1R12A 2BGMA 4OSPA 3MJEA 4QXMA 3OFSA 3ZW8A 3WLEA 1LQTA 1EFLA 1HDGO 2FSSA 1C1XB 4RV9A 3WWYA 5K9ZA 2POQX 1YB5A 3DFZA 1XELA 1E1MA 1L7DA 1JQBA 3IDSA 1KY5A 5JDCA 4GVLA 5COAA 3CXRA 1HDZA 1FXSA 2B83A 2FR8A 3H3FA 2A9FA 4M1QA 3AFNA 5U9CA 1ADGA 4XA8A 1T4BA 2D5AA 3I23A 1KVQA 4FPXA 3LDHA 5CDSA 5L4SA 5F1OA 2YV2A 3DZGA 4NG5A 3ANLA 3FBGA 4RZIA 1UXJA 4FFRA 1E7MA 4CLHA 2C82A 1UDCA 3JQDA 1DC6A 1E6EA 3O26A 5ICMA 5DBIA 1GYRA 2PD3A 3OHSX 2D8AA 2H9IA 3BMOA 3RCBA 3UKOA 3CMCO 3Q3CA 3KOUA 1BSVA 3B20A 3H8VA 4E5NA 4EZBA 3JCZA 2I9PA 4BQPA 3AI1A 2ZB7A 4CUKA 4PVDA 1HLDA 1N1GA 2AG5A 2O3SA 3QVSA 3H5NA 3GGOA 4GMGA 1H5QA 2O2SA 4PZEA 1Q1NA 4MP8A 1XU7A 4LSMA 1Y5MA 2DQ4A 2X5JO 3GG2A 4DRYA 3CSDA 3BHJA 3KLPX 4J4HA 1IPFA 1SBYA 5JCJD 5KJ6A 1KVSA 4J3FA 5DF1A 4JJFA 5TC4A 1PJ3A 1VKOA 4IQ8A 3F46A 2BELA 5G4KA 1JAXA 1LSUA 3E6AA 4WKGA 4BNZA 2HO5A 4YJDA 3R3SA 4CLOA 4ZD6A 3UXYA 4A73A 1B14A 1HE4A 3ZN2A 3G1UA 5KJEA 4MINA 5G0UA 2FMUA 1D8AA 4BNGA 3LF1A 1ZEJA 1ZW1A 2BI8A 1KS9A 4DYVA 3DBHA 3F4LA 2JAPA 4G5HA 1WNTA 4MOWA 1EVYA 2EP5A 4YJHB 1ONOA 1SAYA 1B3RA 2I5PO 5HBRA 1K3TA 3WYEA 4I5EA 3BMQB 3PWSA 1C1XA 5LCXA 4JXKA 3PWZA 4N5LA 3UOGA 1D3AA 3RC2A 2DTDA 1I36A 3KRTA 1A72A 1JKIA 3RBXA 4DC0A 5C7IO 3IKTA 4PLZA 1KYQA 4ALJA 2FP4A 1PGOA 1D7OA 1GY8A 1H2HA 2DM6A 1HEUA 2ZCUA 4XYGA 3W8EA 2NACA 1N5DA 1P1HA 2C5AA 1SMKA 3PLNA 1C0LA 1UDAA 1WAMA 4BGEA 2Y0CA 4CR8A 5BSGA 3GEDA 2W2LD 4FB5A 3DMTA 1MC5A 4K28A 2OBNA 1O9BA 4JNKA 1N1EA 1G1AA 3ZU4A 4D3FA 1R0KA 4DMMA 3VH3A 2HMTA 2HMUA 4BNXA 5EERA 3B1KA 3VH1A 4IDAA 1VE9A 1A71A 2GR9A 1ISMA 1HSOA 3BTUA 4KUHA 4D46A 2HU2A 4YAKA 1DEHA 2Y93A 3EZLA 1ZO8A 1MUUA 5IXSA 2VZ0A 3HDHA 1M67A 3L6OO 4XYLA 3GT0A 2I65A 2O3QA 3GN2A 2NUAA 2P5UA 1B0AA 1ZH8A 1PWXA 1YH3A 1E1KA 3I9LA 4BL5A 3WBFA 5JO0A 4TQGA 4TVOA 5JW6A 4YYZA 3ABIA 3HE3A 3JD2A 4J7CA 5IJZA 1TB4A 5TT0A 3X2EA 6ADHA 3DEYX 4II2A 3EHEA 4LGVA 1YKFA 1VRWA 1BDMA 5ILGA 3PRJA 1UP6A 1B8PA 1J0XO 1YOVB 1GZ4A 3VPFA 3E9NA 4B4WA 4RLHA 5A5FA 3NKLA 3DZJA 5THQA 2X9NA 3ITDA 4JP2A 4PLGA 2C7VA 4YJHA 1EVIA 3QJ5A 3H2SA 5JS6A 2GF2A 3QY9A 3PZBA 4RF4A 3NGLA 3WGQA 5KNLA 1P1KA 4W99A 3WGYA 1U3TA 2X22A 3BMQA 3IMFA 1NWCA 4Z9XA 3VDRA 3OQBA 2FHSA 5IFLA 2CSUA 1GUZA 5JMPA 1PJQA 1KIFA 3UVEA 2PNFA 5BNIA 3PVZA 4PZDA 1P33A 4TRMA 3I4FA 3O38A 2VCYA 3GEGA 3E18A 1DOHA 4AJJA 3W4KA 4P4NA 3ORFA 1O89A 4BNMA 1TT5A 1HF3A 8ADHA 3FPLA 2ZTVA 5I9MA 4M86A 4CM3A 2P5YA 1NASA 4I1IA 3INRA 1HRDA 3W6ZA 3UUWA 4RF2A 4UUPA 3H2ZA 4XZ3A 1U8XX 2WM3A 4L4SA 3G1TA 4MKRA 3ROKA 4BB5A 1DFGA 4PLTA 3DAGA 3IKVA 4M8SA 4RDHA 5BNTA 2CVZA 3JTMA 4K6FA 3U62A 4BO8A 5BSEA 1C0IA 1VJ1A 2AA3A 1JKJA 4FN4A 4QUKA 3OEYA 4FFLA 4JLWA 2LDXA 3K73O 4BNIA 1F14A 4WOKA 4ZRNA 4ALIA 1YOVA 2FZWA 3WB9A 2D1YA 2VRCA 2VHXA 4WCDA 5AXBA 5KVQA 1GADO 4YDRA 3IUPA 3GPIA 3V1YA 2RH4A 1IHXA 4EW6A 1SPXA 1VM6A 3MWEB 3PI7A 4LRSB 3U09A 1KVTA 1PJ2A 1R0SA 2PFGA 3PHIA 3RKUA 2GRAA 1U3UA 2DC1A 1NWHA 2PZJA 3HADA 3PHLA 5DNAA 2PGLA 1VPDA 4QSMA 1SCUA 3ZU5A 1EDZA 3BZUA 3LT0A 3ASVA 1K5HA 5TNXA 3ZHZA 4BO2A 1DRWA 1V3VA 3C85A 4G81A 4BNJA 4EI2A 2TMGA 5AQ1A 5HTOA 4XEHA 4EUFA 1ML3A 4XB1A 4XIYA 3AI2A 1NTOA 3Q11A 4IIVA 2AQ8A 3EGOA 1PZFA 2WD8A 1H9BA 3L6DA 4KDEA 3KYCA 4LK3A 4MIOA 1I0ZA 6LDHA 3MTGA 1J4AA 2NM0A 5T67A 4QT0A 1WMAA 4ALNA 3KYDB 3HN7A 3PZRA 1K0UA 2JHGA 1FF9A 3HZZA 1W8DA 5BT9A 4WPGA 3K9QO 5F1PA 4WLFA 2C59A 1T2FA 4OSOA 3R6DA 1HLPA 1IZ9A 1LLUA 1KEUA 2BRUA 3GUYA 3PEFA 1PU2A 1X0XA 1JVSA 3BTSA 2A4KA 2B5WA 3PXXA 1HXHA 2HRZA 2DU8A 4R5MA 2NVUA 5TLSA 3CMMA 3F1KA 3OH8A 4R41A 3L0DA 3JQGB 3DOCA 3UAGA 2XXJA 1G0NA 4F6LA 1DRVA 4FDAA 1UDBA 3L07A 5MDHA 4Y67A 4TKMA 4BV8A 3ROPA 4IZHA 1DIRA 1IHYA 4DIFA 4YT2A 2DBZA 3HQ4O 4R4JA 1P3DA 4NIMA 1EQUA 1H6CA 4URFA 2VNSA 2O23A 3L4SO 5H81A 4CM8B 3FSRA 2O3JA 1HZZA 3DBRB 3QWFA 4ILKA 1PGQA 2JCYA 4PIVA 3WGOA 2VTEA 3W6UA 3H9EO 2O7QA 3LLSA 1QYWA 4GLLA 5L9AA 3DDNA 3I9KA 1DO8A 1AE1A 4DLAA 1JKFA 1DAPA 3PYLA 1BW9B 2NV6A 1U2GA 4OGWA 4XYEA 5KJCA 4XGIA 4R9RA 4QTZA 4CUZA 1LRLA 3OJLA 2VWHA 2X5KO 4D3DA 4HKTA 4Y6PA 1P77A 1VSUA 2BH9A 5JDIC 3QVOA 1Q0QA 3C3XA 1KC3A 2EIHA 4IGFA 4D44A 3DZHA 5BSHA 4NK4A 1IL0A 4BNNA 4XYMA 4DIOA 4YRAA 4TZKA 4PLPA 3WS7A 4OXYA 4BGVA 3KYDA 4IJKA 4Z0TA 2VOEA 1P0CA 5EQFA 4GGOA 4CQMD 3RC7A 3TOZA 4IY1A 4CV2A 3RIHA 4CL8A 5CEJA 2PLAA 3LZ6A 1CEQA 3ZWYA 4II3A 2GLXA 2CDBA 1MC4A 1PEDA 4FFOA 4H15A 4K9DA 1NP3A 1XCBA 3D4OA 4PLVA 3ICCA 4DREA 5JYDA 1R6DA 2DLDA 2VHZA 2GSDA 3TZCA 1X14A 4A03A 4YRBA 3FTPA 3WNVA 2B0JA 4JJGA 3EYWA 5ENDA 2AQKA 4WLVA 1G6KA 1E5QA 1FDUA 4XGKA 3GFBA 3PPIA 3D4NA 1V9LA 2WYWA 2X8LA 1IZ0A 2NU6A 2FSVA 1P74A 3DMYA 4YAJA 4P22A 5A05A 1V3UA 4DIBA 3IAHA 3ZNOA 3GZNB 2X58A 1D1SA 4HWKA 3DBLB 4P4LA 3F3SA 3FR7A 1IY8A 1M75A 2O7SA 5I7VA 3GMDA 2C5EA 5G2OA 4PG5A 1B16A 3DBRA 5FWNA 3VKUA 3OIFA 4RJTA 4PFJA 4J6FA 2X5OA 3GGPA 4JP3A 3RKRA 4NBTA 2ZYDA 1BW9A 3GHYA 4A0SA 1E3EA 1FDTA 1PZEA 1N7HA 4MKZA 1R4NB 2QYSA 4BO1A 1GPJA 4IDGA 4M87A 4UVEA 2X7HA 2GZ1A 4WJZA 3LT1A 2OGUA 3I9JA 2XAAA 3I9MA 4L0QA 1I30A 4EEZA 5KJFA 3PLRA 5JAZA 3ZHBA 1R66A 4OL9A 1BVRA 1Y81A 4CJXA 5I9LA 4AJEA 1LSSA 3K30A 4J9UE 4OHUA 3L9XA 1Q2XA 2Y99A 1AXEA 1X15A 2G0TA 1E6WA 2AE2A 2UYYA 4E5PA 4IDDA 4IDCA 2ZATA 2IYPA 4LSWA 2PZMA 4HXYA 4NH4A 3VZPA 1U3WA 1EUZA 4LRTB 4Q3CA 5A04A 3LK7A 1P1RA 2H1SA 5ES3A 4WEQA 3RWBA 4XB2A 2C2XA 2GGSA 2YW9A 1ZFNA 1PJBA 1EUCA 2DTXA 3WG9A 3AM4A 3GDOA 3GG9A 4N18A 3U4DA 5JY1A 3ZV6A 2NQTA 3S1LA 1EK5A 3GAZA 4Q9NA 4U7WA 3STHA 3C8MA 3FNGA 3MZ0A 3MOIA 4GL4A 4TZTA 4CMGA 2Q50A 2WJPA 1HT0A 4XJTA 1GR0A 3U3XA 4NBWA 1LEHA 1T1SA 4YQYA 5BQFA 2JAHA 3A1NA 3GZNA 5IN5A 3DL2A 3DBLA 4BNFA 3P7MA 1PR9A 3M2PA 1Z74A 4AJ2A 4B3JA 4CQLB 4BNTA 3OIGA 2VZ9A
chains in the Genus database with same CATH superfamily
1UEXC 1KXZA 1L4EA 4KUEA 1O5IA 3FG9A 1AO0A 2Z43A 2G5CA 4E6PA 1Z7GA 3VSEA 1PJRA 1U5BA 4DKXA 4YUXA 3NDBB 1X7ZA 3LS2A 1NLMA 2IYQA 3DAFA 3MHTA 1W59A 4NZ9A 4YT5A 3R5HA 3ZY6A 4BNKA 1RD4A 4S35A 3UW3A 4ZJYA 3KR2A 1R4NA 1NN1A 1NQAO 1UK6A 1XROA 5IG2A 2FW8A 2VSFA 5M29A 4HBGA 3V2UA 3TZQA 3PDCA 5LP6C 3A9UA 2ZUVA 5F2EA 3T3HA 2I7DA 1P6QA 2X9GA 3IUJA 1SOVA 1GV1A 2IIQA 1JPVA 3KJHA 2O54A 1E96A 2EFGA 2QVZX 4IFTA 1KDZA 4N47A 2IWRA 1PL7A 5CFLA 1J24A 1QDEA 1V7PC 2Q9BA 4U8HA 5TGDA 2GZHA 3A4IA 4B4UA 4LYEA 1O96A 4Q4HA 2RB4A 3QLTA 3GYGA 4ZRMA 3NONA 3D5QA 5A6VA 2R5WA 4C6HA 4LXIA 2C8JA 2WYVA 2P91A 2GB4A 3FDJA 2X4DA 3NIBA 3RS2A 3V97A 4AX4A 3UK7A 1GKLA 2JGJA 2Q9UA 2CYCA 1ONBA 1ZN2A 2QSYA 2WRZA 3EISA 3KAKA 3NUGA 2Q4RA 3PFWO 4YLGA 4XE5A 5F2KA 3DZDA 2M6LA 3OI7A 1UMKA 3AVPA 4B4VA 4C7OA 5GZ3A 5EUCA 2RAUA 4H1VA 6Q21A 1UEJA 1CSEE 1JG6A 2IZOA 2HXSA 4Q9AA 4V39A 4UBLA 4YGXB 5IZCC 4PSVA 2PG3A 1HTTA 4E7OA 2RI1A 3KSAC 1O94C 1XKQA 3FKSA 2FE1A 4D3ZA 3TLXA 4R1TA 1XCMA 4R9VA 1G7SA 2IOHA 1I5OA 1AS0A 3QRWA 5BY2A 3ST7A 2BCEA 3MBKA 1WCYA 1LQUA 2ZW9A 5FWYB 4H7PA 5BRNA 2BW0A 1WXDA 2Y1FA 4HAYA 2VPWA 3S44A 5DK4A 4MROA 4AK9A 4EGSA 5KWSA 3KAPA 2B7LA 2CMFA 2ZXEA 3O84A 4IJVA 4GWLA 4X0EA 3TEFA 3CVWA 5DGHA 4NJMB 1HFWA 3L4KA 1XZAA 2WJZB 4MB2A 1AN9A 1UPAA 4HNAA 2PZLA 2DT5A 2R8BA 2WUGA 3A10A 1PBNA 3S2ZA 3VC7A 3LHKA 3PHCA 1USKA 1TZBA 2E4ZA 3BTVA 2EFEB 3FR8A 4FS3A 4RK1A 3UUFA 4DWOA 4TKVB 5AIAA 4EB3A 2QTZA 4JI8B 3CPSA 4KIWA 1EEXB 1NW8A 3DBVO 3H5IA 1O4VA 4AUKA 5JAUA 1P5ZB 2OXCA 4OIFA 1J33A 4FGLA 3EW7A 5DYWA 4R98A 5IDWA 1SURA 1IOZA 1BWQA 1T9HA 4X7RA 5HS6A 5CM8B 3LKZA 4XDGA 4I3HA 3RF6A 2BZGA 3ZE2B 4OX9Y 1XD9A 3F0TA 1VMDA 4ZQFA 1FSPA 3ZDRA 2F9LA 3TSAA 1K9SA 2XLBA 1TM4E 3ZZ1A 5EKUA 1WCIA 3T1QA 4WACA 1UK8A 1JYEA 3M9WA 3OUTA 1IAVA 4DYDA 3L8MA 2YVAA 3NWEA 1ORRA 3OF2A 3VQTA 1EWKA 2C92A 3LI2A 4KPGA 3V9AA 1CKEA 5L51A 1W4RA 1M2JA 3IBGA 2I1WA 3LQ1A 3O7MA 4CYMA 4ZU1X 3SZLA 3L1JA 2H08A 1E9SA 3I0MA 3OZTA 4EF5A 1JWBB 3VR1A 1QU3A 1JSZA 1NQVA 1ZICA 1YI8A 4QNRA 3VAYA 4EHKA 5CDTA 1FP4B 1FYEA 2VXYA 1A7AA 5BW6B 3UIEA 2ZG6A 5TGZA 4YR9A 2HT1A 3H2GA 3SC6A 3ZWXA 3GLIB 1V2GA 4JT4A 3SHVA 4BFCA 5JNVA 1KO8A 3K2EA 2BN4A 3P4YA 4HDOB 4MVXA 4QQRA 4N03A 3AF0A 3AZOA 2LR0A 5PGMA 1SCQA 3V4OA 1VRCA 2HCRA 1GNLA 5ICFA 1EE1A 1C14A 2ZE6A 3G0HA 1SBNE 5DRYA 1TC1A 5BNFA 4OQFA 2OFFA 4JA0A 3RRNA 3GU3A 4WKCA 1XRLA 1HI9A 1R8JA 1Z2EA 1PF7E 1VG9B 3ENNA 2WFMA 3OTGA 3K72B 1Z7EA 3I5MA 2XA1A 3LPLA 1CR4A 1BH6A 1E99A 2OZVA 4ZCPA 3GVIA 5DTJA 4CDGA 3RWMB 4DG9A 1G3IA 3FGPA 4N7JA 4U3JB 1AMOA 3JD4A 3MBIA 5FWYA 3JQFC 1LLQA 3KAJA 1XDZA 2P9BA 1AHPA 1AKVA 4RCZA 1NYTA 3ND6A 3OZ7A 3R5TA 4XVUA 2WFZA 4E1AA 1FTWA 3MNFA 3ZTWA 2C8LA 4NJMA 3DWGA 3AUJB 2W6IA 3D31A 3ZWDA 4MVJH 4DDVA 4JLMA 3TNYA 3KHUA 4GHWA 2MMGA 4OMCA 2F00A 2H4WA 3MLAA 3N2GB 1QUFA 2EDCA 3SZRA 3U7GA 4XJXA 1DAKA 3B1FA 4OXKA 1UT8A 1MX3A 4TKVA 5D1HA 1HUQA 2NTEA 5F52A 3CM0A 1ADCA 4ADSG 5I7WA 4I55A 2VEDA 5CJPA 4M9CA 1J7KA 1Q14A 2CF6A 5K6AA 2MYUA 3S81A 4HS9A 4DSNA 1OAAA 2WINI 4JZYA 3DOIA 5EXTA 4E5YA 4JMPA 1RI4A 4TLDA 5CT6A 2HCJB 2FX2A 2ZJAA 1Y9DA 2R48A 4I5DA 4I4CA 4Q4DA 3HP1A 4YCAA 3WIDA 4BDTA 4D41A 1CZKA 1H6BA 2F9MA 1D6SA 1QLHA 2XWPA 2K2QB 1G9TA 1Z6ZA 2MINB 3R0VA 2MWMA 1S89A 2X4IA 4YJ2F 4M0KA 3C7TA 5DM0A 4RVDA 2BGWA 3HB9A 2OO5A 3O03A 4UTNA 1I14A 4IS3A 4MYCA 1JHUA 4QULA 1UKZA 2VAVA 3RG8A 4FFMA 4NV1A 4EEXA 2KSQA 2J48A 2ODEA 2PD6A 4FDLA 5JZ9A 1BMFD 4RABA 1YZHA 1J9ZA 1NXSA 5JAQA 5B7QA 3ETJA 1JEAA 1M6HA 3O3NB 3CEAA 5HKAA 5EJ8A 1XHEA 1CERA 1PNVA 2GYYA 3GARA 3OLXA 1CPYA 4CLDA 1FA9A 2QLNA 3E8XA 5IBRA 3E27A 3GVCA 1RXVA 4YMSA 3X1DA 3URKA 1M66A 1XZMA 1RQPA 1E1RA 4EG0A 2A33A 1PSWA 3TL2A 3JQAB 4JLNA 4W5OA 3AINA 1NJSA 3P1JA 1XRNA 2VK8A 2BV3A 1VL5A 1T5IA 2EBFX 4Y8VA 3WRXC 3KVOA 5B3JC 2YMLA 3I73A 1LX6A 5HOEA 4A2QA 2X9QA 2PL9A 4RKYA 5FNVB 3R9KA 2YHAA 2W83A 1CZHA 3HGQA 10MHA 1DFHA 1ECLA 1MRNA 1YD7A 2XPCA 3O8DA 3OZAA 3S27A 5AW3A 4EVIA 1XGKA 2W9XA 1GAEO 4PG6A 1VLJA 1J0AA 4B83A 1SC6A 2BEWB 3DXFA 3AU8A 2G17A 2G71A 3GJ3A 4WRRA 3JPYA 1QOQB 2XUZA 4FC7A 5JSYA 1WULS 3RPEA 3EF1A 2QPLA 3WO0A 3RTAA 2VSQA 3QQPA 4IHKA 4U3JA 2EL9A 2PT5A 5GIPE 4JAVC 4N7BA 2WWHA 4C7XA 1M5RA 3KKMA 3T5DA 1J2EA 1U8TA 4ZU3A 5E9JA 1I3CA 2PX8A 3SLGA 4BZXA 4ENWA 3FMOB 2O4CA 2QW0X 1J42A 1JEDA 3FHTA 2JBAB 2JJMA 2NSHA 1TF5A 4Q05A 4DLVA 4IQGA 4UNRA 1TL7C 1HBJA 1GKIA 1AKQA 1NDQA 3G89A 2IHYA 2PUFA 1TVCA 1TLTA 1NVDA 1K7YA 1ZSVA 2IK8A 2J3JA 3N2GA 5BUZA 3WAGA 2PV7A 2VPXA 1JG7A 1XRPA 2Y1DA 4TM8A 4TWZA 1O9HA 1RU3A 1UMDA 1N5RA 3IVGA 2IYSA 1OX4B 3C5VA 1JHOA 4UXJA 3STWA 5BV1A 3PHJA 1EDBA 2W58A 5IUNC 2I8CA 1QPBA 4G07A 2J33A 3VPSA 1C0KA 1U81A 4GKBA 1BVHA 2IP4A 3VDQA 1Q6YA 3OZRA 4KZKA 4JXZA 4ML3A 4ND3A 4ER7A 1VLHA 3I5AA 1ESCA 3NALA 1RAHA 2NXEA 3L1IA 1MEOA 1OU0A 1PZGA 3WYCA 1LJLA 1BA3A 2OLKA 3SKVA 1U8FO 4HQKA 1SOWA 1U0FA 3PQDA 1RXUA 4KQXA 1T3LA 1DG1G 3FOEC 5T64A 3AR6A 1H2XA 1O6GA 3IJPA 3HSSA 3KPYA 1Y7PA 1UM9B 4KVFA 1DIHA 1H94A 2V3VA 2F64A 2H11A 3F71A 3D6AA 1PG2A 3DDOA 1K6XA 3I6ZA 4OO3A 1TTPB 2F1OA 1OFHA 2BY4A 2AI2A 3K05A 3B9BA 3DKKA 3NFYA 4Y9UA 4ZP1A 3RS5A 3RTCA 1CC1S 4ZIRA 5C2JB 1C1HA 5EPEA 1ZGHA 3W0LB 3BIOA 4B6SA 2ADFA 3JQAA 1KK1A 1QSGA 2CCGA 3OT1B 1XKLA 4TROA 4AY5A 4DBVO 3H9CA 1LSOA 4OK6A 2ECKA 2P9GA 2IIVA 3HNPA 4PLHA 3DBOB 3HL4A 4MIEA 3ZX5A 2CVOA 1N34B 1C50A 2J3IA 5FNVA 2F17A 2FEXA 3Q7PA 5GZ1A 1AXGA 2Q99A 1Q1EA 3FH0A 1ZD2P 1VFNA 4P32A 4UE3S 3RVQA 3ZY2A 1U2DA 4BWGA 5FWXB 3QU7A 4CR6A 5CLJA 1W88B 1A4RA 2BEWA 5EMHA 1JKXA 4PICA 1CY8A 1Z18A 1ZUD1 2IDMA 3WQBA 2W00A 2CYBA 1VPEA 4MS3B 2RHBA 3TPFA 3CRNA 5JO9A 3OOEA 3U9SA 3HN2A 3IR5A 3WFIA 2WJIA 4B09A 5C8YF 1AMNA 1QAMA 5FTNA 1LS6A 4HFNA 4MUEA 3C70A 3FWZA 1NY5A 4DLLA 4HAWA 2CLSA 3CIFA 2ZRAA 3H2JA 4Z4HA 4B3GA 3V8PA 5H1YA 1GVNB 2XUOA 3DEIA 1XZ8A 2QMQA 4WBSA 3IDAA 2JBAA 3AUTA 3SFTA 3E1SA 4EECA 3S2FA 4CMCA 4DR4B 4J0QA 2IPLA 1XVIA 1RM5A 3DAPA 2J9XB 4FK8A 1YKSA 3L0ZA 4JBHA 2GEJA 3LL7A 2YMMA 2AK3A 1JDBB 3KZCA 4CXMA 2RBGA 3W2GA 1IHPA 3IIKA 5AVKA 3VR6D 5J5VA 4MWSA 4BCCA 1CLUA 2CBZA 4FEEA 4YAEA 5KHLB 1P2UA 5BR7A 2W98A 4KC0A 2C99A 1Y48E 1OX4A 1U9JA 1KZGB 1UMCB 3PXBA 2VHTA 4WERA 4F4HA 3GZ4A 1M2OB 1JW9B 5CLIA 2NQ8A 2YWFA 3HZRA 3S3TA 3TZKA 4EJ0A 1F12A 2AWOA 3TLZA 1PTJC 1ONPA 2ZEJA 2FFQA 2H5LA 4A27A 1ZJWA 1Y42X 2QIOA 4MVJP 4K9NA 1L4BA 2X3YA 4LOAA 3RVOA 4E88A 5CDUA 1LXCA 1LF0A 5GONB 4F9EA 4AROA 1TIPA 1Q12A 5D00A 3DOOA 4V0ME 2J9FB 2R2AA 2ON6A 3ZHQA 4TKZA 4MUYA 4EBFA 5A03A 3ENKA 4KO3S 2VR1A 2O5VA 3EXG1 1NBME 4Y7CA 3QYFA 1UM9A 3OKPA 3RI3A 1CR2A 4F1JA 3I83A 4IEEA 2VN8A 4GX1A 4C30A 3NNSA 5LZ2A 1RXCA 1S8NA 2WIGA 4GE3A 3FFXA 3CLUC 3NH9A 4L76A 3T4EA 1N6LA 2X40A 1NF9A 4MARA 1GGEA 4N0QA 1R15A 3FRHA 1ZK1A 3OT1A 4DCJA 5JSUA 2O8CA 4P54A 4DA0A 2VUUA 4Q3DA 3GPBA 2EFCB 3EZYA 3RYIA 3TFOA 4HMOA 4TYQA 1OZHA 1QP7A 3JYNA 4GM4A 1E66A 1YGPA 4CIBA 1DUIA 1OAKA 1UPUA 5I7SA 1IN1A 3HUDA 1M6VB 4XKJA 3THSA 5IPFA 1VDZA 5FWXA 3QEMB 3N8HA 1MXHA 1W88A 4DJTA 3WB0A 1IN7A 1J56A 1WJGA 2JLYA 1O94D 1U98A 1ND6A 2IYTA 2Y9PB 3LVRE 1GTSA 2Q2QA 4MS3A 5JE8A 1PSZA 1DE0A 1DKUA 4XD2A 3W4IA 1TZMA 1ZOPA 2C84A 4LQLA 3N9IA 5F21A 5K0LA 3SDSA 3X44A 1DBSA 2AQHA 2QX4A 5BQ5A 1UR5A 2X7XA 2YY5A 1O4WA 4OMFG 4RSMA 2R97A 2GPWA 3COVA 5E4JA 4ZJUA 3URMA 2RH9B 3EUWA 3AO0B 3D1LA 1ZD1A 1O6ZA 4LJSA 3AUKA 3GFGA 3JQ8B 3L1KA 4Z0HO 2CF5A 3RC9A 2C29D 4JLUA 5HUJA 2C2MA 2FWRA 2Q8PA 3DONA 1X94A 2ZWAA 3OA0A 4OX9B 2X42A 1N9ZA 4RPGA 4KXLA 2RK3A 3IT0A 3SS7X 3WKBA 2PKQP 2DR2A 2XOKD 3QLUA 2WAOA 4OJYA 3WGTA 1Y4AE 3DEKA 1LH0A 1BC5A 1WXIA 2W6ZA 3P27A 1ZA1A 4OOFA 2PR7A 3VR3A 4DGSA 5ECWA 2EKDA 1GIAA 5AVQA 5JSZB 3RVDA 3RRXA 1XT6A 4KAAA 4PIPA 3P0FA 3WLOA 1M2OA 4J4TA 1A88A 1UBEA 4WLEA 3ROEA 1NXQA 2RB5A 2WVHA 4TL9A 1IULA 3GR6A 5GJCA 3HU1A 1GSOA 2JCGA 1FNDA 2NT4A 4FI3F 4KGDA 4ZDIA 3FZNA 2WWRA 3U6BA 4M1OA 2J3QA 4GI3A 3QE0A 3P71T 1RLOA 2HEIA 5ENVA 3DAOA 4RNCA 1JL3A 1XVAA 5GONA 3UTDA 2HFKA 1EM6A 2J9FA 3OO0A 3STUA 3TPZA 1W5AA 4R16A 5A0FA 1WW8A 3MB8A 4U5XA 2COUA 3U61B 3RVPA 5BV7A 1M0EA 1Z73A 4MRVA 4TM7A 2VS1A 2JJ8A 3DPIA 4X6LA 3QEAZ 1BMFA 1Z4PX 2WTXA 4P35A 1OXVA 4UE6A 3QU2A 1HK7A 1NNI1 2QZ4A 1E5DA 2JLAA 3DLPX 5CA1F 1KYZA 3DAYA 3RYCB 3RHSA 1L7MA 2K7FA 2GZSA 1YASA 4FJ2A 4GBED 4WBXC 4QX6A 1XP5A 1LUAA 2ET6A 5JHHB 3LU1A 3WZ2A 2XUQA 4ZOLF 5F5LA 4Z4GA 4RY8A 1N6PA 2Y0DA 4GLBA 4OHRA 1Z4QA 3SEFA 1M6VA 2I4TA 3OE4A 4CBVA 4UATA 3QEMA 1NVXQ 2DFKB 4ACAA 5G0WA 4QTUB 3THYB 2PUCA 3KU4A 4EUKA 4UM8B 3GUUA 3KKOA 2XDYA 1GDHA 1Z0AA 4FFNA 1DOZA 4KLRA 3TTWA 1K2WA 5EP1A 3T9FA 3IFSA 5EMMA 1LBTA 1APBA 5A6SB 3KYBA 2IZ1A 1F0KA 3IQEA 3OM9A 1N8TA 3GV0A 3H6HA 4J7UA 4HDCA 1QYCA 2VQ3A 4G25A 2FOIA 3M6MD 3C7CB 4NDNE 1KR2A 2GM9A 4RDIA 3ZCSA 2WB2A 3QBDA 3PHHA 2ZJ4A 1QE0A 4P7JA 4KJZA 1QG2A 4YMWA 3H8JA 3IQIX 4F5YA 4LCEA 4IHJB 4BO0A 5B12A 1GNSA 5CRIA 2GMWA 2JKVA 3ED5A 4TMKA 4EHBA 4F56A 7MDHA 3HCAA 3CNNA 2LGJA 2ZR9A 4MAFA 3ORRA 3OZXA 4HH0A 5P8WA 2AYYA 3M3HA 2V58A 1C29B 3ZQKA 5KYWA 4CN9A 4A8PA 3GLFB 3DFIA 4AO7A 2JIQA 5JQGA 1RPNA 2QR5A 4KTVE 4BVKA 1GLGA 1NM5A 1OHHA 3OBIA 3KT0A 3RABA 4QXAA 2PVPA 2Y68A 3K1AA 4RADA 4BY9E 1AKNA 2EFDB 2PBZA 4ZQHA 4L6CA 2IYRA 3GUHA 2QL7A 2J3DA 1FNMA 1PS0A 1PQYA 2Q3JA 2XTZA 1VE3A 3BFKA 3P9SA 4QC2A 4AP5A 2B5OA 4MZDA 1I4TD 4IO1A 1G5TA 2SNIE 3PE6A 4JEUA 2IJGX 4P34A 3UFXB 1HEIA 3P9PA 1BXRA 1HY3A 1PIWA 3G5UA 3KE9A 4QELA 3ZLTA 4EGFA 5CDGA 1KMHB 5CDYA 1QRDA 3JS5A 1NPYA 1W36B 3EZ9A 4YQZA 3DLAA 4PZ0A 3VI3B 5GADl 1X42A 1U4SA 3QJYA 3NDPA 2VWGA 3WISA 4J0HA 4H6XA 1T6NA 2ISCA 3DMDA 3O1HB 4FMPA 4MVJF 3VPHA 2Q4BA 3HBAA 4BV2A 2FSGA 3VV2A 4MRNA 4R3WA 2WE7A 1IJBA 4FQ5A 1OJLA 1T3GA 4DHWA 1WBBA 4DN6A 3ZJ5A 4EO9A 3B1XA 3GUCA 4I5IA 3MIIA 1HG1A 3D3EA 1DWUA 4R54A 4UCFA 3RYCA 5GTDA 2OORA 3VZBA 1T5LA 1Z5WA 4B6EA 1AK2A 1I2ZA 4QHSA 1NBEA 1HSZA 1ZZGA 4XR4A 2PJUA 4BVFA 3ZVKA 1EPUA 3ZXYA 1XVTA 1RKVA 1XQYA 3HXKA 3O9VA 2L2QA 1HV8A 1QMPA 4WL0A 3AR3A 3I4CA 4DV2B 3O3MB 3CVJA 4FHFA 4NMWA 5TQVA 5K0JA 3NYWA 4LF5B 2ZLBA 3H5AA 1CIJA 1HDRA 1BS2A 2YV3A 2ZSHA 3QOXA 3TVYA 3THYA 3T9DA 2AMJA 3BREA 2WM8A 3N2YA 3RFCA 1ESDA 4PWZA 1UEIA 1ZVVA 3FPAA 4UDYX 2I22A 2WPDD 2WIJA 1FSGA 4XX1A 2QW8A 2A9QA 3WYAA 1WKVA 2X86A 4IVQA 1FCJA 1DV2A 2CZCA 1UUFA 5DIFA 3DR3A 4OV6B 5KHAA 4CL0A 5H82A 1SEVA 1BHJA 4CMHA 3DO6A 3GVPA 4NX2A 5L7YA 3WZMA 4C6SA 4GI5A 4K2HA 1SZPA 2F1JA 2PBFA 2PSHA 2QSZA 2QRGA 5HQTA 4II7A 3R74A 4DUYB 3K71B 2BMWA 2Z04A 2TRSB 1NZJA 1AD2A 4B9EA 3G2IA 3HYSA 2VQFB 4BFSA 5IAKA 4HAOA 4ZCTA 2ZDQA 4DCVA 4JYBA 1T9GS 3T4PA 4UU0A 1CUJA 2Z95A 1W1IA 2ZFUA 3AHHA 1S7GA 5T4BA 3C3PA 3PQCA 2QRUA 3U4CA 2IPAB 1BN7A 1AZTA 1KP2A 1PR3A 1CDOA 3LVQE 1NUPA 3JWJA 2M1XA 3G17A 3ONDA 3SWWA 4FYIA 2VYVD 5A9SB 3OZCA 2R7KA 1KP3A 1Q83A 1IZZA 5DGDA 1XN1A 3MJSA 5ALXA 4WOJA 4QTTB 3UFXA 2KPOA 3H5WA 3BBLA 2Z9CA 2VF2A 2UYOA 3JPWA 3B9PA 5AUOB 6GPBA 1OYOA 1KMHA 1UJ4A 4RYLA 2GPAA 4YJ3F 4F5ZA 2ZUEA 1JEEA 5IDQA 3B38A 4S04A 3DE0X 5EWLB 1FXWF 3SZGA 4EW1A 1Y37A 1TA0A 3PDJA 2WQZA 3X1KA 1QJ4A 2Z98A 4DA7A 1IB6A 1EQ2A 4F93B 2X9LA 3QMPA 2E1PA 3OHPA 1R74A 3ZZNA 1WP4A 1JQ5A 3F6CA 3UHFA 3NVKI 3QIVA 2GAJA 4AL4A 1KY3A 3HYNA 3P97A 5JCOC 2A0XA 2P6MA 1Z6PA 2GJ8A 1I24A 1C8BA 2NTNA 2W22A 2I4MA 1GPNA 1OASA 2GK7A 4ZXFA 3W8DA 4D8VA 5CG2A 1AQNA 1XWWA 5HCUA 4B48A 3HM2A 4UU7A 1VFPA 4C4OA 1QFMA 3SR3A 2YZ7A 4FQ8A 1G6Q1 2I1VB 2HIGA 5AOAA 4C89A 2G4CA 1FMJA 3EYAA 5KSPA 2NVBA 3L0SA 1NOKA 3FLBA 3RBVA 1Y6RA 1YHNA 3OAAD 4IP0A 2IYNA 3UJ9A 3VYRB 4DPLA 1BXGB 2H3HA 1LC0A 3NKVA 5ALIA 4O4IB 4DABA 5AXDA 3QI7A 1B2LA 2JI6A 2VDJA 3BMNB 5H80A 4B0OA 1CY0A 2II6A 3EA5A 4IKPA 1RYZA 4QXRA 4RH0A 2XGGA 3CRMA 4J16A 3S5JA 1M2NA 1XU4A 4X8HA 3DM9B 1YRQA 2PGAA 3PR1A 2XTAA 1NV9A 3VKVA 4E30A 3DTTA 2OG1A 4DLPA 2BT4A 3H1FA 1FJGB 2SICE 1OSNA 5JLAA 5G4KB 4IPTA 1I0LA 2PPVA 4B6GA 2UVQA 1Y8AA 4GQBA 4JV5B 4BS9A 4ME6A 2IGTA 1KJIA 4YO7A 4BO3A 3JTEA 4WNYA 3LBFA 4INJA 3UJHA 5IZCA 4D9NA 3NWPA 1NF3A 5KVAA 3W5HA 2NZUG 3W3AA 2AFVA 1L7XA 5AVOA 3TDKA 3GEIA 1W9HA 2ZTMA 5DE3A 4ZI7B 2AEJA 2XOKA 4AWXA 3QX8A 3PPYA 2O8EB 2IX9A 2QTAA 1DCMA 3E5HA 1Y98A 3QELB 2NO6A 1ITZA 1RMTA 1Z13A 3ZJYA 3V6MA 3TZHA 4F3RA 4XQ9A 2VWQA 4ZO8A 4OUDB 3C1UA 3D59A 5IYZF 2WZQA 5A9SA 1K8YB 1P2DA 1W0JA 2HNKA 1KJYA 2W6NA 3IOMA 3IOYA 4M0UA 5JDCC 2GHRA 3GROA 3VR4H 1GKYA 4U7GA 1XXLA 5K3OA 5F1YA 5JI2E 1JFSA 5EESA 3QK7A 1B3BA 4KLAA 4E33A 2O52A 3EDOA 5EEHA 4EYEA 4DC9A 4L9SA 4CODB 5EWLA 3RSZA 4M1MA 2WWYA 2P75A 1I5RA 3C0KA 3OJFA 4B7XA 5L3SB 3U4IA 1NZFA 1ODFA 4PQFA 4MA5A 3OA2A 4DTIA 2FEKA 4X3PA 5IT5A 3EXFB 2IHZA 4I36A 2FWMX 3P32A 4FC6A 3NPAA 3L1VA 5KWIA 4BFXA 5DULA 4NZPA 1G8GA 3CLUD 5AOVA 2Y27A 2X13A 3P2EA 1X7XB 4B6QA 3NRCA 4MLDA 3Q8MA 1EQAA 4B40A 1RVDA 1A3CA 2FK8A 3TOVA 4V1CB 1UBGA 1NBOA 4DA8A 1E3LA 4MV4A 2AJ8A 3PFKA 4IUBS 4FBGA 4F71A 5GVSA 3ZU6A 5IC4A 2XI4A 4PCUA 5TF0A 1JU4A 1NR1A 1GZVA 5HKKA 1DMRA 1U5AA 4YYEA 4OLAA 3ZHXA 5LM3A 3L0OA 1M1ZA 1YMVA 3OPXA 3PENA 1E92A 5T8KC 4GH5A 4G4SP 4J91A 1EWYA 4L9RA 4BNDB 1UJ2A 1NVBA 3GRKA 1LV7A 1LTKA 5BXQC 3WTBA 1BXGA 4U7HA 5H3LA 1YBAA 3BULA 2WT9A 1N5KA 2G1KA 3KBBA 1DSSG 1FYFA 4DDHA 3NTUA 3RUDA 3BMNA 1QP0A 1M73E 2PLWA 3IB3A 2V4UA 3NCHA 3H5TA 4PSCA 4QYXA 3GLHE 4US1R 1RJ9B 4CFZA 1YQXA 1Z6QA 3O21A 3O9MA 1QDUA 3WMFA 1OPRA 1ZINA 1JWLA 4ARSA 4NENB 3BXHA 2B1GA 3V46A 3JQFA 1OXMA 4XASA 4L9WA 4P82A 3SQXA 3HHPA 4J0FA 2GPSA 4DXHA 2BKLA 1GN8A 1L3BA 4JL6A 4B79A 5ALHA 1H4TA 1Z29A 4R6WA 3ECCA 3OX1A 3AI3A 3WLKX 5ARBA 2JFYA 2Y2VA 1P2TA 5AM4A 2NADA 4LUCA 2QLTA 4UTPA 5FUMA 4JCCA 4NQZA 5F23A 1Q16A 2ZSKA 1KJ9A 3JD1A 1JLSA 4D79A 4M38A 3WYNA 5LQKA 2OHXA 121PA 3QZUA 4A1OA 4JI4B 3D2LA 2O8EA 1K5PA 4X3OA 2BJVA 3QELA 4KVAA 1QTNA 4KP7A 4MQMA 5E6UA 4QOIA 1DAIA 5LKRA 5DCLA 1YRHA 1D2NA 2J4FA 4QGHA 1QGYA 1CTQA 3QPVA 5AVJA 1OXKB 4CKXA 5DPMA 2QLBA 1V6AA 1Z4JA 1GGMA 1U0HC 2FQYA 3MRSA 3NUZA 4NPAA 1NOJA 1C9KA 3PYMA 1X86B 3QLJA 4DT1A 2HNAA 3JYQA 4DQLA 4ETWA 2ERXA 2KX7A 2ZBRA 3G0CA 1W0KD 2H4FA 2OZPA 4H16A 3NI2A 4NEQA 5FCDA 1RJFA 2QP3A 2OFPA 2Y1CA 4YDSA 4DR7B 3LP5A 1E5LA 3ETDA 1KDOA 4L4RA 2YINC 4TT8A 3NHJA 3P2JA 3EPKA 2WVJA 5L3SA 5EGNA 4LCBA 3IUNA 3A32A 4TSFD 1BQEA 2B4RO 4YAGA 5E9AA 5JECA 2DCMA 2RGRA 3EXFA 4EY3A 4J1TA 3D6JA 1SXJB 1W44A 1W4ZA 3LBNA 5CD1A 1QHHB 3CKLA 5BORA 3ICQB 3JQEA 1X7XA 1IC6A 3JZIA 3NTRA 5TQ2B 3NU1A 2ENWA 2YFHA 3R6TA 3NMUF 2QN1A 2JJYA 4TV9F 4V1CA 5DTEA 3N6XA 4AY3A 5BN4B 1U3FA 4WADA 4W8OA 2I62A 4P92A 3KQKA 1Z82A 3NJRA 3OJ0A 3KQWA 1XQ6A 2QT1A 4R0MA 4HAXA 1VE5A 5IK2D 5H83A 3DZKA 1NAIA 4A6DA 4PYQA 2WIBA 4U4AA 4A2PA 4E2YA 3LTNC 2JFWA 1MABB 5LZ4A 2OT3B 3AOEA 4J0CA 4RPKA 3OZWA 2IU4A 3GK3A 1JFVA 4Q7MB 4ZVTA 1V6CA 4O59O 4EI7A 2YZ2A 2EFHB 3FPJA 3WGUA 2CY0A 1RJ9A 2B82A 2QD2A 2NV2B 4G9GA 1R0ZA 2ZBEA 3JWEA 1WQ1R 4F21A 4R3NA 5JUWA 2IUSA 3I1JA 2BM1A 2WPDA 1P4GA 2ERCA 3G8YA 4NENA 4P08A 4YRKA 3Q15C 3L05A 4OIMA 4TSKA 1W1UA 2CW5A 4M8LA 4WK2B 5E2IA 3S5UA 2P9HA 4B4OA 3P96A 2W2NA 5IFKA 3PKIA 5SZHB 3BYZA 5BSWA 2O5EA 3G9XA 5JD6A 2YYAA 4OY3A 4U1RA 4LF8B 1H93A 2GN2A 3AF4A 3O8QA 4V0OA 3SSNA 2PZEA 3M5WA 2C5LA 3AM5A 3VU9B 4NNOA 4PRLA 1FUEA 1E1QD 5ALRA 5CURA 2VP2A 4R5HA 4AMBA 4YGYA 4MYTA 2QLJA 4FNOA 3A1EA 5I9TA 1E2KA 2IGBA 3MVEA 4GP9A 3DO8A 4FHCA 4MWTA 3LT5A 4QDZA 5ECYA 3SPXA 4I8XA 3PVCA 5EJFA 1ISJA 1U8ZA 2A5FA 3DDWA 5CEEA 3GDFA 4GICA 4JD5A 1GKUB 2AW5A 4FUTA 1GZSA 4E51A 2CFOA 1J00A 3P52A 1YB2A 3TNJA 1YCGA 1V8BA 2V59A 1STOA 3I39X 4ZVKA 2O4UX 1XA3A 2GOYA 5D8DA 1PV4A 4KXQA 2P3QA 5I4CA 1TKRA 3LY8A 1TPZA 2QGZA 3MJ4A 2HLDD 3KB6A 2BGTA 2PO7A 3TLEA 1GR1A 1VHLA 2C9YA 4L4XA 3KKPA 3K1TA 1YHZA 2I87A 3SD7A 3W3ZB 4B87A 4WJLA 1KQFA 3ZD9A 4BNUA 1DJPA 3PSAA 1NBWB 4BVAA 1V96A 3B78A 4BEBA 4E5KA 5FOVA 2GWRA 3ANXA 1T5SA 3P0EA 4Z6KA 2Z08A 1ADBA 1QHHA 2FPMA 1E64A 3GBSA 4J0DA 1CY2A 3V4PB 2IXGA 4G41A 2X3UA 4NXMB 2FPUA 1Z2CA 2HMAA 3NT5A 3NHPA 4RVFA 1TEZA 2HZ7A 4LOIA 5IHPA 1JH8A 2QN6A 2ZB4A 4ZDWA 5BN4A 4E21A 1YDFA 3SQNA 4B73A 5L40A 1E98A 4JB0A 2GBPA 3P9KA 4B17A 3MERA 1T9GR 3WNQA 2F9FA 4RJKA 5EKDA 3A9CA 2CWDA 2NXWA 2XNHA 5ITZB 4A4DA 3V4VB 1N2BA 4D3SA 3U56A 4M37A 1Y1QA 1LDYA 2GDZA 1QIFA 2PWBA 4FILA 1A9XA 2EEZA 1BD4A 1Z4LA 3DE4X 3EDQA 3QVUA 4YDHB 1W19A 1ECPA 2H5IA 3UJPA 1PGJA 5KYUB 4OJKA 1BXZA 3QXCA 4J1SA 3L7LA 1KYWA 3MFYA 1E4VA 1U94A 3OAAA 1HEYA 4NBKA 4B45A 1JHAA 3ND7A 3C39A 3I9OA 4ZVSA 3RS0A 1BG6A 1L4UA 4CM6A 2IFTA 1D2GA 4LPSA 4UHCA 3OQ6A 2F6RA 4DSTA 8LDHA 2X0NA 1U3VA 3WGLA 1IN4A 1KYVA 5TF4A 4EELA 1N2CE 4L5CA 3EPJA 1GCAA 4YUZA 3DTYA 3ZQ4A 3C3JA 1YVPA 2G4VA 4KFTA 4Q82A 2PS9A 3PGVA 1T2AA 3HO6A 4G24A 4G86A 4BOYA 1Q1ZA 2CUTA 2G67A 4TRJA 1GPLA 1COWA 1U4OA 1Z88A 3VU9A 3N6VA 4G0XA 2BEVB 4AZVA 3GNLA 3TTTA 1TCUA 2AL7A 4I5GA 2AJDA 4K9SA 1ZD8A 4LCJA 3D6NB 4R05A 5EINA 4D9FA 4ZYXA 2IYAA 2LTAA 1EFCA 2ZIUB 2EZ8A 3IEKA 4G9EA 3FA2A 3IAAA 3WJAA 3ND9A 8ATCA 1U1EA 2DPHA 4H3VA 1SXQA 2F4NA 2KB0A 3F5FA 5B58C 2EW2A 3AJEA 2ZYIA 4O8CA 3VC2A 4KVGA 1OI3A 2C0QA 5DHRA 4DNQA 5IS2A 4NF2A 4HH1A 3COSA 3OLCX 1O0SA 2IUTA 5FHQA 4E15A 3P9CA 5FEMA 1QPZA 1ATZA 3LKDA 2OENG 2FUG1 3PNPA 1N9GB 3R8XA 3SJUA 1AB5A 5JJBA 1A76A 5DHSA 1QV6A 1LSJA 3AKEA 3OBBA 2QV0A 4I50F 1ENZA 4LOHA 2HB6A 4MVJE 4WY8A 3UM9A 1TQDA 1PEYA 3GC6A 5DX1A 4E4RA 4Z3DA 5AICA 3G9ZA 3IBFA 3MQ2A 4WKNA 3WSTA 2XTMA 2Q0HA 1L7EA 4MSUA 4OKNA 5DYGA 2RJ3A 3ICPA 3WJ7A 1JAYA 1NVEA 2GCOA 2NO4A 2O7VA 2Q1WA 1ECFA 3BF8A 3EC7A 3QW2A 2E6KA 2YS7A 3RUCA 2VATA 4WEOA 3EXG2 2OV3A 3CN7A 4D81A 1KMQA 1R4ZA 1YVRA 1E9BA 3GEBA 4FFPA 4K6GA 1T1RA 3RO7A 1OROA 2TMDA 3PDHA 3ECAA 1C8LA 2J3MA 5IAJA 2VJBA 2HKIA 2CXTA 1G60A 1QIJA 2IC5A 4GYJA 3UHAA 2ZAIA 1HOXA 1YVUA 1VCIA 2WEKA 3AESB 3UYKA 3RYFB 4YUYA 3NDJA 5IJ0A 1WU8A 4INZA 2MMCA 2X8BA 1KGSA 4KQ9A 3NNNA 3K8ZA 1LD3A 3IMKA 3QKWA 4NJEB 4P8RA 1DRKA 3MTAA 3PT5A 1LLDA 5CJJA 3CLKA 4LKOA 4YI5A 3I64A 4EPTA 5KYUA 1EUYA 4CQJA 2EKPA 5CVVA 3LK6A 5WRFA 4EG3A 1CUVA 4AMVA 1O0BA 3I8SA 2QXTA 3OSUA 1NW5A 1Z4NA 2D54A 1VBKA 2ZUBA 2X1MA 4L75A 2YWDA 1RSZA 4DIEA 3EC2A 4E2ZA 5CLQA 5AM3A 2SHKA 2H4JA 1RKUA 4MI6A 3VZCA 3EOAI 4TUYB 1BDHA 4IH4A 4DLYA 3IL2A 2AUMA 5TMEA 1FFGA 1K68A 3N86A 2R6ZA 3ROMA 4WFJA 4C3OB 1E3QA 1NYLA 2XH8A 1EBFA 3AW8A 3BXOA 4NNJA 3D6MA 3KZMA 3HWSA 3VZQA 1ZUNA 4D0NA 1ZVMA 5EIFA 3THXB 3A4YA 2DPLA 2WIAA 3FVRA 2BEVA 3HA7A 1VIAA 1CY4A 1HZZC 2AJBA 5C1IA 4LBWA 1NNUA 3B2NA 4M7OA 5K3AA 3ESCA 4C20A 4JR1A 2GEUA 1X7HA 4H31A 4KWHA 4DMCA 4QPPA 4YMUA 1JR3E 4YRCA 3RU2A 4EHNA 4IIGA 4KE6A 1OI4A 3CT6A 4U7JA 3BL5A 2GKOA 3QE2A 4RCYA 2KYRA 4U0JA 2Y3IA 1F0YA 2AG6A 2GM5A 3O8LA 4FIZA 2ZQ5A 5DX0A 3M6VA 2IZ6A 2VDPB 3WMWA 1BFDA 1CULC 1SWWA 4WGGA 1QK5A 2RHHA 2XMGA 2COEA 3WDKA 3OC6A 4G8CA 1PK8A 1N9GA 4KODA 4KYVA 4G0MA 4O2AB 4C7KA 2QTGA 2H9AA 5DN9A 5H4HA 4EJ6A 1WDMA 5CA0B 5CFPA 3D8RA 4LVUA 4D26A 4LNAA 2BE7A 3QPDA 3PE4A 2EX0A 1FSSA 2I6FA 4QHTA 3X2SA 5FXMA 4RKFA 1M10A 1JDVA 5AVWA 5L95A 3C8ZA 1J1IA 3OZVA 4KO8A 3M33A 1KH3A 2FG6C 4QUIA 1V7QA 2P4UA 5GVRA 1UOEA 4DR2B 2H1FA 1S5PA 1Y9ZA 4G0QA 4U02A 1G5IA 4IR7A 2F8SA 2NAPA 2XF8A 1HLGA 1NA5A 3GMTA 3EFOB 4TMZA 3WHKA 1AOXA 1MX9A 2E55A 4P0PB 2WYIA 4YRLA 4RVGA 4INAA 2Q1SA 5ICCA 1XA0A 1RHKA 2OUKA 4Q6BA 4HGOA 4CF4A 3RTGA 3AESA 4HLQB 3TX2A 4MI1A 1YVDA 3N74A 5J5CA 2QGFA 2X0FA 5JPDA 4CMEA 2CLOB 5IK2A 1WWKA 3D7MA 4KL8S 3TL6A 5BV8A 5KTSA 3W5BA 2QP4A 2WQ7A 3L02A 2QDKA 1TUBB 1YE8A 4J0KA 5KTNA 3CVXA 1ZHHA 1R9NA 4O2LA 3TL3A 5KREA 1G9XA 4GXTA 4M9SA 3EVZA 4HTFA 2RSLA 4E3ZA 5T3UA 3TRIA 3D4IA 1ENYA 2HA7A 4BQQA 1JR6A 5F33A 3LSYA 1RPTA 5K0FA 1GLVA 2FSVC 2DY1A 1QYVA 3FPCA 4JQZA 4TUYA 4PC2A 4ND4A 1V5FA 1T6BY 1I7QB 1U7PA 1ZLXA 2WWIA 1F8YA 2R6CA 3KQPA 3VHXB 5FKJA 1AKRA 1G0OA