1PWZA

Crystal structure of the haloalcohol dehalogenase hhec complexed with (r)-styrene oxide and chloride
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
252
structure length
252
Chain Sequence
STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERWPGMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords halohydrin dehalogenase
publication title Structure and Mechanism of a Bacterial Haloalcohol Dehalogenase: a new variation of the short-chain dehydrogenase/reductase fold without an NAD(P)H binding site
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Lyase
total genus 89
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pwzA00
2O3RA 1D3AA 2HKIA 4OL9A 5JY1A 1M2WA 3I9LA 1GCUA 4HUJA 4IQ8A 5U4QA 3FSRA 1RM5A 3MOIA 4XCVA 4D3DA 5K6AC 5MGBA 2D3TA 4XGKA 3OETA 4YEDA 4DPMA 4CMAA 1YGYA 3D4OA 3GN2A 3VPSA 4QO7A 1DXYA 2A94A 2I99A 1Y6JA 2JD2A 1I3LA 3MJSA 3Q9UA 1ZMTA 2C54A 5BQFA 3OBBA 1IE3A 1V8BA 2JAPA 5L7YA 3FPCA 2W2LA 2HK9A 3NRCA 1TEHA 4DMLA 3JD3A 4R3WA 4UULA 4CV1A 3QV1A 3D4NA 1U8FO 1EFKA 2P5UA 1HDCA 4AJIA 4FGWA 1MB4A 4JX8A 5AVOA 3EVTA 3RKUA 1B15A 4Y8VA 2YFQA 3BHMA 4J43A 4DVJA 3GUCA 4R5MA 1E3LA 5HS6A 4GLLA 3F4LA 1E1MA 4PN3A 4BMNA 4OM8A 3AK4A 4CR6A 2YV1A 2VYNA 1MXFA 2Y1FA 3H7AA 5I9MA 6ADHA 2C20A 2JHGA 4RQTA 1KVRA 3C85A 4YA6A 1MV8A 5C3MA 5KIAA 4DC1A 2DFVA 4FQ8A 3ZU2A 1CERA 1C1DA 4OO3A 1Y5RA 5F3RA 1NWCA 5C37A 4YCAA 1TLTA 3CTMA 1ARZA 3OSUA 3Q3CA 4BOYA 4BGUA 3EMKA 1VKNA 2IXAA 2BI8A 1ZVMA 1DO8A 3FF4A 4BO4A 3N58A 3ITKA 2Q1UA 3E8XA 4B4VA 1IUKA 1P1IA 3OHSX 4CM7A 2BI7A 1ONPA 4DQVA 4Z3KA 1H2BA 1LX6A 3OJLA 5EPOA 3TDKA 4II2A 3ONEA 4FFPA 4B79A 3AI2A 2WM3A 1B3BA 3ANLA 1LNQA 5FWNA 1LSOA 3JQGA 2EG9A 5H81A 1DPGA 2X8LA 2P4QA 3KZVA 4UVDA 1ADCA 2BF7A 1T24A 1HDZA 4XYMA 5A9SA 3NT2A 1JN0A 3A14A 4Z0HO 2EWMA 4XQCA 4MKXA 2D8AA 5L53A 4PZEA 3O4RA 3WGTA 3FTPA 2OP1A 1KERA 2Y0CA 1EVJA 4G81A 3F1LA 5EQDA 3WGYA 2O3TA 3A1NA 2JFGA 3JQ9C 4Z6KA 4ND4A 4AJNA 3GMDA 3C7DB 3UN1A 5L9AA 1I33A 3BMOB 1F0YA 4RZIA 4RVHA 3FD8A 4BKOA 1R0KA 4OMUA 4R01A 3VPXA 3Q11A 2PK3A 5DF1A 2BLLA 4EEZA 1N9GB 2Q1TA 1LC0A 3B1FA 3I9JA 5C5IA 3IQDB 3HNPA 4U0JA 4TRMA 1PSDA 3I6QA 3JQ8A 5A5EA 3B20A 3BTSA 3WS7A 3DFZA 4E32A 4OHUA 1HDOA 3FWNA 4B4WA 4FJ2A 3TZKA 1BDBA 4XIYA 2AHRA 4ND3A 3BYZA 2Y93A 3NTQA 4QT0A 2Q50A 1HE5A 3DAGA 1EUDA 3ZU3A 3K2EA 1ZK2A 4G65A 1BGVA 3PWSA 4CM4A 1CF2O 1HDRA 1Z7BA 2Q2WA 4PLTA 1T25A 3ZWVA 3NDJA 4EITA 3WNVA 1R37A 1LDYA 3LT1A 4MVJA 1B26A 3HG7A 1SCUA 3K73O 2HAEA 5I9LA 1PTJA 4CR7A 1PQWA 1U3WA 3QWFA 4FJ1A 4CMCA 1LDNA 1P77A 3RU7A 3KV3O 1ZXBA 2X23A 4CMIA 4M1QA 1ULSA 4Q3CA 1SB9A 1I2ZA 4RVFA 2NTVA 5IXYA 3G17A 1YOVA 3KBOA 3MJEA 3ZWCA 2R2GA 1XG5A 2VHVA 2VZ9A 2C7GA 5T64A 3RKRA 4P38A 2Z95A 2DUWA 1PJTA 4EEXA 2E49A 2DPGA 3VKUA 1NAHA 3A28A 1ZUD1 1P33A 3RFTA 1GZ3A 2UAGA 5A05A 3AM5A 2E48A 3FBTA 4XA8A 2DLDA 1A72A 4U8GA 1N92A 3SC4A 3ZZNA 4P22A 1LXCA 3KYCA 2QIOA 1VI2A 1XIVA 3RAJA 3RROA 1DC3A 4YQYA 1DRVA 2RCYA 3AFNA 1QYXA 1VM6A 4TVBA 3PZBA 4J0EA 3D64A 4NJMB 4AFNA 3RASA 4BNJA 4CL3A 5JDIA 1EUCA 2WDZA 1UDBA 2Q4BA 3F47A 5TRTA 1IL0A 1U4OA 3JQFC 3PYMA 1NQOA 4FFMA 3WDSA 4CQLA 5TLSA 1NQAO 5DBIA 2EJWA 3RD5A 4YYZA 3RC2A 3E5RA 3GZNA 3JV7A 3X2FA 4O5OA 1BMDA 1T2FA 4QUKA 3DZFA 1ZFNA 1SAYA 3ICPA 4KWHA 4PCVA 3WQRA 4GVXA 4N5LA 1RM0A 5LCXA 1ENYA 4YAJA 5EN4A 4QTZA 4WLFA 1R4NB 3A9WA 1PL7A 4L73A 3AUAA 2ZCUA 1VL6A 1VSVA 3C24A 3FBGA 1OOEA 4CMGA 4C7KA 4EUHA 5JAZA 5EESA 1NQTA 1X15A 3IIEA 4R68A 1VKOA 5AOVA 4XWYA 3RQSA 1PS0A 3RJ9A 3ZV6A 2QRJA 5JCXA 3TOZA 1I30A 1U3VA 1U1IA 3NJ4A 4OAQA 3E5MA 3BXXA 4L4XA 2AG5A 1BXKA 2IXBA 3AUSA 3GGGA 4Q39A 8LDHA 4L76A 1UXJA 4DBZA 1LSSA 1B0AA 3PVZA 4E2XA 1EDZA 1LRJA 3ZHBA 3MTJA 3O8QA 4F3YA 1LA2A 3RI3A 1Y5MA 3A4VA 3H3FA 4GGOA 1OC4A 2EW8A 5TX7A 1WP4A 1ZCJA 4WECA 4YJDA 1YO6A 1HXHA 4BNKA 2C7VA 3GEDA 1NBOA 2YZ7A 4J6FA 1ML3A 3NV9A 4B4OA 1RYEA 3ABIA 4QQRA 3DTTA 4ZRNA 5FYDA 4QSMA 3H5AA 4E2ZA 3AOGA 5KVCA 4B3IA 1CRWG 4W82A 3GNSA 3KUXA 4UUNA 3VH4A 4B7UA 3ZDFA 1V0JA 4TROA 3M6IA 2DTDA 1FDTA 1H6DA 1V3VA 1H0KA 2G1UA 3A06A 2HMUA 4LRSB 1UXHA 1UXIA 1X7GA 2J3HA 1X7DA 3DOOA 4GH5A 4R54A 1GYPA 4EUFA 3LZ6A 2VOJA 3C8MA 3F5SA 2JHFA 2VRCA 5G0TA 3GHHA 4NU6A 1P44A 1Q0QA 4NR0A 1DRWA 4MVJE 2JCVA 1I36A 4IDCA 5G2OA 1Z45A 4PZDA 1GCOA 2IZZA 3HADA 4J1QA 3EYWA 2X9NA 1T4DA 4D45A 1BG6A 4R4JA 2Y67A 4P4GA 5GZ6A 2VYND 4FCCA 2QZZA 4PLGA 4BO0A 3W4JA 1EBFA 4MINA 4J4TA 1C1XB 3LC1O 4J2OA 4BO2A 2VOEA 4EJ0A 1U2GA 2EKQA 2FSSA 1LI4A 4RF5A 2I6TA 2X0NA 2W98A 4JCOA 3OIDA 3OQ6A 3O03A 5TJHA 2ZYGA 3DFUA 3KYDA 2X5OA 4IBOA 3PPIA 3WWZA 1NFRA 1YJ8A 2WJPA 2CVOA 3INGA 3JD2A 3HDHA 1T1RA 4PLHA 2QG4A 2TMDA 1AXGA 3EY4A 4LMRA 1ZW1A 4XQGA 2P4HX 1Y9AA 2NWQA 3OJ0A 2P68A 5ITWA 2XF8A 2P9EA 2A35A 3EHEA 4BGVA 1U3TA 4CMBA 3GVXA 3E6AA 1HTBA 1DC5A 1WMBA 4XDYA 4AJLA 2GO1A 2VHZA 2X0IA 3VDQA 4YJFA 4EYEA 4JK3A 1J4AA 4ZGWA 1PU2A 1YJQA 2PFGA 1VRWA 5A06A 4RVDA 1RYDA 1ONOA 3JYOA 5DDIP 3DBHB 1PWXA 4J9VA 3TZ6A 4FFRA 5BSGA 5L7TA 3IJRA 2Y1DA 3L0DA 5CEJA 3G79A 2VHXA 3MWDB 1P3DA 4E2WA 4DPLA 3CZRA 4XD2A 1YL6A 4WCFA 5IG2A 5A04A 4I5EA 2OBYA 5L51A 3ZNNA 3CXRA 4UEOA 4BIIA 1Y1PA 3PHGA 4BS9A 1PQPA 3NUGA 4F46A 4O0LA 4YACA 3JYNA 4IDAA 1C3VA 4E5PA 3KTDA 1D4FA 4H15A 3PFWO 4CLRA 4FPXA 5JW6A 2EKLA 2VZ8A 4KUEA 1BDMA 1SBYA 2NU8A 3OH8A 3G1UA 4ZD6A 4UVHA 3ASVA 3TZCA 4BUCA 3FI9A 2WD7A 4NBVA 4UAGA 1Y81A 4DIFA 5KJ6A 5KOIA 5L45A 1PZGA 2G5CA 3U0BA 4PLFA 2CMDA 5A9RA 1MP0A 2P5YA 4CV0A 1XA0A 3OECA 4EBFA 1NVGA 2BFAA 2ZKLA 4CLXA 5HS4A 1RM4A 5L40A 4XZ3A 2AW5A 4E12A 4DPKA 2WYUA 2ZQYA 4RF4A 3U3XA 2J5RA 4QFCA 5TNXA 4I08A 2VUSA 4URFA 5F21A 1DDOA 2NM0A 2HJSA 3PXXA 2R00A 3NAQA 1ZJYA 2W2KB 4NBRA 3AW9A 3JCZA 3VDRA 4YT8A 4DLAA 1QYWA 1YH3A 3AU8A 4RPKA 1O8CA 3JQAD 2I3GA 4OOFA 1JW9B 1IYZA 1DIRA 1HSZA 5T57A 1W4ZA 3GRPA 3AUUA 4QFDA 3RC1A 5U9CA 1A9ZA 1BWSA 3TN7A 1UJMA 2YHIB 3DZGA 3RUHA 3ZWPA 2FY8A 4ALIA 3RUFA 2YDYA 5AXBA 2C59A 3VTFA 1YQXA 2RH8A 4A5OA 1P45A 4YJGB 2I66A 5JPIA 5K6AA 3WBBA 1PGJA 2PZJA 3OQ1A 3WFJA 1P1FA 2V6FA 2V6BA 4KOAA 1UAGA 4BKUA 4L8VA 4ZN6A 2OFPA 3QW2A 1NX6A 1E3SA 1KEWA 2Y0DA 1UH5A 1CIVA 2NQ8A 3KRTA 3G0OA 5JAQA 5JMPA 2CDAA 4D44A 4BO8A 1FXSA 2H1SA 3K30A 1PGQA 4BNWA 4Y6PA 1A4IA 4MVJI 3GPDG 4TWRA 4NHEA 1VLLA 1ZK1A 1JKJA 1UR5A 1PS9A 4ZQFA 4WUVA 3GAZA 3TL3A 4M55A 4GMGA 2AEFA 3ADPA 1ADGA 3DBVO 4BNGA 3PHLA 4ND5A 1PJ4A 2B4RO 1T4BA 2VQ3A 4NDNE 1VJ1A 3ZW8A 2IYOA 3H9QA 4GX0A 4O1MA 1E1LA 2X9VA 2B36A 2NACA 2WWRA 1WMAA 4RL6A 5G4KA 2QX7A 2YQ4A 4NQZA 3RFVA 5IZ4A 4CQMA 3PHIA 4FD3A 4R9SA 3VAZA 4DXHA 1J49A 2HMSA 1XYGA 4M87A 3ZWMA 3OQBA 3W4IA 1EFLA 1H2HA 3K6JA 1ZSYA 3GZ4A 3ZV5A 2OUIA 4R1UA 5COBA 3STHA 4C4OA 2BRUA 5DOVA 4NK4A 1Z7EA 3HN7A 4JROA 2EIHA 3BMCB 4R41A 4LISA 4TSKA 3WMWA 1M76A 3ZW9A 4NU5A 3IKTA 3NYWA 1E3IA 5G0VA 2A4KA 2I3AA 1ZIDA 1GTMA 1I8TA 2FN7A 2UUPA 4BGEA 5AXCA 3SC6A 8ADHA 3VOSA 3DO5A 1DOHA 1KVQA 1U5CA 4GX2A 1B2LA 1H6CA 1PL8A 1QP8A 3ZWAA 2I65A 2X5KO 4ID9A 4AJ1A 5MDHA 2J5QA 1QKIA 2X22A 3D5TA 3QVXA 4RVSA 3KXDA 2AQKA 1VL8A 1W8DA 5IZCC 5IJZA 2Y1GA 2P9CA 5IDWA 3C1AA 4BMVA 2WTBA 3VHRA 3IKVA 5KTKA 1FDSA 5CEEA 2C2XA 1LLDA 5K0ZA 4Z9FA 1ID1A 3AI1A 4BO7A 2PTGA 3TNLA 5BT9A 5DULA 3L6OO 1V35A 1EQ2A 1R4MA 2X86A 3DBLA 2ET6A 2P9GA 4PLZA 2YV2A 1GYQA 3GOHA 1BW9A 3AY7A 4N18A 3ULKA 3RUCA 1WZIA 3QP9A 4EZBA 1NVMB 2PGDA 1HLDA 4RO0A 4FBGA 3RUAA 4IQ0A 2DPHA 4NIMA 3VZSA 1XDWA 5F1PA 2BHLA 3BTOA 1Z74A 4NFYA 1D7OA 4W4TA 3VZQA 2VT3A 1ADBA 1JVSA 4FOSA 2GZ2A 4ZJUA 5CDSA 4ZQHA 3ZNPA 3GHYA 1QRRA 3CE6A 1HYGA 5THKA 3AFMA 3VH1A 2OOSA 3DZJA 3GRKA 1CWUA 1LUAA 5LDGA 4FIZA 4BO6A 3V1TC 5B4UA 3JD1A 4C7JA 1GFSA 5KJ1A 1LDEA 4KTTE 3ANNA 4D0RA 1SO8A 2AA3A 3DMTA 3U62A 3COSA 1N1EA 4IIUA 2DFDA 5EL0A 4DLLA 3LLSA 4W6ZA 5KVSA 4CPDA 5DZSA 2IDZA 4K9DA 2X0RA 1QLJA 3E9MA 4BNXA 4CUKA 2CZCA 5K9ZA 2YQ5A 3DBRB 3WQQA 1OAAA 4RQUA 2HUNA 4XJTA 2I5PO 1DHTA 3ITDA 2I76A 4WNCA 1NM5A 3EGOA 4HFMA 4GMFA 1S6YA 4RLSA 4DREA 1PGPA 4GGPA 4XGNA 1B3RA 2D5CA 4MVJH 3OM9A 2BMAA 2OO5A 3MJVA 3PJDA 2NTJA 3PQDA 5ENDA 4E13A 3ZU4A 3AY6A 4J1NA 4XQ9A 1C1DB 4GL4A 3VZRA 3EAGA 2UDPA 1O94A 3TFQA 1ZBQA 3TOXA 3UH1A 3IP3A 3G3EA 4RV9A 1PQUA 3DQPA 1PZFA 1SC6A 2NV6A 3DZKA 3I4CA 2I9PA 4K26A 3RC7A 4TRJA 2PZKA 1WWKA 2C5AA 2VWGA 1TXGA 1U4SA 4INAA 1EBUA 4NZ9A 2BELA 4YJHA 5FI5A 1UP7A 3G49A 1NTOA 4R51A 4CM5A 4DGSA 4K6FA 1I3MA 4CMKA 2GLXA 2X9GA 1XU7A 4RCVA 1U7HA 2CUKA 3PHHA 3KEOA 4FW8A 4I5DA 2DBVO 2AEJA 1HL3A 1A7AA 3PJEA 5AQ1A 1NFFA 3ONDA 2YJZA 3PRJA 3DB2A 3JQGB 3KLMX 2YY7A 3JQFA 2B4QA 4HP8A 5H82A 4FFOA 4BNYA 5DCWA 3H5NA 1JKIA 3W6UA 3GDFA 4AJKA 3V8BA 4H7PA 1DIBA 5BNFA 1PZHA 5H83A 3I52A 2Y1EA 3ZGYA 4R3NA 4F45A 2VWPA 3L4SO 1NQ5A 4ALJA 2XAAA 1Z6ZA 5CHEA 4RORA 4PLVA 4H16A 3TZQA 1C0PA 1NYTA 1QYCA 3RBXA 1DSSG 4OXNA 1YDWA 2GPTA 3W8DA 3EVNA 1NXQA 4RPLA 2EP5A 2PKRA 2G17A 3L77A 3GPIA 2RIRA 2WD8A 3VPFA 2AG8A 4KWIA 2B5WA 2NLOA 3F3SA 1NASA 1R15A 4J1TA 3JQ8B 2ZB4A 4PLPA 1JDJA 1YB1A 5BNIA 2ZIZA 4KP7A 2BFMA 2B35A 1IPFA 1E3WA 2PY6A 3R3JA 4UREA 4F6CA 3GMSA 5ICMA 4GKVA 4JIGA 1E5QA 4IM7A 5JS6A 5IDYA 4ZICA 2VUTA 1GQ2A 4FOOA 2AE1A 3GNQA 2ZATA 5I7SA 1A5ZA 3N74A 1RPNA 2FR0A 4CM4B 4U7WA 4CLOA 2GNAA 4HY3A 4L74A 4N5NA 3PIIA 4F6LA 3PGJA 3QLJA 4II3A 4DWVA 3RU9A 4IJUA 4IGEA 4E21A 3NDRA 1ADFA 2OBNA 3I1JA 3JQAB 3ZWYA 1O0SA 2DTEA 4WEOA 3I4FA 4ZQBA 1O6ZA 1OMOA 4CODB 3L9XA 3DR3A 4HFJA 2GD1O 1N7HA 2FZWA 2BGLA 2FOIA 5G0UA 1QSGA 4YT2A 4U6QA 4WLEA 1BTOA 3C7AA 1HE2A 1QMGA 4G2NA 1YOVB 4CV2A 3WQSB 1F17A 1R0LA 2GSDA 2YW9A 1P1RA 1MGOA 5EIOA 1U8XX 3K92A 3BMNB 4ND1A 3P7MA 2HK7A 3CIFA 3KHUA 4NH4A 3R0IA 5B1YA 1N1GA 4ALKA 1PEDA 5HRUA 5IDQA 3UUWA 3WG9A 1LSJA 3KYCB 2PD6A 4TRNA 3DEYX 4GVLA 4S1VA 1C0IA 5JCJA 1IOLA 3D3EA 2PD4A 1D1SA 1VL0A 3HN2A 4UVGA 5T8KC 1JU9A 3P19A 4PLYA 1LQTA 3WGZA 4DL9A 1DB3A 1PL6A 2OMEA 3EDMA 1QR6A 4D3FA 3WYBA 2PA3A 1H9AA 3ZWOA 2VRBA 3RUDA 4NMHA 1V9LA 4BGIA 4Z3DA 3U4CA 5HA5A 4RPJA 3WIDA 5JXWA 4CQLB 1OZAA 3IP1A 3F1KA 3HUDA 3GG9A 2A92A 4PG8A 4QECA 4MKZA 3F46A 3RJ5A 5JC1A 1HKUA 2X0JA 3FPLA 2H9IA 3KOUA 1VPDA 1Y8RA 2D5AA 2B5VA 2HRBA 3GZNB 4YAKA 1PJSA 2Z1NA 3Q0EA 4WE3A 1YBAA 4CM6A 4JBGA 4OSPA 3GY0A 3ONFA 1LLUA 3DC2A 4ZVVA 2Q4EA 3QJ5A 3H9EO 2ZTUA 3IMFA 4FDAA 2NQTA 3HWRA 4IQGA 1UXGA 4NK5A 4WJZA 5JO0A 2ILTA 3WIEA 3UW3A 3MJ4A 2AQ8A 1VE9A 3MEQA 3FCOA 3TSCA 3V2HA 1P31A 1ZEJA 3C1TA 3EC7A 4TQGA 2D4AA 1R16A 1G0NA 3U49A 5C7IO 4CM9D 5CPBA 4A10A 3S55A 3EUWA 5DT9A 1DBVO 3AY3A 1TVEA 3PWZA 2O23A 3TF5A 5J23A 1B7GO 4J7XA 5JYDA 3O8QB 1JWBB 3QHAA 2WE7A 4XR9A 3K8ZA 4NJOA 4R5HA 3QRWA 4J7CA 3OICA 4UEJA 4R9RA 4FR5A 2FP4A 4JJFA 1YXMA 4Q3AA 5IFLA 3CH6A 4TZKA 4RF3A 2DM6A 2PD3A 3H8VA 1GZ4A 3D0OA 4EJ6A 1IHYA 2GYYA 4N5MA 5L7WA 4CUZA 1MC5A 3SLGA 1LDMA 5I8ZA 3CSDA 1N7GA 1PGOA 3I5MA 3PFFA 3RIHA 2DU8A 1YVEI 4BNVA 1KY5A 2B0JA 3PYXA 4BL5A 3E1KA 1EK5A 1M6HA 4MO2A 1PS8A 2C07A 1W0CA 1EMDA 1FMCA 1PJ3A 2GN9A 4KUGA 4ZQEA 3F9IA 4RDHA 3R3SA 4JGBA 5I7VA 4RDIA 4U5QA 4HFRA 1PR3A 2TMGA 5L4LA 1LLCA 2Q2QA 1MG0A 2CVZA 1Z73A 1HDYA 1VSUA 3D3WA 1AHIA 2EGGA 4YBZA 1H93A 2Y0EA 1LBEA 2Q46A 2HO5A 5CEFA 3DZIA 4BNMA 4JJIA 1DJQA 2O4CA 1VJ0A 1G0OA 2PKQP 1DIHA 4BQRA 3E9NA 1B8PA 4K28A 3EZLA 3DXFA 2NU7A 2QQ5A 3CEAA 4AVYA 1OBFO 4MP8A 9LDBA 3B6ZA 1I2CA 4CLHA 4PLCA 3IUSA 4NG5A 3QWHA 4E30A 4D43A 1GDHA 1ZSVA 3H9JA 1YWGO 2W2LD 4A03A 3RFXA 2Q99A 4ONEA 4BVAA 2SCUA 3O26A 4N54A 4XGIA 4LSMA 3KYDB 5GZ3A 1Q0HA 2YV3A 1ORRA 2EV9A 2PZMA 3ST7A 5B4TA 1DIGA 1EVZA 4J9UE 4XB1A 3GDOA 4P8RA 2CF6A 1ZZEA 3AM4A 3O9ZA 1DLIA 3BHIA 5G0SA 1EVYA 4Q9NA 2HSDA 4BNHA 2WE8A 3AU9A 4YRBA 1D1TA 4M49A 4AICA 1HT0A 3GT0A 2HDHA 3HB4X 2Z5LA 2X6TA 2JL1A 3DZBA 1GUYA 3QVOA 4YJFB 1HLPA 2ZJ1A 3T4EA 1XU9A 4BO5A 1KBZA 5EMHA 1XHLA 4ALMA 1ONNA 4R1SA 4D42A 1FDUA 3INRA 4N7RA 2IODA 4BO3A 3L4BA 3BAZA 1W6UA 3JQBA 1PR9A 4OH1A 4O63O 4WCFB 1WXDA 1LQUA 1M75A 3IAHA 1N2SA 3RCBA 4ALLA 3QE3A 3WR5A 1N5DA 1KIFA 3C7CB 1SPXA 3S2GA 2F1KA 2XXJA 3SEFA 1U28A 3JQ7A 3FTNA 2HLPA 1IHXA 4DTIA 3F5QA 2Z1MA 3S1LA 3GEMA 1DC6A 4CLRB 4OKIA 1M67A 4NNJA 3K9QO 1KY4A 5A4DA 5DBFA 3TRIA 2F00A 4Y98A 1NAIA 3H6KA 4R1NA 2D2IA 4OXKA 1KEVA 1XQ1A 2C2YA 3FR7A 1WVGA 2WD7B 1MUUA 3K31A 1U7TA 4UVIA 5T67A 3V2UA 4E5MA 1HDGO 4ILKA 3H2ZA 4TZTA 3PP8A 5HBRA 5KJEA 3DL2A 4JP3A 1MFZA 1H6AA 3FRJA 5JO9A 5IZCA 2ZJ0A 5ADHA 1W73A 4M86A 5EERA 4D41A 3ZWNA 3JD4A 5KVQA 4EDFA 3GFBA 3CINA 4IJKA 1UP4A 2D1YA 3N7UA 4IMRA 3IS3A 4TKMA 2EJVA 3VH2A 3TJRA 1ISGA 2O48X 4KDEA 2IZ1A 1BVRA 1DAOA 3OJOA 5FI3A 2ZTLA 3UHAA 1L7EA 1GPDG 3PWKA 4JNKA 5A02A 1YB5A 3GGOA 4OQZA 2GN6A 3E9QA 2NADA 5TQVA 3FNFA 4IXWA 1HSOA 2C29D 3DOCA 4LCEA 4A0SA 4J2HA 4DIOA 4YXFA 5ILOA 4PG7A 3L9WA 2FPIA 1PJ2A 4X54A 3TFOA 4BKPA 3Q1LA 3PYLA 1IB6A 1WPQA 3M1AA 3V2GA 3GGPA 5BSFA 3HB5X 1GEGA 1AXEA 1M66A 1TI7A 3NT5A 3NEPX 4I8XA 2FPGA 3CZMA 3IDSA 4M89A 2LDBA 5JE8A 5BNTA 1OFGA 3DBHA 4MVJD 3GC6A 1XCBA 1E1KA 3TWOA 4FB5A 4CMHA 1A71A 5CFZA 5IN4A 4XYGA 2G0TA 4B8ZA 3G1TA 3AOEC 1S7CA 4WEQA 1BSVA 4WLVA 2E6UX 2J3JA 3KSZO 2GDZA 3S8MA 2EP7A 3ZHXA 2UUOA 1F8FA 4B7XA 4KMSA 4PIVA 4YWJA 3ROKA 4WOJA 4IGFA 2JJYA 2PH3A 5G4KB 4KQWA 2JAHA 2QYTA 5L4NA 2VNSA 1ZH8A 2AMFA 1FDWA 5LC1A 3BHJA 4CQMB 3VC7A 4FGSA 3PEFA 3LT0A 4BNUA 1JKFA 3H4VA 2CVQA 4YRAA 1HYEA 4A73A 2P91A 5IXSA 4NI5A 3UF0A 4BKQA 3GVCA 1KVSA 1UP6A 4B8WA 2NVUA 1WZEA 1YKFA 2RBEA 3LK7A 3OEWA 4E5YA 2QRLA 1EVIA 1EUZA 1U2DA 5A9TA 5JDCC 1B16A 1PZEA 5JC8A 4TVOA 3GVPA 4QO8A 4E2YA 2OGUA 4Q3DA 2C0CA 4IDEA 3X2EA 1MX3A 2XOXA 3PDUA 3ZWXA 4YR9A 3Q2KA 1Q2XA 1AUPA 3UCXA 3BMQA 3UVEA 4AJEA 1QV6A 3KLPX 4A27A 1R0SA 1DLJA 1KOLA 2DUUA 3HDJA 3M1LA 4WOKA 1Y8QB 2J3KA 3KYBA 1YRLA 1WDMA 2W2KA 2WMDA 3O38A 1O5IA 1Q7CA 1X7HA 1PGNA 4H3VA 3EW7A 5HTOA 4E5KA 3LC2O 4Y6RA 1T2DA 2B37A 3MJTA 5A03A 2Y99A 4L4SA 4EW6A 1YQGA 3ZV3A 4IUYA 4ZRMA 1QLHA 2PLAA 4DYDA 2YHIA 1A7KA 3BTUA 3JYQA 2RH4A 4XB2A 3NGXA 1R4MB 3DBLB 4FC7A 5KWEA 5HM8A 3GFGA 3VVBA 4MIYA 4MVJP 1MA0A 3IUPA 3BA1A 1I5RA 3AI3A 3GN1A 4GSLA 2YFHA 4DUPA 5JFOA 1TT5A 1E77A 1IZ0A 2DBZA 2H5LA 4CR8A 3H3JA 1HDXA 4XDZA 1CEQA 1NHWA 4QX6A 3S2EA 4AJ4A 2P2SA 1A27A 5JYEA 1UXKA 1NWHA 1YBVA 4QXMA 1DJNA 1DC4A 1U5AA 3WICA 2Y1CA 3ZHZA 1E5LA 3I3OA 3TPCA 1UZLA 5KNLA 2C5EA 2IZ0A 2H6EA 4OKNA 4Q3EA 1GL3A 4PLWA 2OP0A 3PIDA 3JQ9A 1NPYA 2PWZA 1E3EA 3FR8A 3KETA 1EDOA 2IEBA 4WCDA 2J3IA 1BXZA 1Y9EA 4PFJA 3PI7A 4NPCA 3W4KA 4AJJA 4W99A 1R6DA 3WB9A 3R6DA 4GWKA 3UFXA 1X14A 3CUKA 3BMCA 4PVDA 2UV8A 4AG3A 4LW8A 3L6EA 2J6IA 2PV7A 3IJPA 3NTRA 3WTCA 2DBQA 2VT2A 5DP2A 1KVTA 4Q3NA 3WJ7A 5CAEA 2VRCD 3ORFA 3ASUA 3P5SA 4D7AA 2Q2VA 4L9RA 2POQX 1O95A 3OJFA 1TT7A 3JD0A 3PHJA 2RHCA 1ULUA 2QYSA 2VN8A 3HQ4O 1UZNA 2AQHA 4BNFA 1LLQA 4DRYA 5FEUA 1HZZA 1SEVA 3DWFA 4OOEA 3WGIA 4IS3A 4NBUA 1B8VA 1I01A 1XLTA 2FR1A 3ON5A 2PNFA 1GAEO 5KCZA 4UEKA 4W7HA 2R00C 3PDJA 4YB8A 2HCTA 3W8EA 3ZI0A 4CMEC 3ANMA 3FNHA 4E0BA 1XR3A 3WXBA 2VTEA 4FN4A 4DQUA 1T2EA 4PG5A 1ZO8A 4JQCA 1N8KA 4W9NC 1FJHA 4YRDA 4JBIA 2GZ3A 1CQIA 4BNZA 5DP1A 2O2YA 4LSWA 2NVBA 2X1HA 4Y9DA 3QVTA 1KVUA 1MLDA 3OF2A 2FMUA 3OIFA 1CYDA 3F4BA 5IN5A 1BXGA 2FWMX 3NDIA 5LDHA 1Q0LA 1KYQA 4KUHA 2CNBA 4ALNA 4K1LA 1RWBA 1UAYA 4BV8A 1JVBA 1JA9A 2AE2A 4AJPA 4KQXA 2ZK7A 1L1FA 5I8WA 3AUTA 2QZ9A 3T7CA 4GPD1 4MDHA 1T2CA 3GAFA 4PRLA 1JAYA 3Q6IA 5L3ZA 2UYYA 1VJTA 4IZIA 1WDLA 5DCYA 3RWBA 1SZJG 3DAPA 4J0FA 1DFHA 1ZSNA 3U4DA 4CM8A 4ESOA 3JQDA 5JY6A 1WDKA 2BKAA 2HK8A 1E3WB 5A9SB 3ZNQA 3KO8A 3LF2A 1NR1A 4JJGA 1BRMA 4YPOA 3ETDA 1JQBA 3MCVA 1KS9A 4WPGA 1YS4A 3BIOA 3DBRA 1ZXLA 4LN1A 3W1VA 2OXIA 3SJUA 4LVUA 1PWZA 2X7HA 2JD0A 3FNGA 3WLFA 4CLOB 5TT1A 4XIJA 5ER6A 1YE3A 3QA9A 1F14A 4I9UA 2G76A 3MWEB 3WX0A 3M2TA 1U3UA 1RJWA 3OA0A 4O59O 4IS2A 1GZ6A 1Q7GA 3UAGA 5AXDA 3E18A 2VHWA 3BTVA 4JXKA 2DTXA 1ISJA 1RKXA 5TT0A 3V5NA 3NTOA 3HDQA 4BB6A 5COQA 2NVWA 4UUPA 3PGXA 4Z9YA 1KEUA 4BNNA 1BVUA 1F8GA 1ENZA 2VYVA 2EF1A 3D1LA 1V6AA 2B69A 4OGWA 2Q1WA 5TS3A 3AM3A 2IEDA 4UUMA 3LLVA 2Y68A 5JAIA 4LMPA 4RZHA 1ENOA 2WYVA 3PZRA 4QEDA 4E31A 3SLKA 4IJWA 4W7IA 4A7PA 1VC2A 4RVUA 4IMPA 1NR7A 2BFPA 2NNLD 2G82A 4IXTA 2CY0A 1KC3A 3WGHA 4DBVO 2H63A 1CJCA 5ITVA 1PIWA 3U5TA 4PG6A 1D8AA 3HE3A 4BHTA 4CMIB 3LT2A 5EINA 2QHXA 2IYPA 4FJ0A 2FR8A 2PGJA 2BD0A 2WSBA 3ROMA 5C7OO 1ISIA 4I9NA 4ZU3A 5TF4A 1GV0A 1EE2A 2VTDA 3I9OA 1HRDA 3INTA 4O6VA 1DEHA 1P1KA 1V3UA 2E4AA 1Y8RB 4MIEA 3ZCXA 4LCJA 4IDGA 3SBOA 4PVCA 4B3JA 3I9KA 2CSUA 1YBMA 5JMWA 3KB6A 4U0KA 1F12A 1PJCA 3HDYA 4MVJM 3CMCO 4WLOA 4YAGA 5CG1A 1ZK3A 3PLNA 2O3JA 1J5PA 1I24A 1SNYA 4OIMA 4HADA 1ZNQO 2V6MA 2W90A 2A9FA 3JYLA 1HF3A 1XQ6A 3NGLA 3ZHYA 3JQCA 4ZA2A 4JBHA 3DMTC 4G5HA 2HMTA 4CQMD 2BH9A 3GK3A 5IDXA 4IPTA 1CDOA 1E1NA 5L4SA 5G4LA 1XSEA 2QRKA 3RUIA 1J6UA 1E6EA 2E82A 3S2IA 5T6BA 4XKJA 1WAMA 2O50A 2EKPA 5BSHA 3HSKA 5TIIA 5A1TA 3GQVA 5IF3A 1DRUA 3BMOA 4OXYA 4GX5A 2C82A 3JQAA 2JCYA 4XYBA 1NNUA 5CDYA 3ZWBA 2HU2A 2RHRA 1HE3A 2O3QA 5L95A 3ETGA 1N9GA 3PJGA 1QYDA 2GN4A 1LC3A 3FHLA 2V7PA 4BKRA 3WTBA 3WGOA 1K0UA 5KKCA 3TZHA 1E6UA 7MDHA 4UUOA 3GA0A 3CPSA 4XEHA 2B83A 4BNTA 3EZYA 3VH3A 2VWHA 5DBGA 1QORA 2HRZA 4J3FA 2J5KA 1SB8A 3KM0A 4S3MA 4Y6SA 3BMNA 3VPGA 3P2YA 4WKGA 2GERA 3LDHA 2AXQA 1CQJA 4GKBA 4D79A 1I2BA 1TA4A 1IZ9A 3I9MA 4IY1A 1GQQA 1EE9A 4J4HA 1LJ8A 1X13A 1I3NA 5BSEA 3ENNA 2JFFA 3I6IA 4IINA 2AEMA 4RVGA 3SJ7A 3GH3A 5JBIA 4B3HA 3D3WB 2FZEA 4MP3A 1E3JA 3UOGA 3MOGA 3MTGA 4U6SA 2ZTVA 4GLOA 4FS3A 5JNLA 2GASA 1SOWA 1E0DA 2XPCA 3CKYA 4TKLA 3T7EA 1SEPA 2JCXA 3QWBA 3TQHA 2WYWA 4Y67A 5CDUA 2RAFA 4XYLA 1GUFA 4D46A 4MPDA 2NU9A 5ILGA 1P0CA 2GRAA 3CMMA 4NFSA 3WNQA 2OHXA 2ZYAA 4GBJA 1QXSA 1K5HA 1PX0A 1I10A 2I67A 3OA2A 2ZB3A 3ICCA 4XYEA 2DVMA 3D5QA 3PTZA 4OSOA 5AYVA 2IRWA 4Z0TA 3W6ZA 1E7RA 1YQDA 4PZCA 4IIVA 5TC4A 4WLNA 3V1UA 1E7MA 1X0VA 4NJMA 5F5NA 3RBVA 3QSGA 3HHPA 4GI2A 1GY8A 3PQFA 5BR7A 1P0FA 4EGFA 5I9NA 1ISHA 2VZ0A 2PZLA 1R12A 2DBRA 2B4TO 4OQYA 3U4HA 2W4QA 2CF5A 1IPEA 3WMXA 1SMKA 1HYHA 3L6DA 4JP2A 4BO1A 1BHSA 4RPGA 2OORA 1G6KA 5CG2A 5GY7A 3AOEA 1ENPA 5CPFA 2CFCA 5CDTA 1K2WA 7ADHA 3TL2A 4KTVE 4LK3A 2CD9A 1GR0A 3H65A 5JLAA 4DLBA 4AJHA 1F06A 3B1KA 3OFSA 2GCGA 3ZU5A 4CJXA 1R4NA 4HXYA 5AXAA 3RSHA 2ZQZA 1GADO 4CV3A 5EJ2A 1J0XO 2CDBA 4GSKA 4HX5A 4AJOA 2E37A 1NPDA 2OZPA 4CUJA 3PLRA 2DQ4A 1PJBA 2LDXA 2NUAA 3QVSA 2NU6A 3T4XA 5ES3A 4JN6B 4RPHA 4B4UA 3DMYA 3OMLA 3JQ7B 4P4LA 3GNTA 1HETA 1AN9A 1GV1A 3BZUA 2Q49A 5JDCA 4ND2A 3M2PA 2VCYA 4FSHA 4NBTA 4MJLA 2Y05A 1O9BA 2ZCVA 1QG6A 1MG5A 5CDGA 4J91A 3U9LA 1HEUA 2EHDA 1I3KA 4AL4A 5DNAA 5A3VA 4OYRA 1H5QA 2DAPA 3PQEA 4BNIA 3LQFA 4PGFA 4HNHA 2DT5A 3OP4A 3GG2A 1X0XA 1XGKA 3JTMA 2V65A 4GAEA 2GN8A 2X5JO 1ZMOA 3JSAA 2O7QA 3WGQA 1T1SA 4GWGA 4DMMA 1RM3A 1UZMA 3MJCA 2Q1SA 4YTEA 1E7QA 2X58A 3R1IA 2VWQA 3ROPA 4BB5A 4HKTA 4YT4A 3SXPA 3WJAA 2AQIA 2YDXA 4E6PA 4BO9A 3LVFO 3F6YA 3FWZA 5JSFA 2UVDA 5KJCA 5KKAA 1XKQA 3PK0A 2WEKA 2ZB8A 2CDCA 4RF2A 3PJFA 4HBGA 2GGSA 5IAAA 5ICSA 3OEYA 3VVCA 4MIOA 1DAPA 4TRRA 1XEAA 2YUTA 3D4PA 3KVOA 2EERA 4FC6A 4ZQGA 4BQPA 1FDVA 4EJMA 4XJSA 3NX4A 4DA9A 1A4UA 1MC4A 1ZJZA 5I7FA 1GQYA 2O4UX 5G0WA 4E3ZA 1I32A 4CLEA 5CP8A 3DZHA 1DFIA 1K6IA 4XRGA 9LDTA 2GF2A 2XXBA 1P74A 1NFQA 4J7UA 3HFSA 2VYVD 1IY8A 1PJQA 5FF9A 3P2OA 2VHYA 4YAEA 3JQEA 4K6CA 3QWAA 3OIGA 3UCEA 4R69A 5JDIC 5ENVA 3DAFA 3FNEA 1HZJA 3NT4A 4ITUA 3WSVA 4BMSA 4WASA 3K96A 3V1YA 4PRKA 4D3SA 3I23A 1SOVA 3LSYA 1GPJA 2O7SA 2GR9A 1ZEMA 3DONA 3QWIA 1C1XA 5F1OA 2YHUA 2BGKA 3WGGA 1MFPA 3SVTA 3LT4A 4MVJF 1ISMA 3DHYA 5F5LA 1Q1NA 3ENKA 3GUYA 4BNLA 4ROSA 1H9BA 4GQAA 4IZHA 1QYVA 1ZKMA 4HFNA 3ADOA 4MP6A 1ZK0A 3GLQA 2YYYA 1O89A 4L75A 2EEZA 4CMJA 5EQFA 2O3SA 3H9UA 3QY9A 5U1PA 5GZ1A 4XQEA 6LDHA 3KEQA 2Q3EA 2NVUB 2PGLA 4J1SA 1PJLA 4B7CA 5JCJD 4L4RA 3LC7O 4IDFA 1I0ZA 3D7LA 5B37A 1K3TA 4BV9A 4RLHA 1X1TA 1JLLA 1C14A 4CM1A 1CETA 4A26A 1E7SA 5HWSA 4WK6A 3BMQB 4IDDA 3WSWA 1GUZA 5A3JA 3AJRA 3WBFA 1P1JA 1NPTO 3GDGA 1Q7BA 3RBZA 5TGDA 3EK2A 4M8SA 3DTYA 4Z0PA 4CMEA 5KVVA 1LRLA 1XWFA 3ETEA 3ZV4A 1JWAB 2EGHA 3GVHA 2PKQO 4CL8A 5TJ9A 3DHEA 4CM3A 1XELA 1EK6A 3GVIA 5FFFA 2J8ZA 4W9NA 1ZK4A 1NP3A 2ZTMA 4YVFA 5B4VA 1G1AA 4IDBA 3UICA 3HJAA 4RJTA 4UVEA 3KSUA 3WYCA 3E03A 2DC1A 4XRRA 3DOJA 2O3UA 4OJNA 3RUEA 4I1IA 4I5GA 3W8FA 1R66A 1WW8A 3LU1A 5ER9A 2HMWA 1YL7A 3LYLA 4WLUA 2X4GA 4MOWA 3UXYA 1V3TA 1TB4A 2D59A 2Y66A 3SX2A 3ZH2A 1HWYA 3OJEA 1FF9A 1TT5B 4EI2A 3K5PA 1H6BA 5GMOA 4KDFA 5T5QA 1YB4A 1Z82A 5TSDA 2FRDA 2BGMA 4IJVA 1OC2A 1LEHA 3GEGA 4XX0A 4D0SA 1GU7A 2OL4A 1Z75A 3QQPA 3HFGA 1YL5A 1B8UA 2JFHA 4FFLA 1H94A 3ZN2A 2VNAA 3IC5A 1E7YA 4R1TA 2Q45A 3WWYA 2O2SA 4P4NA 5DOZA 4I5FA 3E82A 1LDGA 3GR6A 5KJFA 1MXHA 3L4BC 5JAMA 4YJGA 3NJ8A 4CLDA 1P1HA 4J49A 3JQBC 1DFGA 1L7DA 1UUFA 1GEEA 3U4IA 1BW9B 1K6JA 3RC9A 4A2CA 5C7LO 3JYPA 1M6WA 5F1KA 4AJ2A 1UDCA 5B12A 3UCFA 5THQA 1LDBA 2EXXA 4J16A 2GUGA 1LU9A 3S2FA 1EZ4A 2JKVA 3H2SA 3H5RA 2HQ1A 2R6JA 4J4BA 4Q3BA 2JD1A 3JQ6A 3H9GA 3WYEA 1LRKA 4J90A 4DIBA 1P9LA 2BFOA 1NHGA 4YDRA 2EW2A 3GF4A 3WOHA 1NVTA 3QIVA 3ZNOA 4LGVA 4WGGA 1E7WA 4HV4A 3RVDA 3KSDO 4E33A 1OI7A 3I83A 1WLYA 1Y8QA 3HZZA 2W8ZA 3ZWWA 4Z9XA 4WCFC 3WFIA 2V6GA 4MVJG 4HNGA 1JAXA 4CM9A 1LTHR 3FN4A 4LRTB 3NKLA 3DDNA 1EQUA 3UGKA 2FPPA 3L07A 3QVWA 3MZ0A 1AGNA 4DC0A 3WLEA 1Y7TA 2IE0A 2HMVA 4WNIA 3Q9NA 2D0IA 5DN9A 4PG4A 1E6WA 4E4YA 1AHHA 4R16A 1EEHA 4RGBA 3C3XA 5I7EA 2GZ1A 2ZYDA 4YT5A 4EUEA 3C1OA 1QV7A 1KEPA 2FSVA 4XR4A 1KC1A 4TMFA 3VTZA 2PH5A 1GD1O 3VKVA 1DIAA 3VPHA 3VZPA 3U09A 4HWKA 3IOYA 3UKOA 1A9YA 1LSUA 2QW8A 5A5FA 4LVCA 3E48A 1JTVA 4DYVA 3B70A 4I9HA 3AWDA 1BXGB 2FHSA 4ZHSA 1YDEA 5COAA 4YJHB 4YAIA 1FK8A 2NSDA 4FFNA 1AE1A 1B14A 1IULA 1K89A 4YQZA 3I9NA 2ZB7A 1YONA 4JLWA 2VUUA 4KZPA 1E92A 5T8KA 1ISFA 2NTNA 3B1JA 4NFHA 4DQXA 1DHRA 1C0LA 1X1EA 4M54A 5DCUA 1WNTA 3ROQA 1KETA 1T26A 2HJRA 1U9JA 2PR2A 4CM8B 3IL2A 3DHNA 1UDAA 1HE4A 3K2BA 4GX1A 4L0QA 1GYRA 4NBWA 1T2AA 4MKRA 3Q2IA 4E5NA 1K6XA 1C0KA 2DKNA 3LF1A 2Y1OA
chains in the Genus database with same CATH superfamily
4KKVA 4Y2SA 3I9LA 4LYYA 1GCUA 3W5CA 1XNGA 2FMKA 2P69A 2XNJA 4HUJA 4IQ8A 4PBTA 5G02A 4CIWA 3I1IA 4WRRA 5JCOC 5JQWA 2R3SA 4PCLA 5CD1A 3AEZA 4XCVA 2WW8A 4AUEA 2G04A 2XDYA 4U7HA 5K6AC 4XGKA 3TTSA 2QDKA 3ENZA 4HEA6 1LZKA 2I7DA 3OLVA 3SU8A 1E5XA 2A84A 4DV2B 3VPSA 1DKRA 1MJHA 1U3DA 4QO7A 4YONB 3W8NA 3MJSA 3HM9A 2MR6A 4QASA 2UZIR 3IRUA 4H7KA 2PQ0A 5L7YA 1ZOPA 3FPCA 2R4UA 3SIXA 2X5XA 4G1CA 1GZDA 2HK9A 4PGGA 3SJBA 2YV4A 3ICQB 4DMLA 3DDSA 4D9EA 3QVVA 2FTKE 4OJKA 4R3WA 4RIIA 1ZL2A 3QV1A 3GBPA 3D4NA 1T91A 721PA 4BEJA 2CGEA 5IMSA 2QF7A 3FFAA 4FGWA 4UM9D 4XQ0A 4IKPA 3DDWA 3EVTA 3QKUA 5FBHA 1ECGA 3SAJA 1F6DA 1YI1A 1WPGA 1FB5A 4J43A 4DVJA 4G0QA 2C7BA 2AOUA 2BGTA 2NO0A 2RHMA 4KG7A 1E3LA 1Q1AA 4OLHA 4QYXA 1RRCA 3C6MA 2H8KA 4GLLA 4UZFA 1D2HA 3FSJX 2F7SA 4OM8A 4X1IB 5DRYA 5GP1A 5HYVA 3X3HA 3MBIA 4CR6A 2Y1FA 1Y82A 3OC6A 4TMWA 4BLVA 2JHGA 3W5SA 1KVRA 3C85A 4IJ5A 5KIAA 2PGNA 3D8RA 2DKFA 2C4TA 4PAOA 2JH9A 1PZNA 1JHQA 1GTVA 1TW2A 3R5KA 4AQDA 1JIQA 2QRUA 4A2PA 2V3VA 1Y5RA 2V58A 3BWCA 2GNOA 2ZDGA 2A5LA 2J5XA 1T8WA 4YCAA 1EK2A 3CTMA 1ARZA 1UJBA 3KQPA 3G5LA 4BOYA 3HCBA 4XVQA 2PGOA 3EMKA 2ZRQA 1AA9A 1VKNA 1I4OA 4AX8A 1HNNA 2BI8A 1J22A 1FQWA 4HB4A 2AZMA 5HUJA 1M1YA 3A1VA 2DZDA 3IMEA 1IUKA 4J7AA 1GZUA 2JDID 2BGRA 4ABYA 2ERCA 4D9FA 3PT9A 5DHPA 1FW6A 4BFUA 3CUVA 2QZPA 3FRHA 2BI7A 4MLZA 2XRYA 3OJLA 3FA2A 2QQGA 2ZI3A 3N8DA 5EPOA 3R6TA 4LWPA 4ZZ1A 3ONEA 3WK4A 1KFCB 3LDGA 4GQIA 4F3KA 1EFUA 2VAPA 3VR5A 1KEEB 3PS9A 1UJ4A 4C06A 3I05A 2GEUA 3ANLA 5EJ4A 4IIBA 3R77A 5FWNA 1CULC 1SRRA 3N7TA 5ARDA 2P8JA 2XUKA 4JP5A 3O5AA 1O6CA 2HHLA 3WLQA 4GR9A 4AXBA 4YCLA 3DTVA 1GRQA 4O4HB 3DE0X 5A9SA 4YUVA 3F8TA 1JN0A 2CK3A 4Z0HO 2IH5A 1JZSA 1KS2A 4MKXA 2D8AA 2FV8A 5L53A 1FFXA 3IIIA 1DXQA 2IEYA 5IT0A 4DA4A 4P1ZA 5E4JA 1ULZA 2OP1A 3ADBA 2AMLA 2G8LA 3U7QB 4G81A 4Y2QA 2QGFA 2FGJA 3JQ9C 1GL6A 4AJNA 1IG3A 3DUWA 1SVIA 4W8GA 5AUQA 2J0VA 1DARA 1F0YA 3RH0A 4N0MA 4HAYA 1R0KA 3VPXA 3Q11A 4B3MB 3N8HA 4WXHA 5LMNB 4MS1B 1V1JA 2X2OA 3LUCA 1B41A 4EGQA 3Q4GA 4ON9A 3HNPA 1XL0A 1TK2A 2XUQA 4C9BA 2O57A 2ZQ5A 3QLEA 1Y1QA 4BBAA 4YAOA 3BTSA 1V16B 2CEAA 1PTKA 4DJEC 3UPDA 4OHUA 3VR4A 2BKLA 2X7JA 3R76A 1IUOA 1KMHA 2H2FA 3TZKA 4Y2UA 3WIOA 1PD1A 3QPUA 3Q40A 4LY0A 4OH7A 1N5OX 4NDZA 1OPRA 5D6OA 3T41A 2V8BA 4ZI7F 4Q1BA 1EUDA 4RMJA 1G3RA 5CXQA 4JJAA 2AN5A 2ZYHA 3V1NA 4CGZA 2WP8J 3DFFA 4KZKA 3G2KA 4WBXC 2DOKA 5K3EA 1GL7A 2GDJA 3PWSA 4YP1A 3OZEA 2Q2WA 4PLTA 3GUUA 4YO8A 3V9PA 4EITA 1O96A 5TV2A 3NTXA 3HG7A 4MVJA 2HUPA 3K73O 4P7KA 5ECWA 1GTRA 3O2NA 2OPHA 3GLGE 1QUFA 2A1TS 5I9LA 1PTJA 4POAA 4MXDA 4ZC8A 4ZT5A 1DKOA 3DMRA 3AKDA 4R2JA 2E5WA 4G97A 1DADA 1H3FA 1XMPA 2Q5CA 1KMMA 1NUTA 1J2YA 4FYVA 3Q7IA 1IVNA 1JSRA 2QGZA 1ZA2A 2DCUA 2JGMA 4M1QA 2OO5C 4ARVA 4CMIA 4X62B 1SB9A 2K6GA 4H59A 1FOEB 1G5FA 2F1JA 3CRMA 5TDHA 2Q6LA 5HKKA 1JP7A 3OO0A 4Z5XA 3G17A 5J1SB 1L7XA 3KBOA 1FFHA 1C2TA 2ZBRA 3MJEA 4B75A 1XG5A 2GZAA 3GW8A 3ZWKA 3E3AA 3GLVA 1WHTB 3RKRA 4P38A 2OFWA 5DM1A 3SOPA 2QLJA 4A8JB 1X80B 1PJTA 4N03A 2E49A 4EEXA 1JA0A 3EF3A 3FPGA 2CLKB 3AHIA 2NU9B 3RFTA 2Z6QA 1R64A 4LKRA 4BXOA 2Q5EA 3GARA 3C5WP 5ES4B 2FQWA 1EB9A 3AM5A 3FBTA 2DLDA 3LECA 4NVRA 3ZZNA 3HZOA 4ER3A 1ACMA 2VJPA 3KYCA 4L5YA 5AK4A 3TRDA 4IXMA 2COEA 2I3DA 4RS3A 3RAJA 1K27A 4YQYA 3RROA 1QWSA 1JFFB 1BX0A 4FNAA 3HM2A 1PG2A 5HK9A 1BOOA 3AUXA 3D64A 3ESQA 3HJTA 5E6RB 5LP6A 4BNJA 4CL3A 3UQZA 1UPTA 3UGJA 3JVVA 2OBLA 4QDUA 3S2SA 4NZYA 3KUUA 3A26A 5TRTA 4OJQA 4FFMA 4NE2A 5BMVA 2GNPA 1NQOA 5BV2P 4RK0A 5TLSA 4GQBA 5CFLA 4XUEA 3S5JA 5DBIA 3FPHA 3H6GA 1B6TA 2VDPB 2YWHA 4MCJA 5K3DA 4TLAA 3I01A 3L7JA 1QP7A 3F3MA 4JR2A 3FZGA 3RC2A 3UENA 2AFVA 3JV7A 5E38A 3D2CA 3LQQA 2GETA 3W79A 5CFQA 3R7AA 4EPYA 5LMZA 1VCOA 4DQKA 4YMUA 1ODCA 1CJMA 4B76A 1ZU4A 3KOYA 2QRVA 3D54D 1C7FA 5JTUA 2ZYIA 4GBGA 5BV8A 2Y92A 4ZCLA 3EIWA 4PX3A 2C2KA 3FOBA 4BJ5A 3EEYA 4N5LA 4R8VA 2C84A 4WLFA 2AEEA 1PL7A 3A9WA 1NGSA 5AI8A 4MYSA 5DIZA 4XFJA 1B23P 3DS8A 5KYYB 5HZKA 1JEJA 3C24A 1QHSA 4R8KA 2VPQA 2H1RA 4ZEMA 1NQTA 1X15A 3DVAB 3IGFA 3IIEA 4JJ8A 1Y80A 5IARA 3I3SR 3L8CA 3P0EA 4RMGA 4TL8A 4YJ2B 3TOZA 3VJLA 3BE4A 5C1DA 3M4YA 4U9UA 2ZRKA 3FTQA 3JQPA 4DBLE 2AF3C 5K3OA 3PVZA 1EDZA 2BKEA 4MV0A 2YJ3A 4F3YA 3DR5A 2Y9PB 1IN5A 3RI3A 1Y5MA 3A4VA 4GGOA 2Q1YA 1OC4A 5TX7A 4E2FA 2GTIA 3L79A 4HO1X 1CY6A 4Z7OB 1WP4A 2WWYA 2WF7A 4WECA 2QD4A 2FU5C 2IOYA 4YIKA 1KFKB 5K45A 4CEJB 1MENA 4M0FA 3C7KA 2V59A 4A92A 3FTFA 1MQ8B 5ABPA 1CZUA 3C5HA 3CH5A 2QY6A 2YZ7A 3ELBA 1GZHB 3QXXA 4FDMA 3RNLA 5IEJA 2XV1A 1ML3A 1QS0A 3L0ZA 3PWTA 1RYEA 2QMOA 3NBFA 5E2IA 4B4OA 3HNRA 4BWYA 3MUNA 3QMWA 1O3YA 2E4YA 3ETJA 4JB8A 4JLSA 2VFAA 4B6GA 1GAQA 5DLPA 2H0AA 2QN3A 3EGDB 2VATA 4XARA 4EY4A 1XRQA 1PKXA 1IMJA 1CC1S 1G59A 1WMFA 2FX3A 4JA0A 1V3VA 1Z7YA 4XOUA 4BQQA 2G1UA 2NZJA 1EGVB 2HMUA 4LRSB 1Z0AA 3MERA 5IJ9B 1EVLA 1UXIA 3LPMA 1X7GA 1E4EB 2J3HA 3UUGA 4BLPA 1SBZA 1XZLA 1X7DA 3V1MA 4E51A 4GH5A 1BJTA 2JEYA 4EUFA 4URVR 3LZ6A 1TVKB 3DTNA 1YACA 4ZZ2A 4RY2A 2VRCA 4O4JF 3T9FA 5CB4A 2ZRCA 3ESDA 1J99A 2X2EA 4NU6A 1BU8A 4YJ3A 3ITEA 2NYAA 4NR0A 5DLEA 4BUZA 3DQZA 4F9GA 5K3BA 4OCZA 3D3NA 3RT7A 1B73A 1N5LA 1QIFA 3ZIUA 2IEGA 4M88A 3T1QA 4JR0A 2BL4A 5BW5A 4HLCA 3WYGA 1Z63A 3VC3A 1BCRB 1DI0A 2I80A 3N05A 3PUKA 3R0JA 4IDCA 3WHKA 5KOJB 4UTNA 3SS9X 1FZQA 4UM9B 1QIMA 4DDUA 2ZPTX 2J3EA 1J00A 2FW9A 3RHZA 3A1EA 1BG6A 1RWWA 3ZJ5A 2Y67A 2ZJ3A 5EEGA 2ZIXB 4Q7QA 1XMIA 4HNRA 4FCCA 1L5FA 3NTUA 3VR1A 3ZE9A 3TAHA 2ZUBA 4CI9A 4DDHA 2IHBA 4OSEA 3LRTA 1E2BA 2GM9A 4BO2A 2VOEA 4EJ0A 2EKQA 5JHHB 4FM9A 3QLUA 4D9KA 4JCOA 2H2GA 3O03A 8GPBA 2MTBA 4LFBB 4FX2A 4AQ7A 1U7WA 2X5OA 1BYIA 10MHA 4IEEA 1NFRA 2I6FA 2OHFA 3BGDA 2HZBA 3CLRD 3E35A 5LXTF 3UATA 4B40A 2QG4A 3MTBA 4LJYA 1AXGA 1P1CA 4Q47A 4X1YA 4DCPA 2Y6VA 2P4HX 2RARA 1RKQA 4TMYA 5EJ9A 3TYXA 3QPWA 5IC6A 2A35A 3EHEA 3L4KA 4CMBA 3GVXA 2GEVA 1DC5A 1QDUA 1WMBA 3K5IA 4LJ9A 1U0EA 2R7AA 1TMYA 1Z6YA 3BFKA 3LYAA 4X9XA 1S9HA 1AA6A 1J4AA 3N2ZB 1PU2A 2Z3VA 1YJQA 2PFGA 3U56A 3O2QB 5A06A 4RVDA 2H92A 4IX1A 1A8QA 5D3ZA 2ST1A 4FFRA 3S70A 3S44A 2GVZC 2Q6OA 3HXLA 1RYHA 3L0DA 5CEJA 1RRMA 1NF2A 2EFCB 2FN9A 2VDVE 3MWDB 3QF7A 2WPNA 3EWAA 3UK6A 2CE7A 4HD8A 5A0FA 3RTCA 4C4ZA 2XMGA 2QVYX 4EYSA 4WCFA 3EEBA 1VBNA 3GJXC 5BN4A 2OBYA 2MMCA 5L51A 3LBAA 1FRQA 1ZL0A 4QG3A 3CXRA 3DYIA 4K5QA 4UEOA 3AVUA 1Y1PA 2ZR7A 3SJCA 4BS9A 4LQDA 4Y2XA 2M6LA 3KWLA 4F46A 4B0PA 2H07A 3SR3A 1RI4A 3DOHA 4QPPA 4YACA 3TBHA 4QGAA 4IDAA 4RSHA 3KZKA 3KTDA 4BXOB 4OHXA 2UXBB 1T5TA 3WGUA 4GP7A 3PFWO 5AW0A 3G8DA 1JQAA 2RHBA 4FPXA 1K6MA 2G9ZA 2HXYA 4Q00A 2ATCA 3EZXA 5J4HA 1J9ZA 3U4QB 3D8HA 3LUKA 5LL6P 3F3YA 3GT3A 2XKAA 3AKZA 5FQOA 3CF4A 2ZU6A 3WC4A 5J2UA 2O2HA 4AO6A 4BAUA 2W71A 1XVIA 2XE8A 3ASVA 5CIQA 3TZCA 1QZTA 3FI9A 4OUKX 1Z4NA 4NBVA 3MWJA 4GPIB 5I7HA 4RTPA 5KOIA 3U0VA 5LZ2A 1YRHA 2CFRA 2M1ZA 3ED5A 3ER8A 1ZI6A 4PLFA 5MN4A 4CV0A 1U3FA 4LYGA 4C4YA 4F38A 4WOPA 3OECA 4IAOA 2NGRA 4O4IA 2KSQA 2ZKLA 3HCDA 4RIGA 5HS4A 1A5AB 1RM4A 4BVJA 5L40A 5ENZA 4E12A 1YJBA 1KY3A 5DSTA 1AQUA 2CHEA 4PPGA 5LYYA 4RF4A 2ZQYA 1KO4A 3CX4A 2ZRAA 3R7LA 1RSZA 4KXLA 4URFA 1DDOA 1GNLA 1ZS9A 2HJSA 2Z2KA 3Q6MA 3HSYA 5ALMA 5F21A 2Q0HA 3W3AA 4DUGA 3OLWA 3PICA 3NBXX 4QHYA 2PUFA 4YT8A 4M38A 1QYWA 4DLAA 3QBJA 3REGA 1O8CA 1QFMA 1P0PA 3JQAD 3KHKA 3MCWA 4HUQB 4IR7A 4OOFA 2GK6A 4LYJA 4PPYA 1IYZA 4IYJA 5T57A 4X1OA 4Q9IA 1NKVA 3RC1A 5EKXA 4LDZA 1NN1A 2OYSA 3H5IA 4RYDA 4AP5A 2YHIB 2XYVA 4RGVA 3I37X 3SMQA 1ZG3A 3JALA 4ALIA 3QEKA 1ZX1A 4LUCA 4MW1A 5CLQA 2P4SA 1DTEA 2EYUA 4UHJA 5AXBA 5JCOA 3VU9A 2BZ0A 4LBVA 4EGSA 2I66A 5K6AA 2AN1A 2C7RA 1A4XA 2PZJA 4P83A 3U6KA 3FYHA 1JEQB 1G3UA 1SKQA 2PG3A 2V6BA 2HA7A 4KOAA 1QGAA 3TMYA 2WT9A 5FADA 4PPNA 2L18A 4I6JA 4DLYA 1UH5A 2WAOA 4OX9Y 2VRWA 3KRTA 1AGYA 2CVPA 4LTMA 5AMXA 5JMPA 3W06A 2AVNA 3NNDA 4FUQA 1JQJC 1FXSA 1IY0A 4BO8A 2PANA 3K30A 3K09C 5K5EA 1TC2A 4P7BA 4Y6PA 4OHZA 4MVJI 1FW8A 2V0NA 4TWRA 3QKWA 2OCIA 3HVRA 3BZBA 1JDBC 2PUBA 2C9MA 3LVQE 1JKJA 4DA7A 2HFJA 1EIWA 3ZE0B 5A4IS 4WUVA 1BQEA 1P9WA 1NBMA 2ZUVA 3LIIA 3BHNA 1W9HA 3ADPA 1T6YA 2HK6A 3DBVO 4ND5A 4AS2A 5M04A 1SQFA 1PJ4A 4NDNE 1J2RA 1N25A 4GX0A 4O1MA 3ZXXA 1EE1A 5KWVA 2G3YA 4TKUA 1RZUA 1LPBB 1RBZA 2NACA 1NJ5A 2WWRA 4XLLA 1UMDA 1YFZA 4G9GA 1RQRA 4UUBA 5D5QA 5ALVA 4PSVA 5IKEA 1E1RD 1JX6A 4AD8A 3NRJA 1HMYA 2XT9A 3LUBA 1SKYB 4CQMA 1PT8A 2R87A 2EP8A 4NC9A 1GNRA 3UOAB 2R65A 3ZWMA 3OQBA 4DQDA 1NNSA 1AGPA 3KLBA 3R6GA 3O1HB 4AAYA 1IQPA 4ZC1A 4UQLA 1S01A 4EGCB 3ZV5A 3D0QA 1AKRA 5COBA 3G2JA 3BREA 1CRPA 2Z9BA 4NK4A 3HN7A 1M73E 1QH8A 2CDNA 4ML3A 3KQYA 4M9RA 3VHXA 2HWWA 4LISA 3AIIA 3WGMA 3ZW9A 3ISVA 4FVTA 3UK1A 4U5XA 4ZT7A 3N2YA 4O25A 4WL0A 5DNYB 1UZUA 5G0VA 3UOWA 4EPRA 5C81A 2ONZA 3IUMA 4B34A 3V4VB 1PV1A 1M2KA 4Q5IA 1MABA 4HGYA 5C1IA 1YUBA 4BGEA 3CB2A 3SC6A 3BB4A 3IQIX 4UHEA 4CQNA 4KE6A 3COJA 1DOHA 1EFTA 1SUWA 1U5CA 2PMKA 3KP1A 2POCA 2IH2A 1SOAA 1KI4A 2FPMA 2I65A 1I4WA 2D1TA 1HLFA 4L1KA 4Q82A 5MDHA 3KT3A 4LFAB 2H31A 2P2YA 2YYAA 4C7VA 2C4UA 3ZZMA 3KXDA 3ZQ6A 5INTA 1T1EA 1VL8A 1W8DA 2D62A 4MS4B 2DB3A 2Y1GA 4LXHA 2HPZA 3WRVA 4B73A 3TQTA 5IDWA 1JHMA 4BMVA 4BCCA 2F8LA 4KNYA 1Z88A 2MSKA 1Q0SA 3X2SA 4X3OA 2XWSA 4M37A 3LP6A 5CEEA 5K0ZA 1LLDA 2BFEA 1GKKA 1OLXA 3CUYA 4Z9FA 3AI1A 4BO7A 1CZOA 4BVAA 4C43A 4EY8A 5ICCA 4KR7A 5MHTA 1V1MB 4BQOA 1MW8X 4OL0A 3B1XA 3HYSA 1XDSA 1V35A 3L6OO 3RIYA 2PSDA 2X86A 5KTRA 3CJTA 3OX4A 3RC3A 1P1BA 1YI0A 1XLVA 1QHHB 2II6A 3O8RA 4PLZA 2YV2A 2PO7A 4BECA 4DAOA 3GOHA 8AT1A 1K8QA 1BW9A 3A11A 1N0VC 4HJXA 4RH3A 4N18A 1P0MA 1WZIA 2GAOA 3QP9A 1ODFA 2IHVA 4AB1A 1YHYA 2JKZA 1EA5A 5FL3A 3K7EA 1YZQA 2PIAA 4NIMA 3BXGA 4G36A 3EA0A 5JVDA 1OLUA 4JV5B 3HA2A 4FN5A 5D7BA 2UXCB 4G07A 2Z9DA 3VZQA 1GFWA 4QGSA 5C8YB 1MRSA 3TVYA 3OPMA 2H29A 1JVSA 4FOSA 5CDSA 3A3PA 4MWOA 3MQ4A 3GJYA 3ZVLA 3BORA 3PQ6A 3AF5A 1ZYUA 1YS9A 1O5OA 3GHYA 1JR3A 1CUIA 1PT5A 4IHAA 5EAIA 5HSGA 1JEYA 4X7MA 3DZJA 1CWUA 1LUAA 3UAWA 4FIZA 2XLCA 3OWOA 4OXRA 1OB2A 1N77A 2WJYA 1GFSA 5KJ1A 1LDEA 4KTTE 2BJVA 3WK5A 5CHYA 1SO8A 1SVWA 2BDTA 2QTCA 2ZIFA 1SGWA 2JGLA 2Q3HA 2ZBDA 4TSRA 4I4TB 4EW1A 3DQQA 1QCCA 2IGBA 4IIUA 3M6LA 2ACWA 1E3TA 4W6ZA 2NW6A 5KVSA 3VV3A 5DZSA 2IDZA 4IXDA 1LBSA 2HNKA 3A05A 5P21A 1L4EA 4UMFA 2A14A 2WOJA 3DEJA 3LPCA 1XJCA 5H9VA 2G08A 2EDAA 2RHGB 2X0RA 1QLJA 2ZSBA 3T1OA 4CUKA 3L8DA 3FYUA 2WAAA 3A6FA 4IILA 1QFSA 5A4FS 1AKQA 2FGKA 1DHTA 5C31A 1NV8A 2I76A 1MHPA 2W2NA 1TM4E 1KAOA 4HFMA 5JSZB 2YYZA 4BDTA 1CKEA 2X6QA 3OF5A 3OIWA 1LH0A 3K8OE 4MVJH 5IWAB 3KB2A 3VSCA 2OO5A 3SC2A 2CLDX 1HOTA 1ZNXA 4MA4A 1BO6A 3PJDA 4LRQA 2ACEA 5ENDA 4E13A 1XTBA 3E61A 1YHNA 4R0VA 2A9PA 4XQ9A 5F4ZA 2LW7A 3AHCA 2B21A 3PEVA 3PFIA 3TFQA 1M0TA 3UH1A 2WU8A 4YV7A 4RV9A 5D3QA 4Y9RA 1MKYA 2DWUA 4TV8B 3ABQB 3DQPA 1SC6A 1MPTA 3I4CA 3RV4A 4AMYA 2I78A 2A1UA 1N32B 1PG5A 4TRJA 1V37A 4LJRA 1TXGA 1RJ9B 1U4SA 2W6JD 1LWNA 3AIMA 3DT8A 4PAMA 1LWOA 1N7IA 2DR0A 5GIOE 1NTOA 3HCRA 4CM5A 2V6IA 2GLXA 4MWGA 1UF9A 3A3OA 4RCVA 3TG2A 1XLUA 4OQDA 4PHHA 1UAAA 2IYTA 3HS3A 5DX1A 3KEOA 2DBVO 1QU2A 4EJ2A 3SLRA 1NFFA 3B5IA 1GQOA 4I9FA 3ONDA 5ITZA 1RU3A 2YJZA 3E53A 3MSCA 3PRJA 4A1FA 4WK0B 3BDVA 4JC0A 3RVNA 1ND6A 1MX5A 2C77A 1PWEA 5KHAA 1MTOA 3KFLA 3L7IA 4C01A 1VDMA 4Q9LA 4YRMA 4GI7A 1VCHA 4LX0A 3BXEA 4KO4S 3FTDA 3V8BA 1B6GA 1XQYA 3LUJA 4H7PA 5BNFA 4AW9A 3HY6A 1YS2X 5CYGA 2OG2A 3KZCA 1WIWA 1SK8A 2ZRHA 3L4SO 3PNOA 1NQ5A 4LSZA 2XAAA 5TVGA 1Z6ZA 3DV9A 4G85A 4PYJA 5KDDA 4GPAA 2XA2A 3NWOA 5BRNA 4EFLA 2UU9B 2WIJA 1C4XA 4MR8A 1AURA 4FYHA 1KZ7B 3IERA 2VHJA 1Q12A 2OHJA 4KXNA 3RBXA 1DSSG 4OXNA 2GPTA 4O2LA 2V0GA 1BXRA 1NXQA 3OWHA 4OLAA 3VJRA 2EP5A 2G17A 1L5KA 2ZETA 1N2ZA 3THRA 3W5DA 2XCIA 4XWOA 1CEXA 5K0JA 3HKBB 1EESA 2OXRA 1S3SA 4UU8A 3NO4A 2J09A 1P2BA 2NLOA 2PZ8A 3QE2A 4HWRA 4O2AB 3OPYA 5AKIA 2XBLA 2ZB4A 1XQ9A 5LQMA 5JWHA 5BNIA 2R8RA 4N82A 3USES 1C7JA 2ZIZA 3N6RA 5HILA 1IPFA 3R3JA 1IN1A 2F1RA 3PR3A 3GLFA 2P1ZA 1KP2A 2GJ4A 4I3HA 2FN3A 2IX9A 5C8DA 1E2IA 1A4RA 2C94A 4GKVA 4JIGA 3C8DA 3OEEA 2GZRA 1TEXA 3MTIA 2AG6A 4H9GA 3OD1A 4I1RA 4HQ6A 4FOOA 4EKDA 2AE1A 4TL9A 2ZATA 3GP3A 1FSGA 1RPNA 3N74A 3C3AA 4UFNA 1KDRA 3UXHA 4CM4B 4F3CA 4N5NA 4F6LA 4GMHA 1E9FA 3PGJA 4II3A 5AW4A 5CYPA 3KXIA 3MWEA 4MUYA 1CK4A 4NNPA 4S35A 1KSHA 4E21A 5FNVF 3WK6A 4H6PA 4PZLA 3D4LA 4NYIQ 3N2KA 2ZUWA 3E05A 4L5CA 2OBNA 4K9OA 3I1JA 3JQAB 4B6OA 3JWPA 2QM8A 3INNA 5M34A 1GO2A 1TUBA 2DTEA 4BATA 3UM9A 1MEOA 4JVOA 1ULHA 4ZQBA 2OV6A 4CODB 2EJCA 4B71A 3DR3A 5AI0A 2G88A 3AEQB 2BGLA 2VJCA 1U0TA 2FOIA 1BMQA 3SSMA 5IABA 5JNSA 5D2CA 1IJFA 2IKQA 5DX8A 1QMGA 1DO2A 2F3PA 1H2ZA 5JD4A 1R9JA 1R0LA 3KTOA 1TM7E 2IYLD 4FE3A 2A30A 4FW9A 1JSCA 3VYUB 4CG2A 2WQ7A 1O95C 1TYBE 4JS0A 3K92A 1KORA 1T0BA 2QUHA 4WFQA 4DY6A 5K2MA 3PPWA 3QVKA 4NH4A 4DSUA 4LKOA 5B1YA 1GTG1 1K66A 4AWXA 4OHYA 2X6RA 1USUA 2X3FA 1YJCA 2IPOA 4ZMRA 5ED4A 4QXRA 3TLMA 2DEUA 5LB4A 3NV7A 3SXUA 1CFJA 4IUCS 4ROTA 5EE5B 1F5SA 3T1HB 3K4PA 3KAPA 4C4SA 3HN2A 4Q9DA 3CLUC 4UVGA 1JU9A 1Z4OA 2WNSA 3P19A 5EG5A 2RGDA 3WGZA 5B55A 1DB3A 1KF0A 3EDMA 1Y6FA 1QR6A 4OUDA 1N4DA 2VRBA 3RUDA 2HA0A 2GH1A 2IU0A 3DAYA 1NXWA 1EUCB 4Z3DA 3U4CA 2PEYA 1JA1A 2OGZA 3I5UA 3MB8A 2NSHA 3JWHA 2FFHA 5K0SA 3NGMA 4PG8A 1NI3A 2IYXA 3F46A 3PI6A 4Q24A 5JYBA 4UNSA 2JIQA 3I8XA 1HKUA 2X0JA 1X86B 3MD9A 1OIWA 2VZEA 1VPDA 4WY2A 1HG1A 2RJOA 2HRBA 3GZNB 2HPHA 3RRZA 1S2OA 2XCRB 3IDFA 4KN5A 1NVEA 3B7PA 4HQKA 1MO2A 2VDJA 3QKRA 4EENA 1V8FA 4IRXA 2BAGA 1MIOA 4REQA 5A6SA 1P8JA 1P4GA 1KTIA 1C2YA 3PNMA 3FWKA 1V6SA 3DC2A 3RFCA 3QJ5A 3H9EO 3GJTA 2C2GA 5JZVA 3BQ9A 3C3KA 2I4NA 3QFSA 3SYNA 3HWRA 4NK5A 5FNZA 1A50B 1EK0A 2CFIA 2ILTA 5JI2E 3NVKI 1U5BA 5KNBA 1QG2A 3AC0A 1L6IA 1VE9A 1L8LA 3IUYA 4XSGA 3T5DA 3EMDA 1TTPB 1II8A 1CP3A 1CY0A 1F60A 4A2QA 1ZEJA 2BR3A 3C1TA 4FSXA 3EC7A 4OIFA 5HJ2A 2XDQB 4N6GA 1SRQA 1Q0ZA 4U7PB 5C7IO 2JRCA 3DPIA 1HDEA 3E23A 4RDXA 4PFQA 5K51A 3RYFB 2P5SA 3S55A 4IIXA 1RWPA 2FW1A 3EUWA 3QLVC 4Y2RA 5HGJA 4ZRDA 2JJMA 1WCWA 3EXIA 3IB3A 1U2PA 4W6QA 5DMHA 2N75A 4D5GA 3PWZA 3GLIB 1I7LA 3VC2A 4OKSA 3QZUA 3M49A 4LXGA 5FOXA 4MLPA 1J24A 3A70A 1RWXA 1GSAA 3QHAA 1ZOLA 4ZJZA 2AFHA 1K06A 1RWMA 1CUJA 3K8ZA 2J31A 4NJOA 5B1IA 2CFSA 1B42A 2C58A 3HCEA 3HBAA 4YRIA 5D87A 1GA6A 3KEGA 3IAFA 1ID8A 3QE0A 1WEHA 4DILA 4NLLA 3F6CA 5IFLA 3L8MA 1R4AA 2OQIA 5BWLA 3HK2A 4L8YA 1GZ4A 4GU5A 3D0OA 2E5FA 2BHTA 4UD6A 3C4VA 4CUZA 4BQFA 3HB9A 3K1TA 16PKA 2ZAOA 2ZR0A 4XE5A 1H3EA 1EHCA 2G9UA 2GK4A 1QGED 3VDXA 1E79A 3CSDA 4BLQA 3I5MA 5BP7A 2DU8A 4BNVA 2FWBA 2H0QA 2HO4A 4OBWA 1KY5A 3PYXA 5E9AA 1K2VN 7MHTA 4KGDA 2EF0A 2V7WA 1EK5A 1M6HA 1KGDA 1O87A 3PC2A 4MO2A 1E6LA 1JUDA 2N1BA 3IPCA 5TMBA 5IM4A 2UUCB 1MAVA 4BZXA 4CXMA 4HPWA 4QQ8A 1VECA 4KDCA 4OHVA 3EQ8A 2FFQA 4ZQEA 3FY4A 2OAP1 2SKDA 3O2SB 3R3SA 3FYSA 1JEOA 2WSIA 5KMGB 1JH9A 1LTQA 3HYNA 3HLTA 1E4VA 2O7RA 5L4LA 1UK8A 1MG0A 1HTWA 4CHTA 2O2IA 3HUFA 3QKSB 5EVCA 2WAXA 1VBKA 5KS2A 1OFHA 4EYGA 2XJ9A 5IAKA 2O05A 1V2HE 2HCRA 2BFDA 3DZIA 3LJKA 5JI3E 2FCAA 3G5TA 3A6EA 1D0VA 3P71T 3R9IA 1G0OA 1L5VA 5EJAA 2JLWA 1DIHA 1RC1A 1TJPB 3EDYA 4LE2A 3PGMA 4LI3X 4W7SA 5J4LA 2EFHB 2QTVB 3FPAA 4KVFA 2MR5A 1FX0A 2QQ5A 3A36A 1IH8A 3GQBB 3W3AH 5EKTA 3B6ZA 2ERXA 5CT6A 3GLKA 3VR3A 2H59A 3IUSA 1RXEA 4NG5A 2BFCB 1QFZA 3YASA 4M8LA 1YRQA 4DLPA 3I6MA 3EC2A 3CKLA 3PFCA 4JR1A 4KBFA 4KH0A 4CWAA 1Z37A 3X44A 5LDDC 3KSMA 1YWGO 3NFYA 2GARA 1ZONA 2Q62A 2AZDA 1MTZA 2XQGA 2YMMA 4AZSA 1AS2A 1XK7A 2VT6A 2NVOA 2SCUA 3AUKA 4ONEA 3WDLA 4LSMA 3FFTA 3KYDB 4ARCA 4PQRA 2XZDA 1ORRA 2EV9A 3TK1A 5B4TA 2DPLA 4NZNA 1PDWA 3SFZA 1M7GA 3QXGA 4MW2A 5F73A 3K09A 4P8RA 5FPTA 5CFPA 4CTJA 1Y9DA 4YRCA 1DLIA 4O2BB 2BEVB 5E4TA 3UGTA 4BVFA 4BNHA 4KRYA 3G0GA 3DW1X 4TTIA 1Z33A 1SELA 2HJGA 4F12A 4J8PA 3WO0A 2PU5A 2W00A 1KHHA 5BV1A 1ZMBA 4BJ1A 1IEVA 5EIFA 2PKCA 3ROTA 4H7IA 4RD1A 3H5WA 4RHUA 1D04A 1GUYA 2ZJ1A 3KZ1E 1QIEA 4RMIA 5A71A 1XTTA 4EFKA 1ATIA 1ONNA 1YK1A 3H1PA 4HLQB 4L4ZA 1Q6YA 3KQSA 4LXYA 3TQQA 3INRA 1JFSA 3PRYA 4G8BA 1CT9A 3M6UA 4N7RA 4TLMB 3ODGA 4BO3A 3O4GA 2RK4A 4KPGA 3CG0A 1GRNA 3BIXA 5KCMA 2ZB2A 3W9SA 5KNCA 1N9KA 2BTQA 2JCSA 4HDSA 5JAHA 4CW7A 2ZRMA 1KJNA 3IAHA 5LN1A 4ALLA 1E9RA 2FSHA 3T12A 1RRKA 1DBPA 1YNOA 1M8JA 5K03A 1Q1BA 1NOKA 1JIJA 2OV2A 2ALJA 2GBGA 3GJSA 1CLEA 4KK4A 1AK1A 1FXWF 1BIFA 4X7RA 1XN4A 1KU0A 1KSFX 1EM8A 5FPYA 3E1GA 1MH1A 2H2AA 1WETA 1TAGA 2HLPA 2W2VA 4CRWB 4DTIA 5J58A 2Z1MA 4WOBA 5EZYA 4M1MA 5KX5F 1MR3F 2V97A 2VLIA 3NKVA 4H35A 5FULA 3LFHA 3COZA 1Q14A 1QOQB 3I4LA 1D2GA 3WAKA 3T52A 4Y98A 3NORA 1QQAA 5BYJA 4MVWA 2GD6A 2I2BA 4MUEA 1BEUB 2XNHA 4B82A 5EIBD 3LSTA 4UD2A 4XCXA 4I66A 2XUPA 3K31A 2IOHA 3DDCA 5CFRA 1QLWA 3LGSA 4LNHA 3L4EA 5LJIA 1A95A 4R1MA 3DLTA 4JP3A 1SXHA 5EJFA 2O54A 1MFZA 1H6AA 2DP4E 3FRJA 1KEZA 3BK1A 1UANA 3N8GA 4I2VA 2Q0SA 4L72A 1LNZA 4PX9A 2ZJ0A 4RM3A 1F3OA 4LYFA 1SHTX 1W73A 2JVKA 3AVQA 4PGHA 3T9CA 4B6SA 3WY9A 1T4CA 1HT3A 2ZI5A 3JD4A 1G8PA 3A4IA 4MUKA 5KVQA 3DWIA 2D3WA 2D1YA 4CQJA 2PT6A 1ULBA 1SXQA 3GRAA 4CI0B 3TJRA 1Z4IA 4GS5A 5AKEA 2NP7A 1OZ0A 3ZE2B 1M9NA 1PAUA 4K9QA 1OASA 2B5OA 2ZTLA 1U1GA 5LPNA 1JXAA 4P3YA 4X8OA 3LKZA 3SX4A 3N86A 3PWKA 3OWXA 1S89A 1I13A 3T5PA 3PUVA 2AIRA 4D6XA 3ODPA 1YJAA 1E9SA 1IWBB 1L5GB 4A8JC 2RKWA 4GGMX 3SHVA 1D2MA 4Z54A 1OYVA 3E9QA 5DSXA 1TADA 3BBLA 4IKOA 4U3JB 3H19A 2ZYTX 3DOCA 3GFFA 1OQAA 2P3LA 3IBGA 4KMMA 2Q3MA 4DIOA 4DNOA 4FU0A 4Z4CA 4YXFA 2WSSD 4JGGA 3G9QA 4PG7A 1EPUA 1KAEA 1I0LA 1W85A 5IP5A 5SV2A 2J4FA 6NULA 3THYB 3PYLA 1RIFA 4B85A 5JH7F 1E98A 2V5VA 5KTYA 4C6TA 2C1EA 3GGPA 5JSHA 5ALUA 2ZYUX 4IJ6A 1NW4A 4HWGA 2IZOA 1UDXA 4FYIA 2RH5A 4WX2B 1N2IA 2XYRA 3GEEA 3HB5X 4Q6WA 5DBEX 3BX1A 4HNQA 5CVVA 4EHFA 4I8XA 2OKCA 3WRXA 2C61A 4M89A 2FPGA 3CZMA 3N5CA 1WW2A 1AN0A 4MCHA 4BMOB 4RTLA 1PT9A 4ASUD 4W5RA 5HFNA 4WV3A 1E9VA 4LOHA 2CB9A 1E2LA 4XX0B 2PGXA 5IT9A 1NXOA 5J2TB 3U3JA 2BMJA 5EP2A 1UINA 3C3CA 2C97A 3JY6A 5LXTA 1SUBA 5H7XA 5CRIA 3E2MA 2A3RA 2ZDHA 4HDNB 3PU6A 1AS0A 1XAJA 4BDSA 2J3JA 3S8MA 4ZTUB 4B7XA 2UUOA 2DCMA 3V7YA 4KMSA 4JLKA 4QFMA 3ROKA 3AP2A 4ND8A 2AXEA 4WOJA 4YY3B 2XVMA 1K63A 1MOQA 2QQEA 2XNCA 4R81A 1GG5A 5G4KB 3SXUB 3WMFA 4BFSA 5BPHA 2QYTA 5LC1A 2AMFA 2J0QA 4HDMA 1QGOA 4FGSA 1AKVA 2DJ5A 4BNUA 4UQOA 1GGEA 2CVQA 1SN7A 5K3CA 2V3CC 3QY0A 2ZE7A 2D0DA 4Z2YA 3VZBA 1Q57A 3Q41A 3TM4A 3MQFA 5KU1A 3UF0A 5THXA 4BKQA 4F4IA 2WJHA 4EDHA 1A9XB 1KVSA 1QG0A 3FWPA 3M6FA 2Y1LA 1YKFA 1Z12A 1JIVA 2NVUA 3CLSC 3OBIA 3OEWA 1SBHA 2QRLA 1EVIA 3RNOA 4E5YA 3BBPA 1EUZA 4WD3A 2OZLB 3GFSA 5JDCC 3RHSA 3Q1KA 5JC8A 3NHWA 4BP3A 1K3FA 3MTAA 4QUAA 2D54A 2G7ZA 2Q1XA 3L1IA 5IK2D 5EA2A 2OGUA 2BH2A 1WABA 2PT9A 3F7MA 2PMEA 5EFZA 4IDEA 3GT7A 4K8OA 5DTIA 2C8VA 3REOA 3IULA 4WBNF 4O1IA 4ZI7B 1L1QA 3UVEA 4XD7A 3T8YA 1QV6A 3LDFA 1WO8A 1SZDA 1QIJA 3CSUA 1KOLA 4QDXA 3RQSA 1LFDB 4PNHA 3ZTWA 1Y8QB 4TT3A 1P62B 1Y4AE 2PXXA 2W2KA 1U8UA 2WMDA 3C1UA 3ZDZB 1DAFA 1PWYE 2J0UB 2JFVA 3AI7A 3DOIA 3LS2A 5HTOA 3EZ2A 1GUBA 3ABSB 4E5KA 4DV3B 1T2DA 2B37A 3MJTA 2BDEA 4EW6A 1YQGA 3ZV3A 1RHJA 4IXNA 2OSVA 3FRIA 2PLAA 1PDVA 4INZA 3SSOA 3FPKA 3FXAA 3KVVA 2IC5A 4NG4A 4UM7A 3ZPXA 5KYUB 2BWJA 3OZCA 1QQ7A 2IS4A 3VR6H 1BVYF 3HY3A 2I6QA 4UHBA 4DV0B 3JYQA 4ZVNA 3NGXA 4CTOA 2HRQA 4IYRA 3DBLB 5KWEA 4U00A 1W46A 3A1TA 1Z0UA 4QOFA 1J21A 2OHGA 1X19A 4N0QA 3VVBA 5K0BA 1Z25A 4HGQA 4MVJP 4ZAGA 2FK7A 1VBMA 3DE2X 1AQNA 3M5WA 2CJYA 3KKLA 4EO9A 3BA1A 2Q6VA 4PHTA 3BCSA 5FHQA 1X7WA 4CKZA 5ALKA 3IPAA 4NF2A 2I2DA 1CUBA 4QARA 1TU3A 2DBZA 3WWCA 1N5JA 3MFQA 5I5GA 2H5LA 5EJEA 1LV7A 2QORA 4MPPA 4GBED 5EIHA 2BGUA 3H3JA