1PWZA

Crystal structure of the haloalcohol dehalogenase hhec complexed with (r)-styrene oxide and chloride
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
252
structure length
252
Chain Sequence
STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERWPGMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords halohydrin dehalogenase
publication title Structure and Mechanism of a Bacterial Haloalcohol Dehalogenase: a new variation of the short-chain dehydrogenase/reductase fold without an NAD(P)H binding site
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 89
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pwzA00
5ES3A 1NP3A 4IZHA 4EDFA 1VKOA 3HN2A 1I24A 1F17A 3PYMA 4NK4A 4XQCA 5DBFA 3RFXA 2X5JO 4IXWA 5DP1A 3ZHXA 1EUDA 4Q3DA 1YBMA 1DEHA 1ZJZA 3L77A 3TQHA 2WYUA 4EZBA 3Q0EA 2OUIA 2YUTA 3PVZA 3FF4A 4HFRA 3M1AA 1PJCA 1ULUA 4DL9A 3EAGA 1GFSA 2UDPA 3ADOA 3QVWA 3OJEA 3NAQA 2GZ2A 4ID9A 4TWRA 4R5HA 5I7SA 1R66A 2ZCUA 4R01A 4YRBA 4IJUA 4K6FA 4RF2A 3JQCA 1ARZA 2UUPA 5DBGA 4AJ1A 2OBYA 1LLDA 3INTA 3EYWA 1EK6A 2GERA 2EGHA 4IQ0A 3P2OA 5K0ZA 1JU9A 1LSSA 1U5CA 3DQPA 4IZIA 3ANMA 4DPKA 1TT5A 5C3MA 1DC6A 4XJTA 3AUAA 1LX6A 3ONEA 1XLTA 4DUPA 4UULA 3K6JA 5T8KA 1DIAA 1C1XA 2P9EA 3CZMA 4J3FA 3U3XA 3CEAA 3RUHA 3VPSA 4TSKA 4FR5A 4CM4A 5L7TA 1SOVA 1U2DA 3PGJA 4WASA 2NLOA 4YAKA 1FDSA 4W99A 4B7UA 3R3SA 3UHAA 5IZCA 1CJCA 4GX1A 1LQUA 4DIOA 3U49A 3CMCO 4OM8A 3SC4A 4CR7A 1HDOA 3I1JA 4KWHA 5BR7A 4K9DA 3PYLA 1E7YA 4B4UA 1KBZA 1DFHA 3FN4A 2IXBA 4FPXA 3JQEA 5U9CA 3Q9UA 5TC4A 1SO8A 2X6TA 3VHRA 4F46A 4GI2A 1F8FA 2C82A 3TFQA 5JO0A 1TT5B 4D3SA 2NU8A 4BKOA 4PRLA 1Q7CA 1YS4A 5CFZA 4Z0TA 4CM1A 5KKCA 1UDBA 1H9BA 1Z7BA 2DFVA 3RUAA 1ADBA 2AEFA 3HB4X 1SMKA 3QVOA 3AI1A 5GZ6A 2HJRA 4CLXA 3SEFA 3GHHA 4B3JA 5MGBA 5JS6A 1WZIA 4TZTA 4W7HA 2DVMA 3C3XA 1S7CA 2OMEA 1X14A 3IAHA 5ER6A 3GNQA 1NQOA 4TRJA 4D0RA 3KVOA 1I32A 3UGKA 4CL3A 3SXPA 5HS4A 3UCXA 4BIIA 1YH3A 1ZKMA 1U28A 1AXEA 2BGLA 2O4CA 1EQ2A 4XGIA 3EGOA 4L4XA 4QX6A 5FEUA 5IJZA 2YDXA 2OO5A 3ZWBA 5LDHA 4CLRB 2VT2A 4J7UA 3S2GA 5TT1A 3IUPA 1M2WA 4LGVA 4MIOA 4CM5A 4BGUA 2R00C 3WGZA 3AI3A 3OBBA 4O5OA 1LC3A 4OSPA 3AU8A 4M86A 4EW6A 1LBEA 1HXHA 4BNJA 3H5RA 4AJEA 5LCXA 1HETA 1R4NA 4Y8VA 2VT3A 1O5IA 3HDJA 1CIVA 5L7WA 2ZB3A 4H7PA 4KDFA 2O3UA 4B8WA 1D1TA 3LC2O 4HKTA 1DFIA 4L74A 3JD2A 2G82A 3D0OA 3E1KA 1YBAA 4CQMB 1DO8A 1JVSA 4DBVO 4BO5A 3IKVA 4FOSA 2OORA 4ROSA 1T2DA 3BHJA 2OHXA 1CETA 1X13A 2Y1DA 5DDIP 1IHXA 2XPCA 3LLSA 4WPGA 2GO1A 2A92A 5C7OO 3VAZA 1KY5A 3DBVO 4MVJH 1GUZA 1MGOA 2PZKA 1VJ0A 5ICSA 3CPSA 2E6UX 3ROKA 3ZGYA 3Q2IA 4ALKA 4IJWA 3DZHA 4RDHA 1BW9A 5CAEA 1H5QA 4ZN6A 3CE6A 1VKNA 3GH3A 4DPMA 3GUYA 1R4NB 2C5EA 3PLNA 3PLRA 4FJ0A 4U6QA 1MLDA 4A27A 3IQDB 3ZWMA 3LT1A 4RLHA 2E48A 3RIHA 1HYEA 1ZSYA 4J91A 1PJBA 1RYDA 3NDRA 4D42A 3RSHA 4PLVA 1HE4A 1M6WA 4CJXA 2IYOA 2I66A 4BQRA 2RHRA 3GF4A 2EG9A 1U8XX 1P45A 3WGHA 4E2XA 5B4UA 2VNAA 4XEHA 2YFHA 4JX8A 1N5DA 3NDIA 3ICCA 1MG5A 4FBGA 4UVGA 1OI7A 1ONPA 5B1YA 4YJHB 1U4SA 3F1LA 5FWNA 1Z6ZA 2PY6A 4YACA 1HL3A 3FBTA 4E2WA 4U6SA 2R6JA 2Z1MA 3MJEA 2VRCA 1LSJA 1ZSVA 1NFQA 3TRIA 2FN7A 3E18A 2HJSA 1BW9B 1BXKA 3ZWXA 4CMJA 2BKAA 2Y1FA 4GMFA 3DHYA 4BVAA 5KVSA 2GN4A 4CMEA 5CDYA 3ENNA 1IZ9A 3V2UA 2IZ1A 3WYBA 3PDUA 1KERA 1KVQA 1R0LA 1WDMA 2PNFA 1HE2A 4R16A 3H65A 4JP2A 3INGA 4OXYA 1ZFNA 2AHRA 1T25A 1KVRA 1GV0A 3KZVA 4NFYA 3WBFA 4UVDA 3WICA 3B6ZA 4DWVA 1EUCA 5A9RA 1B3RA 3HB5X 4N5LA 2OP0A 2J6IA 4GX0A 1Q0QA 3ZCXA 1MFZA 2Q46A 1YJ8A 1GEGA 1Y5MA 4GLLA 5CPBA 3PIDA 2ZTUA 4P38A 3L6OO 3TSCA 3WSVA 2UUOA 4ALMA 3UKOA 3QV1A 3BTUA 5IN4A 1C3VA 2YHIA 1SZJG 3AK4A 1E92A 5F1OA 3STHA 3B1KA 3H7AA 4H16A 3D3WA 1UZNA 3QLJA 3WYEA 4NBRA 4AJNA 4EBFA 1XU7A 3PHIA 2WYVA 3VPFA 1BHSA 2CMDA 3D7LA 4XIYA 2PR2A 3AJRA 3K92A 5JY1A 5A05A 3RUCA 1A4IA 2AEJA 5IDWA 4INAA 1NVMB 1T24A 2AQ8A 1O89A 3P7MA 5TS3A 1I3NA 4LSMA 2EF1A 2ZATA 3H8VA 1ZEMA 1ZH8A 4D41A 1C0IA 1VPDA 4DREA 3TWOA 4PVDA 3NTQA 1Z7EA 1IY8A 1PZFA 1IYZA 3RQSA 5TGDA 2JD1A 2C20A 1DC4A 2HUNA 5CHEA 4W9NA 1MG0A 1NXQA 1WDKA 3KEQA 4DXHA 2X5OA 4KUHA 3N74A 1IL0A 5EERA 2E37A 4PCVA 3PGXA 2JD2A 4MJLA 5I8ZA 4W7IA 3WOHA 1EBUA 3D3WB 3GVXA 5JE8A 1PZEA 1MFPA 2DQ4A 4OGWA 4YT5A 3BTVA 5C7IO 4ALJA 1PJSA 4RVSA 1NPYA 2QZZA 2C59A 1CEQA 4RV9A 3DMYA 4GVLA 4FSHA 2TMGA 3KM0A 1UZLA 3H3JA 1JKJA 3X2FA 4ZQHA 1E7RA 3DR3A 1V6AA 4IGFA 1D7OA 4PN3A 2DBVO 1H2BA 3JD0A 4BNFA 4U7WA 5LC1A 4YCAA 3DMTC 3DAFA 1EVZA 5H83A 1NPTO 1QYDA 3KXDA 2JFGA 2FPGA 1BG6A 4XRGA 4BOYA 5AYVA 2PGJA 4D44A 3LVFO 4MKRA 3BMNA 3JYOA 5IF3A 3ANLA 3KLPX 3ITDA 4YAGA 1H93A 2CDAA 2DT5A 3L9WA 4Z9XA 1JWAB 2DUUA 3OEWA 4GSLA 4B4VA 3QVTA 3NRCA 4FQ8A 3AOGA 4FIZA 1XDWA 3O26A 3E9QA 2X9GA 5I8WA 2CUKA 2O2SA 4OMUA 4XJSA 1B14A 1HLPA 1RPNA 2ZJ0A 3AM5A 3GGOA 3GPIA 4FOOA 4MOWA 1B15A 1HLDA 3CH6A 3BA1A 3FR7A 1X7GA 4IY1A 1B3BA 4O59O 5A4DA 2W2LA 4F6CA 1NWCA 4L4RA 2IEDA 3ROPA 1LRLA 4FN4A 2I3GA 5T64A 1WLYA 2DBZA 3DWFA 1YE3A 2VTDA 5DBIA 2X9VA 5KKAA 1JAXA 1N1EA 3FCOA 4EJ6A 3JSAA 3NGLA 5A06A 3GZ4A 5EL0A 1UZMA 2VYVA 3D5TA 1U4OA 1XR3A 4DYDA 5JAIA 3WSWA 4OH1A 3QWFA 2WYWA 3CKYA 1ENOA 1OMOA 3GHYA 4YVFA 1OC2A 3CMMA 4MKZA 2H1SA 1YB4A 5K6AA 5DOVA 5EQFA 3F4LA 1DOHA 4J7CA 1VC2A 1TLTA 2ZYGA 4RCVA 2P68A 2JFHA 1EK5A 3C7DB 4BV9A 4LMRA 3QSGA 4TMFA 4J2OA 3VDRA 3QJ5A 4MO2A 1DPGA 4EUFA 1MXHA 2J3IA 3JQAB 3TL3A 3UN1A 3AOEC 4J0EA 3ZDFA 3CZRA 4XDYA 2O3JA 2NUAA 2AMFA 3HQ4O 1BSVA 3MJ4A 3GOHA 3GDGA 4GSKA 1NQ5A 3WTCA 3JTMA 4RVUA 5A5FA 1Y81A 2Y0EA 2B35A 5FF9A 3TZCA 3LDHA 1MX3A 3PHLA 4RF3A 4CQLA 1D1SA 4Q3EA 1DIHA 2JKVA 5KTKA 2EP7A 3IJPA 1EQUA 3RC9A 4UEOA 5DNAA 1WXDA 3PPIA 3ZWYA 1P1KA 1O8CA 3ASVA 3OIGA 2SCUA 1WNTA 4J2HA 4UREA 5TJ9A 3OA2A 1E3SA 4Q3NA 3GG9A 5G0SA 5KWEA 3O38A 1NYTA 3HWRA 3X2EA 2DU8A 3ABIA 3RC1A 1YB1A 2VQ3A 4QEDA 4M8SA 4RVGA 4YYZA 1GYRA 5I7EA 1K3TA 2G17A 4U0KA 1QORA 1E3WA 1T4DA 1JQBA 3FR8A 3PJGA 4A10A 1SB8A 4EYEA 4RPJA 3ZWCA 3SLKA 1BWSA 3EZYA 2VWPA 4MP3A 3PFFA 4JP3A 1MB4A 3NJ8A 4A03A 1I2CA 4DC0A 4WUVA 4ZA2A 3H6KA 3IMFA 3V1YA 5ENVA 5KJCA 3LT2A 1G1AA 1YOVB 3GEGA 4PLHA 3NYWA 4I9NA 1YQDA 3DBHA 3U0BA 2Q2QA 1PQWA 3DZFA 2RBEA 3OA0A 4B3IA 1I3MA 3HADA 2Y0CA 3LT0A 4G65A 1YL5A 3GAZA 1UP7A 4RJTA 2ILTA 3DAPA 3EVNA 1XQ1A 3R1IA 1R37A 1P1RA 1NM5A 3E03A 2O50A 4Z0PA 3H2SA 4HFNA 4QT0A 2A4KA 3ONDA 2ZYDA 4RZIA 3QRWA 4J43A 2JL1A 3PTZA 2YJZA 5JYEA 3F1KA 1WWKA 4P4NA 2RH8A 5DCWA 3WDSA 4J4BA 5BSFA 2RIRA 2PKRA 5JMPA 2CNBA 1E3WB 1HDCA 3ENKA 2Z95A 4AJLA 3E6AA 4AJPA 3FTPA 1ZSNA 4XYGA 2EEZA 2VHZA 4MP6A 1JN0A 3WFJA 5I9MA 1SB9A 1DBVO 3PEFA 4PG7A 2GASA 1KC3A 4YT8A 3O8QA 1H0KA 2DC1A 4XRRA 3C1AA 4Z9FA 3OIDA 1B7GO 3WIEA 1TXGA 3EZLA 5ILGA 3JCZA 2I99A 2BFPA 2O7SA 3L4SO 3D5QA 2NM0A 3FD8A 4UAGA 2C7GA 1PGOA 4NDNE 5JYDA 3C8MA 2FPIA 2Y66A 3KSZO 2FZEA 4XYBA 4CV2A 4HBGA 2Q4EA 7MDHA 4MPDA 2UVDA 4HP8A 2VRBA 4PG4A 4TRNA 1ULSA 4WE3A 3JQGA 4Q9NA 4CV3A 1GCOA 1ZMOA 4M55A 1T2FA 3D4NA 3EW7A 3JQBC 2CVOA 5CG1A 2X7HA 5G4LA 2DLDA 1ZNQO 2V6FA 2W2KB 2QYSA 4BNUA 3AUSA 2FZWA 4G81A 3I4FA 3FNGA 4BO2A 4DQXA 4AL4A 3FNEA 4QO8A 5A3JA 2P5YA 4JJIA 1KOLA 3K5PA 3BYZA 3O8QB 9LDTA 4A26A 1MC4A 5L9AA 1JKIA 1JW9B 4YPOA 5A3VA 3GPDG 2DTEA 4IBOA 1DLIA 1HDRA 1JWBB 3ZWNA 2XAAA 5I9LA 3RBVA 1GD1O 4WKGA 4OIMA 2FR0A 5F1KA 4RQUA 1HRDA 1TB4A 3C1TA 4E30A 1KY4A 3OSUA 3GLQA 3FPLA 4ZJUA 1IOLA 1B8UA 3A14A 3TZKA 4YJFA 5TIIA 3JQGB 2OFPA 2BH9A 2D59A 5FFFA 2WTBA 3RKRA 2BELA 1NQTA 3A1NA 1C0LA 2NADA 3HDYA 1A9YA 3OQ1A 3W8DA 3WBBA 3M2PA 2FR8A 4B79A 1E1NA 2DKNA 2GRAA 3IC5A 5A1TA 5ILOA 4BO3A 3AY7A 2G0TA 4D3FA 1QV6A 1H9AA 5H82A 4IJKA 3GVHA 3NTRA 4M89A 2X58A 1DC5A 1DJNA 2NACA 1E1LA 4I9HA 2R00A 4NBWA 1T1RA 1ZW1A 3R3JA 5B4TA 4RF4A 1RJWA 4WGGA 4N18A 3WWYA 1F8GA 2EJVA 4NBUA 3TZHA 4PVCA 1M75A 4MVJG 4BNMA 1Z45A 3LYLA 2W98A 2EKQA 4MKXA 4YJFB 3U5TA 4CLEA 1ZEJA 4QFDA 4YRAA 5DF1A 4I5EA 4JCOA 1PS0A 1X1TA 4JQCA 5BSHA 2QQ5A 2TMDA 1CDOA 2VRCD 1DIGA 1VM6A 1E5QA 3L9XA 3PRJA 4BNKA 4KTVE 1P3DA 2XXJA 2NU7A 4ZQGA 3KEOA 3PHGA 3WYCA 2JCYA 2EP5A 1DIRA 5TQVA 4ZHSA 2OL4A 4BL5A 2NTJA 1UXKA 3F3SA 3BZUA 5L4NA 4CMCA 1ML3A 1L7DA 5TF4A 2VOJA 1Y9EA 1BDBA 3JYNA 3IOYA 3UF0A 4CM3A 1Z82A 4Y6RA 2YFQA 3NT5A 4UEJA 4BMSA 4NJOA 3B1FA 3I9KA 3K9QO 4OOFA 3GA0A 4TVOA 1VRWA 4FW8A 3WNQA 4IIVA 2GZ3A 4XQ9A 1H2HA 1HE3A 1GCUA 3BTOA 4IXTA 4FGWA 1MC5A 3AY3A 3LC7O 3U4IA 4NR0A 4NBTA 3FI9A 3TF5A 1I5RA 2HU2A 1KVSA 1NTOA 3GAFA 1P1IA 2J5QA 3MWEB 2PA3A 3ZWVA 1W4ZA 3F9IA 2YY7A 5IXSA 1LA2A 3CIFA 1E3EA 1BVUA 2QZ9A 1CERA 2UYYA 3D4PA 5KVQA 4CLDA 1WZEA 4R1SA 2CD9A 5A9TA 3KTDA 3RCBA 2H6EA 4ALLA 1KETA 3ZZNA 1E6EA 3KYCA 2NVBA 4CUZA 3I52A 4A5OA 4CLRA 2P2SA 4TRRA 1KEPA 3K2BA 4ESOA 4UUOA 2CZCA 4B3HA 1PJ3A 1Y8QB 3GZNA 1FDUA 3VH4A 1PZGA 3PQFA 4UVHA 3EUWA 1HKUA 3HSKA 2V6MA 2YDYA 2GUGA 3HE3A 4CPDA 5HWSA 4J4HA 1EDZA 1ZJYA 1UDAA 3IKTA 4HV4A 3FNHA 1ZZEA 3I23A 5GY7A 1E1KA 3E9MA 1GY8A 3PFWO 4KZPA 4NFSA 3MTGA 3RUFA 3VTFA 3UFXA 4JBGA 4B7CA 2YZ7A 4CQMA 5L4LA 1Y6JA 2D1YA 1MUUA 2PTGA 1V3UA 4R3WA 3MOGA 2FRDA 1SOWA 5B37A 5JMWA 4AJOA 2CF6A 1O0SA 1PJ2A 3RFVA 3SJUA 3F6YA 4CM9A 5C7LO 3WJ7A 4FFRA 1WPQA 1K89A 3KYCB 1LDGA 5CDSA 2OOSA 2Q1WA 1TVEA 4WLEA 1LDNA 4GKVA 3FWZA 3UCFA 4D46A 3GZNB 2QRKA 4DIBA 1YL7A 2AE2A 2ZB8A 5HS6A 4BO9A 4M54A 2O48X 5JBIA 3FRJA 3KSDO 4YWJA 4C7KA 3AFMA 3WGOA 3AM3A 1J4AA 2GLXA 3F5SA 1X0XA 3A28A 4I8XA 1Y9AA 2X0JA 2JAPA 5AXDA 4PLFA 1UUFA 1PEDA 2EKPA 3HG7A 3PQEA 5DOZA 3RC2A 4GX5A 2WD7B 3W8FA 4ILKA 2PKQO 3IDSA 2VZ9A 4Q3AA 3ZW9A 3COSA 4NQZA 1B0AA 5AXCA 4YJDA 5T67A 4IDAA 3QWHA 4BB6A 4RZHA 2W2LD 3NKLA 4YAJA 4CMIA 1QRRA 1F14A 1LI4A 4YJHA 1XELA 2YV2A 3GVIA 4L4SA 4XYEA 5ENDA 2RCYA 1FDVA 1PR3A 1ZXBA 1DRVA 3DEYX 3F5QA 4R1TA 4YJGB 1NFFA 3C7AA 5G0UA 2VUTA 2NU9A 3S55A 5IDXA 3BMOB 3QIVA 1AUPA 2Y1OA 1UXHA 3DFUA 2UV8A 4XGNA 4BGEA 1T1SA 1FF9A 4BNGA 2VYVD 4EEZA 5L4SA 3ZV5A 2GDZA 2XOXA 2BI8A 4BO4A 3LT4A 1HWYA 2V7PA 3QVSA 3CSDA 1SPXA 5KJEA 4J6FA 1GTMA 2EKLA 3C85A 2WM3A 3PHHA 4X54A 4EGFA 5KJ1A 2PD3A 2C0CA 1N7HA 4CLHA 4LMPA 1K5HA 1XA0A 3PJEA 5C5IA 5L45A 3QWBA 2P4QA 5HBRA 3S1LA 4KUEA 1XEAA 3DMTA 1C0KA 1K0UA 1BDMA 2EIHA 1LLUA 4IJVA 4U0JA 3NT2A 1SBYA 4IINA 6LDHA 5A9SB 3KLMX 2CVQA 4E5MA 4CMIB 3JQFC 3ZWPA 4CMHA 3A9WA 4N5NA 3VH1A 3ST7A 1JA9A 3FNFA 4JJGA 4J1QA 3WFIA 8LDHA 1VLLA 1Y1PA 3D1LA 2W4QA 2AXQA 3UOGA 1ISHA 1UXGA 1ZMTA 4ZU3A 2C2XA 3GK3A 2YHUA 5AXAA 1ZBQA 5DP2A 4R5MA 4WLOA 1ISJA 1MP0A 3PXXA 5HA5A 1QG6A 3ZNNA 5AVOA 3TDKA 4NMHA 4Z3KA 1R15A 3KSUA 3DXFA 1UJMA 4OYRA 4Q3BA 2ZTLA 5G2OA 4IQGA 1GQQA 1CQJA 1O6ZA 3ZV3A 1I36A 2JAHA 4K1LA 1K6IA 4GPD1 3W4KA 4XYLA 5JDIC 2FSVA 1PL6A 2BLLA 1NX6A 2X9NA 1QMGA 2O3SA 3GMSA 1EE2A 3OFSA 3TNLA 1HDXA 2A35A 2WE8A 4NPCA 3RU7A 3GEDA 4OSOA 1OC4A 4DPLA 4BQPA 4HADA 1PWXA 1QKIA 1HTBA 1T26A 4LK3A 3WQQA 4R1NA 1VI2A 2WSBA 1GL3A 3KYDA 3O03A 1WMAA 2B4TO 2ZQZA 4C7JA 5FI5A 3BIOA 1PGPA 4EITA 1NWHA 1DAPA 1LUAA 5TRTA 1TEHA 1U3VA 5LDGA 1IPEA 2V6BA 2JD0A 3VPHA 5DT9A 4B7XA 1GV1A 1LDMA 1P74A 5BSEA 4F45A 3GGGA 1ZK3A 2QX7A 3AOEA 2BHLA 2YV1A 3I6QA 2PGDA 1GR0A 1N7GA 1QYXA 3IP1A 5JAMA 1ZK2A 4CMBA 3KB6A 4NU6A 4YQYA 2IODA 3HN7A 3AU9A 4QQRA 2HK8A 2PH5A 5ITVA 5TLSA 1D4FA 3LF1A 2P4HX 4BNLA 4EJMA 3ZHYA 5JW6A 5ITWA 3I9OA 1I0ZA 5BNFA 4IMPA 4FCCA 3JQ8B 4HWKA 2Y1GA 4MVJA 3G3EA 1GPJA 1HE5A 4BB5A 2Q1TA 3RKUA 4BKPA 1XYGA 1RM5A 2FP4A 3RI3A 3KYDB 4DVJA 4HFMA 2GN8A 2E49A 4F3YA 3OETA 4J4TA 3W6UA 4W4TA 3WQRA 4IM7A 3Q2KA 1ZK0A 4AJ2A 3TN7A 2RH4A 4LRTB 2ZB7A 4LCEA 4R9SA 2ZCVA 3GRKA 5THQA 3DZIA 4JBHA 4ND4A 1QYWA 5IG2A 1OOEA 3PWSA 3NGXA 4Z9YA 4XB1A 4PGFA 2CY0A 3QQPA 4O1MA 3I4CA 4BNWA 4TROA 3V1UA 2ET6A 2WMDA 1A72A 3VZPA 4P4GA 1T2CA 4WNCA 4DLAA 4OOEA 2J3JA 3U62A 5JC8A 2J3HA 2PD4A 3KBOA 2EGGA 4TQGA 2Y1CA 4ZD6A 4R3NA 3RROA 2VYNA 1XGKA 1OZAA 3AWDA 4JGBA 5IZ4A 4XWYA 1DLJA 3WLEA 3L6EA 4P22A 4E5KA 4PG8A 1W73A 4ZVVA 4F6LA 1EE9A 4MVJP 1D3AA 1U3TA 4UEKA 3RU9A 3JQAA 3TOXA 4UUNA 2A9FA 3QVXA 5ER9A 4XZ3A 1QXSA 4J1SA 4XDZA 3MJCA 3JQ7B 4KQXA 4DTIA 1Y8RB 1YDEA 2C2YA 5EESA 1FDWA 1M67A 1R12A 1DAOA 4IS2A 4NH4A 2I6TA 3WGYA 1ONOA 2IEBA 2QHXA 3RUDA 3WG9A 4W6ZA 2NWQA 3E9NA 4XGKA 2E82A 4Y6PA 3PZBA 1VJ1A 3RWBA 1N1GA 2B0JA 5G0WA 4KWIA 4FC7A 4OAQA 4WECA 5A5EA 1X7HA 3JQBA 3LU1A 2XF8A 3E5MA 1BRMA 4R51A 1ZVMA 1LRKA 4ZRMA 4E33A 5BSGA 2I76A 3GDFA 1PWZA 1RM0A 5B4VA 5KVVA 3W4JA 4Q39A 3PDJA 2CF5A 3NT4A 1UP4A 4QTZA 3QWIA 4RL6A 3SC6A 2HMWA 4J90A 4XX0A 4CM6A 4CMGA 4CMKA 1IZ0A 2CDCA 1A7AA 1KVUA 5JAQA 4D45A 5KIAA 4IQ8A 3WJAA 1YOVA 5IN5A 4RVDA 3NEPX 1C14A 3JYLA 1GQYA 3IJRA 5AQ1A 2E4AA 1DFGA 3O9ZA 4CL8A 1DDOA 2POQX 1VL0A 5JCJA 2H5LA 3IP3A 1RYEA 3JQ9C 4GQAA 2GF2A 1HSOA 3H9QA 4MP8A 4PLZA 1KYQA 3TL2A 4BNNA 2JCVA 1DC3A 4PG5A 4CV1A 5DCYA 2VZ0A 4CLOA 2ZB4A 3VKUA 2XXBA 4CMAA 3ZHBA 5L7YA 3DL2A 4YTEA 2Y99A 4BO6A 4BGVA 1UAYA 1ISGA 3CINA 1EDOA 4NNJA 4AJJA 4NBVA 4BHTA 5JSFA 3GMDA 4E2ZA 1VSUA 4IGEA 3LC1O 4MDHA 4IDCA 1WVGA 4PLTA 3HUDA 1BGVA 4AJIA 3P5SA 5CPFA 2X23A 1A27A 3I9MA 1SAYA 2DTXA 1U8FO 4YQZA 3ETGA 3L0DA 4XQGA 3ULKA 2PZLA 1CRWG 3JQDA 4HX5A 1E0DA 3DZGA 3DDNA 1YONA 4JNKA 1XIVA 1E3LA 1E7QA 1GU7A 2VHYA 3H2ZA 1WAMA 4NI5A 5IAAA 2G1UA 4J1NA 1HF3A 3OECA 1PS9A 3G1UA 1AGNA 5CP8A 1QP8A 3V2HA 4CLOB 3GRPA 1EFKA 3K8ZA 3EDMA 2VTEA 1HYGA 2PFGA 1ZK4A 4HFJA 3ITKA 3PP8A 3ZH2A 3WLFA 2B37A 3B1JA 1NHWA 4I08A 2DTDA 3LF2A 4JXKA 4Y9DA 3RVDA 1YDWA 4A7PA 1PZHA 2W2KA 3TZQA 4O6VA 1NAHA 2BRUA 4NK5A 3FTNA 5DN9A 2HAEA 2I9PA 3C7CB 2DAPA 5BQFA 4QSMA 4ND2A 4BO8A 2Q3EA 3ROQA 4G2NA 3Q6IA 1EZ4A 4OO3A 5ICMA 4H15A 3ORFA 5IFLA 1FDTA 3B70A 3WGGA 3OJLA 1ID1A 2C54A 4YXFA 1HDGO 5CEJA 3LZ6A 3MJSA 3OJFA 4BUCA 4NU5A 4OXKA 1ZK1A 4J7XA 4OQYA 2GCGA 1L1FA 4CQMD 4NJMB 2Y0DA 4PG6A 4MINA 2J3KA 5F1PA 3MCVA 4FS3A 4ZGWA 1A7KA 3ONFA 1KVTA 4E4YA 4G5HA 1AE1A 1JLLA 1XKQA 3E5RA 4GL4A 3OF2A 1NBOA 1TI7A 3NV9A 1SEVA 3I9JA 3BMQA 2QG4A 4WLUA 1KIFA 1PGJA 1Q1NA 2NTNA 3HJAA 3T4XA 2DFDA 4XIJA 3UW3A 3ON5A 4FFOA 4WCFC 3L4BC 4MIEA 4EUHA 3U4DA 1F0YA 2NVUB 1B16A 3ZNQA 1AHIA 3OICA 3P19A 2AQHA 4FJ2A 5F3RA 4RPHA 5JC1A 3D3EA 3AUUA 3GG2A 2P5UA 4P8RA 4KMSA 4NIMA 3SBOA 4GGOA 3QA9A 3UH1A 1M76A 4Q3CA 1ORRA 4CV0A 1XG5A 3OMLA 3HNPA 1PGNA 4J16A 1QYCA 4DLBA 1QLHA 3DBRA 4M1QA 4MVJM 1I01A 2OBNA 3G1TA 3P2YA 4GKBA 3DTYA 1O9BA 1E77A 4N5MA 2YQ5A 4IDFA 2FOIA 4IMRA 3I5MA 4UVIA 4R4JA 2CFCA 2D5AA 2J5RA 1LRJA 2X4GA 4OXNA 1FJHA 1R4MB 2NV6A 1OBFO 3BMQB 1SNYA 2X0NA 4MVJE 3HZZA 3T7CA 4J9VA 3WGIA 4Y98A 1R6DA 4E13A 2O2YA 1R0SA 4ALIA 1JAYA 2ZTVA 3K96A 3IL2A 4C4OA 2EV9A 4U5QA 5JCXA 3ZWWA 1N9GB 2HKIA 2HSDA 3VPXA 3UCEA 3I83A 4BMNA 2RAFA 4RQTA 1UDCA 3K73O 3VVBA 3LLVA 1PJ4A 2B4RO 4CODB 1NVGA 2Q2WA 3AW9A 1B26A 2Q50A 4RF5A 2GR9A 3DBRB 2LDXA 4DRYA 1U1IA 1PL7A 3WGQA 2GN6A 1LTHR 5A03A 5L51A 5CG2A 3D4OA 2HQ1A 1E3JA 1ISIA 1ENZA 3K31A 1SC6A 1R16A 3JD1A 4BO7A 2B5VA 1EFLA 2QIOA 3BHMA 3H3FA 3B20A 1UXIA 1IB6A 3F46A 2G5CA 1H6BA 3DHNA 3ZWAA 1GEEA 1YJQA 1YVEI 3VZSA 4YT4A 1LQTA 3PIIA 4LISA 3UAGA 2Y68A 3JQ6A 2HLPA 3MTJA 4AG3A 3U09A 4BNYA 3F47A 1EMDA 1NR7A 4R41A 1TT7A 5CEFA 2Q49A 2D3TA 4E3ZA 2PZMA 5H81A 2Q4BA 2EJWA 3GQVA 1Y8QA 4CUKA 3NJ4A 1WMBA 3I6IA 2V65A 1Z75A 2O7QA 2BI7A 1ONNA 3VZQA 4LN1A 2NU6A 3IS3A 1FK8A 1EVYA 4PZDA 2D4AA 3T7EA 4ND3A 3V1TC 3VH2A 2C7VA 4GGPA 4Z3DA 2J5KA 1YXMA 3U9LA 1LDYA 1GYPA 3S8MA 3WR5A 4WOJA 3RASA 3ZU4A 1WDLA 2PWZA 4DQUA 5JXWA 1YL6A 2B4QA 4RVHA 4JROA 3FHLA 2BGKA 5EIOA 1BXZA 1Y7TA 1LSUA 3JV7A 2Q1UA 1P1JA 2IDZA 1F06A 1HZZA 2Q1SA 2QYTA 2VHWA 2OGUA 3JQFA 3RC7A 4BKUA 3PQDA 4BMVA 1QSGA 1U3UA 2F00A 3FBGA 2FR1A 1P0CA 1P33A 4OL9A 1DJQA 1FMCA 3G79A 2PH3A 1U7TA 3SX2A 1PIWA 1X15A 2PK3A 2BFAA 4S3MA 1P1HA 3O4RA 2EERA 1IPFA 5TSDA 2DUWA 1LXCA 1AN9A 2BD0A 3DZJA 5TJHA 3RFTA 1A4UA 1PGQA 5GMOA 1C0PA 1CF2O 4MVJD 1M66A 1NAIA 3KO8A 5T57A 1IHYA 2P9GA 4IPTA 1J0XO 3GEMA 1HSZA 3SLGA 2WD7A 3PK0A 1GQ2A 4XQEA 5JDIA 4KDEA 3RBZA 1C1XB 3L07A 1QYVA 4YBZA 2P9CA 3LSYA 1CWUA 4JN6B 3GR6A 4WLVA 1RM3A 4CM4B 1J6UA 4GX2A 4KP7A 7ADHA 3ZWOA 1E3IA 1G0NA 4Y6SA 1I33A 1KS9A 5JDCC 4UUPA 1PJTA 1LJ8A 5FYDA 4FDAA 4YJGA 3IIEA 1IUKA 3ASUA 3L6DA 1HT0A 1XHLA 1CQIA 3MOIA 1ZXLA 3BMOA 4XR4A 4K6CA 1V3VA 3MEQA 2BFMA 3UICA 3W6ZA 1P31A 3WMXA 1T2AA 3BTSA 2NQ8A 4QUKA 2DBRA 2HO5A 4FFMA 4J0FA 1U2GA 2HRZA 2VWGA 1NHGA 3ZV4A 2H9IA 4R9RA 2A94A 3GDOA 1XCBA 3U4CA 4ND5A 1YB5A 2VYND 4WEQA 4JLWA 2HK9A 1ZO8A 4BS9A 1I2BA 3EHEA 1NVTA 1JKFA 2RHCA 1T2EA 3EMKA 1PL8A 3I9LA 3GNSA 3E48A 4XB2A 2V6GA 4E5PA 3ZU2A 5JNLA 2HDHA 4B8ZA 3KYBA 4RVFA 1N2SA 4PRKA 4ZRNA 5A9SA 5U4QA 4QXMA 3JQAD 1U5AA 1C1DA 3A06A 1ENYA 5EPOA 2Y05A 4I1IA 5A02A 3H9UA 1K6XA 2D8AA 1HZJA 3ETEA 4E21A 5C37A 5G0VA 1PSDA 3Q1LA 3QP9A 3U4HA 3H5NA 2Z1NA 2HK7A 4KOAA 3TJRA 1N92A 1ENPA 1ISMA 2AG5A 4ZQFA 3INRA 4LW8A 2PLAA 1V35A 4HY3A 2JHGA 1EVIA 2DPHA 3Q11A 3WB9A 4RPGA 2VOEA 5DCUA 3OJ0A 4GBJA 2C29D 4Z6KA 2BFOA 1YWGO 1XSEA 2Y67A 3KETA 2IYPA 1SCUA 1PR9A 3DZBA 1H94A 4IDDA 2BMAA 4KQWA 1OAAA 4O0LA 1I3LA 1P1FA 5T8KC 1LU9A 4YR9A 4YB8A 1GADO 3Q9NA 5BT9A 2DBQA 4GVXA 3KHUA 1JVBA 4FB5A 2O3TA 4S1VA 3JYQA 4XR9A 3H4VA 4ZQBA 5CDTA 1P0FA 1C1DB 4D7AA 2WE7A 3DB2A 1HDYA 1Q2XA 4AVYA 4GWKA 3JYPA 4CR8A 2VUSA 3GFGA 5IZCC 1UAGA 1Q7GA 2IE0A 2O3RA 1GPDG 1V8BA 1LC0A 4DBZA 3HFSA 2FSSA 3QWAA 1EVJA 3WNVA 3ZNOA 1P44A 2FWMX 2YW9A 3HFGA 4E32A 2ZYAA 5DULA 1U9JA 3QHAA 3ZU5A 2GZ1A 4WK6A 4RDIA 3KUXA 1YKFA 1IULA 1GYQA 4NZ9A 4R1UA 2PKQP 3DHEA 4FFLA 5AXBA 1E7WA 5JCJD 5BNTA 2I65A 4DQVA 3ANNA 3M1LA 4YDRA 5JAZA 2UAGA 5AOVA 3TOZA 1XQ6A 3FWNA 4BO1A 5HM8A 5G0TA 3ZU3A 3EY4A 4ONEA 5F5NA 4P4LA 2ZJ1A 3DFZA 3OEYA 2IZZA 4PFJA 5L95A 2VNSA 4MVJI 3RJ5A 3I9NA 4LVCA 1UXJA 2NTVA 3AFNA 5COQA 4RGBA 1PX0A 1Y5RA 3RBXA 3M2TA 2ZKLA 4L9RA 1DIBA 1E1MA 1RWBA 1Q7BA 1LEHA 1LLQA 4WCDA 1PJQA 2PD6A 1D8AA 4XYMA 3JQ8A 1KEUA 1J49A 3OQBA 1O94A 4JJFA 4PZCA 1V3TA 1HEUA 2GGSA 3PHJA 3E8XA 3DAGA 4WLNA 3HHPA 2FY8A 2WJPA 4MVJF 4E2YA 4WJZA 4E31A 2R2GA 3CTMA 1QR6A 1E5LA 2ZTMA 2WDZA 4XD2A 3VVCA 1BMDA 3GNTA 1Z74A 2DPGA 1LDBA 3G49A 3NDJA 2AQIA 4D79A 3GUCA 3S2IA 3RAJA 4E0BA 1VL6A 1VSVA 3KOUA 5KJFA 2QW8A 4DA9A 3DTTA 2GD1O 4QO7A 4DIFA 5HTOA 3BHIA 2HMSA 2JHFA 1ZIDA 3GT0A 4ALNA 1OFGA 4KUGA 3JD4A 1E6UA 3VTZA 3N58A 3RJ9A 3FSRA 4PZEA 1BTOA 3JQ9A 1J5PA 4GAEA 4I9UA 3AI2A 4YRDA 4EUEA 2VWHA 4PLCA 1GDHA 2Q99A 5U1PA 1BXGA 1RM4A 4LRSB 3F4BA 2QRLA 1L7EA 1NNUA 3K30A 4YAEA 1FXSA 4GH5A 3WMWA 5MDHA 4HXYA 1ZCJA 1E7MA 2HMVA 3WGTA 5TT0A 3W1VA 4R54A 4OQZA 8ADHA 4PLWA 6ADHA 3R0IA 1A5ZA 2FMUA 4FD3A 4E12A 3EK2A 3PJDA 4UVEA 4H3VA 4B4OA 3VPGA 3DOCA 5I9NA 1I30A 5THKA 4O63O 2ZQYA 2YHIB 4D43A 1B2LA 3FPCA 4YT2A 3JQ7A 1O95A 4YAIA 1P77A 4RPLA 1LSOA 1Y8RA 4WLFA 2OXIA 5F21A 2GYYA 3QE3A 4WEOA 3GN2A 4A0SA 5FI3A 2EXXA 3AM4A 5L53A 4GWGA 3ZHZA 1I8TA 2NSDA 1PS8A 4A2CA 4K28A 2ZIZA 2GNAA 4DC1A 1BXGB 4TKMA 1Z73A 2CDBA 1W0CA 2DM6A 5COAA 5JPIA 3ZW8A 3OJOA 3V8BA 1DHRA 1H6DA 2W90A 2D2IA 3K2EA 3V2GA 2HMTA 3QY9A 3SJ7A 5EN4A 1YGYA 2AQKA 2B36A 4DLLA 1MA0A 4OHUA 4L75A 4OKIA 1NPDA 1GUYA 4ND1A 4QECA 1RKXA 4E6PA 5CDGA 3ICPA 3D64A 1KEWA 4AICA 3TFOA 3PYXA 4PLPA 2AEMA 3ZI0A 5A04A 3NUGA 3OIFA 1A71A 2PGLA 3IUSA 1X0VA 1AHHA 3LQFA 1NR1A 3WIDA 2VWQA 1E6WA 3RUIA 3VDQA 2AA3A 4XCVA 1G0OA 4CMEC 4NHEA 2VHXA 2VN8A 4EI2A 2NNLD 3DO5A 3WXBA 1GZ4A 2J8ZA 1LDEA 1DB3A 4BNZA 3GGPA 4M87A 5KCZA 2BF7A 4DMMA 2HRBA 3W4IA 3WX0A 3VC7A 4NFHA 3NTOA 3WS7A 4BNIA 2IXAA 1YO6A 3ZN2A 1VE9A 5BNIA 4WCFA 2B83A 1R0KA 3L4BA 4IUYA 1PTJA 3GVCA 4TRMA 5JLAA 5KNLA 5IDYA 3QW2A 3BMNB 3DBLA 1ZUD1 2X5KO 3R6DA 4IDBA 5ADHA 4D3DA 1A9ZA 1GUFA 3BXXA 1HYHA 5EINA 4AJKA 2Q2VA 4U8GA 1W6UA 1PQPA 1YQXA 3VH3A 4L8VA 1X7DA 3W8EA 1WW8A 2ZK7A 2NVWA 3AUTA 3ZNPA 3PZRA 3PWZA 2JJYA 2WD8A 3OQ6A 2VUUA 3DOOA 1DRUA 1QLJA 3GVPA 4E5YA 3KRTA 4L0QA 3UXYA 3OHSX 2O3QA 3S2EA 3C24A 1UH5A 3WQSB 4BGIA 5JY6A 2G76A 2H63A 1JDJA 2Y93A 3N7UA 4AJ4A 4BV8A 1LLCA 4WCFB 1M6HA 1F12A 5L40A 2IZ0A 3Q3CA 3DBLB 4N7RA 3DC2A 4II2A 3E82A 3OM9A 4JBIA 3PJFA 2O4UX 1HDZA 2CVZA 1YBVA 1WP4A 4NG5A 1CYDA 4W9NC 1EEHA 3GN1A 1DHTA 2D0IA 4PLGA 2C07A 3KV3O 4K26A 4QFCA 1XWFA 3CXRA 3UUWA 1SEPA 4N54A 1W8DA 4ITUA 4CR6A 4LCJA 2EW2A 4WNIA 3BMCA 3NX4A 1YRLA 3M6IA 3MJVA 4I5GA 1I3KA 4IDEA 1DRWA 1I10A 2QRJA 1I2ZA 3H5AA 2YQ4A 4J9UE 2X86A 1ADCA 1GAEO 2EW8A 4OJNA 4FGSA 4RO0A 3LK7A 5EQDA 4CM8A 4CM7A 1EBFA 4NJMA 4PLYA 3MZ0A 3TPCA 5L3ZA 2BGMA 4EJ0A 1ADGA 1NQAO 1GZ6A 3SVTA 4A73A 4AFNA 2X0IA 4B4WA 2I67A 4ZQEA 4JK3A 1H6CA 3ZV6A 5JFOA 3ADPA 4GLOA 1V0JA 5JO9A 4CUJA 1K2WA 5CDUA 2VCYA 4XKJA 3VZRA 3TZ6A 2EHDA 2Q45A 1U7HA 1JTVA 4TVBA 4IIUA 4CQLB 2NVUA 2PZJA 1XU9A 4HUJA 4OKNA 5TNXA 1VJTA 2D5CA 4EEXA 2VZ8A 1Q0HA 2C5AA 5B12A 4XA8A 3UVEA 1UP6A 3PI7A 4L73A 3HDQA 1B8VA 4FFNA 4I5FA 4W82A 3H9EO 2I5PO 3BMCB 4R69A 1K6JA 3DZKA 2X1HA 3VKVA 4Z0HO 2Z5LA 4PIVA 1H6AA 4TKLA 5J23A 4ZICA 1PU2A 2AG8A 3G0OA 2GN9A 2NQTA 4CM8B 1LNQA 4J49A 1U3WA 2HMUA 4RLSA 4RORA 5G4KA 5I7VA 5KOIA 1AXGA 4HNHA 2I3AA 5GZ3A 1BVRA 5T5QA 3GC6A 3OP4A 2P91A 4BNHA 1S6YA 3MJTA 4CM9D 4DGSA 3G17A 1R4MA 2OZPA 4BO0A 3EC7A 5TX7A 4BNXA 4IDGA 2Y1EA 4I5DA 4YA6A 4AJHA 2AW5A 4JIGA 5F5LA 3BAZA 5GZ1A 3CUKA 3DBHB 2VHVA 4L76A 3RD5A 2FHSA 4FJ1A 4R68A 3WTBA 3HDHA 2YV3A 5EMHA 2F1KA 1Q0LA 1NASA 1X1EA 3AY6A 3GY0A 1YQGA 3VOSA 1N9GA 4IS3A 4UUMA 4M49A 2EWMA 3ETDA 1N8KA 3I3OA 1T4BA 4II3A 3OH8A 5K6AC 1IE3A 2CSUA 4FFPA 1NFRA 2IRWA 2JFFA 3DONA 5I7FA 4URFA 1G6KA 1V9LA 2W8ZA 1ADFA 1PJLA 5K9ZA 1EUZA 3JD3A 4GMGA 4BKQA 5DZSA 4D0SA 1ISFA 2B5WA 1P9LA 2GSDA 3H9JA 5G4KB 4KTTE 2JCXA 2WWRA 4YEDA 1PQUA 3MWDB 2YYYA 1B8PA 3GFBA 1DSSG 2LDBA 3S2FA 4TZKA 1MV8A 3V5NA 4DMLA 5T6BA 5EJ2A 4LSWA 2HCTA 3A4VA 1KEVA 1MXFA 4DYVA 4HNGA 2AE1A 3DOJA 4LVUA 3RUEA 3WWZA 5IDQA 1GZ3A 4RPKA 3ROMA 1VL8A 1KC1A 5HRUA 3H9GA 5COBA 1TA4A 1UR5A 2GPTA 4E5NA 4BKRA 4MIYA 4J1TA 4Y67A 2X0RA 3EVTA 5KJ6A 5KVCA 2B69A 1E7SA 3PWKA 4BNVA 2OP1A 2WEKA 2X22A 2X8LA 3C1OA 1QV7A 9LDBA 5JDCA 3T4EA 5CEEA 2PV7A 1DXYA 4FC6A 4WOKA 5IXYA 4BNTA 2O23A 2FPPA
chains in the Genus database with same CATH superfamily
3RDPA 1DS6A 1FFAA 4RSMA 3TRJA 4FWBA 2B2CA 4V02A 4YUXA 3KWMA 4XQCA 1XVVA 1F17A 4DIEA 5IYZA 4C7OA 4BMDA 4D9HA 1HC7A 1SKUA 3HUFA 1SIWA 3EBPA 5DP1A 2G9ZA 3ZHXA 1BGXT 4GUAA 1QO0A 4AUMA 2I9KA 1XZNA 3UWPA 1UK7A 1ZJZA 4WFQA 3QBVA 1RP1A 5CDFE 1L7AA 3R09A 2FWNA 4P3KA 4EZBA 4P86A 1QQ6A 3V3TA 5JECA 5K45A 5IAKA 1V95A 3VU1A 4O8CA 4HFRA 3B5IA 5HQJA 3BRQA 3L0BA 4TKVA 5CNKA 1BN6A 1ULUA 3JASA 4IWXA 4UDXX 1BCSB 1NXXA 2MCFA 1DG9A 5BSRA 1G17A 3KJZA 1FVFA 1IVSA 3ADOA 3TW8B 3ZIAA 4RA9B 1ZN8A 1XJ5A 2GZ2A 3ONVA 1OLUB 4KJXA 2PT6A 4MLZA 2X9LA 4R5HA 4IJUA 1BHQ1 1Y6RA 2G5PA 4YJ2F 3VPCA 3X0DA 2DULA 4JUCA 2W6IA 4QPZA 2H1WA 3K0AB 2UUPA 3S2ZA 1O96A 4QGBA 4AO6A 2FPPB 5JADA 5JWOA 5IVIA 1HFEL 4L6CA 1H4QA 2CHFA 3JQPA 1M5TA 2AJ8A 3FSJX 1MD9A 3R7FA 1CRPA 1F2TA 3U4QB 4B33A 3AF3A 4UU8A 2IS4A 2QRPA 5FA8A 5HZMA 1KGSA 4H6PA 3P2OA 1ECBA 1G21B 1JQ5A 2IUTA 3PUXA 5K0ZA 3DDZX 1U5CA 1F38A 3TRHA 2WHYA 3ANMA 1IQUA 3RVRA 1Y3DE 1BEZA 1DC6A 3B7PA 3HFRA 1ZBDA 3P9CA 2AT1A 3WL4A 3QE0A 3E53A 3M6MD 3PQ2A 3BG5A 1J2EA 1IH8A 3ONEA 3OWOA 4DUPA 5T8KA 3CVVA 2WLTA 1J2UA 2GM3A 1YRQA 5E9QA 1Z33A 2FGKA 2GDJA 2ZJ3A 3D0QA 5KWIA 4X6UA 2REQA 2G04A 3BHNA 4MI6A 2XUOA 2VXCA 2HMAA 5AI8A 3M3DA 3ZDXB 1JIXA 4I1UA 4MV3A 5IXJA 1U2DA 3RODA 2NLOA 4V0OA 4WKCA 1FDSA 1CJMA 2H2DA 4PTLA 1XZJA 1N2IA 5I7UA 4KLCA 1T9CA 5IZCA 5IT0A 3C87A 3RK4A 1ZLYA 2XGMA 1DRKA 3IOBA 3N05A 4TQAA 2WG0A 4NABA 1W93A 1MAUA 1UOQA 1HDOA 2ZRMA 1DTWB 2ZS7A 4KWHA 1KORA 4JI7B 2W0MA 5BR7A 2AFVA 1ISRA 3COPA 1E7YA 4HB3A 3SY8A 3R9XB 2PCLA 2IXBA 2XUDA 2RMKA 3I0ZA 1JG1A 4FPXA 3PITA 4WQMA 5TXGA 3KOWA 4RTLA 5DGHA 1W85A 1SO8A 3CRVA 5U9CA 3A7DA 3OQJA 4QELA 1F8FA 4ACBA 1TT5B 2UZ1B 4I6GA 2C2GA 5JTUA 1USUA 3TLGB 2NU8A 3D5EA 3G9ZA 4ZV9A 1NN0A 1P6UA 4L3OA 2Z9CA 2BH2A 3RABA 2ID9A 1IDN1 5IEBA 1CUWA 1H9BA 2EFDB 2QTWB 1EZZA 2DFVA 3K4PA 1P4SA 5EKUA 3T1VA 2I4LA 4KJZA 2GLUA 2HA7A 3QKUA 1OH8A 3QVOA 3AI1A 1WY5A 2CLKB 2AD1A 4LECA 2HJRA 4MV4A 4OYLA 4QRIA 4URWR 3RIGA 4B6EA 5MGBA 1XNGA 5JS6A 3HLYA 5AI6A 3ZIDA 1E5XA 4XWWA 2DVMA 3GAAA 2GK7A 1HT2E 5EJ5A 5J2UF 4MDEA 2Q21A 3DKKA 3TB6A 4M9QA 2OMEA 1X14A 3MLAA 1U0OC 4XJXA 4DWOA 3EXIB 1FUYB 4GNRA 4TRJA 2ZYHA 1I32A 3UGKA 4CL3A 1UBFA 5FAKA 2CNKA 4BIIA 4S1NA 2H1IA 1E63A 3FKQA 4UFNA 3KKPA 3QMWA 3WK9A 1SK9A 3HJGA 3PD0A 3J7TA 4HPJB 5JS8A 3ER9A 3L79A 4V03A 4MWCA 1ORHA 2YCLA 4U7PB 5ALWA 5J5CA 4L4XA 1BWRA 4PYNA 3RBAA 1DADA 4YV0A 1DVRA 1PFGA 3EA0A 3IR5A 4AP5A 5LDHA 5SV2A 2V58A 1V47A 2VT2A 4OBXA 3UBTA 1TNDA 2IIQA 1F4PA 2NYAA 1M2WA 1FP2A 3DEFA 3IUPA 3F98A 4MIOA 3OE5A 4U2KA 2W6QA 4X71A 3UG6A 5DSTA 4OSPA 3MMXA 5EMMA 1LC3A 2PUGA 1LBEA 2HR1A 2ZXFA 4MR8A 4OHMA 2PL9A 3H5RA 3I76A 4MAAA 4C04A 1I6LA 1HETA 1R4NA 1R10A 2VT3A 2PMFA 3EUEA 4PQRA 5L7WA 2XB9A 1R9MA 1QYRA 2CHVA 3S70A 4HNTA 4KX5A 4MRPA 3KELA 3NUQA 4Z7NB 3LC2O 1E8MA 1KZ9A 4KQGA 2O5VA 2XB6A 4JASB 4MH0R 5FIUA 3WB2A 5C35A 4UNQA 1QIEA 3FROA 3VHXB 4KIJA 1U0HC 1U80A 5EFZA 4HSEA 2N9UA 2DWOA 3BD6A 4FHGA 1RI2A 4KYVA 4PCUA 1DO8A 1JVSA 1P3JA 4V2UA 5EWLA 1ORVA 4DBVO 3ETCA 3IBSA 5FUQA 4E08A 2OUKA 1MTZA 4ROSA 3ZTYA 4CTJA 2Q41A 2I2WA 5AJZA 3BHJA 2ZYWX 2Y1DA 4Y2GA 1U1EA 1IHXA 5EWJB 2QRQA 2A2ZA 4CKBB 4EVIA 1GTG1 3H1EA 4RYLA 3USZA 3B2QA 5C7OO 4X1YB 2ZJAA 1R5JA 2X2EA 2FSGA 3QFSA 4JL8A 2FLVA 1GUZA 1AK2A 1MGOA 1Z6AA 4QC2A 2GHIA 2Y1XA 3SJCA 1N3LA 2E6UX 3ROKA 5BY2A 1NN1A 2JBAA 3OLWA 3ZGYA 2WSLA 3EDYA 4IJWA 4BTVA 5ENZA 5I48A 1G9SA 3LY9A 2PRKA 1VKNA 4DPMA 3NKFA 2G40A 4FJ0A 5EXPA 4W1SA 3RS7A 3MTAA 2Z5VA 4LTDA 3LLCA 1BKSB 3IVXA 4H0FA 3ND8A 1AUOA 2J08A 2BOVA 1EK2A 5TGTA 1FS6A 4J91A 3OM8A 2AUMA 4G5YA 1V4NA 4BX9A 3PNKA 1K7YA 1MC1A 2OWDA 3OQOA 2NXNA 3L4JA 4JU8A 1E8NA 1M6WA 2XHEA 1RTTA 4FI3C 3ZJUA 3M0EA 1QHNA 4QOEA 2OPHA 1E4EA 1G6Q1 2VBFA 3QH4A 1JR4A 1JQ3A 3R7NA 1SBZA 1N0IA 3QEKA 3G2PA 3X44A 3VJRA 1DUVG 4YJHB 3F1LA 3RTGA 3T3NA 3O4FA 3FSGD 4YACA 4NYIQ 2R8OA 1ORIA 4B83A 1U2EA 1A77A 2R6JA 1P5RA 2Z1MA 3DMGA 3MBOA 1N2CB 3MJEA 4JBYA 2YNMA 2EYQA 2PUEA 3ZGLA 2VF8A 1ZSVA 4H31A 4JIMA 2HJSA 2D1QA 4RTPA 4U7TB 3SMVA 1BXKA 5K0GA 3TLKA 5SYMA 1RC1A 2J9FA 2FN8A 3UHOA 1H4TA 1LPBB 1QNLA 3QQ5A 3WYBA 1KERA 1V7CA 1WDMA 2PNFA 2XQKA 4R16A 4U7HA 4JP2A 3JWPA 4OXYA 1QJ4A 1T25A 1VCOA 2XA1A 1ILWA 1VKJA 3LY7A 3D3QA 3PB3A 3IULA 2LUOA 4OYHA 2WHEA 3U7IA 5C46F 1ZUIA 5A9RA 1B3RA 1M2EA 1QRDA 1VDZA 4N5LA 3V4ZA 4BLVA 4KR9A 4IW3B 2VSNA 4GX0A 1GZHB 1K63A 2C5FA 1Q0QA 2IP4A 1GTL1 2FRDC 1MRZA 1Z15A 4JLBA 4URHA 5CJPA 3S99A 5CFQA 3HVIA 2G9RA 4TN5A 2F3QA 1ABEA 5FL3A 4DNXA 3V4FA 2X8JA 5C4IA 5JNTA 1Z6GA 2ZTUA 1NC3A 3TSCA 3VA7A 2HCJB 1XDBA 2EJUA 4X1IB 4DUGA 5IAOA 3LOUA 4ID3A 1C3VA 2F8MA 1E92A 1RABA 2JIMA 3HCOA 1PVDA 3C5WP 3BCRA 4HDSA 3CS3A 3S5UA 1MDBA 3H7AA 4ZO8A 4IDQA 1UZNA 5T4EA 3QLJA 4B09A 3PUHA 3PHIA 3SM3A 4CFZA 5EQTA 1XF9A 2GARA 2WU8A 3WLMA 5FTJA 3THSA 4XIYA 1FY2A 3K92A 3DV0B 2FQWA 3ESDA 1JX6A 2ZYIA 1A4IA 1TVCA 1WO8A 4K86A 3RYCA 1NY5A 4QQNA 4V1CA 2AV6A 2ZBGA 1XTBA 1C2TA 4LXXA 4TTIA 4UHEA 5FP0A 1X86B 3H9BA 1E2GA 1WXFA 3P7MA 1NA5A 2CXNA 1JQLB 2JEOA 1LBIA 1LNZA 2BVNA 3C6XA 1J09A 4UPVA 1JFTA 4W5WA 1J24A 2II6A 2BGNA 4QOIA 3H1GA 3V4RA 3N3AC 4MV5A 3G5AA 2A1IA 1ZH8A 3DV2A 3WRVA 4D41A 1VPDA 1XKTA 2E9SA 1KH2A 3TWOA 3MT9A 1KS2A 1QGYA 3P9XA 2AI1A 1PZFA 3AVTA 1IYZA 3CUYA 4FYJA 3VVLA 1SXHA 2J9YB 5BSVA 2WQ7A 3LDFA 2QD1A 3GQBA 3U61B 3H4IA 5FLYA 1DX4A 2XTJA 3MMPA 1NBME 2QTZA 2D5BA 2E37A 5EERA 3PGXA 3D3WB 2OVBA 1PZEA 2VJBA 2XVMA 2R8BA 2I8AA 3DMPA 3FGOA 4S0ZA 1FMTA 3AEZA 1USIA 2HV8A 3HEMA 3K53A 1OZ0A 2E4UA 4RVSA 1NE2A 2XCLA 4K46A 4XLZA 3CM0A 1CEQA 3R2JA 3NS7A 3BD7A 1XTPA 1SC1A 1XWWA 1KAEA 2TMGA 5DLDA 1CJBA 5JZSA 3T7KA 2W22A 1UZLA 2C7OA 1G4AE 3H11B 2OXTA 3W77A 4CU2A 4HNSA 2A7QA 4O4HB 4P80A 2MYTA 2G80A 1D7OA 4UTXA 5H3LA 1T8UA 3WISA 4DZTA 2HSJA 2VQEB 2PRIA 1H2BA 2AGVA 1MGPA 3QPVA 5IS2A 1KSJA 1UQRA 1Z8DA 2OEPA 4RHYA 3TPFA 3ETNA 3NHPA 4HLUA 1HA3A 4X84A 5SY9A 2ECKA 5AW8A 3HR7A 3GLIA 3NBKA 1QYDA 4KQ2A 2RC5A 3KKLA 3OY7A 1BG6A 3ZY5A 4KITB 3BE4A 4EUSA 3HM2A 4PSAA 4ABYA 1Z5GA 1JEYA 4UM5A 1RRVA 5IF3A 2OV4A 3KLPX 1APBA 3L82B 3O1JC 3S7TA 4BJ1A 5EWMA 3VR4H 3WWEA 4JU9A 3LD9A 2DUUA 1ZNZA 3OEWA 2BFEA 2DMRA 4FQ8A 1XMSA 1H0HA 1KH3A 2DOKA 2IUFA 2RG1A 5EHQA 1HOXA 4O2BF 4BYGA 4KV9A 5ALPA 3LPMA 1FSFA 2IIBA 4M6WB 4G09A 4URVR 2O2SA 1M0WA 4LJ4A 4FOOA 4EJSB 2FE4A 4OB8A 4PZYA 2IU0A 1B15A 1CEEA 3CH6A 2AFIB 1Q0PA 3DF9A 5EG5A 5EXEA 1W0JA 2VNIA 4O59O 3IQWA 5A4DA 2FAXA 5LDDC 2IUYA 4MUJA 4F6CA 5H8WA 1JKJB 3RHTA 5F12A 1K3FA 1UEIA 3H5LA 1Y7LA 1RWPA 1O0BA 5JT1A 2K7ZA 2I3GA 3FGZA 4FN4A 4OHWA 4TTTS 5JJ5A 3DWFA 1ABBA 1S9DA 4RZXA 2X9VA 3VMMA 1JAXA 1N1EA 2QRMA 2RGNA 4Z54A 3BSFA 1YULA 4BXOB 2FPGB 1XLUA 3AR8A 1FPQA 4RV4A 3UMFA 3BIWA 3AF5A 1NDUA 2JIRA 3AR3A 3F6CA 3MGGA 3RRXA 1U4OA 2HHLA 1FLNA 2JA2A 1YKSA 2EKZA 3SF8B 1VPVA 4KYIB 4OH1A 5AJVB 5ARDA 2WYWA 5LUAA 5B1YA 2I2FA 1OMOA 1RHJA 4UQOA 5K0JA 3AEKA 3FI0A 1RWMA 2J3EA 1QO7A 1UFKA 3E3OA 4MKZA 4XI9A 5FBLB 3TTUA 3CUEF 3DM9B 5K6AA 4LFAB 1FB5A 1UFOA 1TAUA 4OFWA 1M7GA 4ZP1A 3H2KA 1E89A 4CI9A 4WVLA 4TMWA 3Q5DA 1GRRA 5BQOA 4LMRA 3UMCA 1AGRA 2ANCA 1CY7A 1VGRA 2ZJ5A 2AOTA 3I34X 4EKGA 3VDRA 3OFND 1L7NA 1V5EA 2PS3A 3GXBA 3AOEC 2O2XA 2ZB2A 4J0EA 3GRRA 4GG1A 4MWSA 3CGGA 3KDAA 3ECAA 2O3JA 2XECA 2R1VB 3H97A 5EP3A 3RUPA 2XZPA 2QB5A 3G5LA 3LUJA 3M1IA 2P75A 3N70A 1S7GA 4IFEA 1JU3A 4RHEA 4AI6A 3NPAA 1Y81A 3D2CA 1IG3A 4GNKA 1SIOA 3LDUA 5TB5A 3TZCA 3LDHA 3PHLA 2Z8YM 3H6HA 4C7VA 1PG5A 3LZDA 2EP7A 2C1EA 1TVMA 3EGCA 4LWPA 3RC9A 1U6KA 3IIJA 4L78A 1GRQA 1WXDA 3PPIA 5DNAA 3VMFA 3ZWYA 2CFRA 4Q9AA 4OP3A 3TIGA 3CBQA 4C20A 1XN4A 2X40A 1WNFA 2W2QA 3OLXA 2X41A 1T15A 3OA2A 4RMHA 4EZEA 3M70A 3GG9A 4L5IA 4R8RA 4WZAE 3MD9A 5G0SA 4EX7A 5JUWA 1EP2B 3KB8A 1RFGE 2IITA 2DU8A 1PUIA 3DO8A 3UJBA 4W5JA 1QWOA 1W36B 4I50F 2Z2JA 3RC1A 1YB1A 4H1TA 3B5JA 2ZIXA 3DNMA 3KWJA 4MS4A 1KNXA 1OY1A 1G5PA 2EARA 2R47A 1N3IA 1TAHA 3DMHA 3JVUA 1IK6A 2WKPA 3D9QX 4L8WB 4BFTA 3TNDA 5I3CA 4U0KA 1QORA 4N40A 5CNMA 4JCCA 2ZSHA 5LBUA 2A5LA 1HDEA 3E0QA 4N0PA 4GOXA 4BVFA 5DPMA 4M8KA 3W5DA 4IGKA 1O1YA 4EYEA 3ZWCA 5JIBA 3SSAA 4EMSA 2HLDA 3AM1A 1OW3B 2VWPA 2ZROA 4L5JA 4XOUA 3HO6A 3OUZA 3TQCA 1AK1A 3TMKA 4EY3A 3ZD9A 3FCEA 3KOYA 2AUTA 4HXFB 4S1PA 1GG8A 4NWIA 5HIJA 5FOTA 5TQ0B 3V1YA 1P7YA 3GEGA 5C9ZA 4I9NA 5KTSA 2BZ1A 1ZRHA 1FZQA 5JZ9A 1GZDA 1HY3A 1ZHHA 5LL6P 1SU7A 1YTUA 1XDUA 3OA0A 4B2YA 3KEFA 4B3IA 4JXJA 2Y0CA 1PWEA 5CGQB 2C78A 3GAZA 1UP7A 5C32A 1M6NA 3FCAA 3EVNA 1AIPA 2SCUB 4QWWA 4ZTZB 1R37A 5JHGB 3RS0A 2O0LA 3LVQE 4KQCA 5J4YA 1QS0B 4Z0PA 2FFHA 4HNAB 1OH7A 1KO5A 2ZYDA 4GZMA 4RZIA 4D4HA 1Z2NX 2JL1A 2UVPB 1CUAA 4Y9UA 1GTVA 1L5VA 4G3XA 3A1FA 2G06A 1VL1A 3HU2A 2QTMA 3PQ6A 4B2PA 5JD4A 4LRQA 4P7GA 2EJCA 5BSFA 3QX7A 1Z5OA 3ENKA 1HDCA 5JMPA 2Z95A 3WZLA 4C88A 1NYRA 2I33A 1IBMB 1BJKA 3PSHA 3B9PA 4XYGA 5I9MA 1SB9A 4PG7A 2BDTA 4UHBA 4H17A 1KC3A 4YT8A 1TCAA 3O8QA 1KRHA 4LXTA 1JH8A 1W0KA 2FKNA 3ODGA 3Q41A 4XRRA 1ZVKA 3C1AA 2YVLA 1QBKC 1YCGA 1TF5A 1YS2X 4N12A 5AJHA 1OXTA 3WIEA 3C5VA 1ZR2A 1FW8A 2OXEA 4C2UA 4A3SA 2PAAA 3JCZA 2BFPA 2O7SA 5B30A 3ONNA 2CXPA 3GFTA 2A0XA 5CVCA 5HFAA 2QQFA 5BSWA 3C8MA 3NLLA 2Y66A 5K51A 4E5VA 2BGIA 3VO1A 3EZ2A 4KQIA 4LJRA 2GKOA 3C48A 1P17A 1TEVA 1YZ3A 2E6KA 3W6NA 5GVRA 3W5CA 4A2QA 2PUCA 2VVTA 1FOEB 3K20A 4PG4A 3DSRA 4WE3A 3PCRB 3DW3X 1LB1B 4Q9NA 4CV3A 1ZMOA 1KMIY 3IT0A 5DTMA 3D4NA 5KZMB 3PL5A 4LVNA 2UXCB 1ZNQO 4GE0A 3A2KA 1N75A 4MJXA 4BNUA 3AUSA 4KEAA 4X63A 2FZWA 4G81A 5D01A 4RETA 4TGLA 4IP0A 3S3TA 4BO2A 1DKPA 3N1UA 4IJQA 4XASA 4DDKA 4DGQA 5D87A 2YOHA 1NNI1 3VTKA 2QTBA 1HQDA 2F43B 4HRAA 5L9AA 1Y3IA 2VQ6A 3CH4B 3WADA 1A5AB 4DWJA 1JKIA 1JW9B 3EXFA 4XM2A 3U2QA 1GILA 1P5JA 4BE7B 4PPNA 4YPOA 4B87A 1JMYA 2FUCA 3GPDG 3P2IA 5A3VA 2HPZA 4WJLA 4DR4B 1QZTA 5L3SA 4WNAB 5FADA 1B76A 5I9LA 3RBVA 4ZT5A 4LFBB 1IQ0A 3I3SR 4OIMA 1WCWA 1Z3IX 4ZOQI 1L6IA 5BO5A 1TKRA 4O4LA 5FNVA 1JLLB 4YO8A 1II8A 5FPKA 3FPLA 2J0SA 1A8UA 4X3CA 3A14A 1FQJA 1K6EA 1DARA 2OAGA 3PUYA 4O0MA 1DJLA 4RHXA 5KHLB 2BH9A 5HIMA 4CZ2A 1YS6A 3BF7A 4L57A 4AROA 5JPCA 2RB4A 3B7WA 3RKRA 1Z0DA 3AV0B 3UWOA 3KCNA 2RGXA 4DDMA 1ZD9A 4JI3B 3A1NA 1C0LA 2NADA 3I6ZA 3LJKA 3N2LA 4IV5A 1N6LA 1MZPA 3JZDA 5ALIA 2VPZA 1C7RA 2X3UA 2K6GA 5JAHA 3UGQA 3OUTA 1XQYA 1E1NA 3B2EA 1M10A 3FNRA 2X5XA 3IC5A 3AY7A 3T9FA 1M1XB 1GFZA 1V48A 2V55B 4M9RA 1WVMA 3VC1A 5KOJA 5BSUA 1LBHA 5REQB 4KRYA 5H82A 1WXIA 4IUDS 3EY9A 1Z56C 2X58A 4KK4A 3ZJ5A 3T3OA 4CETA 1ZD1A 3DO6A 1E1LA 3AUFA 4HG2A 4NBWA 3R9WA 1KOJA 1MU0A 1PJAA 3R3JA 1ZA2A 1TAQA 4RF4A 3AVXA 5BWOA 1RJWA 1RMYA 4WGGA 4N18A 1F8GA 1EFPB 1D2HA 1YT5A 4NBUA 3TZHA 5ILQA 4ETIA 4BNMA 3HJTA 3IXMA 4BP9A 1OYYA 4MKXA 2UUCB 1QVVA 2H7XA 4EQZA 1MIHA 4QFDA 5FQOA 4YRAA 1IIBA 1XRRA 1XNJA 1WHTA 2QQEA 4HZUB 3GLHE 3HKEA 3R76A 3OCWA 2UUAB 5BR4A 1H0RA 3REQA 1RBYA 3PF9A 1NRXA 2TMDA 1VKHA 3SKXA 4G1FA 4BNKA 3PRJA 1NP6A 3T38A 1NDHA 3WYCA 4D5GA 5B3JC 2J5BA 2A0FA 3IBFA 4KAJA 4O2RA 2NTJA 3QE2A 1FFEA 3CR7A 1EFRD 5CLFA 3NEAA 1KH1A 1NMZA 3BZUA 5KYTA 4KSBA 2MIIA 2VOJA 3LO8A 4I3FA 1Y9EA 3HI6A 4PHGA 1VA4A 4MUFA 3JYNA 3UF0A 3HWWA 4E94A 1UBHS 5AM1A 3CX6A 2HF9A 2YFQA 3NT5A 3O47A 4I1YA 4UEJA 4BMSA 4NJOA 4WY2A 2B99A 3B1FA 4HF7A 4TVOA 1VRWA 4KIGA 1RWXA 3GUUA 4WY8A 1HG0A 1U8TA 4BQQA 3WNQA 4GRIA 2HTFA 3C2QA 1IQRA 2ZJ7A 1SHZA 3AKEA 1T4MA 3ET5A 4LOKA 4D8XA 3C6MA 2WVAA 4NY1A 4LQLA 5DM0A 4PTYA 3AUYA 2ZM5A 1ZN9A 3FI9A 4I66A 3EWIA 1MO5A 4WY5A 4FKBA 5FUBA 2HU2A 4CKWB 2D2FA 1WV0A 1H22A 1NTOA 4H2DA 5H5JA 3D7KA 3MWEB 2PA3A 5EJMA 4W1QA 2PZBA 4G0QA 2X77A 4DY6A 3U7EB 4H4DA 5FBWB 4QYSA 4EYSA 1E3EA 1XRNA 2VKTA 2QZ9A 1K3UB 3A9VA 1U9YA 1IATA 1ACLA 3IE0A 3D4PA 4U3JB 1J7JA 4J6EA 5KVQA 3VR3D 4R1SA 1THGA 2CD9A 2OXFA 5FOUA 2WB2A 1ZN7A 2GPAA 3VNRA 1MT3A 4KRGA 3WLIA 1NKVA 1E6EA 3KYCA 1AUQA 2CL5A 4CUZA 4CYMA 4J16C 3RC3A 2WIFA 4YP7A 4QUJA 1A98A 1C50A 3LQ2A 2JFQA 2W0SA 2FRVA 1U7DA 4GEKA 4QPNA 1JHAA 3EHDA 3K94A 1PZGA 2A0UA 5A7GA 2HA3A 4A6EA 1LPSA 2AF3C 2WOJA 4NZMA 1O0CA 4NDZA 1D6SA 3DAYA 1UANA 2Z98A 2WJAA 2V6MA 2YDYA 3B48A 3JZIA 3P9RA 4ZV7A 3ZY2A 5TMEA 3VU0A 1HGXA 1R6VA 5HWSA 1PNOA 1AS2A 3HVRA 1QGAA 4GP9A 1UDAA 4HV4A 4QHYA 3AFHA 3FNHA 1GHTA 4OQMA 1DI0A 2CL6X 1R74A 3E9MA 2V97A 1W2HA 2VPXA 1CP2A 2QXTA 1EJ0A 2XRMA 2A0YA 2GF0A 1NQUA 3JYHA 1X1CA 1Z39A 1CS0B 1U7PA 2D1YA 3FOEC 1G8MA 1V3UA 2PTGA 1TK9A 1T8YA 2AMLA 3GRFA 2YYAA 1O0SA 1UC4B 1R1DA 1PJ2A 1QZZA 3M5PA 3ITNA 3MRVA 4MAFA 4BQEA 2QTRA 4FFRA 2Y2VA 1GU1A 1VE7A 1LDGA 1E2MA 3HWSA 3D8BA 4IFBA 3G2HA 4QVIA 2Q1WA 4E07A 3TZBA 4A8TA 3M6WA 2J32A 1ODCA 1MQSA 1UIRA 3AEUB 3LKDA 1VXOA 3NP7A 2C9ZA 3GZNB 3VNQA 3W90A 1VRVA 1FS5A 2AYXA 1IN4A 3G2NA 5K0SA 5M04A 5CB4F 4M54A 5A3RA 2O48X 4DT1A 2WIDA 3KSDO 4YWJA 4Z1MD 1LCIA 3KAPA 4NEGA 5H02A 2H92A 3WGOA 4RWZA 1J4AA 1Z68A 2JCGA 4EVRA 2OGTA 2BYTA 1H8HD 1X0XA 4WV3A 2QE7D 3EJWA 3ELYA 2DP4E 1DT3A 1Y9AA 3OEED 2Y6UA 5LKRA 4L51A 5F3WB 1UUFA 2ROQA 2IOYA 2VHQA 3HKCA 1Y1RA 4HHEA 5IT4A 5JV5A 1IONA 2MINA 2GETA 3GCXA 3COSA 1QC5B 3NEJA 5AM4A 4G8DA 5G02A 5HF6A 4IZ6A 5FNZA 5D6OA 4AMBA 3MPOA 4IDAA 2XSZD 4RZHA 1H2RS 4QJ5A 2IUEA 2UZ0A 4DNPA 1A9SA 1QJCA 1VGVA 3L46A 5J2TF 1QRRA 1LI4A 2XITA 5EXDA 3VDXA 3GVIA 4XYEA 5ENDA 5AK0A 4LDPA 3OZFA 4DCSA 2ZE6A 3TEMA 5A5DA 2X1VA 3FLBA 3S55A 2SKEA 1G3RA 1UM9B 2NSLA 4HCJA 5IDXA 1BX1A 3FXAA 1AUPA 2Y1OA 1VHLA 2EVWX 1DO0A 1IHOA 2CLLB 2WVGA 2I4MA 4QUIA 1T1SA 5ADVA 1SVIA 2IV7A 4BNGA 2VYVD 2RG7A 5A4AA 4HXGA 4BO4A 3GJ8A 1UJ6A 3LT4A 1K88A 1Z6TA 3GIDA 3H5IA 4F4DA 1HWYA 2V7PA 1ANKA 3QVSA 1H1TA 1WULS 3CSDA 1E94E 1K4YA 1SPXA 2LCFA 2GT1A 3DE5X 4J6FA 1GTMA 3C85A 3WIOA 1Y7IA 2IX3A 1Q0TA 1HFWA 4EGFA 3FVRA 1P39A 3FYDA 4F38A 1A97A 2FWAA 2WTNA 1JMKC 1F8XA 5HUJA 4ARUA 2PXAA 3AINA 1T3HA 4LMPA 1XA0A 3GJQA 5C5IA 5L45A 2ABWA 3DEHA 2BMDA 4ZGBA 3SFVA 4AWAA 1XEAA 3LVRE 3DMTA 4R71A 3COYA 1BDMA 1BMTA 3IAM6 5FBRB 4WERA 3SZMA 3AZPA 4U0JA 1QK4A 3N9IA 2LBPA 4JGGA 4X24A 1V1JA 3TNYA 3AFIA 3CUUA 3NVDA 4IINA 1AK9A 3WLHA 3ZOZA 1IBCA 3JQFC 1USGA 3A9WA 2IXDA 4K40A 3ST7A 1JA9A 1F0PA 1Q91A 2PZEA 1DBRA 3FNFA 1DXHA 2PQ0A 3GWGA 1W88B 5I9SA 4DCOA 5KOHA 2ZZMA 1F1JA 1Y1PA 4FEGA 2NU9B 5JFTA 1BOOA 2AXQA 2J46A 1ISHA 1ZMTA 2WA2A 3H7IA 4JQOA 5ESXA 2FYTA 1C8LA 1XCGB 7AT1A 2BFNA 5E3HA 1SG0A 3CZ9A 4QQ8A 4TTJA 1ISJA 1EWRA 1LD3A 1FYDA 1UQTA 1QG6A 4TV8A 1KPIA 1SUFA 1BJRE 3JWGA 1JSCA 2CNWD 2QVLA 1GM5A 3FWPA 2OLKA 3KSUA 3UWSA 2I71A 3DXFA 1UJMA 3BRWD 2BFFA 1NMEA 1S3GA 2VHEA 4Q3BA 3TCNA 3CQ9A 1Q3KA 4JL5A 1CQJA 2G72A 1K5PA 1I36A 2C3OA 1T9BA 5KNBA 2VPPA 1ND5A 4XWOA 4XYLA 1ETUA 1V7QA 2FSVA 1J70A 4D3ZA 4W5OA 2XR1A 2H0AA 1TEXA 3OLQA 1BFDA 2IEGA 2X9NA 2I4TA 3F73A 1EE2A 4OM7A 2OCXA 4JC4A 5EE0A 1QGED 4N7BA 3V7YA 1KMHB 2NO6A 1F2DA 3GEDA 3IB6A 3IESA 4OSOA 4XWKA 2JLWA 2XBUA 1WMDA 1O5TA 3QXCA 1RYMA 1T8SA 1A04A 1Y4UA 1UIMA 2C92A 3MWYW 4JSTA 4X1KA 1RC8A 1T26A 4H1UA 3C3AA 4KNWA 4LK3A 2C1XA 1EINA 3WQQA 4R1NA 2ZITA 2VG8A 2WUWE 3O03A 1S8FA 4U63A 1ZY2A 4Z7JA 1LVUA 1WMAA 4ARVA 5FWYB 3RHFA 3WHLA 3VHQA 5EC8A 1LBQA 4MUBA 5LB2A 1AQ6A 1WF6A 2OGWA 5EVCA 4EY8A 1TEHA 3SR3A 1U3VA 3I8OA 5LDGA 3BGWA 5ARBA 3IA2A 2ETXA 1QH1A 3T5TA 5DT9A 4Q4LA 5AQEA 3VPHA 1P74A 1YNOA 4B7XA 5AJWA 3I04A 1JDSA 1H05A 4NJEB 1Z4PX 2G9VA 3EPPA 3I6QA 3IP1A 3TMAA 1H4VB 1I2DA 4ZI3A 5JAMA 3L5OA 3RADC 2W58A 3QVKA 2V1XA 1KI6B 4DV7B 3IKLA 2IODA 3HN7A 1IXKA 4H3HB 3G0GA 2AN1A 1PV2A 4JKOA 4KXXA 2HK8A 2IWRA 2PH5A 3SMQA 1WSWA 1E2LA 4MITA 4TYYA 2IHJA 1AUVA 2GB4A 4LF6B 4PCAA 5BQ3A 1GGJA 4QUGA 5CLLA 4BNLA 2Y76A 2QN7A 4IOJA 3VHLB 4GR5A 3WXMA 2YZKA 5BUQA 1GPKA 1J5XA 1KFBB 2YWBA 1LQ2A 2HA6A 4FCCA 2Y1GA 4X8OA 3G3EA 3V9PA 3ZE0B 1YQQA 1KJ8A 1NYLA 1AF7A 3RKUA 1T2VA 2WF9A 3RI3A 1E0JA 1GGHA 3AKYA 3HV2A 3KSAC 3ER8A 4G0NA 2Q3CA 1CX9B 1XDSA 1RCTE 2VDVE 2WM2A 3CLSD 3OC0A 4LNUA 4M1ZA 4UU1A 4Y0VA 1K66A 4D0NA 3C3YA 3OZRA 3Q2KA 2IV3A 1G4UR 1RQNA 5IWCA 5EEGA 5JCOA 3C4JA 4RKEA 3CVXA 4LRTB 3G85A 5BSTA 3DP9A 1U65A 2IOFK 4C1BA 1A9QA 1D0SA 1N5RA 2XGOA 3L8CA 4JBHA 2F17A 2QM0A 1OOEA 1GSHA 2VUHB 3GT3A 4Q37A 4MPPA 1RT9A 1JSLA 5KMGA 2WPDD 2A5DA 2BISA 5I7OA 1FLDA 2XWJI 5CFRA 3P9SA 1E6LA 3PFKA 3BWBA 2ET6A 8AT1A 3BSSA 3I1YA 4JI2B 1YQUA 2Z1DA 4GICA 4DR2B 1HT3A 2HF7A 5KX5B 4S1OA 2GCOB 4ZVNA 5CD9A 2RBGA 4XSHA 3RWOA 4BFLA 3D81A 3CLHA 3INNA 3P9YA 4NYJR 5K8LA 2ZRLA 3P32A 5BXYA 2EGGA 2V7WA 5KNCD 2OFWA 4HVAA 3WVNA 5SY6A 1KI8A 2VYNA 3RROA 4JGBA 5G40A 2JCSA 1BWPA 3LI2A 1DLJA 2CJXA 3ABZA 1SVLA 3L6EA 4L85A 4EG7A 3HK2A 4MTCA 3X3HA 5DW0A 3RS8A 1JDVA 2XMQA 1Y3HA 2GLTA 3VVMA 4C2TA 4GYKA 3SU8A 3K6KA 5B3LA 1UADA 4HDRA 1K8QA 1A1VA 2HT1A 1U3TA 1LJLA 4NCKA 1P0IA 5TS2A 4PC1A 1ZICA 1YB6A 1SD5A 3CUVA 4ZDKA 4NLLA 4UUNA 1HLFA 3SEAA 4DJTA 1SC3A 5E1OA 4DJFC 1NX9A 1P29A 5CVDA 3VUEA 1T3LA 1QXSA 1LZKA 4O4IB 1PYOA 3D6NB 4Q1VA 2F1JA 3SXUB 2AN4A 4IVQA 3ELUA 5EAIA 1V9CA 4JP1A 3HBLA 4EA9A 1FDWA 3W34A 1R12A 3E23A 3EFEA 3K9BA 4HTFB 4WESB 2JJMA 3ICQB 1SHUX 3GRCA 1VLZA 2DCMA 4CWAA 4FHCA 4BQSA 2F9FA 3H5VA 3W2GA 2PU7A 1XEWY 2Z2XA 4Y6PA 3P9QA 4KE6A 1VJ1A 1BS9A 1N1GA 2OHOA 2VJMA 1UC5B 2B0JA 1NV8A 3I39X 2GQ0A 3L1UA 3MF4A 4U9HS 4BU1A 2VPQA 4GMDA 1QO0D 4FC7A 4C06A 4JHXA 3MOSA 1KNQA 4U7JA 3DVLA 2XF8A 3L18A 4GBMA 2HSEA 3U7QB 1BRMA 1GXSB 4R51A 4BE9A 4E33A 4ZZ1A 1RAEA 1D6MA 1UMDA 5JI2E 2JATA 2GEDA 4KAXA 4JHLA 1X1DA 4LFCB 5B4VA 1M6VA 2JGLA 1VKRA 3LHSA 3LMKA 3QLUA 3O0DA 3CRZA 3DD5A 2JLBA 2Q4RA 4RL6A 3NNDA 1R8QA 3NNNA 2FVXA 1P61B 4JT9A 2VDUE 5AH0A 3N75A 1A7AA 5EE3A 3RR2A 4D45A 4UBIA 2YXBA 3Q87B 4D96A 2QT0A 5AW3A 2VAPA 3QYPA 5IN5A 2JJ2D 4RVDA 2W6ID 5K7SA 3DKVA 4EIWA 3BBLA 4IKOA 3DZDA 4ZDIA 5IUJC 2O20A 3A1WA 4RC9A 5LP6B 3UXMA 4MCAA 1IY1A 1DDOA 1XDGA 1VL0A 3O4IA 5JCJA 1KR5A 3REFA 2BMFA 1RYEA 1TZ2A 2GF2A 1M2OB 4LV8B 3VJKA 3SX4A 3E22B 5JRZA 3F5MA 5LD2B 1DC3A 1PFWA 3FUTA 1UZAA 5DN6A 3OCYA 4HNQA 5DCYA 1CKEA 3EZ6A 5F7JA 4BJ5A 4IDNA 2YBEA 4CMAA 2FW0A 3UV3A 5L7YA 3L05A 1K7XB 4YTEA 1K7SN 1UJ2A 2HWYA 4I6EA 5GAJA 4HSGA 4WRRA 1GTZA 5D3ZA 4DV2B 1ISGA 1QOQB 5CX4A 2D62A 1CPYA 3ENVA 3FFAA 1EDOA 4QXPA 1OGIA 4NU8X 3SYLA 3WQHA 5GVSA 2NXEA 1BEUB 3MXTA 4MYDA 5DWQA 2HWWA 4E2ZA 3OT1B 1H8EA 1RS0A 1VSUA 3CRNA 1OX5A 2WJ4A 3DT9A 4IGEA 3P4YA 4MDYA 2W48A 5EGNA 1TM4E 5FOWA 1A8SA 4XX0B 3KZ1E 1A27A 2CJWB 2PGAA 5I9BA 3DCJA 3AI7A 3I2GA 3KV1A 4Q02A 1ORDA 5EIBD 4ZK6A 3ETGA 3FX2A 3FYSA 2DQZA 3KB1A 4I1SA 4MV7A 2C4NA 1UBUS 1V16A 2P4SA 3EFBA 3O84A 5EHXA 1GA6A 4G5GA 4NAUA 5FWXB 1AKNA 3BL5A 4S2UA 4ZZIA 1YHNA 3WAGA 4ZHQF 1HE1C 3K4QA 4JL6A 1SBQA 4IMJB 3I0NA 3R77A 4K9PA 1TMYA 4FM9A 3A6EA 3OECA 2YJ5A 3DUWA 5KCMA 3SQNA 2MMCA 3G6KA 2A5JA 1AGNA 5CP8A 1QP8A 2NV0A 2O8EA 3BORA 3GRPA 5M7EA 1DKUA 4IXMA 3RW9A 4EQ6A 2OV8A 2PFGA 1ZK4A 3NVAA 1I3OA 4YLGA 3PP8A 4IWNA 3WLFA 1BMFA 4IZOA 5JRJA 3ZDAA 4YRSA 1O8BA 3TLCA 3OLZA 1PFKA 2VT6A 2NNWB 3E3MA 2KWIA 2XTMA 4HBZA 2GO7A 3IERA 4JXKA 1Z26A 3I09A 4Q34A 5LOVB 1KZGB 1PZHA 2EWVA 2W2KA 3ABOB 4IV8A 3LK6A 4I50A 4O6VA 4LE2A 5H4HA 2JIQA 3P0EA 2R8XA 1OYVA 5DN9A 3VOTA 3KLOA 4P3NA 3IUEA 1AQLA 5BQFA 1XCLA 4LC0A 4BO8A 5HM6A 4G2NA 4G4SP 4YRQA 3AILA 2ZTSA 4MVXA 4OO3A 1W4AA 3ORFA 4PXSA 3HBJA 5BVHA 5ICMA 3K09A 3WGGA 4A8JC 3P0JA 1NLMA 4OPMA 4QICA 2HNKA 4G25A 1NF2A 1ID1A 2C54A 2XADA 1N2JA 1HDGO 3EPKA 1P4HA 3LZ6A 3MJSA 3LFTA 3O90A 5FUYA 4OXKA 1ZK1A 3PICA 4J7XA 5GV7A 1GT6A 2GCGA 3PQ7A 2RGBA 4MINA 2A6PA 3ZDDA 4ZGWA 1FFCA 2AOXA 3ONFA 3THRA 3ZIUA 1ZIXA 1J2RA 3KNZA 1DEKA 3RS3A 4TMTA 1LGYA 4ANFA 2W2OA 1XV5A 1HKHA 3JPWA 4PO9A 4UBNA 4BTEA 2AJDA 1KIFA 2QVBA 5IAGA 1R27A 5KQMA 1L5YA 1NOKA 2DFDA 2NIPA 4XIJA 4FFOA 3V80A 4WCFC 3L4BC 4ZOLB 1RRCA 1UDXA 2GTHA 4KIFA 3ZW7A 2NVUB 1NUPA 5BP7A 1I5EA 1MV5A