1PWZA

Crystal structure of the haloalcohol dehalogenase hhec complexed with (r)-styrene oxide and chloride
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
252
structure length
252
Chain Sequence
b'STAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERWPGMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords halohydrin dehalogenase
publication title Structure and Mechanism of a Bacterial Haloalcohol Dehalogenase: a new variation of the short-chain dehydrogenase/reductase fold without an NAD(P)H binding site
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Lyase
total genus 89
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1pwzA00
2GNAA 4K28A 3GQVA 1U3VA 1Y9AA 1KEWA 1LUAA 3FBTA 2QRKA 5IDYA 1VM6A 3HHPA 1TEHA 5IJZA 1PL8A 2EGHA 3L6DA 1W73A 3QW2A 3VDQA 1AE1A 1O9BA 4IGEA 4ALKA 4CM8A 4S3MA 3FRJA 3VH3A 3D5TA 2W2KB 5B37A 1ZSVA 4JP2A 4FC6A 4Z3DA 9LDTA 4CV0A 3GR6A 4BMNA 1B8PA 3K92A 3WLEA 3DZKA 3GGGA 4HV4A 3IC5A 4DMLA 3EVTA 1BXGA 2BH9A 4WOJA 1IPFA 2X9NA 4N5NA 2HMUA 4OHUA 5L4NA 4IGFA 4RPKA 2GN9A 3GMDA 1KVTA 2HJSA 1RKXA 4W7IA 4IM7A 1BHSA 1D1SA 2BGKA 1QYDA 3I9LA 3KSUA 3H7AA 1QYVA 1E3JA 1J5PA 1UDCA 2AA3A 4Y6SA 3AUSA 1W8DA 1CIVA 1DAPA 2DT5A 4YJGA 4IY1A 3QVXA 4Z6KA 3CMCO 1N2SA 3OJEA 4YVFA 4BKRA 2Q50A 3KYBA 4BO9A 1KVRA 1A72A 1UP7A 4CR8A 3P7MA 1T26A 3INRA 4R9RA 4CR6A 2CZCA 3SLKA 5TJ9A 1N9GA 1GZ6A 4O6VA 4DLBA 1H6BA 4CUZA 3U62A 1XU9A 1E0DA 3SVTA 3OIFA 4GX0A 2NVUB 1U5CA 4E6PA 3O26A 4CR7A 5MGBA 3JCZA 1NR1A 2P2SA 2J3HA 1ZSNA 1EFKA 2VOEA 1PQUA 3JD0A 4RVUA 5HWSA 5DDIP 3JQBC 4RV9A 1TT7A 4YRDA 4UAGA 4J9UE 2C7VA 3H3JA 1ZH8A 2YQ4A 1BWSA 3E5MA 3RUFA 3DTYA 1OAAA 3JQFC 1M6HA 4J1QA 5JY1A 4RDIA 2WWRA 3WICA 1WVGA 3JYNA 1Y5MA 5T8KA 1SCUA 4K1LA 1E1KA 2X4GA 2ZCVA 2EXXA 1M6WA 1G6KA 1UP4A 2YV3A 2AXQA 2VUTA 1EQUA 1P1HA 1P33A 4K9DA 3GGOA 1E3EA 4CQMD 3I9NA 2YUTA 5JYDA 2HUNA 1IZ9A 1YO6A 5A9RA 1J4AA 1A7AA 1B3RA 4MOWA 3FSRA 3I4CA 1AN9A 5C3MA 4DC0A 2YHIB 4IDCA 4D44A 3HADA 2V6GA 3G17A 2FN7A 2DTEA 3GA0A 3GK3A 3JQDA 3Q3CA 2NUAA 1FK8A 3ZI0A 4G2NA 1X1EA 4BNFA 1FDVA 4NFSA 3ZWXA 4KTTE 3Q9NA 2FMUA 2V6MA 2FSSA 1Q0QA 1PJSA 2D8AA 1Y8RB 4EGFA 5JC8A 1P0FA 2I3GA 5DNAA 3PXXA 4M8SA 5G0WA 4ZQBA 3VPGA 2OO5A 3S2IA 1UXGA 2G76A 2IZZA 4AL4A 1PTJA 1C0LA 4IDFA 4BKOA 1X1TA 4EJ6A 2PFGA 1H6CA 1AUPA 1P0CA 1R4NA 2NU7A 2R00C 4W7HA 1Q0LA 1BGVA 2IDZA 3GNQA 1I0ZA 4R54A 1DC5A 3NTOA 4NQZA 4XGKA 3HFSA 3ZU4A 5L51A 5HA5A 1HSOA 2PGLA 1PZFA 4IDAA 2RCYA 1HXHA 3KYDB 3AUUA 3C1AA 3RI3A 4XRGA 4FJ0A 4KMSA 5COQA 3K30A 3CXRA 5KNLA 2W98A 1PJ3A 4EUEA 5I9MA 1ONPA 1HYHA 2YZ7A 5DULA 3DBHA 3OFSA 1X13A 3DWFA 4E2XA 3QWBA 1DAOA 1MGOA 3ZDFA 4IDBA 2B37A 3VOSA 1SEVA 4CLOB 4RCVA 3V5NA 1JWBB 3B1KA 2DPGA 1YVEI 1LQTA 1IHXA 1MG5A 2D59A 3N7UA 3RVDA 3RUIA 1X0VA 3DZFA 2E37A 4XR4A 2WD7A 4NBRA 4BNWA 3OETA 1R16A 4ZJUA 4IQ0A 3DXFA 3BHIA 2FZWA 3QIVA 2D3TA 3RSHA 1S6YA 1HDOA 3JV7A 1BDBA 1XYGA 2D4AA 2Q1WA 4OXKA 4RF4A 3FNGA 4D79A 5JBIA 3DONA 3P2OA 4YCAA 3GAZA 4JLWA 1JDJA 3NDIA 4LCEA 5A06A 2JAPA 4BNLA 2CUKA 3AFMA 4BNVA 2E4AA 1HZJA 1BXKA 2P9EA 2Q2QA 3QLJA 4Z3KA 3K6JA 1ID1A 3DZGA 1DEHA 1ZFNA 4PIVA 1B8UA 4KDFA 1YKFA 1LSJA 3OH8A 1ZMOA 4QECA 5I7SA 5IZCC 1HDZA 1T2EA 1ZXLA 4NK5A 1E3WA 1EUDA 1CETA 1NR7A 3IL2A 2AEJA 1R37A 4J4BA 2C2XA 3NT4A 1KVQA 3GZNB 4DGSA 1NQTA 4CLRB 1WP4A 1HDYA 3HUDA 4WPGA 4IIUA 1DIHA 1RM5A 3IUPA 2P9GA 3FPCA 4E30A 1OZAA 1YB5A 1DRWA 4WLVA 5JE8A 3EK2A 3F6YA 4JJGA 4R41A 5A9SB 4WNIA 4YRAA 1FXSA 1R15A 3PDJA 1NQ5A 2X9GA 3FNHA 4LN1A 2G1UA 3PHLA 3UN1A 1VSUA 5EN4A 4NMHA 2DBVO 5HM8A 2JFFA 3LF2A 4L4XA 3I83A 1QYCA 2OP1A 1I10A 1TI7A 3KM0A 2B4TO 5IDWA 5JDCA 4QUKA 4W82A 1YL6A 2JD0A 1ADBA 1R4MB 1LDGA 4YQYA 4RGBA 4P4NA 1LDYA 2X0IA 2P5UA 2QRJA 1B14A 3LC1O 4OM8A 2Q99A 3ROMA 2PGDA 3GZ4A 1KC1A 1WAMA 3GVCA 2WE8A 4IDEA 3AI1A 3STHA 5LDHA 4L4RA 1QYWA 2H5LA 1K3TA 4FS3A 1HSZA 3F46A 3PLNA 4N18A 3ZHYA 3PHIA 4DBZA 1J0XO 4MIEA 4B7CA 3DR3A 4CLDA 4BB5A 2IODA 1NHGA 3V8BA 4BVAA 2DUUA 1HLDA 1MV8A 1NWCA 3PI7A 3KTDA 1A4IA 3B20A 4CUKA 4E33A 3LLSA 3BYZA 2WM3A 3A14A 3W4KA 3OQ1A 3D3WB 1YB4A 1ZVMA 1YONA 2X0JA 1GDHA 4G65A 3PWZA 1ZK1A 5FWNA 1EFLA 4NBWA 4RJTA 4RO0A 1BG6A 3WMXA 4DA9A 3I5MA 2C54A 4YR9A 4LSWA 4QT0A 1J49A 1K89A 3BMQA 7ADHA 1V35A 1XG5A 4QO7A 4CL8A 1E1MA 4G5HA 5A04A 2RBEA 4RLSA 1ZJYA 4KQWA 1VL8A 1A9YA 1F17A 2WJPA 1GQ2A 3OA0A 2XPCA 5TQVA 2GN6A 3R0IA 3DBRA 3U49A 3L4SO 4PN3A 2VZ8A 2UYYA 1NFQA 2BGLA 3QHAA 5IN5A 1XSEA 3ZWYA 3OEYA 4YJFB 1UXJA 2JAHA 4Q3NA 4CQMB 2GASA 3M6IA 3PEFA 1EVZA 1T1SA 5KVSA 3G79A 3ADOA 4B3JA 2X7HA 1MXFA 4WOKA 3GVHA 4BO8A 3N74A 1E3SA 1HDGO 2B83A 1P1FA 4NR0A 2GGSA 1KEVA 4C7KA 2BGMA 4J6FA 3KSDO 3EZYA 2C20A 4A7PA 2IXBA 1YL7A 5BT9A 2VUUA 5DBFA 4J7XA 2VOJA 4CM5A 3UKOA 3MZ0A 3MTGA 4PZEA 4XYEA 3KVOA 2EGGA 3ZH2A 1OFGA 4XQ9A 3D64A 4J0FA 3UW3A 1O89A 3VAZA 3D0OA 4I5DA 1HE3A 4KZPA 3TSCA 1IULA 5ADHA 4QFCA 5JPIA 1C1DB 4UVEA 1HF3A 2CVQA 3D3EA 4R1SA 3UUWA 1LU9A 1PJQA 5F1OA 1B15A 2EEZA 2GUGA 2YQ5A 2C5AA 3MJEA 3WGZA 3L07A 1I36A 2PH5A 3IS3A 4WCFC 4RPJA 1ZKMA 4XIYA 5EERA 5IXYA 1H6DA 3MWDB 2CSUA 1U4OA 3PYMA 5DF1A 5THKA 4CQLB 5L9AA 3EDMA 4CLHA 4CV1A 1KOLA 4L76A 1I3NA 3BMOB 2NSDA 3ETGA 4FGSA 4F46A 2PKRA 5TF4A 4W4TA 1IE3A 4UEOA 4Q9NA 3E9NA 4CM3A 5JMWA 3WGHA 4Y9DA 1P3DA 1LXCA 4U6QA 4BO5A 3PZBA 2XXJA 4NNJA 3EUWA 3D1LA 4EUHA 3DOJA 2JCXA 3JQAB 4MKXA 4R9SA 3S2EA 4D0SA 2EP7A 4I08A 3DB2A 5CAEA 1YBAA 4FW8A 3UICA 3L77A 3GFBA 4C4OA 3JQ7A 4OQZA 2DKNA 3A4VA 4OMUA 4PVCA 3UOGA 4XB1A 1YL5A 4D42A 3M2PA 3HWRA 3X2EA 2G5CA 1FMCA 2JHFA 2Y1OA 4WE3A 1K2WA 4BNJA 2VRBA 3AOEC 1UAGA 2BHLA 2NQ8A 3EAGA 3ZW8A 4LSMA 3LT1A 1GZ4A 2HDHA 3PYXA 1NPTO 3NX4A 4HX5A 3WIEA 3GHHA 2C29D 3KYCA 3H6KA 2YV2A 4MPDA 4CMBA 4NPCA 3O8QA 4BGEA 3TF5A 3FNEA 1VJ1A 4CM1A 4PRKA 2GCGA 4JBHA 2X5OA 3HE3A 3TDKA 4BKQA 2WD8A 1HETA 4MVJI 3KOUA 1ARZA 3CKYA 5GZ1A 3ABIA 2RH8A 3BTSA 1Q1NA 2B35A 4J2HA 1PU2A 3E1KA 2X0RA 2HRZA 4GX5A 1CF2O 3ZHZA 4AJNA 2WE7A 4M54A 3MJCA 1ZEMA 4I9NA 2IXAA 5MDHA 4J4TA 1NAHA 1N8KA 1ZMTA 3T4EA 5L3ZA 1E1NA 1UUFA 3WGOA 5A03A 3JQCA 5KTKA 4DWVA 3AY7A 4ND1A 4CV3A 2C82A 1B26A 1YJ8A 4JX8A 4R51A 3C7DB 3VPSA 2AE1A 3ZWCA 3H9GA 5F3RA 4UUPA 4ITUA 4YRBA 4D7AA 3VZSA 3L4BA 5A9TA 4R3WA 2BFOA 2PZMA 4NBUA 3WTBA 4D3FA 3RKRA 1PGNA 1ULSA 1EUZA 4GMFA 3WGYA 1N5DA 2ZJ1A 2UUPA 1YOVA 3GG2A 3WQQA 5LDGA 3V2UA 3KUXA 4IS2A 4GKBA 2Y66A 3LQFA 4BGVA 1LTHR 2X5KO 3N58A 1OI7A 1I2ZA 3VVCA 6LDHA 1LLQA 4AICA 1V3VA 1PR3A 2XXBA 2YW9A 1Z7EA 5COBA 4CMEC 3WGTA 2R2GA 5EMHA 5DBGA 5KJ1A 1PJ4A 1ZK4A 2W90A 2VUSA 1YH3A 4TMFA 5I9NA 5FI5A 3S2GA 1JLLA 4WCFB 1WMAA 1WLYA 1XWFA 1KIFA 2Y93A 3MOGA 5JXWA 2BFAA 1XDWA 3SC4A 2VHVA 1A7KA 3LYLA 3ZHBA 4H15A 3OA2A 4QEDA 5L53A 2PLAA 2RAFA 2EW2A 2O7SA 3BMNB 4A2CA 1VL6A 2HMWA 4U8GA 4C7JA 3WGQA 1PX0A 1O8CA 4MJLA 3JQ9A 1MC4A 5IDXA 3ST7A 1LNQA 5CDSA 1NFRA 2IEDA 4W6ZA 1C0KA 4IJWA 2AHRA 1DJQA 5T5QA 4E5NA 2YJZA 3PQFA 2VHWA 2HK7A 3JQGA 4WJZA 5DOZA 4CM9D 8LDHA 4FFLA 1UZMA 2PZKA 4ZN6A 3U5TA 4XQGA 4DVJA 4XZ3A 2IZ0A 4MO2A 4AFNA 3OIGA 1PGJA 4XDYA 3JQBA 1NWHA 2P5YA 4UREA 3ULKA 3GVPA 3VKUA 5HS4A 2FWMX 4HFRA 4NG5A 4G81A 3E6AA 4BUCA 4HKTA 3C3XA 1U8XX 1I3MA 3HDJA 4OXNA 1LRLA 4DQVA 2CNBA 3CSDA 1SMKA 4ZRMA 2HJRA 3VPXA 3BMCA 4XKJA 1GQYA 4GGPA 2BELA 4B4WA 2EW8A 3KB6A 2X6TA 4EJMA 5IDQA 1YGYA 4RVHA 4ALJA 3E8XA 2FOIA 4GSLA 4RVGA 5G2OA 3SBOA 2BI7A 3A28A 3WMWA 2B36A 1Y5RA 1CERA 2GD1O 2HCTA 3GPIA 4F3YA 2J5RA 1AHHA 4NU5A 2NQTA 2LDBA 4PLZA 2VZ0A 4JK3A 1ZUD1 3RC9A 3Q1LA 1KEUA 1ISGA 5TC4A 3RIHA 3PJEA 3PWKA 1DRUA 4AJJA 2RH4A 2GR9A 5KOIA 1BW9B 4FIZA 3W4JA 3GF4A 4J1SA 3NRCA 2I5PO 5EJ2A 1H93A 4UVHA 4L75A 2VTDA 4D3DA 1G1AA 1R6DA 1D4FA 2EIHA 1QMGA 3R3SA 4PVDA 4BOYA 4IQGA 3T7EA 5I7EA 3NTRA 5JO0A 3U09A 3RU9A 3PGXA 1QP8A 2ZB4A 1E5QA 1RJWA 5FYDA 4ZHSA 4BHTA 2QZZA 5TT1A 1SZJG 3LC2O 4F45A 1PWZA 3GG9A 1LA2A 4WLEA 4A03A 2Y0EA 4ALIA 4OOEA 5G0TA 1GADO 4YT4A 2H63A 4JXKA 1EVJA 5KVQA 4BO0A 4LRSB 3BXXA 1KY4A 2VHYA 4JQCA 2YDXA 1PJLA 2BF7A 3WLFA 4U6SA 1M76A 3S8MA 1B2LA 3IQDB 3VHRA 1NVMB 2IZ1A 2UVDA 4I1IA 3FR7A 1UXHA 4JP3A 3BZUA 1G0NA 3WQSB 3UVEA 2F1KA 5IFLA 2VYVD 4II3A 3E82A 2PA3A 1HDRA 2OMEA 1GCUA 1HYGA 2EP5A 4OAQA 5IF3A 4IMRA 2GZ2A 4KQXA 4XDZA 5F21A 3ROQA 1C1XA 4JJFA 4A27A 1SOWA 5ENVA 1E3IA 2CY0A 1OBFO 3H2SA 2O3QA 1MC5A 3TN7A 4FFMA 4GL4A 2VRCD 1TLTA 1Q7CA 4K6FA 1E3LA 2NADA 3ADPA 5L7WA 1LX6A 2HLPA 4EI2A 1I01A 3I6QA 5K0ZA 1VJTA 1N7HA 3W8EA 4YT8A 1TB4A 1HT0A 4YXFA 5TRTA 4AJPA 2VTEA 3ONEA 3H8VA 5IZCA 1ADCA 3TL2A 2VQ3A 4E13A 5KJCA 1O0SA 4PZCA 2X1HA 3FF4A 3WJAA 3K5PA 3C1OA 4DLAA 2SCUA 3IDSA 3QSGA 3DQPA 3TZ6A 1RPNA 2W2LD 3O9ZA 3IOYA 3PJGA 2TMDA 3NJ8A 4TVOA 4BO4A 3G49A 1N92A 1HLPA 3U4IA 1YE3A 3BAZA 1JU9A 4F6LA 1TA4A 5C5IA 1L7EA 2J5QA 2JCYA 4GWGA 3GN2A 1RYDA 5AXAA 2PD6A 3OF2A 2ZYDA 2DTDA 3ENKA 5A4DA 2AG8A 3OECA 1XQ1A 4WLNA 5K6AA 4R69A 1B7GO 4CMIA 4I5EA 4O1MA 5J23A 2O50A 3KV3O 3I1JA 3ROPA 2JJYA 2HRBA 4J9VA 1Y8QA 1DIRA 1U9JA 3I4FA 2WYVA 5JY6A 2C07A 1PQPA 5TT0A 2V6FA 1DC4A 4NIMA 1UR5A 4E2ZA 2V65A 4Z9YA 1DIGA 4PCVA 1U8FO 1DC3A 2Y0DA 1PS8A 3DZIA 3PVZA 3IKVA 4NBVA 1HDXA 2UDPA 1SO8A 1R0KA 1GU7A 1WXDA 3IJPA 4MVJF 4GX2A 3OJFA 3L6EA 1DIBA 3Q2KA 3U4DA 4ZRNA 4DPKA 5CDYA 2C2YA 4LMPA 3CINA 4BV9A 4JBGA 4YYZA 1L1FA 4J2OA 5EQDA 1QR6A 2DM6A 3GRPA 5JC1A 4L0QA 5G0UA 1A5ZA 1EK5A 2QRLA 4QX6A 4A73A 4NJMA 1K0UA 2X58A 2HQ1A 2ZCUA 2J3IA 4MVJP 4NK4A 2NTVA 3NGLA 4ESOA 1PL6A 3IMFA 1ZBQA 3FI9A 3AI3A 5KWEA 2FSVA 3NEPX 1C3VA 3D4OA 5C7LO 3NUGA 1DRVA 2IEBA 1MXHA 2F00A 1Z82A 4RORA 4OKNA 4PG7A 1DFHA 1Y1PA 4RF3A 4RVDA 4BO1A 1DHTA 4E32A 1E7QA 3R6DA 1F14A 5FEUA 2ZYAA 2VHZA 1N7GA 1YS4A 3H9UA 4HFMA 1H94A 5BNFA 3HZZA 2AE2A 3CE6A 4MVJH 4TZTA 1M2WA 3VKVA 2O7QA 5IN4A 3JQEA 4IDGA 2NTJA 3AY3A 3H5NA 1H5QA 3KXDA 3MJTA 3LC7O 1BMDA 2PTGA 1ZK3A 3WFIA 5T57A 2D1YA 2I67A 1N1GA 1K5HA 3UCFA 2Y0CA 3NAQA 3OP4A 4AJKA 4H16A 3ZCXA 3GOHA 4O5OA 1CQIA 3S2FA 3JD4A 5G4KA 2GPTA 3JQAD 3FHLA 4FOOA 4MVJE 3V1TC 1AXEA 2DBQA 2IYOA 3LT0A 1KY5A 1E92A 3EZLA 3HN2A 2J3JA 4DXHA 2WTBA 4Z9FA 4OSOA 3OSUA 1GEEA 3IAHA 1F8FA 1QV7A 2GSDA 4FFPA 4YAEA 3H65A 2A94A 4LW8A 1EQ2A 5AXBA 5F5NA 3GFGA 4YT2A 1I5RA 1HDCA 4ZQFA 3H2ZA 1YQXA 5CDTA 3WSWA 3U9LA 4OOFA 5EINA 1NPDA 4YAJA 4R68A 3WBFA 5IG2A 3W8FA 3PFWO 4BB6A 1U28A 3I9JA 2Z95A 4B3HA 2VWHA 3DL2A 2GN4A 2EERA 4JIGA 1T4DA 4WUVA 5THQA 1DBVO 5JDIA 1YQDA 3JD3A 4PG6A 3TJRA 3RASA 2AEMA 1VPDA 2ZB8A 4CM4A 4JN6B 3WYEA 1PZGA 4MKZA 3RC1A 2HSDA 2EJWA 4TKMA 5T8KC 3DMTC 4R5MA 1ZXBA 1EBFA 3L0DA 4OXYA 4FPXA 2VZ9A 4GVLA 1LLDA 4PG8A 3ON5A 1X7DA 3C7AA 1R66A 5U9CA 4IXTA 4PLHA 4XX0A 2PGJA 1ZO8A 4HXYA 2Y99A 4CODB 1X7GA 2ET6A 1H6AA 1IUKA 4FCCA 3ZWMA 4IIVA 5DCYA 1GYQA 4FFOA 1PJTA 1LDNA 1QSGA 3IP3A 5TGDA 1TT5A 3VPFA 4HUJA 4TSKA 3ZW9A 3H9QA 4AJLA 4ZICA 5BSHA 3H9JA 4KWIA 3QP9A 4YJHA 2OBYA 4XYLA 4M87A 4NDNE 3HQ4O 4FQ8A 1MLDA 5TSDA 3CUKA 2Y1GA 3FNFA 1WWKA 1H9BA 1F8GA 3SC6A 1DXYA 3ZWVA 5K9ZA 1PS0A 2ZTUA 3PLRA 4GQAA 1WZEA 1DJNA 2ZTLA 2V6BA 3AK4A 4DUPA 7MDHA 5HRUA 3UAGA 1WPQA 4Z0PA 3FTNA 2QQ5A 3PZRA 2AG5A 4QSMA 2AQHA 3UXYA 3DAPA 4PGFA 5JSFA 2UAGA 3I9OA 2NNLD 4OH1A 3A06A 1GY8A 2WSBA 3DDNA 3NDRA 4D0RA 1V0JA 4U5QA 4OKIA 4GH5A 4MVJG 4ND3A 3KZVA 2PK3A 3KRTA 2I9PA 4R1UA 2Z5LA 1DFIA 3P5SA 4O0LA 1NNUA 3JQ8A 4U0JA 3PHGA 3DBLA 3RWBA 4OSPA 1JKFA 1XEAA 4OGWA 3WFJA 4XR9A 1E6EA 1I2CA 2DVMA 3PQEA 4IPTA 4YA6A 5G4LA 4CM8B 4PZDA 5JMPA 3WYBA 2FPPA 1VL0A 2GDZA 1MP0A 4BNMA 4FB5A 3R1IA 3K8ZA 1NTOA 2A92A 1VKNA 2J3KA 2DPHA 2DU8A 4UUMA 1MFPA 3V1UA 4RPGA 1RYEA 4CMHA 3CTMA 2RIRA 4J7CA 3RCBA 3HJAA 3LF1A 1IPEA 3GUCA 5H82A 1BXGB 4A10A 5CG1A 5JCJD 1E7RA 1ISHA 1R0LA 1DIAA 2W2KA 5DN9A 3AM5A 4AJOA 3EGOA 4B7UA 2ZQZA 2A35A 5ES3A 2IYPA 2HMVA 3WNQA 2YFQA 1YJQA 3C85A 4UVGA 3PHHA 1KEPA 4XQEA 2CF5A 3ROKA 3ZNOA 3WQRA 4NFYA 2Q4BA 3I52A 5KKAA 2Q1TA 5GZ6A 3SJ7A 1U2GA 3F4LA 4E12A 2PD3A 2BLLA 4YJGB 1A27A 4M1QA 1SB9A 4MINA 1DOHA 4B7XA 5A3JA 3DBVO 1MA0A 5BSEA 3H3FA 4II2A 3I3OA 1M66A 2PR2A 1GFSA 3C24A 2VNAA 3W1VA 1N9GB 1NP3A 2VCYA 1U3TA 4DC1A 4DIOA 2DFDA 4W9NA 4CMEA 3AW9A 5TJHA 3GEGA 2DFVA 3PGJA 1Q0HA 5JLAA 4ALMA 2AQ8A 5A05A 2Q1SA 1IY8A 5CFZA 4QXMA 4I9UA 4TVBA 5F5LA 1KETA 1IL0A 3NGXA 2JKVA 2VWGA 4UVDA 3OJLA 2NVBA 2OGUA 2VNSA 2Q1UA 4IINA 3VDRA 3BTUA 3EMKA 1E6UA 3LK7A 1LDMA 2NVUA 3BTOA 4RDHA 1O94A 4BIIA 2O3TA 1BDMA 4XGIA 5JDCC 4RF5A 4J1NA 4J43A 4P8RA 4BO6A 4GVXA 1MUUA 3A1NA 3G3EA 2OZPA 1HRDA 5JYEA 4DREA 1SNYA 5BQFA 1E7SA 3WJ7A 3AUTA 1HEUA 1P9LA 4MVJD 2X0NA 1DO8A 4Q3EA 1WDMA 1K6JA 5DP1A 3K2BA 2CDBA 3D4PA 1UJMA 4HP8A 4IXWA 4NZ9A 4O59O 3TNLA 3ZV4A 2HK8A 1B0AA 3GDGA 4FGWA 1J6UA 1GQQA 3ZNQA 4DTIA 4FC7A 4P4GA 4XYMA 1SC6A 3TFOA 1OOEA 1T24A 4WNCA 3HN7A 3IP1A 1EMDA 1JQBA 2HKIA 3Q6IA 3FWNA 1F0YA 2JFHA 3QWAA 2Y1FA 5ENDA 4BNGA 3JTMA 4DYVA 1P31A 3JD1A 5F1PA 2NACA 4J7UA 1XCBA 3ANMA 2B5VA 2TMGA 1WDLA 4WK6A 1H0KA 2YHIA 4EDFA 1NVTA 3UCXA 2GN8A 3W6ZA 3OQBA 1Z45A 1VKOA 1T2CA 1JAYA 4RVFA 2EHDA 2P68A 1R4NB 5A1TA 4J90A 5JFOA 4CV2A 1RM4A 1ORRA 4EJ0A 4GWKA 4ZQGA 3F3SA 4N54A 1Y8RA 2FR1A 3QE3A 4OJNA 1TVEA 2CFCA 2IE0A 3GDFA 5T67A 4YDRA 2PNFA 4Q3AA 5CHEA 3GC6A 1GL3A 5IAAA 4AJEA 4BV8A 3DFZA 3WG9A 2BI8A 1GYPA 4K26A 3GAFA 4NI5A 4YT5A 1GZ3A 2BRUA 3ZU3A 3DBHB 4IBOA 1ZK0A 3F5SA 4CM9A 3PK0A 1LC0A 1LSOA 1KYQA 1T1RA 3L6OO 1EK6A 5I8ZA 3Q11A 2NM0A 4RF2A 3HDQA 3KYDA 1LDEA 1JTVA 3E48A 3GMSA 5TNXA 3RC2A 1LSUA 3RUHA 5B4UA 1GAEO 4LMRA 4Q3CA 2WD7B 2QHXA 4MP3A 4FD3A 2PD4A 5ITVA 2OFPA 4IS3A 3C8MA 3RFVA 2WEKA 4CLOA 2DUWA 2AW5A 5JW6A 3AFNA 4YAKA 2Q49A 3ASVA 3B1FA 4IMPA 3ZWAA 3EVNA 2FR8A 2ZQYA 4IDDA 5DCWA 4R1TA 2R6JA 2OP0A 3WNVA 3EC7A 4I5FA 1EE2A 3TPCA 4L8VA 4EUFA 3VH2A 2E6UX 4ONEA 4JGBA 1UDAA 5F1KA 5GMOA 1BTOA 3LZ6A 4OO3A 3F5QA 3G1UA 3OJOA 3RROA 4MP8A 3ONFA 1E3WB 3F4BA 2ZATA 4TRMA 2ZTMA 1HZZA 1LDBA 1UXIA 3H5RA 5U4QA 5A5FA 3O03A 1O95A 4HBGA 3TZKA 3DAGA 3M1LA 5IZ4A 3ZN2A 3ICCA 3K73O 4K6CA 2OHXA 4FN4A 1VI2A 4TWRA 3DZBA 3FR8A 4PLFA 3ETDA 5DP2A 3UH1A 4XYBA 3U4HA 4E2WA 1CJCA 2CDAA 1EZ4A 2VYND 3GZNA 1U3WA 2AEFA 3AWDA 5B4TA 4CLRA 3NJ4A 3RU7A 3W4IA 1GCOA 1Q2XA 2JCVA 1YBMA 1IOLA 4YPOA 3FBGA 3JSAA 5A9SA 1BXZA 2G0TA 3JD2A 4D43A 3QWHA 3AY6A 3VZQA 5A5EA 5AYVA 3PRJA 3KO8A 5DBIA 3BA1A 1D7OA 4PRLA 3DAFA 3JQFA 3WB9A 1Z73A 1X0XA 3MJVA 4D41A 1GPJA 1R4MA 2XOXA 3GN1A 4QFDA 1NYTA 5EL0A 4BO7A 4BQPA 1EBUA 2Q3EA 3L9WA 3BIOA 3NTQA 5EIOA 4BMSA 2VYVA 5HS6A 2AMFA 1I30A 1M75A 3OICA 3S1LA 4XJSA 4DQUA 1C0IA 4NU6A 4OYRA 4BO2A 1KVSA 4ZU3A 3C1TA 4E21A 4NBTA 4M49A 4MDHA 3ZGYA 1WNTA 4P22A 1PR9A 1VLLA 5ER6A 5CEJA 3EYWA 2GYYA 1PJCA 2DBRA 4FFRA 1P1JA 5CPBA 1U1IA 1E7MA 4BGUA 4GGOA 4DL9A 3CIFA 2OUIA 5I9LA 3WGIA 2IRWA 3TL3A 3GH3A 3LT2A 4LK3A 1V6AA 3D4NA 4WCDA 1DLIA 5CG2A 2O23A 2O3SA 4KUEA 1NVGA 5U1PA 1OC2A 3D3WA 2PKQP 1LBEA 4Q39A 3BMQB 1YQGA 5A3VA 3E9QA 3VH4A 4Z0HO 1ENZA 1XQ6A 2FRDA 5EPOA 3V2GA 3NV9A 3VTZA 1F12A 1JA9A 3CH6A 3DBRB 1BSVA 3UCEA 1AXGA 2Y67A 2R00A 5B4VA 3B1JA 5JO9A 1GV0A 1FDTA 1ADFA 3ZWWA 1U7TA 3ITDA 2Q46A 3F1LA 4M89A 1C14A 4L9RA 4FJ1A 4PLPA 5CEFA 2BFMA 2QYSA 4GBJA 5C37A 1ENYA 3SXPA 3OHSX 4Y67A 4E3ZA 1P44A 1HYEA 2VHXA 1NFFA 4F6CA 1DC6A 3CPSA 3GT0A 4M55A 1FDWA 4YJFA 4HWKA 4CQMA 3L4BC 4YEDA 3RUAA 3AI2A 2UUOA 1KS9A 1ONOA 2BMAA 3LLVA 3ETEA 1XHLA 1P1KA 3WSVA 1RM3A 3JQ6A 4X54A 1E7WA 4TRRA 3KETA 1XA0A 1Q7BA 3ANLA 4LISA 5EQFA 1NHWA 4Y8VA 3PJFA 2YHUA 1PZEA 4BGIA 2ILTA 2Y05A 3OBBA 3E5RA 3E9MA 5BNIA 4CUJA 5KCZA 3H5AA 4YAIA 2D5CA 3COSA 1LSSA 2X23A 4Y6PA 3U4CA 4ND5A 2BFPA 3SLGA 4BNTA 1FF9A 1EUCA 3FTPA 1E1LA 4DIBA 2AQKA 5TLSA 1E7YA 2CMDA 1D1TA 1HL3A 4YQZA 1WDKA 3WOHA 4RPHA 2O48X 3LU1A 3DMYA 3ZNPA 1I32A 1C1DA 3TZCA 1I2BA 2GO1A 3WR5A 1NXQA 4R16A 2X22A 1JVBA 2ZB7A 2NU8A 1IHYA 3PWSA 1E5LA 3QQPA 3ZWOA 3GDOA 2HU2A 4CQLA 1B16A 1W6UA 1UZLA 1KVUA 3JQ9C 4E2YA 1LRJA 4KWHA 3AOGA 3ENNA 3IJRA 3INTA 4AJ2A 1V3UA 2Q4EA 4DLLA 1NPYA 1AHIA 3BMOA 4J91A 2CVZA 1GEGA 1DB3A 5KVVA 4OIMA 3C7CB 4ZA2A 1QKIA 1Z7BA 4HNHA 4UUOA 3D5QA 2HAEA 4LVCA 4FFNA 3QWIA 3JQ7B 3PIDA 1VE9A 4L74A 4CLXA 3RJ9A 2GF2A 4Y6RA 5C7IO 1A4UA 1MB4A 3EW7A 1BVUA 5EESA 2GERA 4ID9A 1MFZA 4YJDA 3JQAA 4UULA 3RBVA 4D3SA 1PL7A 3F9IA 3S55A 3DMTA 2RHCA 1M67A 1A71A 3WTCA 1UXKA 2FHSA 2Q2WA 2NLOA 3INGA 3AM3A 4ZVVA 4XA8A 3NYWA 4RQUA 3LDHA 3GHYA 3NDJA 2NU9A 3EY4A 4D46A 4DMMA 3QA9A 1PS9A 1BRMA 2HO5A 4CL3A 1Y81A 2VT3A 3KYCB 5COAA 2DAPA 2WDZA 1GTMA 1ZZEA 4AJ1A 4J49A 3O8QB 1DFGA 4JCOA 4NHEA 3PJDA 3QVOA 2NTNA 3FN4A 5JAMA 3O4RA 3JYPA 3HG7A 2E82A 4WLFA 5GZ3A 4B79A 3OQ6A 3UF0A 4FJ2A 4E5PA 3K9QO 2YY7A 2Q2VA 2X86A 3ASUA 2EG9A 1Q7GA 1SEPA 5BSGA 3WX0A 1LLCA 3KLPX 6ADHA 1R0SA 1YDEA 4P4LA 3HB5X 4GMGA 4IZHA 3T7CA 4Q3BA 1QRRA 1KBZA 4R01A 4XGNA 1SAYA 1SB8A 2NVWA 5H83A 4ALNA 2YYYA 2P4HX 4NFHA 4URFA 2I3AA 4H7PA 2B0JA 1EVIA 3ZU5A 5G0VA 4GLLA 1GUZA 1Y6JA 1Z6ZA 3GPDG 4PLTA 4WKGA 1CYDA 5LCXA 5BNTA 1LLUA 4YB8A 2XF8A 4TQGA 1YOVB 3GEMA 3DTTA 3KBOA 5L45A 4GPD1 2QG4A 3LT4A 4FOSA 4HFJA 3DZJA 4ND2A 3TWOA 4PG4A 1HE5A 3QVWA 4ZD6A 1ZW1A 2J8ZA 1QG6A 4RL6A 4E5KA 2HMTA 3QWFA 4AJ4A 1Y7TA 3GNSA 2O2YA 2EV9A 1B3BA 1CEQA 2Y1DA 4YTEA 3WS7A 5KIAA 3BHMA 1YB1A 1P1IA 3AUAA 3MTJA 2D2IA 1NAIA 3DOOA 1GPDG 5KJEA 3WWYA 3FCOA 3MCVA 3WYCA 2NV6A 5T64A 4BKPA 3DEYX 2O4UX 4XIJA 3SX2A 2O2SA 3QJ5A 4YWJA 1PQWA 1QORA 4CMKA 4WCFA 3I23A 4HNGA 3TOZA 4E31A 3HDHA 2Y1CA 4BS9A 2OORA 1P1RA 3JYOA 1ADGA 4BNXA 1R12A 4GKVA 1U7HA 4XB2A 4BNNA 4E0BA 1FDSA 1MG0A 1QLJA 4NH4A 4UVIA 5JAQA 2GZ3A 4TRNA 2DLDA 2Z1MA 3BMNA 3OIDA 3AM4A 4GX1A 2P4QA 3MWEB 3IKTA 3QVTA 3JQGB 4B4OA 4IJUA 1XLTA 3W6UA 1VJ0A 4H3VA 3F1KA 3VVBA 4A0SA 2CDCA 1H2HA 1IB6A 2BD0A 5I7FA 3BTVA 5AOVA 2P9CA 4NJOA 2Z1NA 5ER9A 2GZ1A 2E49A 4BMVA 1QLHA 5JCJA 5B12A 2EKQA 5K6AC 2E48A 1U5AA 5ILGA 1T25A 4Y98A 3VC7A 3L9XA 4J3FA 3ZZNA 3UFXA 4O63O 3PYLA 1ZSYA 3G0OA 5T6BA 1YXMA 3RFXA 1CRWG 3X2FA 4RPLA 3BMCB 4JNKA 4ALLA 1N1EA 5B1YA 2FY8A 1EE9A 2GLXA 4GAEA 4Q3DA 3HFGA 4WASA 3WBBA 4R1NA 1H9AA 3TFQA 1CWUA 1HE4A 1BVRA 1OC4A 5JAZA 4LVUA 5JS6A 5DZSA 4AJHA 4PLYA 1QV6A 4IJKA 4CMAA 4W99A 4MP6A 2POQX 4CM6A 2O4CA 4JROA 5KVCA 2ZB3A 3QVSA 3SJUA 3CEAA 5L7TA 1E77A 2OBNA 3AOEA 1FJHA 2FZEA 4CM7A 4RZIA 5CP8A 4I9HA 3MJSA 2EKPA 4HFNA 4TRJA 3T4XA 5TIIA 1XKQA 2HMSA 4J1TA 3W8DA 3ZV5A 1GR0A 1X15A 4U7WA 2JD2A 3ZHXA 2C7GA 1XIVA 2X9VA 1NASA 3HB4X 2OXIA 2FR0A 3ICPA 3MOIA 2FPIA 4IUYA 2J6IA 5HBRA 4DQXA 4DRYA 1BW9A 2JD1A 1Z74A 2W8ZA 3OEWA 3HDYA 4TZKA 3BHJA 4EEXA 4ZGWA 1O5IA 2CVOA 3OJ0A 1UH5A 1YBVA 2YDYA 4L73A 5GY7A 2G17A 3DHEA 3SEFA 4I5GA 3GLQA 3I6IA 4PLCA 2QZ9A 4WECA 1JWAB 2PV7A 1ZCJA 4EITA 1U3UA 3ZWPA 4E5YA 5TX7A 3PHJA 4B8ZA 1IZ0A 3V1YA 4E5MA 3K2EA 4FBGA 2VN8A 1EEHA 5DOVA 4UEJA 3QV1A 4CJXA 2ZYGA 4MVJA 4BKUA 1GV1A 3GVXA 4XYGA 1ZNQO 4RQTA 4EW6A 2QIOA 3MJ4A 3RJ5A 1NX6A 4WLUA 1Z75A 4EBFA 3TRIA 3TZQA 2J5KA 4DIFA 2VWPA 2FP4A 1AGNA 3G1TA 4WGGA 3RQSA 1PGOA 2NWQA 3TZHA 3O38A 1EVYA 3ZV6A 4DPMA 4XJTA 1C1XB 3P19A 1NQOA 1GUYA 4WLOA 1VSVA 5ICMA 3DFUA 1UZNA 2VWQA 3WWZA 3DHNA 3KHUA 3LSYA 2PWZA 1I33A 9LDBA 3QY9A 3NT2A 2EJVA 3ANNA 1PGQA 5KJFA 1I24A 4RVSA 1UDBA 1GD1O 1DLJA 4GI2A 1ZK2A 1YWGO 3AU9A 5AXCA 1P74A 1C0PA 3RBXA 3PIIA 4KUGA 2EKLA 4PLGA 4R3NA 5AVOA 2NU6A 1SBYA 3NT5A 4N7RA 4WEQA 2ZTVA 5FF9A 5CPFA 5JDIC 1UAYA 4IZIA 3ORFA 3PQDA 2C5EA 1OMOA 3M2TA 4JJIA 1RM0A 2LDXA 3RAJA 1SPXA 2A4KA 1I3LA 2YV1A 1EDOA 3RBZA 3K31A 1NBOA 1JVSA 4BNKA 4CMCA 3A9WA 1PIWA 1LQUA 1QYXA 1DPGA 5BSFA 4CMIB 3VH1A 3P2YA 5IXSA 2PZJA 4LCJA 1P45A 3TQHA 2H9IA 5FFFA 2O3JA 1LC3A 3GRKA 1NQAO 4BL5A 1X14A 4IJVA 1QXSA 1Y8QB 3ZWNA 1A9ZA 4JBIA 4HY3A 3KEOA 3GNTA 1XGKA 2C59A 1IYZA 1WW8A 3NKLA 3H4VA 1PZHA 4BO3A 2QYTA 4YBZA 4L4SA 3VZPA 2I66A 4A5OA 2FPGA 4KP7A 3WGGA 4PFJA 3VZRA 2PH3A 3RD5A 3TOXA 3CZRA 4EZBA 1P77A 1XU7A 1T4BA 3D7LA 4CPDA 1U4SA 5L7YA 3RUEA 1CQJA 2DTXA 2BKAA 3RFTA 4BNHA 4B3IA 4PLWA 5KJ6A 4NJMB 5L4LA 1U2DA 2DQ4A 1V8BA 2I65A 4YAGA 1T2AA 4FR5A 4MKRA 3E18A 4YACA 2Y68A 3GVIA 4A26A 4IQ8A 2QX7A 3AU8A 2A9FA 3OMLA 1YRLA 2DC1A 2VYNA 2Y1EA 3ZWBA 1T2FA 4CMJA 1D8AA 1DSSG 2AQIA 4AVYA 1NM5A 4XRRA 4B4VA 3RUDA 4ZQHA 3ZNNA 4DYDA 4QO8A 5CEEA 1E6WA 4BNIA 2X5JO 1V9LA 3B6ZA 5DT9A 3VTFA 1LEHA 3GGPA 3RUCA 1SOVA 2UV8A 3EHEA 3GEDA 1ML3A 1VRWA 1GYRA 2YFHA 3IIEA 3LVFO 1O6ZA 3DC2A 2ZKLA 1G0OA 3K96A 2P91A 1LRKA 1W0CA 3B70A 2WYWA 3H9EO 3PTZA 4QTZA 3GY0A 2WYUA 1LI4A 4QQRA 4XQCA 1B8VA 4UUNA 2I6TA 3RKUA 1K6IA 3JYQA 3PDUA 4BQRA 4KUHA 3ZV3A 4MIOA 1ISFA 3GUYA 1T2DA 3ZU2A 1W4ZA 4PLVA 1ISIA 5G4KB 3QRWA 3F47A 2RHRA 3WIDA 2VT2A 3VPHA 1HTBA 4WEOA 2JHGA 4M86A 2B69A 4E4YA 5A02A 3KLMX 1ZJZA 5L95A 3I9MA 4FSHA 5JCXA 3UHAA 2ZIZA 4GSKA 3FD8A 5ITWA 1JW9B 5JAIA 1GUFA 2EWMA 2PZLA 1CDOA 1ZEJA 2B4QA 3FPLA 3HNPA 4BNUA 5HTOA 3U3XA 2XAAA 4MIYA 5AXDA 4D45A 4EYEA 1PSDA 2PY6A 4KTVE 1ONNA 4BNZA 4TROA 4AG3A 2Q45A 1LJ8A 2I99A 4W9NC 4N5LA 1L7DA 4S1VA 5KKCA 5JNLA 1JAXA 1KERA 3Q0EA 4INAA 4DBVO 2EF1A 3DOCA 3PFFA 4KDEA 2JL1A 2OOSA 3PPIA 1ENOA 3HSKA 2CF6A 4XD2A 4N5MA 2B4RO 3OM9A 2H1SA 4MVJM 5DCUA 5FI3A 1JKJA 2PKQO 2QW8A 4P38A 5I8WA 5H81A 2D5AA 1JKIA 4OQYA 2WMDA 1FDUA 4CM4B 1HWYA 1I8TA 4BNYA 3E03A 5I7VA 4OL9A 1ISMA 1JN0A 3FWZA 3Q9UA 4LRTB 1F06A 3CZMA 1YDWA 2I76A 5L40A 4J4HA 1ZIDA 4ND4A 1ULUA 3ONDA 4Z9XA 4Z0TA 2X8LA 4KOAA 1EDZA 5G0SA 2JFGA 1PGPA 4J16A 4R5HA 4ROSA 4XCVA 1V3TA 3MEQA 4LGVA 1XR3A 2O3UA 3IUSA 1XELA 4DPLA 1TT5B 2DBZA 4HADA 2GRAA 8ADHA 2B5WA 1PJ2A 4XWYA 4ILKA 5ILOA 4TKLA 3AJRA 4YJHB 2VRCA 3I9KA 4R4JA 1HKUA 1HE2A 4PG5A 4AJIA 3U0BA 1WMBA 3DZHA 3R3JA 5CDGA 1UP6A 3KEQA 2HK9A 5LC1A 1I3KA 3DO5A 1PEDA 4B8WA 3DHYA 4U0KA 1DHRA 1WZIA 1RWBA 3M1AA 5ICSA 2G82A 1PJBA 2D0IA 3RC7A 1H2BA 2C0CA 3CMMA 4RZHA 4CMGA 1Y9EA 4FDAA 4EEZA 4XEHA 1X7HA 3ITKA 1K6XA 3WXBA 1S7CA 3WDSA 4B4UA 3JYLA 2W4QA 3UGKA 5C7OO 4I8XA 4J0EA 1VC2A 4RLHA 2W2LA 3KSZO 4UEKA 1PWXA 2O3RA 2CD9A 3V2HA 1ENPA 2ZK7A 4CLEA 1ISJA 2OL4A 1TXGA 3PP8A 5BR7A 2ZJ0A 3JQ8B 5L4SA 4GLOA 3DBLB 5AQ1A 1D3AA 2V7PA 5CDUA 2H6EA 5TS3A 1MX3A 1DDOA 1KC3A 3Q2IA 4ZQEA
chains in the Genus database with same CATH superfamily
3T06B 3ZIDA 2WWVD 4Z4CA 2AKEA 4K28A 3L6RA 4GECA 2FZLA 3SE7A 5IVKA 5NLLA 2DHRA 1LUAA 3H75A 3HH8A 2TRSB 5IJZA 3DPIA 1T4GA 4I99A 1PL8A 2EGHA 2VXOA 5DIFA 3UA4A 2FN3A 2PRZA 2Q0QA 1TX4B 2NVOA 3PNQA 1KDOA 1QVZA 3P9NA 5LA6F 1N75A 1X7XA 3WGUA 5IEJA 3FRJA 2ZRGA 3VH3A 2HT1A 1TQHA 3CURA 4R8KA 2IYVA 1JHPA 3V34A 4LJ6A 1ZSVA 4OFXA 1AV6A 5EMJA 5JFGA 3LX6A 5CFOA 5DBOA 4FC6A 4Z3DA 1N0HA 4KSYA 2QVZX 9LDTA 4LYYA 5KHOC 5B2ZA 4I5IA 3K92A 1KSJA 3TAUA 3SNKA 4HV4A 5AK5A 1TMKA 2PDAA 1OR8A 2BE7A 2R7LA 3NG1A 5BV1A 3ZJTA 1P2BA 4WOJA 1Z6XA 4Z1MD 1H4TA 2QEQA 3M6XA 1IRIA 2FLWA 4RPKA 2P6RA 4MO9A 2GN9A 5EJ6A 1YRHA 1QO9A 2HJSA 2WFLA 3B3FA 2H2IA 5AKLA 5BSRA 4J7AA 4LY0A 1QYDA 2ZJ8A 3H7AA 1EIZA 1QYVA 3A6FA 3UK7A 3ZDRA 4JJ6A 1UDCA 4DR6B 4Y6SA 1MJGM 5CITA 1VYVA 2H11A 2GETA 4FMCB 1HQYE 4CEIB 1DAPA 3H19A 4XWGA 2OWEA 4IXDA 2WNSA 4LZZA 1JNXX 4YJGA 2B34A 1WV0A 2JEOA 4G86A 3QW4B 4CHTA 5KTNA 1GPLA 4DMHA 1T6ZA 2ATXA 3RAPR 3T5DA 1KVRA 2XJ4A 4X7RA 4LDQA 4MYRA 5SY4A 1ULBA 1DRJA 1UBLS 4TWZA 2HA5A 4QYMA 4U7FA 5EPEA 1PYGA 1VJ5A 1XAJA 2OD7A 4H0NA 3SLKA 3NASA 4PBRA 1T4MA 4XW2A 4CUZA 3TKYA 3H9CA 1R9GA 3PFIA 1GG8A 4GX0A 2P90A 4RV4A 2NVUB 4KXFB 5IS2A 4P33A 1T4CB 3SYTA 3O26A 2FZVA 4DOMA 3TLGA 5MGBA 1NR1A 4RVUA 2WVJA 121PA 2ATCA 3DYVA 3PE6A 4QWWA 3GCZA 1JPJA 2QG6A 4MRRA 3A0UA 4B85A 4DKXA 2YQ4A 3E5MA 4KQ2A 4GYKA 3JQFC 4WACA 1PJRA 1UK9A 1M6HA 3ZHSA 4A3SA 4TVSA 1E2BA 4U6NA 2Q6IA 3ZI7A 5KX5F 3U4QA 3JYNA 1Y5MA 5H02A 3R6WA 4QGGA 1PQYA 1OI2A 2VTBA 3DFMA 5IASA 3CUUA 1QWSA 1Z13A 2EXXA 1RP7A 1ZD8A 1NDQA 1UKVY 1EM6A 1UP4A 2B0CA 3NBAA 3R7SA 1P33A 4S05A 1VI5A 4IILA 1YR8A 4QDOA 5BN4A 1F4VA 2AMVA 2KQUA 3HEMA 3MUOA 2BGWA 2B3TA 4RTKA 2R86A 3HUUA 2YWCA 1YO6A 5A9RA 1J4AA 4JQCA 4X45A 3OFNA 3FSRA 4C6TB 1GCAA 3ZY5A 4GBGA 3ESYA 2FKAA 3HKDA 4MUKA 3HKBA 4DC0A 3OY2A 2V6GA 3LDUA 4DMFA 2FN7A 3OTOB 4YFVA 2DTEA 3GK3A 2VSOA 4OHBA 3JQDA 3RT7A 4K0KB 1E60A 1L1QA 1FK8A 3ZI0A 2V7EA 3DYBA 1U9IA 3EW9A 1P4JA 2QRUA 5JXGA 1J56A 1G17A 3BB3A 3CNNA 2KBEA 5FPYA 4Z7OB 4OX9B 4QBFA 2FMUA 3V2IA 5KC9A 1DP4A 3HVRA 2QW1A 1CUVA 1PJSA 2ZYRA 1Y8RB 1YCFA 2ZS7A 1P0FA 4GE0A 2V3CC 1FU7A 1YRBA 1L6RA 2I3GA 1J8YF 2DKOA 3HYLA 1T35A 2YOFA 2ZVPX 3PF8A 4FZ5A 3BZWA 4Q4JB 3V55A 4ESEA 2BGGA 4QUDA 1A4XA 3VHXA 4XIFA 2FX3A 2H1CA 3E3LA 1R4NA 1S8NA 2YWGA 3RIEA 1BGVA 3R6GA 4RK5A 4UMFA 2YZGA 1VCHA 1D0IA 4Q1FA 4QGBA 3L0OA 4HUTA 4RTJA 4A4DA 2PGLA 4NF2A 4ETIA 3DTVA 1Q74A 2X4DA 1ODLA 4NZNA 2DHCA 2MYNA 1ZH4A 4UBJA 3W2FA 3ZCPA 5FR2A 3CXRA 5KNLA 1UK6A 1KFKB 1PJ3A 4NFLA 3OWXA 1RMYA 1RAHA 5DULA 1FS4A 2FFJA 3F8SA 3DWFA 4E2XA 3OOSA 1QHGA 1WTAA 1YJAA 1WXHA 3IV7A 3OUUA 3V5NA 1CUYA 2PJZA 4NQRA 3B1KA 1U0TA 3GJ7A 1J9ZA 2WU0A 2R1TA 1I51A 5J2TF 2XSZD 2E37A 4MDFA 2BDUA 2WSLA 3E3NA 3GEBA 4UNRA 2GTHA 1WW2A 3TL6A 3ZK7A 5A7FA 1TKCA 2HH9A 3FB1A 2FZWA 3MMNA 3QIVA 4KVGA 1GR1A 5AW4A 1S6YA 3TIIA 1K27A 3KOOA 3OWOA 2WAMA 2ZM5A 1MA3A 1JEQB 2IH5A 2QTMA 3D1VA 1GTVA 3O47A 1ZHOA 2G5PA 5BW5A 3DONA 5IHXA 1X7WB 3GAZA 3OPYB 1JDJA 4I3GA 1YJ5A 5LUBA 3TR0A 5A06A 4ETMA 4ZQIA 2OOKA 2CUKA 2JIQA 4IW3B 3VTKA 4ZT3A 1O97C 5LQRA 1AUQA 4ZEVA 4JV5B 3L7JA 4LHWA 2ONKA 1PUJA 2ORIA 1TEVA 4X93A 5KQRA 3IT1A 3IEIA 2CCGA 3QLJA 4WN3A 1RI3A 1ID1A 2P79A 3AEXA 4KDFA 2F7SA 3FOFC 1YKFA 1LSJA 1ZMOA 2AKYA 2QROA 3BX1A 2ZJ4A 4MI1A 1RP1A 2JIPA 5CIWA 1HDZA 3DLIA 2CHVA 5MN5A 4M46A 1YZHA 5AM1A 1E58A 3ZJUA 4C20A 3IL2A 1Z35A 3HVHA 2V8OA 1JDSA 1QTRA 2G0AA 2IXEA 4KPFC 4J4BA 4DV5B 1YTUA 1B93A 3NT4A 2I4NA 2P27A 3CRW1 4YMSA 2QP4A 1QQTA 1M2OB 1P2DA 3IULA 3KIPA 3PFHA 3IR6A 4BX3A 4C7OB 1RM5A 2P5SA 2P9GA 1J00A 1SUDA 4MWCA 1H2EA 1DRWA 4N82A 4ASUA 4UBOA 5JE8A 3ZJ4A 1RC0A 3F6YA 2NXJA 3LUJA 4P08A 4AZTA 5GINE 5DB4A 3VR2D 5GM2A 4WNIA 4AURA 3AG6A 3BFVA 2I2XB 3NORA 1R15A 2A0UA 2PYDA 1NQ5A 1UMKA 5BRNA 3TSZA 3PHLA 4Z9AA 1J24A 1N2GA 5CVDA 3VKWA 3ORYA 5I7VA 3AERB 5C1OA 1TAGA 1RQ2A 1L5FA 4WBNF 3BD8A 3LF2A 4L4XA 3RSOA 5E6UA 1QYCA 1C7RA 5KNBH 1M34E 2IGBA 5JXHA 1SA0B 3SEAA 4EX7A 5GAJA 5JDCA 3ZZMA 1FX0B 2WVHA 5GJWC 4EI7A 4DN6A 3SVLA 3TXXA 4AKGA 2I6FA 4AY2A 5B1SA 1A2BA 4MTCA 2DQZA 1KMIY 3BH0A 4MQEA 5DU2A 2QRJA 1B14A 1WBJB 3ROMA 2Q99A 5ALYA 4ARZA 3HEAA 5UKDA 3TIXB 3PC8A 2QV0A 2OXRA 1IC6A 2GT1A 3GVCA 3HBLA 2WE8A 3AI1A 2MIIA 2R6HA 4QSHA 4BMOB 2W2VA 4HAOA 5CA1F 5FL3A 4L4RA 3VAYA 1S8OA 3HYCA 4G97A 4DBLE 4V1CB 1C8VB 5B1IA 1DBWA 1HSZA 1D9ZA 2COEA 4DBZA 1J0XO 4CLDA 4CIYA 1JPUA 5TMDA 4G24A 1EK0A 4BVAA 4BATA 3PI7A 1A9XB 3ICEA 3EJWA 4X9XA 4CUKA 2WKWA 4UDYX 4E08A 2HPAA 2QSYA 4IH4A 1SXPA 3A14A 3ILSA 5I47A 1G20A 1W25A 4PC7A 2GBIA 3ETHA 5H8WA 2AL7A 4TQ9A 4FX5A 1YB4A 3KJHA 1P81A 1J07A 5AJVB 1OV4A 5CBPA 1OPRA 2C3MA 3PWZA 3QBDA 3QVLA 3WYNA 1EFLA 3BS4A 3NXKA 4EHKA 5FWNA 3IFSA 1HH4A 1BG6A 4X7PA 5EIHA 1D2GA 3WMXA 4DA9A 5B7GA 3IURA 3O3MB 3R0VA 3L0YA 5C1BA 1UBJS 2JH8A 4QT0A 4QLAA 4P35A 5A3SA 1AK2A 2C3PA 1J49A 1GOTA 2EDAA 3NDBB 1WULS 1K89A 1M2NA 1L8AA 3BMQA 2XCIA 3CUEF 3NBZC 2XTNA 1VMEA 3GJ4A 1CPYA 2FEXA 4R81A 3WHLA 5FRDA 1E1MA 2D13A 4CL8A 3OHMA 4PYNA 1XKLA 1ZVQA 1ACJA 1VL8A 3CU5A 4DQKA 4P0PB 2R6ZA 4JR0A 3PA8A 4GNKA 4BJ3A 1MAWA 3RRMA 2EYQA 4PN3A 5BSWA 4DV3B 2VZ8A 2UYYA 1U0GA 7MHTA 3Q5GA 5IYZF 3AUFA 3Q8XB 1ISSA 5BNWA 2GJKA 3RC8A 2G3YA 1KI9A 2WIBA 5I3CA 4PPGA 3RSLA 4YJFB 1JAIA 1FMTA 5IABA 4YRLA 1ZG3A 4ZIRA 1EVZA 3DS8A 5KVSA 5B5SA 4GR4A 4C7XA 1EFPA 1S8AA 1XVLA 2WAOA 2IY8A 3GJ6A 4M9CA 5CLIA 3R5SA 4Q7LA 1IBRA 1MXFA 1KAOA 1ZXXA 3B6EA 3BK7A 1HORA 2OZLA 4WOKA 3Q41A 2Z9DA 1DOAA 2CLEB 1P7CA 3JVDA 3MGKA 2EZ9A 4QBHA 4TYQA 4UNPA 4AROA 4KMRA 2XLBA 1VLQA 4C7KA 2BGMA 5F64A 4ZXPA 1AHPA 2C20A 4D8YA 3ZV7A 2CHFA 2GHTA 2VUUA 2VOJA 3R24A 1UKYA 2A1TR 5E2AA 5JISA 2JLQA 3MZ0A 1VBNA 3DMGA 4XYEA 5DM70 4X1YA 4BU0A 1NVWQ 1T1JA 4XQ9A 2J3QA 1EUCB 3RAFC 3RVSA 3G68A 1O89A 2JBAB 4LYJA 2YWHA 1AO3A 1N6NA 4I5DA 3TSCA 4KYVA 5GP1A 1BYIA 3G5MA 2BTEA 2GRJA 3ACDA 4LXYA 1NUSA 1C1DB 2OVBA 1GAWA 3LPMA 2QL7A 1CIPA 1HF3A 1INLA 1Z4LA 3TCNA 3RHFA 1LU9A 1PJQA 4AMVA 2GUGA 4YY3B 1TM2A 2YQ5A 2I7XA 2C5AA 1L8XA 3WGZA 2YWBA 5K8JB 1CZKA 2HHJA 3GEEA 1I36A 4MPPA 2XGJA 3MWKA 5AICA 3RVRA 1IVNA 5IXYA 2FB9A 4P80A 3DXXA 3L1HA 5EE0A 3W6NA 1BJTA 1JNYA 1FW8A 2V9ZA 5FA6A 3PUVA 5EZSA 1W49A 2MYUA 3ECSA 3G5AA 3DZDA 1OROA 2FWAA 4WXRA 4G1UC 4KYIB 4KREA 1XNHA 2O8FB 2FZ4A 3EDMA 1SWWA 1UCFA 3L6BA 4CLHA 3LUHA 3KQPA 1J8VA 1IVYA 1LBIA 3WLSA 1EWKA 4CG3A 3UPUA 2JPDA 1MHTA 3QU9A 3ETGA 4FGSA 5C18A 1W76A 2WHEA 4W4TA 2AVNA 5G3YA 3O4JA 3P1JA 1L5ZA 4UEOA 3WNCA 3PL1A 3U7EB 2C5FA 4HTAA 4N8SA 4QNNA 1NRJB 1PFQA 2NUTB 3ZDZB 5JMWA 5IBQA 2E6KA 3JVVA 1E6LA 4YP1A 4YRGA 4WKPA 1P3DA 4EYKA 2E5FA 3IEVA 4F84A 1C8KA 4ED9A 1XZBA 2IPLA 2ZYWX 4QIHA 2GZMA 5K03A 3BBLA 4Y2SA 3JQAB 3O83A 4Q15A 3FGPA 4HF7A 4I08A 2ZIUB 1VMAA 3L0ZA 2XOKA 3TLXA 3FUUA 1YBAA 3FKQA 4YNBA 1QPBA 3AR4A 1ZGHA 2XUQA 4OQZA 5FUXA 1KI1A 1RXIA 2UYQA 3G85A 4GM0A 3KCNA 4U4AA 3UOGA 3QEBZ 2QP9X 1TK3A 4RJKA 2QK4A 1SCKA 1AKRA 2J7PD 4NTZA 1X1CA 1ZGAA 2Z04A 3EIXA 4ARIA 1GUDA 3LS2A 1CF4A 2VF8A 3RYCA 1JF8A 3ZX4A 2FWJA 1XMSA 3AXSA 1G8JA 1YAHA 1O58A 2ZSUA 3IDFA 4RK1A 1BDJA 2NTYC 1ZUWA 3AOEC 4EA6A 5IT9A 1UAGA 2BHLA 2BFWA 3ERCA 1G4AE 1W88B 3Q15C 2P4EA 4PZZA 1L5RA 8ATCA 4X6XA 2RFLA 1K06A 2DPXA 1NPTO 4A1FA 3WIEA 5LD2B 4FUTA 3FOAA 3ORSA 5JR3A 3H6KA 3ZKAA 3WWDA 1WPRA 2GK6A 5EYPA 1Z0ZA 4A0GA 3GBSA 4NPCA 4BGEA 4DIMA 4B48A 1TK9A 4TS9A 4L28A 4CM1A 3F6BX 4EY3A 3TF5A 4YQEA 1FSPA 2C8LA 4FE4A 1KRXA 1H65A 1N2CE 1N5IA 4WNAA 5E9AA 2GN1A 2AYZA 2H08A 2QKYA 3NAMA 5IDVA 5GZ1A 2WK1A 1TYEB 4UBKA 1Q1NA 4PS0A 2HIHA 3QHQA 3IP9A 4JJEA 2O5RA 1PU2A 1ZUNB 2ZS8A 3A3PA 4WA7A 1AIPA 3IT3A 5T4EA 2EU8A 3X1JA 4GX5A 2Z83A 4G1CA 3VDMA 4D2IA 3ZDXB 4AS2A 4FP9A 4AJNA 4IV5A 2A9OA 4M54A 4OD0A 4MR8B 1ZNXA 4F5WA 4S04A 2IXAA 2AUNA 1W4BA 4NENA 2XUDA 2H18A 1NAHA 4J4TA 4MXDA 1ZMTA 2B6HA 5ESWA 4DXAA 2WAYA 2DT8A 4JQZA 4RKEA 4EUSA 5L3ZA 1E1NA 4L7VA 4TMTA 5KTKA 1OH6A 4X85A 4DWVA 1FXWF 4UE3S 1DELA 3EVFA 2AZDA 4O4LF 3C7DB 2YJNA 3NB0A 5JJCA 5E38A 3ZWCA 2YRXA 3H9GA 3O0TA 1YZKA 4UUPA 3C97A 4C0AC 1M83A 3IUJA 4P58A 1W5AA 1N8TA 3R7NA 3UMCA 1NU8A 4N4AA 3OKCA 3PXGA 2ZANA 2J30A 4AZ0B 3BWYA 4DVGA 2PZMA 4NBUA 3E5HA 4D3FA 2OCPA 1X2BA 3ZY4A 4TLEA 4RYLA 1ULSA 5FI1B 1XTRA 3HBFA 3E61A 3LNTA 4JLAA 2WZBA 1GG5A 2Y92A 3HLYA 4Q16A 3LDFA 2KWIA 3PUWA 3OCUA 5LDGA 3V2UA 2XGGA 1E2KA 1DINA 1WPGA 3DF9A 3AP1A 3KJFA 5LA6B 3G82C 6LDHA 1GTRA 3F97A 2V7QA 4LSGA 2O8CA 3PEWA 2ZEJA 2I4MA 1PR3A 2QAGC 3JATB 4IYRA 5HJ7A 2XXBA 1G98A 1W52X 5B1EA 1MABB 4JVNA 1LBQA 4DSNA 2Z8XA 1PSWA 1EG7A 4YI5A 1P2SA 2P9ZA 5DBGA 5KJ1A 4TMFA 4ZAVA 2VUSA 3WP1B 2RKBA 2ZKIA 1R6XA 1WKCA 3DE6X 1WLYA 1XWFA 2ZUDA 1KIFA 2EEPA 3MCTA 3FKSA 1RJFA 1E32A 4XARA 3SQLA 5LSAA 2HWWA 2JGEA 3NKFA 3C2QA 4KK4A 4MTLA 1XDWA 5CB8A 3KQKA 3CJTA 5EZ5A 3ZHBA 1VKZA 2PL9A 4RQBA 3OA2A 1L7NA 4QEDA 1CE8B 4H6PA 2PLAA 1Z2EA 5BWLA 3FTQA 2EW2A 4A2CA 1IEVA 1EZ1A 2HMWA 5KOHA 4OI2A 3QPAA 1K8XB 2I7DA 4O3MA 3TMAA 2ZWVA 4ZEXA 2BMEA 4KX3A 5KOYA 4L3VA 2EQ5A 3BN3A 1O8CA 3R8XA 3JQ9A 1MC4A 5IDXA 3KPUA 1I94B 1LNQA 2O0KA 4KIGA 2ADOA 3SZOA 2IXFA 3THXB 1XZHA 4W6ZA 1UODA 1YQEA 2PXAA 3P2IA 4IJWA 4BRZA 5T5QA 3CZQA 3MWEA 4CM9D 4RQAA 2P6OA 2VHWA 3NBXX 4WJZA 5DOZA 3RT1A 1X80B 1DU4A 3PDIA 1DI0A 2PZKA 4FFLA 1JTFA 1UBMS 4QM7A 1FRNA 2ZJ5A 4XQGA 3W9SA 4DVJA 1BVHA 2FQ1A 2QPLA 3P94A 4MS3B 1HL7A 1Y6ZA 3DFKA 4QA9A 1K8RA 3B6IA 1SXIA 4G8DA 4UREA 4UHDA 3EIHA 5I9SA 3T52A 2XDAA 4G0XA 5HS4A 2PX5A 1QOZA 1T1EA 1XLUA 1DEAA 3A9UA 3E6AA 3BUSA 1I3MA 3HDJA 3M6LA 4TV8B 4BUCA 1CRPA 4DQVA 1YK1A 3N0RA 1QYIA 1SMKA 2QWXA 3DVAB 2JLRA 3VSCA 1ZS9A 2REQB 3VPXA 2NZVG 3FYTA 3ZE0B 1BE1A 2WQZA 3WLAA 4ZPXA 3BMCA 4DJTA 3DAHA 1FNBA 2OECA 3M5WA 4FK8A 3A25A 5TQ2A 5LXTA 4LTNA 4EJMA 1C3LA 1YGYA 2Z2ZA 1R18A 1RYBA 2X1LA 3OO1A 5G2OA 3DYIA 1PK9A 2PUTA 3UAZA 1KWGA 5FFNA 2QUZA 3FLAA 3TUZC 2V03A 1YJXA 3IHTA 4HLQB 3URMA 4BMZA 1YCHA 1U2DC 2SECE 2GD1O 2K4MA 1TQ6A 2LTAA 1TZKA 1Z6YA 3FDZB 3CV3A 5E4YA 3F7TA 2LDBA 2FSIA 4LKRA 2VZ0A 5FWYA 2WJ6A 5DASA 1A2QA 1ISGA 1KEUA 4MULA 1WM1A 1ZIPA 1BOFA 3M5DA 4N49A 2ZUCA 1GGKA 1CX9B 1DRUA 2FPIB 4O2BA 2C95A 4AJJA 1YKSA 1O95D 5LQCA 3PU6A 3GF4A 3DSRA 1TM1E 3LZCA 2R65A 3NRCA 2I5PO 4KQHA 5A4IS 2AXEA 2XI4A 2ZP1A 3HVIA 1G1AA 1D4FA 1JIVA 2AXNA 3IUBA 3UPTA 2Y2UA 3NIDB 3T7EA 4YRZA 2H9YA 5EIAA 3T54A 1J8QA 1L7VC 4EHJA 5L45A 1PNQA 1BJRE 3PGXA 1OXSC 1WEKA 2ZB4A 4L50A 5E0OA 4UUAA 3UUEA 2QZZA 4OAPA 3WXMA 2G5TA 3A0RB 4FHDA 1P91A 1PWZA 4HATA 3L01A 2XKJE 3GG9A 2YOHA 1BE0A 5KSPA 4WLEA 1SOMA 4ZC8A 4W1QA 4OOEA 3C6MA 4OK6A 4YT4A 2H63A 4JXKA 2P0EA 1MAAA 2PBLA 5ELMA 1NXWA 3VI3B 4CTJA 3O1LA 1I14A 3S44A 1T3HA 1L7AA 4YUZA 1YB7A 4LXQA 1KY4A 1SQ6A 1UAAA 3WQHA 1IHUA 3C4QA 2C9MA 3OJCA 4M9UA 1M76A 1OU0A 2FP4B 4FFBA 4S1PA 2AF4C 3IQDB 2RK4A 2IVFA 2WABA 5ALKA 1KJIA 3S8MA 3VHRA 1YHYA 2IZ1A 4BWGA 1N2BA 3CEPB 3L02A 1ZD3A 1KMCA 4I1IA 3GP5A 4MUJA 5DYGA 2Y6VA 1YUNA 5EJIA 2GD6A 3IUYA 4OMFG 1G0NA 1ELOA 1EA7A 3O2QB 3K6SA 1NVDA 3IAM1 2CLSA 3SSMA 3EXIB 3C14C 3WRXC 4OAQA 3W3AA 3Q8WA 3THRA 3A26A 1R8SA 4KQXA 5I6DA 1YR9A 5BRAA 5TGTA 1H2FA 2FN9A 5F21A 4A27A 1C9MA 2C4VA 1E3IA 2PMBA 1RE1A 4M7PA 3R7FA 3H2SA 2O3QA 3TOCA 5KZMB 2GLTA 2R25B 1V11B 1GGEA 3TN7A 1P1CA 1PJ8A 3CEMA 2O05A 2J45A 3ROFA 4K6FA 2NADA 3EIQA 1V43A 5L7WA 2PMFA 1VMDA 3QBVA 3C3WA 1RPJA 5GPBA 3I6QA 3R5KA 1RADA 4GEKA 2SKDA 4HN4B 4PSVA 1SBCA 4AUKA 5HZGA 3DEHA 5K0FA 4JI0B 1GA6A 5AI4A 1HT0A 1JSLA 2JLSA 2P30A 3ZIUA 1G42A 3T8YA 4D9EA 1FTQA 4AJPA 2CK3D 2VTEA 2X14A 3GCWA 1I2MA 2NSJA 4D9HA 5IZCA 4YALA 2L0XA 2O8NA 2VQ3A 3T61A 4E13A 3IAM6 1OXBB 5IAEA 5IF9A 1PUXA 2CZQA 4BFYA 3FF4A 2JZOA 3K5PA 4O08A 4DLAA 3DQPA 3AT1A 4NZOA 4UNSA 3S29A 2W2PA 1GG9A 1XZIA 2OM2A 3BRWA 3DNFA 3O9ZA 5FWXB 5CB4A 1EFUA 3PJGA 3BA6A 1VFNA 2HZBA 1E9DA 3NJ8A 2BHRA 5CM2Z 1N92A 2P69A 1QS0B 1M1UA 4G23A 3UB3A 5EJ8A 3HABA 3DMNA 1SUPA 1EA5A 2OEPA 4UUBA 4A0FA 2RGBA 3GN2A 3KSRA 5AXAA 5LZ9A 3H4IA 3IHKA 4N0DA 1HE1C 2WG2A 1ECPA 3CKLA 4P4UA 1JMKC 5FTMA 3S6JA 1QGDA 4Q4AA 4AY4A 1HV8A 2AG8A 3OECA 1SU6A 1XQ1A 4WLNA 1KGSA 4BRWA 1J22A 1G6HA 4WERA 4H3HB 2J3LA 4DJAA 2WSSD 1WDWB 4LWOA 2WB4A 4XTRA 4P34A 3KV3O 3I1JA 1KE2A 1TC2A 4KXUA 4NYJQ 4JOQA 5F98A 4GMHA 1C50A 1CVIA 1DIRA 1NJ1A 2OAP1 2WYVA 3KQNA 2X19A 3E8SA 5TPWA 4WBNB 1K4MA 1N25A 4H9GA 1KPHA 2VDOB 3UAOA 4UNQA 4PHTA 2DQKA 2QMOA 3LBAA 1CRQA 1A5SB 1DIGA 3G6KA 3NHSA 3O75A 1ZZGA 2ZI4A 2FUKA 3RVOA 2PGAA 1RXVA 4V03A 1XHEA 4UM5A 1NZDA 4NBVA 2QTWB 2YFKA 4CDGA 4B6FA 1SO8A 3H1FA 4LVOA 1GU7A 3L7MA 5B3LA 2O2XA 3EPKA 3QVVA 3HXTA 3SDSA 1KEZA 3Q7SA 4WN9A 1X9IA 1Q2UA 3U4DA 4DPKA 5CA1B 2AG0A 3UAXA 2QENA 4JBGA 3S7TA 3D2CA 4CL0A 4N1AA 5JH7A 2VNHA 1VJCA 2C2WA 4X65B 2Q6OA 3P71T 1M1ZA 2GFQA 1K0UA 1TCUA 3WYDA 4F2HA 2X58A 1OYYA 2J3IA 4MVJP 2C4KA 1RRFA 4NK4A 3RGGA 3OU6A 4LAFA 1M6VA 2PL5A 4JC5A 4ESOA 4EWLA 1OA1A 1PL6A 1ZBQA 2OVFA 3FI9A 3IMFA 3PD0A 1T0JB 5EIBC 3I61A 1UPFA 4U7DA 1C3VA 3IQZA 1QIMA 1W4CA 1YDMA 4ZDIA 5HX7A 4X63A 2F00A 1T0PA 2IYZA 3P4YA 2J9FB 3GV0A 1Y1PA 4RVDA 5JD5A 2EBHX 3FZNA 1WHSA 2M1XA 2EL9A 2WOJA 3EEYA 3R6DA 3C3KA 5ALQA 5FEUA 1A8IA 2VHZA 4X1IB 1N7GA 3H9UA 2PV0A 5BNFA 3HZZA 3HGTA 1RRKA 2HHAA 3KELA 3C3JA 4DR3B 3RARA 3OX1A 4WHMA 3VKVA 1CJMA 5IUJC 5EWLB 3E3AA 4IDGA 2NTJA 3NYQA 4BQQA 2IHYA 3H5NA 3VKHA 4CXMA 1LI5A 2OQ2A 3LC7O 2B2XA 4IVNA 5KDOA 1IWOA 1ZC3A 1ZK3A 2E5WA 4KN9S 3WFIA 1JFSA 1VKRA 4H7DA 2OAQ1 2Y0CA 3UCFA 3NAQA 5E3JA 2CUNA 3OP4A 4H16A 2TMKA 3ISVA 4JOCA 3SC2B 4XVCA 2H0AA 3JD4A 1KYIA 5G4KA 2GPTA 5K3FA 2IU0A 2QVCA 4X84A 4Z5XA 3V1TC 4FOOA 2MJLA 1Z63A 3LT0A 1JKXA 1YGPA 2ZSBA 1IQRA 1KY5A 2QGNA 1JU3A 2X15A 4LJ9A 4CEJB 5IPFA 1L5MA 3DO6A 3PITA 4IZOA 4Z9FA 3AHJA 2ZB2A 4HGYA 2D74A 3MGAA 1EEXB 2BSXA 4MV0A 3WYGA 1E9RA 5AVXA 1L0BA 1L7OA 1QR2A 1EQ2A 2NP7A 5AXBA 1P7VA 5BXQC 3A4NA 5CFQA 1E2PA 1X19A 1HDCA 3O2NA 3OZXA 4M8KA 3CVOA 2ASEA 1YQXA 2NYUA 3ZE8A 1H9CA 2YZKA 1J33A 1L4HA 1UQRA 2WF8A 2E4VA 2ACKA 2PGXA 4HGRA 3L8GA 5H80A 4OHYA 4E7PA 4YAJA 4ERXA 1I7LA 4G1EB 1QZ3A 3WBFA 4AYWA 2QIPA 2W8BA 3I9JA 2CXPA 2KW5A 4LNHA 1R9MA 3R0XA 2VJPA 4E4TA 2WUVA 1MO6A 4OQEA 4PE5B 2EERA 4QZVA 3R6TA 2CEAA 3Q7QA 2CZGA 2XB8A 3UG7A 5JDIA 1UEJA 1DBVO 5THQA 2NUPA 2BISA 5D85A 2I03A 4R0NA 2V5AA 5CIYA 3IEPA 4EHAA 3NQ41 3LHFA 1A1SA 2PYZA 1OQAA 2OC4A 3DE0X 3H18A 3M70A 4G3XA 4YECA 1DT3A 4CM4A 5IULC 2R5FA 2W43A 2ZRBA 4J29A 1N6RA 3WYEA 4EHNA 4X1KA 2EFGA 3RC1A 3AKCA 4MKZA 1S2NA 2NOAA 3IMCA 5K5EA 1XNQB 3JVIA 2J0VA 2QD4A 3DTVD 2YASA 4JBWA 4PXAA 3L0DA 1J0CA 3QVJA 4MKFA 3A04A 4OXYA 4CI9A 4BLUA 4YP6A 1S1CA 4GVLA 2P9FA 1E9CA 2J9XB 3NHZA 4Z7JA 1X7DA 3JWGA 2BMVA 1JHQA 5U9CA 1YS7A 4RPCA 5G53C 1DTWA 1OGJA 1FUYB 2QTVA 3PB3A 3DW1X 3N1UA 4HXYA 4KGXA 4RD0A 1JQAA 2D00A 3HRHA 2XX3A 4PQEA 3SU8A 4CODB 3DMPA 3L0BA 2CXRA 2QA5A 4IIVA 5DCYA 1GYQA 5FTJA 2A5FA 1RTTA 3V7NA 3OLWA 1PJTA 2F67A 3KAJA 4V3CA 4DJDC 2NO6A 2XB4A 5I48A 4FT2A 3EZNA 3Q3EA 5CH5A 4BB9A 4ZK6A 1Y98A 1OAOA 3H9QA 4F2DA 4F96A 4ZICA 4C7BA 4ZK2A 2XXAA 1SXJA 4B82A 4IIJB 4XYLA 1UMBA 3KSBC 4WOPA 2QN8A 5J3JA 4FQ8A 5BOSB 3KXIA 5HIAA 4G4SO 5TSDA 4ZEMA 2ZE7A 1PCXA 2GNPA 2X9LA 5LD2C 5ALEA 1DXYA 4FKZA 2ISCA 1PS0A 3HCFA 4K9SA 1WZEA 3QVMA 3I0MA 3AK4A 3BM5A 5HRUA 5EZYF 3UAGA 3DOIA 5CHYA 4Z0PA 1QFZA 4RBNA 2FQXA 1TD9A 3PZRA 3UXYA 3O8LA 3W06A 3DAPA 1B1CA 1BEEA 2NNLD 4UNIA 4ZOBA 1SG0A 2ZWAA 4JJKA 2O6HA 1FP2A 3WSTA 4G84A 4J0GA 4XUDA 2WHXA 1FBNA 1J2UA 5LKRA 2A67A 2RDMA 3NDRA 1G7CA 1N6IA 4EOGA 3FOBA 3RIXA 4YJ3F 4ND3A 2XZDA 3KZVA 1JFFA 3AUKA 1O5TA 3W2TA 3KRTA 2I4TA 2CXXA 5ALOA 4H31A 4P81A 1OU4A 2H8GA 2WNIA 3P5SA 2W6JD 2X3YA 3CZAA 1G5QA 3JQ8A 4U0JA 3KKZA 4JL5A 1XLVA 1C4OA 1QPGA 3D4LA 4QDJA 4JLNA 2HN9A 4I1RA 1KSGA 4C0QC 4GPEA 5G4LA 1X7XB 1SGWA 1RWKA 4JBYA 4UE2A 1J42A 3A2MA 3BFPA 2FPPA 3EXG2 5DWVA 2GDZA 2G71A 4BNMA 3A37A 4X8LA 1MB3A 1BJKA 1S3IA 4WZAA 2QNBA 4P4SA 4QXRA 2ZE5A 5FLYA 4FHZA 3SBXA 5DH9A 5J5VA 2VQDA 2DPHA 4YRJA 3T5GA 4XSGA 1CSEE 2ECOA 4NE9A 1MFPA 1P2GA 5HRAA 1RYEA 1RHJA 2C1ZA 3CTMA 4GZ5A 4ON9A 4EFNA 3RCBA 3LF1A 1IPEA 4PSUA 3FDIA 5H82A 3D9QX 5JCJD 1NL3A 3PXDA 3ESXA 5ALDA 4TMWA 2XCTB 1SUIA 2JGKA 3A9SA 1VG1A 2H3EA 2QG9A 3GLSA 1DV2A 1KI7A 2DWCA 5ES3A 2WFLB 2X1MA 1Y3FE 5TXGA 1QG4A 5GWXA 5LYJF 2A9RA 4Z2AA 1U63A 2QN6A 1XTUA 1DWQA 2QTFA 2OXEA 4LQLA 1NN5A 5TEWA 4EY5A 3JX9A 4OQDA 1N2EA 5HIKA 3FPKA 1F4PA 5H70A 1YASA 4NFYA 2Q4BA 2J4DA 5GZ6A 2UZIR 3EWNA 4L6CA 4G2TA 4O3FA 2Y4NA 2PD3A 1LCIA 3KFLA 4BCDA 4YJGB 2N42A 2C77A 3EWIA 4GE3A 2OYSA 1SB9A 4M1QA 4MINA 4B7XA 4F8YA 4KHPB 1MA0A 2M6KA 2V98A 1OKKD 1LKZA 3ABRB 3BK1A 3H3FA 2ZTSA 3Q85A 4ESVA 4QQNA 1GFSA 2OORC 4X00A 4WXEA 2CMHA 5LZ2A 2E7ZA 3W1VA 1MGPA 4Q7QA 1YJBA 1QPZA 1U0SY 1JFVA 2WSYB 4EF5A 3F6RA 4W9NA 4KIFA 3RRNA 5FV7A 1FRQA 5TJHA 4AY6A 2GXUA 4GGMX 1MAUA 1TO1E 3MTIA 2B2CA 5FOWA 3GLIA 3U7RA 3PGJA 1F9AA 1Q0HA 2K87A 1GO2A 2AQ8A 1HQCA 5HE9A 4TSFA 5CFZA 3TLGB 1GTJ1 1KETA 1V47A 4Q9KA 3A6JA 1IL0A 1U8TA 4NCHA 4UVDA 4P98A 5JG7A 4FFVA 4JXXA 2QMYA 2VNSA 2Q1UA 4LG1A 2QVGA 3CH5A 4C1BA 1C3OA 1LDMA 2JFQA 2DSTA 4LIPD 5LXTF 4AMUA 3BTOA 5A5VA 3E84A 2WT9A 3QKUA 4ZGGA 3HB1A 4PGGA 5C5EA 2Q7OE 3AJ9A 3GFSA 3VO2A 4URXR 3U4QB 1P9RA 2WKSA 2IOHA 3LFTA 3L7KA 4BO6A 4KXMA 2VTBB 1IBSA 3A1NA 1XZ8A 1M1YA 1EDBA 3G3EA 4C7MA 2OCYC 3DEZA 1UPAA 2AN5A 3ZD9A 5BQFA 3FVWA 4JODA 1Z6QA 2J0UA 2X4IA 2E18A 2JCBA 3AUTA 3FUXA 1D2MA 2FFAA 4Q3EA 4IO0A 1OWMA 4FS8A 3TZBA 3K2BA 2CDBA 4IXWA 4NZ9A 4O2BF 4REOA 5BN4B 5K3DA 5MFPA 3FZGA 1D1PA 3P96A 3Q7EA 3A9VA 3GDGA 3O1IC 1DXHA 2GXSA 3DLAA 3R5HA 4QRIA 1Y4ZA 5CGQB 2QQGA 4JHXA 5DSTA 3DPSA 3GEPA 3UH0A 4F2GA 3FHOA 3RFFA 1MOPA 2DUNA 5K51A 3ZYCA 4BE4A 3HKDB 1K98A 1U4NA 3HKBB 3TFOA 1OOEA 3M0EA 5HF6A 5A3QA 1ETUA 1NE2A 1U0JA 3IP1A 5HUQA 4AZWA 2FEPA 2RGEA 3Q6IA 4RCYA 2JANA 2D54A 2Y1FA 4LZNA 4QL3A 4YPFA 1WDTA 1QH9A 2V55B 1L5GB 1L4EA 2NACA 5F1PA 4F9FA 3ANMA 4EO4A 2CKMA 4L57A 4DMRA 3CT6A 2ZVDA 1F51E 1ZNWA 3UCXA 1UJCA 1G18A 4JU9A 1O6GA 1Z07A 1X2EA 3VHXB 1JG4A 1P0QA 1JG2A 2P68A 3FMIA 1R4NB 1RD4A 4EYSA 5A1TA 4WVFA 1ORRA 3TUJC 1ZOPA 2CFIA 2HU8A 3CVXA 5BW6B 2IOQA 3F3SA 2I7VA 3QE3A 4OJNA 2G8NA 1XX6A 2OR3A 4FYKA 4YDRA 4WJLA 3FLMA 2VCEA 3DTVB 2PNFA 2C99A 3L1VA 5K0TA 1SKUA 2VPQA 4YMHA 2XCRB 2WLTA 4YHHB 1H8EA 2DX7A 2XBLA 3TIVA 3WG9A 4EI8A 2O1SA 2X40A 3GAFA 4NI5A 3NEJA 4DLPA 4PTLA 4BVHA 2GFHA 4ZODA 1ZK0A 1EFRA 3SIWA 1SKBA 1QHNA 1T1RA 4G67A 1C30A 3LGXA 3FTEA 1OI4A 3ND9A 4RF2A 4FB4A 1GDTA 2BDTA 1F8UA 2A30A 1DVRA 1JTVA 1U3DA 2PKXA 2R1TB 1N5OX 2W0MA 1BGWA 3HR7A 5M29A 2DWQA 2Z2KA 1DARA 2QHXA 3KKKA 1ZICA 2J7KA 4HDQB 2Q3LA 1OE0A 4FD3A 5L3RA 4CNBA 5KSOA 3OZSA 4IS3A 2O2ZA 3C8MA 3RFVA 2HFJA 1DQYA 4GXTA 4CLOA 3AFNA 2UZ0A 1ZUHA 4YAKA 3WL6A 4LOLA 5LMUB 3X1WA 1Q6YA 4PZUA 1OAKA 3EVNA 2ZQYA 2DQYA 4IDDA 3KQOA 4KMMA 4R1MA 5DCWA 4YPVA 2R6JA 1OXXK 3HFRA 3I2IA 1NI4A 1XZCA 4I5FA 4A2PA 4C9BA 1SC9A 1WB4A 4RK6A 2IP4A 1U7XA 2QS9A 3L40A 2XOKD 4EUFA 5JAHA 3W2HA 3L7IA 3SFZA 3RV4A 4E6PA 1UDAA 3B2QA 1BTOA 1AKNA 4RMIA 1N36B 4M1TA 2X76A 1A9PA 4JJAA 1ICIA 1ID8A 4KXXA 1XD8A 4GM1A 4AXXA 2HB6A 4NKRA 1CS4C 2PPVA 3RROA 3W5UA 4UTPA 1W47A 2YS7A 5D2CA 4RFVA 3A4TA 3RT9A 1RBZA 1T5HX 3H5RA 1Y0BA 3TSYA 1USVA 3LVBA 3O03A 3FNIA 4HBGA 4V02A 3UWPA 1NXXA 3DEKA 3L7OA 4MCAA 5IZ4A 1QANA 2CNNA 2EZTA 4I4IA 3QV2A 3ICCA 2OHXA 4FN4A 3I30X 1VI2A 2Z58A 3ET5A 2BF4A 4QEZA 3FR8A 4PLFA 4URHA 3U7IA 4QHTA 4M21A 4XYBA 2P9TA 3M6UA 3O4GA 2V59A 3LVRE 2HFKA 4HLCA 2G9UA 1EZ4A 1BD3A 1FFWA 3FY4A 4JXJA 3TIGA 4E5DA 5K4GA 3P27A 1U2QA 3NOOA 2XQKA 1I7QB 2WF5A 4BP1A 5E6UB 2AF3C 1IEWA 1XPUA 2CLHB 3FBGA 3JSAA 4Y9SA 2C5SA 2HWKA 4FDUA 4JEUA 2H2DA 1BXZA 1Z2NX 2G0TA 4F0JA 5HKKA 4D43A 1UADA 5IM5A 3WIUA 2ZUWA