1JEAA

Altered topology and flexibility in engineered subtilisin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
269
structure length
269
Chain Sequence
b'AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN
publication title Engineered Bacillus lentus subtilisins having altered flexibility.
pubmed doi rcsb
source organism Bacillus lentus
molecule tags Hydrolase
total genus 95
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1997-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1jeaA00
4NE9A 2E1PA 1Y33E 3QFHA 1KDYA 1SUCA 1TO1E 3TECE 1LW6E 1C9NA 1GNVA 3PRKE 1THMA 4FONA 1S2NA 1SBCA 2PWBA 2Z57A 3BX1A 3DVQX 1AU9A 2DP4E 1WMFA 1ZVJA 1SCAA 1AH2A 4CG0A 2Z2XA 1WMDA 2B6NA 1SUDA 2Z2ZA 1YU6A 3LXUX 4B5LA 1GCIA 3VTAA 1SBIA 3DDZX 1EGQA 1ST2A 1TM1E 1Y3CE 4Z2AA 3F7OA 1TM7E 4H6XA 1Y4DE 3HJRA 1R64A 3TI9A 3DW3X 5JMOA 3DE7X 2W2QA 1SIBE 1SUAA 1SBTA 4ZOQI 1Y34E 1OYVA 5CW1A 1SIOA 2P4EA 2ST1A 1GTL1 3SICE 4I0WB 1T1EA 5B1DA 1ST3A 1OT5A 1TM3E 1WSDA 5AVKA 2W2PA 4OMDA 3Q40A 2DUJA 1BFKA 3VV3A 2X8JA 1SUEA 2IXTA 4H6VA 3VV2A 1CSEE 1C9JA 1AVTA 1GT91 1A2QA 2G4VA 3T41A 2IY9A 3A3PA 3AJ8A 1SPBS 2XRMA 3DE5X 1C3LA 5AVJA 1WVMA 2W2MA 1OYOA 1PEKE 3DYBA 1TM4E 3A3NA 4M1ZA 3D9QX 3BPSA 1EA7A 2SBTA 2ID4A 2W2OA 1V5IA 2ZWOA 4WOCA 4HVLA 4HX2A 3OSZA 1R6VA 1SCBA 1YJCA 1SCDA 1V6CA 1KE2A 3WIVA 1R0RE 5ARDA 2ZRQA 4RYDA 1KDVA 1Y9ZA 3CNQS 1KE1A 3ZXYA 3D43A 1SUPA 3CO0S 4KB5A 4CFYA 1GA6A 3ZXXA 2WV7A 4JP8A 2WUWE 2SECE 1KDZA 2PRKA 1Y4AE 1BE8A 1NLUA 3WHIA 1UBNA 3DE6X 4C3VA 1C9MA 3EDYA 3EE6A 1S01A 1P8JA 3SQOA 3I34X 3I37X 2PWAA 3QMPA 3F7MA 1SCJA 3WIUA 5B1EA 4NE7A 5I9SA 3H42B 1Q5PA 5FFNA 3VSBA 1GA1A 2W2NA 1AV7A 1HT3A 2HD4A 1SBHA 1PTKA 2Z58A 1T1GA 3AJ9A 4CFZA 3AFGA 4H6WA 3GCXA 1Y3FE 1MEEA 2TECE 5JXJA 3DWEX 3TI7A 1IAVA 4NMXB 2XTJA 2V8BA 3A3OA 3GT3A 3LPAA 4DWWA 1SH7A 1YJBA 1AQNA 2SNIE 3I30X 1P7WA 1Y3BE 1DUIA 2PKCA 3QTLA 1ZVKA 1TMGE 2PQ2A 3P5BA 2GKOA 4OV6B 4K8RB 5FAXA 3DE0X 4AKTA 1GNSA 4AKSA 1BFUA 5JXIA 1SVNA 1TECE 4WOBA 3LPCA 3DE3X 3I2YX 1CNMA 2SICE 3WQBA 4KG7A 2Z2YA 3LPDA 3DE2X 5AMXA 3VYVA 3DW1X 2HPZA 3EIFA 2PMWB 3L1KA 1NDUA 1VSBA 1AK9A 4LVNA 5ARCA 4DJ5X 2DQKA 5FBZA 5AQEA 3VHQA 3PTLA 1TO2E 3DE1X 4LVOA 1PJ8A 3GCWA 1T1IA 2QTWB 3DVRX 2WUVA 3DE4X 1S02A 3Q5GA 2X8JB 4ZARA 2WWTA 1P7VA 2ZWPA 1GTG1 4GI3A 1AF4A 5ARBA 1DBIA 1BH6A 2ID8A 3UNXA 1PFGA 1GA4A 1YJAA 1SUBA 1NDQA 2PYZA 5JXHA 1Y3DE 1JEAA 1BJRE 2Z30A 4OMCA 1GTJ1 4BWGA 4C3UA 4KPGA 1Y1KE 1XF1A 3BGOS 1IC6A 1TM5E 1SBNE 5K7SA 1SCNE 3DVSX 1SN7A 1Y48E 1SIUA 5SICE 3GT4A 4MZDA 4DZTA 1TK2A 5JXGA 1SELA 1BE6A 3F49S 1WMEA 4YN3A 2Z56A 1MPTA 4J94A
chains in the Genus database with same CATH superfamily
4DJDC 1VMKA 2AMYA 4HK4A 4A3SA 4GZ3A 3WLRA 2J9FA 3KYDA 4WVLA 1Y1PA 4OQEA 5EMLA 2GZMA 2QLNA 3ETEA 4MB2A 1FTNA 2WFAA 4EHHA 4MH0R 1KNQA 2YWHA 3IOCA 3PFNA 3BAZA 4LJRA 5TGZA 4XQEA 3KR2A 4RFSA 3PTZA 2FMHA 1G63A 3ANNA 3L7BA 4RSMA 4QATA 1AN9A 3CONA 4R0NA 2YHUA 4WY8A 1UDXA 4DLZA 1D0VA 2D7CA 2ZUBA 3LGXA 3KSRA 3N05A 4PZAA 3U3ZA 3QU9A 1G8MA 3D31A 4KH0A 4M9ZA 4MDHA 5JY1A 2REQA 4O4JB 2B9VA 3HACA 3HR7A 4US2R 1ZVJA 4LHEA 2VTEA 2X76A 2ZK7A 3MUOA 3PFHA 4ALIA 4C4RA 1Q2XA 3UAYA 2YYSA 2PBFA 3IVMA 1IQUA 1XIVA 3CRZA 1E61A 5CFQA 1NSTA 1PDVA 2VDRB 4P33A 4TLLB 3WLNA 3LXUX 2VN8A 4TQGA 3RSCA 3PGKA 4N3NA 2NU6B 4YALA 1V26A 1U7ZA 2ZXFA 3DNMA 4EFMA 2R2GA 1B0PA 1D2MA 4OREX 2XITA 4IOLA 4P58A 5CVCA 4V1CB 2GA8A 5KJFA 1EGQA 2DR3A 3JWPA 5ALYA 4TMXA 3AEZA 2D1RA 2GR9A 2HK7A 1CYEA 2P5UA 1VXOA 3TLKA 3O9ZA 2QSYA 3I5YA 4EYOA 2HREA 1MDFA 3DF9A 3EEIA 3Q88A 4RVDA 3UANA 4UFOA 4BGEA 4DC9A 5CDTA 1Y6QA 4R40A 4KP7A 1JIUA 3UCEA 2Q5HA 3C6QA 2OV3A 4OA8A 4XIYA 3DW3X 4X6XA 2Q3HA 3DMPA 4DSUA 3ZHTA 2ORED 4LK3A 2BDTA 2IYWA 2DUMA 2WOJA 2FOIA 1JMVA 5GGYA 3S6JA 4LVCA 4Z4IA 2ZSFA 4MRSA 3AR9A 1E9FA 3I9LA 1Y34E 3EB9A 1JQBA 2JPDA 2PT6A 3GT0A 1VYUA 4D6XA 5K8JB 3NONA 1P1CA 3UO8B 3HPRA 1A0OA 2H4WA 3H86A 3MJEA 4ZOAA 2Q0SA 5D84A 4CKBA 1LUAA 1QK5A 3BHIA 3PFKA 4NFSA 4AT1A 5LP6B 1JKJA 1X2BA 1GAQA 1R0CA 3EW7A 4NWIA 2WIGA 3ODGA 3TIGA 3R8CA 3SIRA 3D4IA 1R16A 2OV6A 2XMPA 3ELBA 4XIGS 5H3LA 1XZBA 2I7DA 4CIDA 4X65B 4YT4A 3TFWA 1NYLA 1EJ6A 3GGSA 4OXKA 2VRCA 4RA9A 4XDHA 3ZKAA 4MW2A 4BLQA 2EKDA 4ENSA 1T4CB 1B23P 3DHVA 3DVLA 1BSVA 5HYVA 1H6CA 3P52A 1G291 1ST3A 3B1VA 1NKTA 3MMNA 5AVKA 4EUFA 1XRLA 1H2RS 2RI1A 4FMDB 1YF3A 1IPEA 2FG6C 5DN6A 1F2TB 2WD7A 4OIMA 3RC3A 2UXBB 1PJBA 4CF7A 3GRRA 3BFKA 2J4CA 4EJFA 3KR9A 1U9JA 1NRJB 3RS7A 4M8LA 3KEOA 3NFRA 1OZGA 2G1JA 3ENVA 2IZOA 2NAFA 5J5CA 4ZVUA 1KC1A 3UOWA 4XDYA 3A2MA 2FRVA 5IAAA 4C43A 1PJQA 5HS4A 4XQ0A 1W5SA 1Z73A 2HK6A 3P19A 4ZRNA 3UN1A 3PFCA 3E3AA 2QTRA 3EQ9A 4FHFA 1GNRA 1QYRA 3HHEA 4WLVA 1FSZA 3JSAA 4LXYA 3ELYA 1F5SA 3RSLA 3NJ4A 3FDZB 2ZUEA 5FBHA 1PT8A 3BD6A 3FWNA 3OQJA 3ZK9A 4PX2A 2FSVA 1ISSA 2C9ZA 2QRZA 1RACA 4H77A 1C4XA 3D2LA 1LVUA 2FFBA 2WMNB 3NKLA 3I05A 4JI3B 1C8KA 3TW0A 4F4JA 2C9YA 3N0VA 1CETA 3FX2A 2F4VB 4XPIA 2IODA 3FLEA 2PE5A 1FP2A 4RDHA 1CZHA 2W6NA 2YWGA 2AZMA 3RVOA 3RODA 4R41A 1IYZA 3O4GA 2P77A 2RGRA 4S12A 5K6RA 4WBXC 1QB7A 4FKBA 2C4HA 2VP9A 3W7BA 4EFLA 4M1ZA 2HY7A 1AXEA 3MBOA 1F60A 3NHFA 1IL0A 1UXKA 2EW8A 2HHAA 2PUHA 2WVJA 4AJ1A 4QTYA 4KTVE 1NMQA 3LCJA 1HZZC 2J7KA 3CPSA 2BSQA 3VU9B 4HX2A 3RFTA 3ESRA 3KVYA 2OZLB 1YAHA 4ZDJA 1V48A 4GP6A 1LI5A 1LGYA 1HLFA 3PWKA 3AI1A 1PG0A 2OD7A 1L7XA 1P62B 3WSTA 1ZMRA 2JJ2A 3H19A 4F4FA 3NOQA 4GSLA 2W8BB 4RYDA 1FUYB 5LCXA 4UTPA 3W4KA 5KAMA 1SHUX 3HXMA 3ET5A 4RD2A 3PD1A 4ER3A 1G2IA 3I9OA 1EFCA 5JMTA 3QU7A 1EFUA 2YJ5A 1AHPA 2YXEA 5A6VA 3RS3A 4D8UA 2VI5A 1FSSA 1WJGA 3WMGA 3I4LA 1XQ6A 2YV4A 2RKOA 1A2BA 3OMXA 4PYMA 4WZBE 4UZSA 5E3IA 5K20A 4LXHA 4MW6A 3UPTA 1A9YA 4MEJA 1AX9A 4YJ2F 2Y66A 1DIBA 3M1LA 1V16A 2HDNB 4NG5A 4MYRA 1XCOA 4EY3A 1NW6A 2HDWA 3EIWA 3ZXXA 3FHLA 4QHTA 5JADA 1F06A 1KOJA 1XVLA 4S1NA 3FUVA 4L8FA 1SU7A 3HLYA 1UKCA 4FMCF 1SUWA 2GFIA 2ZI4A 1QIGA 3OM9A 2PRJA 4P31A 2WZBA 1FQOA 2EJUA 1JPJA 1VLZA 4BLRA 3DMHA 4IO1A 2RG7A 3VBCA 5KYXA 1J5XA 2D5IA 2EKBA 1H4TA 4LA4A 3TGWA 5HZHA 1XMPA 3W8EA 1Y4AE 3E1SA 2R1VA 1ADJA 1GCUA 2VH5R 3RHZA 1AGRA 1R6TA 3GB9A 3H2JA 1HBJA 1GAWA 4KH1A 3DBRB 1NLUA 4OQYA 1RSZA 3K0AB 1UBNA 1ESMA 2WMOB 3EF0A 3LDGA 4IILA 3FTNA 1WU7A 4W6ZA 2BIFA 2WWHA 5KQLA 3U56A 4CKCB 5INTA 3EULA 2P1RA 4BP1A 3AZOA 2FPIB 2UZ1B 2DWUA 1L1EA 2IHYA 3KT6A 5I9MA 1SG0A 4L5JA 5AI9A 4WX2B 4TV8F 2DKNA 2YVUA 3I34X 4LFCB 4JJ7A 2AKAB 2BZSA 2V74B 4DSAA 1YGPA 4F3YA 3PNVA 2DBQA 5HF5A 4PQGA 2DTEA 1H1DA 3Q9SA 5EHGA 3ZCUA 1CRLA 4CEIB 3ZU2A 4QA9A 3TOZA 4NK4A 3S8YA 5A4JA 2OZEA 2NVUB 1E7MA 2RK4A 1E3EA 1G8FA 2JI6A 2CUNA 3EAQA 5DHAA 3K6JA 1E2UA 2JJ1D 1JR3E 2ACWA 3KJHA 1K7XB 4M9SA 4RSRA 3T7DA 3B3QA 2CNWA 1FYXA 2CBGA 2XJ9A 1ONNA 1U6JA 4AFNA 1YB5A 4M1TA 1V8FA 2B1IA 4FXPA 3MJHA 6GPBA 4XJVA 4AJLA 4GQBA 4MKIA 2GPYA 4RO0A 1HT3A 4TKVB 4KIWA 1Y5MA 2Q49A 3BRCA 1SBHA 1WKVA 3C3MA 2G9UA 5AJTA 3QP9A 1JPVA 3HKCB 3F4BA 2NP6A 3KPWA 3P2IA 4UTNA 5HW0A 2VAMA 2EBFX 4GKAA 1LH0A 3AEQA 3HS3A 3K9NA 4CJXA 2CNWD 4KUHA 2D2EA 2FR8C 2ONCA 2BGRA 4R6WA 3HR4A 4WZ6A 5LMCA 1IVNA 2OSBA 2Q1SA 4BWVA 2DSTA 1RYMA 1U28A 2XKJE 3Q2OA 4X90A 4E3WA 1TAUA 1UBFA 3H2KA 4KGZA 5TPZD 1ML3A 3L1JA 2OORC 3CFYA 3CNBA 4XJXA 4NMXB 2ZB4A 1LC3A 5DP1A 1UKAA 1KK1A 5KJ6A 3FFTA 4COKA 3OX1A 2CF5A 4F6RA 4KGXA 2Y1DA 3IEMA 5BMVB 2WA1A 5DTQA 3OOJA 4FN4A 4NCXA 4TM8A 2UV8A 3OUTA 1SB9A 4ACBA 1XAJA 1AQNA 4IIFA 2I2AA 3I30X 4RMGA 1QR2A 1ZSNA 1P7WA 4YGYA 2EFEB 4JODA 3NAMA 4RAQA 4ZYUA 4BYMA 4JV5B 1YRAA 1QVVA 2EJVA 2IEBA 3OZRA 5D7NA 1ZCFA 3GA0A 3ZV5A 2XCTB 1QONA 3T3DA 5HPYB 4L0DA 2PVSA 1AHNA 2Z9BA 1GWNA 1DUIA 3JQGB 1QIHA 4FYMA 5FPYA 3TZHA 1P19A 1TCBA 3H83A 2VC2B 4OV6B 4TWIA 3VDXA 2NUAA 3ZWOA 1FIUA 1FYEA 1N2XA 4MO2A 2BW0A 4EW3A 4AJ2A 5JCZA 1TU3A 5EIAA 2ZZMA 4YUYA 1QFSA 5EHQA 4AMVA 1KARA 4YRLA 4OFWA 1QPBA 4XWAA 4DMMA 4R5HA 2ZBEA 1XUOA 2E55A 4ZKEA 1UC8A 2ZIXA 3DKIA 3HMKA 4PTZA 2UXDB 3TSZA 2ABWA 2PFGA 2H07A 4HDRA 4HDKB 1LNQA 5A3QA 1HE3A 1VCOA 1ZD1A 2X0NA 3A31A 4WLFA 5HS6A 4PIMA 1Q3HA 2A0XA 1BQ3A 1D7AA 2HN9A 1L7VC 2MYUA 3T1NA 2FH5B 3K3PA 4HYQA 4J0KA 1TAQA 2HWWA 2BJWA 1X7XB 2JGNA 1L4FA 1YMQA 3IPAA 3AC0A 1KI8A 4AAYA 1CK4A 1P9RA 2V7VA 3MTGA 4OUKX 4PV7A 4G6ZA 4D46A 2GKSA 2GBLC 2O2ZA 3SI7A 1UFOA 1XXHB 4GWGA 5E4JA 4I14A 1TEHA 2QUBA 4AG5A 3U5TA 3D7NA 4XOIA 4N5HX 2GN2A 4XYBA 5FYQA 1Z2AA 4Y9UA 1M2NA 5CLJA 3DLCA 1NASA 4Q3AA 1BCRB 2G83A 1MF7A 4IIYA 3GLIA 4DIUA 2V98A 2Y0PA 1U80A 4DG9A 4RUKA 1TLTA 2H00A 5L4LA 3AEKB 1UC4B 2AZTA 5E2IA 3TRIA 3ZV3A 3FXAA 3I6BA 1IN1A 1I7QB 2R8EA 4DV6B 3KT3A 4KN8A 4NMMA 3ZXIA 4PN7A 1M5RA 2O3SA 1DINA 2H1CA 3EZLA 3PNYA 2D1FA 2WT9A 3ZZNA 1HETA 1UPUA 2ZXUA 2PVCA 3FPHA 4WBNA 1G9TA 1UK8A 1WDTA 2QQEA 1UBEA 2VPQA 4B48A 2W4IA 4IIEA 4PLZA 2Q3DA 3IUYA 4HTFB 5TPWB 3TEFA 1F2UB 5KYKA 2F90A 5F3RA 3AF6A 3W7VA 4DB2A 1RAIA 5GQSA 2Q41A 3W6NA 4DWOA 3NUQA 1NJ5A 1CRZA 4IJQA 3MTAA 4DFDA 3C3PA 1GKLA 1P6QA 2VCHA 4MV3A 2KE5A 1PQ4A 5T6MA 5A2QA 3ZVMA 1ZH8A 3KSMA 4MYSA 3TSCA 4CCWA 3ZJTA 4XGQA 1QAOA 3EIHA 3FTFA 1HL7A 1H05A 1QE5A 3WWDA 2G70A 3U5ZB 4L57A 1SQGA 1I2DA 5F5XA 2X8AA 4BECA 3WP0A 2EF0A 3JV7A 1PKEA 1N2EA 3NR2A 5GONB 1AKWA 2H2HA 4ENRA 2QLBA 1INLA 1HWYA 3CIOA 1W1WA 4U0KA 2Z3VA 4L8LA 2C2BA 1K27A 1DS6A 3TDNA 1KRXA 5D8DA 4J4TA 4UFPA 3GK3A 2CUKA 2W0MA 3ESCA 4Y2UA 4QELA 3N6RA 4QOGA 3EDOA 1BWSA 2VWGA 3L0IB 3H2GA 1O94D 1ULSA 1JTVA 2WR8A 3FPGA 3V4OA 1GTG1 1FPQA 1QHXA 3LYLA 5GY7A 3J81A 5J59A 3EPKA 3K15A 3E0XA 5EKTA 2AG1A 5C80A 3ER8A 1JMKC 1XI2A 2JLRA 3NM6B 5D2CA 1C0EA 4RTLA 4NDNE 4P3NA 3N39C 4GBJA 5C5DA 3EVBA 4FSDA 4P0QB 3NV9A 4E5DA 5CA0B 1KI6A 2V9CA 5JXHA 2CXHA 2I3AA 2HHJA 1EJ2A 4UC0A 3BE4A 3RHTA 1PSDA 2TMYA 2GNPA 3RKSA 2QYSA 1BFDA 5FP0A 1G55A 1GTJ1 3PC6A 3ZH2A 1EZZA 3D8TA 4PCVA 4UM7A 1R50A 3BJRA 1P33A 1YZUA 4Q18A 2B4YA 3RDPA 4TS3A 4RQUA 5K1ZA 5GJBA 1UBSB 1LF5A 1IG0A 1XB2A 3LD9A 5BT9A 3P2YA 2W6PA 3ZZ0A 5DNDA 4RD1A 2WF6A 2EP7A 4XUDA 2G04A 2OGWA 1DG1G 3DV0B 2C1EA 1LS6A 3G2MA 4RZXA 5FBLB 1T0IA 1UINA 2QNRA 4HRXA 5CLGA 3SE7A 5JNVA 1G8PA 2IIPA 1RJ9B 2JCBA 3IJPA 3NNSA 5JWRA 3C1TA 1KY4A 5KREA 5DSTA 5FRDA 4BNIA 2GAAA 2WC1A 2EL9A 1EG2A 2CL6X 1A4IA 2ZTMA 4JSRA 1J00A 2AMLA 2HBRA 2NPIA 4R2XA 4BMPB 3L0BA 3Q8WA 2IZ7A 4Y0AA 4FZJA 2JCSA 3ETNA 3Q8XB 4FDVA 4B6EA 5C35A 4NFYA 4BX9A 4NBVA 3AK4A 2XZLA 4K3UA 5BSKA 2BKUA 5DTMA 2AEMA 2G5CA 2VSXA 4ND3A 1E89A 3ZWXA 1UKEA 1Q0QA 2BAGA 1UADA 1BE6A 3DMNA 1E2BA 2P6NA 5AOAA 3QKSB 3UOGA 1SAYA 1X38A 1LSOA 4G1BA 1RKXA 1XL1A 2IBMA 1P17A 2X41A 1DBPA 3JD4A 5BQ5A 1LPMA 2IUEA 3KOZA 1ZGCA 2R8ZA 4J1SA 2FQXA 2PL5A 2WE7A 3MYRA 2COEA 1JDUA 3ELUA 3GPDG 4RK0A 1QJ4A 1DBQA 4P0TA 3NYRA 4MV6A 4ZC1A 4M0PA 5GV8A 2KB0A 1BO6A 1Q7RA 3C3BA 2AR0A 2BEUB 3OTWA 4FE3A 2WUDA 4FIZA 1B8UA 1G5RA 1C7QA 1LDMA 1JP7A 1M6VA 2GK7A 3HG7A 4PM4A 4UFNA 2JFUA 4Z86A 3K5WA 1QH8A 3GI1A 4C2AA 4HS4A 1Q1NA 5JMWA 1J39A 3BRQA 2PUAA 3QYJA 3KZCA 4DJAA 3AM3A 3OVMA 3AIKA 4BLTA 1RXEA 1R6UA 4QFBA 3ICWA 2ATCA 2C04A 2PUDA 1XPJA 1HORA 1K4YA 1T3LA 3TNLA 1M7GA 4XYEA 3KEQA 3DOUA 2CXNA 4DUPA 4PHGA 1HE4A 2FETA 5ESRA 2PD3A 3BKWA 3TNDA 3T5BA 2Z09A 3EFEA 4KWEA 3RRNA 3GR6A 3L5OA 4LOIA 4NG4A 4S3MA 3ZLUA 3V8QA 3JYNA 1EHYA 2A0WA 5JO0A 2R5NA 3QKTA 3OJFA 2YOHA 3HRKA 3IP6A 5A0FA 3S2GA 4UM9D 2Q0QA 2IEAA 1Z2OX 3HPQA 4MI6A 1K68A 3KQVA 4IDCA 1PYDA 3PXEA 1X1QA 3IVXA 3VQTA 1U9IC 4NOMA 2YINC 1MHPA 1Y4UA 3KDPA 3ZCPA 3JQEA 3RABA 5JC1A 5G2OA 1IBKB 4UOQA 4F2GA 1N3LA 3L43A 1Y98A 1GR0A 1C0PA 1KPHA 2BWJA 3QVKA 4ZVTA 2H1RA 2QTAA 1Q2UA 3LCRA 5IBQA 3T7AA 4HVCA 1IBMB 4LAFA 4JC8A 3CS3A 4TV9B 4QHYA 1TZCA 4ZCQA 1TZBA 1YMVA 4PYJA 1CUBA 1Q21A 4OBEA 4D44A 4PCLA 3JZDA 4OP3A 2Q5QA 1G19A 5BSWA 1B16A 2FLWA 1QYCA 3NJRA 1DOAA 1RAFA 3BICA 3W2EA 4Q3NA 1M7BA 4H0CA 9LDTA 3C3AA 1MOSA 4G1VA 1FU4A 2B69A 4XDGA 2P91A 1C2TA 1DEAA 3VNAA 1WQ4A 1JDSA 2P2YA 3UTDA 1N5OX 3NDJA 3ZQKA 5FEUA 2GXSA 1UFKA 1BS2A 1A7UA 5HEKA 2RGBA 1PV2A 4PPGA 3B6JA 2IU0A 1WZEA 1J5EB 2VYFA 1FRQA 1GITA 4MVCA 3PC3A 3TDMA 1M1YB 2BFWA 1V6AA 2RONA 3VAAA 5A9SA 1ZY2A 2VK2A 3I2KA 1S1CA 4O4LF 1VJ1A 2MDTA 1T6YA 1DWOA 4UDYX 3HB1A 1KYTA 1DKRA 3RRYA 2VPPA 1ZUHA 5CCBA 1ZGGA 4K9QA 4MGYR 3UHAA 5JYDA 3VXKA 1BX0A 4MQBA 1QP8A 4JFAA 4UNNA 3V7YA 2AFIA 1ZWKA 2QI9F 3E5NA 5AVVA 4GVPA 4MVJF 1MEOA 2DHDA 4ZRMA 2X8JA 4LDNA 3T5AA 1T25A 3SDSA 4P5PA 2GYUA 1QBKC 1V25A 3QI7A 1C9JA 4LJLA 4XCVA 2H2AA 3AL3A 4HDCA 2LD4A 4MR9B 1Z16A 1SIWA 1MAHA 1MB0A 2JFZA 2PKYX 2E18A 4RJJA 1IHXA 3W5BA 4C2TA 3H5VA 3ZEIA 1EZ4A 3QELB 4HH3C 3REQA 3ZS9A 1QIJA 4TKMA 3T3NA 1G2PA 3HXKA 1YQTA 4IUYA 3Q8KA 2IY9A 1FFCA 2A5DA 3KUKA 3O8QB 1XZHA 4AP5A 1PK9A 3VYSB 2YCLA 1ZD4A 4QGHA 3RR2A 4DLVA 4HXFB 2BR4A 5EIEA 4GNKA 4XRGA 4UHFA 5F12A 1RPAA 4G01B 5T8KA 2TMGA 3L4JA 4DR5B 4YRJA 4ZYTA 2A5GA 1TQ4A 2BFFA 4DMKA 2B8WA 2HXYA 1ZYUA 3EG9A 1DB3A 3W9SA 1PEKE 3FLBA 4QJ3A 1IIBA 1JZSA 3CQ9A 4DDVA 1E58A 2PY6A 3EUWA 4B3GA 2RAFA 3GBVA 1NJGA 3M9XA 4NMHA 1B2LA 1UMCB 3TW8B 1U0FA 2BEWA 2ATIA 2FWJA 4QYXA 5F2EA 5FCDA 5FO0A 4CMEA 2W2OA 1JFVA 2VNSA 3PNBA 4YDHB 3BIFA 3AVYA 1PNTA 3TLZA 1EHCA 3BB4A 3PA8A 3CT4A 4NJMA 1EE2A 2Q21A 3F5MA 5H68A 3MEQA 2BTOA 3T8YA 1Z17A 4EVIA 1CCWA 3I01A 2R87A 2H18A 1NBIA 1U3WA 3DXYA 3P2OA 4H27A 3RJ9A 4AJEA 1I9GA 2I54A 3E7WA 1XJ0A 4KBFA 1AG9A 1F6DA 4NJEB 4NEQA 4QE3A 1QM5A 2FPKA 4UVEA 1RM0A 3WGHA 2BHSA 1RYEA 5C8YF 3TLGB 1ONBA 5CNIA 3KHUA 2QGFA 3FZYA 1FNBA 1XR3A 4JENA 1XZKA 1JFFA 2PBZA 4NE2A 1T3SA 5EI5A 5FB3A 3FNEA 4X1YB 3LDAA 3CX4A 4B32A 3WMRA 4A73A 1IZYA 3WL6A 1NVAA 5IUNC 2Q2VA 4JJ6A 3MN1A 5COQA 3D43A 1G8AA 1XBTA 5K09A 4D9KA 3OKFA 2VJYA 3DOIA 3ILHA 2G6TA 3ND9A 4NCKA 4OUDB 3TAUA 3FWPA 5FH9A 2HZ7A 1O96A 4ZXPA 3I61A 1SUPA 4KB5A 1X80A 2FPXA 5THXA 1O6ZA 2OP1A 1GG8A 3I72A 3ET4A 4LHYA 3GPCA 2W6QA 3AF2A 5LB4A 4TMFA 1K97A 3UMFA 1AQ6A 5CFZA 2V6IA 1JEQB 3D4OA 4BE4A 2PMDA 1P2TA 3X1YA 4EPTA 3R3XA 2AN5A 1RPNA 4KNYA 4II3A 5B2EA 1FXWA 1KPIA 4N41A 1QFXA 1SD1A 1S5PA 1ZNYA 3WXMA 1P7CA 2A0KA 4B6OA 4TX1A 2QG4A 1C30A 2FSPA 3MFYA 1P1JA 3NYQA 4D56A 5CEFA 1TB4A 2QX9A 1VDMA 1R27A 1VPLA 3H0CA 4HN4B 4KTTE 4LTNA 1PTJC 4UNPA 3O3NB 2EX4A 4I8IA 4DMRA 2Q9AA 3JQAA 4BP9A 3UV6A 1NN0A 1ZXLA 2YKGA 3ZC3A 3H3XA 3P32A 2CLLB 2BZ0A 1ENYA 1IHUA 3ABQB 4JLBA 4NYJR 2FW7A 2N46A 1YJ8A 2RHJA 4LXIA 5KTPA 4ACAA 3HBAA 4INAA 4ESHA 3A4YA 2ATXA 1KFBB 5F1YA 4EGCB 5F2NA 5LIRA 3GEMA 3GGJA 3SZGA 1NFRA 5DEIA 1Y9AA 2EDCA 3EVCA 2ZDGA 2YHIB 3IUEA 3LRTA 4KMRA 1Q83A 4JBNA 3WL3A 5KNCD 4MVJP 5CYPA 4W63A 3E58A 5HE9A 3U4DA 5HCNA 4YGXB 3FVWA 2V7BA 1K7EB 1W47A 1T5BA 2VIIA 3IE2A 4FGKA 2WHPB 4YCJA 2X9LA 1IU9A 4RD6A 4W7SA 4BNTA 2AI1A 1O6CA 2F43B 1J1UA 5A7FA 2RIPA 3FCSB 2A9JA 5ALKA 3FTDA 1Y5RA 2OCIA 2XF8A 5JRDS 3IL2A 2QW1A 4M6WB 4QRHA 2FCAA 4MA5A 2YQ5A 3N2GB 3O4RA 2FX2A 3E4CA 3KWMA 4MIKA 4RZIA 3VHXA 4TN5A 4B33A 4DMFA 1CE8B 1LJUA 1ZH0A 1G3MA 1ZD8A 3DL4A 4RKWA 2G67A 5JNLA 3KKEA 4MARA 3RO7A 2E89A 3FMFA 3HXPA 3IBTA 5CX1A 5EIBC 5TC4A 3OP1A 3VSCA 2BZGA 2HD4A 7MHTA 1GL6A 3PSHA 4NBTA 4FFRA 4CKEA 3K9GA 4DCCA 3KKMA 1FVHA 4MMZB 3IEUA 2IXDA 2Q8NA 3B6KA 3VC1A 2WJZB 1XQVA 2MYNA 1M74A 3EXHA 3JARB 1CKEA 3Q12A 3A6PC 2QD5A 5F98A 1DLIA 1G41A 2JBAA 2WDZA 2Y1LA 2Y3IA 2I2WA 1K7CA 1MEEA 1RZ3A 2G08A 1KF0A 3A4NA 3D6TB 3HBMA 3PS9A 4KLRA 4YRKA 2QF7A 4H0NA 3OE4A 4E08A 1PR4A 1Z0AA 3BXFA 5FNZA 1L4HA 4UEQA 4CHTA 2Q28A 1EEXB 2QP9X 3K1AA 5T4EA 1Y7IA 3F8SA 4DWWA 2V97A 4Y67A 4YIHA 1QYDA 3RM3A 3BTSA 2ZRIA 4MI1A 5CM9C 3RBXA 2VJDA 3ZZ1A 1TMYA 1E5VA 4BNNA 4LCBA 2PBLA 4N5DA 1DJPA 1SM4A 3OF3A 4ZFNA 3CVUA 2XGGA 5K3OA 1D6NA 3JX9A 3RSQA 5D7BA 3RYTC 2DPLA 4NCBA 1II8A 1R15A 4DBLE 2V0GA 2JGFA 2Q45A 3HJUA 3NHWA 1TTPB 3QJYA 5IT4A 3LKVA 5IEBA 5JFOA 1DARA 2GHTA 2OAP1 4NOLA 3AIMA 3C3JA 5JMPA 3VZDA 1K0UA 1R5OA 1WIWA 3D4BA 1VHWA 2PTGA 2C42A 1L5YA 2WMYA 3G0IA 4L4SA 1HEIA 3QY0A 2J3IA 3EBLA 2PWZA 3LX5A 2HRBA 1GNSA 2I6UA 3THOA 4WD3A 3K6KA 3VVBA 4F9TA 4PN3A 2G9QA 4ZGBA 1X7GA 3UYKA 2OC4A 2XCUA 3I5XA 1FFYA 3FB4A 4A2QA 4M83A 1XZQA 4DA0A 3IAHA 3HGMA 4TL7A 3RPEA 4S1OA 1O77A 4Y2VA 2AF3C 1U0LA 2OWEA 3M1YA 1PL6A 1FS4A 3KXPA 5ELLA 4ECEA 1FZTA 1I80A 4K6FA 4R2HA 4QQKA 3LL7A 5J63A 3R7FA 3T9BA 1G18A 1QR6A 1X7WB 3BZWA 2XQFA 5AXDA 1P7ZA 1DIRA 3EOBI 3QK7A 5CVVA 2TS1A 4KVZA 2IPLA 4D9MA 1Z2EA 3OEHA 3PC8C 4C7JA 1KXZA 1U81A 3NBUA 1H6AA 1Z74A 4EJ6A 2HO5A 2EIHA 3PUIA 4HR7A 4MKXA 4TSFD 4XW2A 2OK7A 1P72A 1O5OA 2ECQA 4MP3A 5ENVA 5HK8A 4D81A 1MBZA 1VKHA 2NOAA 2YS7A 4O4IF 3KTFA 4IJVA 3CLRD 4FNAA 4MV5A 2Y0EA 1N6PA 3K6RA 5TXGA 3TRFA 1R6AA 4PPNA 2EF1A 3Q7TA 1IN7A 1CRWG 3H5IA 4FOLA 4H1VA 2B61A 4II2A 4YUWA 2OCLA 3ZDXB 3NDBB 3CUEF 1Q1ZA 2PMWB 4FI3C 4LNUB 4M0MA 1TW3A 2JIOA 2J0UA 5AIAA 5AJWA 1YHZA 2Z3ZA 2KM1A 1CY6A 3FYDA 4GBED 2Z4RA 1QQBA 2H51A 2UVDA 3OEHD 3U4HA 1XRNA 2WWGA 1X7HA 2O2IA 2YYZA 1DSSG 2BE9A 4W1SA 5BRNA 3D6FA 5JAMA 1NP7A 3IPRA 1FYWA 2DPGA 4DY4A 3U81A 1E98A 3H75A 2VA8A 2DQKA 4KX5A 4X20A 2ZJBA 4F04A 2ZUWA 3A6ZA 2XA9A 3NHMA 3T99A 3ZCTA 1EP2B 5EIFA 5HQTA 2BGTA 1PI3A 1XQXA 1YWGO 5FBZA 2O48X 5BWCA 3ETCA 4KN5A 2PA0A 3PE3A 3G1UA 2FSIA 4M1EA 5ITWA 2O8VA 4D96A 2B92A 2CDAA 2CXPA 1N4AA 1H4SA 4UVGA 3ADBA 1RXIA 5T6BA 2CKMA 1Z29A 4NECA 3O4IA 4ZO9A 4KQMA 3GP8A 1GILA 2EW2A 3PL5A 1M0TA 4FFWA 4FGJA 3VTFA 1TZMA 2GZDA 1P2BA 3ZY6A 3NTQA 3FM9A 3I64A 5C18A 4P86A 1RWOA 2BGJA 5F2OA 3WLPA 2YHAA 1QTRA 1Q0SA 3FY4A 4K88A 1I0ZA 4N01A 4TLAA 1NU6A 4WESA 1E9BA 5HCIA 3WADA 3LOUA 4MAMA 3DUFB 4PIVA 2IYTA 1GVNB 4TOIA 3J81k 3X1MA 5EXSA 5I3CA 1DQSA 4Z4GA 5ITZA 2QMQA 1EGMB 3I09A 2CCJA 3PD0A 1I7SB 1Q6YA 2I33A 2O1EA 3ZDBA 2XEXA 1TA0A 3EMBA 3LUGA 4H7JA 2IW1A 4RVHA 5LA6B 4CT4B 4B8YA 4BNFA 4F5YA 3E22B 4E4TA 3CZ4A 2VHTA 4GQAA 3IV7A 4DSOA 1SXHA 1J2UA 3F47A 3AWIA 3W1EA 2EP8A 3NBKA 3O82A 4FOPA 5BUCA 1V45E 2PUEA 1BCSA 1UZAA 2HPAA 3N59A 1E2IA 4GBMA 3PQEA 1NDQA 2DR0A 4HWRA 1Z45A 2GBPA 1RI3A 3A3YA 4LYJA 2VYND 5IVIA 2Q5CA 1JEAA 3R6LA 4NHEA 1VHJA 3PIRA 1S3FA 1UXGA 3B5IA 3GJXC 3HDJA 4MB0A 4PCUA 3CW2A 4G86A 3E15A 1IVYA 1DEHA 3HFSA 1D1QA 3FHJA 4UBNA 4JGBA 1ADBA 2A4KA 2VXBA 2FW8A 3EF1A 1NQVA 2OHJA 4NU0A 2P1ZA 1O3YA 2P79A 3O8OA 1E6CA 1O4WA 4GLJA 4MUMA 3ZE9A 4DV0B 2B20A 2O8EB 2D2VA 3GRZA 2OHIA 4FDTA 5AK3A 4RNDB 2P9BA 3BZBA 3WNZA 2W6MA 3CRW1 5KYGA 4JYPA 1GZ3A 4GEGA 3BXHA 3GQBA 1PRYA 4N0MA 5DLYA 1M2FA 5EZQA 3M6AA 3PR3A 3U19A 1Y48E 2Z6AA 1NW7A 3DZDA 5B58T 4C3OB 3LT2A 1POWA 1VTKA 4D7AA 3GFVA 5JSYA 5ICEA 1H0RA 2BGUA 4F96A 1I32A 3RIMA 2DWCA 4PU0A 1EE1A 2QXUA 5CDSA 4HDAA 4B9EA 5IPFA 3IS3A 1KTVA 2MWMA 3JAKB 4UXHA 3WGVA 3IDAA 4L4UA 2W58A 1GPMA 2XOKD 4EHLA 1GO2A 4K6MA 1NJFA 1AGYA 4RXMA 3TRDA 1MPTA 1FTQA 3WBJA 1WMAA 4YI5A 4Q82A 1P1HA 4O3FA 3GVHA 2GPAA 1U3VA 1PJ3A 3AF0A 2RE8A 3JS5A 5IEJA 4MUYA 1UWLA 3T95A 3I9V1 2WWIA 5HKKA 4DKJA 2ZBDA 4H4EA 4PWZA 3WLQA 1MQAA 4HCJA 4BQOA 4YP0A 2J6CA 3QVLA 3CY6A 4ZI7B 2LBPA 4UASA 3MM4A 1E0KA 3RK1A 3PRKE 4J49A 1XF9A 2VDKB 2EYQA 1V1RB 3V4VB 4E0BA 4YRGA 2HK8A 3H2SA 4DS3A 2CHQA 1M1XB 3KKLA 4QZVA 4K9MA 5K45A 5A3VA 3WSVA 5CXQA 5HJ7A 2XKAA 4ZP1A 3VOBA 4LOLA 2HJVA 5F3WB 4ZCSA 2Y76A 2G40A 4R1OA 5BWOA 1TJ3A 3MJCA 1J25A 4JBIA 5ADWA 4EO9A 4BRUA 4CG0A 1LDEA 2UU9B 1YIOA 2PZAA 2H7YA 3CX8A 1ZM4A 4WADA 5CK5A 5CTAA 5DN9A 5ESDA 3K35A 5EMMA 2DKOA 2JKVA 3QV2A 1JU9A 5GGXA 4CCSA 3A6GA 4XJTA 5FBKA 4B5LA 4GYKA 4UXJA 3C6ZA 3YASA 5C2JB 5IMSA 3ESZA 2G0NA 3ETJA 2GF0A 3OZUA 4DTIA 1YBMA 1PDOA 1I6WA 2BFBB 3RFFA 3T5DA 2PFSA 1KO4A 3VTAA 5BV0A 4G0UA 4KO8A 3IBFA 1GLVA 3ZJ4A 3HJTA 1K9SA 2X42A 3OJOA 1Z3CA 3U1TA 3IPXA 4H9GA 4YCMA 1E69A 3SZLA 3AV3A 5EE9A 1VRWA 1NBHA 1E3WB 3TQIA 4OHYA 5HWSA 5J9FA 4X85A 2A0YA 4LF4B 3FPSA 4N7BA 4CEJA 4POOA 1EFAA 2LZ0A 1PUJA 4BKQA 2BL4A 4E2ZA 1SUAA 3AESA 4A1OA 2QP4A 1Z12A 2VJCA 1NYTA 1SBTA 3DLAA 3UGKA 3HA3A 2KMLA 3HXTA 1YONA 3A9UA 4QFCA 3D3KA 2WAOA 1QYWA 1JHYA 5I9BA 2BJVA 4RHEA 4MS4B 2R4TA 2O2HA 2AXNA 1YBAA 2P4EA 4DPKA 5GM1A 2OFWA 1OWOA 1RJWA 5COAA 2CHVA 2CLEB 3FSGA 3VU0A 1EJBA 1LFDB 5TB5A 1XHFA 1XFAA 2JS7A 4MQ4A 1XD2B 4YJ3A 3R9IA 2X7JA 1XYVA 4I81A 2VK1A 2ZS7A 1UFVA 3N2KB 2FDXA 3R41A 2OQVA 1HE5A 4DYVA 2R7NA 5ITVA 5L95A 4CDNA 1JALA 2I87A 1T5SA 1ZGAA 1WSDA 3OOSA 4NR0A 2R2AA 2VAPA 3L0YA 3M2PA 3Q6MA 1CZLA 1Y5NA 3D3WA 4KN6A 2B2XA 2B9EA 3FSGD 3SAJA 4B6RA 2IXTA 3V7UA 4ND1A 4QU0A 1JXMA 2XHZA 1JHZA 5EGSA 5IAJA 2FFJA 5JASA 2JK0A 2CVQA 1UP6A 5CVTA 4O5AA 2GMWA 5D87A 4A6XA 3QJGA 3PU6A 1ATZA 3OG9A 5C7OO 1W36D 2DB3A 1FE8A 1RWKA 1PZEA 1EMDA 1WRBA 2C1XA 1QGYA 2QW8A 1ISPA 1HDGO 3I23A 2NO6A 3L8GA 1PZXA 5CRIA 2DUUA 1CQJA 3SDBA 3OE7A 5HF9A 4L9SA 3UJ6A 2FQ1A 3QUAA 2RHDA 4PSAA 5CJ2A 3HXOA 4KX3A 2VJLA 4Z6KA 4BNMA 3FMOB 5KOJA 3ZI7A 3AUAA 4YUXA 1GPUA 8OHMA 2NW6A 2X2FA 3RC9A 1AY0A 5BQFA 4UBKA 2FJPA 1CJCA 1KIFA 3BJMA 2W2MA 1RT9A 2VHVA 3U2QA 5K3FA 2BM8A 5CA1F 3LE8A 4QRIA 3KL2A 4B7CA 1NPDA 1CUUA 3MWLA 2RHWA 1KJIA 4QEZA 3HVIA 1BIFA 4GPZA 1Z38A 1JA1A 3JVEA 1L7RA 3BPSA 3EGVA 1XTRA 1APBA 3TOSA 4CODB 4CM8B 1KJWA 2CXRA 1JA0A 1YL5A 1Z8DA 3NI2A 4IQGA 5DWQA 1MO6A 3IH5A 3TXXA 4GGOA 1ID8A 3EJ6A 1I10A 3EOAI 3ZHOA 1MT3A 1HRDA 2OBYA 3HUDA 4PGFA 2GJ4A 5J2TB 1UM9B 3WK9A 1N34B 1HEYA 5ALIA 3FAKA 2HA0A 1BDBA 4OHMA 4EQ6A 4QTTB 2XD4A 4GI2A 3UT5A 5ARDA 2QR3A 1PHPA 2WUGA 4YFVA 2F62A 1K2VN 3L1IA 1AKEA 3DEHA 2D0PB 3R40A 1EBUA 4PZ9A 1MVLA 1PLJA 2P3OA 3NKFA 4BWYA 1ZICA 4IVQA 4RSGA 3ZJ5A 1Q17A 6ABPA 1YHNA 3HH8A 3PEUA 1HURA 2R4UA 3IOMA 4P81A 2J3JA 4FW8A 4WA8A 1N2ZA 1AO0A 2BMJA 2BGIA 3H5AA 5G4KB 1XDZA 1XLUA 2ATEA 4DJJA 2E82A 1K1EA 1VJDA 2JI8A 1L7PA 1PO7A 5DYIA 4F86A 4BFYA 3I5UA 1IEQA 2V6BA 3F9RA 2XECA 2UKDA 4BLOA 3W7AA 5KSYA 1TE2A 2Q2NA 1OXMA 1XX6A 4W9NA 3LOQA 2G80A 1NW9B 2VHXA 2C4UA 3RC1A 3D4NA 2M6LA 2C7BA 2QAJA 3GFPA 1SVMA 4FD2A 3BXPA 2QTLA 4L51A 5I7AA 1XJ5A 5FBVB 1W88A 1OFHA 2O50A 2H3EA 1JX6A 3LC2O 4OK3A 4YRAA 3F4LA 2J4FA 2PS9A 3CRRA 2OUIA 1M8GA 4NCJA 3THRA 4W1RA 4YRDA 5KBYA 4PAOA 2IVZA 1W93A 2GVDC 4HDOB 2DHEA 4OGLA 3GIDA 3TF5A 5G53C 2JRLA 2OPHA 1RPJA 1W9MA 3PQ6A 4M55A 5FTWA 1U28C 5GPBA 2ZQYA 1WZNA 4WIAA 1YHYA 4ZODA 1WP4A 3W8RA 3C5HA 4Q1DA 4X84A 3UVEA 3BK7A 2BFDB 3BJEA 3L6CA 3WGKA 3EDYA 2D5LA 1JBEA 1OTYA 2R8PA 1RE0A 1M34B 5FBWB 3V2UA 3RIHA 3DL0A 4I4TF 1V4BA 4XASA 4KAAA 2Q4BA 3NRJA 4MS3B 2XVAA 3AETA 1WL8A 2Q0XA 5FR2A 4RPJA 1WY5A 2PRYA 4ZEWA 1ZMTA 3ZUGA 4TPKA 5EUCA 2JIZD 4AX4A 4E03A 3UXHA 2CLCX 1QFZA 1JT9A 3G9TA 4D9IA 5B7PA 5FX2A 3COYA 3DFKA 3K94A 2RC5A 2H65A 2ODPA 2QBYA 3C15C 1VI2A 1DFGA 2NSYA 3CGWA 1TCCA 1L7EA 2ANCA 3A1CA 4IIJA 5GVRA 3RT1A 4URVR 3F6YA 4B80A 4NQZA 1PJCA 2AQIA 4Y6LA 2VWHA 4US1R 3KTAB 3G5AA 1XTKA 4OLFA 3W2GA 4BNJA 4A0HA 5I7RA 3JWGA 4IDBA 4O4JF 2QVCA 2AC2A 2NQTA 1AMNA 1BXRB 1B93A 1GNTA 2VBFA 3ZR4B 4QQRA 4IF6A 4MUAA 1OGIA 2X9GA 1JHAA 1HI9A 4S1VA 4PYIA 3WNCA 4XKJA 4OOEA 4QUIA 1XU7A 2HQRA 3EIEA 3T9EA 1AK1A 2HXSA 1CY1A 2ZJZA 2FXVA 5EJEA 1Q6ZA 2JH8A 3PX2A 2AJLI 4J07A 3BKXA 2XE6A 2AFVA 1QCYA 3ABOB 3C6MA 5DHPA 3TIIA 3G0CA 3IXQA 4CQLA 2BH2A 4U8HA 2ODTX 3BJZA 4LTDA 2XGSA 5EJAA 1W0CA 4JP2A 5IH3A 2DT8A 1J8DA 5D51S 3VISA 1HO3A 1IEWA 1JLMA 2QQFA 3QBTA 4XM1A 2Y0DA 1B4DA 4MNTA 3NHBA 1MU0A 4O8CA 3D3JA 3IUBA 4W5RA 1II0A 3DZHA 4Y9TA 3UMSA 1ODCA 4Z1MA 1YFKA 3EIUA 1TIBA 2PAAA 3C6KA 4IDHA 5TMDA 1KDRA 4C06A 1DO8A 3HY6A 4ZK6A 1NR7A 4Y6SA 2FWMX 3D5QA 2VJMB 3IXLA 3JD1A 4LRSB 2Z6QA 1NRXA 3R7WB 1PV4A 2FWBA 4ZGWA 3HO8A 1GZUA 1BXGA 4YBZA 4HB3A 3QVWA 5EIHA 1GM5A 3FUWA 3O3CA 2GH1A 2FUEA 4G26A 2NLOA 4BUJA 2J9FB 1ULUA 3KYDB 4KIJA 4EYQA 5AUQA 4CQMD 4H4CA 2ZI7A 1QYIA 4N47A 2WG0A 1J09A 2EHJA 4JJGA 2JA2A 3TMAA 3WIEA 1I2AA 2Q2OA 4ZVRA 5BR7A 3QBVA 3E3OA 2E7ZA 3IUNA 3CINA 3JYHA 3Q85A 4RFSB 1CY4A 4N3CA 2RMKA 1QGUA 2HIMA 2O7SA 3WHLA 3D3NA 1BFUA 3KLPX 3MB5A 4LRTB 1FFGA 1CNEA 2EYUA 4FMDF 1GZVA 1QQ6A 3UPUA 1L3CA 2DJIA 3NHPA 3AQIA 4F4HA 2P8JA 2C98A 1TQ2A 2BPOA 1J5PA 1GPNA 2REQB 4D57A 4EX6A 3A4TA 3R0IA 4QUKA 1GGFA 2IU4A 2Y1WA 2GEKA 2JFPA 3AF1A 3R3JA 1GPYA 4E30A 1PYOA 1A76A 1KK3A 2IUTA 3TCXB 1L4NA 4BEWA 1MAUA 2VRNA 4HQ6A 2XTNA 3JWEA 4DHWA 1L1RA 2J07A 3JYOA 4OMUA 4B17A 3FZEA 5IVHA 5E3HA 4O0MA 3LPDA 2FSGA 2RARA 1EWTA 1U0JA 2DHRA 2PWYA 3A9RA 5AMXA 3S5UA 1IDOA 2B36A 3FFAA 1P2SA 4BWFB 3VGJA 3Q3IA 5CXUA 4QYIA 1PF7E 1SXJA 1WP9A 3H2YA 4N5MA 4BC0A 1AKMA 4HYEA 3U0VA 4ZHQF 1XPOA 4LEIA 2ZREA 1PD0A 5T3YA 3LP5A 1CVRA 3FRIA 4TVKA 4BMZA 1XTZA 2MR6A 1FQKA 2NVOA 5IANA 4L7VA 1ZM9A 1BN6A 1IFXA 1OFUA 1RZVA 4YROA 4ECAA 4UUAA 1AQUA 1AK9A 3H0KA 3UAZA 4C6RA 4F3NA 3K5PA 3UMVA 1VCHA 3DEFA 3BFJA 1E2PA 4M1WA 4DJ5X 3UXMA 3JXEA 2BZ1A 1U1GA 1C3JA 3U7HB 1SXJD 5I5GA 2UZAA 4BTVA 3AVXA 4TTTS 3FMGA 2ZPTX 4YLGA 2PL9A 1HFKA 1JS1X 1OQAA 2RKWA 1MAWA 3KPUA 3VJKA 521PA 4CKBB 4NNJA 3NNNA 4GD3Q 5A4IS 3DYVA 1HL3A 5E4FA 2A9QA 5BYJA 4D5EA 1JKJB 4F3RA 2DPYA 4QASA 2AOTA 3G8CA 3H97A 4NBRA 2I6TA 4QM7A 3QVGA 3ES9A 3GCWA 1C29B 3QXSA 1YRLA 3QIAA 5FWNA 5LMUB 4KO2S 4RA9B 3DFUA 3W2TA 4X61A 3N74A 1NUSA 1PG5A 1FMLA 5CFOA 4UMVA 4RY9A 4LBYA 1MHTA 3EXG1 2G4CA 3Q7IA 4RQTA 4GM4A 3WGMA 1N6KA 1KGSA 1ZM2A 4FGZA 2ONJA 4AJHA 1YCGA 2WD7B 1RR6A 3C70A 4GGPA 4INPA 3DT9A 4R8RA 3HDGA 5H5JA 2PL1A 5JAZA 2EGGA 721PA 3PDCA 1TPYA 4X1IA 1N0IA 3IT2A 1NVUQ 4C7OA 1JXAA 3E9YA 4OSEA 2ZVDA 1UBLS 3FBTA 3VMMA 4CRWB 3QVXA 5LU9A 2H0QA 3OZCA 4HAOA 1M8PA 1RI1A 3BB1A 3M4XA 4TTSA 5AM3A 1UK7A 2JFWA 4OB6A 3WNDA 3LWZA 1HFWA 5G0VA 4EKYA 3VH2A 1DKUA 2VPZA 1L4YA 4BQNA 1XEAA 1WD7A 4DL9A 4JBWA 1TK3A 3R3HA 5FBQB 3WGUA 1FUUA 5K6AA 4LSMA 3FNGA 2RH8A 1J4AA 3ADOA 1RKBA 3A27A 1AB6A 2W2TA 1U3GA 1GNPA 1MX5A 2IUYA 1Y9JA 3NW9A 3OZIA 2PZFA 3AILA 3RYCA 2K2WA 3JYLA 5DTEA 3ZE2B 1ECJA 4EF6A 2A5LA 4XPIB 5ERXA 3N8HA 1VCMA 2GEBA 3INRA 1PW7A 2NT3A 1B2RA 1C9DB 1CDOA 4U9HS 1P0CA 3JVIA 3KAQA 4TTQA 1SKAA 1D2CA 4WZBA 4OHUA 2W6IA 3W2FA 1DADA 2PR7A 1P60A 5CCEA 3E9NA 3NXKA 4YRCA 3L0DA 1SBNE 4HDMA 1P0FA 3IUSA 1LTHR 4KI0A 5KQSA 2BFOA 2G63A 3MCZA 4EX7A 1WF3A 4EDHA 6ADHA 3L07A 2C9OA 1W2HA 2C99A 3H3FA 3RUDA 1FTSA 3VYUB 2QNIA 5J5VA 1K7FB 2L82A 1EDBA 2IV3A 1OCEA 2PH1A 3GL9A 5I4IA 1X39A 2FFAA 1E2HA 1LV7A 1FB5A 1WD5A 3TG8A 1T6BY 2G8LA 3QX7A 3V4ZA 1QGED 2CMHA 1GN9A 4LG1A 5H59A 4GLFA 2Z1DA 5CYOA 5ILGA 4JI4B 5J1TB 3B9QA 4KYIB 3IR6A 4GS5A 3T9FA 3ZV7A 2ZETA 1JU3A 4NF2A 3U4QA 1REQA 1N7GA 1H2FA 1G4UR 3FROA 2AW3A 2O0JA 3QFHA 4IJMA 4M8SA 3CNHA 2ZTLA 5K4HA 2BVNA 2J5RA 2XQVA 3AR6A 5JS8A 3IAXA 4TROA 3E9QA 1EX7A 3VH3A 1AQJA 1X1DA 3GYGA 5LFAA 3OPYB 1E96A 1ZRNA 3MLAA 4KIUA 4L27A 4CNBA 4C0JA 1V16B 1ULZA 1XQ1A 4TLBA 4A2PA 2I6XA 4PYRA 1GNVA 2QOEA 4AMYA 1THMA 1XQ9A 1L8OA 2HLDD 4YRSA 5I7UA 3FR8A 3IB3A 1UC5B 5DT2A 3MT9A 5BNZA 5KYWA 2VDJA 1EFTA 2ZM6B 1E9DA 5SZHB 2I6FA 4GWLA 4CN9A 1FU8A 3JVDA 4WXYB 2QG9A 5EWLA 4ZT2A 1OPRA 1OXUA 1VKZA 2HCTA 3N5KA 3PHLA 1K06A 4PIPA 4EB8A 4C0BA 1R3UA 3AUKA 5FIUA 5KYXB 2P62A 4I1PA 4MVJH 1MJNA 2CFOA 1X1TA 3B6ZA 2R1VB 3JQ6A 1ZK4A 4JXJA 1JAHA 4G9BA 4F8EA 5BMVF 2B6NA 1YZQA 1KVQA 3EDMA 2F3TA 3VBEA 3KLNA 2H1WA 4M9CA 1K89A 3L46A 3EFOA 2CHFA 4B8WA 1CFZA 1XMSA 2EP5A 1WXQA 4ZU6X 4OK6A 2N1BA 2FUG6 4YRNA 4L3VA 1OVGA 3JQQA 5FD8A 4RTRA 3K9BA 5JAPA 2LDXA 2YNMA 5DJ5A 1A9OA 3HKDA 4Q1CA 1QZXA 3DXZA 2RJOA 4F84A 1JJVA 3NGXA 3QXHA 3WWCA 3H8SA 4OEHA 5CIWA 3QUTA 4UE6A 5C3MA 5KQMA 3B9BA 4DXDA 2C03A 1A9RA 3HM9A 3NJ8A 3O4VA 1QP7A 4HWOA 1KETA 3S2FA 3LO8A 5AW1A 3U1VA 1EQ2A 4LECA 4ZTBA 2CMFA 1H6DA 1X0XA 1S4MA 2RGYA 3DWGA 4NFHA 4EB3A 3CM0A 4M9RA 1NR5A 2WJ6A 3DEIA 1U4NA 1FCJA 1PK7A 2IFTA 4PYQA 2GK4A 2VHCA 1IY0A 4QO8A 1T0PA 1OH6A 1PFWA 3S2EA 1SZJG 3O95A 1I1HA 2X1VA 4UUQA 5T8KC 3PQCA 3ROGA 3I28A 4ESVA 4MWSA 3NCTA 2QMEA 2QN3A 2OE2A 3QGMA 5CT6A 2DQYA 1MMFB 1L5SA 1Z5PA 2VL7A 5A5EA 3QW2A 3DV2A 1LWOA 4RVCA 4F5WA 5JH7A 1OFUX 5GP1A 3TIXB 1HNWB 1DDOA 3TR6A 4JLVA 3TD9A 3OLXA 4AP9A 5BP7A 2FFQA 2IBTA 1MGOA 5E7IA 1ABFA 4BNXA 3DZGA 3GLUA 2X0FA 4Z8XA 2HMVA 2H2GA 3IP7A 5ALJA 4CMEC 5D5QA 3AEQB 3VPSA 2E4YA 4CKZA 3FPCA 1FJGB 3NTXA 2HEIA 2ZQZA 1CUFA 1T4BA 2AFHA 1H2WA 2BI8A 4Q19A 3H7IA 4QGSA 4IJ6A 3EXIA 3CVJA 1GZSA 4BQSA 1XLVA 5DSXA 1U2QA 3GUCA 2IYUA 1JGTA 1A2QA 4IMIB 2J9YB 4EW6A 1H42A 4F6RB 2ZYWX 3RYIA 1IY2A 2QN2A 1U31A 1DKLA 1U0TA 2ZAMA 2QRMA 2HRRA 3LL4A 1LDGA 1H2BA 5E38A 3JD2A 3I76A 3OWXA 3P7MA 3QTBA 3WGZA 2NU9A 1N36B 3O73A 1SPBS 1FX1A 2CDRA 4P38A 1XEXA 2JLWA 4BKMA 4DADA 3FTEA 3OIUA 3O0DA 4EDFA 1USVA 2D13A 2PMKA 2QU7A 4LYFA 4I9GA 4L8YA 4AC9A 3D8HA 1EP3B 2HAEA 4IIXA 2WYOA 4F9EA 2DZDA 1Z4PX 1RLTA 4N76A 2DERA 3AT1A 2B1RA 1AE1A 3FIJA 1NV8A 3KXLA 4FYKA 4U5QA 2NUAB 4DQXA 4M89A 5KCZA 1O0CA 1H0HA 2JGJA 3EQZA 4PLCA 4KXXA 3DYBA 1HC7A 1X1CA 5B7GA 1PX0A 5AJYA 2O3QA 3DD5A 1KIMA 3WRVA 3UC9A 2FUCA 2ZIXB 2BFEA 1LS1A 1MB4A 1MABA 1ZITA 4MUBA 1A3CA 4CLEA 4EYEA 1JEDA 2LGJA 1SXGA 4HVLA 1H5NA 4BFCA 3BMNA 3TD6A 2I6GA 1UKZA 2IZ0A 3QX8A 2ZBGA 3OIWA 4HDRB 4I5DA 5B4VA 1KWGA 5C52B 1SD2A 2UYGA 1PS8A 1KI1A 1M3SA 1RRVA 4BKOA 5LKRA 3UHPA 3VYWA 3K71B 1ZU4A 2B7CA 4H7EA 5F5NA 1YL6A 5DIZA 5TRTA 1KZ6A 3GDWA 4RTPA 4IDAA 1P1KA 2EFJA 4P4TA 4NBLA 2TSYB 5AHOA 2HR1A 1KDVA 2XUGA 4H60A 5BSTA 4MW1A 1N7JA 3CSUA 1K86A 1U3FA 3I5AA 3EF3A 5CNMA 5FPTA 3UH0A 4GPIB 4ZOLA 3GEDA 5CA0F 3AGQA 5E0KB 4ZMRA 3GLIB 3F5DA 3G8DA 1QCCA 3A0RB 3FCYA 4X8OA 4DJFC 2WPDD 4W8GA 2XDWA 3ONFA 3ZWVA 4GKKB 2QR2A 2DPXA 4C7KA 2EV9A 2OEPA 1LQTA 1AKQA 1GGMA 1RM4A 5H3CA 4ZJZA 3A6HA 3H13A 3TLCA 2HB6A 1OJ7A 3DBLA 3MMPA 5JSUA 3DGFC 4LJ6A 1ZL2A 5L9AA 2OGSA 1MRSA 2JHFA 3G8BA 2EKZA 5KVCA 1A5SB 1WKCA 5FWYA 3NOOA 3AB8A 4LI0A 4BEBA 4WBNB 4GZMA 2WKSA 2H85A 4FP9A 4Q00A 4QXMA 5IFKA 1YUMA 3AF3A 3IP8A 2AJ8A 2SECE 3BHJA 1JRLA 4G89A 1D3AA 3SS7X 3IPCA 1JWAB 4CTMA 1ZSVA 1KDZA 3I73A 1Q3TA 2ZR8A 2IH5A 4UCQA 1Y6ZA 1BA2A 4HKTA 2I62A 2F1HA 2XYHA 4FJ1A 2J48A 4UZEA 3ZBPA 4B76A 1JSLA 5IWCA 1Q0RA 2P9QA 3V3KA 2VHZA 3H18A 1Z6GA 3O7MA 3EXHC 2JW5A 4HG2A 4HY3A 3E70C 1G9XA 3O9MA 4ZZIA 3ADDA 4NAUA 2NG1A 2HHLA 1A9TA 2R9VA 3CLTD 1NRIA 4P5EA 1D2NA 4QG3A 4TQAA 5JR3A 3MHTA 2J45A 1NUHA 4Z0TA 2IXAA 2AYZA 3IAFA 4LWPA 4HX9A 1XCGB 2RAVA 4WGFA 1GDHA 2QL6A 4WMLA 1XEFA 1KVRA 1DX9A 2WP0A 1PGOA 2ZYSA 4WKBA 1RVDA 1RAAA 4AXBA 3PTAA 1M66A 3S81A 1RHUA 3DG9A 4KSBA 5EHXA 4J29A 3DHYA 2CMDA 1P8AA 3ZWCA 3CJQA 4JLJA 3RRZA 5DHUA 3PPVA 1GPAA 4M87A 3OZFA 3ETGA 5HILA 1YC5A 2YZNA 5IHPA 4S04A 5FWDA 5ERYA 1W85A 2BMVA 3I52A 2C00A 1OI7A 1IJBA 2HIGA 1JSZA 2A1TR 4L02A 1MP0A 3AIIA 1JA9A 2I5PO 5GJCA 1NOKA 5BV2P 5L3SA 4TYYA 1UXOA 1ATIA 2WF7A 3O4HA 5FL7A 4YV0A 4LISA 3WLAA 4Q03A 1FFSA 4MR7A 1XHEA 3PCTA 1U9CA 5E2AA 1QVRA 5PGMA 1E0SA 2IYYA 2YX1A 3MINA 2YR0A 3LOPA 1AZLA 4MRPA 1KY5A 1KI6B 1RDFA 1UDBA 2RBGA 3LQYA 3U3JA 3UWSA 1VSQA 3T94A 1VLLA 5CEJA 3IKJA 1O0BA 4RCZA 4YP1A 1PTKA 1IUOA 1L4UA 3CB4A 1E5QA 1QLWA 1JAIA 1T1GA 5AK4A 4ZCPA 5LBTA 3SVLA 1MFZA 3NRCA 1PR3A 3LXXA 2CW5A 3HE3A 2FG7C 1W2GA 4L07A 3R9XA 1M6WA 2ZB2A 3CLRC 4RK7A 2QE6A 3NP9A 2G4LA 3TI7A 4A5SA 1XVUA 4KOAA 2PUJA 1NDHA 1SK9A 1TK9A 1ORDA 2J33A 3OMWA 4YYEA 3U17A 4QU5A 4DUGA 3ASYA 1N5KA 2C92A 3KQOA 2X1LA 3MCVA 4N03A 4HRVA 2X0EA 5KIAA 3OTQA 4IWXA 3U3XA 3W5CA 4WOCA 2FOLA 3ZLJA 4TV9F 2QZJA 3HP7A 3GVPA 4B79A 3M2TA 1I36A 4HAZA 1ZXXA 4OU5A 1CY8A 1SH7A 2H31A 3EIQA 3OC6A 2C8VA 4KYTA 1N8SA 3JR7A 4B7UA 3E9EA 1T3ZA 3AHFA 3EJWA 5DIFA 2JLBA 3COWA 3BK2A 4OXXA 2UUOA 4IH4A 3C6BA 4C6HA 4DKXA 2HBYA 3AVQA 4NMWA 4HZUA 4BAUA 4DUGD 1GNLA 5EQDA 4P34A 3UJ7A 1CUHA 3RU7A 2GAIA 3VFDA 5AW2A 1N6OA 3CEJA 1XKQA 2E6UX 3D3EA 2J8ZA 4HC4A 3DAPA 4Q9JA 5K3BA 4BFLA 4CCYB 2ZCJA 2WJ3A 1A7AA 2GKOA 4LC1A 4TQ9A 3HK2A 4Q9LA 1M6VB 3NORA 2D2FA 2YVQA 4RPLA 1QH8B 2GN1A 3CVOA 3JCZA 4MX8A 1DC3A 1TXGA 5KDLA 3UXEA 3WQRA 4CNQA 1BX1A 4QUEA 2M2IA 3U9TA 2RHBA 4RGYA 1ZH4A 4RS4A 1AJEA 5HMMA 3EGEA 5L7YA 3GMDA 1EK0A 1N9KA 4UM9B 3E7XA 1RHQA 3AH8A 3GROA 3D6HA 4MGKR 5TS2A 1XJWA 3FSEA 5JSZA 3EARA 4DV7B 2EKLA 1QCZA 2IEZA 3KUUA 1H23A 5FNVA 3L41A 3VDNB 4C6TA 4UDNA 4Q24A 4C4AA 4EMTA 1Z5GA 3QXXA 3UOAB 4WK2B 1NMXA 4J9VA 4F46A 2H1LA 5JSKA 3DDCA 1FYVA 3IA7A 2JB9A 2WOOA 4O2AA 5REQA 2PGOA 3T4XA 3HB7A 1FSGA 4BE9A 5IT9A 3WO1A 3KO8A 2VJPA 1WBBA 4ARIA 1EGVB 5FUVA 3SHWA 4LDZA 2C95A 3T1QA 3HYSA 4QOJA 3LUJA 1MCZA 1BX3A 1E1QA 2ASEA 2YRWA 3RVLA 2ZROA 3P20A 4Q4AA 2GDJA 4INJA 4RD3A 1WABA 1J23A 4GMHA 4JB3A 2OBBA 2DTDA 2XUAA 3DM9B 4G63A 2P5TB 2IYRA 3R7NA 3WKCA 4CDRA 4YBRA 3KK0A 4EA8A 3WIBA 1Z0DA 2XB2A 1D2EA 1W6UA 2O3TA 3FWYA 3T52A 1F9AA 3BFPA 4XVQA 2CEAA 4KZPA 2VYVA 3L9XA 4L0MA 4LJSA 4GQIA 3V1NA 3T3HA 1YDHA 3A6EA 2WM2A 4GVLA 1KAQA 1E1QD 2XEDA 3V5NA 3CTPA 5CBKA 2XGJA 1T8YA 4JBYA 3FGOA 1RI4A 3D8UA 3OZ7A 4GX5A 2HRCA 3MT8A 2W90A 1JYFA 4K9DA 2EZ9A 4UEJA 1JAYA 1ULAA 3A06A 4WCFC 5EXTA 4XAQA 3NC1C 3OQOA 4Y1RA 4BGUA 1HFEL 1BMDA 1AKRA 1X7DA 2XUOA 3HFGA 3MBIA 1M67A 2PS0A 4F60A 5BWNA 5K3EA 1M8KA 5ES4B 4BAZA 3ASUA 4LV6A 2CE2X 3O94A 2FI1A 5A9SB 3V80A 4JVMA 2JEOA 1QF7A 3DVRX 1U0EA 2CWWA 3T5MA 3AHHA 3U1BA 1K88A 1RKVA 3A1FA 5FR1A 4FVTA 4U7JA 3GAAA 3H5WA 4Y18A 1F5NA 2LVBA 3HU3A 5DPMA 2O8DA 3MTBA 2AFIB 1YB1A 3TPZA 2XWQA 3Q5GA 1U7UA 2GBIA 5D00A 3QE9Y 2X8JB 2R6GA 5HFAA 4MVYA 5K8VA 2BV3A 3VO9A 1RZRA 5AVRA 4KPYA 1NLMA 1PQPA 2B1JA 1B0UA 2I99A 2P4UA 2H4HA 4U0JA 3GRUA 4G4GA 2WE8A 4DBZA 1T2VA 5IF9A 1N5RA 2H8GA 1TO6A 1Y1QA 2GJ8A 3BORA 3LT1A 3AR8A 4PZ0A 2Q4EA 3REQB 3VH1A 1HDEA 1WHSA 2MSLA 4WXRA 3FI0A 5TEWA 2X3UA 3U7QA 3BL6A 3CHYA 1ESEA 1JDZA 5DCYA 4H15A 1CTQA 3VR3A 2B37A 4QNRA 3MJSA 1DC6A 4WZAA 1H2HA 5BWBA 3MILA 1RZRD 4ZO8A 1C4OA 4CIBA 1UBUS 3PXCX 4CIXA 1RMTA 1QRDA 3NBYC 3K9LA 1QUFA 2GM9A 4TQUS 2PNJA 4JWTA 1JT2A 2ADMA 5K2MA 5CITA 3EDQA 4YCSA 2BFFB 3OQHA 3KQPA 3EG9B 2NO0A 3N7AA 1YQWA 3C8UA 3CZMA 4L8GA 1BMTA 1P4SA 1VYTA 1CU1A 5EZSA 3VR3D 4ZYYA 5JJLA 2QPLA 3MTIA 4MQLA 1QZZA 4XFDA 3SLKA 3S68A 2J0EA 1I30A 2BEWB 1B1AA 3DVSX 4GICA 4MUXA 4D3ZA 1MW8X 4EAQA 1YRYE 3ZWWA 4I4CA 3JQ8A 1SHKA 4AQDA 3TIVA 2HPHA 4IVRA 4NJMB 2R00A 4PYNA 5ENDA 1P2FA 5G41A 3I39X 3B70A 1Q7BA 3IE1A 4I5GA 4ZZ2A 2ZYIA 1QOZA 3EPPA 2D0OB 4YDQA 3Q9LA 1FUIA 5JEEA 1VQ1A 5TLSA 2IWHA 3P9YA 2R751 3MRSA 8MHTA 5BN1A 4BJ5A 5BNTA 3OFND 4FT2A 4ZQIA 1TVKA 5H9VA 1WW8A 5AW7A 1JFFB 4FSHA 4CWAA 1T9KA 3G7NA 5FFMA 1HA3A 1YMUA 2C07A 2J0VA 1HOTA 2V7QA 3MT0A 4FEEA 1Y7LA 1SRQA 1SUCA 5IU6A 1MO4A 7YASA 3NIWA 1CZRA 3QKRA 3OJEA 1O96B 4FIDA 2R3SA 1X80B 1TEXA 4P84A 1XDDA 2Q8QA 4G9EA 5K05A 2FGJA 4KN9S 4W5NA 1IBRA 1Q1AA 3IXMA 4YP7A 4RJIA 4U7GA 3W2HA 2OFFA 2PGXA 5A6SA 3DF7A 1VE7A 4G41A 3TINA 4AECA 4ZDIA 4FR2A 4IG4A 4FX2A 4PNZA 1T15A 2DUWA 2KYRA 4MQ5A 1LPOA 3C43A 1N5MA 4EKDA 4W5TA 1CDDA 3KHTA 5FI1B 2Z2XA 3HCEA 1C30B 3F6SA 4FQ5A 3VC3A 5B6PA 4NXNB 4NXMB 5CT4A 2Z2ZA 3HDQA 3BMXA 2QMYA 4EZIA 3A1VA 4FYIA 1BKSB 2CN1A 1S2OA 1Q12A 1C8LA 1C8BA 4C4PA 1NQ5A 3JZIA 3V55A 3G0GA 4H3VA 3O8DA 3JQAB 4KITB 4Y2GA 4S24A 1C1YA 2NVWA 3AIOA 1TA4A 3KKZA 3CU5A 4RIIA 1K6MA 3G8AA 4DTCA 4PICA 4PRKA 2JJYA 3D1LA 3SCZA 4X64B 1J8FA 1Y3CE 5DBFA 1ZIOA 2Y71A 1IAQA 4DDMA 1YI1A 3EC1A 3GVXA 1T4GA 1VB5A 1ZJ5A 4GXRA 4LHZA 4MW4A 1Z0KA 3HJRA 3P4YA 3E18A 2DWOA 3NWPA 2ODAA 3AKZA 1Z6XA 2JFFA 1Q7GA 5JZBA 4DQUA 3L6BA 5U9CA 5F3DA 3AR3A 2E48A 1KRWA 2O4CA 1VE1A 4X45A 4ZXFA 3SJ7A 2NO1A 4AP6A 3OTIA 1T0BA 3IV6A 4QHSA 4Q12A 5DBHX 1RYDA 2G1AA 2ROQA 4WW0A 2OC9A 3DMRA 4TZ6A 1VIYA 2A57A 4ROTA 1WUKS 3CUSA 1SIOA 2ZWAA 3CURA 4P3YA 3VHXB 1RJGA 4H17A 2I4LA 2WYIA 4I55F 1ABEA 2Q27A 1UXJA 4X6LA 5CX1B 3SICE 3RJMA 1K8YB 4OATA 3HABA 4JMPA 4CKEB 1CZKA 4OX9B 1A8SA 3CR3C 4WH0A 2AW5A 2K2QB 1YDFA 4C4YA 3V1UA 1V9SA 3H8WA 1L5RA 1YSCA 4JA0A 5E8RA 3SMQA 3CPEA 3TZCA 1PHRA 1MN6A 2VLIA 5D01A 3EZYA 5FOWA 5L3QA 1ACJA 3EXHB 5ICFA 2A0FA 3BILA 3RVNA 4IZHA 3THWB 4BXOB 4IKOA 4DA6A 1C1XA 1BFKA 4ZU1X 3ANTA 5TEVA 1LI4A 2VFAA 4NCIA 1H93A 3VPBA 4XSGA 5HXAA 2NTVA 2DBZA 2DSNA 4FGLA 1WXIA 1U4OA 1Z7GA 3K1AB 5WRFA 4JJ4A 5LLSA 5A4DA 2PFKA 2ZR0A 2Q46A 2RD2A 2IEGA 4BV2A 3EMDA 3FGZA 3B9PA 5DT9A 4DWVA 2IOYA 5B30A 1RWNA 3A3PA 3NDIA 2PRIA 4DLKA 3HWWA 4IGIA 1U0NA 2KQUA 1II8B 3GPBA 1EUQA 2AR9A 2VF2A 1V7CA 3N58A 3BK1A 3QPAA 4B4OA 1M8JA 4MPDA 3E9RA 5L3RA 4LRUA 3K4HA 1FL9A 3CXRA 4CR7A 5B58C 4AI6A 3NWJA 1CEXA 3LO5A 2GD0A 2I4RA 2X19A 4OF4A 4FCWA 1OILA 2Y9MB 1W30A 3NYIA 1O9GA 4KRYA 4RKQA 3SSMA 3OQ6A 3EA5A 5KNDA 1NNEA 3IB6A 4WUTA 2CHEA 4W9NC 1U1EA 3BRWD 3CLKA 3OAAD 3S29A 2R79A 1R0XA 2HCRA 1SEVA 3AUTA 1D4ZA 1SKYE 3GLVA 3HJGA 3MGAA 2FTKE 4IUDS 4KO3S 4N18A 5JV5A 1TLLA 1M2JA 3NV7A 3S4YA 1IXSB 2G36A 2NSJA 4OBBA 4F5EA 1OD6A 2YXNA 4HOYA 1D2RA 3WIOA 1B0ZA 4FR0A 2ID4A 4GGMX 5G1PA 3SEZA 3SYMA 3RU3A 2C7QA 1QP0A 1SOMA 3UMBA 1EXNA 1V5IA 3ZGYA 3ESYA 3C3WA 3MUNA 5E7JA 4WXMA 3JTEA 4Z3DA 2ZRPA 2D8MA 1DDIA 2IE8A 1SQ0A 3LECA 4K9PA 4F2WA 4Z4CA 1QHGA 2V65A 3C7AA 1PVVA 2PMCA 3NOXA 4HUTA 5H83A 1CR6A 3NMUF 2X40A 2R96A 3DL2A 2Q62A 2IIVA 3UW1A 4BFXA 4BLPA 3MXOA 1E3MA 4EEZA 4EGAA 4U63A 2ZAIA 5B7NA 4GH5A 2QUJA 2ZBUA 4URXR 2FEKA 1VSTA 2HYIC 2CCKA 5F64A 1H1LA 1KJ9A 2VNAA 1ZJWA 1QJCA 2IKSA 2AOXA 2PIDA 3ANSA 1L1FA 3WL5A 2V7WA 4JUDX 4F3CA 4OJYA 1THGA 1G3IA 1CW2B 3WJ1A 3ZX4A 3D8NA 3JQ7A 3L4SO 3M4YA 5TQ2B 4HB0A 4HH4A 4KPFC 2PXAA 1Z0UA 1L1QA 4GM0A 4UEOA 3MTJA 1NJ8A 4O29A 1O5IA 1RLUA 5PNTA 2F2TA 4ESOA 2EBHX 2J0UB 3TX2A 4IWNA 1JILA 1Z22A 2WVGA 3PGMA 1PUXA 4M54A 4N4AA 5EJGA 2IJGX 3WWEA 4Q9NA 5I8PA 4JZYA 4J4BA 2XW6A 3H16A 5E2BA 2NV6A 2OCGA 4BZQA 1AS3A 2ZIFA 1T2FA 3VPCA 4DYHA 4DN6A 5DHSA 4X20B 1IJKA 4BAGA 3SLRA 4TTAA 2VXOA 2JF0A 1M6YA 2QQGA 2QN1A 2YZGA 3LW7A 3A2LA 1LC0A 2ICAA 3KT0A 4BLUA 2JANA 4M0LA 2QE7A 4OHBA 1VLJA 1NP6A 3ZU6A 4JQSA 3LY7A 5DK4A 2AQKA 4RD4A 1YOBA 2A1TS 1QFJA 2C0PA 3OLCX 4KACA 1U2TA 4XWWA 1V5FA 5BV1A 3K05A 3AKEA 2FP4A 4JQZA 4DDKA 3HUEA 5MF6A 1GL3A 2PQ6A 3FVVA 5G0SA 1QWOA 1QUEA 3TTXA 1I01A 3PWSA 2GJSA 2H63A 2L0XA 1D1PA 1PZFA 2EWWA 3GUUA 1OI2A 2D5BA 4XB2A 4YMTA 4WESB 1XGKA 2WSMA 3HJCA 1GKIA 3NBQA 4XCXA 2X2OA 4ZJYA 3LW8A 2GZ3A 4G1EB 4LZWA 5ALVA 5I3ZA 3IGFA 1TQ8A 5ITZB 1KR2A 4AKHA 1QO9A 4NHOA 1A7JA 5DBEX 4EA7A 2ZE7A 3VJLA 3VKHA 2R8BA 1BGVA 4WLOA 4Z2YA 3V1KA 4Q0MA 2ZJ7A 4PHHA 4ZI7F 1U8ZA 4JB2A 2UYQA 2FPUA 2JD1A 2I2XB 4NE7A 2PM8A 1BDJA 1YDMA 4O4HA 2AC4A 4K6OA 3HVJA 5FJJA 2ADFA 3H5RA 2JCVA 2VQFB 2C83A 2W00A 3OFKA 3QENA 1BCSB 4JLOA 1TC2A 2ZJ0A 3JVVA 2QV0A 3RRXA 3EY9A 5AYVA 3VVCA 5HKBA 4M53A 1LLFA 1JJFA 1ANKA 3IALA 1AUOA 1A9ZA 2W2NA 3DHWC 1DC4A 4LZLA 3TRHA 4R0MA 2JLXA 3OIFA 4MUNA 5HQ3A 1RXUA 4MUEA 2QM3A 2CLSA 2E4ZA 2BMWA 1NJSA 2VS1A 1NQUA 2ZCUA 5CDHA 4Q9KA 2AK2A 1GTSA 4WKNA 1XK7A 1P6XA 3AFGA 2Q3BA 4LQCA 3DOFA 1L4MA 4FC6A 3O8OB 5KNDH 3R8FA 1CUYA 2HCBA 1U3TA 3AWDA 3DMDA 1VG1A 2I4MA 1RQNA 4HADA 1BZYA 5ALNA 3SYTA 4ZPJA 4Y1EA 5JXJA 2IP4A 3TOVA 4OYLA 1IAVA 1XDBA 2W8ZA 1L5NA 3D4PA 2HSEA 2XUQA 1J22A 3SDZA 3I9V6 4BKRA 1CRQA 3EBPA 4X44A 5JPIA 3GT3A 3UFXA 3GQBB 5LMZA 5D6OA 1YVPA 1A77A 1GU1A 4MV0A 2ORYA 2O2EA 5EESA 4C1BA 5TVKA 1KA9H 5BSMA 4PX5A 1RXSA 1Q1GA 3SYLA 5KI6A 4EEXA 1JU4A 1JAZA 4H35A 3ZLVA 2C4TA 4AY6A 2GI4A 1YZVA 5FBRB 3HMQA 4MYTA 1SXJC 2HJWA 1GYQA 1CR2A 1KH1A 4BFVA 1JAXA 3EUEA 5G4LA 5BQXA 1GRRA 5C32A 4EJ2A 5ED4A 3CCCA 4TMVA 3MLEA 3A4IA 1N6IA 3O21A 5DM60 1CWUA 1S8FA 1TVEA 4QBKA 3F8TA 4YYZA 4B35A 2NXWA 1WW3A 1FQJA 1OIXA 2OTCA 2I29A 3HDYA 3ICPA 3LY8A 3N0WA 3MRXA 4I3GA 4KE9A 5LBUA 2F8LA 5KVSA 2O19A 4K6GA 1ZD3A 2GN8A 2PN1A 3OZEA 4R9VA 4Q48A 1UAYA 1NU8A 3RVBA 5AHRA 2F1IA 3IVRA 3EK2A 5D3QA 1DJNA 3U9SA 3Q7PA 3QU5A 3HHPA 4O02B 1P3DA 3GJ6A 3UB3A 4XQGA 2WJGA 4TV8A 1P18A 3VR5A 1U2EA 2OO3A 2W71A 4CLDA 4JJKA 4HDQB 4XOUA 1TNDA 1N57A 4LJ9A 1TU0A 1NATA 1I1OA 1N0VC 3A58B 1KKUA 2NQ2C 4AU1A 2B8NA 2H57A 2IIBA 2WZCA 4JUCA 3VR6D 4C0SA 1FFWA 1NXQA 2QDKA 3AUSA 4A27A 4Z51A 5LPNA 2ZBPA 1RBYA 4JT9A 4PWYA 4CUKA 5T3UA 4HTAA 1CF4A 2FWPA 3WB0A 2JIRA 2ZYVX 4UM8B 1DXQA 3DE2X 2PWPA 1MLDA 2WHEA 4LK2A 5FTLA 5IXJA 4JEUA 5JU6A 3OCWA 4HGQA 3LA6A 3LJKA 3DW1X 5AKYA 3IP1A 2PUWA 5IM4F 3DT6A 1EUYA 1H9AA 3CZCA 3LIPA 3F3MA 3PDJA 3RKUA 2Z9CA 4RIHA 5HZMA 1K98A 1GGKA 1NLFA 5KNBA 3K70D 1MZVA 2I2BA 4DVGA 1MZPA 2D2IA 3HR8A 2Y93A 2X13A 1SY7A 3D8BA 1XMXA 2W37A 4BRWA 4E70A 3PEYA 1QQAA 2X6RA 4CEJB 2ZFUA 2DGDA 3K9HA 1AK2A 1YKFA 2BMEA 3CWZA 3WTCA 3WLSA 3WOHA 3F97A 3QE2A 4JVSB 1F1BA 2B0JA 2XD9A 1YD7A 2HSWA 2QDXA 4AS1A 1Z4QA 5ALHA 5CU7A 2XCRB 1FRNA 3UPDA 1IY1A 2V7EA 4UHDA 3PPXA 1ECLA 1UBJS 1WXHA 5F23A 4UTZA 3EAFA 1MJHA 1PAUA 2G1PA 3LQ1A 2PSFA 3MYYA 2ZRCA 3HV2A 3LY5A 5J2TF 4Q4LA 2FZKA 3PUYA 3ZE8A 4FEAA 1OWMA 4LYDA 2GO1A 5K3DA 3SKVA 3DAGA 2F4NA 4CBVA 4YJ3B 3FHOA 5JVDF 4BJ1A 1H0KA 3F71A 4YAIA 4I46A 1IY9A 3FI9A 3NHKA 2IYNA 4G0XA 4ZV7A 3VRHA 3TW4A 3TZQA 1Q22A 3CH5A 3MIIA 3UWKA 3PNSA 1Z35A 1N8KA 3SQXA 1EXWA 3PLRA 3VU3A 2PX3A 1DMRA 1M10A 1QQ7A 1Y1RA 2C4MA 3BE8A 3LDHA 4YJGA 8AT1A 1VJ5A 1V4NA 3W6PA 2H11A 2DLNA 3D3WB 3U9LA 1BA3A 3IMCA 4DT1A 4EK9A 1ZONA 3INTA 1T6XA 1ZCZA 4V38A 3W5UA 4LE1A 3UJCA 4B3JA 2RJNA 4D9JA 5ALPA 1BTOA 4GX1A 1VGQA 3RIGA 1GDTA 2ZWPA 5K8CA 4GPTA 2BMDA 4OGKA 2QWXA 4Q1VA 1LVHA 1DWQA 4UAUA 2J3MA 2OFOA 2OHXA 3AUJB 4Z54A 1QIMA 4MWGA 4IQFA 2AFRA 1Q0HA 2W48A 1AS0A 1RHRA 1CQJB 1DELA 2PSJA 3FETA 3MS2A 5TX7A 1WE2A 1LPPA 1ILEA 1ZMBA 2X15A 4CL2A 4OMCA 4HMPA 1FVXA 3WE7A 3ZW7A 4CM7A 3ZZMA 3D0OA 2QX7A 4M22A 2B83A 2IWRA 5KSWB 3AVTA 3P9KA 5KOJB 4OH1A 2Z8YA 1J70A 1YQDA 4C76A 1U0SY 3K53A 5DU2A 3WMWA 2FYTA 2IS6A 2A1UA 1CVLA 1M6HA 4G81A 3W5HA 1DAPA 3GOQA 4D4LA 3BGOS 4D97A 4MROA 3PDIA 4PZUA 5K3FB 5TMPA 1EXMA 1VLMA 1ZM7A 2CFRA 2FPMA 4GR4A 3GZ4A 4HLUC 2ZJ2A 3UJAA 1DV2A 3K92A 1TKBA 1NN5A 1Z4NA 2NADA 3RUIA 3S40A 3VR5H 4DCUA 2AB0A 4ZI2A 4PSDA 3NPAA 4I4LA 1WPGA 4Z9XA 3OJCA 3KUXA 3VPFA 1SIUA 1NW8A 2FWRA 3GT7A 3TN7A 3JWIA 2IV2X 4XWKA 4LZPA 1PR2A 1WG8A 5ESWA 5JXGA 4M21A 2O3JA 2YNMC 4EQ6B 1CLEA 1NA5A 3MHPA 1JQ5A