1JEAA

Altered topology and flexibility in engineered subtilisin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN
publication title Engineered Bacillus lentus subtilisins having altered flexibility.
pubmed doi rcsb
source organism Bacillus lentus
molecule tags Hydrolase
total genus 95
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1997-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1jeaA00
3BGOS 3VV2A 4K8RB 2PRKA 4GI3A 2ST1A 2Z2YA 4NE7A 1Y3DE 4J94A 2HD4A 4AKTA 1Y48E 2B6NA 1GT91 4WOBA 3HJRA 1WMDA 1JEAA 1Y34E 2WWTA 3F49S 3WIVA 3CNQS 1KDYA 1Y4DE 3DE0X 3DE1X 1S02A 2GKOA 3A3OA 1SELA 3I30X 1EGQA 5AQEA 3EDYA 1NDUA 1Y3CE 1SBCA 3AJ8A 3T41A 4KB5A 3EE6A 1PTKA 1TO1E 3DE7X 3D9QX 2SECE 1TM3E 3WHIA 3Q40A 5FAXA 1KDZA 1AK9A 1GTL1 2W2OA 1SCBA 3EIFA 4C3UA 2QTWB 1AV7A 1YU6A 2DUJA 1SCDA 1TM5E 1SIUA 3LPDA 1HT3A 2Z2XA 1C9MA 2PKCA 4HVLA 3GT4A 1SUEA 3UNXA 1PFGA 5FFNA 1P7VA 1SIBE 1XF1A 2TECE 3GT3A 1TMGE 1Y33E 2ID8A 5JXGA 1DUIA 1DBIA 1YJBA 3SQOA 4OV6B 1T1IA 3L1KA 4I0WB 5JXHA 1ZVJA 1SUCA 1SUAA 4RYDA 3SICE 3I37X 2SICE 2WUWE 1T1EA 3I34X 2V8BA 2Z58A 1TK2A 2ZWPA 4LVNA 1R6VA 1BE8A 4ZOQI 3DVSX 3DE3X 1SBHA 3DE2X 1OT5A 3DWEX 1YJCA 2Z30A 4CFZA 1WVMA 3ZXYA 4DJ5X 1SUDA 3D43A 1BFUA 4CG0A 3TI9A 2XTJA 4NMXB 1GTG1 1BE6A 3DE5X 1GA1A 3TECE 4M1ZA 1Y4AE 2Z57A 1GNVA 1CSEE 2WUVA 4KG7A 3OSZA 1AQNA 3QFHA 1BFKA 2E1PA 1GA6A 1KDVA 1LW6E 1NDQA 5JXJA 1V6CA 2Z2ZA 3VYVA 3DDZX 2ZRQA 1SCJA 3VHQA 1SH7A 1Y3FE 1Y9ZA 2SBTA 1SUPA 1ST3A 4Z2AA 1KE1A 2X8JB 3CO0S 1AU9A 5ARDA 5FBZA 1SVNA 3LPAA 3VSBA 1SBTA 5CW1A 2XRMA 2IY9A 2G4VA 1SUBA 4DWWA 4OMCA 1TECE 3A3PA 3Q5GA 5JXIA 2P4EA 1WMFA 4JP8A 2PMWB 4ZARA 1IC6A 1S2NA 1V5IA 1YJAA 1ZVKA 4BWGA 3LPCA 2SNIE 2ZWOA 3DW3X 5ARBA 4C3VA 2HPZA 3I2YX 4HX2A 1OYOA 3F7MA 5JMOA 2WV7A 3DE4X 4H6VA 3PRKE 1SCAA 1EA7A 1BJRE 1CNMA 1A2QA 2Z56A 5K7SA 2DQKA 2X8JA 5AVJA 1GNSA 2PQ2A 3BPSA 1S01A 3DVRX 1KE2A 3WQBA 1UBNA 2W2PA 3P5BA 1T1GA 1R64A 4WOCA 1SBIA 4OMDA 1P8JA 3TI7A 4H6WA 5ARCA 1OYVA 2W2MA 2W2QA 1P7WA 5B1EA 2IXTA 4NE9A 3QMPA 3H42B 4LVOA 1GCIA 2ID4A 1BH6A 4KPGA 5B1DA 3F7OA 1WMEA 3GCWA 4AKSA 3WIUA 1Q5PA 3LXUX 1MPTA 1TM1E 1GA4A 1THMA 1TM4E 2PWBA 4H6XA 1GTJ1 1R0RE 5AMXA 5SICE 2PWAA 4FONA 4MZDA 4B5LA 3AJ9A 3VTAA 1AVTA 3DE6X 1PJ8A 1AF4A 1NLUA 1PEKE 1SIOA 1C3LA 1IAVA 1SBNE 2PYZA 3VV3A 3PTLA 1Y1KE 3QTLA 1TM7E 1TO2E 1VSBA 3DVQX 1MEEA 4DZTA 1AH2A 2W2NA 4YN3A 1C9NA 3BX1A 3DW1X 1SN7A 1C9JA 4CFYA 3A3NA 3ZXXA 1ST2A 5I9SA 1SCNE 3DYBA 1Y3BE 3AFGA 2DP4E 1WSDA 3GCXA 5AVKA 1SPBS
chains in the Genus database with same CATH superfamily
4NLLA 1FUUA 4WFJA 3EFHA 1L4NA 3INYA 4TKUA 4LXYA 3OEHA 4DBZA 2QBYA 2QZ4A 1JQ3A 2WD8A 2COEA 3E7PA 3OMWA 4PRKA 5BRAA 2WU1A 2WAXA 5CW2A 4DWJA 3G17A 4RA6A 3L6CA 5C4IA 1VCMA 2FZCA 2IYXA 3HYRA 2B0JA 1UBSB 3SIWA 2NZWA 5KOJA 1Z45A 3ABRB 3OCCA 3HEAA 3K9LA 3AMVA 3E3OA 3IQXA 2YHUA 1U3FA 2VATA 3JYHA 4GWKA 3WGLA 1BH2A 5EAIA 4V0ME 2ZRHA 4GP9A 1YB7A 4CIBA 2IL1A 4RK1A 2VP9A 4WIAA 1KZ9A 4TT8A 1O6CA 2ZWVA 5CVVA 4NI5A 3O4VA 5LZ7A 2DBQA 4H16A 2DJIA 3E9NA 1MN6A 5JRZA 1O87A 3AY3A 4GO1A 1F60A 5EHXA 2I7CA 3SIPA 4OPMA 4B47A 1U11A 5DLPA 5HDBB 3DE0X 2NV0A 3FFBA 3NC4A 4O8CA 5I9NA 1P4HA 2BFEB 2GKOA 4AY3A 3LBNA 1Z35A 2GO1A 2HF9A 2C4KA 3D3QA 3MFYA 3I30X 3KE9A 1R6AA 2DHDA 4CGZA 3K09A 2VBCA 1BHJA 5KHOC 1NHWA 2AOXA 5FPSA 4B79A 2YTZA 1Y1QA 3LGXA 3TR6A 3NR2A 4ZOBA 2L82A 4P1ZA 4A9AA 2H7XA 4CUZA 1RKUA 2R0QC 2WD7B 3BXZA 2GK3A 3OLQA 3Q1KA 4C21A 3WHPA 1RBYA 2I1WA 4LZJA 3TLCA 1A4RA 3HXQA 2Q2NA 5JWHA 3GFGA 1JHXA 2DQ4A 3PX2A 4H3KB 4D8VA 5BXYA 5KU1A 1UQUA 3D9QX 1GT6A 1Q1QA 4M1EA 1Q16A 1G3RA 1IULA 3KCQA 2R7LA 3T94A 1HDEA 2JF0A 2P3SA 2W48A 3HWX1 4I46A 4HVTA 3OKFA 4JL6A 2WAAA 5EJ2A 1XJWA 2WU0A 4NIMA 2V9ZA 1ZPDA 1P7PA 2O3JA 2ZXFA 3ZWAA 2XZLA 1IZ8A 2V1XA 4WK2B 5E95A 4JWTA 3EUAA 4QE3A 1UFKA 4OI1A 2O5EA 3UAXA 1RLOA 4BO4A 1K3TA 3CX8A 1UANA 4OBBA 3LPDA 3AC0A 5A5VA 5C80A 1CEXA 4GPZA 4KL8S 1JWBB 4S35A 4U9IS 5CLJA 2RAFA 1HL3A 3U3MA 1PVDA 2SKEA 4QJ3A 1DX9A 2RBGA 3CKLA 3GARA 4MWTA 5HZKA 4RACA 2IH2A 5FNZA 1C9KA 3QVJA 1UPTA 4F5EA 3I01A 3FB4A 4BP1A 1XTJA 3GEHA 2X5XA 1SG0A 2PYDA 4PG8A 4DA8A 3N07A 4H3VA 1Q0QA 3H6KA 4M3NA 4BMYA 4M88A 2C9DA 4B9AA 4P5DA 3QLVA 1UWVA 1Q2UA 6AT1A 2EFCB 3MGKA 4DXAA 1ZD3A 1EUZA 1G1AA 1KMQA 3TSCA 5IZ4A 4JLSA 3F78A 1PFVA 2X0EA 3RM3A 2O19A 2CZGA 2OHXA 4J1QA 4U7PB 1HDYA 4TV9B 1QFZA 1DBIA 2WICA 1JT9A 3R6GA 1EQUA 4PFKA 3E03A 4CCWA 4DTCA 5KQLA 4IVQA 4OV6B 4QGAA 3RRYA 3CE6A 4E03A 1RM3A 1MP0A 4V0RA 4MV5A 4XVCA 5I9MA 1E60A 4N65A 4XJXA 5EPOA 3F71A 3UHAA 4X1IA 2WDPA 5HIAA 4N6OA 4DV0B 3RI3A 4P3YA 2PWPA 3WJAA 1U2DC 1KK0A 1YCGA 4C6SA 3GLKA 1E2BA 4YWJA 4O5AA 2AHRA 2QTAA 1S8FA 3A6KA 4W8OA 2GK6A 4AS2A 1JTVA 5KNDD 3AEUA 4UCQA 3FHJA 4H9GA 5A3QA 2MYPA 3Q10A 1N1DA 2WUWE 2V1UA 1BRTA 4C07A 5I3CA 1C29B 3H1BA 3C8HA 2L69A 2ZP1A 1J2UA 5F1OA 1ESCA 1UMDA 5TV2A 5BVGA 2QTHA 4JVLA 4QT4A 1P1HA 3Q8LA 5KVCA 4A15A 1Z0UA 2P27A 3QBEA 3QXCA 1WULS 3E7FA 5ALNA 5H5JA 4EKNB 2CNKA 1WG8A 3QWHA 5G1PA 3WOVA 1ZIOA 1AUPA 3GEGA 4M7OA 5C8ZA 2PU7A 3PQCA 1AY0A 4E5DA 3LT4A 1Z0SA 2I2FA 1HTTA 4FFWA 4X20A 2QT9A 2QD5A 4IGKA 4XPIB 3T5TA 3LW8A 3LM8A 1HEUA 2PL9A 3A6EA 1XDWA 2X19A 3D6MA 4UBMA 3VNQA 2JLYA 3IRUA 5EPEA 4XXHA 1AS3A 4BMZA 2B83A 3JWPA 3E53A 4UJ5A 5LBIA 4CCSA 4ZOCA 3GEPA 3CCCA 5J4KA 2DHEA 4AXBA 3DE2X 4JB0A 5H0IA 1KRWA 4MI6A 1I4LD 1XEFA 5JAIA 1VIMA 1L7AA 1XU4A 4ZAFA 5AR1A 2ZRDA 5LUBA 4H17A 3AKEA 5EUQB 5KDOA 2AQIA 5K9ZA 5D3KA 1GCGA 1R3DA 2YJTD 3Q7TA 3ZD6A 1T2AA 2GILA 4B76A 1W44A 4LMPA 1PJ3A 2DWCA 5JS6A 1DLJA 1JVSA 1QIKA 5EEHA 3QBDA 3EG9B 4F4HA 1JIXA 3LIPA 2ZJ2A 2FP4B 2AL7A 2PO7A 1HE1C 4J2OA 2CHGA 4IQ8A 4OKIA 4WA8A 3SJCA 2XH8A 4Y9TA 1CQXA 3VZRA 5ESDA 3D54D 3M4JA 3HGTA 1GLGA 3COPA 3LWNA 1WU7A 4YRBA 1TTTA 2GBGA 1VPWA 1QYRA 3MPUA 3D3NA 2OSBA 1XTSA 4HDNA 3ME5A 2RBKA 1A2BA 1EUDA 3OT1A 1RU3A 3ZIAA 1D0VA 2V6BA 3TZQA 2X2PA 1XVIA 4XR9A 2HO4A 3DV2A 5FTNA 3ZYZA 4EYSA 1YRHA 3GELA 1F3LA 1QNFA 3A4TA 4H27A 4OU4A 2WINI 1Z4OA 3RUIA 2G71A 2VNAA 3B48A 2P6UA 3DV0B 4WKOA 3WLJA 2ZCVA 5BP7A 5AW7A 3R6TA 1U8YA 4EI2A 5KSWB 1KJNA 3G7UA 5HS6A 2OY0A 1GNVA 3NVKI 2JFGA 3OFND 4RD2A 5HCIA 4UUBA 4C6HA 1DHRA 1I0IA 3BKXA 3E7XA 2JH3A 1SC3A 2Z8ZA 2QVXX 3UJHA 4NY1A 1BFKA 2E1PA 2PBZA 4HWPA 4D0NA 2PJZA 2ZDGA 1QFSA 4KLRA 3ZHRA 5H9VA 1MJGA 1GAJA 4KE9A 4PNHA 1QQ5A 1H0KA 1UT6A 3OHSX 5IJWA 3LXRA 1C1XB 2VPYA 4NBSA 3ILSA 2QUJA 2GJ4A 3IQGX 4XYGA 4ZEOA 4PEVA 3D0OA 2CBXA 3JASA 3CTPA 2A59A 2EFJA 1M0SA 2NU7A 4CMIB 3G2OA 4XSVA 5EJMA 5IRCD 1E1QA 1PKEA 2R1UA 5IS2A 1KI7A 4QNNA 2IPAB 2AK2A 1QYCA 3F9CA 4NAHA 5A9SA 5AW1A 1ILEA 2ENUA 3E7WA 2OV3A 1MR3F 3GRVA 2F8MA 3GLUA 2JLRA 2MTBA 2YN0A 3X1DA 1KE1A 3FR7A 5C51B 2YXEA 1KO1A 1OC4A 1AOXA 4KO1S 3IP5A 4DLPA 2ZJ5A 1VE3A 4INAA 4KGDA 2X8JB 5KKNB 2O8CB 3SEFA 2GD6A 1ZUNA 2X3FA 3GDWA 3OIFA 3PXAA 4RS4A 4F86A 5BW8A 1UMCB 4X84A 3W5HA 1SHKA 1BWSA 4IG9A 5EA2A 4G8DA 4FB4A 4DMHA 5B6IA 3LQ4A 3UV3A 3G2IA 3T3MB 1UFQA 1PJLA 1BWQA 1O9GA 2NTJA 2YJ6A 2ZE6A 3QHQA 4S0XA 5ALPA 2AIRA 3KSRA 1JEEA 3P5SA 4EG3A 2XSZA 3VSBA 5HPYB 1PHPA 2GHQA 3MCWA 1KNQA 3GNSA 3PGA1 4HXFB 3DTNA 5BPHA 3VKWA 3ORRA 4TKVA 1ISHA 1D1QA 2JHCA 3ENZA 4RLFA 4LXXA 2FY8A 5BNZA 3O84A 4JJAA 4LHYA 4A8TA 4OGGA 4ANFA 4YDHB 1N0WA 4UTZA 5F4BA 1GL7A 1AURA 4ZYUA 1F8GA 2OQIA 1GZDA 3KU1A 4K03A 2ZCUA 5JNLA 1B3RA 4RZSA 2BI7A 4KAFA 5JFTA 1Q7CA 1Z8HA 1GKUB 5FTMA 4AVYA 4X93A 2ORIA 4KACA 2H11A 1IM2A 3KKPA 1Z6YA 2OZLB 4HNAA 4UUAA 4XUDA 5IVKA 3AK4A 2YVKA 4LAFA 1T10A 3PQ2A 4NBWA 3D8BA 5CT6A 2D62A 1LX6A 3T9BA 5A5GA 3ZJTA 3FSRA 4TSFD 4YLYA 4HYEA 5SY9A 2QLMA 2XYRA 4BWGA 2BOVA 3O1JC 3O2NA 2I2WA 4CLXA 2JA1A 3AKCA 5EXTA 3IXLA 2BP7B 2XE6A 4XWWA 1ULTA 4N0DA 5HR5A 2IGTA 1JJVA 2QRGA 4ZMBA 2PSSA 2H7VA 1EG7A 3RWMB 3IBTA 1DAGA 5KC8A 1XP5A 4IIUA 3NVDA 4DUGD 4G1VA 4PIPA 3MT7A 3SYLA 4QOGA 4AULA 1K6JA 4PS1A 3HG7A 3OQIA 2H1WA 4PS0A 1CUSA 4F7WA 3BTOA 1GSIA 2E6UX 2OBXA 3MMNA 3R7WA 1NPYA 5K4AA 2VEDA 7GPBA 1ZK4A 5K05A 1A2QA 2YNMA 2WJ3A 3IQZA 4II3A 3GBVA 4ECEA 1WD7A 2BMFA 2XZTA 4Q4HB 1PJBA 1U9CA 2ZJ4A 3LUBA 1AUXA 3FPAA 3HKDB 4OJKA 3JYNA 5BYKA 1Z9BA 4FNGA 1THZA 5LVAA 2H5EA 4E13A 3F6YA 1KE2A 3BAZA 1IZYA 5F64A 1S3SA 5IM4A 3P5BA 2JZOA 2ZIXB 5CURA 3PQFA 2I6UA 2JFBA 5CPFA 2BEWB 3S1AA 1S8NA 2XQJA 2G5GX 5EFOA 1LZLA 4PZPA 1JKJB 3L40A 2D6FA 1NQXA 4AZVA 2VDMB 3BB4A 5ALIA 2Y68A 3RWOA 4UM8B 3ZHYA 4I4IA 3Q0IA 5CYGA 1B1CA 5HGJA 3WS7A 2WJHA 5JQGB 5HNKA 2W42A 4KOAA 4MULA 1XNHA 3FF1A 4BNGA 5EE5B 4NH0A 1XI2A 3N6VA 2BFDA 2YFYA 3STHA 3QMPA 1UK6A 2WYVA 3EF1A 4FGWA 2CL5A 3KKOA 5DZSA 5EWJA 4QQFA 5BT9A 3UJNA 4NTZA 3I32A 4AQ7A 4KZKA 1ZSYA 4JMPA 1JDBC 4LXGA 1JMYA 1H0SA 1Z7EA 2WE7A 3FUVA 3MJTA 4DQUA 5JJLA 3QEMA 5LKAA 5H59A 4C0LA 1LQ2A 4QQNA 4NZ9A 2J4DA 5B1DA 5CB4A 3O3MB 4DIFA 5AK0A 3NAQA 3Q2KA 1FYDA 4JOCA 4MINA 2Z3ZA 2FLWA 2Y1EA 4H7DA 4OHYA 4P5PA 2YVLA 1S9DA 3IPYA 4RV4A 2CVHA 2Y05A 1MRSA 2A2ZA 1X1DA 1BMQA 2R1TB 3LHKA 4D9HA 3L0PA 4XJSA 1NVGA 1VJ1A 3NORA 1RXWA 1E79D 4TOIA 1JJ7A 2I71A 3AR6A 4FJ0A 5K5EA 1RC1A 1PZNA 1XFAA 2G09A 2VR1A 1R0RE 3QG5A 1VB5A 3ZU3A 4RKRA 3GF4A 3WL3A 3G0CA 2Z4RA 3GLFA 4QLBA 4UM5A 2O57A 3NQ41 1EBFA 4MEBA 2QN8A 3GVIA 2O8NA 1W96A 4ZCMA 2BV3A 4FBGA 4M87A 1HETA 3K6KA 1VJDA 4CMJA 1NJ5A 2D13A 1RYZA 4L78A 1EUCA 1E7SA 3OBIA 4ENVA 5KWEA 1WCWA 3HB0A 1OTHA 4FMDF 5K8JB 1HDGO 4AWXA 2WUDA 3LTNC 4WN9B 1KBOA 4X8MA 3TD2A 1FQJA 1LQTA 1N6LA 2AFHE 4UU8A 2AMFA 3D2CA 4EARA 1NYQA 1H4QA 3LVFO 4MS4B 3NIWA 2HQSA 1DEHA 4LSWA 1DIAA 4OI2A 4Q66C 4F6RA 1PWZA 4IMIB 2Q5EA 5F2KA 1T3HA 1SQ6A 2C5EA 1O96A 3U4AA 3CF4G 3GT7A 2X76A 2XNHA 1I7DA 3HP1A 3DMPA 1TO2E 5DW0A 1MO2A 3IVXA 1XZFA 5CB6A 1JJIA 1QLJA 1S0UA 1V45E 3NEYA 1AXEA 1G7SA 5D8DA 4AICA 2BFDB 3Q85A 1JDUA 1NC3A 2W2NA 4FHDA 1VHDA 5BNIA 3D8UA 2ZZNA 3TZLA 1KORA 4CBVA 4RTNA 1EINA 2FZVA 2IV2X 2CXNA 4IICA 3NBUA 1M73E 1Y8CA 3A10A 3C39A 3CUSA 4OHWA 2Q1SA 5CIWA 1V9CA 3TX6A 2N42A 4D97A 4FDUA 4ISCA 4LJ4A 3D7KA 2X6RA 4K2HA 1XZCA 4ZP1A 5HGXA 3GGPA 5F77A 2FR8C 3O3OB 3MWEB 3NTQA 4J0DA 4IIJF 2G83A 3O9MA 3I2HA 1VKZA 3WIOA 5C1PA 1JTEA 1O5TA 1Q20A 1S96A 3P9QA 1FVHA 1SCNE 3KO8A 1YACA 2FUG1 2YZ2A 5KTTA 1YK0A 3RHTA 2OTCA 2P2GA 3S29A 4AO6A 1JG6A 2FV8A 3L8MA 3LBFA 3NHFA 3DR5A 4AZ3A 4DLYA 2PVSA 1NKSA 1FBTA 1I3OA 5LPNA 4IIBA 1CRPA 2ICAA 5IT5A 4FGKA 4AX8A 3HEBA 1DWQA 2J0EA 2BTEA 1G8YA 2MIIA 3JW8A 2IY8A 4HMOA 2QJTA 2CBGA 1AA6A 2QQFA 3CKMA 4R3WA 1AMOA 3VO1A 3C3WA 4MWOA 4BP3A 4G0NA 5ICEA 4HEJA 4IYRA 2W7TA 4NVRA 1Y8RB 4HRXA 4K6KA 5FLXA 3ZU6A 3U5ZB 4G0UA 1FYVA 4BWFB 4FU0A 1PR1A 2BGTA 4ER7A 2NO6A 3MF4A 1T6ZA 1UFOA 4Z1MD 4JC4A 3WHLA 3DYVA 1V7QA 4U00A 5PNTA 3ZWBA 1NXPA 3DEHA 1OXVA 1QGYA 1EFLA 1GT91 1G60A 3OPYA 2PUGA 2XUQA 3KZKA 4L5YA 2A9RA 3CH6A 4BU0A 1R16A 2HBZA 3EY4A 3GVPA 1Y89A 5AI0A 1O4VA 2WF7A 2CUKA 4ZV4A 3R4CA 3D1VA 3WRYA 3M8KA 3LI2A 4I4NA 4TTQA 2G8NA 1RXYA 4HDKA 3KTAB 3JRNA 3TUZC 3TQOA 5B2FA 3ZCSA 4D99A 4PLHA 4QPDA 3AETB 1Y63A 1HLPA 1ZWKA 3WWZA 2G70A 2J32A 4RMGA 4J3JA 4LWZA 1WHTA 1PFUA 1WNFA 3D6TB 1JHUA 4GGMX 1OCEA 2YJ3A 4LECA 4F1KA 2R8PA 4EJ2A 4KGVA 1RFLA 2P7IA 1VBKA 2Q2VA 2W4IA 2A9JA 3NYIA 4YAKA 2D1QA 2PR2A 3GMTA 5L3RA 3R7SA 1N2CB 3PIIA 3UKOA 3UXYA 1DJQA 3EPRA 4QELA 1XU7A 1X7ZA 2B7LA 2JCYA 4WGFA 1XNQB 1GNPA 5FBHA 2YYAA 4AN0A 4LYDA 4Y2UA 2C99A 2YBDA 1FYWA 3RUCA 1YZ3A 2AMYA 16PKA 3M3HA 1IPEA 2JD1A 4GBED 4GX1A 4W1SA 1KJ8A 3PX3A 5ADWA 3W7VA 1V5GA 2FFBA 2IHJA 2BISA 1NBMA 1S2OA 3Q40A 4IUYA 4P3KA 5TVGA 3LECA 4B4WA 4XGQA 5FAXA 3TW8A 4GYYA 3LCVB 4B6SA 1AQIA 2OD2A 5TQ2B 1B6GA 2I7VA 1NULA 1X92A 1D2CA 2I4OA 3OP4A 4HQLA 3BUSA 4D82A 3JTMA 4QOJA 2X4GA 3WBFA 1P6XA 3AILA 4E32A 5K1ZA 4NSNA 1G0NA 1QJCA 1R5OA 2I6SA 2C95A 2VF7A 5JJCA 1XZKA 3SYMA 2UU9B 2QZZA 3HKCA 2J6IA 3F9RA 3TM5A 5BN1A 2C2BA 1YQTA 3HMQA 2Z8YM 1A5TA 4MB2A 4PU0A 2J5XA 1M1NB 3HM2A 3PJGA 3WZMA 4EUSA 5C3MA 2BJWA 1N2SA 5LJIA 1QVRA 5F7JA 2GPSA 1ND5A 1YR2A 3TTTA 3W2IA 5CAEA 4JI8B 5ALYA 5E6UB 3PXUA 3NALA 1BGVA 2VK1A 2ZUVA 1MC4A 3C3KA 2PFKA 1GAWA 2HYIC 4QFCA 3GLHE 1AKRA 4WW0A 1Y33E 2P7HA 1RLIA 1CS0B 2EIXA 2VHVA 4KQHA 1QHHA 2EP5A 2GF2A 2VHUA 1W2HA 3N0XA 4MYUA 4UD2A 4XX0A 1T24A 3P9RA 3G7SA 1N5MA 3ZHVA 2IZOA 2CNNA 4R2LA 4D9BA 4JEIA 4XIYA 4OHRA 5MF6A 4MUHA 4KXUA 5K0FA 2GYUA 3AF3A 5GZ6A 2GPTA 1B1AA 2IYUA 4L9SA 3IMFA 3PNVA 3RT1A 4K0KB 2JEZA 5E6RB 2QTGA 1OFHA 2O2CA 2Z1DA 3HU3A 2O06A 4MW0A 4PXAA 1FX0B 1ZD4A 1BDMA 2QIOA 4IZHA 1H2HA 1XMIA 1HEYA 4K9SA 5KYNA 4DPLA 5D84A 4EW3A 4IOKA 4MA0A 3CR8A 2HMYB 1REQA 4PAMA 2DY1A 1F5SA 5DWQA 3CW9A 2EFYA 2WJPA 4IJQA 3JATB 3HA7A 2BBWA 2QTVA 1NOIA 1PL8A 2Z58A 3IXQA 4CF4A 2WKSA 2ZYUX 3HQ4O 1A96A 2PS3A 3NGXA 3OZUA 3L8GA 4CDMA 3LW7A 3LF2A 3VVLA 2LW7A 5H82A 1SBYA 2B78A 1NMYA 2QQ0A 3TSOA 3OQOA 3R9XA 1FFYA 2GEVA 2EKQA 2DMRA 4Y6GB 4KR3A 4YUZA 4Q1CA 4L5JA 4ZYXA 1ISFA 1JEJA 1UKCA 2DUUA 2XA1A 4HJRA 4Q7QA 1DC6A 2R9VA 2X5NA 2H48A 2R8OA 4TWZA 3RVBA 3UXHA 4BP8A 2ERCA 2F3PA 4FE4A 2HIMA 4UVIA 3CBGA 2RJOA 3DE3X 4CMEA 5C35A 4PQEA 3FDJA 2C0CA 3E9DA 4QFBA 1FJXA 1RWOA 2AXNA 4OLBA 2ONCA 3M6FA 5IAGA 1W36B 2QN3A 3DEKA 4CKZA 1DADA 4ZDKA 4R98A 4LZWA 2ZYDA 5E2IA 4GM0A 4W5WA 1WJGA 2WB4A 4ZJZA 1YU9A 2VUUA 1T2FA 1PDWA 2DKOA 3E4CA 4BNMA 3NHSA 3N2GB 4ZT3A 3OUZA 4C0AC 1L4YA 2B3DA 5BW5A 2GN0A 2CB0A 3M7IA 4NK4A 3L8CA 2R48A 3G5UA 4HEA1 4HNQA 1DKQA 1PK8A 3T35A 3VNUA 3L8EA 1JZTA 5CX1A 3T1NA 4BNDA 2RGBA 1EGVB 3DZJA 3IUQA 4EHAA 4KNYA 1O6BA 3G82C 5EZYB 1K7YA 3F5QA 3C4QA 3BFKA 4RESA 4KLCA 1AGXA 4A92A 3LCMA 2IITA 3FNHA 3OMXA 1WZ2A 2WNSA 3LP8A 4RTLA 1TRHA 1JIJA 2H54A 3ICVA 2CNWD 1EVLA 4Z86A 1ZOOA 4INPA 3L7DA 4AJPA 1X3LA 1ESEA 1Z5OA 3KBOA 1ZD1A 2WABA 3CLKA 2EKPA 4GXNA 4WNCA 1YL6A 2NADA 3K9HA 3H2BA 3UHFA 4QDZA 3E9RA 3V33A 4YA6A 4U2KA 4OO3A 4C7KA 1JP7A 3RK1A 1K9SA 3CLRC 1IOVA 5AHKA 2WTUA 1GARA 5LNK1 3AFMA 4XM0A 4C7OB 4M9CA 5JMPA 3EPJA 3RV3A 4XVUA 4RPLA 1QE5A 2QAGA 3PHIA 3HP4A 4AY5A 4LHSA 3DULA 1A5SB 5AW5A 1ZLXA 2ZBDA 1V7ZA 1ZVMA 2OCBA 3RVRA 2LCFA 1TT5A 2RHDA 2J6BA 3RBXA 1NDQA 4LE0A 2O3TA 2OFXA 5JCJA 3V46A 4KE7A 1D2EA 1XD2A 1IPFA 1QHFA 1XKXA 4BB9A 4B4UA 4BMSA 4EBBA 4LV8B 5IK2A 1SH7A 1HXHA 2XTNA 5K3CA 5K3FB 1M1YE 1A8PA 4F91B 1DVRA 3CE9A 2NO7A 3UMBA 4O4LB 4RF3A 5G0VA 5HUHA 4ZRMA 2VHWA 4NP6A 2JGMA 5ICGA 5JEEA 4OQEA 1I1HA 1YBVA 4MW6A 4Q1AA 3VC3A 3LCUA 3WO1A 5EIBC 1LTQA 2EP8A 4M46A 2NU8A 4CIWA 2FX2A 1WM1A 3JZAA 4RJ2A 3O8BA 2QW0X 3RRZA 4FFRA 2DSNA 1TAUA 3ROEA 4DZRA 2VJQA 1DO2A 2CVOA 2ZS7A 3BWBA 2L19A 3ZDBA 1GWNA 4LHXA 4RNDB 1VHQA 3OQHA 5J2TF 3QYPA 5CM8B 2IYZA 3OFNA 4FYPA 1LS6A 2XNSA 4FR0A 4KSYA 4UDNA 4C20A 2M2IA 1WB9A 5ARDA 3I04A 3IE2A 4KAXA 3HY3A 3VOAA 2OGTA 3H2SA 3PNLA 3LPLA 4EK9A 3G5MA 3IJEB 1NNI1 1ZSNA 3CNNA 4FC6A 3EEQA 1A8IA 3AR7A 1EUQA 4NHEA 1JSXA 2WSSD 4FNOA 4OAQA 1VP9A 1EGHA 1ZM2A 2V9PA 1FW6A 3OKCA 3ZW7A 3KC2A 3OQBA 4EHKA 3M70A 4LYJA 3REQA 4ZHQB 1ZMRA 3ZWCA 2P2DA 4BO3A 4DR7B 4M8LA 2MYNA 4RW0A 5LR6A 1LK7A 1R4AA 1J00A 1WHSA 1QGZA 2JGJA 3PG5A 3QNUA 3ZWNA 2X5OA 1G3MA 2Q46A 4XWAA 1YB2A 1DAFA 3AR4A 3N2IA 4CLOB 5JSZA 4XJVA 3ZVRA 1WXDA 5DCLA 4D44A 2BGUA 3GAAA 4I9UA 1CF2O 4LSZA 4RVCA 1ONNA 2R66A 5JXIA 5TQ0A 2BGLA 5HHTA 1UZUA 3OY7A 4PXSA 5LU9A 1UOOA 1FLDA 1ZJ6A 2RI1A 2YWBA 4J7UA 2YC2C 3JSXA 3ZK7A 1TT5B 4YRIA 1HFKA 3IUBA 2GCOA 1DJNA 2QZJA 1H4SA 2QRZA 1I1OA 4P6VF 5T64A 2DLNA 3N9IA 3MT8A 2M6SA 1C9EA 3PYMA 1QK3A 1WD5A 5GGYA 2OESA 4G1FA 1JKFA 1AC5A 1ZVKA 4MLDA 5DCYA 1H5NA 2LWIA 3MTDA 821PA 2QJRA 2VSNA 3GGCA 3KOOA 1MW8X 721PA 3H3FA 4RK7A 3WJ7A 3AUXA 2VK2A 4KPUB 2YYSA 3OZSA 4ZU3A 1BC5A 4HYTA 4DY4A 1BVYF 1BXZA 1VHTA 3H8WA 4B3TB 4KBGA 3FTFA 1ETHA 3DLIA 1CEQA 3UMCA 5CVJA 1GTRA 4NWIA 1KU0A 2GOYA 4QDTA 2PQMA 2E4UA 4Q19A 2PJRA 3KQNA 4G65A 2CDBA 3G9XA 3STUA 2FPIA 3E9ZA 5EUCA 1DIHA 1UKBA 3NI2A 1AZWA 3KSMA 1GNSA 1NUUA 2DOKA 4JELA 3HZOA 4BFZA 5JD6A 3IEMA 4RJTA 1YRYE 2J8ZA 1T91A 2QLBA 4HWSA 2XE8A 4KQIA 4OXYA 3OQPA 4JYMA 1JALA 1OH5A 4RKYA 1ZC3A 4TSFA 3UOGA 4HH4A 4MR7B 1T1GA 1QONA 2EG9A 3MMXA 1KEZA 4MP3A 1CWUA 3UH1A 5B1YA 4EX7A 1XQ6A 4MKGA 4MITA 1P5RA 2QR2A 3ZJYA 1G21B 3BXPA 4XYBA 5JASA 1DQYA 1XR3A 1B0PA 3CINA 2EKDA 5B1EA 5JARA 2A9FA 4URFA 1K4YA 1N75A 1ZD9A 3U9TA 3IBYA 1LWOA 2CL7X 2P6OA 4IDAA 2HA6A 1E18A 2QM0A 4YT5A 3OA0A 1KGDA 1VZ3A 4Z49A 3TUIC 1G2PA 2HJVA 2GCOB 4JBIA 4KK3A 5J2UB 4XCVA 2W6NA 4Y9UA 4MJXA 3NIFB 1XOIA 4H1WA 1EFKA 1K6XA 2OCYC 4FC7A 3FIJA 3K09C 3F7OA 5FO1A 1E1NA 2GZ3A 1EBBA 3N0WA 3VR6A 4RADA 3GMIA 2YYYA 1P9NA 5I5EA 1Q17A 3Q6IA 3CY6A 3OOYA 4FPXA 1ZKDA 2C77A 1IQRA 3IAHA 3K1AB 2ZSJA 3OQ1A 5C34B 1FXWA 2UZ3A 3QQ5A 4G1CA 1OZAA 3UWMA 3V32A 4WQMA 4HDMA 4LCBA 3VR4H 4E3WA 5LJLA 1FSSA 2MWMA 4U7JA 3BCSA 4MWZA 4BKPA 3DKKA 1X7DA 5BWLA 4KLNA 3OC0A 4IV8A 5HIKA 3GJ6A 1FTYA 2BFPA 4MZDA 4NKRA 4XUCA 3CONA 2OO3A 4KXFB 4Q16A 4ZVUA 3ZH2A 4R1OA 1DFIA 5JTTA 3PDCA 4C4TA 1A88A 2ERYA 1L3BA 2X77A 3VR5D 4I55B 1P1CA 1OIXA 2O3QA 1WW3A 2F43B 1PNTA 1SQ0A 4U5XA 2Y1FA 4OJMX 4F45A 4N82A 1RXVA 4LWQA 5EE9A 5L4LA 4KQWA 1RFGE 3U4QB 3GZNA 4B81A 2PY6A 1XNJA 3N53A 3CU5A 4OMUA 3BXOA 1CUJA 1JHOA 3E3MA 4PSDA 2BMEA 3D7SA 1KK1A 3HI6A 3PTLA 2JGIA 2GN4A 2Q3CA 2ECFA 5WRFA 2WR8A 3SQLA 1F2TB 1ZK3A 5EIEA 3RNLA 1Q6ZA 4DRXB 1FX1A 1NW7A 2ZB8A 2NSDA 2VYVA 3QLVC 1XMPA 3AXTA 4QJ4A 2PS0A 2YDYA 3EEFA 4K9NA 4WJZA 5D6NA 5BN5B 4AKEA 4LS3A 4MQMA 3PWZA 3P97A 1ZBQA 4G0OA 4HK4A 2A58A 2G76A 4Q18A 1S7CA 1SKYB 3PD7A 4AX4A 1B8UA 1XQ1A 2PX8A 1BXGA 1FUYB 1NBEA 4FD2A 3RGWS 1EZZA 2CD9A 2ZIFA 4FJ2A 4MRNA 4D8TA 2YV4A 3KU4A 1AE1A 2EZUA 2VUHB 2XZDA 3IMEA 5B7QA 5EZ6B 2YWCA 1LVUA 3NHZA 1DAKA 2YASA 1YGPA 1KEUA 4L28A 2D06A 1D5WA 3CRVA 2HWUA 1NI4A 3AEQB 3JD3A 3QTTA 4J8PA 4RHCA 2HHLA 4WUVA 1ATZA 5JJBA 1RYNA 5JZOA 3E22A 2CLFB 5ALMA 2AOUB 2FZEA 3HMKA 3EXFA 5FI3A 2ODAA 3GLGE 4YRRA 3GCXA 3KG2A 2Z6AA 2V7XA 2PZAA 5DCWA 3VR0A 3WLRA 3DL0A 5AM3A 2BCJQ 5EZSA 4YV1A 3EUWA 4RD1A 1YAJA 3TD6A 3RS8A 2IX9A 3A9TA 2HPVA 4KIJA 3ZU4A 1RIIA 2QHXA 3BH6A 2DT5A 3KLBA 4TLDA 4EA7A 3NETA 4DCGA 2W83A 5H3HA 1N78A 1L7QA 3UAVA 4IF4A 1RWNA 4J76A 3C1UA 2XBLA 3UWOA 1WUKS 5C81A 1ZGAA 2JFHA 3B6MA 1I5OA 4RSMA 5BN3A 3KNZA 1NU8A 1Y48E 4JN6B 3O0DA 1PJSA 1ILWA 2AG6A 3Q72A 1A7KA 3VU8A 3K0HA 2NX2A 4YUAA 5AD1A 4URVR 2AX4A 3CCFA 1U0SY 2J45A 1GR0A 2HM7A 4PR0A 3MEQA 1FS5A 3K0CA 2P2LA 3OVMA 2IF2A 5BVHB 2VT3A 4AL4A 2XGJA 1E8DA 4TXNA 2QR5A 1X1CA 5DJ5A 5LOVB 3EUFA 5TGDA 4MA5A 3UO8B 1RWMA 2G8LA 2DUMA 4RDIA 2P9ZA 1HG0A 3LCCA 3CKKA 4M0MA 2XKKA 3GC6A 4ZU6X 4TYYA 3A2MA 4BBAA 1L7MA 4MGYR 4RHFA 4DMRA 2JHFA 4E1AA 2BN4A 5ILOA 1V1RB 1J1ZA 3QPCA 1R66A 2H51A 2C96A 4IINA 4G0MA 1SBCA 3R6LA 4JLVA 1KFKB 3EMBA 3KYDA 4N5MA 4W1QA 4ZDIA 1T5TA 3G02A 1TVCA 4S1NA 5KNCD 4BGVA 1KYYA 1OBOA 1ZNWA 4E7OA 4R1UA 4LOHA 5M7EA 2FRDA 1NP6A 4JVOA 1YI1A 2Z9CA 2Q21A 3GJSA 3X1JA 4N7JA 1SUFA 4UQPA 2E7ZA 4I14A 4E5MA 1G38A 1TLFA 1NBOA 1Q0PA 4XDZA 4L27A 3HDYA 4TQUS 3VC2A 5A4DA 4I5DA 4K9LA 5IEJA 3F4LA 1WUIS 4G36A 4K0RA 3V8MA 5FYQA 3EIFA 2IDMA 1XWWA 2YR0A 1Z34A 2A5FA 3CW8X 3N2NA 1NOJA 3F8SA 1LBQA 5LDGA 2VQ6A 3RQSA 3VKFA 3SZ3A 2CUTA 4D6YA 2GTHA 1G4AE 3OT5A 2Y0BA 3VVBA 4EIWA 3KQUA 1LPAB 5I8PA 1Q7TA 4I3FA 2XD4A 4Q0MA 3PUXA 4FHCA 1OWNA 1JDPA 1U2PA 2NUPB 3AM5A 2ZUEA 2HJGA 2Z2XA 3N76A 3GCDA 3WV4A 1T5BA 3AVPA 3RYHA 1FFBA 1YTLA 4BFYA 3IHWA 2PKCA 2V59A 3SOPA 1OI4A 2FFQA 1NATA 1SOUA 2YWXA 2NO5A 3D7LA 1WTAA 3QKSA 4HC4A 1XQVA 4JEHA 1EXNA 3E7DA 3JQBA 3ZDYB 5FBVB 4ZOLA 5F7XA 3H5LA 1ONPA 2Q5CA 3USES 3EMVA 1LLFA 5FFNA 4Y0AA 4JA2A 1DC8A 4CTMA 5I4KA 2R8RA 1IEVA 1VBNA 2AGVA 1RRFA 4MRAA 4PTYA 5HIIA 3BE6A 4IDFA 1XJ0A 1YZYA 1J25A 5EE0A 3HBJA 1KC3A 1II8B 3HDHA 5FUVA 3SJAA 4D0LB 3ETDA 3W5DA 3KQLA 2OILA 2C54A 4KWIA 4G8CA 5YASA 1V4BA 2CHEA 2O7QA 2ZTMA 1LB1B 2IEBA 3GAZA 4P86A 5IVDA 2PMCA 4XVRA 3V4PB 2EKZA 1ZDMA 4DABA 5B7PA 4IJKA 4ENTA 4QDJA 4IDEA 2JCVA 4L0CA 2M6RA 4MJ3A 4TTIA 3Q7QA 1GTZA 3H0KA 3KETA 2VHQA 2AN1A 3PYLA 4C2UA 4NAVA 1AX9A 4IJ6A 1WDWB 4R8MA 4RPKA 5DI3A 4ZQCB 4I0WB 5JJ5A 1TA9A 4RZUA 2GYYA 4WJKB 4LQCA 4Z3OA 9MHTA 3TVTA 3KX2A 4F71A 3JQDA 1V9SA 3GJ7A 4JLBA 1JJBA 1RMTA 2GDJA 4X1YA 3AR5A 4ZYZA 3ZXUB 5EWLB 5H81A 4DJEC 1OFUA 4TVSA 4HLUA 2IWHA 2VSYA 3G79A 3AY7A 3SICE 4HD8A 5FNVF 1PHRA 2O2XA 4CMCA 3C2QA 3CGWA 2WAOA 4TYNA 1D09A 1FNSA 1TM2A 4V0MA 3ZD9A 4BMXA 3KB8A 5ICCA 3C6MA 3H11A 3OEEA 1X7WB 2F8TA 3QGMA 2NAFA 2WRZA 4R9SA 1QVZA 2JDID 3OESA 4YONB 1UZMA 3P2JA 3L7JA 4AUEA 1SAYA 3EQ7A 2OFWA 1NVDA 1UC8A 1IDOA 3G1TA 3UMFA 5DTEA 3FTNA 2VEOA 2H85A 4M86A 4EO4A 3C7CB 3CNBA 3DHVA 3MJEA 3WYGA 1LSJA 2PZEA 3M5WA 4BDTA 2Q4EA 2MSLA 1S5PA 4LVNA 4XEHA 2JHGA 2I34A 2E5WA 4KQ6A 5DT9A 5L7TA 1PV1A 2JGKA 4E5KA 1TJNA 1BE8A 1UT8A 2BT4A 1U7OA 2J6HA 2RGUA 3PEVA 3QYAA 1G6HA 3ICCA 4XE5A 5FLYA 5ULLA 3R9IA 5ICMA 2QRJA 4PBSA 1BDHA 2UDPA 1J8VA 1ECCA 1HDXA 3B8HA 3PFWO 4IIEA 1TAHA 1EHCA 5JC8A 5KOIA 5KAMA 2KQUA 3LQ1A 2VG8A 3IPAA 1HZZA 2V7QA 3OFVA 4E3ZA 1W93A 4MWGA 2PUCA 2I55A 5CR9A 5DBOA 2DFLA 3AF0A 3DWEX 4N9QA 1T15A 4Q6BA 1AN0A 3AB7A 3VHLB 1Z16A 2WLSA 1E3SA 1DJOA 1FNNA 1H8ED 1IDN1 1PJTA 1W25A 1WVMA 4B1FA 4A1OA 1JMVA 3FOAA 1I3MA 4O2LA 2FMUA 2CKDA 4GU5A 2YRFA 3GRFA 1GZVA 4R8KA 4B4DA 4LZAA 4F1JA 5ALFA 4ZANA 3HNRA 3I72A 3IAFA 4RDCA 1MTOA 2HTFA 3L01A 4Y2VA 1E63A 1GU7A 1ZNYA 3FUUA 3I6YA 1HT1E 1J5XA 1T4CA 1IB0A 2YNMC 4XFDA 1GTG1 1L6IA 5JCZA 1UC4B 3L4SO 1PVVA 4XVQA 1J8FA 1SM4A 3RYTC 1HOTA 1I7NA 4JJIA 4PSKA 5ALKA 3T3HA 4BU1A 3F98A 1DDOA 4M9RA 4D0GA 2PGLA 5C2JB 1GDDA 4PGHA 4FX5A 4Q05A 1A9XA 4MV4A 4KQKA 4PG5A 4E5PA 4NZMA 4UVGA 5A5FA 2BGKA 1FW8A 3NHUA 4TWBA 2V9CA 4EY5A 2VNSA 1W52X 3CUVA 4RD0A 5DRYA 3P2EA 2AOTB 3CRQA 5TNXA 4BMVA 3HDVA 1PFYA 3PDIA 4B8YA 3H4VA 4JWKA 3EZFA 3LQKA 5IJ9B 1HTBA 3K73O 5AUOB 3MIIA 3OPVA 3SJBA 3QVOA 1U81A 4BTEA 3BTUA 4RZXA 5I7RA 3MRVA 4OI0A 1YR1A 1AS2A 4BUZA 1KI3A 2PJUA 1V6CA 1GN8A 3GJ0A 2XCQA 3GUYA 1OUMA 3ORYA 4O1HA 2BYTA 2LIVA 4HY3A 4ZJUA 3OQVA 4D3DA 3MINB 4XIJA 1ECPA 4XGKA 1E5XA 3LDGA 3SXUB 4MRPA 1J42A 4PPQA 1D5CA 4DQKA 4RDXA 2FSVC 3OZ7A 1ZCAA 1EDZA 1OFIA 5EY5B 4DBVO 1MGPA 2JAUA 2NQ8A 5HOQA 1X14A 2FFAA 2BRUA 5BSRA 3TJRA 3O92A 3A1CA 3PFKA 1SBQA 1BVHA 1RKQA 1A1SA 3A4MA 5AK4A 3Q7IA 5EIOA 4ZWNA 3N0VA 1V4NA 2B4AA 4UDYX 3TDNA 1FMFA 4EAQA 4U7HA 1J49A 5K0LA 2FPMA 4IWXA 4CM8A 1QVAA 1BYUA 1Q91A 3DMTA 2XJ4A 1BYIA 1QLWA 3OZGA 4ZOAA 4BKUA 3U4DA 1NVKA 1SVNA 3TCKA 3UKDA 2AK3A 1SU8A 2EYQA 3H3JA 4XH9B 1KVSA 5E9AA 1AKNA 3RPEA 4DV1B 3GAMA 3HVUA 3NBFA 3NDPA 5LP6A 2WMDA 3FDXA 1U5AA 3R5HA 4J07A 5E38A 3VH3A 2FWBA 2YMMA 3NM4A 4HSGA 4XFKA 5TF4A 5CDYA 3QVKA 1GZ7A 4EKEA 2Y99A 3LY8A 5ALXA 5CYOA 4CT5A 5TE9A 4PYMA 3U26A 2BUCA 4QQRA 1U2RA 2VZ0A 4FSHA 4K9PA 4WFKA 1TCVA 2GN9A 5JLJA 2EFGA 4RVSA 8ATCA 1N5OX 5AM2A 4JGGA 3GVXA 2R6JA 2WVHA 4OX9Y 4ZVSA 2CLEB 5GVSA 2ERXA 3NGMA 5CYPA 1OR8A 2OP0A 1FDTA 1MB0A 1SOMA 2AUTA 2H1IA 3A05A 1I7QB 2C2YA 2YQ5A 2GZDA 3D2AA 1U0OC 4GSKA 3LFUA 3EPKA 3U48A 4GSYA 1E20A 4JUFA 3BDVA 4Y1EA 4PLVA 1ZM9A 5HJEA 1QWSA 3C8ZA 3IS3A 2SNIE 1UAYA 3U4IA 5AXDA 1KAEA 3HM9A 5AIAA 2UYYA 4C3VA 4FR5A 2WYHA 1YKSA 2ZVDA 1ZR4A 3PR1A 2CFTA 4GQBA 3H83A 4Y0NA 3R75A 3E23A 4DQ0A 3DWFA 4ME6A 3JWGA 5K6RA 5B36A 2EL9A 5I7OA 3KOMA 3NP9A 2Q0XA 3WDLA 1IQPA 4O4HA 2GETA 4S1OA 4TXMA 2G7MC 3IAM6 4EGCB 5JBIA 2ZM5A 3ZLJA 2ZFUA 1T9GS 4WSOA 4A0SA 5C8YB 1ZGJA 2QPOA 4L4ZA 1DPFA 1C3XA 3VQTA 4PGMA 4CMBA 1P4AA 1EFPB 5KTMA 4O4IF 2ABWA 1P2BA 4ZYVA 3RK0A 3OPNA 5ALGA 3ZU5A 1XALA 2JASA 4IEFB 4IJUA 3SKVA 4BVLA 3W8RA 2K7FA 1DAHA 2QZSA 3I6IA 4RJJA 3VPHA 4EG8A 3ZE1B 2K2QB 3WQBA 1BHQ1 4KC0A 1H2FA 4IRUB 2JEOA 2PVCA 2WOJA 2IH4A 1N5RA 1PD0A 4BMCA 3RYFA 3RS3A 1R64A 2GTPA 2P6MA 1HFEL 4C7VA 4U3JA 1BS1A 5E4JA 1HL7A 1YOBA 5T3YA 2IP1A 3C5CA 1SBIA 2BEUA 2UYQA 1W36D 3BHIA 1LZKA 3OPXA 1JFSA 3TLJA 4QU8A 5EXDA 1W88B 1IBSA 5ARCA 3SBOA 3ZQUA 4BE7B 3HU5A 5AVXA 3PENA 1OYVA 3U3OA 3WRYC 3OFKA 4YYZA 4WD3A 4J4BA 1NXOA 5EWMA 4C4AA 2CXPA 4M76B 4YV7A 2CFOA 2XKJE 1W5TA 3L1IA 3T4XA 5HBGA 1GZSA 4M9ZA 3AI3A 1KU6A 2X7HA 5CFOA 3AEKB 3EWNA 4JI2B 1PYOA 1VL5A 1VRWA 2O4UX 1I4OA 1G5PA 1Q74A 1SD5A 3D3KA 3KV1A 4BNUA 4YMIA 1LDYA 1UOEA 1IHPA 2KBEA 2OOKA 3PUHA 5M2QA 1TYEB 4O1IA 4A3SA 3DWIA 2EJCA 3I52A 4PE5B 1WDMA 1N36B 5CA0B 2BFMA 2ZE8A 3CG4A 4GMXA 3ZH9B 2IVFA 4PPGA 1ONSA 2CCGA 4H0NA 1E96A 3GQBB 1U98A 2CHFA 3URMA 3TSAA 3KVYA 1QRDA 4HB0A 1NJ6A 1IUOA 3TVDA 4FYKA 2DFKB 1ZLYA 3CUUA 3PGMA 4FB5A 1G7CA 2HUPA 1M8KA 1G98A 2ZTUA 3CKYA 1DI0A 3BCUA 3HKBA 1THMA 3L9XA 3RU7A 3H9BA 3KB6A 3QU7A 5AW8A 1HFWA 2BFFB 2PZLA 3PI6A 4KQJA 1MA0A 1M54A 2G6TA 4XGNA 5JS7A 4BMOB 5AMXA 2AH5A 2M1XA 5EHNA 2FCRA 4K7JA 2IZ7A 2V5AA 4DDWA 3ACDA 3EYWA 4OIFA 3V1YA 1CZOA 1F17A 1NVXQ 2LUOA 2WIFA 4JA0A 1XAJA 3U7QB 4HX9A 1FEZA 2P8SA 5BUSA 1AV6A 1DLIA 1NLYA 1T2EA 4JCCA 1B26A 1T2NA 1HE3A 2ATEA 5EMHA 4F11A 1E6MA 3ZE0B 1SXJB 1PJ8A 3DLCA 4AUMA 2RB5A 4CHTA 1AMNA 5KNLA 2XYGA 2QJWA 2HMVA 2XIJA 4ZT5A 3A2NA 1BKDR 2JJ2A 5B6PA 5JROA 1IXYA 2AR7A 4Z9FA 3I3SR 4NC9A 4CKEB 3P2MA 2PMEA 2FE1A 2CFCA 3HFJA 4LJYA 1A76A 3A4VA 5IMBA 1RLJA 1ORWA 2E18A 2PLRA 1MRZA 1E3MA 1EFTA 3DFMA 3UVEA 4DMKA 3RC1A 5C7OO 1M2WA 5JFGA 5ECDA 2KX7A 4PZZA 2EC5A 2HA4A 1CFZA 2HSJA 1L8LA 2RK4A 2XT0A 1V47A 3BVPA 3BWCA 3LLUA 3PGXA 5AWFC 3TVYA 3W34A 1L5YA 2WZDA 3BJEA 3D3WB 2JLUA 1XCBA 3L04A 1II0A 2JBAA 2A88A 3KXPA 5HFAA 3K70D 1NBIA 1ZN9A 2NZYA 3NT2A 1VL8A 1Z29A 2HMTA 4JL5A 1AQYA 3NVAA 3E84A 3CVUA 2YXDA 3ZTYA 2EEZA 2XLBA 3HUUA 2JLVA 3FHLA 1XEXA 4MVJP 2H9AA 1VG9B 4QICA 4EELA 4AKHA 4MGKR 4ED9A 3QIAA 1IRIA 3IVGA 1POWA 2I54A 3DNFA 3W79A 1JAZA 5TPZD 2R1ZA 1D2RA 2PCLA 3AT1A 4NMHA 2VSQA 4FFNA 1ZBDA 4GZ6A 2RB4A 1VQ1A 3C15C 3FCUB 2IBTA 5F73A 3HKBB 2IOYA 2QX6A 2GM3A 3AL2A 1UBEA 1V2HE 1FNBA 1K66A 1WV0A 1Y9DA 2GKGA 2HBYA 3BBPA 1FFXA 2O23A 4FUTA 1PJ4A 4GOLD 4IVRA 4QPZA 4RA9A 3FYUA 5HG0A 1ZK0A 1QH8B 2X0RA 4M8IA 5AVTA 2WJ6A 4W9NA 1N0VC 3AUFA 4WXMA 1A4IA 2POQX 4WNYA 4BPBA 4W9MC 4P4NA 4QHTA 3M4YA 4LDJA 4B6OA 3ZD7A 1VJCA 4J94A 5CLHA 4ZALA 3T12A 3QVXA 4YAGA 3GWGA 5CJ2A 2ZUBA 4NOKA 2HSZA 1O5IA 1TFRA 4CMEC 4P80A 4ZRNA 1UWLA 4MR8A 4YJFA 4RIIA 3I4FA 2WWTA 1XZGA 4M4SA 1NXVA 1WMBA 4MWCA 1PWYE 1DAIA 2EX0A 1TB4A 3KFVA 2ADMA 3VSCA 3VC1A 5A3RA 3PEWA 1L5FA 3GO4A 3IUJA 4HUQB 4YPFA 3AHFA 1TIPA 4JJEA 4C7XA 3G3EA 4W5JA 5C4MA 1JBQA 4U7TB 4DL9A 3L1UA 1SU6A 3O75A 2ON6A 5CVDA 1K3UB 1D9XA 5LD2B 3O8QA 4NEHB 4QYWA 4TZ6A 1R00A 1QX3A 5C31A 3LDHA 3WKEA 3DEJA 2DKNA 1MMFB 4ASUD 3EFOA 4J7AA 5NULA 1QZTA 3R7DA 3EDYA 3D8SA 3THWA 1NN5A 1Z68A 2VBIA 4C03A 2WIDA 4R0NA 1DPGA 2FW6A 5JD3A 3KQYA 1Q77A 4CEHA 1IN7A 1RLUA 2MR5A 4EDFA 5A2GA 1E2QA 3FNIA 5BSUA 1OGIA 2FQQA 4UVHA 3TMAA 3NHRA 1V7PC 2EAUA 1R15A 5T4EA 3WL7A 1G3UA 5EMMA 1Q0TA 3ITNA 5BV7A 1MVNA 5BWMA 5B55A 4BYGA 1YA4A 1TQHA 2UZAA 2UUBB 4IGFA 1YBHA 2N75A 3OIWA 4M1KA 5LB2A 4O3FA 5A4IS 1JEDA 2AFHA 4KJXA 5C7LO 1EXMA 2VQDA 3JD4A 4M9SA 4WCFB 1WV1A 2C4NA 3LY9A 4J90A 3V1NA 3V4LA 3BGSA 1RZRD 4E12A 2QTWB 3FKSA 5IYZA 1ZL0A 2CNBA 1YU6A 4J0KA 1COWD 4FINA 1BA2A 1EFDN 2HWWA 3I92A 3Q9LA 1JQLB 1WOYA 5BSGA 5HW0A 4BE9A 1SIUA 4Z0HO 3FPFA 3V8NA 2F2TA 1YFLA 1DTSA 2CMGA 4E2YA 2VDQB 3UMSA 3AZOA 2FE4A 4KO3S 1UEXC 4X41A 4KQFA 5KNCA 4Z4CA 2OORA 4PZ0A 5HOEA 1W2WB 1QIEA 2XQVA 1YA8A 1EVYA 1JX6A 3QPBA 5KINB 1TYCA 1OX4B 1KJIA 2CVQA 1O54A 4J3NA 2WJ4A 3U7EB 3MBKA 2OCXA 1GKKA 3GGGA 5AHWA 3WGMA 4ENSA 4UD6A 3WLSA 2HPHA 4ZV7A 1QRSA 3CNOA 4RMHA 1E1LA 3QI2A 3R9KA 1R88A 2G88A 3AW8A 1QPGA 4IH4A 2PFSA 4U6NA 3DO8A 4JBXA 4JSRA 3RFFA 3H1AA 3AG5A 1ZRMA 3OX4A 2GEJA 3FCOA 4A0GA 4US1R 2C7BA 3RANA 3ILXA 3AF1A 4Q7KA 5DTJA 4A0QA 1Z0ZA 1KI1A 2V7PA 3DDWA 4RY2A 1BEUB 1R8SA 2WK1A 1L4FA 3FAZA 3RUEA 1FJGB 3L43A 1CZNA 4P8RA 1DRVA 1Z82A 2QL7A 3TBKA 2HHAA 4HX5A 4CDRA 3IEKA 3IJ5A 4OQMA 1RQLA 1KI4A 2J5QA 2B7BA 1U65A 1KO8A 1E4VA 3OZRA 1PEAA 5KHLB 3BWEA 4LJRA 1A82A 1IM8A 2VP2A 4OXQA 5BR7A 1DQPA 3ZHBA 5EJEA 5HK8A 3HFSA 2VAVA 1GM5A 3BMOB 4AJ2A 4NG4A 1JSRA 1LF0A 3QXGA 5T4FA 5J23A 4DR3B 1YJQA 5D5QA 3I34X 2G07A 3FM9A 1GGEA 1W4CA 1O0CA 2V8BA 2YWJA 2P11A 4GI1A 4NFSA 1GP2A 1X38A 3BH0A 1T6XA 1TK2A 4O2RA 4PFQA 3RHFA 2G77B 2PWYA 3C1OA 4EL0A 3KQPA 1U31A 4LI0A 2PKWA 2JFZA 2C4WA 3G8CA 3VO9A 2AE2A 3DQPA 3X1WA 1KPGA 1KZ6A 2HLPA 2LCIA 2VDLB 4G8JA 1JHVA 4M38A 4DSZA 1BGWA 1XZPA 4LCJA 2X0DA 3BREA 3LL7A 4DBLE 5I51A 3E3LA 3LU1A 1HR0B 1TEXA 1I94B 2QX9A 2OV8A 1QK5A 5JBQA 1XYGA 2P9GA 4G0ZA 1DTWA 3AR3A 3O03A 4RTKA 5ELLA 1WEKA 4V0NA 1K08A 4FZ3A 6NULA 4MIOA 3LUCA 1GADO 4MKFA 4NCIA 4OFXA 4G4SO 4DNQA 1RWPA 1DBWA 1Q7GA 1UWKA 3C70A 2YWGA 4P93A 1B14A 4IR7A 1NP7A 3IEXA 2CWDA 3SVZA 1VKNA 4OUDB 2XX3A 5FL7A 1ZZGA 4LBWA 2O2YA 1KJYA 3RTBA 1VBMA 2WVGA 3GFVA 2ZBPA 4D81A 2JDIA 4OLAA 5E2BA 1YHZA 2J33A 3DCNA 3JAKA 3UCEA 1DMRA 3U39A 4ZQIA 3DEFA 2FMKA 3PQ7A 1OA1A 5FUXA 2H1LA 4YP7A 4ZCPA 5HE9A 4NRDA 4BOYA 4F12A 3P0IA 2YW2A 1IEXA 3CX3A 4N5NA 2ETXA 1Z4LA 3MJVA 1LCIA 1WABA 1YIOA 3K1JA 4NYJQ 4DA7A 4MHTA 3I64A 3BQ9A 2O7RA 4CLHA 3TFWA 2QDXA 2YV2A 1NSTA 4JOSA 4OCZA 4R2JA 4ARIA 1XMQB 3KXLA 1Z0JA 4RETA 4AC9A 5CJPA 4FK8A 5LQDA 1YRQA 1PR4A 1YVPA 5KHAA 2XTZA 3H97A 2NTEA 2ZJFA 1SZPA 3NPMA 1Z6AA 4H7JA 4XAQA 3MTEA 2C8LA 3RKUA 1JYEA 1GZ3A 1TQ6A 2IYRA 1EX6A 3OWOA 2R8BA 3LO8A 1LNZA 1RHMA 2QROA 1YQGA 3L02A 3O8OA 5AI8A 2PA3A 3HC7A 3AR9A 1H8EA 5HF5A 2IV7A 4FIZA 2PDAA 4N0QA 1OA0A 4UEQA 4X65B 3P45A 5CCDA 1O58A 3OE5A 4EP1A 4P7KA 2F4NA 3GLHA 3RSOA 1XBTA 4NOLA 3ANNA 4O4JF 4B43A 3KS9A 1KDVA 4IRMA 3JPWA 5IH7A 2I3BA 4M0UA 1G6KA 4DLRA 1KEEB 2IXDA 3KEFA 2G1PA 4GKJB 2HNKA 5JS8A 1JXAA 3DMDA 4EPWA 1T6BY 4RLSA 5HJ2A 1FRNA 3QUBA 1E4EA 2CD7A 3MZ0A 5D87A 3PWTA 5CT9A 4HTFA 1TMYA 2JBWA 4JDUA 4CKWB 2IYOA 1TZKA 2C5AA 1Y3FE 2ZRIA 4QO7A 4Y18A 1WXWA 2JJQA 5JOQA 1X1EA 2V4UA 2VXYA 3C3BA 4KSCA 2HT1A 2XMBA 3U4GA 4RTQA 5DNVA 1AGPA 4OLHA 1WMAA 4M1QA 2KJQA 4DYHA 1BDJA 2Y9PB 3F5FA 1QIDA 2QGNA 1UZNA 3CVOA 3DXFA 3J80A 2UUOA 2GH1A 5FUBA 2AXQA 3T5MA 3X43A 3L93A 5L95A 2FQ1A 1AU9A 2A5LA 1JPJA 1P9WA 3LGAA 2DG2A 2DWQA 3WL4A 4URWR 4B48A 2HEGA 3IP1A 3VJKA 3DONA 5DLEA 4COOA 3B1ZA 2OAQ1 5HKKD 5JISA 4NDZA 2JVKA 1TRKA 2J67A 3ZN2A 4C4ZA 3SY8A 2B92A 3WYNA 1BW9B 1JA1A 5EP3A 4YY3B 3DL2A 2GN6A 3V2HA 4XEUA 1SXIA 1VDZA 5B6JA 2AQHA 1PT6A 2IYLD 3FGPA 4KR6A 5KNBD 2J3EA 5C53B 3TAHA 2H8KA 2JCXA 2ZRLA 3L0CA 4AF6A 4V2IA 1M5UA 2PRZA 4YRSA 3A58B 4K3UA 1ZAYA 1KJZA 1VSUA 1U6JA 1EP9A 3Q5GA 1N33B 1SWVA 5BOSA 5CFMA 4OKSA 3TPFA 2ACEA 2G9VA 4RJKA 2M1ZA 4EGSA 3I8OA 4LPKA 4LY9A 3DZ8A 2Z1NA 1LFAA 3E9EA 4UE6A 5K2OA 3PC8A 1N6KA 2J3DA 1D8TA 3DAPA 1PFQA 1BMTA 1M2EA 4M98A 2XOKA 4HG2A 1L4HA 1WXGA 4ODIA 4ZI2A 1NWHA 5B58T 1K1EA 4EGQA 1RQNA 3VYSB 5ANRB 4QGBA 5D1HA 4EQ6A 3QEJA 4LWOA 4BATA 1F9EA 4Z7OB 4WK4B 4KR0A 4CL2A 2BZSA 3PEEA 1S6YA 1N4AA 4R8SA 4IIYA 4GP6A 3W9YA 3DW3X 3MMZA 4GEKA 2XITA 3IRVA 4JLKA 4JFRA 1TCUA 3WA6A 3I2YX 2VP3A 4YCNA 4H35A 2ZTHA 2CKMA 4HB4A 2F3SA 4WBNF 2ZWMA 1KI6B 9ATCA 3SZMA 1M34B 4KX3A 2VJMB 2IV3A 5FI0B 4AB1A 1JDZA 5CDSA 1FMJA 1O95A 2FMXA 5CIQA 1HTWA 1I80A 3X44A 2GD0A 1RR6A 3DTYA 3I9NA 1TVKB 4TVKA 4Y2XA 4Q4AA 4D8WA 4J7XA 2QRVB 1H2WA 2FB9A 4JB2A 1P72A 1CNMA 1Z28A 2JGDB 1Q0LA 3IIIA 5CDHA 3GI1A 1DE0A 3FG9A 2VTEA 3H1PA 1SRRA 2IEYA 1THGA 2HU2A 2ZLBA 1U8CB 3QFTA 1DEOA 4TTJA 2OXTA 3KK0A 5E6SB 1H3NA 5D3QA 2GEDA 3LQFA 1TYBE 1NYLA 1CHDA 5DF1A 3WK6A 5I3ZA 2F3QA 2D7JA 4J91A 4WK0B 2F1IA 4GMHA 2ZR0A 3CS3A 4YJGA 3KQWA 4MTLA 2ORWA 1CUUA 4X9XA 2R8YA 4FMDB 4IX1A 3QMMA 1YMVA 1KWKA 2IFTA 3CV3A 4NK5A 1RJ9B 3DOOA 4WOCA 3ND6A 3KOXA 1HORA 2ZI7A 3I45A 2G7ZA 3DL7A 1M1YA 4DIBA 3ABQB 1BKYA 3DP9A 3U62A 3EIEA 1R9JA 1WEHA 3R8CA 3K0CC 4KDRA 4A5OA 4Y2PA 3Q9UA 3RTGA 2QG9A 1RKVA 2O8EB 2VRCA 1F6DA 3A1EA 5SYNA 1OV6A 4Q3BA 1LH0A 2FYTA 3P0FA 2TMYA 3U3ZA 1Y8QA 4P2BA 3SEZA 2Y93A 3GPBA 4OEHA 1KYZA 4RAQA 3FZYA 4DR5B 1AO3A 2JFUA 1C7RA 3DBHB 3Q2OA 3R5SA 3JARB 4MUBA 2I8CA 2LNDA 4I50F 3A36A 4UAJA 5A6SB 5K8VA 1QGUA 1ZAKA 2HIAA 3ENKA 3RTDA 3VDNB 4B71A 3IEIA 2V7VA 4MPRA 2Y3IA 2R5WA 3X1XA 3OKPA 1T6NA 1KTVA 1U1GA 4UZSA 3TTUA 4EHNA 1XRLA 1W1IA 1Q5PA 3V9AA 3GD7A 3WIDA 4FGSA 4IIJB 3HCOA 4OOFA 4D9NA 1PV4A 4NBRA 2YH2A 1F8XA 2FRDC 2ECKA 3E0XA 1S89A 2VZ8A 4WXYB 2HXSA 1E9AA 1HUQA 1N6RA 3N8IA 1MF7A 4RABA 3RRMA 5FQOA 3SM9A 2UUCB 4FNMA 5IJXA 1ZQ1A 2I1LA 4R4JA 4HEQA 4LTNA 3LX4A 4GR9A 1EE2A 2O20A 3NFRA 3O74A 2BH2A 1GL9B 1SBZA 1O0BA 5HKLA 3HTXA 4DVJA 4ZI7F 2UZIR 4PG7A 4D41A 2Q1XA 1IB6A 4WZAB 3U3DA 1RC8A 3H99A 2O50A 3IIKA 2DERA 1MT0A 2B7CA 1C7IA 3DGEC 3LAWA 3P26A 4F6CA 2CLSA 4H4CA 2DECA 3C3EA 2O9JA 1CUIA 1ORIA 3R09A 3DH0A 5P21A 1ACMA 1TC1A 1G9TA 1RMYA 2MINA 2E87A 2GLXA 2XI4A 1F06A 4MPJA 3MIZA 2QGFA 3BFXA 3UG6A 1T8RA 4U7WA 5IVIA 2COUA 5AOBA 2XQIA 5I4CA 1CQPA 1F0YA 4WKGA 3U6KA 3RIEA 2V0CA 3S5UA 5AVUA 3NYQA 1MV8A 2C2KA 4LFBB 5FWYB 2XNDD 2WIGA 5K6AA 4DILA 1PEKE 2JIOA 2V7EA 5FJJA 1EWRA 3JQBC 4ZA2A 5EKXA 1IAVA 3OETA 4PIMA 5HJ5A 2VLBA 3A04A 3N6RA 4G41A 2D3TA 4NYJR 4RMNA 3UT5A 3EB9A 3BOSA 3HB1A 1M2VB 1FL9A 4M0KA 4QYIB 3VZSA 2UVPB 3VKVA 1YRWA 1KI8A 3JQCA 4HUTA 4GQAA 4QOEA 4AMZA 4UU7A 5FPYA 1C9NA 3BX1A 3JQ8A 1E7MA 3QVGB 3EFBA 1HE8B 2YQZA 3ROKA 2XZOA 5F2EA 4R2KA 1PEDA 3TB6A 2JBHA 2CCKA 4RM3A 1A50B 4XQCA 3DXYA 3WMGA 3KJFA 1G1MA 3ZQKA 1RXIA 4HPWA 4JC8A 3BSSA 5A1TA 5DNUA 1H65A 5E3JA 3A1SA 3FTEA 3WNDA 3HA2A 3I1IA 1YI0A 4BZXA 2A57A 3VJLA 1GR1A 3B3QA 2HWKA 4HLUC 2O2HA 2HDOA 5IC4A 1U6IA 3OT4A 5DNEA 2VTBA 4JXZA 2AG8A 3U9SA 2GM9A 3STXA 3DBIA 4FWBA 4LC9A 1DKMA 1E3LA 4JYBA 1U8EA 3A31A 5IP5A 5F12A 3OEYA 3E8SA 3OCXA 3QJ5A 5KOHB 5F5XA 2XUAA 2A33A 4YRGA 1PR5A 2JLXA 3P1JA 4MPPA 3SLGA 5ECYA 2H4WA 1Y1TA 3PUVA 4HH1A 4QODA 5IF9A 2MYTA 2OFFA 5AK3A 2DU8A 4PYJA 2EJWA 3I4LA 1NVMB 3QU9A 4J75A 1YC2A 1HOXA 2P3OA 4OL9A 1CY2A 1KSGA 4B4OA 1T13A 3QKIA 3V2GA 4EUKA 1J7KA 1JF8A 4F8JA 2ZS8A 4KGZA 3AB8A 3T3OA 2AFRA 2EL7A 2QV7A 4U9HS 4BMPB 2QT1A 2WWRA 1OREA 2JJYA 3JQ7B 1JEAA 3BGVA 2M6KA 1TZMA 5TPZA 3RRFA 3T7KA 4BNVA 3QXJA 3VPFA 1XL0A 5C18A 2HRBA 2PGXA 3UYKA 1SIWA 1ZC4A 1XQWA 4XDYA 5F78A 2C2MA 3O4JA 4AO7A 1HZZC 1SVOA 3F49S 1Y4ZA 3I01M 3BGIA 2HEIA 3K3PA 1U0NA 4IF6A 3E15A 5DSXA 4KE8A 3UWSA 1MKYA 1KDYA 3CHYA 3GGJA 3IAS1 2B82A 1DRWA 4G63A 1EFUA 2JK0A 1JLKA 1XB2A 1QDEA 4HDRB 5HF6A 1E5VA 3NKVA 1EGQA 5FBWB 1GG2A 3E3AA 3ZIDA 2UZ1B 4CF3A 1CB7A 1QH1B 4RLHA 4PRZA 3STYA 3VOBA 2CXXA 4MI1A 4J6FA 3Q5EA 4B3SB 1AQ6A 3T41A 1N9GB 1TVMA 4F2PA 4G5RA 2QTFA 2XNJA 4GOKA 4YAFA 1KGSA 5GZ3A 3T3PB 2EHDA 1G5HA 3EE6A 1NQTA 4H08A 2VPWA 5ESWA 3M2PA 1V48A 7MDHA 1O6ZA 1T9BA 2R4UA 4D56A 1TM3E 3F6RA 5FUWA 3MTGA 2DBVO 2DEUA 3NM5A 4MMYB 3KOWA 4OK6A 4OMFG 6CHYA 4HYQA 4TQ9A 3LLCA 1UMBA 5L6LB 1M8PA 2DUWA 4N3AA 4AG6A 3UGJA 1CUYA 1JQKA 3FB1A 4WAUA 5A4KA 2DGDA 2H7CA 4HDSB 4CM6A 1W9HA 2CEKA 1E77A 3QVWA 4ASUA 2VP6A 2BR5A 3VSAA 3ZCTA 2R79A 3NT5A 4I36A 4UW9A 4H4DA 3OOJA 3PF8A 2E6KA 2VH5R 1TGVA 2GA9A 5CLGA 3ZDCA 4WESA 2QUHA 5HMMA 4FM9A 3ZV5A 3DM5A 2PGDA 4HQ0A 3GT4A 3OX2A 1NI5A 1Z37A 2HA0A 3R5FA 1XQ9A 3DZKA 2XKBA 3I0NA 2AFVA 2QQGA 4P58A 4B7XA 4BEVA 3OIVA 3WYEA 3QQPA 5BSTA 3DFKA 4UASA 1SXHA 2C94A 4JR0A 1WPQA 4OIMA 1CJTC 4TTRA 1B3BA 1J7JA 2QF7A 1L5RA 4ZVLA 5H7XA 4JSTA 3MGCA 4WNIA 2NUTA 4O59O 3T3EA 4L7QA 4X5OA 1TMGE 1ORHA 4Q00A 5DOVA 2H9IA 2WKQA 4PHHA 1YB6A 1WP4A 2XVAA 4U8HA 3LKDA 1XMXA 4KKVA 4BASA 5IBCA 4DT1B 5DX8A 1RDFA 2BRUC 1RZRA 1YZFA 1JFRA 4Q4JA 3KPWA 1WA5A 2HZBA 4F3YA 1C80A 2NLOA 4J2TA 4YMSA 1C0LA 2BR4A 4WL0A 5SV2A 5IABA 4LJLA 3A2KA 1NURA 1H2RS 1JDJA 1AXGA 1FP2A 3N86A 1AGRA 2ONJA 1TQ2A 4MDFA 1VCHA 1Z07A 4FHFA 4HGRA 3FMIA 421PA 4GOMD 5JXHA 4UAGA 2NIPA 1E2FA 3C3CA 3SI7A 1HYGA 1EFVA 1MAHA 3DMTC 3SLRA 5JD5A 1RP1A 3JWIA 4M1MA 3ACCA 1ZVVA 1SXJD 2JS7A 1R74A 2VDRB 4TGLA 1CZKA 1K6MA 2FZ5A 1QCCA 1U0EA 2XDQB 4ZVTA 3ZV6A 4NQRA 3QF7A 4V0QA 3K9CA 4O2AA 2NN3C 3EZ2A 1L5WA 3AQ4A 1T9AA 1O5OA 4KI7A 1E3WA 5LP6C 1UPXA 3D31A 4JCOA 3FTCA 3THOA 3W5VA 2X1LA 4Q3NA 1TF7A 1HRKA 1HK7A 1Y3AA 3E5RA 3QENA 1Z62A 4M60A 5JAMA 1B93A 4Y2YA 4UOQA 4AJJA 1VPTA 4C4SA 4HAZA 2WKPA 2H5IA 3S5JA 1E6EA 3FPEA 1ZG3A 2WBLC 2JK1A 1M33A 2XZPA 2ZOSA 5CT8A 1M7BA 1NKVA 2P67A 3Q7PA 3QPVA 1EVJA 1JLLB 3A27A 1SC1A 3IP6A 2VRNA 1E3DA 2OAEA 7REQA 5LCXA 1GFSA 1XCGB 4M8NE 1CS4C 5I7FA 3S7ZA 1BEZA 2GVDC 3MD9A 3UGTA 2KLHA 3KAKA 2C0QA 1DWOA 1JQBA 3B9RA 4CE6A 1RAAA 2ZAGA 3Q9SA 4RTJA 3FPCA 3H9GA 3X1KA 1V43A 1ZI6A 2PAFA 2ZAMA 1QK4A 1ZL2A 2QW1A 1LDNA 1TYDE 1C3VA 1MJGM 4TWJA 4ERNA 3KJZA 1VJRA 4R81A 1TKCA 1SXQA 3PGVA 1OGYA 2HXYA 4MKXA 3IMKA 4MTCA 2P6NA 3SPXA 1BVUA 3QE3A 5CNMA 5AM5A 4NAUA 1VSVA 5FOWA 1C7QA 1T35A 1U3VA 1U02A 1KMHA 5CDGA 1FCJA 1A95A 2C5LA 2I67A 3PGLA 3GLGB 5AH0A 3AUTA 2BKXA 3F4KA 2A86A 3DBRB 5B4UA 2PMKA 5K45A 5J2TB 2ATIA 1JFVA 2CJFA 2EATA 1Z5UA 3FYSA 4K9DA 4CG0A 3ENNA 2J59A 2I3GA 4DSAA 2D5CA 1BX3A 1IHUA 2FPRA 2WHYA 2FEAA 1M0TA 1QVWA 1D7AA 4Q4CA 4MW5A 4MMZB 3Q8MA 3OCYA 2KB0A 1DJMA 2VA8A 5AVSA 4AT1A 3BWVA 5DP1A 4M0FA 3RSLA 2NU9B 3EGXA 1ZS9A 1EI9A 3EIWA 4ND8A 4C06A 1T0JB 1NASA 4BX2A 1P75A 1E7WA 2D5LA 3JQAA 1NX9A 2WHPB 4HTAA 3LBAA 2AX3A 4OATA 3BRQA 4J0JA 1OZGA 1UZLA 4WLOA 4A5SA 1CT9A 2QE7D 1JLSA 3EY9A 1ISPA 1PQ4A 3WWEA 3NCHA 2IIPA 4MUAA 1NJGA 3ABIA 5CXQA 2A30A 3GJYA 1RZUA 1Z2NX 2IWRA 4GOXA 4WZZA 2QLFA 3K0EA 4Z5XA 3H0CA 5K0GA 4NJOA 1IYZA 4LQDA 2GA8A 3LL4A 2VWGA 1D0SA 4ARZB 4CG3A 5BUQA 2BSXA 4L0DA 4B44A 4MQBA 3K0FA 1QV7A 3AX6A 2P9YA 3X3HA 5GM1A 2Y2VA 4AD8A 5AKIA 1W59A 2V7TA 5DM4A 1H05A 5LQKA 2K6GA 4II7A 4BGEA 5EYPB 5LL6P 1CIPA 2B94A 2BEVB 4L95C 2H0AA 2J09A 1QRTA 2J0UB 3PUIA 3RBAA 2IYQA 1MHPA 1CCWA 1U3GA 3D81A 4ZYTA 2RONA 1DBRA 1GOTA 1GG8A 2PH5A 3NT4A 4J0CA 5EVJA 3WLHA 3QKRB 5CFLA 1ZY2A 3O6VA 3A0RB 4IZ6A 2RHBA 4FDAA 2ATVA 4UFOA 2QR3A 4GXTA 1UBOS 4AZWA 2PRIA 1BX1A 4IGEA 5KREA 3K5HA 1N25A 3Q4GA 3ZHUA 2AUNA 4ZGWA 5JCOA 4CG2A 2C3YA 1G18A 1FFAA 2PUVA 3JQQA 3A1FA 4GG1A 4GNKA 3R74A 5MN6A 1E2PA 4BBZA 4FLEA 2XDWA 1HFJA 2LP4Y 1IHXA 1QS0A 3D5EA 3FOEC 1DBQA 5L8VA 1R12A 4EAAA 5LQSA 1RXUA 1OI3A 2P9QA 2OAGA 3CJRA 5FBZA 1DXHA 4KXNA 3VR4A 1GUAA 3DHYA 4P81A 4XASA 1G3QA 4GOOD 3UOAB 1ZM3A 2OXFA 4FZVA 3R5TA 1A8QA 3AI2A 3CW2A 4C4RA 1MJHA 5GAJA 1Z73A 1YJXA 4G0PA 2GASA 4CL0A 3FF4A 4LXUA 3Q12A 3RB8A 3QE0A 5BSVA 4QM7A 1AT1A 4QAQA 4UOZA 5I6DA 4A36A 2PH7A 1JDVA 2GD2A 2XRMA 5AVOA 3VZQA 1CRWG 3B3GA 2HBRA 4XPZA 2C7PA 1E5DA 4FHEA 2ZIAA 3UJCA 4K6HA 1YB5A 2H92A 5DHFA 3INRA 4G89A 2RGAA 3FGNA 4EY3A 1JFFB 3OF2A 3CUKA 5LB4A 1UKYA 3BD6A 3H18A 4QEZA 4QXMA 5AXCA 2X9LA 5DNCA 2XVMA 1KY2A 4NPAA 5CNKA 4FXOA 1SCIA 2NT3A 1DQZA 4NARA 4CT4B 3V7NA 1XKLA 2GBIA 4P83A 3IP9A 1K7XB 2FR1A 5DTQA 2AKAB 3SIRA 3W6PA 4YYEA 4TUYA 4ZARA 5JS2A 1DAPA 1P5FA 3KFLA 4FOOA 4BVJA 4TTPA 3SF8B 3R7LA 1V5IA 3LY5A 3O8LA 1MB9A 3COSA 1QOQB 1V8BA 4BECA 3C16C 1YB4A 2QUAA 1KPIA 3A7DA 3DZHA 3LDAA 3MB5A 1XXHA 3FPSA 3L4BA 4HGYA 2A0KA 4IHQA 3H4TA 4DRZA 1M0EA 1JI3A 5KNBA 4YDSA 2IYFA 3H19A 4ENQA 3AVYA 3DDUA 3FLMA 3NRJA 1UM8A 1WF3A 2PXHA 2IOFA 2VXCA 1OYOA 3ANMA 1ARZA 1BXRA 4PCAA 2H2IA 3T5BA 2ZI5A 4TVOA 4BJ1A 4ER0A 5HUQA 1XTVA 3T7IA 1U2GA 2CL6X 3D0KA 2AZTA 3WMWA 3EVTA 1Y7HA 4HDOB 4YB8A 1U6KA 2P65A 2WT4A 3H9EO 3IEPA 5F52A 3WWYA 5KQPA 1IRXA 1E66A 3HLKA 4F21A 1DT5A 1IEQA 2GX6A 2ZRCA 4QARA 2GVZC 1EDBA 3FYUC 1XV5A 4MQFB 5EIHA 4TROA 1J07A 2X7XA 4W9NC 1CB0A 1OQAA 1XRRA 4LY3A 5IM4F 4WVFA 3V48A 1GRVA 2C4HA 2TS1A 1WDTA 4LRXA 4I1RA 4QG7A 4IQGA 5THQA 3SR4A 1KZ7B 2NUBA 3A4LA 3DD1A 3TTSA 4CRWB 1WSWA 3PI7A 4J9UE 5FO0A 5C1DA 3K9GA 3G6WA 4XLZA 1UBNA 4TT3A 3IUYA 1MOSA 2C07A 1ZCZA 4EJFA 5ILGA 4DYVA 4E14A 3K9FC 3JYLA 1X1QA 3O83A 4V24A 1DMSA 3IBCA 2NO4A 1M6YA 2HT6A 1VFNA 3KLNA 2GZAA 3LYLA 3DJFA 4TXHA 4RKEA 3G2LA 4H6WA 2Q45A 3EGDA 4B33A 1R4MB 3BE8A 3SQNA 4XQGA 4PY2A 1RKBA 2F3RA 2W2QA 3R0ZA 5FUMA 3HYCA 4QNRA 3W06A 3HDJA 4FEGA 1PWXA 4KAJA 4ZTZB 2CHUA 3G9TA 2GZ1A 1CY6A 1IJFA 1LBEA 4GT1A 5COQA 1N2GA 1OI7A 3LZDA 5CB4F 4ICIA 1SC6A 3OJEA 3T7EA 3MILA 5BMVA 2FEPA 2R4QA 1PZHA 3LQRA 3NB0A 3PNMA 4Z9AA 5IJAA 5IKOA 3M6XA 4ZO7A 3TM4A 3RUAA 1UBMS 1E3TA 4Q3LA 5FOTA 1EWKA 1D6SA 2IQIA 3P9SA 2PUTA 2VYQA 1XMOB 2EWWA 5DTMA 3TX2A 3QHPA 4YRJA 4KN8A 3GEDA 2W2VA 3DNPA 1KVTA 1XZQA 3FOBA 2VP0A 5ELMA 1E1CA 3RRXA 2JGFA 3O94A 1Q57A 3U7HB 2B25A 2WZQA 3OLZA 4MDHA 1KPHA 2OWEA 3R77A 3C5WP 4MEJA 3K9WA 4ZTBA 4CCYB 4P53A 2IE0A 1BZYA 1T0BA 1B4DA 3PDWA 2P3LA 4KPEC 3QUSA 4OYYA 2IHBA 1G3IA 3TKLA 2GGSA 1WZNA 1SVIA 1NVVQ 2HU5A 4RCZA 5H02A 4HWKA 4FONA 4WKBA 2O7VA 3U13A 3L0OA 3VTAA 5CX4A 1KIFA 3TLXA 5HS4A 3RTAA 1FDIA 5KYWA 2J3MA 3Q3HA 3MJCA 2G0AA 4J4HA 2JATA 3BL8A 3VM6A 1KJWA 5KYXB 5AJTA 1E5QA 2MU1A 3AUSA 4OUKX 1P9RA 4WDRA 3EXEB 3E4DA 5JWRA 1LLCA 3P9YA 5AXAA 3WNVA 1RAFA 3T95A 2ZRAA 2OORC 3F8TA 2VTDA 4F6LA 2JPDA 3EXIA 4V1CA 5ES4B 2FG6C 4D9GA 1KAGA 3P9PA 4IDHA 4X8HA 1CNFA 4QVGA 5I7EA 4DG5A 4TLCA 1BG6A 1CQIB 1U3UA 2FMFA 3QTLA 1ADBA 1ZMTA 3ELYA 3QUQA 4YASA 2EZ8A 3W3AH 3HLYA 3L7OA 2XMPA 2GCGA 2OYSA 2YUTA 1G5IA 2DETA 3HK2A 5F1KA 5JUWA 4YN3A 2C7VA 1EJ6A 1NFFA 3L7AA 3MT0A 1GUZA 1D2AA 1VA4A 4BWVA 3U7GA 4MKZA 4TZTA 4WXEA 3VHRA 4OXNA 3RS9A 2NNLD 2FK7A 5E0OA 2ZPUA 3TN7A 2RJ3A 1IMJA 3HJBA 3VXKA 2IF0A 2VHEA 4BAZA 4O0LA 2PH1A 4Z3KA 5LM3A 4INOA 2HSWA 5KO2A 2Q29A 4W99A 2FRVA 2V98A 1RYDA 1T0HB 2OQ2A 5EHGA 4BNTA 2QNRA 5JEDA 4R3UC 3HXPA 4DLAA 3GLSA 4BFVA 2IOFK 4IFIA 1HQKA 4L5CA 5EG5A 5JAQA 4C0JA 3AFGA 1LI7A 1XO1A 3ZDDA 2DP4E 3V80A 1IUKA 2RD2A 2YV1A 1UPAA 1JIUA 2AN9A 4GDMA 3CH4B 2A67A 3EVBA 2IPXA 1BAPA 4GPTA 3HV0A 1P73A 5GTDA 5H8WA 3PIDA 3N3AC 2Z5VA 3QNMA 2WU4A 1YASA 4BVHA 2F55A 3RKRA 3ZZ1A 4TRJA 2MHCA 1UIMA 2XVZA 2P35A 1HLDA 2QGZA 1U8FO