1JEAA

Altered topology and flexibility in engineered subtilisin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SUBTILISIN
publication title Engineered Bacillus lentus subtilisins having altered flexibility.
pubmed doi rcsb
source organism Bacillus lentus
total genus 95
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1997-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1jeaA00
1AVTA 3DW3X 1SIOA 1AQNA 3CNQS 1SH7A 1R6VA 2X8JB 1T1GA 1T1IA 1OYOA 1OYVA 1TK2A 1BFUA 1AV7A 2PMWB 4HVLA 1P7WA 4KG7A 1ST2A 3I2YX 2ID4A 5JXHA 1TECE 3AJ8A 1GT91 3TI9A 4BWGA 1P8JA 3CO0S 1S2NA 3VV2A 5ARDA 1SCAA 2GKOA 4DZTA 1WSDA 2Z2XA 1GNSA 3TECE 3BGOS 4WOCA 2E1PA 3EDYA 1BE8A 1GTL1 1TMGE 4GI3A 3D43A 4ZOQI 3GCXA 3A3OA 1YU6A 2WWTA 4AKTA 1GA6A 4K8RB 3PRKE 4H6WA 3Q40A 3TI7A 1C9NA 1SBHA 3F49S 2X8JA 1GA4A 1KE1A 1AK9A 2WUVA 3DE2X 1EA7A 1MEEA 2HD4A 4LVNA 1EGQA 1KDVA 3GT4A 3P5BA 2IXTA 3DE3X 2XTJA 1V5IA 1HT3A 3SICE 1Y4AE 3VTAA 3DDZX 1IAVA 3VYVA 1NDUA 3A3PA 1SUCA 4M1ZA 1BH6A 3HJRA 1SPBS 1Y9ZA 2DUJA 5ARCA 3F7OA 1ZVKA 1AF4A 2SECE 4CG0A 2QTWB 3Q5GA 3ZXXA 1Q5PA 1Y3DE 1S01A 1Y33E 3GCWA 1SCNE 4NMXB 1WVMA 5FBZA 1GNVA 2ZRQA 2PYZA 2ST1A 1SVNA 1TM5E 3EIFA 2W2PA 4C3VA 3LXUX 2Z57A 1PTKA 5AVJA 1TM4E 1TO2E 2PWBA 3I37X 4J94A 5ARBA 2IY9A 1UBNA 5AQEA 1DUIA 3DVQX 1TM7E 4H6VA 1BE6A 1ST3A 1NLUA 4B5LA 1TO1E 1MPTA 3WIVA 1TM3E 1SCDA 1SCJA 1SIBE 1THMA 3EE6A 2SNIE 1PFGA 1SUAA 1SUEA 2W2QA 3QFHA 2ZWPA 1VSBA 3BPSA 3AJ9A 3ZXYA 3I30X 2WUWE 2SICE 3VV3A 3DE1X 1SIUA 5B1EA 2Z58A 1KDYA 3GT3A 5JXIA 3VSBA 5FFNA 5AMXA 1SUPA 1SBIA 1Y3BE 4ZARA 3QTLA 1C9MA 1R0RE 3DE7X 1PJ8A 4AKSA 1P7VA 1SUDA 2PRKA 1TM1E 1SBCA 4DWWA 2PQ2A 3H42B 2HPZA 3AFGA 1T1EA 1R64A 1OT5A 3DW1X 3WHIA 2DQKA 3DYBA 4OMDA 1SN7A 4MZDA 3SQOA 2Z2ZA 1Y4DE 5I9SA 2ID8A 3DWEX 2TECE 3LPAA 3DE5X 1Y1KE 1GTJ1 1NDQA 1SELA 1CNMA 3OSZA 2W2MA 3DE0X 1AU9A 1WMEA 2WV7A 1BFKA 1PEKE 2ZWOA 1SBNE 4OMCA 2PKCA 4H6XA 3A3NA 3T41A 3VHQA 2G4VA 4YN3A 1CSEE 2W2OA 2V8BA 1ZVJA 3UNXA 3DE4X 1YJBA 1SBTA 1GCIA 2W2NA 4I0WB 2SBTA 5B1DA 4NE9A 1WMDA 1YJAA 1Y48E 1KE2A 4Z2AA 1C9JA 1S02A 3WQBA 5AVKA 1IC6A 4OV6B 1JEAA 3DVRX 3I34X 4JP8A 2Z2YA 3PTLA 1C3LA 4HX2A 1Y34E 2Z56A 1XF1A 3LPDA 5K7SA 3BX1A 3L1KA 3QMPA 3F7MA 3WIUA 1Y3CE 4C3UA 1YJCA 3DE6X 2Z30A 2B6NA 3DVSX 4KPGA 1LW6E 1KDZA 4CFYA 4LVOA 1BJRE 4RYDA 1V6CA 2P4EA 1SCBA 2DP4E 1WMFA 5JXJA 4WOBA 1AH2A 5FAXA 5SICE 4CFZA 4KB5A 3LPCA 1DBIA 5CW1A 1SUBA 1A2QA 2XRMA 5JXGA 1Y3FE 2PWAA 4NE7A 5JMOA 3D9QX 1GA1A 4FONA 4DJ5X 1GTG1
chains in the Genus database with same CATH superfamily
1ANKA 5MN6A 4E4RA 2V0GA 2PWPA 3AB7A 1DAKA 4YDRA 2OZKA 3AWIA 1TUEA 1BS1A 1SIOA 5DLPA 2XUJA 4IYJA 4YCAA 4BEVA 1YS2X 1XPUA 3LLUA 1KMQA 4LXXA 5LWQA 5KKNB 4JD5A 1H69A 4UVHA 4FFNA 3H9JA 5F3DA 3ZWXA 4BVGA 4EKNB 2FWJA 3DDNA 4RFSA 3RTCA 1ZVVA 2H63A 3C39A 3D0KA 1IL0A 1BFUA 1WU8A 1AV7A 2YW2A 3HBAA 1CR1A 3GRZA 1RP1A 3HCAA 3OIUA 3O4JA 2PL3A 2Q8QA 3TDKA 3VR3D 3ZEAA 4CFSA 2PMWB 3U4DA 1B42A 2QYOA 3PD7A 3TGLA 2ZUCA 4E33A 1XCMA 4C2AA 4BUJA 2IX3A 1FVHA 1Y4ZA 1RWVA 3MWDB 2J3IA 3EH2A 3RREA 3KX2A 2ZI7A 1EX9A 4GOOD 2V7VA 3AJ8A 3SS8A 1CT9A 1PRYA 4GNKA 4IOJA 3WX0A 2O8BA 1MVOA 4IF4A 1ZSYA 4NAHA 1CUWA 1Q1ZA 4MEBA 3GA7A 4EZBA 2Z2JA 1S3FA 1WY5A 1H1DA 1Z82A 3G7SA 3WBBA 4QO8A 2IYEA 2LNDA 3LFHA 1URPA 2R7KA 3WHKA 5DBGA 4KK4A 3DC7A 1H2EA 3H65A 3TNDA 1KI7A 2IZ0A 4HKTA 1H8ED 3ETJA 2V54A 1XJWA 1EX6A 2CHUA 4IWNA 4DLRA 5HUHA 5I9LA 1VL8A 3BD6A 2WAAA 2BONA 4JGBA 4MQBA 1P1IA 1CXZA 1VI2A 4ZVPA 1MEOA 1T9DA 4ZJYA 1RM5A 1YI1A 2NO6A 2OESA 4HQ0A 1A8QA 2C97A 2JFGA 2ZI9A 5EP3A 4C88A 8LDHA 3Q0TA 5K4GA 3AZQA 2MWMA 5FOUA 2A1TS 5I51A 1WUKS 2GCNA 1KKMA 2H18A 3ZDXB 5IKEA 3QNMA 5IM4A 2OGUA 4OAPA 2FUEA 4F93B 3F78A 1PJZA 1IRXA 3OWHA 3DD5A 1DBRA 5L95A 4WXYB 1QOPB 4RA9B 5IDWA 2HF2A 3CGGA 1EMDA 3HA3A 4N9QA 4BKPA 2PVCA 1GA4A 4U1RA 2V5UA 2IV2X 3UJ3X 2R6JA 3Q7PA 3S5UA 4IQGA 3RIEA 3A4YA 4UEJA 5EN4A 1ABFA 3MJ4A 3JD0A 4XR4A 4A15A 4P3PA 2NU6B 4PTLA 4XVUA 4HXYA 4PTZA 1WLYA 2A88A 1P0CA 4KMMA 2AK3A 4D4LA 4BXOB 2PSFA 2JJYA 3QVVA 4YPOA 4K0RA 4L95C 4ZOLF 4O8ZA 4QVIA 1RVDA 1IWBB 2IA5A 2QGZA 4LVNA 3USCS 3M70A 4M4SA 4KMSA 2IW3A 1NW3A 5E7JA 1SZJG 2XTJA 1W0JD 5HFNA 5GTDA 1KH3A 2ZEJA 2HLPA 3MQFA 1VGQA 1HZZC 4HXEB 3T7JA 4ESHA 4CM8A 3FOFC 3KQSA 2OQVA 2WQ6A 1GG5A 1GSIA 3MJHA 3TVDA 3KDAA 4O5AA 2P90A 1B6GA 3H9QA 4AJLA 2ZIXB 4RY9A 3SSNA 1UBHS 2CHGA 2DUWA 2XDAA 4B4UA 2HLHA 4B0OA 1A95A 2IEYA 2AA3A 2X7HA 1DEAA 1XRSB 2P4SA 3KTAB 2F8SA 2OPBA 3HZHA 3PDWA 4KK3A 4X66B 4XWOA 1Q7EA 3D7SA 3G2JA 4G0YA 3SKYA 3FNBA 1GPNA 5H16A 2A35A 1W4RA 4QUKA 2JJMA 1G63A 1UJNA 4WXRA 5D3QA 3T3MB 3WYAA 3DQQA 5JJLA 3EGWA 1HDIA 1XP8A 2AEFA 1WW2A 3OCJA 4DT1B 1Z29A 3R3WA 2FRDA 3RJMA 2Q1TA 3N7TA 2Q9UA 2VPXA 3RBXA 4NCBA 5FBQB 2VTBA 5FUYA 2ZJZA 4FFBB 1PJ3A 5KVQA 2ORWA 2CDNA 1OFIA 3N5KA 3R5TA 4M83A 1XJ5A 4WNYA 5FPYA 1VJDA 3CG4A 4RFVA 1GDTA 4RD3A 2CMFA 3LUJA 4C5BA 1JQKA 3FYDA 3PUJA 1OX4A 5L4SA 3PC4A 4MJ7A 1T5DX 3CF4A 5JAIA 4L5AA 3IBTA 1TKCA 4LSMA 4OUDB 2HLNA 1DDGA 1UL1X 4I8DA 1GNTA 2IYNA 1KORA 4DPKA 2BGLA 5CBPB 4P4GA 5LR6A 4P34A 3OVMA 4V2UA 3IS3A 1W6RA 5C7LO 3ZCUA 4US1R 5CA1B 4N7JA 3CA8A 2FQWA 4DYDA 4QELA 2E89A 4EJMA 4RK7A 2E0IA 2PQMA 5BMOA 1WZEA 2P78A 3W5BA 1WX1A 4UZSA 1ZMTA 3SDSA 4JB8A 3LT1A 3V2IA 3G17A 5G1NA 2Z57A 4G0NA 4PHGA 3S99A 3SZLA 3K70D 1PTKA 1YOVB 3ABZA 2XGSA 4D98A 2H8GA 4ETNA 1I1OA 1OXTA 1WXEA 1XLUA 1RXUA 2HCRA 2BDUA 3ZZ1A 2BSQA 3VDXA 2DQSA 4Y1RB 4WE3A 4IIVA 1E6LA 2AI1A 5K0NA 4OB6A 3DNPA 5U9CA 1XALA 4LXGA 1VA4A 3KSUA 5ALFA 2AV6A 4MI3A 3QW2A 2XLCA 4X65B 5KSOA 1DJMA 1R6AA 2OC9A 3H5IA 5ALWA 3VHRA 2CD9A 3UOAB 4CI0B 1MNAA 1T1JA 2OILA 4GWKA 4RENA 1JEJA 1U1FA 1JAXA 2GJ4A 2CL0X 1V16A 1E2JA 4P5DA 4WOKA 3VNAA 5LMCA 1QKIA 5DYTA 2HA4A 1U9ZA 3HG7A 4IG9A 3E9CA 4HEJA 4YJHB 4DA8A 1AN0A 4NX2A 2V6MA 3IJRA 5L4LA 2F3RA 3N86A 4FFPA 3MT8A 3FLBA 3S4YA 3TSZA 1DRUA 2OCDA 3LL4A 1CTQA 2CXXA 3JVDA 3ORHA 1IWOA 4PYOA 4RKQA 1OFGA 4D42A 1OPXA 3R1IA 4K6FA 4CG2A 4G8BA 3U4CA 3DBLB 5F4ZA 1ULBA 1R0LA 4QZVA 5KNCA 2WD7A 3BXZA 3EH1A 4MS1A 2VT3A 3Q7RA 4GS5A 2YJ4A 4L73A 2X9QA 4CEHB 3FWZA 1JEDA 4IMJB 1RJEA 2Q46A 4ZA2A 1R0SA 2PH5A 3RE1A 1VPDA 2HMAA 1PQUA 4KNYA 3ECAA 3KAJA 4FFSA 5E6RB 1LBEA 1FOEB 4G85A 5AJZA 2Y67A 3DEFA 1IUOA 3K2BA 1KGSA 2C5FA 3EVAA 2WSSA 2IT1A 3RTBA 1NVKA 1OLXB 3BPSA 4N0PA 4B2PA 5K99A 2BZSA 4Q01A 1XZQA 4WXMA 2C9DA 4G5SA 3RTDA 3I4LA 3VH1A 3W6UA 5K6TA 2QAJA 1YTUA 3M6UA 4BNJA 4JUIA 4TTSA 5HUJA 4RTPA 1HM5A 4DS3A 2X1HA 1MNQA 2ZT6A 2AG6A 1V45E 2Q6TA 3UC5A 3G2NA 2I8AA 4OQDA 4DJJA 3RT9A 1O08A 4MAFA 2QORA 2QT1A 1PBNA 2ZULA 4MQFA 5EE9A 5TDHA 4E2FA 3S40A 2VAMA 3KLMX 4YQZA 5LQJA 1NATA 2FOLA 2GO1A 2VAPA 1NF2A 1UMBA 4ZARA 4BE9A 4DSUA 1KEUA 3G79A 3MWFA 3F5FA 3Q7QA 4TWZA 4CMIB 4JOBA 5EHNA 4LHSA 2HTFA 2DTDA 4OLFA 4BO5A 1VXOA 1XCPA 1NVGA 2BJVA 1TMOA 3RBZA 2GUWA 1RRGA 2I2AA 3LPNA 1J5XA 5HXAA 1F2UB 3BM5A 3QK7A 4IFTA 2QLFA 4JSRA 1YZTA 2H2DA 3HDHA 4KGVA 2PO5A 3IRUA 5TB5A 4KYVA 3WLLA 1AHPA 4R05A 3DBRA 4K9PA 2P8SA 1NY6A 621PA 4YRNA 2HPZA 1ISPA 2EQAA 4FIDA 4HDOB 2QT9A 2FUCA 4IDCA 4YQYA 3K4QA 4FYJA 5KTYA 4Q9JA 2CFRA 5H5JA 4B80A 1T36A 3GEDA 3KKLA 1SHTX 5ALXA 1EFTA 4HQOA 2VJMA 4FX2A 4V39A 5I4CA 1T6ZA 3FR8A 4LYJA 4JSTA 4ENUA 1IN5A 3OZIA 5EJ4A 3L8CA 1ZOIA 3JQQA 2NVUB 1QFXA 2PO7A 5T5QA 5DM1A 2CKDA 1P44A 3OZEA 1WXHA 3LT4A 4WK0B 2Q5IA 1P6XA 1HGXA 3S2FA 1TQHA 1XSEA 2VPWA 3L05A 1J8YF 1X6VA 1XCBA 1RWMA 2IKQA 3E7PA 4BDSA 1GKYA 2OM6A 4EPRA 4C05A 3TSAA 4F2WA 1GCGA 3B3QA 5JFOA 1EVIA 5C7YA 3KJIA 3CZQA 5A5EA 1SG9A 4FLFA 5M7EA 1L9XA 3RABA 4JKIA 1SC3A 5AIAA 4WGFA 4EUSA 2BFMA 1L5OA 2X40A 2I2XB 4EG3A 5DCUA 2VWGA 1Y1KE 4ZAXA 4BMNA 4BZPA 3OPMA 5CB4A 4Z4FA 4JBLA 3FTQA 1SA0A 2XZDA 3L5OA 4QHTA 4FGJA 5JAPA 3W2GA 4PG6A 2I4NA 4EYEA 3BWBA 3RVNA 1E99A 3OSZA 3JQPA 2D74A 2WYOA 3GAZA 4IIJB 1CYDA 4Y9RA 3JSXA 3T7AA 2BTOA 1GSHA 4YY3B 3ZU5A 2SKCA 1VLMA 3PEVA 1YB1A 3NYWA 2HZ7A 4YT8A 3OZ7A 1G21A 5BN4A 2PZAA 1UKBA 2VPIA 4WJKB 4EO7A 1IG0A 2EFDB 1K06A 3OZCA 4MZXA 4Q66C 5IZCC 3HYTA 2WJ3A 4KJZA 2FSGA 4KXMA 3JAKB 821PA 2QRNA 3A6EA 2EDCA 5DWQA 1EDEA 3HY4A 4L3OA 3U7QA 4Z4HA 1I5EA 4X3CA 4X95A 3ROPA 1K8ZB 1MBZA 4BO0A 1SVSA 3PZRA 3BJMA 1BMFD 2HSGA 4GE0A 4JFAA 4MWDA 2PUEA 3IHLA 1U4SA 2CWDA 2QQEA 4KLRA 3INTA 3LW8A 1SQ5A 2QTCA 4FYYA 4DDMA 2W93A 4F5YA 1NLYA 1XMQB 3HWWA 2IDKA 3AGQA 5E9QA 2NVOA 3G5AA 4CKXA 3R7AA 3C1OA 3ICEA 2OD2A 1EQAA 3AIKA 1NG1A 2G9ZA 4QA9A 4A3SA 2QUAA 1DZ3A 4QNRA 1ZJ5A 2G63A 3GJZA 1ZGJA 3GJ4A 3N6VA 1PG2A 4NRDA 3T9AA 4Q3KA 2OBBA 4QQNA 4Q4JA 3WGKA 1TT5A 3DDHA 1FTNA 1U0NA 1F4LA 1XTBA 2Y4OA 3KYDB 2RGNA 3O21A 4FDVA 3ZWQA 2AF4C 2P35A 4CGYA 3OZGA 4K2HA 4JGIA 3EDRA 1V8FA 2WUFA 4FCTA 4O4HA 4RADA 4ZCPA 4QGSA 3GLUA 1Q11A 1QHEA 2IPXA 4JC4A 1K8QA 2OXCA 3GLIE 4Z0HO 4Q3AA 5E1DA 3U49A 1M8PA 1W4AA 1V9CA 1JR2A 2VRBA 1QSGA 3GBPA 3JATA 1P7ZA 1T5LA 3N3BC 4MDEA 1QTNA 4BQPA 4EG7A 5HPYB 1DDOA 1VG1A 4ZEVA 8MHTA 3EEFA 2H4JA 1RXVA 1DAMA 4ON9A 4NZPA 4DR5B 4MQEB 4WKGA 5HFJA 3UPDA 4BGIA 4BGVA 1L4UA 5IAOA 1BYIA 1DADA 4KEAA 4PFQA 2DWOA 3I83A 1WE2A 4Q0MA 3KLPX 2WF8A 4YGYA 2AQ8A 1IC6A 3UKOA 3F5MA 2M9MA 5J5VA 1NUSA 2O1WA 1QRSA 1YL6A 4EHKA 2AZ4A 1E98A 4UREA 4EAAA 3HJNA 5ALSA 3JYHA 2OORA 4ZPXA 3LI2A 1KJIA 3PBKA 4MMXB 1PDWA 2ZAGA 2ZRAA 5SY9A 3MTEA 3O4FA 3O9ZA 2H0QA 3KLOA 3UTDA 5KINB 4CQMD 4GKBA 5AKHA 2HK6A 1IQ0A 2P2NA 2ZUWA 3LGAA 1U2RA 4ITRC 5AW6A 2XD9A 3GRPA 5A9SB 4W9MC 3SYTA 3K3PA 2FW7A 1UEIA 1YRQA 1KQOA 1T8RA 2HAEA 3Q88A 1EFLA 1LY1A 4XIJA 5JPCA 3GPCA 1X1QA 2BGTA 2J3JA 1Z38A 2JANA 2P5UA 3OTQA 2C0QA 1FLDA 4G09A 4IFEA 2WINI 1AKTA 1W581 4GXRA 2JD0A 1IHYA 2PNFA 3GR6A 2Z30A 3K9NA 4KIWA 5CHYA 2G8NA 5CLIA 1CEYA 4QOFA 4EPVA 3EUFA 1I32A 2BBSA 2JIMA 2FUG1 3P0JA 4IDNA 2NXJA 3AVPA 3QKTA 5F33A 4UXHA 5BURA 4GU5A 1JE0A 1JDNA 3CN9A 2J6BA 4Q4HB 3TLBA 1NQVA 1RLJA 4P4TA 1CNEA 2OCYC 5IARA 3HLYA 4HS4A 1K0UA 4PLZA 2VTVA 1T9KA 4PRYA 2VDUE 4GSYA 3BK2A 3LLVA 4CEJA 1E9SA 5IYZF 5SYMA 10MHA 1OXXK 1DELA 1DC7A 1RXYA 3OZUA 3PQFA 5ES3A 1SUBA 1EK1A 3GFVA 1JLSA 4N47A 1UJCA 3F3MA 1TU3A 1ZUNB 3C70A 4LPSA 3DOUA 3PE3A 2QTBA 3NDRA 1OXKB 2OBXA 3TL2A 1GIAA 5AUNB 1GGVA 3ABRB 4J7AA 4MRPA 4K9MA 1HL7A 2B2XA 3TOXA 2C95A 1GA1A 4FONA 5EINA 4NLLA 2IBMA 1E8DA 4ZC1A 4B73A 1IBKB 4CLDA 1KFJB 3PB3A 4OXYA 1ODKA 1AZSC 1S2GA 1W88B 2UVPB 4O2BF 4QICA 1JF8A 4MR9A 5TY0A 1ISHA 1DXYA 1KBOA 4HAUA 4DCPA 4WUVA 3QP9A 4TN1A 4CV2A 1T26A 3IMCA 5HZMA 2XOEA 2JKZA 3V1KA 3V1LA 5BORA 1QHHA 1EUZA 1T8UA 2AUTA 2FFRA 3DV0B 1GZSA 2YFQA 4UD6A 3DKRA 4DQVA 1SMKA 3JQ8B 5AW0A 2FCRA 4B46A 1KIMA 3AIMA 4PCAA 3ST7A 3ZH9B 1IVSA 2IS2A 2B21A 2O7NA 3ICPA 4YRAA 1DNPA 2G6BA 3G2LA 4MDYA 1MGPA 1TZKA 4RGBA 4FE7A 3M33A 5IAGA 4B6FA 4OQPA 2ISSD 1L5HB 5JXHA 3HVIA 4CEIA 2O0KA 2XIJA 1QGUB 4AWAA 4R6WA 1TVKA 2NZYA 1AQIA 4HL6A 4HCJA 2VHXA 2RCYA 3NB0A 4LZPA 4U2DA 4Q21A 3TL6A 1W9HA 2XOKA 4QFDA 2GBCA 3VZDA 2GHIA 5FIUA 5IASA 5JD5A 5JJBA 2XUHA 3ZIAD 2B78A 2NV2B 2XMRA 4OSOA 4KQ1A 4P1ZA 5GJCA 4QGFA 3PPVA 3UXYA 4HGQA 3COJA 3V1NA 3QVTA 3Q2OA 3IBYA 5K05A 3GLIB 3B20A 3QYAA 1GRQA 1ZD8A 3VPAA 4DRYA 4F8JA 4GOKA 5DBFA 3VA7A 2NNWB 1X1AA 3CVOA 4TKVB 4IDAA 1JR4A 2KBEA 1VKZA 1Z3IX 4Q48A 5AJHA 4Z9XA 3ZN2A 4BUCA 4MI6A 2B1GA 1D6SA 5ITZB 2DBRA 2GVNA 1RYNA 5HK8A 5JADA 5ISMA 3GVHA 3HGMA 1N0VC 3CZ4A 5T57A 3K73O 3PKIA 3V48A 3FZYA 2HJSA 3D7RA 1ZGAA 1CRZA 1RPTA 1E9FA 4V0ME 4HBGA 2H5IA 4Z7QB 2QA5A 3NHZA 3C43A 3OLVA 3KU4A 1ARZA 4GFDA 1KI6B 1XV5A 2M32A 1EDBA 3DFZA 4CQNA 3TG8A 4WW0A 4J7XA 4DM4A 3BT7A 1KU6A 3NHWA 2OA0A 1QLWA 3GD7A 3SR0A 1YK0A 2JLZA 3TXYA 2Z43A 1WZIA 3KQYA 1NXPA 4L0DA 4ETMA 1OH7A 2PJRA 2YHAA 1L7EA 2H3EA 2QRGA 4F2PA 4KXYA 2ODQA 3CKYA 3L0CA 3RSOA 4BP9A 5F7XA 1QO0D 4JASB 3IAS1 4RLQA 1V3UA 4FYXA 2IP2A 4QOSA 2W5UA 5AJWA 2IZ7A 3RG8A 1ZK0A 4A82A 1F0KA 3WGIA 3H1GA 3M6LA 1N92A 3OZBA 5H81A 1I6LA 3OJLA 3NP7A 2GEUA 2CW5A 1JQAA 2EQBA 2IXTA 3DE3X 4RHUA 4OFZA 5D84A 4N39A 1BVRA 5C5EA 1M83A 1W47A 3JV7A 3NP9A 1DWPA 5DW3A 1HFEL 4YCDA 1ZK2A 5IHPA 3L77A 4G36A 1DQNA 4IQ8A 1GUFA 1VSTA 3NAZA 2BYTA 5CDHA 1Q84A 3GEPA 3GRAA 3N05A 2VF4X 4DIBA 3UV6A 2BCEA 4QU0A 1RLUA 1WB6A 1K4YA 2Y68A 4WADA 4AMUA 3ZWPA 4BLQA 3L84A 3JQDA 4REQB 2AX3A 4KWEA 1KS2A 4RTRA 4AJKA 4IXTA 1H2RS 2KW5A 2XR1A 2EAUA 2HO4A 3N0TA 4EJ0A 4GUAA 4O5OA 1KIAA 4E1VA 5TARA 4GG1A 3PUWA 4XWKA 4BNYA 1ZEMA 3HGTA 4PYJA 4UBIA 1EDOA 3K1ZA 2ZJ6A 3MIZA 2Q62A 3CE9A 1KVRA 3DXZA 1HLPA 2WI8A 4XWWA 2X4DA 3VR5D 4C4OA 3LQFA 7ADHA 4GBED 1GM5A 4ED9A 3C48A 1W4ZA 4MVWA 5A3RA 3BFPA 2ECKA 5EC8A 3D4PA 1Q5PA 1NZFA 1CIVA 3DDCA 2G77B 3JU3A 3VQTA 3G13A 3JY6A 1Y3HA 3L7JA 1T91A 3PTZA 1E4EB 3CXUA 5JZMA 4LOIA 2C2ZA 5ADUS 3OFNA 4DR4B 4Q4AA 2A0UA 1SCNE 5AK5A 1Z06A 4Z9FA 1OBCA 4RD2A 3T3PB 3UJ7A 3T7CA 3QVLA 4F60A 5JIBA 3LO8A 1X14A 2W6JD 4N40A 2QGFA 2FSSA 4X8HA 3QKRA 5DTRA 5B3KA 1NZDA 1W6UA 1YIDA 2VC2B 1PFWA 3GBVA 2H1HA 2B8WA 2H17A 2X2FA 2J3MA 3LKBA 5DCLA 4JI1B 1E2QA 3SX4A 4Z7JA 5JECA 2F3SA 3QBTA 2ZUTA 2P91A 1ULHA 4RORA 1GUDA 3GJTA 1GL7A 2FRDC 3RAJA 2HIMA 3DLAA 4D4JA 1IDN1 2C2GA 4RH3A 5AK6A 4QVGA 2VAWA 3NBYC 5ILOA 2WYIA 2EKBA 1ZK4A 3GARA 3OHMA 2CUKA 1QCCA 3B36A 4QSHA 3EC1A 3SY8A 1MENA 4Q1VA 4ZJPA 1J1UA 3K9QO 1C29B 1X7GA 4PAWA 3T95A 4UM9B 1HRKA 1Q7CA 3VTKA 5EYPA 1FW6A 2IHNA 1P3Y1 2FUG6 2MYUA 4F9GA 3WK6A 4R8MA 4YX9A 5L6MB 2FPWA 1J9GA 1R6TA 2O6HA 1JQDA 2H0AA 5LXTB 1B23P 1P0PA 1K3TA 3DT8A 4U39A 1RXWA 3G3EA 3VJRA 4C29A 4C14A 1GEGA 4G2TA 4H6VA 4PVCA 1EEXB 1V43A 4MVJE 1XDDA 4UCWA 1EVJA 1NW7A 5HUQA 4JLBA 1NVMB 4BWFB 1OWOA 4HJRA 3RIMA 4R2MA 1Q22A 1LQTA 3IVMA 4ZVSA 3Q3VA 1H1TA 2FPGB 2CMKA 2JEYA 4C6TA 4UDNA 4JYAB 1ZCZA 3LFTA 2FG5A 3K1JA 3C3BA 2OLKA 1FYFA 3R3JA 3BF7A 3ZNQA 3ZUPA 3V33A 1HORA 1UBMS 5G3YA 5IANA 2ZPTX 3B13B 1JLRA 1UWVA 2TMYA 3ED1A 4I66A 4B31A 4DARA 2N1BA 1RWXA 3E58A 2QY9A 3FJOA 3A1TA 3IV6A 1ZN8A 1Z68A 2OMKA 2I3BA 4C4SA 4BGDA 1QIGA 2XNSA 1NDHA 1WU7A 1VHJA 3F6EX 4ZVVA 1AQ6A 5FD8A 1N3BA 1SUEA 1G3UA 1C7FA 2V7QA 1H6BA 1Z45A 3CU5A 3KIPA 3M2TA 4PQYA 1YMVA 2GT1A 3KXPA 4I6EA 4TT8A 4MTLA 1QJCA 3ZIDA 5A4JA 4D8WA 1H1LB 2GAAA 3HP7A 3H97A 3NBQA 5I45A 2GAFA 1E79A 4KIUA 1QS0B 5JNLA 3AJ9A 3W5UA 1UFOA 2AG8A 4OQMA 5FLEX 3V1YA 3X1JA 3WMRA 3ROXA 2BI8A 4UDOA 4UHKA 3B89A 2AOUB 4KN5A 3QMMA 4PX3A 4RVDA 5H70A 4CKEA 1JLLA 2OENG 1WKVA 2HA0A 1TMYA 3F8SA 3QVKA 2UUPA 2BHTA 2AJCA 1LFAA 1U0LA 1QPBA 1UMDB 3HCCA 1V71A 3L7AA 1KDYA 2F8MA 4JOSA 3ZC3A 2O5CA 1S8FA 2P9EA 2GA8A 2VJBA 3F97A 2EZ8A 4LJSA 1WF3A 5AMXA 4EFMA 4MHSA 2R11A 3K05A 1Z6GA 2IC5A 2BH2A 3LLMA 4TUYF 3K1AB 2IOYA 4ZYUA 1QH1A 3SFTA 5BNWA 2YWCA 2D8MA 3DAHA 1C9MA 1N5OX 3PEUA 4L75A 4RVGA 3GZ4A 4AZ0A 3W05A 3AUAA 1RFGE 1RPNA 2I34A 1JIVA 1GNPA 3H86A 1K6JA 3EWAA 3P4XA 4KW7A 4MCIA 2Y1EA 1I0IA 2ZQYA 4QRHA 3RUDA 5JBNA 3QVJA 2NXNA 3GLFE 1VYHA 2PRKA 4BNLA 3A9UA 2GK6A 1EINA 1HLGA 1ECJA 1W2HA 2HNKA 4HYQA 1E1QA 3RHTA 4A8JA 2PA0A 3TRHA 4TWAA 1N8NA 4CLOB 1SEVA 1DBPA 3M1AA 5D3ZA 4YWHA 4C03A 1HZJA 3AG6A 1GXSA 2JLVA 3PUZA 1R0ZA 3QE0A 4Z9BA 3RFCA 5HYVA 1Q7TA 1VBKA 4B9EA 4LBVA 2B2CA 1DQYA 1OE0A 4K46A 4RXUA 1ZM2A 2DY1A 2VH1A 4YWJA 2FN7A 3T4XA 4OMDA 1QF9A 3A6FA 4KQKA 2FN8A 4ARZA 3EZ7A 4I81A 1H42A 2O3JA 2FW9A 4G5RA 3CR8A 4PQEA 3PJRA 3T5BA 2ZKLA 1MN6A 3DA8A 3GAAA 3UWDA 2D8AA 4OI0A 4RWZA 5FH9A 3AVXA 5FXMA 5AM2A 2D7DA 4E07A 1RJGA 4IMRA 2PXHA 4EO4A 4XUEA 2R2AA 1KR5A 4DIFA 1NXOA 4XB2A 2NACA 1T8WA 2ZK7A 5AW1A 5KX5F 2XPCA 3WNCA 4QO7A 1BO6A 3VSCA 4CKYA 4HJXA 3SHVA 1KIFA 3BFKA 3PL5A 1JFVA 1M34A 3RTEA 3MTIA 5ITVA 2IE8A 1YBFA 3IV7A 4UM7A 2OHHA 4X1IA 2ZIGA 4ND8A 3HVUA 4R1SA 5JAOA 3UMGA 1N3LA 2V7EA 4FC6A 2PU5A 4IJQA 1WBJB 2QY6A 1RI2A 2VHCA 3R7DA 3F8TA 5BSEA 1Y6ZA 2A4MA 1IN1A 1LI7A 1IH8A 3WKCA 5B2FA 1CDDA 3NIFB 3TKLA 5EY5B 2LDXA 5A71A 4ARVA 4N5HX 1GTRA 1JZQA 3LWDA 1L9KA 1WZNA 2O2CA 3BZBA 3EGOA 3OTHA 4QYTA 1BKDR 1EQUA 2WJYA 2W11A 4Y2JA 2E6UX 1B6TA 5L3QB 3P2MA 3UMSA 2WC1A 2II6A 1Z8NA 3FYUA 3PGA1 4KVFA 1FZTA 4DNFA 1LCIA 1SXPA 1N2ZA 1VB3A 2JHCA 4N03A 4QLAA 1ZVMA 1Q0ZA 4MVYA 3G02A 2LIVA 3F4LA 5M29A 2QTLA 2GPSA 1FDIA 3K9BA 1I5RA 2VKQA 4YN3A 3ZY2A 1P0IA 1QX4A 1RCTE 3GNSA 4QEKA 4C4RA 5IJ9A 3KQNA 2IYUA 2VUUA 2VSNA 1K0FA 1V47A 3IKTA 1UANA 4I46A 3RUEA 3QWHA 4MVCA 1R9GA 4Y8VA 1PL7A 3TAUA 4AZTA 2YYAA 1G6Q1 1N2HA 3BD7A 3BHJA 1EFVB 1BWRA 1G8JA 2PANA 3HUFA 3RSHA 3SF0A 3NFYA 5TT1A 3ZWVA 1Q0QA 4M89A 1D5CA 3OQMA 4R51A 1NQAO 3DE4X 5AXDA 1IOLA 3C3EA 3OWOA 4FW9A 4LYEA 1GTVA 4J4HA 4ZXFA 4E7PA 1A4UA 1LVHA 2BKAA 4HAOA 5E9JA 1QFJA 2X3UA 3ZHRA 3CMCO 1Y8CA 2V6FA 2VCYA 4OOFA 3EVNA 3JQAA 3Q85A 3QU2A 4QJ4A 2FY8A 5L3RA 2K4MA 3VR4H 3WNQA 4TV9F 2GWRA 5JSKA 2OWDA 3LUGA 3P2EA 3H8JA 4MRAA 1Y48E 4MKXA 1O8CA 3IPYA 1P5FA 4KXQA 1FLAA 4TTJA 2C7PA 3O95A 4WOPA 2FOIA 3IPCA 3W5HA 3KYBA 4OATA 2R5WA 4YRRA 1KE2A 5BW8A 2VDQB 4Q9HA 2XGJA 3LL7A 1K6IA 1YB5A 3VPXA 1BJTA 1YHNA 4BP8A 5AVKA 5BV2P 2DQ4A 3RVKA 4OAQA 4WBNA 1F6WA 5KYVA 3GLFB 1U2QA 1V5EA 1WULS 1OV6A 2RGNC 3I1IA 3NBAA 3PC3A 4C4XA 2LCFA 1S3IA 1XU7A 3GDWA 1G0NA 2VYCA 1EQ2A 4HX2A 5TPZD 3DCNA 5K09A 1ZH6A 2XODA 5CMLA 5NLLA 4DMGA 3DR5A 3KWJA 2M1XA 4WH0A 1FMJA 2FYTA 1E1MA 3KR9A 2E3JA 2PKWA 4M9UA 4RZHA 3IAFA 4V1CA 1Y1LA 4ECEA 5CYPA 3WGTA 1VHDA 4DLWA 2LRHA 1KRWA 1E3QA 4KN9S 6ABPA 2FVYA 4GBMA 5EZYA 1S89A 5CP8A 2EP8A 1EI9A 4RABA 4JI6B 5HKAA 4OHOA 1F2TB 1DC4A 3FFAA 4R41A 3V4FA 1QE5A 3C16C 3ZWCA 4XM1A 3T1NA 2UVQA 1UQRA 1B8PA 2HU8A 5K0ZA 1IG3A 2RDMA 4TMKA 2NXWA 4TWRA 2VLIA 2B6NA 5IPFA 2D5AA 3H5RA 2C1EA 3KKKA 3H17A 3VUFA 1JA1A 1SXGA 1JQLB 1GPUA 2CJFA 2QL9A 3B2QA 3FSGD 4FZVA 1UBOS 5GONF 1OX6A 5HE9A 1MPXA 3HFGA 5CDFA 5JCXA 2FZ4A 1KXZA 2GJAA 3DAFA 4YCJA 2RIRA 1WMFA 3QX8A 4NPCA 2ENWA 1FSFA 4NTZA 1GSOA 4UTZA 3PXAA 4YQEA 2MSEB 2C7OA 2R65A 1XTVA 1R5NA 1TJPB 1EHYA 3I8OA 3UXMA 2CNWD 4OQNA 3BSFA 1FFXA 3LHKA 3OCCA 4G0MA 5CFQA 2WPDA 1CB7A 2EFEB 1K8XB 2ZRKA 5HRAA 3THWB 1NMXA 1Q7RA 4D0GA 4CFZA 2VAVA 4ID9A 1P60A 1NL3A 2V58A 3C5WP 2FFHA 1J39A 1DEXA 1PVDA 4LC1A 3MOIA 4RMNA 3GAMA 1COWD 3QXHA 2X8LA 3QNUA 4IJKA 2N75A 3CRQA 5A3QA 3E18A 1Y9EA 2Q3MA 5FEMA 4DJ5X 1KH1A 5EKDA 2ZUFA 2V55B 2O59A 4MX8A 1VIMA 1VZ2A 4PU0A 2WF5A 3FZNA 3PR1A 1WMBA 3T5AA 5U4QA 3GIDA 1XEXA 3ZEIA 4A8HA 3K4PA 3L3BA 3LUCA 3U6KA 4BE4A 3C3MA 2DWCA 1QNLA 1MOZA 3PX2A 3D6VA 3QHAA 1FZQA 1SVWA 2Y6VA 4GPIB 3FNFA 1K8YB 2EFGA 3MHPA 3CJTA 2X7XA 2I4IA 2R8XA 3QU7A 2AT1A 4TYPA 3V7UA 4HLQB 2X9NA 5LP6F 1EB8A 1SFRA 1WP9A 3TB6A 421PA 5JU6A 3BC1A 1JV2B 2QQ0A 3SIXA 1GN9A 4ARIA 4AROA 2VHUA 1L5RA 1Q2UA 1B1CA 1EP3B 3MPUA 1S8OA 2HC9A 1YJQA 2Q0SA 1KWGA 4DR2B 4TV8B 5JWOA 1USWA 4OQ4A 2D3TA 4F0JA 5ANRB 4H0CA 1JEYA 4RKWA 2YJNA 5LQAA 7ABPA 3RBAA 4PQFA 3BMNA 1D0VA 2C5GA 3QXCA 5T6BA 4DIDA 2DYKA 4F46A 1T24A 3ITNA 3O2NA 1D09A 2GM5A 1FU7A 2GKOA 3AINA 4K1XA 4W1SA 1ZA2A 2GD2A 3T54A 4A5OA 1FFYA 2BIFA 4ZVKA 5CNIA 3TSWA 3CVWA 4EWLA 1GQQA 1TC2A 3COSA 4I99A 1IATA 2V45A 4IQ0A 2D1RA 1M73E 3OOEA 3WL3A 2FPIA 2VNIA 3QUBA 4GRAA 4E30A 4EFKA 1UQUA 4H3KB 1G1AA 4GI3A 3U3JA 1U8XX 3L1IA 1J1ZA 5B3AA 1B2RA 5BWOA 4EHBA 1NFRA 5GADl 3ZZ0A 5HZKA 1XT6A 2BTQA 5AW3A 1GTMA 3HGQA 1ADJA 2PJZA 1D2GA 4LCBA 1VJTA 1O0CA 1P33A 4KTTE 2C92A 5BSFA 3CBGA 2YC2C 2V4ZA 3JVUA 4FEEA 2QI9F 3EG9B 1N0WA 3U3XA 4NPHA 1QBGA 3DHWC 4U7WA 3IB6A 4DOMA 5LLSA 3ZIUA 1V3TA 4W5OA 5K0FA 2FSIA 1YDFA 1WXWA 5BMVA 3NJRA 1I2BA 4ENVA 2ONJA 1Q1BA 3OD5A 1QQ5A 2JKVA 3V4VB 5L53A 2Q4RA 3A6PC 3A4MA 3FZGA 5EWLB 2ZETA 4YV1A 1CE8B 4LHVA 1X8LA 3CW8X 2QJRA 3HNPA 4AO8A 4IVQA 5EJ9A 2GTIA 4OK3A 1XCOA 5KVAA 1FE8A 5BQOA 4B7XA 3KV1A 1XEAA 2WP0A 1H9AA 5AT1A 1DQZA 1JPNA 1SQSA 1IBCA 3GI1A 2XTMA 4I1SA 1FXWF 2HOQA 1E9CA 3TINA 4LJ4A 1C9EA 4QGAA 4DG9A 1B0AA 5FPSA 1D8AA 3L02A 4JBGA 5THKA 1IZ7A 2BI7A 2J0UB 4D8XA 4FDMA 3MAGA 6YASA 5ALNA 5HGJA 5HBRA 3HKCA 3WBFA 3KETA 3BMOA 1MJHA 4K28A 2AEEA 3DDZX 5DKFA 1PS0A 3G0OA 5FWXA 2HXSA 1ULZA 2H4FA 4B8YA 1JMYA 5KYUB 3W5DA 3K0HA 3RFVA 2ZM5A 3LY5A 1AUQA 3UWKA 1V2GA 1DJQA 2I2CA 1ZH2A 1RWBA 2XF8A 3DS8A 1GPYA 4P0TA 5FPTA 2QP3A 1OIXA 1T1RA 1TLTA 3G2MA 5E8RA 2XQKA 4IW3B 2W7TA 5FFMA 4QTUB 5BR4A 1V7ZA 2JS7A 1T8YA 2OGTA 1HURA 5IABA 4B6JA 1E3DA 3V46A 1AZWA 1JJBA 1ZIXA 2O0MA 2AKAB 4OSPA 4F4DA 3QTTA 3SFVA 1X86B 2CL5A 4JLJA 2ZPAA 3HPQA 4L2IB 4CIBA 4UE3S 3KJXA 2VH5R 5DX1A 4C7OB 3BWMA 3EQ2A 3STYA 1IK6A 3DL0A 2EARA 2P5SA 2HQRA 2JH8A 3I4CA 1OFUA 3SC4A 4HEQA 4KE9A 3GJ5A 3BHIA 2PGDA 1KEPA 1NBHA 3LS2A 4QFBA 1G4HA 3K8ZA 5G1PA 1FU4A 4AZSA 2C03A 1GPKA 2I71A 1ISSA 4TMWA 2FJUA 3I1YA 4OJNA 4EF4A 3USES 3HXOA 4TXLA 1LSUA 1S01A 1UOOA 3OLWA 3SDZA 4DQKA 3ZDCA 1RKBA 4QDZA 2ROQA 2WTAA 2OK7A 3AQ4A 3PUHA 1C0IA 1O9GA 4IJ6A 3RNOA 4BO3A 2GNOA 2Y05A 4ABTA 5CG1A 3F98A 4Z8XA 5KNLA 1E64A 2V97A 1RAAA 1VMDA 1U5AA 1HPLA 1N6LA 4QSMA 3TTUA 2XXAA 1GG9A 2ORED 2WJIA 3SC3A 1MG0A 5ERXA 1MGOA 1P3DA 4Y6GB 1LX7A 2VNHA 2QM7A 4A6XA 4ODIA 2IBTA 4ZHQF 2VSXA 2ZSIA 5AVJA 2DBQA 1LUAA 3AHHA 4RPJA 4HVCA 4A1OA 4UM8B 1AS3A 1G17A 3OEWA 1Q21A 2VJDA 2WBLC 3QXSA 3GZJA 2PCJA 4I4LA 2ZRPA 3OLQA 1Q15A 4QXMA 2BEWB 1ISJA 1CJCA 1AS0A 3IOBA 4DADA 3SLGA 5D7BA 3FWHA 4HDCA 4OHPA 1MB4A 3EJ6A 4EB0A 1AKYA 4GLLA 3WP0A 5CPFA 4ZO4A 4L57A 4KXFB 1UZAA 3V8MA 2Q7OE 3PX7A 3DT6A 1CRQA 3IO5A 5CXUA 521PA 2J4CA 2VPZA 3FNRA 2CB9A 2KWIA 4DIOA 3INRA 1IZYA 3NASA 3AY7A 2YINC 2AR7A 5J1TB 4OJTA 2JIZA 3QOYA 1GZHB 5K0JA 3Q7EA 1FFDA 2B20A 2CFSA 2ERYA 3ME5A 4QJ5A 3RC9A 4KRFA 3KQQA 5H3LA 2MMCA 2X76A 5KSPA 2Q2QA 4KPUB 4Q3NA 3WB0A 1D2AA 3BUSA 2ONYA 3U39A 1GLNA 3HACA 3W04A 4UNNA 2EL9A 2QT0A 1ONBA 2WWWA 3QUAA 1LB1B 5K8JB 3S1AB 3E3MA 4RK6A 4MV8A 4AUNA 3ROEA 4UHFA 2BE9A 4XJSA 4PR3A 5J2TA 2EEZA 2SNIE 4BC0A 3OPYB 2D0DA 2E5FA 2QD4A 4IIHA 2FE4A 4D6PA 1BHQ1 1B8OA 1PZGA 1U5BB 2RC6A 1G4AE 2Y66A 4L9WA 5FA8A 4LHZA 2RSLA 4TQUS 1OIVA 4JVSB 3NDBB 2XYGA 3NIDB 1GGJA 3NJ8A 4UEKA 4UEQA 4BC1A 3AC0A 4Q3LA 3TSYA 3LHDA 5CA0F 3KQKA 2PMFA 1NYQA 4S24A 1K3FA 4JUCA 3NM4A 3FB4A 1REQA 4OVKA 5I7OA 3ZXYA 4B5KA 1XXHE 2WA2A 3I30X 3L0OA 5EXEA 1N75A 3NRJA 4IIDA 1CY8A 2TSYB 5BV7A 2GCIA 3W9SA 1XTZA 2FSVA 1NPDA 3GPIA 3A1EA 2P2GA 1R66A 3Q15C 3RB8A 1UPUA 1D07A 1OPRA 4U8GA 4BQFA 5JLJA 2JLQA 4TTAA 1MX3A 2REBA 4OA5A 2P40A 4V03A 4X8OA 1S8NA 1XX6A 3U44A 3QU5A 2J6HA 3DKIA 2NQ8A 2VT2A 1RZRD 1EM8B 4TSRA 3P9ZA 1TZ2A 5LQCA 4F4FA 2X0NA 1D0SA 2MOKA 4WV3A 5JJKA 3KFXA 2VYVA 4FMCB 3I6QA 4ZALA 2AE2A 1TEZA 3EMVA 3GVXA 3QITA 4YGXB 5FT9A 4GLOA 1WDKA 3TZHA 2B4KA 3KZKA 1PEDA 4F6RB 3ILYA 2BV3A 1WDLA 2NO1A 4BKUA 4I6JA 2NUPA 1JG1A 2OBYA 3VR6H 2C5BA 2VSYA 3F9RA 5F4BA 3KWMA 4A10A 3RQIA 4E31A 2D54A 2HCTA 1BJKA 2VF7A 1N7JA 4Q34A 4YALA 2O2HA 3QU9A 4WVFA 1PT5A 4MYSA 3CF4G 2QL6A 3ZLVA 4ZN6A 5IS2A 2VXCA 3AU8A 4I55B 2VT6A 2FHSA 1OT5A 2ZBGA 5IU6A 4BO4A 3WHIA 4ER6A 1DBSA 4YLGA 4J43A 2WFLA 3MWKA 4QHYA 1P4JA 1RFLA 4K3VA 4MA5A 5CEFA 3DAYA 4QAQA 2HGSA 1RMTA 5ES4B 3BSSA 5J5CA 2ZROA 5FB3A 1W0KA 2HMSA 5BV1A 4NCKA 3FPAA 4NZNA 3GCZA 5KYYA 1QRDA 2GGSA 1D4FA 1FVXA 3L8GA 4DCOA 4N7RA 2DTXA 2GR9A 3WLSA 1XHLA 221PA 4CKWA 2FX3A 4GRIA 3LOQA 1FNSA 1W85A 2VNJA 3OE7D 4QXQA 3T52A 3TZ6A 1AURA 4Q02A 2IWHA 3R7BA 3U9LA 2Q9BA 4JENA 2RHTA 4A8JC 3IVAA 3SVLA 4ZEOA 3D8RA 5JROA 1T3HA 1A8HA 2W2LD 4J0IA 3OP1A 2YVQA 4C04A 1BIFA 4MR7B 4F9TA 4X20A 3RWOA 5HIJA 1GAEO 1MU0A 2RGXA 3BK1A 2ZAMA 4MP6A 4KXVA 2GXAA 3WMGA 2UZIR 1EFDN 2H7XA 1UJ2A 4HGYA 4IINA 4RESA 4D3ZA 3FOAA 3WLFA 4DE5A 1KYIA 3OLCX 4YFVA 3EAFA 1VL1A 2QRMA 1DC5A 4HFNA 1X7WB 4OG2A 1WXIA 1QH8A 3TW8B 4F5EA 4GKVA 1MO5A 2VVTA 3BZWA 4JJKA 1AUXA 2Q5OA 4J7UA 1B15A 1Z8HA 5BSHA 1K75A 1X7XA 4RY2A 1L7XA 2IGTA 5EJGA 2IV3A 4BNIA 3FTPA 1WSAA 4WZAE 5ICEA 5L3VA 2ZPUA 2CVHA 3UANA 4L5IA 1UJ5A 4I3GA 5CVUA 3ZCRA 1ZNWA 3PT9A 2I7DA 1JYFA 2WF6A 1ZKDA 3OC6A 4DG8A 4TKMA 1TEVA 2CC2A 1P1KA 2NTEA 3R77A 4O4IF 3RWBA 2PG3A 1U3DA 1W36C 4TT3A 1VHQA 2NTYC 3TQRA 4OBBA 1UBJS 3A32A 1X2BA 1JU4A 2GCEA 2XA2A 2XCQA 3AR8A 3FVRA 5DRYA 2BMDA 3RKRA 2W2OA 3U4HA 4F3YA 4EY8A 3GGGA 1J49A 1OVGA 2GTPA 1IZ0A 5HJ7A 2OZPA 1OOEA 3G49A 4GGPA 4OXQA 1QYDA 3HO6A 5ALDA 1Q20A 5EJ2A 2CNOA 5GPBA 3QFFA 1WO8A 2YXBA 3GFSA 5KU1A 1U9CA 3TTXA 1DRVA 3BWVA 4CKCB 3LIIA 3O8RA 2HJWA 3TUZC 1U3VA 5CEEA 1YJBA 1KJNA 5C80A 2ATCA 2YQ5A 1MO4A 1X77A 1XXHB 3FYUC 5KO2A 2FR0A 2JRCA 4DDTA 1UFKA 5CW2A 3BL5A 4AS1A 4JEHA 1DFGA 4BKMA 1Y8QA 5CCXA 2IYXA 5BUSA 1YDGA 3ZHZA 1JHYA 2F1IA 3UB4A 3M4JA 3BERA 3X3HA 3EEBA 1DKUA 1PNOA 1MAVA 2QE6A 1F38A 1PSWA 1T0JB 1YJAA 3DMHA 4Z99A 4BMZA 4BNGA 2IKSA 4HH4A 3MBOA 2H29A 4EI2A 2A9RA 1HRDA 2B6HA 2GPYA 1Z5PA 3PSHA 3QW4B 3T3NA 1U6JA 2REQA 1S2LA 3EN0A 2JHFA 1D9ZA 5FOWA 3CUUA 4GRDA 2WKRA 5G4LA 5JATA 2BGRA 3LG2A 3ETNA 5HFAA 3B3JA 3DOHA 3WQSB 4Q12A 1Z35A 1Z4LA 3ISVA 1BD4A 3LDFA 4LGMA 2WTMA 2YWRA 4BMOB 1JEAA 4P8RA 3UN1A 4ZGWA 1UADA 3A05A 3PUYA 1V1RB 2F48A 2L42A 4E2WA 1YASA 3VXKA 4Z51A 3ORSA 4ETWA 5GP1A 3KJEA 3TKAA 2BISA 1ZM7A 2NOAA 3MMZA 4JITA 4DIUA 4F6LA 5LWHA 4K05A 3ZBUA 2JGLA 5IKMA 3U9SA 1XA4A 2HADA 2GYUA 4KZKA 1BCRA 1VC2A 4KH1A 3AFOA 4MEJA 2FU5C 4UMEA 3T5DA 1XC7A 5FWAA 1RKUA 1R4AA 3HSKA 1R18A 4GOLD 3HO8A 3PPWA 2D1YA 4HP8A 4PLYA 4RK0A 5EZ5A 1PF7E 3E0QA 4U7GA 4NOKA 4KVZA 4XLTA 2FF7A 2QLNA 1SCKA 1Y80A 2RONA 3V8QA 2IHVA 1NVBA 2V7GA 1K97A 3V1UA 1J8VA 1T3SA 4KPGA 1HLFA 4EY3A 5DTQA 4RM2A 2W6IA 2BGIA 4S1NA 4FE3A 3EFOA 5C4IA 2XLBA 4ZI2A 1XNRB 1ETHA 5FR2A 1PTJA 3C7DB 4IX9A 3HJBA 4WOBA 1YH3A 5EEGA 4AUMA 4B35A 2NTNA 4C0HA 1EWKA 1M5UA 1KA9H 4PYMA 1V8OA 1P9LA 3C6KA 1JN0A 2PRJA 4K9OA 4DXDA 4H7PA 2FR1A 4O4LF 4ZT4A 2B37A 5CYGA 2I2WA 1M1NB 3PV0A 1KNQA 1FYWA 1YQUA 1SCUB 3PDJA 1E3TA 2PR2A 2X15A 4LN1A 3DD1A 3U37A 2AJ8A 2Q1XA 1JHAA 2WIKA 3M6XA 5ILGA 4HVTA 1QGDA 2RC5A 3H1TA 4MKZA 2MYNA 3V34A 3HJHA 4D4MA 2GDJA 3PJDA 3BQ9A 2PL1A 2AZTA 1AZTA 2PWAA 2VK2A 4NZ9A 3CURA 1VMIA 3D9QX 1R4NA 3DR3A 4AMVA 2PGAA 1EK5A 4PQGA 2M98A 2FMUA 3DV9A 1ZAKA 2GVZC 4S3MA 5IC4A 1A9XA 1XZMA 1WEKA 2UZAA 3T7IA 1V96A 1QP7A 1TIPA 3I0NA 1JDZA 4FNAA 4WZAB 1CUXA 1Z0SA 3VX3A 1FX0B 1P9NA 5C1PA 5DX8A 4GX5A 3H2HA 1UDWA 3B53X 1J09A 3KKEA 3MD0A 2VDRB 4GZ6A 1YNSA 4QWMA 4RFLA 5G4KA 3ZTYA 3F6RA 5DM0A 2FWNA 4IRXA 1ZICA 4XD7A 3OM0A 4HB3A 3EEOA 3RYHA 5AWFC 1PKXA 2Z9CA 2Q4EA 5CHEA 2HTEA 2SHKA 3QKSB 2BLNA 5HDBB 4GEGA 1Q0UA 4JLVA 4PNHA 4EKGA 1YZKA 5CT4A 1F9AA 1XBTA 2C9CA 1LLCA 5TV2A 1QG2A 1TAGA 4S1TA 2PBLA 3IODA 2VDKB 1YRHA 1NV9A 2ZIXA 4TRJA 5FOSA 3FHOA 4BB6A 1E5XA 1KYWA 4JI3B 1CS0A 1HG0A 4OGLA 1VL6A 1GZDA 4UBMA 2QEQA 3RVRA 1N34B 1GP2A 4P4SA 2FW1A 4ZOLA 4KZPA 4II7A 1QGZA 1NBMD 2P1DA 4RPGA 3BGOS 4X6YA 3ONEA 2IHZA 2PLFA 4Q1FA 4W8HA 3H5NA 5F21A 1YRBA 2CLSA 5B53A 3D4NA 1OAOA 4MVJP 4UMDA 4YJ2B 3ROQA 3RVJA 3QVXA 1EP1B 4D9BA 4DJAA 1N9KA 2JGRA 3T3EA 3NHUA 4WECA 1Y4UA 4YK7A 3I9MA 2PMDA 1LDYA 4KPFC 2AG0A 4BQRA 4XRGA 5BWBA 3V9PA 4B09A 2IQIA 2A57A 3NGLA 4JL6A 3L7OA 2WU8A 1VE7A 2TS1A 2ZAIA 3ELDA 1DIAA 4B3BA 3THXB 1T8PA 2OKCA 1DKRA 1ESNA 2J9FB 3PQ8A 2A84A 1ZU5A 1SD1A 4O29A 1MDBA 4PC7A 3K9WA 3QXGA 5LZ4A 1V3QE 3DHYA 3QE2A 2PU7A 2A9KA 3BRCA 4Z3DA 4F91B 3SX2A 2HDHA 1R9MA 3D2BA 3FMOB 4NCHA 1FQKA 1KOJA 1C7JA 2E4UA 2OHJA 3I6ZA 2YHUA 1ZJJA 4G1UC 3G5MA 4YO7A 1LJ8A 1JSLA 1NN0A 4MWTA 3EC7A 3EYWA 3OKFA 4Z0TA 4UNQA 4RSHA 1JRLA 3BMQA 4DHEA 2DPGA 4PZEA 2A2ZA 4IRUB 4MKFA 3FAZA 1DCMA 5EJ5A 3GPBA 4GP9A 1D2CA 3KZMA 3N7UA 3WYDA 5A5VA 1YOVA 1DE0A 2XXBA 4NZOA 1LZKA 1P7YA 4DCNA 4PANA 4KR6A 4N3AA 4B3JA 4MS4B 2G28A 4EI9A 1PGJA 2Z3VA 2OCXA 1M6VB 5LB2A 3FWKA 4C4TA 3JTMA 1UKAA 1OROA 5JY1A 4GSKA 3HRKA 3KYCA 1KJZA 1M7BA 1QF6A 3JTEA 1V35A 1QVVA 3O7MA 2QQFA 4PYIA 4ZRNA 3PK0A 2Q2NA 2HK8A 3PNBA 3H2YA 2QMZA 4RS4A 1ZNQO 4JVLA 2E1RA 2Z3WA 1P1RA 4D79A 3AY0A 3ZJVA 4M9RA 1CHNA 1JTVA 1FVFA 1CQZA 5IJ0B 1GN8A 2XDQB 2EKDA 3WFZA 2CFCA 5I8PA 3SQWA 3FMGA 2FXVA 3NTUA 2OWEA 2D59A 4TOIA 2RG7A 4WK2B 1JPJA 5BNIA 4B2LA 4IJ5A 4FU0A 1B7GO 4S12A 3OFVA 1NUQA 1SVOA 3R40A 5B5SA 1DG1G 3JCZA 4UQOA 3K94A 2NU9B 1KVUA 4L8FA 2A1IA 3AR6A 2FQXA 1Y1SA 1FDWA 3G8BA 4BRSA 3AO0B 1CQXA 2PUVA 1A3CA 2BGKA 3VC3A 3LWZA 2HSDA 3ZXXA 3BXPA 3G59A 2A92A 1G3QA 3JARA 5F2NA 1U8AA 5A9RA 5CFMA 2IHTA 1Y3DE 1KU0A 4MUFA 1M0TA 1WSWA 3T9FA 2H1LA 1A7UA 3DO8A 4M6WB 4B7CA 5B7QA 5C1DA 4EY5A 1Z8DA 1OLXA 3AKYA 1GL3A 1LLFA 4GXQA 1HBJA 3UT5B 3BA1A 1M75A 5LP1A 4GD3Q 4I4TB 1VCOA 3X2FA 3EJWA 2IYRA 1GNVA 3WLIA 4JR2A 5BWMA 2CXRA 3CZ5A 4B44A 1ZI6A 3GAFA 1VKJA 4BNZA 2OD9A 5AVQA 1G2QA 5FWYB 1GY8A 2C5SA 4TVBA 4ZV7A 5BP7A 5T6MA 3MCZA 4Q6WA 4D57A 1VJCA 3U40A 5CFOA 5K8IA 5E7IA 2GJSA 2IYVA 1OXSC 3PYLA 5AICA 1Z0UA 4ZOAA 1RC1A 2BZGA 3SHFA 2ZRIA 1PIWA 5KQLA 1UKYA 3PF8A 4M7RA 4AX4A 2NW6A 4M1WA 4INPA 3A1VA 5IXSA 2BL4A 3RUHA 4PZCA 1CUYA 3T9CA 3JYLA 3F6BX 2CD7A 3M3PA 4MQUA 1UDXA 5JAQA 3DH0A 1RTKA 4YH1A 3QOFA 5AOAA 5EIWA 4RIGA 5JVDB 4CMIA 3IR5A 1XMXA 1H85A 2IY9A 2OAP1 3G9ZA 4IF6A 3HCFA 5DTMA 5A7HA 4UAUA 3S7TA 4UFPA 4P84A 3R7SA 2IPAB 3CEAA 3V8NA 2F3UA 3GA5A 4P80A 4KP7A 2YHIA 1M2EA 4UHDA 1XVIA 3DZHA 1L7BA 3FW1A 4G01B 1ST3A 5EPOA 2I6TA 3FCSB 4HDNA 3GWGA 4MAAA 4B5LA 1P2TA 1MPTA 1L4NA 1YQ9A 2Z4SA 3MUNA 4N6NA 1LPAB 2XA9A 2BBWA 4M76B 3RC8A 1WKBA 1OLUB 5GZ6A 1BN7A 1NRWA 1R15A 2OBNA 3CV3A 4DRZA 4DSAA 1QR6A 3RSGA 3IT1A 1OLOA 4J49A 4RAQA 1SD2A 4ESEA 1B6RA 3VKGA 1LWNA 4FVTA 2B82A 3A6LA 3WL5A 2ZWAA 2KYRA 2FP4A 5JD4A 4WFJA 1PFGA 2WZCA 4OHMA 2YHSA 3W9UA 2QS9A 4RQBA 3QSGA 2NTJA 2XJ9A 3VMFA 2GLXA 3HXPA 4RZXA 3GRFA 3VU3A 2HV9A 3Q7SA 4RGQA 3ZE2B 4PICA 2A94A 3KQWA 3MB8A 1ZN9A 3X1DA 1U0BB 1N2OA 1M5RA 1QHXA 4QIHA 1FXUA 2XYPA 3JYPA 4LA4A 3VNSA 4EVQA 4QG3A 4M0PA 1CUHA 2ZWPA 5TMBA 1JEQA 3C1UA 1HYBA 3HR4A 4PGAA 5J2UB 2CHFA 3WKAA 4BFSA 1C4WA 1VDZA 4TMFA 4OXRA 1MJGM 3Q0EA 5EIAA 4TL7A 4AULA 3OJFA 5BNTA 4HXGA 1W5BA 4DLUA 1CFZA 3NHSA 4ADSG 5KYWB 5FUWA 3GK3A 2BJHA 1SIUA 5LYJF 3KSRA 3FOBA 4YRKA 1XZIA 4Y98A 2J59A 5GIOE 2R7LA 1FTSA 3KEOA 5EJIA 4EGAA 3VSBA 4CMHA 4KPYA 3H1AA 4AMBA 1IUPA 1CU1A 2C82A 3OFND 3U1BA 5GAJA 3A1UA 4YAJA 2AFHE 4EPXA 1Y3BE 3LK7A 4LVUA 4DYVA 2ETXA 3I9V6 1D4OA 2H0RA 5REQB 3C4QA 2QD5A 3QGMA 4KXUA 3EWSA 3AB3A 4TN5A 4CU5A 1RYYA 4IAOA 1C4OA 3A8TA 1CR4A 3O8CA 3A2LA 4EVSA 4QEZA 2TMGA 4E46A 3VZSA 1BCSA 3EF0A 3BOSA 4C01A 721PA 5D2CA 3ZV7A 3EUEA 1OLSB 1DQPA 1S0UA 2PQ2A 5CX1B 3UA3A 2FSVC 1QHSA 1BWQA 3QPUA 4ZCRA 3OTOB 3KZXA 2WTBA 3AVOA 4YJFB 2QJOA 1KZYC 4OD0A 3DYIA 3O82A 1JXQA 2W2KB 2F3PA 3WK9A 3FUWA 3P1JA 3ESZA 3ET4A 2I4TA 1CY6A 1DCKA 1JXMA 2PRYA 3BD8A 3DOIA 1ZCBA 3DUWA 3IDFA 3ZXIA 5DHAA 5DI9A 5FX2A 3FUUA 5MFPA 4S0XA 2EU8A 1CJVC 2OCIA 4PXAA 4IJVA 1BA2A 3WIDA 2WUEA 3DAOA 2P2CA 3MGGA 2G1PA 4Q93A 4D0LB 4FXPA 4FT2A 3CB4A 1VHWA 3ICOA 1WLSA 2CXTA 4RM3A 1HTBA 1NBOA 2VQ3A 3DFKA 4KVGA 3U0VA 5KOJB 3MAJA 2BEUB 3PUXA 1CBUA 3KEMA 4BBPA 3DOCA 3PYMA 3DWEX 1E2PA 1TEHA 5F9HA 2RHOA 1GPLA 3FPFA 1DTSA 2XSZD 3W3AA 2DHCA 3CTMA 4J03A 4GM1A 4OREX 3ROZA 4AJ2A 1QDUA 3O94A 1PQWA 4FB5A 4PN3A 1EAMA 2GN4A 3OPYI 4X1KB 4WXEA 1EXNA 3LP6A 1FNDA 2OXEA 4RDXA 1E6CA 3E3AA 4NYIQ 2JGAA 2JLUA 3F9IA 2AFVA 4DC1A 2XTZA 4G0OA 2YV2A 1HT2E 4J0QA 3KKOA 3ONNA 1CERA 1V7PC 1L8LA 4FMBB 4HWGA 4OB8A 2DGDA 4X45A 3TWOA 4LKOA 3G9XA 3PFGA 3SZMA 1YU9A 1FP4B 3HEMA 3VPSA 2PX6A 2CVZA 1DFHA 3A9VA 3OX1A 2HW8A 3BRSA 2WKSA 1MOPA 1M2OB 1U4NA 5B58T 3ICCA 3FYTA 1BH2A 1TJ4A 2I7TA 4G5OA 4FNMA 4ZQFA 3ND5A 4B79A 1NJ8A 3PWKA 2AUNA 4OMCA 3TCNA 2R7MA 1YR2A 2H31A 1ZJWA 2C77A 3UJ6A 1AUOA 3AF6A 1TZJA 1NQOA 2HYIC 1W73A 3KJNA 4DLLA 2RK3A 2F00A 4OY3A 4K7JA 4XIGS 4A4DA 5EZQA 2B5VA 4OQFA 3COZA 2N9UA 4Y2GA 5K3FA 2GYYA 2J4DA 5B58C 4BO6A 1H05A 4KQ9A 3U3KA 2BY4A 3MTAA 3L41A 5K0SA 2BLLA 3KDSE 1YA8A 3ZLTA 1QHYA 3ESAA 2FQ1A 2RKOA 4W7HA 3L79A 4Y1FA 3I64A 1UIMA 1YC5A 2G0NA 2ZKIA 4R8LA 2D2EA 4KFUA 5J40A 3ROTA 3HA5A 4ZVTA 4E11A 1QGAA 3EUAA 1BRTA 1U8ZA 3TLGB 1FMCA 3Q6IA 3GGDA 4AL4A 2B7BA 4CF6A 5FR1A 3BJRA 3TNLA 1U2DA 1JHVA 3N8KA 2HNBA 2OV4A 5BOVA 3HDYA 1KQPA 2B8TA 2W2NA 2Y0EA 4BEJA 3CSSA 5LNK1 2HSZA 3A0UA 3O75A 3RD5A 4U6NA 3BAZA 2XADA 3HADA 1WMDA 3EULA 1TTHA 1WDMA 2PVPA 3NWEA 4BNFA 1AGPA 2FEPA 5EL0A 5ALJA 4R8VA 1AT1A 5JQGF 2AFHB 2HA7A 4L78A 3TBKA 1KOGA 3FPGA 3SD7A 4KO2S 2UVPA 3HSYA 2RJ3A 1I1HA 3PA8A 4IX1A 4TKUB 3G0IA 4ZAYA 1HE3A 5BVHB 1EUQA 1TW2A 1E7RA 5ELXA 2OFOA 3JASB 3RFTA 4EJSA 2WWFA 3HYSA 4OV6B 1NAHA 3VKWA 3TW0A 1SHJA 2QENA 4AKGA 3PTLA 2Q1SA 5LQNA 2FV8A 4BLRA 3WSWA 3IULA 4RY8A 3GOQA 3BWCA 3SKVA 1XKTA 2XYQA 3A27A 2R6AA 5DHFA 4DZZA 5I3ZA 4OU4A 2QNRA 5HW0A 4J1QA 2JFPA 4RFSB 1CIJA 3WV4A 2PMCA 2G04A 3AL3A 3IKMB 1QVWA 1XD9A 3WL7A 5K2OA 1Q16A 2WMDA 1MMFB 1OZFA 1M6NA 4S1VA 4RIHA 2O1SA 1AXEA 3CG0A 4IUYA 3DLBA 1E2BA 3KQVA 1SU7A 1OFVA 2VA9A 3E9NA 4O2BA 4PIPA 3RSZA 1Z4OA 2QXTA 4YB8A 3PYXA 2IYFA 4HDSA 2BELA 1CRWG 1M0SA 4L8LA 1PVVA 4Y6PA 3NTLA 4KQWA 4AJJA 1O6FA 2B8NA 4W5WA 3G2KA 2ZYVX 3KWLA 2JFVA 2QN9A 2YWJA 3DMPA 4HX9A 2O8BB 1YONA 4P86A 3H5OA 3HNOA 5TF4A 1U3GA 2C5AA 5FTLA 2JI7A 1KSFX 1KHHA 4N3BA 3GLTA 5DTEA 16PKA 2FZEA 2YFHA 4UNSA 3UJBA 4AP5A 4Q7KA 2VQ6A 5EIHA 4OHCA 1AJEA 1YQEA 5TGDA 2GXQA 4BRWA 1F1BA 3IV9A 3H0EA 4LOKA 2P4UA 1QRAA 3DLPX 2GFQA 4EYSA 2DJIA 3DHNA 5FBLB 3GRVA 2FKAA 4QYIA 1PUIA 4G5GA 4PPNA 4GLJA 1TKAA 5DEIA 1N77A 4C3ZA 2OV3A 2GSDA 5B1HA 3LSTA 5K51A 3BAFA 5HKLA 3WO0A 2A5LA 3ZWKA 4Y2YA 2P7IA 2CJPA 4CCSA 3BRWD 5ITSA 4RTMA 3LUHA 5GGXA 3EVBA 3IT0A 3HHEA 4KRGA 2FEMA 1JDUA 1B4DA 3EPLA 1Y3FE 1KEVA 2E49A 3NZEA 3REGA 3M6MD 1XI2A 3RK1A 3ZVKA 1DX4A 4DHWA 2VTDA 1KO8A 5ENDA 2QL7A 1UC5B 2IEAA 3AR3A 4FZ3A 2HF9A 3O1JC 1HDZA 1YZHA 3ZDFA 3CNQS 2G9VA 4U00A 1PTJC 1LBHA 2C00A 5WRFA 5BUZA 2BCJQ 1DXHA 2C9BA 4KAFA 1IYZA 1RC8A 3JQAD 1QE3A 1TYAE 3TW4A 5FBVB 1C7IA 4G8CA 4ZAVA 5FLKA 2H00A 3SR3A 2YVLA 3LX4A 3DL4A 2H7CA 4AECA 4L4ZA 1UPBA 1YE8A 1EFPA 1Z56C 2H4WA 2I6XA 4M22A 4DTIA 3KM0A 1T13A 4M99A 1HTWA 4KXXA 1NOIA 1ZOOA 3ND7A 4KG7A 3P0HA 4YT4A 2H3HA 2E37A 1WHSB 3VTFA 2ZU6A 1A4RA 4ZT5A 5AW9A 2GNAA 4M37A 1NQTA 5AXCA 4P32A 1ZISA 1P39A 1LDMA 2QTHA 5IUKC 3LCMA 2ZQZA 1H4SA 2XGOA 3VVBA 2IHBA 5BRJA 3UWSA 1QIIA 1F8UA 5LQKA 2PMKA 2V0NA 3AUTA 4CM8B 2OO7A 3ZW9A 3MUOA 1IIRA 2O7RA 1XTQA 3H18A 4I3FA 4K9KA 1SURA 5BN5B 1G64A 4UJ3A 1UXHA 3ZCPA 4DPMA 3ZLJA 1HFWA 1E5DA 4PZ0A 2DH6A 4M9XA 3V42A 4YAIA 1C30A 1G42A 1TVEA 3BXXA 4BLUA 1SK8A 4BZQA 5EHXA 2NADA 2PFKA 1GRNA 3GFBA 2GAIA 4M9QA 2J30A 1OI7A 2P9CA 2XJ4A 3SPXA 5JCZA 4TYYA 1SUFA 3V4LA 2JFQA 2VJPA 2Q5CA 1NURA 3WYNA 4RH1A 1DV2A 2Q1YA 3G1UA 3JWGA 3QWBA 5A5FA 5HIKA 4W8GA 1XJQA 1O57A 2PIDA 1FS5A 2VNSA 2ETVA 4IQFA 3V32A 3KJGA 1UAAA 5EP4A 3NEYA 4NY1A 1UK8A 1X87A 1ULSA 2VTBB 1RJDA 3UAVA 5KPDA 4CMEA 2FMXA 2I29A 3D5QA 1B8NA 1U11A 4LRTB 4G97A 2CMDA 4TXMA 4HR7A 2B4YA 4HMOA 2PDAA 1OX4B 2Q3EA 3T7KA 5JAMA 1VIVA 3FFTA 2X8JA 1PP4A 1J9EA 3G7NA 4QREA 1MDFA 1OAOC 1XUOA 3MW8A 1H2XA 1RE1A 5IJAA 1GR1A 1QAOA 4UOZA 4I9UA 4YMTA 2ZCVA 2WPDD 1AQYA 1NFFA 4J0HA 1QG4A 1D1SA 2H1WA 2VF5X 4HLDA 5IDYA 2XIQA 2XT0A 3PJEA 3D0QA 4P3KA 4I9FA 5FEUA 1XNQB 2YWXA 3C4VA 4BVHA 2OAEA 3T0GA 1ULAA 4W5HA 1BU5A 1YO6A 4P38A 4PGFA 1P6QA 1YIOA 2DKOA 3KE9A 3QMWA 4DCCA 2Q3BA 3K5WA 4I9NA 4PO8A 2W98A 4RHCA 4A03A 3G2IA 2WWYA 2QTNA 5IC5A 4CNBA 2WJGA 3ON5A 4FHDA 4IV8A 3RK4A 2FLVA 3AERA 3O4GA 4ZZ3A 1PS8A 1Y1RA 5FF9A 4EPWA 3H16A 3EWNA 4JWTA 4R0MA 1LS6A 3I12A 4QT0A 2AGVA 2D6FA 1SU8A 3OMLA 1N1DA 5D3MA 4CM6A 1EGAA 1ZH8A 4EFDA 2CV0A 1GITA 3CPHA 3EZNA 3MG9A 4GGMX 3QH4A 1OBOA 1X3LA 3BK7A 4GBGA 2CVQA 4E0BA 5DTJA 5EXSA 2EIHA 4JH0A 1O54A 3ZHXA 2QVXX 1V16B 4NMLA 4JC0A 5IAAA 4KE6A 1JNXX 1G21E 2PX4A 5F9MA 3S2GA 1WDTA 4G6ZA 3W4JA 4JVNA 1T2EA 2WJPA 3M49A 4BMDA 2M6SA 2PQ0A 3JW8A 5D3KA 4DXHA 3QA9A 3K0FA 4KDEA 1CUBA 3CWQA 2W2VA 3BH0A 4IGEA 1R8SA 1UCFA 3I2JA 1T6YA 4L0QA 4Q16A 3HABA 4Q39A 1AF4A 4KO1S 4RVFA 1DKQA 1OZAA 3TTWA 3QPDA 3A6GA 2ZIVB 5BY2A 1XD2A 2VPYA 1I3KA 3C0KA 3Q5GA 3OAAD 4ZOCA 2WD7B 5H3HA 4MS1B 4RSRA 5D00A 3G8CA 1NT4A 1EFKA 1Y3IA 4AF7A 4TPKA 3DLIA 4KQCA 2PV7A 2AMYA 4D43A 4C6RA 4LECA 4TXNA 4F04A 3LC2O 5KQMA 3TQHA 3IAM1 2OXTA 3GDFA 2N47A 1DO0A 1G3MA 3HUDA 1EP9A 3B1XA 2JLBA 1QB8A 1ZM3A 1I36A 3HB7A 3D6MA 5KTSA 2PUCA 4R4JA 1VQ1A 2MIIA 4JR1A 2QYHA 2ST1A 4JBYA 4NP6A 3CX3A 2ZBUA 1C8VB 3VSAA 3U1TA 2VHJA 4RA6B 3GEBA 1E58A 4HYYA 4CLEA 2COUA 2ZRLA 3U31A 4CMAA 3VBEA 2BN4A 5KTPA 3RUIA 1R74A 1E1NA 2A8YA 3A70A 2XB6A 1PLLA 1CY4A 2H9YA 4BFTA 3CFYA 1FSGA 3AYXB 4YLEA 3TO5A 1YDMA 1QCZA 3WZLA 4TYWA 1FPMA 4LY0A 3H8WA 3P9QA 4JC8A 3CVJA 5JPIA 1SU4A 2AD5A 4CM3A 2AW5A 3T5MA 2HO5A 2AZMA 2WJJA 3NKLA 2NPIA 1ZHFA 3KKPA 4AMGA 4DJTA 2C4TA 4HH0A 2QPLA 4MQFB 3HVRA 1RXSA 1EVLA 3R4VA 3H19A 1Z33A 1UMBB 3GT0A 1O6CA 1PX0A 1RS0A 4QYXA 3TPZA 4OXKA 2G0AA 1O95A 4QGGA 2P3SA 2AMFA 3QI2A 4XYBA 5C8YF 4AJEA 2I4LA 3UYKA 2C83A 3I5AA 2RAFA 3BEDA 4FZRA 1K63A 1TO1E 4QU9A 5KDOA 5EXDA 3MD9A 3IUEA 4TUYA 2VJNA 2DOKA 1TM3E 4B3MB 3DBRB 1QFYA 1A9YA 1EH5A 3C5VA 4NZYA 1WL8A 5B2ZA 3LC0A 3GJ0A 3QVOA 4XVRA 4O8CA 3U3MA 1QRUA 5BT9A 2QTVA 2FEOA 2B8EA 1JWAB 3CB2A 1T36B 4LI0A 4MQ5A 1E9AA 1GJRA 2GERA 2R8BA 2VJMB 4XXHA 1US8A 5ULLA 1M0EA 3CJRA 1Y6FA 4QU8A 2CEKA 2RI1A 2XMGA 5L7TA 2G71A 1DPGA 3O47A 4HAZA 4BVJA 2V7PA 2ZYWX 4FBGA 5C3MA 5DT9A 4BTLA 3S55A 2B30A 2HF7A 3M5WA 4GX0A 1XA0A 3G8YA 4TZKA 4FNGA 4LWPA 3QFHA 4R2WA 4FMPA 3TX6A 3P8ZA 1DXQA 4II3A 4DMKA 1WMAA 2NSJA 1E7MA 2ZR7A 3AKDA 1IIBA 2XI4A 1WEHA 5IEBA 3PDUA 2JJ1A 5FNVF 3ZDYB 2R6GA 5KJEA 1J6UA 3K9HA 2ZUDA 4RE6A 3VNQA 3DGFC 3RHZA 2BGGA 3KD2A 5THXA 4B87A 3N39C 4BFYA 2PT6A 3L1VA 3NNNA 4M1TA 4E94A 2P2SA 2CDBA 1O7JA 5CB4B 1JI3A 1VLQA 3FPJA 5LDDC 1SA0B 2DHDA 2HHJA 2JD1A 2QYTA 1RHRA 2G9RA 4L0CA 3WYEA 1GAJA 4U63A 4EX6A 3ZU6A 1KMIY 3DEIA 2BKVA 3NWJA 2WILA 5CH8A 5FFNA 3U16A 4U2BA 3RW9A 1ILEA 4ALJA 1T9CA 1DIOB 1RP7A 1XHFA 5AIBA 1P1HA 3OG9A 3ZI7A 3FTEA 3LYHA 3AFNA 1LDNA 2XCIA 3D1JA 5EXXA 2NN3C 5KX5A 4EX7A 3OZFA 4WKNA 3FG9A 3ICVA 1WUHS 3PQ6A 3KQUA 5DGHA 1G21B 1WD7A 2IVFA 4KSBA 5BN4B 4JDUA 3RUCA 4Q7EA 3C6QA 3HBLA 5F12A 3QLEA 2AQHA 5AK0A 3BICA 4J16C 2EKLA 3ZE1B 4ZYZA 2Y2UA 4JQCA 1KNXA 5EIBC 4OXXA 1SBCA 4KLAA 4BY9E 3U7QB 3HU5A 4W7IA 3OQOA 1XE3A 2QRHA 2YZNA 1EK0A 3E9ZA 3UK7A 1ZWKA 1HL3A 2BR5A 2A14A 1RYMA 2OCAA 1ML4A 5E9WA 3AGPA 4ZPJA 2W37A 3PE6A 1VKHA 4YDQA 4EMBA 3CEPB 3AJRA 3GGCA 9LDBA 2FLKA 1P5JA 2CLKB 5EMHA 3B7WA 2F55A 4Y0VA 1B2LA 4B3SB 1DIRA 1F8GA 4JGGA 3CPJB 3GLVA 3QV1A 1TJ5A 1OZGA 4Y2SA 5EZSA 2VUSA 4FCCA 1KWKA 4JEUA 5HJ5A 1F5NA 5KVVA 5P21A 1NMZA 3BTUA 1MJGA 4KLNA 3I01M 3COWA 1TT5B 4Q4JB 1RBQA 3CLSC 4RYLA 4BP1A 2MYTA 1ECGA 2NZJA 4XSHA 1T2DA 3S2SA 4C89A 4LQDA 2TECE 4O4HB 3N8DA 1GPMA 2MSDB 1HNNA 4CVNA 2Q6VA 4R2IA 4HNVA 3E9MA 3CCFA 4HZUA 1DC3A 4EA9A 2JLXA 4D6YA 3JRNA 1T5TA 1MTOA 4R1MA 1HDGO 3JATB 5A6VA 2FJ0A 4DUYB 4OM8A 1QIMA 3GLQA 3O84A 1G8AA 1DOHA 3RYCA 1BA3A 2EBFX 3QBJA 1Z7BA 3J81k 1PE0A 4RPHA 4N6GA 1VLVA 3W1VA 2BW0A 2J5QA 2G88A 4DGQA 1P77A 1CY2A 3RC7A 3D3NA 1D3AA 1R2QA 4EHLA 4GDFA 1GRRA 4IVNA 3D0RA 3N2GA 5EPUA 1N33B 4ZZIA 2EG9A 4TV9A 1TXGA 1BFKA 4ZANA 4RIFA 4AP6A 3PGVA 1XG5A 3LECA 4YUVA 4ER5A 1XZHA 3FWYA 1WUJS 2QD2A 1JAZA 1EVKA 4ZT3A 2DX7A 4BTVA 4LRUA 5FJJA 5BR8B 3VDQA 1ECBA 1XELA 4ENQA 3LGXA 1MQAA 3ANTA 5KQSA 1R8JA 1F2TA 4WKBA 2NIPA 3BD9A 1TJ3A 2JPDA 4KRYA 3K9GA 2ANCA 3ZKWA 4ZHSA 3ASYA 3CH4B 3D8UA 5D51S 3KPYA 4DR1B 3ADKA 2EDAA 3CRNA 3CZAA 4NAUA 4E2XA 3COVA 2DF8A 1EE2A 3RLIA 5JH7F 1K98A 4ZVUA 2NUTA 2CJWA 4KLCA 3E2IA 1YJ8A 2R68A 1J24A 2AMVA 2DWPA 4BNNA 1PSDA 3AM5A 5EJ8A 4ZOBA 1OGJA 2PM8A 4MDHA 1TRKA 4WMLA 3M5PA 4FI3F 1E6WA 2MSWA 4PLTA 3PHLA 5EE5B 1O89A 2AN9A 2HHCA 2VHEA 2ZTMA 3UMJA 1YA6A 4DBLC 1J22A 4G24A 1I2AA 2YYZA 4CM4A 3STUA 2J7PD 3ZDQA 2WM9B 4F3KA 4BBAA 3OQHA 3QVGA 4L74A 4NE9A 5CFPA 5BWLA 2DXIA 4CEJB 3K2IA 4DC9A 5JR3A 4J0DA 5GONA 4M8NE 2PHZA 1TIKA 2VP6A 3L4SO 1VE6A 4N5DA 2Z5GA 4G5QA 2YRXA 2YZ2A 1APBA 2H4HA 3DLCA 1ZQ9A 4EW3A 5HZHA 2ADFA 2WRZA 3UMVA 5C8VA 1KDOA 3KKQA 3H4VA 1OILA 2GILA 3DULA 4TTRA 4H1WA 3I34X 5CU7A 3C5CA 3ZZNA 3GH3A 4PG7A 3K4HA 3WRWA 4MR9B 1C1HA 1K2VN 4KR2A 4U7DA 1ZD9A 5B4TA 4PPFA 2BGWA 4GZ3A 2Q5HA 4LYHA 3GNTA 2DCMA 5DIFA 3CKLA 3I5MA 4PLPA 1QHHB 5IBPA 2XEDA 4DSTA 2KM1A 1U0EA 3EZ6A 3CWCA 3LK6A 2CF5A 3BWXA 4IEEA 2D62A 3X1MA 1ZCJA 1S9HA 1J07A 1J5EB 3KT0A 3LPDA 4G67A 1DIGA 3PFHA 1O2DA 4PFKA 5L3SA 3HDGA 3OEYA 1NFQA 1D4ZA 1E1RA 1E61A 2P41A 4W82A 4WRRA 5K3CA 3BFXA 2W9XA 2YVKA 4PBTA 4ZC8A 3B6MA 2ODEA 4KLZA 1Y3CE 4OQQA 4Y2VA 3WYFA 4CEIB 4B9AA 4C3UA 4AURA 1NKTA 4FILA 1TVKB 3O4RA 1SVMA 1YVEI 2VHYA 2PLRA 1MG5A 3CXRA 1C80A 3ZGVA 3UG7A 1T9GR 3HL4A 4EJSC 5LP6A 1YBVA 4FOTA 2R1TA 5C37A 1H23A 2O19A 4CFYA 4IZHA 4JFRA 3GB9A 2CZGA 3PJGA 4QQFA 1HKUA 2AI2A 3MGCA 3VR4D 3AJAA 5B6IA 3HZOA 4RYDA 4DCUA 1V6CA 1N2GA 4FS3A 1QUFA 2G6TA 5LL6P 5K3OA 4YEDA 3PEFA 1KO7A 4KUHA 5DHUA 1QV6A 1XRRA 2ADMA 3MMXA 4HN2A 4NDZA 1NW5A 1M1XB 1UBUS 3H6GA 3ORRA 1BAPA 1CY1A 3K9FC 2IV7A 2FW0A 3TB4A 4WUTA 4NNJA 4YXWA 1P91A 4FZJA 4MYRA 2G72A 3ZYCA 2OHVA 4EGFA 4UEOA 5B30A 5IDQA 2YJ5A 3IE0A 3C87A 4YP0A 2NZXA 3SEQA 4CG1A 4KYIB 4CM9A 1ISMA 1XMVA 1RYZA 2O0LA 3DZ8A 4LE2A 1PZXA 3RF6A 4I5DA 3RVQA 3A1FA 4LXUA 8ADHA 1EVEA 1BEUB 1VJGA 7AT1A 2CXOA 4NU5A 1MJNA 2NSHA 5IK2A 2W00A 1J99A 1Q0SA 4BPRA 1VSQA 3GMSA 1U8UA 3LBIA 5E95A 3ZQJA 4DAEA 4F7DA 3DTNA 3UJNA 1R6VA 2CXNA 2XCUA 5LIPA 1U81A 1INLA 1XP5A 4L02A 1KI4A 4B2YA 3DXXA 2OHFA 4EG1A 3OJOA 2B7CA 2WJZB 3LDAA 2NWQA 1NYLA 1G5IA 4OQLA 4TVOA 2XBUA 4D02A 3A36A 3QXXA 2HEGA 1V6SA 5A4DA 1C0KA 4ZT7A 3KE8A 3CJQA 2J0UA 1VXRA 3BL8A 5BYBA 4I9GA 2JGIA 1SKMA 1YI8A 3GYGA 2GEVA 3FAKA 2JGFA 3ZI4A 3IKLA 1YZFA 3HFRA 4JMPA 1C3EA 2CZQA 1UZMA 4XWYA 3ICQB 3WDSA 2GA9A 3ILSA 3Q3GE 3HCWA 1G5RA