2QMQA

Crystal structure of a n-myc downstream regulated 2 protein (ndrg2, syld, ndr2, ai182517, au040374) from mus musculus at 1.70 a resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
278
structure length
278
Chain Sequence
b'HHHHTHSVETPYGSVTFTVYGTPKPKRPAIFTYHDVGLNYKSCFQPLFRFGDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCILQYLNFSTIIGVGVGAGAYILSRYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPDMILGHLFSQEELSGNSELIQKYRGIIQHAPNLENIELYWNSYNNRRDLNFERGGETTLKCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein NDRG2
molecule tags Signaling protein
source organism Mus musculus
publication title Crystal structure of the human N-Myc downstream-regulated gene 2 protein provides insight into its role as a tumor suppressor.
pubmed doi rcsb
total genus 90
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2007-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qmqA00
1X2EA 1SCKA 2HRRA 3WMRA 2GYUA 2FX5A 5K3DA 1EB9A 4CG2A 1QIEA 1LPOA 4Y2QA 5AK3A 4HTAA 3OG9A 1DU4A 2ZYIA 4KE6A 5ALEA 4ARBA 3RLIA 1CUVA 3AIOA 3FNBA 4LXGA 1CUIA 2X76A 1TIBA 4CG3A 3RK4A 5AI4A 1T4MA 4H7IA 5ALRA 3WKBA 2CKMA 1W4LA 2AJ8A 4AQDA 1FFDA 1QOZA 5IKXA 1QLWA 2WUFA 5AKEA 3ICWA 5AI8A 4H7JA 3L1IA 2RGUA 3R41A 5JYCA 3C5VA 2CUTA 3SX4A 1EK1A 4EY8A 3STWA 2QM0A 4DIUA 3MVEA 4TVKA 5DTJA 3FCYA 4YPVA 2QTBA 1MX9A 4KAAA 1GZ7A 3LP5A 1EDDA 4RE5A 5FRDA 2WFLB 2JGLA 4BZZA 1CEXA 5JZBA 4HAIA 5A71A 2IX9A 5AK4A 3T52A 4Y7DA 2AXEA 4GHWA 3AZPA 1Y7HA 3R3WA 1ETHA 5D3ZA 1M33A 4KJXA 1PJAA 3PUHA 3WK4A 4J3JA 2GZSA 4MYDA 4N8SA 1HBJA 3ZLTA 2I3ZA 5T4EA 2WTNA 4DLNA 5IVHA 4UBOA 3WK5A 1L7RA 4Q34A 2GBGA 2FUKA 4DMFA 5EHZA 3DOHA 4G9GA 4GXNA 4J0JA 3MUNA 5LZ2A 3D5EA 3WYDA 3HJUA 4HXEB 1QIDA 4LHEA 2C58A 5AKXA 1USWA 1UZAA 1E89A 4QEKA 1UK7A 1QFSA 4AN0A 1WM1A 4DNOA 4CIBA 1JFRA 2WIFA 3ZWQA 1EXWA 3F8SA 5BWCA 4OB7A 1AGYA 4W1SA 5AKYA 1YASA 2HA2A 4I4CA 4HRYA 3WK6A 3D59A 1QIIA 5HCUA 3S8YA 2H7CA 3AFIA 4P08A 3WK7A 1QTRA 1XROA 3O9MA 2Y6UA 4CCYB 5CXUA 3KWJA 1R9MA 3ED1A 3IBTA 1G42A 3Q8WA 1MNAA 1FSSA 4X97A 1F6WA 2DHCA 3GROA 2JF0A 4KEAA 5T4HA 4HXGA 2RHTA 4PF1A 3I2KA 5CMLA 1ODSA 4UBMA 1EDBA 1QFMA 5EHQA 1THTA 3WA6A 3F67A 4B0PA 4BE9A 5I7UA 3PE6A 1ZI8A 2WILA 1XZMA 1E3QA 1UK6A 1CQZA 2JGMA 5K3FA 3HRHA 1LPSA 5JASA 4UFPA 3JWEA 5IVKA 4PSDA 2OGSA 5JD5A 3H04A 3BWXA 3DJYA 1CVLA 2WG2A 1XRLA 5CT9A 1HLGA 3MGAA 4RE6A 1CUWA 1QZ3A 4ZWNA 4TPKA 3V48A 1DX6A 5HQ3A 4LIPD 2QRUA 2XUFA 1IUNA 1R1DA 5ALVA 3TEJA 5AK6A 2OCIA 1LBSA 4QDXA 2VEOA 1UKBA 2WU4A 5AI5A 3A2NA 5E4JA 3EQ9A 4DNPA 1XRMA 4C89A 3QITA 1Y7IA 3B12A 4I3FA 1GT6A 3FLAA 1EVQA 5I9IA 1XKTA 1BCRA 1H23A 2XMZA 3U0VA 4CG1A 4QLOA 4OU5A 1XZDA 2VJBA 3DQZA 3O4IA 2C7BA 3I28A 4BCDA 4K2AA 1BU8A 2XQGA 3H19A 2HDWA 5CBKA 2HA7A 2HFKA 3I2JA 4PW0A 4L0CA 1JT2A 3GA7A 1NU8A 4AO8A 2B4KA 5ALOA 4QNNA 5CH8A 5LIPA 4A16A 1ZJ5A 3WKCA 4B6GA 1YCDA 3GFFA 5K3FB 5T4BA 3FSGA 2GYVA 1ACLA 1OCEA 4L72A 2WJ3A 4UHFA 3WKAA 3WWOA 2PX6A 3ESBA 2ECFA 5FP0A 5JAUA 4BB0A 4EBBA 2XMRA 1LZKA 3WZLA 3C6ZA 2J3QA 2XUDA 4PSCA 4EY6A 4BVJA 3H18A 4UBIA 1H22A 5AK5A 1K6EA 2DFPA 4H7EA 4KE9A 4UFNA 5DTIA 3IVMA 3BIXA 2QT9A 2Z5GA 2J3DA 5ALTA 3ZLUA 2V98A 4FLMA 3H17A 1W75A 1YB7A 3W06A 3O4HA 3G9XA 4U2CA 1JU3A 1A8SA 3M81A 2PSDA 2XMSA 2J4FA 5LKRA 3ANTA 1G4HA 3KXPA 4GEGA 3WJ1A 3W2TA 3EQ8A 5HZGA 3F97A 3WZMA 1AUOA 3IB3A 1LPAB 1XQWA 4G8CA 2G5PA 4K6KA 4QA9A 2K2QB 5C8ZA 2WHPB 5AI6A 4OPMA 1GPLA 1XRNA 5HF6A 4O08A 4ZXFA 1GKLA 3LIPA 5CTAA 4QWWA 3D3NA 4X93A 3DEAA 4CCYA 1X70A 4YX9A 1MPXA 2WIDA 3HC7A 3IULA 1FFEA 1KU0A 1W1IA 2QXTA 3DNMA 3A2MA 1WB6A 3WI7A 2ACEA 3OTQA 1FFBA 3WKEA 2OLEA 3STYA 3RM3A 1DTEA 5AHXA 5JALA 4ETWA 2QS9A 2WQZA 4CCWA 4QDTA 4MWTA 1VZ3A 1VXOA 2XUQA 1THGA 5BV7A 4X92A 4IH9A 1CUYA 2B61A 3EF3A 1MT3A 5F4ZA 1E8MA 3FYUC 5ALYA 4DMKA 3RARA 3QPAA 1SCIA 1WCYA 2Y1KA 3MUOA 2NW6A 4G8DA 4E14A 1BEEA 2XLCA 5ESRA 4P92A 4J0CA 1QIGA 2XUOA 3O9VA 4AZ0A 3G0GA 4KR0A 1XZFA 3SC2A 4U2DA 2WUGA 3AILA 5LZ4A 1DWPA 4WFIA 4WY5A 1YA8A 4PO3X 4BAZA 4K6GA 1Q83A 2VAXA 5CURA 1XZJA 1X2BA 4Q05A 4G4IA 3I6MA 2Y2UA 1U8EA 2WM2A 1YAJA 5DLPA 2OQIA 5ALNA 3GZJA 3ZPXA 2EEPA 5SYNA 2XUKA 1N8SA 4OD0A 3I1IA 3HZOA 1XLWA 1U65A 1EH5A 3PICA 2XUJA 5FLKA 5HF5A 3QMVA 4F0JA 5JATA 5FPQA 5JAHA 3OOSA 1RWQA 2O2HA 3EQ7A 4OB8A 4G5XA 3C43A 4UHHA 5AH0A 4Y2SA 3FLEA 4EHBA 3R40A 4XX1A 3OPMA 4KE8A 3CCBA 3STUA 1EX9A 4Y2RA 2XE4A 4LXIA 4WDQA 4MYSA 3G9ZA 1CRLA 4XJVA 5ISMA 5HFAA 1K4YA 2RI6A 5JZ9A 1IUPA 1ZIYA 1CV2A 2VJDA 1CPYA 4D9JA 3H0CA 4FBLA 3VKFA 5C8XA 3C45A 4FKBA 3V1NA 2V96A 1IUOA 1TCAA 1ZICA 3WKDA 1EA5A 1P0MA 3O0DA 4FWBA 1P0PA 3DOIA 3SK0A 1WHTA 3P2MA 4LYEA 1N5MA 1U2EA 1F0PA 1B6GA 4P93A 2VT7A 1BE0A 1GPKA 4X91A 1JJBA 2XQJA 4OCZA 2HU5A 2QMQA 1IVYA 4INZA 1XKLA 4BC1A 1MX1A 5CXXA 3G9TA 4B85A 2W22A 1XZCA 4BRZA 4B84A 4B82A 4JYPA 5ALSA 4P9NA 5DYYA 4F5ZA 1HPLA 1O6FA 4C4ZA 3BF7A 1JJFA 4ZV7A 1O6GA 3VVLA 1EB8A 3WL6A 4H7FA 4FBMA 1XZBA 5AM3A 4WFJA 4H35A 3CN9A 5AKJA 3HLKA 3O4JA 2PKYX 4UBJA 4FMPA 3ILSA 5A7FA 2B9VA 2XQIA 5C8VA 4E46A 4X6YA 4BC0A 4M0FA 3AJAA 2XUIA 2WFLA 1QIKA 4FLEA 2AJCA 4CI9A 3DL7A 1DX4A 1PV1A 1D07A 2VTVA 2C4HA 5EIAA 4F60A 4X94A 2JEYA 1H2XA 1CUFA 3NWOA 1E8NA 1TQHA 4AZ3A 1VZ2A 2OAEA 1H2WA 1QTIA 1UWCA 1XQXA 1VKHA 1VE6A 4J03A 5SYMA 4C6HA 1ACJA 1ZD4A 1LZLA 3D2AA 4YK7A 4Y2XA 3QVMA 2QVBA 4H0CA 3D7RA 1UKCA 5AJHA 2WUEA 2BCEA 2XDWA 4DTCA 4C88A 2XQFA 5AOAA 1CUUA 1C7IA 2Z3WA 3H2GA 1H2YA 4FDMA 2Y2VA 4U2GA 5HFNA 2BGNA 5D6OA 1DQYA 4Y2YA 3DCNA 4G4JA 1VJ5A 1L7AA 1MO2A 2OGTA 1TCCA 4ITVA 1AURA 1J07A 4AN1A 1A8UA 2LIPA 1C4XA 3I6ZA 5JD6A 5AM1A 1G66A 2PL5A 2HRQA 5IVDA 2ZVDA 5EHXA 5J3JA 3C87A 2XUHA 3DYIA 2BGRA 2JBWA 5KREA 2HFJA 1WPRA 2VJCA 1BN6A 2BUAA 3KD2A 2DHEA 5EFZA 2XUGA 1QO7A 3G8YA 5ALQA 5K3EA 3SWWA 3AUKA 4X00A 3WA7A 5A6VA 3R0VA 5K3AA 1W76A 5FPPA 2C0PA 5I8PA 2Q0XA 4J0GA 2XI4A 3H2JA 3I6YA 1QIHA 3ANSA 4FLFA 4B7ZA 3ESAA 1L7QA 5CW2A 5HQ3B 5A7HA 2GBIA 4NZZA 3WYNA 5AOBA 1SFRA 1QJ4A 3L1HA 1ZOIA 2J4CA 2HA5A 4NS4A 3IUQA 4C4XA 4X3CA 5LZ8A 4DSAA 1DT5A 2EDAA 2RIPA 1NU6A 2O2GA 1LLFA 5HF9A 3AZOA 1ZGBA 3D2CA 2QXUA 2UZ0A 4OYLA 2QR5A 4M0MA 1JMYA 3AINA 3PFCA 4JYMA 5H3HA 4Y2UA 3HABA 2VA9A 5AIAA 4ZI5A 1KEZA 1XLUA 2D5LA 4H18A 1XRRA 1XLVA 2X8BA 3WWDA 1ODTC 1ORWA 2ONCA 1LNSA 2WFMA 4UUQA 1SOMA 3C6BA 1MX5A 4ZGBA 1HQDA 3IDAA 2C5FA 4XWGA 4BZWA 4DMHA 3VXKA 3FVRA 4WFKA 2PSJA 4U2BA 1OXMA 4ZV9A 4GDMA 1QIFA 3UUEA 1YS1X 3BF8A 1UOQA 4WJLA 1UK8A 3EBLA 4BDTA 3C8DA 4W1PA 4J0KA 5JZSA 4C4YA 4CFSA 1ZI9A 2OAGA 1FFAA 1ZJ4A 3K6KA 2ZSHA 1CUDA 3NOXA 3WIBA 2OPHA 3FYTA 3TGLA 3I2IA 4B9EA 1YSCA 3PDCA 4I19A 3W9UA 2V97A 1DWQA 2ZYHA 1R88A 5CH5A 1CFJA 5ALZA 3A6ZA 3H2IA 4V2IA 1K5PA 5CT6A 5K3BA 3A70A 5AM5A 1AQLA 4W1RA 2H7XA 4PQEA 2GYWA 4MQLA 1TCBA 3WLAA 3O4GA 5AOCA 4S0XA 5EGNA 2WSLA 5ALPA 4B9AA 1XZEA 2PUHA 5HK9A 2I03A 3LLCA 2GBFA 2BUBA 1CUHA 2WHRA 4Q3LA 1SCQA 1XFDA 2GBCA 1MTZA 4JUIA 1G5FA 5E2IA 2ES4A 3E1GA 4EZIA 2HU8A 4BATA 4X6XA 5LZ5A 1Q84A 1CUGA 1CUAA 1LGYA 3VDXA 3R3YA 1ZIXA 3B3QA 1YAHA 3WWEA 4Y2JA 3VVMA 3I2HA 5KBYA 2XQKA 2PU7A 5AKLA 1B41A 1P0QA 4UBKA 2Z8ZA 4DSZA 2PVSA 2VQ6A 1ODCA 2HADA 1TKRA 2WJ6A 1LPNA 5AKGA 1E66A 2JGIA 3C70A 4RGYA 5T4FA 1MJ5A 4B0OA 3DYVA 3OURA 1N1MA 5HKBA 3OM8A 1VA5A 1MAAA 5AKZA 1QE3A 4UBLA 1XZHA 3WL7A 1ORVA 3TJMA 3G02A 1FFCA 3VJKA 1AMNA 3F96A 3UUFA 1GPNA 3E3AA 1OILA 4WY8A 1AKNA 1XQVA 2XMDA 2HA4A 1BCSA 1XZAA 1A7UA 3IUMA 2AJDA 3V1MA 4AMZA 3U1TA 1DQZA 4OSEA 4UHCA 3ESCA 5FDFA 5HK8A 2ZYRA 2RAUA 2ZJFA 4BRSA 5ALHA 5ALKA 4KRXA 4OYYA 2XMQA 4UPDA 3H2KA 1WHSA 4OU4A 2WJ4A 1QO9A 1ZGCA 2JEZA 1QIMA 4B83A 3ZI7A 2QUAA 4QDZA 4W9RA 4ROTA 2I3DA 3AZQA 1EK2A 1CLEA 1U4NA 4BBZA 4BDSA 3LS2A 2Z3ZA 4QE3A 4WCVA 2WIGA 4KRYA 4KAJA 4QDUA 1E5TA 5ALUA 3Q0TA 3W9BA 4EY4A 1C7JA 4BTLA 5K3CA 3AIMA 4UHEA 5ALJA 3STVA 3E0XA 2WUDA 1JI3A 3G0DA 3BXPA 3HI4A 1MNQA 2BKLA 2PM8A 4PSUA 5DNVA 1UFOA 4KYVA 2O7RA 2WIJA 3G9UA 3DKKA 1CIJA 2OXEA 3X3HA 2CB9A 3KSRA 1SC9A 1CUEA 4BCCA 1MU0A 1BROA 2H1IA 5AICA 4UFOA 1XZKA 2ZSIA 3K2IA 1CUCA 1H2ZA 2C0QA 1DWOA 3STXA 3QBJA 4KAFA 2VT6A 3R3XA 4HRXA 5FV4A 4EB0A 1Q0ZA 3FCXA 3WL8A 5AKKA 5FKJA 5JAOA 4A5SA 1QGED 2EDCA 3FWHA 4Y2VA 2OCLA 2CMFA 2BJHA 5JANA 5FOQA 2PPLA 5CH3A 3WK8A 3GUUA 4WDRA 4FHZA 3VISA 3C8HA 3V1KA 5ALWA 2FJPA 4OB6A 2G5TA 2D0DA 1XQYA 5AM4A 4EY5A 4QDOA 4X95A 2XUAA 1IMJA 1GKKA 2VJAA 2B20A 3S2ZA 3PF8A 4DNQA 2OGZA 4H7DA 2IITA 1QONA 4Y2PA 1S8OA 4AO7A 1K63A 2HIHA 4L3WA 2PSHA 3QPDA 2HM7A 2W6CX 1R50A 2DCMA 2JGEA 2Y6VA 5DYTA 4AO6A 3IIIA 1K8QA 2PSFA 3QMMA 2AJBA 3FYUB 1XZLA 3H2HA 4LXHA 3PI6A 4FFVA 1MAHA 2R11A 2XMBA 1AZWA 3HACA 3NGMA 4FOLA 4AB1A 3DLTA 1JMKC 6YASA 2VSQA 3JW8A 1BEZA 3G0CA 1AX9A 4GECA 4K6HA 4UBNA 1VOTA 1GXSA 1VLQA 1BN7A 3YASA 1EI9A 1GGVA 1RYYA 1EINA 1UOPA 2OCGA 5DJ5A 2QKYA 4BVLA 4DM7A 3QYJA 2WG1A 4BAGA 3D4LA 2PU5A 1UKAA 4PV7A 3BJMA 3K9BA 4BTVA 4A23A 3PFBA 4FNMA 1LPBB 1YA4A 4J0IA 5AM2A 3D0KA 1F8UA 5C81A 4N8DA 1KU6A 1UOOA 4MQMA 1NX9A 5AM0A 4MJ3A 2PBLA 3DDUA 7YASA 4JNCA 2O7VA 1R4ZA 1XZIA 2RONA 1WPXA 2XB6A 2YXPX 1CQWA 2O2IA 3FOBA 5DYWA 3M83A 3W05A 3HSSA 5FXMA 2YH2A 3CN7A 1Q0RA 3FYUA 3I1YA 3JYHA 4L9AA 5LZ7A 5CT5A 3ICVA 4AX4A 5JARA 3IUJA 3G7NA 2WHQA 5JADA 5JIBA 4GW3A 4EA6A 3QH4A 1BRTA 3B5EA 1YB6A 4BYMA 4DNFA 2FJ0A 4AMYA 3N0TA 4MXDA 1HKHA 4E15A 4C87A 2HA0A 3DD5A 1XZGA 3G0IA 3M3DA 4H7HA 3CXUA 4EY7A 4X7BA 2XT0A 3O95A 4HVTA 3TRDA 4MWSA 4QLAA 5D7BA 3LCRA 3FBWA 2R8BA 3FLBA 3KWFA 2ZYSA 1CUZA 5C7YA 3BDVA 4H77A 2Z8XA 5DWDA 5A2GA 3QMWA 3PF9A 4KACA 4BP9A 5EHNA 4FFWA 2OQVA 3STTA 3ZLVA 1R9NA 3WWCA 3R3VA 2CBGA 4IH4A 5KWIA 2ROQA 4X85A 1VA4A 4BAUA 4N5HX 4Y9SA 1W6RA 3V1LA 5AP9A 2HL6A 2VATA 5AO9A 2P8SA 2G4LA 2WTMA 2V9ZA 1P0IA 4W1QA 3OC0A 4XVCA 3C6YA 1LPPA 4X6UA 2XLBA 3F9CA 3R3UA 5HKAA 5ALXA 5ALLA 2WG0A 3QM1A 1TRHA 2RHWA 2BFNA 2HA6A 4Q3KA 2DQYA 3H1AA 1CUBA 1IZ7A 2YASA 1I6WA 5LZ9A 2C5GA 4N5IX 3GBSA 3LIIA 1XRQA 1J2EA 3E4DA 4IQ4A 3W04A 5EI5A 3N2ZB 4KE7A 3BL8A 5JD4A 5IH7A 4U2EA 4BCBA 3M82A 4F21A 1YS2X 1R3DA 3WWPA 3HEAA 3I2FA 2HHAA 4DGQA 1J06A 4Z49A 4CIAA 3F98A 5DNUA 2JIDA 4B80A 2H9YA 2PUJA 4J7AA 1JJIA 1T2NA 1TAHA 3WJ2A 5LLSA 5LKAA 1FJ2A 4K5QA 3A2LA 2IIVA 3HXKA 3DS8A 1Y37A 2ORYA 4HS9A 3D2BA 1JU4A 4G8BA 3QZUA 3T4UA 1CR6A 4YASA 4Q3OA 4GBGA 4IH1A 5KWJA 3G0BA 5AKIA 1Z68A 2PSEA 3WK9A 3V9AA 2XMGA 3IURA 4J0DA 4BE4A 2JGKA 2DR0A 3KOOA 4HXFB 1CUJA 4GWLA 5BWBA 1ZD3A 3H1BA 4N8EA 5IVIA 2E3JA 1LBTA 5ALDA 1XRPA 1UXOA 3I2GA 5K5EA 4IHAA 1A88A 1HDEA 1RP1A 4AXBA 2VF2A 3QPCA 3FVTA 2YYSA 4M0EA 3RKSA 4EUSA 3KDAA 3VJMA 2QZPA 3WIOA 1AC5A 3UMJA 4X90A 1PFQA 2DQZA 5ALMA 4MEBA 2GZRA 4B81A 3VJLA 1J1IA 3PUIA 4NMWA 5ALIA 1QIJA 5CT8A 5LYYA 4XIIA 5A7GA 5BOVA 4H7KA 2WKWA 1ZD2P 4JH0A 3FSGD 5AKHA 3WQHA 2QUBA 4C01A 1DINA 3BJRA 2CZQA 1DT3A 4BVKA 3IA2A 2QJRA 1YR2A 4QZVA 3BIWA 2WU3A 2JGJA 2QJWA 4RPCA 4G9EA 2ACKA 3FAKA 2WIKA 2XUPA 1MN6A 2ZJ7A 1WB5A 3C5WP 5CT4A 5ALFA 2I78A 4GLBA 2ZJ6A 4FTWA 2H7YA 1GQRA 4NVRA 4HZGA 1VE7A 1ZI6A 4ARAA 1CUSA 5E4YA 4UHDA 4J0HA 5JAPA 3EIOA 2JGFA 4X71A 2X5XA 2WHPA 1WOMA 3L1JA 1F0NA 4ZREA 1UT6A 5YASA 2WFZA 1BS9A 3IUNA 1JKMA 4OUKX 1LPMA 2CEKA 2OCKA 4BP8A 5ALGA 1N5RA 2XMCA 4Q1VA 5AIBA 2HA3A 5EIEA 3ESDA 4UHBA 5A62A 1IZ8A 1EHYA 1TK3A 4Y2TA 4GI1A 3R3ZA 3C6XA 4QWMA 4PNZA 3ZV7A 5AI0A 3AIKA 3DKRA 1ISPA 1EDEA 5EIHA 2AJLI 3WL5A 4RNCA 5D3KA 2BAGA 4ZRDA 2G63A 3HYSA 4W63A 4G1FA 4E11A 5LP1A 1E8DA 4U2FA 4LYDA 2BUCA 3BE8A 4LKOA 2HU7A 4G4GA 5DNWA 4FNGA 1HL7A 2WLSA 1UK9A 1WB4A 4TGLA 4DMCA 1GQSA 5AI9A 5E4TA 1VXRA 2VAVA 5HF8A 3DL4A 2OG1A 3NUZA 1EVEA 3CCCA 1ZD5A 4Q82A 5CRIA 5FUMA 4IO0A 4MEAA 1A8QA 4DYHA 2QOEA 1CUXA 2DSNA 4JEIA 3BDIA 1W52X 2CJPA 3GELA 2DHDA
chains in the Genus database with same CATH superfamily
2W2NA 1EHIA 1ZBDA 1E5QA 1TX4B 2JFGA 1P81A 2XDYA 2Z95A 4AI6A 1XOIA 4UATA 2YCLA 4B3HA 3D8BA 3KU4A 2UYGA 1QAOA 2VYCA 4IMRA 5HIAA 3FM9A 4CNQA 3H6HA 3CF2A 4GPD1 1X2EA 1SCKA 4LTMA 2ZIFA 1S8FA 1T6ZA 4PSVA 3ZCQA 4BWGA 3LWBA 3WISA 1V5FA 2QJFA 4P84A 4Y1GA 5EKTA 4KPFC 3W3ZB 1B8VA 1LPOA 4CEIB 1ZKDA 2PHZA 1G41A 1GU0A 4IDQA 2GVDC 4G37A 5GGXA 3I5UA 4X1IA 3P8ZA 4IJWA 3ADKA 1FUEA 3KETA 1PJQA 3MJHA 3OG9A 1FP4B 5CFMA 5GMOA 3RQIA 4ARBA 5IU6A 1M6WA 2JBAA 1Q20A 3GDFA 4GG1A 3CMCO 3A4IA 4WACA 5L51A 1JG1A 1PT6A 2H4FA 1I4EB 5JNTA 5TJHA 1M5TA 1JX6A 3CINA 4PGHA 4MA5A 3Q3GE 1HYBA 3B9QA 2JI9A 1DIBA 4Z0PA 2RCNA 1C0LA 2J0UA 3U7IA 3ZGVA 3DV2A 3NEAA 4DUPA 5LYJA 1OT3A 2YRWA 2E4AA 3FVVA 3WRYA 3WLLA 4BLWA 2OCBA 2V7QD 1G5QA 1WSBA 1XGKA 3KEMA 4F4CA 5AI4A 1G3RA 3OA0A 1HTTA 1LI5A 2FSSA 2AX3A 3JQAB 2A7XA 1ZGHA 3AJ8A 3DVRX 1CWUA 3OZTA 4HSEA 1KDOA 2AJ8A 4QYMA 3VPSA 4AQDA 1G4UR 2XNHA 2FF7A 4XXHA 4D3YA 5LQUA 1XL1A 4TV8B 1LV8A 3RFTA 1X87A 3E35A 2GDZA 3RANA 3DBIA 1OLOA 3ZVRA 2FUG1 3CEMA 4RA9B 4TLBA 4FHEA 2BTEA 2YINC 1VFNA 4PPGA 1T8PA 4KQFA 3K09C 4B5KA 2RGUA 4UTRA 1G3IA 1QFZA 5AUPB 3R41A 4IHKA 4MDYA 5DLQC 4YCJA 1MQSA 3RE1A 4MVJG 4MQEA 3GJXC 2QGNA 2WIAA 3GCZA 3II6X 3RKUA 4ZZ3A 5IPFA 1LRJA 1JHUA 4GMFA 3UHPA 1EG2A 3H97A 1P8JA 2VSOA 4JBNA 5BWNA 1JDJA 1KJJA 3HPQA 1V5WA 3MVEA 3T61A 1ZJWA 5DHTA 4MVXA 2A58A 2N75A 1IQUA 3LUDA 5CGZA 1CK4A 2D4AA 2NZVG 4DCNA 1R8YA 1EUDA 1U9ZA 1IDOA 4K1LA 1UODA 4YPVA 4TKMA 3JQ9C 4FDTA 4Y2GA 4KAAA 1YVDA 4LG1A 3QYPA 3QVJA 2MTBA 3VR6H 5DO9A 1N6PA 1USGA 4BU1A 5KU1A 3LP5A 4LJLA 5BQFA 1R10A 1M8GA 5FRDA 3ANYB 5H02A 4AS3A 1I3LA 1KAOA 3KCQA 2JGLA 3AHCA 2OE2A 1ZMOA 4X7MA 5EOVA 4XH9B 1PS0A 4KXVA 5LMUB 1CEXA 2HJHA 3CS3A 1O6ZA 1TLFA 1XDGA 3L0BA 4D3DA 4PR0A 5H1YA 3JRWA 3VO9A 5A2QA 3UPUA 1P91A 5LNK1 4LK3A 1OFTA 2XVZA 4Q4JB 4Y7DA 2AXEA 3K9NA 4DLXA 4L8WB 1KEVA 3LT2A 1KP2A 4GHWA 4ZD6A 5DNCA 2GK3A 2R1ZA 2HO4A 3RREA 4NK4A 1Y3DE 3RVRA 1ETHA 4V0OA 2C9CA 1AV6A 3CVJA 4DMMA 2AG6A 4EHFA 1V8OA 2OZVA 2VHVA 5D3ZA 1GZSA 3ZD8A 4I9NA 4PLHA 1FUYB 1E4EB 3PUHA 3RU3A 7REQB 4TZ6A 3IR7A 4NY1A 2IOYA 4IYJA 2GZSA 4EFKA 1FFYA 3SYRA 2O1EA 4KDEA 1N9KA 3LTEA 2V1XA 5BSVA 1HBJA 1ZOLA 3KX2A 3RSZA 3VPDA 3ZLTA 5SV2A 4DY6A 3THWB 2I3ZA 2VHWA 4GX1A 1BX1A 4QICA 1RAGA 3A4TA 3UAGA 5IVHA 1HNWB 1NE2A 3E3NA 4DABA 4FN5A 1I0IA 1H3NA 5GADl 3AEKB 1VPVA 4O02B 3DLIA 4Q34A 3L8DA 4BYGA 3UMBA 1L5YA 2YJ4A 5EHZA 4J2TA 5KHLB 2PT6A 3I9NA 2OBYA 1JYFA 3KR1A 3REFA 3B3JA 1BW9A 5FTKA 2H4HA 4G0OA 4UD6A 5A9RA 1XTPA 3OWOA 1AG9A 3SZMA 4L74A 1UJ2A 1NWCA 4QHYA 3SVTA 1N0VC 3MS4A 4GPEA 4KQ2A 2QTCA 2Q50A 3DTNA 3KJFA 4MI9A 2PNJA 3UMGA 4RZUA 1GRNA 2ICAA 3WLHA 4DMGA 1EX7A 3WS7A 2AVNA 4YRIA 3V7FA 2QRVA 1QIDA 1HORA 2VXYA 2XBUA 4EJMA 5INTA 2C58A 4JL6A 1BC5A 1JDNA 5JH7A 1U6JA 1TZJA 2ZJ3A 5C34B 4HAOA 4EB8A 1E89A 2ZUDA 4E22A 5A5EA 4I46A 1UK7A 3FNQA 3KSBC 4DNOA 2XGOA 2EKLA 4FJ2A 1YRHA 2WVAA 1HUQA 1CNEA 1W59A 2OKGA 3O8RA 2XGMA 1TEZA 2BW0A 5IBRA 4AKGA 1GT91 4WLOA 1C3EA 2B7LA 1SVOA 2NZUG 2O4UX 2V7EA 2WIFA 3LQYA 3BB3A 3PUJA 4KYUA 5CB4A 2AZXA 4IMIB 3LGXA 3K3PA 4JOBA 3TRFA 1A8PA 2JANA 2BLLA 4MLZA 4RW0A 3SJCA 5I9BA 3Q0EA 5JDIC 4W1SA 3V5NA 1EYZA 2AFHB 1J7JA 1J8DA 2N42A 1Z6XA 1DV1A 1D0IA 3RT7A 1V1JA 1YKSA 3GFGA 4I4CA 3UJDA 2C2GA 2CLKB 2PGLA 4AY3A 5EZYF 2RB4A 1JV2B 3D59A 3FROA 1SO8A 1U94A 1MORA 3C14C 3OIYA 3Q5DA 5DLEA 4ZDWA 3M0EA 2MIIA 1JDTA 2OHJA 3ZWDA 4AY5A 2GN2A 3GAZA 1U02A 2IYFA 5DGXA 1TM1E 2AOUB 1YUNA 3JQAD 4QHSA 3ZWWA 1A9PA 5GINE 4YAOA 2KLBA 2NXCA 4GI3A 1QTRA 1BD4A 5E6RA 3QVUA 5BV0A 1I5OA 4PX3A 1I4WA 2WINI 2Q45A 1VL2A 3AY0A 3BGWA 2ZI7A 5FEMA 3RG2A 4OIFA 3I45A 5CXUA 2NACA 3KWJA 5KVSA 5H81A 4JHXA 3IBTA 1TZMA 4O5AA 1FK8A 1E7WA 1WDLA 4WOKA 1AKWA 1MNAA 3K0SA 1RIIA 2JJQA 4YRBA 3GFRA 4K1XA 2Y3IA 3JYQA 1YDGA 2C3UA 1BHQ1 2XNJA 5A4IS 3U7FB 1F6WA 4FFRA 2DHCA 3BJIC 4KEAA 5T4HA 4KSBA 3OTIA 3JAWB 4H9GA 1C4OA 5AHWA 2CV0A 2PV7A 2DFVA 3KKKA 4PF1A 2IGBA 3VO2A 5B3KA 1U1EA 5F9FA 1FP6A 3JY6A 5A3VA 2V4ZA 3M4YA 4AQYB 4FMCF 5EXDA 1EDBA 3OQPA 2V7XA 4RSRA 3O93A 1XDWA 4OA5A 3F67A 1U2SA 4XW2A 4AJNA 3PRYA 4MRRA 4B0PA 1L7PA 2VRWA 5I7WA 5G0VA 4C0XA 3FKSD 4PBTA 2BJVA 1MOQA 1H3FA 3RSHA 1E3QA 1UK6A 3CVXA 1ECGA 4Y0AA 1GPYA 3GT0A 3RBVA 4XSVA 2GD2A 2JD2A 4G67A 1LU9A 2VXBA 3OFKA 1LPSA 2QPLA 3QJYA 1Y1TA 5C4GB 1SXJA 1Z6AA 3LF1A 3QIAA 5JASA 4UFPA 3OEHD 4RY9A 3UATA 3DJYA 3F5DA 2I6UA 2PUFA 2WG2A 3SXJA 1XMVA 1ZZEA 2JAOA 2IUSA 5KUTA 2ZFUA 2JB9A 1EWTA 3KU1A 4K9NA 5E7IA 3WO0A 4YMWA 5FL3A 2RGGA 1NVAA 1FBTA 3ESRA 1PBTA 4ZWNA 3D7MA 4RA9A 3JSXA 1X15A 2HCBA 4LIPD 1JHOA 2QRUA 4GOKA 3W78A 4F2DA 3JQQA 4FR2A 1IUNA 1YBVA 2G9UA 2ZIEA 4JITA 1R1DA 4NI5A 5ERXA 4NJEB 5ILGA 1ZYUA 3TEJA 4EPWA 5MGBA 1BEUB 3MGCA 5EJFA 1G2QA 5F51A 2LTAA 4QDXA 4OHBA 3ABIA 3THSA 3CC8A 3GH1A 2H85A 1PVVA 3FNHA 5FFMA 4D8YA 4HH4A 4YXWA 2AG1A 4BLQA 4MJXA 5E4JA 3NFYA 2Q1TA 3TD9A 2C54A 1NUAA 3CF6R 2OSBA 2YW2A 4DNPA 4JZYA 5JTTA 1XRMA 2XCSB 5F5LA 3QKIA 1USUA 1HNZB 3B12A 4OJKA 4TUYB 4DJEC 5KPJA 4QSMA 4XD2A 1EVQA 4H27A 1P3Y1 2I33A 4M55A 1X38A 2ET6A 1EFRA 4L50A 5JVDB 3T7TA 2BH9A 3ASVA 1TYZA 3ET4A 4LI0A 4UULA 4Y98A 3RRBA 5IJ9A 1PT8A 4DLRA 4M0KA 4O8ZA 4YRFA 5DN6A 3A28A 3I30X 1V9CA 1JKFA 1CEQA 3TBKA 2VP2A 3WLOA 5CVTA 1WWKA 3PQ3A 1TJYA 1YQXA 4WZBB 3T94A 3X1DA 4BLOA 2C7BA 2ZAIA 4D6PA 4O4JF 4BCDA 3B78A 4FC6A 1DUSA 1T5LA 1I5RA 2V7BA 3WDSA 3ZE7A 5KQGA 5CBKA 1ELOA 5FI5A 3RTDA 1NZDA 2HFKA 3T3PB 4FX2A 1E7MA 3HJRA 3I2JA 3TIGA 1D4OA 1Y3HA 1YL5A 4L0CA 1JPNA 4PVDA 1VSQA 3GA7A 4YFYA 3U40A 4GMKA 3AVYA 4OOEA 4AO8A 4O4IF 5KCZA 2QM7A 1FF9A 2B4KA 4HDSA 2XSZD 5EN4A 3UJCA 5FD8A 221PA 3UMFA 6REQA 4O5OA 3GLIB 4ZO4A 4YC7A 4RFSA 4QXRA 3U49A 3WMGA 3PGKA 3OKCA 3I8XA 1XDBA 3UG7A 4A16A 4GR9A 1Z0JA 3WKCA 1Q91A 3RO7A 1AGNA 3DBHB 5M5BA 1JECA 3DCJA 3L9WA 1EJBA 4GYYA 4PRZA 2NT4A 4JJKA 2P7HA 1S02A 4NZ9A 2Q41A 2UUOA 4PE5B 4QC2A 5AJUA 1IZ0A 3AETA 2OZPA 3FSGA 3HB5X 3G0HA 3ID6C 3CPHA 4GE3A 2P4HX 4BHTA 2GYVA 4US1R 2JI7A 4KV9A 4G26A 2LCQA 3COWA 2JFBA 4LTDA 3ODGA 3IPAA 3AR3A 3WKAA 3JD1A 4D99A 1JS1X 2IXTA 3EVDA 1PZXA 2ECFA 5JAUA 4BB0A 5E0KB 4KC0A 5T7BA 4JY7A 3NWJA 3P9YA 3T5MA 2PA0A 3WZLA 2FY8A 4JI0B 3C6ZA 1OQAA 2NGRA 3PDJA 4F3KA 2J3QA 3FDFA 4F2HA 5ENZA 3A6PC 2W93A 1CP2A 1W5TA 1ZJZA 4FKZA 3ND6A 3RRMA 3ZKAA 3ZTTA 2FFQA 3GYBA 5KDOA 4LY3A 3WX0A 2X5JO 3KEGA 1YS4A 3BMOA 4UBIA 3I34X 2BMDA 2B92A 2PWZA 3VPCA 1P9NA 2VSFA 1KPIA 1QRRA 4I1PA 1QCZA 1WEKA 4H7EA 3KKQA 1A69A 1I2DA 4CIYA 2ACVA 3LVQE 1GGHA 5AMXA 3IVMA 2CJXA 4C0AC 1EGMB 5CK5A 4UKDA 2QD3A 4N3CA 2RCYA 2JDID 2J3DA 3ON5A 4V0QA 1NUHA 3ZLUA 4M1TA 2GCNA 2HYDA 4UMVA 3WFJA 2XZDA 3L4EA 4RHCA 1E7QA 5K0EA 1RI4A 3FWKA 4TRRA 2F8TA 2F1IA 1ECJA 2ECOA 3DAFA 3IDZA 3FY4A 3I0MA 4R8VA 5I9SA 4EKIA 4W8HA 4BFUA 2CFRA 2ORED 1C1DB 4L5BA 4U2CA 3TTWA 4HVCA 3P94A 4WXEA 4Z6KA 2A0XA 5BQXA 2DQKA 4W4TA 4YRRA 4EVSA 2FNAA 2Z58A 4OQNA 1YHYA 3KBBA 2XMSA 5KTSA 2AL7A 4BNGA 1B00A 3BEOA 1BD3A 3ANTA 1Z8DA 4AJEA 1FP7A 3FMFA 5K3OA 1M3SA 1NNUA 3WP1B 3WJ1A 3Q2IA 4MDEA 3D8SA 1V7CA 1N92A 2AEJA 3EQ8A 3NT5A 5HZGA 3ZY2A 3MPOA 3EFOA 3FBTA 3H75A 4C2UA 5HTKA 1AUOA 2ZP1A 1JGTA 3CLRD 5EUQB 2LV8A 3BWVA 1KDRA 1TF2A 4E1BA 4AMUA 2WWHA 1XQWA 4LX0A 2G5PA 5JHGB 4YEDA 3UJHA 2XAAA 1L5NA 4BMYA 5I3CA 4BLTA 4U7GA 4I5GA 1ANKA 4JSRA 5I9LA 1G5TA 2PCJA 5HIJA 2XYPA 1L4FA 1AQ6A 5J5CA 4AJ4A 4E4RA 1GCAA 1YIDA 1J49A 2GCOB 3G17A 4OPMA 5KDDA 4RJLA 4RV4A 1TIPA 4EA7A 3DH0A 1UJ6A 3RSCA 3QUQA 3MAAC 2VDOB 5FTNA 1ABFA 1JEQB 3ZIAA 5CTAA 2DERA 1C9YA 3AFMA 4QWWA 4KH1A 1PD1A 4P80A 1Q17A 4GX5A 5JNSA 2FG6C 3N6XA 4X93A 4MWDA 4QOEA 1HDCA 1VL1A 3L6EA 3LW8A 2CVOA 1PSWA 1I51A 4DIKA 3L7YA 3G3EA 2BR5A 2EJWA 4MP3A 1SXJD 4RUKA 2WIDA 4WINA 1Y3BE 1U2PA 2WF8A 1VGVA 3NYWA 4DT1A 3EULA 3LBYA 1U0LA 3N8GA 4NCJA 4ZOLB 3LT4A 4CG0A 3HY6A 4DWJA 5ADWA 2JAWA 1ZU4A 3T5TA 4M7OA 4V1CA 3K72B 4LF5B 1QK3A 1ZRHA 3ZTYA 5FNVB 3OTQA 1FFBA 1TU0A 2LRHA 5KNBD 5TLSA 1N78A 1XBTA 2W71A 4P22A 3OE1A 4IOMA 3RM3A 3STYA 5AHXA 3W4IA 6REQB 4ETWA 3REOA 5F3RA 3WO1A 4CKWA 2QS9A 2WQZA 1GKYA 1XD2B 2AKYA 2W4IA 4G23A 4MWTA 5CU7A 4CCWA 1QUFA 1DC7A 2FMFA 2NTEA 2X4IA 4Q47A 3R8FA 1VXOA 2RAFA 2R6R1 4L2IA 1MABB 4EPXA 2O6LA 1CYDA 2OM6A 2KW5A 2B61A 4PLVA 4F6RB 3EF3A 3BBLA 1A2OA 3NTXA 3ROGA 1E8MA 3BQMB 3N5KA 4KDRA 4FXPA 2BEUB 2ZUWA 4GKBA 1X1RA 4ZAGA 3UV7A 5FB3A 4RTOA 1JDBB 5GJWC 4A0HA 1D7AA 1WCYA 2Y1KA 1ISRA 1DLJA 4JKYA 4IKPA 2H2GA 2HF9A 5E1DA 2ZBPA 3O75A 3U09A 2PDAA 3I62A 1N5IA 3UKJA 1YRYE 1H66A 3G2OA 1FX0B 4RHFA 1LK5A 4NRDA 1BEEA 3CUEF 3EDOA 4D4IA 4ZMBA 5FEUA 2F1OA 5ESRA 1F1JA 2ZVPX 4IJQA 1YACA 2AN4A 3ZGOA 2GMWA 1AHHA 3EJ6A 1CIVA 1EGHA 3E5HA 4X41A 3EHDA 2VIIA 3M9XA 2XUOA 3OE4A 3O9VA 4LOLA 4S05A 1T5IA 3G0GA 1VHWA 3O2QB 4KR0A 4ED9A 5AW5A 3EXFA 4QODA 1RJDA 3I73A 4Q18A 3O1LA 3QUAA 3THYA 3LZ6A 2AB0A 4U2DA 3P97A 1NBWB 3EEQA 4JASB 3HN2A 4HYYA 4WFIA 4WY5A 4JBXA 4HYQA 1B16A 1LSUA 1ZVJA 3E2PA 4JP1A 4R2WA 3RTEA 4N41A 3P2IA 1J25A 1MD9A 1Q83A 1BDBA 2VAXA 1BFUA 1FSFA 1ECBA 2VBCA 4UNQA 1R4NA 1TCVA 4AJ2A 4PZPA 4JC0A 1DBIA 4E3ZA 4TSFA 9GPBA 2ESRA 3MFQA 4QFBA 2MSEB 3LCMA 5E6SB 4TMKA 1WXWA 3S2YA 3EEOA 1MPTA 3DKVA 3I6MA 2NUBA 3QUCA 3SYMA 5EP1A 3RRFA 5DRYA 3S40A 2Y2UA 5BQ3A 1E2DA 2CCGA 3U3KA 1LQ2A 2C1ZA 3HKBB 3ONDA 1UC9A 3W5HA 4ZYVA 5L6MB 1OKKD 1LVGA 1TVMA 1WCIA 2R751 1ZSVA 4WLUA 3GPLA 3VH4A 4FE3A 2QAJA 3AESA 3W8DA 1X77A 4IF6A 1GN9A 2O6HA 1F38A 4NFYA 5CDUA 621PA 1I0ZA 1L5ZA 2DBRA 2F2TA 3V2IA 2EFJA 4IOJA 2EEPA 3DDSA 3ZPXA 13PKA 3C3XA 4E5MA 1RMTA 1ONSA 1GTSA 1ZUD1 4GNRA 4JBYA 4PO1A 4KG7A 1JEEA 5JMTA 2RHDA 1ZMBA 2DPGA 3PUWA 1J90A 2BRUC 1PCXA 3H8JA 3KOMA 1EH5A 3GMSA 2XUJA 3PICA 5EJ8A 4ZAXA 3WMXA 3UW3A 1DIGA 5JATA 4G0QA 4KMOA 2VYQA 2HNKA 5FADA 4TYQA 5FPQA 3U60B 4WK4B 4B3TB 1NBIA 1L3IA 1W35A 2P9FA 3WGKA 4J0QA 1W0JA 3C43A 3EWNA 1J70A 1OBOA 3IGFA 3MCUA 4PIPA 3ME5A 5AH0A 3KLBA 1UBKS 1VYVA 4MV4A 4CLXA 3D7KA 4ZHQB 1PEKE 2DZDA 3FLEA 1E6WA 1QGYA 1MC4A 4KNWA 5J4HA 2ODEA 3WAJA 2HY7A 3BC1A 3ZUGA 2J08A 4FCTA 1MMFB 1T4CB 4KE8A 4DYDA 1NKTA 4HGRA 4D1YA 7ABPA 1F2TB 4LXIA 1ZR2A 1DG1G 3KXKA 4RORA 2Q5LA 4BNKA 1QDEA 4Q66C 1VJ0A 5KOIA 1JIIA 2I1WA 5L4LA 1J00A 3F47A 5D2CA 1H6AA 3FF1A 4LJAA 4HAVA 4E51A 1DZIA 4WUVA 2ZRLA 1EFPA 2OC9A 1CVRA 3LYHA 3KQLA 5JZ9A 4QKQA 4KO2S 1YUBA 4ADSG 3GLFA 2D5BA 1IUPA 3DWEX 4YRJA 1ZK1A 4PXSA 2XOKD 1ZJYA 2OCAA 3GRPA 4Q7EA 4RFVA 5E95A 3Q85A 4NU5A 1BGXT 2YHAA 4EA8A 3JWIA 3GJ7A 1T1SA 3I9KA 3WNVA 3THYB 1HDXA 4NYJR 1OGYA 1WG8A 3MOSA 3W7AA 6AT1A 4J7UA 5DU2A 3A4LA 2B2XA 4RH3A 1I10A 1Z2NX 2CC2A 4UEKA 1EFKA 2OQ2A 2O1WA 3M5CA 1NNLA 5JS2A 3PD7A 4U5XA 2J0UB 1KBZA 3RBXA 2WI8A 2NSDA 3LNTA 3O8BA 5EJEA 1VMKA 4ALIA 1HYQA 1Z0KA 3JQAA 2R84A 4KIUA 5EE1A 3N2NA 4GL4A 4HQRA 4NBNA 2VP9A 3BRWD 1SZCA 4QNRA 4NZPA 1T36B 4REMA 2ZVJA 2I0FA 1P0PA 4MUBA 1H9BA 1KDPA 2GWHA 2H92A 2XB4A 2OBMA 1R0ZA 3DOIA 3ZE0B 3TK1A 1JHAA 1OOEA 4MGHA 2XGGA 3JQ7A 3D7LA 4V38A 2R68A 2BYTA 1F0PA 2P0AA 2QY6A 1B6GA 3HUEA 1MDFA 1R0WA 1NR7A 4MW5A 3SC3A 3H9EO 3HJBA 3EW9A 1U28C 1RI3A 3HB9A 4GGOA 1NA5A 3PQ5A 4M88A 3FN4A 3EVNA 1OE0A 3DHVA 3HM2A 2VYFA 4GBED 2XQJA 2I6QA 1VGQA 3LC0A 5LWQA 1NRXA 2EBHX 2YXBA 2BBWA 4J90A 2R4TA 1V35A 4F1WA 3AY7A 4B85A 1C7QA 5K99A 2OV8A 3OCYA 3WBFA 4YRQA 4ETMA 5HJEA 1O54A 1V8DA 4CDMA 2R86A 3DFIA 3OOJA 4OH1A 4E08A 1ORIA 3LUGA 3MJFA 3QEMB 1MB9A 4M7PA 4FT2A 3AFNA 2FFJA 4XJSA 3HBJA 5H80A 3OFND 3DD1A 1CE8A 3N2LA 1HPLA 2ZRBA 4IIGA 4DA8A 1PSDA 1H6DA 1FB5A 2OHIA 2I71A 4NU6A 3UQZA 5B64A 1TADA 3R5JA 1JDPA 3B1YA 1DAPA 3D6HA 3EF0A 3CKMA 4BRWA 3V34A 3N8KA 4FD2A 1S7CA 3KKMA 1E6CA 3CGGA 5K9ZA 4ZOLA 4U00A 1PK7A 1D9XA 2P40A 3P2OA 2JGDA 3D3EA 4R84A 2IYLD 1I2AA 1EB8A 4DJTA 4M38A 1GHTA 3AUAA 3GEEA 3PFKA 4X1KB 4QM6A 4EG5A 5FBZA 5JLJA 1V5EA 1FTQA 1QS0B 4MAFA 3OZCA 2NO9A 5A9SA 3FYDA 4GVLA 3C7KA 1HMPA 3WYGA 4BO7A 1XZBA 1TOAA 2I91A 2D7DA 3E4CA 3GJ4A 3VH3A 3U1VA 2JHCA 4RVHA 2PKQO 4H35A 5AKJA 4EDHA 1CIPA 4Q37A 4E12A 4DCJA 1ZW6A 3OKAA 2J5RA 4UPVA 2J8ZA 3O4JA 1I1HA 1U90A 4OKSA 4UBJA 1FX1A 2GEKA 1H9CA 5A7FA 2FPGB 4OJYA 2B1IA 2PFKA 2XQIA 3L3BA 3KJNA 4LRSB 4XWAA 4LS3A 2YYAA 521PA 3RSGA 4BKRA 1II8A 1VFPA 3DG9A 3VPGA 4D8XA 5HS4A 1G20B 4MCIA 3TLEA 3N70A 2EJVA 4MAAA 1DBSA 4QVGA 5M34A 2WFLA 4AZTA 3VPHA 5KKCA 1QIKA 2GF0A 1U8XX 3NOVA 4CIVA 2ACWA 1A8IA 1KRWA 4XUCA 5FFNA 4CI9A 3QPWA 5KTOA 2N1BA 1J0EA 1FQKA 5HMLA 2R6DA 3JASA 1M0WA 3VSCA 4AAYA 2V6JA 3D6MA 5HOEA 2B69A 1PV1A 3QFSA 4U3JA 1H4SA 2ZRGA 4RNDB 4I1SA 4F91B 3RIHA 4ZDKA 1FMTA 1HRDA 4KB5A 2C4HA 2ZB2A 3OZVA 2I1VB 2IYOA 3TL6A 2JKVA 4DXAA 3KVOA 8AT1A 2YOFA 1TJNA 2X86A 1XZQA 2QTNA 4JJEA 1MX3A 4QQKA 1CUFA 1QQ5A 2N1MA 2NOAA 2OO5C 3HYNA 3N76A 4FYVA 4X9XA 4B8ZA 4BVAA 2CXTA 4M0DA 3QHQA 2IZ6A 2WY2D 1DHTA 3OSZA 2OAEA 1UWCA 3WL3A 1DXQA 1XJWA 3RHTA 1H2BA 2ZE7A 3L8YA 4J03A 5J5AA 3NB0A 3SXUA 4C6HA 1XU9A 4ZKDA 1LZLA 4KGDA 2VTKA 1PX2A 3FJOA 1P73A 2RHHA 2B83A 4V2UA 1ZM2A 5E9QA 5E7MA 1YBHA 3OLZA 2YCBA 2CLCX 4Y2XA 4ZAVA 2AI1A 3PGLA 1B23P 1DEXA 4CM6A 4EYEA 1SD5A 4HV4A 1XKQA 3AG6A 3G49A 1R66A 3QVMA 1M1NA 2Q2VA 4O25A 3L9XA 3PIIA 3TX2A 1GNPA 3COSA 1R15A 1R9GA 2IJGX 5AJHA 3LOQA 1E6KA 1X94A 3OTWA 4N0DA 1I2MA 4Q9JA 4OHZA 1TQ6A 4YJHA 1LD3A 1GYQA 1TKBA 4TZ0A 4IM7A 4RVNA 1V45E 4E7PA 2QZJA 3GCXA 4URFA 4DTCA 5IT5A 2GN9A 4IXMA 2F43B 2WR8A 5CX1A 3CLRC 2W2LD 4ABTA 4AJIA 1SJ9A 1LKZA 5AOAA 1WJGA 4M1YA 3LO8A 3UUWA 4BV9A 3H2GA 2WHEA 4J7XA 4NOKA 4BWVA 1X7ZA 2B6NA 1H2YA 3KTDA 4YT8A 1OY1A 3TTVA 5D3QA 3FNEA 2HK7A 1U8ZA 1VCHA 5F7XA 2AOUA 4WPGA 4ZEWA 2WSSD 5D6OA 4UVIA 1WRBA 2I4OA 3E7WA 1N4AA 4O4LB 4UMEA 2H2WA 4DV7B 3AY6A 3I05A 4LV8B 4A1OA 2R25B 2JGRA 4AZSA 5IBPA 4OSOA 4Y6LA 2VPTA 1Q14A 4D0GA 2PZBA 1QVAA 1WPGA 2C42A 4XDZA 2A6PA 1H1LA 2KQUA 1SHZA 3B1ZA 1SKQA 3RYCB 1MO2A 2OGTA 2X0NA 4S2EA 1AURA 1IWBB 4AN1A 4DQLA 3VU1A 3HYCA 1AOXA 2LIPA 4IWYA 3VNRA 5CVDA 1SAYA 3TLCA 5FBKA 6PFKA 1G66A 4W8GA 1E7SA 4WGFA 4HFJA 4J07A 5CUQA 2GRAA 3D9QX 5EHXA 1GNSA 1L0BA 2A4MA 1JHMA 2WHYA 5CGQB 4JGIA 2FPUA 3K05A 4FC7A 2FUEA 4DW8A 2OR3A 2IEDA 2IZ5A 2Y99A 5EJMA 1HE2A 4YCNA 1KS9A 1RYZA 2P3QA 3U44A 3W9SA 1VG1A 3UXYA 2X19A 2WHXA 2D2VA 2CLFB 2WE7A 2EP5A 4H3HB 1FQJA 3O73A 5EFZA 5MGNA 4O4HB 1YJAA 4RD6A 1I1NA 4YJDA 3UOWA 3KT0A 2ZWPA 4A82A 2MR5A 1XTBA 4DMLA 4E03A 1ISHA 1ABBA 3G8YA 2E85A 5ALQA 3SWWA 3COYA 3IVAA 3OE5A 1QH8A 1Y8QA 5A6VA 4PHFA 4WOCA 4NDZA 2VHUA 4CN8A 4MVJE 5B2FA 2JJMA 1NP6A 1SKMA 1N36B 3RC9A 1U0TA 3W6OA 2GYYA 3RSFA 1UDBA 2IQIA 4NSNA 5D8DA 5ADHA 3W6NA 1H94A 1PWYE 4FLFA 5K4HA 3VAAA 2NUAA 3V2GA 4KFCA 3NONA 1NJGA 3ESAA 4R1UA 3HGQA 1TYAE 2OGUA 2C99A 2FLVA 3FLMA 3AEKA 4HGYA 1K4KA 4NARA 4D98A 1JB1A 1CSEE 3L1HA 1F2UB 1DJOA 2HTFA 4I9UA 4ENQA 3ICQB 1AE1A 1QOQB 2F7SA 3LT5A 5JXIA 4MWGA 1ES9A 3UC9A 2VPYA 4RF4A 3S81A 1M76A 3IAXA 4E94A 1BWSA 1DI0A 1N5KA 1U31A 1MO4A 1RKUA 3I4LA 3KWLA 2DH6A 4WESA 4BY9E 4CEJB 4RSGA 3K8ZA 1NVVQ 4ZT6A 3R4VA 2J3KA 2M6RA 3C5HA 1KOFA 4KQ9A 2WPNA 3EPHA 3ADPA 3RW9A 1I30A 2BGWA 2GEVA 2PO5A 3RUAA 4RDXA 3D2CA 4EG7A 2QXUA 1F9EA 1FDUA 2E4VA 4M9QA 2PQ0A 3BK2A 1J0XO 4I99A 1JMYA 2PLWA 3E9MA 1UP7A 1OA1A 3P52A 4CL2A 1XB2A 4PIVA 1YIAA 4D4HA 2O2YA 1P1FA 4JYMA 2H52A 4H16A 2X7HA 2IYXA 4PM4A 2PBFA 3NWBA 1EBUA 5H3HA 4G85A 4LVCA 3RLFA 2H0AA 4H60A 3AL0C 5B7PA 2ZIZA 5MF6A 2VN8A 4MUHA 1RJ9A 3ZWXA 2VDUE 4DWOA 3TECE 1I2ZA 1KEZA 2D5LA 5JJ5A 1LDMA 2FPWA 3OICA 1M2EA 4WKOA 5AOVA 4ZT4A 5IN4A 2XEXA 2Y8EA 3LJKA 4HDSB 2Q9UA 4UCWA 4WECA 5B4VA 3MCZA 3GB9A 4NULA 2RK4A 3G6WA 1N2EA 4I50F 3WWDA 2FSVC 1ORWA 1YIOA 721PA 3T99A 4OVKA 3CKYA 2IUUA 3TXXA 1VP3A 3LECA 3V8NA 4P83A 2JGNA 2BHTA 5FUXA 1WIWA 2OYCA 3C6BA 4CE6A 1KL7A 4RPHA 3GJSA 2VJNA 3IDAA 2XOKA 1NVEA 4YJHB 4YLGA 2CMDA 3VSEA 4YY3B 2C5FA 3KVVA 2A0FA 3T7EA 4MA4A 5JPCA 3QA3E 4BZWA 2ZE5A 5KYWA 1D1QA 3QE9Y 1PKXA 2YN2A 1OPXA 2PSJA 4NESA 2PNFA 3RVMA 1BS2A 3DCYA 1R5OA 4ENPA 2F3UA 2HWXA 2WF5A 1DPFA 1HV8A 1QIFA 3EMVA 4GDMA 4L0QA 3C74A 1GTVA 1NQXA 4BMSA 4TL9A 1U0RA 1GZVA 4UTPA 3BF8A 4W5JA 5JYEA 4CR6A 1UOQA 3LPLA 5DSZA 4QJ4A 3VTKA 4UARA 3FGPA 5DBEX 2OCXA 4KUGA 4JT2A 1VLMA 3PX3A 4Q16A 2H1OA 2CHQA 4U7TB 1ZVMA 4J0KA 3IYLW 3A37A 1ULHA 5CD9A 2XTAA 1K68A 1QYDA 1ZI9A 2BEVB 2Z8YA 3AHGA 1T0JB 1UDWA 3MQ4A 4DC9A 1FFAA 3GJ3A 1J1ZA 8ATCA 4N5NA 3UWSA 1GG2A 1T1IA 2PUTA 5F78A 4TWBA 4DLSA 1W5FA 1GUBA 1CUDA 4YIKA 1STOA 1V95A 1XCJA 1VIDA 1Z34A 2B4QA 3FYTA 1E2NA 1PV2A 4JU9A 4B9EA 3IX7A 1YSCA 1YB4A 4DDUA 1P2TA 4EKDA 3PDIA 4RELA 2DM6A 1JHXA 4G9BA 4P4TA 1DC6A 1R88A 4D0NA 1F2DA 1N1GA 2PMDA 2GPBA 4L15A 4QBHA 3WHIA 1C0KA 2DB3A 5DXAA 4IAOA 5ALZA 1CJUC 2HV9A 2G9RA 2JATA 4ZICA 3MINA 4M0PA 3GT3A 1G0OA 2V45A 4HQOA 2OKCA 1QZZA 2I9PA 5IC6A 3SZUA 4YV0A 1WDKA 4UVEA 3A70A 5K3BA 3RV4A 4IICA 3BMCA 3GHHA 1AQLA 4PQFA 4ARVA 2GILA 2H7XA 5HMMA 3JX9A 1B4DA 1OFVA 1HFJA 3OECA 4LA4A 1JR3D 1MJNA 3O4GA 5AOCA 3OMLA 1PSZA 1WP9A 2JLSA 1S4MA 3DMGA 1X1EA 2WSLA 3JRNA 5ALPA 4XM1A 3GFQA 4R2IA 1J2UA 4B9AA 5B6JA 1MC8A 5B2EA 5HK9A 4DQUA 2I03A 3OD1A 1RMYA 2YFHA 3TOSA 1ODLA 2QY9A 2ANBA 1YDEA 3BQNB 2W2XA 3DXFA 3L0ZA 4M1KA 3RK1A 2R66A 3DDHA 3WLTA 4ZVRA 5DHRA 1A9ZA 1L5GB 1M7HA 1OZAA 5A9SB 1XHFA 2BC9A 3H5LA 1G5FA 4JUIA 5E2IA 2ES4A 2DAPA 1VSTA 3ORYA 4EKEA 5F3DA 3GLKA 3DKIA 3K4HA 3LWNA 3R8CA 2OLJA 1KYZA 4DFDA 4MRMA 4KHPB 1Y8ZA 2ZXEA 4MW9A 3VR0A 4CLEA 4BLUA 3ORHA 1N5OX 4EJSC 2UXDB 4NKRA 5TV2A 4LMAA 1UIRA 4B7UA 4YAEA 1CUGA 3BN3A 1LGYA 4YMSA 4JJ8A 4R98A 4QG3A 1QX4A 2Q27A 5BP7A 2D1SA 3BCUA 2VHEA 3VR2D 3I9V6 1Y42X 4RVOA 5M3BA 3TRHA 4UNRA 4DHWA 4FD3A 2C95A 4Q9LA 4AURA 4DANA 3L8GA 3L84A 4PGFA 4DCSA 1G8YA 3I2HA 3VVMA 3WLIA 5KBYA 3NALA 2GUGA 2PU7A 5AKLA 1NF2A 2A9RA 3ZYCA 3A3PA 2CLIB 5K3SA 3NH9A 2O7SA 5JFOA 1L7OA 2Z8ZA 3QU5A 4DSZA 3IKTA 2VP6A 3O4FA 3KE9A 4HNHA 5DMXA 4LV5B 3N58A 2JFHA 4PYJA 3CVVA 3C7CB 5EWLA 5IAEA 2E4UA 3BB4A 2QN1A 3V2HA 3PG5A 4WADA 1WUTA 4D6YA 4EG0A 1O9BA 4POOA 2GXAA 2MSLA 2QLJA 2QM3A 4ZHQF 2J9XB 2PZGA 3S1LA 3WP0A 4QU5A 3PA8A 4PYNA 1YTLA 4MIEA 4R54A 1LPNA 4I81A 4B3XA 4KFRA 2VUUA 2GERA 4HR7A 3TEFA 3TZBA 5F1PA 4ZVKA 2CV1A 1VG9B 2X15A 1VMAA 4EF4A 2H06A 3VAZA 4O29A 1V5GA 1MUUA 4YMUA 1D1TA 1ZY2A 3OM8A 1E1QD 3M33A 3TLZA 1GEEA 4FZRA 4QVIA 3WL7A 1JZTA 1OHHA 1V7ZA 3R1IA 2GPTA 3KR2A 2IX3A 4ND8B 5A3SA 9LDTA 3PVZA 2XQVA 4P6VF 2HF8A 2I7CA 3U17A 3PS9A 2HQBA 4MDFA 3WRXA 3SQNA 4BEBA 1HY3A 4TROA 2R7KA 3SMVA 1F7VA 3RC3A 2H5EA 3FMOB 1L5FA 3WY9A 5CEEA 3E3AA 4RMJA 2Q0QA 4AF8A 3GEMA 2QZ9A 3KCNA 1ZZGA 1WV1A 5JYDA 1TIKA 2BFWA 2O06A 3TW4A 3ERCA 2J0SA 1NVTA 1ZWLA 3P0FA 2YV4A 3GEBA 1NATA 1KZ1A 1UKZA 3IUMA 3KQQA 4RKRA 5DX8A 3V1MA 4AMZA 2Q4RA 4DZRA 1GWNA 3EB9A 2V55B 1N5LA 2Z9DA 4WHMA 2AN3A 3UFXA 3VHXB 5HKKA 3VVCA 2JFQA 3HV2A 1SPXA 3C48A 4JLMA 3AJRA 1NFQA 1JDZA 3AUXA 3F5FA 4M1OA 2I62A 2Z5VA 4BRSA 5ALHA 1ONPA 2H9IA 4IF4A 4OI0A 1FP4A 1QHIA 4GBJA 4ZPXA 3ZDZB 4BO6A 4HUJA 3H2KA 3CZCA 5AW6A 1ZEMA 3HVIA 2H54A 4V0MA 3TMKA 2OD2A 3U56A 3LA6A 3ZJUA 1IBKB 4ZYTA 4YN3A 3I5AA 2RMKA 4GR4A 4M54A 1M54A 2O3TA 4FDUA 3TQFA 1GG8A 2FZ5A 4TXHA 4L6CA 4P5EA 3SYKA 2ISSD 2LP4Y 4B47A 4MKXA 3F2IA 1HKUA 3L18A 2ZWIA 2WDPA 3THRA 3VYTB 2VJOA 4G24A 3TM5A 1Q0LA 2BR4A 3N2IA 1Z06A 5IUJC 4JOSA 2Q4OA 5KNBA 4BNZA 2ZJ5A 4M7WA 3MBKA 4FEYA 4W9RA 3ZDYB 3EEIA 4B45A 2QRJA 4O2BA 2WD9A 3WRYC 2M2IA 2XA1A 3GN2A 3BZWA 3MCTA 1CNFA 4DBZA 3LBHA 3M3HA 3AZQA 4NR0A 4B6EA 3F7NA 3QYFA 1U8TA 4KXMA 4L75A 4Q5IA 4UM5A 4BDSA 1INLA 3AYZB 3UUGA 4QE3A 5AHKA 4L6IA 4WCVA 1R5BA 1OZGA 1TPYA 2FPOA 3CH6A 1WU7A 2R3SA 2ZSAA 4QDUA 2WTXA 3CV3A 4DMRA 3VR5D 4B3DA 4BIMA 4I7EA 2PQ6A 4KWCA 2QRPA 4CF4A 1OZ0A 2ZQYA 1RIFA 4GF5A 5CVCA 5JNRA 4AG6A 2QNRA 2YJNA 2I4TA 4YJFB 5EFOA 2YOHA 1EFDN 5K3CA 5F7JA 3BWEA 2BBSA 3GLRA 3STVA 3K9HA 5EJIA 2WMNB 5KSZA 2XE8A 2C4TA 3NP9A 3G0DA 1NVBA 4F3CA 2FA9A 3N7UA 4KKVA 3HI4A 4MWEA 3PXGA 3DDNA 3TAXA 2IYQA 4X61A 2NPIA 2P7IA 3I83A 2I66A 4FUQA 1UMKA 5AXBA 3FSJX 2I2DA 5DNVA 4EF6A 5IXSA 2UV8A 2JFUA 2UZIR 1UPBA 1VI6A 3HWX1 3PQ2A 3DV9A 4D45A 2X5NA 3GUZA 4O3MA 2JLBA 1DELA 2QGFA 1CR4A 2FK7A 5DIZA 3X3HA 4HG2A 2XXAB 1PGQA 1PR2A 4PZYA 4IQ0A 3ESZA 2EJBA 4XYMA 4PHTA 4UE6A 1SXIA 3TR0A 4Z4CA 3JYPA 1XNHA 3KSRA 2I6TA 2Q5CA 1Y5IA 4YLEA 4GWKA 1E3WA 1EVLA 2F4VB 3CEPB 4V0SA 2QENA 3LI2A 5T57A 1KI2A 4NONA 2NNLD 4IIXA 2PMKA 1MU0A 3IUBA 5EXEA 1TECE 3FWNA 1BROA 3I92A 3MWDA 2YY6A 5AICA 2AN1A 3NT2A 4KBGA 2BP7A 4WVLA 1C2TA 1ZOOA 1DC8A 4S3MA 5M04A 4DRXB 1XZKA 3AB8A 4NNJA 5BORA 2NVWA 5E6UA 1KY4A 1H2ZA 1UMCA 3EEFA 1XVUA 5C31A 3GJRA 1AIPA 4DBVO 3ZZTA 4YDQA 2I2AA 2FSIA 2F9FA 1I7LA 1TEXA 2UYYA 2VT6A 2WJYA 3R3XA 4OX9B 1S2OA 3EGWA 1E2JA 3HR4A 5DISB 5EIOA 3UH0A 2M98A 4RK0A 4XA8A 3CJRA 3WL8A 3DDWA 3ZHYA 6CHYA 5ENVA 4N3NA 4HK4A 1GPMA 1G2PA 2VC2B 2X3FA 4FZVA 4J4BA 5FKJA 3ZUPA 1LK0A 2XOEA 5AHRA 3AM1A 2GTPA 2DR2A 2QW8A 3SHVA 5CPFA 1ZESA 4EK9A 4GPAA 1XTRA 2BJHA 2O57A 3TOZA 4LWOA 5JANA 5FOQA 5CH3A 5FAKA 4FW8A 2E18A 4E09A 5CFNA 3ZDCA 3EPKA 3GUUA 3AWIA 4FHZA 1PGNA 1I0LA 4KW7A 2H57A 3LOUA 2I7VA 3SDSA 3UT5B 2I65A 4OB6A 1REQB 3K30A 2FEMA 2DGDA 4UQLA 1Y9ZA 5BVGB 3ZVMA 1C3OA 1UP4A 2B8TA 5KYXA 1LNZA 3WG9A 1XFAA 2QI9F 3DBRA 4LBVA 2QK4A 4DCCA 1IIRA 4AWAA 5BSHA 3JQ8B 1IMJA 1H2RS 1T26A 4RPGA 4IVQA 2OV3A 1JFFA 2B20A 3CH4B 3LP6A 3TR6A 4CR8A 3PF8A 3R3HA 4KPYA 2IITA 3JAWA 1QONA 4G0WA 4Q7QA 4J49A 3A04A 3Q9LA 3VKVA 3SCZA 5FOWA 1K63A 1U5BA 3LPAA 5LQCA 2X6RA 3IHKA 3LY8A 1ZM4A 3NP7A 3RD5A 2PSHA 1AKEA 3I72A 4D3ZA 1HOXA 4KTVE 1T2VA 4OM7A 4BTEA 3R4CA 5SICE 1LQTA 1RHRA 4PNHA 1WUIS 4I5DA 3HRKA 2W6CX 3GGDA 4FFPA 1FDSA 1MIOB 1E3JA 4NAVA 3SQDA 2BSQA 3VOSA 1ZPDA 4J2HA 4D0LB 3IIIA 4JK3A 4NCHA 5F1OA 4PCAA 1DNPA 1Q0HA 3GAMA 5U1PA 1T6XA 1UP6A 3QKWA 3FYUB 1M6YA 3AO0B 2MT9A 4B4DA 4AD8A 3DAGA 4LXHA 1BMDA 1IU9A 3ISVA 1W8IA 2Z2XA 4FFVA 3GVHA 4ITRC 2CFTA 1O95C 2ENUA 1Y33E 2QUHA 2AEEA 1T0PA 3LUCA 3RJ5A 4DSOA 1UEXC 2GNPA 5AT1A 3C8UA 4HDAA 3HACA 1YR6A 5AJWA 5HKKD 4R2XA 1A4RA 3PFWO 4X64B 4CM3A 2O5VA 4ND8A 2OO3A 3TLKA 1W94A 1YB2A 2VNIA 2YJ5A 4HEHA 5IDQA 3T5PA 2CLSA 3NDJA 4K8RB 4P4SA 1WO8A 1JMKC 3LSYA 4YCSA 4XE5A 1PKEA 6YASA 3QW2A 5C9ZA 2VQFB 5JCOC 5K45A 4GECA 4ITUA 3KHTA 4LQLA 3B2EA 4CMIB 4UBNA 1T6YA 2EP8A 1OC2A 3OZIA 1IAVA 1NSYA 4RHEA 2PZFA 1K97A 1B15A 3KHUA 4MV7A 1M2VA 4BUJA 1NF8A 4ZI7F 1DBRA 1DC3A 1Z0DA 3MUFA 3RIGA 4IIJA 4JMPA 4KLAA 3K70B 3F3YA 4YP5A 1I1OA 3RT9A 1JR3E 2JH8A 3OOHA 2P79A 3QYJA 2INGX 2P8JA 1NXOA 4BAGA 4BB9A 4LGVA 1HYHA 1LY1A 3F49S 3QE4A 2WD8A 3HXPA 4JR0A 3BQ9A 1UKAA 2QN7A 3BJMA 3O8NA 4R9NA 3A1NA 3ZI4A 4BTVA 4RIHA 4EI9A 4C0KA 1UIMA 1K08A 3I1FA 3SBEA 4LRTB 4A23A 1WMAA 2RGYA 3O4VA 5C4IA 3NG1A 4WASA 3E7FA 5DCLA 3AFGA 1IOWA 3O8DA 4IKEA 1YA4A 4BX2A 3LDGA 3D0KA 2ISQA 3UGQA 2CHFA 4D81A 1QR2A 1CEYA 3KKZA 5DT2A 1II9A 3RTBA 4N0MA 3PXEA 3HO1A 1Z2AA 1L4NA 4KO3S 1JSZA 1Z17A 5HP4A 1UOOA 3GDGA 4FGSA 2XNCA 4PR3A 2QE7D 2LKCA 3LP8A 5AM0A 3W1WA 1C3LA 2YBDA 1RJ9B 3AP3A 3H5TA 5CDFE 1KPHA 4JNCA 3L46A 3RHZA 5U4QA 2OECA 4K0RA 1RHJA 1N57A 3ZXIA 1O58A 1SUEA 1XZIA 4IINA 4DLUA 3RB8A 4DUYB 5LBTA 1WPXA 3IEIA 5JRZA 1WKCA 3LG2A 1CQWA 2O2IA 4C08A 3PGMA 5C1PA 1Y9EA 4B8YA 3QIVA 4QPZA 3W05A 1RYNA 4MMXB 2XHZA 1U2QA 2YH2A 3DWGA 1PNVA 3D3WB 4HQKA 1MCZA 4FHDA 2F64A 1KYQA 2EBWA 4U6QA 5FA5A 3WYAA 1D0VA 1XAJA 3KAPA 5DW3A 2NU7B 3JV7A 1KYVA 1NYRA 3JYHA 3U0BA 1O5IA 2HMYB 3D4OA 3G8DA 2QNBA 4P36A 1DXOA 2G28A 1XMPA 1RZUA 2QDKA 4NTZA 3H0KA 3TIFA 3HB1A 4R69A 3U61B 3I53A 3EARA 2BFPA 1WABA 1NRWA 3EJWA 3G7NA 1YT5A 5AVTA 2XBLA 3CVWA 1J8QA 1JBQA 1ZLXA 1WUKS 1ZCBA 2JCXA 2WHQA 1XTKA 1Z0FA 3G7UA 4HMOA 2L19A 1N2XA 3LQ1A 5LL6P 5HIIA 2RGEA 4IJVA 2DE0X 2H0RA 1CD5A 3HJCA 2VT3A 1HX7A 4OBEA 1PZGA 5JC1A 1NLZA 2WT9A 3ZW9A 3ACDA 3D54D 4RL6A 2WSBA 3M4NA 3F4LA 1Z18A 4JB8A 3MIZA 4RBNA 2H4ZA 1HFWA 3OA2A 2EZ4A 4NWIA 2FMUA 2ZGVA 4UDNA 2C7OA 4IS3A 3GLVA 2Q7OE 3T0FA 1QMGA 3V7UA 2FGKA 2QW1A 1NY5A 2MU1A 2ZJOA 4GMDA 2ZR7A 3FTDA 3KSUA 4HX5A 2VZ9A 1GTZA 5D7NA 4DNFA 1JE1A 1PR3A 2JA2A 3MK31 1DVRA 4I6JA 4R7TA 1TVKA 3DE7X 4KIWA 2F1JA 4NYMQ 3ZHBA 4EEXA 3BA6A 1PZEA 4LZAA 2AX4A 3GLFB 3IMEA 3CE9A 4FMCB 4MUJA 4XDYA 1P0FA 4J94A 4ZCPA 4HXYA 5K0FA 1WUHS 1TF7A 2EZ9A 4X1YA 3CXUA 1CQJB 3H11A 5FUVA 2FW0A 3FPKA 5TQVA 3N2YA 5EXSA 1A8HA 3L4KA 3U6BA 4L0DA 1J2RA 4A8JC 5EPUA 5FI1B 2IUTA 3FFAA 5EINA 5EMKA 3WOVA 4J91A 2WIBA 2P4QA 4IDFA 2BGUA 4QDJA 3OWHA 3O1IC 4TXMA 3OOWA 4L73A 1VJCA 3DHNA 3KWFA 1VLJA 2VDNB 4C0BA 2AOXA 2R47A 1CUZA 4DILA 4RD4A 1DIAA 4FVTA 1U3TA 4K9PA 2CE7A 4KQEA 3PGA1 4RDHA 5A2GA 4EI2A 1E1KA 4MZXA 3BFJA 2DPHA 3TE6A 3QMWA 5LOVA 5JO0A 3E2MA 5EHNA 1Q0QA 1H1TA 1LK7A 2X2EA 1IY1A 2GCIA 2NPFA 4OQFA 1TI7A 2ZT8A 5E2BA 1LS6A 4DGSA 4YMVA 4R83A 3MTEA 2YJGA 1QX3A 4IH4A 2ROQA 5KWIA 3AI7A 4BAUA 4B2PA 1ZL0A 3G5UA 4LMPA 2OVFA 4DV1B 4N18A 3WHKA 1UC8A 5COQA 4Y9SA 1XEXA 1OLUA 3AR8A 2W43A 3M8KA 3UXEA 3V4OA 3DGEC 4H15A 3BBPA 4KR3A 4MV5A 2OL4A 5TPZA 1NI4A 1VECA 1H4VB 1T9CA 3P9XA 5LUAA 3RS8A 4NQRA 1T15A 4W1QA 1BHSA 3HH8A 3V7WA 1NT2A 2XE6A 2C3OA 2Z04A 4YS6A 2GDJA 1ATZA 3P0JA 1JHZA 3E61A 4H4DA 3T3HA 4JUAA 1ZNQO 3WYEA 3ER9A 1MO3A 1DCTA 3LRXA 5JVDF 5KJ6A 3EWIA 3INYA 2J9ZB 1FS6A 2MSNA 5LCXA 1WXIA 4KYTA 3BCRA 2B1QA 3QM1A 1TRHA 1G60A 1UZLA 4V0NA 3RC7A 2BFNA 2QL9A 4YRLA 3HJFA 5L3QA 1AY0A 4JKOA 3A9WA 3X2FA 4R9VA 1YL7A 4DPLA 4GZ6A 3VH1A 3VQTA 3S55A 1I6WA 2NSHA 4XLLA 4Y6QA 1GPWB 1E0DA 2FHPA 1BMFD 1JDVA 2BGMA 2C5GA 1PJCA 4YI3A 3N8IA 1BA3A 1G8SA 2ABWA 3E15A 3O31A 3USZA 1HYEA 3PJRA 3LIIA 3V8QA 3UYLA 5L4NA 1MH1A 2X9QA 1DRUA 1QC5B 1GNVA 4OIMA 3L93A 2V9CA 5EXPA 1NDUA 5FWYB 3SY8A 4CKEA 3KJZA 3DT6A 3BL8A 1COZA 5A9TA 3HV0A 1PS8A 2PGIA 3BK7A 3ZGNA 1T43A 1EIWA 5IH7A 2R87A 4GOXA 3UJBA 3RYFA 3M82A 4XGKA 4F21A 3MRSA 2MMGA 3AF2A 1XXHA 3QW4B 3DR3A 3PL5A 4MYUA 4ZEOA 5BYAA 1AVTA 1J06A 1TUBB 1YE8A 4PX5A 1PZNA 3JQ7B 1ZH6A 3ZQ4A 2WF7A 4Z49A 2AN9A 1ZNXA 4CIAA 5JMOA 1NX6A 3GGOA 3W0LB 3VKGA 4HEJA 3MLEA 2H9YA 1WX1A 3R5SA 3V46A 2XVMA 1IZZA 1GSHA 1FX0A 5EPEA 1UBJS 1LCIA 2Y9MB 4XCVA 5J5VA 1TAHA 4GC5A 5LLSA 4FGZA 4PAOA 1GVHA 4QECA 2X1HA 2JLXA 1CJMA 4D9EA 3KRTA 1FJ2A 4FU0A 2IE0A 2ZB3A 2W2PA 3HXKA 3QOFA 4O8CA 2OEPA 1BW9B 1RE1A 3MGKA 3PR1A 1XEFA 3QWBA 3G23A 5DGCA 4CBVA 1EESA 1NBMA 4AULA 2PJUA 1FPMA 4N6GA 3ACBA 4FMDF 2XSZA 2Y66A 1CDZA 3R3JA 3ENVA 3PPWA 1JHQA 4YASA 4CYMA 2ZCUA 1ZOSA 3VX4A 2XYGA 3GG9A 4LOAA 5IBCA 1L9KA 3OIDA 1J8YF 1YQQA 2OP0A 3NXKA 4RKQA 5KYUA 3MLAA 5B3LA 4FT4A 1FP2A 3EH2A 4DXHA 3CY6A 4OBBA 3K9QO 4FMBB 3U3MA 1EP3B 1QLJA 4DR1B 4PLYA 1THZA 1UM8A 2B82A 3HB0A 4W7HA 4BE4A 3BD8A 3WRVA 1B7GO 3WJ7A 4PNPA 4RVSA 2WSIA 4FNAA 3ROXA 1CUJA 2Y67A 4C4OA 1M1XB 1RAEA 4DCPA 3ZLBA 2WKSA 1IJFA 3FD8A 1PHPA 4AMGA 5BWBA 3INRA 5CCEA 3OTOB 3F6YA 3H1BA 4YRPA 1T5SA 2HMSA 3CNHA 2CNBA 2E3JA 2P75A 3LBFA 3MMPA 3SE7A 2CDCA 1GL7A 3KZOA 4XVRA 5ALDA 1B8PA 3TQSA 2IOFA 2O23A 4OHXA 2C77A 1XRPA 4QGBA 1N0UA 1VIMA 3AQ4A 2X4GA 3BH6A 3FZEA 3ZNOA 1XVLA 3I2YX 1HDEA 2IVZA 1CVIA 3FCUB 1V96A 1O96A 2VF2A 3CLVA 4TMZA 1E2HA 2XJ4A 3TXAA 3TSYA 3COJA 3PCRB 1FRZA 1C29B 2CCKA 3FJ1A 3QVGB 4O6VA 2WM3A 2Q2OA 3QWHA 3U3DA 4MR9B 4BUCA 4EUSA 5IF9A 2A0KA 4N0PA 3VJMA 2VDRB 3JQ8A 1YULA 4JC5A 5EUBA 1ZP6A 2FETA 3UMJA 2KBFA 3IP8A 1SBYA 1C8KA 4YRDA 5DBIA 1PFQA 3GNSA 1JFVA 1IN5A 4MEBA 4J16A 1J99A 3LYUA 1TKAA 4OAOA 2I34A 5CA0B 3IO3A 5COBA 3VI3B 3HBAA 5BN3A 4DVJA 5KYNA 1AGPA 1XTZA 3BXFA 3UN1A 4JA2A 2Y0CA 5ALIA 1GPBA 4GEKA 3ZDQA 1D2CA 1P31A 1QIJA 3LU1A 1MFZA 1KTIA 3TUJC 5LYYA 2XECA 2BMAA 2H11A 4IXNA 4NOJA 5HBRA 3RIXA 4AF6A 1W9HA 4O2AB 4C6TB 1AZSC 3UAOA 4LDRA 4H7KA 4MZDA 1ZGGA 1TQ4A 2C7GA 3E22B 5I4IA 3A4MA 4I55A 5CEFA 4R16A 1IY8A 1N6IA 4OGFA 3IP1A 3PHHA 5HILA 2BFAA 4B17A 2OBNA 2P2CA 4LECA 4LXTA 3UPDA 1AKTA 4C01A 5JR3A 2EGUA 3ZU3A 4QULA 5BMVA 2KLHA 1D04A 1KJIA 1PT9A 4FYHA 4G65A 2H31A 4ALKA 4MOWA 5D51S 3IA2A 3NETA 3ILYA 3VR5H 4Q9NA 3ZEAA 1HSOA 2C4MA 2KYRA 3ETNA 5HXAA 1YR2A 5KQMA 2I55A 2QRHA 1S96A 1RWPA 3BIWA 4M76B 2WU3A 2QJWA 4RPCA 4YAWA 4QBKA 4YECA 2NV2B 3UAZA 4G9EA 2PUWA 2ZI3A 3N2EA 1B42A 2QN9A 4M8LA 4MH0R 4N6NA 3DVLA 1VMEA 5D00A 1P5HA 3A1TA 3R7SA 4ZK2A 3QEJA 3FBGA 4ZVSA 1RM3A 4UNIA 3OLVA 2ZJ7A 2ZREA 4OJNA 4C5CA 3OPYA 2W48A 3VUEA 2DTXA 3WLNA 3G5TA 3EYAA 2A1TS 4IZHA 4A2WA 3ER8A 1UBCA 1YC5A 2HSDA 2LW7A 7GPBA 1IONA 2GFQA 3VR4D 1FDVA 2I78A 2XJ9A 3GCWA 2JCGA 1JHVA 5L53A 3NBZC 4JUCA 5FHRA 1EXDA 3TIXB 4E70A 1IB6A 3QWFA 4EYSA 1WXEA 3U1TA 3L6RA 1J5PA 2QXYA 5DBGA 4DPKA 1G2IA 4RETA 4OXXA 4URHA 3QG1A 3PQEA 4HFNA 4UHDA 2DLDA 3EH1A 3E84A 4WZZA 4O1MA 5AUOB 2JLWA 1KO8A 3LH5A 1I14A 1JFTA 3IOBA 3QMPA 3W9YA 5L4SA 4FZ3A 2X5XA 1O8CA 3EVGA 3PRHA 3TZ6A 1WOMA 3L1JA 3FDIA 1W2HA 4KRGA 5T8KC 5YASA 4IV0A 1SOUA 1PDWA 2NX2A 2WFZA 2IXBA 3GLUA 3OE7A 1WP4A 4FMDB 3RJTA 1V11A 3D0OA 3ZWAA 4KGVA 3VNVA 3FKSA 2JFVA 1Y6ZA 3EZFA 3X1WA 3QEMA 4QXPA 1RXEA 3LHIA 3EQZA 3SI7A 1RADA 4KBYA 3JSAA 5I8ZA 3GZTB 1EZZA 4DSNA 4LK2A 1M67A 2Y1XA 2FWJA 2HA3A 2GLTA 3G82C 3ESDA 3LM8A 3I76A 4QBIA 5A62A 3AVOA 3CO0S 5GQSA 5BR8B 3RNLA 1EE9A 3CWQA 1KQGA 1QDLB 3RU9A 3BJZA 4I6EA 3DAYA 2X8JB 2G1UA 1R8QA 1G8KA 3GDHA 2F17A 1I33A 2Z1DA 3CZ9A 2BR3A 1D1PA 2P9EA 5KTMA 1KTVA 4JBHA 3C6XA 4KQHA 4PONA 5HGJA 2VP4A 3IMGA 1WW3A 2VXOA 3EZYA 3F6SA 2QV0A 3NC0C 3T7SA 3NTUA 4DQXA 2JAHA 1R64A 4UUOA 4ZVMA 3FPFA 1A1VA 2PFSA 3AIKA 3DZHA 2XAUA 3ZWOA 1EDEA 2QG6A 2ZSKA 1I3KA 4IHJF 5EIHA 1V48A 4JLDA 4RNCA 1BE1A 1P5ZB 1WF6A 2VDJA 2VRNA 1QPZA 5CDGA 1C3XA 3CX4A 5IH3A 2G8NA 2QE7A 2C5HA 2B25A 4HRVA 2IBSA 3RU7A 3RC1A 2YJZA 2AXQA 1NN1A 5EY5B 4G1FA 4RDIA 2AKEA 1FRFS 1WDTA 2EFCB 1EG7A 1JEAA 3N9IA 4M2LA 4A2CA 4NJOA 1U11A 4U2FA 4HNSA 3RTAA 4DPMA 3F1KA 4MQ5A 4LV6A 1Q16A 2XYRA 4G4GA 3GQBA 4GGMX 2NTNA 4LKOA 3AUYA 3LGSA 4NHOA 4RENA 5K0JA 4W9MC 1OLSB 2ZATA 1X8KA 1GGFA 3OD5A 1LFDB 1T5HX 4IS2A 3NRCA 3GAAA 1GQSA 2XNSA 2B1RA 4RGQA 5AI9A 1N2GA 2ZJAA 2FZEA 2OB1A 3D6NB 2O8NA 3IJ5A 3QBTA 4PINA 2VAVA 3DL0A 1QZTA 1E1CA 2W37A 3IESA 3CCCA 2ZM6B 4COOA 2CVFA 4QUKA 1X1SA 4RXTA 3R5FA 2G08A 3PNPA 3VV2A 1JSCA 2QOEA 4YPFA 1P8AA 1DAFA 5E9WA 4CLHA 3MB8A 2NZJA 2Z8YM 4DUGA 2DSNA 5DM60 3MPUA 1WBBA 3BDIA 2GJ4A 1AO0A 3SXUB 3WAKA 1N77A 4MPDA 1W52X 1UBTS 3QJ5A 4X3PA 3W5JA 2GZ3A 3EFBA 2LCIA 2X0IA 4JS0A 4OHCA 1NMZA 2DBVO 2YDXA 4NE7A 4UREA 4EYKA 1MT0A 4DB2A 1NBHA 2YJTD 3BAFA 5DHFA 1N3IA 1U3DA 3MT9A 3U4HA 3VTZA 4CUJA 4TV9B 2QTVB