2QMQA

Crystal structure of a n-myc downstream regulated 2 protein (ndrg2, syld, ndr2, ai182517, au040374) from mus musculus at 1.70 a resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
278
structure length
278
Chain Sequence
HHHHTHSVETPYGSVTFTVYGTPKPKRPAIFTYHDVGLNYKSCFQPLFRFGDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCILQYLNFSTIIGVGVGAGAYILSRYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPDMILGHLFSQEELSGNSELIQKYRGIIQHAPNLENIELYWNSYNNRRDLNFERGGETTLKCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human N-Myc downstream-regulated gene 2 protein provides insight into its role as a tumor suppressor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Protein NDRG2
total genus 90
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2007-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qmqA00
1UK8A 3DJYA 5AM4A 1ISPA 2XUFA 4UPDA 5FDFA 3PI6A 5J3JA 1SOMA 4U2FA 1GPNA 3O9MA 2X8BA 4AB1A 5ALYA 1BCRA 1XZHA 2WIKA 1ACJA 2OG1A 1HKHA 3C70A 3FLEA 2DQZA 3I6YA 3R3UA 3TJMA 3E4DA 4Z49A 3SWWA 1R4ZA 4G8BA 2GZSA 3O95A 5DTJA 1CEXA 4X00A 5CW2A 1EINA 3Q8WA 5AM1A 1DTEA 4AXBA 4QZVA 1R88A 4GXNA 3ICWA 1XRLA 1UXOA 1F8UA 1M33A 1KU6A 3G0CA 5IVDA 1I6WA 1TAHA 2BAGA 2VJCA 4UHBA 3FOBA 1JU3A 1SCIA 3K6KA 3D3NA 4Y2JA 1QIIA 4FBLA 3WK5A 3GZJA 3FSGA 4J0DA 5KREA 2JBWA 3M3DA 1QIEA 3IUMA 1UOOA 2OGZA 5AKYA 1XZDA 3V48A 1BEZA 1XRPA 3O4IA 5CT9A 3EQ9A 1EXWA 4G4GA 1XLUA 4RGYA 4INZA 1T2NA 2GYWA 4DIUA 1LPAB 3WL6A 5ALZA 5AKXA 4FBMA 4E14A 2XUHA 3AZQA 3LLCA 2DR0A 2XUIA 2WUEA 5FRDA 3PUHA 4QNNA 3QVMA 1CUCA 6YASA 5EHNA 3WK7A 3IUQA 2WHPA 2Q0XA 4AZ3A 4ETWA 4IH1A 4Q82A 3WKEA 2OAGA 4E11A 4LIPD 4N5HX 5E4JA 4K2AA 5CH5A 3ZLVA 4UFPA 5K3AA 3WYDA 2HU5A 1LPPA 4WFIA 4QWWA 1ODSA 1ZOIA 1YA8A 4N5IX 5HK9A 4ZV7A 1BEEA 3WK4A 2X76A 4Y2TA 3X3HA 4GEGA 1NX9A 2GBGA 3F98A 3L1JA 3AFIA 5AK3A 4LXIA 5AH0A 2XUPA 2WFLB 4B82A 4C4ZA 5FUMA 4QWMA 5KWJA 2DHEA 2R8BA 1DINA 4H35A 1UKCA 3H19A 2GYVA 4OD0A 2OCGA 3ESDA 2QUBA 3C87A 4K6HA 2AJDA 3ZLUA 2ZJ6A 3C6XA 5AKKA 5HF6A 3RLIA 1TQHA 1ZI6A 3G8YA 4AO7A 4BAUA 1VXOA 5AOAA 1E89A 5K3BA 1GPKA 5ALHA 2HA2A 1JU4A 3AZPA 2HFKA 4C01A 5E4YA 1JT2A 1YB6A 3BDVA 4DNOA 4CIBA 4PO3X 1ZICA 2ORYA 3M81A 1XZIA 2JEZA 2RAUA 4PV7A 1CUWA 2GBFA 5ALSA 4Y2QA 1E66A 1TCAA 4Y2YA 4BCBA 3A6ZA 4H7KA 5FV4A 4DYHA 4ZWNA 5I9IA 1K63A 2G4LA 5JATA 2Z8ZA 4B9EA 3GFFA 1H2WA 1Q83A 1XZMA 4MWSA 1F6WA 1SFRA 1XFDA 1GQSA 2I03A 1FFDA 2CUTA 1TCBA 2NW6A 3Q0TA 5HKBA 3G9ZA 3ZWQA 1QO7A 1HBJA 1W75A 1Z68A 4H7HA 3HABA 1XZLA 1MX1A 3QMMA 3BF8A 4RPCA 1VZ3A 3NOXA 5ALDA 5T4FA 5ESRA 4NVRA 1BROA 1ZD2P 1WB6A 1SC9A 4L9AA 4KE7A 3W05A 2YXPX 3PFBA 1TCCA 4EY8A 1MT3A 4BDSA 2WKWA 2XQFA 3WL5A 1CUXA 1G42A 4IO0A 5CH3A 3WIBA 4I3FA 3DKRA 4LXHA 1ZIXA 4DNPA 3SK0A 5HF5A 1WHSA 4MQLA 5HK8A 5EFZA 4EUSA 1PV1A 4ZI5A 5AIAA 3C6ZA 5D6OA 4CG1A 1W52X 3L1IA 1CLEA 2XMBA 3H2GA 3DQZA 2XQJA 1ZD4A 3E0XA 4UHCA 4BDTA 1ZGBA 4YASA 1LPBB 5D3ZA 4BAZA 1HPLA 1W6RA 2QR5A 5E4TA 1XZGA 4U2GA 4X92A 2ZYHA 1U8EA 3F96A 3VVMA 4X6XA 5JIBA 2CEKA 4AQDA 2WFMA 1CUSA 4FWBA 4W1SA 2OGSA 1A8SA 5I8PA 1F0PA 3RM3A 1L7RA 5FLKA 2DSNA 3FCYA 1ZD5A 2QVBA 4KAAA 3WA6A 3PE6A 1CUBA 1Q0ZA 3LIPA 5C8XA 4X95A 4JEIA 1CR6A 4DNQA 2XLCA 3C45A 3LIIA 4A5SA 5JAUA 1GQRA 5K5EA 1N5MA 1IUPA 4W1PA 2ONCA 2ACKA 2YASA 4GBGA 1R3DA 1YS2X 4C88A 1ZD3A 1L7AA 3JWEA 4AO8A 3IIIA 5BV7A 4UUQA 1XRNA 2ZSHA 4PSDA 2O7RA 1WHTA 3C6BA 1IUOA 2GZRA 4FOLA 5IVHA 1CV2A 4BVJA 2H9YA 3CCCA 2XMSA 4M0FA 3WL7A 4MQMA 3H2HA 1YCDA 1A8QA 1TRHA 1QONA 1A7UA 1FFAA 5K3FB 1GXSA 1DQYA 2CKMA 5ALMA 3I6ZA 4IH4A 2JGFA 2XUKA 2VATA 1QIMA 2XE4A 3ESCA 2YH2A 5T4BA 4BP8A 5FKJA 4ITVA 1QIJA 4AO6A 1MAHA 4F0JA 4RE5A 4NS4A 4KYVA 4X6YA 1QFSA 2HU8A 4P08A 1FFCA 1MTZA 1F0NA 2FJ0A 2BGRA 3O0DA 4ZREA 5C8ZA 3I28A 3VVLA 5DTIA 5A62A 3N2ZB 4CCYA 2I3DA 5HF8A 3I1YA 2Y1KA 3R3WA 3FVRA 3W9UA 2W6CX 5JD4A 4C89A 2ZJFA 5DYYA 3BIWA 1ACLA 2QXTA 1UKAA 3GROA 4XJVA 2RI6A 3SC2A 3HEAA 5EIAA 1XRMA 1VA5A 2JGJA 2Y6UA 3WWOA 5ALFA 2HIHA 2DHCA 4HAIA 5DJ5A 4BYMA 3HXKA 3ZPXA 3JYHA 4EY4A 3VDXA 1R9NA 1DX6A 1D07A 4D9JA 2V9ZA 2HHAA 4J0HA 2OPHA 4QDUA 3GBSA 4N8SA 1VZ2A 1RWQA 5CURA 2PSFA 3L1HA 3WQHA 3H0CA 5AP9A 4JH0A 4X90A 3UUEA 3U1TA 4U2DA 5LZ8A 2JGMA 2RHTA 1EH5A 4A16A 1EDDA 1O6FA 4DM7A 4WJLA 5AM3A 4FHZA 4AX4A 5DNUA 1XQVA 2OCKA 5CBKA 3EIOA 2Z3ZA 3VKFA 4EHBA 5LZ5A 1GKLA 2E3JA 5AOCA 1ZI9A 2YYSA 4KE6A 4F21A 1QLWA 5LYYA 3D5EA 1XROA 2H7XA 3QMWA 1P0IA 4Y9SA 4OCZA 5AI6A 2RHWA 4G8CA 5EHQA 4HRYA 4DTCA 2B4KA 1EHYA 5ISMA 1YR2A 3RKSA 4BRSA 5HQ3A 3W2TA 3W06A 4UBNA 5DLPA 5FP0A 3WKAA 2XB6A 4O08A 3AILA 4RNCA 5A7GA 4F60A 4Y2UA 3C8HA 4X7BA 4L0CA 2D0DA 1BRTA 4N8DA 4WFKA 3ILSA 4K6KA 2XQKA 4WFJA 4G4JA 5K3FA 4E46A 2VF2A 4IH9A 2VJBA 1THTA 4Q1VA 3QMVA 4MYSA 2B61A 2C7BA 1USWA 4J0KA 5ALIA 2XUGA 2H7YA 2W22A 3OG9A 2PPLA 3MUOA 1E5TA 5HCUA 4FTWA 3DL4A 3BL8A 2VTVA 4OB6A 1H22A 3BWXA 1XKLA 1AQLA 5LZ7A 4G9GA 4PSCA 4NMWA 1CUZA 2VQ6A 5IVKA 1VLQA 5LLSA 4J0JA 3UUFA 4UFNA 2V98A 1OILA 4KE8A 3BIXA 4LYDA 3WKBA 4Y2XA 3VJKA 4CI9A 1MPXA 2J4CA 4E15A 1LZLA 5JADA 3V1NA 3PDCA 5CT5A 1VA4A 2XQIA 1UFOA 3TGLA 1XZFA 1E8DA 2J3DA 1VE6A 2FX5A 2O2HA 5AKIA 2WIDA 1B6GA 4PNZA 3FYUB 1XRRA 2XMGA 1AZWA 1X2EA 1EVQA 4B9AA 4QDXA 1U65A 3F67A 3FYUC 1AMNA 1WOMA 2HA6A 2XUJA 3H2IA 3R3YA 2WUGA 3KOOA 2IIVA 4H7EA 3DKKA 3M83A 5EIEA 5E2IA 3D4LA 2GBIA 4X6UA 4FMPA 2WU4A 1JI3A 4I19A 4HXGA 3BDIA 2VAXA 4KRYA 1TIBA 5JD5A 2XLBA 2JEYA 4B83A 3HYSA 4G4IA 1H2ZA 2WG2A 3QZUA 4IQ4A 1T4MA 3A2LA 2QUAA 3AZOA 2RONA 2AXEA 3DD5A 3IA2A 4XVCA 2OQIA 5ALNA 3F8SA 1UK7A 5A7HA 1YASA 2PSDA 2V96A 1B41A 2B20A 2CMFA 1XZAA 3N0TA 4V2IA 4W63A 4ARBA 1LPMA 2ZYSA 2JGIA 1JKMA 4U2BA 2WILA 2WHQA 4DSAA 3MGAA 1SCQA 3IDAA 4HZGA 3I2HA 2HADA 3WA7A 4B84A 1P0MA 3G02A 3PICA 3I2JA 1CUVA 3B3QA 4C4YA 4CCWA 1EB8A 3YASA 1UZAA 2QS9A 3ESBA 3EQ7A 4KE9A 2XUDA 4XIIA 2HA0A 3FBWA 2OQVA 3HACA 3NUZA 2QRUA 2QZPA 4CG2A 5T4HA 4C6HA 2Y6VA 1C7JA 4QDTA 5JAOA 4PF1A 1G66A 2BUAA 2H1IA 4W1QA 1EK1A 2QMQA 5HKAA 1FJ2A 3OTQA 4B81A 4P93A 2XQGA 4JYPA 4EY7A 1IZ8A 1TK3A 2G63A 3DEAA 3GELA 3PF8A 1IVYA 5YASA 1UKBA 1XZEA 4B0PA 3K9BA 3WZLA 3V1MA 4BAGA 1LPNA 2AJ8A 4DSZA 4B85A 3CN9A 5A6VA 3AJAA 1MO2A 4L3WA 4X71A 5DNWA 3DOHA 3R3VA 1MX5A 1CUAA 3TEJA 3QPDA 1ORWA 4FKBA 1LLFA 5DWDA 2PX6A 5HF9A 4AMYA 4EBBA 1EX9A 1QJ4A 1CUEA 5AKJA 2WUFA 4HRXA 4BE9A 1QZ3A 3LP5A 4J0CA 2RIPA 2O7VA 3PFCA 4RE6A 1JJBA 2VT7A 5I7UA 3DL7A 1XZBA 3AIMA 1L7QA 1N8SA 1WM1A 4Q34A 2BGNA 1UK9A 4H7DA 3PF9A 3C8DA 4GW3A 1GZ7A 4FLFA 4KR0A 4ZXFA 4B7ZA 1NU8A 4CCYB 3HRHA 2D5LA 5AI4A 4LYEA 2HA7A 1XRQA 3HSSA 5K3CA 4J0GA 4WY5A 3T52A 4FNMA 4HXEB 2H7CA 1QE3A 3ESAA 2OCLA 1S8OA 7YASA 1DQZA 4P92A 1EDEA 1CUJA 3WWDA 4BBZA 4QE3A 3KSRA 3QYJA 4BRZA 2WHPB 3ZV7A 2HA5A 4J03A 2I78A 4Q3KA 3A70A 4ZRDA 1K5PA 5ALWA 1A8UA 3DYIA 2XUOA 2QJWA 2HFJA 4PSUA 1K8QA 4U2CA 2WM2A 4M0EA 1VOTA 5ALOA 1YA4A 3KD2A 3VJMA 5EHZA 5LZ9A 2BUCA 4Q3OA 3G7NA 1QIDA 3G9TA 2PM8A 3TRDA 1TKRA 1QIKA 3S8YA 5JAPA 1AX9A 1EK2A 4BB0A 2DFPA 1HDEA 2XDWA 4BTVA 2C5GA 5AICA 2WHRA 3WYNA 4BTLA 2PSJA 3I2IA 2ZSIA 4PW0A 4DMHA 5A71A 5JZ9A 3NWOA 1ZIYA 1PFQA 1UOQA 3CXUA 4BC0A 4J0IA 4N8EA 2DCMA 1LZKA 2AJBA 1QO9A 4Y2RA 2V97A 1AKNA 3EF3A 1XZJA 2ROQA 4BATA 3BE8A 3AINA 3FYTA 3IULA 2ECFA 4UBLA 1E8MA 3RK4A 5FXMA 4GDMA 4X97A 3FSGD 5DNVA 4ZV9A 2RGUA 1LBTA 1LPOA 2JGKA 1VXRA 2QT9A 4QEKA 4QA9A 5BWBA 1J06A 4BZZA 3F97A 2G5PA 4C4XA 2PL5A 5JALA 2UZ0A 1J2EA 3SX4A 3O4HA 5DYTA 1CUFA 4YX9A 1FSSA 2BUBA 2XT0A 3O9VA 1N1MA 3D59A 4TVKA 1Y37A 3KXPA 1VE7A 2VT6A 1XZCA 4Q3LA 1YSCA 1UOPA 3IB3A 4QDZA 4UHEA 3EBLA 2C4HA 4WY8A 1EI9A 3STUA 3UMJA 3G0IA 5AKLA 2XMRA 4EY5A 1CVLA 2VJDA 4ZGBA 5AIBA 5DYWA 2WTMA 3AIKA 3WK9A 1ODTC 2K2QB 4TPKA 1IMJA 1CPYA 1R9MA 1XZKA 2HL6A 1U4NA 3I2KA 1N5RA 2I3ZA 4BE4A 1BU8A 1DWPA 4MEBA 1U2EA 2C5FA 3ED1A 3OURA 3FLBA 3STYA 1XQWA 4W1RA 1DT5A 1P0PA 1X2BA 4GLBA 4Y2VA 4UHFA 5JD6A 3DYVA 3QM1A 2DHDA 4J3JA 5A7FA 4H7FA 5CRIA 1G4HA 2CBGA 1CFJA 5A2GA 4ROTA 3WL8A 2PU7A 3V1KA 3R0VA 1A88A 1XLWA 5SYNA 1KU0A 2WIGA 3STTA 2WJ3A 2OLEA 3AUKA 3BF7A 5HZGA 3FVTA 1VJ5A 1QIGA 1C4XA 1QGED 3E3AA 1JMKC 4M0MA 4F5ZA 1HQDA 4MWTA 2XUAA 5LZ4A 3G0GA 1E8NA 3VXKA 1VKHA 5AKHA 1DX4A 5AKEA 2J4FA 3WMRA 4BVLA 4BCDA 5D3KA 3P2MA 5AM2A 1IUNA 1HLGA 1QIFA 4Q05A 5ALXA 3A2MA 5C81A 1R1DA 1ZI8A 4EA6A 3KWFA 4X94A 1JJIA 3QPCA 5ALTA 3HZOA 1EA5A 4DMCA 3DCNA 2HU7A 3C43A 5ALKA 4BZWA 3V9AA 4WCVA 4OU4A 1W1IA 2BKLA 1MX9A 5LP1A 4H77A 1BE0A 4I4CA 4BC1A 3H2KA 1LNSA 4GWLA 2G5TA 3WK8A 5FPQA 5CTAA 2OGTA 3MVEA 3WJ2A 3BJRA 5ALEA 4X3CA 2QOEA 2XMQA 2WIJA 4C87A 5AHXA 1ZJ4A 1MN6A 1YB7A 2JIDA 3QH4A 5T4EA 3STVA 4EZIA 4HXFB 5HQ3B 2VJAA 2JGLA 4MYDA 4Y7DA 5BOVA 3H04A 3G0DA 4Y2SA 4OU5A 2EDAA 1YAJA 2QM0A 3ICVA 5AK6A 3WWCA 1LBSA 2QTBA 2HRQA 5JASA 3EQ8A 1AC5A 3G9XA 5F4ZA 1FFEA 3H1AA 2WFLA 3DOIA 3IVMA 3DNMA 2HA4A 2ES4A 2XI4A 4JUIA 4FFWA 2PU5A 5FOQA 4KEAA 1WPXA 2PSHA 4L72A 1AGYA 5HFAA 1QFMA 4KAJA 5EHXA 1MNQA 1EB9A 2Z3WA 5C8VA 5JANA 4B0OA 4OSEA 5ALUA 3OOSA 3U0VA 1EVEA 1EDBA 3WKCA 3FAKA 5LKRA 3OPMA 4X93A 4H18A 3HJUA 4QLAA 3V1LA 4BP9A 3LCRA 3AIOA 1X70A 3VISA 3C5VA 4DGQA 5AI0A 1G5FA 4FNGA 1H2XA 1C7IA 5AI5A 4G1FA 4S0XA 1ETHA 4OB7A 1BN7A 3I2GA 4XX1A 2Z5GA 3CCBA 2CJPA 5EGNA 1JMYA 4OYLA 4AMZA 3WI7A 3ZLTA 2GBCA 1E3QA 4LHEA 5AKZA 2FJPA 3C6YA 5LZ2A 4LKOA 1THGA 3DS8A 2C58A 1PJAA 4G5XA 1WB4A 4QLOA 3ZI7A 4X85A 2HM7A 1MJ5A 5JARA 4DMKA 2X5XA 1J1IA 4UBJA 2WG1A 2PBLA 3D2CA 4PQEA 1KEZA 5CXUA 4GHWA 2PUJA 2ZJ7A 1ZJ5A 5ALRA 5FPPA 5AO9A 2PSEA 2PUHA 1J07A 5SYMA 5D7BA 1Y7IA 5AK5A 4JYMA 3FLAA 1UK6A 4TGLA 1XQYA 5C7YA 2WLSA 4K6GA 4AN0A 5IKXA 3K2IA 3HLKA 1WCYA 3JW8A 3HI4A 4U2EA 3FNBA 3QITA 5CMLA 1CUGA 5H3HA 1WB5A 4G8DA 4KJXA 1UWCA 4MEAA 3H18A 1CUHA 3DDUA 3GA7A 5KWIA 1CRLA 4KACA 2O2IA 4FDMA 3H17A 5ALQA 2VEOA 2BJHA 3STWA 4OPMA 4MXDA 4ARAA 5CH8A 2GYUA 2Z8XA 5BWCA 4DMFA 2QJRA 2J3QA 4B80A 4Y2PA 2AJCA 2WTNA 4XWGA 2LIPA 5ALPA 3LS2A 4G9EA 2XMDA 3MUNA 3D0KA 3D7RA 1DWQA 3FWHA 3F9CA 1CIJA 1MAAA 1ORVA 4H7JA 1W76A 1JJFA 4UFOA 3BJMA 3FYUA 1BN6A 4LXGA 2Y2VA 1Y7HA 1MU0A 1UT6A 2WJ4A 3GUUA 3BXPA 3WWEA 1CUDA 1SCKA 2B9VA 1LPSA 1MNAA 3G9UA 1Q0RA 2HA3A 2ZVDA 2BCEA 4H7IA 4UHDA 3NGMA 4BCCA 4UHHA 1GPLA 3WLAA 1YS1X 3ANTA 2XUQA 4HS9A 2XMZA 1GKKA 2WJ6A 2EDCA 3QPAA 5K3EA 4X91A 1RYYA 2R11A 3D2AA 4HTAA 1LGYA 4AN1A 2VSQA 4K5QA 4CG3A 3M82A 4YK7A 2ACEA 3IUNA 2CB9A 1K4YA 2ZYRA 1XQXA 1OXMA 1ODCA 5ALJA 2IITA 5K3DA 3ANSA 4NZZA 1NU6A 1XLVA 3CN7A 5ALLA 4B6GA 4EY6A 1BCSA 3RARA 2IX9A 2OCIA 5LKAA 5AKGA 1H2YA 2C0PA 2FUKA 1GT6A 1ZGCA 1DT3A 5EIHA 4CIAA 4AZ0A 2VAVA 4P9NA 4FLMA 2HDWA 5IH7A 4A23A 3I1IA 5CT8A 2PVSA 2BFNA 4YPVA 4KRXA 4WDQA 1AUOA 3OC0A 1K6EA 2WIFA 3O4GA 4IHAA 1QIHA 4J7AA 4UBIA 5IVIA 2WU3A 1O6GA 5JZSA 1RP1A 4UBKA 4OUKX 1W4LA 1R50A 1FFBA 5JAHA 4FLEA 1CUYA 3WIOA 5JZBA 4H0CA 1WPRA 4MJ3A 1CUUA 3HC7A 5LIPA 3R3XA 1YAHA 2DQYA 3WJ1A 2PKYX 3A2NA 2XMCA 5ALVA 1JFRA 1DWOA 3R41A 5HFNA 4OYYA 4WDRA 5AM5A 4HVTA 4W9RA 1Q84A 5CT4A 4KAFA 1P0QA 2P8SA 4GI1A 3IURA 3H2JA 1AURA 4UBOA 4CFSA 2ZYIA 2QKYA 3WK6A 2HRRA 5CXXA 3G0BA 4OB8A 3WWPA 4QDOA 3B5EA 2JGEA 3PUIA 3W9BA 2JF0A 1DU4A 3IUJA 2QXUA 4FFVA 1OCEA 1QTIA 3H1BA 4GECA 5AOBA 3B12A 1IZ7A 3KWJA 3R40A 1QOZA 2WG0A 1CQWA 1HL7A 2AJLI 3I2FA 1CUIA 5AJHA 5ALGA 3VJLA 2CZQA 3IBTA 3STXA 4EB0A 5EI5A 2WSLA 4DLNA 2OXEA 5AM0A 3C5WP 1H23A 3D2BA 4JNCA 1CQZA 1BS9A 3E1GA 1QTRA 3W04A 3R3ZA 3S2ZA 1XKTA 4UBMA 2Y2UA 3OM8A 3QBJA 5CT6A 2WQZA 2C0QA 3T4UA 5AK4A 3FCXA 2WUDA 3I6MA 3O4JA 2O2GA 2EEPA 5KBYA 5JYCA 4BVKA 5AI9A 2OAEA 1GGVA 3WKDA 4DNFA 2WFZA 3WZMA 5AI8A 3KDAA 2VA9A 3DLTA
chains in the Genus database with same CATH superfamily
3DHYA 1RYHA 1S7GA 1P72A 5DP2A 3UBMA 3X2EA 1B8OA 2CVPA 2C57A 4TZTA 3DR5A 4PGMA 4QBHA 3W1EA 3AU9A 5HBRA 4OO3A 2E4ZA 4IIGA 5AM4A 5IUNC 2XUFA 4QPJC 3ZCVA 3GEDA 3UKDA 1BYIA 3EXAA 3DKVA 5J3JA 3WIUA 1VPWA 1TNDA 1IB0A 2ZAGA 4U2FA 3RREA 4BMZA 4U7PB 5TQ0A 2Z2IA 5JAMA 5L9AA 3I92A 2IDKA 1CXZA 4Y0NA 4XPZA 2AW5A 3WLRA 4EI7A 4MUKA 5ULLA 1T3GA 5K8VA 2VZLA 2ZROA 3QKRB 2WIKA 4IDEA 4WLUA 2FFRA 4Y9RA 2GH1A 1OF1A 2H4ZA 2AC7A 2J9ZB 4BPRA 5AJTA 1W4AA 5HJ2A 4Q93A 4CM7A 1IULA 4G1CA 3KQLA 1Z4QA 3ONWA 4NMLA 4OL0A 2OG1A 3H3FA 2BGJA 3FLEA 4YI3A 1NI5A 1R0XA 1YL6A 3EVDA 1ZM2A 2QX9A 3TJMA 1Q57A 3U3OA 1GILA 1V1RB 3TSCA 1D0SA 1R66A 3ADDA 2O07A 4U7FA 2GHQA 1B1AA 1R4ZA 2Z83A 4CR8A 2GZSA 3O95A 2HX1A 3TTSA 3WDLA 2G40A 5M29A 5IC4A 5CW2A 3ZUGA 4XIYA 1SVLA 1EINA 2XW6A 5JWRA 4KIFA 4TSRA 2PXXA 1BKYA 2IYYA 4YJ3F 2IU4A 3T7DA 3U80A 4A2QA 4AXBA 5B1YA 5KHAA 4TVSA 4LSMA 5JLJA 1AXEA 2IW3A 5KSOA 4HC4A 4J4TA 1CZKA 1OLOA 1AS0A 1BHJA 2B6NA 2QAIA 3NDPA 2IWHA 2RJNA 3AERA 4GMHA 4A73A 4HCJA 3Q3HA 5IVDA 3ZDAA 1V45E 3L6DA 5IHPA 1I6WA 2HDNB 3GZTB 4B4KA 2VJCA 2XA1A 3FOBA 3QNWA 4I50F 1SCIA 3NATA 4P0PB 4OFXA 5M5BA 3DDHA 1EDOA 2AZ4A 3FDFA 5LOVA 3D3NA 3W5SA 1R0WA 1QIIA 2V5VA 1VBMA 3OZRA 5FOWA 3SXUB 4WAUA 3TUJC 4E33A 2BBOA 3VR0A 1XE3A 4CMIA 1E1MA 1LBEA 2JBWA 4RTKA 1TT5A 4K88A 1OBOA 4ZODA 2XECA 2IRWA 1O2DA 3PNVA 3RT7A 2REOA 1IXZA 5JHHB 1LVHA 3F1LA 1Y8CA 1UOOA 1ZWKA 5HPYB 5DISB 4LY0A 1H6CA 2GX6A 3PC7A 2RHLA 4KKXB 4RDHA 1OPRA 5EWLB 3P26A 5CT9A 1B0ZA 3PEFA 5SYAA 1GPH1 3UAXA 4HLNA 4KC0A 3O94A 4CMJA 3NYQA 4UUNA 3UANA 2IXAA 3BD6A 1MORA 4I9FA 2GYWA 1S2OA 4RZUA 1TC2A 3BHIA 3UJAA 1WE2A 3LZ6A 1KBOA 2A92A 2VN8A 2XUHA 1AN9A 5U1PA 2L18A 5F98A 3DTNA 5E95A 1TDJA 2COUA 2DR0A 4KQ9A 4A8HA 1IH8A 2WUEA 3Q7IA 2F1OA 2ZJAA 2FMXA 2QW8A 4OP1A 3AYZB 1J00A 4RENA 4Z1OA 1YOVA 3JYQA 3D6UA 1EK0A 4N39A 1Q22A 4BJ3A 5BRJA 3GF4A 2VHWA 3V8VA 4DF3A 5JCZA 1L8XA 3EDYA 1E4EB 1CUCA 3QVMA 3WK7A 1GZ4A 1I1QB 4JVNA 5HIJA 5JXWA 4MKZA 3PYXA 3ZIAA 2I9KA 1LK7A 1VB3A 2QD1A 2HY7A 2QRNA 3TZEA 1KZ4A 1GZ6A 3FYSA 3H6GA 3MWLA 4N7MA 1FSZA 1P2GA 3T4PA 1L5NA 2OAGA 1V43A 5T64A 4E11A 1WW3A 4N1AA 4HUTA 1BW9A 1CK4A 2C5HA 2I1LA 3GGSA 4HMOA 1XCPA 4PSKA 4YCJA 4BNJA 4BJ5A 4NCIA 4PQFA 4LW8A 3V34A 4HVLA 4UTRA 1USVA 4UFPA 4YV1A 5D86A 4P7GA 1PSWA 1XGKA 3KYCB 4TYNA 3KJZA 1CJVC 5E3HA 2WVJA 1VE3A 2JLSA 3WGUA 4WFIA 5CR9A 3C4VA 2P30A 3OWHA 2REBA 1BNCA 2DBRA 5K0BA 1M72A 2VHJA 5KCMA 4N5IX 1BG6A 2ZZMA 3HKBA 5HWSA 3H5NA 2JHAA 3PENA 3THYB 1EUCA 5AHRA 4A6PA 3OQVA 4CT4B 3WK4A 4HUQA 1CR1A 3ENQA 4MRMB 4WK6A 4LEIA 2IYEA 3UGQA 4FKZA 2F48A 3N8DA 5K01A 3RI3A 3UZUA 2DETA 4DQDA 1OAAA 1QHHB 1NX9A 3DGEC 4YAEA 1CQIB 3M1YA 4A8TA 2YXNA 4EP1A 1WDMA 3OPYI 4XQ9A 3K15A 3ZEAA 2VKTA 1KH3A 1Q15A 5BSEA 4FE3A 1V8BA 2HCTA 3KYIB 3MT8A 2YICA 2IBSA 3AFIA 3GYBA 4KDRA 5AK3A 4LXIA 4M1SA 5AH0A 1NP6A 3FWYA 4TQAA 4O63O 4BEVA 1HR0B 4BV2A 4N9WA 2BGGA 2HKIA 1ULUA 1C3JA 3C3XA 3MF4A 4C07A 5K51A 3UJ9A 1D4FA 1FP7A 4RJKA 4C4ZA 3G8BA 5AQ1A 4FILA 2IYFA 2QHXA 1B3BA 2BGIA 2ZS7A 3K2QA 4HLUA 1GG8A 4NU0A 4Y30A 4YJFA 4B47A 4HRAA 1IL0A 1UKCA 1M54A 1UBFA 2O2DA 1RHKA 2IKSA 3ONDA 3RKRA 5KKNB 4FYMA 2AG6A 1TM4E 1PGOA 3I8OA 4YDRA 3ZLUA 2CUZA 1BGVA 3HJTA 4LTNA 5JMPA 1NC3A 4C7XA 4RTSA 2XF8A 2MHCA 3C6XA 5JFTA 4Y6OA 2EQBA 1RVDA 3CKYA 4PG5A 4D9GA 3B1XA 4JT4A 1JFLA 1RZUA 4G0ZA 4GU5A 4AO7A 1VXOA 4KOAA 3INYA 5KJCA 1E89A 1ISSA 2QORA 1FL9A 3ESRA 1T5BA 3DDZX 1ZONA 4HYTA 3LVQE 3PNQA 4UAVA 3AF5A 1QLJA 4RS3A 4KYTA 5ALHA 1U28C 3K6SA 3SDSA 4L9WA 2J7PA 3C0KA 4R6XA 4C01A 1JQ3A 3CEAA 3I9MA 4KQCA 4Q7EA 5EZQA 1N57A 4LXQA 4P36A 2DT5A 1DQSA 2FPPA 1RR6A 1GL6A 3F8WA 3VA7A 3BDVA 3HSYA 3ZVLA 4HDCA 2AQIA 1RAIA 1QMGA 2GJAA 2F9MA 3CM0A 1LI4A 2PD6A 1ZICA 2ZWAA 1SOVA 3KYDA 4CF4A 1RKXA 5HRCA 1FFYA 2ORYA 3M81A 4I6JA 3GH3A 2JEZA 3CLRC 2QSZA 4UTOA 2FKNA 1ZN2A 4B40A 3NCHA 1CUWA 1GGJA 2GBFA 1U02A 3CRZA 1OFGA 3VR2A 1SXPA 1E66A 1F4LA 1NYTA 4OHKA 1GSHA 1EWVA 4G2TA 2Y1OA 3ZWAA 4AP6A 1JEOA 1NFRA 1RABA 3A6ZA 4H7KA 4O6VA 5JDCC 3THSA 1Y9ZA 1YRYE 2K7FA 4PTZA 1WMSA 3AY7A 4KLNA 5C37A 2V6GA 3FKSA 5I9IA 2DUNA 2G09A 2ZQYA 5ERXA 1DAOA 4E4TA 3CLUD 4B9EA 2BR5A 2Q1WA 2ZRCA 2B0JA 1T8TA 3NTVA 2R1TB 5DHSA 1O77A 5E3IA 1CR4A 5I51A 4OVKA 3UYLA 4MWSA 1F6WA 2ZSDA 5DHQA 4EA9A 1XFDA 2ICAA 2VJYA 3DKPA 4X44A 1DTSA 1FFDA 2DUMA 4OY3A 4JOCA 4Q19A 4W5NA 4PN7A 5KJFA 1ZNYA 2W0SA 4OQPA 1FYFA 4KL8S 2V7XA 2WF6A 1J0DA 3EISA 2I29A 3K0FB 3K8ZA 1JRLA 4JDUA 4JT9A 3B53X 4MQFB 1L8LA 2VDNB 4L6CA 4L4UA 1TD9A 3E3NA 3O8DA 3I9JA 1XR3A 2IUEA 5G4LA 4ZDIA 1O0CA 3QVGA 3ADBA 3KT6A 2IYSA 1DC6A 4FHFA 2ERCA 2OO5A 4OH1A 2IF2A 1ZEJA 3KUCA 1BZYA 3C14C 4AU1A 3SQNA 1LBIA 4B09A 1IPEA 1YE5A 2A67A 3E9NA 1X1CA 5BV0A 2WWWA 4N5MA 2AN5A 4WBSA 3ZDRA 2YWRA 5HGXA 1WBDA 1QU2A 4CLDA 2NZ2A 4UVDA 2QAGB 2BZGA 3KSZO 2GDJA 4JX8A 3QOWA 3T1TA 4TLMB 3NOXA 4ZOAA 2Q6VA 2QG9A 3ZDXB 1EUCB 3TTWA 4BV3A 4F71A 2E5WA 4R9VA 1R4NA 4DXHA 2V03A 5A1JA 2VHXA 4LDNA 5F5LA 4E2ZA 2BHRA 2QAGC 3DOCA 4NQZA 3LHFA 2JANA 3AHEA 3HCAA 2WTEA 4O2LA 4QOIA 5JY6A 4DUGD 2C31A 4I1RA 5DK4A 3PIRA 1PVDA 1YI8A 2G82A 3QHAA 4OHUA 4TRNA 3TFQA 2GJ9A 4UNIA 4EY8A 2V7GA 1MT3A 5IWCA 5CM8B 2XQFA 3BMNB 1I8TA 4DQKA 2IS4A 5TS3A 4Z3KA 5BV2P 1CY2A 2HXYA 1TADA 3LDAA 5AYVA 4KO8A 1USKA 3CLTD 3R3JA 1XCLA 4BMPB 4RH0A 5HE9A 5KOJA 3TMYA 1VCHA 2C96A 4OIFA 1I4DD 4WINA 4B71A 2JARA 4DNPA 5JRZA 2B78A 5PGMA 1P2SA 2E37A 3D0OA 4E5YA 3A1WA 2R6R1 4D3FA 3JVUA 1LK5A 1N0IA 3QY9A 4EUSA 1BMFD 1YCHA 1GIAA 1HDYA 3G2JA 5BN5A 2GAOA 1XJWA 4JA2A 2R44A 4UEOA 5JHGB 5D6OA 1JHVA 3C6ZA 2FMUA 4CG1A 4ZN6A 4Q4HA 1T13A 2ZSEA 1UT5A 2RH4A 5DASA 2GETA 5GY7A 4ASUD 5JS8A 1JEYA 1MKYA 2XGMA 2CLFB 5JEEA 3DM5A 3NORA 2GAIA 4NNOA 1VE5A 4BHTA 1OH6A 5HIIA 2XQJA 1BHQ1 2H17A 3UMSA 1TO6A 1YUBA 1J1ZA 2DPLA 4BDTA 2ZBDA 5FLXA 4MQEB 1C80A 2NLOA 4D79A 4W6QA 4FEYA 3R7WB 1PDWA 1W6RA 2RK4A 4L8YA 4LYAA 5EN4A 3HXMA 4KWEA 1YE3A 2VP9A 1I3OA 2ID4A 3AF2A 1BFKA 3RYCA 4YRKA 4ZFNA 2NXCA 4MB6A 4MRPA 4DPLA 2IBMA 3VKUA 5K05A 13PKA 4LNUA 5BN3B 4CHTA 1BVUA 4GBJA 3LGXA 3TBHA 4D8TA 1UDWA 3KYDB 3W5JA 1T8SA 1FF9A 3MPOA 2RARA 5GAJA 3OU7A 1E1NA 2DUJA 3HL4A 1GP2A 1YIOA 3FIJA 3Q2IA 2NZ8A 3BEDA 4PYJA 2YWJA 2JRCA 4YRNA 4KO3S 1EVKA 1OIWA 1T1IA 2HCFA 5IM5A 5JS6A 1NUTA 3N2YA 1CUSA 2PY6A 4TUYB 3RIYA 3RUHA 3EYAA 5HNKA 1B8VA 1BX3A 1TKCA 1GFIA 1WXXA 3NONA 1KEEB 5DB4A 1A8SA 4TLDA 4YMIA 3U9TA 3P32A 3GGJA 1PQPA 4P3OA 2CLIB 2ZVPX 1L7RA 1Y1PA 3FE2A 3IAXA 4XUGB 5JH7B 3ZV5A 4ERXA 4IGAA 1PZFA 2DSNA 1N5OX 3CUEF 3GN1A 3RFXA 2UAGA 5J2UA 1AU9A 4H27A 3WA6A 4D0GA 5T3YA 4NU6A 1ZCAA 1HT1E 3MRSA 2JFZA 2VP6A 2K7ZA 1KMIY 4D4IA 1KGSA 1GFZA 3KJHA 2ONYA 3QX7A 2X2OA 1CUBA 1DHRA 2ZUDA 1NUSA 2P79A 3LIPA 2FP4A 3SSMA 1X6VA 1EZ1A 2I66A 2DR2A 2NWQA 4MHTA 3T1HB 5AXAA 1ULAA 2QYOA 3KVVA 3FUVA 3M4XA 5EIBC 1OW3B 1H1TA 3B82A 3HADA 2BFBA 3LIIA 2VTBA 3DC2A 1OI2A 4I50B 4Z4EA 1DFIA 1SO8A 2HMYB 1N5MA 4GP9A 2Z8YM 1JYFA 4W1PA 2ACKA 3SJCA 3PQ5A 1N6LA 3JVVA 4MQEA 1NI4A 3IP3A 1N2CB 4O4IF 4UDXX 3ABOB 3TBKA 2P9CA 4XIFA 5JRJA 3HCBA 1I6LA 4RVCA 2XY4A 3JD2A 5LXTA 5HMLA 1X38A 5IU6A 5K3OA 3WGHA 3D31A 3RTGA 4Z8YA 2GCGA 4UUQA 4EPRA 5L45A 1MEJA 2ZYGA 3DEFA 1DBSA 4KQMA 1SGWA 5EXDA 1Y3CE 2YHSA 3B20A 1AVTA 2FMFA 3K0KA 2M6SA 1ODFA 4DVJA 1XNGA 5EQDA 2MSKA 4TQUS 3S68A 2RAFA 3V8EA 1DO0A 4Q4AB 4BVBA 2G67A 1K7YA 2HJVA 3Q8XB 3JQRA 1H5QA 4IQ8A 3T5PA 4N6NA 3CE6A 3BAFA 4UJ5A 3WBKA 5IYZA 3DE0X 4MQMA 4DSOA 4F1WA 2BELA 3TTXA 3CRQA 2C2XA 4JGBA 2BHSA 3PDUA 4GBED 4OHZA 4RQBA 2IS6A 3PQ6A 1FUKA 1TRHA 4XASA 1QONA 4GLLA 1TA4A 2H0AA 1HLFA 2F1IA 3QIAA 3D8TA 2OHIA 1Z5VA 3Q7TA 1NR5A 5HDBB 3RVMA 3VU0A 4KWTA 2FF5A 3M34A 2H54A 4H1TA 1TEXA 2G71A 2L19A 4NESA 2CC2A 3HDYA 1ID1A 1U1EA 2N42A 2HSDA 2Q9UA 2YN0A 4TZKA 1QTNA 2WJZB 3EULA 2AI3A 4UE2A 2WF8A 3P9ZA 3WSWA 3EMVA 4D3SA 1KETA 2JGFA 2MIIA 2QQFA 3TSZA 3LWBA 4MWEA 4C30A 2A58A 2XUKA 1FTGA 2OK8A 1HE1C 2EX4A 2WTAA 3QENA 4RD2A 4E21A 4DCSA 2F64A 3OFKA 3OKAA 1KOJA 1QIJA 1IHDA 5JECA 1W5TA 4ZHQF 4RE5A 1KQNA 4KV7A 3FSJX 1GCAA 1P4SA 3OT1A 4MPJA 2X3UA 3WSVA 4YIHA 8MHTA 2PJDA 2J7PD 1WXDA 3BAZA 4KIGA 4XH9B 3ZN2A 2P11A 1QFSA 2B1GA 4LXXA 2A3RA 3C2QA 1LRJA 4LE1A 4I4IA 5TARA 1Q7EA 1TKBA 2OBXA 1E7QA 3OTIA 4DHWA 3OBIA 3PP8A 1NN1A 2X0JA 5HR5A 1FFCA 1T5IA 4MPDA 4JV5B 2XYRA 4UUOA 2WE7A 1D6JA 1F0NA 1MF7A 2FJ0A 2IIBA 3PRHA 3A1TA 5AMXA 1RRPA 2W8ZA 5GVRA 3B6JA 3DOJA 3GJ6A 3BM5A 3L7YA 5AW8A 3SIXA 3VVLA 4PG8A 1E1CB 1T24A 1KZ7B 3U3RA 2HJRA 3U6KA 1RRKA 5HF8A 2I33A 4FT2A 2SKCA 3MCWA 4LQ4A 2NXJA 4JSYA 1TQ8A 4ER5A 3DFUA 4IMRA 4I8XA 3TSAA 4YPFA 2YW9A 3W8EA 4EHAA 1Z2NX 4JC4A 3SAJA 3LUCA 2ZBQA 5KI6A 4C89A 5BMVF 2ZJFA 4IDNA 4EG0A 3EH1A 3OOEA 3HFRA 2W6NA 1RWWA 4ZEOA 1KPGA 2OOKA 4QKQA 1A8HA 4L5YA 3WY9A 2FMKA 1CFZA 1JEAA 1PDVA 1UKAA 1YV9A 2AD5A 2DBZA 3V00A 1M6HA 1II9A 2RI6A 1U7UA 4IW3B 3WLPA 1ECBA 3ECCA 1EVZA 4E5VA 1DC4A 1QHXA 1VFPA 1P17A 3M49A 1QB8A 1HK7A 2NV6A 4X1YB 3T7JA 4LSGA 3WWOA 2E5LB 3HJHA 4PBTA 4IVRA 3HDVA 3AKZA 1J8FA 5IKMA 2PH7A 3EMKA 3EW7A 4ONEA 4I8IA 3OZCA 4J2HA 2WSMA 4D02A 2EQAA 3EZLA 4XOIA 2WFAA 4QPPA 3T9CA 5ADWA 4XQGA 4ZP1A 4HB2A 2IEBA 2C42A 1ZK3A 2QV0A 2PANA 5D84A 4BFTA 1GZ3A 3KC2A 1RP7A 3WFZA 4I7EA 8LDHA 5LA6F 3OZUA 3ZPXA 1XCGB 3GFOA 4LDQA 1Z83A 5EIOA 2NU8A 2QUZA 3KHUA 2DFNA 3UQZA 3W5UA 2XT6A 1BHSA 2FEPA 4LOAA 3L0YA 1F2TA 2Q46A 3L7KA 1SHUX 4PICA 5MGBA 2IC5A 1J49A 3D1VA 3PCXA 2ZSJA 2J9XB 4CIDA 2P35A 3AR9A 3HB9A 4ZTZB 3Q8KA 2C3PA 2YNMA 1FY2A 2PLNA 1FJHA 2VBFA 2C84A 3DOOA 4GMKA 2VTDA 3QV2A 2B5OA 5HJ5A 3BIFA 3EUAA 4BWYA 2Q2OA 1C4OA 4N8SA 1RWQA 3WIVA 3O3CA 3JQ8A 1HE2A 2V6IA 2GHTA 4M46A 5CYOA 3IILA 5CXQA 2PSFA 1ZH2A 4IAOA 2A9KA 1HYGA 4BE7B 2IYOA 3HNOA 3PLRA 2B6HA 1Z0UA 3ZIAD 3ZD6A 2Q9BA 1NVKA 2II6A 3F5QA 4NOMA 4WOPA 2QNIA 2DYKA 4IKOA 3SJUA 3UUEA 3HYRA 4F46A 4QDKA 2NSJA 3DP9A 5LZ8A 2O8BA 3LVFO 2RHTA 5A9RA 4DW8A 2ZSFA 1TMGE 3VH3A 2M6LA 3G1UA 1EP3B 1N4DA 2J0UA 3T99A 1DKRA 4IXDA 1AKYA 3VOBA 1KTVA 3FPGA 1FRZA 1U1IA 4DM7A 3G2KA 4WJLA 1ZWLA 2YW2A 4OYHA 3FH0A 1PLLA 1PUIA 4FHZA 1LTKA 4TKZA 4HGYA 5CX1A 1YO6A 3WV5A 4QHSA 4WTOA 2ZU6A 1GPAA 2RAVA 3WTCA 1PSZA 1BOFA 2DRIA 3IVCA 4KWIA 3PJGA 1X7YB 3IKJA 3HV2A 4H3SA 3EIOA 5EY5B 5I5EA 2BFDB 1D4OA 2EYUA 2ACVA 3LX4A 2Z3ZA 5A04A 4E09A 2HHJA 2NZYA 3JD4A 1E5XA 2E3JA 2C9YA 3ET5A 1OA0A 4F4UA 1IBSA 1LV7A 1CIVA 2GZDA 3DKIA 1K8ZB 1NW4A 3PHHA 1ZI9A 4KE6A 4OQFA 3GLGA 3MS2A 3U60B 1MVOA 2Z5FA 4PCVA 4QSHA 2VXYA 4BWFB 2QN7A 3M6MD 5F78A 1VPLA 3ED5A 1QS0B 3OVMA 3QMWA 5C5IA 2ZGVA 2NOAA 2QD5A 2BF4A 4OKNA 5BV8A 5KYTA 2XCQA 1WF6A 2ECPA 5HM8A 2X0IA 1REQA 3WDMA 3AHJA 3GFVA 1FDRA 1Y8RB 3ESZA 3M3HA 4ZYZA 2X86A 3K0EA 5M04A 2YL2A 3GY0A 1T8YA 4ZZ2A 1BWSA 1PSDA 5EHQA 3LYLA 4BX3A 3FI0A 1JIIA 4DTCA 2E6UX 1YL7A 1EHYA 2XV1A 3PV0A 4IIUA 5ARCA 5ISMA 4OLBA 3RUDA 1GA6A 1AZSC 4M8IA 3A58B 3EVFA 5EPOA 5JTUA 3KZKA 3O1LA 1H8EA 1YGPA 3LX5A 2QPOA 4OATA 4HATA 1RMQA 3GRCA 3KQWA 4U00A 2X40A 4CTOA 3KHTA 3KPWA 1BE6A 3NALA 4BMDA 3KQNA 5FADA 4FW9A 3IDFA 5JNUA 3LQYA 4P38A 2Q45A 2ZCUA 4FEGA 3ND6A 4XUDA 1EWTA 4BNDB 1GPJA 2XQVA 1QZTA 5LQRA 3DZGA 4NTZA 2Y68A 3UUWA 4GI7A 3DMPA 2UYGA 2XTMA 4IX1A 2J9FA 4QUJA 4V38A 4J6EA 4F1JA 1PG0A 4II3A 1WAMA 1K2WA 2I87A 2ODPA 4H15A 1JHXA 4N8DA 2W70A 4AVYA 4MUYA 2JBHA 3UC5A 3D4NA 3OQ6A 4PYNA 2B25A 1FDSA 1XD9A 5K3FA 4E46A 1SWVA 4QPDA 3CJTA 3SBOA 1H0RA 5HUQA 4CL0A 3DXFA 3H9QA 3G2HA 3PHLA 1WZ2A 3WADA 5D3MA 3GLHB 2D2EA 2PS1A 3E9EA 3QMVA 1WBBA 2DE0X 3NKVA 4M8SA 4MYSA 4U9UA 2B8TA 3KDPA 1OHHD 2UUOA 4BMXA 4CU5A 3A7EA 3S44A 3CA8A 1P1HA 3O1JC 4WWHA 4UARA 2IV3A 3OG9A 2W22A 4TSKA 1F6DA 2C7VA 1JHYA 4HBZA 5DI9A 3TINA 1QSGA 4GMFA 4KVZA 1KARA 1DBQA 2P9GA 1KR5A 1T0HB 4IXTA 3VR3D 3W3AA 3ZHSA 2A0FA 2QRPA 2ZTLA 3L8YA 3JYLA 3BL8A 2VTVA 1SXJE 3SZOA 2O3TA 1GQ2A 4QPZA 5KPJA 2WOJA 5THKA 4RTJA 3AFNA 2WV9A 1ML4A 3NM5A 3IBGA 3EFOB 1XVUA 1MTOA 4YLEA 3TM4A 4A3SA 4KFUA 2PYDA 4FE4A 1JZTA 2BDTA 2QMUA 4HNTA 2XB4A 2RC6A 3PG5A 4FI3F 3WP1B 3KOUA 1ZGJA 1P31A 3OO0A 5GOZA 4E5SA 4J0JA 3C1OA 4ZIRA 2F1JA 4KP7A 3GIDA 4DANA 4E2XA 1AQUA 1BOOA 4UFNA 1CY0A 2V98A 4JI5B 3B9BA 4XW2A 1XF1A 4YRAA 4KE8A 1ODLA 3SBXA 5A4KA 4LYDA 2W90A 2NN3C 4N0EA 3SKVA 1XELA 1L7OA 4CIVA 1BJKA 1OWNA 2A5LA 1QKJA 3CJQA 2A0UA 4OA8A 4CVNA 1OWOA 1QHIA 2QP9X 3DNFA 1K9SA 4II2A 4LE0A 4V0SA 4CI9A 3OQIB 4XYEA 4QD3A 2DX7A 2JJQA 4P7KA 1KK2A 2AI1A 4AY2A 4EW1A 4RVNA 5GZ6A 2GRJA 2QXYA 1GARA 3LW7A 2V7VA 1J25A 3O91A 1LZLA 3M9LA 4E15A 5JADA 2VQFB 4JHXA 3TLXA 2AWOA 1YKFA 2GCIA 2CBZA 2GPYA 3I1JA 1PBNA 2FRXA 3SFZA 5KWJA 1WCV1 2HMWA 4IZ6A 3SD7A 5MN4A 1XZFA 1E8DA 2FEKA 2LIVA 2CFTA 4HI0E 1VE6A 2D54A 2DWQA 1EAYA 2C3UA 4MGIR 2WP0A 3Q3GE 4RHXA 2O2HA 1U8AA 2WIDA 4HVCA 3T3NA 3KTFA 1N3IA 2FPIB 2G0NA 3E18A 4DABA 5KB3A 3HTXA 4RD0A 4JJGA 3KIPA 4YQEA 2YKGA 2CWDA 2WHXA 2PFSA 4NAUA 1EE2A 4QDXA 3H84A 2POQX 1HDZA 1V6SA 4MLCA 4BLTA 4BFLA 3CEJA 3UJNA 1CY4A 4C3ZA 1I1OA 1W4ZA 4IS3A 4YC7A 5E38A 4Q5IA 2FLWA 3GDHA 3KP1A 4XIJA 3C3DA 2HZBA 1Q44A 1DG3A 2IYNA 3H2IA 1QKIA 4HYQA 1KDTA 3KOOA 3FB4A 2PD3A 3N39C 3KJEA 4KQEA 2PUCA 3MNFA 4FXOA 1P6UA 1LDNA 3LCJA 2FZCA 2HIMA 3WVNA 1XD2B 4GQBA 4PZZA 4XTCS 3D4BA 1FA9A 5AVSA 4AECA 4EYEA 2ORWA 1T3TA 1GCIA 4PCUA 3O90A 3T5TA 5CFQA 1JI3A 3FPSA 1JSXA 3JSXA 3MPUA 4HXGA 2DGDA 1XNHA 4Y2GA 2VAXA 2J48A 4WE3A 3BRWA 4J1TC 2B2CA 1IZ0A 4CPDA 2J5KA 1GRQA 3HWRA 3PD1A 4W9NC 5GJBA 4UE3S 5KNBD 1FLNA 4CM9A 2JEYA 3HLTA 1C9YA 4YHHB 2VOEA 4I6GA 3KETA 2OHXA 3HYSA 1Z0ZA 4TMZA 3PKJA 1DOAA 2A0XA 1H2ZA 2WG2A 3QZUA 4FJ2A 1T4MA 5IUKC 3S55A 2CHGA 4ZTBA 2H1RA 3L6EA 4MH0R 4Z9YA 5KJ1A 4ZOCA 1JIJA 2QUAA 3GJ0A 2NZUG 1XLTA 5JNSA 4RTLA 1RYMA 1UZLA 1GV0A 2QN8A 3EUFA 5H80A 2HHCA 3QVSA 3U7IA 3I12A 3OJEA 2HGSA 1Z9BA 1TM7E 3HXQA 1PFYA 4X60A 2TSYB 2C9MA 3T1QA 1A0OA 5CNIA 4PFSA 5B7QA 1YB4A 4XUCA 4JBYA 2BL4A 5JC1A 1I9GA 3NGLA 1NBMA 4P35A 4L0QA 3KZMA 4ZHQB 2ZKLA 2R68A 3UAYA 1ZOSA 2FZGA 3FMGA 2GA8A 4IIDA 2MR5A 1V39A 5FI0B 1XMJA 1XZQA 4UVIA 4JBGA 4XM1A 3I9OA 3QWBA 1T9DA 2CV0A 3O0TA 3DR3A 4O25A 3Q0IA 3PQFA 4W63A 1DC5A 1PE0A 2PKQP 5L40A 2J31A 2J85A 1GTL1 4LRXA 1D2HA 1KP9A 1P1IA 2VK8A 2Y05A 3MUEA 4MQUA 4TTIA 4XSVA 4ZCPA 3ZIUA 4MK4A 4LJSA 1MMFB 2I2CA 5I3ZA 3E70C 2FSVC 4DSAA 2GMWA 2WDZA 1CERA 3UAVA 3VZSA 3MGAA 1SCQA 1YR1A 3BZBA 1N1GA 3A05A 3CW8X 4Y1EA 1XDSA 3PWTA 6LDHA 3B1YA 3PICA 4K8RB 4A6DA 3RRNA 1EFVB 1R6VA 5HOEA 1JGTA 2HBRA 1UZAA 2AA3A 2PUFA 4IFIA 4I5FA 2WLTA 5B36A 2D5IA 5F4BA 2RH8A 4KE9A 1DEXA 2Q2QA 2VZ8A 4EJSC 2PYIA 1U0TA 2PRKA 3IRUA 4MQFA 4POAA 5LFAA 2HREA 3CNNA 4OI0A 2GXUA 4LC1A 1GSOA 4K2HA 1YD7A 2Q62A 2VYFA 4BUZA 5BR4A 2CLKB 4J7XA 3PNYA 2KBEA 3FBWA 3R09A 1QKKA 4TXJA 3P2EA 2OQVA 4B8WA 2AYYA 4RQAA 1U80A 5FORA 4AY4A 3GZ4A 2ZJOA 4ENSA 1SD1A 3U4IA 3S2UA 4LG1A 2IU3A 3UO8B 1P44A 2H2DA 1TAQA 1Q2XA 1WMDA 1FC0A 1SCUB 4MUFA 4C6HA 1QHYA 2GPJA 2JVKA 4EHFA 2IXFA 1X86B 2Z98A 3KPUA 3VO2A 1BD3A 4BFWA 2B1JA 1AA6A 2J07A 1G66A 3RO7A 2IHVA 4BU1A 5CDGA 4YVFA 3ZGNA 1M83A 2XE7A 5D5PA 4EMBA 1EK1A 2NUBA 3B7GA 3L79A 4WECA 5LM3A 4DV6B 4F5DA 1TJPB 1V48A 3N8HA 1HUQA 5REQB 4BFYA 5K0LA 1E4VA 2VCEA 3EEIA 3GJ8A 3P0RA 4NPHA 5A3RA 4DAOA 3GELA 3A37A 2ZR8A 2G4VA 2VF5X 2G0TA 3IBCA 5KJ6A 1WETA 1IVYA 1V9SA 2B4TO 2G5GX 4R1NA 5EGSA 4LDRA 5IFKA 3E4CA 5DN6D 1MRNA 4G3XA 1KIAA 1OGIA 3TDKA 4MCHA 4MI9A 1DE0A 3F71A 4XQCA 1C7FA 4Y6QA 4JSTA 3UATA 5HYVA 1KXZA 3UAZA 4Q39A 4B85A 1RCTE 5KSPA 4DEXA 1P2TA 2FPWA 3B3JA 2AQKA 4BNGA 3ANLA 3R9KA 1L4KA 5BSFA 4AS2A 4L3WA 1VJGA 1RXYA 2W2LA 4V0MA 5AUQA 2OO5C 4ER6A 3AEQA 3NYWA 3PEYA 4U63A 1MX5A 6PFKA 2PUGA 5J4LA 4U39A 1PKXA 4PHTA 1BE8A 2C4VA 1BWPA 2J6HA 1ORWA 4FKBA 4IVPA 4RVGA 1SG0A 2OV2A 3B1JA 2IX3A 3DWIA 3WB0A 4IDDA 4IZHA 1K7CA 1JYEA 1CUEA 2O50A 1YGYA 1VCNA 4W9NA 2VF7A 5MN5A 3A8TA 4Q1BA 5BSHA 1HYEA 1ECFA 5GQSA 4KUHA 2RIPA 3NRJA 1QAOA 3DTTA 3TTTA 4Q47A 2O7VA 2A4MA 3KZVA 1LDYA 5E1DA 4I66A 3DAOA 3C4JA 3FZEA 2D7JA 5I7UA 3MS7A 3X1YA 1QGUB 1F5NA 2IUTA 2Q28A 3O8QB 4RHUA 2FPGA 2UUBB 1WM1A 2YR0A 4Q34A 4LE2A 3BREA 3VC2A 4D4JA 5K99A 2BGNA 4RZHA 1CTQA 3IJEB 2EJCA 3UF0A 2VDMB 4H7DA 3D2LA 1P61B 1O96B 1MO4A 2JEOA 5FNZA 3JQCA 1GZ7A 2ZIEA 3QBTA 1KIFA 4A0QA 4IQGA 3H16A 4K9OA 4K9LA 4B7ZA 1Y48E 4HQ6A 3IAAA 4Y6LA 1JR3E 4Z0NA 4U9IS 1MG0A 2VI5A 3U4MA 1KO4A 4LYEA 4TV9F 3GDFA 5AR1A 1QF6A 1N7GA 4CM9D 3JPWA 1PEKE 3BFKA 4F91B 4C03A 1P9LA 2G25A 1AQ6A 1KMNA 1KJ9A 4LHYA 3QEOA 1UMDB 3ZCRA 5IKEA 1DRUA 1YQWA 4BQPA 3L7BA 5A4IS 5GP1A 3LUHA 5B6PA 4FNMA 1EVLA 1F8YA 1PBTA 3NHBA 4UVEA 5D51S 2WWRA 3INRA 4CHGA 1NG9A 1PQ4A 4H31A 1UPXA 2H7CA 2G1PA 4NOLA 2Z2YA 5C5EA 1C3OA 3EZYA 3ETCA 1RIFA 4J8PA 1YUNA 1B2LA 2PKQO 1G291 3GFRA 3PQ8A 1CR0A 4GGPA 4DCPA 1E9FA 3L7OA 3R7NA 3B52X 1SEVA 2IHUA 5T8KC 1JE1A 3THWA 2WE8A 5BSUA 1CUJA 2V3WA 5CK5A 3WWDA 2YV3A 3D8NA 2R8OA 4QE3A 3TKAA 3QFSA 3KTDA 2J6IA 3QYJA 4YB8A 4JI8B 4GC5A 3GAAA 1FFSA 1UQTA 3E9DA 3UB2A 3VH1A 1YJ5A 2VOJA 5K0SA 1XALA 5J4YA 3W5IA 5DBOA 2JATA 1QHSA 4D0NA 2AOUA 1U6KA 1OH5A 4TX1A 3A3NA 4OKSA 1A9YA 1X74A 3E7XA 4Q3KA 3A70A 1DKPA 4PRZA 1RKQA 1JQAA 3KJNA 4EGQA 2G80A 4YDHB 2XUOA 4PQGA 4QXAA 1AKEA 4F6LA 5FBVB 3PRKE 2ATVA 2DY0A 4PYLA 5TPZA 1U3WA 5G40A 4ME6A 2YRFA 3NMUF 1NDHA 2ZETA 4YXWA 1JQLB 1FNSA 1H1LA 3IE0A 4WKOA 4UAJA 5ESWA 3TL6A 3K9HA 4PHHA 4U2CA 4M0EA 4BLPA 4IGIA 1T0IA 5A3VA 4RZXA 1ZHFA 2ZIFA 1Q7BA 5ALOA 1GG2A 3KD2A 3AU8A 3TX2A 4BLOA 3CTPA 4DA8A 2HF8A 2WICA 3R77A 4QYTA 1G5PA 2ZI6A 4IG9A 4OQYA 3G7NA 2JHGA 3E9MA 3ELYA 4M1EA 4Q3OA 3G9TA 2NNLD 4QU8A 3UTCA 1AHNA 3OSUA 3NAMA 4D4MA 3DVQX 4EKEA 1NVVQ 1V3QE 2QTVB 4QT4A 4NCAA 1SAYA 2OV6A 3PHIA 4CM8B 4E32A 1JIXA 1SRQA 3KKOA 1EJBA 1N92A 3OJCA 4QUAA 3KL4A 2FXIA 4D56A 3RRJA 1EK2A 4FEAA 1WXHA 3C39A 3H11B 4YYEA 1Q20A 4C4SA 2A1TS 1OBCA 1G8YA 3EXFA 2D59A 3UK6A 1N6IA 4JMPA 4TXHA 3HG7A 1EZ4A 3QY0A 5E0OA 8GPBA 3I34X 2J46A 4B6RA 1MV8A 4Y67A 1JIVA 1ZD1A 3K1JA 4GKJB 1C1XB 1QGDA 3MSCA 1ZHHA 4J3NA 1B1CA 4DMHA 1EU1A 4RQTA 3OCYA 3OCWA 3ZOZA 4DJFC 3DWFA 5IF3A 1IRXA 2CCKA 2FZWA 3GNSA 1ZIYA 3L8MA 1RLOA 1UOQA 1FMTA 2YJ3A 3QXCA 3BIOA 3HQ4O 4IX9A 3UPTA 4C6TA 4DZRA 5BOSA 3U4QB 3N1UA 4N8EA 5NULA 1LZKA 4J0EA 1PEDA 2AJBA 2FE1A 1GV1A 2CMHA 2KWIA 3K32A 3LQ2A 5FHQA 5KQGA 4ITRC 1XWFA 5GV7A 1NVXQ 4IJVA 2OHFA 3QG1A 1CQJB 4Y1RB 2H57A 3UMGA 5IT5A 1DJQA 3EF3A 4ZAVA 1QQAA 2ROQA 4BATA 2IYVA 3BE8A 3U1VA 3ZWNA 1RYBA 3FYTA 1ESCA 5IUJC 1CRPA 3LYAA 1I0LA 4ZOQI 1K89A 3GUCA 3DAGA 2VPYA 2Z1NA 2ECFA 1ZD9A 4UBLA 3VNSA 4HJRA 4WADA 3ZE2B 1QGZA 1MJFA 4GDMA 3H8JA 4J43A 2FH5B 4FZ5A 4BN0A 5JG7A 3RASA 4F4DA 4H59A 4MULA 4BFCA 2WOOA 4NYMR 2D3WA 1W581 1XZPA 1JHDA 3DL0A 4F3RA 4QJ4A 4ZV9A 4W7IA 1PWHA 4MIKA 2ZB7A 2VHYA 2QRZA 4L1KA 5K8TA 4RD4A 2R00A 3HUTA 5A03A 2FG6C 2PMBA 2QGZA 3NEYA 5IKPA 5KTPA 5LD2C 4LWPA 1VXRA 2X4IA 3KJQA 4B8YA 5EXXA 5IM4F 2CFRA 4TL9A 3CO0S 1P1CA 2P3LA 2YQ5A 5CA0B 1W88B 2OMKA 1XCBA 5DSZA 1Z7BA 1MAVA 4JBXA 4M1KA 3W8NA 3P7MA 5HHTA 4GOLD 1DEAA 2OEPA 1WMFA 3CR3C 1O5TA 1ZC4A 3UICA 3G3EA 2CL7X 3Q3CA 1L7MA 1VP9A 2G5PA 2DT8A 2PGDA 4JLDA 5JLAA 2OCYC 4C3VA 4HGZA 4M7OA 1T8UA 1T35A 4YRIA 2KMLA 1Z6TA 3GRPA 4UNSA 3SZMA 2UZ0A 2Z2ZA 3KQSA 1J2EA 4Y6RA 3UFXA 3HJAA 3WB9A 2XDQB 3SX4A 2QZ9A 4MB2A 2G1UA 3FYDA 4XIGS 2K4MA 3M6WA 2FR0A 2YHAA 3INGA 3MEQA 3NETA 4FHCA 2M1XA 3NANA 4L6IA 3BVPA 3HYTA 4N65A 1FSSA 2BUBA 1Z6QA 4RBNA 4X6LA 1N1MA 1UJ4A 3D6VA 3D59A 1C29B 4LJ6A 1FZQA 4QBFA 5ED0A 4F3YA 2GQ0A 4Q37A 4CUKA 1IVSA 2CV2A 1UDXA 1KI2A 3SG0A 1IJKA 3H5AA 4HDAA 1XQ6A 4QXQA 3CLSD 2VT6A 2AR9A 2MOKA 3KKQA 2JIBA 2Z57A 4AJ9A 4EUFA 1JPNA 2EP5A 3GPIA 2H7VA 3RIGA 1NW8A 4NEHB 2AOVA 4JQOA 3RSQA 5PNTA 4EVSA 3IR5A 2NU6A 4UHEA 4NZOA 1EVYA 4NX2A 3A9UA 4BQSA 1RQNA 3HGQA 3IAM1 4QUEA 5CB8A 4CKWA 2INGX 3LBIA 4UXHA 2JB9A 3STUA 3CIOA 3UMJA 1OV6A 4QNMA 5L6LB 4IUBS 3E22B 3VPCA 3WICA 4ZAWA 2BBTA 3KOWA 4L74A 5FO0A 1WNTA 2C98A 2PFKA 3H9GA 3QKSB 4TXNA 3LCUA 4WSOA 3TM5A 5AIBA 4W8HA 2W2KB 4RHCA 5ARBA 1E2LA 1L4NA 3AIKA 3D64A 4KXUA 3SBEA 3WK9A 3SKYA 3UIEA 3ZXYA 2FDRA 1AK9A 2K2QB 1IMJA 1R9MA 2R8PA 4D4HA 2YYAA 1U5BB 4A36A 1QX3A 1XZKA 2X4GA 1TF5A 1UAGA 2ODAA 1G20A 2R60A 1Z06A 3HUFA 4U5QA 4DA0A 1U4NA 3HU1A 3L8HA 1N5RA 3U9SA 4ML3A 4OM8A 2BTEA 4LZPA 3FOEC 3L1VA 4LAFA 1BU8A 2GN4A 3A3KA 4DE5A 5JYBA 1BDMA 3LUPA 1DKNA 1X9GA 2PX0A 3ZD8A 3L8DA 1YBFA 3AF0A 3TZLA 1BS2A 4N82A 4R0VA 1T9HA 3FLBA 4ZCLA 3VR5D 1WS6A 1USGA 4M7WA 2G0AA 3GA0A 1QR2A 3STYA 1QDLB 2BP7A 3IDZA 4NNJA 2ZSKA 3RBAA 4ANFA 3JASA 3SN6A 4GLBA 2E4UA 5HKKA 5K6TA 1UC8A 3ES9A 2X0DA 5JD6A 1BH6A 4QODA 5JCOA 3PKZA 4D41A 3SXUA 4TYWA 2GLTA 1DHTA 1U99A 3PQEA 4KGDA 3W8DA 1NASA 2CBGA 2YMLA 3MTQA 3IQDB 2BFDA 3IQHX 2H1LA 3HXLA 2FSHA 3OFND 4Q7QA 4H3HB 5JDCA 3ZQ6A 3R9IA 5LNK6 1K7SN 2FFQA 3W79A 2P4QA 4DSTA 5A2GA 1AHIA 4FQ8A 4ROTA 3O2QB 2O8VA 4U6NA 5DYIA 5JR3A 3P9CA 1SNYA 1VLHA 3ETDA 2BFMA 2EW8A 2G9ZA 1YHZA 1P2BA 3R0VA 1CDEA 3IP9A 2RI0A 1R3UA 3FBGA 3SFTA 1D7OA 3DZDA 3QWAA 4MW9A 1G7SA 3RVKA 4DPMA 3AFOA 2VYCA 4KITB 3HMQA 1XD2A 4IOKA 4F96A 1U98A 4PRKA 3WR5A 3STTA 2WJ3A 4KNYA 1IHXA 2F4VB 2RHOA 2F62A 1QFYA 4JQSA 1SM4A 4OJNA 3TG8A 3DV0B 3R8XA 4QTUB 1IEQA 3AJEA 3BDAA 5DSTA 3ZTWA 5HZGA 2BLNA 1NVMB 5J23A 4ZOBA 4QOGA 4OHFA 3FVTA 1VJ5A 1N6OA 1QIGA 1YHNA 2VBGA 3TI9A 1XTKA 1W9MA 3E3AA 5I47A 3K09A 4KI7A 1G9TA 2E7ZA 2QRQA 2VRCD 4YMSA 1Q6YA 3LW8A 5EYPB 1ODIA 4MO9A 2ISCA 2PJUA 1NOKA 5DM60 3K9FC 1EMDA 2HLHA 3QUTA 3WRXA 5M2QA 4QUGA 4W5JA 2W4QA 4ND3A 1X8LA 2O48X 1NBOA 3QLTA 4HQKA 4TKUA 4XWYA 3RRFA 4ACBA 5MFZA 3WGIA 4BO3A 2JVIA 2JKZA 2JAPA 3FPKA 3V8BA 1V11B 4I1SA 2AV6A 4BVLA 1DIAA 4BCDA 5ITZA 4J16A 4QYIA 3L7LA 1YDGA 1TW3A 2KB0A 1IUNA 1HLGA 5EEHA 1CQPA 1GWNA 2JFXA 3HGTA 3KQKA 2XNSA 5C81A 6Q21A 1R1DA 1X7YA 1KOGA 4NOKA 3PCTA 4UULA 2DUUA 3LXUX 4Q9HA 5J5VA 4D8UA 3EGXB 5BN4A 2F90A 2P4SA 3KWFA 4X94A 3MXTA 4BWGA 3AHGA 4DJTA 3ZQJA 3QPCA 1L3CA 4O2AB 1K3TA 5HXAA 1UPAA 3ELBA 2Y1CA 1EA5A 4O1IA 4OF4A 2JJ2D 4B32A 2JLCA 4NONA 4CEHA 2N0SA 1T6BY 3U7QB 2CCGA 4D42A 4BECA 2HU7A 1QE0A 2UYQA 4FQ5A 1JG4A 2Q8QA 2F4NA 2QP3A 2YS6A 2YWDA 1PGPA 4HZUB 4WCVA 4BZWA 1NXWA 5LP1A 2JHFA 1VLLA 4V1CI 3CZPA 2O59A 4I4CA 1FB5A 5IZCA 5JXIA 4QQNA 1N2ZA 1B6RA 1A4RA 3KZXA 3QKSA 2LD4A 3SNKA 2NUAA 4K40A 2GXSA 4MLDA 3BGWA 3QUAA 1LV8A 2ZRAA 2PJRA 1TEVA 2H65A 1JBKA 3CNOA 2JDID 5E1MA 3VU8A 5IANA 2VUSA 2HLNA 2XOKA 2R8ZA 2XYHA 3T1VA 3UK7A 4FYHA 3BJRA 4MLPA 1SVUA 5JISA 5BPHA 5ICGA 5ALEA 1AV6A 2Q8PA 4MMYB 4UTZA 1HNNA 2DBQA 1CDOA 4JLSA 3FOWA 3ROTA 4KU4A 2XB8A 5FWXA 1UBGA 4C87A 5H4HA 4R05A 1BDBA 2C95A 1S2LA 1JHOA 1QOQB 3H9JA 4QX6A 3NC4A 4TWZA 4EZIA 4EIWA 1TUEA 1KRHA 3NT5A 3L77A 2VJAA 5DOVA 1PR3A 1STOA 4MI1A 2HI0A 3QVUA 4ND1A 4EZEA 5FNVA 5I7WA 4HWSA 4AD8A 1SR8A 2XADA 4FT4A 3K0SA 4MX8A 3Q2KA 1KQPA 3SZ3A 1E4EA 4ETIA 1M75A 2A1UB 4F4IA 3COYA 4S2UA 4QYIB 3WGQA 3F7MA 5JPDA 4DDWA 5AJYA 2J09A 3TCNA 3CCFA 2WWYA 1YAJA 1HG1A 2ODBA 1MG5A 2OO3A 2QM0A 3LAWA 3OQPA 4HDOB 4FFNA 3O2NA 1A2BA 3KJGA 3KB6A 1PF7E 3ORSA 2E82A 5DBFA 3EQ8A 3A7DA 4YXWD 5J4KA 4KPYA 4R4JA 1AIPA 4F04A 2EHDA 3R44A 2VYVA 2Y77A 4O1HA 1GFSA 3VR6A 1DEHA 3SLGA 2A0YA 4E1AA 4KR9A 1RHUA 4C4PA 1Z2CA 3GWZA 2DLCX 4CZ2A 4CQMD 1U7HA 2GEKA 2I2FA 3OM9A 4BNNA 4FFWA 5EZYF 4PYOA 4E5UA 5JY1A 1KRXA 5FOQA 4K0KB 2EBUA 4A0FA 1C50A 1WPXA 3I3SR 4YLYA 3BT7A 4UEJA 2QRMA 1XN1A 2C9DA 5I9BA 4C4RA 1Q0SA 2A5YB 5BUQA 3TLJA 2XOEA 2KPOA 1QFMA 4KAJA 3FHCB 5J2TB 2EG5A 3VR4D 4BLQA 4XVRA 4KVFA 3U3MA 3SHOA 3UENA 1PG5A 5T67A 5HM6A 3FZGA 1UBJS 2CLEB 4OSEA 4DLZA 1AT1A 1T9KA 3OOSA 5ALUA 3V8RA 5I4CA 4EM6A 5CD1A 1SUIA 4LF4B 5IJ0B 3HJBA 4JXZA 3I01A 5EHGA 2E4XA 3UA4A 3EZ6A 3PHJA 5EZYB 5C80A 3A0UA 2XAUA 4UEKA 1OASA 3CUUA 3DDSA 4A26A 3GA5A 2OXTA 4LF8B 4FINA 1KSFX 1Y1QA 3MINB 4M6WA 1SKQA 2XOKD 4C1NA 3LCRA 4D8YA 1YA6A 1ULTA 1Z29A 1EFLA 3AIOA 4D5EA 4EUEA 1E7RA 4TV8B 1MC8A 1H2XA 2WF7A 1C7IA 5L3VA 3E1KA 5AI5A 5L3ZA 2YJ4A 3CRVA 2H52A 1AS2A 5E2BA 2VBCA 2V0GA 4LOJA 1XDWA 1MOPA 4RA9B 1EWQA 2ZWMA 4KBFA 2HAEA 1XPUA 4S0XA 5F7OA 1ETHA 3KT3A 1KWKA 3MOGA 4OB7A 1PO7A 1Z07A 5FBHA 1BN7A 3RHZA 3QOYA 4HDSB 1NJ1A 1GL9B 1Y34E 3LYHA 4XX1A 5CX4A 3SVTA 5BYJA 3Q4GA 1R18A 2GXQA 3F5MA 1Z3IX 4QU0A 3ANNA 3KU4A 3IXLA 3TE7A 3N2GA 2V45A 4L7VA 4WN9B 4AMZA 2ST1A 3R6DA 3R75A 3W5DA 3QPBA 3WI7A 2QZ4A 2PRYA 5KTMA 5DO9A 1RJ9A 1Z2PX 1E3QA 2C8JA 3PTLA 2PSSA 5KS2A 4MKFA 1BDHA 4NG5A 2DTDA 5ELMA 3L93A 1UPTA 3DS8A 3OKCA 3PHBE 5JU6A 2QVXX 2V8BA 4BKOA 1PJAA 4LGYA 3CG0A 1H0SA 4D4KA 4G5XA 5CEEA 1OR8A 3KR9A 4JVLA 3ONFA 4WZBA 2HM7A 3TAUA 3R9XA 3LUFA 1DAFA 5C32A 1WVIA 2XXJA 2C1XA 3TW8B 4FKMA 2WMYA 2OP0A 3RVBA 3NJRA 1I7DA 4AG5A 2WQ7A 1PDOA 4OP3A 1ZD8A 2WG1A 3D2CA 4UBJA 4QVIA 1B93A 4ATNA 3KQTA 3A4VA 5C1BA 1JXOA 2M9MA 4X7RA 5TQJA 3OIFA 2AXNA 5ECYA 2HK8A 4QNRA 3Q12A 2I65A 3ENNA 4R41A 2ZIUB 2VRCA 3IUYA 4KQWA 5EMKA 2Q2WA 3TSOA 4FR2A 5G1PA 4DBZA 2WIBA 3B8EA 3H5WA 1QYVA 1QB7A 1SBHA 1U8TA 3A9RA 2FPXA 3M6LA 3FLMA 5JMTA 1G16A 1LJUA 1OXUA 1E3SA 4ZYVA 5K6AA 1L3IA 5SYMA 5THXA 3WBBA 4JUAA 4ZT3A 3UJ8A 1TPZA 3S0JA 2CNOA 3VX3A 4PYKA 4BNUA 1Y7IA 5AK5A 4N47A 3UT5A 4TT3A 2WWXA 1XDDA 3IVAA 3RAGA 2OZLB 1EFPA 4CMBA 4DRYA 1F1BA 3R0XA 4WEQA 4GYWA 5C7YA 4JA0A 1IBKB 1BVHA 4JAVC 1TIPA 1HO3A 1SVWA 2VT2A 4CM5A 5KX5A 3N58A 3HLKA 4UDYX 4CMAA 5AVOA 3DE3X 5KSYA 1Y4DE 1WCYA 4WNIA 1WR8A 2FY8A 3RC8A 2HBZA 2X9QA 1CUGA 4YY3B 3WAJA 3ZVMA 1ZJWA 4NP6A 7ABPA 1A4XA 3R8FA 5I7VA 4YI5A 1YRQA 3TLEA 3GJ5A 4WHMA 1CUHA 1P1FA 3KR1A 3P2JA 4RTQA 1T9BA 2OWEA 1E0AA 3EVCA 2RAPA 3HNRA 3O83A 2QY6A 2UXBB 2WU1A 3WRWA 1PK9A 1DIRA 4QC2A 3A31A 4AKTA 2ZWOA 1AF7A 2EOAA 2O7QA 2FUG6 4RF5A 3SF0A 3WRYC 2JL1A 3F6BX 4WZZA 4FDMA 1IM2A 1U8YA 4U2KA 3KSAC 4NYIQ 3H17A 5ALQA 2BJHA 3STWA 3ZVKA 3JQ7B 2IS2A 3PNMA 2OV4A 4YTEA 1GPWB 3BTUA 2OFFA 4NCHA 3CBGA 3WLJA 1UOEA 4AZ0B 1T8PA 1VKZA 4JBNA 1DAHA 4LZJA 2GYUA 5CH8A 3AFHA 2IEIA 1Y5MA 3L2OB 2W00A 2AF3C 3IOBA 3L05A 3G7UA 4I9NA 2OO7A 3JVDA 4HPXB 3ZOKA 5BWCA 3E9YA 3BJZA 4DJAA 3EEYA 1J0BA 2QJRA 2PBRA 2BW0A 1DG9A 3CPJB 3FKSD 1W85A 3EZ7A 2E4AA 3IP6A 1OTHA 4RF2A 4Y2PA 2WTNA 5DM2A 2Q5HA 4XWGA 1KQGA 2LIPA 3E5RA 3RVQA 1U1FA 2ZRFA 3T9FA 5BNTA 3E9CA 4KBGA 4PZ9A 4B6JA 4RCZA 3TTVA 4FZVA 4HNVA 3ILYA 4L0MA 4JL6A 1JHPA 1JVNA 3CLVA 5CLFA 5JQGA 3PIDA 1LJLA 1FJXA 1GZ5A 1JJFA 4BNZA 4UFOA 3FPAA 2QMOA 1LXCA 2C77A 4TTQA 1TF7A 1YZ3A 4LXGA 3BB4A 2ZYUX 4ZWNA 1LLUA 1XO1A 3PNLA 2E1RA 1I5RA 2B2NA 1O6CA 1S5PA 4F72A 3ZHYA 3CF4A 1ZZEA 2CYAA 3UCFA 3VGJA 1M7GA 4DR3B 2FPRA 2BJVA 3AKYA 2NZVG 3BQNB 2CL6X 4FYKA 4WCDA 2I67A 3DP7A 1J23A 3TOZA 1NFQA 1KO7A 4ZVNA 3GUUA 3MXOA 5HJEA 3WWEA 4DCGA 4OP2A 1JKJB 4FMDF 1NJ5A 2QLBA 5FA8A 3ROFA 1LPSA 5IJ9B 1PTJA 5KNBH 3K71B 1U90A 3K9CA 1AZTA 4HNRA 5AVTA 4DEYA 3KHKA 4Q9JA 3RK1A 1LTQA 4Q66C 2H4YA 3DVAA 2YHUA 4NF2A 4ID3A 1XTJA 3Q1LA 2DKFA 1T0UA 4R51A 3R0IA 5FWDA 3SOZA 1PV2A 2BM9A 2Q6IA 4M1WA 3M2PA 1YZGA 3NGMA 4PFQA 5FYQA 5K1ZA 3PX7A 2Z2KA 4Y18A 1OUMA 1C30B 1ZJ6A 1YS1X 4G41A 5CA0A 3QK7A 2VWQA 1W4RA 3U19A 1A72A 2XD9A 3B1WA 3SIPA 3S1AA 4L0DA 1KDRA 1HL3A 4RNDB 1R74A 3DMGA 4YUAA 2BVNA 5KNBA 3TPFA 4DILA 2ILVA 2YIVX 2R96A 1FS4A 1HM5A 1QGUA 2EDCA 4OL9A 5K8LA 1RI5A 3ZJ4A 5ECWA 2X2FA 4H6XA 5C0OE 3ZC3A 4RDXA 2HPAA 4EEXA 4KQIA 3DT6A 2O23A 4TL8A 5DTRA 3R6TA 1GZDA 3FR8A 2MSNA 5BWNA 4K3VA 4PLPA 3AK4A 1HE3A 5EUBA 1T4BA 4REQB 3WAGA 1ZMTA 4HLQB 4UW9A 3U0BA 5BXYA 5H4GA 3N0RA 2B21A 1DXYA 4BTEA 3IMEA 4ZU3A 3TQQA 3IUNA 2CB9A 4PYQA 2ZE8A 3MLEA 1RYEA 2XDYA 4PZYA 4HJXA 1OXMA 5KSZA 2QJOA 2R751 3KJFA 3AUTA 2QN9A 4CM3A 3PBKA 1YJQA 2IITA 3BL6A 4M7PA 3K05A 1FUEA 4ZOLF 5K3DA 3ZE6A 1FRNA 2BEVA 1IATA 3VTFA 4XCVA 2P5YA 2NVWA 1QVRA 3L18A 1GUAA 5BW4A 5CJJA 3A4NA 1VL5A 3ZX5A 3QU7A 1NVWQ 1PIWA 4CKEA 4RK5A 1KL7A 4U7JA 2Q21A 4CFZA 4C7VA 3QWHA 3EWSA 1U6JA 1KY4A 3PPIA 2P2CA 1Y4ZA 3E7PA 4QQ8A 2PMEA 2CVZA 4EY6A 1C3XA 4MTLA 5DEIA 4UM7A 4F3NA 2Z30A 4B6EA 2RGAA 1L1EA 1UWKA 2OCIA 3V6MA 1CZLA 2ZRGA 5LKAA 4KPEC 1H2YA 1OYVA 4V24A 5JO0A 4QULA 1FP1D 4NBWA 1WULS 4P33A 3PQ2A 1PEAA 1SUFA 1UFVA 3WGVA 4FGZA 1C0PA 1DT3A 1Z6AA 3AVQA 4XCQA 4JU9A 4W9MC 3NWEA 3KX2A 2IV7A 3IMFA 4CUZA 5I48A 5I6DA 2KLBA 3TQSA 1PWEA 5K8JB 4AF8A 4QGBA 4Z54A 5DCUA 2CGEA 4RK4A 3IP7A 3GGOA 2FKAA 4YCBA 4LRTB 4H60A 3ZDYB 3SYLA 3CVWA 4KAXA 2Z95A 2X5JO 4F9GA 3S8EA 3MC1A 2ET6A 4RIIA 1N36B 2J32A 2VS1A 3G2OA 3QV1A 1HEUA 3SOPA 1D2AA 2EL9A 4CLOA 2C94A 4OREX 5I9LA 3EHDA 4J1QA 5J1SB 4CIXA 4O8ZA 5EA2A 4WX2B 3ADKA 4MYUA 5TJ9A 3QX9A 3HBJA 3UT6A 1TUGA 3TW4A 1JTEA 3U49A 1FNBA 5EVJA 2OCDA 3OC0A 1WUJS 3HXTA 3KAPA 5CAEA 3O4GA 4HWRA 4QREA 4A6EA 1L5RA 2PWBA 5C46F 1U8FO 1QIHA 4ZC8A 2V58A 5IVIA 1V9LA 4HGNA 2YZ2A 4CBVA 1G8GA 2YJ5A 2OVFA 5JZSA 1G5QA 1OXVA 2R25B 3IIEA 1RP1A 4Q21A 3FRIA 4CTJA 3HV0A 1KE2A 4DR5B 3AR4A 2Z4SA 3LVRE 4PVCA 1DIHA 4ALLA 4MDFA 1I7SB 3M6AA 5HCNA 1W6UA 1YDEA 3LP8A 3QKTA 4FLEA 1Z08A 2HLPA 2WF5A 1HLDA 4URYR 1SQFA 3EX7C 2IY9A 3EA5A 1RDFA 2P5SA 4KGZA 4ZO8A 3FJOA 5JZBA 3UJCA 4BGVA 3WLNA 2GI4A 1HX7A 1GGFA 1WPRA 5B58T 3T3GA 1TZBA 3R3XA 1YAHA 3PHGA 2YWFA 3O5AA 3W90A 4HAWA 4RJIA 4LCEA 3IHTA 3OJOA 1QRAA 1JDPA 5DTMA 1ZISA 2QJTA 3CFYA 3MHPA 1RLUA 1U9ZA 3HKDA 4LJLA 4MRRA 3FG9A 4PBSA 1EEHA 1NQUA 4RVHA 3WB2A 3OY7A 4G0YA 4NXMB 3AGPA 3EGIA 1DWOA 2O19A 3J81k 2EWVA 2F9FA 5HFNA 4OYYA 1IHOA 2CXQA 4G5OA 4ZJPA 2WA1A 1JQBA 2MYTA 4WDRA 2YYYA 4LA4A 4F4HA 4B3DA 4LDZA 2QBYA 5EZSA 2QRLA 1DZIA 3PKIA 1ZMBA 1GU7A 5GM2A 3HY3A 3WC4A 1LLDA 1R0KA 4KFTA 4ZA2A 4GI1A 2P8SA 3V4PB 4G23A 3RAFC 1FSPA 1A1SA 2J6BA 2J67A 2XRMA 4TLEA 2ESRA 3H2JA 1AURA 1JDNA 4UBOA 4CFSA 4D57A 4Q7MB 4L02A 3WK6A 4KHPB 3Q98A 4GRIA 2HRRA 1TK9A 3CTMA 2QSUA 2XXBA 3D3KA 5BORA 4OB8A 4GVLA 3A4YA 3M4YA 2XA2A 3OZTA 4ENRA 4YT5A 5EE5B 5E6UB 1YZFA 4G86A 3OHSX 4DKJA 3KQPA 1W44A 3LUJA 1W88A 1M0TA 1NI3A 4V0KA 1SXJC 3P20A 1ADFA 3PUIA 4ZHSA 3ZWMA 3MCAA 3ROKA 3EPJA 2Z6VA 2O0JA 4FFVA 4YRCA 5C5CA 3KDSE 4MS1B 3IEUA 4FYXA 3M2TA 1Z8NA 5AOBA 7MDHA 3B12A 3GFBA 1R0LA 3KQVA 3OMWA 1QTQA 1KDYA 1OV4A 2WG0A 2HTFA 1LDEA 1WCIA 2PFGA 2MU1A 3BB3A 3I6IA 3NIBA 5DNAA 5J47A 1QC5A 2ONKA 2QLFA 4JFAA 4PCLA 5AJHA 3HB0A 2JAOA 3A3OA 1MJGM 2BEUA 2CZQA 3BICA 3O9ZA 3JZFA 3LF2A 4MR8A 1E9VA 1EUDA 2XZOA 1UFRA 4XVUA 1NE2A 2J5XA 1UKZA 5EI5A 1RC8A 1RBYA 2ODQA 5DN6A 1NJFA 3SEFA 5FPSA 4Y8VA 2OXEA 3B6IA 5AM0A 4L08A 1H23A 1QNLA 2GN1A 2OORA 2Z08A 3D2BA 5GOTA 3OQHA