2QMQA

Crystal structure of a n-myc downstream regulated 2 protein (ndrg2, syld, ndr2, ai182517, au040374) from mus musculus at 1.70 a resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
278
structure length
278
Chain Sequence
b'HHHHTHSVETPYGSVTFTVYGTPKPKRPAIFTYHDVGLNYKSCFQPLFRFGDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCILQYLNFSTIIGVGVGAGAYILSRYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPDMILGHLFSQEELSGNSELIQKYRGIIQHAPNLENIELYWNSYNNRRDLNFERGGETTLKCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein NDRG2
publication title Crystal structure of the human N-Myc downstream-regulated gene 2 protein provides insight into its role as a tumor suppressor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 90
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2007-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qmqA00
1L7AA 4Y2JA 1XROA 4YPVA 1CUJA 4KE9A 5EGNA 2PSDA 5EHXA 2XMZA 2QR5A 1MN6A 4OB6A 2DFPA 1E89A 2ACKA 5AO9A 1K5PA 4EY4A 1HPLA 4G8BA 3SK0A 4H7KA 2ORYA 4WFJA 3BDIA 2QKYA 1XRLA 1BROA 2JGLA 4RNCA 4FKBA 4Y2QA 2HA0A 1ZI6A 1HQDA 3FYUC 2WIJA 3M81A 1QFMA 1LPOA 5CH5A 1C7IA 5EFZA 5ALRA 4BAGA 2K2QB 1XQWA 2HA6A 1EB8A 4WY8A 3WZMA 2C0QA 3G7NA 4EY6A 2DHDA 2V9ZA 3O4JA 1BS9A 2J3QA 3MUOA 4WDRA 5JD6A 1JJIA 2D0DA 4GBGA 2V98A 1XQYA 2C7BA 5AOAA 2AJDA 1UK8A 4Q34A 4Q3OA 5HZGA 3G0DA 2AXEA 4JNCA 3G8YA 2ZSIA 4TGLA 4MYDA 3FLAA 1MX1A 3ZI7A 3WK6A 4BVLA 4EZIA 2PUJA 1QGED 3WI7A 3P2MA 4RPCA 1QIHA 1H2WA 1RWQA 1YB6A 2XMSA 5EIEA 2QM0A 5DYYA 1EK2A 4IH9A 2Z8XA 1K4YA 4PSDA 5ALEA 2BUAA 2QXTA 1YSCA 4ROTA 1O6FA 2JBWA 1A7UA 1WB5A 5LIPA 2OCLA 3DL7A 3D0KA 4AMYA 5D6OA 1ZD4A 5LZ9A 3WK8A 4FNGA 3WKAA 4B6GA 2VA9A 3G0GA 1Q83A 3QPAA 1XZAA 4B85A 2XUOA 1WCYA 1NX9A 3I28A 5DNVA 2JGMA 3DKRA 4X94A 1N8SA 3D2CA 2WUGA 4U2BA 1CUAA 2XQKA 3NOXA 1JMYA 3WZLA 1ZICA 3LLCA 4E15A 2YH2A 1MAHA 3AZOA 4EA6A 3WK4A 1KEZA 1N5MA 3F97A 3HXKA 3WKBA 5DNWA 4FDMA 4CIBA 1K8QA 2DHEA 4LXGA 4TPKA 1EDBA 2QVBA 3AILA 3G0CA 4Q3KA 4W1SA 4PNZA 2Y2VA 4Y2PA 1H2ZA 4KE6A 1YR2A 1ZD3A 2O2HA 5T4FA 4OUKX 3STXA 4F5ZA 3K9BA 1XRRA 3DEAA 5ESRA 1PFQA 3H1AA 2HA3A 3VJLA 5HFNA 3L1HA 4QDUA 4ZGBA 4LKOA 3I1YA 2WKWA 4L0CA 1J1IA 4BATA 3DDUA 3C6ZA 4HTAA 2ONCA 4OSEA 2C5GA 1WPRA 2WUEA 4ZV7A 1THTA 5HCUA 2HA7A 3A2LA 1B6GA 3OC0A 4GI1A 3WYNA 1Z68A 3Q0TA 2Y6VA 3STTA 2QS9A 4U2CA 3M83A 1HDEA 1WB6A 4OPMA 1UFOA 2QUBA 5DJ5A 1ACLA 1CUVA 2VEOA 4X7BA 1MX9A 4BCCA 2GBGA 4CCYB 3WIOA 2I3ZA 4FOLA 2X76A 5AI0A 4X3CA 2QJWA 2RONA 1XFDA 5JYCA 2B4KA 5T4EA 4J0KA 5IVKA 3V1MA 1TK3A 1N1MA 4G8DA 1FFCA 4ARAA 4LIPD 4EHBA 2OGSA 3T52A 3WL8A 4MYSA 1CUZA 2J4FA 4QDXA 1F0PA 4UBMA 3I6MA 2G4LA 3UUEA 1GPNA 1VZ3A 1XLUA 2PSEA 4F60A 4DNOA 4W63A 2XUJA 5KWJA 2Z5GA 2B9VA 3CN7A 2WJ6A 4X6XA 2XUGA 4Y2SA 3DYIA 5CXXA 5AK3A 4ZWNA 4W9RA 3HACA 3UMJA 2VAVA 1BN6A 1XRNA 4KAJA 5AOCA 1YASA 2QZPA 3O95A 4B82A 5A71A 4FWBA 4Q82A 4UBIA 3BL8A 1Y7HA 4B83A 2BAGA 3WL5A 3O9MA 1GXSA 1E8MA 2H1IA 1TRHA 1WOMA 3LS2A 3HSSA 3FBWA 1XZEA 5CT9A 2XUQA 2ES4A 3I2FA 4L9AA 5A7GA 5FP0A 1TCCA 4QDOA 1A88A 3TJMA 2HA5A 4G9GA 3YASA 1EA5A 3QYJA 2CUTA 1JFRA 1UWCA 3ZLUA 1CUGA 4BBZA 4J7AA 3NWOA 4G4GA 4IHAA 3IULA 4DNPA 1ZOIA 4MQLA 4S0XA 1XZGA 2QJRA 1Q84A 1A8UA 4HXGA 2PPLA 5ALIA 1Y7IA 4W1PA 4UBNA 1SC9A 2HU5A 5KBYA 1EVQA 1WHSA 5BWBA 3WWCA 5AIAA 1L7RA 5E2IA 3BJRA 3VVLA 5IVHA 1QO9A 3F96A 1XZDA 2XE4A 1MPXA 1ODTC 3G02A 3ANTA 4LYDA 4TVKA 3I2GA 2ZSHA 1EB9A 3PE6A 1HLGA 3O4GA 5YASA 1YAJA 5AIBA 3BIXA 4DNQA 4MJ3A 5C8ZA 4BP8A 3PUIA 2IX9A 4IH1A 1FSSA 1J07A 3L1IA 4BTVA 5AKYA 1W76A 5H3HA 3IB3A 2YASA 1IVYA 2GYUA 2PM8A 2CKMA 5JZ9A 1EI9A 5CT5A 3AJAA 3G9UA 1MNQA 1X2EA 2JIDA 1LLFA 1MX5A 4K6HA 3VVMA 2DHCA 4G4IA 2XUHA 3IUQA 1VA5A 3I2HA 4EY5A 1DT5A 4YX9A 5JATA 1YS1X 2HA2A 3ZWQA 1ORWA 2JGIA 4GEGA 2HDWA 1R9MA 5AKKA 1GPKA 1SCQA 3C6XA 3TRDA 4C89A 2R8BA 1F0NA 5LLSA 3VXKA 5CMLA 2RGUA 2HM7A 1J06A 3S8YA 3H18A 3STWA 4BZWA 4AN0A 1QIFA 5KWIA 1XQVA 1ZJ4A 2I78A 2BKLA 5AOBA 4X90A 4H77A 2WFLA 3KDAA 5ALUA 4DGQA 5ALWA 2WHPB 1JU3A 4QWMA 5JAHA 5DTJA 4JH0A 2WIDA 1JT2A 5ALHA 1VXOA 2PU7A 4C01A 1MTZA 5LZ4A 1QIEA 3FYUB 2Z8ZA 1BU8A 4LXIA 5A62A 5ALMA 4X71A 3LIIA 3B3QA 1O6GA 1UOOA 5JIBA 4ZV9A 3AFIA 1OCEA 4JUIA 1LPBB 1SCKA 4G8CA 1WHTA 1E8DA 2XUAA 4KJXA 3WWOA 5AI9A 5C81A 4BE9A 1DWQA 3GROA 4IH4A 5ALPA 4GDMA 3HRHA 3CCBA 1E8NA 5CT4A 4J0DA 4ZRDA 1E66A 2V96A 3WKEA 5D3KA 4EY7A 3G0BA 3DD5A 4KEAA 1UK7A 5FXMA 5JZBA 3D7RA 3MGAA 4FMPA 5FUMA 1CIJA 1IUPA 1DWOA 2C0PA 3WL7A 1LZLA 1A8QA 2IITA 4UBKA 1QIMA 1DX4A 4DMKA 5ALQA 5K3AA 4RE6A 4HZGA 1BEEA 2Y1KA 4RE5A 3ESBA 1MNAA 2OCGA 3V9AA 3PUHA 4X97A 3BJMA 5AKEA 4M0FA 1ZD2P 4BAZA 2HL6A 3WKDA 3R41A 3H2GA 3H2IA 2XQFA 5IH7A 3FYUA 4X93A 3IDAA 3C45A 3EBLA 4GECA 2OQVA 2B20A 3AZQA 3WIBA 5KREA 2GYWA 5AICA 3G9ZA 4QLAA 1P0PA 4UFNA 4QLOA 3U1TA 1RYYA 4CG3A 5A6VA 3ZPXA 1GGVA 4AN1A 3R3YA 1R3DA 3GELA 5CT8A 1G5FA 4UBJA 3MVEA 3NGMA 3RKSA 4HVTA 2H7CA 1T2NA 5CH3A 2XQJA 3OTQA 4WJLA 3WK7A 4DLNA 4Y2VA 2HADA 3OG9A 2O7VA 5AKXA 4BCDA 1QTIA 4QDZA 2B61A 3IUNA 4KYVA 5FOQA 3W2TA 3R3VA 5A2GA 2DR0A 1CUXA 2GYVA 3F98A 5FV4A 2WTNA 4BRZA 2ZYRA 1MJ5A 5K3CA 1SCIA 4NVRA 2WSLA 5CH8A 1S8OA 3DNMA 1LPAB 3R3ZA 5K3EA 3KWJA 5FLKA 1EH5A 3VISA 3R3UA 1H2YA 2QUAA 2XUFA 4A5SA 4UPDA 4LHEA 3FSGD 2C58A 1YA8A 1F8UA 1SOMA 4UHCA 4QWWA 4QA9A 3DOIA 4GLBA 2VTVA 5AKGA 4U2GA 4EB0A 1ZJ5A 1YA4A 1QZ3A 3RARA 2HU7A 3FVRA 4M0MA 2UZ0A 1XLWA 2WG1A 1ZIYA 1HKHA 4WFIA 1HBJA 3NUZA 4QE3A 3I6YA 5AHXA 4N8EA 2NW6A 5SYMA 1QIIA 5FDFA 1GZ7A 4OU4A 2WFMA 3PICA 2RHWA 2VQ6A 4Y2UA 2OAEA 4FHZA 4AZ0A 3SC2A 3C43A 3HC7A 4X6UA 4G9EA 3WKCA 2VT7A 5AM4A 1QFSA 3OOSA 1GT6A 1VKHA 1UK9A 4PSCA 2E3JA 1CEXA 3HJUA 5HK9A 4X92A 1BN7A 3FAKA 3D4LA 1K6EA 4HXFB 5DYTA 3QVMA 2WTMA 1TIBA 3A2NA 2X8BA 2DSNA 4DMCA 4Z49A 1AMNA 2EDCA 4BDTA 4HS9A 3SWWA 3CCCA 1CUCA 4Q3LA 5FRDA 3G0IA 2J4CA 1DQZA 2XUPA 2ECFA 3EQ8A 2C4HA 3E1GA 2ZJ6A 3LCRA 5IVIA 1IUNA 1DT3A 5AK5A 4L72A 2O7RA 2VJAA 2Z3WA 1GKLA 3R0VA 5JASA 4CI9A 2ZJ7A 3DKKA 1USWA 5FPPA 4KAAA 1MAAA 3D3NA 5HFAA 3C8HA 2HIHA 4B9EA 4ZREA 1ACJA 3BF8A 2I03A 3AIKA 1WM1A 2H9YA 4MWSA 2FJPA 5EI5A 1CQZA 2VJBA 3AINA 1ETHA 4C4YA 5LZ8A 1DWPA 3B12A 3QITA 4W1RA 3L1JA 1BCRA 1CRLA 4JYMA 3V1KA 3WWEA 2YYSA 4H18A 3TEJA 5D7BA 4CFSA 3PDCA 2OQIA 1R88A 3H2KA 3T4UA 2PKYX 4P9NA 5DTIA 4UHBA 2OGTA 4OYLA 4AB1A 1THGA 4X95A 3FWHA 3S2ZA 5HF8A 5ALSA 5AI6A 2XQGA 3F9CA 2XMBA 1BE0A 2BGRA 3QPCA 2YXPX 1EK1A 5K3BA 2I3DA 3C6BA 1Y37A 5JZSA 1CUIA 2PSJA 1VE6A 3AIMA 1CVLA 4K6GA 4INZA 4CCYA 2WU3A 3H17A 1W52X 4G5XA 3RM3A 1CUSA 2PVSA 3KXPA 4H7JA 4PW0A 2XMDA 3WYDA 3FYTA 5C7YA 4DTCA 2CZQA 2QT9A 1UKBA 4P08A 2PU5A 2PUHA 4WDQA 1OXMA 5ALYA 3JWEA 3DS8A 3C8DA 4H7DA 3ESDA 2G5PA 5AJHA 4EBBA 2JGFA 1W1IA 1JJBA 2H7YA 2Y6UA 2OLEA 3H0CA 5AK4A 3OM8A 3ZV7A 5AKIA 2W6CX 1QO7A 1YAHA 5HK8A 5JD5A 4BC0A 2WLSA 3C5VA 1XZFA 4J3JA 5ALVA 3QZUA 1T4MA 2VAXA 2WG0A 3R3WA 3RLIA 4KRYA 4BB0A 1N5RA 5AKJA 4A16A 5JAOA 5E4TA 4H35A 2XMRA 4B81A 3IVMA 3B5EA 3A6ZA 3FVTA 1LPNA 1P0QA 3D2BA 5D3ZA 3WLAA 1G42A 4OCZA 2EDAA 4V2IA 3H04A 1IZ7A 1XRMA 4GHWA 1EDDA 4ETWA 1BCSA 4CG2A 3G9XA 2QOEA 5EIAA 1ZGCA 1DX6A 3DCNA 5ISMA 1BEZA 2V97A 2XB6A 2FJ0A 2Z3ZA 3E4DA 4OD0A 3AIOA 2XUIA 3C70A 3WJ2A 2PSHA 4ARBA 5AI5A 5LP1A 4UUQA 3O9VA 5AM2A 1ZI9A 4DSAA 2FUKA 2ZYHA 5ALOA 1XZLA 1U65A 2XLBA 1VA4A 4B7ZA 1X70A 1U8EA 4C6HA 1IZ8A 4J0HA 2JF0A 3I2KA 2AJ8A 4DYHA 4BP9A 5DNUA 1H22A 4MQMA 5LZ2A 3SX4A 4AZ3A 5T4BA 3HLKA 3W04A 3AUKA 1W4LA 1DINA 4J0GA 1LBTA 2HRRA 3VDXA 4BVKA 5HQ3B 1JU4A 3I2JA 1TKRA 2QTBA 4FTWA 3QPDA 5CBKA 2X5XA 5CXUA 5ALXA 1CUYA 4U2DA 4XWGA 1QLWA 2ZJFA 5ALLA 1YS2X 3VJMA 7YASA 3IUMA 3STUA 5DLPA 2BFNA 2OXEA 4Y7DA 4UHFA 2OGZA 1CFJA 5LZ5A 5HKAA 1GQRA 5AM1A 2BCEA 1LGYA 4HAIA 4J0IA 3BXPA 4O08A 1FFAA 2OPHA 5CTAA 1XQXA 3GZJA 3IUJA 3ANSA 2HFJA 1EVEA 5FPQA 4UHEA 4H7EA 5CRIA 2RI6A 5LYYA 4X00A 5SYNA 3PFBA 2XUDA 1F6WA 3WJ1A 4C4ZA 3DQZA 5ALGA 3U0VA 3R40A 1LNSA 5JARA 1FFBA 2WM2A 4AMZA 4G4JA 3FSGA 4Y2RA 2C5FA 2XUKA 4MWTA 4DNFA 1DTEA 3GFFA 1VE7A 4ITVA 1AGYA 1TCBA 4FBMA 2XMCA 3ICVA 1QIDA 3F8SA 4BZZA 1G4HA 3KWFA 4BYMA 4WY5A 1CUUA 4B84A 3G9TA 4J0JA 1QTRA 4MEAA 5HQ3A 3HI4A 3IA2A 5HF9A 2WHPA 1TAHA 4FLMA 4KAFA 2G5TA 3KSRA 1XKLA 3QMWA 2VJDA 4PQEA 5ALTA 4UBLA 3STVA 1ODCA 2DQYA 4DM7A 1XZIA 4ZI5A 3PFCA 1ZD5A 4AXBA 5T4HA 5CW2A 5HF5A 3KD2A 5C8VA 3C5WP 4NZZA 1UKAA 3HZOA 1MO2A 4GW3A 2P8SA 4U2EA 4UBOA 4J0CA 5K5EA 3ZLTA 4KE8A 2G63A 3IIIA 1EXWA 3QH4A 2HHAA 6YASA 3DJYA 1AURA 1DU4A 5AM3A 4DMHA 2EEPA 1KU6A 1Q0ZA 5A7FA 1CUDA 3ZLVA 4CIAA 1JMKC 5J3JA 4C87A 1ISPA 3FLBA 4L3WA 5EHNA 1XRQA 2XQIA 3IURA 3ESCA 3BE8A 2OCKA 5EHZA 4A23A 4QEKA 3FCYA 5LKRA 1YCDA 3EQ7A 5I9IA 4XJVA 1C7JA 2WILA 3I6ZA 4KACA 1FFEA 1GKKA 4QNNA 5AM5A 1CLEA 1IUOA 3BWXA 4WCVA 5AKZA 2VJCA 1LPPA 3EF3A 1QJ4A 2FX5A 4H7FA 3V1NA 3K2IA 2BJHA 2WUDA 1RP1A 3ILSA 4XIIA 2BUBA 1EDEA 4CCWA 4JYPA 2BGNA 2PX6A 2PSFA 2WHQA 3W06A 5I8PA 2LIPA 4FFWA 3JW8A 2QMQA 1IMJA 3OURA 3VKFA 2GZSA 1EINA 4YK7A 2XDWA 3QMVA 1NU6A 4G1FA 5AP9A 1CV2A 3V1LA 5JD4A 4P93A 1CUHA 4HRXA 1CQWA 1HL7A 1CUFA 1DQYA 2CMFA 2VATA 2PL5A 5AH0A 1AX9A 1LPSA 1QE3A 1G66A 3QBJA 2H7XA 3W9UA 5ALFA 3TGLA 3STYA 4E14A 5CT6A 2J3DA 2WG2A 2GZRA 3N2ZB 1CUEA 1H2XA 5E4JA 1CPYA 1CUWA 3PF9A 1XZJA 5I7UA 1LBSA 4E46A 3BF7A 1QIGA 2AJLI 5IKXA 1H23A 4JEIA 1QIKA 3H2JA 4UFPA 2QRUA 4FLEA 1KU0A 4K5QA 5LZ7A 3WK9A 5JALA 4K2AA 1XZKA 3H19A 3M82A 5FKJA 3QM1A 1WPXA 3DYVA 3C6YA 4F0JA 1U4NA 1FJ2A 5AKLA 3H1BA 4Y2XA 1AKNA 1ODSA 4AO7A 4AO8A 4X85A 4C88A 2VSQA 1XLVA 1U2EA 4GWLA 4ZXFA 5JADA 3GA7A 2XLCA 5CURA 3CXUA 4LYEA 1P0IA 3JYHA 1LPMA 2DCMA 1GQSA 3W9BA 1I6WA 2R11A 5EIHA 1P0MA 4CG1A 1AQLA 4AQDA 4C4XA 4DSZA 1QIJA 5ALZA 3I2IA 1ORVA 3WQHA 4OYYA 1AC5A 4I4CA 2WHRA 4J03A 3M3DA 1VJ5A 2WU4A 3EIOA 1PJAA 5BV7A 4BDSA 2RAUA 4MEBA 1B41A 3I1IA 4BTLA 1R9NA 4FNMA 4WFKA 1X2BA 4M0EA 4BCBA 4OB8A 4IQ4A 2Q0XA 1SFRA 4LXHA 4XX1A 1XZCA 2HA4A 3DLTA 3QMMA 4BC1A 3GUUA 1VOTA 3LP5A 2PBLA 3VJKA 4Y2TA 2IIVA 1EX9A 4N5HX 1J2EA 4N5IX 4DIUA 3X3HA 2ZYSA 5ALJA 2XMGA 3C87A 1GPLA 5ALNA 3DL4A 4BE4A 2WUFA 1LZKA 1JI3A 1E5TA 4OU5A 3WWDA 4IO0A 4BRSA 5JAPA 1A8SA 4NMWA 2D5LA 1TQHA 1ZI8A 1FFDA 4B0OA 3H2HA 3IBTA 5K3FB 1XRPA 2ZYIA 4RGYA 4EUSA 2WQZA 4I3FA 5AM0A 4Y9SA 3EQ9A 4HXEB 1UT6A 2JEZA 4YASA 5DYWA 3D59A 4QZVA 1L7QA 4UHDA 1K63A 2GBIA 3ED1A 3GBSA 4PF1A 5AI4A 1D07A 2XT0A 3PF8A 4NS4A 4AX4A 2AJCA 5EHQA 2CJPA 5DWDA 2WIGA 3D5EA 4EY8A 2WJ4A 2CBGA 3F67A 3UUFA 1JJFA 5HF6A 1M33A 4KR0A 3WK5A 5E4YA 1VLQA 5ALKA 1VZ2A 4HRYA 2WIFA 3WA7A 5A7HA 4AO6A 1XZBA 1R4ZA 2HRQA 5ALDA 4E11A 4H7HA 4H7IA 2WIKA 1UK6A 3D2AA 1QOZA 3O4IA 3E0XA 3FCXA 4B0PA 2WFLB 4GXNA 2OAGA 2W22A 4B80A 2WFZA 4DMFA 2OG1A 2CEKA 2QXUA 2WJ3A 4UHHA 3R3XA 5K3DA 2VT6A 4FBLA 4X91A 5K3FA 2O2GA 3HYSA 4Y2YA 1TCAA 4I19A 4KE7A 2HU8A 1BRTA 5JANA 4K6KA 5HKBA 1CUBA 4BAUA 2RHTA 4BVJA 4N8DA 5IVDA 2XMQA 1UXOA 1W75A 5BWCA 4XVCA 4H0CA 3O4HA 4FLFA 1VXRA 1Q0RA 1EHYA 3E3AA 1UOPA 1XKTA 3WWPA 1YB7A 3FLEA 3BIWA 5BOVA 3FNBA 1AZWA 3K6KA 1WB4A 2JEYA 3WMRA 3V48A 4Q1VA 4KRXA 4X6YA 1AUOA 3DOHA 3Q8WA 1C4XA 1XZMA 4OB7A 2ACEA 2ROQA 1E3QA 2BUCA 1R50A 2GBCA 4FFVA 4Q05A 3N0TA 3A2MA 1NU8A 5F4ZA 2JGJA 3HEAA 4QDTA 3HABA 4PSUA 5JAUA 3OPMA 1W6RA 1CR6A 3WA6A 2OCIA 5AKHA 1ZIXA 3KOOA 1UZAA 5LKAA 4MXDA 4B9AA 3CN9A 5C8XA 2JGKA 2HFKA 3RK4A 2O2IA 2XI4A 3O0DA 2DQZA 1UKCA 4W1QA 1PV1A 5AK6A 1MU0A 2ZVDA 3W05A 1XZHA 2JGEA 4F21A 3PI6A 3AZPA 3WL6A 2AJBA 3LIPA 1R1DA 3ESAA 3MUNA 4N8SA 5AI8A 1OILA 2GBFA 4D9JA 4PV7A 2VF2A 2Y2UA 3BDVA 1ZGBA 2RIPA 1UOQA 3ICWA 4UFOA 1MT3A 1JKMA 4U2FA 1QONA 3FOBA 4P92A 3A70A 2CB9A 4PO3X
chains in the Genus database with same CATH superfamily
4GU5A 1LSSA 2EFHB 2VAPA 3CHYA 5FA8A 1OBCA 3FI9A 3UK6A 4YPVA 4KE9A 8LDHA 3GJSA 3CRRA 3ED5A 4MMZB 2W71A 3L01A 1CNMA 2ODPA 3A9WA 4UEOA 2YFQA 3SLRA 4KXLA 5AJTA 3W79A 2HK9A 4R1NA 2JZCA 3QTLA 2O5VA 3PPXA 1IULA 4R0VA 3L8YA 3HO1A 1N6NA 2G1PA 5FWNA 2BF7A 4C0JA 2DFPA 4LFCB 1URPA 1Y48E 1XYVA 2ACKA 4R68A 3G2LA 5AO9A 5LXTF 2PKQP 4C05A 2B1IA 4LGCA 2RE8A 3C85A 3Q6MA 1LF0A 2P3LA 2FUG1 3U4IA 5IN4A 2ORYA 2ZBEA 4PNEA 1IBKB 1DKNA 1KFJB 2V7EA 3CS3A 4RV9A 3WTBA 3KZOA 3SD7A 2IH5A 4NOLA 4ZC8A 3KPJA 2II6A 4KX5A 1YVPA 3BSSA 3FLMA 2JGLA 4RLFA 1F17A 2W2LD 4RNCA 1DEOA 1E9RA 2PNJA 1QZXA 1VLLA 5FBZA 4MB6A 4DXDA 1Y1PA 3U9TA 2HA0A 2HIGA 1T5DX 3SF8B 2I6QA 3EC7A 1QC5B 4P80A 4RPHA 1O97D 1NMZA 5J59A 1ZHFA 2VBFA 4G37A 4CKEA 1LPOA 2KW5A 3TDMA 3PBKA 2R65A 3IDSA 4PRYA 3GAZA 1H2BA 3C74A 1NLUA 4IKPA 5CYFA 5IF9A 5EMHA 5DI3A 1PRYA 2Z1DA 3EWSA 3UAXA 4CPDA 3EDYA 1RFLA 4R5MA 2J09A 4D3ZA 1CB7A 1EUDA 1ESDA 2G08A 3IP9A 3K2QA 3MCTA 2UYCA 3GDOA 3F2VA 2W8BB 5IANA 3Q3JB 2HDNB 1T0HB 2HA6A 2YFHA 2J5RA 1H3NA 3OP1A 4QFMA 3WLQA 4BEJA 5LNK6 2QNIA 4AAYA 2FSPA 3ER6A 5TR9A 2VCHA 2CZCA 2GTIA 2WM9B 4UUMA 5E1DA 3RJTA 3FZEA 5BSRA 3P9QA 2D74A 2P2SA 4NPCA 1EP2B 2WWFA 1BS9A 1JAIA 2J33A 1Z4LA 2IYEA 2J3QA 1XOIA 3FCUB 3NM4A 5IBPA 1C5KA 1U0SY 2NSJA 3JSAA 1GRQA 4PLCA 3ESXA 5EE3A 1DL5A 4GSKA 4HDSB 1VJGA 2DZDA 1BWRA 1RMTA 1OLOA 2G9UA 2PQMA 3D4PA 1RE1A 3F5SA 3IAFA 4XPIA 1E2EA 1SXIA 5AOAA 1OXBB 2RAFA 3RRMA 1UK8A 2A0UA 2QZZA 3K32A 2R0QC 4LJAA 3Q9UA 2CLLB 1Q1QA 4IP0A 1DSSG 4Q93A 2XD9A 1EDOA 4Q3OA 2GCOA 5HZGA 4B3MB 1MIOA 2WF5A 1Z6QA 5C2JB 5I4IA 3KXKA 3R5KA 1YQDA 2B92A 5FI0B 4R4JA 2F9FA 1R9GA 5B7GA 5JMTA 4TYNA 2IHNA 3CEMA 5F9MA 2A5GA 4AZ0B 1D5WA 2SKDA 4TZ6A 3P2EA 5CJJA 4F5EA 2NQ2C 2R85A 1OX5A 4TGLA 1KSGA 1V3QE 3LT2A 4X62B 3MTJA 4BVLA 4EZIA 1EBUA 3WIUA 4E5SA 1RYBA 3HRIA 3P2MA 3WI7A 4CM8A 4WGGA 1E9BA 3WG9A 4AT1A 3C8UA 2E48A 1B76A 2AL7A 4NPHA 2G9VA 2YY6A 1KS2A 2L19A 4MW4A 1LX6A 3DAYA 1YB6A 3CSSA 3RAGA 5BUSA 5HGJA 4HLUC 3V1UA 3RS0A 4MDEA 4X66B 4DJJA 1GRNA 3ZXXA 2RC6A 2YZMA 1EK2A 1W73A 2VJPA 3HDJA 5KC9A 4ABYA 1SM4A 1ZSYA 4DYDA 4ENUA 2CK3D 2MOKA 1X1CA 3M4XA 2MSNA 2O0LA 1ONSA 3K9FC 4EYGA 3R7NA 3OF3A 4OIFA 3U7GA 1MPTA 3QP9A 1REQB 2BUAA 1NIPA 1YSCA 4MQ4A 1NR7A 3IKMB 5CEFA 3I62A 3A7EA 5ICSA 1BA2A 2JBWA 2DY1A 4IHJA 2DKFA 1A7UA 1A9TA 1FYEA 2AEMA 1XC7A 3WB2A 4I1IA 1UKEA 4BNXA 3DL7A 5A3QA 3D0KA 4ZOBA 3NUQA 1YWGO 1UPTA 4HAWA 1PHPA 4XDGA 5GGXA 1UEJA 3HDQA 5C53B 5LZ9A 2ZAGA 1N2ZA 1UJBA 1YJXA 3WKAA 2F8MA 2IVFA 2YJ6A 3L77A 5LD2C 5EKUA 3EHEA 4BV8A 5THKA 1WL8A 3REOA 5DI9A 1X86B 2VA9A 2UKDA 1HDOA 2CXHA 1TTTA 3AR6A 3E15A 4HL6A 3OO0A 4ALNA 3IT3A 3P9KA 4B85A 3AOEC 1TW3A 1JXOA 5C1PA 5JBQA 1B23P 2J59A 2QRLA 4D57A 2JGMA 2LDBA 5HIMA 1T24A 3DKRA 3ZU4A 4IQ0A 2HWXA 5ITZB 5L53A 1WUTA 1TFRA 4GIBA 4U7JA 2WUGA 5FUYA 3PE4A 4IYRA 4W5TA 2Z08A 1I2MA 3NPMA 3SLKA 1IB6A 3H5WA 5KTKA 1JMYA 4RQTA 3NYWA 1ZICA 4L15A 3GEHA 2C59A 4TRNA 4JI6B 3ZCRA 3VZQA 1XD8A 4OQPA 3IMKA 3TIVA 4E15A 9ATCA 5KNDD 4R3WA 3C3PA 2XSZD 5KCMA 1Z17A 2MTBA 3RD5A 5JRJA 3U3KA 5K0TA 4H60A 4TS3A 5CD9A 3L7MA 1Z38A 2CXRA 3HZZA 4O4LB 2YWEA 2FSIA 4F2WA 2GK7A 1G8MA 2HPVA 4U3JB 1FUUA 1M1XB 1WCXA 3HXKA 5IJ9B 1N3LA 4PTLA 2I4RA 1T4DA 1F4PA 1GIAA 1XCLA 3CLHA 4LHXA 5AUOB 4V2UA 1DAIA 3JVVA 3KKMA 2V03A 2DHEA 2YR0A 3WC4A 5EJ6A 1P33A 1WXHA 3SN6A 3CIOA 1WW2A 3IO3A 4LYYA 4XDHA 4D5GA 3GA0A 1USIA 2B82A 2BGLA 3EASA 4N5DA 1U0GA 1DPFA 4W1SA 3TIIA 4PNZA 2Y2VA 4Y2PA 3DSRA 3MCUA 2GUWA 4YIKA 1GR1A 2OXTA 3LQFA 2PSSA 5BOSB 1QZUA 3ZZUA 2A0YA 2O2HA 1NW7A 4QYSA 4GC9A 3KHTA 1D7AA 2Z09A 4LJYA 4OUKX 5DBIA 3STXA 3WHLA 2E4ZA 721PA 1XRRA 3DEAA 3GVIA 4J3FA 1Y3AA 2AI2A 2C9CA 3A58B 3KSMA 4PBSA 1EZ4A 5CNMA 2PL9A 5ESRA 2HEGA 2J30A 4I1PA 5P8WA 4EKYA 1AY0A 4JMLA 4KLRA 3FSRA 4TV8F 5EOVA 4KVZA 1VCHA 3PLNA 4YT8A 2HA3A 2Q62A 3HLTA 4INOA 5EJ5A 4JJGA 4AFNA 4UTPA 4L5IA 4QDUA 3S7TA 4D98A 4DA6A 3IQZA 2XH8A 4ZGBA 4MHSA 2C8LA 3C98A 3N3BC 3CPJB 3W90A 2H2AA 4UVEA 3L4KA 4J1NA 3PUZA 1OIVA 2BGMA 1W46A 4K05A 4RU1A 5IDYA 5JNTA 1TGVA 5EXDA 4DCSA 3MTQA 2BHRA 3C6ZA 3IAM1 3R0JA 4HTAA 3LY5A 4BATA 1VPTA 2OQ2A 1O9HA 5KYWA 2C5GA 3DZDA 1WPRA 1DG3A 1YUNA 3HJGA 5FBLB 4KHZA 1K1EA 4MS1B 5K05A 4JYAB 2WUEA 2CNNA 3HY4A 1X0VA 3LKDA 3A2LA 4R9SA 4DY6A 5M3BA 5FFFA 2J0QA 2Y9MB 5CJ2A 3LL4A 5LXTB 2HBRA 1Y6JA 3RKRA 3TN7A 3TPZA 3PD1A 3HSKA 3ZV5A 2Q8QA 3RG2A 2E1RA 3UCFA 3A6JA 3VAYA 1IHDA 4Z9FA 2A5DA 5A1TA 1EFKA 1K06A 3HB5X 3M83A 1F6DA 4E1BA 1SXHA 1ACLA 1DOZA 1F38A 2HK7A 1T13A 3FJ1A 4OQDA 2OP0A 1FNDA 2FN7A 2ZUSA 1MX9A 4IY1A 2IA5A 2ZG6A 3EA5A 1N2JA 4X7BA 3RJZA 1T5LA 1PR4A 5ERGB 1Z07A 3L7KA 4O4IA 4BIIA 1LDBA 2I3ZA 5FQNA 2AFHE 2CXPA 4IIHA 1YOVA 2GEFA 1KBZA 2MSCB 1KY3A 1M76A 1XLTC 2O0KA 2WTBA 4WLEA 1J8YF 2D5CA 2PNFA 2AT1A 1WKBA 1N2GA 4HN2A 2ZIZA 1VHTA 1SXQA 3Q10A 1U6IA 4GP6A 4EUFA 3M9WA 3H5VA 1DKRA 3PGMA 4U63A 4ND1A 5D5PA 3V00A 3ZCUA 3RQSA 4BUCA 1CJTC 3UV6A 1L2TA 3QE2A 3CUYA 1M0EA 1W34A 1EWVA 4L1KA 2GETA 2VDQB 3MAGA 1U8XX 4I6EA 4LQDA 2AOTA 3TOCA 3V1MA 1MB0A 4BBJA 4G8DA 2VHEA 3VH3A 4ARAA 3HDGA 5LOVA 1W2HA 3O47A 4GMHA 4OUDA 2CCGA 3CUVA 3H97A 3CZPA 1N75A 3OJWA 4KXWA 3WL8A 3GJ8A 1NUTA 3SOPA 3WAKA 4B7AA 3HU3A 4RHTA 3L49A 3W8EA 1WHSB 2HNAA 1CUZA 4FGWA 3RYCA 1U2TA 1XMQB 2NT4A 2YV2A 1RQ2A 4BO2A 3KZVA 4E22A 1I7DA 2PX5A 4B35A 2BTEA 1RQLA 4WNCA 4X84A 2JHGA 3BMOB 1M2VA 5JSKA 5IHPA 1V37A 3CEPB 1E60A 3DO5A 1GPNA 4FYHA 1QRAA 3ROGA 1OLXA 2PSEA 2X41A 3LHFA 4M76B 3ND6A 4F60A 3UMMA 3PT9A 3GNLA 2HBQA 2V9CA 3BQMB 3ROTA 1N8TA 1IHPA 1ZD9A 3DDSA 2HMYB 3ZWYA 4C9BA 3IHKA 3DVAA 3LUJA 3P7MA 4P0PB 4Q4JA 5CM9C 2BEUB 4Y2SA 1SIBE 4LJ7A 4PWYA 5KYNA 1XAIA 2BSAA 4MRAA 2P4HX 3OWXA 1DKQA 4WBNA 3N8IA 4IOKA 1G0OA 2NU6B 4M1EA 3IVXA 2I6FA 4NEHB 2CHUA 2EAUA 2X5NA 5EUQB 4O59O 4KAJA 3S2IA 1YZNA 4F9FA 2PZMA 5BMVA 5FL3A 3VGPA 3PPYA 3N75A 5THQA 1DFHA 3O95A 1W87A 1MUUA 1YV9A 5JLAA 5JXHA 5SICE 2NMVA 1COWA 3GPIA 4H6VA 2FKNA 2PR2A 1E2KA 3CX7A 2NZVG 3BL8A 3ZK7A 3AVVA 1P5RA 1FS4A 4GPIB 2I34A 3O9MA 3QGMA 1E8MA 2VJKA 3PNSA 3O38A 2HDHA 3QYPA 1KH1A 3ZD6A 1XVUA 3K8QA 5EHGA 5C5DA 4N41A 1YI0A 1F8GA 1TUBB 3I5UA 4TMYA 1VM6A 2E85A 5F98A 3B3AA 2PIDA 5CT9A 3OCXA 2XUQA 1E2DA 1XU4A 2VF7A 3T3NA 2WJVA 4N82A 3O7MA 4CLOB 2ZE5A 3DBRA 3ANNA 2FOXA 4TTJA 3N6XA 3EE6A 1P2BA 4NYMR 4RZ2A 1XBTA 2HA5A 1Q0HA 2O3SA 3AERB 4G9GA 1ISSA 4BLOA 3QSYA 1RRPA 1XF9A 1P31A 4YS6A 3K0AB 2WAAA 4RQUA 1UWCA 3NIBA 4KQIA 1PVDA 4DV2B 3C6MA 1TJPB 4M9CA 1M0TA 4KYTA 2YV1A 3V8PA 4DNPA 1KETA 1E1RD 2NTJA 3I92A 5FB3A 2WVGA 4HAXA 4KVFA 5D6NA 3MT7A 4QRDA 5AOVA 1QK3A 2FOIA 2I4OA 2IEIA 2QJRA 1Q84A 4FDVA 4L5CA 5EWLA 4CMEC 1I4WA 5ALVA 1A8UA 3CVJA 1USUA 3AFHA 2LGJA 4CF6A 3M1YA 3F4KA 3RVJA 4DLTA 4I2NA 2Y77A 1N2CB 4HDKB 4Y9RA 2ORIA 6AT1A 4MQBA 5A0TA 4FD2A 1IE3A 3E18A 1WAMA 2ZP1A 1OGYA 1ZINA 1CB0A 5BWBA 4D0RA 5K03A 4B6JA 4PHHA 1LBIA 4IQ8A 3S70A 3BFJA 4HNAB 5A9SA 5JH7A 2ZETA 3D8NA 3PC4A 5LYJA 1N0IA 3F9IA 2ZSAA 3BJRA 2SNIE 2VH2A 4R2HA 3T3IA 3WLFA 1ZU4A 1MPXA 1ODTC 1TZCA 1L4BA 3GCWA 3QXJA 4HAOA 1B8PA 1JAXA 3KIPA 3BJEA 3IBFA 5CDSA 3FD8A 3AM1A 4YUYA 3PITA 2ZSHA 2PD4A 3LUGA 5EUMA 1WQ3A 3DP7A 4DQXA 2YMMA 4YQEA 3ENVA 3OQIB 2JLCA 2PGNA 4WI1A 5AIBA 3BIXA 5EJFA 4DNXA 2VEDA 3HCFA 2NYUA 4U00A 4GOXA 2ZAIA 3BA1A 5C8ZA 3BXOA 2BBOA 4BP8A 3OF5A 4JLSA 3ZWKA 5IBCA 3R6WA 4Y3UA 1K2WA 2D1YA 3H6GA 4A27A 4BO3A 1J07A 4R05A 1LWNA 1TNDA 5AKYA 1VLJA 1JZQA 3IB3A 4R8RA 4OH1A 2F64A 2REQB 1IVYA 5E7IA 4WKGA 4J4TA 4QTTB 5DGHA 1P3DA 2X77A 4N54A 4XRGA 2OA0A 3WGTA 4TV8B 1Y63A 2C3UA 2ZCUA 2CKMA 2ZIXB 1HE1C 1HRDA 5KOJB 1FTQA 2SBTA 3FCCA 1NC1A 5B3JC 1XGKA 5JROA 4WECA 4R2LA 1IM8A 4RYLA 4AIRA 3Q8KA 2FVXA 3LWBA 3G9UA 4L76A 1YZQA 4JLKA 1COZA 2C2YA 2OL4A 1BW9B 3AM3A 3LHSA 1UDXA 1JPUA 1HDXA 2B7CA 1U8YA 2GTPA 2W2OA 1YR9A 1MX5A 3BDAA 2ZRMA 2BKUA 3KKKA 2YIVX 3VVMA 1ORTA 3VYSB 3NWEA 2CV0A 4Q7MB 4YP9A 4G4IA 1ZNYA 2OFFA 2IS6A 3KPYA 2PGXA 3DKIA 3GJ4A 4IV0A 3ZZNA 4EFMA 2FVYA 4YX9A 5JATA 3GLGB 4JLOA 1N9KA 5LBUA 1N78A 2HA2A 3NFYA 2ACWA 1U3GA 2IEZA 4ER3A 5CIYA 4GEGA 3MPOA 4LJKA 3QWFA 4YMVA 1TYCA 2ID4A 4FKZA 1U28A 2O0HA 3NXSA 3O1IC 4ZMSA 3RU7A 4WN3A 1R9MA 3ONFA 2OO7A 3PUJA 4QXAA 5AKKA 1GPKA 1SCQA 1RKXA 3WLJA 4QATA 3U44A 1SXPA 1QG0A 4C89A 2H7VA 1E3JA 2B35A 2WSIA 3ECCA 2GSDA 4ZQBA 1XJ5A 2NPIA 2R8BA 3M8KA 1KQOA 1R5BA 1EIZA 3UO8B 1KP9A 2VOEA 4IG9A 3VXKA 3U40A 2BP7A 1ZRHA 3F1LA 2X86A 2JJ2D 1SXJC 1J06A 4K9MA 1W94A 3ROXA 2JFQA 2B8TA 1DOHA 4RMIA 3STWA 3TRJA 4AN0A 4NG5A 4CM9A 4ENVA 5JAZA 5KWIA 16PKA 2R6JA 1UPFA 1NUAA 3URKA 1W5SA 3V1TC 2C99A 2VRCA 4R7TA 1P44A 2YOFA 2C5HA 2FPOA 2WSMA 2Y1CA 1VSQA 2FRVA 2BKLA 1VSVA 5AOBA 5ALIA 3INGA 1G1AA 4H16A 4M86A 2WFLA 1NBWB 2VXCA 2B6NA 1N6PA 3HPQA 4R1MA 2OEPA 3HA2A 4R9NA 2CF5A 4KXUA 1R5OA 5ECWA 2P9QA 4F4UA 1JU3A 4EYKA 2XNDA 2DBZA 2MSWA 2QN7A 1GPDG 4LJ5A 3L8HA 4AY5A 3KVNA 4XR4A 4P4LA 4UMEA 3TXYA 4TZ0A 2IF2A 3GUZA 3P0IA 2Q7OE 2WP8J 4GKKB 4NJEB 1QH8B 1P2GA 4WKNA 5DHTA 3F5DA 1HYGA 1MTZA 1NY5A 3AKEA 3HE3A 4OK3A 4X5OA 1H8HD 3O8RA 4FHDA 3FYUB 2J41A 3TQOA 4LXIA 1KZYC 3TW0A 1AT1A 2G28A 3ZVKA 1DKLA 4TLEA 1HE4A 3THYA 1ISFA 2DSTA 5A62A 4JV5B 5ALMA 2A9VA 2FWNA 4YAIA 4XRRA 4JJ4A 4M0DA 1JKFA 3DXXA 1BU5A 1O5IA 1QDEA 3EVBA 3OM9A 1C4KA 4K6FA 4ZYVA 2PUBA 2N3ZA 3ESRA 4LHYA 4D9NA 3AFIA 1GEEA 4B87A 2NUAB 5ECGC 1KSJA 1X1EA 1S2DA 1KYXA 4UUAA 1SCKA 2PUWA 3PHJA 2ERYA 2XUAA 2EOAA 1UJ2A 1BX1A 4BJ3A 2DUNA 2BFFA 4HNRA 1DWQA 5G40A 3ZBPA 2AI1A 3HLYA 2OCAA 1JE1A 1NMEA 2QGZA 4GR9A 3SHQA 1JLKA 3UYKA 4WN9B 1JU9A 1HF3A 2QRVA 3ORFA 1K3FA 3HY6A 1HQCA 2QAJA 5FHRA 5I8WA 2VYQA 2FPIA 1VJDA 4G84A 4U4AA 5C1DA 3ZW9A 4KB5A 3BE5A 4ZRDA 4DWWA 1LI4A 1SKBA 4Z3DA 4DKXA 2QW8A 4XLZA 2EZTA 2C5LA 2OMEA 2V96A 4PPYA 2ATVA 2P5SA 1IBRA 2ZI6A 3TQFA 1CQIA 2QTHA 4YRZA 1DEAA 3WKEA 3SM9A 1UOEA 5D3KA 4JI3B 2ZATA 4XVUA 2WYHA 3DD5A 4AVYA 4PTYA 3IDOA 1UK7A 1VKNA 5AW3A 2DPGA 1NXQA 2Z30A 3HCAA 4LXYA 1UPAA 2Q2VA 2LCIA 3D7RA 4MLPA 4YUAA 3U1BA 3FDIA 2J32A 4EKIA 3SVTA 3ENNA 1S6YA 2ZPUA 4KP7A 5DM60 2JHCA 3SQMA 2A0WA 3IV9A 5ED0A 2H4JA 2FSVC 4B8ZA 1U0LA 1A8QA 1VI2A 2P69A 3E84A 4ZU3A 5IVPA 3TLGA 1DX4A 1MHTA 1Q7EA 2PT6A 2CLIB 2AR0A 4FR2A 2VWPA 5CA0A 2OR3A 2GYYA 2J87A 1IM2A 3LC7O 4HZGA 5B30A 5C4MA 5KWSA 2VAWA 3THWA 1NMYA 2QRJA 4NBUA 2VLBA 4MR7A 3F3KA 1MNAA 4LCBA 5IN5A 3SZMA 4AECA 4N5LA 1KYWA 4X97A 1JYEA 5GQSA 1Z0UA 2ZWVA 1EWTA 3JPYA 2J3LA 4PIPA 4YLYA 1HSZA 5AKEA 2J3EA 5JC8A 1ZD2P 3I53A 2HL6A 1H66A 4J2HA 3U31A 4TXLA 5BSUA 4LRTB 4EW3A 1P39A 3Q7IA 3F78A 2O5RA 3CUKA 4UZSA 1XVIA 1V26A 1GNPA 1SXJD 3DOUA 3O8QB 3OZCA 4X93A 4DG5A 5FO0A 2W98A 4GECA 4OSOA 2XYQA 4C7OB 1DRWA 2OQVA 1E3LA 3VPAA 5BUQA 5KREA 2GYWA 2RH5A 3G9ZA 5CLFA 2BFEB 4LXQA 2Q0QA 1P0PA 2ON6A 2EGHA 4OREX 3MMNA 3P5BA 4QLOA 3U1TA 3E8SA 4CG3A 1B3BA 4ZIRA 1KO1A 2BMVA 3TINA 4AJIA 4ARZA 1DI0A 1YBMA 5ECDA 2RJNA 3R3YA 4BN0A 3SXUA 4MMXB 5DDIP 3UTCA 1F5NA 4O33A 4AKHA 4EEXA 2DFKB 4E5YA 1EMDA 1NMQA 4KMMA 4FT4A 2OBXA 4DRXB 3VTZA 1G5FA 4LRQA 2WMOB 2NXNA 2OHFA 1JEOA 2VZEA 1JLLA 1PNQA 4UBJA 4DV3B 1CP3A 2FW7A 1SK8A 4KAXA 4MI6A 1T0UA 1RSZA 1AKEA 1M66A 1JFVA 1EJ0A 1HK7A 2QVYX 3F6SA 4OJMX 3MWGA 2OHHA 2SHKA 5DIZA 3TVDA 3WNZA 3VDRA 5KPJA 2IXDA 4TUYF 2FZGA 2GPYA 4L4SA 4Q4CA 2HU2A 2XNCA 5C1OA 4BQQA 1T2NA 1EWQA 4TVSA 4FZ5A 1I30A 5E6RB 4WOCA 4AWXA 3ENWA 1X7XB 4FM9A 2HMAA 4IIYA 4ZANA 5CG1A 3KPUA 5BY2A 3WK7A 1QZZA 2HADA 2IHZA 2PWPA 3L06A 3L8EA 4QU0A 3L04A 4QSMA 1Z47A 3RDPA 2BDUA 1RHUA 4WZZA 3FI0A 3IUNA 1JLMA 4C6TA 2OZEA 5D3MA 1RBYA 5FOQA 1U8UA 1UMCB 3WGJA 4YJHA 1NONA 4RKWA 3W2TA 4TMKA 4MROA 3V4ZA 4RIEA 4KOAA 2E4UA 2WF7A 1LKZA 1Z33A 4RXTA 4PFKA 3SC2B 3A14A 4OVKA 2M9MA 2DR0A 1CUXA 3A37A 1RFGE 3RK1A 3WYEA 2GYVA 4JIMA 3F98A 4H3VA 2P9HA 1WE2A 4V03A 4EOGA 1G41A 5D7NA 5GJVC 5B1DA 3ZNNA 4NH0A 2EKZA 4K3UA 2FDXA 3RO7A 1ZMOA 1E61A 1XFAA 3N58A 4MP8A 3CR7A 2HQ1A 2WTNA 4YJ2F 5JHHB 1HDGO 2W6NA 3T6KA 3ELWA 4I5GA 4BRZA 1I94B 2PN1A 3WLPA 2Q28A 4R9VA 3TLCA 1E7WA 2V4ZA 3TLMA 4HV4A 4HO1X 4C76A 5ESWA 1YF3A 2PZEA 1B3RA 5J4YA 1FTWA 2VIIA 1UC4B 4LE2A 5CH8A 2VG8A 1M8GA 3COZA 2AQ8A 3BWEA 2BFDB 5TXGA 5ICGA 5K3EA 1JUDA 3KWJA 3LBAA 3M1LA 5TNXA 2Z2IA 5FULA 2VZLA 3BB3A 1DJQA 2QUAA 4CT4B 3PXUA 2XUFA 2VXOA 2C2XA 3OA2A 2NZXA 3AH8A 3EHDA 4JBLA 3TKLA 3UOWA 5L51A 1W59A 4LHEA 2R6R1 2VYVD 4N0MA 4QU9A 1RRFA 4QUDA 4QYIB 2IUSA 2XPCA 3FSGD 1P72A 1EHIA 3FNIA 3AIIA 3BK1A 3KLNA 3PNLA 2I33A 4RFVA 3VR1A 1W47A 2O7NA 4BZXA 4MPJA 5ADVA 2X19A 4QA9A 2PT9A 4W5RA 1ADYA 1E1DA 4AULA 4AG3A 4IS3A 4N01A 3MWJA 1I24A 4YMWA 5AKGA 5H9VA 2FW6A 5TT0A 6ABPA 3PVCA 2PUEA 4EB0A 1C0LA 4YAWA 3DDOA 3B8HA 1ZJ5A 4YECA 4NV0A 1I5OA 3OTOB 1EX6A 2R97A 3ICOA 5BNZA 3OSUA 2C7OA 1P2DA 1LNQA 2IZOA 3GZNB 4KMSA 4EJMA 5JC1A 3OE1A 1XD2B 1EFVA 2HU7A 1RDFA 2PKCA 2QTZA 3GJXC 1ZD8A 3OZXA 1R0LA 4FHEA 4MARA 2FWBA 4WXRA 4Z9XA 4E5VA 3THRA 3THOA 2YV3A 5JAIA 4RXUA 1CETA 5A4IS 2V3WA 2C29D 1ZIYA 2IQ5A 3GJ7A 5EWJA 4CMIB 4L5BA 4F84A 5IU6A 5DCYA 4G5SA 1GSAA 5GZ3A 1HBJA 2B5WA 4IVPA 1ODLA 1MZVA 1PS0A 1RJEA 3TW4A 3MA0A 4WFQA 4NYMQ 1E2LA 4R7ZA 4M1SA 3UKJA 1J6UA 1GCOA 2CZGA 2GVNA 3LRPA 1VYTA 3U49A 1SUBA 2G9NA 3K0BA 1A1SA 3A3KA 4LG1A 5SYMA 1BFDA 3F3YA 2DR2A 1LTQA 1XEWY 1K8YB 3FIUA 2D6FA 1E9DA 1GZ7A 4OU4A 1M6NA 3LK7A 5IZCA 2J0SA 3OZGA 4DGSA 3HBLA 1IEQA 1XRJA 2ECPA 2ZRPA 1GNTA 1GZ5A 2D5AA 2RHWA 3A3NA 3GGDA 7AT1A 1KI7A 2VQ6A 4XUEA 5CLGA 5TY0A 5KNCH 4FI3F 5LNK1 3ER9A 5AVVA 1RKVA 3D4NA 4CLDA 4FHZA 1XDDA 2V59A 3TNYA 2AXNA 4NP6A 3O21A 1SY7A 4QEDA 2IEBA 4B79A 1QHXA 1Z2CA 3OOSA 2D0PB 4MAAA 1ID8A 1HE3A 2FUNB 4AWBA 4X7RA 1NVFA 1VDMA 4PLGA 5CDUA 5IDQA 4KTVE 2P4SA 2XEXA 2XIJA 3DEHA 2VF8A 4JSTA 2E3JA 4PGFA 4RIIA 3HJTA 1B00A 3UH0A 1IVNA 2A0XA 5PNTA 2BGIA 1VSTA 5FOSA 4BFCA 1OF1A 5HK9A 1WU7A 2RAVA 2RIRA 4OHMA 2WWVD 4A91A 4OHYA 2J9ZB 3AHDA 1M8JA 3EUWA 2W0SA 3KYIB 4NNJA 5KNBD 3D4LA 3QELA 1L8LA 1OLSB 4HXFB 1L5GB 1R6TA 3PHLA 3BHIA 3A25A 2GFQA 4ZK6A 2FPGA 1U7DA 1N7HA 2JASA 3Q3IA 1ZM9A 2CY0A 4XCQA 2V6MA 3VU0A 1TQDA 3B9PA 2NZ2A 1VG0B 2WR8A 2DSNA 2QYTA 3MFYA 3JD0A 3WO0A 5DSZA 5I3CA 1YH3A 4F8JA 3NBKA 1PV2A 4RL6A 1YI8A 1EVKA 4I1RA 5TJHA 2J5QA 3RNLA 2KJQA 5HILA 4Y0VA 3C3JA 1KYZA 1Y3DE 1I4OA 1R8SA 3EW9A 3JQQA 2BFCB 3NHKA 4HS9A 4MVXA 4WLOA 5HS4A 4RF4A 3WNBA 3S27A 3LVRE 3PIRA 1MXHA 3PR1A 4Y1FA 2IV7A 1V48A 2YTZA 2ZJ5A 3KTOA 1SD1A 4A5OA 2C4WA 4H0FA 2I91A 5J2TF 4NCHA 3FHCB 4E3ZA 1N0UA 2QX9A 2C88A 1Z2OX 3BGIA 4DAOA 4DJEC 2RHJA 3EIXA 2O7QA 1UBNA 4FFNA 2Z6VA 3O9ZA 3SHVA 5FNZA 4Q3CA 1NAHA 1CJMA 3DTVD 3JAWA 3VR2A 2OORA 2ZLBA 4ETIA 3QLEA 2QPOA 1DT3A 3CRZA 1E1LA 4JQZA 4GMDA 1Q0LA 2ZRDA 1DAGA 2CGEA 2Z3WA 1JLHA 3V2UA 4O6VA 2IGBA 3FFTA 1NJGA 1H3EA 5F51A 3JQ7B 3BULA 1Y1LA 3G9QA 4RJLA 1S4QA 1WY5A 4O2AF 3SIRA 1RM4A 3OPYA 1CF4A 4FEEA 4U8GA 2V6GA 3JALB 3L7BA 2WD7A 4D3FA 4BQSA 4ZV4A 1U2DA 4DV7B 1AKRA 1LEHA 3KD3A 4YJFA 3KDSE 4ZREA 4R2JA 4JI2B 1WM1A 3IIMA 3FBTA 4MINA 3ORSA 4PC6A 1OSNA 2G1JA 2JFFA 1A9ZA 4BGUA 2NAFA 1WUIS 3OCUA 3QVVA 1IN7A 2HQOA 5F2OA 5EI5A 3FPEA 2VNHA 1UXJA 4MPPA 4OGFA 3ILVA 1GY8A 1CQZA 1MB4A 3KUDA 2DEUA 3EIHA 3L8ZA 5EP3A 1QGUB 3AINA 2GHRA 5KYKA 3PQ4A 3LP6A 2QB5A 1DV1A 2WJJA 3ENKA 4Q9NA 4U6SA 5FPTA 2PRIA 4NZOA 4TUYB 5LZ8A 4I9HA 4ZCIA 2ONKA 2D13A 1QKKA 4H1TA 5KZMB 1DWPA 1I9GA 2E21A 2BI7A 4XFKA 1XMPA 3I6QA 3E22B 1BCRA 2P68A 2OPBA 2G36A 1G8JA 3KOZA 1CTQA 1KJWA 2R9VA 1TOAA 3JAKB 1GFIA 2HIMA 3RBVA 1FRZA 2YYSA 4H18A 4UAVA 3TEJA 2X23A 3Q98A 3VU9B 3TZBA 2AG5A 1OTHA 1I5RA 4DC9A 2O8EB 1C30B 1O95A 5KSPA 2JK0A 1G8GA 2OQIA 1R88A 1TTPB 3T4UA 1BFKA 4Q1FA 1VYUA 5JTTA 2NADA 4BWFB 2ZI9A 4E4TA 4M38A 4QUGA 3NRBA 1GCGA 3O03A 5DTIA 4ODIA 3QKTA 3UJ8A 2IHYA 3ITEA 3LLVA 4YJ2B 2VK2A 5DLQC 4AB1A 2KBFA 3O3MB 5D5QA 3V8VA 4X95A 1XL1A 4ADSG 4GC5A 2HT1A 1J0XO 421PA 1JR3E 5C5EA 1XQ9A 4K26A 4JUCA 2PD3A 3CF4G 3S2ZA 3TTSA 3LAWA 1KI4A 3AEKA 4RHCA 4WZBA 3AUFA 3NT5A 3OQBA 5FBVB 4ER5A 3EGXB 5FTKA 1CG6A 1XNHA 5CYOA 3VNRA 3CU5A 1C4WA 3MOIA 3IJPA 4M8KA 4S2EA 3ZWBA 2X9GA 2PUVA 2ZRAA 2Q4RA 5JAMA 3KOMA 4DCTA 3LRXA 1N32B 1QANA 4LSMA 1T1GA 1NRXA 4OXQA 3V46A 3PPVA 1M2HA 4LKRA 5INTA 2FKAA 5EJIA 1Y7LA 2HAEA 4TS9A 3ABRB 4TXMA 5K3BA 2R1VA 1WKVA 2I3DA 3K71B 1BO6A 1NW8A 1Y37A 3Q7TA 1IJFA 1CUIA 4EI2A 3AIMA 1XEAA 1FP2A 4Y7CA 4F5WA 5LMNB 4K6GA 2PXCA 4CF4A 2WAXA 4QUKA 4EO7A 4D56A 3CB2A 4CCYA 4UVHA 1NVXQ 4TWIA 2ZT8A 3BXZA 1DARA 3H17A 4KGZA 1X39A 5ER6A 4G5XA 1UP6A 3IP7A 5BRAA 1CUSA 4Z4CA 5BSMA 3MQ4A 3LTEA 3O26A 4PYQA 4F71A 3FAZA 4HUQB 2PVSA 3K70C 4I4IA 3K0FB 4EPTA 4HEJA 5TS2A 2XBUA 2ZB3A 4OLBA 2XMDA 4CEIA 4P84A 4JBIA 4HKTA 1R15A 3QU4A 3EVTA 2QTLA 3COPA 3I0NA 1E5DA 4GRIA 3A0UA 1MJHA 3VPDA 2CZQA 3OUZA 1MLDA 2PU5A 1DG1G 2XW6A 3AB8A 4MS3B 3VR6D 3UJNA 3MAAC 4W6QA 1NPYA 3FTEA 2W2KA 3ZE1B 1IVSA 3MB8A 3BH7A 3AUYA 1GGFA 3QWBA 3DS8A 3UQYS 2GESA 1T8TA 5KIAA 1GTMA 5KEIA 2I76A 5LMCA 1P5HA 521PA 3QVWA 1U2ZA 2PKQO 2ZIGA 3ESDA 4E5KA 5GIOE 3L0YA 2V65A 4EBBA 2C9OA 1XTRA 3FGNA 4E1AA 1PQUA 2Y6UA 3E8MA 3KZNA 1NRWA 1JKJB 1RCTE 3IBYA 3KJEA 4ILEA 3T3EA 4UM7A 3ABQB 3HVJA 1XJCA 5E95A 2WKSA 1YAHA 2VBIA 3F7OA 1R8QA 1PK8A 1CQPA 1R6UA 3TAUA 4HTFB 4BC0A 2EWWA 4JSRA 1PO7A 2VR1A 3C5VA 4H9GA 1II0A 4MI9A 2AH5A 3MT8A 2VT2A 3DB2A 3PWZA 1QHGA 4IZ6A 1F9EA 4V0RA 2F17A 4NL4H 4B4VA 5TPZA 2VQSA 1T4MA 4DMLA 2ZJ3A 3DBLA 2WG0A 4MKRA 4REQB 4YMIA 5B55A 4KRYA 4IHJF 1FTNA 4Q9IA 4BB0A 2QBYB 2GNOA 1N5RA 1M7GA 2CWDA 3CGWA 4L16A 3G2NA 5AKJA 1UAAA 5E4TA 1XA3A 2XMRA 4B81A 5KX5F 1KEWA 4M60A 3ZOZA 1UBGA 3CONA 1TZJA 3PQFA 4KLNA 4KQ6A 5C3UA 4PLTA 4CV2A 1LPNA 5AVUA 2H1CA 4N5MA 5CPBA 5D3ZA 4AMVA 4DLAA 3DWGA 4JJ8A 4PZUA 4UJ5A 4D4MA 4A2CA 1KJNA 3KLMX 4QPPA 3FTQA 4N7RA 1JECA 4REOA 2X0RA 3LOUA 4CR6A 2X0FA 4GHWA 1WZUA 4I50A 1ZCAA 4RS3A 1U80A 2EZ4A 4ETWA 1EVLA 5LDGA 1Y1TA 3PJDA 2YMLA 3H86A 3DO6A 3OLXA 3T5BA 1VRWA 3BIFA 1JQLB 4OP3A 3IOBA 4KXQA 1A72A 2QOEA 4K9SA 4HYTA 5EIAA 5HMLA 1DX6A 3G1WA 3C3XA 4DAEA 1QM5A 4TXJA 1T2FA 3F5MA 4X1OA 3KB6A 1BD4A 2D3TA 2WMNB 3PKIA 4JLUA 4RH1A 5ULLA 1WZNA 5CX4A 3R7FA 4IDDA 1F9AA 4OHRA 2Z3ZA 2KBEA 3OZ7A 4YCDA 2C2HA 1Y8CA 3PDIA 3CEAA 1QMPA 3V4RA 1DRJA 1LLDA 2XUIA 5AW2A 3ASUA 3AFNA 5J2TB 1AU9A 1H6CA 1ZOOA 1A9XA 1RE0A 2W6IA 3IJEB 1JQEA 3AU9A 3GBPA 2OOKA 3F5QA 2PZLA 2QI9C 4G6ZA 4I1OA 1ILEA 3ULKA 1WTAA 3SHOA 3FBGA 5H1YA 1ZI9A 1HOXA 2ISCA 1YMQA 3FTNA 4CI0B 1IU9A 4POAA 3RUDA 2PGDA 2ZYHA 3B1KA 2X8JA 4URYR 1OXSC 4A8PA 3EXIA 1ZVVA 1DCFA 3HH8A 4UMFA 5EUBA 3GWGA 2EG9A 2O20A 2PRKA 4HLCA 3VR5H 4DQDA 1JIIA 3RVDA 4FQ8A 4E5NA 1U65A 2JKZA 1VA4A 3C3KA 1OFVA 5EUCA 3CSDA 4OM8A 4G0PA 2DWOA 3O93A 3DXFA 4O2AB 5BNTA 4JX9A 4MVJE 3V80A 2F8TA 3FSJX 1IZ8A 5F4BA 5HP4A 4QASA 1GGEA 2BGUA 1P0FA 2QRMA 4GBJA 4ISBA 3TL2A 4OHWA 3VOAA 1JEDA 1G63A 2JF0A 1UBUS 5LWHA 4G67A 2M32A 1N2IA 3I2KA 1MOZA 1QX4A 2AJ8A 4TWAA 4FMCF 3K70D 2XOKA 3OQ1A 3JRXA 5KU7A 1PKXA 4UCXA 1Z4QA 3ID6C 5CJPA 4ZXPA 1ZBQA 1DJPA 2XWSA 3JWGA 3CWZA 1LDEA 1I3OA 3DBIA 2XCSB 1GU1A 3OLYA 2ZBGA 1WUHS 2IYQA 1PWEA 3KV3O 4E6PA 2XNSA 4QUEA 3NOQA 3CJTA 1Q21A 3IOYA 2HRRA 1M2OB 2AK3A 2JPDA 3KPWA 4MITA 1LU9A 3SNHA 3V8BA 3EWAA 1R0RE 4RY9A 4CFZA 4CLEA 4XB1A 1JU4A 1TUIA 1TA9A 4M4SA 4E2ZA 1TC2A 2G80A 5FOUA 5LBTA 5K6TA 2Z6QA 1IZZA 2XCOA 5CBKA 3BKXA 3K05A 3MJDA 1SA0B 5FBQB 1HEIA 3SIWA 4C5BA 2IDJA 2IBSA 5CFQA 3RFXA 1QLWA 5TEVA 4UCWA 5ALLA 1D0VA 4N76A 1E59A 1JXMA 2ZT6A 4FB5A 1GAQA 3HKDA 3FPJA 2X9LA 5D85A 2OBLA 3IUMA 2X0DA 4D9HA 5BPFA 1IWOA 1G3QA 3P5SA 2OXEA 4G07A 1BVHA 2Q1TA 3OQ6A 1T15A 2OGZA 4LX0A 5T8KA 1ADGA 4HCJA 4CQNA 2HLDA 2QN2A 1GQRA 1RAHA 4IRMA 4MUJA 5AM1A 1VSBA 2DT5A 4IIGA 2BCEA 4M1WA 2Q6IA 1XCJA 5L9AA 4CIDA 2MYPA 1JSCA 4M7OA 1VL2A 2BR5A 5LDDC 4EG8A 3UGJA 4M37A 4EPVA 1CZLA 4RHFA 1XDSA 5KYUB 2ZRGA 1XQXA 4KO2S 2ONZA 3ANSA 4UASA 5FPQA 5CVCA 2H31A 1DZ3A 3HMKA 3K1AA 4BIMA 4H7EA 1U90A 4UXHA 3X1WA 3GT0A 3BHNA 4CKEB 3JZMA 4L9SA 3QJ5A 1PYGA 4DZZA 4UOEA 5DI3B 2XUDA 4PCUA 4AJ2A 2X2FA 3FDZA 4EEKA 2EKDA 2UYHA 1G8FA 3L02A 3WJ1A 2EU8A 2RC5A 4DXAA 4PYLA 4DG8A 1TLTA 1PT8A 1XDWA 3ZK8A 3B7WA 3CNQS 4CL8A 1N6RA 1YHNA 1JB9A 1HLPA 1RPJA 1LNSA 2PQ0A 3A6DA 4GR5A 1S7GA 1J5XA 1FFBA 4DLRA 1SNYA 5LQJA 3PEWA 2WM2A 4EGCB 4G4JA 1LQTA 1G16A 1X1RA 4NNPA 4PVCA 4TOIA 3K0SA 5HIIA 3E82A 2QAIA 2QP9X 2H2WA 2JCGA 3PNPA 1M6VA 2GHIA 3HUEA 4JUDX 4Y2RA 3QBTA 1K97A 2I5PO 4FZRA 4FQ5A 2ONYA 5LOVF 1OXKB 1X7WB 3MWYW 3OTIA 3RWBA 2MSEB 3J80A 3GFFA 3G0HA 3G1TA 4ITVA 4XPIB 2XBLA 1B0UA 2VDLB 4L3VA 5HDQA 3VR4H 2XMCA 1Y9JA 1O7JA 1EGHA 1PTKA 3NBZC 1E1CA 3F8SA 4U1RA 4Q9DA 4R1SA 1PN3A 2XKKA 2JGRA 3KWFA 3L8DA 3TH5A 2QIOA 4IDEA 1U8FO 2GCOB 3OMXA 1MIOB 1U7WA 1CUUA 1N5LA 1UMDB 5AUQA 3RBAA 3G9TA 3WGKA 3ZI4A 3FTDA 4P7GA 3CVVA 3W2FA 1RAAA 3LT5A 5HQ3A 3PDJA 10MHA 3P4XA 1XNGA 4DLKA 1OH8A 1C1DA 1FDOA 1TM3E 4OFBA 4YAKA 4CYMA 2YFYA 2BGGA 2FK8A 3CYFA 3L4BA 1W85A 1NI4A 4P54A 1Q0UA 1THZA 1PNVA 3KFLA 1CIPA 3OKCA 4PG6A 1XKLA 5TB5A 5BRNA 2COUA 3T9FA 2ET6A 5ALTA 3LPMA 2H4WA 4CM8B 4WBNF 1I01A 3UB4A 3A6HA 1GD1O 3PZRA 4FKMA 2BEWA 4PRLA 3STVA 1J33A 1JFLA 3QENA 4R1TA 5CDYA 5BMVF 1F12A 5HJ5A 1QSGA 2FLWA 4QUJA 4DM7A 2ZYUX 3OX3A 1XZIA 4EF5A 2JH9A 2EW1A 1F48A 3FRJA 2Q6LA 4KSCA 2C82A 3REQA 4I8IA 2EBWA 2PV0A 2QVLA 4AXBA 1P6UA 4A8JA 1VHWA 2AYXA 3DW1X 2QX6A 1DMSA 2X6RA 4IFEA 1JT9A 1NBAA 4LZPA 1I3NA 5HF5A 4AW9A 1BMQA 2YVKA 4RVOA 2AG1A 5E0OA 2HN9A 1GGKA 1YR6A 4WA8A 4X0EA 2ZYGA 4E2FA 1JSZA 1I0IA 1UKAA 3RRBA 5DM4A 2P8SA 4INAA 1SBIA 3ZE0B 3EPKA 3A1TA 2BD0A 1HM5A 1W0KD 5T6BA 1FFWA 4XSGA 2VP4A 3OOEA 1PJTA 3FJOA 4AJJA 1GPBA 2G63A 3QLTA 2QRPA 2XECA 3CCFA 4S1OA 4BNFA 3R76A 4I1UA 5HPYB 1NFFA 1KC1A 4ZA2A 5KX5B 3QH4A 1P2SA 4HN4B 6YASA 3LW8A 4A26A 1MBZA 3F47A 1I3CA 1L3BA 2DMRA 4DMHA 4ESEA 3UA3A 5H80A 1OAOA 3WRXA 4BO4A 1YIAA 4L74A 4R41A 5TGTA 1DS6A 3QKRA 1I3MA 2UYQA 2X9QA 3IYLW 4FYVA 2B4TO 5A7FA 3K8OE 4P36A 3N8DA 1Q15A 2QD4A 5U9CA 1CUDA 5BR8B 3T3MB 3GJZA 3ZLVA 2AMVA 2KYRA 3H1EA 4XD7A 4EB6A 4F38A 4CIAA 3HMQA 1GG9A 3RREA 1MEJA 4Z4FA 1TYAE 5B2EA 6Q21A 4Q5IA 4QM6A 4L3WA 1XRQA 2XQIA 4Y6PA 4BLPA 3IURA 3SM3A 1NQWA 2I6UA 5HZMA 3H6KA 2OCKA 1AG9A 3LDHA 1RJFA 4A23A 3GK3A 1ZK0A 4P98A 4U7GA 4OBWA 4E1VA 5LKRA 4DV4B 5KYXB 1XPJA 4GRDA 3NAZA 4FFLA 4KZKA 5JH7F 1P7CA 3PVZA 3Q85A 4ZZIA 5LYJF 1VE5A 1WXQA 1HFJA 3U3DA 1GKYA 3TVTA 1EEXB 2IUTA 2B99A 3SVZA 3EULA 3I6ZA 1TI7A 4NBVA 2X8LA 4RJIA 4M8IA 4AJKA 4LK2A 4YRCA 1NTRA 2WVJA 2YHSA 4MAFA 2P6UA 2QX4A 3RB8A 1I13A 1E2QA 1KOFA 3R7AA 4TTSA 1QRTA 1KZHA 4AZSA 1LRJA 3DHVA 3DB1A 3HHEA 3NRJA 4CEHA 4Q7KA 3HCNA 1D1PA 2YXEA 1BQ4A 2G76A 1O08A 2GCGA 3C6KA 1R0KA 3IODA 4CCAA 5EVJA 4DR3B 2VJCA 3B38A 4UU8A 3EF3A 3II6X 1L4FA 4FMCB 5AYVA 1E0SA 3TMKA 3K6JA 2IIPA 2BJHA 2QMOA 2QP3A 2WUDA 2WQ7A 1ESEA 4YDQA 3HS3A 3EQ2A 4ZVPA 4Y8VA 4WZAA 1ZISA 2BUBA 3OIUA 5F1OA 2BW0A 2X4GA 4RLSA 3CINA 4QYWA 2RGAA 4RULA 1TAQA 5H83A 4C6RA 2PSFA 2WHQA 1THMA 2DFTA 1OPXA 1KO8A 3W06A 2LIPA 3E6AA 4LNAA 4YV7A 4XTRA 3UG6A 1N5OX 4L78A 2IV2X 2H2GA 2V55B 4I5IA 1R12A 1IMJA 1GPAA 4RCZA 3FOCA 2C9MA 2LV8A 3HP7A 2GZSA 1H9CA 3NVMB 4ZTBA 4DC0A 3ISTA 3T1VA 3VSCA 1CF2O 4YREA 2AZDA 4YK7A 1WXWA 2XD4A 3R8CA 5KYWB 4M1YA 3FFAA 3TRFA 4HAYA 2VK4A 4LWZA 3RRFA 1SZPA 1FZTA 3K4QA 3W3ZB 4WZAE 2IQIA 3ICEA 4WRRA 3EGCA 4ACBA 1HZZA 1W5AA 2ZVPX 4IWNA 2NZ8A 5TS3A 1CDZA 4DIEA 5J43A 4HRXA 1XA0A 2V1UA 1S9HA 1O6ZA 5KCZA 1ZITA 2INGX 2YN2A 1HL7A 3LQYA 1SUFA 1VL1A 3B85A 3WGVA 1SVMA 2VYND 3I9MA 4NQZA 5AVQA 2CMFA 2V1XA 1QXSA 4YJKA 2IU3A 2VKQA 4FILA 5E6UA 3L8FA 3GLUA 3UBTA 3AHCA 2PUDA 1YBVA 3GXBA 5HFJA 3ZI0A 3FGZA 1RHJA 4F2GA 5JXIA 3N2KA 5KTYA 5L3QA 3IR6A 4HEA1 4L51A 1G66A 1Y3FE 4PIMA 5BQ3A 1P73A 1NF3A 3LOQA 4IDBA 3QBJA 3OHMA 3F4BA 3AEXA 2JFWA 4LUCA 5ALFA 1EM8A 1UPXA 2WUWE 2XNKA 4P5DA 3FNHA 2C4MA 1KDZA 3OIVA 2EYUA 3A1FA 1SRQA 1T6YA 2HSEA 2XA1A 4O3FA 2FXVA 4ABTA 1C3OA 1RD4A 2D1RA 5CNJA 2JCBA 4BNGA 1CYDA 3N2ZB 4UHJA 3IL2A 1U81A 3NAMA 3PF9A 3U4AA 1U7ZA 4LAFA 4UTNA 3IA2A 2VNSA 3QLJA 2ZAOA 5D2CA 2B1JA 3OCZA 2WEKA 5CVJA 3ZHYA 4QARA 1O8BA 5EQTA 4UVGA 1Y98A 3D3JA 1NNEA 2BFBA 4NFLA 1EHCA 2B1QA 5C80A 1L5OA 1ZW6A 2AOTB 2GS9A 2LE0A 3GL9A 3LLUA 3HXQA 1E2IA 3F6PA 5IKXA 4UNPA 4X65B 1H23A 1SR8A 3A05A 4C30A 4JEIA 4ZRNA 1YRYE 4L5AA 4OUDB 1N3IA 4R81A 3UHFA 5LOVB 4LF7B 1GV0A 1KERA 2ZZNA 4DY4A 3QPUA 2ORWA 1KI1A 1NI5A 2G5GX 2OKGA 3H2JA 3U81A 5I4KA 4UFPA 5CB4A 3LXMA 3BT7A 4B09A 1A1VA 3DCYA 2C2GA 1X74A 4ZVMA 2NPOA 5LZ7A 4YRPA 3ZJYA 3I23A 3P0RA 2XCTB 2IPMA 4B75A 1XX6A 5BSTA 1IY9A 1WRBA 2ZTMA 3OCCA 4LGVA 3HJHA 2IOFK 4HUJA 3H19A 3LCUA 4ND4A 2CMHA 3WS7A 5JSZB 2NN3C 3ZHOA 1JWAB 1ZDMA 3D02A 4LZLA 5MF6A 1WPXA 2XXBA 3HN2A 1NX6A 2J48A 1N1EA 3C6YA 3T5PA 3GJTA 4YCBA 3HWRA 2IYSA 3DVAB 1B0ZA 1JGTA 5CM8B 2R1TA 3HA5A 3FG9A 5G4LA 4P4TA 2RGEA 4DIDA 2VSQA 1XLVA 2R7NA 1EP9A 4PINA 4QFBA 2JAWA 3KT0A 2ZVJA 4ZXFA 4WBNB 2FDCA 3DAPA 1K7YA 3GA7A 2FP4A 3B51X 3KQVA 4P5EA 1OB2A 3M3PA 2JCSA 5B5SA 1TIKA 1LPMA 5BMVB 2WAMA 1JILA 3R5SA 2IDKA 5C18A 3SQWA 2GZDA 5ED4A 1VGRA 1BSVA 1E99A 3T34A 1W19A 3H16A 3SYKA 1I6WA 4EHJA 3EVFA 2PJRA 4B7UA 3U39A 3WGQA 4CEJA 5JBNA 1JHRA 3DA8A 3U3MA 4EUNA 3PV0A 3JCZA 4KQMA 4M6WA 2NTNA 4Q3AA 4ZQHA 3ZDQA 3NDIA 3S5UA 4DMKA 1OH5A 4C4XA 2IKSA 2XE8A 1XEFA 3EZYA 1CHDA 1K8ZB 4MS4B 1E3IA 1QO0A 4XLTA 1GPUA 2AKAB 3RTCA 1TQ2A 3OICA 2JJ1A 3EFBA 4RDIA 3MCAA 1LSJA 2NYVA 4K40A 1Y89A 2CUZA 3Q7SA 5ITWA 2Q3BA 3UWSA 3PQ3A 5D3QA 3DBRB 2QN9A 3JQCA 3IKTA 3WB1A 4WCFA 1Z18A 3LY8A 1VHQA 3IHWA 4BTLA 1WOYA 2DG2A 2BM8A 5GV7A 3OFSA 1T4CB 4EFDA 2AFIA 4FNMA 1PJBA 2ZRKA 3QWHA 4WT7A 2E4VA 4M0EA 5EZ6B 3IMCA 1NY6A 5CDFA 3G2JA 5REQA 3ZWWA 4BCBA 2CFTA 2D0OB 5ADHA 3BD7A 1YO6A 4OHVA 4DPMA 2Q0XA 5IJXA 1T1JA 2GPSA 2ODWA 1D2NA 3O3NB 2EP7A 1NF9A 5EWLB 4HQKA 1XXHA 2V4MA 1U5CA 1JDVA 3EIFA 4Y1EA 1EP1B 2DBYA 5LB2A 5AW0A 4OAQA 3DLTA 2Y4OA 3OX4A 2WP0A 3QMMA 4BC1A 1EG2A 4RETA 2WABA 2F59A 4B6SA 2AC7A 2PTHA 1NL3A 2W2PA 3IT1A 4NFHA 3ZQJA 5JY6A 2AEJA 2WT8A 2YYYA 2YS7A 1JG1A 5E4FA 4ZAFA 4ZAGA 2N1MA 3RFVA 1CRWG 1JHXA 3EMVA 1Q0TA 3URMA 4AUEA 3ZJUA 3VPSA 5AVXA 1NVMB 3SR4A 4N5HX 2YV5A 4FFOA 4HXYA 1SCJA 4K03A 4N5IX 3OQHA 5A9SB 5JH7B 2I4NA 2WUVA 4J4HA 1U2SA 5LYJB 3RC3A 4JZKA 2XMGA 5L7YA 4BPRA 3M5PA 4J9VA 5CVTA 3QLUC 2HXSA 3U09A 1FU4A 3GJ6A 4NE9A 4DKJA 3FGOA 3TW8A 3PFWO 1A9QA 3AM5A 3OZDA 1SHZA 1R0ZA 2V5AA 2PRJA 3GQVA 2VP6A 3HDVA 2BM1A 3Q7QA 2QTTA 4URHA 2BN4A 4B3IA 1L3IA 3REFA 2GCIA 4TL9A 1UPUA 4ZJPA 2DHQA 3RW9A 4HGPA 4JXJA 3RHSA 1TQHA 1H2RS 1HGXA 2JLAA 4LBWA 2ESRA 3FR7A 3CNBA 1ZMXA 3C5HA 3DZJA 3B3JA 2CJYA 5IAGA 2G67A 5EE1A 5BW8A 2WWRA 4C03A 2FWPA 3AEZA 4MGEA 4R69A 4N47A 3A1UA 5KDOA 2QVGA 4QUHA 2Z9CA 1E9EA 3PE3A 2XHEA 3OTHA 4TMFA 4Y9SA 3AR3A 3DT9A 4AKEA 5J1SB 1D6SA 1JS1X 5DT9A 1A5TA 2EGUA 4R8LA 3NXKA 5H4HA 4H1HA 4IVNA 1I2DA 4HGRA 3W8DA 1Z0JA 5L4NA 2IWRA 3UW3A 2O3RA 4G0WA 5BYBA 3EXG1 4AMGA 4F1WA 4QTYA 5F3RA 3RAEC 3GUVA 2BELA 4GPBA 1IBLB 3D59A 2DFDA 1A9PA 4UARA 2QYOA 4CQLA 1L7QA 1KI8A 3TRKA 5JCPA 1GUBA 1U0TA 2A9OA 3FVWA 4KFRA 1SH7A 3TM4A 1AV7A 2FPMA 4MWGA 2XIQA 4DDWA 1FP7A 5F3WB 5AI4A 2XDAA 1DDIA 3LFUA 2GXUA 3GEIA 4NS4A 1VKJA 4EKGA 4YI5A 5EHQA 4D74A 2CJPA 3Q1LA 4X1IA 4XGIA 4RPIA 4UTOA 3CE6A 2MU1A 2ZSBA 2WJ4A 2IRWA 3D5EA 2CBGA 4HMQA 3F67A 2WNHA 4FVTA 1Q3KA 3NJRA 4NCBA 3U44B 1EAMA 3MINA 4OXIA 1RAEA 1BMFA 4FGJA 2BMJA 3T15A 4RV5A 3KUKA 5AVYA 3IQGX 3DHYA 4KV9A 4Q4HA 2BBWA 1QCYA 3OPXA 5LQCA 1DUSA 1Z5UA 4D2IA 1UKVY 5B4UA 1EFPA 1RACA 2D2FA 4HNHA 4RGQA 4B46A 1JA0A 2P11A 1OIWA 4LCEA 5A7HA 3R9IA 3UENA 2Z8YA 3WA7A 2RB5A 1VCIA 1YHZA 3T7JA 3MF4A 1A8IA 3AHEA 2Q6TA 4EK9A 3LVBA 1VG8A 1U8CB 3D8BA 3P9SA 4Q02A 1ZWKA 3H0EA 5EFOA 4IDHA 1NV8A 2QSJA 3UJCA 1TM7E 1QOZA 2PX3A 1PNRA 4TZKA 3BSFA 5K51A 1YC2A 1CR1A 4YMHA 4GNKA 1XTKA 2WFLB 3WDSA 1ULBA 4GXNA 4MRPA 2PRYA 5KNDH 3COJA 4DEVA 3N87A 3PXXA 4QOIA 5G1PA 1GZVA 3VOTA 4WNAB 3S1AA 1SUCA 2QLJA 5A5VA 1EE9A 2I2CA 1U11A 2WFZA 3LM8A 3IEXA 3I8OA 2IHBA 4HDQB 4D0SA 1H2HA 1TUGA 4LJRA 1SU4A 2NZUG 3IEMA 3W4JA 3H5TA 1OZFA 4MVWA 1DE0A 1MVOA 4FZVA 3L1KA 4JWTA 2IBMA 4N4AA 2H9AA 5K3FA 3CNNA 4CM6A 3BZBA 2AQHA 4GNRA 3CKKA 3V5NA 3ESZA 1TCAA 4JYBA 5BR1A 1I2AA 2OCPA 5E1BA 4MV6A 3CVOA 3W6ZA 2O06A 3OX1A 4Q6BA 2PFSA 4A8TA 1Y4SA 4KE7A 1VE9A 5K8TA 2PO7A 3MZ0A 2ZK7A 4UEQA 1U9IC 5JANA 2H2FA 2G70A 1UBOS 2ATEA 3C6QA 4YJ3F 2ZJBA 3CB4A 4ZRMA 4BYGA 1T2AA 2WD8A 1IQ0A 5J5CA 3X1XA 2RHTA 4BVJA 1U02A 2ZJZA 2ZJOA 2GZHA 2ZIWB 4M22A 4OI2A 4RDHA 1ZK2A 6ADHA 1IK4A 2XZOA 2VF4X 3LBNA 4ETMA 2CE7A 2GM3A 1A97A 1UBLS 2J6IA 2WF9A 4M49A 1AQYA 1HNWB 3BCSA 3MJFA 3TX2A 4CV0A 3P32A 3KKEA 1JR6A 1P29A 4BMYA 4PXYA 1B6TA 4YYZA 4G1EB 2RKWA 2GD1O 1Q0RA 3RTAA 5DYNA 4OQFA 3WL3A 3E3AA 3UATA 3PXGA 1OMOA 1UOPA 4NXMB 2ZRBA 3TE7A 2FPIB 5CLLA 5LVAA 2CHQA 3BIWA 1O94A 1T0JB 1M5UA 2V7VA 5BOVA 4EG0A 1KRHA 5DE3A 4YRBA 4D0LB 5BUZA 4XJTA 3GLFB 1N2XA 4Q7LA 3TAHA 5A4DA 4C20A 1CQIB 3K6KA 5FQOA 4AF7A 1S2MA 2QENA 1VIMA 2E4WA 4TSRA 3WMRA 1P4AA 1E63A 2J4DA 5DHQA 2K5UA 3V48A 4KRXA 2KQUA 4UM9B 4NWIA 4ZYLA 3L43A 4X6YA 2H51A 5I4BA 1K6XA 2WPDD 2EC5A 3HA7A 4GOND 4EF4A 3NHRA 1JZTA 2AUNA 3KR1A 1H3FA 5DSTA 9ABPA 3H65A 2B4RO 3A3OA 4JA0A 5IJ0A 4AWAA 4X3PA 3A3PA 1L4MA 4D81A 1KO7A 2YQ5A 1FC0A 1XZMA 4OB7A 5LLDA 5JXGA 4LVUA 4G36A 2YZKA 4XAQA 2BUCA 1IIBA 1ZXBA 5BURA 4IMJB 3EFHA 5LL6P 1BXRA 3THWB 4HLQB 2RGBA 4U9IS 4DSUA 2RH4A 4RIGA 1KAGA 4PO9A 1NU8A 1KDOA 1L7MA 2A94A 2G25A 1NF8A 3JWIA 3LUDA 5KHAA 3UK7A 2RCNA 2E87A 2PGOA 3HABA 3UJ6A 4MLZA 1GUDA 1S3SA 1GWNA 3K5PA 4FX2A 7ADHA 1EGMB 2P2LA 4YC7A 5E3HA 1ORHA 1ORIA 1SQ0A 2P2DA 3D8SA 5KVQA 2CNLA 4M1KA 1F06A 5KQRA 1SBCA 2EKPA 2OCIA 2Q8NA 4QXPA 1QORA 2EXXA 3E3OA 3HB7A 4WTOA 5AKHA 1CNEA 4LA4A 1ZIXA 2F4NA 3JYNA 1K7CA 3Q3VA 3WP0A 1R0YA 1QOPB 1HYBA 1SU7A 2I1WA 3SQNA 2HCBA 2YNMC 3IAS6 4RABA 4MXDA 3DONA 4CDMA 1RAIA 3SZGA 4XM2A 3WLKX 4JI7B 2J3KA 2JIZD 4UCQA 4NJOA 2IH2A 3VU8A 2TSYB 2VDWA 1TKBA 4M1OA 4ZIRB 4JP3A 4BN4A 3NT2A 1FFXB 2V8BA 3BJIC 2HEIA 1PV1A 2ZWAA 3D7KA 2NU7A 5IEBA 3SXUB 5JOQA 3C48A 4DR4B 1WCIA 4IEEA 2ZGVA 4IDQA 2BSQA 1JPVA 2ZVDA 3NANA 2A0KA 2IZ6A 3UJ7A 2JGEA 1NOIA 3EZ9A 2NYRA 1GVHA 2MT9A 3OD5A 3FR8A 3WL6A 1ZH8A 1ZX1A 2ZUUA 4K9DA 2OV8A 3RVPA 4XEHA 3U7IA 3O75A 1BWQA 4QVGA 2PT7A 1AXGA 5B6JA 2DERA 1Y9DA 1C14A 3MUNA 1X7YA 2QQ0A 3NWJA 2I6GA 4IRUB 3JYOA 3IP8A 2GBFA 4IXNA 1ISHA