2QMQA

Crystal structure of a n-myc downstream regulated 2 protein (ndrg2, syld, ndr2, ai182517, au040374) from mus musculus at 1.70 a resolution
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
278
structure length
278
Chain Sequence
HHHHTHSVETPYGSVTFTVYGTPKPKRPAIFTYHDVGLNYKSCFQPLFRFGDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCILQYLNFSTIIGVGVGAGAYILSRYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPDMILGHLFSQEELSGNSELIQKYRGIIQHAPNLENIELYWNSYNNRRDLNFERGGETTLKCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Protein NDRG2
publication title Crystal structure of the human N-Myc downstream-regulated gene 2 protein provides insight into its role as a tumor suppressor.
pubmed doi rcsb
source organism Mus musculus
total genus 90
structure length 278
sequence length 278
ec nomenclature
pdb deposition date 2007-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qmqA00
4BC0A 1BROA 2WJ3A 5A7GA 5FLKA 2V9ZA 4H0CA 2PX6A 5EHXA 4FNMA 2XUKA 2OAGA 2WIFA 2HA6A 5CBKA 4KAFA 3IIIA 2HRQA 2ZYIA 2Z3ZA 1EX9A 3WK7A 4L9AA 3CCCA 1IZ8A 3WK9A 3R3XA 1JKMA 4KAJA 4GI1A 4OB6A 1K4YA 4U2GA 4X92A 3WK5A 3R41A 5AKXA 1CVLA 1G42A 2CB9A 4LXGA 2OG1A 2XMBA 1UWCA 2Z5GA 4QLOA 5CT5A 4TVKA 1EVQA 1U8EA 4UHHA 4N5HX 4ZV9A 2PVSA 1GZ7A 4CG3A 5BWCA 5F4ZA 1UKCA 1DU4A 1LPSA 2RHWA 4GECA 4P08A 1UOQA 1Y7IA 5AKGA 3L1IA 1OILA 1XZHA 2EEPA 3WA6A 1J06A 2HM7A 4MEBA 2V98A 4FMPA 4BDTA 1YSCA 3HJUA 4X71A 5I8PA 1TKRA 5FPPA 3V1LA 1F0PA 5IVDA 3CN7A 4G5XA 4QLAA 2JGLA 3FBWA 2HA2A 2VSQA 5ALZA 1ZD4A 1J1IA 1MAAA 5AJHA 4BAZA 5C7YA 1QTRA 3H0CA 2XMZA 2PSHA 3OG9A 3C70A 4LKOA 2AJLI 5HK8A 3MUNA 4EBBA 3CXUA 5T4HA 4BAGA 1WB4A 5ALWA 3U0VA 7YASA 1HL7A 1N8SA 3M83A 2XMRA 3QPAA 2H7XA 3V1KA 4X00A 3R40A 1EI9A 4QDUA 3QYJA 2XLBA 1G5FA 5IVKA 1UZAA 1ZJ5A 3AINA 5T4EA 4MEAA 4H77A 3C8DA 3SWWA 5BV7A 4F60A 3W9BA 1NU8A 1N5MA 3STXA 5CT8A 1JJFA 5K3BA 2WJ6A 4NZZA 1XZMA 2BCEA 1CUDA 4V2IA 3BXPA 4Q05A 3KD2A 4X7BA 1W76A 4RE6A 1CEXA 4INZA 1QIIA 3W9UA 2XUDA 3BDIA 5D6OA 3WMRA 2WQZA 2XQKA 4NMWA 2PL5A 5T4BA 4J0GA 3G0BA 4MJ3A 2VEOA 3DNMA 3HZOA 3E4DA 3IUMA 4B81A 1ZICA 5HK9A 3D2AA 4OB8A 2QUBA 5EHQA 2HRRA 3M3DA 3G0DA 1MPXA 2O7VA 1EH5A 4H7FA 3DS8A 2IITA 3I2IA 4DGQA 4X3CA 4AO7A 4FFWA 3ED1A 4FLFA 2FX5A 2V96A 3D0KA 4C4XA 4B9AA 4HXEB 1WB5A 2OQVA 3PDCA 3DEAA 5A7FA 5K3DA 1ORWA 3FYUA 2JF0A 4G4GA 4PSDA 3WWCA 6YASA 3RK4A 3VISA 2WKWA 1XQVA 1D07A 4W1PA 1LPBB 1YA8A 1LBSA 4RE5A 2XQFA 3WL6A 2O2HA 4OU4A 1XRMA 1EK1A 1EK2A 5AP9A 3ANTA 2UZ0A 3GROA 2OGZA 4BP9A 1HKHA 1ISPA 2PUJA 5A62A 4Q3OA 4BZZA 1E5TA 1TCAA 4PSCA 2PUHA 3PF8A 2BKLA 2ACKA 3I1YA 1MT3A 1XZIA 3IUQA 5JAOA 2WHQA 4Z49A 3QMMA 3K9BA 3LS2A 4RGYA 1EVEA 1DT5A 1LBTA 4WDQA 2XUQA 3BIXA 4K5QA 1ACLA 1R88A 2OGTA 4MQMA 4AQDA 1A8UA 4PQEA 2Z3WA 1JU4A 2DHEA 3QZUA 5LZ5A 1DQYA 4KJXA 4Y2SA 4BE9A 5K3EA 5AM2A 5AIBA 1P0PA 1ZIYA 3IBTA 1W4LA 2VAXA 1UOOA 3ZI7A 1N5RA 4U2DA 1RWQA 1T2NA 1MX1A 2E3JA 1CUGA 5ALOA 3DJYA 3JW8A 5HKBA 5CH5A 5FP0A 2ZVDA 4K6GA 2ONCA 4LIPD 5JZBA 3H2JA 4JYPA 5ESRA 3MVEA 5ALHA 3O4JA 4X6XA 3I6YA 1CUSA 3HACA 3D3NA 5AKYA 4Q82A 3GA7A 1I6WA 4J03A 1E66A 1QIJA 4FKBA 5HF9A 1K6EA 2H9YA 2VATA 2VQ6A 1XRQA 2AJDA 3HABA 4AMYA 3S2ZA 5A71A 2JGIA 2WIDA 1HDEA 1ODCA 5DJ5A 2G5TA 2RONA 5K3FA 3MUOA 3I2FA 4DM7A 3WA7A 5ALYA 1ZD5A 5HZGA 5ALUA 4LXIA 2XUHA 1EDDA 5HF6A 4KE9A 1R4ZA 3OPMA 1MNQA 4H35A 1RYYA 5JATA 1R9MA 1Y7HA 5FKJA 1DWQA 4B0OA 2XUFA 3C6ZA 2ORYA 5JALA 1VXRA 2YYSA 2P8SA 2YH2A 4XVCA 1AQLA 1HLGA 1WCYA 4P93A 1EINA 1XZBA 3H17A 2ECFA 2HA4A 2QJRA 2X5XA 3KWJA 4Y7DA 4DSAA 4X95A 1USWA 2H7CA 1DINA 4IH1A 3GZJA 4UBNA 1CPYA 3KOOA 5ALXA 3QVMA 2ZJ6A 1XQWA 4IH4A 3V9AA 3WIBA 3IVMA 1SCKA 4OUKX 1H2WA 4QZVA 2BAGA 5AOAA 4G9GA 4WJLA 4B84A 4ZREA 3PUHA 4OB7A 5DWDA 1BN6A 3I28A 1AX9A 4HXGA 5CW2A 1QO9A 3G7NA 3WJ1A 3EQ8A 3LIIA 1ORVA 4UHBA 3D5EA 4CG2A 2G63A 3L1HA 3W05A 5A2GA 2XDWA 4BB0A 1QE3A 3DYIA 2OCGA 4EA6A 2WUGA 1QIDA 5AIAA 4X85A 2WU4A 5AI6A 5KREA 3A6ZA 3C87A 4I4CA 3ANSA 3AZQA 2XQJA 1MX5A 1GQSA 1RP1A 1FJ2A 3C6BA 4Q1VA 3D7RA 4EY6A 3M82A 4MYSA 5BWBA 5ALEA 1L7AA 3DD5A 3AIOA 1YCDA 2D5LA 4GWLA 2ZJ7A 3VXKA 1P0QA 5JD6A 2ZSHA 4P92A 1F6WA 2HFJA 1Q0RA 5EIHA 1AC5A 1YR2A 5AKLA 3VVLA 4EY8A 4XX1A 2JGJA 3OOSA 3VVMA 4RPCA 4BCCA 3BL8A 3ZLUA 1AKNA 4E46A 4H7EA 1YS2X 2GYVA 3FLEA 3H1AA 5CMLA 1U65A 3IULA 1JMKC 3DCNA 3FYUC 3DKKA 3L1JA 4M0EA 1QOZA 4X91A 3HC7A 4N8SA 5HCUA 4BZWA 1ZI8A 4LHEA 3WWOA 1XZCA 2XMQA 1QJ4A 2YASA 5ISMA 3FCXA 3QH4A 2DHDA 4FBMA 1TCBA 5JANA 2GBIA 2WHPB 4QDZA 4B9EA 5C8ZA 2WFZA 2WFMA 3R3YA 3SK0A 1Z68A 3PFCA 5AOBA 3STWA 4M0MA 4J3JA 4WFIA 1UK8A 1CUZA 3C5WP 5ALDA 3H18A 1CQZA 3GELA 1XRPA 3VDXA 3WIOA 3D2CA 1WB6A 2ES4A 2C7BA 2C58A 5AK3A 5K3AA 5LYYA 5JD5A 3I6ZA 5AKZA 5E4TA 4S0XA 2C0QA 5I9IA 2JEYA 2JEZA 4YX9A 1XZGA 3ESBA 4UBIA 4B82A 4BTLA 1E8NA 5JD4A 3E3AA 1ZOIA 2X76A 4YASA 2XT0A 3OTQA 1NU6A 1GQRA 2WG2A 2RGUA 2CMFA 1JFRA 5CT4A 1CQWA 3H19A 5IVHA 1Q84A 4EB0A 4U2BA 2DSNA 2O7RA 1JMYA 2J3QA 4B7ZA 2QM0A 5LLSA 3JYHA 4HRXA 2PU5A 1H2YA 3RKSA 4JUIA 4HVTA 4W9RA 5D3ZA 4FWBA 4G9EA 2OXEA 1E3QA 5AK4A 5JYCA 2W22A 2BUAA 3H2GA 1CUHA 1ZJ4A 5DNUA 4AN0A 5DNWA 2QMQA 3BDVA 5AM1A 3DL7A 3R3WA 1CLEA 1FFEA 4B83A 3R3UA 4Y2YA 4W1RA 3QMWA 3GUUA 2FUKA 4CI9A 1CUCA 3VJKA 2OGSA 2VAVA 2BUCA 1K63A 4UHDA 1N1MA 2PKYX 1CRLA 4G1FA 5A7HA 4MQLA 1BE0A 5DNVA 4NS4A 1MU0A 4L72A 1EHYA 4X93A 1MNAA 2WLSA 4C6HA 2XUAA 3VKFA 3EIOA 3WZLA 4C87A 4CFSA 1ZGCA 1FSSA 2XUIA 4GBGA 4GEGA 1EXWA 5CXXA 4P9NA 5I7UA 5JAHA 1K5PA 2ZYSA 5EIAA 4WCVA 1YA4A 1ZI6A 4BCBA 3C8HA 5AKJA 5ALNA 2PSDA 4AZ0A 4BC1A 4BYMA 2WU3A 2B9VA 1VA4A 3QMVA 1VE6A 2C5FA 2VJAA 2GZRA 1WM1A 2DCMA 2XMSA 2OPHA 4BAUA 1LPMA 4QA9A 5EFZA 5ALQA 4DLNA 1XZLA 4CCYB 3G9UA 1O6FA 5CT6A 3F67A 5J3JA 1CUVA 1KU0A 4G4IA 1WPRA 1JT2A 1EB9A 2WIGA 5IKXA 4Y2QA 3C43A 1IVYA 1JJIA 4Y2RA 3ICVA 5FOQA 4DSZA 4KRXA 1XLWA 2OCLA 5AK6A 1R50A 5AOCA 2QRUA 3EQ9A 4A23A 1HPLA 1UKAA 5AHXA 2BGRA 4GXNA 2XB6A 3IB3A 1UKBA 1X2BA 5YASA 4HTAA 2R8BA 1YAHA 4ZI5A 1TAHA 4B80A 3AUKA 2NW6A 4UHFA 3AZPA 5ALRA 1CR6A 5AI9A 1A88A 3F8SA 4XIIA 3Q0TA 3Q8WA 2K2QB 4KE8A 2XUPA 1H2XA 2XMDA 3OC0A 1TQHA 2PU7A 2AJCA 2PM8A 3LIPA 4TPKA 1VKHA 5LZ4A 4UFPA 4ROTA 4CG1A 3W04A 2Y6UA 5HQ3B 1G4HA 2GBCA 3BE8A 2HA0A 1XZJA 3IUJA 1FFAA 3D4LA 2WIJA 1MJ5A 3F97A 5HFAA 2R11A 5AM4A 2I03A 3I1IA 1SCQA 5FDFA 4FFVA 3S8YA 3V1MA 4WDRA 4K2AA 2QVBA 4DMFA 4X94A 3O4IA 4OYYA 3O4HA 4ITVA 1SC9A 4UBKA 2B4KA 4AZ3A 1H23A 1BCRA 2HU8A 1H2ZA 1JJBA 3HSSA 3R0VA 4EY5A 4K6KA 2QOEA 2LIPA 1ZGBA 3B12A 3LP5A 1UK6A 3LLCA 1U4NA 4Q34A 3WWDA 4C4YA 5DYWA 3M81A 3FOBA 5EHZA 1W1IA 1WPXA 2WIKA 1UXOA 4H7KA 1BRTA 2OQIA 2Z8XA 4GDMA 3EBLA 1K8QA 1XLVA 1IUOA 3DL4A 1CUYA 1PFQA 4QEKA 1DT3A 2WUDA 1YB6A 2X8BA 4C01A 3IUNA 4Y2JA 4E11A 5FRDA 3D59A 3FLBA 4IH9A 1C7IA 1BU8A 4Y2TA 3U1TA 1EB8A 3ESCA 2WFLB 3MGAA 2GYUA 4J0JA 3FCYA 4BATA 4GHWA 2QJWA 4BTVA 4W1QA 1LZKA 3WKAA 2AXEA 3HYSA 3TGLA 3W06A 2HU5A 2OCIA 5CH3A 2G4LA 3BIWA 1VOTA 5EIEA 2BGNA 1DQZA 2WILA 3FVTA 4GLBA 4BP8A 3DOIA 1H22A 4FTWA 4UPDA 4B85A 3W2TA 3QM1A 3FYTA 1IUPA 5K5EA 4F0JA 3G0CA 4J0HA 2ACEA 3ICWA 3WLAA 3E0XA 2PSFA 1TRHA 5ALLA 5SYMA 2QR5A 2HDWA 1DWOA 3DLTA 2O2IA 2HU7A 2G5PA 1CV2A 3KSRA 1P0MA 5DTJA 1OXMA 1CUAA 3PFBA 2I3DA 2DR0A 3IA2A 3UUEA 2FJ0A 1E8DA 4MXDA 3AZOA 4JEIA 4MYDA 4C88A 2HA3A 1T4MA 3HI4A 4L0CA 4AN1A 5IH7A 1ODSA 4F5ZA 5A6VA 4RNCA 4JH0A 1OCEA 1FFCA 3WK8A 4D9JA 1GXSA 4KE7A 3BJRA 5AICA 5LZ8A 4B6GA 3STVA 3FSGD 4KR0A 2V97A 4Y2VA 4GW3A 4QNNA 5HF8A 2XI4A 2WTNA 4ZXFA 4ETWA 1GPKA 5HF5A 4BVLA 3H2HA 4WFKA 1VZ3A 1QONA 4J0IA 1SFRA 4FHZA 1XROA 4KEAA 1XZKA 2C4HA 4M0FA 4KRYA 5ALJA 3WWEA 1QZ3A 1GPNA 3TJMA 5FXMA 4DMCA 2HFKA 2QXTA 4AO8A 1XKLA 3FVRA 3BF7A 5ALPA 3KXPA 4JYMA 3FYUB 1GGVA 4H7HA 3I2KA 4X6YA 1GPLA 3ILSA 5DYTA 1AMNA 1QIHA 5FUMA 4WY5A 4QWWA 5ALMA 3O95A 3NWOA 3ESDA 4ZV7A 3PE6A 5AH0A 3WQHA 3VJLA 1BEEA 1YS1X 1NX9A 3RM3A 4DYHA 4X6UA 3JWEA 5JADA 2PBLA 2XMGA 4QWMA 2C0PA 1U2EA 3IDAA 2Y2UA 2YXPX 4ZWNA 1THTA 1BN7A 1QIMA 4LYDA 4WFJA 3OURA 3G8YA 2JGFA 3DQZA 3P2MA 3E1GA 1QIEA 2QTBA 1Y37A 5DYYA 2B61A 2PSJA 3RLIA 5T4FA 4A16A 3WZMA 2WG0A 3SX4A 5H3HA 2CJPA 5AM0A 2QT9A 3F96A 3N0TA 3NUZA 1THGA 1XLUA 4FBLA 5AI0A 1AGYA 3PI6A 4FNGA 5JZ9A 2ZSIA 4WY8A 1J2EA 5HFNA 3C45A 1G66A 1S8OA 4H7DA 1O6GA 3C5VA 2JIDA 1X70A 2XMCA 5ALTA 1FFDA 4PO3X 1GT6A 2VTVA 1QLWA 3DOHA 3PUIA 2ZYRA 1DWPA 3VJMA 1VZ2A 3AJAA 2ZJFA 3H04A 3D2BA 4CCWA 4N8EA 4AXBA 1WOMA 1MO2A 1QFMA 4Q3LA 5E4YA 3ZLVA 2B20A 3B5EA 1KEZA 5D3KA 5KWIA 1GKKA 1IMJA 5AKHA 2HADA 4DNQA 5CH8A 2J3DA 5C8XA 3WI7A 1VLQA 2C5GA 4X90A 2H1IA 5AI4A 1ZD2P 4CIBA 3UMJA 2WHRA 2VJDA 5ALFA 4YK7A 1E8MA 2HA5A 2RIPA 4UFOA 3WL8A 4U2EA 1QIKA 4W63A 4EY7A 2JBWA 2WUFA 4O08A 5K3FB 2WFLA 1UK9A 3BF8A 4BVJA 1X2EA 5LIPA 4K6HA 3WL5A 3B3QA 1ZD3A 3SC2A 5JASA 5ALSA 1DTEA 5SYNA 3HRHA 2EDAA 2HA7A 3BWXA 3WKEA 2WM2A 3G9XA 3GFFA 4KYVA 5EGNA 2IIVA 4L3WA 4ARBA 1CIJA 1XZEA 3O9VA 1CUXA 4HZGA 2BJHA 4BCDA 1CUUA 4LXHA 3WKDA 2XUOA 5ALGA 2XQIA 1AUOA 3DKRA 3CN9A 1HQDA 2AJBA 3HXKA 5AI5A 3R3VA 3PF9A 3DDUA 1FFBA 4PSUA 2PSEA 1J07A 3AILA 2CEKA 2BUBA 5CURA 4KACA 3A2NA 3V48A 4C89A 4N5IX 5CTAA 5AM3A 2VF2A 1LPPA 4G8CA 3KWFA 4YPVA 3QPDA 3STYA 5FPQA 2FJPA 1AURA 1XZAA 2GBFA 1ACJA 4PW0A 2I3ZA 3AFIA 4KAAA 1VA5A 4H7JA 2RAUA 3O4GA 1MN6A 3N2ZB 3NGMA 4BE4A 2HHAA 2VA9A 5JAPA 2J4CA 4J0KA 3FSGA 1HBJA 4IQ4A 1LPOA 5EHNA 3I6MA 4FOLA 5KBYA 2XUJA 4FDMA 2WTMA 1SOMA 3A2MA 4Q3KA 4DIUA 4A5SA 2JGMA 1L7RA 4Y2PA 4EZIA 5K3CA 1XQYA 4QDXA 2ROQA 1A7UA 2EDCA 2QS9A 4J0DA 4OSEA 3C6YA 1C7JA 1ZIXA 4G8BA 4I3FA 1IZ7A 1MX9A 1JU3A 2XQGA 1TIBA 4X97A 1MAHA 2AJ8A 4BVKA 1LLFA 3G02A 1SCIA 4EHBA 3YASA 1QIFA 3FNBA 4AO6A 1LGYA 4EY4A 4G4JA 2WSLA 3BJMA 1JI3A 1ETHA 4UFNA 4QE3A 4HXFB 3WK6A 2XLCA 2ZYHA 5AM5A 2RI6A 1CUJA 3HLKA 3ESAA 5AO9A 4DNOA 1CUEA 4HRYA 3ZWQA 1P0IA 4ZGBA 1CUFA 3R3ZA 4DNFA 3WWPA 3C6XA 2W6CX 4BRSA 4MWTA 4AMZA 1UOPA 2D0DA 4OU5A 1Q0ZA 2WHPA 1BEZA 5AK5A 1A8QA 3TEJA 1TK3A 3I2JA 2Q0XA 1BS9A 3AIKA 1PV1A 3T4UA 1EDBA 4UHCA 1C4XA 3O9MA 2XE4A 4JNCA 1QFSA 1GKLA 1CUIA 4H7IA 3I2GA 3WK4A 2Y1KA 4H18A 4AX4A 3LCRA 3ZV7A 1CFJA 2WG1A 3WL7A 4E14A 4KE6A 4Y2UA 4OYLA 5E4JA 2GZSA 3G9TA 2CZQA 2DFPA 4UBMA 1PJAA 1XQXA 1UFOA 2QXUA 5JAUA 3WKBA 3TRDA 5AKIA 1XRLA 4QDTA 2J4FA 4UUQA 3H2KA 1F8UA 4EUSA 4BDSA 1YB7A 2PPLA 5LZ2A 4F21A 1UK7A 2I78A 2WJ4A 3GBSA 2VJBA 5CT9A 2H7YA 1QO7A 1DX6A 4J7AA 2OLEA 1ZI9A 4XJVA 5LP1A 2CKMA 4BBZA 3QBJA 4B0PA 2HIHA 1W52X 1XZFA 3CCBA 1ODTC 2OCKA 4PNZA 3FLAA 3WYDA 5LKAA 4LYEA 1R9NA 2GBGA 1QIGA 4DTCA 5CRIA 4UHEA 3HEAA 3K6KA 3UUFA 3A70A 2JGKA 1EDEA 2QKYA 3WYNA 4C4ZA 4UBOA 2VT7A 5KWJA 5AKEA 5DLPA 3STUA 2RHTA 1W6RA 3ZLTA 5AI8A 5ALKA 1Q83A 1MTZA 5ALVA 1XKTA 5BOVA 3NOXA 5C8VA 4U2FA 5IVIA 4PF1A 2DHCA 1L7QA 3H2IA 3FWHA 4NVRA 5JIBA 4G8DA 2BFNA 3O0DA 2OAEA 2QUAA 3K2IA 1B6GA 1TCCA 4HS9A 4I19A 1VE7A 3AIMA 4J0CA 1VJ5A 1IUNA 4OD0A 1XRRA 1CUWA 5EI5A 4N8DA 3STTA 3F98A 1B41A 4MWSA 4Y9SA 1UT6A 3PICA 1W75A 1E89A 5CXUA 2VT6A 2Y6VA 3T52A 4U2CA 3DYVA 1LZLA 1AZWA 1LPNA 2Y2VA 3EF3A 4UBJA 4IHAA 4AB1A 1YAJA 2CUTA 2VJCA 3IURA 2GYWA 2XUGA 1XFDA 3KDAA 4DMKA 5HKAA 1XZDA 4CCYA 4HAIA 2QZPA 4FLEA 1BCSA 2CBGA 3ZPXA 4PV7A 3EQ7A 1YASA 3FAKA 2IX9A 3V1NA 5E2IA 5FV4A 5DTIA 5ALIA 4QDOA 1LNSA 1M33A 3WKCA 4OCZA 3G0IA 5AKKA 2DQYA 1VXOA 1EA5A 1WHSA 3G9ZA 4OPMA 3WJ2A 4E15A 5JZSA 1WHTA 1QGED 2DQZA 3G0GA 1R1DA 3RARA 5LZ9A 5C81A 2HL6A 2JGEA 4DMHA 3OM8A 1XRNA 2WUEA 1A8SA 1QTIA 4UBLA 2Z8ZA 1CUBA 3H1BA 1F0NA 3QITA 1R3DA 3I2HA 5LKRA 4W1SA 4ZRDA 3F9CA 4CIAA 5D7BA 4TGLA 4ARAA 4IO0A 4FLMA 5LZ7A 1DX4A 3X3HA 1KU6A 3A2LA 4DNPA 4XWGA 4Y2XA 5HQ3A 2O2GA 5JARA 1LPAB 3QPCA 4BRZA
chains in the Genus database with same CATH superfamily
4V3BA 2XJ4A 5FWAA 4F2GA 1BROA 2WJ3A 1E7YA 4Q3EA 1MAVA 5AVSA 3UCXA 2Q21A 3QKUA 3BXGA 5ANRB 2BTQA 4R84A 3JU3A 5A7GA 1SXJD 2CHGA 3UJCA 5AVOA 1IU9A 3RSZA 2PX6A 4MKXA 4FNMA 5IDWA 5LN1A 4QQFA 1H6BA 5IWCA 9LDTA 3ND6A 1A95A 3OPNA 2N46A 1ZK2A 3DR3A 4OUDB 1D1PA 1U7XA 3CRRA 4E3WA 3DXYA 1FFGA 4F6LA 3A4LA 4BIMA 5K0CA 3U56A 4RJLA 2P75A 1EGMB 1THZA 2IJGX 3OY7A 5J2TF 1XWWA 5DHQA 3IAFA 4NU6A 3N8HA 3ODPA 3MSXA 3CUYA 4PG8A 7GPBA 1OH8A 1IZ8A 3TQOA 5KOHB 3HVIA 4V0OA 1RM3A 1H9AA 4YRFA 1YZKA 1JKMA 2CXNA 3KR2A 3OPYB 1OXBB 4U2GA 1EXMA 1DJPA 2ZM6B 1QYRA 3BSWA 4GNRA 3AKEA 3SIXA 2I55A 1G42A 2CB9A 1N5KA 1O6ZA 4BLWA 4LXGA 4G1EB 1YQWA 3NXKA 3OBIA 2Z5GA 1NMSA 1RLOA 2Q2WA 3ZI0A 1YZUA 1PWHA 3HKCA 3NLLA 4QLOA 4TVKA 5HKLA 3CEMA 1ZK3A 1V3QE 3L6BA 4L4RA 4Z6KA 2E6UX 4M53A 1FMCA 1W96A 3PUZA 4TTPA 3U7HB 2WYOA 3S7TA 3DE0X 4KXFB 4N5HX 3N7TA 4NARA 4EDFA 1QBGA 2OV3A 1JLSA 3ZJUA 4P35A 3PQEA 2WJWA 2NUPA 3VPBA 1NC3A 5EKUA 3QOXA 5F4ZA 1DU4A 2QLFA 5A4DA 4K9SA 1SOVA 4UUOA 1PL0A 1TO6A 3HXLA 3T7SA 2IYAA 4BO7A 2J31A 2QUHA 1JIJA 2C2BA 1ZONA 5KQPA 1X7HA 5TEWA 4Y1FA 5M04A 3OO1A 3DBIA 4XCXA 3M9XA 3ZJ5A 3PJRA 1Y7IA 3BH7A 2ZJ4A 1P6UA 4I6GA 1K1EA 5K0JA 2VSFA 4HDNA 1LSSA 1CVRA 2TECE 3TRJA 2HUNA 1NAHA 2H4XA 2YIVX 3AT1A 3KR0A 2JLVA 4G1MB 1WWKA 3NT4A 5B4VA 3VZPA 5KYUA 3C1OA 4M98A 3HJUA 4KFCA 2XRMA 2ERCA 3TQFA 3K6RA 4E7PA 3V1LA 5DHRA 4ETIA 5IZCC 2CJFA 3ZHTA 1CP3A 1M2FA 2QGZA 3CN7A 1WVGA 3T35A 4G5XA 4LZJA 2C42A 2H8GA 4R81A 4CTJA 4CF3A 1MFZA 2OTCA 2HCBA 4BB5A 1N6HA 4OM7A 3FBWA 4S1NA 2HA2A 2VSQA 1T8TA 5DOVA 1XLTA 2UYGA 1HETA 4Z4GA 1XPRA 2Y1OA 3H5RA 5AJHA 2P6MA 1WSAA 3JYQA 1QTRA 3IB6A 4D9BA 5DNEA 4F2PA 4JI2B 2PZ8A 4I5EA 3GNSA 4MVXA 2I3GA 1UMKA 3OG9A 3C70A 4LKOA 3DNPA 3JQFC 4QECA 2WTXA 4WLNA 5HK8A 4CQMD 3ADPA 1SOUA 2R68A 2R2AA 3E2IA 1FK8A 3LSYA 3KTAB 4HQNA 4IDNA 4NDZA 4EBBA 4DBZA 1NF2A 1YMQA 2YY7A 1LB1B 3QUCA 2YQZA 4QICA 1JHMA 1VLVA 3KKMA 4MZDA 5ALWA 3VVCA 5IULC 5HDQA 1DHRA 2BWJA 5I7EA 1HL7A 1N8SA 2AQ8A 2YXBA 2NSHA 3JR3A 3LLUA 1N77A 2YZNA 2AXNA 2NM0A 1YE3A 3IHWA 4KDCA 4YMUA 3V1KA 2JI7A 4PBTA 4UOQA 4BN5A 2OC9A 1WDKA 2OBBA 2IPAB 3DAYA 2WNIA 3R40A 3I3SR 3IOBA 1QR2A 4B6PA 4L57A 1R12A 2E89A 4CKXA 3KE8A 4YYEA 5DYNA 4ASUA 4BUZA 3S5UA 1F17A 3UM9A 4P53A 3HJRA 4DSNA 5FPKA 2JLZA 1KI2A 1K9SA 2XLBA 3VR6A 3TQTA 1Y7LA 3N2NA 1D0IA 4F85A 2GFIA 2W4IA 4R1QA 3INGA 2MIIA 2XNJA 4MWBA 3JPYA 1QCCA 2C2HA 2VF7A 3KLPX 3LGAA 5I51A 5A02A 1NQXA 4H77A 2CYAA 3SWWA 3TQSA 3LLVA 1SU4A 1JZSA 2ISSD 4F60A 3LFUA 4PXSA 3FHOA 2FB9A 2JVIA 1NU8A 2ZWIA 3GD7A 2QUKA 3H65A 5CM2Z 4EZBA 3RBAA 4PLWA 3RH0A 3LW8A 5CLHA 1DCTA 5L4LA 2XZOA 3CVJA 4RIEA 1EFUA 4ZU1X 4PYMA 3SI7A 2V6JA 2QQ0A 2EJUA 4LDPA 2AN1A 2QNRA 3SSAA 4QRDA 1CUDA 2VAMA 2WJAA 4QJIA 3SR3A 5IYZB 4KFUA 4L3VA 4TS4A 1I3OA 2C8JA 2CLSA 2V59A 2YR0A 3L6EA 1A7AA 4Y98A 3V46A 4R1SA 3GFGA 3KKKA 5IAGA 121PA 2BLNA 2XZTA 1XTIA 3IMGA 4MYCA 4IAOA 5B2ZA 5JFTA 4JHLA 2JZOA 3R5HA 1Z2OX 2BFCB 4CM7A 4DFDA 3OWHA 3W9UA 4DMUB 2BTOA 2HQOA 3DLBA 3JPWA 4GMGA 1UT5A 2B94A 2O2YA 2JFYA 5DXAA 1X13A 3L0YA 3LRPA 5KC8A 4G81A 4BGUA 3HB0A 3HN7A 3RAGA 1BWQA 3N75A 5CVUA 3OFNA 3LDFA 5JCXA 2R5FA 3KZMA 3I9OA 2WQZA 3I6IA 3IP9A 3V4PB 4TZTA 4ZYUA 3ML1A 4RV9A 2FPWA 3B51X 3W5VA 4HAYA 4ZVVA 1AKRA 4LWQA 3NEPX 4UEWA 1H3FA 1PFYA 2QAGA 2UKDA 2ZIFA 3EOZA 2EX1A 3GGJA 2VEOA 4TTRA 4CUZA 1GXSB 3V97A 3TGPA 5DIFA 4LJRA 4MO9A 5LQAA 3E4DA 4G2NA 2RMKA 3PKIA 5TGTA 4WZBE 2NN3C 1ZICA 5HK9A 1TB4A 3QV2A 3REQA 1PR2A 5BPFA 3WJ7A 4M3NA 4FZ3A 3SAJA 4BWFB 1WUHS 4AVYA 1TT5A 3JZIA 2DH5A 3D3JA 4XTRA 5J4HA 3NBAA 1PLJA 2JD1A 2VP3A 3F2VA 1MPXA 3D6VA 1VCMA 3PXBA 2HUPA 2NTEA 3TLJA 2DXIA 5A5DA 4A2QA 4YFVA 3S1AA 5JYEA 3HJFA 1Q14A 2B3DA 2OY0A 4Z9FA 3EZ7A 3ICOA 2AYXA 3O31A 5JI3E 1FXUA 1FBNA 1IQ0A 1NDHA 2Z2ZA 3SQWA 1YR1A 2FFRA 4X3CA 3AFGA 4B4VA 4CLEA 4KIJA 4MQ5A 4RJJA 4QUEA 3UYLA 2GAOA 2YXDA 4ZAGA 4FFWA 4NBWA 4JA2A 3IEIA 1MW8X 1ID8A 4L7VA 1GL3A 1WW8A 1G1AA 3PCRB 5FBLB 2Z5VA 3AYZB 3D8NA 4E5NA 1DAHA 2O3RA 2CY0A 1XTSA 2FVYA 1EVJA 4NCXA 5KTYA 2QPLA 3PQ7A 1LKZA 1ZUHA 1PJCA 3VDQA 5FD8A 4EENA 3P5BA 2M32A 4X1YB 1I7PA 1L2TA 4RD6A 2ZK7A 3R8XA 4F45A 3AQ4A 2FSUA 4FGJA 4HDCA 4LOLA 1HNZB 4QPCA 1NR1A 3L18A 1LLUA 4CQNA 1W5TA 3RVBA 4BJHB 1RTTA 3U19A 2WTEA 2IZ5A 1YONA 2C9CA 3GPIA 1BA3A 1K4MA 2I6FA 3A28A 5A7FA 5BSFA 1ZUNA 4IIJB 3FGPA 5CJJA 1RZ3A 4G5HA 3ASUA 2IE8A 5EIOA 2QTCA 5J2UB 3V4LA 4BRUA 3NI2A 2P6RA 2FP3A 2RK3A 3TQHA 3BWYA 2AX3A 3OWXA 1EZ1A 1C1HA 1Z13A 2LW7A 3LP8A 1Y3FE 4GGMX 4DNXA 3DG9A 4YAOA 2GHTA 3FUXA 4MQ4A 2JHCA 3CX4A 3FIJA 2GCPA 1WXDA 4MVJP 4YJ2B 2F3PA 1GQYA 1GNVA 2LE0A 3AUYA 4UXJA 2ESRA 1D07A 3TM4A 2O5EA 2CGEA 1LPBB 4E5SA 5KX5B 4BFUA 3EC1A 4ADSG 2CL6X 4ZAWA 2EKQA 1CSEE 3OJOA 2H5EA 4RE5A 2VP6A 4UDNA 2PMBA 4D74A 2O2HA 3NWBA 2HF8A 5IBPA 4YAKA 4HGYA 1EGVB 4OP1A 4TKMA 4F12A 2ZJ3A 4HTFB 3UJAA 1YUNA 3F7MA 2E5FA 3FDFA 1T25A 4MW5A 2AMVA 2OGZA 4FUQA 1YVRA 2OHVA 3CSDA 4MKZA 4OJKA 4FZ5A 3VFDA 1O95D 4BP9A 3TF5A 1QKKA 5GJCA 3VNRA 1GLGA 2A1TR 4MLZA 3C5CA 5A62A 3H42B 2GJ8A 1N6OA 3ZVRA 4ISCA 3X0DA 1TCAA 2PUHA 4AKIA 1NASA 1BDJA 4Q6WA 3OE7A 1PZGA 5EUCA 2VHTA 4F84A 1F2UA 3PGMA 5E1MA 1O9BA 5EPUA 4UM9D 1SH7A 2VJMB 4DARA 5A3VA 1PNTA 2Q0QA 4KDEA 3LS2A 4RGYA 4TMZA 4U2KA 1LBTA 1UFKA 2B7CA 1I3CA 4GMKA 3EHDA 2EYUA 1T8WA 3T7JA 1B8OA 2JCBA 3L0CA 4BUJA 4MTCA 4PR0A 2FEWB 1F2DA 4G5FA 3OMLA 5U9CA 2ZIAA 3TKLA 1FYVA 1OXVA 2CBZA 4AQDA 3VR5A 5C80A 1K6JA 4P7KA 2C2WA 3CPSA 1N9GB 1D2AA 1Y42X 2G88A 4MYRA 4R2WA 1VKJA 3EXFA 3GLFE 3FMOB 3MTJA 2IE0A 4KJXA 1U0BB 3IE0A 1ZITA 3N3BC 3CUVA 4NQRA 2ONJA 3ZD6A 4DAOA 1V7PC 2Q3EA 5AM2A 2OENG 5HOEA 2R60A 1U7ZA 3B38A 2FPIB 1P0PA 3WLFA 4RK4A 2WDPA 3L1KA 1WSWA 1R6XA 2VAXA 2ZRLA 2ATXA 4OLFA 1ESDA 2EW1A 3PNOA 2BE9A 2ZKIA 2IZZA 3NYQA 1QGUB 3S1SA 1WETA 2HRDA 2ZANA 2FG6C 5ALOA 1I9CA 1L5FA 5BW6B 4OMFG 1PT8A 2HF9A 5L95A 3JW8A 4TTJA 3IVCA 3G17A 1KMMA 3KK0A 5GVRA 4WESA 3ZZTA 4N3BA 2FFJA 9ABPA 2X1HA 3WGQA 3CPHA 2IUYA 3ELYA 1Q5PA 1OGJA 5AXCA 1OB2A 2YMPA 3PQ5A 3FTEA 2Q8PA 1M2GA 3BQ9A 3KPYA 1OBHA 3MILA 3RC8A 1IZ0A 5CDSA 4WT7A 1DE0A 4Q9AA 2XKKA 2FZCA 1QZXA 5A04A 4K0KB 4FC7A 4JELA 4N40A 2PFKA 3MGCA 4DR1B 3J7TA 2B82A 4R05A 4CT0A 4DHWA 3HCWA 4HFMA 3ZIUA 1CETA 4R9VA 1NYQA 3HACA 4BMPB 4ZI7B 3D3NA 3SDZA 3JVUA 4PAMA 1ID1A 4C0LA 2X3YA 2REXB 1KARA 4RZIA 2PZFA 2H6EA 5FIUA 1BGWA 3PHGA 1I6WA 3JS5A 2BW0A 2RB4A 1FS6A 3IEKA 5JXJA 4J03A 4CEIA 3MCAA 1BMTA 1E66A 3V7UA 2BHRA 3DO6A 4QOEA 1QIJA 2C2KA 4HEA6 4I50F 4O4HB 3FFXA 3P19A 2PEZA 3USES 4FB4A 2VDOB 5E8JA 3W3AH 1Z7YA 3GPDG 3NOVA 1N3YA 2VQ6A 5NLLA 4LXXA 3P9RA 4UTOA 1RXYA 1R27A 1ZNWA 3JWJA 5AXDA 2AJDA 5TVKA 1Z2PX 1EP9A 2IYXA 3BB4A 3WDKA 4JI1B 3KEQA 3L6RA 3ZD7A 4PEVA 4Q19A 5H0IA 3SBDA 4GEKA 5EXXA 3FF1A 2F48A 4JJFA 4X3PA 1ODCA 1SVMA 2ANBA 4YJHA 4YNBA 1TLFA 4M0FA 3ND7A 3M1IA 2IU3A 2Z0MA 2BHLA 3KTOA 4PRYA 2BC9A 3G2HA 5L4SA 4HX9A 5FQOA 2JGAA 3KB1A 4KYIB 4QYIB 2J1LA 4H08A 5ELMA 4DM7A 1KVTA 5JXGA 2H1LA 2PA3A 3GQBA 1Z33A 3DDCA 2YC4C 3HYLA 4LX0A 1ZD5A 3BRCA 3RG8A 5ALUA 4NYJR 5HSGA 2E1RA 3LDUA 2YV3A 3B1VA 5FUXA 4GZ3A 3OLZA 4ESEA 2R1TA 1F8YA 4CQMA 1E9FA 2PX2A 3IYLW 3WWYA 4DV2B 1KRWA 5DI9A 4DY6A 4DLWA 1R0YA 5FTLA 1M0WA 3PC8C 3HUUA 1SUIA 2A7QA 4DWWA 4OX9B 3F5DA 1DCFA 2HC9A 1JXAA 5EIFA 4AG6A 5KSYA 2FEAA 1ADGA 5FKJA 4IQ8A 4B0OA 2XUFA 4R8RA 4TV8F 1H0KA 2P1DA 4G0UA 1QNFA 7ABPA 5TMPA 4FGSA 1M8KA 1WF3A 4PZCA 3EARA 3LWZA 1KKLA 1V5WA 8ATCA 2OHFA 5DGHA 2YH2A 4WASA 5EKXA 2P67A 1MB4A 5IXYA 2IEYA 3L8CA 1AQLA 1HLGA 1T1JA 4CF6A 4CIYA 4P93A 5EJMA 2QE6A 1XO1A 3VM6A 2OAQ1 3BUSA 3CT6A 5FNVF 3OCCA 4LSWA 1P61B 2A0UA 3H17A 2D5BA 4JUCA 4ESOA 1N92A 3FDXA 2HA4A 3JQAB 4KL8S 3N0RA 4NC9A 3T1VA 4A6PA 3MINA 4L5CA 4U7TB 1S4QA 3TIGA 3QWBA 4MJLA 4X95A 1T43A 2A8YA 1USWA 2HBYA 2H7CA 1Z07A 5JNSA 1KDPA 4OMDA 3SEAA 4I66A 4LX8A 1NX6A 4D4LA 1CPYA 2VEDA 1TRKA 2ZJ6A 5KNCH 1XQWA 5J23A 3RABA 4C7OB 1KI1A 4EYGA 1Y3CE 2Z2XA 3C8MA 1ZRHA 2O8CA 5BSHA 1YQUA 2XSZD 2CLHB 4YAJA 3SJBA 3N76A 4I55F 2ZAMA 3TXYA 1PHRA 1FYFA 3OZBA 1PZEA 3V7YA 5H81A 2C4NA 4TXNA 3V9AA 3IVMA 4KIWA 4C3UA 1Q6ZA 1QF7A 3TE7A 1VL0A 2H29A 1G63A 3BHIA 4PRKA 3NATA 5C0OE 3VKUA 4HXYA 1KPIA 4AUMA 1QVAA 1IOZA 1FTWA 1N2SA 1SHUX 3SR4A 4QZVA 2OR3A 3FRJA 4WNYA 2GTIA 3UJ6A 3SZOA 1E1CA 2C9OA 4FFOA 5FOVA 4GNKA 4ZREA 3ZGNA 1IN1A 4KPFC 1B4DA 1LI4A 5F2EA 3H5NA 3GRKA 1G8GA 1U0RA 3SXUB 3MMSA 3PT9A 5CW2A 5HUQA 1QO9A 2ARKA 2PRKA 4RZ2A 3EQ8A 3TZCA 2CWDA 3EDQA 1WQ3A 4D41A 4DA8A 3KJGA 5U4QA 2R1ZA 4GOND 3ZGYA 2WE8A 1DJMA 2VHUA 1I1NA 2QL7A 3NAMA 4ZEXA 1C30B 5AVUA 3DMGA 3OCVA 4W8HA 4CG2A 5B30A 2DUWA 3IR5A 2YY5A 3IUEA 2NQ2C 2EFGA 2PBRA 2JLRA 3G8CA 4IYJA 5A2GA 1TPZA 2HMYB 1QJCA 2OO5A 2QVLA 3NEAA 4BB0A 3DYIA 1I3LA 3PXUA 1PBTA 2AG0A 4O4IF 4EA6A 2WUGA 1QIDA 5AIAA 1HKUA 2J9FB 1R66A 3UN1A 3QKSB 1VBMA 3HDTA 1H4QA 4JLVA 1Q1NA 1J25A 3K32A 1PR5A 2D2FA 1SUPA 2YVQA 4BLPA 1CKEA 5ADVA 1KSFX 1GP2A 4P4UA 5LXTB 4L4SA 1IATA 2CZCA 4Q4CA 1Z0IA 3VSCA 1M34E 1QG0A 2XQJA 3CZ9A 3PJGA 4MLCA 4WCFA 3NB0A 3CO5A 1WNTA 4H1UA 3SQLA 2Y71A 3KQOA 2JKYA 4CE6A 1KBQA 1GQSA 4LC1A 1AKEA 1XAGA 2F67A 1UIMA 2RKBA 3F6BX 5EG5A 2J5RA 4W82A 4EB3A 2JIPA 3ETDA 3V1TC 3D7RA 4DWJA 4EY6A 5DW3A 3ENZA 1IWBB 4REMA 4RH0A 3M82A 4ZAXA 4F7WA 3JAMA 4HN9A 1C0EA 3SN6A 4DVJA 3WHKA 3ER9A 5F4BA 1JBEA 3RR2A 1SUDA 3VH3A 5ALEA 5BWBA 1I94B 1R4MA 3UW3A 1IEWA 2VDNB 3JTEA 4QPJC 1M66A 2HNBA 4BVAA 2JFXA 3HU2A 1L7AA 2JFNA 3U62A 4YJGB 2W8BA 2FN8A 5ENVA 1Q91A 1YCDA 1Q1QA 2D5LA 3AKCA 3K0KA 1U9CA 3WGHA 1XA3A 1C80A 1JHYA 1GG9A 4DADA 1VSVA 1P0QA 1PUJA 1UBKS 2X77A 4RK5A 2DPHA 4G1VA 3VI3B 3QVXA 2HFJA 4HLUA 3E70C 4PO1A 3RC1A 5C7OO 1AC5A 1YR2A 3EGXA 5DV9A 4NL4H 1Q19A 3N0WA 1U1IA 4PG5A 2J0UB 2JIZA 3AEZA 3D8TA 4XX1A 4A10A 5AVJA 4MCAA 3E81A 4RPCA 2XZLA 3SJCA 3AB7A 2BHSA 3HRIA 3N59A 4BCCA 1CE8B 2WVAA 4ND7A 1D3AA 4M8KA 1UBCA 1EWRA 5FUBA 2EHDA 3BL8A 1NVXQ 1CBUA 3WAJA 2IF0A 3P9IA 3R09A 1JQLB 4I36A 5BMVA 1QU2A 2L42A 4QUIA 1AKNA 3ZK9A 4UU0A 4E46A 4XX0A 3HBAA 3VV3A 4MVJF 1NQOA 1U11A 1POWA 1TA4A 3DTNA 3OBBA 4MW2A 4WCDA 4ND2A 3TLYA 4Q4DA 1LW6E 1Y3DE 2OBXA 3B13B 1VPEA 2XYGA 2AYZA 3FLEA 1QM5A 5BRAA 3GRZA 1P73A 1JGTA 3IULA 1HO3A 4QSMA 1P3JA 3L1JA 1TKCA 3MWYW 1CJMA 1MO5A 3UT6A 5HHTA 3KBOA 2V03A 1USIA 1LQUA 1Z7EA 1P1HA 5FWYA 2P40A 2H07A 3C15C 4FYHA 4MK4A 2VNHA 3ZE7A 2FKAA 3HM9A 1YD7A 5EMHA 1RKXA 4EJ0A 4F4FA 3FHCB 1JPNA 4JI0B 4FBGA 4UM7A 4NK4A 2YWFA 4LHEA 1GILA 3QEBZ 1IXSB 1C9EA 1VP9A 2VBGA 2XMQA 4REOA 3WG9A 3PRJA 1UDBA 2XVYA 4XYGA 4TMYA 4Y18A 4KMRA 4RDCA 1T6BY 1KAOA 2YN2A 2J7PA 3BS4A 3ZK8A 5IU6A 1XYGA 4M7RA 5JANA 2Q9AA 1D0SA 1SQ6A 4G0XA 2WHPB 1ZC4A 3CF2A 2Z9CA 3MYRA 2RKWA 4QDZA 3OP4A 3DMDA 4M0UA 3HXPA 2PE5A 3ZDQA 1P5JA 2BFOA 13PKA 3QYAA 1V1JA 3U3RA 4UNPA 4M0MA 1OSNA 1K08A 1MQSA 3B3GA 2FDXA 3I52A 4NOLA 1UK8A 3TRIA 3ZR4B 4H4DA 3ME5A 2B5VA 2HHLA 3AEYA 2YW9A 4Y9DA 4H6XA 3M33A 1C7QA 1CQZA 1XRPA 3K92A 3VDXA 1KAEA 2FFQA 2MR5A 2X6TA 4J2TA 4LHXA 1JIQA 1ZFNA 4UMVA 2C7RA 1WB6A 4G4SP 2EZ8A 1UBFA 1KRXA 2IS6A 2A58A 4XQCA 4CKCA 2HSJA 1DUIA 1PJ3A 1M8PA 2H1CA 3I6ZA 5B58T 3T7IA 5KQLA 2H2HA 3WBBA 2DFVA 3A9SA 4E21A 1JDPA 3MS2A 5TQJA 2MINA 2WKQA 1XZGA 2GF2A 1R2QA 4JZKA 4ZHQF 3JARB 5D5QA 3OE1A 2FX2A 4N01A 4AULA 2GEJA 3AMVA 4KUEA 2O5CA 2XECA 4ZCLA 4L50A 1Y4DE 4UPVA 3UWPA 4PLVA 1Z06A 1IOVA 3E3AA 3AEKB 1F38A 4KWEA 4BASA 1A9PA 3VJRA 3AP3A 4LF8B 5FAKA 2NYVA 2P7IA 2VDMB 4I3GA 1GQRA 3S0JA 3WXMA 1ZDMA 1P1IA 3GRYA 1TAGA 4KR6A 1QYDA 2RGUA 5JI2E 2CMFA 3U7FB 1K5GA 2YRXA 3LF1A 2FGJA 1JFRA 2FE4A 2QW1A 1KZGB 3E7DA 3H19A 3JAWB 4KNVA 4Y6RA 4UVGA 1G21E 1QB8A 1TYBE 1YCGA 3MT7A 5A4KA 2HYIC 2BZSA 1CEEA 4Z9YA 2IPLA 1KAMA 3ZJYA 4K6CA 4HYYA 1JMYA 1ZM2A 3GYGA 2Y1DA 3LO8A 3R1IA 4N5DA 5BQPA 2WJYA 4B7ZA 4DLXA 5LL6P 3FTFA 2J4DA 3TD9A 1QOQB 1UR5A 2QF7A 5B53A 4Q02A 4DA9A 4R5MA 2KJQA 1T3SA 3KYJB 3TSOA 2QI9F 2H1WA 2OA0A 1RC0A 4Q4JA 1LBEA 5K4GA 1YK1A 2ZYWX 3DL0A 2FHPA 1V8ZA 5D3ZA 4BE7B 1GTL1 3W8RA 3EPPA 4FFBA 4DYDA 2L18A 2WJGA 2J5QA 2XWPA 3QYFA 4M8LA 2IZOA 2JBHA 3O26A 3EMBA 3KOYA 5B1SA 3HYRA 1PJRA 3AIIA 2Q7XA 5DPMA 3UJ9A 2P3QA 3RIEA 2AE1A 1DC4A 2AFIA 5TJHA 1Y4UA 2IUSA 1ZJ4A 4ZOAA 4LMBA 4NRDA 4DA6A 1Z6AA 3IPAA 3BDVA 2HWWA 4ALNA 3ONDA 1J00A 4CLOB 3T7AA 3NHPA 3S4YA 3VDNB 1I3NA 2VJYA 2EX4A 1RWKA 5EKTA 3DL7A 2WB2A 1FFEA 3C85A 1HWYA 4H3HB 4ZRNA 1JVSA 4UPEA 1JVBA 1KI3A 3UJNA 2D74A 2TRSB 1ZGGA 5KEIA 3IMCA 2II6A 4B6RA 3F6PA 4CI9A 2JHFA 2VAVA 3DMHA 1E1RD 4IUYA 1N1EA 1L1RA 3IP8A 1SZDA 4JV5B 1K63A 3MPUA 1PK9A 2DJIA 3VYVA 3G8BA 4A0HA 4C4RA 2Y0PA 3G85A 5D87A 5AW3A 3KV3O 1MXHA 2WVJA 3E9QA 2XVMA 4YP9A 3DVAA 1NBWB 3B48A 3TXXA 5IT4A 4H3VA 4MQLA 3K94A 2JA1A 4I1UA 4GMDA 4ZYTA 2DERA 5DNVA 1GVHA 2RHBA 5BNIA 1HYQA 2HV9A 2HI0A 2QHXA 2R84A 4IICA 4V3CA 3T3GA 3LL7A 3FNQA 4NNPA 3ZKAA 2GKOA 4ZT3A 1BX3A 5KTNA 2PCJA 2YX1A 5CFNA 3PHLA 4OXQA 2XE6A 2WF9A 4LJ6A 3UMVA 1MB2A 3D64A 1PT6A 3RTBA 1M7GA 4M8IA 5GAJA 1EXWA 4TUYF 5HRUA 1WTAA 2LP4Y 1ZR2A 4ZIRB 4BMDA 1XN1A 2ZYSA 1RQLA 2GETA 3H4MA 4EMUA 3AEXA 3QJYA 1YA4A 2FEMA 4XSHA 3C8HA 1C9JA 4A8JA 1KH2A 3M9WA 2X40A 3C5EA 1IUKA 2BGUA 2EL7A 3PD1A 1MIOB 4N3GA 1LSJA 3CSUA 4MW6A 5DXFA 5IAJA 1KJ8A 2G17A 3QWAA 4TL9A 1SIUA 3EC7A 3VZSA 1GT91 3ZGOA 2GRUA 2DHRA 1SJ9A 3ASZA 4AZ0A 2Z2IA 4IIDA 1EYZA 2ZUTA 3GCWA 3ANYB 3QU4A 3G23A 4LQDA 1PS8A 3GDOA 2XSZA 1RADA 2Z30A 4ER3A 4JJGA 1BSVA 1I5EA 2ZI6A 2A9OA 4LF5B 4QTTB 4NESA 2A9KA 4JOSA 4GPZA 1RXIA 4TKZA 1M2NA 3E18A 1W25A 4UHJA 3UBMA 3G5UA 1DAGA 3QE3A 3SEZA 1X38A 1JDBC 5DH9A 4EMBA 4OFBA 1DQPA 2H4WA 4FR0A 3D8BA 1A8IA 4LTDA 4US2R 1JEYB 2OPHA 3SR0A 4HDSB 4QYXA 2Q3HA 2CXXA 3L04A 4KQXA 5ALQA 3VO9A 3GFQA 2OG2A 4QD3A 2WKPA 2E37A 3OIDA 1XZLA 5HZKA 2PVCA 1TF7A 1O6FA 4L08A 2OPBA 3QVTA 4NY1A 3SE7A 3UK7A 1BCSB 4GT1A 2P62A 4YY3B 3JQ9A 3RUPA 5CCBA 1LX7A 3T5CA 1M1NB 5IH3A 3N8GA 3RS9A 2FP4B 1QXSA 1RDFA 2PXAA 4NEGA 1GFSA 1HK7A 3H0KA 4K8RB 1JT2A 1UDCA 4F9TA 1N8KA 4E1AA 3HJAA 1T4CB 5IKXA 3A9WA 4BO2A 4Y2QA 5C18A 2HDOA 1Y98A 3KU1A 4R4JA 1IVYA 1JJIA 1OWPA 2H9IA 2OHOA 3HCEA 3PWTA 3WY9A 3K0BA 3ZY4A 2HIAA 4DLAA 4Y2RA 4DSZA 1E2DA 3TOSA 3BMQB 2GF9A 4ZVQA 3EGDB 3ZU4A 2D2VA 3C4JA 1R50A 2BJVA 2V7GA 4V0MA 4G5QA 4KR9A 1FQKA 3WDSA 4A23A 3WLKX 2H16A 4Z9XA 1KMHA 4DC1A 1X77A 5TF0A 3VPFA 3WISA 3C3MA 3FPHA 4B40A 2UXCB 1VMAA 3FIUA 4IIYA 3IJPA 2X0FA 3NHBA 4HEHA 1JVNA 2XB6A 4O2AA 3FPJA 1EWYA 5YASA 1VJ1A 4HTAA 1RD4A 1MB0A 3N0XA 4FOSA 1YAHA 3ZWNA 4XVHA 5BQ3A 5LR6A 1U5CA 1JDNA 2QL5A 1PD0A 4E0BA 2QRVB 2JLCA 5TS2A 4CTMA 5PGMA 3RS3A 4BEBA 2NW6A 4UHFA 3AZPA 4D5GA 2WIAA 1NI4A 2NV6A 3HR8A 3ID6C 1JR4A 2QA5A 1RLIA 2QG6A 3EAQA 3F8SA 3AL2A 3JZAA 1KK1A 4R6WA 3E5MA 5F21A 5P8WA 4B3IA 3VKWA 3EXG1 2CYCA 5HQJA 4YTEA 1MORA 2VCEA 1V16A 4NFSA 2JVKA 5CLLA 4J4TA 4TSKA 4URFA 3BWEA 2B4TO 3NNDA 2QLLA 1H2XA 4E1BA 1WCIB 5EEHA 4O63O 4GVLA 1H2FA 3VSEA 5ICEA 4PCVA 2ZB2A 3HDJA 2XDYA 2Y1CA 4K2HA 4B2PA 2BN4A 4JMPA 3ZCVA 1YE8A 1VHDA 3AR3A 3FFWA 1IVSA 2PM8A 4TPKA 3W2IA 4M9CA 4L0QA 1YZGA 2HWKA 1K97A 2WYWA 5F7XA 3U44A 1RABA 3BCUA 3AEUB 2B98A 1KDRA 1GUYA 3LC0A 4G0MA 1BH6A 1EFRD 1M2HA 3ZG6A 5HTKA 1NKVA 2DC1A 4UU7A 2Y6UA 1G4HA 3BE8A 2I6GA 4GI7A 3FGNA 1J5XA 3GDWA 5CK5A 1VIMA 3LHKA 2WWHA 4JVLA 3IV9A 4NATA 4JLMA 3IUJA 1FFAA 1ZM9A 3G13A 5IANA 2ZT5A 2VTBA 4Z1MA 1CJUC 3GNTA 4JUDX 4DIKA 1QPBA 3OLVA 3OC6A 4YCSA 5C1IA 5JXHA 5KNBH 4QGFA 2B34A 3ROQA 4I50A 4V0NA 3HCDA 3OOWA 4KMMA 5G1PA 5C51B 1NV9A 3BG5A 3HDHA 5GIPE 2O20A 1QC5B 1PQPA 1KIAA 4WZBA 1XWIA 1U6KA 4L5BA 3MJHA 3DV0A 1GAXA 5K0NA 2K7ZA 3O7WA 3HBJA 2NXEA 3V1MA 1BMFD 1V71A 4RPIA 1T5LA 2CE2X 4EECA 5B7PA 1CDDA 1ENYA 1NFQA 4GPTA 4LY6A 3I5AA 2R00A 3JQPA 3OFJA 2M1ZA 4ITVA 4NICA 4NZPA 2AZMA 4XDZA 4EB0A 1SC9A 1X86B 2B4KA 4DTIA 1IK6A 4B3MB 3ZDRA 4Q7LA 4AZ3A 2EYQA 1H23A 1BCRA 2NWQA 4HLCA 2HU8A 5DGDA 5JV5A 1AQ6A 4WOCA 1H2ZA 4J16C 2GBLC 2GWRA 3FOCA 1JJBA 3HSSA 3OZTA 1L4EA 5DRYA 4ENSA 4EQ6B 5DCUA 4C78A 1DO2A 2YVLA 1Z75A 2RHGB 1NA5A 3MZ0A 4N12A 4PG7A 4UD2A 5CK4A 4CHTA 2R86A 4K6KA 1NJ8A 1Q17A 2DYKA 4TKUB 4ME6A 2AEEA 2LIPA 3LP5A 3LSTA 3WV4A 1E4EB 3IDOA 1U0EA 4JHXA 3MTGA 1Z5NA 4L74A 4RW0A 4ZHSA 8ABPA 1GNTA 4Q4HA 4TVBA 3PNKA 4AJOA 4Q34A 1L7PA 1X1DA 3OX1A 2ZRHA 5I6DA 5DYWA 2QTNA 2YWEA 3FOBA 4P8RA 4RTKA 4BEJA 2EIHA 1I6KA 1FTQA 1AM4D 4KQJA 4IDQA 4U9UA 4EPYA 5IZCA 4C2TA 2O8FA 2KYRA 1Q7RA 2ZXEA 5T8KC 5BOSA 4RKRA 3Q0IA 5JOQA 4WUVA 1CY6A 2HK9A 1BU5A 2BI8A 4UCWA 1BRTA 1RWBA 3SKXA 3NCTA 2VLIA 5DLEA 4GDMA 2Q9CA 5JQWA 1AA9A 3EBLA 4Z4FA 1H2BA 4JSTA 3DL4A 5FNVA 4DR6B 1PFQA 2ORED 3LNCA 2OCBA 5CLQA 2P4EA 1UBTS 2PZEA 1ODIA 5J5CA 3AK4A 5COBA 4YQEA 4RIGA 3C1AA 1XP8A 1HM5A 3IUNA 3VMMA 1FBTA 4DQDA 1U0NA 2A59A 4Y2JA 1RVV1 2QTVB 4E11A 1LC0A 2CXRA 3V55A 2PS9A 4IH9A 3AVXA 3MUEA 1VGRA 1JJAA 2R4UA 4IFEA 3KYDB 4Y2TA 3BRWD 1J2RA 1N2CA 2AOVA 2PEYA 3FFBA 3LQFA 4I55A 3KJHA 3U1TA 1GGEA 1RAIA 4JSRA 4MICA 3F8WA 4M22A 1EB8A 1UDAA 2ZUCA 4LJKA 4OHMA 3WYCA 1KY2A 3SNHA 2WFLB 3MGAA 2CF5A 2YMMA 3GH3A 3WSWA 3LHIA 4YJFA 1PFUA 2BR5A 1NFRA 1FNDA 2FRDA 3Q1KA 4HDMA 3VH1A 4C43A 1QV9A 3ZDDA 2QVYX 4BATA 3CVYA 2IVZA 1PE0A 1XMSA 4EF6A 1Z83A 5FO0A 3TPZA 1PWXA 1R4NA 1KXZA 3LNTA 4FGUA 4P33A 4MPTA 5BWOA 4UJ3A 1QRRA 2CEAA 4RANA 1LZKA 4YACA 2SKCA 4JJ7A 1Z22A 2CMHA 3TGLA 2ZJOA 1JALA 3TK1A 4G6ZA 5LJIA 4ZRDA 3CNHA 5KSWB 3BIWA 2HCJB 4TKVA 2IBSA 3ILHA 2NNWB 4RY9A 1UP4A 1QWSA 3PQ8A 4IZIA 1W8IA 3AERB 3L93A 3E9ZA 1EAYA 1JE1A 1M1YE 1DTSA 4DG9A 2LCIA 1JEEA 3SKYA 4LJ8A 1X7YB 5JWHA 3U7QA 1BQ3A 4A0QA 5K8VA 2JLWA 3E2PA 2OORA 4G07A 4ZZ0A 2W6JA 1OIVA 2ET6A 5DTMA 1IUPA 4O4IA 2A1UA 3T7KA 4OJMX 4BV8A 4EG6A 3G0CA 5I3CA 4MV9A 2BEKA 3D6MA 4G5GA 4CNBA 1IG3A 4JC4A 4IF6A 3MWDB 4MULA 1YVPA 3LL4A 4IL5A 1Q0HA 2PKWA 1HSZA 1EWKA 2GAIA 1G2OA 9LDBA 3ZDZB 4EIWA 1T8YA 1OU0A 3HZHA 2E9SA 3ABQB 1OYWA 2G5GX 1CP2A 1S7CA 2AF3C 4MR9A 1ZRNA 4MPPA 1U0LA 3BXEA 1K7YA 1TRHA 2WT4A 3H6GA 2XTMA 1SVNA 2W2LD 4A1FA 4EW3A 3DL2A 3AKZA 1V5EA 2CFOA 2CXOA 1P9RA 2Q6LA 3C97A 3GJYA 2PMEA 1BQ4A 2QR5A 3RUCA 4IIUA 1FB5A 5FYQA 3ORYA 3TRHA 3EPKA 4I4LA 4KK4A 5EQDA 3DLTA 5JHHB 1DRUA 1W30A 3RTDA 4C06A 4XRGA 3OT1A 1I0LA 2HU7A 5AVRA 6GPBA 2O23A 4FFPA 2ID8A 2OBFA 1CV2A 1E5XA 3FMVA 3JRWA 3RRZA 3SYRA 3UA4A 2J0SA 1P1BA 1Z2AA 3KSRA 5JDIC 3PGLA 5JISA 1OXMA 2V0NA 2X2EA 3DPIA 1CUAA 1V8OA 4Z4EA 3GRCA 3QVGA 5TPWA 3O8RA 3UUEA 2ZB4A 3MTEA 4RK6A 1EESA 2FSHA 2F90A 1K7FB 2GAAA 4N9WA 3AZOA 4C0BA 1SEPA 2E2WA 4RQAA 3BEDA 2OXTA 3O0TA 2AI1A 1O4WA 2HA3A 3DT6A 1Z5OA 2GBPA 3CX8A 2HZ7A 1T4MA 2CDAA 3HI4A 5J63A 5IH7A 1A2BA 4Y1RA 1ODSA 2BI4A 3U4HA 2NXWA 1YOVA 1ZVQA 3N2GA 3ENVA 1RPTA 4RNCA 5A6VA 4CKBA 2XCRB 4Z2YA 1OCEA 1ZIOA 2VWHA 1C7RA 2GPYA 3I8OA 4KI0A 3T95A 3NONA 1FS4A 3EXHB 1VMEA 4B6GA 3PEEA 3H9CA 4TOIA 3T7EA 2I8AA 4RJIA 4CIWA 4FYMA 3N0VA 3D7KA 2E87A 2VF8A 4ZOLB 3IPLA 5FBKA 1RC1A 4OQMA 3QVKA 2FDCA 4FX2A 4MS4A 4I4NA 1PVDA 2WPDD 4GW3A 1I2DA 1EE9A 3BMXA 4H1WA 3CFYA 3HKEB 3G5TA 2PAAA 5HF8A 1RAEA 2XI4A 2GJSA 2QPAA 3SJUA 2CV1A 4MRSA 3SS7X 1GPKA 2I71A 5ENDA 3W6UA 2FSIA 4MJXA 5HF5A 3CE6A 1GVNB 3AONB 4ZVMA 1RU3A 2FK7A 2RBKA 3BA1A 3IEUA 4UU8A 4WFKA 2X23A 1VZ3A 1Q2UA 1T0JB 2VYFA 3IQXA 3FETA 4JBYA 4WXYB 4FR5A 5LYJF 4I4TF 2QY9A 1DV2A 5E0OA 3IP7A 2WM3A 2KPOA 1XZKA 1M7HA 1OI7A 2MCFA 2GN6A 5THKA 3NX4A 3SU8A 1XUOA 2Y3IA 2QVXX 2X8WA 2C98A 3EEBA 5IMBA 3UT0A 5JZOA 3Q3HA 3H11B 4NX2A 4O4JB 3INRA 5JSHA 2XMPA 4YCCA 3KKOA 5FUWA 1KI8A 1B3RA 2QSZA 2OKCA 1XEXA 4YC7A 3NKFA 3ZE1B 3KXPA 3MGBA 4MVJG 4V02A 1ZESA 4YRCA 1EEXB 3MAAC 2QJTA 3CVOA 3I0MA 4FDLA 1XRSB 1TO2E 4DCUA 4DSUA 5F5XA 4PTZA 3I2KA 1BGXT 1EP1B 2YOHA 4I9FA 3PC3A 1Q74A 2Y1EA 4HAUA 3RHFA 2PXCA 5KHAA 2DUJA 5KVSA 5EJAA 5LDHA 4QU0A 2Q3JA 5DYTA 1NOJA 5IG2A 1AMNA 2ATCA 5F35A 3KEOA 3OIVA 4FDVA 1H3EA 4FYYA 3DBVO 3N8NA 2ZTUA 1VIVA 3DMNA 3RBXA 3FPGA 5FBZA 4ZHQA 4WQMA 3OH8A 1FFXA 2WEKA 3UB4A 3ESDA 3LCCA 4M1YA 2I2CA 5BSTA 4JLOA 3WQHA 2C7OA 3OWOA 2O07A 3NHFA 4OH1A 3I8XA 1YS1X 3TTUA 1A5AB 1X6VA 4LGYA 3HCFA 4HGZA 2DKFA 4V0KA 3EULA 4QWMA 1PG5A 1U9YA 4FJ2A 2V7EA 1M2OA 3CW2A 4XM1A 4CMJA 1DNPA 1Z45A 1LW7A 1YHZA 1ZSVA 2FOXA 4MV7A 4Q24A 3GP3A 3KU4A 1RHJA 1ZH0A 2CLFB 3VZCA 4AX8A 1VG8A 4YROA 1AGPA 4CGYA 5KC9A 2EQAA 2UZ1B 5ILOA 2D0IA 4LYDA 4WFJA 4QXAA 1W5FA 3GVXA 4BXOA 3P2MA 1L5HA 3E1GA 3ZJTA 2W0MA 3WSVA 5CPBA 1R4AA 3TPCA 5C7LO 2BIFA 3NT5A 3N87A 3PWSA 5KHLB 2UYCA 3MMXA 3IEMA 5ELXA 1O0CA 3CM0A 3HZRA 4E2FA 3RLIA 1J0EA 3D4BA 1O89A 1XXLA 4XLZA 4Z7QB 2DR2A 3QELA 1GU7A 1HLDA 3WL4A 1XX6A 2QTHA 3B70A 3JYLA 3WZMA 1HNWB 1WVMA 3D1JA 2RIRA 2ZIGA 3RTEA 4BFSA 3K9CA 4MUHA 3LU1A 3DHYA 4M1ZA 5GV7A 5H3HA 3SX4A 2C2GA 1PV2A 3A1CA 1W2HA 3SF8B 5H3LA 5E1BA 5KMGA 3GLIE 3NUZA 2YIMA 4CF7A 1XLUA 1YDFA 1C7FA 4ZPJA 3CBQA 1VPWA 4IIFA 1T34A 3ICEA 2HK6A 1TVEA 4AKSA 4EFLA 4OOEA 3B1JA 4NG4A 4OHUA 3CE9A 3UMSA 4ZKDA 5JZ9A 1AKTA 1RRFA 5ES3A 4WY8A 1J2EA 5C8YF 2W2XA 5SY6A 4YMLA 1MKYA 1L7NA 4CYMA 1A7KA 3TW6A 2EC5A 1NUSA 3GIDA 1S8OA 4H7DA 1FDTA 2XWBF 1O6GA 3B20A 3C5VA 1M34A 4P4SB 4R1OA 2Q3DA 2ILVA 2JIDA 5ETJA 1VHJA 3KAQA 4F9FA 1CB0A 1FYDA 4G01B 2C59A 5ALTA 1FFDA 4L9RA 3JYOA 4L4ZA 3B3FA 1M0TA 1NM5C 2P27A 1O4VA 3ZTTA 2SBTA 1QTQA 2I0FA 2NZVG 2PFSA 4UEQA 4F8EA 2WPNA 1S1CA 2VJLA 1L8LA 2NAPA 1U9ZA 2GYYA 2HSZA 2FH5B 2K87A 4D3SA 2ZT8A 4PFKA 1CCWA 1ZGHA 1C1YA 3EOBI 3PC4A 4I9NA 3V4FA 1XV5A 1I3KA 1QHFA 3MOIA 3F9RA 2ZJFA 3ETEA 2FRVA 4L76A 3MJEA 4TWBA 5CGZA 4YJKA 2JNWA 4ZVTA 3L2OB 3ORSA 1ZK0A 4A8TA 4N8EA 1ML3A 4DLRA 3QQPA 1XGKA 4KXYA 4AXBA 5JW6A 3VO2A 1WOMA 1ZA1A 3SKVA 2GHRA 2ZXFA 3JXEA 4Q3LA 3RYFA 1NKTA 3ZWWA 1OH7A 1U02A 4HN2A 4F1WA 4DLKA 1EP2B 1BJKA 2B20A 2JL1A 1KEZA 3B5EA 1MC1A 2HWXA 3TSAA 5KVCA 1MOQA 5AKHA 2HADA 3S6JA 5IABA 2Q2OA 3LPNA 3AUXA 3AL0C 5FCDA 5DHSA 3IOEA 5BR7A 1FXWF 2C5GA 2IDZA 2GX6A 1JQ3A 4KLAA 3A1VA 4R1MA 4EABA 1GITA 5AI4A 1GFWA 2QP9X 2ZREA 1K2VN 3UAXA 3I04A 3UMJA 3V2HA 1G7RA 2P9HA 3IBFA 4NBLA 5FWXA 3HB1A 2FKNA 5ALFA 2WFAA 1E8MA 1B26A 4C5BA 2XCUA 3CW9A 2F1OA 3CPEA 4F5YA 1I4OA 2WYVA 4W63A 4WZAE 4X45A 2JBWA 3G2NA 1FNCA 2WUFA 4O08A 3KJQA 1YL5A 3EGOA 4EJSB 2UUOA 2B3TA 3PWZA 4L8YA 3SX0A 4F96A 3U13A 1OJLA 2RKOA 5TVGA 3T3IA 2IYEA 3LWBA 4TS9A 5EXEA 3Q8LA 1OZ0A 1NSTA 4M46A 2B4RO 1IPFA 1E6KA 4IIVA 1SOAA 4F4IA 3UJHA 1TK2A 3C3XA 4PO8A 4Y9TA 1CB7A 5EE0A 3GOHA 2G76A 5LIPA 2JFWA 3MC1A 2E4ZA 1D1QA 2XA2A 2ZYAA 3U7GA 1FCJA 3FNIA 1HTTA 1YZYA 5CA1F 3QG5A 3HBLA 4UOEA 4M1MA 4CLRA 3ES9A 3THWA 2R6DA 3GU3A 4ZVRA 1J9GA 2CNLA 2FPGB 4I1OA 4L4UA 2ZRJA 5ALSA 1DTEA 4XTCS 2BFPA 5SYNA 4HAZA 2UYYA 1X9IA 2EDAA 3RLFA 3ADDA 5I4CA 2AH5A 3WKEA 2J30A 3K0AA 2WJVA 3NAZA 4OHPA 5E2AA 2CVOA 4FZRA 3FTNA 3FSJX 5HMLA 1A5ZA 4KZKA 1PL8A 1CIJA 1L5VA 2ADFA 2W8ZA 4PYKA 2VTEA 1UPUA 2WINI 2XTAA 4LMPA 5K1ZA 3IP5A 1CUXA 2BJHA 4NWIA 1U99A 2R8XA 5IARA 3GLHE 5TY0A 1MHPA 2NUTB 3PYLA 3U4AA 1HOXA 3OTWA 1OASA 4HBZA 1CUUA 1WAMA 3IQIX 1E79A 3WKDA 1F5SA 1ULHA 5FWDA 4EUKA 2XUOA 3ZY2A 4A92A 5DGTA 1E0KA 4AY2A 1AUOA 3O90A 3LYLA 3HK2A 3B7GA 2HLHA 1CR4A 5DE3A 1GPBA 3RSGA 1ISIA 4QBGB 5CYOA 5ARBA 1KH3A 3CV3A 1AXGA 2W2LA 4HMQA 3UG6A 2VG8A 3F6YA 4FZJA 4R5HA 3WMEA 3RUDA 5F98A 1PAUA 2UZ3A 5HX7A 3MLBA 1JYFA 2PSEA 4IDEA 2Y9PB 5F2KA 4KR7A 2P7HA 5DBIA 1U94A 3NHSA 3U80A 2CEKA 5JR3A 2BUBA 4Q1CA 4ZO9A 4TLEA 2NU9A 2BFDA 1KVSA 3QJ5A 1GDHA 3H9UA 1NXQA 4G0NA 4N5IX 1YULA 2D1QA 1I2MA 5CTAA 4C89A 1U3WA 1Y4SA 1PL6A 2I3AA 4BBAA 2FR8A 3QPDA 3FGZA 4V2UA 5FPQA 2QT1A 4HWRA 3STYA 4RMJA 5KSPA 5AVZA 3UXEA 1QRSA 1P7YA 4CM9D 4PPYA 3TOXA 1BDHA 2W6ID 3DCIA 3QOYA 1ACJA 1PEYA 2OC4A 3BCRA 1OLUB 1T36B 2NU6A 2ZIXB 3H1FA 4MKHA 4YAFA 5IFKA 3QEMA 2XE7A 4JLKA 1ZG3A 5CNMA 5PNTA 4PGMA 2XR1A 1KJYA 5IMSA 2QE7D 2O3QA 2R8OA 2X7JA 3GVIA 2Q5EA 5EE1A 2AFHA 1FLVA 3QTBA 3OM9A 4H7JA 1YJBA 2W6ZA 1C3XA 5A9TA 3IUSA 3O4GA 4ILKA 4HZUA 3W5UA 4YRZA 2DUUA 1GQFA 3F8TA 3OJXA 4Z54A 3C3AA 3LY9A 4L07A 1WEKA 3GJ0A 3GLSA 4XPIA 5D3MA 1ORTA 2HHAA 4BE4A 4A2PA 5K0EA 3IKVA 5AT1A 3ZGVA 1TECE 4WZ6A 5DWVA 1IQRA 5KKAA 1P1CA 2EZ9A 1Z26A 3KEGA 3P94A 1XQ6A 2QTTA 3H5VA 1GHTA 3FPBA 4LV8B 4NBUA 3ZC3A 4EWLA 3I6MA 3L7DA 2HY7A 2VHCA 4FOLA 3V80A 3GY0A 2D6FA 4Q7QA 2HSEA 1E9RA 4FDMA 4B7CA 1SOMA 2FWRA 4Z0HO 3ZDAA 1EFVB 1L4NA 1FP1D 4N0DA 5D86A 2NMVA 3LUFA 3DH0A 4W99A 3A4NA 2AN5A 4JYAB 1SURA 3NUGA 4HVAA 5JCOA 1Y8CA 4BNZA 5LQUA 1GZ5A 3TINA 4KPUB 1NNEA 1NP6A 2GILA 3CF4G 4LW8A 1ZINA 2PLWA 1WXEA 4YAIA 1ABEA 2GZDA 3EGIA 4XGQA 4Y2PA 5AWFC 4DDHA 4Q9JA 1IK4A 1EVLA 1U28A 2OGUA 3UAYA 2WOOA 5GJWC 2RGXA 3FW1A 3AI1A 1HG1A 1ZIPA 2E6KA 1JECA 3CVWA 3QOWA 2JJMA 3P0FA 2JCSA 3T5MA 4C0SA 4F8JA 1WMEA 2EJVA 3COSA 4J7CA 2EDCA 3OF3A 4J0DA 4NKRA 4OSEA 4TTSA 3R7AA 4ZGGA 4JBNA 1DWUA 4KVAA 3C6YA 2O0MA 1P18A 4FQ8A 4R2XA 5EUMA 1L6RA 2JHPA 4TS3A 1E94E 1ZM4A 1AZLA 2GM5A 4I3FA 3ZBTA 3VDRA 3HGTA 5LLDA 1N5DA 1CQIB 4UQLA 1NOIA 2I7CA 3U4IA 4I1PA 4MNTA 4WJZA 4GKJB 2DY0A 3DBOB 3BIJA 4BVKA 1DBRA 1G19A 4IJUA 1D2NA 1LLFA 1C8BA 3N5KA 5HOQA 1SCIA 2VK4A 3AETB 1KGDA 3LKBA 1WUYA 3FNBA 4ALKA 1TW3A 4IWYA 5TQ2A 1EUCA 4BMYA 1VKOA 4UTVA 3U9LA 4G4JA 2QORA 1HOTA 3ZYZA 4MUKA 1OU4A 4ZTBA 3KYCA 4ECAA 3KB8A 3VUEA 2FV8A 4EHLA 1L4LA 1RRGA 1ETHA 2XDAA 2FW1A 1UZLA 1L8OA 3VTAA 5JLJA 2RHCA 2HCRA 1UJMA 4IDCA 2P9TA 2C9DA 3MWEB 4N1AA 1MW9X 1JWLA 4WERA 2ZRCA 2AK3A 3KLMX 2KLBA 3R6GA 4PONA 5GM1A 5I4BA 2AC4A 3BRQA 3OY2A 4OHKA 3RB8A 1XAJA 4J3FA 5JRDS 3M49A 1KI4A 2LKCA 1BVUA 1BS2A 2VK8A 2XLCA 4ZT5A 2ZYHA 3NM6B 3O8LA 2ZVJA 3CLVA 5TJ9A 4M76B 1CUJA 1YKSA 5JEDA 1RC8A 3GHHA 2IY7A 3ESAA 2FA9A 4MUMA 3MFYA 5FADA 3UXHA 2OT3B 4GBJA 4F1JA 3N3AC 4JS0A 1J4AA 3A6LA 1W36B 4F2WA 4NJEA 1YU6A 4ZGBA 1VECA 1RW4A 4Y9RA 4FPXA 1CUFA 1KI6B 3TEMA 3ZKWA 5J4LA 4EUHA 2E55A 3WLRA 1Z5WA 3WMWA 3GRFA 1R5OA 4QNMA 5ICFA 4GWGA 4J4HA 2Q3LA 3WWPA 3QVOA 2IXDA 2V65A 5H3CA 2O2DA 2BSQA 1KVQA 3KT3A 3RTAA 1VGQA 1RPAA 4H6WA 1PZFA 2GZHA 4MWTA 1Z36A 4DILA 4YXWD 2ST1A 3FDZA 4C0WA 3I05A 4S2UA 4CKYA 2Y1FA 3TL6A 4OU5A 2FLWA 1Q0ZA 3KJZA 4LUCA 4N4AA 1D6NA 1HX7A 3WLHA 1YUBA 1AKYA 4PX9A 1RXUA 4OXXA 4N82A 5K0LA 2PK3A 5FI5A 1XK7A 4IINA 3QRWA 4IIXA 3DUFA 3MJFA 5A5GA 4JL5A 3GG2A 3DULA 3DB1A 2I33A 4EA8A 1BS9A 3P26A 1U8TA 2E82A 3IQEA 1PV1A 3RPEA 3R8FA 2FEXA 5JQGB 4UHCA 2ODBA 3IAM1 3LW7A 3MHPA 1FYXA 1C4XA 4P83A 3HKCB 2ZJ8A 3JQ6A 3DDWA 5HJ2A 3RU9A 3R0JA 4UVIA 1B00A 1YC2A 3L06A 5BV2P 4NAVA 3AHDA 2XYHA 4FW9A 5BW8A 3JQ8B 1QFSA 3MTBA 2H2AA 3OSZA 4LSGA 3UB3A 4H7IA 4G8JA 3E6AA 2FWNA 1C8KA 1T2AA 4GU5A 2WF7A 4GPIB 3O8NA 4E2ZA 5I47A 4H18A 5DLDA 3I61A 2HMVA 4NOJA 3V7FA 1NNSA 3ZV7A 3EIWA 4K9LA 4O5OA 1S02A 2ERYA 3KUUA 5J43A 1N0VC 4G0PA 2Y99A 1GGHA 2RAFA 5CYFA 4E6PA 5I48A 1JDVA 4R7GA 4ZC1A 1TI7A 4WADA 3CEJA 3UK6A 4CM8B 4BEWA 2O19A 4HDNB 3U5TA 5LIRA 2XHEA 5LCXA 1Y9AA 1N9KA 2CHQA 3KYBA 3D4NA 4D9EA 4H0FA 3DDNA 4UBMA 5KYUB 5KTKA 2ZRPA 4CDRA 2CNBA 1PEKE 1G20E 3TRDA 3SBOA 5AKIA 1WPQA 1BXRB 3GNLA 2GZ1A 2V5UA 4G5OA 2XHZA 2OBYA 3GPLA 2WIBA 2CW5A 5G02A 4FNOA 3DD1A 1SOWA 4LXUA 3DBRB 1XRLA 2DWPA 1DZ3A 4HB4A 5C5DA 1FFWA 1XAHA 1M5TA 2J4FA 4MVWA 1ODJA 2F00A 2HHJA 1UXIA 2HMTA 5C4MA 5HZHA 2K2WA 3C41J 4E5YA 1T9GR 4EUSA 2CZGA 3KSBC 2PPLA 5F1KA 4EW6A 5LZ2A 4F21A 1RRPA 1AUQA 4LDAA 2PH7A 4PPGA 1KWKA 1OAOA 4GM0A 2BM0A 4CZ2A 1ZJ6A 1N8NA 1QGAA 4RACA 3E7XA 1AMOA 4GPD1 1ZHHA 3U61B 4FFSA 4GI3A 3LK7A 4BMOB 3WRYC 2HMWA 3CRVA 1QMGA 2H7YA 3L4EA 1AUVA 2YINC 4O2BF 4URUR 4B48A 1GZ3A 1QHIA 2XX3A 2HLPA 3B89A 1ZI9A 3HVUA 4XJVA 4F56A 2XY4A 2CKMA 3A31A 3OD1A 3Q11A 1WP4A 5CBPA 5FL7D 2VFAA 3QBJA 4B0PA 4WNAA 3R74A 4ZCMA 1D2CA 3WNZA 3IT3A 2CXQA 3VU9A 3B53X 4TSFA 5CB4F 4PNZA 3FLAA 4KBGA 2FHSA 4ND4A 3UPDA 1UJBA 3OEYA 3WYDA 1EJ6A 3ZBPA 4DE5A 4A15A 3ZQ6A 4RM2A 3GD5A 5LKAA 2X15A 3TOVA 3EHEA 2P5UA 4ZAZA 4IUBS 2EJWA 4RH1A 2AN9A 2QGNA 4MYUA 3TB6A 4BWVA 2WNSA 3UUFA 3A70A 1EDEA 4QODA 1SVIA 1T6XA 4GR4A 4MI3A 1OMOA 2A5YB 1EFAA 1GSOA 3KJFA 4RVGA 2LBPA 5DLPA 5GY7A 4JMLA 2CNKA 2CC2A 1BDIA 1RWNA 2BDUA 4C7BA 5AI8A 3LXMA 4IX9A 4IV8A 1N2EA 1ZBDA 3QKWA 1SG9A 4S35A 1I7DA 1G38A 4LGCA 5ALVA 5BOVA 4LY3A 4OBWA 3UJ8A 3HO8A 1M73E 1Z0KA 1KTVA 5LYJA 2XH8A 3MCUA 4I4TA 1H6DA 2VYND 3REFA 4A8PA 1L7QA 2VK1A 1S1MA 3SHFA 4F86A 4JEHA 3BA6A 3FWHA 5DW0A 2ZRBA 2HMSA 3FCOA 1QG6A 4C7KA 4NVRA 2WP0A 1ISSA 5AHKA 1UMCB 2A57A 2HQRA 4Y3UA 4G8DA 3JYPA 4HHEA 4JYBA 3O0DA 2H11A 3HZZA 4RYDA 4K8OA 5ERXA 2OAEA 3TXAA 3JAKA 1NN1A 1P5FA 3GUYA 2WTAA 4GXRA 5FH9A 5DSTA 5LD2C 2J09A 3ZCRA 1D8TA 5JRJA 1VJ5A 4YH1A 5HILA 1ZIDA 1E98A 1DFGA 1O3YA 5GM2A 4Y6SA 3TVDA 1M5RA 1T29A 1IZZA 1P33A 2POQX 1ISRA 4U7PB 2IEIA 2KM1A 4KNYA 4C04A 3F98A 1DIBA 3LZDA 1J99A 2PV0A 1DTWA 3A6FA 3IQZA 4ICIA 5AW1A 4KUHA 2WJJA 1B41A 3CQ9A 4LJ9A 3S55A 2H18A 4W7SA 3BHMA 1Y9JA 5HJ5A 2GDZA 2IPNA 5IJ0A 2FEOA 3LX6A 5HE9A 4GICA 4ZI3A 2V3CC 3H75A 1PG2A 1U31A 1ESEA 1YJQA 3HY4A 1RZRD 4GBED 2XWSA 4B3HA 3EF3A 4IHAA 4K1XA 1B42A 4WLOA 4DC0A 1EQAA 2DT5A 1Y1KE 3REQB 1N1GA 4DVGA 4XYLA 3BMCB 3AOEC 1XXHE 1NSYA 1YZLA 4C0AC 2Y66A 3WS7A 4B6FA 3T7DA 2XEDA 1JTFA 4WL0A 5C1OA 5IWAB 2GYWA 4EMTA 2QE7A 2ZYGA 1QYWA 1V7QA 3GAZA 1E1QD 1W9HA 2ONYA 2REQA 3UHAA 4BO1A 3B85A 4DMKA 3ICPA 1SC6A 1XZDA 4BO8A 3LGSA 4CCYA 2AI3A 1U5BB 3T9AA 3TZQA 4B3CA 4F7DA 4ZI2A 3ZE2B 4FT2A 5I9NA 2ODTX 1ISFA 4FLEA 5EHGA 4PNPA 4X7MA 4UNIA 2PMFA 2CBGA 3ZPXA 3SFZA 4A8HA 4EPVA 5JPDA 4PX2A 4WNCA 4OGGA 2VRWA 3D54D 3EQ7A 3F74A 4DSOA 4G89A 3NVAA 1QORA 4Q5IA 2JIOA 3FSEA 3QUTA 5CFPA 2AL7A 1M6YA 2FZKA 1M8FA 2IX9A 3A6HA 4X0EA 2WYUA 2YUTA 3K1YA 4LMAA 1L4KA 2F9MA 3V1NA 4RKYA 2DPMA 4JFAA 1TYCA 1AV7A 1LXCA 1Y1QA 1X7WA 1VI2A 5FV4A 2G9NA 4DEYA 1G2QA 4JBIA 4CVNA 4DDTA 2ZDGA 1N2OA 2R1UA 4D9NA 3KX2A 5K6RA 4IV5A 1RQPA 1M33A 1Q3HA 4CF4A 4LJ4A 3L0IB 3WKCA 1E5QA 1UEIA 3ZJVA 4EGFA 4MI6A 3G0IA 2QIPA 2YRWA 5HEKA 3S2EA 3GLGE 4LSZA 1E62A 1Z12A 4JC0A 1RRCA 3R9XB 4HQFA 1ZUNB 3VR2D 4EUNA 5CDGA 2VIIA 3NYWA 4BGDA 3UXYA 3ROXA 1DUSA 3EN0A 1EIWA 4IDHA 1X7ZB 5KNCD 4OHZA 5JZSA 5K20A 1H1DA 1WHTA 3IQHX 4NBRA 1BFUA 1CU1A 1HUQA 4RWZA 1R1DA 2O0HA 3RARA 4GQIA 1ZSYA 1KP3A 3CSSA 4R9UC 1UWLA 5LZ9A 3PJFA 5JTUA 3PD7A 1Y8RA 3L6DA 4YRTA 1HT2E 2FPPA 5FTMA 3LVQE 3V4RA 2GK3A 2ZR0A 1WF6A 1SK8A 4IGAA 3HN2A 5C8YA 3USZA 1GTRA 3PHHA 1K88A 2J59A 1QPGA 1XHFA 3NHWA 3C3KA 2NZ8A 2HSWA 1O57A 1TLLA 2XGMA 4YQYA 3TQRA 1Z34A 3HWX1 2GN8A 1KK2A 2A0XA 3T5DA 1JR3A 2Z8YA 5EXPA 3BRSA 1XR3A