5JEEA

Apo-structure of humanised rada-mutant humrada26f
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
229
structure length
218
Chain Sequence
TIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGKAMYIDTENTFRPERLLEIAQNRGLDPDEVLDNVAYARAFNSNHQMLLVQQASDMMKELLNTDRPVKLLIVDSLTSHFRSEYIGRGALAERQQKLAKHLADLHRLANLYDIAVFVTNQVQANGGHSATLRVYLRKGKGGKRIARLIGEAVFSITEKGIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering Archeal Surrogate Systems for the Development of Protein-Protein Interaction Inhibitors against Human RAD51.
pubmed doi rcsb
source organism Pyrococcus furiosus (strain atcc 43587 / dsm 3638 / jcm 8422 / vc1)
molecule tags Hydrolase
molecule keywords DNA repair and recombination protein RadA
total genus 82
structure length 218
sequence length 229
ec nomenclature
pdb deposition date 2016-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5jeeA00
1XXHE 1Z0AA 3ND9A 4HYYA 4P4TA 2P6UA 3X2SA 1JPJA 1LV7A 1B23P 1Z28A 2KB0A 1SXJE 4DLRA 1VMAA 1F2UA 1E2IA 1CP2A 4ITRC 1O87A 5EE3A 2R44A 2AR7A 2XNDD 2FZ4A 3ADBA 4LGMA 3WMEA 1E9CA 2NQ2C 2PMKA 2IXEA 4LRWA 4Q1BA 4XSGA 2OAP1 3UWOA 5J4KA 2FSGA 4ZI2A 2A5JA 4Q4JA 4KV9A 2QP4A 3KDSE 4PQRA 3B85A 3A8TA 1KYIA 4RKEA 4BLSA 3CM0A 1YRAA 2P0EA 2A9KA 2D74A 4M53A 3F3YA 2R6AA 3QY0A 2PX3A 1A5TA 4FINA 2WKQA 5DSZA 1UBFA 2WOOA 4MKIA 2DWPA 1P73A 2D3WA 5JHGB 2NMVA 5AUNB 4PZYA 3HPRA 1KAOA 3GJ4A 4R9UC 1ZCBA 2F1JA 1ZD9A 3THYA 1XBTA 4D0GA 1SHKA 1QHGA 2JJ2D 2FV8A 3AKYA 1GL6A 2ECKA 8OHMA 5KYKA 2QT1A 1TEXA 4BRUA 1N6NA 3RS2A 2Q9BA 2DR3A 1BO6A 3WBKA 1D9XA 1OFHA 1RFLA 1HQYE 1NIJA 3TK1A 4B74A 1KAGA 2IL1A 3SOPA 2J7PA 1NMZA 1Z2CA 4LOAA 5E95A 1P61B 1JR6A 4ZDIA 1P3JA 4NH0A 4DCUA 3GLGE 4QGHA 3I62A 1W36C 1XTQA 4I81A 1RVDA 2UZIR 5BN5A 1SVMA 2HJGA 1I4TD 3CKLA 4BFYA 2QGNA 2QQEA 2BMEA 1HUQA 3KQKA 3U44B 3CPJB 2W6ID 4RSGA 4KITB 4B3BA 4JBXA 1GNRA 2O8CB 1TMKA 1OB2A 3X1DA 2P5SA 1T5LA 1VG1A 2KBFA 3NBYC 4Q1DA 2CLSA 2R9VA 1G8HA 4D6PA 1TU4A 3FHOA 1KNXA 1E1RD 1KMQA 3AH8A 3PVSA 2QU8A 1YU9A 4DKXA 3U7GA 4YLGA 5FTKA 1ZD8A 4QGGA 1AJEA 5FPKA 2GKSA 5SZJA 5K8IA 3SHFA 1H8HD 5KU1A 4FN5A 1NVWQ 1I2MA 5FBRB 1CTQA 4LJYA 2FGKA 2WWWA 1XTIA 4W7SA 1IN7A 3R9WA 3R20A 4W5WA 2WIAA 2C96A 2EVWX 5K8LA 2OILA 3ASYA 1YZQA 3O8CA 2SHKA 1ZAKA 2BJWA 1Z07A 4RJLA 2ONKA 5JZVA 3J81k 1RRPA 3X1YA 3AVOA 4BLQA 2CCGA 2ZROA 1MOZA 2OESA 4M1MA 5EJEA 3U44A 3IHLA 2RGEA 1IQPA 2JGNA 2ZJAA 4M8NE 3OEHD 1RJ9A 1KI1A 3SHWA 4X8OA 3U61B 1EXMA 2CCJA 3PUZA 3CWZA 3LWNA 3LDAA 1OYYA 4M1YA 2ZI9A 2FZLA 3EIEA 5BWMA 1UKVY 1L4YA 3G82C 1GOTA 1P2UA 1TF7A 2W2VA 4DIEA 821PA 1VHLA 2JLVA 4TTQA 4MGKR 1AQYA 2JEOA 4DBLC 5FTLA 2YHSA 3PUXA 5KSOA 1OH6A 1JNYA 1KO7A 2BM0A 1EFCA 2J0VA 4UXJA 1X8KA 4QHSA 2W6JD 3ZVRA 4LPKA 1WF3A 1U0LA 1W49A 1KI4A 4AKHA 3NH9A 2I1VB 4JS0A 2GILA 2VL7A 1EESA 2G1KA 3F0TA 3I4LA 2AWOA 2A3RA 4G5SA 3ADDA 1G19A 3KFXA 4B3CA 2QSZA 1Z83A 5GJWC 3ZLJA 4IVPA 1FMJA 3OAAD 4DC9A 3GFTA 1YZTA 2X1VA 4MITA 2CLCX 2OO7A 3BFKA 4C0HA 3OAAA 2DWOA 3VTKA 3A36A 4JVLA 4RZUA 2EYQA 4Q4HB 4MGZR 1KJYA 5FPSA 2XXAA 2GCOB 4I1VA 3W6PA 1JQLB 1WRBA 3MWJA 4OBEA 1UEJA 3QBTA 3OEHA 2P65A 2OCYC 1E2JA 3VX3A 2OM2A 3DDCA 3MSXA 2WJJA 3VKWA 5L3QA 3K0SA 3ZIAA 4TMKA 4MGYR 3CNLA 4TMWA 2ERXA 3NBXX 3OEEA 4JJZA 1XJCA 1UAAA 5FBVB 4TMZA 1SXJA 3QKUA 3RRYA 5LD2C 2B92A 2FSFA 2ZSFA 4V03A 2VHQA 2J9RA 4MGIR 4NCHA 2KBEA 2QNRA 4HAYA 2ZYVX 4P3YA 5H68A 2XTNA 1A2BA 2OT3B 3CR7A 1OIVA 4G01B 4DCNA 4EQ6B 1FUKA 2BIFA 3QKSB 2O8EB 1ZW6A 1AS0A 2MMCA 3AVQA 2J59A 1AQUA 4JIMA 3T1TA 2YOHA 5D3QA 5LB2A 2IYVA 4AURA 1X3SA 3QIAA 3IUYA 1AS3A 1GL9B 2ZRMA 2R6DA 1YR7A 2OHFA 1N6OA 4URWR 5K8UA 4ZIRA 3W9YA 4I1UA 1IHUA 4RD3A 1GUAA 2MSCB 3UK6A 1F5NA 3HPQA 1U90A 3SQWA 4ASUA 4HLCA 4QBHA 4A8JC 4HAWA 1D6JA 2ZE5A 3ZZTA 2A5GA 1JR3E 1GG2A 4LYAA 4DUGD 4IOJA 1BH2A 3D31A 4U00A 4EFNA 3AP2A 4XTRA 1O3YA 5FUXA 2WVJA 1P75A 3LH5A 4HLUA 1HT1E 4WZ6A 1L7VC 5LPNA 4DLZA 1E9EA 4A8JB 4QG7A 2AD5A 4S35A 4C0LA 2VF8A 3KUCA 3CBQA 3HU3A 2IK8A 3QKSA 3QVUA 1F3OA 1XTJA 2VSFA 4AY2A 2XB2A 2C78A 3RLFA 1SKYB 4URUR 1TUIA 4E09A 3LXRA 2HXYA 4AKIA 4ILEA 2ZI3A 5DI3B 1E0KA 1ZM7A 2GZDA 4CEHB 2VEDA 4XD7D 4LYFA 1YR8A 1W5TA 2OEPA 3EG5A 4ZPXA 2AX4A 3KJHA 4D81A 1OH5A 4KJZA 1W4RA 3LV8A 1R4AA 3A1TA 3BH6A 2FPMA 2OAQ1 3UG7A 2H7VA 3WMGA 2BCGY 4RCZA 1IBRA 3K09A 3OF5A 1Z47A 3PUYA 4DSOA 1CLUA 1E2FA 4B3DA 2O0KA 5E7MA 4A4DA 4M9QA 3W90A 2WBLC 3DM9B 4S2EA 2VQSA 5E3HA 3QXHA 1KDRA 3B82A 4LDJA 2VHCA 1IXRC 4PSKA 4BUJA 2ZANA 3QXCA 1XZPA 2CL0X 4AG5A 1N5KA 4B3FX 3AVWA 1OW3B 2PCLA 3X1WA 4A9AA 1AN0A 5DHAA 3DMDA 1Z5ZA 3TKLA 2QL6A 5B57C 2ZYTX 4CIDA 4BZPA 2C2HA 5JWOA 3RWMB 5EP4A 2W6IA 1ZC3A 5CYPA 4PC2A 2GXAA 2IYTA 1ZIOA 2AKAB 4N1AA 4TQAA 2H18A 3EPJA 3AVUA 5JSZB 3WBJA 4K8OA 1HT2E 4KFTA 3TUZC 1GKUB 1IM2A 3K8YA 3NBFA 2V4ZA 2RGBA 4F4IA 3NIBA 3LQQA 1HEIA 1II8A 4NYIQ 1TEVA 2PX0A 4RKFA 4AD8A 4QHYA 5CDFE 3KFVA 4YMUA 3I8XA 4BLPA 4LK2A 2C98A 2XX3A 3PJRA 1X6VA 4O2LA 3SBEA 2H92A 4O25A 1G8FA 4HATA 4XWAA 3TAHA 1EFRA 1V5WA 1OV4A 4DT1A 2ODEA 3SQXA 2OCAA 3EZ6A 4MUBA 2FU5C 1XWIA 4FMDF 4B35A 2ZRKA 4M1SA 1NVUQ 2OSBA 2V55B 4XSHA 1F60A 2ORIA 4HLQB 2JLYA 4MRNA 4BFUA 2ONJA 3X1XA 3RSLA 3K9LA 3A6PC 3OIWA 2TMKA 4C7OA 1NG9A 4E5UA 1GFIA 2ZRDA 1OSNA 3O8DA 3MG9A 5IK2A 1N6IA 1AZTA 2ZAOA 4FMBB 2NGRA 4LX0A 2Z83A 2IA5A 3U3KA 3ZIAD 5KDOA 4OYHA 1E9DA 3EIHA 1GZSA 4B6EA 3UIEA 4B3GA 2FSHA 4GRAA 1C4OA 4LHVA 2QSYA 2GAAA 3P1JA 3EZ9A 3KQHA 1OHHD 4CDGA 1KSGA 3FKQA 3D8BA 2IW3A 3R7WB 4Q9IA 1K8RA 2GVDC 4RY2A 4YMWA 3RRZA 5FI1B 4EPTA 2H8KA 4CVNA 3P4YA 5L3SB 1Z0DA 4TLAA 1NY5A 2F9LA 3BIFA 3H84A 4BZXA 4PTLA 3GLFA 3N2EA 1KZ7B 4IDNA 4HUQB 4OK5A 1RIFA 2WWHA 5CJPA 1Z63A 2GK6A 2F1RA 1GRNA 1JR3D 2FH5B 3VAAA 3MJHA 5EP3A 5M04A 4KFRA 4KFSA 3AVPA 3I73A 3LLUA 2B21A 3O8BA 2WSMA 1NSFA 1DG1G 1CIPA 4ZCLA 3GJ0A 1E1RA 3NC1C 5LD2B 3BB1A 1W46A 4KHZA 2AD1A 1DELA 1JXOA 1TUEA 2GJSA 4LC0A 3UMSA 1KOFA 3KQUA 3ICEA 1WA5A 5HE9A 1T91A 1NF3A 3FYHA 3KKOA 2CNWA 4LWZA 5JECA 3BORA 1GSIA 2ZS8A 3SN6A 3L8ZA 3S1AA 4GBMA 5KDLA 5E7IA 2YC4C 3SC3A 3SJAA 3GJ7A 2PJZA 3B5JA 3UMRA 2YOFA 5AUQA 1OT3A 421PA 2CDNA 2XNDA 4F91B 3CF6R 2IF0A 1E32A 2OXCA 1DO2A 2FEMA 2ZI7A 1KIMA 2IBMA 2JLRA 1IN4A 4JL5A 2ZQ5A 4Q48A 3E5HA 1IXZA 3W6NA 3HWSA 4TL7A 3TLXA 1N3BA 4LBZA 4BGDA 1ZRHA 3AM1A 1DS6A 3GLFB 4K46A 3QPVA 1GNQA 2LWIA 3QKTA 4LBWA 1XPOA 4MRSA 3CPEA 1LS1A 1S3GA 4C0SA 2I1QA 1W0JA 2FFHA 4D2IA 3ZS8A 1W1WA 3ZVNA 1QHHA 5KNDA 4XJXA 1DAKA 3FWYA 3TNFA 1QHXA 3M6AA 1NP6A 3NXSA 4Q7JB 4EPWA 5JJIA 2J1LA 2IYWA 2JJ2A 2DFTA 2O8BB 2IEYA 3EIQA 2NPIA 3CH4B 1G3QA 4FMCB 4AI6A 2YINC 2YZ2A 3NH6A 4I1SA 5F9HA 1SKQA 2KE5A 4QGAA 2CK3A 1YZNA 3KKQA 5FPHA 3M1IA 3EA5A 1V43A 5G3ZA 1X1SA 1Z6TA 5FL3A 3LD9A 3L82B 1N6PA 3FTQA 3U2QA 5J4HA 2ZE8A 5FOSA 1ZINA 3T1VA 3PENA 1E6CA 1DADA 2Q3MA 5EE1A 1ANKA 2LKDA 4E07A 1E4YA 3WNCA 2EWWA 1T9HA 4AKEA 1NIPA 3LFUA 4GOJA 3T15A 2K5UA 1WMSA 1WDTA 3EZFA 1IONA 3A4LA 5JFGA 1T3HA 5HKKD 5C4GB 2N46A 3P32A 1QVRA 4FXPA 2NO7A 2ZM5A 2OBLA 3BFXA 4YMTA 5DNYB 4DLVA 3EC1A 3HR8A 1IN6A 1RJ9B 2ZU0C 4FD2A 1GRQA 4JT2A 5FBQB 2FE4A 3U7HB 4A2PA 5B30A 3RS0A 4A0FA 3UG6A 1CRPA 4BFWA 1LFDB 2GZHA 4IDHA 4ZI3A 1IY1A 3DL0A 2ZJBA 1U8ZA 1YZLA 1Z6GA 4MYUA 3FFAA 4GZMA 1KMHB 3MAAC 4X8HA 2J7KA 1KJWA 3N5CA 3VKGA 1TF2A 2AHOA 2BEJA 3GJ8A 2QUZA 5KUTA 3RAPR 3A37A 3LY5A 1ELOA 4FMCF 3KZ1E 1DPFA 2IYLD 2A5YB 1NLFA 3VU9A 4US0R 3CH5A 2FG5A 3LW8A 5FR2A 3SFZA 2DYKA 3GMTA 2CMKA 4DCTA 5J40A 5F2EA 4DUGA 1Q1QA 2A7QA 2YWEA 3W3ZB 2JASA 4B2PA 4LPSA 4QHTA 5F98A 1GTVA 1KK3A 1WQ1R 1GL7A 3FOZA 2JJ1A 4JJKA 4Q4AA 1PV4A 4N0EA 1NJFA 4BFVA 3Q7PA 1II0A 1VKJA 1DAGA 5J5CA 1SVWA 5KNCA 2W2TA 2ZS7A 3BGWA 3UMFA 2AK3A 3SJCA 1S9HA 1EK0A 3SEAA 4J0QA 3L43A 2GBLC 5BW8A 2ODNA 3B1XA 2IUUA 4ZCMA 5ANRB 1VCIA 3KUDA 3AF2A 4KBFA 4CEJA 1WE2A 1P60A 1N6HA 4A2QA 5L3QB 4B2IA 3I5XA 4RZ3A 5FR1A 1E96A 2GEUA 4TYQA 3WHKA 5FUVA 4XWKA 1EWQA 4DDWA 2QBYB 1KI7A 1KK0A 2RKOA 2W2XA 4ZDWA 1RE0A 4WW0A 4PAOA 3SZRA 2QQ0A 1FMLA 4LV5B 5EUQB 4PPGA 3AVYA 1M8PA 5AJVB 4D4JA 4EQ6A 2ZYWX 1CR0A 2C99A 4A6XA 3LVQE 4M2LA 2BBWA 3PUVA 2ZRFA 5KSPA 4D82A 2J0UA 4EPYA 1XPUA 3RS4A 4X8MA 4PC7A 3RS7A 2GDJA 3CRVA 4MYHA 3A1WA 2VTKA 1U9IC 4G5GA 5CJ2A 4WXPA 1E98A 1Q22A 4IOKA 2V3CC 2QGZA 4UJ3A 3B1WA 4KLNA 3QEJA 4PXAA 3DPUA 3LLMA 1HE1C 5P21A 2FDCA 1X1RA 2YVUA 2XJ4A 4HEJA 2VHTA 2EFDB 3MUFA 3NEYA 1OKKD 5ELXA 3NBZC 2ZE7A 1TL7C 2N1BA 3GEEA 1J8YF 2ZITA 2GJ8A 4YONB 4EPXA 3LBNA 5LB4A 4LV8B 5DYIA 4Z1MA 4QNRA 2HUPA 4GP6A 2BMDA 3NTUA 3ZH9B 2ZI4A 1JJVA 1E79D 2QTHA 1G291 1J8MF 2NZJA 1G18A 4Q1FA 1D2NA 2QBYA 1VCOA 2G9NA 3K9HA 3B2EA 4LHWA 1A2KC 4KSCA 4EKDA 4ABYA 4G1UC 2PEYA 5KSZA 4GDFA 4RFVA 5JRZA 3QI2A 1M74A 4OI1A 3B13B 3VR4A 3WXMA 5FOXA 4YMSA 2J0UB 2V54A 1NNEA 4C0KA 1YE8A 1ZNZA 2GTPA 1OFIA 2QRNA 3OIUA 3AB3A 4N0DA 5D3MA 3VR3A 3FMPB 4O3MA 4OHYA 2EFCB 1JECA 2V9PA 2OCBA 2G77B 3CWQA 1M2OB 3HU1A 4M1TA 2ZSAA 5A0FA 3RC3A 3B8HA 4D4KA 2YJTD 1XXHB 5FUYA 1CRQA 2RGNC 4O0MA 4GL2A 4GI7A 2GZAA 1E9FA 4V0OA 3VHLB 2HJVA 4NDZA 4OK6A 2JIZD 4LSGA 2ZAMA 4K81B 2KI5A 1GRRA 4AYTA 2JLUA 2HCJB 1SZPA 5FOWA 1E2HA 4PQFA 2IXGA 3A1SA 4HLUC 3PXGA 3CLVA 4C0QC 2JLWA 5IT5A 3PITA 4PO8A 5DISB 1EGAA 4TWZA 4BFXA 4OQMA 2HDNB 3ECCA 1Q3TA 4KFUA 3THYB 1P6XA 3KB1A 3QBVA 1E2DA 5DGXA 3ZYCA 1Q1EA 2OV2A 1P2VA 3KJEA 5D3MB 3RHFA 4HAZA 2X8AA 3K70B 1W2GA 3MWLA 2IXFA 1W4AA 4LBVA 3SDZA 2QMOA 4GP7A 3ZGXA 4JLPA 1LS6A 2HT6A 4PPQA 5G53C 5TXGA 1S1CA 4L5BA 5B58C 2P2LA 2EWVA 4QOSA 1YVDA 3D7MA 4IW3B 1DO0A 5IF9A 4BZQA 1IXSB 1DG3A 2BC9A 5CK5A 3IBYA 5FPTA 5HE8A 4OQFA 2ZTSA 3EXAA 4LY6A 3GLHA 3BOSA 1JXMA 1I4LD 1U0JA 3TE6A 5A5GA 4DB2A 3R9XA 1ZUHA 3F8TA 4HDCA 4C2TA 1F2TB 1LTQA 1MO4A 1SVLA 3O8RA 2V1XA 1PZNA 2FF7A 4P4SB 4Q66C 4CZ2A 1DBSA 2YWFA 4JMPA 3WNBA 2ERYA 3I8SA 3MWYW 1XP8A 4FCWA 4QBFA 4RFSA 2P3SA 5JWRA 4TL6A 4M1KA 2QMEA 1FOEB 1IN8A 1FPMA 2ZRCA 1ZUNB 1DAEA 1JEEA 1HTWA 4AKGA 2E9SA 4G0NA 1P4SA 4TLEA 3R8CA 4GMXA 2W6JA 1VIYA 3SYKA 2VYFA 4NYJQ 3T1QA 1TNDA 4H9GA 1VTKA 3WRXC 3EPLA 4DCSA 4D4MA 4P31A 2FMXA 3AUYA 3BRWD 3TUIC 4LJ6A 2HYIC 2R6GA 2IS2A 1NN1A 4H1UA 1AK2A 1X86B 4A15A 3GFOA 2ZRJA 1R5BA 4TTPA 2CJWA 1KDTA 1E3MA 4B75A 3GLHB 1COWA 1VG8A 2BKEA 4HUQA 4MH0R 5KNBA 1FUUA 3WYGA 2BEKA 1XEWY 3LRPA 4XVUA 3U3JA 5JCPA 1XF9A 4FI3C 1U98A 4P4SA 3K0EA 1XJ0A 2P67A 3RYTC 3U6KA 4CEIA 3B1YA 2RGGA 3TQCA 1OKKA 4HAXA 3NHAA 1CBUA 2YWGA 1Q44A 1XB2A 2O5VA 1UBGA 1H65A 4IEEA 2XAUA 1NG1A 4M4SA 4WXRA 3QF4A 3C5HA 4M9SA 1KJZA 3BH0A 2I3BA 3CF2A 5J4VA 3PR1A 1QRAA 1R0ZA 3K0FB 5HZHA 5H8WA 3RS3A 4DCVA 1QHYA 1E4VA 3I32A 2IEZA 5KTYA 1G5PA 1XFAA 2G6BA 4NMMA 2EU8A 4UJ5A 3RANA 1W0JD 4CRWB 1OFUX 4M22A 1U2RA 3QPUA 3ZVLA 4QC2A 2WPDD 2QE7D 4TMVA 4FWTA 1GDDA 1ZCAA 2YV5A 2ZRHA 1HH4A 2WJVA 4RD6A 4P4UA 5KOYA 2ZPTX 4HZUA 3GJ5A 4NCKA 1ZBDA 3K70D 2R6FA 1CEEA 2IYRA 3CZPA 1GVNB 4TLDA 5EXPA 2VH5R 2J0QA 5BQ5A 2WWFA 3T61A 3K0CC 3RS5A 4R2IA 1QHHB 1G7CA 4URYR 2ANBA 2DPXA 2DB3A 1G17A 1DEKA 2XOKA 3L2OB 2ZJ8A 2NOAA 3L0OA 1ZP6A 2BCJQ 1XEXB 2OZEA 2NZ8A 4Q4HA 1WXQA 3EW9A 2OLKA 4DSUA 5BYKA 1N6RA 1OF1A 2ZIAA 3ASZA 2WMOB 2F9MA 5FTMA 1KO8A 4KU4A 4B44A 4C9BA 2MMGA 2JLSA 1PUIA 4JBYA 3ZD6A 2REXB 4KODA 3M0EA 4IEIA 2XEXA 4XTCS 5DI9A 2Q9AA 1T3SA 5C46F 1Q0UA 3JZMA 2ZUDA 4Q9KA 3MD0A 2J0SA 2VP6A 3AF4A 4KBGA 2Z4SA 2Q21A 1M7GA 3ICQB 1G9XA 3K9NA 3TGPA 2DBYA 4HB3A 1FTNA 3EX7C 1UJ2A 2WV9A 4A92A 4EPRA 4FCTA 1LF0A 1F48A 2ZXUA 1M34E 2CEAA 4M1OA 3PEYA 2J3EA 1VG9B 3MJRA 3CRW1 2BBSA 3DMNA 5JI3E 2JLXA 4M1WA 1HYQA 1E79A 2IUTA 1KSFX 4OHWA 4TYPA 1AS2A 3I5YA 1BOFA 4YXWD 4Q4LA 3I3SR 1BMFD 2RGXA 1HV8A 1S1MA 1CJUC 3PEWA 3MWKA 1XTSA 2BDTA 4M9ZA 4PZLA 2IX3A 1W44A 3HDTA 2AFHE 3PQCA 1QVAA 4BFTA 1SGWA 1G3MA 1SVOA 2CLDX 1R2QA 1D2MA 2D7CA 2Z6VA 2WWGA 3QJYA 4R98A 4V02A 5J4YA 3RRMA 3IIMA 3IO5A 2J87A 2GAOA 4GMDA 3Q8XB 2PEZA 4B2LA 2EYUA 1KNQA 1P2TA 2F43B 1PLLA 4PHGA 1L2TA 1G16A 2CCKA 1OFTA 4CYMA 1RRGA 1P9NA 1J90A 2B6HA 3CB4A 4HI0E 2JJ8A 1K5GA 2JIZA 2GJ9A 3KB2A 4L8GA 3LNCA 4LV6A 5B2ZA 4D4LA 2GEDA 4DB4A 4RVCA 2VSOA 4ARZB 2WKPA 3C16C 3EARA 1UDXA 1UEIA 1LF5A 1YRBA 3IQXA 3W8RA 4EFLA 3QOFA 4C0AC 4UNRA 5B64A 3LVRE 1W4CA 3DOFA 2I4IA 4PFSA 4URVR 4TT3A 2XNSA 4QJ5A 1RC8A 1ZM3A 2ZREA 3BBPA 2BM1A 5FOUA 1VPLA 3BE4A 3ZJYA 3BK7A 1JR3A 1NI3A 3EAQA 2YKGA 1G3UA 3A4MA 1KDOA 1ZM4A 4LJ9A 4B34A 5C2JB 3PIRA 4NCNA 4PO9A 1G64A 4WZBE 2HF9A 5CYOA 3GJXC 4A6PA 4TQUS 4XOIA 1BYUA 1U0HC 4IDPA 4MKHA 5FOVA 2LKCA 4H1VA 5F3WB 4P33A 1NBMA 1XMSA 3UATA 1E2MA 1OHHA 4Q00A 1CJMA 2J5XA 2B8WA 3OHMA 4DLWA 5JCZA 1COWD 1BKDR 2NPFA 1KDPA 3Q5DA 4YDSA 3BJIC 1OXVA 4DDTA 5C1BA 1GITA 3KTAB 3U60B 5JMTA 1H8ED 2V1UA 1IY2A 2V7QA 3IO3A 2QMHA 4W9MC 4JL6A 5AWFC 4EJSB 3U3RA 1Z6XA 4PPFA 2QP9X 5EE9A 4AK9A 3P26A 1HURA 5IK2D 5FUWA 2QENA 4A36A 2VPPA 4OQNA 4JVSB 3PUWA 4AYXA 2RAPA 1Z6YA 3RC8A 1E9RA 2ZRAA 5CM9C 3MCAA 1G6OA 2J46A 2DFNA 3TJZA 3THXB 1Z08A 3AF3A 1NRJB 2HCBA 2OFXA 4US2R 1Q3HA 2G88A 4LYJA 3U3MA 1MR3F 2Z43A 4FMDB 1KKMA 4V0ME 4NYIR 1TADA 5KDDA 2O52A 2R62A 4G5QA 3EZ2A 4PC1A 4Q9JA 4EPVA 1MO6A 3QUSA 2Z4RA 4TL8A 4B43A 1ZD1A 4Q1CA 4XVRA 1JBKA 521PA 4TMTA 3T06B 4PQYA 2BMJA 4PR0A 1N6LA 3GLGB 3K1JA 1NSTA 2C9CA 2FFAA 4HZIA 4ZKDA 3KTAA 1YKSA 4Q21A 2AK2A 4GPTA 4Q19A 4OQLA 5DN6A 4QJ4A 4JL8A 3KKMA 1XD8A 4GZLA 4C0JA 2CE2X 3GLIA 4E03A 2FSIA 2ZRLA 3FHCB 1OIWA 1U94A 4IOLA 4BEBA 2JATA 2GXQA 3NDBB 2V8OA 4WVFA 5EZ6B 1C1YA 1KTVA 3QF7A 5C18A 4Y0AA 3WHLA 2RH5A 5A4JA 4LJ4A 2DFKB 4C30A 3ZD7A 2QRZA 2CVHA 4HLDA 1SHZA 2HF8A 2VA8A 3SBDA 2GWHA 4NPHA 5JS7A 1MV5A 3AKEA 4A0RA 3P4XA 1DAIA 3EASA 3K0AB 4EAQA 4DLXA 121PA 4F93B 2ZVPX 3VX4A 3K53A 3T34A 1G5TA 3AVXA 1VG0B 2WJIA 2HLDA 2ZR9A 1N25A 2YNMA 1JI0A 3IGFA 2E1RA 4NZYA 1XD2B 4US1R 4I4LA 2N42A 1N5JA 2ZR7A 3E2IA 3TAUA 3TW4A 4Q47A 3BS4A 3GCGA 3RWOA 2IYZA 1E9BA 2DHRA 2YWHA 1WBDA 4NONA 3LA6A 1S0UA 3W34A 1PJRA 4IKEA 2DY1A 4HUTA 2OFOA 1G8YA 3KQNA 4DIDA 4PHFA 4QRHA 4B32A 1G4UR 3OZXA 4TMXA 5EE5B 3T1OA 2PMDA 3OFND 2MSEB 2WOJA 1QHSA 1F2UB 2H16A 3S1AB 2CK3D 2GETA 4GOKA 1E9SA 3Q5EA 4NYMR 4TTRA 5KSYA 1KSJA 5FPYA 2PT7A 2Z0MA 1T8TA 3DVLA 4WOPA 5JBQA 2XZLA 3SFVA 4IHQA 1PLJA 4NYJR 1US8A 2WJGA 4ZV4A 2A5FA 1JPNA 1OPXA 1Q20A 3FDIA 5CLLA 1KO4A 3H86A 2QM7A 2QORA 4DLUA 5AJXA 5KPJA 3V4RA 4MKFA 3FHTA 5TV2A 1MKYA 2LCFA 2Y8EA 1Z2AA 4F4CA 1Z29A 4A1FA 4BLRA 1XMJA 1NKTA 3I1FA 4KYUA 1U99A 4PX9A 3ONWA 2REOA 2QPAA 2RHDA 2HT1A 4WAUA 1W2HA 2BBTA 4LBYA 1Z0FA 4DVGA 4RFSB 3OESA 3A1VA 2D2FA 2JJ1D 2OFWA 5FOTA 3NG1A 2ZR0A 5HCNA 4X8LA 2FEOA 2VSXA 5JJKA 2F1IA 1Z0JA 4Y0VA 1J7KA 2VP5A 1Z3IX 1II9A 3C4JA 4D26A 2CHVA 1N0WA 5DLQC 2G0TA 5JSZA 3IPYA 4HB2A 3BERA 4JYBA 3KX2A 1N0UA 2CE7A 3HP1A 2BBOA 5K8TA 1Q21A 2VP9A 1Z6AA 1K6MA 4EIWA 2GEVA 1M6NA 1AKYA 4M9XA 2D62A 3PV0A 1R7RA 4KCGA 4PC6A 3Q9LA 1E0SA 1N5IA 2RGDA 3FPAA 4JSYA 1ZNXA 4CT5A 1G8PA 2GCPA 3ETLA 4IXNA 5TARA 4EJSC 1IY0A 4B73A 1WB9A 3BH7A 2KJQA 3GP8A 2J45A 3EA0A 3VR2A 1ONBA 2JDIA 3GLFE 1ODFA 4FIDA 3K09C 3W8NA 2O8CA 3AVVA 2AXPA 4C7OB 5G41A 2OCPA 1IN5A 1XMVA 1TQ2A 3CW2A 2PT5A 2ZRNA 3THOA 3TR0A 5CB8A 2WHXA 4D80A 5EQTA 2FA9A 3EC2A 2DFLA 3QF4B 1KSHA 1G8GA 3ZVMA 3LW7A 3WY9A 5CIQA 4LJ7A 3E1SA 4F7WA 3FB4A 1ESNA 1E2LA 1XEFA 1MO3A 3FMFA 3VU9B 1G7RA 3UANA 3AV0B 2QEQA 4KI0A 4Q1AA 3QVVA 1VIAA 3VKHA 3Q85A 2C77A 4C4PA 2Q9CA 2F1HA 5J4LA 2EW1A 2O0HA 4OJQA 1DAHA 1ZU4A 3IKJA 1E2GA 4NL4H 2ORVA 3HU2A 4IVQA 1S2MA 4ACBA 2IS6A 1OXSC 5EZ5A 4TSFD 2UVQA 1U8AA 4YQFA 2PZGA 1CULC 4KLZA 3WP0A 4JLKA 4YC7A 2R2AA 3M4YA 3Q72A 4JT4A 4RZ2A 3R8FA 1T8UA 3BXZA 2QA5A 5CDFA 1FNNA 1QG2A 1SXJD 4BWYA 2IWHA 1T5IA 2ZRGA 1BYIA 3G0HA 1BS1A 3MRSA 3LAWA 2PLFA 2ATXA 3AKCA 1GKYA 1NVVQ 4MUAA 2KWIA 2A78A 4MA4A 3TSWA 2FFQA 4URZR 2QN6A 4Q7MB 1Q1BA 2D7DA 2AN9A 3SJZA 3U5ZB 3NEJA 4WIAA 2QPTA 4DDUA 4QKQA 4M0LA 5BN3A 1OXUA 1ZUIA 2E87A 4DZZA 3ZQ6A 1XEWX 1YZKA 4D0LB 4UNNA 4A0HA 1SVIA 3C14C 1YQTA 2IC5A 1D9ZA 4JLAA 3SE0A 2L0XA 4NBSA 2ZUBA 3V9PA 3GLIE 2C5LA 4LJ8A 4V0LA 1P2SA 4DHEA 2RCNA 2OLJA 2WIBA 4TLBA 4DWJA 3DZ8A 4P32A 4F4JA 1YZGA 5HKKA 3GEHA 1VYTA 621PA 5EE0A 4UNQA 1ESMA 1KK1A 4OI2A 2QT0A 1H8EA 3KKNA 3B9QA 2RHMA 3CONA 3FKSD 1SXJC 2QTFA 1NJGA 1FQKA 3I72A 2CL7X 1W0KA 1G3RA 2QZ4A 4U02A 5GJCA 1ZYUA 4Q5IA 3RNLA 3MMPA 4CW7A 3ND8A 1P72A 2GF0A 3B78A 1MH1A 2BJVA 3B6EA 3FMIA 3F5FA 4BLOA 1T6NA 1F6BA 1VCMA 4RD2A 1NVVR 3AUXA 4B33A 5JJLA 4YMVA 2WM9B 4B76A 3VMFA 4BEJA 1OE0A 3BD9A 1QHIA 3ZZ0A 4FWIB 4KXFB 1CJVC 1EX6A 3SNHA 4ERNA 4QM7A 2GCOA 3IILA 3VQTA 2C04A 1G3IA 4IDOA 2RMKA 3VFDA 5JEDA 3GPLA 4GOXA 1G20E 4LCBA 6Q21A 2F7SA 3ZS9A 1U8YA 2IYUA 3LBHA 4NYMQ 4QJ3A 2V6IA 1VYUA 4IRUB 1XRJA 3N2IA 3V4FA 2HXSA 3QXXA 4UKDA 2O8EA 2WSSD 1AM4D 1JAHA 1ZJ6A 4O2RA 4LHXA 4A2WA 4L16A 2WTUA 5HTKA 4FCVA 1XCPA 1UADA 1KO1A 2ZVQX 4BQSA 3NDPA 5UKDA 4JLMA 4KO8A 4ARZA 1R10A 1Q12A 1PVOA 2QY9A 4DRZA 3U4QB 4TSFA 3IBGA 1W36B 1W7AA 1AA9A 1JAIA 2R65A 3QKRA 2JA1A 1CS4C 3MGCA 1EFRD 1NMYA 2G83A 5CLQA 5TY0A 2QE7A 3OEED 2VRWA 2QAGC 1LB1B 3UPUA 1S4QA 4JKIA 2PLRA 1R5NA 1KMHA 1GWNA 2GK7A 2Q3HA 1JJ7A 2VHUA 1M1YE 5AUOB 1HQCA 4JSTA 4BLTA 4GT1A 4DLYA 4ZIRB 4G5OA 1XTRA 4NE2A 3DKVA 1L8QA 5SZIA 1MRNA 3VR5A 1ZNYA 5CITA 5DIFA 4N3NA 3EPKA 2PCJA 4GNKA 2FX3A 2R8RA 4KSBA 1W4BA 1SKYE 4Q01A 1YHNA 5HCIA 4JLDA 1IAQA 1KY2A 1X8LA 1HY3A 2ZEJA 4XVQA 4B47A 3L0SA 5FL7A 3WRYC 1ZC4A 5LDDC 1OH8A 2IHYA 2CVFA 2EFGA 2P6NA 1TQDA 1IJEA 1E69A 1QHNA 4U5XA 5FTNA 3L0IB 4IDQA 4A8JA 4LZZA 3C7KA 2YC2C 4Q4AB 1FP7A 4BASA 4LUCA 3PCRB 1E2PA 3U4QA 4TLCA 4OI4A 4C0BA 1CF4A 3UXMA 5AJYA 1D8TA 1LVGA 3FFBA 2VP2A 3LX5A 3THXA 3QG1A 4XIGS 2WWYA 1R0YA 4KVAA 4DEYA 5DI3A 1AGRA 1UBEA 4MKGA 2F55A 2W83A 4OK3A 4A82A 5TMPA 2MSDB 1ZNWA 2W0SA 2ATVA 2DCUA 4KYIB 1J99A 5JHHB 2F3TA 3P27A 5HZKA 4HB4A 2JAQA 4AYWA 4TZ0A 1D5CA 1R8SA 4F92B 3CRMA 5TDHA 1YR6A 3U7EB 4BECA 1FTSA 5DO9A 2NO0A 3CF0A 1EX7A 2XTZA 4KVGA 1A4RA 4PZZA 2FGJA 4OI0A 2OBMA 4L9WA 3GD7A 1NLZA 4BPBA 3C41J 2OBNA 1XX6A 2F3RA 2GA8A 2X19A 1F2TA 3E70C 3K0CA 1SVKA 4LI0A 3ZDQA 2XB4A 4F38A 2ZSDA 3VR6A 2GHIA 2IYYA 3W6OA 4BFZA 5JS8A 1UBCA 4EDHA 3C15C 2PBRA 4DDVA 2FOLA 1ETUA 3TSZA 2NO6A 2GF9A 1G6HA 2JLZA 5G40A 4HDQB 1Z8FA 2Z5FA 5AJWA 3N70A 4HB0A 4L9SA 2JDID 4Q9HA 4C2UA 1G7TA 3HYRA 5FBLB 1FL9A 5JWHA 1TU3A 4PAQA 1MABB 1YR9A 1CJKC 1QDEA 1NMXA 3KL4A 1H8HA 2BMFA 3A58B 1KKLA 3H4MA 2G1JA 3K9GA 3QENA 5SZKB 1II8B 2WWIA 2XZPA 3IDQA 2GJAA 5GVRA 1KGDA 2XXAB 2AKYA 1W36D 3CO5A 2QMUA 4CGZA 2CJWB 4C3ZA 3NVAA 2NG1A 721PA 1RRCA 4XWOA 2UKDA 2AFIE 4DT1B 3NKVA 1E9AA 4D0NA 1XJQA 1SXJB 3WNDA 2IF2A 3FGNA 2ZSEA 3B60A 1T4GA 3ZQJA 5EXTA 1X8JA 3AP3A 3LQRA 4CEIB 1XDBA 5EXXA 3CX8A 3WP1B 2Q3FA 2ODWA 5CIWA 2OG2A 3DHWC 4PANA 2ZE6A 1E0JA 1IOZA 1KI8A 2QG6A 4NCIA 4UXHA 4II7A 4LJAA 4TN1A 4Z8YA 1LY1A 2FWRA 4WBSA 3HYTA 1XPRA 1Y3AA 2EFEB 2UZ3A 3LO5A 4TYYA 3EZ7A 1E0AA 4L15A 5LBIA 2D06A 5L3VA 4I99A 4W5HA 1N2CE 1SQ5A 3AP1A 4OHXA 3R7WA 4G5RA 1LNZA 2EQBA 5L8VA 3RDPA 1N5LA 4MRPA 5L3SA 3CNNA 4JZKA 1CXZA 3KXKA 4ESHA 3AVTA 3PEVA 3MFYA 1G4AE 1SULA 2PJRA 1T3LA 3T35A 2WAYA 5IRCD 1E2QA 4PSVA 4RD0A 4DJTA 3VNUA 1NKSA 5IHPA 1NLYA 3X1ZA 2ANCA 2XSZA 5JEEA 1UPTA 5DHFA 3QQ5A 1VECA 4ZDJA 3VNVA 3I92A 4EFMA 3NHBA 3ZZUA 5AUPB 3NC0C 4DLTA 1XTKA 1XEXA 2WPDA 1ZM9A 2IS1A 4G3XA 3T12A 221PA 1XU4A 2QAGA 2RGAA 1L4UA 3IHWA 3TW8B 2GJKA 3IIJA 4IOMA 3R9IA 2IWRA 2DWQA 1GKIA 1J2JA 3QE0A 1MO5A 4LYHA 3B9PA 1AGPA 1AKEA 1G41A 1M7BA 2IHBA 4Z8XA 2HV8A 4TYNA 4MYTA 1MRSA 3LXXA 4NHOA 3TBKA 1WCV1 1UKEA 1NVXQ 3U3OA 1FP6A 1QF9A 2RGCA 2ZJ5A 4QBIA 1AIPA 3TSOA 2QPOA 2B7BA 4ACAA 2O8FB 4PO1A 1UDWA 2QM8A 4QBGB 1P5ZB 1R8QA 4M21A 3QXJA 4TYWA 2CNWD 3AGPA 2IYXA 1C9KA 2ZU6A 3H0KA 4D25A 4QM6A 2B8TA 3B1VA 1E94E 3Q7QA 1FNMA 1A82A 3O47A 2QI9C 3WYFA 4JVMA 4RCYA 1EFUA 3OIYA 4RZXA 1RZ3A 1OXXK 3B7GA 2O8BA 2C9YA 1E2EA 4PHTA 2FN4A 2KSQA 1EFHA 4ZDKA 4P0TA 3PEUA 1JQJC 2ORWA 1FZQA 5JRJA 1JALA 2C03A 4MRRA 4MDFA 2BHRA 4JLNA 2QAGB 4MQBA 3BFVA 4TQ9A 4DXAA 2H17A 5DYGA 1R5OA 4U7DA 5DH9A 2XITA 1XCMA 2F43A 1Z0IA 1WBBA 2GRJA 4B48A 2V6JA 1ZU5A 3FVQA 4PSAA 4AWXA 1U9IA 2EFHB 4YXWA 1KI6A 2CHGA 2Q0HA 2O8FA 3THWA 1XNJA 4ON9A 5EXSA 5FBWB 1P62B 1DAMA 1BIFA 2G0NA 2QAJA 3A4NA 5AK0A 1UKZA 1JEDA 2QROA 3HR7A 1ZIPA 2D4HA 3QG5A 5L3RA 4B6FA 3RRNA 1E2NA 2ZS9A 2VF7A 3GEIA 1FFHA 3TVTA 1DVRA 1YJ5A 2QP3A 2WZQA 3AGQA 3RVBA 4V0NA 1S96A 2YYZA 5FTJA 4UNSA 2D2EA 4WA7A 5DE3A 4MDEA 5FL7D 5KO2A 3D6TB 5E7JA 2GXUA 1XMIA 1NY6A 3U6BA 1G7SA 1YZUA 4I1OA 2W58A 3TRFA 1TQ4A 1UM8A 4XD7A 3AEZA 1P9RA 4Z51A 3A1UA 1NL3A 2IUSA 3GJ3A 3VHXA 3BWDD 4AG6A 4DSNA 3K70C 1G5RA 2JLQA 4UQOA 5SZHB 1CR4A 4RD4A 1CKEA 1NN3A 2NO1A 3Q3JB 1DAFA 1NN0A 2PH1A 1FQJA 1KY3A 1VHTA 1EWRA 3BB3A 3IEUA 3K0FA 1XZQA 2IS4A 3FE2A 4QXAA 3W5IA 1TQ6A 3QNUA 3MLEA 4L4UA 3TQFA 2QTVB 5GJBA 1FX0B 1UKYA 4NP6A 1HA3A 3CNOA 2XZOA 2IYQA 4LHYA 5EP2A 2HEIA 2GNOA 3BB4A 3QSYA 2XOKD 2WJYA 3KKPA 3GFPA 3W3AA 1KI6B 4MYCA 3TR5A 1VYVA 3THWB 2WJHA 4HDOB 4HZUB 4ZO4A 4DEXA 1G1MA 4OQXA 2ASEA 1E1QD 4V0MA 2VP4A 3REFA 1KHTA 1RYFA 4YDHB 2XTMA 4QNMA 4DSTA 1Z0KA 1VCNA 3SJBA 4LJ5A 1G21E 1A1VA 2ZSBA 1GNPA 5JLJA 3GJ6A 5TB5A 1KI3A 4EUNA 2PZFA 3REGA 2HYDA 2GCNA 1GAJA 1OLOA 4URXR 3PG5A 3P20A 2R6CA 3DEFA 3DM5A 3VR1A 4DLSA 3TMKA 1AZSC 2ZETA 2ZRPA 1TF5A 4CEJB 3CIOA 4Z1MD 1T0HB 5HR5A 4UXIA 2BOVA 1E99A 2VP0A 1XCGB 5EP1A 1Z06A 5GJVC 4B71A 5EUMA 5JI2E 1FX0A 1RRFA 3OE7D 3SS8A 1N6KA 1NN5A 2AWNA 3T5GA 1UFQA 2ZI5A 4B3XA 4W5JA 2PZEA 2NIPA 2AXNA 2WKRA 3BC1A 1S3SA 4Q18A 1TTTA 2X77A 1FW6A 2BKUA 3GLIB 1ZVQA 3OFNA 2H1LA 1CR1A 3KXLA 4TT3D 2J41A 2WAXA 2NTYC 4HSEA 1RPZA 5HPYB 2VO1A 3HJNA 2FFBA 2BVNA 3FKSA 3JVVA 2AL7A 1S9DA 2RGNA 3QKRB 2ODBA 1CJTC 4IXMA 1RW4A 3TH5A 3WYAA 3V00A 5KPDA 4BFSA 3AF0A 1OXTA 4IFEA 4Q02A 1U81A 2F6RA 2ZI6A 3CR8A 4PC3A 1R0XA 3GQBA 1I2DA 3SYLA 5C4MA 3CRRA 4Q1EA 3B1ZA 4IJMA 1A7JA 1DOAA 3JZAA 4IFBA 5AR1A 2VIIA 4AC9A 1TPZA 4QGFA 2BV3A 3K0AA 5DN6D 4ZKEA 3OE7A 2CHQA 2ZRIA 3C5CA 3NWJA 3KXIA 1P9WA 4CF7A 4RD1A 3C8UA 3CPHA 1KZGB 3CUEF 4NU0A 1N0VC 3GLHE 3QXSA 5F9FA 1Q1ZA 3ADKA 4FW9A 1BMFA 4E22A 1XD2A 4XH9B 4Q9LA 1WP9A 2YOGA 3OIVA 2XGJA 4NKRA 3SR0A 4Z54A 3BAFA 2ZUCA 1IJFA 1KI2A 3SU8A 3PFIA 4OKSA 3G5UA 1RKBA 1GM5A 1TAGA 2B7CA 1J70A 4LHZA 2OXRA 3WMFA 3ADCA 3LBIA 1RYHA 3DO6A 5GVSA 1QG4A 3L8YA 2BWJA 4R7ZA 1K5DA 1OIXA 2HLDD 2FJUA 2O8DA 1MT0A 2ZJYA 1VDZA 4Q7KA 3L0PA 1OJLA 1SVSA 2CBZA 2A5DA 4OJKA 4JLBA 4QFMA 5KHOC 1ZMXA 1KO5A 3GLGA 3AQ4A 1XXHA 4UNPA 3UKDA 4AIIA 3AKDA 4TL9A 2WMNB 2REBA 4CT4B 2PL3A 5BXQC 5CK4A 3CX7A 4JLJA 1US8B 3DOEA 2X2EA 2G3YA 1PUJA 3I61A 2J7PD 2Q6TA 2VLIA 4Q7LA 2GVZC 1KI9A 1KK2A 3IEVA 1M7HA 4ZCIA 4NCJA 5BN4A 2CL6X 2RB4A 1UF9A 3IIKA 5AJZA 1HE8B 4KAXA 3SI7A 5FH9A 1LW7A 2IT1A 4GSYA 4JLOA 1NBME 2FNAA 4PPNA 4EJSA 5J47A 1OYWA 1QZXA 2P6RA 1E1QA 1EG7A 1XD9A 2IYSA 2WICA 4R71A 3EWAA 1GILA 1QBKC 4POAA 4LC1A 2C95A 2W0MA 4R2HA 4MRVA 1DARA 2OUKA 4HAUA 1CU1A 4Q03A 5CM8B 2O8DB 2C9OA 2GXSA 1T0JB 3CX6A 1MABA 4JBWA 3TVDA 4OHVA 3CRQA 3AF1A 4CEHA 4JVNA 4ESVA 1B0UA 3SYNA 2WWXA 1R6BX 1GIAA 2FPLA 5BYJA 4TZ6A 2VBCA 3EPHA 3TUJC 4IVRA 2A2ZA 4JLVA 1NBMD 5H70A 1DTSA 1Q57A 1TX4B 2CXXA 2XSZD 1ZM2A 2ZJ2A 4A0GA 3JVUA 3EWSA 4OL0A 5G3YA 2O0JA 3D3QA 5GADl 5FFMA 1Y63A 4ASUD 2VHJA 4WZAE 2ZRBA 1EFTA 3IPXA 1W47A 3QEOA 3T5DA 4BRWA 1OB5A 4JYCA 1W5SA 1GP2A 1JB1A 1Z22A 1OH7A 2OE2A 5FI0B 2NO9A 4NTZA 2V7QD 3H1TA 1W0KD 2P5TB 5CB6A 3CZQA 2C8VA 4HAVA 5TVKA 4V0KA 4GFDA 5E4FA 3LX8A 1E2KA 4OHZA 5IDVA 4JKYA 2GESA 3TIFA 2X2FA 3DKPA 2ZJOA 3DZDA 2JCSA 2FPKA 1S8FA 2GBLA 1R0WA 2A30A 3KQLA 4PAMA 4Q4JB 5H1YA 1PLKA 2XJ9A 1D2EA 2ZJZA 3U7FB 2ZYUX 3RABA 3RSOA 3FMOB 2W00A 3KJIA 1W48A 2WSSA 4PHHA 3W5JA 1P7CA 1I4DD 3IQWA 2H5EA 3H2YA 3QPWA 1CR2A 1DE0A 3KJGA 2H57A 4QL3A 3UWKA 4BE7B
chains in the Genus database with same CATH superfamily
1JHAA 1GQYA 1QORA 3NTOA 1C9JA 1XXHE 3ND9A 1OUMA 2I7VA 4NFSA 3V1LA 3D6JA 4HFJA 4P4TA 4R81A 4Z9BA 3X2SA 1LV7A 1B23P 3F9CA 1Z28A 2HMSA 2XWBF 4P5PA 4YI5A 1CZHA 2VJAA 2CBGA 3IELA 2OWEA 1VMAA 2X15A 3PE3A 3TVYA 1FTQA 5AKEA 3ZTYA 2R44A 2AR7A 4ESOA 2FZ4A 5CT6A 1TTTA 3ADBA 3I1YA 2P1ZA 3NHUA 2PMKA 2AZ4A 3E3NA 3LLVA 2ZT7A 5D84A 1F8GA 3UWOA 1DJLA 5BOVA 5MFPA 3F97A 4YN3A 3CUWA 4JP2A 3P9PA 5E2IA 2IU0A 3CZAA 1JX6A 3LYHA 2A5JA 4LI3X 4Q4JA 4ZPJA 2V7PA 1CYDA 1JFFB 1WOMA 3BWEA 4OGGA 5TEWA 4D43A 4N40A 3E9CA 3B85A 1HDOA 2XMPA 3FOBA 3F6CA 1M2FA 1H6DA 4IF4A 5DN9A 3CM0A 4E4YA 1XA4A 1AB6A 1Y6FA 4M53A 4MMYB 1XMOB 4LXYA 2R6AA 4Q3AA 3IKMB 4KWHA 2PX3A 3GOHA 5DSZA 1YMUA 2DWPA 1P73A 3DXXA 4O08A 2M6LA 2XYPA 3L7YA 4MWEA 5FLEX 1SY7A 4G5HA 2J67A 1KAOA 1QO9A 2WA1A 1JJBA 1ZCBA 4LEIA 4DW8A 5ALJA 4UUOA 2P0AA 3IQIX 1JIUA 4J1QA 2F1JA 4BV3A 4V1CB 1Z7YA 1D07A 1XBTA 1RAAA 4RV4A 4JUCA 2GPYA 2CGEA 2FSVC 3C98A 3CE9A 3DB2A 5M3BA 3S7ZA 4EA9A 1PU2A 3L6BA 4BRUA 2AKEA 2HNBA 2Q9BA 5I4BA 4JGGA 2AUMA 1TPYA 2XDAA 1RXWA 3L1VA 1BEUB 1HQYE 1NIJA 1O2DA 2AOUB 2RE8A 2HNAA 2IUYA 2WSLA 1QP7A 2J7PA 3GZNA 4MQ6A 2CEKA 4LOAA 5E95A 5CD9A 1P61B 2R8XA 5C1PA 5AM0A 3ZC3A 2JIMA 2NU9A 1FFBA 1XZAA 3PVCA 4BX2A 1RM4A 3VRHA 3N74A 1XTQA 1YVEI 2FMUA 1SUIA 2HC9A 3L18A 1D7OA 1KF0A 5BN5A 4PWYA 4C5AA 4HQLA 3OC0A 4H4CA 5GMOA 3EXFB 5B7NA 4RTNA 1I4TD 1AKRA 4WXHA 2JHFA 1NMEA 4Q1VA 2H1FA 4PLZA 4UD2A 1IOWA 1NMQA 2FR0A 4GZ3A 3FPEA 2XMCA 4K6GA 1PEYA 1M2VA 1Z2PX 3SKVA 1O58A 2W6ID 5AOVA 1NXTA 3MLBA 2GFQA 2C97A 3D6AA 3G2LA 1SBCA 3AJAA 2VOEA 4Y6QA 4LKOA 4ZQEA 3TJMA 1KH2A 1OB2A 4DV4B 1IY8A 5DZSA 1KEUA 1RQPA 2P5SA 1OVGA 5IDWA 4FS3A 4Q1DA 5JQGB 2AHRA 2CLSA 3DTVA 3MTAA 4J16C 4D6PA 2ZIXB 1P17A 2I78A 1KNXA 1E1RD 2R8YA 2X76A 3O93A 1G21A 2IDZA 1U1IA 3OM0A 1OR8A 3KTOA 3U7GA 1VI6A 1LW6E 1ZD8A 1OX6A 1M2NA 3OZTA 1OT5A 2A59A 1PGNA 4WESA 1I6LA 4AO7A 1UMCA 5A71A 5KU1A 2FJ0A 3H8SA 1ZGCA 4FP9A 1EK5A 4WJLA 3QMPA 1ES9A 2FGKA 2OAEA 4GO1A 4TM8A 3REQB 3R20A 1E59A 1JHOA 2NV0A 4OQDA 1AA6A 3W9SA 4F6RB 1DWOA 1Y1RA 1ZJYA 1WZNA 3ASYA 3M6MD 1YZQA 3K2QA 4PU0A 4ABTA 3CZCA 3RROA 4TN5A 3DB1A 1DKUA 1ZWKA 2RBKA 3GVPA 2BJWA 4F71A 1G98A 2UAGA 2ONKA 5C5DA 5CA0F 5JZVA 2FPPA 4BLQA 1PBNA 5A9SA 4K6CA 2QQGA 1T5BA 5BRNA 4HPXB 3M9WA 5TQ2A 4ZCSA 2ZUEA 3VI3B 1GU7A 3OZBA 3OOSA 1Z6ZA 4F4HA 5BVGA 2HCFA 2ZSHA 2AFVA 5I48A 4NE7A 1K8ZB 1RT9A 1JG7A 4JWTA 1GNVA 2CLIB 3FG9A 3PUZA 2W7TA 5FBZA 2J9XB 4YT5A 1YIDA 3LWNA 3OZWA 5AM2A 3H6HA 3BQ9A 4P3PA 3QFHA 3TTUA 1HC7A 5IDYA 3SP1A 5FT9A 5BWMA 1L4YA 5CVEA 4KKVA 2Q28A 2W2VA 3A06A 3PDWA 4JLUA 4NMWA 4R01A 4Y9SA 4EHHA 5H81A 821PA 5LUAA 1O08A 4MGKR 1AQYA 4BYMA 4B1FA 1NXOA 2VPQA 1G2IA 2W93A 1DEAA 3DLIA 1NDUA 3BCRA 1QNLA 5HF5A 1QLJA 3OQ1A 3L40A 4RTPA 2W6JD 3MQFA 3H5VA 1XZDA 4LPKA 3RVLA 1U31A 1W9HA 4DMUB 3R3WA 1KI4A 4FT2A 4WEOA 3CX4A 2WD9A 4W5QA 2Y1OA 4PZEA 5E2AA 4WZAA 1UC8A 1VSQA 1CQIB 1NUAA 3F0TA 3I4LA 1SQ0A 3IEKA 4GLBA 1ZRMA 2G4VA 4EI2A 1A5SB 4PM4A 1RRVA 1T1JA 4EUKA 2B4QA 2EIXA 1K5PA 2AG6A 2EIHA 4Q7QA 4ZVVA 4XM0A 2X6TA 4NZMA 4LQCA 2IDMA 4DC9A 3G0DA 3GFTA 1XWWA 1B3BA 4MITA 2BFWA 2J3DA 1E7MA 3BFKA 3A6GA 4FU0A 1I0ZA 1T2AA 3VTKA 1PHRA 3OUTA 5JCJD 2E55A 2EYQA 4RZUA 4YUAA 3ZCRA 4RABA 1KJYA 1AB5A 2ZJ7A 1V41E 4CMKA 2OOSA 1NJ8A 4IDEA 4I1VA 4ZVMA 3VTFA 4UUNA 1JQLB 4JI5B 1X70A 3RPEA 3MWJA 2DF8A 1F5SA 3IEXA 3VX3A 5H16A 4O59O 5L3QA 1VGVA 4PE5B 3SHOA 1GLNA 1THMA 3JQPA 1MF7A 4BIIA 2JEZA 2ERXA 4PZUA 2I7TA 3OEEA 1R9GA 4AKTA 4N7BA 2H1VA 4CU5A 1IB0A 4TMZA 4JYZA 1DX6A 3VVLA 1C7FA 4V03A 3WZ2A 2QE6A 4QLAA 2QZJA 4UBLA 3WJ1A 4KZPA 2QNRA 4ER7A 2FUKA 2JFQA 5DHRA 5A5FA 2DUJA 1OIVA 2BR3A 2OHOA 1KU0A 4IX1A 4MV5A 1FUKA 2BIFA 3EZLA 2O8EB 4O5AA 1GLGA 1O54A 1A9PA 1AS0A 2MMCA 2JGDB 5AESA 4M49A 1VPVA 4JIMA 5F1YA 3MEQA 3GPCA 3UB2A 5F33A 5D3QA 1JPUA 1VP3A 5JXJA 4RTKA 2JJQA 3KALA 3C87A 3ENVA 4I8DA 4KQKA 4AURA 3K1ZA 2QM0A 4CMIA 5FAKA 4TWIA 4R9RA 1XQWA 1T26A 1GL9B 2UYCA 2RHTA 4OHMA 2R6DA 4RVHA 3LQKA 2JFNA 1DBIA 4I1UA 1IHUA 2BZSA 1FXWA 5ERYA 2Q2NA 4RVUA 3ILSA 4RFLA 1AG9A 2R4UA 1MGPA 1DBVO 1TVCA 3WIDA 4DCPA 1JHRA 4QBHA 5CEEA 4FDLA 4H27A 2G9RA 2IDKA 5KQPA 4LXIA 4GQIA 2V96A 2F3QA 5F52A 1GG2A 1I6MA 3WIEA 1GTSA 4IOJA 5AVQA 4GSKA 1BH2A 3DEZA 3DO8A 4C05A 5HZGA 2QLTA 3IUSA 4UE3S 4KIFA 4IWNA 2G06A 1P75A 3WYEA 1EP3B 3GGDA 3CINA 3PI7A 4HLUA 4ALKA 1U28C 2CD9A 2KS6A 5B3JC 3Q4GA 2AF4C 1L7VC 3WKAA 4ARBA 4PYJA 2AD5A 5GP1A 3TB4A 5JYDA 1JKFA 2P11A 3A3OA 1RWVA 4D97A 4YUZA 5B4UA 1OXBB 3PXXA 3QKSA 1KIAA 1HO3A 2WT8A 3SZUA 4IV5A 3F4KA 1P3DA 2C78A 1V1JA 3TKAA 4URUR 3FH0A 4ZP1A 3B5IA 3U4MA 4AKIA 5A05A 3BE5A 5DI3B 2YWXA 1U2ZA 1U7HA 3KM0A 4R54A 3TTTA 1GPJA 1T36A 4M7PA 4LYFA 3T4PA 3FFXA 4Q3OA 1YR8A 4RPJA 5DCWA 1YS2X 1LTKA 4ZPXA 4EG8A 5DK4A 1XWFA 1R4AA 1QV9A 1KAMA 2D59A 2HA2A 1H05A 3INGA 1DQRA 2DWUA 5JS1A 3OQMA 1R1DA 2ON6A 3UG7A 3UA3A 2BONA 2VYVA 2XUAA 1MA3A 2Q3CA 2BCGY 3L7JA 3LECA 5CDGA 4BO9A 3UW1A 5A62A 2ZB8A 1RHJA 3K09A 3OF5A 5FYDA 4GMKA 5LMNB 3ORSA 1TRKA 3N8NA 1RZRD 1E2FA 3TTVA 1FC0A 4YCBA 4DBLE 1T10A 4UTNA 3PCTA 2D8AA 3NTQA 5K6RA 3U7RA 2AG1A 3W90A 4I50F 2VQSA 2QW1A 4QUKA 5E3HA 1JDVA 3B82A 1KL7A 2A4KA 2FWBA 1QQ5A 2BRUC 2XRYA 4PSKA 4LRSB 1HLFA 3AVWA 4JJ6A 1EA5A 1QK5A 3CVUA 3CTPA 3DMDA 3TKLA 2QL6A 2ZYTX 1YULA 3E3MA 4M0DA 2HLPA 4Z86A 3T4EA 4IYJA 1SUCA 3WK8A 3RWMB 5CXXA 2YJZA 5IBCA 3EPRA 1C30A 1V95A 3IBTA 2BE9A 4TMYA 1QF6A 1SELA 1ZC3A 3OMLA 1HDYA 1ZISA 3GX1A 4EZBA 1ZK1A 4OQQA 5G02A 1H6AA 1HYEA 4YRRA 3WLLA 3WLTA 1NQOA 4LWPA 3A1EA 1KQFA 2V6MA 3B8EA 1JHMA 1EZZA 1HT2E 1NF8A 3LOPA 4EMUA 3HVUA 2PUVA 1GKUB 3TMAA 3CLTD 3NBFA 1URPA 5BURA 4MVJG 5EMJA 3JQ9C 3V8QA 1CNFA 5JNRA 4LXHA 4RKFA 1D7AA 1WDLA 4AD8A 3H18A 1JTEA 5ITSA 3I8XA 1THGA 5ALDA 3SBEA 3CHYA 2H92A 2FG7C 3TAHA 4XWAA 3W6UA 4L22A 3SY8A 1IBSA 2C20A 4ROSA 1V5WA 1OV4A 3N8KA 5C53B 1DKNA 3E61A 3SQXA 2FU5C 4FMDF 4JUDX 1Q14A 4OLFA 1P9LA 2TMYA 3T7TA 4HLQB 3S55A 1QNFA 1GFZA 1T4CA 1ZH8A 2INGX 4TZKA 4BFUA 1Q91A 4CKWB 5THXA 2EBHX 1S89A 5I7VA 3K9LA 3RHZA 3QYPA 4JBNA 4YUWA 4BC0A 5LWHA 2AOTA 2TMKA 3EVTA 2Q5IA 3RREA 5E6SA 2ZRDA 3O8DA 4DCJA 1TZKA 2RHBA 4UTXA 2R6HA 5IK2A 4M9RA 3VHXB 1XRPA 2E4ZA 3QUQA 4HVTA 2Z83A 3FYSA 2WFZA 2YIVX 1U2DC 3H0EA 4MV4A 3URKA 4DGSA 1TEZA 4RZHA 2MINA 1RMQA 1Y3FE 4IJWA 2CLOB 2VTVA 3PXCX 4GRAA 4EG0A 2R6JA 3X43A 1BEZA 3SYTA 4NXMB 1JQDA 4OQEA 3F5SA 1PL7A 1OHHD 3KK0A 5EN4A 2B1JA 1QYIA 2RG7A 5F21A 3UCXA 4CDGA 2ZDGA 4CUZA 5K7SA 1ILEA 3V8RA 1P1CA 1LQ2A 4RY2A 5FULA 5FI1B 1GCIA 5BVHB 3ZZMA 4JI7B 4TLAA 5F77A 1SWVA 4W6QA 1WXDA 3JRNA 3G9QA 4GBGA 4B09A 4ARUA 1KZ7B 4C07A 2IP4A 3FLEA 5CJPA 1UBRS 1S6YA 1AD2A 4Y6OA 1Z63A 2F1RA 1JR3D 1LRJA 1CS0B 4IMJB 2Q1WA 4JT9A 4BB6A 5EP3A 2BDUA 3OMWA 1WPGA 1P8AA 4KFRA 2PUCA 2P79A 1WMBA 1TDJA 1DJMA 3KQMA 3AVPA 2FY8A 1U7WA 3R74A 2B21A 5KEIA 3OBIA 3RBZA 1YQDA 1Z3CA 4L3OA 5DMHA 4ZCLA 4R2KA 2M98A 3BB1A 1W46A 3PGXA 4XWGA 3ZTWA 1DELA 1P2GA 4KI7A 3N2GA 1I4OA 5DNAA 2OK7A 3RU9A 1MD9A 1DBPA 4QTXA 3S68A 1T91A 1NNI1 1NF3A 1NVFA 1E3WA 2EBUA 5FEMA 2BEVB 1WXIA 3ZOKA 2OBYA 3MSCA 5KYXB 1R0RE 2ZB7A 3E4CA 3BORA 3LC7O 3QFSA 1YGPA 4HK4A 4H60A 2WIFA 3ONNA 4EECA 2Z9CA 5E7IA 1BX3A 3SJAA 1EQ2A 3I39X 3QM1A 3TW0A 5E9QA 3IODA 1KE1A 1TVMA 5AHKA 2PV0A 2ZYSA 3G49A 2P2GA 3UK0A 3UY4A 4E4RA 1V37A 4AMBA 5JD6A 3I0ZA 5CFZA 2F67A 1IN4A 2JPDA 4JL5A 1IZ8A 2CUTA 3MB8A 3E5HA 4Q48A 1U8EA 1L7QA 2OGWA 3ULKA 1IXZA 1DC5A 3VKFA 3W6NA 3HWSA 4QOJA 1CUBA 4TL7A 4ZAGA 5E6UA 3AM1A 1NTOA 2QJTA 1SCQA 2PT9A 3ASUA 3DVAA 1DS6A 3PHBE 3WI7A 2UXBB 3GLFB 2AG0A 3PUHA 1SAYA 5CW1A 1JEJA 5J1SB 2P5UA 4UVHA 1I30A 3I9MA 1S3GA 1B8NA 3DCIA 3WNQA 2CDRA 1P1IA 1QO0D 2J07A 1JIIA 9ABPA 1VLLA 4Z3KA 5KMGB 3ZVNA 3MT8A 1QHHA 3D4NA 4XJXA 4K86A 3FWYA 3TNFA 1QHXA 5PNTA 1V45E 2VK8A 3T3OA 4RAOA 3S28A 2L19A 5JJIA 4M0CA 2E85A 2O8BB 2VDNB 4OV6B 4FYVA 1HLPA 3C48A 4Q34A 1G3QA 3AFGA 4MWOA 2YINC 3X1MA 5JPCA 2O6LA 4ZT4A 3NH6A 3OPXA 5JFTA 3KV3O 1YQXA 2Y1FA 2CK3A 4FFLA 4RX1A 5TPZD 2H11A 3HY4A 3IBFA 1N2HA 1JEQA 4XOUA 1VLMA 4RJJA 1PHPA 4P83A 4QQNA 4WZZA 3FTQA 1QYVA 5J4HA 2ZE8A 4DTCA 1D1SA 3FFWA 2C1ZA 3DMTC 4MQ5A 4F2WA 2FI1A 1A4XA 3KOMA 1MX1A 1BS2A 5BV8A 3T1VA 4RQUA 3KB8A 2Q3MA 1PT7A 4HWRA 4MGHA 4E07A 3TOCA 4ZOLA 5A6VA 4Q9AA 2WYWA 3OPYA 3O8QA 4OXXA 5AH0A 2QV7A 4RK0A 1P19A 2EWWA 1T9HA 2G5PA 3EFBA 1DZ3A 3LFUA 1YJBA 4FZRA 2D5CA 1KP9A 2FAXA 3D81A 1WDTA 2JI6A 1Y80A 2WSIA 1L5MA 1IONA 2O14A 3JYNA 5JVDA 1NYQA 3VXKA 1W581 2N46A 1MIOB 1JG2A 2C5FA 3DLAA 4MW0A 5CW2A 1CRZA 4FGWA 7ABPA 3NMUF 3I9OA 1W1UA 3SQLA 2SCUB 2VHEA 4BUZA 3VSCA 2XIJA 3EC1A 1F20A 1GRQA 1E1LA 2CXOA 3LHFA 4JT2A 2DM6A 1LRLA 4A2PA 4OG2A 2JFZA 2BE7A 3MRXA 3T0IA 4LZJA 5KB3A 1SCDA 2RJNA 1G0NA 4M7WA 4I5DA 1U8ZA 4YAEA 4MYUA 4RE6A 3EMBA 1N7GA 5A3VA 3N5CA 1LKZA 1TF2A 5CT5A 4JEHA 2A0YA 4I08A 3O38A 4HJRA 2Y0CA 3DTVD 3RAPR 3T1NA 1QVWA 1PJTA 3IXLA 3UTDA 3V3KA 4RZQA 3MCVA 3VPBA 4BVFA 3KZ1E 1AO0A 2G07A 3QA9A 1ZEMA 2BFPA 1QLWA 1N5DA 2HQOA 2ETXA 1ZVVA 4C5CA 4QO7A 4ZGGA 3QH4A 1O0CA 4KN5A 4DCGA 3SFZA 3L46A 4K9LA 2NXNA 1SC4A 1ZMTA 4HYEA 3SIPA 4DUGA 3PXEA 3VBEA 3W3ZB 1Z2DA 1DQSA 1PFUA 4W5OA 1VJTA 1NNSA 4QDUA 5CH5A 5AI6A 3T3HA 3X3HA 1GTVA 1HRKA 1WQ1R 4J0GA 1GL7A 1CJSA 2VBFA 4KW7A 1XAGA 5EESA 3OFVA 3SBXA 1GQSA 2AF3C 3FOZA 3HQ4O 2W4QA 1WD5A 2FPIA 1KJQA 2JI8A 2ZBEA 4N0EA 4BFVA 3Q7PA 3GVIA 1II0A 1VKJA 1XMXA 1DX4A 2AJCA 3HB0A 3H4TA 4RKWA 4OVKA 3ZW8A 3UMFA 4JKOA 1GZ3A 1OAKA 1U8CB 3H8JA 3O4IA 4FC6A 4L02A 3F5DA 2AK3A 3E8MA 4OM8A 1EK0A 5BQ3A 8LDHA 1PG5A 3L43A 2GBLC 1Z33A 1NHGA 4DNOA 3VC1A 2NUTA 1XVLA 4ZK6A 4KR2A 1V7QA 4NY1A 1M6YA 4ZCMA 1VCIA 3ELWA 5KYWA 3TFOA 4KBFA 3VZDA 1KOGA 3EXHB 3RBAA 1V1RA 1WE2A 3HS3A 3P2JA 2NSDA 4N9WA 4PRYA 3SXUB 3H04A 5KWSA 1OZFA 4LE0A 3L0ZA 2IH5A 3I5XA 2QD5A 1CEYA 4ZD6A 3Q98A 4OSOA 1ZOLA 5AVXA 5FAXA 1YB2A 2A86A 2GEUA 3AESA 3RV3A 5LZ5A 1KA9H 1YFZA 1G1AA 2WLTA 5FUVA 2XQIA 2YUIA 4OIMA 1XNQB 5HKAA 3W78A 1LPMA 5AI0A 1KI7A 1IAVA 2RKOA 3VR0A 4C0LA 4M8SA 4PAOA 3SZRA 1QVZA 1UUFA 2YVLA 4DA4A 3BWYA 4HR7A 1WUYA 5EUQB 2FQXA 5DSXA 4B0PA 3QLTA 3BSYA 2QS9A 2BM8A 1YDGA 3B52X 4PW0A 4EQ6A 1PZGA 1YZ3A 1QJ4A 2QNIA 3LVQE 4A6XA 5FWXB 5LOVF 4Q6BA 5DX0A 2ZRFA 5KSPA 2DGDA 1L6IA 1WO8A 3T94A 4EPYA 2RK3A 2VK1A 3ONVA 4NAUA 1QS0B 3RS7A 4R2MA 1USUA 2YQZA 3DE1X 4HQ0A 4UAJA 2XDWA 2HRCA 4QGBA 3Q7SA 4WXPA 1E98A 1NUSA 4R51A 2V3CC 4N76A 4Y6LA 4P3OA 4JR1A 4KLNA 3NR2A 4DIUA 3DPUA 5EZYB 4JI6B 1OCEA 1PK7A 2IPAB 3S27A 2J3IA 4AMYA 2YVUA 4HEHA 2XJ4A 3IHTA 4B81A 1J21A 3MUFA 4KWEA 2J30A 4N3AA 1OKKD 3BJMA 4JUFA 4OFXA 4X45A 3GEEA 3EDMA 1PTKA 2QLJA 1O97C 2VG8A 3HVKA 2GJ8A 1CR6A 3QX3A 2V7WA 3LI2A 4U7WA 5DYIA 5LB4A 1QO0A 2VYND 3KSMA 5LBUA 2DBRA 1B8VA 2BMDA 1Z15A 4D8YA 4E5YA 4UU7A 1TFUA 3ZY2A 3OJXA 2JBAB 1YTUA 4C6HA 1V35A 2NZJA 4MWZA 1Y4UA 4XB6B 3WLFA 4HQKA 1YUMA 2G9VA 5AP9A 3V1KA 2CJXA 5J2UF 5CG1A 4HRVA 4LHWA 5FHQA 1TCUA 1LGYA 3NWPA 1GA6A 5JDIC 2PEYA 2G67A 4I9HA 3IAS1 5KSZA 4GDFA 1M75A 3B13B 1AF7A 3WXMA 1FA9A 2A9OA 4MYSA 4YMSA 1SG0A 4BIMA 4BZWA 3C6YA 2V54A 3AW8A 4WHMA 3OIUA 2GTPA 2NSHA 2QRNA 3GIWA 3AB3A 1LU9A 4WX2B 4F85A 3FUVA 4O3MA 2ODQA 2VOJA 4FOTA 4TRJA 1JWLA 1RMYA 4PS0A 4WY2A 1RBZA 3K4PA 3RSSA 4E1VA 4H4DA 2ZSAA 1BVYF 1ONOA 4YJ3A 3RTCA 3M6VA 4WLNA 4EY3A 5LUBA 3WICA 2IU4A 3SR4A 1HNWB 3SQDA 3IUPA 4GL2A 2GZAA 4JYMA 1PWHA 2IPXA 5AXCA 2HJVA 3VYVA 3LGAA 5F5NA 4DA8A 3QPDA 2IOHA 4OK6A 1WQ4A 1ZCJA 1QIHA 2ZAMA 2FVXA 1C7ZA 1NW4A 3UMGA 1OBOA 2Z08A 3BGSA 4JGBA 1Q19A 2WJAA 4QRIA 5DBFA 2C5GA 5CVJA 5DM0A 2BFMA 5FOWA 1TIKA 3WGKA 5KYYB 4PLCA 2J9FB 1DIRA 1C5KA 1LPPA 4HWSA 2AJTA 4LHEA 5DIZA 3H9EO 1EGAA 4BFXA 2HDNB 1GGMA 3ECCA 1IPFA 1N5MA 5KAPA 3DV9A 4KFUA 3BEOA 4OGKA 1F7VA 4JX9A 3KB1A 4UCQA 3ZYCA 4CT0A 3CN9A 4D45A 1WG8A 2OV2A 3EOZA 3Q3GE 3RFUA 1WSWA 5AKGA 3O82A 2X8AA 1Z5VA 4LTDA 4ZREA 2VXOA 1OYOA 1B26A 1W4AA 3MWLA 1DXYA 4YS6A 5KYNA 1TLLA 4GP7A 5JSUA 3ZGXA 4CF4A 1LS6A 4JC5A 1F38A 2HT6A 2SICE 2ZWVA 3EHDA 5LA6B 1PSDA 2Z95A 4U2KA 5TXGA 4C01A 4D4HA 4L5BA 4EY8A 5B58C 3GL9A 3GLKA 5AD1A 2EWVA 5JAUA 3D7MA 3OLZA 4HPWA 4ZEVA 1XHLA 1IXSB 1DG3A 5HE8A 5LCXA 5EJMA 1JG3A 1IHXA 1FSGA 1T2EA 3DKRA 3EUWA 4NU8X 3FGZA 5AW8A 3GLHA 5IN4A 5JNWA 2XUGA 2P9GA 2UXCB 3JQ7B 2NU8A 2XNJA 3BJRA 3GLSA 4RVNA 1JXMA 3C1OA 3R1IA 1BRMA 2YY6A 4LOHA 3WGYA 3R9XA 4S05A 3F8TA 3LL7A 3DA8A 1F2TB 2A0UA 3W5CA 1LTQA 3LG2A 1SVLA 3E22A 3O8RA 2WDZA 4PTYA 1JHUA 1ISGA 1MOSA 3N2LA 1F8UA 4WPGA 4H77A 2YWFA 3H5NA 1HE2A 3PPWA 1DKOA 4QBFA 3IIEA 4TL6A 2QMEA 4JCCA 4C4OA 1FPMA 3E8XA 4PRLA 3USES 4UVGA 1NSYA 1ZUNB 3E9MA 4CLOA 1RE1A 1T4DA 4G0NA 5JADA 1ZD3A 3ZQKA 1WPQA 3R8CA 5HQJA 1B14A 2VYFA 3KTDA 4X3PA 1ZOOA 1UXGA 2HDHA 4S1PA 1Z4QA 3DBVO 2GF2A 3WWEA 4MP8A 5E6RA 4K87A 1E9VA 3FUXA 1U1CA 4E08A 4HHEA 5CXUA 1RAGA 4HDMA 4LOIA 2FMXA 3AUYA 4HOYA 3N2ZB 4UUQA 1V11A 4LJ6A 5JDIA 4XFJA 4KMRA 5JROA 2IS2A 4LVNA 1RYDA 1EYZA 3RC1A 1X86B 4A15A 1MLDA 2LE0A 5JXGA 2ZRJA 1R5BA 4YJDA 3LUJA 1YJXA 1E3MA 1A9ZA 1NPTO 2HB6A 2B20A 4KPUB 4UTVA 3FVVA 1AMNA 3F8WA 3DBLA 1GKKA 4KQJA 4PX2A 3MGBA 5JAHA 5AVOA 1FUUA 3WYGA 3H1EA 1Z0SA 2EHDA 2BEKA 4DQ0A 2CNNA 4W8HA 3E7PA 4EHKA 1L5SA 1UBSB 4HTFA 3ZV5A 4M98A 5I7EA 2ZKIA 1U98A 2C58A 3NQ41 1L7AA 3M3PA 5DX1A 3RYTC 3SF0A 4BTVA 4M99A 1V1MB 2PQMA 4PN3A 4CEIA 1IQRA 3TQCA 1OKKA 3UJBA 4HAXA 4RLHA 3D1JA 3ZY6A 1XB2A 1UBGA 1H65A 4EK9A 1G2OA 3JASA 5GOTA 1USIA 1U9JA 4TUYB 1TYDE 4B6QA 1ORIA 4XIJA 4CG3A 3E3AA 2IW1A 4JHXA 1XE3A 1UBTS 3IR6A 3BBLA 1MB4A 3ABOB 4P80A 1QRAA 1R0ZA 4CM4A 3QELB 4XPZA 1H3EA 3RS3A 1DOHA 4O1HA 3NHJA 3ABZA 3E2PA 4X54A 1JYFA 5DBEX 3ABRB 1JJFA 3Q7TA 4CIXA 3P9IA 5H80A 5FOQA 1WXHA 1XFAA 1RYYA 1Q50A 2EU8A 4NMMA 2HRQA 5JJ5A 3RF7A 3LBYA 5C7LO 3L1UA 4EO7A 1UC4B 1ML4A 2I54A 2DQKA 4QC2A 2Y0BA 4HH4A 4TMVA 3Q6IA 1GDDA 4KR7A 3FCSB 2YV5A 5CD1A 2ZRHA 1U2EA 2WJVA 4XPIB 1U6JA 4RD6A 1BE0A 2XRFA 2ZPTX 2HGZA 2DUNA 5AOBA 3CZPA 3RYIA 3VKVA 2N75A 4TLDA 1IU9A 1C9YA 3C6MA 3UJPA 2P2DA 4YMLA 4B7ZA 4FZVA 1ZN7A 4Z4QA 4LJSA 3JQ8A 2I2WA 1WW3A 3K0CC 3ZDAA 2MYTA 4CM5A 3OTOB 4UBOA 1G7CA 4BB0A 2ANBA 2VC2B 3E0XA 3IYLW 3UJAA 2ZIUB 2P78A 2P7IA 4C3OB 2PV7A 4CM8A 2ZJ8A 4Z9YA 4WK2B 1YRYE 4CQNA 2WR8A 2Y67A 4V1CA 1XEXB 1FIUA 1T34A 3MT0A 1AK9A 3FYTA 1RQXA 4M0KA 2GOYA 3ABSB 3X2FA 4GX0A 4BJ3A 4WFJA 1KEWA 3A7EA 4G0VA 2UVPB 4OEHA 2I34A 5EHQA 1XYVA 1HZJA 3GEPA 4GLOA 2RIPA 3KQVA 5GPBA 1XMPA 2NV6A 1SBNE 3GZNB 5DI9A 3RU2A 1VRWA 1IBLB 4QQ8A 5C46F 3JZMA 4LRTB 3UMYA 1OTHA 2IXDA 2NU9B 1V2GA 2ZUDA 5D1NA 3U9TA 3GAAA 1QMPA 1VIVA 3ZD9A 3AF4A 4IFTA 3PHCA 1SBHA 4RIIA 2CLMB 2Q6KA 2Q21A 1W25A 3PQ2A 2Q3EA 4YP5A 5ENDA 4C7JA 3R8XA 3OJOA 1GVHA 1XKLA 1I5OA 1XDGA 4CM1A 2DBYA 3ZE1B 3EX7C 2A14A 2VCEA 1DRVA 3EY4A 3FIJA 3IAM1 4PCLA 1MJFA 4PCVA 4A92A 4DPMA 5JXIA 1T8RA 1LF0A 1H1DA 1F48A 2Z8XA 4Y9UA 5D5QA 1M34E 2CEAA 4P92A 4JHLA 3S3TA 1RQLA 4YCSA 2XDQB 5JI3E 5FV7A 3ZJVA 1XI2A 1YKFA 4Y2YA 2HWXA 4QVGA 2I99A 2IUTA 3G2MA 1AS2A 4DQKA 3GUYA 4G5XA 5JD4A 4Q4LA 1OI7A 2XF8A 3UHPA 4D3ZA 4D46A 2FQQA 2PA0A 1HV8A 1S1MA 3T9DA 1LLQA 1MEOA 4I2NA 5T5QA 2C59A 4M9ZA 1SUPA 2CXUA 1MGOA 1QVAA 1H2XA 3G6KA 3GJZA 3O92A 3PQCA 3PUIA 1D0IA 1SVOA 1V9LA 1MW8X 3LF2A 2RKBA 4NCAA 4R98A 5JBIA 2ZUUA 3RRMA 2GB4A 4YBRA 3TG2A 1QTNA 2J87A 1LC3A 3HE3A 2PEZA 1P2TA 4YYEA 4B46A 4PHGA 3GT4A 5AQ1A 1YJQA 1DUSA 5PGMA 5FA5A 4UM7A 1RQGA 3WOHA 5CDYA 1G66A 4YV7A 1P9NA 2Q4DA 2PDAA 4HI0E 1YQWA 3KOXA 3ST7A 4B5LA 4EGSA 1PWXA 3I04M 2WKWA 2GEDA 2PU5A 2G1UA 2ISQA 3K05A 2VSOA 2JEYA 4J90A 4TYMA 5JD3A 3VTAA 4YCMA 2RAVA 3N6XA 1A72A 5K0ZA 4IH1A 1LF5A 4K26A 2JCBA 4JR0A 1HORA 4P08A 1TQ8A 3ZOZA 4EFLA 2X0KA 5B64A 2YL2A 3LVRE 4IIVA 1VB3A 4FFDA 3GW8A 2GH1A 2I4IA 2XMSA 1Z88A 3UNXA 4ER6A 2XNSA 3ZU2A 3DE3X 2TMGA 4PAGA 2YJNA 4HAOA 5FWAA 3WGLA 4AWAA 1JDBC 1PNVA 3TQRA 1JR3A 4U2DA 4OLJA 1CT9A 2D1QA 2YYAA 3SLRA 5JALA 5JPDA 3IESA 5T4HA 2R1UA 3K0BA 4I4CA 5C2JB 4BY9E 1A2QA 4UMEA 1G64A 1BU8A 3WB1A 2EJWA 2E7ZA 3FBWA 1U0HC 2FN8A 3V4VB 2ZJ0A 5FOVA 1ZQ9A 3K73O 4C6TA 2YV2A 1PS8A 5KNDD 2CB0A 1OHHA 3REOA 3T41A 3W2TA 4H2DA 4YDSA 4N6OA 4IHKA 2B61A 1K5HA 2JFVA 3BJIC 3EVZA 5A1JA 1OJ7A 1ZG3A 1HKUA 3KTAB 3U60B 1M1XB 4G85A 1AV6A 4F86A 1YFLA 3WIVA 1G42A 2J3MA 1WU7A 1E1KA 5BYAA 4CL3A 3KXPA 1E4OA 1HURA 3P26A 5FUWA 1FE8A 1K4MA 4L0QA 1K2VN 3CEHA 4RANA 2OORA 1L5VA 1Z4MA 1Y37A 2RAPA 2WWRA 3VSDA 3BIXA 4E2ZA 1XN1A 4UC0A 3ZWWA 4UPEA 4IKOA 2ZRAA 2UZ4A 1R64A 1YR2A 5CM9C 9MHTA 2BGTA 1GQFA 2E4AA 4ENUA 3QVLA 1G6OA 1V16A 5AVUA 4H7DA 2DFNA 2R47A 3IAS6 1G2QA 1WQ3A 3G8CA 1ONPA 2Z8YA 3JY6A 3THXB 2HSGA 3P94A 4Q37A 3EVFA 1IXKA 5CGZA 3E9NA 1Q3HA 4LYJA 3AJEA 3ITKA 4QYIA 3HO8A 2M1ZA 4V0ME 5LYYA 1WABA 3SFTA 1PL0A 3ZW7A 6YASA 1YIOA 4BGEA 2FDRA 2LIVA 4G5QA 4HX5A 5JNLA 4BB9A 2JRLA 3ND6A 4PC1A 5EIAA 1VIMA 4DDMA 5A0TA 4R40A 4UMVA 2IIVA 5K0EA 4GPZA 5ALKA 1Q6YA 3E9ZA 1EXWA 3HLYA 3LL4A 5LU8A 4XVRA 521PA 4TMTA 3DLBA 4PQYA 3NVKI 2BMJA 1UK6A 1UDBA 1L8XA 1GYRA 4FKZA 3FOWA 1RJGA 4N48A 1NXVA 2QR5A 3WKDA 3CC8A 2P75A 2C9CA 2FFAA 4HZIA 2OZLA 1YKSA 3PSHA 4BE4A 3LOUA 1Q0TA 1UKCA 2H1OA 4KN6A 4GPTA 1SZDA 4L0DA 2BFBB 1L0BA 2GRAA 3KKMA 3GBSA 4GZLA 4C0JA 2AZDA 4EF4A 3GLIA 2VNSA 4WADA 1MENA 1Q17A 1NVBA 4OMFG 1H0KA 3VU1A 3TNYA 2JGDA 3FHCB 5KYUA 2O2YA 3TQQA 3DZIA 4TWBA 2ZIEA 4RJKA 3PUJA 1RWMA 4J94A 4NBKA 4X1KB 3U3ZA 3N7TA 1M34A 1GAEO 3B1KA 3OCVA 5BUZA 2C5SA 2F64A 1NLMA 2OBFA 5A4JA 3O2SB 3ZDEA 4Z3OA 4B3TB 3ZD7A 1IB6A 4P82A 2QRHA 4UTZA 3AUSA 2BKLA 4IQ4A 2XVYA 2TRSB 4QG3A 2MOKA 2HQ1A 4RTMA 2VDOB 1HK7A 3NI2A 3AKEA 4A0RA 2I4OA 3EASA 3K0AB 4EAQA 5B1EA 4BNWA 3VBCA 5H83A 4RTQA 5IDXA 1DZIA 3M5PA 1QUFA 5E8JA 2ZJ1A 3KSRA 3T34A 2B25A 1G5TA 3AVXA 2HLDA 1U2TA 1L5LA 1B1CA 3HV2A 1N25A 2NSYA 4YVFA 1JW9B 2E1RA 3IX7A 1XD2B 2GM4A 1ORHA 4YALA 2N42A 3MGAA 3NHRA 1TT5A 4RETA 3TW4A 2AVNA 2EKZA 1VJ1A 3GCGA 1T3TA 3CBGA 3TN7A 3QFFA 3KKKA 3KOYA 3T3NA 4F3KA 2Q4TA 1J9EA 4NONA 2ZSJA 2DXIA 3VNRA 4V38A 1AHNA 3QVSA 1I32A 1BHO1 1HXHA 3COYA 3IUJA 1L5HA 1PQWA 1PJRA 4EELA 4TM7A 1SU8A 2HBYA 2JKYA 3OIDA 3KJNA 4HZGA 1K97A 4DIDA 1V8DA 3BD7A 3FZYA 1X2EA 2HCRA 3VUEA 3T1OA 3ZIUA 3GVCA 1EM8A 4YV2A 2P1DA 2PMDA 2MSEB 2WOJA 3HSYA 1F2UB 2H16A 2I91A 2CLHB 1V6SA 2GETA 4CV1A 4GOKA 1E9SA 1Z45A 3AUAA 4TTRA 1KSJA </