5JEEA

Apo-structure of humanised rada-mutant humrada26f
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
229
structure length
218
Chain Sequence
b'TIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGKAMYIDTENTFRPERLLEIAQNRGLDPDEVLDNVAYARAFNSNHQMLLVQQASDMMKELLNTDRPVKLLIVDSLTSHFRSEYIGRGALAERQQKLAKHLADLHRLANLYDIAVFVTNQVQANGGHSATLRVYLRKGKGGKRIARLIGEAVFSITEKGIED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair and recombination protein RadA
molecule tags Hydrolase
source organism Pyrococcus furiosus (strain atcc 43587 / dsm 3638 / jcm 8422 / vc1)
publication title Engineering Archeal Surrogate Systems for the Development of Protein-Protein Interaction Inhibitors against Human RAD51.
pubmed doi rcsb
total genus 82
structure length 218
sequence length 229
ec nomenclature
pdb deposition date 2016-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5jeeA00
1J70A 1N25A 3EA5A 4M1TA 2HT6A 2PT7A 3PJRA 2IF0A 3DO6A 2FPLA 1ZC3A 2QAGB 1G8YA 4TMVA 1A5TA 1AGRA 3PR1A 3R9WA 3K0FA 1KI8A 5TDHA 2JLSA 1IHUA 3BFKA 1II9A 2F7SA 2JJ8A 1SVMA 2IL1A 3QXCA 2GJKA 4EPVA 3PQCA 3DMDA 2BDTA 2F43A 3Q3JB 4JKIA 1F6BA 5JFGA 3DZDA 4RFSB 4B2PA 1VYVA 3QG5A 4YLGA 1YZGA 4AY2A 3B13B 2AKAB 4V0ME 3B1XA 3GFTA 1KY3A 1XCPA 3B60A 5AUPB 2O8DA 3KKPA 3IDQA 4J0QA 4TLDA 2F1JA 1DAEA 4M21A 4V0MA 3VMFA 3KTAA 4DLWA 4CEJA 1AN0A 4KODA 4LSGA 3PITA 4MGYR 3EPKA 5EXXA 4F92B 2V7QA 1GP2A 1IN7A 5DO9A 2XTMA 5JI3E 1BYUA 4GOXA 1IXZA 2VO1A 2ZS8A 3NBYC 3CWZA 2JLUA 2NO7A 1GDDA 3KQLA 1Z47A 3RANA 4TL6A 2YJTD 3WMEA 1T5IA 2ZUBA 5FUYA 2VH5R 3AF3A 3K0SA 2J59A 1Q0UA 3FMFA 4DEXA 3Q8XB 1XNJA 4WA7A 4M9QA 3WYAA 4Z8YA 2WTUA 2QP9X 3K09A 4HLUA 2HDNB 4FMCF 4MYUA 2VYFA 1GL9B 4N0EA 3L8ZA 1IJFA 5SZIA 4V0KA 3TVDA 2ODBA 3O8CA 4ZPXA 4LJ8A 1XTJA 5J4KA 2HEIA 3CPJB 4AKHA 3ND8A 4Q5IA 4R7ZA 3FGNA 3PXGA 5JSZB 3GJ3A 5JJIA 1G7RA 4XTCS 1QHIA 1AJEA 4DSOA 1CULC 1J99A 1VG8A 3TSOA 1XF9A 2H17A 2JLQA 4Q4JA 5CDFA 4HB4A 1SGWA 5EE1A 2HYIC 4TYPA 3BRWD 4MUAA 1Z0KA 5JS7A 3SQWA 2A5GA 3OIYA 3TQCA 1N3BA 1TF7A 4DJTA 2V6JA 4OQNA 5JJKA 1UPTA 4PTLA 1QHNA 4PC3A 4OHYA 3B8HA 1W4RA 1NLFA 2CHGA 1Z6GA 5DYGA 4B32A 3BJIC 1F2UB 1G64A 3K70C 4CVNA 3TQFA 2QPOA 3GJ6A 1NN5A 2W83A 1RRCA 1KI9A 2WJJA 3ADKA 1MO3A 2QSYA 3Q85A 2IS1A 3QPUA 4P31A 2VA8A 4XIGS 4BQSA 1F2UA 4Q1AA 5J5CA 4JLKA 3QSYA 3FVQA 1FTNA 4BRUA 2OXRA 1FTSA 4Q00A 1S1MA 2GZAA 4B74A 1TEXA 4OQFA 2R44A 5DI3B 4JLVA 2NGRA 3U61B 2EQBA 3CNLA 5K8IA 1HUQA 1H65A 1W4CA 5JECA 4HZUB 3SNHA 1TQ4A 3BH6A 3AVYA 2R8RA 4QHSA 2ONJA 1OFHA 2PZFA 1J8MF 4IEEA 4IVQA 4D4KA 3CB4A 3OE7A 4NHOA 3MAAC 4PPNA 3GLHB 4M1YA 2W6IA 4RY2A 5FPTA 1G5TA 3B2EA 3T1QA 3VX3A 2G0TA 3U7EB 4OI2A 4BWYA 3CPEA 4OJQA 1DTSA 4B6FA 1MO5A 3RNLA 1KMQA 4JT4A 2JIZD 1FMJA 4URZR 2C9YA 4WXPA 3U4QA 4C0LA 4DDTA 1N6OA 1RZ3A 2HYDA 1XXHE 4TSFD 1ONBA 4TL7A 2Z4RA 1JI0A 4JSYA 3CBQA 3IKJA 3LBIA 3HWSA 4X8MA 2PH1A 1QVRA 2DFNA 1DO2A 4LJ7A 4LRWA 3H2YA 4LBZA 4WW0A 4ZI2A 3UKDA 3NC0C 4MUBA 2ZVPX 2ANBA 3AF0A 1ZUHA 3EW9A 4QNRA 4V0OA 1GVNB 4PC7A 1M2OB 3QI2A 4HB2A 2IW3A 3OEED 4Q66C 1H8HD 4KJZA 5EJEA 1KNXA 1LB1B 3SJAA 3N2EA 1Z8FA 4DDWA 2ZJYA 2EYQA 2QMUA 3PG5A 4PPQA 5E4FA 2XJ9A 4PX9A 3X1YA 4KXFB 1EG7A 1VPLA 2GVDC 3BBPA 5CB6A 4HLQB 3I61A 1CP2A 4LHXA 2YNMA 4HUQA 1CKEA 2AXPA 3Q5DA 2IYUA 1G8FA 5EZ6B 4JL8A 5AUQA 3EZ2A 5FTJA 1IAQA 4O2RA 1GIAA 3EIEA 2W2VA 4OK6A 3X1XA 1QHGA 4IXNA 1TNDA 4NP6A 1LY1A 4UKDA 5K8UA 3AB3A 4FWTA 5IK2A 3CF2A 4IOLA 2EWWA 1NVXQ 1W4BA 2GWHA 3F0TA 4QKQA 4AWXA 2FPKA 2FNAA 1CJMA 5TB5A 5DGXA 3U5ZB 4DLVA 4M1SA 4Q1FA 3DPUA 1HT2E 3AEZA 1FMLA 3UATA 1RW4A 4BLRA 5L8VA 5FBVB 2DFLA 2GNOA 4V02A 3G0HA 1GITA 4URVR 2OV2A 2KSQA 2XAUA 1GL6A 3FTQA 1E2KA 5K8TA 1L4UA 3WXMA 3UK6A 3VHLB 4EPRA 3LWNA 1CJKC 4KI0A 3GJ4A 4M8NE 4S2EA 1KK2A 1DAKA 1RE0A 1E1QA 2OG2A 4LYJA 5GVSA 2O8EA 2D74A 2WAXA 3AVTA 2V9PA 5AJWA 2VRWA 1N0VC 2PLFA 4DCNA 3ICQB 5KHOC 4OI0A 1TEVA 3MFYA 3BB1A 3WP1B 1CS4C 1NKSA 3ETLA 2V8OA 4RD3A 1NP6A 2QRNA 2W6JA 1E2HA 2FJUA 4KSCA 1M8PA 3K1JA 3BXZA 2PJZA 1SULA 3A4NA 4JVLA 3MWKA 4B48A 4WOPA 3QF4B 3FFAA 4UXHA 1XEWY 4N3NA 1FNMA 4EIWA 2QTVB 3VR2A 2DBYA 2P6NA 2PT5A 4JVSB 4M53A 5DLQC 1H8HA 4I1UA 4QGAA 4JLBA 4DCVA 1I4TD 1Z3IX 5FOTA 4BECA 1QRAA 4KFUA 2GK6A 3OESA 3WNDA 1D9XA 4Q9HA 4IDPA 2Q3MA 1TQDA 121PA 3HPQA 4AG5A 3CX7A 1NSTA 1R5OA 2CVFA 3WY9A 2O5VA 4EQ6A 1PZNA 4F91B 4QOSA 2OM2A 1W7AA 3ASZA 2IS2A 2ZI7A 1OT3A 4UJ5A 4BASA 2IXGA 1E9DA 2C95A 2XGJA 4G5SA 2IYVA 2EFCB 1T4GA 2XTNA 2ONKA 3A6PC 2OT3B 3LX8A 3QPVA 1O87A 4ABYA 3EZ7A 4M22A 4PQFA 4AYWA 2EW1A 4HLDA 5IK2D 1ZCBA 2QL6A 4O25A 1Z22A 3KKQA 3U6KA 3TW8B 1XPOA 2PEZA 3TR0A 2OZEA 3IEVA 4IVPA 2ERYA 1R0ZA 1KDRA 2C5LA 4RKFA 5EE5B 1GM5A 1WDTA 2I1QA 2ECKA 4F4JA 1XWIA 1ZNXA 4BFVA 1Z6AA 3QIAA 2YOHA 4GBMA 3R8CA 4E09A 2OBMA 1E79D 2JLYA 2P5TB 3MD0A 1T9HA 4R9UC 4QL3A 1R0YA 2N1BA 2PL3A 1JXOA 4DWJA 4OHXA 5L3SB 2GEDA 4IDOA 2ZVQX 3THYB 1X6VA 4QBFA 5SZHB 3C41J 3IPYA 4A92A 2ZYVX 4XWKA 1RKBA 4JBWA 1LW7A 4A0GA 1Q3HA 2ZTSA 1R4AA 2BEKA 2R6FA 3KDSE 3E70C 3Q7PA 2WJIA 3AH8A 4B71A 1GFIA 1N6NA 4LJ6A 2OFWA 3TAUA 3W6OA 3REFA 4HSEA 3HR8A 2AXNA 2JDIA 4R2HA 1IM2A 2A2ZA 3IIJA 2MSEB 2H57A 1ZMXA 2O8FA 2XB4A 4Q9KA 1L2TA 3HU1A 4Q7LA 2CLSA 5CLQA 5GJVC 1F5NA 1I4LD 2XZLA 2BMJA 4HLCA 2R62A 2ZM5A 4OKSA 4W9MC 1R10A 1EWQA 4LYAA 3AF4A 1ZU5A 2XX3A 5TMPA 1W1WA 1XEXB 3U7HB 4CDGA 1NL3A 1UM8A 2R6CA 3C8UA 1P2VA 2J41A 1A2BA 4JSTA 1AKEA 2FZLA 5DHFA 1HQCA 2VF8A 1E94E 4B3CA 1W36D 3DOEA 1VDZA 2YV5A 1PLKA 5FL3A 2W6ID 2ORVA 1GRQA 2BKUA 1C1YA 2D7CA 4RJLA 4UNNA 4ZO4A 2G6BA 4E22A 2NZJA 1YHNA 4YMSA 4EPXA 1OHHA 3KQNA 1DBSA 1N5JA 1M34E 4A9AA 5FL7A 4A0HA 1W49A 1X86B 4UNSA 2QT0A 1IN5A 3ZVLA 1CRQA 1OH8A 2BBOA 2Q0HA 1T3HA 3LNCA 2VHQA 3U3RA 2RGXA 4NBSA 2FN4A 2CBZA 1G3MA 3SE0A 4FMDF 4DVGA 4D4LA 3K0CA 2IXFA 2ZI5A 2ODNA 4URWR 3AP2A 1XDBA 1G6OA 3CR7A 2UZIR 1D2MA 2P0EA 1OLOA 2NO0A 4NCKA 1BS1A 4NYIR 1XFAA 3G5UA 5D3MB 3UIEA 3LD9A 4BLOA 4DIDA 1N6HA 4GNKA 1XEXA 1JR6A 1NMZA 3I1FA 3QVVA 4NE2A 2QP4A 3KUCA 3I3SR 2V3CC 2BKEA 3TAHA 2GF0A 3QVUA 4JJKA 1GILA 4I99A 4QFMA 2N42A 2JLRA 3EZFA 4DKXA 5DE3A 1VKJA 2X77A 3ADDA 3CR8A 3VHXA 1ZM3A 3I92A 3MWYW 2G9NA 1MV5A 4I1SA 1VHLA 1FPMA 1GRNA 2VHUA 2QBYA 1DAMA 2XOKD 4B2IA 1E0JA 4JYCA 1GRRA 4RCYA 1KSJA 4TYNA 3LY5A 2QA5A 1G6HA 1F2TA 4BLQA 2VSFA 1NSFA 2GVZC 4G01B 1XMSA 3U4QB 1Z28A 2HLDA 3C5HA 2JLZA 2H5EA 4KCGA 3SFVA 5FH9A 1VCNA 3PVSA 3M4YA 3U7FB 2CXXA 4JLAA 2W2TA 2G0NA 1KIMA 3KXLA 4XD7A 2ZEJA 4DRZA 1ZP6A 4A0RA 5B58C 3F5FA 4BEBA 3DZ8A 4YDHB 3BH0A 4HUTA 1KDPA 2HXSA 2OBNA 5EZ5A 5G3ZA 1ZM2A 1BOFA 3CO5A 1G3QA 2GRJA 4MKIA 4POAA 1YZNA 3TMKA 2C8VA 1C9KA 3V4FA 4B34A 2B92A 2BEJA 4DC9A 3NHAA 1SKYE 4TZ0A 1NY6A 4Q48A 2CL0X 3GJ0A 1CR0A 4D2IA 4TT3D 1YR7A 5KSZA 2O8BB 1OFTA 4JT2A 1NBMD 2ZRAA 3VU9B 2VIIA 5CK4A 3K09C 4HLUC 2CK3A 3EZ6A 3LBHA 4JBYA 4TLBA 4D0NA 3H1TA 4HATA 2VQSA 4I1VA 2OCAA 3QKRA 1KMHB 2E1RA 2RGDA 4TL8A 3A1SA 4H1VA 1G20E 5IDVA 2JATA 3P26A 4B44A 2Q21A 2WOJA 5B30A 1ZD9A 1PVOA 2OXCA 1UKVY 3U60B 3EWSA 2RKOA 4ZDKA 5JMTA 1P7CA 4ON9A 1JB1A 3U3JA 1QHHA 1EFTA 4QBHA 4OK3A 4PC6A 4US1R 5JEEA 1OJLA 5JWRA 4OQLA 3I62A 3CZQA 4C2UA 1G4UR 2P67A 3W3AA 2WOOA 2F1RA 4MRPA 3RLFA 4LPSA 2PMKA 1CLUA 3GPLA 4Q4JB 3UXMA 2FGJA 3N70A 1NJGA 2WKPA 5J4VA 3PEVA 3R7WB 5L3QA 5JRZA 2J1LA 3KFVA 4NMMA 3GLIB 3ZH9B 2QM7A 4CGZA 3WRYC 5TY0A 2DY1A 1RFLA 2IEYA 2BJWA 2X2EA 3SN6A 5DNYB 4MKHA 1P62B 4OQXA 4DZZA 2J7PD 2QU8A 5BYJA 5FUWA 4TMXA 3NKVA 1E2JA 1ZVQA 2DFTA 2QPTA 4MKFA 3SC3A 3SDZA 1R6BX 5BYKA 2IYTA 4F4IA 1CR4A 3W8NA 1XJ0A 3NBXX 3QEOA 2OLKA 1BMFD 1W0JA 2ZSEA 4B2LA 3IHWA 4N1AA 4W5JA 3KKOA 1KMHA 4FN5A 2VHJA 3OIVA 5A0FA 4PQRA 4BZPA 3CRRA 5D3MA 1OF1A 3RRNA 4A8JA 5CLLA 5KOYA 4F7WA 5AWFC 2A9KA 3BK7A 3JVVA 3RSLA 3VU9A 4ZIRB 5JJLA 3RWOA 4FIDA 3ZJYA 4ESHA 5GADl 1E6CA 5TVKA 3LXRA 3OHMA 1E9SA 1VG0B 3KL4A 2YOGA 4YMUA 3ZS9A 2WMNB 4CEJB 1NLYA 3KZ1E 3HU2A 2ZYUX 4XOIA 2AK2A 3IUYA 2DB3A 1A1VA 1SKYB 4OI4A 1E3MA 1T0JB 1ZIPA 1CR2A 3NDPA 4ARZA 2NMVA 2ZU0C 1G41A 2NQ2C 1OKKD 2XZOA 4QM6A 2OAP1 4NYMQ 2IK8A 2VLIA 1VYTA 3MGCA 4D0GA 1JPNA 1JALA 1MR3F 4ZCLA 5TV2A 3GEIA 5J4YA 1L7VC 5LB4A 2IWHA 1JPJA 3TNFA 3K0FB 1EX7A 1XD9A 2ZYWX 4MGIR 1WBDA 1OXUA 4XSGA 4PHHA 4DBLC 1P5ZB 2WPDA 5JRJA 2DHRA 4C0AC 3NBFA 2C99A 1RYFA 1Q1ZA 5DYIA 4WIAA 4NU0A 4BLPA 4JVNA 2PBRA 4B43A 5DSZA 1LF0A 1CTQA 3Q5EA 5F3WB 5JZVA 2H18A 1S3GA 1JEEA 2DWOA 2IA5A 4EJSA 3E2IA 3QEJA 4O2LA 1LVGA 3DDCA 3UWOA 4DLTA 3A36A 1E2FA 2CK3D 2HF9A 1QHXA 3S1AB 2RGGA 1ANKA 4GFDA 2P2LA 2ZJ8A 5AJYA 4XSHA 4DLRA 3P4XA 3CZPA 4LBYA 1DARA 3ZZTA 1V5WA 2GILA 2ZSFA 2WKQA 1XCMA 5IRCD 4DHEA 1OH7A 4JLPA 5DN6A 5BQ5A 2QTHA 5KDOA 4D25A 4G1UC 1Q1EA 3RRMA 3IHLA 1XX6A 3QKSB 3TLXA 3VNUA 2ZJBA 4LK2A 2GEUA 2G88A 3IGFA 1QHYA 4B73A 2JJ2A 4RD1A 3K9GA 3CPHA 1WB9A 3RS2A 4Q4AB 1TUIA 4EPYA 1WF3A 2J0SA 4G0NA 1KSHA 1XZPA 1OIVA 5EXTA 4OBEA 5HKKD 1J7KA 4S35A 4XVRA 2CLDX 1SHZA 4Q1DA 3N2IA 4US2R 4HAWA 5LBIA 1DG3A 3QOFA 5JLJA 1NMXA 1UEJA 5FBRB 4L15A 1TL7C 5BWMA 3GEHA 4DXAA 1ZU4A 3EC2A 1S4QA 4RVCA 5EP1A 1Z5ZA 4GZLA 5E7MA 4DUGA 1NJFA 1YR9A 1OYWA 2P6UA 4FD2A 1E79A 4US0R 3CM0A 4AKEA 1ZNWA 5FUVA 2ZRCA 5SZJA 5AUNB 2BVNA 1NG1A 5KPJA 3D7MA 1UF9A 2GAOA 4IFEA 4P0TA 1E2LA 4IW3B 3RYTC 3ZZ0A 4A36A 4EQ6B 3B85A 2VP0A 2WSSD 1XRJA 4IEIA 4PO9A 2GF9A 3QXSA 3KX2A 3IPXA 3RDPA 4HDQB 1E9EA 4YQFA 3KUDA 1ZJ6A 3RS0A 2KBFA 5L3VA 4IDNA 2O0KA 1KI6A 1NN0A 1X1RA 1W48A 2KBEA 2ZI6A 3I73A 2BMFA 2J46A 3NTUA 1E2MA 1G1MA 3KB1A 3RC8A 1P4SA 2F9MA 4AK9A 2X19A 1AIPA 4KAXA 3ZQJA 4DSNA 4TT3A 2BMEA 1R0XA 2HCBA 3OAAA 4PO1A 5JWHA 4BFXA 4C3ZA 4DCSA 1GKIA 1W0KD 5FR1A 4BLSA 1XCGB 3A58B 2RGCA 3A4MA 3QJYA 2FSIA 2W58A 3TK1A 1KGDA 3ZD6A 2NG1A 4QBIA 2XXAB 2NPFA 5JEDA 2AWOA 3TUIC 2FSHA 3HU3A 1UBGA 1HA3A 3GP8A 1DO0A 3T1OA 4K8OA 4F38A 4LZZA 2ZSAA 1HE1C 1XJQA 1XEWX 3EXAA 3R20A 4A2QA 3EPJA 1CEEA 4OI1A 5LD2B 1TX4B 4KO8A 2ZJ5A 4Q9IA 4Q4HA 4LV8B 5KYKA 2RGNA 1KO1A 3FMOB 4JS0A 4V0NA 4P4UA 5UKDA 2VP9A 4PO8A 1JQJC 2N46A 1D6JA 1N6RA 3BOSA 4A1FA 5HCNA 3FYHA 3AVQA 2KB0A 2NO1A 3KXKA 4M9SA 4LJ5A 3JZMA 2AL7A 2Z6VA 1ZM4A 1FP6A 1FP7A 1P2SA 1N6PA 4PZZA 2OBLA 4JLOA 4AIIA 3BC1A 1G3RA 3AKDA 1I4DD 2AK3A 1VECA 3LDAA 4LGMA 2CJWB 2Z5FA 1YE8A 2YINC 4FXPA 4DEYA 1IY2A 1HE8B 1G8GA 2ZRMA 3CF0A 3I8SA 5D3QA 1A82A 2CNWD 2OCPA 3JZAA 1DVRA 3IQWA 1WE2A 5H1YA 3O8RA 2R2AA 1NKTA 1L4YA 3SJBA 1RVDA 3RSOA 3HYRA 2BM0A 1GNRA 1RPZA 1TAGA 3NHBA 2QT1A 5C2JB 2O8CA 4A0FA 5AUOB 1W44A 5BN4A 1E2IA 3EIHA 1EFHA 4URXR 3T12A 1E0KA 4NDZA 2QSZA 3FOZA 4TN1A 1VG9B 1N5KA 4MYTA 4B3GA 4QGFA 4QJ3A 2AWNA 1OV4A 5CIWA 1EGAA 4BUJA 2GJ8A 4R98A 1OH5A 2O8FB 4RD6A 4DB4A 2D2EA 1VIYA 3M0EA 3ECCA 2UZ3A 3CKLA 4BPBA 1ODFA 1ETUA 4C30A 3OE7D 1AZSC 2EYUA 3BWDD 2LCFA 2OE2A 3B5JA 1Q21A 3KKMA 3TSWA 2JLXA 4IOJA 2FFBA 2DCUA 4WAUA 4GL2A 2IWRA 1Z6TA 1KI6B 2I4IA 2ORIA 4TLCA 5DIFA 3NC1C 1GKYA 3QQ5A 1PUIA 3NIBA 3QXXA 2VL7A 2RGNC 3KKNA 2B7CA 4NYJQ 4QGHA 4OHWA 3T5DA 3AVVA 3KJIA 1GOTA 3ZS8A 2D3WA 1YZKA 1Q1BA 2WPDD 1G3UA 1E2EA 2GZHA 2HXYA 4LOAA 4QHYA 4WZBE 1JEDA 3GJ7A 3PUWA 1OH6A 4W5WA 4UXJA 1ZM9A 2GDJA 4C0BA 2HT1A 5FTNA 3NH6A 1COWA 2JIZA 4V03A 4ZKEA 4X8HA 3K70D 1NN3A 3DKVA 1W47A 2WIAA 2VHCA 2MSDB 1OXTA 3AM1A 1KJZA 1G19A 1UBCA 2ZRBA 4HZIA 2OESA 2J7PA 2JLVA 1R8SA 2CL7X 2CHVA 5FBLB 5KNDA 2V55B 3A1TA 3EPHA 3FMIA 5CJPA 4JLDA 1G17A 5GJWC 2NTYC 4HEJA 1X8JA 5JBQA 1M7GA 3PV0A 2GCOA 1AQYA 2BBSA 2CL6X 4TTRA 1TU3A 2RH5A 2UKDA 3CONA 2BHRA 2LKCA 3K9NA 3LBNA 1JR3E 1Z0DA 4ASUA 2CVHA 4YMWA 1KTVA 4B6EA 2FSGA 2WM9B 4G3XA 4BFWA 4MDEA 5FOWA 1P9RA 4FI3C 1O3YA 2VP2A 3NVAA 2NO6A 2WWGA 3L0SA 3C4JA 4H9GA 3W5IA 1XTIA 4ESVA 4A2WA 1P72A 3KJEA 3RWMB 5CB8A 4M1KA 3WBKA 2WIBA 4MYHA 5KNBA 4DB2A 2BIFA 2FE4A 4C0HA 1NI3A 2AD5A 3X1WA 4U00A 3RS4A 4U7DA 2FEOA 2O0HA 3THWB 1D2NA 3DKPA 4TQAA 5JCPA 4GOJA 2REOA 4C0JA 5C4MA 1TU4A 2C2HA 2IHBA 2Y8EA 3KJHA 2WWYA 4C4PA 4CEIB 1QVAA 4L8GA 1JNYA 4LBWA 5HPYB 4CT4B 3ICEA 2EWVA 3FE2A 1D8TA 2OCYC 2GA8A 4MQBA 2ZRKA 4TQUS 3SYNA 3AKEA 4E03A 3U6BA 2ZYTX 4UQOA 5CJ2A 1T3SA 3VX4A 4TYQA 4IDQA 1S0UA 1K8RA 2ZJAA 3TGPA 5C18A 1OXSC 2ODWA 1Y3AA 4CW7A 3LX5A 1MRSA 2HV8A 3A8TA 3JVUA 2ZE7A 1SVIA 3EWAA 4PZLA 3ZLJA 4M9ZA 2PEYA 4WXRA 1G8HA 4D4JA 1P75A 5M04A 3CIOA 5E3HA 5C46F 5HE9A 3BB3A 3C14C 5B57C 3ADCA 2DFKB 5K8LA 1Q12A 1LNZA 2R65A 2VPPA 4RFSA 4DCTA 2V6IA 3IILA 2ZE6A 3I4LA 1Z29A 3FHTA 2MMCA 2VP6A 2Q9AA 1S96A 1SXJA 2H8KA 1P60A 3FB4A 2JJ1A 5IF9A 1IY1A 1XXHB 2L0XA 3CUEF 4GT1A 1KDOA 4LYFA 4PSKA 2A5FA 1II8B 2WWIA 3CNOA 1KNQA 2YC4C 2YYZA 4FCTA 4Z8XA 4PR0A 2IYLD 3HDTA 4CEHB 2OAQ1 3CW2A 2GETA 4FINA 5EUQB 2AX4A 4EFLA 4A8JB 4LY6A 2GBLC 1E0SA 4E07A 3W5JA 5DH9A 3WMGA 2KJQA 1US8B 4GP6A 2NPIA 3P1JA 1JAHA 4DLZA 5BW8A 4R2IA 3B78A 3BD9A 4OL0A 3AV0B 2AR7A 1ZM7A 2HF8A 2IHYA 2IYQA 1Q1QA 2QMEA 4M1MA 5P21A 2QENA 2ZE5A 1IXSB 1KO4A 4W7SA 4UJ3A 1VG1A 1EWRA 1UDXA 1G21E 2OILA 4XJXA 1Z0JA 1TQ6A 2CCGA 1AA9A 3IIMA 3Q9LA 3TJZA 4ZV4A 1ZW6A 3NH9A 4XVUA 1E4YA 2FU5C 3BE4A 1NVUQ 1X8LA 3TUJC 1U8YA 1FFHA 3TKLA 1U8AA 2Q3FA 2YOFA 4CEHA 1KO7A 1W4AA 2RMKA 3MLEA 3R9XA 4WZ6A 2FSFA 3CF6R 1Z06A 3ZVRA 1II8A 5LPNA 1YRAA 2YWHA 2CJWA 1MOZA 3CRVA 1XXHA 1DAHA 1BYIA 2RCNA 4PSAA 1QG2A 2E87A 4V0LA 5JWOA 1IOZA 3OIUA 1CR1A 1Q20A 2Q9CA 1OYYA 3F3YA 2JAQA 1E2GA 1W0JD 2ZRNA 3HR7A 4IKEA 2BCJQ 4G5RA 4Q7JB 3QE0A 5KUTA 1HV8A 3K70B 4QM7A 4TZ6A 3I72A 3Q72A 4HB0A 5KO2A 1RJ9A 2ZITA 3TUZC 2WWFA 4M4SA 1UAAA 3TVTA 1S9DA 2NZ8A 4LI0A 3BAFA 1KO5A 1YR8A 1NN1A 2BC9A 2BOVA 3QXJA 1SXJE 3AVWA 2FOLA 4Q19A 1G5PA 3QKTA 4HI0E 5LDDC 4LJ9A 1E9RA 1VMAA 3FPAA 1SVSA 1OKKA 2DWPA 3K9LA 1R2QA 2G77B 2XJ4A 3EARA 3TH5A 4Q4HB 2WV9A 2ZS9A 5H70A 2JGNA 3FKSD 4OJKA 2C9CA 3X1ZA 1HT1E 4B3XA 3K0EA 521PA 3IO5A 4F93B 4AI6A 1PLLA 2JJ1D 4AD8A 2LWIA 3WHKA 5CM8B 3GLFB 1W5SA 4I1OA 2AFHE 3BORA 3TBKA 3DL0A 3IQXA 5C1BA 1XD2B 3BGWA 2WZQA 3SR0A 4Q03A 4RSGA 2B21A 4JZKA 5C4GB 621PA 3FWYA 5G41A 2XEXA 2DPXA 2XXAA 1S8FA 3AKYA 3HYTA 4PFSA 2NOAA 1K5DA 2X8AA 4ERNA 2LKDA 1SQ5A 1J8YF 2W0MA 2ZRLA 4FMDB 1D9ZA 1DS6A 3PUZA 4BFSA 4N0DA 2D7DA 2ZUCA 3LQRA 1KJWA 4U02A 2PCJA 3UG6A 1W2HA 1DELA 2J0VA 3QKSA 4O0MA 4M2LA 3A4LA 1NVVQ 4QBGB 4M9XA 2PZEA 4QRHA 3LVRE 3SJCA 1IBRA 4KSBA 1Z0AA 2REBA 1MKYA 2ZR0A 5TARA 2IS4A 1OXVA 4Q47A 2WJVA 1LV7A 2Z43A 4LWZA 2GTPA 1MABB 1XD2A 3H0KA 2ZREA 5JCZA 2ORWA 2O52A 4BZQA 4Y0VA 3I5YA 4RFVA 3SYKA 3VR6A 2IF2A 3DM9B 1XD8A 4OK5A 1LFDB 4B47A 3REGA 4AC9A 3QKRB 4LC1A 1L8QA 3ND9A 3LXXA 1A7JA 4LUCA 2CLCX 2V54A 2F3TA 5BN5A 4GOKA 4MRNA 1ZYUA 2Q9BA 3I32A 1S9HA 2PLRA 4NCNA 2QRZA 1NRJB 4KU4A 2XOKA 1FNNA 4QJ4A 1P2UA 4MGZR 3OF5A 3TSZA 5DN6D 3P4YA 5HZHA 3OIWA 1E2PA 5E7IA 2O8DB 3PFIA 1IONA 1K6MA 3L0OA 3PEUA 3QNUA 1NLZA 4TMKA 3SFZA 3W90A 3WP0A 1E98A 2XNDA 3E1SA 1T91A 1HTWA 2XB2A 5FI1B 4NCJA 2NIPA 4Q4AA 3QF4A 3D3QA 2FZ4A 1P73A 4LHVA 3H86A 5A5GA 1ZD8A 2WSMA 1U90A 2AKYA 2GXAA 2RGEA 2RHDA 3D6TB 3UMFA 1TTTA 2D06A 3VR1A 1U8ZA 2QGNA 2C9OA 4TMTA 2QQEA 2UVQA 1FL9A 2WWHA 4ZDJA 3T15A 4ACBA 1BO6A 2ANCA 2H92A 2ZRDA 4KLZA 4BRWA 4ILEA 2HLDD 1RRGA 4P4SA 4PPFA 4C9BA 1DAGA 2GESA 5JHHB 1JR3A 2O8EB 3KJGA 4AKGA 5G3YA 5IT5A 3TIFA 4HAVA 3B82A 1E99A 2C98A 2BWJA 1ESNA 4C7OB 4DT1A 4EAQA 2CCKA 3K0CC 1WXQA 2QORA 3AGQA 3ZD7A 4CZ2A 1ZUIA 2MSCB 5FBWB 3P32A 1G5RA 4E5UA 2QY9A 2VEDA 4HDCA 4LHYA 3CH5A 2B8TA 5SZKB 3WYGA 4X8OA 1VHTA 4KVGA 3R7WA 3VKWA 3WMFA 3CRW1 1ZRHA 1Q57A 4NPHA 2CE2X 2JCSA 3RRYA 1W2GA 1RJ9B 2YVUA 5LD2C 1SXJD 2XITA 2C78A 4DDUA 3RABA 2GBLA 4AKIA 4M1WA 1XTSA 5EE9A 1EX6A 4ARZB 1TQ2A 5HZKA 4C2TA 4HAUA 1JQLB 1G7SA 2AN9A 1T0HB 4HUQB 2C04A 4OHVA 2EFEB 1JECA 3RVBA 1T3LA 3WBJA 1ZUNB 2FFHA 1P9WA 1YJ5A 1BIFA 3GLFA 3AVUA 1NG9A 1YU9A 2A7QA 3CRQA 4LV6A 4B76A 4EJSC 1DAFA 2QI9C 2CEAA 3OFND 1KI2A 2CDNA 1ZD1A 1AS3A 4RZXA 1SVWA 1OSNA 4D0LB 2QUZA 2FF7A 3EASA 3EPLA 3QBTA 4FCVA 1XP8A 1I2MA 1Z2CA 2J3EA 4KYIB 2VP5A 3FDIA 4LBVA 3CLVA 3OEEA 3VKHA 3DM5A 3FHOA 3M1IA 3KXIA 3GLGA 1CJUC 2IYRA 1UFQA 1YQTA 4QNMA 1VCOA 1KSGA 2ODEA 2XSZA 3HJNA 1CXZA 3W9YA 4LDJA 3CX6A 3AF2A 3DVLA 1RIFA 3PUXA 5HKKA 3LVQE 4PHTA 2FWRA 2BBWA 1KY2A 4GDFA 4DLUA 1F48A 3ZYCA 1KZ7B 3I5XA 4Q4LA 4IHQA 4EDHA 4HAXA 1W36C 2GJ9A 4OYHA 3GLHA 2EFDB 2ZANA 5E95A 1Z6XA 1JJ7A 3THYA 3DOFA 3AUYA 1NMYA 1SXJB 2VHTA 1KI1A 2IUUA 4ZDWA 2R6GA 4NCIA 4LCBA 4XVQA 1BKDR 2CCJA 3EA0A 1G291 3EAQA 1N2CE 3BIFA 2FFAA 1GNPA 1AGPA 3QUSA 3K53A 4DSUA 3KQUA 2AFIE 2J7KA 1M74A 2ZRHA 3B1ZA 1RC8A 3FKSA 5F9HA 2V1UA 4BFZA 1YZTA 421PA 1U0HC 4GZMA 5KDLA 3H4MA 2ZPTX 1JJVA 3L8YA 2GXUA 3MJRA 1YVDA 4PHFA 5FOSA 1SZPA 4KFRA 4ZKDA 3VNVA 4ZI3A 3AF1A 5EP3A 2NO9A 3K8YA 4IXMA 2J5XA 5CM9C 2R9VA 2I1VB 3OEHA 4Y0AA 2PJRA 4IFBA 2GJAA 3TE6A 2JLWA 4PC2A 1NVVR 4UNRA 1XJCA 3I8XA 4CIDA 4PZYA 1CRPA 4BZXA 5FPSA 2I3BA 4DLYA 1XMVA 4JLJA 2JA1A 3GD7A 3KFXA 4CT5A 4H1UA 3TR5A 1S2MA 3NXSA 3W6PA 1P3JA 1Z83A 1MRNA 4U5XA 3B9PA 3SYLA 4YDSA 3RS7A 1N0WA 2GXSA 1FUKA 4M1OA 2YZ2A 2CHQA 4RCZA 1EFRD 2AD1A 1Y63A 3UANA 1OXXK 1YRBA 2V4ZA 4LC0A 1YR6A 3EC1A 4EPWA 1U9IC 3IBYA 4TQ9A 1AQUA 2EFGA 2YC2C 3ZVMA 1G3IA 1KK1A 1MO6A 4MKGA 1VCMA 1G16A 1TADA 1K5GA 5H68A 1UDWA 3SI7A 2G83A 3QPWA 4RD0A 1LTQA 4DT1B 4B33A 1IQPA 2HUPA 1IN6A 2ZRGA 2QM8A 3MUFA 4RZ2A 4KVAA 2PX0A 2X2FA 2ZETA 2OO7A 3CWQA 4Q02A 4KBGA 2K5UA 5KPDA 3A1UA 4LJAA 1WBBA 3THWA 4P4SB 4D26A 5A4JA 3H84A 5EE3A 2IYYA 4TTQA 3AVOA 4F4CA 1FX0A 1ZBDA 2F6RA 1Z0FA 1DAIA 3ASYA 1XBTA 4UXIA 1RRPA 3L43A 1EXMA 1KI3A 1A2KC 1ESMA 4IRUB 5HTKA 4ACAA 3T61A 1J90A 3B7GA 1KI7A 2F43B 4C0QC 1NBMA 3WNBA 4L16A 3VFDA 3T5GA 5L3SA 4MRRA 4JVMA 2WJGA 4ZCMA 1N0UA 3F8TA 2H7VA 3D8BA 4D4MA 4Z1MA 3KB2A 5DI3A 3MSXA 1G7TA 3MWLA 4G5OA 3U3MA 2QN6A 2ZSBA 3K9HA 4Q9JA 3EIQA 4CRWB 2QAGA 5JI2E 3B1YA 1KK3A 1Z63A 2A3RA 3SEAA 3SHWA 3SZRA 3GMTA 2BJVA 1JXMA 3LA6A 2WWXA 1D2EA 1W46A 1B0UA 4MRVA 3RS5A 1AKYA 1VCIA 3WHLA 1R5BA 4KFSA 5KNCA 3O47A 3C15C 2QE7A 2ZS7A 2J0UB 2XTZA 2A5JA 2ERXA 1VTKA 1G9XA 4KLNA 1CJVC 3GEEA 4TYWA 4EUNA 1M7HA 1WQ1R 1CIPA 2ZRFA 4LX0A 2REXB 5EUMA 3VR4A 1FQKA 1WCV1 3U2QA 1E32A 1T8TA 4B3BA 4A8JC 5FI0B 4PSVA 1G18A 1UKEA 4K81B 3SQXA 3N5CA 3GLIA 3ZGXA 5BN3A 3GLFE 1TMKA 1ZNZA 5L3QB 1R5NA 1AS2A 3QENA 1E96A 3QG1A 1JAIA 3PIRA 2OUKA 2KE5A 1AZTA 1SHKA 2J87A 1RYHA 1U2RA 1UEIA 4QGGA 3RRZA 3UMSA 4JBXA 2GJSA 2CE7A 3TW4A 2E9SA 2V1XA 1OIWA 3QKUA 1XPRA 3U3OA 4BFTA 5JHGB 1YZQA 4CF7A 4DLXA 3W6NA 5FUXA 1COWD 4B3DA 1AK2A 4MGKR 4URUR 5CDFE 5F9FA 4Q21A 3PENA 2P6RA 3IO3A 4RZ3A 3U3KA 4L5BA 2ZIAA 3FMPB 4HAYA 4LJYA 1HH4A 1T6NA 5FOVA 1AM4D 4XH9B 4EFNA 3BS4A 4D6PA 5B2ZA 1DEKA 2ZU6A 2D62A 3WYFA 3ZDQA 3AQ4A 3FKQA 3L0PA 3SBDA 1SXJC 1HQYE 3B1WA 3IIKA 4HB3A 2BV3A 4A2PA 1IN8A 4L9SA 3L0IB 4Q18A 2C77A 1WRBA 2ZI4A 2O8BA 3ONWA 4XTRA 4YXWA 3AKCA 3ZIAD 3NEJA 1GKUB 1Z6YA 1CF4A 3FHCB 4L9WA 3ZVNA 4DDVA 3LO5A 4TTPA 4BFYA 3QY0A 5LB2A 2FA9A 2H1LA 3MRSA 4LHWA 4FMBB 1KI4A 5AJXA 5B64A 1UADA 2QAGC 3SBEA 5FFMA 3GLIE 1I2DA 2OSBA 3WNCA 5HR5A 3A37A 2B6HA 2BCGY 5CK5A 1QG4A 4EFMA 4GMDA 1DE0A 2ATVA 1E4VA 5DISB 1CU1A 1N5LA 4A4DA 1FUUA 1FZQA 4NCHA 3O8DA 5AJZA 4EPTA 5KDDA 3M6AA 4GMXA 3UMRA 1E2NA 5FR2A 4UNQA 3VQTA 2FV8A 3CH4B 1OW3B 2VP4A 3LW7A 2OEPA 3NG1A 3B6EA 1HURA 4MYCA 5DHAA 3AP1A 3LQQA 4JL5A 1SVKA 2ZSDA 1KDTA 2H16A 2F1HA 3T1TA 2B8WA 2J45A 3ZQ6A 5G40A 4MDFA 4NZYA 2QNRA 3ADBA 4LHZA 4Q9LA 1XTKA 1BH2A 1M6NA 1E2QA 1U99A 3R9IA 2DR3A 1UBEA 2FDCA 2ZR9A 4WZAE 3WRXC 2IX3A 3LLUA 4WVFA 2EVWX 1KKLA 2W2XA 1XEFA 4MH0R 2QGZA 4OQMA 2WICA 5L3RA 1E9AA 4L4UA 2FX3A 1EK0A 2QPAA 3T06B 2QP3A 1OFUX 1ZIOA 3SHFA 2GEVA 4XD7D 221PA 3SS8A 3HP1A 4HYYA 4NYIQ 4R71A 3QXHA 2O0JA 2ZUDA 1FOEB 4TWZA 3KTAB 5EQTA 1E2DA 4JLMA 2ZROA 5ELXA 2XZPA 5J47A 2VTKA 1KO8A 5JS8A 3AGPA 2W6JD 1U9IA 3NDBB 3W34A 1PV4A 1GL7A 2FEMA 2G1KA 2ZAMA 1XPUA 4B3FX 1X8KA 4BGDA 5KTYA 4P33A 1X3SA 2RGAA 2YHSA 5TXGA 3OEHD 4EKDA 3MWJA 5CIQA 1Q22A 1SVOA 2VSOA 2OLJA 4OHZA 2IBMA 5H8WA 1DPFA 5ANRB 3CRMA 4A15A 2ZQ5A 1CBUA 4C0KA 1E69A 821PA 5FTKA 4Q1CA 3A1VA 4BFUA 5BXQC 2W00A 1R0WA 1EFCA 4JIMA 1KAOA 1NVWQ 5EXSA 2YKGA 5AR1A 1UKYA 1ZC4A 1GUAA 4KITB 2SHKA 1GAJA 2IYZA 4IOMA 5KSPA 2ASEA 2OCBA 1TPZA 5CITA 1KOFA 3S1AA 3AVPA 1QHSA 4PANA 3SJZA 3T35A 2PX3A 1H8ED 2OFXA 1QDEA 3MG9A 3V9PA 4EJSB 2FMXA 4YXWD 3GLGE 3GJXC 1OB2A 2HCJB 1P2TA 2WAYA 1E9BA 4LV5B 4Q7MB 2YWEA 4B35A 1SVLA 1Z0IA 4HAZA 1V43A 2X1VA 3OAAD 3PEWA 3R8FA 4CEIA 5AK0A 4FWIB 4PAQA 4I81A 5G53C 2GCPA 2C96A 1II0A 1N6LA 3J81k 2HJGA 1R7RA 1GNQA 4JKYA 5JSZA 2A5DA 4G5GA 1FQJA 3NBZC 5E7JA 3C16C 4B75A 5FPYA 1TF2A 4A82A 3K0AB 5CYPA 1AS0A 4CYMA 3X2SA 2VBCA 3SOPA 4TL9A 3MMPA 2PZGA 1KYIA 3GJ8A 5EP2A 3LFUA 4GSYA 1G7CA 2ZJOA 1IN4A 1KHTA 1J2JA 5EE0A 1Z07A 1DG1G 3C7KA 2WMOB 3HPRA 4QG7A 1A4RA 5FL7D 3PEYA 3E5HA 4II7A 3D31A 2ZRIA 4TYYA 1E1QD 1EESA 2DWQA 4W5HA 3GFPA 4IVRA 1GZSA 2ZE8A 2GXQA 2ZXUA 4Q01A 1E9CA 3ZZUA 3BH7A 4QJ5A 1NF3A 1SKQA 2CMKA 3UWKA 1PUJA 3PCRB 5FPKA 3RHFA 1MT0A 1MABA 5CYOA 1E1RA 4DCUA 1DOAA 4KYUA 2V7QD 4BEJA 2WVJA 1F60A 2P5SA 3DHWC 1NNEA 2QG6A 4BE7B 1KKMA 4XWOA 4AYXA 4NYJR 1PJRA 3OFNA 2IYXA 1GTVA 1CJTC 3Q7QA 1KK0A 4NTZA 1YZLA 4TMWA 1HYQA 2F55A 1W5TA 4P4TA 3PUVA 5J40A 2PCLA 4C0SA 2IC5A 4P32A 3CX8A 2ATXA 4ITRC 4FW9A 1GWNA 1ZCAA 2YWGA 2QAJA 1ZAKA 2BMDA 1Q3TA 2WHXA 3TRFA 1UJ2A 1JBKA 2GK7A 1B23P 1XZQA 2WKRA 2FGKA 2R6AA 3BERA 1FX0B 2JASA 3THOA 1P61B 5FOXA 1OPXA 4M0LA 5KSYA 3GLGB 1OFIA 1QHHB 1TF5A 2GZDA 1W36B 1X1SA 3ZIAA 2KI5A 3C5CA 2FH5B 2RAPA 3AP3A 5IHPA 1W0KA 2GCNA 3G82C 2FFQA 4UNPA 5KSOA 1RRFA 4MITA 4TSFA 2Q3HA 4D80A 2O8CB 1Z08A 4A6XA 1T8UA 1KAGA 2WWWA 2B7BA 4A6PA 4DIEA 1UBFA 1MO4A 4PPGA 2A78A 3L2OB 3CNNA 4NH0A 3RAPR 4YONB 3T1VA 2ZI3A 4IJMA 8OHMA 1OB5A 2QMOA 1NY5A 721PA 3LRPA 1H8EA 2Z4SA 2WSSA 3NWJA 4JLNA 4GRAA 1U0LA 3W3ZB 5KU1A 4FCWA 3GFOA 1YZUA 4ASUD 2GKSA 4WBSA 3QF7A 4TLAA 2WBLC 2IS6A 1NBME 2VF7A 4MA4A 3U7GA 2J9RA 5FTMA 2Q6TA 2A30A 1WP9A 4Q7KA 2BBTA 3IBGA 2Z0MA 4Q1EA 4PAOA 3UG7A 3V4RA 4PHGA 1LF5A 1S3SA 1XB2A 4MRSA 4URYR 3VKGA 4DUGD 4LPKA 3LV8A 4GP7A 3VAAA 3THXA 1KSFX 2TMKA 1M7BA 2QROA 1XMJA 4O3MA 5GJCA 5FTLA 5J4LA 1LS6A 2ZRPA 1HY3A 3LAWA 4KBFA 3GJ5A 4X8LA 4XWAA 3FFBA 1EFUA 1VIAA 4K46A 4D81A 4Z51A 4ZIRA 3UPUA 4RZUA 5F98A 1GG2A 2XNDD 1NIJA 1BMFA 2ZJZA 4I4LA 2RGBA 1E0AA 3DMNA 4TMZA 2BM1A 2MMGA 2QZ4A 3EG5A 3EZ9A 5AJVB 3AUXA 4DSTA 4TLEA 2IYSA 4QXAA 1U81A 2A5YB 2P65A 1US8A 4NONA 2QTFA 4PC1A 3U44A 3DEFA 4RD4A 1N5IA 5EXPA 1C4OA 2IYWA 2QMHA 5FOUA 4NKRA 2AHOA 2QQ0A 1OHHD 6Q21A 1XTQA 2ZR7A 4YMVA 2D4HA 3K0AA 1F3OA 1IXRC 2PMDA 2JDID 4LYHA 1U0JA 1E1RD 1E9FA 4QC2A 2J0QA 3MCAA 3IEUA 1NIPA 3EX7C 3AVXA 5HCIA 3V00A 2G3YA 1XTRA 2ZAOA 4AYTA 3LW8A 3RC3A 2D2FA 2RHMA 4G5QA 2XNSA 4KHZA 4IOKA 1G4AE 1ELOA 3GLHE 4HZUA 2F9LA 4PXAA 4PAMA 4NL4H 2F1IA 1QBKC 1EFRA 2P3SA 3BFXA 5HE8A 1N6IA 2FG5A 4P3YA 2GCOB 4AURA 4RKEA 4Z54A 4HDOB 1R8QA 4KFTA 4JYBA 2CNWA 4LJ4A 1U98A 5FBQB 1FW6A 2IXEA 5J4HA 2G1JA 4Q1BA 4JL6A 4D82A 2OFOA 3P20A 3RS3A 1Q44A 3B1VA 1ZINA 3L82B 3X1DA 1G8PA 2JJ2D 3GQBA 1D5CA 4Z1MD 1TUEA 3BB4A 1P6XA 2C03A 1P9NA 1JR3D 5DI9A 3VR5A 3KQKA 2KWIA 2XSZD 3O8BA 4RD2A 4YMTA 1GSIA 5FPHA 1M1YE 4AG6A 2IUSA 5F2EA 3PUYA 3VTKA 1XMIA 2IUTA 4QHTA 5EP4A 1OIXA 3BFVA 2Z83A 4ZDIA 1VYUA 2ZI9A 3THXB 3B9QA 2EFHB 2QEQA 2WJYA 4KV9A 4NYMR 5GVRA 4BLTA 2WJHA 2R6DA 1N6KA 2VSXA 4YC7A 4IDHA 3A1WA 1WA5A 1KJYA 3GCGA 3VR3A 4DLSA 2OHFA 1T5LA 2QE7D 3P27A 2F3RA 1IJEA 2GHIA 2ZRJA 3T34A 3NEYA 4GPTA 2GAAA 2FPMA 1F2TB 3LLMA 2JEOA 1DADA 1ZNYA 4PQYA 4GI7A 2YWFA 2IEZA 2ZJ2A 2QBYB 1WMSA 3LH5A 3OZXA 3QBVA 4ZCIA 1LS1A 2IT1A 1U94A 3U44B 5GJBA 1MH1A 1OE0A 2EU8A 1QF9A 1Z2AA 3SU8A 1QZXA 4C7OA 2J0UA 1XU4A 1IY0A 3W8RA 1UKZA 1YKSA 1S1CA 4JMPA 2W0SA 2DYKA 4FMCB 1HEIA 4JJZA 1KZGB 2HJVA 3KQHA 1PLJA 3MJHA 2RB4A
chains in the Genus database with same CATH superfamily
1DUIA 5JDCC 1N25A 3EA5A 3RPEA 1JHAA 3VAYA 1XU7A 2PT7A 1RHUA 4YAKA 3HUEA 3K71B 2D1QA 3F3SA 3DHEA 2QAGB 4NAUA 3GCXA 1G8YA 5DULA 1RABA 4HDNB 1KVUA 3NUQA 3PR1A 1ZMBA 2I8AA 1B93A 1SUBA 1A5BB 3R76A 1II9A 2JJ8A 1SVMA 2IL1A 1ZI9A 2XYHA 4AX4A 1BQ4A 2HMYB 2BDTA 3DMDA 2BGRA 3ZXSA 1AB6A 4E4RA 4JKIA 2O3SA 4KAFA 1GGHA 5JDIC 3GDHA 2Z5GA 2GO7A 1JDZA 4AY2A 1TAQA 3B8EA 1LSOA 3AJRA 3PJFA 1GCAA 1KY3A 4E6PA 5AUPB 4FGLA 1ADGA 2Q6VA 3IDQA 3LQFA 4J0QA 2XUPA 4CL0A 1QPBA 1DAEA 1TKBA 4M9RA 3BMXA 4HFMA 4M0MA 3MBOA 3VMFA 3V32A 3E53A 1SUCA 2Q7XA 4QUHA 3WWEA 4UW9A 1J22A 1MC8A 1U2GA 3NORA 3GAAA 1XOIA 4MW4A 4YBZA 1L5KA 4F92B 2V7QA 4Z2YA 1MB0A 5DO9A 4BLRA 4GOXA 3WWZA 3WAJA 1IXZA 1M0WA 1EJ2A 4X92A 4ZT5A 5CD1A 2GAFA 1ZR4A 4ZVQA 4XVHA 3T0FA 3DW3X 4ZXFA 1KYWA 2VHZA 3PIDA 1P1FA 3NIFB 4DJFC 1CUAA 4FFBA 5CURA 1L6RA 1V2GA 3QPCA 1U1EA 2ZUBA 2ADMA 2VH5R 4F97A 2QUBA 1X80A 1U5AA 3SZOA 2HPZA 1BJRE 3FMFA 5EA2A 4KIGA 3Q8XB 3JQ7B 5EKUA 4EO4A 2F8MA 3K8QA 4DJAA 3WYAA 4HD8A 4Z8YA 5JYEA 4G26A 4AO7A 1I3KA 3QV2A 3K09A 4G1CA 4QPCA 4MYUA 4B80A 2VYFA 1GL9B 3ET4A 3L8ZA 4IKOA 2VBGA 4ZYYA 1S2LA 1AB5A 2DKNA 5SZIA 3EXEB 2V6GA 3DLBA 4UTZA 4Q1VA 1A9QA 2MDTA 1P1HA 1AGXA 5J4KA 4G1EB 2HEIA 1XYVA 2WM3A 3WLFA 3DD1A 3FGNA 1XMXA 4I19A 3LPLA 1W5EA 3GJ3A 4M87A 1KPIA 1G7RA 2XA2A 4GMHA 3Q1KA 1ZCFA 1AJEA 2ECFA 5FV7A 2J3HA 2ZT6A 3R09A 5HM8A 4DEVA 1CWUA 1VG8A 1GQQA 4OP3A 3AR5A 3SXUA 1KY5A 4FS3A 1SGWA 4JSRA 5HEKA 4WZAA 4HPXB 4TYPA 1NW4A 2EZTA 1AV7A 2AUMA 2OBBA 3MUOA 4FZ5A 2W11A 3QU2A 5FA6A 3EEQA 3SBXA 3U40A 2G36A 4B2YA 4OQNA 4ZK6A 3D0OA 4WQMA 5HZMA 1QHNA 1U2GC 5IT9A 3DYBA 3NWOA 4PQEA 3EGDB 5JJBA 3ZH2A 3WLOA 1CSEE 3BJIC 4D3SA 3PNYA 4NJEA 1JQBA 2W83A 3O0TA 1KI9A 4HEQA 4LVNA 1UJMA 4EKEA 2RAVA 4GI5A 3QPUA 3SMVA 4XIGS 2O2HA 4MPDA 1U1DA 1SUIA 2I2CA 3HGMA 3FVQA 3IHKA 3PFFA 1PU2A 2XMSA 3GN1A 4W82A 5G0SA 1G0OA 3CEAA 4DMHA 1SO8A 2B0JA 2QQGA 3KBBA 4BNTA 5ES4B 4OATA 2E37A 2R44A 3P9ZA 3HNRA 2NGRA 3W1WA 1A76A 2ZJ3A 2ZWOA 2EQBA 2I4OA 1NRXA 2QE6A 4DA6A 4EF4A 4EHDA 2IVFA 4F9GA 5JECA 1W4CA 4PTZA 4FEGA 4TVBA 3SNHA 4QD3A 1LDGA 3ZZNA 1Q17A 4C3UA 4QHSA 4OSPA 5KYWA 5T7BA 3KZCA 5AHOA 1HX7A 4Z9YA 4PGGA 3WNZA 3OCXA 2XQGA 2WB4A 2W6IA 2ZBEA 4K26A 4M8IA 4OD0A 5DLYA 4EHAA 3ELBA 5K0JA 1RD4A 3FRHA 3PRHA 2OENG 3OQVA 3OQ1A 4C03A 4EMBA 3HB4X 1ZOLA 3BREA 1GPYA 4BWYA 4ZEVA 1XNGA 2EOAA 3CLRD 2PY6A 4FDLA 4OJQA 5EWLB 1VC2A 1ZSYA 2JIZD 3S0JA 4ENQA 2ZIGA 4URZR 3ZKWB 4WXPA 4X91A 2FX5A 1GPMA 3FF4A 1TK9A 5IAOA 4YV0A 1RZ3A 2HYDA 3OFVA 4UC0A 5DB4A 1ECBA 1TZKA 2HLNA 4X6XA 2FSVA 3HCCA 5F78A 5IC4A 4XB1A 4ZV9A 4D9CA 1M2OA 5IWCA 3WYCA 4C78A 3MT7A 4NK4A 3WLMA 1DO2A 2FVXA 3HK2A 4JDUA 4LRWA 3HUDA 4BJ5A 1VSUA 4IIEA 4O1HA 3UKDA 3CG4A 4JGIA 3GAFA 3KU1A 1J33A 3GU3A 3VHXB 3CNHA 2ANBA 1Y8AA 5AVZA 3EMVA 1E6KA 3AF0A 4S0XA 2G17A 4QTYA 1GVNB 4PC7A 1S3FA 1J9ZA 4EG7A 3A1DA 3H2JA 3OEED 4P0PB 4BNGA 3EEYA 4JFRA 3VOTA 3K6JA 3FY4A 5C4IA 3D7KA 5DNWA 2EERA 2JI7A 1CNFA 1RYMA 4WY8A 2WILA 3SJAA 4N5IX 5KHAA 2ZJYA 1H0SA 2QMUA 2UVPA 3AUKA 5E4FA 1G59A 4R1MA 4H7FA 3AEKA 2GVDC 1HFEL 1PZFA 2CUZA 1AU9A 2MINB 4HLQB 3QI7A 1UBLS 2G06A 1Z5VA 4Q34A 3RK1A 5CB6A 1VPTA 4E22A 1CP2A 5HS6A 4G67A 5E4JA 1XAIA 3E9MA 3D0KA 4ZO8A 1T8PA 3IS3A 1JU3A 1LNSA 3JQCA 5AUQA 4BO6A 5FTJA 4O2RA 4JI5B 3YASA 1GIAA 2OO5A 2W2VA 2NNLD 1TNDA 4GHWA 3AW8A 1TZCA 1WD7A 5A6SA 4UKDA 4P84A 1MGPA 1JSXA 3QLUA 4D56A 2QTWB 1J00A 2B94A 2Y4OA 3ILVA 4JA0A 4R3NA 3D3EA 3LBAA 3A11A 5GQSA 4UM9B 1IZYA 2G76A 3O94A 3KZNA 4QVIA 2AI1A 3H1AA 3KPVA 3NW9A 2WFLB 3DPUA 5JAUA 1GZ3A 3AEZA 3UATA 2Y05A 4F3RA 5FBVB 3IRUA 1LWOA 6GPBA 5AM0A 4TS1A 4OHPA 5DSTA 3X3HA 2LNDA 3VO2A 4URVR 2KSQA 5BSVA 1UWLA 4TSKA 3I8OA 4LF4B 4AUKA 1T8SA 3H9QA 4AZ0B 1L4UA 1Z2OX 3KOMA 1X1CA 4F04A 2Z95A 3G17A 3LWNA 1CJKC 2GK3A 4KI0A 1A9XB 4QSMA 3W9SA 4D5GA 4S2EA 4GPEA 3STHA 1RAGA 2W70A 2XDWA 3HZRA 1AXRA 2D74A 3HRHA 3P0JA 5AJWA 1Y6QA 3FLAA 5LXTF 3W8EA 3ROMA 5KHOC 2OR3A 4OI0A 1OLXA 1TEVA 3MFYA 4N8SA 1ORWA 3G9QA 1GQ2A 3ETLA 4RK6A 3G0OA 4GPBA 3HP7A 2I1WA 1NP6A 1OILA 2W6JA 1E2HA 1RXSA 2EFJA 3FPHA 3BWYA 4RXTA 1WDMA 1XR3A 5KWIA 1M8PA 2FRVA 3PHGA 2H1VA 4JVLA 1BJTA 3A4NA 4IQ4A 1YQDA 3NV7A 2HQ1A 2XMRA 1K66A 4XQEA 2PRYA 3M5PA 1HRKA 2C94A 1Y3DE 3NAGA 3GGCA 4FUTA 3GBPA 5K3BA 1T36B 4MIOA 3JWHA 1U7HA 3FCXA 1N2ZA 3C0KA 3IFSA 4Y18A 5DLQC 4JD5A 1I1QB 4X65B 2R0QC 5C7OO 2NUBA 1EVIA 3QHAA 3ZXIA 1IXYA 4WOJA 3MSCA 1JHQA 2R11A 1D4OA 3A27A 1P39A 3HY4A 3LCCA 5DOVA 3V42A 3DTVA 5D5HA 2OV6A 1MX9A 4L5AA 2Q3MA 1TQDA 121PA 2F8SA 2OFPA 4FILA 4ZU6X 5CCBA 2O5VA 3KSBC 1JWAB 1PZNA 1QNFA 3G2KA 4YFVA 4ZT7A 1O6CA 2EBWA 4LQDA 1OT3A 2HRDA 4BASA 5IABA 4IMRA 1I13A 1EVLA 4UHKA 1I10A 4PLWA 2QR5A 1A0OA 1O94C 1J2UA 1ATZA 2VEOA 1U9CA 3D6MA 4ITUA 1SBHA 2EFCB 3VGPA 5A05A 4C76A 1E59A 1DRVA 1GGFA 1OY1A 3QEMB 2DT8A 3LX8A 4MQEB 4NV0A 4Z9XA 1E6WA 3ILXA 4UD6A 1IATA 2AZ4A 3KKQA 1AN9A 3KC2A 3LX4A 4I9GA 2BJHA 4N0PA 4WSOA 2PEZA 5BOVA 2OZEA 1U0NA 3TW8B 3URKA 3ZGLA 4IVPA 2AN4A 3D6UA 4MS3A 2WY2D 4WZZA 2WAOA 1RLTA 2JCBA 2A9RA 4LF5B 2QUHA 1GM5A 3LHFA 1H9AA 5D01A 3DEKA 4LOIA 3B7PA 2EEPA 2FKNA 3J81A 1PV1A 2HDHA 2P5TB 5LXTB 2VHWA 3RSZA 4QL3A 3SS9X 2LTAA 1DFGA 3LLCA 4J1TC 2ZUTA 5J2UB 4ETNA 3RUFA 3JWPA 5L3SB 3D3NA 2NTEA 3NX4A 5EJIA 2GEDA 2I54A 4IV0A 3THYB 4Y1FA 1X6VA 1IEQA 4MW2A 4QBFA 5SZHB 5MHTA 2ZYVX 1FXWF 3G2OA 1X1QA 2GN1A 2LCIA 3Q9UA 4JXKA 2SCUB 1RKBA 4JBIA 2RIRA 1THZA 3B3QA 4MS1A 4X1IB 2CF6A 5D00A 1GNVA 3QELA 1XJ5A 4YCSA 4L76A 4WLVA 2BEKA 2R6FA 3Q7PA 1F38A 1T4MA 3T99A 4CL3A 5A3JA 5HS4A 4W7IA 2IKQA 3T3GA 2YYSA 4JJGA 2JFYA 4MLDA 3U56A 3Q3GE 2JDIA 2CLKB 1N8NA 2A2ZA 3T9DA 4GX5A 1EFDN 5D6NA 3B89A 2O8FA 2A58A 4Q9KA 3OO0A 1M5UA 3HN2A 3L0DA 4XW2A 1F5NA 2IEDA 4TKLA 1I4LD 1UM9B 4I5GA 5EMNA 4MAMA 3F47A 3K5PA 4O4IB 1ETHA 1RT9A 2P78A 5KQPA 1QP4A 3RSCA 4RZIA 1R10A 5TQJA 4DFDA 1OZHA 3AF4A 4CIWA 3HKDA 1BVRA 1G8SA 3SMQA 4EI7A 1HDXA 3HJHA 3CNQS 2GLTA 3M6FA 3O4IA 1PW7A 1BXGB 4DIMA 3OQNA 3I6QA 1YZHA 2PO5A 1HQCA 3OUTA 1W34A 4JCCA 3N0TA 2H65A 2OV1A 1YHZA 1YZYA 2NTVA 1U2ZA 3LUBA 4S1OA 4AF8A 4UVEA 5JXIA 2DHQA 3DOEA 3TEMA 1VDZA 3R23A 4LDNA 2ZBFA 3I6MA 4YS6A 3TL2A 1OASA 4RJLA 4MKZA 1FDOA 1AUXA 4YMSA 3SC2A 2FYTA 1E9VA 3DXFA 1CUSA 1H9CA 1X86B 4BEWA 5BMVB 4YP5A 4YT5A 3SKXA 1OH8A 3FI9A 1W8IA 1EK2A 3IDSA 2YQ4A 5LQRA 1QGZA 1VKOA 3JQRA 2FSPA 3EDYA 1REQA 4YP7A 1G3MA 3WWCA 4UEJA 4FMDF 2HBQA 3ZG6A 1HYBA 3K0CA 1SKMA 2ZI5A 3VR2D 1P91A 5AXAA 4UQLA 1WPXA 3KK0A 1H6CA 2XVMA 1RI3A 3K9WA 4ZO6A 3IE2A 3EIFA 3ILSA 2ET6A 1L5FA 3BMCB 3TNJA 4G63A 3C45A 4MPJA 4KREA 1XFAA 1M75A 5D3MB 3OM1A 3S55A 3SX2A 2L42A 1GTZA 3OLYA 4CKXA 2WMDA 4K40A 1JR6A 3SZ3A 2GM9A 3GQBB 5B37A 2QP4A 3HCOA 1DV2A 5DHTA 2XBMA 4LWQA 4O2AF 3SLRA 2BKEA 2OZKA 3E9ZA 4RCVA 4ZVOA 1GZ7A 5JCOA 2AQIA 1A1SA 2A5LA 2FMHA 1K75A 2N42A 2CXHA 2PYDA 2X77A 2RI0A 4UBJA 4O4IF 2HBYA 1PV2A 2YFKA 3OTIA 1C0PA 1NHGA 4N8DA 2OHXA 1GRNA 2GKGA 2VHUA 3FB1A 2XOKD 3UAGA 4ZMRA 1E0JA 2OGZA 7GPBA 3RSFA 5FHQA 3KSMA 3TIIA 1BFUA 2I66A 1YA8A 3JY6A 3HEBA 2XCRB 5HW0A 3EWNA 2GVZC 5JATA 2OXEA 1GR1A 4E70A 3U4QB 1Z28A 1HPLA 3GT7A 4AFNA 1N2XA 1I51A 1V2HE 1MU0A 1QONA 4TKUA 1VCNA 1XLTC 1YBAA 3M4YA 4XD2A 3UN1A 4BGVA 3J80A 3U7FB 1QE3A 3OZ7A 3F73A 1RKVA 2O57A 4WNAB 4W8OA 3F49S 5J2UA 4BEBA 1KZ6A 2ISCA 2WKSA 5EERA 4YDHB 3BH0A 3ECAA 2OCXA 1R16A 1ZM2A 5G3ZA 3VPXA 1G3QA 4WH0A 4B34A 1YZNA 1C9KA 2R97A 4DC9A 3E35A 4DN6A 2BEJA 4EAAA 9MHTA 2XTJA 4OGGA 1UT5A 3OZDA 3UOAB 3NBKA 1EDZA 3H3FA 4DQ0A 5JQWA 3GJ0A 4WD3A 1TJYA 5CXQA 4JI0B 2ID4A 2Q5JA 1MFPA 1OFTA 1KKUA 3E05A 1NBMD 5CGQB 2V96A 2VIIA 1Z4OA 5L9AA 3RVLA 4HLUC 4JBYA 3ZU5A 4TLBA 2BKVA 3HBLA 4RVHA 5J2TF 5HIKA 4HATA 4I1VA 3CVXA 1W8DA 4WFIA 4I9FA 3QSGA 5ARCA 4BRZA 5ADWA 5I3ZA 3ZV3A 1FE8A 2EF1A 3CEMA 1VLHA 1MD9A 1NQUA 4CM7A 2VJOA 5ERXA 1OTYA 2NNWB 2UYOA 2OXCA 2JIRA 1UKVY 1BQ3A 3QOXA 4MJXA 5A3QA 3FWPA 4O4IA 3CLKA 2NV6A 1P7CA 2YIMA 1JB1A 1TZBA 3K16A 3Q12A 3NIDB 2C2ZA 1JT2A 1X9HA 3LDUA 4B82A 1OJLA 1BKSB 1OBVA 3KOZA 5IC6A 1E4EA 2VNSA 3CZQA 3NALA 4ZAXA 3SC4A 3IODA 4PS1A 2E55A 1G4UR 4XWTA 1N36B 1XSEA 2WOOA 4E5YA 2VZ8A 3S8MA 5G1NA 3WNDA 1Y8RB 4CXMA 1JQ3A 1H1DA 2V97A 4MRPA 2WHRA 3R75A 4HNHA 1ML3A 3D2LA 1CLUA 3GPLA 4Q4JB 2YWJA 2CSXA 4OFWA 2ISSD 4RWEA 3MTQA 1UT8A 2YXPX 1Y4UA 2WYWA 3O8QB 3UFBA 3UKOA 4CQJA 3WRXA 5EQDA 4P4LA 2PZ8A 2C4UA 2WKPA 4JJ4A 2VCHA 5HIMA 1DEXA 5I9NA 2J1LA 3CC8A 4NMMA 2OO5C 3NKLA 3WGHA 4FUQA 5DTQA 3O7WA 3IL2A 1CE8B 2XDAA 2ZJ1A 2X2EA 1HLDA 3N6XA 4H1HA 1QH8A 1PS9A 3A1CA 1P5HA 4HAOA 4MV1A 3DVAA 3SN6A 3TBFA 5EN4A 1CQIA 1RACA 4UDYX 1JG2A 4K86A 2P5UA 2C88A 5T8KA 5BYJA 3F3MA 3PF8A 1FY2A 3NKVA 4CTOA 1X7HA 1TKAA 1K7XB 4NNPA 2X5JO 2IJGX 1R6BX 1SEPA 2BEUA 5CG2A 5JVDA 3CWCA 4J4HA 3E9QA 3IUSA 2R6JA 3QEOA 2JIQA 2Z58A 1RWMA 3JWGA 2DQZA 3PWTA 2ZFUA 3CIFA 3O4VA 3KKOA 3QW2A 4JFAA 2J6IA 1KMHA 1C9YA 2VHJA 4PQRA 1H0RA 3K5HA 4BZPA 3TKAA 1OF1A 2FPPB 3OOSA 1X9GA 3QPBA 3JVVA 1QG0A 4P34A 2Y0CA 3F46A 4PONA 3B6IA 4AJ9A 2FPIB 4KWTA 2W2PA 4BAGA 2FSVC 4KEAA 4IFIA 1E9SA 1VG0B 1OTXA 2ZIWB 1M83A 3C74A 1ZD2P 4H6PA 4OMCA 5DT9A 3SKYA 3T7IA 4E94A 1NLYA 2VPTA 1U1FA 3A6FA 2CLIB 2ZYUX 4HYQA 4XOIA 3QWBA 4LNHA 3AHIA 3IUYA 5AFSA 1M72A 1QIDA 4JP1A 1I2CA 3CCBA 3M6VA 4OI4A 5AW4A 3VNVA 2X41A 2Q1UA 3NOVA 5AQEA 2NMVA 3GJZA 1Q19A 2PG3A 1TECE 1OKKD 4QUDA 4EHLA 3G89A 2EAUA 1VYTA 3MGCA 2PSFA 3JARA 4IHKA 3EVGA 4AJNA 1PHRA 4JX9A 4JP5A 3HXMA 5LB4A 1GKLA 2FZKA 4MMYB 2IWHA 2AYZA 3AEKB 1JPJA 1W30A 4YEDA 5GV7A 1BCSA 3G59A 4GLBA 1P7WA 3R9XB 4S1NA 4JN6B 1ZQ9A 4RM2A 3GPBA 3D7SA 4DBLC 3MTIA 2ZTVA 1KEEA 4NXMB 5BNFA 5CLJA 4RIFA 4ZVTA 2IZ5A 1JMKC 1XZEA 2PHZA 3JVEA 3NBFA 3ZJTA 1GVHA 1NBIA 1Q1ZA 5DYIA 4WIAA 1UQRA 1QVWA 2JVJA 3CZMA 3L7BA 4JVNA 5CNMA 2EW8A 5CEEA 4PGMA 5JZVA 3DAOA 4NZ9A 1S3GA 2X7XA 2IA5A 1QH0A 5CX4A 3E2IA 3E0QA 4EJSA 5CB4F 2F1KA 2GPWA 5G4KA 4AICA 4HWTA 1C8VB 3A36A 5ILOA 2HF9A 4NR0A 2RGGA 1ANKA 3PXEA 1SG0A 3VNSA 4M55A 5AXCA 4CLRB 3P4XA 4DLRA 3WJ1A 5ALJA 4A5OA 5LCXA 2PZMA 2GILA 2VPIA 2ZSFA 2WKQA 1OH7A 5EWLA 4DHEA 4JLPA 1T4CA 4YP6A 3Q4GA 5CBPA 2QTHA 4Y2PA 2C3YA 1Q1EA 2B78A 1RI5A 4D9EA 1XX6A 2FETA 3KKEA 4KN8A 2ZJBA 3VR0A 4IHJB 1TQ8A 4BMPB 3FYUB 2FMKA 2JJ2A 4IDGA 3K9GA 1T0PA 3VTZA 3BL6A 4Q4AB 3MVEA 2DPYA 2H1FA 2XRZA 1PJ4A 4G0NA 2J0SA 5CDTA 1KSHA 1R4ZA 1FA9A 3ESCA 3KYIB 1QO0D 3TNYA 3R1IA 4JH0A 2VT2A 3I2YX 1UBRS 3KPJA 3ZE2B 1RQNA 2HF7A 1SHZA 2MR6A 4RKRA 2QX9A 1BCRB 4MKRA 1RPJA 2XDQB 3VPDA 2I29A 3GROA 3QU9A 5LBIA 3ZIDA 1V1RA 3REQB 1DG3A 1XDDA 2R66A 2ID7A 1PSZA 4L15A 4I50B 3ZE8A 5BWMA 1CDOA 1HKHA 3LVFO 5ENDA 2IZZA 3WLIA 3OMLA 4F84A 4K9NA 5EP1A 4AJIA 5BR8B 3KD3A 3L4BC 1MHTA 4RKWA 3R2JA 4US0R 1E79A 2YIJA 2D1FA 2O2GA 3ED5A 4AKEA 5LZ2A 3UUWA 3M6IA 1NG1A 5ALPA 5DW0A 4JLUA 3H3XA 4IFEA 4UHEA 4YBRA 3RVJA 4YMHA 4CF3A 4IW3B 4WEQA 3SVZA 3ZZ0A 4ZZ0A 2PTHA 1IOLA 1JFLA 2H2WA 3TRIA 4EQ6B 2FB9A 1ORIA 4Y2JA 5DF1A 1ZEJA 2WSSD 4DS3A 3GL9A 4O4HA 2QRMA 3DYVA 3KO8A 1H4SA 3FYTA 4QUKA 4H59A 3KBOA 4N49A 3ZU4A 4ZWNA 3DUWA 4HDQB 3HI4A 3RDPA 2VDNB 1N4AA 4H7JA 2KBFA 2C3MA 4Q4CA 2WPNA 2J46A 3NTUA 3ZBTA 4DA7A 5B1YA 4R3WA 1P4SA 2F9MA 1N2JA 1XU9A 4NV3A 5HFAA 4DGSA 1B26A 2QW0X 3GW8A 1YDHA 3OQMA 1T0IA 1W9HA 1NTOA 4TT3A 5DXJA 4PO1A 5JWHA 5KI6A 4E2FA 1FFXB 1W0KD 3O1JC 3NYQA 1XCGB 1SD1A 2VT7A 3JQ7A 2BUAA 4QYXA 4TMYA 3A4MA 3W2HA 3QJYA 5I9LA 1VJ0A 1Z74A 3TK1A 1JNXX 3LUGA 2HHJA 3TEFA 2IFTA 3ETNA 5JEDA 1UL1X 4KXWA 4BATA 3M9LA 1UBGA 3ORRA 3Q3VA 4Y9UA 1Z5NA 1G0NA 2DLDA 2QRJA 2SKEA 3COPA 2ZSAA 1HE1C 3PE4A 5TPWB 4AMZA 4CM4B 4DMMA 5B5SA 1E92A 1YFZA 2A9OA 2GI4A 2HQSA 2R1TB 3IAEA 3M70A 3Q9SA 3ZTYA 4RUKA 5LD2B 2G28A 2GM3A 1MOSA 1TX4B 4D41A 2XWSA 4Q9IA 2WNHA 1DOZA 1JTVA 3L49A 3N53A 4JGBA 4LEIA 1KO1A 2LBPA 4R51A 2EFYA 1CUVA 3HCEA 4XX0B 1ECLA 2IP2A 4YHBA 3VOAA 1N9GA 1A8IA 1YK1A 1CVIA 1X13A 5JD3A 5K5EA 4W63A 1JQJC 5EMMA 3BOSA 4PNPA 2X8WA 3HFGA 1HEUA 3DXZA 4KWEA 1K63A 1F12A 1O6FA 3EBLA 3FYHA 1T35A 2V7VA 2BUCA 3C70A 4WXMA 4ZYLA 1FP2A 2P8SA 4XARA 1DNPA 3ETCA 3KXKA 4OMFG 3PC4A 1MJHA 1TC2A 2DF8A 2AL7A 2OYCA 1FDIA 2Z6VA 1JIVA 1ZM4A 4KYTA 1FP7A 1P2SA 4IHJA 4HQLA 4PZZA 1PQYA 1NBEA 4JLOA 2C4VA 3ENVA 5LNK1 2IH2A 3NHUA 4BCCA 2BH2A 4DMGA 3H2ZA 2FN8A 1MAUA 2AK3A 3LDAA 2VCEA 1O5IA 1VJRA 4NPCA 2IU3A 1CUUA 1GZHB 4FOPA 1NC1A 3EXG2 4FXPA 1HETA 3ESYA 4UAGA 1HE8B 4KIJA 2ZRMA 4M0PA 1VE6A 3NC4A 3PI6A 4MDYA 4C07A 2VJDA 1F4PA 3VI4B 1OOEA 2D5BA 2JPDA 3IQWA 4JJEA 4QDOA 4Y9SA 5H1YA 5HJ2A 3TINA 2EHJA 1KFBB 2PKXA 1Q95A 3F67A 1L4YA 2OQIA 1SC1A 3KPWA 4GXRA 4ADSG 2I4LA 2NXCA 4Y67A 5DVZA 2A33A 2CJPA 2Q41A 1QRRA 4ND1A 2YHIA 3NHBA 1GTMA 4Y9TA 1YJXA 2FTKE 5F7JA 2RJOA 4EG4A 3LT0A 5BN4A 1EFHA 4PY2A 3CZAA 5PGMA 3C1AA 5C7LO 4NMWA 4TTAA 2FPGB 3TJMA 2CJFA 1N5KA 2BEWA 2O0LA 2CKDA 4ZI7F 4Q3DA 3RC1A 4CV1A 2LZ0A 3MK31 3Q15C 4QJ3A 4FHDA 2A4MA 2NN3C 3THSA 4P22A 4E5MA 3F6BX 2VDOB 3P9PA 5EI5A 1Q14A 3ECCA 2UZ3A 3C6KA 2A1UB 4CI0B 4Q0MA 1NJ8A 1UPFA 3OE7D 1KIFA 2EYUA 4TSRA 7ABPA 2CUKA 2LCFA 2PZAA 2AOUB 3S1SA 3B5JA 5TGDA 2PIAA 4J43A 4IOJA 5LA6F 1AUVA 4EMSA 1S8OA 3WLHA 2I4IA 4WFQA 1RLUA 1SC9A 3KUKA 2J4FA 5DIFA 4E11A 1JYEA 1FYDA 3QVKA 1R64A 1M34A 1RAAA 2YUIA 3L7MA 3NC1C 4H27A 1FDTA 2GPNA 3PHJA 4MVCA 4G4GA 4KL8S 4QGHA 3AVVA 2D3WA 1FSGA 3V8MA 1BMQA 1YOBA 4QHYA 4WZBE 1YIAA 3WO1A 5LZ4A 1OH6A 3OD1A 1VJCA 4W5WA 1QF7A 5KHLB 1CYDA 1XO1A 3KEGA 5KB3A 2HSWA 3T95A 5L7WA 2JIZA 1PEAA 1SOVA 2OPHA 1JIUA 2FPPA 4HQRA 4N7MA 5G02A 1NVGA 3ZCTA 4MV9A 2HMUA 3TX2A 2HREA 3M83A 3BPSA 4X45A 4YIHA 3CEJA 1YB5A 1G19A 2WINI 4HZIA 4TZ0A 1N33B 1OBHA 5B4UA 2NYUA 5CLFA 1U7UA 3O2QB 1OX6A 3AG5A 3E27A 4XJTA 1Z5PA 2F3PA 3QFTA 3F78A 4BB9A 2BEUB 4JJAA 2PRKA 1F2VA 4JLDA 1FRFS 3LUAA 1G17A 4D9NA 2NTYC 1SAYA 4RLHA 4HEJA 1B0ZA 1Y7TA 1NP3A 3DNMA 2CL6X 2NYRA 3LT5A 4TV9A 4MEAA 3ITKA 4KXMA 2E5LB 2OORA 1NWHA 2Q46A 5C5EA 1WR8A 2LKCA 1JR3E 1W59A 1Y7PA 3WYDA 4KQHA 4B6EA 1H23A 4HN9A 3F1KA 4ARAA 4G3XA 4J91A 4KXQA 1B8VA 2DJ5A 1QV6A 3QTLA 4YJ3F 5FOWA 3RROA 1AMUA 1WETA 4F9FA 5AICA 1Z4KA 2NO6A 3FM9A 3GAZA 3NVAA 1ISGA 4H9GA 1XTIA 4Y98A 4ALKA 4KV7A 4D9FA 4A2WA 2OECA 5AVQA 4Q4DA 3KJEA 2E4UA 3UA4A 2TECE 1BU5A 4M99A 3C97A 4S12A 1IB0A 2VTDA 1U8FO 1XRRA 1Y8RA 2BIFA 2IEIA 5LKAA 4K9OA 4C0HA 1NI3A 2AD5A 3ZCRA 5KVVA 3X1WA 4YACA 3RU9A 1EP2B 2JIOA 1QH9A 2RDMA 4U00A 3EF1A 1AURA 2J3KA 3OT5A 1M1YA 4KVFA 5HRCA 1D2NA 1QAQA 1C81A 3DKPA 4GOJA 1VZ2A 5P21A 5JCPA 1MC1A 5F52A 1TU4A 2C2HA 3KJHA 4PLZA 2UVDA 4L8GA 4CLXA 1P0CA 3KJNA 1NI4B 1RSZA 4LBWA 1ZGHA 2XOEA 3WBFA 3OZIA 5F77A 2OHVA 2J9FB 3ICEA 2F17A 2OCIA 1H2BA 1SH7A 5T4BA 4FZVA 1BFKA 2WNSA 3FE2A 1E2UA 4MQMA 2G9VA 1BA2A 2H1RA 2VRNA 3SK0A 5IANA 2DUJA 2Y1OA 4WERA 4TQUS 2NU8B 1ACJA 4H31A 3UK7A 3RCBA 3ZJ5A 4E03A 4LHEA 1UDBA 2ZYTX 1WU8A 3CKMA 4EHFA 1XMOB 4ARSA 1T3SA 2HW8A 4ZHQB 2XGOA 1P0FA 3DKKA 4B0OA 3T52A 4ARIA 1XVLA 2OGTA 5HJ7A 3TGPA 1L1RA 2WM2A 1E8MA 1Q0LA 4CW7A 5HIIA 3LX5A 5HQ3A 1E8DA 1FVOA 3R6LA 4BN4A 1QHEA 3BMOA 1WIWA 4G9GA 1U3UA 4M9ZA 5FLYA 3J7AC 1NXSA 2V7WA 4P7KA 5KNDH 4QX6A 4WCFC 3OBIA 1P75A 4FHEA 1I6MA 1Z73A 3CIOA 1BEEA 3VZSA 5E3HA 5FOQA 5C46F 3I42A 1CCWA 5HE9A 1D8AA 3BB3A 3C14C 4BFLA 5B57C 2DFKB 1COZA 1K4YA 1RKQA 1OFVA 1LNZA 2IY7A 1DHRA 2VPPA 4ICIA 2WYIA 2O2JA 2XMQA 3DAYA 3PC7A 5ALQA 3OOYA 1I32A 5ALSA 1XTBA 1DAPA 1XZIA 1Z29A 4WNAA 2MMCA 2Q9AA 1S96A 3P0IA 2P2YA 2JJ1A 4IDAA 3RUIA 1CRLA 2L0XA 3VMMA 1R12A 2XE4A 4O4LA 2WWIA 3CNOA 1KNQA 1R4MB 1Z12A 3AIMA 5REQB 3SZLA 4Z8XA 2VRCA 2ZGVA 3KJQA 3KB8A 2ZZNA 4ENUA 2GN0A 2Z9BA 2EBFX 3FNIA 1M1XB 1G20A 1L6IA 5EUQB 4EFLA 2IQ5A 4A8JB 4KK3A 1OPRA 5JC8A 3LK7A 5H5JA 1CDZA 3ROPA 3CUVA 1HC7A 1SPBS 3OT1A 4JDPA 1S2GA 3ANLA 3AHHA 1IOVA 1US8B 3OJOA 3P1JA 2G4LA 4GP6A 4OAPA 2GHRA 3BF7A 2HDOA 4HCJA 4J1QA 3TDNA 3B78A 3IPAA 2BHTA 4LRQA 1JJIA 3AV0B 5TF4A 2IYQA 1WSDA 2ZSKA 1Q1QA 4Q7QA 3PQ6A 2OC4A 1IXSB 4CNBA 1YE3A 1EWRA 3AZPA 4IIYA 1RHRA 1L7AA 2OILA 3WLKX 1Z0JA 3AHEA 3IUBA 1AA9A 1CUJA 1ENOA 3IIMA 3L8HA 4D4HA 3DKIA 1NE2A 1Z6PA 4R0VA 1E6MA 2V0GA 4GGPA 2ZBPA 4IWYA 4J2TA 2O2CA 4R7TA 3JATA 1U8YA 2GPTA 3CNEA 1U8AA 4TGLA 3SAJA 4KRFA 1OBCA 1BN7A 1WSAA 4GECA 1O6BA 3MLEA 3L40A 1MA3A 1Z06A 5KTSA 4O4LB 4QVKA 1TKCA 2FN7A 2J5BA 2JHAA 4B3HA 3CRVA 1XDWA 4BNXA 1DAHA 5I9MA 2RCNA 2E87A 2D0PB 2C59A 4IJ5A 1ZHFA 4YPFA 3OIUA 3ZX5A 5I9BA 2XMGA 1UIMA 2HA3A 3F3YA 3FWNA 4PFKA 4PYQA 1E2GA 3GRPA 1J1IA 3FVTA 1ZN8A 3JV7A 3QE0A 4G5RA 4MR8B 4H1WA 3LQ1A 4QM7A 1CY6A 1O89A 4NBUA 3N3BC 4LFCB 3U7JA 2Y1FA 3B20A 2W4MA 1RM0A 4HDMB 4JC4A 4KO3S 5K6TA 3MCTA 4AN4A 5CA0A 5BVGA 2NZ8A 3MGGA 1Y5LA 4K88A 4P80A 2H4WA 2RAFA 4MOWA 4XDHA 5JLAA 1VL0A 5HQ3B 3QXJA 1AT1A 1Y5NA 2HJRA 3LC2O 4HI0E 4BUCA 4LJ9A 5LDDC 1RZRA 2A92A 4GKVA 1BXGA 4GPZA 1ID8A 1FLAA 4Q4HB 1WNTA 2G1UA 4TZTA 5H70A 5LFAA 5JY1A 4RA6A 3FKSD 4INOA 3RUPA 1V35A 2EQ5A 3EZLA 6CHYA 1I4EB 4L5YA 1ZXLA 3MTBA 2ZXEA 1VJDA 1T2FA 3GLFB 4I1OA 4HKTA 2AFHE 4A6EA 2FMUA 3D81A 4DV3B 1JAYA 3UCFA 1YI1A 1G8KA 1WABA 2K7ZA 3N05A 4RPLA 2C3UA 2QG9A 4ONEA 4GF5A 3BGWA 3SR0A 3TXAA 1NMSA 3AHJA 2B21A 2HU7A 2RC5A 3K1AA 1F1JA 1M1YB 2AC4A 2QD5A 3QE4A 4JZKA 1RE1A 2ZTMA 4O5AA 2VDLB 2XXJA 2XEXA 4K9LA 2XXAA 1Z7GA 3AKYA 4YX9A 3HYTA 1U1IA 3R0JA 4ZZ3A 5IM4A 5I9IA 4IS3A 5ALVA 2ZRLA 1EQ2A 5THKA 1YGPA 3HO8A 4HEA1 3TL6A 3FYUC 1ZUD1 1RVV1 3PXXA 5KJFA 4N0DA 2FPWA 4HV4A 5DZSA 1BSVA 1KJWA 1XCBA 5DHPA 4C14A 5BUQA 4YROA 4GM4A 4IY1A 3ZWMA 3AJ9A 3CX4A 3V4PB 1W87A 3CA8A 3KOUA 3WYBA 1CY0A 4IGAA 2R5FA 4M2LA 2ID8A 5GZ6A 4EELA 2BGMA 3A4LA 3ANSA 2OCKA 3LBFA 2VF4X 4QBGB 3CEHA 1DCTA 1X7DA 1RJGA 5AI0A 2HHLA 5TPZD 1CUYA 1HT3A 2VNKA 3BK2A 3BGIA 4MIKA 4PNEA 1T0UA 4HXYA 2EP5A 5CU7A 2REBA 2YVAA 3D2AA 1BX1A 3PQ7A 4Q47A 1FW8A 1IHDA 3NJ4A 2H4XA 2ORED 3JD0A 5A02A 5LJIA 1KYVA 1MABB 3H0KA 1NRIA 1P5FA 1BEZA 5CX1A 5JCZA 1WEKA 1FNSA 1RRMA 2Q3LA 3KALA 4YXFA 1HTTA 4X7RA 3IUMA 1RIIA 3I5YA 4RFVA 1UDCA 2ZIUB 4MWDA 4OAOA 5IX8A 1MUUA 5HSGA 3ZU2A 2IF2A 3DM9B 1V8PA 1XD8A 1LFDB 2P9EA 3EGEA 3G9UA 4OK5A 4B47A 4EEKA 4U1RA 3CSDA 3REGA 2F4VB 2BW0A 3QKRB 3ND9A 1QK4A 2PV0A 4DV2B 1WXXA 1RI4A 3MHPA 3O31A 2PZKA 3N8HA 3U4CA 5BN5A 3LL4A 1ZYUA 3ZI4A 2EXXA 4JUIA 1TAHA 3IC5A 3I32A 4UUBA 1QMPA 4D02A 3A6EA 5KYYA 4KU4A 1NRJB 3TOVA 2XOKA 2IVZA