The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
82
|
sequence length |
229
|
structure length |
218
|
Chain Sequence |
TIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGKAMYIDTENTFRPERLLEIAQNRGLDPDEVLDNVAYARAFNSNHQMLLVQQASDMMKELLNTDRPVKLLIVDSLTSHFRSEYIGRGALAERQQKLAKHLADLHRLANLYDIAVFVTNQVQANGGHSATLRVYLRKGKGGKRIARLIGEAVFSITEKGIED
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
DNA repair and recombination protein RadA
|
publication title |
Engineering Archeal Surrogate Systems for the Development of Protein-Protein Interaction Inhibitors against Human RAD51.
pubmed doi rcsb |
source organism |
Pyrococcus furiosus (strain atcc 43587 / dsm 3638 / jcm 8422 / vc1)
|
molecule tags |
Hydrolase
|
total genus |
82
|
structure length |
218
|
sequence length |
229
|
ec nomenclature | |
pdb deposition date | 2016-04-18 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | P-loop containing nucleotide triphosphate hydrolases |