5JEEA

Apo-structure of humanised rada-mutant humrada26f
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
229
structure length
218
Chain Sequence
TIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGKAMYIDTENTFRPERLLEIAQNRGLDPDEVLDNVAYARAFNSNHQMLLVQQASDMMKELLNTDRPVKLLIVDSLTSHFRSEYIGRGALAERQQKLAKHLADLHRLANLYDIAVFVTNQVQANGGHSATLRVYLRKGKGGKRIARLIGEAVFSITEKGIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords DNA repair and recombination protein RadA
publication title Engineering Archeal Surrogate Systems for the Development of Protein-Protein Interaction Inhibitors against Human RAD51.
pubmed doi rcsb
source organism Pyrococcus furiosus (strain atcc 43587 / dsm 3638 / jcm 8422 / vc1)
total genus 82
structure length 218
sequence length 229
ec nomenclature
pdb deposition date 2016-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5jeeA00
1VCOA 4C0KA 2ZSDA 2J0QA 3KQHA 1KDPA 1NF3A 4TLDA 3BS4A 4LHVA 1D9XA 4YMVA 1FTNA 1R5BA 2RKOA 2XTNA 4I1OA 5CLLA 3ZZTA 4QJ3A 2HV8A 3CWQA 2R65A 1S3GA 5DIFA 4YQFA 1LS1A 2VP2A 2ZI6A 3NHAA 1W4AA 4MGYR 2PJZA 1SXJD 2WKRA 1KK3A 3OFND 2CJWA 3WNCA 1Q44A 4Q18A 4TMVA 1XEXA 2JLUA 2AX4A 4BFVA 1COWA 1MT0A 1YZQA 1QF9A 2VEDA 4DKXA 3CRMA 3CKLA 3FDIA 4US2R 2ODEA 3FMPB 2ANBA 4JS0A 2CJWB 5DE3A 3ZQ6A 3QY0A 4JKIA 4ZI2A 4LBYA 4TYWA 1Q0UA 3JVUA 4M2LA 4P4SA 2AL7A 4BZPA 3K8YA 2BHRA 1C1YA 1SGWA 2CK3D 1TU3A 4Q00A 1U0JA 1A7JA 3EA0A 2ZSEA 4A6PA 4IOJA 3WMFA 2AKAB 4BUJA 5CYOA 2ZYVX 2WKPA 3K0EA 3KTAB 4UNNA 4QGHA 3SQXA 3IBGA 1KDOA 3LX5A 1UBGA 1N5LA 5GVSA 2J0SA 2QPOA 4LK2A 3DHWC 2CE7A 2Q9BA 4B3CA 5C18A 1EK0A 1N5KA 3PEUA 2Y8EA 3EXAA 4TT3A 3SYNA 3T1VA 2O8BA 1E9DA 3QE0A 4GSYA 3JVVA 2NO7A 4A92A 1AZTA 1VG0B 2OE2A 2D2EA 3T61A 5FOUA 3LA6A 2GF0A 5JS8A 1CR2A 4GMDA 4LOAA 5JECA 4DB4A 3KUDA 4U02A 1JJ7A 1XZQA 3FKQA 2CHQA 1W4RA 2F1HA 2ZE8A 3GLHB 5KTYA 5KO2A 1JXOA 3A1VA 2QI9C 3CPJB 4RFVA 3TJZA 4QM6A 2NGRA 5EXTA 1S9HA 1JAHA 2Q21A 4JLJA 4UJ5A 4M8NE 1ZUHA 1X1SA 3DZ8A 1R8SA 4C7OA 3NHBA 2XGJA 2ASEA 2ZJ2A 2O0KA 2OFWA 2G6BA 1NMYA 4HB2A 3TSOA 1G9XA 4TSFA 1E2JA 1XJCA 2CL0X 4C7OB 1PUJA 5FBQB 2RGEA 2A3RA 1OH6A 5E4FA 4IDNA 3IPXA 4US1R 5JZVA 5EUQB 3L8ZA 1Q1QA 5J4VA 3CPEA 3TSWA 3U44A 3O8CA 3FKSA 1ZD1A 5AUQA 4D0NA 2FJUA 3X1XA 3B1YA 4QGFA 2GRJA 4A1FA 4PAMA 3R9WA 3B7GA 2QORA 4PPQA 1YRAA 5F98A 1BYIA 1OB2A 1SVIA 4B75A 3H4MA 1XEWX 4ASUA 3WHKA 4CT5A 4DLYA 3QG1A 4KU4A 4F4CA 4LYFA 2GZDA 1KO5A 1XF9A 5SZIA 2EQBA 1NJGA 2VP4A 4HAXA 3EPJA 3C5CA 1NVVQ 1Z22A 3SU8A 4L9SA 5C4MA 2VP6A 1ELOA 3IUYA 1Z47A 4M22A 1DOAA 2XX3A 4NCNA 5FPKA 2IX3A 1BMFA 5DHAA 3Q5DA 2JLVA 4XTCS 5KUTA 1TEXA 1XMIA 5CK5A 3CRW1 4MRNA 1FMLA 4D4LA 4HSEA 1ZNXA 2FSHA 4AG6A 1IJFA 4YC7A 2N42A 1XZPA 3LQRA 1HE8B 4GZLA 1E99A 4TN1A 4ABYA 5EJEA 5H1YA 4HDOB 4JLMA 3PENA 1KSGA 3X1WA 1SVWA 5D3QA 3PR1A 4AYWA 5FL7A 2VYFA 1FP7A 3W9YA 1GUAA 5F2EA 4XSGA 3UATA 4F4IA 2NG1A 4FCWA 3GLIA 3I5YA 2ZPTX 1ZW6A 3KZ1E 2MMCA 2HYIC 1G19A 4XVRA 3AKYA 2JLZA 3VTKA 2G77B 4Q1EA 3BE4A 1S96A 4JLKA 1UKEA 3QBVA 1ZUNB 3EPLA 4PPFA 4I81A 4R71A 1R0WA 1ZM7A 4V0KA 4XWKA 3IBYA 2IS2A 2GBLA 3SZRA 4WA7A 4C0HA 1G64A 3WMGA 2H8KA 5KNDA 1FQJA 3RLFA 4HUTA 3OIVA 3NC1C 1VCMA 2BM0A 2C95A 3ZGXA 1HE1C 4IDPA 2F1JA 2FPKA 4AWXA 1Z83A 1X6VA 3LRPA 3DEFA 3TLXA 4H9GA 3VFDA 2RGGA 2ZSBA 1E9RA 2GJ9A 1E4VA 5HKKD 3L8YA 1UBCA 1FTSA 3B8HA 4O25A 3KKQA 1N0UA 2ZANA 5JWOA 2PZEA 4JJZA 1EFHA 2VF8A 2YHSA 2QL6A 5B30A 4M1MA 4RKEA 3WRYC 1CR1A 1XJ0A 4BLOA 1KMQA 3JZAA 1LVGA 4GRAA 1KJYA 1NIPA 4V0MA 1SVMA 1Z29A 3TQCA 4KODA 3OZXA 5DHFA 3W3ZB 1XXHA 2WV9A 3C16C 5BN5A 3IHWA 1G7TA 2FPLA 2YC2C 4MYUA 1NN1A 2DR3A 4D4KA 4KSBA 4LRWA 1UKYA 3B1VA 4ITRC 2H17A 2XJ9A 3AP1A 5IF9A 1FNMA 1VG8A 2P5TB 2FNAA 3SOPA 2IYZA 1DAKA 3PEYA 2I4IA 5G3YA 1NI3A 4MYHA 4Q9HA 1OXVA 4AKEA 3K09C 1XTSA 3U4QA 4MITA 1OLOA 2D3WA 3M0EA 4DB2A 5JMTA 4Q66C 1FPMA 1WE2A 2NQ2C 3HPRA 3ZQJA 2UKDA 1UAAA 4Q4HB 1MR3F 1E4YA 2ZE7A 4URWR 4QL3A 1GIAA 4DJTA 1E79D 3CRQA 2GF9A 2HCBA 2WPDD 3RYTC 1SKQA 4HAWA 4Z8XA 3DO6A 5D3MA 1ZIOA 1IBRA 1T3SA 1Q3HA 4OYHA 4UNRA 5P21A 4ESVA 1CU1A 5M04A 4E07A 2J0UA 2NO9A 2A5GA 5JJKA 4POAA 3AVXA 4PFSA 1EX6A 5KNBA 5LD2B 2WBLC 1HEIA 1NJFA 4ZI3A 1G291 3CLVA 5D3MB 2XOKD 1NBMA 2ZE5A 3UMSA 4EDHA 4ZCLA 1P2SA 3QF4B 3SR0A 1JEDA 1Z6GA 3B1XA 4MKFA 2JJ1D 1G3QA 2ZJ5A 1Z8FA 1H8HD 3AVYA 1R8QA 5TY0A 2OBMA 3EARA 3AKEA 1SQ5A 1P61B 5A4JA 4UXJA 1KAGA 2YINC 2WWHA 3EA5A 5FOVA 1E2DA 1Q1EA 2ZE6A 2XB4A 2HLDD 3DKPA 5DLQC 1JPNA 1GILA 5FTJA 1VIYA 2GWHA 2WM9B 3U3MA 621PA 2GJ8A 1WQ1R 3LH5A 4D25A 4YMTA 5CYPA 5GJWC 5HZHA 5FTKA 3SHWA 1U8YA 3FVQA 4DIEA 3NBXX 3MJRA 1KI8A 4JYCA 3JZMA 3W34A 2G88A 5KHOC 2J41A 1K8RA 3A58B 3EZ7A 2XOKA 2YYZA 2FH5B 2YVUA 1IY1A 4Q9IA 5GADl 4RD0A 4BZQA 3RC3A 1D6JA 4HB4A 2ZROA 2LWIA 2ZR0A 3RWMB 3A6PC 3L43A 1T6NA 1KZ7B 4Z1MA 4LY6A 2B7BA 2W2TA 2PLRA 1KSHA 2JJ1A 721PA 2R44A 4MKIA 5BW8A 3NTUA 3IEUA 1JJVA 1P7CA 1SVOA 3TNFA 4TQUS 4CEIA 2HEIA 4FI3C 1UBEA 2Q6TA 1QHGA 2BBSA 4FCTA 1T8UA 1XEWY 1ZC3A 2JAQA 4BFYA 3AGQA 3NKVA 3ND8A 5CB6A 2EFDB 3RS3A 1XTRA 1E2GA 2AWOA 2HLDA 2AFHE 3B60A 1F3OA 4RFSA 3I61A 4JJKA 2QQ0A 4UNQA 2IEYA 4JVMA 2WICA 2REOA 2P67A 4M1TA 2AXNA 2DFTA 2XNDA 2YOFA 3R7WA 1G4UR 2ZREA 4RFSB 3FHTA 5DN6A 2QENA 3LDAA 1TF2A 1MRNA 1DTSA 1ZYUA 2OLKA 4DLSA 4DWJA 2FU5C 1F5NA 4NDZA 3VR4A 3R7WB 3A36A 4LUCA 4R2IA 4UNSA 5DH9A 1DPFA 4EUNA 3B9QA 1KSJA 4EKDA 4UNPA 2QU8A 3GPLA 2O8FA 1JR3D 1S8FA 4WIAA 4DC9A 1DVRA 3THWB 2QSYA 2ATXA 3P26A 1OFHA 3N5CA 4W5HA 2H57A 4O2LA 1TL7C 3LBNA 3KKOA 4TMTA 1OPXA 2CVFA 4C0SA 5JRJA 2O8FB 1Z07A 4XSHA 2ZRGA 1XJQA 3B1ZA 4IDHA 3I73A 4WXPA 5HCIA 2JIZD 1RC8A 4TTPA 1VHTA 1SVLA 1GNPA 4RSGA 2RGNC 2ODBA 4TL7A 4EFLA 2HCJB 1MO4A 4RD3A 2WJIA 1ZP6A 3L82B 5AK0A 5TB5A 3DOFA 2FFAA 1IXZA 1NIJA 4IW3B 2WAYA 3VU9A 2WWIA 3AP2A 4EJSB 2XEXA 3R9XA 2RMKA 4KO8A 1G5PA 2HT1A 4QC2A 1GNQA 1OYYA 2O52A 2E87A 1BO6A 2GVDC 4WVFA 4AYXA 4YMWA 3VU9B 1M1YE 1M7GA 2ZRAA 3A1SA 3HYTA 3BFVA 3U2QA 4NYIQ 5K8LA 4ARZA 4X8HA 1IN6A 3REGA 4FMBB 2CDNA 2IS6A 2UVQA 1II8B 3THXA 1Q3TA 2ZRFA 4M0LA 4A2QA 2P0EA 3AEZA 3MWLA 2JLXA 3DZDA 5H8WA 2QY9A 1XMVA 1W47A 2Z4SA 2JIZA 1Q20A 3ECCA 5G3ZA 1OKKD 4ARZB 1AS0A 3K0CC 4O0MA 3WNDA 1JAIA 2ERXA 2FEMA 4I1UA 4M1KA 3THXB 1G8HA 5FUWA 5E95A 4MRVA 4GFDA 3T35A 5FR1A 5CJ2A 2IWRA 3FB4A 3DMNA 3GJ3A 3GLIE 2GXSA 3TGPA 2V6JA 3GFTA 4DLWA 1HQCA 1G8GA 3KX2A 2FZ4A 2GA8A 4GL2A 3ETLA 4G01B 2AXPA 1E2PA 2GNOA 1W36D 2ORIA 3VX3A 4RZXA 1DBSA 5J5CA 3FMOB 1UKVY 1Y63A 1Z0FA 2YNMA 1KI6A 2HXYA 3CBQA 4IVRA 4FN5A 1NL3A 1DO0A 2KSQA 1ZM3A 1XTJA 2JJ2D 4LHYA 3RS2A 1YZLA 3FGNA 4CYMA 4DLRA 4GP7A 5ELXA 1TADA 4GDFA 1LY1A 2ZAMA 3L0PA 1J8YF 1RYFA 2NPIA 2OZEA 4KCGA 5FH9A 4B2IA 3EC1A 3WNBA 2I3BA 1PV4A 1NN0A 3CF0A 2VHCA 4KXFB 4TTQA 2P6UA 3H86A 4HZUA 4Q7KA 1P2VA 3FFAA 4LJYA 3GLFB 1SHZA 4BFZA 2YWEA 4MUAA 4CIDA 3AVOA 3WBJA 2RGCA 3DM9B 3F0TA 2P3SA 1IN7A 2HXSA 2EU8A 4OHVA 4OHZA 1XD9A 1QHNA 4HZUB 4HUQA 3ADDA 1JBKA 3VKGA 3QVVA 2XTZA 3A1UA 1Z08A 4FWIB 3V00A 3I32A 2JDIA 4NYMR 3WP1B 3A37A 4GOXA 3WP0A 1TNDA 2ZU0C 3RABA 2XTMA 1KGDA 1XXHE 3BB1A 3L0SA 1W36B 1KK2A 3K70D 3MSXA 1K6MA 2D06A 5EP2A 1XRJA 1U8AA 5FTNA 4YMUA 1W5TA 2HT6A 1KO4A 4IHQA 2WJJA 1EX7A 2GAAA 3SJCA 1ZM2A 4Y0VA 5L8VA 1JQJC 3OE7D 4DBLC 1I2DA 1NRJB 2V55B 2X1VA 4A15A 2ZETA 1F2TB 4WAUA 4CEHA 1BS1A 3T1QA 5CIWA 2GAOA 3CO5A 3FOZA 3NBZC 1G18A 3OF5A 1KY2A 5FBRB 5CDFA 4IFEA 1EFUA 2CLSA 3AF0A 2CMKA 2IYRA 1R4AA 3B13B 1QG4A 1QVAA 3ZLJA 4DSNA 3QJYA 4IEEA 4WZBE 1DAHA 4MDEA 3W6NA 4DSTA 2WWWA 1EFTA 3LBIA 5EXPA 2I1VB 3D31A 1CR0A 4JLDA 4ZKEA 1N6KA 4PXAA 1XCGB 2GKSA 2ORVA 3T1OA 5HZKA 3IEVA 3EZFA 5FUYA 3I62A 1NVVR 1E2KA 3EAQA 1N0VC 4BLPA 4XWOA 3A1TA 5FPTA 4KFUA 4JL6A 1NP6A 2Z83A 3T15A 3OE7A 5C4GB 5L3QA 4WXRA 4FWTA 1NBME 2QA5A 1W2HA 2XNSA 3QI2A 5KDDA 3W5JA 1M2OB 1E1QD 3ZS9A 2IEZA 4FIDA 4DEXA 2HDNB 2F9MA 5L3QB 4FINA 4PSKA 5JS7A 2MMGA 2PEYA 1RPZA 4IOLA 1MKYA 1W46A 2JLQA 3HR8A 4MKGA 5E3HA 2ERYA 4NYJR 1F60A 2B21A 5KSPA 4B73A 1RRCA 1F48A 2Q9AA 4XOIA 1ETUA 4A36A 3OAAD 1T3LA 1ZD8A 2C8VA 1YJ5A 2O8CA 3OEED 2QP3A 1GITA 2ZSFA 1EFCA 3Q72A 4OI1A 3KJGA 1X3SA 2LKDA 3BOSA 4BFXA 3LWNA 2B8WA 1IJEA 4OQNA 5JFGA 5JJLA 2Z6VA 2O8CB 1P72A 2H92A 2BVNA 3OEHD 1SULA 1DAFA 6Q21A 3I8SA 1D2MA 2OSBA 5C1BA 4YXWD 1QVRA 1E1QA 1SKYE 2FE4A 4ZO4A 3QXCA 2R9VA 1U2RA 3UPUA 2LKCA 2OT3B 2BJWA 3WBKA 1IY2A 1EFRD 1VIAA 3KXKA 2GILA 1W5SA 2B7CA 4MGIR 3QXXA 4CVNA 4WW0A 2QP9X 4I1VA 1C4OA 2UZIR 2GXQA 3TMKA 2PMKA 1KI7A 3A4MA 4P0TA 4CDGA 1FZQA 1VYVA 2ZI4A 4FMDF 2JLRA 3OAAA 3QXHA 4C0JA 4KHZA 1W48A 1KO7A 4PPNA 2VPPA 4DCNA 3TE6A 2GZAA 4O3MA 4LCBA 1NY5A 1QBKC 4A8JB 821PA 3V4RA 1GM5A 4IXNA 4NONA 2IUTA 4URZR 1GL6A 4B3BA 4TZ0A 1OV4A 1KJWA 2VSOA 3QNUA 2A7QA 1RRFA 4QM7A 1X8KA 2EFEB 3OEHA 3GJXC 4EPTA 2Q3FA 2V1UA 2J9RA 2FX3A 1XD2A 4YXWA 1S0UA 2FEOA 4TYYA 1AJEA 4DSOA 1KY3A 1IXSB 4RZ3A 2CLCX 3AF2A 1IAQA 3QPUA 1KZGB 3CWZA 4UKDA 1BIFA 2P2LA 4KBFA 2QAGC 4NBSA 1XD2B 3IGFA 1VYTA 4OJQA 5FPHA 2BMDA 3AVQA 1W4BA 1L4YA 3GEEA 1M74A 3NIBA 4PX9A 3GJ6A 1KOFA 2DWPA 5AJVB 4LGMA 3ZVRA 1NLYA 1IN4A 2WWGA 2J7PD 2CCJA 3P1JA 2BBOA 5J4HA 1DADA 4IRUB 1ZM9A 4LJ6A 4CEJA 4OQMA 4BQSA 2N1BA 2Q3HA 3KFXA 3KTAA 4JYBA 1KJZA 2WIAA 3TW4A 5A5GA 4C0QC 2ZRHA 1X1RA 3Q5EA 4NMMA 1CJMA 2ZRPA 4XJXA 3RANA 3UXMA 4EIWA 1SXJA 4CEJB 2D2FA 1TQDA 3B6EA 4F38A 3OFNA 5AUNB 2BCGY 2C9YA 4C2TA 5JJIA 1GSIA 1XU4A 4G0NA 1LF5A 2JLYA 2FSFA 2EFGA 2OAP1 2D74A 2ZJOA 4PQYA 3U7GA 2G1JA 4BLTA 3H1TA 2OFXA 1SXJB 4A0FA 2GBLC 1L7VC 3GLHA 2BEJA 4F91B 3W8RA 1OHHD 2HJGA 2OM2A 4LSGA 3ZIAD 4YONB 1NMZA 3OIWA 4NHOA 4BASA 4URVR 4ZIRA 1P4SA 3FWYA 4FMCB 1TQ6A 3NBYC 4JLPA 3VKHA 3CF6R 5BYJA 1P60A 1OFIA 1UEJA 4Q1AA 2RGBA 1OT3A 3GJ0A 1GRNA 2OBLA 1G7CA 2CK3A 2PBRA 2RHDA 2V7QD 2ZI3A 4P33A 1XTKA 4QBGB 4ZIRB 1X86B 4ZKDA 2IS1A 1RFLA 5EZ6B 2ZS8A 3DDCA 4QRHA 5EE3A 2J87A 3ND9A 1UEIA 3OIYA 3V9PA 1V5WA 2CBZA 2FMXA 4EFMA 2W00A 4GP6A 4HZIA 3UMFA 3AP3A 3KKPA 2IYLD 1VTKA 4Q9JA 2GHIA 4HLUC 3O47A 1TF7A 1LW7A 2BMFA 3IHLA 4RD4A 3VHXA 1FFHA 1E9FA 4PQRA 4V0NA 4DLVA 5AJYA 3ZIAA 1G6HA 1R7RA 3LLMA 5DO9A 5EXXA 3MD0A 4M4SA 4ZCMA 5CB8A 3HU2A 2Q9CA 1KDTA 2REXB 3SFVA 1TQ4A 1XB2A 4Q19A 4R98A 3TAUA 1S4QA 2V7QA 4BRWA 1DO2A 4E09A 2C9CA 1PZNA 4M9ZA 1RKBA 2BMJA 2QT1A 1QHSA 5BN3A 3AQ4A 5KU1A 3K0FB 3DVLA 2E9SA 3Q85A 2OESA 3DMDA 3TUZC 4JLNA 2QE7D 3U3JA 4NPHA 4DVGA 2QTVB 3LX8A 1EWRA 3QKTA 4KLZA 1AGRA 3R8FA 1VMAA 1WRBA 1G41A 2H1LA 3QPVA 4JBYA 5J40A 2R6AA 1NG1A 2AKYA 3MLEA 1HQYE 1MH1A 3H0KA 5C46F 4MQBA 2XZPA 1W0JD 1CBUA 1KO1A 3EPHA 3ZD6A 4C2UA 1ZNZA 1GVNB 1KNQA 3AGPA 1E9AA 2JJ8A 3NEYA 3GFOA 4JVLA 2OCPA 5LB4A 4DXAA 2OAQ1 1X8LA 3KJEA 2KI5A 2V9PA 3EWAA 1E0SA 5CM8B 2G0NA 1HYQA 4NZYA 4JSTA 5B64A 2QE7A 1G5TA 2R2AA 1FX0B 2C96A 2PX3A 4PHFA 1TPZA 3BWDD 1YVDA 2QPTA 1YQTA 5SZKB 2WJGA 1T5LA 1W1WA 5KOYA 4TLBA 3FPAA 3CM0A 2X2EA 4JSYA 4KI0A 1UDXA 1CP2A 4QJ4A 4GBMA 4D82A 4XIGS 1UJ2A 1F2UA 4N3NA 3HPQA 3W6PA 2Z4RA 4HDCA 4D0LB 3EX7C 4Q5IA 1T9HA 3K53A 2ZYTX 4G5OA 3PUYA 3RNLA 1CRPA 2X8AA 1F2UB 2NO6A 3M4YA 4M1SA 4L8GA 1WCV1 1EESA 3GFPA 1D5CA 1N6PA 3AKCA 2GEDA 4Z8YA 4ON9A 3RSLA 2P6NA 2VHQA 2OLJA 3B1WA 1KK1A 5FPYA 1Q57A 4TZ6A 3CZPA 2FOLA 1AZSC 3GEIA 5JEDA 1HT2E 4LV8B 1L8QA 2A5JA 4M1YA 1PJRA 4HAYA 3ZJYA 3P32A 4AK9A 4YDHB 1NG9A 1JNYA 2A9KA 4NYIR 4TL6A 2QM8A 5DYIA 2JLSA 1TUEA 5LB2A 1PUIA 1PVOA 4AURA 1R10A 4E22A 4GI7A 5FR2A 2PZGA 3K1JA 4YLGA 3VR5A 3EPKA 3RRYA 5KPDA 2ZS9A 3J81k 3LY5A 4KBGA 5GJBA 5J47A 4HAUA 2MSEB 4KVAA 4DLXA 2YKGA 1B23P 1H65A 1IN5A 2GJSA 4I4LA 5J4KA 4OQXA 4DCUA 1Z2AA 3QEOA 2BIFA 3U3KA 1WDTA 2QT0A 1WMSA 2LCFA 1KI2A 2CXXA 3K0AA 2Z5FA 4BFWA 4BLSA 3PIRA 3PUWA 5HKKA 5KNCA 3B78A 4Q4HA 3C14C 2ZI9A 4DDTA 3HJNA 1KDRA 1GZSA 3K0AB 4EPXA 4V0LA 4EQ6B 5HPYB 1OXSC 1GDDA 2ECKA 2F7SA 3EG5A 2EYQA 1G8YA 2IK8A 2VRWA 1QHIA 1H8ED 2VP0A 2ZSAA 2C99A 1KSFX 2FA9A 4QNMA 4G1UC 3MRSA 1GKYA 2JATA 2OXRA 3EW9A 4IXMA 1VECA 2KE5A 4MDFA 1XCPA 2FZLA 1N5IA 1GWNA 1FNNA 2YOHA 1U90A 2IUSA 4B2LA 3QF4A 1A2KC 3FMIA 4DCVA 4S35A 3DL0A 4B6EA 4DCSA 2FGJA 4MH0R 4D80A 4DDUA 5JHGB 2IF0A 5DI9A 3GEHA 4BLQA 3TAHA 3L0OA 2HYDA 3QENA 5TARA 2V4ZA 3MWJA 2ZRDA 4EPYA 2FWRA 5FOTA 3U3OA 4LYHA 2G9NA 4ZDIA 3LFUA 3BJIC 4NTZA 1Z0DA 1N6OA 2ZITA 3QBTA 2XSZD 2XJ4A 1H8EA 3HU3A 4JL8A 3TK1A 1E79A 4AKGA 2WPDA 1DE0A 4QHYA 4I99A 4QBIA 3HYRA 4WBSA 4ZPXA 3BFKA 2RCNA 4OHXA 3PQCA 5JCPA 5JLJA 2W6ID 3NWJA 4M21A 3RS0A 1GG2A 4RD6A 5H68A 1S3SA 4PAQA 4PC3A 4PQFA 2FGKA 1ZAKA 3TIFA 2EW1A 2ZYUX 2P5SA 3AVPA 1ZNWA 3A1WA 3LD9A 4L4UA 3T34A 1DELA 3RRZA 3SFZA 4JIMA 1OFUX 3CNLA 3R8CA 2RGDA 4ZDJA 3X1ZA 1MABB 3FYHA 4EPRA 3OESA 2OXCA 2F1RA 1H8HA 2OV2A 1IONA 3GLHE 4JMPA 3NVAA 3Q8XB 5JI2E 1RRGA 3C4JA 2CHGA 4O2RA 4DT1B 2XSZA 4A9AA 1ZIPA 4OQFA 2IS4A 2DHRA 2W2VA 4R7ZA 1Z6XA 1VHLA 1RZ3A 1P73A 4II7A 4PZYA 5B58C 3RVBA 2B8TA 4B34A 2GCNA 1R0XA 3QOFA 1GOTA 1C9KA 1JQLB 4D0GA 4KFTA 3RS5A 5KDLA 2W6JD 3GLGA 4KVGA 3P27A 2WWFA 2G0TA 3VR2A 1HA3A 4B47A 4TYPA 1ZNYA 5EP4A 3ZYCA 5JSZB 3W5IA 3EIQA 2CEAA 3THOA 2W0SA 2BEKA 2Z0MA 4A2PA 3GLGB 2QNRA 2RGAA 3THWA 4B74A 2QTHA 3EWSA 4RJLA 2XZLA 4UXIA 1DG3A 2F6RA 1OH7A 1Z6AA 1KI4A 5FOXA 1EXMA 5B57C 2BJVA 1U9IC 1E6CA 1P75A 1QHXA 2C77A 1J99A 5GJCA 3GD7A 1CLUA 2VP9A 4E03A 4PAOA 4L16A 4TMXA 1IXRC 3C15C 4W5WA 3ZH9B 1MO3A 3PXGA 1JECA 4B6FA 1N0WA 1HH4A 1DG1G 3TR5A 4EJSA 4MUBA 3ZVNA 4CRWB 4Q9LA 1AQYA 3BC1A 2ZS7A 1W44A 2EFCB 4J0QA 3EC2A 1AGPA 2P6RA 2BOVA 1U98A 4OK5A 1LV7A 2GXUA 2CE2X 2VO1A 1MOZA 1RW4A 3QKSA 4QOSA 3U6BA 3SYKA 3RWOA 1OXTA 3X2SA 2NMVA 4V0OA 3KB1A 1II8A 1JR3A 1E2MA 4F7WA 3THYA 3AF4A 4IKEA 4ACAA 2WSSD 2FPMA 4LPKA 3QKSB 1YR6A 1M34E 1NY6A 3UG6A 1KNXA 2W58A 3AV0B 4JLBA 1IM2A 1A2BA 1ZVQA 3THYB 4AI6A 4R9UC 4DZZA 4HLCA 4Q03A 1JR6A 4M1WA 4NU0A 3S1AA 1Q22A 3WRXC 1P3JA 1F6BA 1CJUC 4DDWA 5SZHB 2YWFA 1EGAA 1NMXA 4R2HA 2A5YB 2GK7A 3BRWD 4Q1FA 2EFHB 3S1AB 4Q01A 2OG2A 5JCZA 3O8RA 2R6FA 1NLZA 5DYGA 1U81A 4RZUA 5AJXA 2PT7A 2VBCA 4BECA 4LJ5A 1GRRA 4JVSB 3X1DA 2WSSA 1Z6TA 4B71A 1TMKA 4KFRA 4OI4A 4B76A 2ZRBA 2B6HA 2HF8A 3TUIC 4G5RA 1RJ9B 3FE2A 4V03A 4C3ZA 1DAMA 1D2EA 4NP6A 5CIQA 3GLFA 3RDPA 1KO8A 1NVWQ 3NEJA 4BFUA 5KPJA 2QMEA 5J4LA 2ZRKA 1OKKA 2IBMA 3CW2A 4XD7D 5GJVC 3I5XA 2ZJZA 3ZZUA 3QKUA 4PO9A 1Y3AA 5KSOA 4PO8A 2EWVA 3O8BA 2R8RA 2QGZA 3UANA 4BRUA 3DM5A 1FP6A 3VR1A 4D6PA 1QZXA 4DEYA 3TVTA 2GETA 1M8PA 2R6CA 1G21E 1XTQA 3RRMA 1WF3A 1II9A 3NH9A 1LFDB 2C5LA 2GESA 1Q21A 3ASYA 1A82A 1RIFA 1YKSA 3BB4A 4UXHA 2DWQA 1W0KD 1GKIA 3TRFA 2R6DA 3C7KA 5FBWB 4V0ME 3RRNA 3C8UA 2CNWD 2JJ2A 4BPBA 2VSXA 3KL4A 4BLRA 5CITA 4TQAA 5EP1A 1W49A 1TX4B 1CS4C 5CJPA 2VIIA 1ESNA 4WZAE 4BEJA 1GP2A 1F2TA 2VA8A 3PG5A 1US8A 4XD7A 1KIMA 1YZTA 1R6BX 2BV3A 3B2EA 4LV5B 4LYAA 4HB0A 3BBPA 3QUSA 1ONBA 2X77A 4Q21A 1AA9A 1R0YA 4AYTA 2FDCA 3AF3A 1R2QA 1US8B 2OEPA 3LLUA 1TAGA 3ZS8A 2B92A 5FBVB 3LXXA 1L4UA 5HE9A 4ILEA 3PUVA 3HWSA 1FOEB 3LV8A 4I1SA 1GFIA 3WYGA 3I1FA 1W0KA 4EPWA 1N5JA 2YWGA 2X19A 2ORWA 3FHOA 4IVQA 1UM8A 4BGDA 1IQPA 1OXXK 1Z06A 4RD1A 2OO7A 1KHTA 1IN8A 1E9SA 4Q9KA 1JXMA 2VH5R 4B3FX 1TQ2A 3RS4A 4TTRA 2CCGA 4DLTA 3RS7A 8OHMA 5L3SB 3B85A 2QRZA 3TBKA 2O8EA 2DFNA 1CKEA 1YR8A 2PH1A 2IYWA 3ASZA 4MRPA 3VHLB 1WP9A 2G83A 4M9QA 4B3XA 1S2MA 5EXSA 3BERA 3K70B 4HB3A 2YZ2A 1LTQA 4N0DA 5IRCD 2O8EB 1E2FA 1AM4D 1Z0IA 4AIIA 2O8DB 4D2IA 3W6OA 2O0JA 1G8PA 2YWHA 2CVHA 1E2LA 2VQSA 3A4LA 4AKIA 5KYKA 2AK3A 1VCIA 1VKJA 2WMNB 3F5FA 5IK2D 3ADCA 4B3DA 2GCOB 3NXSA 5AWFC 3KKNA 4XTRA 3WYAA 5TV2A 4HLDA 2JLWA 2VHTA 2QAJA 4L9WA 521PA 1KKLA 5TDHA 4LC1A 1XMSA 4LHXA 1WB9A 4Q4JB 3REFA 1E3MA 1Z63A 2QG6A 4MA4A 4F4JA 4KYIB 1J2JA 3QEJA 1E1RD 1ZJ6A 1OH8A 5CLQA 2G3YA 2QQEA 2DYKA 1CEEA 2NIPA 4W9MC 4FCVA 4NL4H 2JASA 4Q1BA 3T12A 4PC1A 1Z0KA 2OBNA 4Q4AA 5FUVA 1XP8A 4LI0A 1UF9A 2ZJBA 5CM9C 4D4JA 4RY2A 3VNUA 4B43A 4ZV4A 2ZJAA 3SN6A 4LJAA 3IIJA 4Q4AB 1RVDA 3IIKA 5JI3E 1XPUA 2KBEA 3GJ7A 1UPTA 3BORA 3QG5A 1X8JA 2CHVA 4WZ6A 3M6AA 2IYTA 4QBHA 4A8JA 3U7HB 1YZKA 3D8BA 4KITB 2ZM5A 2IC5A 4B35A 3M1IA 5FUXA 3FMFA 3HU1A 4L15A 1PLJA 2ZRNA 4CW7A 3OEEA 1Z3IX 4KSCA 1U99A 4HI0E 2OILA 2BC9A 3LQQA 1T5IA 4AY2A 1WBBA 3ONWA 4JLOA 5EE0A 4LYJA 2NO0A 1OYWA 2BCJQ 1COWD 3GJ4A 5TVKA 5TXGA 4B32A 2QZ4A 4NCJA 1CJTC 1CIPA 4W7SA 3IQWA 2BBWA 4DSUA 1CXZA 2D62A 2JA1A 4LJ8A 2ZIAA 4LJ7A 3B5JA 3MJHA 5JHHB 5EE1A 2BMEA 5B2ZA 1EFRA 2E1RA 2PX0A 5AJZA 5L3RA 2J7KA 1L2TA 3AVVA 4LBWA 3T06B 4TWZA 2KB0A 2HF9A 4PSAA 2UZ3A 3VX4A 1OW3B 4XWAA 3Q7PA 3AVUA 1HY3A 2C9OA 2YC4C 3CPHA 3N2EA 5EE5B 3D6TB 1OH5A 1PLKA 2ZRLA 3MFYA 1A1VA 4IDOA 2C2HA 1S1CA 4OI2A 2VP5A 2IUUA 2GEVA 3U7EB 4JL5A 4TT3D 1ZUIA 2ONJA 2CCKA 1FUKA 4A0HA 4ZCIA 3AVWA 2NO1A 3IIMA 2I1QA 1I4DD 5FL3A 2ODWA 4C9BA 1XEXB 2A78A 2J0VA 4RCZA 1T3HA 3OIUA 4LWZA 1GRQA 2ZYWX 3HR7A 3NDPA 1G1MA 2AD5A 4QHSA 1FW6A 1JR3E 2ZU6A 3LNCA 3TR0A 3X1YA 5JWRA 1QHHA 2QP4A 4P4SB 4LJ4A 1UFQA 2QUZA 4U7DA 2QM7A 4FXPA 2YJTD 3H84A 3IO5A 2H7VA 4OI0A 2PT5A 2XAUA 2J7PA 1GKUB 1QHHB 1M7HA 3U6KA 1MRSA 1CJKC 3LBHA 2HUPA 4P3YA 4PHTA 4TSFD 3PEVA 3N2IA 4XVQA 3KDSE 2PCLA 3ZD7A 2GXAA 2WZQA 1D8TA 3LW7A 3W3AA 4Q48A 3QQ5A 3SBDA 3P4YA 4F93B 3DPUA 1Q1BA 1BH2A 1NSFA 4X8MA 2O8BB 1CR4A 3FKSD 1E98A 1E32A 1UDWA 2IYQA 1SVKA 3QXJA 3T1TA 4PC7A 3QF7A 1NSTA 1OHHA 421PA 5J4YA 3R9IA 1GNRA 4JKYA 1U8ZA 5H70A 1CRQA 4TYQA 1KKMA 4NYMQ 2O0HA 4ASUD 3K0FA 3D7MA 4CZ2A 3BK7A 4TQ9A 3GLFE 3ICQB 4TYNA 3KQUA 3C5HA 3PEWA 4HYYA 4OJKA 1OIXA 1OXUA 1UKZA 4MYTA 4NE2A 3U3RA 2C03A 2XB2A 2QPAA 1P2TA 3NH6A 4JBWA 3GMTA 5KSZA 2WSMA 3KQNA 1W4CA 5FI0B 2W2XA 3WXMA 3R20A 3MG9A 1BMFD 1Q1ZA 5JRZA 1CTQA 1E94E 3NC0C 4TMZA 5A0FA 3E1SA 5LD2C 2JGNA 2IA5A 2GZHA 1I2MA 1E2IA 3U44B 3KQLA 1K5GA 4PR0A 3K9LA 2EWWA 1N25A 4QXAA 4YMSA 4URXR 2WOJA 4GNKA 2DFKB 3EIEA 4KAXA 1G7SA 1T0JB 2DWOA 2HJVA 3RHFA 3VAAA 1ZU4A 3IQXA 1FX0A 4XH9B 3GCGA 5FL7D 1RE0A 1YZUA 3CH5A 2PMDA 3EZ2A 1J70A 4OL0A 5DGXA 3GQBA 3W8NA 5IT5A 1K5DA 4PTLA 3TSZA 3QXSA 4EFNA 1KMHA 1VG9B 1Z0AA 2ONKA 5FTMA 2R62A 2NPFA 1N6IA 1XX6A 1ZCAA 2WHXA 5HCNA 3QPWA 4IDQA 4LZZA 1PLLA 3CONA 3O8DA 1KMHB 1OIVA 3BH7A 5CDFE 3RC8A 2QAGA 1JALA 1WXQA 4OQLA 4C0BA 4A0RA 2OCAA 1OE0A 2VF7A 4G5QA 1YZGA 4Q1DA 1YR7A 1W0JA 4NYJQ 4DIDA 4A0GA 2ZUDA 5AUPB 2WIBA 2NZJA 2QAGB 3GJ5A 1KTVA 3KJIA 2F9LA 4Q47A 2V3CC 1DEKA 4FW9A 1JPJA 2WAXA 2GCPA 2GTPA 4QG7A 2REBA 3AB3A 2IL1A 1N6LA 4JT4A 3TKLA 1KK0A 3K9GA 3F8TA 3G0HA 1LNZA 2X2FA 4OK6A 5EE9A 4HAZA 4RVCA 1S1MA 1O3YA 3EIHA 5FPSA 5KSYA 4TLAA 4MGKR 3SQWA 4N0EA 4PHHA 3GLIB 3LO5A 4B2PA 1JEEA 3P20A 5FOSA 3CNNA 4D4MA 4JZKA 2WWXA 3SC3A 1YE8A 4DLZA 3KXIA 1IOZA 1NLFA 4OK3A 2G1KA 1JB1A 4JLVA 5F3WB 3PUZA 4KJZA 1BYUA 4PHGA 1MV5A 3KJHA 1KI3A 3TUJC 4YDSA 2PLFA 4ZDWA 4OKSA 4M9XA 2XITA 3ZDQA 4EAQA 1FUUA 1S9DA 3WMEA 5C2JB 1SVSA 3VMFA 1VG1A 1XTIA 4FMDB 1N6HA 2ZJ8A 3EZ9A 5GVRA 5HE8A 2ZI7A 4HDQB 3MMPA 5E7IA 1HTWA 3B9PA 4D81A 2F55A 2PJRA 2QMHA 4Q02A 2ANCA 5HR5A 5IHPA 2PZFA 2WKQA 2QROA 2YV5A 4EQ6A 5F9HA 4JBXA 2AK2A 4JLAA 4K46A 4QHTA 4HLUA 5G41A 3BH6A 2L0XA 3CNOA 1DAEA 1E0KA 2PCJA 3G82C 4PC2A 3VNVA 1YR9A 4CF7A 2WMOB 5K8TA 2ZUBA 4ZDKA 3I4LA 4GOJA 4Z51A 2R6GA 3UMRA 2AR7A 5EQTA 4URUR 2W0MA 1Z6YA 4PC6A 3K9NA 2QTFA 4EPVA 1WA5A 5AR1A 1P6XA 1XXHB 1A5TA 1RYHA 4EJSC 1Z0JA 1V43A 2EVWX 2QMOA 1NBMD 4UJ3A 1XPOA 3BGWA 1OJLA 4MRRA 4DHEA 5BYKA 2RAPA 4URYR 3CH4B 1TU4A 1LS6A 2ZAOA 2IF2A 2RHMA 3IKJA 4G5GA 3U4QB 1WBDA 2QN6A 3T5DA 4ESHA 2FN4A 3IILA 2WJVA 3KFVA 1FQKA 2MSCB 3GJ8A 5TMPA 3AUYA 1KI1A 2D7DA 2V1XA 3CRRA 4PZZA 1GTVA 1G7RA 1XDBA 2CL6X 3CR8A 2OUKA 3E5HA 1ZC4A 1DARA 4U5XA 1ESMA 1J7KA 1YU9A 2IYVA 4GPTA 3SJBA 2OCBA 4OBEA 1N6RA 3ZZ0A 3SJZA 1NVXQ 1G20E 1D9ZA 3PVSA 2J3EA 4BFSA 2QMUA 4RZ2A 5FI1B 3SHFA 4TL8A 1P9RA 2IXGA 2J0UB 5BWMA 1R5NA 4BEBA 3MGCA 3I92A 1AQUA 1P62B 3A8TA 4IFBA 4LV6A 3BFXA 4Z1MD 2J1LA 1MABA 5DISB 1ZMXA 1QG2A 4IOMA 2IXFA 4RKFA 3KUCA 4QNRA 3K0SA 1SXJE 4GT1A 4Z54A 4CT4B 3PUXA 1T8TA 4DUGD 4BE7B 2AWNA 2CL7X 1UADA 4DT1A 1TUIA 2DB3A 3SI7A 4GZMA 4X8OA 1U0LA 3NG1A 1CF4A 2DFLA 3RAPR 1VPLA 3KQKA 5EZ5A 3I72A 2XNDD 2ZR9A 1B0UA 1I4TD 4Q7LA 2ODNA 4QBFA 3PITA 1YHNA 5DN6D 2FG5A 4KV9A 4LBZA 3BH0A 2J45A 1E0JA 1NKTA 1IHUA 2GJAA 4LPSA 4LBVA 2W6IA 3D3QA 5JSZA 1E2QA 2GVZC 5FBLB 4LDJA 2ZEJA 1U0HC 4MKHA 2CLDX 3BIFA 3CF2A 4E5UA 1W36C 1T91A 3AUXA 1SKYB 3UK6A 3MUFA 3SE0A 3T5GA 4DUGA 3WHLA 3KKMA 1KYIA 4F92B 1NVUQ 2F3RA 1U94A 3FTQA 4IOKA 4CEIB 3BB3A 2IWHA 1NN5A 5DNYB 2ZRIA 2QBYA 4V02A 3UG7A 1QRAA 4LJ9A 1XBTA 3AH8A 1T4GA 1Z2CA 4H1VA 4DLUA 3VQTA 1M6NA 4NKRA 4KFSA 3U7FB 2FV8A 2QBYB 3ADBA 1FMJA 2A30A 1MO5A 3IO3A 4WOPA 4DRZA 2VL7A 4CGZA 1N2CE 2EYUA 5ANRB 3UIEA 4D26A 4JVNA 2QSZA 2KWIA 2W6JA 2IHBA 4TL9A 3LW8A 2A5FA 4MGZR 4LHZA 3U5ZB 4QGGA 1P9NA 5BQ5A 1E2HA 5FFMA 4IVPA 1XFAA 2H16A 3K09A 1GL7A 2J5XA 1XWIA 3SBEA 4Q7JB 3Q3JB 1AKEA 1Z28A 2WTUA 2OFOA 4PZLA 1IY0A 4A4DA 3K70C 3EASA 5CK4A 2QEQA 2NTYC 3Q7QA 4Q7MB 1TTTA 2XXAA 1ZM4A 1ANKA 1I4LD 3FFBA 5AUOB 1BKDR 1G4AE 2RGXA 3CB4A 4FD2A 4C4PA 3WYFA 4K8OA 2XXAB 4P32A 4UQOA 1G16A 1J8MF 1O87A 3QKRA 1OIWA 3U60B 4B44A 1G3IA 1SHKA 4A2WA 1XNJA 1M7BA 2ZQ5A 5IDVA 1Q12A 1NNEA 4S2EA 5JWHA 2O5VA 2OHFA 4OHYA 3FHCB 2J46A 3CX7A 4X8LA 1JI0A 1NN3A 3QKRB 2F1IA 4AG5A 3QSYA 4G5SA 4QJ5A 5JBQA 2IT1A 2V8OA 4B33A 4LX0A 5L3VA 3U61B 4M53A 3CX8A 1E2NA 2VHJA 4P4TA 3I3SR 3I8XA 2IYSA 4AD8A 1KAOA 2ZR7A 1RJ9A 5F9FA 1J90A 2IYXA 2QGNA 5SZJA 5LPNA 4U00A 3DKVA 2IHYA 4GOKA 2F43A 2VSFA 5FOWA 3SS8A 3WY9A 2N46A 2Q3MA 4GMXA 1AK2A 2BKEA 2H18A 2WOOA 3VR3A 1NKSA 3SJAA 1P2UA 2ZRCA 5KDOA 1ZU5A 2QRNA 4C30A 1TF5A 2IXEA 2F43B 2FSGA 3UWOA 4A6XA 1P5ZB 3L0IB 3QIAA 2ATVA 4ERNA 2AHOA 2KJQA 1BOFA 1A4RA 4L5BA 4FMCF 2VHUA 3AVTA 4PSVA 1G3UA 4BFTA 1G5RA 3NDBB 1XMJA 1EG7A 2WJHA 3PFIA 3GP8A 2ZRMA 4Y0AA 1OSNA 1VCNA 2BBTA 4A8JC 1GAJA 4ACBA 2JDID 1ZCBA 3F3YA 4PANA 5LBIA 3SYLA 3AM1A 2P65A 2IW3A 1XPRA 5G40A 3VR6A 4TLCA 5E7MA 2W83A 3UKDA 2AD1A 1E9CA 1KI6B 3LVRE 4A82A 1II0A 1HURA 2ZJYA 2F3TA 1VYUA 2FFHA 1OFTA 1RRPA 5K8UA 2DY1A 3C41J 1AS2A 1E9EA 3MCAA 3N70A 1G6OA 1HV8A 3CR7A 4HEJA 4US0R 1ZRHA 2J59A 2GEUA 4KYUA 1DAGA 2GJKA 3LVQE 4TMWA 3PJRA 1XD8A 1HUQA 3CX6A 3P4XA 4KLNA 5BXQC 4HATA 3B82A 2ZUCA 2WJYA 4RCYA 2JEOA 2PEZA 4B3GA 2A5DA 4HLQB 1EWQA 1E69A 1UBFA 2GK6A 3CUEF 3A4NA 1FL9A 1CJVC 3W90A 3TVDA 2BWJA 2ZVPX 1ZBDA 4JT2A 1AIPA 121PA 3MWKA 3CIOA 1DAIA 4HUQB 1ZD9A 1E96A 5JEEA 3E70C 2WWYA 3TQFA 1AKYA 2OCYC 3TW8B 2RB4A 2FFBA 3TH5A 4C0AC 2Q0HA 1U9IA 2YOGA 2ZVQX 5L3SA 1GL9B 2FFQA 4DDVA 5K8IA 3NBFA 2C98A 5E7JA 2CNWA 3RSOA 1ODFA 4LC0A 3CRVA 3SNHA 1SXJC 2AN9A 3AF1A 2Z43A 4AKHA 2ZXUA 1YZNA 4DCTA 2O8DA 3IDQA 1HT1E 2A2ZA 2H5EA 3OHMA 2RGNA 1G17A 2V6IA 1R0ZA 2NOAA 4MYCA 1CULC 1Z5ZA 2D4HA 4G3XA 4W5JA 2MSDB 4CEHB 2DBYA 3QVUA 2TMKA 1R5OA 1KI9A 2GCOA 1G3MA 3MAAC 4QGAA 3V4FA 2BKUA 4AC9A 3EZ6A 1VDZA 2D7CA 1TEVA 4M9SA 1DS6A 2NZ8A 5BN4A 2GDJA 4Q4JA 1E9BA 3KXLA 5DI3A 2PL3A 3BXZA 3LAWA 5HTKA 3ADKA 4M1OA 5EP3A 2WVJA 4P31A 3VKWA 2DPXA 1OB5A 4LHWA 5DI3B 4MRSA 2AFIE 2VLIA 2C78A 5G53C 4C0LA 3PCRB 4Q4LA 5UKDA 1W7AA 5FTLA 2SHKA 4TLEA 4PO1A 1AS3A 3K0CA 4B48A 1SZPA 1ZINA 2RH5A 4IJMA 2BDTA 1XCMA 2XZOA 1AN0A 1G8FA 4NCHA 2V54A 1E2EA 4IEIA 4K81B 4QFMA 2ZTSA 1LF0A 4XVUA 3BAFA 3AKDA 5DSZA 3UWKA 5LDDC 1XEFA 3DOEA 3HDTA 3G5UA 1G3RA 221PA 5AJWA 3ICEA 4Q1CA 4PPGA 2ZI5A 5IK2A 3SDZA 3CZQA 3L2OB 2VTKA 2BM1A 1D2NA 4QKQA 2K5UA 2IYYA 3BD9A 3HP1A 3E2IA 3LXRA 2FF7A 1QHYA 1P9WA 2C04A 2JCSA 2IYUA 3K9HA 4N1AA 2ZRJA 4OHWA 4NCKA 4HAVA 4RD2A 4BWYA 4BZXA 1E0AA 1E1RA 4H1UA 3ZVLA 1YRBA 3ZVMA 2FSIA 3IPYA 3SEAA 4NCIA 3GLGE 1MO6A 3Q9LA 4NH0A 4TMKA 1OF1A 1QDEA 2DCUA 3KB2A 5EUMA 3H2YA 1T0HB 1N3BA 4P4UA 1W2GA 2KBFA 3MWYW 1LB1B 3PV0A 1N6NA
chains in the Genus database with same CATH superfamily
3MWFA 5BUCA 1NDUA 4QWWA 4LHVA 2DT5A 2QVCA 5LR6A 2DBZA 3EXIA 3PUJA 1XYYA 4YP1A 4W9NA 4YMVA 3V2UA 5BSGA 3UA3A 5T41A 3D3WB 2RKOA 3GIWA 4ZOAA 1H22A 5CLLA 1KPGA 2HV8A 3DMFA 2FN8A 4M37A 4YQFA 1VL8A 2Y0PA 4Q37A 5DIFA 5DX8A 3DTTA 4CMHA 5HUJA 2VP2A 4IS3A 4ZALA 3SIWA 3T4XA 3NHAA 3FYTA 5EZYA 2ZTLA 4LGVA 1SXJD 4E7OA 4DV6B 1QK3A 1KK3A 1RLJA 1LK7A 1YNOA 3EJ6A 3WNCA 3ZVKA 1NJ1A 5GIOE 2H4FA 3D8RA 3GA5A 4HNAB 1UT6A 3MK31 1XEXA 5B7QA 4LQDA 2AX4A 2C5GA 3A25A 1MT0A 1EBUA 1Y8RA 2VEDA 4L5YA 4UAGA 2QDXA 5ALYA 1Y4ZA 3EG9B 3FGZA 3FNEA 3FMPB 3LT0A 4M7OA 4ZI7B 4IUBS 4QIHA 5DE3A 4LHEA 3SYMA 3ZQ6A 2RHRA 3QY0A 4JKIA 4LBYA 1LBEA 2EAUA 2C3UA 1L4KA 4FW8A 3U7QB 2JGFA 1UDRA 4ZOBA 2YMQA 1ADYA 3CC8A 3DWIA 2I6UA 5D5HA 3TMYA 3JW8A 3WK4A 4BP1A 4BZPA 5KINB 1E92A 3FTDA 4Q34A 4D6YA 1V48A 2BHRA 4F6RA 1C1YA 1GD1O 1YO6A 4WBXC 2C5BA 1QFSA 2WVAA 3ZE0B 2B3TA 1A71A 4F3KA 2CXOA 2NSDA 5NULA 2HRZA 1A7JA 3PP8A 4H3SA 5T4HA 1RBZA 3R6WA 4OKNA 4HTAA 4IOJA 4CF5A 3N6XA 4HX2A 2VT2A 5CYOA 4ER3A 4KYVA 5FEUA 2WKPA 1WZEA 3K0EA 3SQXA 3UTCA 1YS9A 3GO4A 1QQBA 3TIXB 5LQCA 2O54A 1UBGA 4UZSA 1N5LA 3SXUA 1CJCA 1NQUA 3BDIA 3QE2A 4NEHB 4JUFA 2VHXA 3DHWC 3N74A 2PD4A 2Q9BA 4LK2A 3PEUA 2YYYA 3A6KA 5IEJA 3I76A 4OA8A 4GSYA 1U8TA 3CFYA 3JVVA 4KTVE 2VHWA 2WE7A 3L7NA 2QLNA 1VG0B 2D2EA 1Q0HA 4HADA 5A4DA 1D04A 5CLIA 3I04A 1ACJA 4YACA 1N8NA 5ALMA 3ZI0A 3H13A 3GLHB 5AW8A 4QRIA 1WULS 4XFDA 3ZE2B 2QI9C 4RFVA 1SUDA 4F21A 4PSUA 1K7SN 1Q0LA 2H3HA 5EXTA 3F6EX 3RJ5A 2XQFA 1T3ZA 1E3LA 1NLMA 1S9HA 3OPVA 3KTOA 2Q21A 4PM4A 4UJ5A 4Y2YA 4PYOA 4ZO7A 1TA9A 5ETJA 1NNLA 1R8SA 4QTUB 2XGJA 2IH2A 1UUFA 2GPJA 2GAFA 3MJVA 1U28A 4GX5A 2AN4A 2F4NA 2IDKA 3LQKA 4HB2A 5GPBA 3ZHTA 3OZ7A 3TSOA 3T7IA 3AJ8A 4QAJA 2RGEA 3SC2A 4D4GA 2BZSA 1V6AA 1I3NA 1V7PC 1ZK0A 2W5UA 4H16A 5JZVA 5KHOC 3BEDA 4H7IA 5C5CA 3WKDA 3RHTA 2R6ZA 5ALDA 3TSWA 1LLDA 4HEA1 3UB2A 3U44A 4MR8A 2G1PA 4QXRA 5EQDA 2F4VB 5E2AA 4AT1A 2FJUA 1ORIA 1E5VA 4CG1A 4D0NA 1NVEA 3B1YA 5LDGA 4A1FA 2W6OA 2QORA 1JHOA 4PPQA 3H4IA 4UNIA 3AESA 3AR8A 1V4BA 2ZXFA 4CT5A 3WHKA 4NR0A 1RU3A 3RD5A 4F84A 3ANNA 3WL6A 4N76A 4LYFA 2C84A 2GZDA 5FNVA 1ODCA 4HYTA 3ETNA 2B30A 1KYXA 5TMBA 4ZZ0A 1NJGA 2CXNA 3AUFA 4HAXA 3FNFA 3OWOA 4ECEA 4E30A 1EUDA 1Z47A 2RJOA 4M22A 1DOAA 2XX3A 3SGLA 5BQ3A 1A50B 7MDHA 3HA7A 3JQAA 2HA3A 3IAFA 4OP3A 5JT1A 2OVBA 1A97A 4FWBA 2LW7A 4IMIB 5ENDA 5L40A 3PXAA 4TN5A 1BMFA 2N3ZA 3ISVA 1C5KA 3GC6A 4XLZA 2PR2A 4GD3Q 4HVCA 2VDOB 1AMUA 1IWOA 3EQ9A 3NYWA 4P82A 4RF5A 5C53B 2SKEA 4D4LA 1PJCA 4HSEA 4MUJA 1ZNXA 4YC7A 1LJUA 1PG2A 1LQUA 1SK8A 2E4VA 4EY3A 4MV3A 3UJBA 3HO8A 4GZLA 1E99A 1Y1QA 2OYSA 4JROA 4TN1A 2QJWA 5M3BA 5KJ1A 4JLMA 3TWOA 3X1WA 3CXRA 3O8LA 5ALQA 1GZHB 1G5HA 4W9RA 1VLZA 3O90A 3KK0A 3HZHA 4AYWA 5B2FA 2VYFA 4GPD1 1FP7A 2A57A 2DH6A 3DTVB 3KYDA 4IIXA 3JQBC 4B85A 1QNLA 3E81A 5J5VA 1NBIA 4O2AB 5JE8A 3UATA 3GLGE 4FCWA 1NUAA 3I5YA 4QARA 3C39A 1Q2UA 1ZW6A 3KZ1E 1VC2A 2MMCA 4RDIA 1KC3A 5KQSA 3HY4A 3DG9A 3ESRA 1B3RA 3BM5A 2JLZA 3U81A 2FDRA 4QTZA 2H4XA 3TQOA 4MHTA 1HNZB 3S68A 4II2A 1E1MA 5HIKA 1QCDA 4HDRB 2FW0A 4N12A 4XUDA 1WUIS 1ZM7A 3P9CA 3ZLBA 4LNUB 4N5MA 4KXWA 2ATIA 4XWKA 1C9YA 4GLJA 2Q7OE 3A6PC 3K6JA 2PGOA 4RF4A 5K2MA 3K5PA 2B4YA 1G64A 4C0HA 2H8KA 5IBCA 3Q0IA 3RLFA 1GAEO 3GNQA 4HNSA 4ZGGA 3VI4B 3ZGXA 2GZMA 5GTDA 3VZRA 4Y2VA 3O4JA 2FPKA 1M3SA 2IOQA 5I7VA 1SZCA 1TVCA 4AWXA 3D81A 3FNHA 2HW8A 1X6VA 2UVPB 1SZDA 2CWDA 3DEFA 1GTSA 4P7JA 3OCVA 1WW3A 1Z9BA 4FSXA 2I7XA 3VFDA 2ZSBA 4N6OA 1KYVA 4AN0A 3UK7A 2PFGA 2EX1A 1RYEA 3L8YA 1JHVA 2HU5A 5BWCA 2JIMA 4HRVA 4ZT5A 4QU5A 2ZANA 5EFOA 1DKNA 4N7MA 5BOSB 2X9NA 1J9EA 1KARA 1IUOA 1ZH0A 1EZZA 1EFHA 2HLHA 2RGYA 4TZKA 4CF6A 4BNJA 4M1MA 4RKEA 1JDVA 1I10A 4QGBA 4BLOA 1LVGA 4GRAA 2XPCA 4L4SA 2DMRA 4ZCTA 1Z29A 3TQCA 3NOQA 3JATB 4YJGA 4LXIA 3W3ZB 2CXRA 2WV9A 5KB3A 3IHWA 1JDTA 2D00A 4KUEA 4JI7B 4KGZA 5EESA 3WBFA 4MYUA 3WB0A 4JJEA 3THSA 3G59A 3EVNA 3ESBA 3B8EA 4NV3A 5BY2A 4LRWA 1UKYA 4ITRC 4BZWA 2XJ9A 4U7WA 1XP5A 1UMBB 2NTNA 1FNMA 1VG8A 2DAPA 3QSGA 3UKJA 3RU2A 3R0VA 4EF6A 5IC4A 2DKFA 1DAKA 4HDSA 1A8HA 3I45A 5K05A 5HW0A 1XTSA 1FUYB 2QTCA 4G0PA 5FT9A 4NU8X 5JMTA 2FUG6 2GUWA 1IRIA 2O06A 2NP6A 1J25A 4JASB 2NQ2C 3MTQA 1MB9A 1GA1A 3MQ4A 1BFKA 2R4QA 3OOSA 1XYVA 4Q4HB 3PHIA 1BEUB 2OECA 3WGVA 5HVNA 1E4YA 3DLPX 3OCUA 1GIAA 5K8CA 1N36B 1T3GA 4ZOLB 2HCBA 1SKQA 1EAMA 3DO6A 5D3MA 1ZIOA 2YQZA 3OCWA 1IBRA 1T3SA 5JS1A 4ESVA 4WLFA 5P21A 4GF5A 2V3VA 1IZ0A 2J0UA 2A5GA 4B48A 4E3ZA 4BJ6A 4WFQA 1WMBA 1D8AA 2QD5A 1EX6A 1YJQA 2OM6A 4RVHA 4Y2QA 5DTEA 1Q1GA 3CLVA 3H9BA 1RJGA 3PRHA 4V24A 1DKPA 5EJGA 3JQGB 1KY5A 4I0WB 5J43A 3NP7A 1U65A 4GPEA 2WV7A 4INZA 2A9PA 5IM5A 3ODPA 2PRZA 3WTBA 4E2XA 5K0FA 4JOCA 3SZ3A 1JEDA 3MMSA 4R7GA 3FHLA 2GH1A 2W11A 4OQQA 1G3QA 1OAOA 2B35A 4IGKA 1UODA 1R8QA 4NAUA 3L6BA 5TY0A 3RVKA 3EARA 2GF2A 1NXPA 2VPXA 2CV2A 5A4JA 1BVYF 5CA1A 1V45E 2WG1A 1QO7A 3BTSA 1Q1EA 3NO4A 4LTDA 4LZJA 3CVWA 2HLDD 3DKPA 3VOAA 4PLZA 1GILA 1PCXA 3GF4A 4KWCA 3H8VA 1F9AA 3CVYA 2W8ZA 4JUIA 4AROA 4CGYA 4MEAA 5CYPA 1QWOA 2QM3A 4BCBA 4E32A 1VJGA 5FTKA 3R5XA 4O4HB 4DIEA 3D6JA 1XQ6A 3MJRA 3NBXX 4BXOB 3B9RA 5HOEA 1GAQA 1M6YA 1GUZA 2J41A 1MOQA 5DW0A 4Q9IA 3NEAA 5FTWA 1IY1A 5LQUA 2JCGA 4II3A 1COZA 2QXYA 1X1BA 4P4LA 3RO7A 3HACA 4L74A 4MK4A 3L43A 3ZCVA 3ZU5A 5H9WA 2ZM6B 4Z1MA 5IKMA 2B7BA 2ZBRA 2Q4EA 2R44A 2CJXA 2VZ8A 3LP8A 1E20A 3KQQA 4LE1A 4MAMA 5DGHA 5DN9A 4GM0A 3TMAA 4FI3C 5L7YA 1UBEA 2CVQA 4FCTA 1WPRA 1NX6A 2JKVA 5DTJA 2C42A 1ZC3A 1ZEMA 2JAQA 4BFYA 4D8YA 4NNOA 3J81A 4ANFA 4FPXA 1EJ6A 3DE2X 2EFDB 2EJUA 2HSZA 3ND8A 4JOBA 5EUBA 3RS3A 1E2GA 2HFJA 3VI3B 4AMYA 2DJIA 2AFHE 2HLDA 3W78A 1F3OA 1U2ZA 5CA0B 1FSGA 1SAYA 1AO3A 4MVCA 3ZR4B 3L8DA 1N5RA 1GEEA 3NM6B 1CFZA 2QQ0A 4JHLA 4JJKA 3VZCA 5AVRA 2IEYA 4IDAA 4I9FA 3RIXA 2REOA 4RK7A 1A9OA 1OZGA 2H54A 2O20A 3QVGB 4B4VA 1XO1A 4HGQA 2AXNA 4LMBA 5CX4A 5BYBA 5C32A 4Z4EA 1G4UR 2FW6A 3FM9A 4DRXB 1N7GA 3D0RA 2C9MA 4RFSB 4B3TB 4DVJA 3FHTA 3EULA 3VYTB 3UA4A 5C8DA 3M33A 1B43A 1J0XO 2ZIFA 2QD4A 1I1HA 2QX4A 4L73A 4L7QA 3T95A 1F5NA 1ZUD1 1PFGA 3AONB 4DV0B 4RK6A 4QTXA 3ESYA 3VH4A 3DXZA 1WKVA 4BNUA 2ZQYA 3A9UA 1Y3BE 3K73O 4CIXA 1KZYC 2Z57A 3LY9A 4CM3A 4H0FA 2R8ZA 1ODTC 2V4UA 2BP7A 5IAAA 1JR3D 2VAPA 1VHWA 2DWCA 3MSCA 1C7QA 2FW1A 1DVRA 1AMNA 2ATXA 3QHPA 3EBOA 3LHIA 2Y1CA 1CUHA 4O2LA 5EMLA 1TL7C 3TEMA 4ND2A 3B51X 5H82A 3K71B 1Z07A 2R7MA 4XSHA 1VBMA 2O3TA 5HA5A 2Q8NA 3VISA 4RZQA 4B80A 4D9FA 4WXPA 2JIZD 4MAAA 4NJEB 3L6RA 4N8DA 4J4BA 4QEZA 4BMVA 3WE7A 5KTRA 2P8SA 4XM2A 1JFSA 5MN4A 2Q4TA 2RGNC 2ODBA 3HJBA 4Q3BA 3M3HA 1MB3A 2Z5GA 4LNHA 1B15A 4XYMA 4EFLA 1C81A 3I37X 3COWA 1DKOA 2VYND 2XYQA 3OURA 2IY7A 3R3HA 4OGFA 1ZP6A 4QOEA 4RD3A 3IB6A 5EY5B 1JVSA 5TB5A 4EYGA 5HGJA 1KVUA 2FFAA 2REQA 3HJAA 1IXZA 1KKUA 2LPMA 1H9CA 2Q50A 2WAYA 4EKIA 4EJSB 3R9XA 3JZFA 1G5PA 4X1KB 4MQ6A 5B1DA 2R0QC 1BTOA 2WAOA 3BKXA 3OM9A 1GNQA 1O9GA 1YACA 3KKLA 3X2EA 4BO0A 2GVDC 5F12A 4Z4CA 1DJMA 1M1YE 3WZLA 3U2QA 4RIHA 2Y1EA 3ZXYA 4X8HA 2B20A 1RKQA 3O8OA 3NHFA 3REGA 1O4VA 4QYTA 1IOWA 1DCMA 1QMPA 1P1HA 3ZW8A 5A0VA 3BGVA 4BL5A 1Y48E 2BFFB 1ENPA 3RUDA 4J1TA 4B83A 3GZJA 3PQ5A 1CEYA 2JIZA 4KO2S 2NT3A 3OPQA 4ARZB 3K0CC 2FEMA 5ES3A 4EGJA 1NW8A 3UVEA 5LQAA 3ETJA 1G8HA 1WSAA 3THXB 4F12A 4GFDA 1AMOA 5FR1A 3SFTA 2VYNA 3TOSA 5AIAA 5LQKA 4H08A 4EG3A 1HYEA 3K1AB 3GJ3A 3WJ1A 3ZCUA 4CFYA 3JAMA 1NJSA 2WC1A 2DULA 4HTFA 1S89A 5F78A 3I01A 3ZDZB 1HQCA 1ZH4A 3KX2A 2QLBA 1YVUA 4L0QA 3ETEA 2YXBA 2H1RA 2QLLA 5LMUB 2Q2NA 3GRZA 4CFSA 4RZXA 4L72A 4MJ3A 3BIWA 1I51A 3S0JA 3GT3A 1UKVY 1Y63A 4FONA 4NVRA 5BQOA 5MF6A 2GRUA 3CZCA 2F8MA 2PANA 3CBQA 2GBIA 1I8TA 3LCCA 4FN5A 1A0OA 1UBHS 1ZM3A 1XTJA 2JJ2D 1YZLA 1NZDA 1XVAA 3HVIA 5B1SA 4TTSA 3U9TA 2PVSA 3B3FA 4QPDA 3U4DA 1T9AA 5ELXA 4KCGA 1Q0SA 4HCJA 3A2NA 5FH9A 4HSGA 1JG1A 5JZBA 2VR1A 1U0BB 2WY2D 4CCYB 2QVZX 3JSAA 1DPGA 3PQEA 4HZUA 2NUPB 2ZSKA 3FFAA 2GKOA 4LJYA 2C3OA 5AW4A 2SCUA 4G1FA 2HNBA 4CIDA 2H4JA 1R6TA 2V5AA 1SWVA 4RYDA 5FADA 2AFVA 1TZCA 2HBZA 3F0TA 4U7HA 4KXLA 4ZQCB 4NULA 2FUEA 4MJLA 2WM2A 4G9BA 3KOZA 3GH1A 5KTKA 3RFFA 4XR9A 2Z98A 1PTJA 1PNQA 3TW6A 4RESA 3CLHA 1LH0A 3KQOA 1N4AA 2HA2A 1HE4A 3HFJA 5JCJD 3ADDA 2ZCUA 4D45A 5IUNC 2QNBA 4AUNA 3PGLA 5I7FA 5IZCA 5DNVA 3HHPA 1SBNE 1EWTA 3PNOA 3FOBA 5EMKA 2OV1A 1O58A 3RC7A 3G8DA 2ZU0C 3CVJA 2R6R1 1XXHE 4GI5A 1W36B 5B5SA 1SXQA 4CQJA 2D06A 2NU9A 3TSYA 2DQKA 3KZMA 4JEUA 1U8AA 2DRIA 2G9RA 3WKAA 2HT6A 4YMUA 2HDOA 1KO4A 4IHQA 2WJJA 1PNRA 1WMEA 3ZJ5A 2R7AA 3Q2OA 3RFTA 3ON5A 5CAEB 3HXMA 2XB6A 1P1IA 3EE6A 4B82A 1LRJA 1I2DA 1VIVA 3Q2IA 1BXGA 1XELA 3F71A 1T5TA 4RPCA 2JL1A 3RWBA 4J76A 3P9RA 4CDRA 1EBFA 1SG6A 5KNCH 1IPEA 2IFTA 1W35A 4HEHA 1MTZA 3IBCA 4I55B 3FOZA 4G85A 4OGLA 1CUFA 5CDFA 4IFEA 2WE8A 1W4ZA 3UJHA 4J0CA 3AF0A 2GM9A 1YIAA 1X7YB 2H07A 1PYOA 1N8TA 1UK8A 3B13B 2ZAIA 4INOA 1CHNA 4W82A 4CFZA 5JPCA 4XDZA 2WVHA 1FCJA 4N5LA 4MEJA 1JPUA 1L4NA 4CL2A 1MDBA 3KHUA 4WY5A 3RYHA 4DA7A 1U2QA 3PHJA 3ZLJA 5DBFA 3M4XA 4WZBE 4MVJA 1CQIB 1H2WA 1FBTA 3AF5A 3A6GA 5T5QA 4IWYA 2I1VB 1A3CA 1SA0B 4P53A 2Q6VA 3AR3A 1HFKA 5HZKA 3IEVA 3U3ZA 3MN1A 4HC4A 2NVBA 1KS2A 1M2OA 3OCYA 4XW2A 1N0VC 2I4OA 4B2YA 5FPTA 1WEHA 1FTGA 1NP6A 4U63A 1W9MA 1KEUA 4IJVA 4XA8A 1UPBA 2OC4A 4FGWA 2BFCA 1SZJG 2XUOA 4FOLA 1N2IA 4FEAA 4PONA 3W5JA 1Y5RA 3EVEA 4I9HA 4IG4A 3RTDA 2IEZA 2DERA 4ZVOA 2HDNB 3CKYA 5B37A 5KTOA 1SBTA 2F9MA 3R3SA 5AKYA 5IBPA 3VR0A 5L3QB 3I9V1 4DIUA 1DV1A 1VE9A 2RBGA 5JC8A 3H2BA 1RPZA 4IOLA 3YASA 1DRWA 4ZOQI 4BE4A 3GFQA 2RC6A 4MKGA 4RM3A 1MC4A 3ZOKA 1F60A 1F48A 4XOIA 5YASA 2Y0DA 1IUNA 2C8VA 2ZK7A 2O8CA 4PRZA 5I8PA 1RZUA 2QP3A 5AK6A 3WIBA 3Q72A 1MQAA 2B37A 4KR9A 5BSTA 1SUPA 4OI1A 5AVSA 1NW5A 4FFBB 2G28A 2YUIA 1I14A 4Q4CA 5B4VA 3CLKA 2C29D 3U4QB 2VFAA 3GJTA 3ROQA 5JFGA 5JJLA 1NLUA 4Z4QA 1TUGA 1U2SA 2H92A 1QC5A 1RCTE 3ED1A 3OEHD 4G0XA 7ADHA 4JB2A 4TV8B 3RYFB 1OJ7A 1D2MA 1O08A 4M9UA 1Z26A 2WIKA 1GPH1 4ZHQA 4NJMB 4XI9A 2JIRA 1CQPA 2J6IA 4K6MA 4HH3C 3GGCA 5EHZA 3TLYA 4IDEA 1XU9A 1VIAA 1JF8A 3FUVA 3LA8A 2NU7B 2B7CA 4MGIR 1UFOA 3RQSA 4WW0A 2QP9X 4RV9A 5MN6A 1C4OA 1F9EA 2A33A 1DWUA 4G23A 4IIJF 3AETA 2HO4A 3G8YA 2QUIA 3NHWA 4UOEA 1GGJA 4WOJA 3VU1A 1I6WA 3JV7A 3KVNA 3PNQA 1BHO1 2K87A 5I47A 3MYYA 1EHYA 1K9VF 3TYXA 3QLVA 2QI9F 1ULZA 3JQ8B 4A8JB 2ORYA 3LCMA 2IUTA 2YL2A 1GL6A 1Y7TA 2UU9B 1V3TA 1ZWLA 4J9UE 2VSOA 3PHBE 5CDGA 3RVLA 2EFEB 3OEHA 1QGYA 2Q3FA 3EPPA 3C7TA 4JY7A 2VDNB 4OG2A 1N5MA 4X71A 4RVUA 4K9KA 4KQWA 1QH0A 1XD2A 4CU5A 2HWXA 1AJEA 5CFOA 5F4BA 1JHMA 1E18A 1G8MA 2AYZA 2E3JA 3H9EO 3GMIA 3L7KA 4RZ3A 3ZH2A 1IAQA 2XQJA 5IAJA 2LP4Y 1SD5A 5DP2A 4NBSA 4PZEA 4ZAFA 2YHIB 5FPHA 4IXDA 2OO5C 1NT2A 2BMDA 3AVQA 3D0KA 2ZSHA 3L6CA 3FRIA 1E6EA 1RWBA 5DV9A 3VGJA 4GOOD 4UVIA 4C7BA 5ESDA 4PX9A 4BATA 2DXIA 4PCLA 5AJVB 5BW6B 5KQLA 2EDCA 3ZVRA 4CIWA 2WWGA 3QX3A 2J7PD 2Q6KA 3P1JA 4QTTB 4WLNA 4R8RA 2W7TA 2PKCA 1MOSA 3KTFA 4LJ6A 1G8SA 2N1BA 3D3KA 3DMTC 1KJZA 3CF4G 4Y7DA 1GPWB 5C0OE 3L84A 2GPNA 1PKEA 2ZRHA 4BUCA 1PWYE 1SR8A 3RANA 2ZRPA 2CFCA 4RGQA 4XJXA 2OOSA 2PD6A 2B1GA 5REQB 2C9YA 3RODA 1V5IA 1XU4A 1LF5A 2JHFA 4KLRA 3R40A 1EFKA 2FSFA 2W6CX 3KDAA 2IXBA 4DL9A 1WLSA 2OCLA 3IV7A 2CWWA 4LDZA 4GGOA 3UCEA 4TYMA 4BLTA 4UDYX 3NOVA 1G55A 4O4JB 4XJVA 4YWHA 3NHSA 4A0FA 3F3MA 3IEMA 2GBLC 3ZWNA 5EJ6A 3QMVA 5CVDA 1FVOA 1WUJS 2BISA 1OHHD 2GBGA 2OM2A 2UZ1B 5JSFA 5JQGA 4U8GA 2H1HA 4N8EA 4TRNA 4AMVA 4EJ2A 1BDIA 1V4VA 1P4SA 4FMCB 1D0IA 1TQ6A 3LQYA 4RPKA 5HMLA 5BYJA 3RJTA 4DMRA 4PYLA 1OFIA 3UJ6A 2HCRA 4BCCA 3Q15C 2OA0A 4TWBA 1YB5A 1A8QA 1PKXA 2EZ9A 2RGBA 2RHDA 3SF8B 4ZDJA 2AOTA 2V7QD 5ECDA 3TL2A 1RFLA 3I6ZA 4G36A 1HK7A 1JLMA 5CR9A 1I1OA 2JFZA 5AVTA 2ZS8A 2C88A 1TQHA 3DDCA 3Q12A 4K86A 4R2KA 1L4LA 4UBKA 3U0VA 1Q1NA 2Z09A 4GP6A 3G17A 1AQJA 3FCSB 1BE1A 3JR7A 2VQFB 1QE3A 3M7IA 1UQUA 2WYIA 2H0AA 3I39X 1V5FA 3RC2A 1TF7A 2DGDA 2HRQA 2FMKA 3O3NB 3VHXA 3JASA 4CI9A 4C2AA 1XRRA 1U7HA 3HBMA 1W76A 4V0SA 4YGYA 2P9CA 3MGGA 5AJYA 1UFRA 2A35A 2EKLA 4RH1A 1S7GA 4E31A 5EXXA 2NTVA 1BNCA 5K3BA 3D5QA 4ZCMA 3HU2A 2DJ5A 2H4HA 2REXB 3P7MA 5K4HA 1WVIA 1XB2A 3JWHA 1XHLA 4BRWA 2V7QA 1NF8A 2VZ9A 1RRMA 1G66A 2BR3A 2QTVA 4PINA 4WDRA 1PJ3A 1PZNA 3MTDA 5JO9A 2PNJA 5BNIA 1PJ8A 2E6UX 1GVHA 5TLSA 5BN3A 3HEMA 2ZBDA 4UCWA 3PFNA 1XZMA 1EHIA 2C7GA 2CL5A 2CXUA 4KQGA 2E9SA 1GGMA 4RQAA 2WABA 3HFRA 4JLNA 2QE7D 4YCBA 1QYXA 2VBGA 3IAM6 1XZEA 1EX1A 3UMCA 1BJRE 2O2EA 4OHUA 1GTRA 1RQLA 2M32A 4WFIA 1AGRA 3R0XA 3N5KA 5BYAA 1YBAA 2CUKA 1HDEA 1Y37A 4HNUA 3KCQA 1R9NA 1EVQA 2IODA 4BNHA 5EWMB 3KC2A 2OYRA 3RKSA 2NU8A 3RVRA 3DE6X 3P9XA 5K3OA 3DR5A 1CBUA 1PT6A 3KD3A 5CFPA 1J2RA 1PJAA 4CKEA 3ZD6A 4C2UA 3KP1A 1P5RA 1QIGA 3O8QA 5K0JA 3U56A 1TYDE 3NEYA 1SUFA 2FR0A 2OCPA 4QE3A 2A0YA 2UVDA 5HQTA 1H4TA 2J08A 3KJEA 2NX2A 2V9PA 4W8OA 2IPLA 5CM8B 1UPFA 1L7PA 3LT1A 2O07A 3ORSA 1C1DA 4JSTA 4X20B 1DO8A 4B3HA 2QE7A 2R2AA 2C96A 2OBFA 2PIDA 3OQVA 4L08A 4UBLA 4WCFA 1KFBB 1YQTA 2XWPA 4XYGA 5SZKB 1GZUA 1QE0A 2WJGA 3GYBA 4QPCA 2PYDA 1B2LA 1T5LA 4AQYB 2FI1A 4L3VA 1S2LA 4OHFA 4UOQA 5DW3A 4EO4A 2X2EA 4KI0A 1AURA 1KAQA 1E3JA 3IMCA 2DPGA 2JRLA 4XIGS 1U3GA 2HKIA 1UJ2A 3CVOA 3D6HA 1KY4A 4QUIA 5FKJA 1SCDA 3FBGA 4KJXA 1F2UA 1MAHA 1LVUA 1S3IA 2GARA 5DIZA 2Z4RA 4YASA 3WWZA 4ARSA 1GTJ1 2H1VA 2V03A 2ZB4A 4D9JA 4PFJA 4DWVA 3IE0A 6AT1A 3T54A 3WAJA 3A1NA 2W4QA 4K9RA 1T9HA 3K53A 4G5OA 4KE9A 4M0FA 3HJRA 3QXGA 1CRPA 4M1SA 3UGKA 4DLNA 3E48A 5KMGB 1XZBA 2YMLA 3K1ZA 4XYEA 3GFPA 3DVSX 2W70A 4MVJP 4Z8YA 1QCCA 2I4LA 3N9IA 5DBEX 5JZOA 4EB0A 3MILA 5JNWA 2FWJA 4FP9A 2FOLA 3MM4A 5JEDA 3MAGA 1O6BA 2YXEA 5DLYA 5AT1A 3W04A 4AJHA 2QAIA 1L8QA 4Z6KA 5CB4F 5ITWA 3KB8A 4H6WA 2OHIA 1PJRA 4HQNA 3RU3A 3MCUA 2YV2A 3AF6A 1V16A 4AK9A 3KKZA 4YREA 1ABFA 3H99A 2ON6A 3W1EA 4F86A 3OY7A 1F2DA 1PUIA 3T3IA 2J9ZB 2J07A 3FYDA 1QG6A 2FPWA 2GPWA 2JVKA 2PXCA 1W1IA 3PGMA 3V4OA 2PZGA 2DY0A 2VT3A 1V95A 4P0PB 1TAUA 4A7PA 2ID7A 2HQRA 3QUBA 3EPKA 1CY1A 3MEQA 3VC1A 3A9SA 4KBGA 1N7HA 1ONPA 1F1BA 3AERB 3WYDA 3OI7A 3BXPA 4WLUA 5CT4A 2MSEB 1ZI6A 1P3DA 4ZAVA 3TZLA 2Q4DA 2YKGA 1H65A 1FYEA 5IMBA 4I4LA 4Q0MA 3Q11A 1R6XA 5J4KA 4KMMA 3SY8A 1C3LA 2F8SA 4KPGA 8ABPA 2C4TA 5IG2A 2EJWA 3NJRA 1AVTA 3QEOA 4BS9A 3U3KA 1GQ2A 2QT0A 3LUGA 2LCFA 2R1VB 4IH9A 3TTXA 4Z5XA 2R8BA 4BLSA 3V4PB 3H9GA 2Z5FA 3NRBA 4YRIA 3ZW7A 1S6YA 1JVBA 3MGAA 4TT8A 1YZYA 2PMCA 1XDSA 5HIJA 4ENTA 4DUYB 3MZ0A 3L7OA 3JD1A 1YFJA 3F7MA 5K3AA 4AL4A 5IT4A 2XMBA 3INRA 4EQ6B 3K05A 3GEPA 1E58A 1DIRA 4H17A 2DF8A 4UEJA 1DXOA 1OILA 2WF5A 2VRWA 2IK8A 3O73A 2Q45A 3WO0A 1KP2A 2BFMA 3DL7A 3ZUGA 4KWTA 1KSFX 1L5QA 2LCQA 2W42A 5AW5A 1GKYA 3L06A 1IAVA 1NI4A 2AUTA 2OXRA 3EW9A 4MWTA 4EB8A 2FHSA 1IEWA 1JIKA 3OFJA 9LDTA 1U3DA 5CD9A 1N5IA 4GR5A 1SELA 3T41A 2YOHA 1U90A 4Z86A 2IUSA 3UPDA 3QF4A 4YA6A 3E9EA 2NAPA 3DL0A 4RAOA 3TINA 4YMIA 1DRKA 3RREA 4KNVA 4BNKA 4NEQA 1ZGAA 4HPWA 4BLQA 1BX1A 3QENA 3LSYA 9GPBA 4I4IA 2PV0A 2V4ZA 4OUDA 1K7CA 5B1HA 2G25A 5KCMA 2Q1WA 2ZRDA 1WWKA 3S7ZA 1WCIA 2FWRA 4RMNA 3RRJA 3ER9A 3U3OA 4LYHA 2G9NA 1HO3A 1PSWA 3BJIC 4CKCA 1A98A 1UJ6A 3VC2A 2G1AA 5TVGA 3RJZA 3EQ7A 3R5KA 2FEXA 2W48A 3HCPA 4XIJA 4TUYF 1XTVA 1UK6A 3K9QO 2BTQB 4H7JA 4JL8A 4K8RB 4MUIA 3TK1A 4LIPD 1ECJA 1VSVA 1ND5A 1OX4B 4R83A 5EXEA 2WPDA 1DE0A 2GYVA 4QHYA 4QBIA 1K75A 2VJBA 4WBSA 4ZC1A 3LPCA 4EJMA 2WF8A 1YE3A 4ZPJA 3DAYA 3PQCA 1ODSA 2W6ID 3RS0A 4M21A 1AUOA 4OCZA 2FPOA 4KBYA 3A9CA 1S3SA 3PCXA 4PAQA 4PC3A 1G6KA 4A91A 3TIFA 1TCUA 3AVPA 3AWIA 3MVEA 1ZNWA 3A1WA 5CGQB 3PT5A 4BUZA 3T34A 1DELA 1LBTA 3SFZA 4CLRA 2AOUA 4RK4A 3JQBA 1FU8A 5TNXA 1G98A 1GZVA 4I4TB 2MINB 3IUSA 2YNMC 3UO8B 3R7NA 3OESA 3FYUC 1K7FB 3LSTA 7ABPA 5I7SA 1M6WA 4PX2A 1OWLA 2CVOA 2LTAA 4L5CA 4ARIA 3D7RA 3STXA 2O05A 3NVAA 5IABA 4INAA 1RRGA 3PDIA 1USGA 3T7SA 3NJ4A 5TF0A 1H23A 3CXUA 2EJBA 2CHGA 4O2RA 1QPGA 1GGHA 1JQ5A 4WHMA 4A9AA 4BWVA 3OJ0A 4DT1B 2IS4A 3R41A 4E88A 1AKWA 1NM5C 1Z6XA 2PH5A 2QRVA 2XD4A 4QOJA 1RZ3A 3N1UA 4MI3A 1ARZA 3RVBA 2C7RA 3FROA 2GCNA 2MJLA 2B9VA 3W0LB 3EVAA 3PA8A 2VS1A 3OQIA 3QOFA 4KB5A 4P8RA 5FI5A 4D0GA 2ZUUA 1MV8A 2ZYHA 4UAJA 3X1JA 2V3WA 4KVGA 4M1QA 4DBZA 2WWFA 3PZBA 4FE3A 2OXFA 1HQKA 1VMEA 3GHYA 3ZYCA 1Y98A 5JSZB 4J90A 3EIQA 4JJ6A 4KYTA 3MC1A 4FXOA 3THOA 3EPRA 4CKYA 5ICSA 3ZCXA 1NFFA 2Z0MA 2FPIB 4B79A 5K0TA 5E0KB 1EB8A 1H2EA 1ZH8A 2FRDA 4FN4A 4N9QA 4R2JA 4L78A 4B74A 2AZXA 2D2IA 5AVWA 1EUCA 4DKJA 4RJLA 3EWSA 1DCKA 4UXIA 1V9LA 1DKLA 1SUEA 1VI6A 2P1DA 1KI4A 5B57C 1C9EA 2PSHA 1E6CA 3QX7A 4Y6LA 1JIVA 2X2OA 2GMWA 3K3PA 4H6XA 5A3QA 3DBLA 3WMRA 2YMPA 4GM4A 3E0XA 1SUSA 4QULA 4KXXA 3ANTA 4TXHA 2WIFA 4QDKA 2JBHA 1RAEA 2LIVA 2P27A 4LZPA 4W5WA 2PLNA 4EITA 1GZ4A 3PXGA 2GWRA 1JECA 3G5MA 5L6LB 1E1LA 1YBFA 5FUMA 4M99A 5IULC 3TG8A 1IRXA 1JDBB 1VPEA 3JYPA 4E33A 2C2GA 5CFMA 3LL7A 3NUGA 4BC0A 2DLCX 3BC1A 4E3WA 1C3OB 4I9NA 3EC2A 1TPYA 2CEKA 2ZBQA 3TEJA 3AI1A 1SWWA 1KAEA 3UQZA 4C4RA 3WWCA 2WB2A 2MTBA 5G2OA 2AI1A 1Y89A 1L3CA 4JUDX 4H4EA 3SYKA 1BA2A 4E5DA 1OXTA 3X2SA 4RTRA 2RK4A 2NMVA 1R8XA 1P39A 3KB1A 1PO7A 4FFRA 5AK5A 1E2MA 1TK9A 4FILA 1MJHA 5HF9A 4F5ZA 2WSSD 3OJFA 1UOOA 4FBLA 1NASA 2YZGA 3LBAA 3QTBA 2FPMA 3HNPA 3IV6A 4MS4A 1ZGCA 3EEQA 4LPKA 3QKSB 1M34E 1NY6A 3STTA 4PGAA 4D9EA 4DMLA 1IM2A 4RTLA 4R9UC 3VC7A 4YAGA 1FBNA 2XIQA 1YIDA 3ABZA 2V4MA 2Z3VA 4M1WA 3VJLA 1YL6A 4IJWA 2Y9PB 3SZUA 1ZH6A 3WWEA 1XL1A 3DNMA 1K0FA 1U2GC 3T94A 2EFHB 3D43A 1ZY2A 1QHEA 2TSYB 2W2KB 1ZJJA 1IH8A 2B4AA 1RM5A 2R79A 2X3YA 1YKFA 2ZUVA 4P3PA 3O8RA 1TYCA 3K1YA 4MV5A 3FY4A 4RZUA 2WQ7A 3UJ9A 2PT7A 5DGIA 2JAWA 2VBCA 1GRRA 4JVSB 2BFBA 2WSSA 4OD0A 2JH9A 5BQXA 1TMKA 1I5EA 1YC2A 2IVFA 3ECAA 3TUIC 1CK4A 2FVYA 8ADHA 3OLQA 3RK0A 3C3YA 4C3ZA 4NZNA 5CDUA 4NP6A 3JD4A 3TPFA 1X9GA 1XZAA 1KO8A 3RDPA 1NP7A 3ZV5A 1NVWQ 5G02A 3SC6A 3NEJA 4IFIA 1DX4A 4OYRA 3B6MA 5C3MA 4W63A 3KLOA 2ZJZA 3BHJA 2LRHA 3OJWA 1Y3AA 3T1NA 3ZGVA 4COKA 3HYCA 2EWVA 3O8BA 2R8RA 2QGZA 3VR1A 1ESCA 2Z6AA 2NN3C 1L5LA 4CM7A 1S2IA 3V7NA 3KCNA 2VNIA 1QS0B 1W87A 1XTQA 5AJHA 3RRMA 3AR6A 3NH9A 1L7EA 4E1BA 1DIGA 1KFJB 3TZBA 1MPTA 4EHBA 3HSSA 3P2KA 3BB4A 2DWQA 2ETXA