4MQ4A

Crystal structure of hpnmt in complex with bisubstrate inhibitor n-(3-((((2s,3s,4r,5r)-5-(6-amino-9h-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-yl)methyl)thio)propyl)-1,2,3,4-tetrahydroisoquinoline-3-carboxamide
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
264
structure length
264
Chain Sequence
b'APGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
publication title To be Published
rcsb
total genus 97
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2013-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4mq4A00
4ER7A 1ORHA 2JHAA 4AZVA 2CL5A 2AVNA 3F4KA 4FZVA 3PFGA 3HVKA 3ORHA 5GIPE 4PIPA 3T7RA 3LCUA 2CKDA 4QTTB 2Q41A 3PX2A 3FTCA 5K0EA 2PKWA 5HEKA 5DXJA 3E7PA 3UFBA 3C3YA 5F2OA 5LQRA 2AN4A 2Y1WA 4GOMD 5FADA 5T64A 4HG2A 1NBIA 2CMGA 1X19A 4E31A 2FRXA 2PXCA 4XCXA 4QQNA 1OR8A 2AOVA 1DL5A 3FUTA 4RTLA 1EJ0A 3BUSA 3BT7A 2N47A 1N7JA 3RW9A 3KPJA 5FQOA 3OZSA 4GOOD 2NXCA 4OBXA 2G71A 3FTEA 5DWQA 1I9GA 2FK7A 4GOND 4PYQA 5HIIA 4CTJA 4PYKA 3ERCA 3GRVA 4KW7A 3DMGA 1O54A 1ZQ9A 2PLWA 1P39A 2QYOA 3JWJA 3MAGA 2Y1XA 4GEKA 3TFWA 2GH1A 3PTAA 1Z3CA 2PX8A 3KPVA 1KP9A 4LWPA 4PGGA 1TW2A 1IXKA 5E9WA 1SQFA 2IPXA 2C7RA 1VP9A 2IBSA 1QAOA 3KQVA 3EGEA 1FP1D 5DRYA 2XYVA 3LX6A 2O05A 4XUEA 3LKDA 1Q0SA 2HTEA 1UFKA 3CJRA 3MGGA 3GNLA 1JG2A 4YUVA 3GRYA 5GIOE 3OCJA 3EVEA 2AOWA 5EZSA 5LQCA 1XXLA 4F84A 4MTLA 3ELDA 2FCAA 4DZRA 1U2ZA 3LSTA 4CXMA 5K0JA 3ER8A 4BP1A 3DLCA 3FUXA 5DT2A 4RTNA 3M33A 5DM0A 3KQPA 4XUDA 4QVGA 3M70A 1P91A 2OB1A 3SSOA 3TKAA 5EKUA 1JG1A 5FA8A 5ICCA 4ER3A 1DUSA 3UA3A 2JG3A 2IP2A 3P2IA 1I4WA 3OZTA 1KIAA 2CWWA 1FBNA 3BWCA 3P9NA 4P7GA 3GDHA 2VS1A 4RVHA 2YTZA 4MHTA 2V7EA 3GO4A 3TM4A 1B42A 1QAMA 2ADMA 2I9KA 4YV2A 1KR5A 3B5IA 4KVZA 1M6EX 3FYDA 3UJCA 4EQZA 5EPEA 2IBTA 1P1CA 4OA8A 5CVUA 4WXHA 3R9XB 2VP3A 3TLJA 3M6XA 5DTMA 3THSA 4PYNA 3V97A 3KR1A 3KHKA 5DM1A 5BP7A 5ICGA 1KPIA 2LD4A 1RJFA 2PX2A 3G5TA 2FHPA 3CJTA 2DPMA 3UJBA 4BY9E 4GC5A 4V0QA 3M6VA 3MERA 1G8AA 4GBED 2QM3A 4PCLA 4RVDA 5DX0A 3IEIA 3SSMA 4RV9A 2DULA 5EIWA 3BZBA 2OB2A 5FUBA 3KQTA 3EVCA 3L8DA 5K0CA 5FQNA 2AOUA 3DTNA 3ELUA 3I9FA 3ME5A 5EIFA 1AV6A 3MTEA 5LQNA 2AOUB 2YUIA 5MHTA 4O29A 5K0FA 4DMGA 5KYGA 3P2EA 2IH5A 3DR5A 3EGVA 4ZTBA 2OO3A 4B17A 2P35A 5K05A 1G6Q1 3LHDA 5FHRA 5K0BA 1M0EA 2BH2A 4PWYA 3KQQA 2OKCA 4LWOA 4PCAA 2JJQA 3LBFA 1RI2A 2ZFUA 4QPPA 4X60A 3CKKA 3OFKA 5LQUA 3OU2A 2P1DA 2VDVE 3DUWA 3G2PA 3QV2A 2P40A 2R3SA 3G8AA 2I6GA 3KQYA 2XVMA 4IWNA 5E1DA 2ZTHA 3TQSA 2OZVA 4LG1A 3TOSA 4A6EA 2EX4A 3ER9A 3NJRA 5CUQA 5E2AA 5G02A 4RTSA 5FHQA 1BOOA 3K6RA 3HM2A 4C05A 4C06A 3MCTA 2O0LA 4Y2HA 3EVDA 3VC2A 2UYHA 2OY0A 3T7SA 4M37A 5K01A 8MHTA 3HA3A 5DLYA 3V8VA 5EHGA 4ER0A 2B9EA 1NW8A 2XVAA 3A26A 4OA5A 4GUAA 2O07A 1G38A 2ZSUA 5GWXA 5EOVA 3NVMB 4QDJA 1N7IA 3VSEA 2NP6A 1YF3A 1NKVA 3FPJA 3G89A 4X63A 5HILA 1Y8CA 4YV1A 2BZGA 2ZVJA 3MHTA 3MB5A 1XJ5A 5K03A 1KHHA 5DSTA 5C1IA 3UJ9A 5K0LA 3TPZA 1KYZA 5JR3A 3FTDA 3E8SA 2VDUE 3KU1A 3GU3A 5C9ZA 5DM2A 3EMBA 4KDRA 3FRIA 3KPYA 3EPPA 3M6UA 3Q87B 4HH4A 4K6MA 4WVLA 4E2XA 1SKMA 1FJXA 4M38A 3GCZA 1G60A 3KR9A 4BLUA 1X1DA 4EKIA 3T7TA 4HGZA 2VDWA 4V0RA 3BGVA 3LPMA 4GC9A 1SUIA 1ZKDA 3LCVB 3GWZA 2QRVA 1V39A 4ATNA 2GPYA 1XDUA 2P3QA 4X41A 5CVDA 5GINE 5DRTA 3PB3A 1VPTA 4YUYA 3DXZA 2AR0A 3EGIA 4RTQA 3B3FA 5U4XA 2XYQA 4CWAA 5K09A 3LKZA 2C7PA 2ZBQA 3C0KA 2ZBPA 2I7CA 4F85A 1L9KA 2B25A 1SUSA 4DKJA 3KR0A 3JWHA 4DQ0A 2UYCA 3EVBA 3KQWA 5H02A 1YB2A 1ZHFA 2PSSA 2JH9A 1FPQA 3DOUA 5KS2A 3ANXA 5E9JA 3FUWA 3TKYA 5EMJA 1EQAA 3UJ7A 2Z6AA 3IHTA 3ELYA 3OZRA 2AOTB 3P8ZA 5E1BA 4C4AA 5KQRA 2ESRA 5EMKA 4YUWA 1SVUA 3FRHA 3OPNA 3TMAA 2AZTA 3WSTA 1ZG3A 1SQGA 1XDSA 2NXNA 3B89A 2JHCA 4E30A 4HGYA 4OX9Y 2OPBA 5HIMA 3I53A 2EJTA 5HIKA 1NT2A 2WA2A 3C3PA 3PLAE 1KPGA 3M4XA 1R6AA 2ZW9A 3BXOA 3HCEA 3Q7EA 5T6BA 2G8NA 3KPWA 3P2KA 2G1PA 4OQDA 1WG8A 1XDZA 1NW6A 1VL5A 2B78A 3BKXA 5IH3A 3B7PA 4YUXA 4GF5A 5EG5A 3SX0A 1IY9A 1KPHA 3O7WA 4QQKA 1ZGJA 4R8RA 1AF7A 3CGGA 7MHTA 4KDCA 1WXWA 3TR6A 1YZ3A 3IYLW 1AQJA 1JG3A 9MHTA 3DP7A 3CC8A 5ERGB 3FPFA 3GGDA 2FPOA 5LSAA 1EAMA 2EG5A 2UZ4A 3G2MA 3LDFA 3NDJA 5FCDA 3LDGA 3PT9A 4MIKA 3U81A 2IH2A 2AN5A 2HR1A 5FULA 4G56A 3RIEA 2ZZMA 2WK1A 3NTVA 5E1OA 5EZQA 5EMLA 1JTEA 4R6WA 2ZZKA 3VYWA 5F2NA 5CCBA 1TW3A 2YVLA 3E05A 1VIDA 2Z6QA 3X0DA 2AS0A 2F8LA 3O31A 3QOWA 4HTFB 3UJ8A 3HTXA 2PXAA 2CMHA 3CCFA 4HTFA 4OBWA 5T67A 4DM3A 2YXEA 5BW5A 2PX4A 3NMUF 3THRA 4X61A 3BWMA 2GS9A 1JG4A 3T0IA 1IM8A 1P1BA 1BC5A 1NV9A 4KIGA 3SR4A 3LBYA 3PS9A 2IIPA 3KQSA 1VLMA 2IFTA 3G2QA 5CM2Z 1NW7A 4RTPA 3IV6A 2PY6A 1INLA 2IDJA 2YXDA 3AY0A 3FYCA 3R6TA 5DSXA 5EHIA 4E70A 4YMHA 4RTRA 3I5UA 5GM1A 1X1AA 1QANA 3NWEA 3UWPA 1L3BA 4E2WA 3SMQA 3S68A 4KWCA 2O06A 5D1HA 3HCAA 3KKZA 10MHA 3I64A 1MJFA 5E9QA 1VE3A 5M5BA 3D2LA 4EKGA 3SM3A 4UOEA 1D2HA 4FS8A 1QYRA 5K0GA 1R18A 2PVCA 4QVKA 4QDKA 1HNNA 1RI5A 4FR0A 2PXXA 3FZGA 5DTRA 3DLIA 3R0QA 4FSXA 1G55A 2G72A 2GB4A 2K4MA 3A25A 4EMSA 1JR4A 2IDKA 2ZWVA 5E8RA 2A14A 4PIMA 4C03A 2PJDA 1VP3A 1RI4A 3G8BA 5CCXA 5EGSA 1ORIA 4R6XA 3P9IA 3OE5A 4MQ4A 3FTFA 1D2CA 2V74B 3O4FA 5EC8A 4ER6A 5KVAA 2NYUA 3DULA 2C7OA 1NBHA 3GXOA 3LGAA 4RYLA 1YFLA 5HFJA 2BR5A 2C7QA 2NP7A 3K0BA 3P9KA 2H1RA 4P7FA 3EEOA 1YZHA 5GP1A 5ICFA 3A7EA 4P7KA 2ONZA 3P71T 3SGLA 1G8SA 3R3HA 2BM8A 3HCDA 1YUBA 3FPEA 1EJ6A 2PT6A 4R05A 4X1OA 3TM5A 3P97A 3B3GA 2UYOA 2XYRA 3SSNA 3PFHA 2PV0A 3UZUA 3AXSA 5E2BA 1ZGAA 3AJDA 4M7RA 5EMMA 3GRZA 2UYQA 3FPGA 4RWZA 1JQ3A 4BLWA 2E5WA 4KRGA 5EQJB 4RTKA 3SVZA 3MTIA 4ISCA 5DXAA 5CVJA 1UIRA 2HNKA 3GRRA 2PX5A 3GIWA 3HCFA 1WS6A 3M6WA 4HSGA 2ZULA 4ER5A 3B3JA 2GA9A 5CVEA 4PONA 2PWYA 1Q0TA 3FUUA 2FYTA 4NECA 4Z2YA 3PVCA 3ID6C 1XCJA 3HA7A 5HOQA 3HVJA 5LR6A 4C08A 3OU7A 4YMGA 2ORED 2R6ZA 3KR2A 3UJAA 4KIFA 3A7DA 4DCGA 3JWGA 5DX1A 3KPUA 2XBMA 4IV8A 1F38A 4FGZA 3DMHA 1AQIA 1JTFA 2ZBRA 2KW5A 2ZZNA 1EIZA 3G2OA 5KQSA 2I62A 2PWPA 4GOLD 1XVAA 2H00A 4PYLA 4PYOA 3EEYA 5GM2A 1L3CA 5FWDA 2PT9A 2QRVB 5E8JA 5FWAA 3HVHA 5BW4A 1UWVA 5K0NA 4GQBA 1X1BA 5P8WA 3UA4A 2BM9A 2JH8A 3EVFA 3DXXA 4U7PB 1MHTA 1M6YA 2NXJA 4E32A 4RX1A 1F3LA 1D2GA 4PYJA 1YFJA 4P58A 5DM4A 3PX3A 2PBFA 3G7UA 1XTPA 4FT4A 5K8VA 3CBGA 2YQZA 3QOXA 4Y30A 1KYWA 2VZ9A 3NDIA 2B3TA 3DH0A 4AZTA 3AXTA 3GRUA 2AOTA 3HNRA 1VBFA 2GAFA 1X1CA 1T43A 5DPMA 5ICEA 1R8XA 5EEHA 3BGIA 5LQKA 3BKWA 1TPYA 3EMDA 3LL7A 2ZWAA 3BGDA 2FK8A 1H1DA 1JSZA 1QAQA 4RTOA 5B1SA 3DXYA 3UJ6A 4YUZA 3G88A 4CKCA 2ZIFA 3HCCA 4HC4A 3SXJA 1WY7A 2IGTA 3G5LA 3HP7A 4A6DA 3H2BA 2O57A 3EVZA 2HMYB 4RTJA 2AOXA 4YV0A 1JQDA 5HIJA 1R00A 3KQOA 2HV9A 5FTWA 3EVGA 2ZIGA 4RTMA 3GJYA 2ERCA 1RJGA 5BXYA 1EG2A 4P7JA 2BR3A 4DCMA 5CD1A 5IKMA 3NVKI 1PRYA 2P7HA 2OYRA 5CVVA 1XCLA 2NXEA 5DTQA 1I1NA 3VC1A 5C0OE 4FSDA 2AN3A 4BP3A 3I58A 4MWZA 3OE4A 3BWYA 4C07A 1WXXA 1L3IA 2EJUA 2P41A 5E1MA 4QPNA 4FP9A 4E2ZA 1NV8A 2OBFA 3HVIA 2YX1A 4JXJA 5F2KA 2IH4A 3MCZA 1NE2A 4C04A 3C6MA 3NWBA 2PGXA 4AZSA 2ZIEA 5FA5A 2P7IA 3DMFA 2H11A 2QE6A 3R24A 2QY6A 1O9GA 5EVJA 4IKPA 2HWKA 3HA5A 4PYIA 4E33A 4EVIA 1R74A 1JSXA 4CKBA 4AX8A 3OU6A 1KXZA 1QZZA 3CVOA 5LQJA 1RI1A 2JHPA 5D1NA 1VQ1A 1HMYA 2B2CA 5EEGA 4HRAA 1L1EA 4AZWA 1SG9A 3HEMA 2ONYA 5DX8A 4EK9A 4R8SA 3ELWA 3UJDA 1PJZA 2ZLBA 1O9HA 4POOA 2BR4A 1RJDA 3TRKA 4E2YA 2GLUA 4L7VA 4AUKA 1BHJA 3A27A 5CIYA 3UBTA 3MQ2A 4OQEA 2Z6UA 4RVFA 2EFJA 3FUVA 4PYMA 5EKXA 4PNEA 1FP2A 4PINA 5HZMA 4IV0A 2YXLA 1BKYA 3FPHA 5GOZA 1JQEA 3CJQA 3LCCA 3JWIA 3LDUA 4QTUB 2ZCJA 2G70A 4DF3A 4DA4A 4M36A 3RODA 3KQMA 4U7TB 1RI3A 4CTKA 1RJEA 3LECA 3C6KA 2WA1A 3REOA 4H0NA 4CKEA 2NNWB 1WZNA 2P3OA 2P3LA 3P9CA 2YR0A 4FT2A 4RSRA 1NW5A 4BLVA 3A4TA 2AVDA 5JUWA 3E23A 3AWIA 4RVGA 3EVAA 4LECA 1R8YA 3HCBA 4XUCA 1DCTA 5LQAA 3BWBA 2OXTA 4F86A 1N2XA 3NW9A 1NW3A 2P8JA 3OFJA 4PGHA
chains in the Genus database with same CATH superfamily
4MQFA 3F6RA 3FHOA 3X1DA 4KQ6A 1WNFA 3HL4A 5KYKA 4XOIA 2QTVA 1IJBA 2PJUA 4TXNA 2FEOA 5AT1A 3JY6A 3N2LA 3OIUA 1AC5A 3F67A 4OHFA 3UYLA 1ZOOA 4GR9A 3BD8A 1JBQA 4HG2A 1LRLA 3FOZA 1FNSA 4CM7A 3UJ3X 1CUFA 4JBYA 2J3KA 4AWBA 3NIFB 1UBHS 1EJ0A 1IE3A 1PJRA 3D4BA 3WGZA 1W5TA 1AGXA 3Q88A 3ZX4A 1V48A 3CSUA 1ZMBA 3UEOA 2OTCA 1NWCA 2VDPB 3LOQA 1P62B 4HXYA 5MDHA 2NPFA 4HLQB 2VOJA 1E6LA 4IIDA 3CNNA 5KNCH 1YDWA 2DFVA 4IG4A 1WCIA 3F3KA 2NTJA 1NSFA 1USKA 3DMGA 3PQ5A 4RY9A 4UJ3A 2PUWA 3WGNA 4AT1A 1PZEA 2EFDB 5HXAA 3ENNA 3ZHRA 2DH6A 3CO0S 4LOAA 4OJKA 3GG9A 2OA0A 2Q1WA 4Y9RA 3OSZA 4BNUA 1IXRC 4DCJA 3FSRA 3DPIA 5AVWA 4ENWA 4QUBA 3EGEA 3RYIB 3LT1A 1VCIA 4LFBB 3GARA 4BO8A 4NBNA 2JGDA 4CL8A 2QL7A 3GNLA 1SR8A 3E03A 2JGDB 2IC5A 2CXSA 2R7LA 2OBMA 3GEBA 1RQGA 2PSDA 3DFIA 3IE1A 1RQLA 3ZNNA 4ZT3A 3V2HA 4B2YA 2EQAA 4TRJA 2QWXA 3JVIA 1RYZA 4DWJA 4ZVSA 4EO7A 2Z8XA 3P0HA 1W47A 4UASA 3EOBI 2BUAA 4MPPA 3ZQ4A 1RKVA 3K8YA 3NGXA 4LVOA 4O0LA 2JFQA 2C1XA 4Q9IA 5DM0A 4BEJA 1OBFO 5A7HA 3KSRA 2BGKA 2QPOA 4IJVA 1FDWA 4LSWA 3SSOA 1TRKA 1PYOA 3A8TA 1DBVO 5KCMA 1DLIA 1U8EA 1YSCA 2A1UA 1VIAA 4JC0A 4DPKA 4HEA6 3OMXA 4YDQA 5AH0A 1WXQA 1KIAA 1LPSA 1E8MA 1FBNA 1LJ8A 3QWAA 1ZMTA 2V4UA 4V3BA 3UH0A 4FMPA 2P77A 3AI1A 4IDCA 3CB4A 3DO5A 4HGQA 1RHKA 1XZHA 3S28A 2Q4TA 5KI6A 1USWA 3IALA 1DX4A 4FXPA 3NO4A 5ECWA 3VR5A 3V97A 4ASUD 2KE5A 2YFKA 1O97D 1HE8B 1ND6A 2PQMA 5ICGA 3E8XA 3JZFA 4GVLA 2Z4SA 2WNSA 5FTMA 3E48A 1AS3A 3GQBA 2PGDA 4RVDA 3ZJ5A 5L8VA 4A0SA 4AJ4A 5D00A 3B2QA 4M7WA 3L0BA 4YCSA 4A8JB 4CIWA 4AS1A 2Q3LA 5I7RA 1DKPA 1YQXA 1U3GA 3LHFA 5EIFA 2B7BA 2HRCA 1A5ZA 3E7FA 4P3PA 4R1SA 1K7XB 1ZPDA 2MT9A 2QQFA 5FO0A 3VYTB 4BFLA 3VX4A 5LP1A 4WLNA 1G8YA 3H86A 1FVHA 1T3LA 2OYCA 3SC3A 1FTWA 3DWFA 1T0BA 3DE5X 2JAOA 2PWAA 3A9SA 3ILSA 3RJ9A 2V98A 3LBFA 4G65A 2IZ6A 4GL2A 3QNMA 3LUJA 3OFKA 2OP0A 3AK4A 4B3DA 3N8NA 2X8JA 1XRRA 1VLZA 5TMBA 1WCV1 4QU5A 3UNXA 2JIMA 1RU3A 4HGNA 3VVLA 2GWHA 4LMBA 4ZXPA 3UG6A 2HB6A 1UOPA 1DQPA 1OFHA 4XIFA 3JASA 3FSEA 1F12A 3NIWA 1ISGA 4M98A 5K01A 1HFKA 3CVUA 1VPVA 2A0FA 1JTVA 4ER0A 4PZ0A 3F74A 5LCXA 1GSAA 1U63A 3VH3A 4YECA 2X8AA 1O5IA 1UBSB 4A27A 4UTNA 5LJIA 5B1DA 3UGJA 1AZWA 3HB7A 1YQQA 4PM4A 3WTBA 3T5GA 5HILA 3ZLUA 2XZPA 2BZGA 1D3AA 4GH5A 3TR0A 4P7BA 5C35A 4IS3A 4WIAA 4G9GA 3TNYA 4MSUA 1JRLA 5D6OA 5BWNA 3THYB 2QI9F 3NRBA 4OTZA 4BC0A 2AG8A 1G16A 4UPEA 2R7NA 1HLGA 4JL6A 4Z0TA 2WJPA 1YR1A 4YR7A 4UNNA 3NU1A 4G9EA 4DBZA 5BRJA 2QZPA 3KR9A 3U7QA 5TQ0B 4MR7A 4GFDA 3ZVMA 3SYLA 2M1XA 3UPUA 3GP5A 2P2DA 3U80A 2QW0X 2J0UB 5ESXA 2QLTA 1QB8A 3ZY2A 3WQBA 1U1EA 5COBA 1R9MA 3HWWA 1UPBA 1NMEA 4NH4A 5ALWA 1R4AA 1BKDR 1NXVA 1REQA 4JP5A 521PA 1NHWA 2CLSA 4Y9UA 5JQGA 1W4RA 1JDSA 3QM1A 3AJ9A 1WUKS 4DV0B 3DDUA 5I8WA 1VLQA 4MW1A 1QLWA 1U8XX 3G17A 4OAPA 2FEXA 4U9UA 5CLLA 3RVKA 3X1YA 4B3JA 4JXKA 1XTVA 4GP7A 1EQAA 1JR6A 3WLRA 3PF8A 3IHTA 2H31A 2NZVG 4M3NA 3JQ6A 5AOCA 2Z6AA 4ZKEA 5KQRA 3BMQA 1PWYE 4OXQA 4WESB 1AKQA 2Z4TA 2X0IA 1HDCA 2BI8A 2ZUWA 3FCEA 2H1FA 2HEGA 2OZLA 4FMCF 3OQ1A 4ARVA 2ZJAA 3JD4A 4V38A 3BSYA 1E92A 2G1KA 3DOEA 2AR7A 1MIOB 1KI7A 3RSOA 5HIKA 2O2IA 1U02A 5ALZA 1ECPA 1VL0A 5FTJA 4ZQCB 3SK0A 1CC1S 4J0JA 1TM2A 3EXEA 1DQYA 4UTPA 3AEUB 3ORYA 4RYDA 1LCIA 3FZEA 4KRXA 1VL5A 1LW6E 1AUXA 2IYYA 3WSWA 4X3OA 3CLVA 4K9MA 5EG5A 4YCNA 4MYTA 1B14A 1PWEA 3ISJA 4FMDF 4KQEA 1G20E 1WXWA 4CF6A 2B5WA 1C29B 3SDZA 3HYLA 1JVBA 3NHJA 4LMRA 2PAAA 1W9HA 2LCFA 4V0NA 1XTKA 1FU4A 1YS6A 5CIQA 5AJTA 1XU4A 2V6MA 2B6HA 3L5KA 5A9SA 1TO6A 1K3TA 1R8QA 3CF0A 2J3IA 5LYJF 5KTOA 4FW8A 3OIVA 2WC1A 3V6LA 3RAFC 3O2JA 1DRVA 2ZCUA 1TJ5A 2ILVA 2SHKA 3ZTWA 4QOHA 1SKAA 1P6QA 4HTFB 1RYYA 2JI4A 3KVVA 3R3WA 4V0MA 3VOBA 4JI7B 3HTXA 3O4RA 3EULA 1X2EA 4JYAB 4QUGA 3TW4A 2ZKIA 3PC2A 1HDZA 1SFRA 4YP7A 1J0AA 2WFAA 4HD8A 1T25A 4RA6A 4QXMA 5LZ5A 1D03A 2IIPA 1Q7CA 3WLSA 1M5UA 1GADO 3KX2A 4GU5A 4Z1MD 2DJIA 2JIQA 4MO2A 4AKTA 4KREA 3DE0X 1WHTB 4QG7A 1S02A 4MI1A 4QASA 4GGMX 4LSMA 4I50F 2X0KA 2SICE 1QANA 3F78A 1Y9EA 1YBMA 4V3CA 4W9NA 3UWPA 5AUNB 3WMGA 2QGNA 3FYSA 2HHHB 3GT4A 3IEMA 2OGSA 2XA9A 3F5DA 3I64A 4IRXA 4XYBA 4R0MA 2HQRA 3CIFA 1Q14A 4BTEA 4PNZA 4U7FA 2CNNA 1SXJD 3DEFA 4BN5A 4UM9B 3D5TA 3T35A 3ZD6A 1G1MA 3LK6A 1SKYE 3DMTC 4J75A 3I9V1 1JIQA 3EDYA 4ADSG 1T9CA 5DTRA 1YR3A 2QR3A 1PDWA 4CKEB 1YZQA 2JAXA 1L5HB 3LUDA 3TR5A 3Q98A 5E8RA 1K7CA 1NZFA 4HDAA 3RC3A 3RYTC 3FJOA 3OETA 4DY6A 5B30A 3TRFA 1ZP6A 1GILA 1M6NA 3HY3A 1GQ2A 4PG7A 4RXUA 2JATA 1OTXA 1X8LA 4D8XA 2J87A 2WB2A 4HWOA 2IWRA 4L15A 5B57C 3GJTA 4NFLA 5EZYB 2H1RA 3CZCA 4PNPA 3ZJYA 1M2KA 2FPKA 4IJWA 2MIIA 4WLUA 4XPIA 3WLKX 3TF5A 3KYBA 1KZ7B 3BIFA 4ZHQF 1NM5A 1MABB 1WB5A 4XPIB 2A9RA 1S01A 3JRNA 1RRKA 4YO8A 3SF8A 3ZQKA 4RL4A 3HLKA 4DT1A 3GEMA 4JB3A 1SCNE 4WY2A 2PSFA 5F9FA 3AJDA 1R37A 4B4VA 1JQAA 4MWBA 4EHBA 2EBWA 2YV2A 1QPGA 1JNXX 3LA8A 5A7GA 1O4WA 4DG5A 5FNVF 4EOGA 3A9RA 2OHIA 5F7ZA 1TC1A 2Z83A 3GRRA 2P0EA 3AM1A 4BXOB 5LZ8A 3AUTA 3F5FA 4R40A 3R77A 3LPLA 5CVEA 3VPXA 2C9DA 1WHSA 4IUDS 4ESEA 1FE8A 1RWVA 4D5GA 1PVOA 5B7NA 2GXQA 2A5DA 1E96A 2G07A 2XDYA 3E4CA 5AW5A 5JNLA 1Z8FA 4KLZA 1C7QA 2A57A 2OBLA 1OGIA 2X22A 2G9NA 4D57A 3KR2A 2FLWA 5DX1A 1B76A 4A0HA 2H7XA 4JJFA 1F38A 2GPWA 2GVNA 2NU7B 4L85A 4WECA 1KBQA 4NJOA 1KEUA 4GX1A 5FL7A 2Q7OE 2DP4E 3W5BA 4EKDA 5I9LA 2M1ZA 1RKQA 4PLGA 1A50B 4PSKA 3WC4A 1N3YA 1P4SA 1X7HA 4BNZA 5KOHA 1L3CA 2AZ4A 1UMCB 3CSSA 1M2WA 3L07A 5FWDA 4DXDA 2G80A 5TRTA 1Z5GA 4RDCA 4G5FA 4AMYA 4ZVPA 3SI7A 2X1VA 2HMUA 3ICEA 1QZ3A 3C7DB 2JH8A 3T3PB 1F1BA 1RWXA 4XWAA 5AKJA 5E6SA 1DAFA 3T52A 1Z4JA 1HOTA 1V43A 3D0OA 1R0WA 1GRRA 2ZIZA 1MLDA 5DM4A 3ZWXA 1L8QA 4AJ1A 3I6MA 4RVSA 5EIEA 1ZK1A 1IHPA 2CLKB 3GUUA 2HV8A 5HIAA 5IBPA 4C30A 1ZBQA 1XMJA 1MV8A 3U2QA 3AJEA 4PGAA 3RRJA 1KEWA 1SH7A 3K0FA 1X1SA 1GA6A 3U4GA 1VKNA 1VRCA 2CD7A 2OZPA 4J0FA 5EZ6B 1U2GA 3W2EA 2ZWAA 3SC4A 3B52X 3LE8A 3JARB 1GJRA 2Z8YA 3ON5A 1CJSA 3JXEA 3IQDB 1Y98A 3ITKA 1MOSA 1XP8A 4PC3A 5T7BA 3SIPA 3OOJA 3LX5A 3C2QA 3H04A 3R0ZA 3ONNA 4GGOA 4TYPA 4YV0A 3CTMA 1YZYA 4BBAA 3L41A 4MAAA 1R00A 1ZRSA 2CL0X 3KQOA 3H7IA 5E7JA 1KY5A 5GVRA 4QBFA 1J6UA 4DCNA 2P9TA 1TQHA 2JRLA 4B34A 4NPHA 1QK4A 3IDFA 5I9BA 3EXFB 3A3NA 1E62A 2B1JA 4M8SA 1I24A 4HDMA 5CD1A 4BCCA 4KN5A 1OOEA 1LZKA 5DBFA 4NG4A 3CXRA 5CVVA 4I9GA 2FPLA 1C7JA 5LA6F 4A0FA 2TYSB 1WTCA 2VHXA 2IODA 1F2UB 1U8ZA 2NU8B 3WRVA 3I6IA 4BPRA 1DG3A 6NULA 3EEQA 5GOTA 4HP8A 4D4HA 4RH0A 3VU3A 3K6SB 1QC5B 2VQEB 3PI6A 2C94A 2J1LA 4E2ZA 1E5XA 2Z6VA 3CN9A 1ZVJA 3AEZA 3DONA 2ZWPA 3K96A 1P5RA 2Q7XA 2GASA 5JD3A 1SBTA 3FWPA 3OPQA 3UKJA 2G0NA 3GJ0A 2JDID 4WXMA 1GLVA 1WMBA 4OMCA 1KNXA 4PW0A 2HJGA 5LYJA 2HWYA 1WUHS 2GBCA 4MIYA 4CDMA 1AJEA 4P38A 3FM9A 2PKRA 4XWOA 4F72A 1Y8ZA 3FCYA 4YAOA 2C42A 3P2YA 3CVOA 1QXSA 1B0UA 2BGTA 4L8YA 3CT6A 4X97A 1FXWF 1NXOA 1XZJA 1QP8A 2RGNA 2AYZA 1IVNA 3G1WA 1ZDMA 4JENA 4OGGA 5CXXA 4EFNA 4TL7A 4B6EA 1OJ7A 3WAKA 1S7CA 3CZRA 4RD1A 3V4PB 3KUDA 1E79A 1L4UA 3M1YA 4IJKA 5CEFA 4EO4A 2XY4A 5CBPA 4FFWA 2VHTA 3A27A 5ER6A 4Y2GA 1V0JA 4M8NE 1BDJA 1P33A 4ZQBA 3D8RA 3OA2A 3B7WA 4YI3A 2ECOA 4IV0A 1DAPA 1V11B 4TMFA 1G41A 1XTBA 1JFTA 4LN1A 1SIOA 2I6QA 2ENWA 2F9LA 4MUKA 4EZBA 2GPSA 1GFIA 1XZKA 2WKQA 1OLXB 2WEKA 1LF0A 2XECA 3I5AA 3KFLA 4JLMA 4TVBA 3U17A 2B9VA 1L5GB 3MRXA 3C6KA 3MBIA 5E4FA 3H5WA 1STOA 1YZKA 2NO0A 3FR7A 1RQXA 3Q7PA 2ISCA 2Q1YA 2VL7A 2AVDA 1DQNA 1R3DA 3PQ7A 4XTRA 4XX0B 5HQTA 1E6KA 1ZN2A 1Q20A 3IQHX 3PR1A 4YJHB 4YMWA 3AL0C 2EJCA 4NEGA 4FWBA 3KC2A 4X5OA 1N57A 5HKLA 2C7VA 3MEQA 5DLQC 3SF0A 4WKPA 4JJ4A 1XN4A 3FGOA 4C0HA 1E20A 1Q0HA 4MW5A 4OJQA 2P8JA 4L72A 3TZBA 4BB5A 1E3TA 2QR2A 3RT9A 4JBXA 2X5OA 3JQ9C 4FHDA 4N0MA 1SVNA 1A4RA 2QNBA 2C9MA 2D1TA 2G7ZA 2I78A 3LPNA 4Q1BA 4WNIA 3TLAA 1NQWA 1CY2A 2PPVA 2CKDA 4TLDA 3UYKA 4GKKB 3D3EA 1VTKA 1E0JA 1XL0A 2DKOA 2BJHA 2JDIA 1NBWB 1A8PA 1H05A 2PKWA 2W93A 3T4EA 2H4ZA 4HNRA 3RSGA 4HCJA 4Q7QA 2H48A 1NBOA 3SKVA 4ENSA 4JV5B 3NANA 5AHXA 2JK0A 3KBBA 2QRQA 3AONB 3EGCA 3MJFA 4L9SA 4BMOB 3QE9Y 4PO1A 4GPAA 1XHLA 1Q0LA 1AZLA 1OTYA 4YJGB 1QQAA 1TM5E 2G28A 1JEDA 3H11B 4M21A 4CDNA 5DMXA 3OZSA 1LLCA 4M1MA 3SD7A 1P80A 3E35A 2NSYA 4XQCA 1VGRA 4RY0A 1RRMA 2HMTA 3TK1A 4LJ4A 2ES4A 1E2LA 2ZREA 4KGVA 3BRWD 3B8HA 3PC8C 4IOLA 3A0UA 1GNRA 3C6ZA 3CRRA 1P39A 5EQTA 1COWD 3NM4A 7MDHA 4YWJA 2YHAA 1ICIA 4UUBA 1E1MA 1V45E 2P4SA 3E7XA 2QG9A 1YRWA 4R1UA 4YMVA 3A3PA 1FYXA 4BZPA 1VP9A 1P1JA 1O9BA 1QIMA 2VXCA 4L0DA 1XVLA 2O05A 4X1IA 3HB0A 3L9XA 3CJRA 3W6OA 1OSNA 1R6BX 2X1HA 4Q1FA 2G9QA 3HJHA 4LOKA 1N5OX 4HWTA 2B4KA 3BC1A 4YLGA 2EFEB 2Q3FA 2W4IA 1V8PA 4MTLA 4F2PA 3WLNA 1ECJA 1ZEJA 4NMLA 3HH8A 3IDZA 4NU6A 2H5EA 1Y6JA 4TQ9A 2HDOA 5CYPA 2IPNA 1ANKA 3MWEB 4ZU6X 3GNSA 3L7KA 5BSTA 4P3XA 1JMYA 4JLBA 4P1ZA 1OB5A 4TRMA 4ZYTA 2QMOA 3BQMB 1U1CA 5FA8A 4EITA 4ZEOA 1O8BA 2O8BB 4MQ5A 4I14A 1PFVA 2O5RA 1NBMA 2G77B 3P2IA 4O4JF 1AKEA 5C3MA 1QG0A 2I99A 5FJIA 4A6DA 2JAUA 5HKKD 2NPOA 4YT2A 3GDHA 1QPBA 2X6QA 5ECYA 1DO2A 2XXBA 1KI8A 1GV1A 2JCVA 2LZ0A 5LVAA 4G5GA 3HZRA 2I9KA 5IF3A 4KVZA 4FGKA 1LX6A 5J5AA 1J70A 4XZ3A 5AI0A 3B7GA 1U2DC 2GRAA 3R9XA 5JCOA 2GN8A 1OASA 4O2AB 5H83A 2LD4A 4CNBA 4F5WA 1QF6A 4QUDA 2UZIR 5JJKA 4O2AA 5KYUB 3ROTA 4GC5A 3VO9A 3M6VA 2JF0A 3Q72A 4ZA2A 3W78A 1J2EA 4ZYZA 2GN2A 5FUBA 4B7UA 2WOJA 4JSRA 2ODQA 2QX9A 1Z36A 2AQ8A 4MPRA 1TK3A 4X24A 4BX0A 3NG1A 4KO2S 3TFQA 4D9MA 5C2JB 1CUAA 2ZAGA 1H8ED 4MMYB 2Y1KA 4HEHA 1SULA 4Z2AA 4XYLA 5K99A 3DFZA 3EGVA 2C77A 3HDYA 1MX5A 2CJWA 2VTDA 4R69A 1E3DA 3I73A 3OLCX 3CHYA 3TWOA 1ZN9A 5I9SA 2YVAA 4F9FA 2BKEA 5AOAA 4QEKA 4XWWA 4QFBA 1X7YA 3H2YA 3KVOA 4RV5A 3SLKA 3G2PA 3DO8A 3NHLA 4G1BA 3UQYS 2IXTA 1NW9B 5ES3A 4NBRA 4IIXA 3TQSA 4J0KA 2VQFB 3V4VB 2R44A 5J2UB 2O0HA 2VRBA 3ZD8A 1YBHA 4IZ6A 1Z0DA 3OIGA 5I8PA 1IDN1 2ZS9A 1ACJA 5EI5A 3OY7A 3TCNA 1A9ZA 1O0CA 4FDLA 2Z3WA 1FX0A 2HXGA 5EE5B 2JJ1D 3DR3A 3IQZA 3TQTA 4A73A 2XKKA 3DV0B 3HRKA 4O33A 8MHTA 4OLHA 1GQOA 1ZH0A 3H0CA 3V7UA 5JFGA 4BV2A 1NW8A 3AP2A 3ITNA 1Z2PX 4HEJA 4IXWA 3KBOA 5AESA 1WE2A 5C80A 1KK1A 4QARA 2IYFA 1N2JA 3AR7A 3K4QA 5BWBA 1Y8CA 4TWRA 2ZVJA 4HQLA 1HE1C 1BA2A 4P6VF 3HR8A 3EZ2A 1DBPA 4P35A 4B6RA 4O5AA 4K88A 3EZYA 2NZXA 1NVAA 2LPMA 3B6KA 2OQ2A 1M9NA 3H13A 3GU3A 2P5TB 3ND7A 4MWSA 4BL5A 3JQFC 2ETVA 2R65A 2VHQA 4PHGA 5E95A 4YV7A 5KYXA 4DIBA 1V95A 2WVAA 4IQ0A 1O77A 3PJDA 4HGZA 4R3UC 2WJHA 1HTTA 3F8SA 3RRZA 4DAOA 2YZGA 1SUAA 1V39A 2P2ZA 2JS7A 5EJEA 3UOWA 2ONCA 2EYQA 3QQ5A 4PC2A 2AMFA 2QN6A 1K4YA 1T8SA 3DMTA 3KWJA 5ESDA 4J1TA 3ESDA 5JS2A 3QK7A 3V32A 1P5HA 4I8XA 3PIIA 4CWAA 1HK7A 2IU0A 3DM9B 1G7CA 3C0KA 5TS3A 4F6LA 1Z18A 4TT3A 5FWXB 4Z4IA 1PHPA 1NXTA 1T1RA 2PD3A 3O1JC 4NULA 4PSUA 1E5VA 3WWDA 1DCFA 1E2EA 4G67A 1A9XA 5FBKA 2PFSA 2YZKA 3G59A 3LG2A 4H0FA 2W2KB 1Y7LA 3E9QA 3UJ7A 5JNTA 1Z88A 2W6MA 2MSDB 1IAVA 1BXKA 1P8JA 4UFOA 1KEEB 2GVDC 3BYZA 1USIA 4R4JA 5DKFA 1RHMA 3KZCA 1SC1A 4QXRA 3WZMA 3FMOB 4J4HA 1QIKA 3KLNA 3SS9X 4AQYB 4G5SA 1XZNA 3GUVA 1J1UA 2NXNA 2DFKB 3FDFA 4FCTA 1CUJA 4QDOA 4LDQA 4RZ2A 1T4BA 2P1ZA 2NPIA 2ZDHA 1AGYA 1ADYA 3JV7A 3OQHA 2VP5A 1P0CA 4TUYB 2F64A 2IYLD 4L5YA 2IYNA 4D8WA 3R3SA 3UBMA 2QRMA 3KYCB 5T6BA 3ZNPA 1U2TA 2QYHA 4A82A 4TS9A 5DDIP 1A3CA 2FA9A 3WWCA 3TQCA 5BSWA 2H0AA 4RABA 5IBCA 1NQAO 1I3NA 1IG0A 3UMGA 2ZDQA 2P78A 4P4SB 4UBOA 1FRVA 1JS1X 1ZGJA 1ADCA 1OI7A 3D2BA 5GJCA 1XDWA 4C2AA 3RLIA 5LZ9A 4LC0A 2HMWA 3VHXB 1JG3A 2A4KA 3V34A 3DP7A 2NSLA 3W2HA 1RAEA 1P4JA 4MS4B 3HRIA 2FSHA 3O4JA 4IKEA 4LQ4A 4JFAA 3F2IA 2GFHA 3A3YA 1F8GA 4G56A 4MJ3A 4A6XA 1G2OA 2FY8A 3F6SA 4IEEA 4DPMA 1SUDA 1VBNA 5IJ9A 1UPAA 1JTEA 4H4DA 5IAAA 3BJEA 5JAIA 5D7NA 3U4HA 4OHOA 1TZMA 3CEHA 4O2AF 1GU0A 2F8LA 2XE6A 3O31A 3VNBA 3I2JA 1GPBA 4Z9BA 4OBWA 4FW9A 5IT5A 4HLDA 5FO1A 1P2TA 5LBIA 1XNQB 4C6TB 1CUIA 2Y66A 1L5YA 1Z5NA 4N18A 2RCYA 4Y6OA 4B7CA 4UULA 4GYWA 4ARZA 1QV6A 3CB2A 1KFJB 5DT9A 4NAUA 1NW7A 5EJMA 4DSZA 3G5AA 1KAQA 3R6TA 4IO0A 2YXDA 3O2NA 4PO3X 5EHIA 3VDQA 5K8CA 3IAFA 2M2IA 5C8YB 3WLFA 1KSJA 4FYJA 2PLRA 1CUCA 4HLUC 2I66A 2FETA 2Z5LA 3HCAA 1JR3A 5GJVC 1BEEA 2PT7A 2RHHA 2YBEA 4O6VA 1K63A 2HYDA 4ZI7F 4GPEA 5AXBA 1BU5A 2Z2ZA 3D64A 4Y67A 2GPJA 4AY5A 1FMJA 1TQ4A 2WLTA 5K0GA 5KWIA 1VCMA 4J9UE 2D0OB 4TTQA 5BNWA 5A02A 4I08A 3UWMA 1A95A 1LD3A 3H5VA 4JYMA 4MGEA 3IUMA 3SOPA 5LDHA 2PLNA 4FOOA 2YL2A 1B0AA 1CZLA 1DOZA 1EU1A 2FZ5A 4WQMA 4XJXA 1E4EB 3UV7A 1NNI1 1BHO1 2W5UA 5ER9A 5C8ZA 2VP0A 2PJDA 1MKYA 2QP4A 4JQZA 1LBEA 3QWIA 1SVWA 3FLMA 4Q16A 5JDIA 2I7DA 2EBHX 2XWQA 4G23A 1SBNE 3EH2A 4TWAA 2NYUA 3W6UA 4KL8S 4F9TA 2C7OA 5DTJA 1KRWA 4OD0A 1T0IA 4YGYA 2FZWA 2ERYA 5TPWA 1W34A 3HCNA 1TFRA 1EK2A 2V55B 1EVIA 4FTWA 5ICFA 1SD2A 4PZDA 3KSMA 1K6JA 1G64A 3EZ6A 4FOSA 3BMNB 3P71T 1T3GA 2HCBA 3R3HA 2BM8A 3WWZA 5KYTA 1X3SA 1Q19A 1DC3A 1X7XB 2X77A 1QIHA 2CNDA 2HRQA 4LQCA 2PO7A 3V42A 2C2BA 2D00A 2CXNA 2UKDA 4GP6A 1I3MA 1PCXA 3UJHA 2DLCX 4Z9XA 4AAYA 3FPGA 4D3YA 3HB4X 1U2DA 5K2OA 3EODA 4ND7A 1FB5A 1VG0B 3C70A 3ZZ1A 3OWOA 2CFRA 4KIJA 3A1UA 3QVJA 4K9SA 1QORA 4R68A 4WD3A 1IY2A 1CQZA 1IEVA 5DULA 2VATA 3MS2A 1MRZA 4ITRC 3L1JA 3QLVC 4BX3A 5KJEA 2D1RA 1XMSA 1XEXA 4JA2A 4KQFA 3JQ7B 4NECA 3TLMA 1H3NA 1THMA 3W9UA 4BVFA 2GZSA 3W1EA 5TXGA 3BE8A 2ZATA 3R5TA 1L5MA 2YFYA 2OK8A 1YFKA 2G67A 1KFBB 2WSBA 3I09A 3PQFA 4FHEA 5B1YA 4DCGA 1P45A 3LHSA 5JO9A 2ZR8A 1N33B 3VAAA 3NWJA 5INTA 5KQSA 4X8LA 4HH0A 1L4GA 1ZM2A 1LC3A 2HPVA 2BFDA 2I8AA 3ZHTA 3VR5D 5EKSA 4IF4A 4JEHA 4WY5A 1P6XA 3P0JA 3ZW7A 5CT5A 5CH5A 2JLXA 1QQ6A 1T5IA 2GN6A 5CG2A 2P2YA 3AUUA 3KT0A 4EHFA 2R47A 4UNSA 1QO9A 3X1JA 1E3MA 5LWHA 1Q77A 6REQB 3DE6X 4QDUA 2X40A 4X71A 1M6YA 4Y6PA 1RC1A 1U11A 5D87A 2Y68A 1JDBC 4EY8A 5FAKA 3VZPA 2Q8PA 5EJAA 2A0WA 3GMTA 1DXOA 4AZ3A 1HNWB 3MELA 3QBTA 4MYHA 5FBQB 2D62A 5HQJA 2Z9DA 2OD7A 3NDIA 1BRMA 2OBYA 2WYHA 5BUZA 2JIPA 3QKUA 1W88A 2RKOA 1LH0A 1C8VB 1MRSA 3HBLA 3ROPA 1Q7GA 2CFCA 3OZFA 5IJZA 3FBGA 1ESEA 5CURA 4ON9A 1TPYA 4AULA 1SBCA 1LRJA 3LL7A 2PPLA 3DQPA 1QVAA 3T3MB 1KZGB 4W6ZA 5DGTA 4B74A 4OB8A 1BEUB 2JIOA 1QCZA 1QDEA 2R85A 2ZIFA 1F9EA 3DKPA 2Y05A 3GVPA 4PAGA 3HP7A 2C4NA 4JUIA 4V24A 5EWJB 4A36A 1I0LA 1NVBA 1P2VA 5EWJA 2AE2A 1DJMA 5J1SB 2Q2WA 4ZCRA 4L9AA 5JADA 2ZIGA 3CWCA 5JWOA 3DZKA 4WLOA 1THTA 2GXSA 4NU8X 1XMQB 2C0PA 4DCMA 4BO0A 4FN4A 4RNDB 3NWOA 4I2NA 5CMLA 2AJLI 3H6KA 1E7QA 2DBZA 3H9UA 4QUHA 3QX8A 4INAA 3RJ5A 3FCUB 1ZXBA 2FJ0A 4BGVA 4OLJA 2P30A 1N6HA 4IYJA 3H5AA 5FYQA 3ROXA 1L3IA 2P41A 2ECFA 3BJMA 4I9UA 5KNCA 1CEXA 1GZ7A 1PHRA 1XRJA 4KX5A 2CF5A 3K70D 2VNAA 1EUCA 3BOSA 2WWVD 3IAUA 5K6TA 3DZIA 4FQ8A 2J9XB 4M53A 1UBCA 2I0FA 3A32A 1KSHA 4F60A 2Q3BA 3QVVA 1K06A 4IR7A 5CLGA 4HKTA 4OHBA 3IUQA 3VSBA 4LRYA 3INTA 3DV0A 4PYIA 3K0CC 4ZO6A 3P94A 1OT5A 3Q15C 5EIOA 4HGPA 4YLYA 4Y0NA 3SDSA 5KSZA 3OTWA 3QVWA 2H85A 2NT3A 4ANFA 3QLJA 2E37A 3NTLA 4EGFA 4DLVA 5K0TA 3ICCA 1WR8A 2JFGA 1FUKA 1PJZA 3VR6D 3UICA 3N2IA 2CFOA 3FWNA 1BCRB 4XD7D 1PAUA 2Y27A 1M2VB 4N7RA 2AJDA 4BATA 3PDIB 1J8FA 2C88A 1XZCA 2BCGY 1Y0BA 1GN8A 4V0KA 5F21A 3ZI0A 1V11A 3WYAA 3GNTA 1FP2A 4OATA 4H7JA 3L6CA 4RVOA 2HJVA 2QBYA 4TV8A 4M1OA 4EY5A 5KVQA 2E3JA 1UQTA 1RHQA 4BQSA 3AFOA 4DMKA 4IHAA 5AOVA 2CVZA 2HI0A 1EAYA 2GOYA 4FNGA 4X7MA 5DP2A 5IEBA 3GFSA 1UXIA 4L73A 4QX6A 1HL7A 2Y0PA 3EB9A 5AKXA 2P3OA 2P3LA 3S2IA 2OSVA 4Y2JA 1NVMB 4YCCA 4US2R 4P84A 3HCBA 4XCVA 3UMYA 5DLPA 2FP4B 1QWOA 1TZBA 3L6UA 3E1KA 3BRSA 4B4WA 3QMWA 2OXTA 3PEYA 4JFRA 5JQGB 1QTRA 3U3KA 2HGZA 3GV0A 1FTNA 3QVTA 1SUPA 1B6GA 5DYIA 3RUFA 2AMYA 2GBLA 4AZVA 4UDNA 1SHTX 4DNQA 1UZUA 2VOEA 3F1LA 3OQJA 1J99A 5DHTA 3W5AA 2WVJA 3OM0A 1ZUNA 3MILA 4YRZA 5KJFA 1R5JA 3CH6A 3BMQB 1XWIA 4KTVE 1W0KD 1L1QA 2MSCB 5KWEA 2F3RA 4ZU1X 4PANA 4LFCB 4DJ5X 2GZMA 1XTTA 3S70A 2QZZA 2UYGA 3W7BA 3O3OB 2WWTA 4ID3A 4COKA 4Z6KA 3WB9A 4X93A 1ACLA 4Y6RA 4HLUA 5EJFA 3T0FA 3GFQA 4WOPA 4Z8YA 3VOSA 4RLHA 2JLBA 3A1DA 4RIFA 3WMWA 1SVLA 3A1EA 4EG4A 2RHCA 2QX4A 3H2KA 4HDRB 5TQ2B 1JLRA 1YAJA 1I36A 2FK7A 1ESZA 3R8FA 2A5GA 4QIHA 3W34A 2FSGA 4E03A 1T9AA 5IBQA 1QB7A 3PXBA 1UJCA 4P4SA 5D51S 3T1NA 2L19A 1V41E 3N86A 5HCIA 1C7EA 1M8KA 3V8QA 5CXQA 1PQ4A 5AVTA 1S8AA 1VHWA 3DW1X 3WBJA 4AIRA 2D5BA 3BGSA 3WQQA 2IBSA 4MB6A 3EFHA 4X1IB 4YCLA 1FP1D 1GZDA 2XYVA 3LVBA 3BD6A 3GT7A 4RBNA 5DRYA 1ODKA 4FJ0A 4PQFA 3O8RA 1XCOA 2R6FA 1E3WB 2VLIA 1WM1A 5ALQA 3OCJA 2OFPA 2ZP1A 1T34A 3ORQA 4KP7A 3O4HA 1NRIA 4FCVA 4IVQA 4KDFA 2GK4A 1DQRA 3VYSB 1KO5A 3BHIA 1CP3A 1JAYA 3N87A 2HTFA 2GJ4A 1NJGA 1A7UA 2GN9A 2J6HA 4EVSA 3R4VA 4A4DA 2ZBUA 1P2FA 2C2HA 2F9MA 2FQYA 2GA8A 3Q40A 3RVRA 3T4XA 5HKOA 2J32A 3GLFE 3L8MA 2DT5A 4KXUA 2X9NA 3H2IA 3PUVA 4J0IA 3TKAA 5I7HA 1B41A 1OX5A 1QH0A 2AE1A 3GZNA 3LNTA 1GPMA 3N0RA 5EKTA 2YN0A 2Q9UA 3RM3A 3GDOA 3KUKA 3WMXA 4P7GA 3HBJA 1C8BA 1DDGA 4IHJA 4LXXA 1W6UA 1JAHA 5LU8A 1G5TA 2B34A 2IY9A 1JHMA 3C39A 1TI7A 3OPYB 1IN7A 1X70A 2IBTA 3KAPA 2WMOB 5KYWB 2COUA 4JLNA 4UUAA 2VP3A 3GRAA 1OA1A 4UHJA 1PX2A 2V5UA 3C7TA 4Q7JB 1KQPA 2BFAA 4WBXC 1R10A 3Q85A 2C2KA 4ZAZA 3LH5A 1VYHA 3A1WA 4L6AA 5F76A 4ZDJA 4J07A 2V5AA 3GLTA 4PCLA 4Z7OB 3EPJA 3WS7A 4RV9A 2XQGA 5BR1A 2QTGA 2MSEB 2ZRHA 3ZHSA 3ZDZB 3SIWA 1EIWA 3VKVA 1AV6A 3MTEA 2NO4A 4S1NA 3D3JA 1NVWQ 2NZWA 5MHTA 4DMGA 4NYMQ 3P2EA 1F60A 4WUTA 1XMOB 4XXHA 2Y6VA 3RJTA 2IF2A 1VIYA 2BH2A 3RHFA 1E0AA 3RVMA 1Q6YA 4Q4JB 2MCFA 2P68A 1ZWKA 3TLKA 3BTVA 1H4VB 3DUWA 1NYQA 3W77A 3QV2A 1EK1A 5IJ0B 3ESAA 3F9RA 5HDQA 1Y3FE 2X8JB 3GJ4A 2HA7A 3H2SA 5GQSA 4H60A 3PNVA 1WDLA 3TOSA 4DG9A 3PJFA 4TQGA 5IJWA 1RQPA 4OMDA 5K3OA 1VLLA 1JXAA 1CPYA 1I2MA 3SF8B 1VB5A 2XTZA 3ZIAD 2NG1A 3WGJA 4DT1B 4EWLA 1UMDA 2ET6A 4KAXA 4DILA 3A0RB 3NYRA 1RMQA 4M37A 5AUQA 3WIEA 1SRQA 2CJFA 3F96A 1OX4A 2GCOA 4Q1CA 3V8VA 5EHGA 1G42A 3ZE2B 1EUQA 2PMWB 2OG1A 4LTDA 3IP8A 1HORA 2FLVA 3CUKA 4P81A 3TYXA 2PL5A 4BQRA 1G38A 3WZLA 2QRKA 4X0EA 5JFTA 5JFOA 1IPEA 1X9GA 1OXKB 5H82A 3R5XA 2TSYB 1NIPA 4TWJA 2QD2A 3K3PA 3D81A 5DBIA 2GF9A 2DPGA 4QXAA 4US1R 1AKTA 1P2DA 2AA3A 3LQRA 5F1OA 3T8YA 3IIEA 3RROA 3C1OA 3TPZA 3UKOA 4IDNA 4RV4A 4QQ8A 1ID1A 1P2BA 3C8HA 4LNHA 4HH4A 2NU7A 1GYQA 4RMHA 4HNVA 1QX3A 4M38A 4B75A 3HP4A 3T7TA 5IG2A 2JFOA 5HBRA 4GC9A 2X0EA 1XCBA 2BFDB 5KSWB 4OGWA 1PK8A 1TTHA 1JIVA 1RZVA 1WP4A 4ATNA 3OE1A 3UUWA 2XWSA 3G7SA 2JB9A 1RQ7A 1W4ZA 3X1MA 3ZV6A 4XDZA 2UYYA 1I6WA 1CS0B 1PE0A 4GECA 4UEJA 4XYGA 3VR0A 4AF7A 4DUGA 3EGIA 2VG8A 4D8UA 2PH5A 5B3JC 4L4SA 1DXYA 1KDVA 3SQDA 2BFBB 1JLLA 4WKCA 1A9XB 1C8KA 1IY0A 3KR0A 3LYAA 4DWWA 5LDDC 1DKNA 4HMOA 5JC8A 1YB2A 4U0JA 1ZH2A 4D8TA 2JJMA 3DOUA 2E6KA 1JEYB 1AO3A 3TOZA 3OEWA 1GA1A 1EHIA 2PUEA 4CFZA 1KEEA 1DPFA 3SOZA 2WAXA 1NPTO 1DC7A 2GNOA 1U3WA 2QMHA 4YUWA 1CJCA 4RK5A 3UW3A 3M5DA 3OPNA 4DTCA 2GJ8A 4Z0PA 2OLKA 3DL4A 3JYQA 4FFMA 2MYTA 4H77A 3THOA 1SQGA 1Y7IA 3TXXA 5LM3A 4JVLA 4M83A 4ZARA 4OY3A 4W9MC 1QNFA 4PV7A 5B4VA 3ZWYA 3KETA 3NYQA 1ZD8A 2PEYA 4OHKA 3CWZA 4GRAA 3IOCA 4OXNA 2GYUA 1KPGA 1PLJA 1R0KA 1R6AA 1W59A 2WTBA 3PGMA 3P2KA 4FNMA 1SB9A 2GZ3A 2GMWA 4M9RA 2OHFA 4BO1A 2ILTA 3AEUA 3UTCA 3HHPA 4AJJA 1CIJA 1U7DA 2IU6A 2J45A 3PYLA 1G4AE 1T5TA 3C3EA 3OFND 4UE2A 4DDWA 1QVWA 3FJYA 4HWGA 4K8OA 5HKAA 2CFSA 4BBZA 3ZJVA 1V3UA 2E7ZA 1CCWA 4FVTA 2MSLA 4CLDA 5H4GA 2NVUA 3F3SA 2Y77A 2GD0A 3Q7RA 1TU3A 3ECAA 4BTLA 2FPOA 4BKMA 3E2PA 4LDNA 3H4IA 3CONA 3PT9A 2HKIA 4TV9A 2IH2A 2P6MA 3OECA 3BA1A 3FLEA 3B9QA 2WK1A 4GSYA 4UVIA 3O90A 3WYNA 2YVUA 3HXTA 4J7UA 2QL6A 5EMLA 4PBSA 3VBEA 4BLRA 4DJFC 4B8YA 1O96A 3HN7A 3G79A 3CCFA 1G8PA 1KF0A 4AO7A 1Y4ZA 3AB3A 5KHLB 1MO2A 4JITA 2PX4A 3OAAD 3THRA 2Z8ZA 3BWMA 5L53A 1POWA 4ZOQI 4C0SA 4ARZB 4KQMA 4J9VA 1TEVA 1R0LA 2G9VA 3F8TA 2A59A 3UMBA 4HNUA 4KR6A 1NA5A 4S1OA 2FZVA 4MULA 1Z0SA 3TTWA 1V25A 3BSSA 2RH5A 2OD9A 3FYCA 1WVIA 1ULHA 2NSJA 1HE4A 3D7KA 1U3DA 2YWHA 2O6HA 1BCRA 2YIMA 4ZHQA 2OXCA 2FJPA 2ZROA 2AMVA 1L3BA 5E6UB 3ZU3A 5CHYA 1M66A 1ZS9A 3S81A 4F92B 1DZIA 5BMVB 3QBEA 2H5IA 2G9RA 4ALIA 1P73A 3BDVA 4RHXA 1KL7A 3ZX5A 5DHSA 2FPGB 5JXWA 3AVWA 1EVYA 3ZS8A 2OORC 1VMIA 2FPGA 1ODLA 2YNMA 3CR8A 3EF1A 3IO5A 3NTUA 1QYRA 2VLBA 2ZJBA 1R18A 4UHCA 1RI5A 3PHBE 2L82A 1IVYA 1MAHA 3CE6A 4KGXA 3TTUA 1ZI6A 1SHLA 3PZRA 2OYSA 1T5DX 3EJ6A 1LWNA 2AD1A 4OQQA 3LI2A 3G9UA 2O9JA 8ABPA 2VFAA 5C3UA 1XZBA 1P9RA 1YCFA 3VVBA 4DRXB 5IPFA 1O95D 2VNHA 1RI4A 3G8BA 1NVEA 4IUBS 1W8IA 2W6IA 4TMVA 3BXZA 4WE3A 3ZVKA 4LZWA 1GTZA 1U0JA 2V8OA 4Y2SA 4MQ4A 3E7DA 4WKOA 3ESXA 1UK8A 2Z58A 4TKUB 3TB4A 4BCBA 4F12A 2GTIA 5KVAA 6AT1A 3FNRA 1GRQA 2HA0A 1NAHA 3GUCA 4YASA 3ETLA 2NP7A 3L7BA 5JV5A 4G0VA 4P7FA 3D7SA 3EEOA 2F8MA 1NJFA 3QEOA 4U1RA 3TRHA 4JI0B 2FE4A 1QYVA 2DBRA 1DO8A 4L5CA 2G0AA 2VF2A 3HFSA 4UMFA 2SECE 4DUYB 3RBVA 3RKUA 3LX4A 3VZSA 2FMXA 1EZZA 3VV2A 1G8SA 4F93B 2PT6A 3B3GA 3N5CA 2GR9A 3C8ZA 4ZPJA 1UKVY 1ZJ6A 3TPFA 3AXSA 4MUAA 3UZUA 4EEZA 4JP2A 4RJKA 2G9ZA 1OLUB 5IDQA 5KTSA 3TQOA 3L7JA 4LCBA 2H1OA 3MRSA 5AHWA 4BLWA 4B79A 3WVNA 1JPUA 3T3EA 1XPOA 4JP1A 1WX1A 4TL6A 1H9AA 3ULKA 4QG3A 3TQQA 3QSYA 1G6OA 1FZQA 2Z2XA 1X1QA 4HOYA 1H2EA 2O0MA 1ZK0A 3BMXA 4IMIB 4W5WA 1E99A 1OXVA 1Q15A 1YFZA 4G3XA 4XSGA 3NNDA 2A67A 3BEOA 1QBKC 3JZMA 2H9IA 1NN3A 3QFRA 4GR4A 4BLTA 3U3RA 5CVTA 3KB1A 2R6ZA 1PGOA 4BU0A 3A7DA 3FFTA 4E21A 4JJ8A 3TD2A 4JNCA 1MD9A 3F9CA 1UKYA 5AWFC 2PWPA 2GCIA 1QHEA 1T1IA 3UB2A 3RJMA 3EEYA 4B31A 2DC1A 4FHCA 3EZ7A 3IO3A 4R2HA 4X85A 3UM9A 5B12A 2GCNA 3M1AA 1ZWLA 4G0MA 2AF4C 5EIAA 3CUYA 3IT2A 4YHBA 1C3XA 5EMHA 1X1BA 4NZNA 4D4KA 3GGSA 4CMAA 1KH2A 1KQGA 4Z7JA 2HA4A 3E3NA 1KVRA 5EZYF 2NIPA 1RC0A 4W7IA 3WK6A 2JBWA 4F4JA 1JKJA 2XNHA 1HT3A 1TNDA 1TF5A 3NP9A 4AM8A 1EINA 4QLOA 3BMOB 4Y30A 4CKWB 3SKYA 4NAHA 1FJHA 3UJPA 1BWRA 3AW8A 2WVGA 3DKIA 4YALA 3VO8A 2VTBA 4HO1X 5IT4A 2WIFA 2PUCA 3DVQX 2AOTA 3SQLA 1U94A 5JDCC 1AX9A 1CX9B 4DC0A 2DXIA 5DU2A 1U2GC 1V5FA 1K2VN 1SZDA 2XUQA 2BTOA 3PFCA 1Y81A 2WV7A 3KWLA 4MYRA 4B0PA 2OV1A 3FMVA 4KN9S 2JZCA 5BV2P 2FX2A 2B8WA 2YJZA 1L7EA 5IMBA 2XB2A 3SMVA 4X64B 1NQXA 3OTHA 1QAQA 3WKAA 3OO1A 4E7PA 2HU7A 1MFZA 5EA2A 5KYUA 1N1DA 2QVBA 3HCCA 1O1YA 2NYAA 3K2IA 4LJ6A 2JEZA 2W37A 1UPFA 3OOHA 1ZOSA 4RTJA 4D25A 2IX3A 3ZWMA 1NF9A 3DHNA 5K6RA 1F2VA 1YDGA 4YAGA 3E9NA 3GJSA 3K20A 4K6CA 5J4HA 5ILGA 4WJZA 4J0GA 4HDKB 5CCDA 5BSKA 3M1IA 4BFTA 5BXYA 3T3OA 1CUUA 2H5LA 5L6MB 3E9EA 1F7UA 1CU1A 1TMGE 4HDMB 1K8RA 2GKSA 5DTQA 1UQUA 1D6SA 3ZWQA 1TFUA 1Z7YA 2KLHA 4E1VA 3GMDA 1FZTA 2QJFA 4EZIA 1FFEA 3E0QA 3EOAI 3S2FA 5IRCD 1WBJB 1XA4A 2RHWA 4Q48A 1P3DA 3O8NA 4IP0A 2RGWA 3OX2A 3CPSA 4JT8A 1CV2A 3GHYA 4OXIA 3IIJA 4ZJZA 4H7PA 1Z0IA 1EK0A 4GOKA 3TOVA 2GHQA 2D13A 1E6MA 3FWZA 1Y7HA 4C01A 4CM1A 1FX0B 1O9GA 3AVPA 3GELA 2PX0A 3KJIA 1E3IA 3WB0A 4CLXA 4F5DA 1RHUA 2A0KA 4ZQFA 5K8JB 4DBVO 3SIXA 1OI2A 2ZWIA 3JSXA 3JX9A 4HVAA 5BR7A 3P9YA 4HRAA 1PZNA 3DEHA 1G63A 5HHTA 4AZWA 4KQ1A 4XJTA 1SG9A 5DHUA 2ONYA 1NY5A 4MJ7A 5CT8A 5FI1B 5CB6A 2C97A 3HJAA 1SU7A 2ZLBA 2ZSBA 3IAS6 4NICA 4DVGA 1PYGA 4EHIA 3IXQA 3A1SA 2JNWA 4GSLA 2GLUA 4L7VA 2HD4A 4LKOA 2RGUA 4Z8XA 3EK2A 1YCHA 2G5PA 2MMCA 1HXHA 3UWSA 1P44A 1WDTA 3IDOA 3RS7A 3OJCA 1NQVA 1QIIA 3AR6A 2F17A 3DXFA 3OUZA 4LNUB 4HVLA 3I2KA 3D8TA 5JSZA 3AKZA 2BHNA 1HL3A 2J08A 2YJTD 1YJAA 1LI4A 1Q84A 3KQMA 3M2PA 3EOZA 5DGHA 5TSDA 2GPTA 5A3QA 5LXTA 2FSVC 4CQLB 1QM5A 1NQUA 3AEXA 4C7BA 3OLWA 5LP6F 3QIAA 5JSQA 4BKOA 2ECQA 1C3OB 5KJ1A 5L3SB 1FFAA 3INGA 1X38A 1EE9A 4BFVA 4R0VA 4LGMA 1JDJA 4D0RA 2QLFA 1PKXA 4LGCA 4NBTA 3OQ6A 2EDCA 4DLPA 3HZHA 3EG9B 4QXOA 1UM9A 3SEZA 4BJ6A 4LF5B 3V2GA 3DP9A 4HDNA 2I29A 3N2KA 4OGFA 4YRSA 4MQFB 5FNVA 3N2KB 3P9PA 4FGJA 1N5DA 1W5EA 3UCFA 4PIPA 2JJYA 2GGSA 1TTTA 4EF5A 5EERA 1N6IA 1Z73A 5COQA 3IX7A 4FEEA 5A6SA 3RRYA 2HJSA 2Y1WA 3TJZA 2KX7A 1HE3A 1T9KA 2CMGA 1G8HA 3UY4A 4E94A 3AGPA 2JVIA 3IRUA 4WCFA 4G0PA 2OXEA 2WKWA 1PGPA 2GLXA 4URFA 1EVEA 2DUUA 2YWJA 4M22A 4WEOA 1OFUX 2FWNA 4AU1A 1PVVA 2X42A 3Q3HA 4IBOA 2B1RA 2FZLA 3IQXA 1NVVR 1SCKA 2G40A 2YNMC 3LHKA 4KAFA 2XD9A 4C87A 4J1QA 5T4HA 2F1IA 2YOFA 4G0XA 1WHSB 2DUMA 2H7VA 3JWJA 4ZO4A 3UHPA 2VSYA 1NVXQ 4ESHA 2IV2X 3WIVA 4DDHA 4O2LA 1Z3CA 3HV2A 3Q7QA 2PX8A 2WU8A 2EHJA 2ZVPX 2J5QA 3IP6A 1GTVA 5JS8A 4P80A 4BJHB 1R0BA 3LX6A 2ZT5A 3QU4A 4BNKA 3U4MA 5BVHB 5C1PA 2RGYA 1NUQA 1RD4A 1YJCA 4YCDA 3AERB 4G09A 3U9LA 5CTAA 1I2BA 3QPVA 2ZAMA 1FFGA 4U7GA 1OWOA 4CQJA 4WH0A 1L5WA 3IEVA 1HPLA 3NPMA 1H9BA 4ZQGA 4Q4AA 3HBFA 4RTNA 1VBMA 1C1XA 3RTBA 2DERA 5CK5A 4E7OA 5JHHB 3DO6A 1GTMA 2YZMA 1KMHB 1NU8A 1TPZA 3MCVA 5K0ZA 3FBTA 4H35A 5IM4A 1LTQA 1XLTC 3VKGA 3FAZA 2GO7A 2I3DA 3KZ1E 3HDGA 3ESRA 2DHQA 1TT7A 4MHTA 2ASVA 1U1FA 1A9OA 2XHEA 1B42A 3DNMA 2ENUA 2GDZA 3S8YA 2FUKA 3CRZA 4CF5A 2OHVA 3P20A 4NK5A 5BP7A 3B36A 4U2GA 4QRHA 3C6XA 1A8HA 3G5TA 1J90A 3CJTA 4MEBA 2G04A 5BUSA 2KSQA 4ZRDA 2DQZA 2VDOB 4LSZA 2FMKA 5HYVA 4N82A 2GZ1A 1TZJA 4JH0A 3K7EA 4W5HA 2BGGA 4QWWA 4RE5A 4NU0A 1NY6A 1O3YA 1TCVA 2MSKA 2PGAA 4H6PA 5CT9A 2ZIVB 4JMLA 4Y2TA 3ELUA 4H7IA 2A3RA 3R0VA 1J39A 1GPAA 1PDVA 5KOJB 1T1SA 2F59A 3SE0A 4A03A 3M8KA 2ZRDA 4D44A 5AFSA 4RKRA 3GIDA 4X9XA 1Z2OX 4M9QA 5A1TA 5ENZA 4C0JA 1G7SA 3MGBA 3PPYA 4MVJM 3T94A 4DJTA 1W9MA 2Q9AA 1CHDA 2RK4A 1EWVA 3BICA 3U62A 4ZYWA 5JCJD 3TDKA 5JSHA 2DZDA 3AHCA 3DLHA 3E2MA 2FWRA 3SJUA 5GGYA 1HLPA 4HATA 1O89A 4JLAA 3L8GA 1DHRA 3L7IA 1YUMA 2FWMX 2VSXA 3E3AA 3P1JA 4K2AA 4QBTA 5ADHA 3FOFC 4CQNA 2QIOA 4QPZA 4WLVA 1ITZA 4Q7EA 3S5UA 5KWVA 1C4WA 4PZCA 1Z6ZA 5LIRA 1QVVA 5JDCA 4NR0A 5AM0A 1J97A 1L5OA 1GT91 4QEZA 5K8TA 2B4RO 2OY0A 4Y98A 4IEIA 3HA3A 2QMUA 3QG5A 5L4NA 4EA8A 5KNLA 1BHSA 1G19A 3A26A 4B6PA 3Q5EA 4BQQA 2W43A 1N7IA 1RYNA 3L0ZA 4KQXA 3WYFA 4EY4A 4X63A 5HF5A 4QHSA 2WIKA 3B1YA 1KI9A 3K4HA 4FFRA 4R8LA 3VBCA 4DNXA 5CBPB 1GL7A 1VG9B 2RAUA 3PLRA 2CV0A 5DWVA 3BORA 1JN0A 1RPZA 1MPXA 3S0JA 2FPMA 4MUHA 4BMSA 1KZ4A 3ZZMA 1ZK2A 5J4VA 3HYNA 4FLEA 5C9ZA 5A6VA 1JJVA 3EMBA 4JEUA 1LVHA 2FEWB 1NLMA 1IATA 3ANTA 2VCEA 1G60A 4FKMA 1VZ3A 4B6QA 1BYIA 4PTZA 3EVTA 4OF4A 1JDPA 2IUSA 3LA6A 3DE1X 3OM8A 4IG9A 1P9OA 2QVCA 4J1TC 5ETJA 4R8KA 5T3UA 5B5SA 1EM8A 1FDSA 1XKXA 3UB3A 3OX1A 4MVXA 2HWXA 5TDHA 4DLBA 4YJHA 3DXZA 5JQWA 2FZEA 2J85A 4IH9A 2V5VA 3EXG1 1QO0D 3KJNA 6REQA 3OP4A 4G86A 2CJYA 3S55A 3T38A 4FZRA 3OHMA 2JIZD 3CF2A 4PX5A 2JI7A 2R5WA 2H2GA 2RC6A 4KN8A 4Q3BA 5KS2A 4DV5B 1GZUA 2IIVA 2XXJA 1SIBE 1Z74A 5SZKB 1EUZA 4QECA 5EMJA 4YRCA 3R5SA 3ZVNA 1EX9A 1XKTA 4N49A 1UK6A 2JEYA 4D9NA 4TSRA 3OZRA 3RVNA 4C4AA 5E1BA 4JWTA 2NTEA 1Q1ZA 5HKBA 3KJXA 2AZTA 2FSPA 5A3RA 1RJ9A 1MIOA 5I47A 4FMDB 5C53B 3QYAA 4G5RA 1CDEA 1NU6A 2C4KA 3Q8XB 3ZDBA 3I53A 4BWGA 4PZUA 2IS4A 1Q7RA 3COPA 3OJOA 3HY4A 4IQ8A 3U4CA 1G9TA 1FSSA 1IUNA 1Y1SA 1E9FA 2VNKA 2G1PA 1RW4A 3KYCA 1HG0A 4WSOA 3J7AC 3GLHB 4KFUA 4NC9A 4Q05A 1EEHA 2VA9A 3VM6A 4IXTA 1KPHA 5K3DA 3W5VA 4P2BA 1AF7A 2BPOA 2D0IA 2Q0HA 1I14A 1KZ1A 1L8LA 1R6DA 2D2FA 2YIVX 3A9UA 3CUUA 2DQYA 3OX4A 2HREA 4PG6A 3CCCA 3ZHOA 2A3NA 4LDPA 1N2EA 2VC2B 3DCYA 4C0XA 2XEXA 1ZU4A 2JJ2A 2SCUA 2I2DA 2MYPA 4DGSA 1FLDA 4ZJPA 1QH8B 4QNRA 3N8KA 3U81A 4M8IA 4YP6A 1Z39A 1CQWA 4L8WB 2Z04A 1FRNA 1RHJA 3DBLA 3WGOA 5TVKA 4B2LA 1B6TA 3HEBA 4UXJA 1QIDA 1Z8DA 3I1YA 3X43A 3ET4A 2IHTA 1M8GA 3EX7C 3NBYC 4L8GA 1ZONA 4R83A 2OILA 4HNTA 4BV9A 3EG5A 3GGOA 2HK6A 4IAOA 3RC8A 3ZGLA 3V7YA 1IM8A 4CL2A 2GEJA 1UT6A 3AT1A 3LWBA 2CB0A 3DSRA 3CLSC 3KQSA 2WTUA 4NWIA 1UL1X 5KAMA 5DNCA 4F3CA 1E1RA 4QQRA 2J4FA 4H3KB 4PFJA 5DSXA 5CDSA 2JK1A 4E70A 2YWGA 2I67A 3SEFA 2CJXA 1UMBA 1ZLYA 2MJLA 4JHXA 1Z4MA 5AIBA 5ALOA 1FL9A 3ND9A 4CEIA 3AGQA 5JZSA 4LBWA 1GRVA 1TMKA 2WP0A 3KKZA 1GZVA 4BX8A 3M89A 1OHHA 2D7JA 1VPEA 3FVVA 4LPSA 3RABA 4D9KA 3SM3A 5KYYA 3ADDA 2V6FA 3KHSA 2TMGA 1TRHA 1U31A 2WHQA 4PZ9A 3ABZA 2B5OA 1GSHA 4LI3X 4U8GA 4BKQA 5FLXA 3FYTA 4MV0A 1TIKA 2Z2IA 3A25A 3HKEA 3ZD7A 5TMPA 3V4SA 4EMSA 5B7GA 1U8CB 3AM3A 1N2CB 2FWBA 1JLHA 4GIBA 1CT9A 1UQRA 3WE7A 2OV2A 4MV7A 5BWCA 3P9IA 4O4JA 3TQFA 1E94E 2CBGA 2H4HA 2G09A 2O14A 2F3PA 2HQOA 3F49S 1QE3A 2ZEJA 3N74A 5TVGA 3PJRA 2E18A 3JQFA 1H8HD 1N5MA 2B20A 2WBLC 2PFGA 2C7QA 2I54A 2Q07A 2BI4A 5F1KA 4OMUA 5IC5A 4PBTA 3WAGA 1I7NA 3IULA 4I1OA 1X7ZA 4EENA 1SBIA 1IONA 1XEWX 4Q9NA 2C03A 2ONZA 1VG8A 3GJ3A 1I32A 5AJHA 2WW8A 4L7QA 4CV1A 3TM5A 1UM8A 1SXIA 2UZ1B 3BHJA 2D3WA 4ZEWA 4A23A 1BE8A 2QG6A 4QQFA 2Z43A 1M8PA 5DBEX 3WHPA 4CVNA 4R2JA 1ZUD1 1DC5A 4ZP1A 4JYPA 4TM8A 3TZ6A 1BW9A 1TKRA 5BWLA 2YH2A 1HLDA 4OUDA 3ZI4A 5DM70 1NUHA 3CZQA 4IDGA 4CLHA 3R3JA 3EXG2 3ZDFA 1OIVA 2P4HX 2PL3A 1NUPA 1MX9A 2QX6A 4DIFA 5KWSA 2PMFA 3GFTA 4D3DA 4G4GA 4EHAA 1WCIB 1FQWA 4NCNA 1NR7A 1Z16A 2JAWA 2FYTA 3FOAA 4UHBA 4GKVA 4M0FA 5F3RA 1YZUA 1QHNA 1QGOA 2I6TA 4NCHA 1RWMA 1AK9A 3BS4A 1I4DD 1UDRA 5BR8B 2WPDD 1Q12A 3NRJA 4YH1A 4C08A 5LR6A 4XGQA 4CUJA 4CLRA 4JJEA 1U4NA 4FI3C 3W8RA 2PS3A 1N0UA 4B48A 4FGZA 3D8BA 3I2HA 3F46A 5C4MA 3JATA 1C4KA 1PZHA 2XBLA 3RIHA 4OFBA 1K8YB 4HUQA 3RV4A 2NO1A 4K9NA 3UHOA 3I04M 4DCTA 5I48A 1DVRA 1J20A 2PM8A 1IPHA 3GXBA 1AY0A 2IYZA 4UMDA 4R7TA 4DJDC 2BY4A 1WLSA 2I1VB 2Q0XA 3GL9A 3IT0A 3N0VA 4GXRA 5E8JA 1I2AA 3RR2A 4M0DA 4AJ2A 4NEQA 4Y1EA 5HF8A 1EZ1A 1DKLA 2WWRA 4RHFA 2BLLA 5LMZA 1OWPA 1Z8NA 1EM6A 1NXQA 2HN9A 1SIWA 2RONA 3MLAA 5G4KA 2GILA 1JIXA 1JYSA 1NNEA 1TT5B 3SICE 5C7IO 1OXTA 1KJJA 2R8RA 3FOBA 4C3UA 4BZQA 3MOIA 2JD2A 3FKJA 3K8QA 5KWJA 4B3BA 1FUEA 4C88A 1Y1TA 2ZT7A 3K35A 1URPA 3JZDA 4GYJA 4IHJB 2VDQB 4FJ1A 5EP1A 1C0PA 5ITZA 1DFHA 1C4XA 3HN6A 5FEUA 1T1GA 3DMPA 4FDUA 1GY8A 4XM2A 1PK7A 3SDBA 3T7KA 1TX4B 4B3XA 1M3SA 3TBHA 1QRRA 3Q2KA 3IXLA 4I9HA 3TCXB 4DPLA 1CLUA 1JSZA 2WF5A 2VPIA 1N6PA 1ZRNA 3BXXA 3KQKA 2UU9B 2BJVA 1T3TA 1N2SA 2NLOA 2J48A 3G88A 3OZ7A 3PFWO 4XAQA 5LA6B 3HXOA 3LM8A 1ZEMA 1JJAA 3I72A 1M75A 4N7JA 2APJA 2J6CA 4ZTUB 4FDMA 4GQIA 3N8IA 5F52A 3EAFA 4YMSA 5TGTA 1CJVC 3UC5A 1VSVA 1TAQA 3C4JA 4KBFA 5DHAA 3RYCA 3QF4A 3IKVA 4NEHB 3WMRA 3NVKI 3LCRA 3O0TA 3VR5H 3WRWA 1QO7A 3C43A 2B3DA 4U9HS 4G1VA 1JHOA 4ZYYA 1F2UA 1YAHA 1WXXA 1Z2CA 2XJ9A 3ZU4A 2WE7A 5F4BA 1NC3A 1QRAA 2EL7A 1NFQA 3I4CA 4E09A 3CRMA 3HVIA 5AI4A 1VYUA 5AK5A 5F2KA 1J4AA 4H6VA 3RS4A 3MCZA 1BDHA 3DZHA 4C04A 3Q0TA 4HQOA 3MUEA 4C29A 1SQ0A 2ZJFA 5GJWC 1YRBA 3BK2A 1ULBA 4Z9YA 3DMFA 3K30A 3VPAA 1VGQA 4IKPA 5EVJA 5L3QB 1MNQA 1FS4A 1PW7A 3SJBA 4EVIA 3U7JA 5BORA 2UXBB 3G0OA 1GP2A 3NDRA 4C4XA 4KR0A 2WNHA 4DEVA 4DIMA 3OJLA 1LTKA 1GLGA 1T8RA 1Z15A 4R8SA 4DSUA 3P45A 1E5LA 1YASA 3ECSA 3P5BA 4J94A 2Q5LA 3TRKA 4DLXA 4HBGA 5B6IA 1BHJA 3H1GA 3H84A 3KZOA 1KYYA 1JAIA 1M2VA 4NZ9A 5DTIA 2NUAB 1BH2A 4DLTA 4Z3OA 1IOZA 4D96A 2CUNA 2QT9A 1Y42X 5BV1A 2HFKA 4MUNA 1BXRB 2IL1A 2ZT6A 1DKRA 2C0CA 3UXHA 5KX5F 2ZSJA 2DTDA 4J7XA 3CY6A 1J8VA 2I55A 2B30A 3F97A 1O57A 3MAJA 4NU5A 4TM7A 3VYUB 1RI3A 2ZJ3A 4GS5A 5GGXA 4CCSA 4QJ3A 5CNIA 5LNK1 4H0NA 2E4XA 2MU1A 3FLAA 3LC2O 4M99A 4P98A 3T7EA 3GGPA 1I7DA 3E23A 1HV8A 2DHCA 4EGQA 1PS8A 3Q7TA 1B3RA 2FSFA 2QRHA 3I6ZA 1IN5A 1GITA 2BE9A 4U7JA 2H57A 5H16A 5LQAA 1DCTA 2X41A 4Y7CA 2FP4A 3NFYA 5LP6C 4LHYA 5TGZA 2B98A 1OT3A 3LFUA 1YZLA 4ZGGA 1X2BA 1V35A 1LNSA 4XQ0A 1H4SA 1A7AA 4TXMA 4M1EA 4NDAA 4BKUA 1M1NA 3PXDA 4EB3A 3T34A 4BWFB 4LYAA 4DIKA 2C4HA 2JA1A 2O3UA 1P7ZA 3JYHA 1YACA 1ZK3A 2V3WA 1KSFX 4D45A 2BM0A 2XWJI 4URZR 3HWSA 4GOMD 1DAEA 4M1KA 2OPHA 1GNQA 1J1IA 5JAOA 4R16A 1FXUA 1Y9JA 5A4MS 4CN8A 3QUSA 4QQNA 2AOVA 1B8NA 2IHYA 3RU9A 5HW0A 3BUSA 2QTZA 1IUKA 1N7JA 4PX2A 4Y1RB 2XLBA 1RE1A 2PMBA 3GFGA 1KZHA 1KJWA 4IW3B 4BO5A 4L8FA 1NFFA 1E3QA 4U5XA 1G5PA 2ZIXB 1Q3TA 2R84A 2EC5A 2Q0QA 4JY7A 3U4AA 4LYFA 2IHNA 3MTAA 1V5GA 4JASB 3VO1A 3JQ7A 2GYVA 2GH1A 1KFKB 1U3VA 4MQLA 2WTAA 2I3GA 4ZHSA 1H2ZA 4Q4HB 1IXKA 1GZ4A 4JR0A 4I4TF 1MX1A 1AZSC 1RR6A 3KQVA 2SCUB 5IAKA 4EG7A 3QPCA 3WMEA 1YC5A 3QNUA 4L74A 4BEBA 3S2YA 4YUVA 1ZW6A 1LSSA 3GRYA 3MWDA 4TPKA 3RF7A 3EVEA 3WLAA 1I4EB 4DYHA 4AXBA 2WD8A 4X8HA 3TX2A 3KSBC 4R41A 3WRYC 4G89A 5F7XA 4K0KB 1RPTA 5JPCA 3QEJA 3VJRA 4AF8A 5EXXA 1UJ4A 4UEOA 1AD2A 2QMYA 3QITA 3LV8A 3O4VA 2PL9A 4WDRA 5DT2A 4UAUA 5FDFA 3TZLA 2WY2D 2HH9A 3D9QX 4M46A 5EKDA 16PKA 3B6MA 2H54A 4YCJA 2PL1A 4KXVA 4QODA 2ZYDA 1ZJWA 2WIBA 1GKYA 4O4IA 2TS1A 1S8NA 3IVXA 4W1RA 1I4WA 2P9JA 3PWZA 1PNOA 1ZH6A 1A77A 2JGEA 3NIGB 2VS1A 3C7CB 4FYMA 4EY7A 3WHKA 4ZZ0A 3CH7A 3MMZA 2C0QA 2ANCA 4ZJYA 3G5UA 4YV2A 4YDSA 2PANA 4INPA 4X6UA 2XYHA 1WV0A 4HB3A 3WX0A 4OYLA 2NTNA 3OPYA 5CVUA 3R9XB 2GYYA 4RFLA 3LYHA 2B1IA 4KSCA 4Q9KA 3KSAC 4KZKA 1NOIA 2BFMA 4URXR 2FHPA 5H81A 4REOA 1MC8A 3UJBA 4BVAA 5J2TA 2BEVA 2WUEA 1UJBA 2D0DA 3LD9A 5BUCA 3M4JA 4H08A 3FB4A 3IP9A 4M9SA 5TQVA 1P19A 5F12A 2B94A 3DDCA 2ACVA 2EQBA 2HDWA 3MT7A 3DF7A 5B4UA 5FJJA 1PT5A 1XB2A 2H4JA 3IB6A 2GN4A 2REQB 4QOSA 4B3MB 3CLKA 5HUQA 1WZUA 3TTYA 2Z5VA 1EFCA 2HCJB 3IMFA 4CBVA 1NMYA 2YJ5A 5DB4A 2HK8A 1MC1A 1DXHA 5K0BA 4DZZA 2WINI 3HVUA 3KQQA 5IUKC 4WBNB 1C0KA 5HFAA 3R7BA 1GKKA 2ANBA 2X2OA 1V7QA 1UDBA 3CLUD 5KPJA 1R2QA 2O1EA 2FH5B 2QX7A 1L7XA 1R6VA 3DE4X 1KK0A 2I6GA 4DR5B 5FPKA 1S3FA 5FF9A 4ZEMA 3D7LA 1OU0A 2GJAA 2OO5A 3GDWA 4YYZA 4KNWA 2NOAA 1VJ1A 4IGIA 2EIXA 1DTSA 3D6MA 1PJLA 4P86A 3UAYA 5FYDA 4GXNA 3NUGA 2JLUA 2XMPA 1LQTA 4A2QA 4P5PA 4XQGA 2IYOA 3LQYA 3CF4G 1QCYA 2JG3A 1NVKA 1NE7A 1PT9A 1QFZA 2GBLC 3GD5A 2B9EA 2R6R1 1ZCAA 2BEWB 1OH7A 3JVVA 4GUAA 4JCCA 1D9ZA 1DOHA 2R8ZA 3B8EA 2JLAA 4G41A 4CM5A 3IHKA 5E6RB 5BW8A 5JXJA 3GJQA 1GZ3A 4JX8A 1T6BY 3C5CA 2VYND 5D5PA 5JLJA 3THYA 5M2QA 2WHRA 1ZH8A 1U80A 3ED1A 4X3CA 1M34E 1GKIA 3KU1A 4DV4B 1UEXC 2C29D 4XM1A 3ND5A 2VHJA 3QFSA 3BE6A 1PSDA 3UXEA 4HH1A 5TQ0A 2A6PA 4BJ5A 5LKAA 5DVZA 3FNIA 2Q27A 3R7NA 4X62B 1IJEA 1VJGA 1V7ZA 2R1ZA 2ZB3A 1T4CA 3QJYA 4L76A 3NH6A 3C87A 2GPYA