4MQ4A

Crystal structure of hpnmt in complex with bisubstrate inhibitor n-(3-((((2s,3s,4r,5r)-5-(6-amino-9h-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-yl)methyl)thio)propyl)-1,2,3,4-tetrahydroisoquinoline-3-carboxamide
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
264
structure length
264
Chain Sequence
APGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Phenylethanolamine N-methyltransferase
publication title To be Published
rcsb
source organism Homo sapiens
total genus 97
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2013-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4mq4A00
4ZTBA 2QYOA 1X19A 4HC4A 3T7RA 1QYRA 4XUEA 2ZCJA 5ERGB 1N7JA 4PYNA 1JG1A 3B7PA 1U2ZA 3C3PA 3GDHA 3HVHA 2G70A 2AOTB 1NW7A 2NXNA 3LCCA 3ELYA 3LKDA 4E2WA 10MHA 2IH2A 1ORHA 3BT7A 2CMGA 3NDJA 4C03A 3GRVA 3O4FA 5EGSA 2R6ZA 4RTMA 5CVUA 4AZTA 4XUCA 2HR1A 5GINE 3EVCA 2ZFUA 4PYOA 4CKBA 5K0EA 3M33A 4IWNA 2IP2A 2Q41A 2NP6A 4AX8A 2P3LA 3G88A 4PCAA 3SXJA 2PXXA 5ICEA 5GIOE 1P91A 5F2NA 1JG4A 5K09A 3SVZA 5DM1A 3SM3A 2AR0A 3GXOA 1M6YA 5DM0A 5JR3A 3GIWA 3L8DA 4C06A 5P8WA 4POOA 2ZIGA 1FBNA 1O54A 2H11A 3ELDA 2O05A 5LQJA 4PNEA 4KIGA 4HH4A 1XDSA 3DR5A 4PINA 4QPNA 4OBWA 1G6Q1 4PONA 4OA5A 4RYLA 3THSA 1JTEA 3AWIA 3PS9A 4HTFA 3UJAA 5K0GA 4P7KA 4BY9E 1L3IA 1XDUA 2UZ4A 3P2IA 2PSSA 2DPMA 4P7FA 3HM2A 4MQ4A 1SUSA 5LQRA 1NE2A 2P41A 2C7OA 2C7RA 3UJ6A 3VYWA 7MHTA 4B17A 5FHQA 1SQFA 3LBFA 2VDUE 3UA3A 5EHGA 4CTKA 1VBFA 2ESRA 4RTSA 3K6RA 4X63A 2UYOA 2ZSUA 4P7GA 3B3FA 2AVNA 2YQZA 3I9FA 3R24A 3R6TA 4R6XA 5E9JA 3I53A 3B5IA 5LSAA 1KHHA 3MTIA 2UYQA 2AOVA 1DUSA 1HNNA 4E30A 5E1BA 5DTRA 2O07A 2PXCA 3LBYA 2ZZNA 5CVVA 1AF7A 3V8VA 2AN4A 1ZG3A 1RJGA 3FTFA 1XCJA 1YUBA 2QRVA 1UWVA 3LSTA 4NECA 5K03A 3MCTA 3WSTA 1FJXA 1O9GA 3OU7A 3UJDA 1YZHA 2CL5A 1RJFA 1SVUA 5DTMA 1ZGJA 4FP9A 1QZZA 4DCGA 5CM2Z 3ELWA 4YV0A 2FK7A 3SMQA 3G2MA 4QTUB 3NJRA 3M6VA 5T67A 3F4KA 4RSRA 3NWBA 4HGYA 2A14A 1WY7A 1XTPA 2V7EA 2GS9A 4QVGA 2G71A 1XXLA 2AVDA 5FULA 5KVAA 4KIFA 4CKEA 2EX4A 3GCZA 2WA2A 4MTLA 5F2KA 1L3CA 3C0KA 4C4AA 2OPBA 5DSXA 2GH1A 4QPPA 3OZRA 2PXAA 2PT9A 3ER9A 3HP7A 2P3OA 4R6WA 2I62A 4OA8A 4RTOA 2Z6QA 3NVKI 1IM8A 2BR3A 5HFJA 3UBTA 3IEIA 3ERCA 4P7JA 2ZZKA 5E1DA 5LQKA 3DLIA 4R8SA 3OU6A 5EQJB 4AZVA 1M0EA 1FPQA 2JH9A 4PYQA 1FP1D 9MHTA 5FADA 4KW7A 3JWJA 2IBTA 4O29A 3I64A 4EK9A 2I9KA 3LL7A 1R18A 4EVIA 3P71T 1F3LA 4P58A 3SSNA 5DLYA 2ONZA 4QQKA 2AOTA 5HIMA 4Z2YA 4IV8A 5HEKA 1JTFA 1JSXA 1RI4A 2FCAA 2N47A 2BR4A 4PIPA 3EVGA 5DTQA 5LQNA 3ER8A 2F8LA 1ORIA 3DXZA 3KU1A 4GOLD 2IH5A 3D2LA 2P1DA 1R74A 2IFTA 4XUDA 4DQ0A 1R6AA 3G5TA 3R3HA 4R05A 3UFBA 4EKGA 4KWCA 5DX1A 5EVJA 4YUWA 2YTZA 5EMJA 3HCEA 3DMGA 3KQWA 2XYRA 5K0NA 2JG3A 3PFGA 4XCXA 3QOXA 4PYIA 1RI5A 2OO3A 2IPXA 2PVCA 3BKWA 3KQMA 4BP3A 2G1PA 3A27A 5FCDA 4GC5A 4M37A 5LQCA 4DA4A 1RJEA 3EVDA 3AJDA 3GWZA 5EKXA 3SGLA 3KPJA 3P2KA 1L9KA 3TKAA 3DOUA 4CWAA 2PJDA 4YUYA 4EMSA 4F84A 4RTPA 5EHIA 5F2OA 8MHTA 4LG1A 3LECA 3SSMA 3M6WA 1RI2A 5EOVA 4JXJA 3VC2A 3A25A 3G8BA 4KRGA 5ICCA 1BHJA 3CVOA 3OFJA 1JG3A 3MERA 3GRRA 2E5WA 3PFHA 1L1EA 4FSDA 5LQAA 1NV9A 5HILA 3G5LA 1P39A 3M70A 4QDKA 2Y1WA 3OPNA 3OZTA 5E2AA 3B3JA 3G7UA 1I1NA 3BKXA 2O57A 3EVEA 2ZBPA 3FPGA 1I4WA 3E8SA 1SUIA 3A4TA 3I58A 5GM2A 2IH4A 1ZHFA 2P3QA 2PGXA 3K0BA 4DM3A 2R3SA 4F85A 2PX4A 3RIEA 2PX5A 1V39A 3MAGA 1D2HA 4MIKA 4V0RA 3KR9A 4E32A 5KS2A 3X0DA 2C7PA 3KPVA 2PY6A 2JJQA 4WXHA 1NW6A 2ZLBA 5EG5A 5FA8A 5M5BA 4LWOA 3BZBA 3HVKA 4KDCA 3FZGA 1XCLA 5E2BA 2NYUA 2CWWA 4RVHA 4CTJA 4DMGA 4HG2A 5FWDA 2GA9A 1QAQA 3BWCA 1WS6A 4PGGA 4RTJA 5CVJA 3G8AA 5DXJA 5ICGA 1QAMA 3G89A 5K0CA 1EQAA 3UA4A 1Q0TA 3A7EA 3HA3A 1G8AA 4F86A 2EJUA 3FUVA 3JWHA 1TW3A 1VP9A 2P7IA 3LDGA 3HVJA 3C6KA 1KXZA 4PCLA 4Y30A 2BR5A 2P40A 2VZ9A 3P9IA 3TPZA 1YB2A 3TOSA 4RV9A 1ZKDA 2PX2A 3HNRA 1BKYA 1N7IA 4G56A 4YMGA 1WXXA 3KKZA 5BW5A 3TMAA 1R8YA 3AY0A 2FK8A 4WVLA 2BZGA 3IHTA 4BP1A 3G2PA 2BM9A 3M4XA 4E31A 5KQRA 4MHTA 3DULA 1NT2A 3R9XB 5EKUA 5DT2A 1XVAA 1QAOA 1P1BA 2B3TA 3GRUA 2IIPA 4PGHA 2PWYA 5D1HA 4FZVA 4M38A 2ZBQA 3B89A 1P1CA 5BP7A 3NVMB 5LQUA 4BLUA 1G60A 3CBGA 5K0FA 4RX1A 5EPEA 4DKJA 3TFWA 3DUWA 3UJ7A 5FHRA 4RTLA 3GU3A 3HEMA 1EG2A 3FRIA 4V0QA 3AXTA 3E23A 4RTKA 3KQSA 3RODA 5K0BA 2NP7A 3UWPA 3VC1A 3KQVA 2ZULA 3PX3A 1IY9A 2UYCA 2XVMA 4Y2HA 2PV0A 5E1MA 3B3GA 2ZWAA 2GB4A 3NW9A 2CMHA 5DRTA 2IDJA 3KPUA 3MTEA 4DF3A 1R00A 3RW9A 3CJTA 3QOWA 2VP3A 3O7WA 5D1NA 2Y1XA 3KQYA 1WG8A 4E2ZA 5GM1A 4KDRA 3EEOA 1SG9A 5DX8A 3TM4A 4GQBA 2EFJA 5FWAA 5GOZA 4X41A 3LCUA 5CVEA 3DH0A 1TPYA 1INLA 1Y8CA 2NNWB 2CKDA 2JHAA 4PYJA 5C9ZA 5K0JA 2ZZMA 3GGDA 3OU2A 2K4MA 3BGVA 3KPYA 1SKMA 2FHPA 3LCVB 3HVIA 4K6MA 4RWZA 2ORED 2ADMA 4IV0A 1D2CA 2ERCA 3HCDA 3OFKA 4GC9A 5EZSA 5GWXA 3HCAA 1EJ0A 1EAMA 5HZMA 4KVZA 4YUXA 1X1BA 3OCJA 5HIKA 4EQZA 2LD4A 2FYTA 1NW3A 2I7CA 3BWBA 2OB1A 3UJ9A 3PLAE 1BC5A 4PIMA 5E1OA 2P8JA 2ONYA 3PTAA 3MHTA 1NW8A 1NV8A 3P9CA 3IYLW 5HIJA 2YUIA 2ZBRA 2NXCA 3CCFA 4E33A 2G72A 3ORHA 1JQEA 3PX2A 1PRYA 1RI1A 4GOOD 5EIWA 4A6DA 4AZSA 4YV1A 1DCTA 4H0NA 3P2EA 3TLJA 4E70A 2ZIEA 3KPWA 4FGZA 4RTRA 3GRYA 5EMMA 1MHTA 4CXMA 2O06A 1Z3CA 1WXWA 3FTEA 5DXAA 5KQSA 1F38A 2PLWA 4OBXA 2YXEA 1XJ5A 3QV2A 5C0OE 5DM2A 3A26A 3HCBA 5EZQA 4YUVA 3U81A 5GP1A 1X1CA 1ZGAA 3BXOA 4QQNA 4FS8A 2Z6AA 3O31A 3UZUA 2HMYB 2XBMA 1YFLA 3BGDA 2IDKA 2NXEA 1AV6A 1JQDA 1VL5A 1VIDA 3FTCA 3EVAA 1G55A 4M36A 1YFJA 1MJFA 5HIIA 3JWIA 3HA7A 2AOXA 3R0QA 4C05A 3HTXA 3LHDA 4ER3A 3ANXA 3KR1A 4OX9Y 1DL5A 2P7HA 4AUKA 2V74B 3LDFA 3SSOA 3VSEA 1FP2A 1YZ3A 3CJQA 3CGGA 4IKPA 5ICFA 1I9GA 3FPHA 3SX0A 1NW5A 2VDWA 3IV6A 4GUAA 4PYLA 3G2OA 3P97A 3CJRA 5EMKA 1EIZA 2ZTHA 3EGVA 3M6XA 4X1OA 3DMHA 2C7QA 3AXSA 3EMBA 3Q87B 4GF5A 4GOND 3UJBA 1NBHA 3GO4A 4RTQA 3TM5A 5JUWA 4ER0A 3NDIA 3CC8A 1JQ3A 2EG5A 2GPYA 2AOUB 3HA5A 3OE5A 4U7TB 5H02A 5CVDA 3TKYA 1L3BA 3JWGA 4CKCA 1AQIA 3HCFA 3NWEA 4YMHA 5T64A 2YXDA 3FUUA 2OY0A 3ID6C 3LPMA 1T43A 1JR4A 3FYDA 3V97A 3UJ8A 5CIYA 2OKCA 4HGZA 1RI3A 1O9HA 2EJTA 4M7RA 4BLVA 1HMYA 2B9EA 5DM4A 5K01A 3DMFA 1R8XA 2ZVJA 3MGGA 4LECA 5E9QA 5EEGA 2XVAA 2HTEA 5T6BA 4C07A 5EMLA 4X60A 3KR0A 1N2XA 3T0IA 4E2XA 2JHCA 3ELUA 3G2QA 3EMDA 1KIAA 2HWKA 4C04A 2DULA 2H00A 1SQGA 5C1IA 4A6EA 1Q0SA 2ZW9A 2AS0A 2YVLA 4EKIA 2QY6A 3M6UA 5FQOA 2KW5A 2P35A 5FTWA 1VP3A 1VPTA 5LR6A 4RVFA 2BH2A 2AN5A 2QM3A 4RVDA 3BWMA 4HRAA 5E9WA 3LGAA 2OBFA 3LX6A 4RVGA 2WK1A 2GLUA 3ME5A 5FQNA 4QDJA 3C6MA 3FPEA 3BGIA 4ER6A 2VS1A 1TW2A 5EIFA 4DZRA 5FUBA 2AOWA 3GJYA 1KPHA 4QVKA 1AQJA 1WZNA 3KQPA 2FPOA 3LDUA 3Q7EA 3FUWA 3S68A 5E8RA 5KYGA 1KR5A 5DRYA 2OYRA 3EGEA 5DWQA 1VE3A 4R8RA 2BM8A 2QE6A 4FT2A 1RJDA 3OE4A 2B78A 1BOOA 4OQDA 2I6GA 5K8VA 2NXJA 4HTFB 1UFKA 1IXKA 3P9KA 5EC8A 3KQTA 3THRA 3NTVA 4OQEA 2O0LA 3CKKA 3NMUF 1X1DA 4ATNA 3PT9A 4FT4A 4U7PB 5DPMA 3T7SA 1EJ6A 2JH8A 3MQ2A 3EVFA 5DX0A 4DCMA 5HOQA 5CCBA 5MHTA 3DTNA 1B42A 1YF3A 5U4XA 3EPPA 2HV9A 5GIPE 2B25A 4QTTB 3SR4A 3MCZA 4E2YA 1JG2A 2PKWA 2B2CA 2G8NA 3FPFA 1D2GA 2FRXA 3BWYA 4FSXA 4PYMA 3KQQA 2HNKA 2OXTA 3TR6A 2XYVA 2ZWVA 3GNLA 3GRZA 5BW4A 2Z6UA 2GAFA 1NKVA 3E05A 2IBSA 3FYCA 4PWYA 3PB3A 4GBED 1VQ1A 4MWZA 3KHKA 3KR2A 2AN3A 5K05A 1OR8A 2QRVB 1X1AA 3DP7A 1QANA 3FRHA 3FUXA 1G38A 3OZSA 1UIRA 1KP9A 5DSTA 2AZTA 3REOA 3P9NA 5IH3A 1KPIA 3E7PA 3EGIA 3P8ZA 1KYZA 3PVCA 5K0LA 1NBIA 5FA5A 4YV2A 4RTNA 3DLCA 3EVZA 4LWPA 2PBFA 4C08A 3I5UA 1ZQ9A 3EVBA 1G8SA 2YXLA 4PYKA 2VDVE 4AZWA 1XDZA 4GEKA 4ISCA 4YUZA 1M6EX 3UJCA 5E8JA 2YR0A 4L7VA 3C3YA 3T7TA 3HCCA 2ZIFA 5B1SA 3DXXA 2UYHA 3DXYA 2H1RA 2AOUA 3TRKA 3H2BA 4ER5A 5CD1A 4UOEA 5G02A 1H1DA 2PT6A 4HSGA 3KQOA 5IKMA 3FTDA 1VLMA 3LKZA 5CUQA 2OB2A 3MB5A 5EEHA 5BXYA 4GOMD 2WA1A 2XYQA 5CCXA 3EEYA 3A7DA 3FUTA 1PJZA 2OZVA 2IGTA 4BLWA 3BUSA 1KYWA 2PX8A 1KPGA 1JSZA 4ER7A 3FPJA 4X61A 2YX1A 3TQSA 4FR0A 2JHPA 2PWPA
chains in the Genus database with same CATH superfamily
2BI7A 4ZTBA 1P29A 3H5LA 1SC4A 2G9UA 1RVV1 1OD6A 1JL3A 2QN3A 1VC2A 4NOKA 4S1TA 5EWMB 3SF8B 3ZDQA 3RV3A 1XLTA 4WBNF 3CEJA 1RAEA 1R0SA 2ZPUA 3QUCA 5AVZA 3FHJA 2ATCA 1E1NA 2XUJA 1XA4A 2YFHA 4MR8B 4WKNA 3M1LA 4DNQA 5GV7A 3GRVA 4BVFA 5FXMA 1H2YA 1STOA 2A9JA 2A8YA 2CC2A 2AW3A 1TJNA 3EJ6A 4NXMB 3IL2A 3G0GA 1SUCA 2YW9A 2XLBA 4FDLA 4PYOA 1Z12A 3EWIA 2X5XA 3CKMA 4FE7A 2ZDHA 1B74A 3B52X 5CTAA 4GM0A 1CUYA 3G88A 2FE4A 1E1RA 2AYYA 3LAWA 4ZQBA 4EVQA 1ZJWA 2AHRA 3R09A 4D6PA 1GZ7A 5F2NA 4KXLA 5JECA 2REQB 1GZSA 3WBFA 4BNXA 3GEMA 3UIEA 3AVTA 1T10A 3GEHA 1GG8A 3A1VA 3RVMA 3WK4A 3GLGB 3LLCA 4LAFA 4N8DA 1NVWQ 2XZOA 4PNEA 4TL7A 2HBRA 3TZ6A 3OE1A 3ZZ1A 3KB2A 2V6IA 2PM8A 1IY0A 5DHFA 5AW0A 1MAHA 4PONA 1RM4A 1ODJA 2ZSKA 4DDTA 5EUBA 3A3NA 4YI3A 2H3EA 1P7YA 2JFUA 1UQTA 3UJNA 4UCXA 3ZVLA 2IQIA 3YASA 4Y6QA 4FJ2A 1J97A 2IU4A 1U3FA 4R3NA 4RMHA 4B17A 1SQFA 1YC2A 1SNYA 2HIHA 1TZMA 5LBUA 1FMCA 3FSGA 5EE1A 1QHHB 4FKZA 2QUKA 2ZSUA 5E9JA 2AVNA 4IOKA 3R24A 4BCBA 2C7RA 4YV7A 3BMXA 3O9MA 3Q2KA 1OYWA 4HL6A 3TW4A 4B7CA 1Z26A 2O07A 4RLHA 4RH1A 1SXJB 2GDJA 1N8TA 1M33A 3ZGNA 2X77A 3VISA 3SC2B 4BS9A 1N5JA 5T3YA 1PJAA 4HN2A 3L6RA 4LYGA 1RQ7A 4N3CA 4BB9A 1FFWA 1V26A 3VZCA 2HA0A 1XNQB 5I5GA 4I1IA 3OT5A 5KNCD 4HRXA 4QOHA 4JUCA 1UFOA 1FA9A 1GFSA 2QL9A 1BJRE 1Y4UA 3D4LA 2EIHA 3G2MA 4GG1A 2GF2A 1UKBA 4HEA6 5T67A 2ZQYA 1ST3A 3EZGA 2D5LA 4KSBA 1UBFA 3OLZA 5AM1A 9ATCA 4A03A 5HW0A 4WK6A 5G1PA 3DJYA 1YQUA 1VI6A 1H5QA 4YACA 1XXLA 1KH2A 4F5EA 3MS7A 1QH1B 2IF0A 4KIFA 4BNFA 3DTYA 1U7TA 1ECPA 2GJKA 4MUGA 3ZBQA 3HU5A 3M49A 5A5VA 1JLHA 2HOQA 1ZNWA 4CIYA 4HNTA 2Z08A 4IEIA 5EUMA 1CXZA 4KTTE 1K5DA 3LX4A 1DJNA 4QPPA 2ZKLA 2GCOA 1W19A 1FP4A 4D79A 3AFMA 1LB1B 2ZI6A 3DTVB 1R6BX 2E85A 2PSJA 3K09A 1H2ZA 3IXMA 3KL2A 5E1DA 1JQJC 2JJ8A 3AW9A 1IN7A 3D2AA 4CMAA 3H19A 1J99A 3WICA 2X8JB 3OCWA 3WQSB 2HQOA 2J0EA 4EPRA 4DLLA 2GLXA 3I64A 4YT5A 5G2OA 2H2GA 2PQ6A 4ZGWA 5CA1F 1E2QA 1Q2XA 2JI6A 5DLYA 1ZRNA 4M99A 2AOTA 3OF3A 3DFMA 2JIOA 2VBCA 3OY7A 1N0HA 3OOJA 1RI4A 1JHXA 1G66A 1TTHA 3LCMA 3NKLA 4JFRA 1A8HA 3KU4A 1OH5A 3ZLJA 1CDEA 2CHVA 4H60A 4JJ8A 1OXBB 2RGWA 2K2WA 3AU8A 2YDYA 3ZWVA 3C14C 1TQ6A 5BQFA 4DR4B 5E38A 4RAQA 3TH5A 3MINA 2BEUB 3BL6A 4R05A 5AM0A 2PX6A 4KWCA 1L4NA 4DTIA 1G9TA 3A70A 1YXMA 4HVTA 1QFSA 4UUBA 3GT3A 1U8EA 1UC4B 4TTQA 1M2VA 1NNLA 2IHBA 2IPXA 2ZBDA 3IDZA 2WTEA 3UAWA 4ZMBA 1V5WA 1O77A 2WAAA 2XWJI 2C2GA 4NE7A 5TMDA 2V7XA 3V7UA 5IU6A 3JQAA 5HWSA 5JTUA 3SGLA 1DX9A 3AEUA 3RUHA 1C9DB 2XE6A 3OWOA 4RFLA 5F2OA 2EF0A 4QX6A 3TVYA 3LRXA 3TX2A 1KE2A 3MWFA 3U3DA 1UDWA 2Y1DA 5ER9A 2FPSA 3QFRA 4FXPA 1P4AA 2EG9A 3DYBA 1V96A 2Z9DA 3N6XA 1SZDA 4N7BA 1MB4A 2ZWMA 3G7NA 1FS4A 4FSDA 3U4AA 1NV9A 3WXBA 2B4YA 1P39A 2R25B 4AT1A 4B8WA 1KVRA 3RSZA 5ELLA 1I1NA 3CNOA 4K9QA 1YHNA 4F45A 1IB0A 4CM7A 2RD2A 1SUIA 1GCIA 4RS4A 1ECFA 1O96B 3K9LA 4E46A 3M2TA 5DH9A 1F6BA 4TLMB 4MIKA 5AXBA 4ZI3A 1GTRA 3TNYA 3WYNA 4RHFA 3EC7A 2HMUA 5C35A 3Q7TA 4F9GA 4PLCA 3BOSA 1DBQA 4E14A 5I01A 4ESEA 2YXNA 2QM7A 4Y2XA 3BIWA 1Q95A 2X0DA 3QEMA 3WL8A 4AO8A 4Y1FA 1PUIA 2B1IA 3W6ZA 5M5BA 1H1LB 2C2MA 2O48X 2YINC 3BL8A 4GM4A 4QNNA 5BMVF 4OX9B 3W5AA 4JJEA 4HRYA 1YZLA 5JZBA 4B73A 1EE2A 1XZKA 2AQKA 4LCBA 4Q9HA 1NRWA 5L3QB 4BZZA 3TLGA 4XB2A 3ZVRA 3SWWA 3QELA 4G5SA 5JRZA 1N92A 3TLCA 1ZN7A 3PPWA 3S2ZA 1G42A 4K9RA 1SRRA 5EKDA 3NHLA 4P3KA 5JASA 1M76A 2JIBA 4W9NA 1OY1A 2B0JA 4YECA 2X0RA 2VZ9A 4NPHA 3SNHA 5BMOA 5KNDH 1GM5A 4J49A 3MJHA 5I7HA 2PX2A 2C3MA 1RLTA 1OI7A 2PS0A 3KKLA 5G4KB 1DLIA 5BOVA 5A3JA 4AQYB 5IJZA 4DA4A 2FK8A 1KERA 3WBKA 1XWWA 2P75A 4A91A 2JJ2A 2BMFA 1AG9A 1J06A 1I1HA 1XNJA 3KEFA 4W1QA 1QAOA 1WHSA 3ENKA 4R1PA 1M34B 4Q4AA 4HXYA 4C4RA 4ENPA 3TF5A 1SIBE 2AG6A 4WOJA 2DXIA 3DMTA 2OHJA 3N07A 2ST1A 4BOYA 4EZEA 4L15A 2WTBA 1Z4PX 3EXFB 3FBGA 1WMSA 3E23A 2DUUA 2DECA 2E4AA 4JVMA 1AZLA 3UWPA 4ISBA 5IG2A 4BE7B 3BL5A 1HE2A 1ATIA 3COZA 4II3A 2CUZA 3UBMA 5FTJA 2CUNA 2L42A 3KYDA 5JROA 2CL0X 3NW9A 3UHPA 3BTOA 4DF3A 3PD0A 2WHXA 4G4IA 3IAHA 3PEYA 3QOWA 1KFCB 3N70A 2DPHA 4X9XA 1XCPA 2A0WA 1Y3DE 4Q1FA 4L0QA 3SKVA 5KJ1A 3TEJA 3OVMA 2B5WA 4XM0A 3R2JA 3VNUA 4EKYA 1YZUA 1NULA 1WZCA 1WZUA 2FG5A 3HL0A 2B8WA 2OMKA 4K2AA 5GOZA 3P0IA 3SC4A 5CVEA 5TQ2A 4BNUA 1G63A 2AG0A 2R4QA 4PX2A 4TTSA 4BQSA 4OHXA 1JE1A 1YQ9A 2EJWA 3DHVA 1H5NA 3GNTA 4PYJA 1DGQA 4YR7A 2WZDA 4AS3A 2NAPA 1BJKA 2L82A 1NJSA 1FRZA 2EL9A 3PVSA 1KGDA 1ZK3A 4AJPA 5JADA 2EYQA 4W7HA 2P2SA 1EAMA 4GUDA 4TMZA 1ZM7A 4INZA 3D2CA 2FEPA 2Z09A 5J58A 4CEHA 3GAAA 1U4OA 3HL4A 2CK3A 1UBLS 3PRKE 4LZZA 3GX1A 2Z3WA 1KMIY 1J49A 1N77A 4KXUA 4F72A 5LYJB 4MR7B 2NVUB 3E5MA 1E2JA 1KFJB 4QLAA 1DDIA 1VE9A 5JCJA 2KJQA 4NR0A 1WVMA 3VHXA 3GHHA 2J0SA 2C2YA 4EPYA 1CV2A 3LKBA 5ECWA 5IAAA 1PGPA 1B0UA 4J16C 3TD9A 4CQMD 1RRGA 1CEEA 3WLKX 2ZIEA 5I7EA 5KZMB 1Y33E 2EDCA 4BV9A 4IBOA 3QLVC 1S0UA 5EJMA 3UOWA 2EP8A 3FPSA 1RP1A 3ZVKA 2X76A 5DNWA 1OT5A 1NLFA 3QV2A 1O5TA 3RF6A 3ZY2A 2YJGA 1QP4A 5CW1A 2C04A 2PYIA 4N82A 1VOTA 3TRFA 1XVVA 3NTXA 3IR6A 1OKKD 1QJ4A 2MMGA 3A6EA 2CF5A 4CLRB 1PZXA 4O4LB 4E5UA 2AMJA 2VH2A 3GJ4A 2VNHA 3I0ZA 4M36A 1AXEA 3O4IA 3VAAA 1ENOA 1IOLA 2JGIA 4BQQA 1J8DA 4RLFA 2GTHA 1FLNA 2VSQA 3DOJA 5A2GA 3OTWA 5DNYB 3W5HA 3AUTA 3SSAA 1HDCA 1HYHA 2C31A 2JGEA 2WF7A 4MGEA 5TV2A 2YV2A 2I4RA 4CU2A 4ASUA 4ND8A 3AU9A 4CG2A 1THGA 3DE4X 3SX0A 3JD3A 1Z47A 1LA2A 4YP0A 2C4HA 3HBLA 4AAYA 4DIEA 1DWQA 2C96A 1ORRA 3PC3A 1VZ2A 4ZDIA 5TGZA 2ANBA 2WD7B 1VCMA 2XCSB 2MIIA 4R84A 1YONA 3W3ZB 4D9BA 1RJWA 3DZHA 3LDAA 3MJVA 1PU2A 4CKZA 1JLRA 2XTJA 2P27A 2ZJ1A 1Z4OA 2JNWA 3UXMA 1NQOA 1SHKA 3AINA 3DLAA 4UULA 1QG2A 1RE1A 4M54A 3ZWCA 4AECA 5A9SA 1CF4A 1GSAA 2PUAA 1MAAA 1GUYA 1W4LA 2H5EA 2WNHA 3HY4A 4GZ5A 3RAPR 1QGAA 2Z4RA 1NVDA 1NVXQ 4QFCA 3JS5A 2CXQA 1NRIA 4IIEA 1X70A 3K4PA 3OFND 4YO7A 1GCOA 5DASA 1U0FA 2FW1A 1FYXA 5KSOA 1GY8A 5KYXA 2CT8A 5EYPA 4M9ZA 2XVAA 3UK1A 4C6HA 4YPFA 2CN1A 5KYKA 2D7CA 1E66A 1XOIA 1T8RA 3ILXA 4AJKA 4GOJA 5ARDA 4G41A 5FNVF 4X1IB 2WWVD 4DDWA 1T9ZA 4RKYA 2JJMA 3PGMA 1QDLB 3RSHA 1A82A 1BW9B 1QJCA 3LY7A 3JRNA 4OYRA 2R44A 3O8CA 2ZW9A 1Y4ZA 3NHRA 5FPYA 4AP5A 4EP1A 2QIOA 3WKAA 1ZGBA 2QM3A 3SEAA 3UB3A 1GDHA 1UZLA 3RBZA 2WK1A 4P0TA 3HNPA 5F3WB 3ET4A 1C1DB 5HQ3A 3BGIA 3MWLA 2C5FA 3EQ9A 1V35A 4YK7A 3MJFA 3MWKA 1SR8A 4QVKA 2GN1A 5DWDA 3HC7A 3RKRA 3VKFA 1MZVA 2LKDA 5K6AA 1P7VA 5KTPA 3R0XA 1UMDB 4MVJH 3U4HA 1Z0FA 3SR0A 1KO1A 5JVDF 2C2OA 1D2MA 2GEKA 3MUEA 4YQZA 3ZQ6A 4ZV9A 4FGJA 4FT2A 4LF9B 5IT9A 4BDTA 3EC1A 3N8HA 4YT2A 1BOOA 1C9YA 1JQBA 2QK4A 3HCRA 4OL9A 2I1QA 4PC7A 1DHTA 2GEVA 1U9IA 2G88A 4FZ3A 5LIRA 2XB4A 3FZNA 5ARCA 1XNRB 1OB5A 3D3NA 5FAKA 1EFVA 3I5MA 3K35A 2PRYA 1NM5A 2B4AA 2WSLA 3H3FA 2YOFA 2IPMA 2I66A 4IILA 1T1IA 2YXBA 4E4RA 3GJZA 1EEXB 1NVTA 1B42A 1QXSA 2WLSA 3ADDA 3SR4A 3FWHA 3NUGA 4IG4A 3U17A 3VGPA 3CVJA 3L05A 5H9WA 1D2GA 5KTOA 3EPJA 3BB3A 5KWVA 2ZSIA 3AO0B 4QODA 2DGDA 2O2YA 1OX5A 1DX4A 1RWPA 4LXQA 5TEVA 2W98A 2WF9A 3R20A 1NUUA 2WFLB 4KUHA 4JUIA 1AHHA 1D4OA 1F4LA 2F43A 3EE6A 1YR1A 3IUJA 3R3JA 2EP5A 3RVLA 2CJPA 2Q8PA 3L5KA 3ZCTA 3DP7A 5IBCA 1TO6A 3FUXA 1PS9A 2NU6A 1HBJA 3PEVA 1VIVA 3L7CA 3Q9SA 3VX3A 3ZNOA 3K9BA 4G09A 4RZIA 1FNCA 3R5XA 2H5LA 2BMAA 5K0LA 5IEBA 4DXAA 3AHCA 2GERA 1JR3A 4PZDA 3W04A 1GIAA 4RLQA 4HPWA 1Z5GA 4YR9A 4RKQA 1ZQ9A 1U0BB 3EVBA 4LDPA 3BWDD 1XPUA 5AHWA 1C0KA 5IXYA 4OKSA 1UBGA 2EFGA 1A8UA 3RWBA 3GLKA 2RHWA 4UEWA 5BPHA 2O59A 3ZDEA 1RFLA 3FDIA 2GPWA 1A0OA 1QYXA 1G8GA 2I8LA 3R8CA 1TTQB 4UOEA 1C0LA 3HACA 3OBBA 1WZIA 5PNTA 1JALA 1XMQB 4NVRA 3FHLA 3BJMA 3IQEA 1N5RA 4DOMA 3P0JA 4KRYA 3EIXA 2Y93A 1C3OA 1HKUA 5CLHA 4EPXA 4P34A 2YIVX 1F0PA 3K9WA 2NOAA 3H65A 1ZUNB 3U3JA 4R2KA 2AGVA 4CODB 4XRGA 3LXRA 3A6PC 1L0BA 2DBRA 1HE3A 2YFKA 2FSHA 3NHMA 5BUSA 4EQ6B 4QSMA 1AMUA 4DXDA 3E9ZA 3GJ7A 4F4FA 4M1YA 1NW7A 5EXTA 2ES4A 3ELYA 2IH2A 3BT7A 3CB4A 4X65B 3FROA 1O97D 5KOYA 4Z6KA 2DWQA 5I7SA 3O4FA 1H0SA 2C84A 2PWBA 3R9XA 3S7TA 4XUCA 2FFJA 2BGTA 1H2BA 3EVCA 3CWQA 1K6EA 3WADA 4G9GA 4M83A 4JT8A 2X5KO 3D7MA 5D3ZA 5DJ5A 3WLLA 5ICEA 4KV9A 1Z5WA 1ORWA 2DFLA 1SA0B 4M8KA 3V8MA 3OTHA 4JOSA 1XJWA 5JPCA 1TTTA 4AW9A 2I65A 4IGAA 2O2IA 1YS9A 1MDFA 1Z4QA 2DJIA 3JQBC 1YDFA 4DIKA 4W99A 1NJFA 2CLCX 1UUFA 1BX3A 3HN2A 1K97A 1P0IA 2HXGA 1KSJA 3QIAA 3HV2A 3BJZA 4MW7A 3RR2A 5TSDA 3TDMA 5KU7A 3TG8A 1CIJA 2GM3A 1VLHA 1QGED 1OVMA 3PS9A 3UJAA 3M1IA 3QY0A 4RHXA 2CLHB 4G5XA 3U7EB 4JI2B 1E6CA 1X0XA 2P9TA 4P7FA 3DE5X 2YRFA 3RGGA 4MQ4A 4B3FX 2HW8A 3MRSA 1T5TA 1UAGA 2CJXA 2E82A 2WV7A 2JJ1D 2ZJOA 1E3QA 4S12A 1R50A 1YCGA 1G41A 2HJHA 2PHZA 1W49A 3KOUA 5EHGA 1DAHA 3SHFA 3MILA 4YRFA 2XUOA 4D25A 2IKSA 2W2VA 4R6XA 2X3FA 3AERB 4UMVA 4YN3A 1A2BA 4NAVA 3RCBA 1V7ZA 3VYVA 2L0XA 2XBUA 3NHJA 1ZG3A 4HEA1 2BFOA 1FY2A 3QXCA 4DGQA 2PRIA 2XB8A 4L3VA 5EP4A 1WIWA 2BISA 2VAPA 4JX9A 3RVKA 3ZI4A 3ORYA 4RIHA 1W5BA 3HJNA 2CWDA 4HQFA 5LD2B 3AP1A 2LR0A 4IS3A 1X1TA 1U2PA 2OYSA 2M32A 3H04A 1S1CA 2P2NA 1OMOA 2DF8A 3C5EA 2CB9A 4OHYA 2Q3FA 1M8GA 2A57A 1Z5NA 2VTVA 4BVAA 1UJCA 3HCOA 3QE9Y 2J6CA 2V7EA 4I1SA 3FCUB 2UKDA 1Y9EA 3VPBA 3WB1A 3C1TA 3E53A 1A9XA 2O7QA 2XT9A 3D7NA 4CMEA 2PJRA 5E7IA 1XDGA 3GCZA 4R8MA 2D06A 3JV7A 2H4XA 1SKBA 3D6JA 4IJUA 2R5WA 4D45A 4C4AA 4OM8A 5AI5A 1NJGA 1JDTA 3SJZA 3NOVA 3OZRA 2PXAA 4R7GA 4DRXA 1OREA 3H1PA 4HDSA 4P3NA 4E88A 5I3ZA 1EVEA 4OA8A 2OG2A 1CEQA 2E18A 3HSSA 4DMLA 1SXQA 3NVKI 2J9RA 2UXBB 1R5OA 3GH1A 1D9ZA 1H4VB 4OGFA 5ALJA 1IBCA 4BO2A 2GJ9A 1EM8B 1M9NA 4EJSB 2OAEA 4DTCA 1G98A 3E27A 1VI2A 2OSVA 1UBEA 1CHNA 2FE1A 2XNJA 3ZTTA 3FNBA 3KAQA 3D8RA 3BRQA 4P58A 1OYOA 3KOMA 4QG7A 1P7ZA 1CY2A 4YGYA 4ZQGA 2CNLA 3DKRA 1XEXA 3L0OA 4F1JA 2VI5A 4QVIA 3LUJA 1PDVA 3G0CA 1U0HC 1PDOA 3KOWA 4OO3A 3AR5A 1C14A 2VDKB 1HG0A 5C51B 1BMTA 3I04A 1FTQA 3IHKA 4LISA 5F77A 1DXHA 1FSFA 1A4IA 1QGUA 3CLRC 3N2LA 3PHHA 4GOLD 2J3JA 5A02A 3L8HA 5K8CA 4UJ5A 1XN1A 4V0NA 3G5TA 1K9SA 4KQJA 1PR3A 4EKGA 2XGGA 3QBEA 2WY2D 3SQNA 2IUEA 5FUYA 3EF3A 1RPZA 3GJRA 3FTNA 4IZHA 3FAKA 4WCFB 5KDLA 3NEYA 3B1YA 3H1AA 3CPJB 3H86A 3OD5A 2BKAA 3GI1A 2DTXA 5BN5B 2G1PA 1ZM2A 3IKTA 5A7HA 2FSPA 1M2OA 2PN1A 3KZ1E 1PWZA 3RQIA 2Z2ZA 1RJEA 5KQGA 5LQCA 1KEKA 1H66A 1GPYA 5IVIA 2IZ7A 4EMSA 3D0QA 4ED9A 4LOIA 2G9RA 4UNPA 4X3CA 5EZYB 1G7SA 5H5JA 3RYFA 4CM4B 1DQZA 3RHSA 3QVUA 3WQRA 4IXNA 4Q4CA 4P4NA 4A23A 3RVSA 4JSRA 4GPZA 3R3WA 1NBMA 4JMLA 3E1SA 5DULA 3OOYA 4ESHA 3SQWA 4GWGA 1JG3A 1CS0A 1XE3A 2I7VA 2RGUA 2WTNA 3H3JA 1P44A 4G1EB 3SHOA 3R1IA 1E79A 3D6TB 2PVSA 3PDCA 3T3HA 1DUVG 3UB4A 3UXEA 3ZW8A 4LFAB 2ODEA 3LFUA 5CCDA 2NZYA 4Y7CA 5LCXA 3M5DA 4AO7A 4AWXA 5TQJA 1NJ8A 5IRCD 2PSFA 4AY5A 1O94C 3DL0A 1B8OA 1UXJA 5GM2A 2JGJA 1V1MA 3AC0A 3ZE2B 1VSQA 2PX4A 5KS2A 4AUEA 1PUJA 1QOZA 1THZA 3HKBB 4NEQA 5C3MA 4MUKA 3QPAA 1CRLA 2I1VB 2KWIA 2ZT7A 3BDVA 4D41A 1PSDA 2C98A 4YJDA 1B4DA 1MX1A 2AMVA 1E92A 4KMMA 4CQJA 1M1YE 4DUGD 2WQZA 3EG5A 1QAQA 2E87A 5DBFA 4PGGA 1ZXBA 2VK8A 1K7EB 1MTOA 1TMGE 4NONA 4WBNB 1KO5A 4GXTA 4C0QC 1TKCA 2BEKA 1N2BA 3H5VA 4HWPA 2VBFA 5U1PA 1ZL0A 2FN7A 2HO4A 2JLUA 4BGVA 2W2LD 1FP7A 3ZWQA 4ZOEA 2GQ0A 4J91A 5DHUA 3L6UA 3FJYA 1ZH0A 1YCHA 4KR2A 3D3WB 1TZBA 3WNBA 3ZQUA 2JFQA 4TN5A 4KMRA 2XUIA 5EPOA 3DOEA 5FB3A 4BCCA 2PUHA 4QUHA 2O14A 3WISA 3QHQA 4IS2A 5EKUA 3T15A 4LPSA 3FHOA 2O8BA 3I09A 3ZY5A 1PJLA 2R5NA 3O91A 2ERYA 2FGKA 2QMHA 2VUSA 2ZQ5A 1H4TA 1Z0ZA 4L9SA 1LJ8A 4TKVA 3THXA 1BGXT 2PPLA 2PR2A 3TLZA 4KAXA 4ALMA 3SHTA 4Y2UA 4M0CA 4H08A 2IIVA 5TVGA 3TQTA 2RONA 3ZD8A 3ZTWA 4GZMA 4A4DA 4WNCA 1Q83A 2PQMA 2X3UA 4LRXA 4RTKA 2O7RA 2PZKA 2PTGA 1KZ7B 221PA 4V0ME 3CNHA 4K3VA 5CPFA 1T2EA 2UYCA 3PITA 3PUWA 2XVMA 3DWGA 3OJ0A 4XXHA 4QYWA 4MCIA 1QR6A 3PCRB 2QNIA 4UE2A 1JR6A 1L8OA 3E84A 1CUXA 3ZBPA 1UPUA 1Z2DA 3K8YA 4DUZB 3PQCA 1QRSA 3GCDA 4HBZA 4ZCMA 3FYTA 3KQYA 1XNHA 2EKBA 4OK6A 5JLJA 1AUQA 3TMKA 1CNEA 2KYRA 2ZYIA 2XV1A 4KDRA 3V32A 3TUZC 5DX8A 2IWHA 5J4HA 1KEEB 2ZQZA 4DLSA 2K6GA 2ZT5A 1P72A 5TLSA 1FNMA 3GJ3A 2ZRGA 3VGJA 3DE3X 2JVJA 2VAXA 4G24A 1HNZB 3DAOA 4GIBA 4DYHA 3GGDA 2YWEA 4LK2A 4ZK6A 1FX0B 3BGVA 3SDZA 3ELBA 5JIBA 2QBYB 3AETB 3U37A 1OPRA 4HO1X 1O08A 3WKCA 2YJ3A 1YE8A 5JCOA 2Q5CA 3LBAA 4HGOA 3T99A 3K72B 1SD5A 2IQ5A 3FGNA 3KC2A 4JUBA 1JIIA 2CJWA 4KMOA 4MUFA 4F46A 3UB2A 2ORVA 4JJIA 2H48A 3PTAA 3QBDA 1E2HA 3R0VA 1Y6QA 4N18A 3U19A 1NNEA 2XUPA 1WF6A 2PYDA 3JQDA 3P45A 1YZVA 1AUVA 1ONNA 3OETA 1J22A 4LMRA 4U1RA 5EZ5A 4AZSA 3ZVNA 3E9RA 3ZHBA 3RIHA 4U8GA 4MQLA 4IVQA 4ZARA 1Q3TA 4HB0A 4V1CI 3K0FB 1TVMA 2Z6VA 5DXAA 5KQSA 1ZMRA 2Q3JA 1TB4A 3R75A 2BDUA 4E6PA 1N2ZA 2YV5A 1VLLA 1DBPA 4GGPA 5T6MA 2BGGA 3EZXA 1G5FA 1A8SA 1ZJJA 2IDKA 2PAFA 3AUSA 3C41J 1CUDA 1DAPA 1VJ5A 1VL5A 1XGKA 3CS3A 3LVQE 1ADJA 2ATIA 2FWNA 2VK1A 3OUUA 4HHEA 1DFHA 1V5GA 2RARA 1CR0A 2XQKA 1W4RA 1LQUA 3AQIA 4AIIA 1T35A 5A6SA 4LF6B 2PK3A 3L6CA 5ABPA 3PHBE 3ECAA 4MUNA 3HJCA 1RNLA 3F46A 5CX1A 1NYRA 1RYDA 1F5NA 1O0BA 2GBLC 1M1NA 2P7HA 1UINA 1HLDA 5DI3A 1MV8A 2VNJA 5LZ8A 5THXA 3EYAA 1XD2B 2XADA 5K6TA 4YMLA 3TW8A 1MW8X 2J6HA 3OZWA 4J1NA 2Y1GA 4ZRDA 1MC1A 4FMCF 3IESA 2PBZA 4URUR 1HZJA 1PEYA 1SJ9A 1GT91 1K4KA 4I5IA 4N8EA 2DPXA 4PRKA 2ZK7A 3EULA 3M6XA 4G0NA 3O21A 3AIMA 1CULC 1SCNE 1QYIA 4GOND 3F97A 4HYTA 5JUWA 2XVYA 2GZ1A 1R2QA 1LW6E 2PTHA 3U80A 2DLNA 4X91A 1SCIA 2G3YA 3HPRA 3EOAI 4KGZA 1T3GA 1W87A 3FDZB 3KB1A 2CCKA 2CNWD 4XJVA 1Q20A 4TQUS 2DYKA 4QICA 2YXDA 1CLEA 1E9EA 1FMJA 1T43A 1HETA 3LPMA 4HD8A 2OKCA 5T3UA 1R3DA 3H6KA 4F8EA 4K6HA 2C2KA 1JDZA 1NP3A 3H75A 3LOUA 1OV6A 3ZDXB 2PZJA 4NJEB 4CLHA 1C80A 5FWYA 2HF7A 2JBAA 3AR6A 5IKOA 2RGEA 2HV8A 4BAUA 1UJ4A 2WYHA 1K0UA 4N47A 1JZTA 1SOWA 2FR1A 2ZTMA 1D2RA 1DE0A 4ZHSA 5IEJA 4EW6A 3DQZA 3JXEA 4BQRA 4OTZA 1T13A 4PZYA 4OYHA 2EHDA 5CGZA 3O1IC 4BTEA 4TYWA 2HWKA 2ZJ7A 3ESRA 3NATA 4MTCA 4FWIB 2OE2A 3GZJA 2YVLA 3DUFA 2XCUA 4M89A 5JSYA 1KO7A 3H8VA 5C1OA 1OZAA 3AF4A 1QTRA 4RVDA 2I5PO 3PI7A 3UG7A 4RVGA 3SX4A 3VVLA 1UT8A 2GLUA 5FQNA 3R7NA 1NU8A 1CUZA 1U8AA 4WZBE 3SLKA 1ZZGA 4HLUC 8ABPA 3O93A 4E1AA 1GN9A 4P82A 5EESA 1U99A 3PJGA 4HT3B 1P2VA 2PMEA 5LXTF 3GNSA 1CTQA 4BTVA 2R86A 1MENA 3DE0X 3IQFA 3OKAA 4J90A 4XJXA 5KNCA 1CB0A 4KQKA 5BW8A 4LJRA 1E6EA 3A1WA 1J7KA 1G3MA 2C1EA 3G2IA 1G5HA 2QT1A 1RJDA 5BSEA 4WINA 3OQMA 3CVYA 4UAGA 5BMVB 1Z08A 3AGPA 1HFKA 3CXRA 4I50A 1I3CA 4WL0A 4YBZA 5FJIA 1C4XA 3KQTA 2AFVA 3GJ0A 4WCDA 5EE5B 4HEJA 5AQ1A 4CQLB 2QENA 1B8NA 1NQVA 2FZWA 4FC7A 4I3FA 4U7PB 3UGJA 3FNEA 2XJ9A 3Q6NA 1ZEMA 2XRFA 1IXZA 3OX3A 4G0MA 3VYTB 1PHRA 5CCBA 4NARA 1MQ8B 1V3TA 1WHTA 4ZODA 5CT5A 2WVHA 5U4XA 1I01A 3RFVA 1YF3A 1XPJA 4E11A 4F2HA 3D0OA 1JG2A 3D0RA 1U9ZA 2APJA 4O3FA 3CWCA 2QZSA 1PTJC 3C6XA 1BHO1 4C5CA 2P79A 3GBVA 3OTQA 4B4VA 4D92A 2VOEA 4MVJM 4XFJA 3L0YA 2J3HA 3PB3A 2C83A 2HDNB 3ABRB 4KBFA 3H9CA 4F6RA 1JDJA 3O4GA 4ZXFA 5C2JB 4W5NA 3AJEA 4TQAA 2JRCA 2GCNA 2BGIA 3FRHA 1XPOA 1U9CA 1RZRD 1FLVA 2CXRA 3I8XA 5EMNA 2SHKA 4GI3A 5TMBA 4ZU6X 2ZT6A 4DA0A 2ZE6A 4ABYA 1K5HA 4L4ZA 3ROMA 1DOHA 1L5RA 4YJFA 1KPIA 3CF2A 3E7PA 3WLPA 2XKBA 4G5YA 5A04A 4LWPA 4KX3A 2BMJA 3ISTA 3GLSA 1RQPA 3VKVA 3WL4A 2LDBA 3MELA 3V4RA 1G8SA 2YXLA 2OG1A 2JFNA 1XDZA 1MFPA 2VJCA 2AMFA 4MB0A 4WECA 2JDID 4D81A 1GNRA 5C5IA 3G1UA 2POQX 3C3YA 1GRRA 1X7WA 3NNDA 4EIWA 2H16A 2VDNB 3Q5DA 4ENVA 4JV5B 1I10A 2V6GA 4PO1A 4PY2A 2GCOB 3FTDA 1FP4B 1JFRA 1NLUA 1GAWA 2LWIA 3O3MB 4X7PA 1TF5A 4C7MA 1YRAA 3FUTA 1U6IA 3EDRA 1R6TA 2RH8A 4HAYA 3A8TA 4I1RA 1NOJA 1KPGA 2IY9A 4MVJI 3ILYA 4PVCA 5FL7D 3VYSB 4A27A 1O95D 4H7PA 1MXHA 2LDXA 3HI4A 4Q1EA 1ZGGA 1BH2A 4P4GA 8LDHA 3NTUA 2QSJA 2ILTA 2IY7A 4RXUA 4RESA 3L43A 2AX4A 5K0ZA 1GGJA 2XVXA 2AH5A 2V0NA 1TL7C 4ZT3A 1HXHA 2YVAA 2NU8A 2JAQA 4EH1A 2AOTB 3GY0A 4EYSA 5C8VA 2R751 4LF7B 3LZCA 4J7UA 4XSGA 2XX3A 3EY9A 4OAQA 1OIWA 1PFWA 7ADHA 3Q6IA 1UC8A 1C3JA 2GO1A 1MRNA 5F4ZA 3BE6A 3T7KA 5HGJA 5GINE 2Q5OA 3AHEA 4PE5B 2FPPA 3K1TA 5K51A 4DNOA 2NP6A 3SXJA 3EUAA 2BSXA 3IP1A 4HP8A 5JO9A 4CTMA 2BE9A 3E9NA 5DCWA 4WAUA 1OWNA 1ZAKA 1KMQA 2AR0A 2C5EA 2CNKA 2I3BA 3IA2A 4HNHA 3WMFA 3CN7A 5HK8A 5JAOA 1V6SA 2H11A 3RSOA 2WDPA 1UQRA 4ZYXA 1TUIA 3OLWA 5LZ9A 4CU5A 4W6ZA 4BE9A 5MN6A 2QDXA 1TA0A 3C6YA 3DR5A 1LC3A 3GFSA 3JQAB 3KSUA 3FSJX 3RO7A 3AEUB 4K81B 4DUYB 1M6HA 3WV5A 4HTFA 2PMWB 4MA5A 4EY8A 1KH3A 3H97A 2FB9A 5LJLA 1JXQA 1QR2A 1SBTA 2J32A 1JHMA 2AZ4A 2DPLA 2C7OA 4IIJF 5CFZA 3TVTA 2C07A 5IMBA 2CW5A 1XZNA 2XWSA 3JY6A 1E59A 2PUFA 5FWXA 4LN1A 1DKRA 1MV5A 4UHEA 3TZKA 4Z9XA 2B3DA 3L0BA 2DUMA 3B3FA 3R6TA 4LGCA 4MLDA 1T4MA 2NSLA 5DM60 1XKTA 4GX5A 1O1YA 3U1VA 1HNNA 1V8PA 1FYWA 4TMFA 3TQQA 1PEKE 3GUHA 3O2QB 3PNVA 1E0JA 4QYIB 4ZVPA 1RJGA 3AEKB 4PRZA 3UMYA 4JP3A 1PP4A 3RADC 3MCTA 4CQNA 3EASA 3PC4A 4Y0AA 2IXTA 2AXEA 2DCMA 2I71A 2IYPA 3STTA 2WTUA 2C78A 4FHCA 5FH9A 3H1BA 1QWSA 1KY3A 2HPAA 5F5NA 2MDTA 3E3LA 3HVUA 2Z9CA 3KWMA 4UTOA 2JCYA 2D59A 5ENVA 4FI3F 2QVBA 1KETA 2ZI5A 3F4KA 4C7BA 1OFUX 1V25A 2ZRLA 3NWBA 3TLGB 1ZK1A 3TLMA 1UZMA 2Q3LA 3QELB 2GS9A 1YR8A 1XTIA 2GZ3A 3GUZA 3QKIA 3TIFA 3GK3A 1ISHA 4MUEA 4UAVA 4WKPA 5AKGA 4WLUA 2M98A 2ZRBA 3MMXA 1P8AA 1F5SA 1DG3A 2CFTA 5KJEA 3NX4A 1R0YA 1OI4A 2OPBA 4JLOA 5AUPB 4OXIA 3VJMA 5KDOA 1WSDA 3W2EA 4J0HA 4HWTA 1XZMA 2XT0A 3K20A 1XTVA 4LHZA 4H7EA 2IYYA 3H83A 2XCQA 4W8OA 2Q7DA 4J3NA 4FR2A 1W36C 1F8YA 3AJAA 1XWIA 2NO1A 1WHSB 3COPA 1CY8A 1WB5A 4YHHB 2WJAA 4L51A 1TU3A 4Q4AB 4AJOA 2XUAA 4JLWA 2X0EA 1I30A 3L0PA 3KJHA 1ECCA 2IXEA 2V55B 3BX1A 1SUEA 3PLRA 5JVDB 3ZU5A 4CV0A 4WASA 3J7TA 1WBJB 2I9KA 1RLUA 1GGEA 3M9WA 1JHZA 1Y7TA 1ONPA 2ILVA 2KPOA 2QD5A 3PUKA 3SEZA 3OJLA 3LC7O 3BE4A 2LXNA 3TD2A 1JHYA 3RC2A 3UWSA 3ZY3A 4F9FA 3GUUA 5BSMA 1MO5A 3MUOA 4AYTA 1DKQA 1SRQA 2QV7A 3IPCA 1YBHA 4D9MA 1DC8A 2QWXA 4WXPA 1M8FA 2WM2A 1RWBA 2SKDA 3DXZA 1GLGA 5AVVA 4J7CA 4JLAA 1ZXLA 4NDZA 4WGGA 2EERA 1U7XA 1P80A 1Y8QA 3CT4A 3T61A 4DQ0A 4DYDA 4KNYA 1AXGA 1MAUA 5IWCA 2NADA 2PO7A 4RWEA 4ZT6A 4MDHA 1U1GA 4HQ0A 2Q6OA 3HB1A 1A1SA 2FSGA 1KI4A 3LGSA 5B6PA 1OSNA 3OJCA 5TQ2B 3V48A 1WMEA 1KMNA 1I2CA 3BKWA 5ELMA 4C76A 3BE8A 1U98A 3EGXA 4HXEB 2PFKA 3U56A 3GWZA 3ONFA 3GPLA 2Q99A 4EF4A 3DVAA 4KPUA 1M7BA 4YUYA 1B0AA 2P77A 2YOHA 2NUTA 3EIHA 1KTVA 4P2GA 4CEHB 5EOVA 1P6QA 1C8BA 1SZJG 2BBOA 1CC1S 5IC5A 3UMCA 3SYTA 2G9QA 4PXAA 1U0LA 3MNFA 4KRGA 1PD1A 2XD9A 2H06A 1YWGO 4F2GA 1DQYA 1IATA 2AXPA 2YYSA 3TRJA 3FJOA 3VHXB 1W4BA 1MOQA 1L7AA 1KU6A 1T2VA 4JQYA 4MA0A 4QDKA 4RFSA 3JZAA 3ESXA 3FVTA 1JB1A 5EL0A 2NPFA 3WMRA 4A8JC 4BX8A 1OWLA 4HBGA 5EJIA 3ZY4A 4RCVA 1Z28A 4CDRA 1IEVA 2F2TA 4YRQA 4DBZA 3KVRA 3OLVA 1E9FA 2D8MA 1AS3A 3F6EX 4JB3A 4BNVA 3SLRA 1V39A 2BGNA 1LLUA 2XZTA 2P4QA 5EIXA 3R5KA 3V1YA 3EEBA 4MAAA 3KPVA 3EA4A 3NHWA 3GAFA 5LMNB 4LSWA 1YU6A 5FLYA 4UBLA 1TZKA 1CRQA 2CNDA 3CZ5A 4NNOA 3L0IB 4UTVA 4MIOA 3BHIA 4Y6PA 3RHZA 3NAMA 4LSMA 2VHJA 2A78A 1XZHA 2EKDA 4CTJA 1SEPA 1FSPA 4Z53A 1MD9A 4HG2A 1G20A 1EJBA 1NWHA 5AYVA 5TS3A 2VPIA 1WS6A 4AMVA 1PTKA 3ZHYA 2A0UA 3OZVA 1FOEB 1TJ5A 2H85A 4P92A 4PZLA 5EIOA 5B7QA 2NGRA 1OA1A 3BCUA 3K73O 3L6OO 2A4KA 3A7EA 4GLLA 4ZAVA 3T3OA 2RK3A 4IEFB 4ND8B 1EVYA 3WJ2A 3GA7A 2D62A 4DN6A 3NHPA 3HVJA 3C6KA 4Y30A 2HQSA 5HS6A 1FTNA 1N9ZA 3GD7A 1LJLA 2F9FA 3BSSA 4ENQA 1YB2A 3EQ6A 4RV9A 3RD5A 4B74A 4A5OA 3N3AC 1NMZA 3HDJA 2G80A 3ZU3A 2OAQ1 4HAWA 4P3OA 4UUNA 2OXIA 4KPEC 3NI2A 1AGYA 5DBHX 5I7OA 4D3SA 1IHOA 2FMXA 2GFHA 5DT2A 3L8CA 5F1PA 2B3TA 4OREX 3P1JA 1LPOA 1YFZA 3D7RA 2C0PA 1Z6GA 3NAZA 3B89A 1TAHA 5FO0A 1LEHA 3NS7A 1FFBA 1ZC4A 2QW0X 5JALA 3J81k 1DOAA 1Q3KA 3KWFA 4B85A 3W4JA 5FHRA 2VDOB 1LRKA 3VPCA 5HFNA 4D1YA 5KNBD 4BO8A 1JKJA 3H2SA 3RODA 3NJ4A 4ARZB 4Z9AA 4QA9A 1ZH8A 2FVXA 2PX3A 1GO2A 4Q9JA 4AP9A 5E1MA 1T8YA 2P11A 3DCNA 4KK3A 4KX5A 3H8SA 1RCUA 3ROFA 3RVQA 2FQXA 4NI5A 3KQKA 4COKA 3WK6A 1ZD9A 2D0IA 3W8RA 4CHGA 4TKMA 1ZAYA 1H6DA 1Z4KA 5GM1A 3KL4A 2ZJ0A 1UPTA 1TF7A 3TM4A 2YZ2A 5ED0A 3V3KA 4C1BA 4F92B 1VL0A 2VKTA 1RQ2A 2EKPA 2HB6A 3LBNA 3V1KA 5HQ3B 5JH7F 4HAIA 4ESVA 2Z0MA 2OZLA 1DQSA 9ABPA 3K1AB 1FTGA 3RS2A 1U8YA 1E7WA 2RI6A 3HGMA 4W7IA 1MHPA 3WRYA 4EFKA 1U8TA 3HV0A 3NASA 3PG5A 3E81A 4MWTA 2J3MA 4QHSA 2OT3B 1U02A 3WWZA 3OCJA 3N74A 4EQZA 1QGZA 5I9NA 2H7CA 3LL4A 4HQOA 3B2NA 4NMHA 4PFQA 4WXRA 3LQKA 3E7XA 3NWPA 5AESA 4JJZA 4K03A 4DJFC 1ISJA 1EUZA 2I6SA 1MX5A 2JFFA 2RHHA 2ZBRA 1YS2X 3IT3A 1OGYA 3CCFA 621PA 1PL8A 2P8SA 3ORHA 3NANA 4M2LA 1DCTA 3BEOA 3OEWA 5J47A 2YN2A 2A4MA 2AEEA 3H17A 3ZZ0A 4U2BA 2WOOA 4Z9FA 4JC0A 1NXVA 4WZAE 4F96A 3VHRA 1LPNA 1PJ8A 3JQ7A 3RC8A 2DQSA 3DO5A 3A1TA 1GNQA 2Q29A 2GA8A 1JQDA 4E08A 2F43B 5CMLA 1K6MA 4NK4A 1KH1A 1L8QA 3DEKA 1D09A 3IPRA 1MJFA 5F1YA 2YCLA 2NU6B 1G5PA 4MGKR 4PPQA 2YJZA 3WO1A 2EAUA 3WLNA 4HDRA 2W0MA 4IIXA 3QLEA 5ES4B 2ZVDA 2ZUFA 1ONOA 4DYVA 3GOHA 4ESOA 1F1JA 4KEAA 4EVRA 2VTKA 1T9BA 2HZBA 2EV9A 3GN2A 1HWYA 1S9DA 3TIGA 2QTVA 3WWYA 2OUKA 4PYLA 3G2OA 1L4EA 3JRXA 1EDBA 1M2GA 4CCAA 5E0KB 1G8KA 1VSBA 3A6ZA 3WVNA 1E1MA 3OMWA 4QU0A 3OZXA 3FFTA 4YBRA 3NDIA 1NNI1 3OE5A 5H02A 3V7YA 2O5EA 1L3BA 2I2BA 3IBGA 4G4JA 4W1RA 5JWOA 1L5LA 3RABA 1YR6A 2ZSEA 3A31A 2G67A 3N28A 1SCDA 4DA9A 1L4GA 1VJ0A 4YMHA 4U3JA 3KJFA 1C3OB 4Q19A 4IP0A 3OHMA 4F12A 4NWIA 2AE2A 1B7GO 1R8XA 2IX3A 4QFMA 1VYUA 4QZVA 2HFJA 4HF7A 1WEKA 3LF2A 4RQAA 5AW9A 1N2HA 2PL3A 5CVCA 4X3OA 4PZZA 3ELUA 2A5JA 3IUQA 1U4NA 3ZHSA 1ISGA 2AF4C 4JI8B 4DCNA 3RIYA 4IF4A 1HE8B 1FRNA 2WIDA 2AFHE 2ISSD 1J0EA 1FVHA 2RGCA 3AF0A 3L1JA 4JL5A 4WY2A 3B9QA 5FTWA 5HSGA 3AVQA 4RVFA 3BWMA 4HMOA 2VF2A 4L78A 3LX6A 2IVFA 4WESB 4YONB 5HUHA 4NBSA 3RRMA 3FWZA 1HX7A 3OQOA 2KX7A 3GYGA 3NCTA 3EXHA 4IMJB 4E0BA 3GPIA 1XZDA 3BSYA 5EIFA 1KJQA 4BP8A 3GGOA 1UCFA 1M0SA 5DHSA 1VLQA 2HKIA 3BRWA 2GPJA 3AI2A 3PIRA 2HJSA 4QBGB 5FAXA 4KQ9A 2J87A 4JHXA 2QM8A 3C3BA 5SZKB 3AFGA 3BQNB 2JS7A 5ES3A 2QS9A 1HT3A 5K8VA 1RVDA 1IIRA 3RSFA 2JCGA 2V7UA 1Z5UA 1D1PA 1LK7A 1V11A 1XLVA 3IPXA 6AT1A 2DBYA 1QOPB 2O1EA 1WUHS 4PG8A 4HS4A 4NBWA 3R74A 4DM7A 4UPVA 1L8AA 4ZGGA 5MHTA 4HUQA 4O8ZA 4QTTB 4TUYF 3TWOA 5KMGA 5KYWA 2XR1A 3UXYA 4O3MA 4RPJA 2DBVO 1I2ZA 1KI1A 1TMYA 1JIJA 1QORA 3II6X 1Z0IA 1KDRA 3E05A 4TMVA 2XEXA 4PWYA 2CV2A 2O8FA 4D0RA 1LU9A 2A35A 2WT9A 3O26A 1GPDG 2X0NA 3OPMA 5ADVA 1CQJA 5C18A 3GJTA 4HXFB 3UWDA 2BZ0A 2AZTA 2BD0A 2GJSA 3NHYA 2P2ZA 3REOA 3GLUA 3QGMA 1JFFA 4CFYA 4URZR 4J4TA 3FKJA 2MWMA 2BEJA 4AYWA 2QM0A 2FNAA 3DWFA 5B3LA 4TWRA 3IQHX 1YB5A 4KWIA 5JFGA 3GYBA 1CSEE 3I52A 4R3UC 2WMYA 5AKHA 2NZXA 1A9XB 3MPOA 4KN9S 3HZHA 4ZZ2A 3D6NB 1NFFA 2WWFA 3C85A 3CN9A 2HGZA 4A26A 4UM5A 4MQUA 1NBOA 4COOA 4KLZA 2CDBA 3WRWA 3DXYA 1QONA 2H1RA 4Q3LA 3NT4A 5CA0F 5H4HA 4DRXB 3QYFA 3H9GA 2UYGA 2WAXA 4HDSB 2BV3A 4GOMD 2I6UA 1EFRD 5TMPA 5JZVA 3VR3A 4K9SA 3MMZA 5EJ8A 1KI3A 2I4TA 1PJ4A 1U31A 2ZIWB 2O7NA 2YV3A 1TLLA 4RPIA 1WV0A 4DA6A 4TXNA 3OQIA 4M9SA 3AB8A 1TKBA 3O74A 3N2KB 3OM9A 4L9RA 1FF9A 3L01A 3R7AA 5AUQA 4O1MA 2OHGA 3AYZB 5BWMA 1QFYA 5KX5F 1DBWA 3B1KA 3G68A 1Y37A 5GV8A 3AVUA 4E2WA 1I7NA 2QUBA 3IVMA 4OK3A 2ONKA 2GZSA 1LH0A 2IP1A 1XEXB 2GWHA 2HHAA 4HYQA 5HJ5A 3PQ4A 1FXSA 3O73A 3HY6A 2R6ZA 2O2XA 1II8A 1U65A 1QHIA 1EUDA 1ZNXA 1SC1A 4HLCA 4N49A 2ZAOA 4B4DA 5EVCA 2ZTLA 2EJCA 1G2PA 3WA6A 1TPZA 4ROTA 1WXDA 2R79A 4OJTA 3ASZA 1ABEA 1L7NA 4XKJA 3TFQA 1VL1A 3SVZA 1XHLA 5A0VA 2F1OA 5FWNA 1M2FA 1JW9B 1M2JA 2CFCA 2G36A 4P4SA 3HR4A 5P8WA 3UF0A 1FBNA 2D5AA 1A7UA 4FSHA 4MQEA 1AQNA 1R0WA 3E9MA 1SVSA 3DFUA 4KIGA 3F73A 1KZ6A 1U1IA 1KDZA 5TX7A 1H94A 1M2OB 4BNMA 3NBYC 4G89A 3K0HA 2HHJA 1T2CA 4UTZA 1A2KC 1WXQA 5CT9A 1J0BA 5I45A 2ZYDA 4FDUA 3O4HA 3SZOA 5B4VA 1NVGA 3WGQA 4NBKA 4UNSA 4FFRA 3WOHA 1ZGHA 4JGIA 2JFPA 3TDKA 2WPNA 3TTYA 1SVNA 7GPBA 1T4CA 2B5OA 3I42A 1QSGA 4HQKA 4LGMA 1U3WA 1GGVA 5FOSA 3WRXA 1XMOB 2W2LA 4P86A 2VDUE 3KHUA 2ORIA 1VBFA 4FFPA 2P4HX 3N53A 5DW3A 1P4RA 1YASA 4FMCB 4LYAA 1POWA 1S1MA 4P7GA 4C0JA 2ROQA 3PCTA 5JPDA 5B1DA 2YVUA 2X6RA 4MWOA 4NU6A 5DTEA 3WS7A 1T1SA 3VH3A 4OB7A 4BEWA 1QYVA 2YV1A 2RHLA 3LBYA 3PXUA 1KDTA 4FKMA 4ZC8A 5I7RA 3EGOA 1PD0A 2IYEA 3Q15C 3R5JA 3A1CA 4HNAB 4EPTA 4AJ9A 3DEJA 1HDOA 4PZUA 3UH0A 1O9GA 1XQWA 2QI9C 2W6PA 2WAMA 4BEBA 1R5BA 1ZNZA 3QKTA 3CG4A 4NYIQ 1TM1E 3LX8A 3ZGYA 4WK0B 1QTQA 5ER6A 2WV9A 2VVTA 4AG5A 4KFCA 4LY0A 3H0EA 1RYBA 4DAOA 1WDMA 1OI2A 1MQ9A 2QVCA 4V0LA 3UCEA 2OGSA 3DV0A 4CKEA 2ZBVA 2QGFA 4A2PA 2Y76A 5JE8A 1FS5A 2XYHA 3OZUA 4O2AA 3DHNA 5IJ0A 4DCCA 3R3UA 4EAQA 2GH1A 4L0MA 1OX6A 4G2NA 4K9LA 16PKA 1WCWA 3BMOA 3H16A 3HP7A 4IW3B 4OHZA 3X1JA 1FNNA 1GZ3A 2Y0PA 3D6UA 1BU8A 1ZM4A 5GONF 1GG9A 2Z3VA 5HFJA 4OQPA 1TI7A 4YHBA 2O8BB 4DR3B 2Z8ZA 5KNCH 1JAHA 1U3CA 1VG9B 3V1MA 4LCEA 5EXEA 4TKVB 4X8MA 4TS9A 1FPQA 4NE2A 3IDSA 5LXTB 3THXB 4HEQA 2CUKA 5H80A 1IHPA 3WQBA 2R7AA 3K6JA 3GRAA 2IF2A 2CUTA 4GS5A 5FIUA 1R10A 1UKZA 3SZ3A 3ADOA 1PKXA 3K2BA 1KZ9A 4H1HA 2XUKA 4IV8A 2RGAA 4FS3A 3ZHXA 1GZUA 1Z34A 2FPWA 1VHQA 2OO5A 4HQLA 4PQRA 4RANA 3MT0A 2VHVA 4WZ6A 2RH9B 4XM1A 4C4TA 2XDWA 4X24A 4MW6A 3O7MA 3UPDA 1M8KA 2ENUA 3EIFA 5JAMA 2VZLA 1ORIA 3A9VA 3B9RA 3E9EA 2W42A 1FDVA 2P1DA 3A05A 3GZNA 4G07A 1USIA 4U00A 1KAGA 3UFBA 3B8HA 4BLRA 1C7QA 4EG8A 4D4GA 1IB6A 4NZPA 3DMGA 5IUNC 3VSDA 1FRFS 5E2IA 1Q84A 4PC1A 2BCJQ 3PFGA 2H4FA 4L2IA 4QULA 4TRNA 1YJBA 5KKCA 2C8KA 4I55F 1TYAE 4G81A 4QUJA 2H5IA 4MPDA 4Q15A 2VSOA 4CMKA 3I9JA 3U13A 1OX4A 3AJDA 4D8TA 4ZK2A 1KJIA 1PW7A 5BNIA 3AF1A 2INGX 3RIMA 4CCWA 2FQ1A 3G0DA 4BFVA 1JF8A 2HWWA 3TFOA 4DR2B 5ESDA 3UPUA 4AKHA 4RPKA 4YRBA 3SSMA 3AQ4A 3CUTA 3GT4A 1Y3FE 4GKVA 3GPBA 4BU1A 1NQUA 4F4HA 5JXWA 3N0RA 2CJWB 5K4HA 4G2TA 4IDCA 4X7MA 3DAYA 3I30X 5DU2A 1SUBA 3OFJA 4X90A 4LOJA 3GRRA 4INOA 3USZA 2WVAA 4IO1A 3BGOS 3N2EA 4O33A 4PV7A 1GCGA 4K0KB 4PCVA 4X92A 5DGXA 1T0HB 1XMVA 3U40A 4RKWA 5KYTA 1VCNA 2BMVA 2QAJA 2WIAA 4INAA 4KAJA 2CNWA 4R0VA 2E0IA 1LLQA 4V0RA 2CYAA 1MA3A 3KEGA 4RS3A 4RY9A 4KR9A 5CDTA 3QF4A 1VLZA 2FPIA 1X7XA 1YJXA 4FD2A 3WDLA 3QXGA 4WXHA 2XQGA 1FJHA 2IIBA 4MP6A 4P1ZA 3TKLA 5E7JA 5JS1A 3QUAA 2GN9A 3E6AA 1K92A 3HB5X 3DFKA 5EFZA 2F3QA 2ZUDA 3UKDA 1M72A 3WBBA 4D74A 1W0JD 1BG6A 2XAUA 2HMVA 3O4JA 2IPNA 2GCEA 1OBOA 4P08A 2P6PA 1RIFA 4LDNA 3RAFC 1CYEA 1ZH6A 3ESBA 3QX3A 4ZOCA 1M1NB 3AY7A 4O1IA 1SHTX 3OO1A 5DI3B 3KLBA 1L4YA 1Q0TA 3GAMA 4M9RA 4DV6B 2ZANA 4AG3A 2JBHA 3U4CA 1L6RA 1RXSA 3TW8B 4K26A 1OXUA 2QUZA 1A98A 1J2UA 3AB3A 3W77A 3RBVA 4RK6A 3ZV5A 3ZK7A 1NBEA 1ZRMA 3ZHQA 2PO5A 5HIAA 3T1OA 1ZI6A 2G4CA 4B6QA 4E09A 4XTRA 2A9QA 1Y3CE 3EZYA 1H1TA 4OM7A 3WYCA 2GEUA 1SOUA 4CTNA 1E94E 1BD4A 4FZVA 3NB0A 5CB6A 3HFRA 1II0A 1K8QA 1VB5A 2FSVA 2H2HA 2WD9A 3W8DA 1WW2A 1PSZA 2WVJA 4M1MA 1AC5A 1U1DA 2EWWA 2QG9A 1Q0UA 3E8MA 1GFWA 1UMKA 1JPNA 3KRTA 4UNQA 5K0BA 1P2BA 5FWYB 1PN3A 1IY9A 3BBLA 5HHTA 3SHQA 4KLNA 2DBZA 2UYYA 1YZGA 5G41A 3B3GA 2CDCA 2GB4A 3FR7A 1JBKA 3OA0A 4LZJA 2DY0A 3KPUA 4CCSA 5IPFA 1KU0A 1NZJA 4C3ZA 5JSUA 3WIBA 4RQTA 1C1XA 2A0XA 2B20A 3MIZA 2VYNA 1KE1A 5LL6P 1GL6A 1OFUA 3GLFE 3DUFB 3DL7A 4FFBB 4DR6B 4I2NA 1DKMA 2FX3A 3TJMA 1K63A 4I4NA 3LW8A 2JHGA 3VC7A 4V0SA 1I32A 1C4KA 1GCUA 3DB1A 4FWBA 4F5ZA 1JBEA 4L8YA 1Y4SA 5B2FA 1SCUB 3EUEA 4HCJA 4ZI7F 3CF4G 2EEPA 2PCJA 3QZUA 2C3YA 1LV8A 3P19A 3RYHB 2ZWPA 1RZRA 2ZOSA 4FGSA 5TY0A 1DUIA 3TVDA 4CMCA 3CB2A 2FHPA 4RWZA 2DQKA 3O84A 1BS2A 2W2XA 1P9WA 1NHWA 4TWJA 4XWAA 2MU1A 3WLRA 4HAVA 2ZJZA 3OIDA 4QDOA 1IN6A 2WM8A 4MV5A 1X1BA 5CFPA 4KKXB 4NH0A 5HIKA 1UOEA 1NW3A 3BWBA 1KQNA 1PJTA 4L07A 1BC5A 3R7WA 3UJ9A 3K2IA 2YFYA 3HCWA 4WXYB 5KB3A 2XQFA 1Z07A 2GR9A 5JY1A 3V4SA 3R7DA 4IIBA 4Z4CA 3WKDA 1ISRA 3H1GA 2JDIA 3VJRA 2QPAA 4Q3NA 1GAJA 3KYCB 3W2HA 4FLMA 4C78A 3T52A 5HCNA 4Q5IA 1BXZA 4JJFA 1G21E 1G5RA 3KZKA 3TLJA 2I4IA 1V1JA 2VT6A 1M2EA 1WHTB 1DC5A 3OCZA 5EMMA 2RB5A 3SOZA 1KYTA 1AIPA 3DZGA 2A1TS 2PLWA 4DCOA 1SXJC 3OH8A 6YASA 4I66A 1N6LA 3MMSA 5EZQA 1DQRA 3QMPA 1TM3E 3KDSE 4L6IA 1GLNA 1X1CA 3W5VA 4BVBA 3JYNA 3DP9A 3NPAA 5LUBA 1XTQA 4GE0A 4B45A 2AK3A 5FL7A 3D3EA 3BGDA 2UXDB 1O95A 3AZOA 4F6RB 1VIDA 3FTCA 3R9IA 1KEWA 1YDHA 1T9KA 2FWIA 2J3IA 3RC3A 1JJBA 2P0AA 3OJEA 5HIIA 1YFJA 5F98A 4EJ6A 1JI3A 3A6DA 2ZUWA 4PR0A 2E4UA 5J3JA 3ANXA 4YJFB 2HU2A 3L1KA 3QX8A 1ZD4A 4WD3A 4XLZA 4TMYA 2G0AA 4CI9A 5GZ3A 3D8TA 1FXWA 5DBOA 3E03A 3O6VA 2FOIA 2ZM6B 3RVJA 3E5RA 2IBMA 1ZUD1 1QZ3A 2E89A 3I1YA 4PLWA 5LMUB 3QJYA 4BNGA 1MABB 1ZKMA 2AEFA 4MKHA 2O3UA 2ORYA 2C7QA 1M1YB 3E7FA 1WOMA 3Q3CA 2VDJA 2BRUC 1X7WB 2VH1A 3LO5A 3IAUA 3SYNA 4BO6A 2ID9A 1COZA 4OQQA 1ZI9A 4YUZA 3R3ZA 1JLSA 5TQ0A 1N3BA 2AUTA 2AIRA 3NIBA 4BNNA 4CM3A 4OVKA 1BHQ1 1MO3A 2HX1A 1SHJA 1QO0D 2J5KA 2WUGA 3GP3A 1DJPA 1JR4A 1YACA 3PIIA 4KO3S 4B35A 4RPHA 4DUPA 4IJKA 4GKAA 1DKUA 3KOZA 3OX2A 1OJ7A 4LE2A 3HYLA 1SKAA 5E9QA 1KAHA 5EEGA 4ENUA 1EXNA 1GILA 4JQZA 4PXSA 1P9NA 4YMTA 4QPJC 1T4DA 3DZKA 3PDJA 1N2XA 3MGKA 1L5GB 2NU8B 1G6KA 4FR5A 3ZZTA 3MAJA 3ABQB 1FZQA 3QE3A 3K0CA 4ND2A 1FK8A 2GD0A 3OIFA 1O94D 3CQ9A 1VP3A 1A95A 3RK1A 6NULA 1UBKS 2G4LA 2HH9A 4N3AA 2V5UA 1DAGA 2FPPB 4E7PA 3BA1A 3TQFA 1PNQA 4N01A 2NUBA 2FWRA 3SMVA 1MX9A 3P20A 3M9LA 3CKLA 1UFRA 2BC9A 3AIKA 3IP3A 5BWNA 5LDDC 1ZZEA 3QNMA 1IK4A 4Q6WA 1TQ8A 1I7LA 4X1KA 5LA6F 3T12A 5C32A 3L6DA 2AYZA 5DWQA 1GGHA 5ALIA 4PW0A 5F7OA 2YIJA 4JP2A 3L79A 3H3XA 4K5QA 3ZGZA 4XDZA 3ZQ4A 2BGMA 3E3OA 3GFGA 5A4FS 1RSZA 1UBRS 2B8TA 2I6GA 1GD1O 4HTFB 1UFKA 1PS8A 4IQ0A 4TTJA 4WA7A 3ZWOA 3IP7A 4M22A 4B0OA 2AL7A 3BJRA 2P78A 3F67A 4X6XA 4QAQA 2NTEA 5ALNA 5KYUA 1NUPA 4W1PA 4UE3S 3SHVA 3X1DA 3SXUB 3WYGA 4G0VA 3D6AA 4RPGA 1RYFA 4BO9A 2V0GA 4S3MA 1RM3A 3GXBA 4G8JA 4A5SA 2QLBA 1HQCA 3MQFA 4JELA 4NATA 5H3CA 4GWLA 1O2DA 1B6GA 3SIRA 3GJQA 1RD4A 4J6FA 1PZHA 1ZUWA 1A2QA 3JALA 2ZJAA 1XQ6A 1SWWA 3CW9A 4NIMA 1FUUA 4W5OA 3ZV6A 4WDQA 1G9SA 5J4LA 2IBSA 2VHWA 3T3EA 3ONDA 3BMCB 2HAEA 1NE7A 2O2CA 2XH8A 4MRPA 2IYNA 2KMLA 1ZOLA 3PQFA 4Z4EA 1Z8FA 2ZYVX 3NEJA 3OZSA 3QTTA 3HJAA 3A1DA 4M9UA 2GPAA 2A5DA 3E15A 3L1UA 1O58A 1CUJA 2GNAA 521PA 4D5EA 1K6JA 1KKUA 1XTBA 3G0BA 3EIWA 3I0MA 1EM6A 1R0ZA 5FPKA 3H2KA 2DPYA 1J8QA 1TVCA 2CYCA 3BQ9A 3GJ6A 4NL4H 3BA6A 4PC2A 5TIIA 2XCOA 1X1RA 3BB4A 2EATA 4ISCA 2IHTA 4CR6A 5CDHA 2VHQA 2WQ7A 2WU4A 1KNQA 2Z4TA 1T6ZA 2J07A 1AN0A 4OUDA 1ACJA 4Z0TA 3UAZA 4XI9A 1I94B 2WI8A 2CZCA 2IOQA 5G02A 2IUFA 2OFPA 4DM4A 1H65A 1BMFD 2XF2A 4YRKA 4RA9A 1YR3A 3LRPA 3K94A 2P91A 1HLGA 2XMSA 3ENZA 3L7KA 1WDWB 4M0LA 1VRCA 2QTHA 3ZJVA 2QLJA 3UT0A 2HLNA 3EC2A 3HN7A 2JLQA 1R0KA 3RS3A 3EXAA 3KE9A 1DAEA 2OV8A 4K9DA 1U7DA 3NRJA 4FR0A 4DCSA 5DCLA 2VRBA 3KALA 3VR4D 1DJMA 1LX6A 3MN1A 3G5AA 3HSKA 1BVHA 3MJSA 1P4JA 1RRFA 1UKVY 3PLNA 3P9QA 4ND5A 4RA6B 2QV0A 5IHPA 4H9GA 4DV3B 3O8OA 3LCCA 2JLAA 2Y1CA 4J1QA 1RQLA 4AWAA 1Z33A 4M9XA 1E2PA 3AUJB 2C59A 4P80A 1KYXA 1DO0A 1JLLA 2GMWA 1DEAA 3LLSA 4HADA 3TAXA 3ANTA 1RHQA 1FQJA 2R8OA 1FFAA 2ZFUA 3IIIA 4JT2A 4Q4JA 4CKBA 3S27A 2AQ8A 1EWKA 3FWPA 1CVIA 3GFRA 4PCAA 3EGDB 3IVXA 4MX8A 1Y8QB 3BXZA 4S35A 1UBUS 1ACLA 1XJCA 2VF7A 5TVKA 3AR7A 4Y9TA 1JVBA 3TTXA 1O4WA 2GUGA 1IG0A 5GJVC 1DXOA 1UR5A 1IOWA 4JK3A 4POOA 1JHVA 2WYIA 1QTIA 1M1UA 1TUBA 3CUEF 3UAGA 3V2HA 4CF5A 4CEIA 5BR1A 3BCRA 4JUAA 4J0IA 1NY5A 3OPYA 1T2UA 1XP8A 2DHEA 2R6GA 3EN0A 1DEOA 3OFSA 3OMXA 4OBWA 4ODIA 3IPYA 2PGDA 1Q17A 3DVAB 3OESA 4KPUB 2C7BA 4E5NA 2VQEB 4GMKA 5AJTA 2RHJA 3AH8A 3A4IA 2BFFA 4FGWA 4DLYA 1U8CB 2F1IA 4FFNA 5K3AA 3D1VA 5SYNA 2P41A 4ZDKA 1Z5ZA 2ZWOA 1IDOA 2BSAA 2YWDA 4FQ8A 4U0JA 1NAIA 1D8TA 1YJ5A 2XNDD 3F5SA 4J1TA 3G2HA 2XNHA 3DGEC 1VL2A 3OWXA 1QWOA 4L0CA 4YAEA 1RBYA 2Y1EA 2UYOA 4PPGA 5BWOA 5TB5A 1FRVA 3W2FA 3MQ4A 3QJ5A 2PT5A 1U3VA 3AIOA 5J1TB 1XZJA 2PS1A 1DP4A 1ULHA 2WJZB 1E1YA 3U7FB 5B30A 2EVWX 4FCVA 3LA6A 1FYDA 2OCGA 4IRUB 5A3SA 5JJIA 2GNOA 5IJWA 2ZE8A 3PHIA 2I6FA 4IDFA 4KI7A 4D3ZA 5C5EA 2C8VA 1ZQ1A 2HCTA 2VJMB 3N8KA 4XD2A 4GLFA 2IPAB 3IVAA 3SYLA 5CEJA 1Z17A 4KXVA 5HE9A 5KNBA 2HK6A 1ECJA 2VYVD 2B5VA 4WERA 3FKSD 4MHOA 1CY1A 1OBVA 1LF0A 2QL7A 1X9IA 4BX9A 5IF3A 1F60A 1DIOB 1RWXA 3CF0A 5CCEA 2PKQO 3EZ2A 4RDCA 3WE7A 1R9JA 3CO5A 4DR7B 3I3OA 5L6MB 1TA9A 3K05A 4DB2A 3K15A 1BX1A 4NV0A 4G0ZA 1OPXA 1L7QA 4O4IA 1PK9A 2X9VA 4OGGA 3DEAA 1S4QA 1CZHA 4M8NE 4QXPA 4TV8F 4UNRA 1UZNA 5FO1A 3O8NA 2A88A 5FLEX 1KDYA 1EIWA 1ADBA 1V8DA 2H1WA 2R7LA 3B38A 3GEPA 3QWHA 4OBEA 3GROA 1F06A 4DSZA 3Q12A 4F3KA 1V5FA 2IIQA 5I9LA 4RK0A 1IM5A 2VPPA 3LC1O 3V1LA 4J9VA 3WL5A 1CHDA 3H2JA 2PNJA 1FP1D 4NJMA 5JAUA 1W4ZA 3LYHA 4WTOA 3TQOA 2OK7A 3U3KA 2HT6A 2Q2NA 1U7OA 4ND1A 3RB8A 1J25A 1KMMA 3MZ0A 3PICA 4OB8A 3PYMA 4BC1A 1U1CA 2G6BA 4ZDJA 1WETA 2DM6A 5KOJA 4B71A 4X95A 1Y6GA 3GFTA 3WZMA 2W22A 4QGFA 4LJYA 2ZR7A 1A5BB 2PFGA 5FBQB 3PFNA 1B73A 1AS0A 1EFAA 3PHLA 2ADOA 2XUGA 4GFDA 4FHDA 3WMEA 1H6CA 3U09A 4GSKA 2NYAA 3INRA 3ILSA 4GICA 4LDZA 4NFLA 1J0XO 2UZ0A 3ZG6A 3NALA 5LP6F 4U2KA 1MJGM 3VZBA 4A15A 1FFCA 4ZD6A 2GHTA 2X1HA 3IJRA 3S2UA 4MNTA 2HRQA 1Y34E 2VSXA 3AOEA 2PIAA 3IAXA 1FW8A 2X8AA 4TUYB 4RFVA 1QP8A 3DV2A 4CETA 5BSWA 2RIRA 3PPVA 2FY8A 3ODPA 1DCKA 4I9NA 1BWSA 3IOCA 2Q9CA 3D5TA 3OJFA 4PM4A 4C3OB 1NASA 2ZS7A 4C5AA 1FJ2A 5JV5A 1HG1A 1G7TA 4IDDA 2I1WA 4JJAA 2HDOA 3JYOA 4BJ6A 4HNGA 5D7NA 3E3AA 1EH5A 2E1PA 1JJVA 5KC8A 4LE0A 3C7KA 3QVTA 5FI5A 1B6TA 2I3GA 2VL7A 3M6WA 2JIMA 2PU7A 1PJ2A 3A25A 1CJSA 1T2NA 1QB8A 2MYPA 3A6HA 3BG5A 1UJ2A 2CHEA 3WLHA 4BO4A 3C87A 4AG6A 4AMYA 4RADA 1RKXA 3CWZA 4Y6RA 1ZICA 5HG0A 3AFNA 1KZ1A 2AD5A 1W1WA 3L93A 1NNSA 3IDOA 2P5YA 4XQ0A 4YDHB 3IA7A 2VUIB 2JLSA 3EVEA 1LZKA 3DBVO 4FPXA 3I58A 5ALYA 4MUXA 1NW9B 2BAGA 1JMYA 3ABZA 4PHTA 4YRZA 4G0XA 2IZ0A 5AK6A 5G0TA 1T0IA 1SXHA 4BNZA 3RU3A 3HJFA 1VB3A 1HOXA 3HGTA 4E32A 2VHEA 4EA9A 3HXTA 2C7PA 3WYBA 5AKJA 3CEHA 3RS4A 4FOPA 5EG5A 5B4TA 4JEMA