4MQ4A

Crystal structure of hpnmt in complex with bisubstrate inhibitor n-(3-((((2s,3s,4r,5r)-5-(6-amino-9h-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-yl)methyl)thio)propyl)-1,2,3,4-tetrahydroisoquinoline-3-carboxamide
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
264
structure length
264
Chain Sequence
APGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title To be Published
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Phenylethanolamine N-methyltransferase
total genus 97
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2013-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4mq4A00
1I1NA 2QRVB 3UJBA 2FK7A 1P1BA 2VP3A 3R0QA 4V0RA 4ER6A 5BP7A 10MHA 1P91A 3A27A 4PWYA 1G6Q1 4MHTA 3U81A 5DTQA 1G38A 3LKDA 2XYVA 5BW5A 5K0FA 2AN4A 3LDUA 3PX3A 4CTKA 3BWBA 1HNNA 1XDSA 3G88A 4GF5A 4WVLA 5ICFA 1BKYA 1D2HA 2ADMA 1HMYA 3AXTA 4PYMA 2HMYB 3TFWA 3LHDA 3GRZA 2YXLA 3M6VA 1L3CA 3GIWA 3PB3A 3PFHA 5LR6A 4BLWA 1SQFA 3KQVA 2C7OA 3UJDA 3SGLA 2HR1A 4YUYA 5FQNA 3O4FA 3DLCA 3C3PA 5FCDA 3EGIA 4ISCA 4CKEA 3SVZA 4BP1A 1SUIA 1YZHA 1DUSA 4FT2A 3FTDA 2FYTA 3ERCA 2FCAA 2GA9A 2Y1XA 4ER7A 4EKGA 1UWVA 1X1AA 3K6RA 3KPJA 4ER5A 2ZZMA 2ZBQA 1KHHA 5EG5A 1KIAA 3OE4A 3EPPA 5K0NA 2QM3A 5G02A 5EIFA 3B89A 1BHJA 2YR0A 2QRVA 3F4KA 4ZTBA 4C06A 2PX4A 3TRKA 4E2WA 5MHTA 4LECA 4CWAA 1YF3A 3KPVA 3R3HA 4EQZA 4AX8A 4YV1A 3DXZA 1D2CA 1YFJA 2ZZNA 4KWCA 2Z6AA 5CUQA 1YUBA 2AOUA 4DZRA 2ZVJA 4R8RA 3FYCA 3FPHA 4E2YA 2IP2A 2PT9A 5DM1A 3V97A 3EEYA 4F86A 2P7HA 1JG3A 1ZQ9A 2OB1A 5CM2Z 5EMKA 5CCXA 3GRRA 1WXWA 2E5WA 3OE5A 3KQTA 3EGVA 2P3OA 2WA1A 2G71A 4QDJA 5LQKA 1RJDA 3C6MA 1BOOA 4FSDA 3GRVA 5FUBA 3ELWA 3PT9A 2PGXA 5EC8A 3GO4A 4RSRA 3P9CA 4GC5A 4PCAA 5LSAA 5HIKA 3HVKA 2IGTA 3KQQA 4KIGA 5DT2A 3PX2A 3EVZA 3MTIA 4KDRA 4GOLD 5DM0A 3KR9A 3HCBA 3I64A 3GWZA 2A14A 3SSMA 4U7TB 4V0QA 2OZVA 1R8YA 5LQRA 5F2KA 1VP9A 2P8JA 4CKBA 3NWBA 2GS9A 2PT6A 3P9IA 3BT7A 3KQSA 2ZTHA 3DMGA 3M70A 2C7PA 3A7DA 4E32A 1NW3A 2YVLA 1UFKA 1FP1D 3G7UA 4DMGA 4PYKA 4DA4A 3T7SA 2BR3A 3B3FA 4RTSA 3TLJA 4HTFA 4OBXA 5D1NA 3DXXA 5LQAA 2ZULA 5E8JA 3C6KA 4M7RA 5DPMA 3WSTA 3EVCA 4P7FA 4A6DA 4M36A 5ERGB 3LCVB 4HGZA 4PNEA 3HTXA 1BC5A 4QPPA 2GLUA 5M5BA 1G8SA 2P3QA 5DTMA 1SKMA 3BZBA 2WK1A 3ANXA 3P97A 2G8NA 3FUWA 3T7TA 2UYCA 4PIMA 5DRYA 3I9FA 5F2OA 2UYQA 2NP7A 4CKCA 4CXMA 3TM5A 5DRTA 5ICGA 5DSTA 3UJ9A 2GPYA 3LCCA 1L3BA 3DLIA 2VDVE 2AOVA 1DL5A 4X63A 4BP3A 5FHQA 4PYJA 2Q41A 3LCUA 4IV8A 2C7RA 5JR3A 5KYGA 2LD4A 2O57A 2FK8A 5D1HA 2IFTA 1SQGA 3THRA 1ZGJA 3G2OA 5LQJA 5EQJB 5IH3A 2V7EA 1SUSA 4QPNA 4X1OA 4RTPA 1KPHA 1SVUA 2AR0A 2EJUA 2NXNA 2PSSA 2O06A 4GOOD 2V74B 2AOTA 3NW9A 4DF3A 2I6GA 3RODA 5IKMA 5H02A 4E31A 2FPOA 4RTKA 3GGDA 3OCJA 4MTLA 4PGGA 3FRIA 3KPWA 3HCDA 1RI3A 1QAOA 2AOXA 2PX5A 4FT4A 5K03A 3SXJA 3Q7EA 3LPMA 2AS0A 2P40A 4GC9A 2I7CA 3DTNA 5E9QA 4QQKA 1N2XA 1Y8CA 3LL7A 2JG3A 2QY6A 2YX1A 2XBMA 1L3IA 4XCXA 5EZQA 3BKWA 3CKKA 3JWJA 3S68A 3OU6A 2C7QA 5CVVA 2GB4A 4DQ0A 3MTEA 1WXXA 3R6TA 4HG2A 3DMFA 1XCLA 2KW5A 3Q87B 1JTFA 3MHTA 5K0BA 1EAMA 5K01A 4O29A 4GUAA 4R8SA 3FPJA 2G1PA 4JXJA 1I4WA 4RVFA 3DOUA 3FTCA 3OFKA 4CTJA 3OPNA 3SMQA 4G56A 3HNRA 4EMSA 5HZMA 1QAQA 1R8XA 5DM2A 2IBTA 1G8AA 4BY9E 2PXCA 3ID6C 1FP2A 2ERCA 4QVGA 3TKAA 1QAMA 5EMLA 5FQOA 3MB5A 2YTZA 3FRHA 5DTRA 2ZIEA 1NW5A 4KW7A 4XUEA 3DR5A 5HIIA 3KQOA 1JTEA 4DM3A 3HVJA 1Z3CA 1ZGAA 2AOWA 4RVDA 3QV2A 3B3JA 4FS8A 5C1IA 4AZTA 4RTJA 3MQ2A 2ESRA 3FPGA 5EIWA 5EPEA 2ONYA 4BLVA 3VC2A 3HVIA 3THSA 2OXTA 4BLUA 2P1DA 4YMGA 1TPYA 1X1DA 2PLWA 3OZRA 2WA2A 4POOA 4YUXA 5GINE 2GAFA 4R05A 3KQYA 3LDGA 4GQBA 5U4XA 2P35A 4QTUB 3R24A 2ZIGA 1AQIA 4OX9Y 2B78A 5GM2A 3B3GA 2H11A 3LDFA 5FTWA 2I9KA 1KR5A 3HCCA 1O9GA 2ZW9A 3FUUA 1VLMA 3KPYA 2F8LA 1V39A 4RTNA 1X1CA 3P2IA 5GP1A 3ELUA 4C4AA 3NTVA 2NYUA 5FA8A 4OA8A 4EK9A 4OBWA 4QTTB 5E1DA 5K0GA 2PVCA 3CBGA 3BKXA 3P9NA 3T7RA 1MHTA 3BUSA 1IXKA 2FRXA 4HGYA 4P58A 3JWGA 2B9EA 3MCTA 4GEKA 3SR4A 3JWIA 2ONZA 5BW4A 5DXJA 1NW8A 5E8RA 9MHTA 3ELYA 2HWKA 2CMGA 3E7PA 3OZSA 5K0CA 4GOMD 3HA5A 5EVJA 2DULA 5GIOE 2QE6A 3HA7A 4P7JA 3FPEA 4C03A 1YFLA 3ME5A 3NJRA 2EJTA 3PS9A 2P3LA 2PJDA 3B5IA 2PX2A 3TPZA 2ZSUA 1OR8A 1JG1A 2PY6A 3AWIA 4P7GA 5DX0A 2FHPA 4PINA 3BGIA 3KKZA 3P2KA 4AZWA 4B17A 3SM3A 2IBSA 5LQNA 4ER0A 5LQUA 3RIEA 1RJGA 1H1DA 2JHAA 3NVMB 4FZVA 4LWPA 4U7PB 5GWXA 1FBNA 2ZLBA 5FHRA 2AVNA 4K6MA 4MWZA 5E2BA 4WXHA 5DLYA 2DPMA 3EMBA 4HSGA 3BGDA 1R6AA 5GIPE 2OY0A 2OB2A 3LKZA 1I9GA 5KQRA 4C04A 5P8WA 2XVAA 2YXDA 1RI5A 4C07A 2AN5A 1XDZA 4PIPA 1AF7A 1YZ3A 1KXZA 2IH4A 5EHGA 4E2ZA 4L7VA 5FULA 5CVDA 4MIKA 3V8VA 2CWWA 3BWMA 3QOXA 1JR4A 3AXSA 5CCBA 3TM4A 1AV6A 1D2GA 2AOUB 2ZWAA 1X1BA 4DKJA 2OPBA 3TMAA 1WY7A 4C05A 3FYDA 3HP7A 3KHKA 2NNWB 2JHCA 3EVDA 3TQSA 2ZFUA 1NW7A 2YXEA 3PFGA 2JHPA 1KP9A 1IY9A 2CKDA 5BXYA 2P7IA 3P8ZA 4YMHA 5KS2A 2BH2A 2YQZA 3E23A 4EVIA 4A6EA 3UJ6A 2JH8A 2VDUE 3ORHA 2G70A 4HC4A 4FGZA 2UYHA 3OZTA 4YUZA 1ZG3A 2IDKA 4UOEA 3EVAA 3KR0A 5DWQA 4Z2YA 2OKCA 1DCTA 3DULA 3GU3A 5EKXA 4F84A 1WG8A 2VZ9A 1PJZA 1ZKDA 3EGEA 2XYRA 1ZHFA 2O07A 2VDWA 5K0JA 2AOTB 4R6WA 5FWDA 5DX1A 3PLAE 2IDJA 3AJDA 4PCLA 1G60A 4PGHA 3GXOA 1FJXA 1VE3A 2BM8A 2PXAA 2NXJA 5B1SA 5C9ZA 5K8VA 3EEOA 3NDIA 1F3LA 3LX6A 5K09A 4AZSA 2BR4A 3SSOA 4OQDA 4AUKA 5EOVA 4YV2A 1AQJA 4RYLA 1T43A 1NKVA 2PKWA 4RVGA 2N47A 3A25A 3P71T 4H0NA 5EGSA 5JUWA 2H00A 3LGAA 2ZCJA 1QANA 3CC8A 5K05A 4C08A 3RW9A 1IM8A 1KYWA 2PBFA 1JSZA 5CVJA 4YUVA 5E1MA 3KQMA 3FZGA 4RTQA 3OFJA 2VS1A 1JQ3A 1NV8A 1L1EA 3FUTA 1N7JA 2Z6UA 3BXOA 5FA5A 5EMJA 2Z6QA 1TW2A 3M4XA 5F2NA 3HCEA 4X61A 3EVBA 4YUWA 5T64A 3GNLA 3DMHA 2UZ4A 5E9JA 1RI2A 1XVAA 2NXCA 3OU7A 3R9XB 4KDCA 4QDKA 5HEKA 2CL5A 4RTOA 3UJAA 1VPTA 2BZGA 1G55A 3UFBA 3UA4A 2PX8A 1KYZA 3MGGA 5GM1A 4FSXA 4MQ4A 3DH0A 3FTEA 4IKPA 2JH9A 3B7PA 1VBFA 5HIMA 5K0EA 2YUIA 3A4TA 4RWZA 2ZWVA 1O54A 4XUDA 1P1CA 1B42A 2BM9A 1U2ZA 3LBYA 3UJCA 5ICEA 2G72A 3VSEA 2XVMA 2IH5A 1PRYA 1R18A 5GOZA 3REOA 1EIZA 3UBTA 4PYOA 2BR5A 3G8AA 1F38A 3LBFA 5HOQA 3PTAA 2GH1A 3KR2A 1FPQA 4NECA 2PWPA 3UJ8A 4M38A 3P9KA 4R6XA 3M33A 3G8BA 1EJ0A 2NXEA 3CJQA 3HM2A 3DUWA 3IV6A 5FADA 1INLA 5CVUA 2HV9A 7MHTA 5HIJA 3O7WA 3M6WA 1VQ1A 4Y2HA 2IIPA 4KIFA 3FUXA 1NV9A 1SG9A 4E70A 2PV0A 1KPGA 4HRAA 5DM4A 2OYRA 1N7IA 3M6UA 3C3YA 4OQEA 4RX1A 3TOSA 4AZVA 4GOND 3DXYA 5HILA 1XJ5A 3UA3A 3OU2A 4PYLA 3E05A 3EVFA 4PYNA 2AZTA 1VL5A 2B25A 3C0KA 3EVGA 4RV9A 5EMMA 3T0IA 3MCZA 5CVEA 1RI1A 3M6XA 2B3TA 2IH2A 1WZNA 3TR6A 2AVDA 1XDUA 3X0DA 3NMUF 3VYWA 1NBIA 3KPUA 1M6YA 1ORIA 2R6ZA 3G89A 1RJFA 4EKIA 4F85A 5KQSA 2I62A 3GJYA 1VIDA 3KU1A 5T6BA 3A26A 2EX4A 1JQEA 5E1BA 5CIYA 3CJRA 4X41A 2UYOA 3A7EA 2K4MA 3QOWA 3P2EA 5E9WA 5C0OE 4LG1A 2ZZKA 1ORHA 3PVCA 4IV0A 5EZSA 1QZZA 4IWNA 1JQDA 3SX0A 2NP6A 2R3SA 3K0BA 3AY0A 5KVAA 3FTFA 3GRYA 3I53A 2H1RA 1NW6A 3NVKI 3LECA 1XCJA 5EEHA 5E1OA 4YV0A 4RTMA 2HTEA 4OA5A 1X19A 3CJTA 3E8SA 2P41A 3LSTA 3H2BA 4Y30A 5HFJA 5DX8A 2B2CA 3EVEA 5EKUA 4PONA 2EG5A 2ZIFA 4FR0A 1L9KA 5EHIA 1M0EA 5DXAA 3KQPA 3UJ7A 3EMDA 4DCMA 3NWEA 4PYQA 4HTFB 1WS6A 1YB2A 2PXXA 2HNKA 3MERA 5EEGA 4RTLA 4FP9A 3I58A 1R00A 3IEIA 3L8DA 1RI4A 5DSXA 1JG4A 3ER9A 3KR1A 3HCAA 1UIRA 5CD1A 1EQAA 1KPIA 1NE2A 1XTPA 3IHTA 3D2LA 2QYOA 4RVHA 4XUCA 5LQCA 3ER8A 3FUVA 2OO3A 2AN3A 5K0LA 1EG2A 1O9HA 1TW3A 2OBFA 1P39A 3CGGA 3DP7A 2O0LA 2ORED 3GRUA 3HCFA 3IYLW 4KRGA 2Y1WA 4GBED 3VC1A 2JJQA 2O05A 4E30A 3GCZA 4RTRA 5FWAA 4X60A 1MJFA 3G2QA 3CVOA 3HA3A 4QVKA 5T67A 3UZUA 2ZBRA 4ER3A 3G5LA 1EJ6A 4P7KA 4DCGA 1RJEA 3BWCA 1VP3A 5ICCA 1Q0TA 3FPFA 3JWHA 3G2MA 3BWYA 4KVZA 3BGVA 4LWOA 1M6EX 2CMHA 5E2AA 4PYIA 3GDHA 3I5UA 4E2XA 2EFJA 1Q0SA 1JG2A 3CCFA 4ATNA 4HH4A 1R74A 4QQNA 3MAGA 2PWYA 1XXLA 3UWPA 1QYRA 4M37A 3HVHA 1NBHA 1NT2A 2ZBPA 3NDJA 3O31A 3TKYA 2IPXA 2XYQA 3SSNA 3G5TA 3ELDA 3G2PA 3KQWA 1JSXA 3HEMA 4E33A 8MHTA
chains in the Genus database with same CATH superfamily
1BROA 3NPMA 3PC8C 3D1VA 3JTMA 5KEIA 4ALJA 5F64A 2J6BA 4MQFB 3E70C 3R7AA 4U2KA 1DIAA 1ID1A 2JAWA 4AMZA 2CKMA 2E4ZA 4H59A 4JYBA 1RKQA 1DOAA 4YJHA 4LV8B 4IX9A 5C18A 1J39A 3E48A 3G88A 4M1YA 2YHIA 3UBMA 3TB6A 4KO8A 2P9JA 3FWZA 4BNUA 2NO9A 4ARBA 3C3KA 1R4MA 3QU5A 5JS6A 1LZKA 4GNRA 5F7JA 1UAGA 4BLWA 4RY0A 3I9V1 3UJDA 3O8OA 2F1JA 3RV3A 1KYTA 4PX2A 2NUTA 1BG6A 1P6QA 2ECKA 4QQRA 1LS1A 1R8JA 2PZLA 2Q3BA 3LPDA 2R7AA 2VT6A 4X8LA 5HZGA 5I7UA 3VJRA 2GPNA 4PBRA 1V6SA 3DEAA 4G09A 4LCEA 1GZUA 4LJ7A 2A9QA 3X1JA 1CUYA 3ONVA 5JNSA 4TV8F 1G3QA 2JIRA 1RTKA 1EFDN 3D8UA 2OGSA 2UZIR 3DDSA 3DBVO 4ER5A 1X2BA 1MAWA 1W5TA 5CX1A 5B4UA 2WWIA 1JPNA 5G02A 4KFRA 2GCGA 2VPZA 4UJ3A 1W49A 2B0CA 4JJ6A 3NTOA 2A3RA 4E2WA 3PHLA 4ETWA 3QJ5A 1YF3A 2QRLA 3T7IA 3FLEA 5IAKA 2F1OA 2E5FA 4N0QA 2Z98A 4OHBA 2GF9A 1S9HA 4KWCA 4WXRA 5C2JB 3SBXA 1FRVA 4BGEA 2FTKE 4KLAA 4M4SA 1NUHA 5HR5A 1POXA 4R1SA 3D2AA 2XQFA 3BJMA 1U6KA 3FPHA 4EY5A 1SJ9A 1DQRA 3EEYA 1Z74A 3DQQA 3IDAA 4XYMA 3NHWA 1Q1AA 5DXFA 3KK0A 3WRVA 4BNYA 4R40A 1GGMA 4DJ5X 4Q3AA 4M7WA 5LZ7A 3VVBA 2WA1A 4GWLA 3C6MA 1AUQA 4AJ9A 1GT91 4JU9A 5JW6A 5M2QA 1H4SA 2CXUA 3R5TA 2BKXA 2FWMX 1LRLA 3QV1A 1U3UA 4EJSA 4DTIA 5REQA 3USCS 3DO6A 3GFFA 1A2QA 3HKEA 2J0EA 4PG4A 3P2MA 1G8JA 2D1SA 3BA6A 4Q21A 3SQLA 5CD9A 5L3QB 2GZMA 5KNDA 3H2ZA 1A8QA 1OA1A 2OZVA 4NAUA 2IS4A 2NTVA 1VP9A 3N5KA 4ZHQF 5AI4A 1I94B 4B75A 2HF9A 3TCNA 1SCUB 1W85B 2RKOA 3QXSA 2VRNA 1W73A 1LSJA 1T9HA 1ULAA 1BKDR 1FP1D 3GL9A 4MGEA 5GQSA 3WI7A 1Y8AA 3D6AA 1I2DA 4L74A 2NUAB 1LSUA 4H6VA 1GZSA 5DJ5A 5ERGB 1TIKA 3N3AC 3T1OA 2VH1A 4GZLA 5COAA 4QSHA 2HXYA 3G6WA 1TMOA 1W36B 2NSYA 3QFSA 3FUWA 1RE1A 3HFSA 3LSYA 5BURA 4AMUA 5F2OA 4B6PA 2BF7A 1GPWB 3L0SA 5IVKA 1VLQA 1GZ5A 5DCUA 4ERXA 1HL7A 2IEIA 4B45A 5JTUA 1ZDMA 2VSYA 3B6MA 3ORYA 5KJ1A 3PTLA 4M7OA 2HU2A 1E3LA 4FYHA 4I5GA 2LD4A 5EJ4A 2BSXA 1A72A 2P1RA 3S1SA 4LJRA 1BRMA 2A57A 3Q2OA 3TZEA 1GSOA 3ZIDA 2GBPA 1WUJS 3NP7A 3Q4GA 5LU8A 3NOVA 5E4FA 3MIZA 1XN1A 4BLPA 3H5AA 3ROXA 2L69A 3INRA 5TR9A 5C1DA 4KSCA 4RTKA 1HDEA 2GF0A 5G1NA 2Y8EA 2DECA 3W9YA 4BVHA 3PUIA 2C7BA 1E62A 5JZBA 4US1R 4EG6A 2W93A 5IJZA 4NSNA 4JCOA 1KRHA 4JY7A 3CF4G 4JCCA 4NEQA 4QQKA 5FBVB 2CBZA 1N2XA 4HDNB 3D0QA 1ZW1A 2AR9A 4KQJA 3U09A 4IXNA 5HMMA 1PZMA 1BW9B 1HE5A 4MV3A 2ZIXA 3MUOA 4I4NA 1OAAA 1OUMA 2YVKA 2I99A 3HYRA 4AJOA 4YJGA 4J0KA 2GB4A 1L8XA 2DHCA 4EBBA 4B8YA 2N46A 1E9EA 4OHXA 4GPAA 4HG2A 4UBMA 4KQ1A 2X19A 3SHQA 1YVDA 1YIAA 4B33A 1DO0A 3FTNA 2NIPA 1QE0A 1W30A 2DBYA 2EFYA 1V8OA 1XZMA 2RFLA 4PLWA 3WK5A 1J2EA 1STOA 1Q77A 3OFSA 4ZCIA 1VLJA 5BWLA 3H18A 4MWGA 4RM2A 4C1BA 3WLRA 1NHWA 2MINB 5G4LA 2YBEA 1E1DA 2BC9A 4GR4A 4PN7A 1IONA 1G1MA 4KLZA 1XKTA 3B53X 1YZGA 4O8ZA 1WEKA 3ONNA 5KWJA 2IIBA 4G2TA 2PK3A 2NV0A 4YQYA 4DR1B 3OBIA 2ZWMA 3I6YA 2JJ1A 5HBRA 1AKRA 2IYNA 4DSNA 3WLTA 1FB5A 2DSNA 4H3KB 1WMDA 5LOVB 3IB6A 5F1OA 3VC2A 1D2RA 3AONB 2OXCA 3LLMA 4LYJA 1TPYA 3EF1A 1ONNA 3GEHA 5B36A 1NQXA 2B7CA 1FUUA 4P4SA 4D4MA 5FI0B 3OHMA 4L0MA 3UPUA 4CM8A 4LQDA 2WHXA 1SXQA 2FW1A 1ODJA 3W2IA 4QXRA 3O4RA 3GPDG 1YAJA 1WCIB 2B78A 2YHAA 3IBYA 5AQEA 2QROA 3ZHRA 5TMDA 2H11A 2M2IA 5I9IA 1HQDA 4ZANA 3HJUA 3D5TA 4JL5A 2OESA 3DFMA 4R9UC 3KUKA 1AKYA 5TT0A 1ZEJA 2XIJA 3RT1A 4HQRA 1JJVA 4B6EA 3NBMA 1E60A 3VOTA 3CBGA 4EHJA 1VSVA 2EX1A 2OILA 4NZOA 4QDTA 2QAGC 2G1UA 4HEA1 5DKFA 1NATA 3CPHA 2ZR9A 3CPEA 2B21A 2GX6A 3QG5A 2RGXA 4H16A 5CEJA 1B6SA 1E3MA 1G63A 3TEJA 1E18A 5DYYA 3BMQB 1TRHA 3OAAD 2HWKA 4JYMA 4NBSA 4XRGA 4MX8A 1WZEA 2IEAA 4B7UA 4OP2A 3LMKA 4C89A 1SRRA 1SHTX 3K0EA 2R96A 2B7LA 1FX1A 1LQUA 1UQRA 2C9MA 1LPPA 3FPLA 4K8RB 4XOIA 2RJ3A 4YDHB 2J9ZB 3AUJB 1L7NA 1ACMA 1JEDA 2PX6A 3ACCA 3B5IA 3CUKA 4FFVA 4MB6A 5ES3A 1PN3A 4YR7A 2HSGA 3AEQB 2L18A 3VR5D 4CV2A 2XT6A 4HFMA 5JECA 3CUSA 4TL9A 4XX1A 4H7FA 1T2UA 2YCBA 1V2HE 2R86A 5AVKA 2JH3A 1Y4ZA 3D3NA 3HBMA 5T57A 2YV2A 5LQUA 5LZ2A 2WINI 3IQFA 3K5IA 2ASEA 3MHPA 1AGRA 1GDHA 4CF6A 5GWXA 5A7FA 1N33B 2HK8A 1QQ5A 3P2OA 1CETA 1P1RA 3EXIB 3REQA 3TNLA 2HFKA 3E7XA 5H9WA 4WT7A 4KWEA 4GE3A 1DT3A 1JIKA 4RABA 1Y6ZA 3BMXA 1OASA 1YZFA 3NM4A 2VCHA 4N5NA 4PIPA 3ZVLA 2PXHA 4PGMA 3R0JA 4RKFA 1N8NA 5JATA 1MO2A 4N0EA 4KB5A 5CVDA 3IE1A 4OGGA 1JMKC 3K0SA 2OZPA 4KPGA 3O8CA 5C7OO 1DGQA 3AXSA 3PXUA 3R3YA 2C9CA 1XCGB 4PZPA 3FSEA 2ZRDA 1WU8A 3DYVA 3CONA 3UV6A 2NSDA 1GNVA 2BTOA 1AB5A 1P7YA 3BPSA 3I3OA 1YRWA 3F67A 3W3ZB 3RUDA 1F2TB 2W2LA 2DM6A 3FPAA 3G23A 4ML3A 1I2MA 3ZV3A 5HK9A 1XDWA 4YRFA 3CWZA 3U4QB 3H4VA 1GQOA 4U2EA 5JALA 2C82A 4GSLA 4J2TA 1A4UA 2H2WA 2QOEA 4RFSB 1BA2A 1H6AA 2VDLB 4DAOA 3VDMA 1P6UA 1OV4A 4A8JC 1K3TA 4PS0A 2H4FA 3QSGA 3UGKA 1ZI6A 5JXHA 5LPNA 3QPVA 2C2ZA 2BM1A 4YRBA 4DDHA 1B8UA 1E32A 2VRWA 1MO4A 3C3WA 3QUBA 3DVAA 3HR4A 4FYIA 5A5FA 3DW3X 3I52A 4PFKA 4CCAA 3QMMA 4H15A 2BZ0A 3QVKA 5JFGA 1R7RA 1UBHS 3D7RA 1QZXA 2WE7A 3LX6A 3U40A 1G291 4QGGA 5CBKA 4TYYA 4XWKA 3S2SA 1T43A 1NKVA 1NJ6A 2XZTA 4NWIA 3QEBZ 3HY3A 2X9VA 5B2EA 1I7NA 2XE4A 2XV1A 5CVJA 1KGDA 2WJJA 3E35A 4PPGA 3FZGA 5CP8A 4ZCLA 2NSHA 4LPSA 4DEXA 5TJ9A 4WKGA 1H0KA 5BORA 3L92A 3ZI4A 3EGOA 5DOZA 4E30A 4LZZA 4IQ8A 4UAGA 3OLXA 1AS0A 2XAAA 3NAMA 3ROKA 3SHFA 1WSAA 1FZQA 1IDN1 1PR9A 1ZUWA 1AKTA 3EWAA 3PXXA 4RXMA 5EE5B 2WM8A 1ZA2A 2PYDA 5IYZB 2IGBA 1XHFA 3EOAI 5E9JA 1KY5A 3R44A 1U3FA 3IALA 3PHJA 4HX5A 1SVOA 1VPTA 1Z22A 3GVCA 3MRXA 5KQGA 1AQLA 5L3VA 3UUWA 2GHQA 4J90A 1Z13A 2HIGA 3WHIA 3ZCTA 2ZI5A 4KFTA 3VO8A 3A6JA 2PA3A 2ZWVA 1XYVA 2F3UA 2ONCA 2B8JA 3WA6A 4YY3B 4GS5A 3H9QA 4OQNA 2O59A 4OJYA 4JLNA 5ALHA 5DT9A 5JD4A 1H2EA 4O2BB 4MWCA 3DBRA 1N2CE 3GDWA 4JLUA 3LBFA 2G63A 4GLLA 2EZTA 5FNVB 1BCRB 3OFVA 4GX2A 2H18A 4KH1A 2GYYA 1NVMB 2C97A 4MARA 4BZQA 2R6JA 4CG3A 3K6JA 3G0HA 1SHJA 2WU8A 2ES4A 1T0JB 1J20A 5HDBB 3AWDA 1FFSA 4L2IA 3LK7A 2W2NA 4JOBA 1Q14A 2XWPA 4DA8A 5C4MA 1SVNA 5F52A 1PEAA 2Z4RA 2OYRA 5L3QA 4N01A 3A9CA 4QA9A 5A7GA 2GRAA 3ON5A 5AXCA 1HOTA 5CDGA 3IUSA 1I4TD 1S8AA 1MAAA 4LS3A 4BP9A 3AJAA 1VL5A 2GBLC 1ZEMA 3H97A 2G9ZA 7AT1A 3W5CA 1L7DA 4XPIB 5CITA 1JR2A 1ETUA 3IAFA 4N82A 3HV0A 3U4CA 3QKSB 3OIFA 5E3JA 5CG1A 4GSYA 1RQLA 4HADA 5EQDA 1M8KA 4WVFA 3HH8A 4HLNA 3ZHZA 1FW6A 2VPWA 4LXQA 3DBHB 3LTEA 4WXMA 2FZWA 2OKGA 2WUFA 5EIHA 3TSAA 2ZRGA 4L5CA 4M0UA 3N2KB 1D2EA 3FHLA 3A7EA 2XDYA 1NT4A 3NWPA 1B8NA 2PYIA 1ZH8A 3DWIA 1WF6A 2YUTA 4PR3A 1QZZA 2RGNA 5SY9A 3PGJA 4LWQA 1RP1A 1V4NA 3I2YX 2FMFA 1QFSA 4OSEA 5SV2A 4QJ4A 4RCYA 1CJBA 1KOJA 3WNZA 2VJKA 4BAGA 4D0RA 2JJ8A 3KYIB 1XCJA 4CDMA 3ESYA 3EFBA 2ARKA 2I3BA 3I4FA 4LOAA 3QXCA 821PA 1UBLS 2E37A 3RK1A 1REQA 2HI0A 4DW8A 3EDYA 3OA2A 4ED9A 1B41A 5JROA 3NASA 2XNCA 5DLPA 2CE2X 2IY8A 2DOKA 3MN1A 5BXQC 3MTDA 4HNAA 4FHCA 1N3BA 1L5FA 3TZLA 2FPMA 4LVUA 3EMDA 5HMLA 4JHXA 2H57A 3TL6A 1FMJA 1JDNA 1GHTA 4OQXA 3MERA 3BD9A 2ZM6B 4NEHB 3J81k 1NOJA 2FQWA 4QEKA 1T9ZA 5DSXA 1E99A 1Y6QA 3IP5A 1XWFA 4B80A 1DAFA 4QELA 4S3MA 4XUCA 3BH0A 3DWFA 2EGGA 1T5SA 1NSFA 1X70A 3HDYA 4RVHA 1KSHA 1ILEA 4AY2A 1EFCA 4DCNA 2QQFA 3N8HA 1HT0A 1YL6A 1U0BB 3E1KA 5E1MA 5LD2B 2OBBA 3T8YA 1JL3A 1LDMA 5B3JA 4YIHA 4Q47A 5LQNA 2H9AA 3VPDA 3WL3A 1M83A 1SK9A 4TT3D 3CX7A 3EJ6A 2WNIA 5G3ZA 3TIGA 3M81A 4FBLA 4INZA 4KG7A 1U80A 1Z6YA 4IXMA 3KSBC 3GJ8A 1XTRA 5ESXA 2Z8XA 2HO4A 1TL7C 2WWTA 3K1YA 2JGEA 2QB5A 3E8XA 3D3WB 1RAAA 8MHTA 1FRFS 3TEFA 3DLBA 3CF0A 4HZUA 1U9IA 1G5PA 3IR7A 1ZSYA 3CKYA 2JL1A 1QPBA 1Z16A 2BTQA 4EZEA 3LWDA 4FFMA 3GAFA 4IDGA 3E61A 2XNJA 3SEQA 3BFJA 4ZYYA 3GN1A 4GIBA 3BULA 2FPGA 4FZVA 1OX4B 2ZRNA 5IBCA 1XNQB 1E1KA 2PZBA 2V7TA 4F0JA 5CM8B 1P91A 2FN9A 1EDDA 3O8QB 1O0SA 1HE2A 3VGJA 2WAYA 3FFAA 3I2JA 3U7QA 4EA7A 3DVLA 2HBYA 3OT5A 3PX3A 3UOAB 2R1TA 1SWVA 2A3NA 3JASA 2AFHB 4Y6PA 3M6VA 5ULLA 4F9GA 1IIBA 3GR6A 3PB3A 3QEKA 1TVCA 5JNVA 1I0ZA 3U5TA 4S0ZA 1YZQA 2P9CA 3LTNC 4PS1A 5EXXA 4ISCA 1W4AA 5K2MA 3N76A 4QYMA 3Q6NA 3HHPA 1JIUA 2FUEA 5CLIA 4U6QA 1P1JA 1T25A 2FZGA 4EEXA 5B64A 3AVXA 1SMKA 4NOJA 3C8HA 3DNFA 4MYDA 4WOCA 5K8CA 3OP1A 2GCNA 2P79A 1RWQA 1KU6A 1R9NA 1U9JA 4FJ1A 3EPPA 1T2DA 2VJBA 3UOGA 3R7DA 1PDVA 3WXBA 3RVOA 1U99A 1PEKE 1KQFA 4LECA 4CWAA 4AMYA 5KUTA 1P4JA 2GKSA 4DSZA 3NBFA 3H7IA 2PBRA 5LB2A 4MUYA 5A3SA 3JVEA 2HM7A 2BUCA 1OGIA 4EB0A 2ZM5A 3ETCA 4ZYTA 1FF9A 1C9DB 5CUQA 3PNYA 4LNAA 4F2WA 2PD6A 4RD0A 2XW6A 3VMFA 4NHOA 2C29D 1PBTA 4GYJA 1JFLA 5F1PA 3VAZA 3GEPA 4B71A 2COKA 4F86A 4ENQA 5ICMA 1G7SA 1R4NB 2XEDA 3L0ZA 3LCRA 2IHUA 4JJ7A 4KI7A 1MC1A 4MYRA 3EGVA 4Q39A 4QDJA 1TO6A 2G71A 1UP7A 5ALIA 3TLGA 3QIAA 3UMVA 3GP8A 1RPAA 1V35A 2FSVC 3AVPA 3WGTA 3QZUA 2KB0A 1RYEA 4LDQA 1QGUA 3KOYA 4EKYA 3IESA 5EC8A 4R54A 1SM4A 4HGOA 2A9JA 2JHFA 4EELA 2XRYA 3DMTA 3E9NA 4GKJB 1BQ3A 1MIOB 1SVWA 4L9SA 4MCHA 4TZTA 3FF1A 4JUBA 4II3A 2E55A 4V0QA 2FEAA 1J06A 5FJJA 3VSDA 3KZMA 5BYJA 3TUZC 1AKVA 4N47A 2GS9A 1ML3A 1ST2A 3X44A 3P9IA 3V7NA 2GHIA 3L4SO 3N28A 1DO2A 3UH1A 5H4GA 2IBSA 2JCBA 3RRNA 2DBRA 3L7KA 2C77A 2PMBA 1I3NA 2W7TA 4GX1A 4YMIA 5CMLA 4AS1A 1C30A 1QOQB 3H2IA 4QHTA 2IQIA 5D1NA 4BASA 4RZXA 1I33A 2OV3A 4B3SB 1WUKS 4P7FA 4LKOA 4ZDWA 4M36A 1C9YA 2HKIA 3CRQA 5DYIA 3SE7A 5M5BA 3ZY6A 3K1ZA 3P0RA 3VH4A 4M0MA 3F7OA 1PK7A 2C99A 2C3OA 4MR9B 1L4KA 1P3Y1 5ALKA 2I6QA 4MKHA 2IV2X 4IJ5A 3PGVA 4CM3A 4FJ0A 3WMFA 1YI8A 1PHRA 1PZFA 4B3CA 5FHQA 5A5EA 4WEQA 2C2GA 3SVTA 1IN5A 1PKEA 4RETA 4K9RA 5HGJA 2Y0EA 3ZD6A 1T5OA 1YRHA 4NE2A 2V6JA 4EGAA 3R3ZA 1ACLA 1SQGA 3JPYA 4DHWA 1EHIA 2VF5X 2BE7A 3JQ9A 1ZM2A 3PXGA 1U0OC 2I1LA 4NAVA 3ZGOA 2O5CA 3A0RB 5FBHA 4HNUA 2E6UX 1KDVA 4AECA 3G9XA 4MTLA 3R75A 1NC1A 1G0NA 2QQ0A 4G63A 4OL9A 1CUSA 4WQMA 2FFJA 4ZP1A 1VPWA 1NF2A 4IWXA 2O4UX 3G79A 4MWDA 1K63A 1Z2CA 2M9MA 3KKMA 4AC9A 2IEGA 1YB7A 1KZ4A 5AUPB 1J07A 4P08A 5J2UA 2AC7A 1Q50A 1EI9A 3CKKA 3JWJA 2R79A 3TTTA 1U3CA 1UT6A 1BKSB 3LT0A 1E3JA 4ZRNA 4YRPA 2A1UA 3JV7A 1N0IA 3SIRA 4WZAA 4D2IA 2W71A 2ZUSA 1EWVA 4BJ6A 1I7QB 3DWGA 2EERA 3FWNA 3H11B 1BVHA 4LVCA 1X77A 1WUIS 1QHGA 4PXYA 4QDXA 5BPHA 3O1JC 3T1VA 1VCHA 3QTTA 1Y5NA 1N2IA 4JXJA 1VE9A 2DJIA 4QREA 2LKCA 4RVFA 3SZRA 2IBTA 3M9XA 1QGED 5CHEA 2NU9B 1VCMA 4J0FA 1NZDA 3NNDA 1IUNA 1ZMOA 2XGSA 3PPVA 2EP7A 1JLLB 4JQCA 1USVA 3EH1A 2QL6A 2XWBF 4JP8A 4PRYA 1R0YA 1GLVA 1SIWA 1S02A 4L6IA 4CEJA 1P0QA 1T91A 4MEBA 4JX8A 4NYJR 4EA6A 4KMOA 1L8OA 3C8MA 3MT7A 2H3EA 4KN9S 4UDNA 4M0PA 3H9BA 4Q4HA 5CXUA 5FBRB 5LC1A 1ONSA 3TFQA 4KK3A 3CR8A 1NM5A 5DYTA 3ZHXA 4DTCA 2PH1A 2QD3A 3TLKA 5TPZA 5HKKD 2V7XA 1YASA 1Z15A 1A88A 1VKRA 4WPGA 2V6BA 4ZQBA 3ZIUA 3KT0A 1AV7A 3C39A 4RVNA 4JODA 3LDGA 4Q1AA 4HDSA 4CBVA 3WBKA 2PA0A 4XPIA 3NONA 3WB0A 3E03A 3GA7A 2QLNA 5J40A 3I01M 1YQWA 4KWTA 5ALRA 4HPXB 2WWXA 1PR1A 3CZPA 1VLMA 4P22A 3L6RA 4YDSA 2MMGA 2GEVA 2BJHA 1AN0A 3AILA 1N2CA 3IKMB 1DP4A 3P4UA 4HNRA 1PK8A 4BE7B 4MYUA 2XCIA 1TEZA 2DT5A 1ITZA 1BS2A 4IKOA 2QTCA 2JNWA 4GRDA 1EUZA 1FUYB 1T4MA 2I4IA 4YPFA 3U9TA 3UTDA 4BCBA 4ZDJA 3H2KA 4CIYA 1IXKA 3Q0TA 4EW1A 3ESRA 1ZR2A 4EM6A 2DFDA 4B9EA 3UGQA 3HLKA 3LAWA 3SR4A 1EJBA 1OWOA 3HN2A 4P82A 5K4GA 4Z6KA 1NW8A 1PYOA 4ITVA 4QUGA 3UJHA 4A6PA 5BWBA 3PRJA 1WZ2A 2ZPTX 1FNNA 1BGVA 4GOMD 4JI0B 4MV7A 2R9VA 2J4CA 2BEJA 2QTFA 5AVYA 3HDGA 4LX0A 3DCYA 4D9IA 2BW0A 2PX2A 1P2TA 2XBLA 1WL8A 1WXHA 2XMBA 3OBBA 3AWIA 1ZHHA 5C4GB 2IPLA 2QMQA 1A2BA 1H2ZA 1YHZA 1EMDA 4DCPA 3V55A 1DBPA 1C0IA 1VE5A 4DR2B 1IEQA 4MVJG 3IKLA 1GQYA 4N8SA 4N3NA 2W4IA 4Q9LA 2C83A 4FLFA 4MWZA 5E2BA 5EKTA 5AYVA 3L0PA 3V7WA 1D7AA 1DC5A 3AJRA 1BWRA 4TQAA 5KDDA 5GIPE 3U44B 1I9GA 3ND9A 1AE1A 4XYGA 1F60A 1KFCB 1SOVA 5CNKA 1RP7A 5ER9A 4FYJA 2R8RA 4FCVA 3OMXA 1UBMS 4X65B 4YAIA 1CY1A 3RROA 1L6RA 3HKDB 4MIKA 3V8VA 3ZDFA 5FTMA 1MV8A 2CWWA 4EP1A 1D9ZA 1TX4B 5BSWA 2BBOA 1Z6AA 2CJYA 3IP7A 3LBAA 4GLJA 4PBSA 4LDPA 2HA7A 3EDRA 4NZYA 4REQB 3TLZA 1LPOA 3U39A 3ZBTA 4C05A 1NXOA 7YASA 2XCRB 2B4RO 1PWYE 4IOJA 1RCUA 4DSUA 1EVIA 1HYEA 3FNGA 2J7PD 1VKZA 1IY9A 2W4MA 4HVLA 1KI3A 2Z0MA 1EDEA 3ZWCA 3AEKB 5LD2C 3QU9A 2JF0A 2P3SA 5IAJA 1FA9A 2E82A 1T2NA 3BBPA 2I7TA 1E8NA 3HB1A 3K8ZA 1UP6A 4TLMB 1YJXA 3ZJUA 4YUZA 3ENQA 2ZRKA 1JSCA 4CF5A 3P19A 5EKXA 4M1ZA 3EIFA 2VH2A 2PDAA 2GZ2A 1FFBA 3RKUA 3M4NA 2LR0A 3WC4A 1JDZA 1VJGA 2VATA 2C57A 3O26A 4FGLA 4IRMA 4IOLA 3DZHA 1IM5A 1BVUA 3G0IA 4JSRA 3E9MA 3BX1A 3EVNA 4X6UA 3PG5A 5J2UF 2NV6A 4PGHA 3I04A 5CH5A 3U9LA 3N6RA 3TVDA 3UMGA 3A9VA 1PDOA 4REQA 4ZJUA 1RRCA 3U4HA 2VH5R 1E3IA 1ZA1A 1CR2A 4L4SA 4YJHB 3LFUA 3JYPA 2FA9A 1H5NA 1E6WA 1XRNA 1Z2EA 4ZQEA 1QIKA 3IPAA 4CT4B 1JQBA 4YV2A 1HR0B 4MVJH 3UAYA 1E9AA 2FR8C 3QHAA 4I7EA 3TTXA 2FLVA 2C92A 3LGAA 4Z49A 4P81A 4W1SA 1ZRNA 3LQFA 3O8OB 3UB4A 1IM8A 4CV1A 5IKPA 3QBTA 4M6WA 1IZ0A 5LDDC 4NBRA 5K8UA 3OFJA 1GA1A 4HYQA 1GL7A 4AMBA 4HKTA 2TS1A 2OD2A 4YGXB 4HS4A 1V1RB 3SU8A 3PQ2A 3FPBA 4X71A 3TNYA 4K05A 3C16C 1T3LA 4CG2A 5CFQA 1TTTA 5JMOA 3HNPA 2HT1A 3L6OO 2HIAA 2XUGA 1PX0A 1A9ZA 4L9AA 3E7DA 1DSSG 3KOMA 2WJIA 4JBLA 3ZKWB 1K9SA 3IDSA 1W9HA 3HYSA 1YBFA 3DDOA 3JAWA 4FS3A 4DJFC 4TV9A 1GPYA 1I5OA 4M9SA 4UCQA 1OXTA 1VBKA 5IT4A 4EGJA 3GEIA 4U2CA 1KBOA 2PAFA 3I2FA 4EG3A 5KU7A 5F2EA 4ETMA 5IBQA 4B3GA 1HO3A 1NKTA 1SEVA 1DXOA 1ENPA 1TA4A 2QRMA 3F4LA 1X86B 4XDZA 3T5MA 2GR9A 1KFJB 2YJ3A 3TEMA 1DAKA 1I4EB 1H2YA 3GYGA 3IPCA 2GZAA 3LC1O 4HPWA 1C8KA 4R6XA 1R37A 2XODA 5BSMA 3BF7A 1V8PA 1FNDA 2O1XA 4RFLA 5ESDA 2C78A 1K9VF 4LVOA 3O7WA 4QVIA 1KMNA 4URUR 5D85A 3THXA 3PA8A 1LKZA 5GJWC 3KSRA 1LVHA 2IYSA 1ADCA 3B70A 1XD9A 4F9TA 2G4LA 1QG4A 1F20A 3MWKA 5DGTA 5HILA 1XK6A 1J2UA 4XJSA 3C6XA 2OGZA 3C85A 1XQXA 3DKKA 1E2IA 4B5LA 2EX0A 2QX6A 2RK4A 3SF8B 2AVDA 3X1WA 1GUYA 2WPDD 3LHKA 1M6YA 2Y4OA 4EZBA 2IYXA 1OFUA 4FUTA 4GKVA 2FQ1A 4JP2A 4LTNA 4M1SA 4EZIA 4TL6A 3ZCSA 4YRKA 5JSZA 5KQSA 1EBUA 4ABTA 4CQMB 5CIYA 4HYTA 3OM0A 1NW9B 3PPXA 2R751 4MKGA 4KQGA 4QASA 2JC3A 4TLLB 2VBIA 4BUZA 1AUXA 1RR6A 3SS8A 3CE9A 1KMHA 1KMQA 5KVAA 1CKEA 4IEFB 3T4UA 3NC4A 3C98A 3I5MA 4LCJA 2ZBDA 3FCAA 2WMOB 3CVUA 4DNXA 2IVZA 3R3SA 3A04A 1RHUA 4IQGA 5E38A 2NAFA 4KWIA 4OV6B 4RWEA 5IANA 1FVFA 2MR5A 4FONA 1GGVA 9ATCA 3PDUA 4YCAA 1EEHA 1P2VA 3IB3A 5KWSA 1KJWA 2ZIFA 1CY2A 3OZWA 3W77A 4DMFA 1HYGA 4NH0A 4ALMA 4RGBA 5FXMA 2DFKB 4N6OA 5KKCA 1AVTA 3K8QA 3VR6H 5JOQA 2E4VA 2UXCB 1JHDA 3I58A 3O2SB 2P4QA 4W99A 3DAHA 3W2EA 1ATIA 1GSHA 5MN4A 3ER9A 4RVOA 1U1CA 4RH3A 4X6LA 3I2KA 1PQPA 5J1TB 3WMGA 4I1UA 4WECA 2QM8A 2RI1A 3BMQA 5BV8A 721PA 2QTAA 4MIEA 1PK9A 2GXQA 1GEEA 4KO2S 1V1MB 2FFBA 3RHZA 2G6BA 2O05A 1H3EA 4OI0A 4ZJYA 4KXMA 2O1SA 3BWEA 4WGFA 4POAA 3G5LA 2YC2C 2RI6A 3GLQA 4HMOA 1NXWA 5CDUA 1N25A 1NXXA 1NOKA 2ODNA 3LQ1A 3F73A 3U1VA 5ARBA 1M34A 4WX2B 3E2MA 2IUFA 3I5UA 3UUFA 4E2XA 1HC7A 3WK7A 2HWUA 1UEIA 3KYDB 4QX6A 3HDJA 3C5VA 4XQ0A 3FI9A 4X94A 2A1UB 1ORTA 4YDRA 5D6OA 2IYTA 2JDID 3FKSD 5DFAA 2FG6C 2YWHA 3VSCA 4E07A 2YZMA 3U4GA 3IULA 3O21A 4PM4A 4DBZA 2Z57A 3WWZA 2OWEA 4MQ5A 3F74A 4B31A 3HDQA 2CUZA 2NU6A 4J3JA 5ERXA 5IFLA 1Q0QA 4MHTA 4G4JA 3FDIA 3U81A 3CLKA 1WDWB 3B60A 3RYTC 1NDHA 5J5CA 1BVYF 2XMPA 1A1VA 4QM6A 2OHHA 4HNQA 1PGNA 4UBOA 2XQIA 3D81A 1VPDA 2B36A 4XLTA 3VKWA 4G5XA 1S7CA 1CUAA 4TROA 4CKYA 3F46A 4GL2A 1O8CA 3JVUA 3R9XA 3WNDA 1LNQA 4AXBA 5DLEA 3VJKA 1S6YA 2AUNA 4I50F 4C43A 1ZK0A 1GKLA 4FDUA 3TIIA 3V8RA 3RGWS 3KCNA 4AKEA 2F3SA 2W42A 3DEFA 3ML1A 4CLEA 1JZTA 3ABOB 2NU9A 1G64A 2ZE7A 4HGNA 4WW0A 3ERCA 3KXPA 4QLBA 2LXNA 2O3JA 5EE0A 4KOEC 4NARA 5IH7A 1X6VA 2WI8A 3KPJA 1IAVA 4KBFA 3FOFC 2FSUA 2IOHA 1SBTA 3KLNA 3O95A 4BNFA 2UUCB 2C8VA 5D3KA 4YB8A 1E2NA 421PA 1WXFA 1TU3A 1L5HB 2VZEA 3C3MA 3GFBA 3ICWA 2DR3A 4GKAA 4PTYA 1T29A 3KJQA 3PUYA 3F7MA 1C4OA 5H80A 1G8PA 5JMPA 2D54A 3CSSA 3KPVA 1GG2A 4KXXA 3RK0A 4F8EA 2O5RA 4LRYA 5BNTA 1ZJYA 5TGTA 1IK4A 2NV2B 3RUIA 1CYEA 1D8TA 2HX1A 5F1YA 3T3MB 4CLHA 2A9KA 3AJEA 1HTTA 1DX9A 2G82A 1ZIYA 4MHOA 3BL6A 3MW8A 5DNAA 1KZHA 1CCWA 2Z4SA 4JT4A 4EFKA 1J99A 4Z3KA 5C5CA 2NTNA 2YJ6A 3ECAA 2YWEA 3WYNA 3DPUA 1N9GB 3VR5H 4WDRA 3KD2A 5JVDB 2YJGA 1BOOA 1WMSA 4FSDA 2RGGA 4G07A 2UKDA 4LTDA 3N74A 4LYDA 3DT9A 5D87A 1I2ZA 4FC7A 3K6SA 4EY3A 3CEPB 3FVTA 4YO8A 3VR6A 3Q9NA 4U8GA 4IIJB 3GRKA 3RYFB 4HAXA 4KEAA 4E5DA 4BBJA 5EVCA 3U3OA 4GD3Q 3VVMA 3WHPA 3HXQA 1AQ6A 3FBGA 3PNOA 3J81A 1IHXA 1U8AA 2BGNA 4OP1A 2WLTA 1QU2A 2VHEA 2WAOA 2Z2IA 5JYDA 4DILA 1NW3A 2D0PB 3BRSA 3FWHA 3NKLA 4K9LA 1KL7A 4R8KA 4LF5B 3T7SA 4IFBA 3W2FA 4HAIA 4DCTA 3DXXA 2HF2A 3F98A 5LQAA 1U2DA 4XIGS 1DKUA 1VDMA 3KJXA 3H0CA 4O4LF 4RLSA 3WSTA 3OESA 1OH5A 2E85A 1Q7CA 2IX9A 2SKDA 3DO5A 3TIXB 3HK2A 4PG5A 5JAPA 5K0ZA 2I4OA 2GLUA 3LUGA 1SKMA 5DTMA 4OX9B 1IFXA 1P31A 2WKWA 1NJSA 2JKVA 1YSCA 1J6UA 3GLSA 3H3XA 4HNVA 1DJOA 1WUTA 4CLOB 3JQPA 1UBFA 3I9FA 5DRYA 2Q2VA 4GRAA 2HK9A 4DA7A 1YWGO 1D1TA 3DTYA 3MT8A 2C4KA 4MLDA 1U8ZA 2Q41A 3UT0A 3RYCA 2R84A 3O8LA 1HZZA 3DBLB 3MXOA 4JMLA 2C2OA 1K88A 4G0YA 1Q92A 3H4TA 4CLRA 2IFTA 3BSFA 3DS8A 2WW8A 1PE0A 2PKRA 2C7VA 1SUSA 4N5HX 2VNIA 4J3FA 4QPNA 4KYUA 2EJUA 4G4IA 1RWOA 1COZA 2ZXFA 5LL6P 5MF6A 1IOLA 3BORA 1NU8A 1NJ8A 3DL0A 3FRIA 1L1QA 1SXJD 1VXOA 3NBYC 1Y42X 4M49A 3STYA 3N59A 1WETA 3LP6A 2HDNB 4JR0A 3UQYS 1J23A 1UAYA 3R0IA 3FVWA 4GC9A 5TEVA 1QZUA 4M54A 1DOZA 4P4LA 4M1TA 4YXWA 4BNMA 1S3GA 2DPLA 1LBTA 2VPIA 2O1WA 5C35A 4ESVA 1NVEA 4CUKA 5LWQA 4PX5A 2CLMB 1G66A 4F5YA 5B7NA 4MGKR 1ARZA 4DR4B 3TAXA 2VQ3A 2E48A 3A06A 5INTA 3I01A 4ARVA 3F7TA 4E5VA 4F5ZA 3IVRA 4DLZA 3B9RA 1M2KA 1C8BA 1E3DA 3F5FA 2VDRB 1ZK4A 1LPBB 4Q18A 3O8RA 4LMAA 4TV9B 1FVOA 3BC1A 2J87A 3LOUA 3NCHA 4WY8A 2ZUTA 2DBVO 3DA8A 3FPJA 1W0JA 3V1LA 1U31A 3OQJA 2O1EA 4XARA 5EUCA 3T1YB 4ABYA 4D44A 2VT3A 3V32A 2YINC 3BGOS 2IZ7A 3BTVA 1QAQA 3IGFA 4LOJA 2WD7A 4ZV9A 3H13A 4D0SA 2XUIA 3H8SA 1GL3A 1ZGBA 5E7MA 1KAOA 4XSHA 4E6PA 4R41A 4L8GA 4U0KA 2YOGA 5FUVA 2CXPA 4HDKB 1Z34A 2AI2A 3S2GA 3ZWNA 2A9FA 2VF4X 1DC8A 4XUEA 5TMPA 4RAOA 2VK8A 3DEZA 5IEJA 1BE1A 2RGBA 4K03A 4HK4A 1VPEA 4FZ3A 4I9NA 3IR6A 4MYHA 4QDUA 4DC9A 2R4QA 3CUUA 1GV1A 4GP6A 5TQVA 4WCFA 5EIWA 1WHSB 5K4HA 2AD1A 4FFBA 4HEJA 2F1RA 1O96B 1G20E 2Q0HA 4TM8A 4EFMA 1RPTA 5CG2A 1CT9A 3KG2A 3AL0C 4P34A 3CCCA 5LZ4A 3N2NA 4RZUA 2VIIA 3COZA 4UEJA 1BFUA 2H9IA 4QTUB 5U4XA 3PU6A 4YNBA 2A5DA 1AQIA 3RS3A 3UG7A 1NR7A 1IUOA 1IZ9A 3RFTA 3N2LA 5E95A 1G5QA 2I9KA 4L76A 2YC4C 4WLOA 4CR8A 2YXNA 3ASYA 3H2YA 1N6HA 1NJ2A 1AH2A 1T8PA 1XD8A 2B4QA 4PLHA 4NEGA 5THQA 2EWWA 2YDXA 1QH8A 2YS6A 4EYQA 1U2GC 2P4HX 3N6VA 3C97A 1CJVC 3ST7A 3ZN2A 1NR5A 3O4GA 4FWBA 3NJ8A 3OAAA 3QLVC 4QOFA 1KSJA 3W6UA 5BN4A 4V1CI 1LWNA 2Z2JA 2FKAA 3R77A 5T6MA 3SIWA 4YLYA 1BGXT 3PCXA 4II2A 3MGBA 3JZAA 1XDGA 4NPAA 4YECA 3M4ZA 5E4TA 4UTXA 4LBVA 4B6QA 1T2AA 3FPCA 1OBVA 2CVZA 3ME5A 1T2EA 4CTMA 1MUUA 1RQNA 3RNLA 4M0EA 4C2UA 1S2MA 1DBWA 1XI2A 4AZWA 3EAQA 3JSXA 3IPXA 3P2KA 5AKHA 4MUEA 3PFKA 4ND2A 3NATA 3CUWA 3NXSA 5T8KC 3Q3JB 1XZKA 1UUFA 2YWXA 4I9HA 4U02A 3RIEA 3HCNA 1U4SA 1KMHB 4U7PB 1IOZA 2C5SA 5FIUA 5TMEA 1QQAA 1CJSA 5DLYA 4OXKA 2DSTA 2A5GA 2V3WA 1XU9A 2FKNA 3W6OA 2XQGA 1J5PA 1YCFA 3DMNA 2IPMA 5DH9A 4BFCA 1NUPA 2F8MA 2QW0X 1R0XA 4EITA 4EHLA 2NO1A 4RA6B 4E5KA 1FDIA 1K98A 4DARA 4TX1A 3MJVA 3WIDA 1Y81A 4AG6A 4DGQA 3V4PB 3MSXA 2QN1A 1GNQA 1MMFB 1L5KA 4E2ZA 1WQ1R 2Q21A 4FQ7A 1R88A 5J4LA 4DWWA 2P5UA 1MH1A 4QRIA 1W48A 3AEXA 5I9TA 1VDZA 5EIEA 4A16A 1NW4A 5CDTA 5L51A 4EG0A 2NNWB 1R6VA 1S2NA 2WSMA 3I9V6 2JI4A 2V0GA 4NU0A 1GAWA 1N5IA 1DC3A 3P8ZA 5CB4F 2PL9A 3U0VA 2HA3A 3ZZUA 1RQPA 1USWA 1ZY2A 2CNOA 3BJRA 3QW2A 3EOZA 5BN3B 4U7DA 5C8YF 2FEPA 2IOQA 3N05A 1XZPA 4OYHA 2PZ8A 2JLBA 3PC8A 4BEBA 4NZPA 3AHGA 2HT6A 4HZUB 4BLQA 1X1QA 2YFKA 4BFVA 1VJ0A 3DAYA 2RGCA 4KNVA 1FSSA 1UCFA 4Q19A 3VA7A 4JDPA 3A0UA 3T9FA 1PR2A 1KXJA 3H99A 2K7FA 1CIVA 2WMYA 4GE0A 2MHCA 5IPFA 2XQJA 4RY9A 5KOHB 1TVKA 1CQIB 3DMYA 4KBYA 5HF9A 2OUKA 1EBBA 4C6TA 1MN6A 4GI5A 1JYFA 1LSOA 2BGLA 2V4UA 1QRDA 4RIGA 4UE2A 4EABA 1D5CA 2ATIA 3EUEA 1YAHA 4ZO6A 4ANFA 5IRCD 1WP4A 3T95A 4E46A 1YCHA 3AEYA 5B58T 3B1XA 3M6FA 1NSYA 3RS9A 2JBWA 1J9ZA 4JLJA 2VJQA 4JLBA 3IUPA 1MR3F 2PKWA 1GTG1 2N47A 3CKLA 1B0PA 1NVAA 3P71T 1TKAA 5TVGA 3GT4A 4FVTA 1US8B 2J59A 2ZG6A 4L8YA 1Q7GA 1AZTA 2JLUA 4F3KA 1FTWA 3MMNA 2I2AA 2X0NA 2D2EA 2ZRCA 5M3BA 4BKOA 3FHOA 2FY8A 1KDZA 1DQSA 2M6LA 3TJMA 4HZIA 4QYXA 3OQ6A 4WZBA 1GNTA 5IDVA 3RS2A 4CN9A 4Q82A 5TNXA 4YUWA 1G7CA 4FGKA 3A70A 4DPMA 4DIBA 3INTA 3OF5A 1HE4A 3ND8A 2RONA 3MGGA 3GHHA 5GM1A 4ZV7A 2O8DA 3I39X 2HGZA 4RC9A 5ALQA 1CS0A 1KH2A 1W46A 2HJHA 3NWOA 3PE3A 5BMVB 1IN8A 4FZRA 5TJHA 4GR5A 4BMPB 4ZI7A 1SQ5A 2ZRLA 4NU8X 4F4IA 4RJKA 5DIZA 2IH5A 1VJCA 4MV0A 3P9QA 4P2BA 4G86A 3IPRA 2GH1A 3AVUA 1WSBA 3OHSX 1QJCA 4NECA 5BR1A 1NXVA 2Y99A 1ST3A 2DCMA 2QT1A 5I9SA 4BV8A 3CR7A 1DAIA 1NL3A 1T4GA 3FCYA 4DYDA 1T4BA 3LCJA 1ZMBA 5IUNC 1Z5WA 5HYVA 2BGMA 4RE6A 1PR3A 3IERA 4FW9A 3QQ5A 1IBKB 1GKKA 1GVNB 2FHSA 3ANYB 3I83A 2DE0X 3C3YA 1KZ7B 2ZJZA 4Y1EA 3NI2A 3RU3A 1E0SA 3B2NA 2W2KA 3K96A 1SQ6A 2GLXA 2P65A 2PWAA 3A14A 4GOND 4YO7A 3HCRA 4ZYXA 2VJCA 4CMEA 3KJIA 4BFTA 1V16B 1GQQA 1DTSA 2PSHA 1FU7A 1LDYA 1UBKS 5IASA 2G76A 1FMCA 1JYEA 5FH9A 4HQNA 1E0KA 2H7YA 1OBCA 1QLWA 4JEUA 3JQ8A 5KHLB 2WB2A 1EGAA 3M5DA 3QYJA 4N0DA 4IJMA 4CMEC 2IXTA 2IX3A 1U1FA 3CVJA 3GJRA 3LUPA 3F6RA 1PJ3A 2EX4A 2HUPA 2JJ2D 3A26A 2G1JA 4YRTA 4AKHA 3CJRA 5JHGB 2EKQA 3L41A 4RJJA 3U7JA 1C50A 4E3ZA 3K32A 4HWRA 1Y89A 1JX6A 3ZNQA 3QBVA 1KU0A 5FWXA 1N1GA 1GKUB 1NVXQ 5G53C 4E1VA 2BMJA 3H3FA 3J80A 3A6HA 4EPRA 3LT4A 1Q19A 2GYUA 2XDQA 4I4TA 3VVLA 4QDOA 3F9CA 1IBLB 1TMGE 1CUIA 4AJHA 2J0VA 2GPJA 1KY2A 3FF4A 1GYRA 3IELA 1JHZA 1X19A 4IJVA 2P41A 1BEUB 3AJ9A 1PQ4A 4JLOA 5FBQB 3RVSA 3LSTA 2AJDA 3IQHX 2B9VA 3IPYA 3K09A 3W5AA 3E3NA 3PX7A 1ZH0A 3LUKA 2AYYA 1KJIA 4RNCA 4XFJA 1RWXA 1DKLA 5A5VA 2EG5A 3OIGA 1LPMA 3ZZMA 1FFEA 1YKSA 2XE7A 3O94A 3V00A 4DSTA 3O3CA 2GETA 5FPTA 5IKOA 1PT9A 5EJAA 4ZAXA 2AV6A 4HTFB 5A04A 1TF5A 1G1AA 3GK3A 2GRUA 1NRJB 2O7QA 3BMNB 3P45A 1OT3A 2GDZA 3IEIA 1PS9A 2YXPX 3C7AA 3KLPX 2CYBA 1GPUA 3KV1A 4OD0A 1CNEA 3B6ZA 4UNIA 3IHTA 1S7GA 2GZDA 2NXWA 7ABPA 1SIOA 3E1SA 4JYZA 3FUVA 4BAUA 4UAUA 4NBWA 5KYKA 1K27A 1U7DA 5B37A 3KS9A 4RQTA 2E2WA 5IC6A 4RACA 3IOMA 3OT1B 5AI6A 3UHOA 2ATXA 3RI3A 3CVOA 3FOWA 3DMTC 1UPBA 4L6CA 5DK6A 5B6PA 3NT2A 1B8PA 1VP3A 1IATA 1RWPA 1YFKA 1CUXA 4HH3C 2JRCA 1AKEA 1KK1A 2FZ5A 4QYIA 5FNVF 2R2AA 5IAOA 2Q8PA 4KAJA 4NBTA 1M6EX 3KL2A 4X6XA 4Y1RB 3ZDXB 2ZUEA 3WICA 3HU3A 4Y9TA 3PEUA 1RZRD 1RJWA 4KXYA 4EW6A 2C61A 1S0UA 1IWBB 2PFKA 3BFVA 4L75A 4BQPA 3E9RA 3A6ZA 4HH4A 4HQ6A 2ENWA 6REQB 3PKIA 3UWPA 4LJSA 2Z5GA 1BNCA 3GJ4A 1AZWA 3IOEA 3ZWAA 3G5TA 1VHDA 1OBHA 3FKJA 3RSSA 4OQLA 4B7ZA 4DMLA 3KXIA 5IDXA 2VWQA 3S81A 1TVEA 4YPOA 4Y6RA 2VP3A 3ICOA 4MNTA 3TAUA 3R6WA 2ZB4A 3WG9A 2RKWA 3FVQA 3RSFA 4IICA 2W58A 4ZAZA 1K0UA 2P0YA 3LKDA 4G5QA 4DEVA 1VI6A 4NZ9A 4F5WA 5JSUA 4W5HA 3SZGA 3B1FA 3LIPA 2QVZX 4M86A 1KJNA 3HJTA 3GZ4A 2IYLD 2R1UA 5LA6A 3IDZA 4V3BA 1T2CA 3CF2A 2FR0A 2FGJA 2ISQA 4CF4A 5AUNB 4R1OA 2AEJA 3O0TA 4K1XA 4GKKB 2FSGA 4JVOA 1KF0A 1P0FA 3SGLA 1DJQA 3M3DA 2VJMA 4NONA 2PIDA 4M98A 1KP2A 3ZDQA 2EDCA 4F93B 1H05A 3A4VA 4BP1A 1L5LA 2BHRA 1IPHA 1NJGA 3FTDA 1NTOA 4Q1VA 1ZL2A 4AJIA 3ANNA 1R15A 3CQ9A 3U3KA 4FB5A 4DFDA 2HGSA 2TMDA 3RAGA 1NY5A 1UWVA 2CZGA 1NN1A 3EB9A 3FZEA 5C7YA 3OUUA 4EDHA 5EG5A 2XUAA 4XEUA 3RPEA 1XVUA 4OJQA 1L5ZA 1UBGA 3N39C 1PGQA 1XTUA 4QXQA 1IQUA 1T1SA 2X8WA 4F9FA 1FQKA 5CW2A 2PX0A 3GP3A 4BUJA 4GOJA 3WK8A 4D6XA 4EPXA 4UQOA 2AFVA 1DQZA 1E4EA 3CZRA 1YFJA 4U7GA 1B26A 5A6SB 4CU5A 5JDCC 4CKZA 1Z2NX 2EZ8A 2JI6A 3CLTC 4DZRA 2YFQA 4Y2YA 5AM4A 3KXDA 2GN0A 3MUEA 1LQ2A 1DLIA 5DK4A 1QIIA 2HWXA 2VT2A 2QUZA 4TQ9A 1ISJA 1SR8A 3RJ5A 3UNXA 4XTRA 1V3TA 2ZQZA 3G02A 4D46A 1LK7A 1O9BA 5KNCH 2D1YA 4AIIA 3N8IA 4JR1A 4KP7A 2ZSIA 4TN5A 1DQYA 1U1DA 1OT5A 2BHTA 5JNLA 1TOAA 2IYOA 2WWGA 3PQ4A 3E0XA 2IWHA 5LSAA 2H48A 2J5BA 2EF1A 3CF6R 3DTVD 3P9CA 2F9MA 4LJLA 1WULS 3BWVA 3KQQA 1FS5A 2IF2A 4ZVUA 3T4EA 4EGSA 5EIBD 5AMXA 3VTFA 4UXJA 3VPFA 3HYTA 4GLFA 1CSEE 2PKYX 1A9SA 1H0SA 2HAEA 2WSIA 3DM5A 4MW5A 5F2KA 4RELA 4CODB 3RS5A 1WSWA 4WNYA 1Y48E 4JMPA 1MVNA 1V71A 4ERNA 1H1LB 2I55A 5A6SA 2AMLA 3B13B 2X8BA 2C7PA 2DBQA 3OWXA 1H42A 2D74A 4J7UA 3ESQA 2I1WA 2WFLA 1ODIA 1LTHR 2G07A 4XJVA 5CTJA 5DPMA 2ONJA 4EUKA 1O6BA 4F4UA 4WKBA 4PLPA 5SYAA 1RT9A 3KTFA 2NUAA 4BB5A 3JWEA 3F5DA 2ZAIA 5C1BA 4G1BA 4LBYA 1BC5A 1UQUA 3U7EB 2CJXA 4UC0A 3Q12A 4IGFA 5COBA 1E6LA 3DE4X 4TYMA 5LZ8A 1S89A 1KKMA 4EYOA 5DNWA 3UMMA 4IZIA 2GKGA 3SJBA 3JALA 1Z62A 2IXBA 1L6IA 1RC1A 1T0HB 2FB9A 2OXEA 2WWWA 2BFBB 2H0QA 2D6FA 3K9HA 1O4WA 4F8JA 3SKXA 4LGMA 3E9QA 4W63A 2GK6A 4BLTA 5DDIP 5DO9A 4KJZA 4B4UA 1ADGA 4GLOA 1WOMA 1FX0B 3ETLA 1KFEB 1G7RA 2A7XA 2BN4A 2NZXA 1EX7A 3PGA1 4R2KA 1T0UA 2V7EA 3VO9A 3CO0S 3K4QA 1RYHA 2AR0A 3MYYA 2Z58A 4OXRA 4DPKA 1PHPA 2XZOA 4J49A 1YGPA 2BWJA 1JR3A 3CNEA 1JNXX 5ER6A 3WZLA 2CLDX 1ADFA 4Y2RA 3HCDA 5HQ3B 1X94A 4C7MA 1N2OA 2AOXA 2PX5A 4PG7A 3R8FA 3IUBA 4M9UA 3DAPA 1FDUA 1JVBA 1TYCA 2Q6OA 5MFPA 1ZJWA 5ALLA 2IHKA 1U0HC 3E4CA 1MOQA 2WC1A 1VPLA 4DV1B 4GZ3A 4Z0HO 2CUNA 2QZSA 4HDNA 1FJ2A 1Y9JA 2H8GA 2ZKLA 3LHFA 4LSMA 4LX8A 4P3PA 2VHUA 1Z56C 4XYEA 3RF6A 3CPSA 5LP6B 2FR8A 5CVVA 5BQ5A 3G85A 5KTPA 1X1RA 2SCUA 2NU7A 3T4PA 1NVVR 2F43B 3OKAA 3W4KA 2CL6X 1I3OA 1KC1A 2FW9A 4BVJA 1EINA 1AQYA 2IKQA 2PMCA 3DDCA 3W2GA 2O2SA 5H3CA 1BEEA 4U7FA 1WXIA 3FOAA 3KV3O 5K3OA 3JQCA 1HGXA 4OHPA 3ZS9A 3MD0A 3PR2B 1I4WA 3UFXB 4MS3B 4OUKX 1B6TA 5E6SA 1LVUA 3HNRA 2OUIA 5DM2A 4QOHA 4CM9A 2XWSA 3VZCA 1SZJG 3ZTYA 4A0QA 4AXXA 1C0KA 3BIFA 2YTZA 3KBOA 5DTRA 4BZWA 5A9SA 3O4JA 1HDOA 1ISSA 2UYGA 3OQPA 3FSGA 2OE2A 3IAS6 4C14A 4M53A 2YWFA 2HK6A 1R66A 5AKKA 3CF4A 3V5NA 4A2PA 1EFPB 5HS4A 3BSYA 3V4SA 1M2OA 1UEXC 1SGWA 2ESRA 3MQFA 1VYHA 3ICPA 2Y6UA 4X24A 2V96A 2GZSA 5F33A 4EAQA 4G5RA 1E6EA 3CIOA 3BDVA 2IW3A 3NLLA 1OSNA 3FN4A 3S99A 4F6RB 2GNOA 5BMVA 5JCXA 5LOVA 4RQUA 3PXEA 5KPJA 1TU0A 2X3UA 3FHTA 4GQBA 1YTLA 3EAFA 4JOSA 2RHGB 4IDFA 3HWSA 5ICSA 2OGWA 5EWLB 5GM2A 1KVSA 4RQAA 2JIBA 3KVYA 1DC7A 3ZI7A 1FDWA 4IY1A 3NDBB 1N7HA 3E5MA 4MHSA 1JPVA 4DWOA 2GBCA 3JQAA 4HH0A 3D9QX 1KC3A 4M9QA 1KSFX 3CT4A 3AESB 1NQAO 1E9VA 2YZ7A 4CPDA 1NZJA 1TCCA 2C59A 1YS1X 1JEEA 1GQ2A 2Y1GA 3EDQA 3WDSA 3ZWMA 3V4LA 5HRUA 2N0SA 3KZOA 3B6JA 4ZEVA 1FYEA 2XMDA 2O8FA 2CZQA 2GQ0A 1L7QA 1T6YA 2I8CA 1FIUA 1X7XA 2FLWA 1BQ4A 1KERA 4Y2UA 3AK4A 1IH8A 2BSAA 5EVJA 5CDFA 4WNAB 5GIOE 3F71A 4IMJB 4CMGA 1KOFA 1XTZA 1Q3TA 3TLBA 2K2WA 3S2IA 4V2IA 1LLCA 5IVHA 4UUPA 4GEGA 5JQGB 3VNVA 1N4DA 2YICA 3C6YA 2I6XA 3CB2A 3SDSA 3WGYA 2G77B 1Y3IA 1ZUIA 1H93A 5CGQB 2PN1A 5D51S 1JH9A 1CR4A 1H8HD 3GUYA 4P54A 4EA8A 2JGKA 1KORA 2HHCA 3C7DB 1RFGE 3G5MA 4FMCF 4LNUA 2G9NA 2CNLA 3ZC3A 2GKOA 5BWCA 3STHA 4N7BA 3CY6A 4FEEA 2XCTB 2VDPB 2O23A 3OF3A 4OU5A 3THYB 1U0LA 5F7ZA 1GR0A 3GFQA 1Q17A 3I04M 4DDWA 1QLHA 2AN5A 4JI8B 1ZNYA 1U28C 5DBGA 3H1BA 1QU3A 2D7JA 1ZITA 2HHAA 3A58B 3D4OA 3LLCA 4BC0A 1F0NA 3RHFA 2P2YA 4L7VA 1I6WA 2D1FA 2OV6A 4UJ5A 3WIOA 2IUYA 2OECA 4PWZA 1HOXA 2J7PA 3VZSA 3L6DA 1VE6A 4ZTUB 1U28A 3OTOB 2VHZA 3IODA 1Z73A 1DKRA 2V6MA 2HRRA 4NBNA 5ARDA 2Q27A 5BYAA 4YFVA 3ELBA 3PFGA 2QIPA 2PGOA 1C9JA 3QWFA 4O6VA 1R27A 1Z0ZA 4YMHA 1OWPA 1AX9A 2VP9A 2AFHE 2GD6A 4BKMA 4CKCB 2F64A 4C0KA 3GFPA 1QHFA 4ZVSA 3TI7A 3AR2A 4X1IA 2JH8A 1U3DA 2PWBA 2RHHA 2WZQA 4L16A 3MMPA 3JD1A 4PFQA 1NQUA 2NSJA 4TPKA 2J3DA 1U7HA 2FUG6 2NX2A 2Z3VA 8ABPA 4Q1EA 5LNK6 3DR3A 1ZG3A 1VJ5A 4QLAA 1DCTA 3DULA 4J16A 1IUKA 4XSGA 1PNQA 5JPIA 1P4SA 1PIWA 3NRCA 2NZ2A 5J63A 2J0QA 2Q50A 2AC4A 4JJGA 1HWYA 2X2EA 4NJEA 1J8VA 2NAPA 1TIPA 2KI5A 1N0HA 3LG2A 4M1OA 5BRNA 4CNQA 3IAHA 2GLTA 4GPTA 1HE1C 1WXGA 2XD9A 2SNIE 4NLLA 5B1SA 3I12A 1E2MA 4H3HB 4IIYA 2VEDA 3K20A 2I7DA 4FNOA 2V1XA 4NCNA 3DHWC 4PVCA 1F3LA 3I1FA 1SXJC 4NR0A 4S1PA 3UK6A 3WB9A 4AWBA 5AJWA 4F04A 1AGXA 1IDOA 1UC5B 3V7FA 3DQZA 3O47A 3P0FA 4RZ3A 1NUAA 2DQKA 2J3LA 1D04A 4F21A 4F4JA 5JUWA 2H00A 1E5TA 4FILA 5LZ9A 2W6MA 5IHXA 5JWOA 2PBFA 3GLIA 4PLFA 3C74A 3B38A 5JCPA 3TLXA 1QO9A 2PH3A 3H8JA 3YASA 5JS1A 3EGDA 3H9EO 2J46A 5LCXA 3K0KA 1F5NA 1QYXA 1U90A 4BNVA 4HCJA 1JP7A 5KOIA 3JYNA 4X61A 3DBLA 4H6XA 1XZQA 2BIFA 3PQ6A 5T64A 1G5TA 2B83A 1BXZA 1LK5A 2UZ4A 2FEXA 2Q5FA 3M4JA 1G5FA 1XA0A 5D00A 2YFYA 3OZUA 5I3CA 3L7MA 3WYFA 4MQBA 1JJIA 2EP5A 1ZC3A 3ZUGA 2IZ0A 4NF2A 3DH0A 5CNJA 1CUFA 4BXOA 3HR7A 1QC5A 4JLDA 3LF1A 5B2FA 3LBYA 3HN6A 2I80A 2JJYA 3PXBA 1SD1A 1G8GA 3R5KA 3AL2A 1WQ4A 2Q99A 3L7NA 4QDZA 3ZY4A 5A0VA 5F9FA 3PTAA 1KQNA 4A6XA 4KQCA 3BE4A 5LN1A 4NQRA 2AWOA 2PWPA 3R3UA 5F51A 3UJ8A 1WXQA 3TZKA 1EJ0A 4ZYVA 1UZUA 1XTSA 4PPFA 3JQAD 4XOUA 4YUAA 4BVFA 2X8LA 5FL7A 1INLA 4IXWA 4CCWA 3PDWA 3EQ6A 1G59A 2QQGA 4U6SA 5HF5A 2EIHA 2CNNA 4IO1A 2VNKA 3D0RA 5HQJA 2PV0A 4N5LA 1L1RA 2GTHA 4C0WA 2YN0A 3QUSA 4QG3A 3GG9A 4NBKA 5JVDF 6ABPA 3V1UA 3L4JA 4D4IA 2GN1A 4CHTA 3AR7A 1F7VA 1NXTA 5I3ZA 3EVGA 3T0IA 1ZJ6A 2B3TA 1N1DA 1QFYA 4URWR 2FPIA 3G2JA 4P53A 4BPBA 5BPFA 1W93A 2DFNA 2H7XA 3GQVA 2ODAA 4JFRA 5LP6C 4DIEA 1QGAA 4JKIA 3V48A 1L1FA 4EKIA 1W36D 5FA6A 1VMKA 4NJMB 4MRNA 5KX5A 3EGXB 3AI3A 3ACBA 2Q28A 2HZBA 3D8HA 3DGEC 3FB1A 4XD7A 1UDCA 1W5AA 3B9BA 3DEYX 4KQKA 5LUBA 1XTVA 2ZBEA 1V37A 3FYUC 4BN4A 3FIJA 2BPOA 2P2NA 1I36A 1SU8A 3D1JA 4V02A 4B4KA 3ANTA 5CLLA 2VYVA 5EZSA 3VGPA 1G3RA 1L5YA 3ZE0B 5KU1A 1HNWB 1HLFA 2N1BA 4HF7A 4NFYA 4RK6A 1CZHA 2C20A 3NIDB 3QHQA 4LE1A 2BBSA 4CQJA 4UQLA 4KLNA 3UHPA 1LCIA 2XTMA 1Y3CE 3GJ6A 4C5CA 1SCNE 2Q4DA 4IOMA 4F9EA 1V3VA 4YCSA 1H4QA 2AEMA 2LCIA 3KLBA 3DE2X 5LU9A 2FXIA 2N75A 3DKRA 1EB8A 5JZVA 4IIXA 4UUNA 4LXIA 2YNMD 5DX8A 1K08A 1JFRA 4RPLA 1TD1A 2J30A 4WL0A 3WJ7A 5IAAA 1E6MA 1Z33A 3BQMB 1CFZA 5AW5A 4CW7A 1K7SN 1WMBA 3EW7A 3OLYA 4NX2A 2YMPA 3T41A 2FW0A 1XHLA 3FYUB 3M6MD 4OGWA 5ED4A 3U4IA 2FZ4A 3BDIA 3N2ZB 1YS2X 1ABEA 1JT9A 1QR6A 1VJRA 1ZIDA 5AM1A 4NJMA 3W4IA 1OAOA 3JALB 2QXTA 1O94D 1VJDA 3WV5A 2TECE 2PANA 4FP9A 3X43A 3EEQA 2ZJ1A 3QKWA 3FFBA 3ODGA 2X40A 5J43A 4UD2A 1CQJA 1KVRA 2ZJ3A 4BNJA 4BVLA 4MMZB 4Q6BA 3CNOA 4EVSA 3KKQA 1W2HA 3LE8A 5CLGA 4DMMA 2DC1A 4IF6A 3U80A 4EEZA 2HA0A 3DP7A 1S1MA 2HQOA 1XEWX 3NGLA 4LHWA 4ZZ2A 5KOJA 2OZLB 5K20A 1H6BA 5IMBA 2EQBA 4H7DA 4QFBA 2A9RA 1DO8A 2BHNA 5JD6A 2I65A 2JHGA 2XZPA 3EXG2 3QXHA 3KQHA 3INYA 3KYCB 3KSUA 2PTHA 3BGVA 3ZV4A 5IEBA 1J2YA 4GXNA 2BGJA 3ZGVA 2W6IA 3LU1A 3NETA 5C5DA 2WKRA 2CV1A 3FFXA 3MJRA 4J0HA 5I7VA 1G0OA 2IHNA 3RO7A 4M9RA 1OPXA 1A7UA 1UKEA 2OCKA 2RB5A 3URKA 5JFOA 4G0VA 3AIMA 5BV1A 3WGKA 3DOFA 2RGWA 1U1EA 4R2XA 2WOJA 2ZRIA 1NT2A 1XAHA 4AQYB 1TI7A 2XYQA 4AG5A 1GTVA 1WV0A 3VHQA 1K4YA 1CQIA 4C7VA 1YUMA 1U3WA 5JV5A 1I1NA 1GTJ1 3A9SA 3QE3A 5EPUA 4X85A 1S3IA 2FFQA 1RRFA 2QYTA 3GQBA 3LCMA 1J2TA 1NMEA 1F2DA 1G6Q1 2PYZA 2Q3JA 1T13A 1SIUA 3RBAA 4AN1A 1CQWA 4DJTA 3MWEB 3C87A 5DCLA 4NRDA 2BDTA 4C0XA 3DAOA 4JQYA 1D2HA 1ORDA 2EVWX 4RLHA 4ZYLA 3O5AA 2Z43A 2HJ9A 1L8QA 2OEPA 2WTBA 3UW3A 3VV2A 3THWB 1V43A 3GIWA 3ENWA 3PFHA 1KAMA 1SHZA 3PHBE 4UATA 4ON9A 5FNZA 5JXWA 1DBIA 3I9NA 4S12A 1ONOA 3GRPA 4OQZA 1GGFA 2C04A 3MGKA 4PZCA 3P32A 2CV2A 5ECDA 3OOEA 3AU8A 3AEUB 1TT5A 3OSUA 4J91A 3I3SR 4JBNA 3TJZA 4MWBA 4WXYB 5EWMA 3JATB 4TS1A 4EKGA 3AF3A 3IT3A 1CUBA 1P9LA 2WG0A 1IVYA 1E79A 2Y92A 3UYLA 1OREA 2IS1A 4IP0A 3HWWA 3R40A 1A9YA 1JXAA 4K2AA 4MA4A 2PZFA 2YV4A 2QM3A 2VK4A 5JARA 1H2WA 4P35A 3KSZO 1JKMA 4CTOA 3C4QA 2ANCA 2HH9A 3MJ4A 1TQ4A 3I8XA 1JDTA 3QP9A 3TSYA 3PWKA 4CIAA 4M1WA 2IODA 1QTIA 1T5TA 3PVSA 4QT4A 5ABPA 1A5AB 1E3WB 3GA5A 1L0BA 2F4VB 3VR1A 2AUTA 1HQKA 5K3BA 1VMIA 4YQZA 1CZUA 4L95C 3T5AA 3HXLA 4R8RA 4AQ7A 2ROQA 1P7PA 4TQUS 5IVPA 3BXGA 4MRMA 3F3YA 1PL7A 1DFGA 5DM1A 2J5QA 1JQKA 5B4TA 2W2VA 5A03A 4KTVE 2OB1A 4AJKA 1TUBA 3GRRA 1JDBB 3SIXA 5G1OA 1Z5UA 2VT7A 3DDZX 3SOZA 4KFUA 4M8SA 3SHTA 4AWAA 3DOEA 2PRYA 3VPBA 3RREA 1Z9BA 4H9GA 4YCDA 1CZRA 4E7OA 3GRVA 5J5AA 3WSVA 2YKGA 4LC9A 4NYMQ 4C4YA 2JFNA 3AIOA 3ZKAA 4GC5A 3T1QA 1Q0ZA 3ZDYB 4RS4A 2A33A 4FI3C 2BH9A 1GNSA 3K9GA 5HBGA 4B73A 3UJNA 1HQYE 1BDMA 1A9RA 1KEUA 3SSMA 1WZUA 3FNIA 1P8JA 1OJLA 4FYVA 4KPUA 2P8JA 2VK1A 4CKBA 3LUCA 4D9NA 2DUJA 9GPBA 5EXTA 1K8XB 4N40A 4LIPD 1SC4A 2ZTHA 1E2LA 2H5LA 5AUQA 3F0TA 4K6KA 3G7UA 3GROA 4KQ9A 1CK4A 3ZWVA 3EQ9A 1ELOA 1WCYA 4EX6A 4ZCRA 2BFEB 1ESEA 5KYXB 3G0DA 3K73O 5H70A 4IZHA 3D4IA 3I2IA 4BLSA 1ZPDA 1W5FA 3RU2A 3ZHQA 1XZGA 1NBME 4QPPA 2GDJA 1C14A 1NM5C 3I6BA 3MWGA 1H6CA 3QVGB 4AY6A 3ANXA 2NWQA 1XZ8A 3P97A 2A88A 3SFTA 1PV2A 1Z7WA 2Y67A 4NDZA 4NS4A 4RHTA 4C3ZA 2I4NA 5LKRA 3W3AD 1KNXA 4KGDA 3ROMA 1RPZA 4AJEA 2O5EA 3LCCA 2QRGA 1FTYA 5AJYA 4UZFA 1FLVA 3BH6A 2C7RA 4ENRA 1ZMRA 1NHGA 3S2YA 4ZOCA 4DQLA 4O4JF 2O0KA 2ZI7A 1ND6A 1C1YA 3HY6A 5I8WA 1T6XA 3SC2B 8ATCA 2PSSA 3OZGA 4HB4A 5KTYA 2AOTA 2H0AA 2C4VA 1CP2A 2YW2A 3CZMA 3KZXA 4ZOLA 1S8OA 2HRQA 5EP2A 2RC5A 1TO1E 1Z35A 2HMSA 2WJYA 2FVXA 5FOVA 3RUPA 2Q4EA 2VQ6A 4QUAA 1YQQA 2IEYA 1J1ZA 2AS0A 3LPMA 3LWBA 2ZJYA 2ZJOA 4LEIA 3ZGNA 2I6TA 4XKJA 2XNSA 3IP1A 4A4DA 4A10A 3KZCA 3FOCA 4FLEA 4GOKA 4OVKA 1WMFA 3S68A 3FVRA 1S4QA 2ZVQX 1OZAA 1PQWA 1VFNA 2PQ0A 1R50A 3UXMA 4L2IB 5B5SA 4NP6A 2WJHA 1K92A 4S1WA 3LRPA 5KB3A 2IC5A 5E3IA 2IHZA 2KW5A 3PFFA 4QXOA 3WV4A 5HCNA 2XTAA 4Y1RA 3X3HA 2VQFB 4KNYA 4X7RA 4Q1CA 2VF8A 3SM9A 2VBFA 4MICA 5L53A 1Y4DE 1K8ZB 3UANA 4RPHA 3NIFB 1L7RA 3GELA 1UDRA 4G56A 4YBZA 4QGFA 1EZ1A 3I2GA 3RIYA 3GT7A 2QJRA 3RB8A 4BMCA 2OQVA 2ERXA 3AFMA 4Q1BA 4LVNA 1Y5IA 5AIAA 4KQ2A 2Q3FA 3A36A 3MB5A 4PSVA 4BYGA 4F2GA 4L4XA 1KEEA 2ZB8A 2ZXUA 3N0RA 4JJZA 1JA1A 5C3MA 2X8JB 3JPWA 2YN2A 5HW0A 4FGWA 4ZI7B 4FEYA 3SX2A 1BOFA 1ECLA 5C46F 3OM9A 2AN9A 2OSVA 4Q1DA 3VU9A 3WDMA 5A3QA 3FPKA 2IPAB 2P2CA 4X6YA 1KJ8A