4MQ4A

Crystal structure of hpnmt in complex with bisubstrate inhibitor n-(3-((((2s,3s,4r,5r)-5-(6-amino-9h-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-yl)methyl)thio)propyl)-1,2,3,4-tetrahydroisoquinoline-3-carboxamide
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
264
structure length
264
Chain Sequence
APGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title To be Published
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 97
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2013-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4mq4A00
3NWBA 3AWIA 1V39A 3KQTA 2ZTHA 3TOSA 1RJDA 1VQ1A 5U4XA 3R24A 4ER7A 1NW3A 4RTOA 1EJ6A 3PS9A 3GNLA 4GC5A 3CBGA 4DCMA 5DRTA 3G2OA 2FK8A 2XVMA 3I64A 4IV8A 4R6WA 5KYGA 2IBSA 2HWKA 2UYQA 3CKKA 3VYWA 1AV6A 3B3FA 3LCUA 5GIPE 5EKXA 4GOND 3E8SA 5BP7A 3DTNA 1DUSA 3E05A 1D2CA 4QPNA 4X61A 2GAFA 2P8JA 1O9HA 4U7PB 5DTMA 2VS1A 5EMKA 1MJFA 1VE3A 5E1DA 3THRA 3HVJA 3GIWA 1O9GA 2YXLA 3H2BA 5G02A 2YR0A 2AOTB 3FPEA 3DUWA 3GGDA 1EQAA 1KYZA 1KP9A 2DPMA 2VP3A 3BGIA 1RJFA 5ICEA 5CD1A 4DA4A 3CCFA 5DPMA 2IDJA 3OU6A 1WS6A 3TR6A 4AUKA 2HTEA 5DTQA 3EVGA 5E2AA 5C9ZA 3OFKA 4GQBA 2ERCA 2ZW9A 4PYJA 4C03A 4PYKA 1KPHA 4PINA 4DQ0A 1XJ5A 2Y1WA 5K0CA 3MCZA 1RI2A 3OE4A 2IDKA 5ERGB 1ORHA 2IP2A 2PJDA 3FYCA 4HTFB 2AOUB 3S68A 4AZVA 4R05A 4E2WA 1PRYA 3DMFA 5HIKA 5LQRA 5P8WA 1XXLA 2P41A 5E1MA 1YZ3A 5K0GA 3GRRA 5C1IA 3SGLA 2I7CA 2P7HA 2JHAA 2P3OA 1KHHA 3AJDA 1YFLA 3PB3A 2XVAA 4QDJA 5DM4A 1SVUA 1F3LA 2YQZA 4GOOD 2CL5A 3P2EA 5DM2A 4RVHA 2GLUA 4PYNA 5GIOE 3DMGA 5EIWA 3A25A 3NVKI 4PCAA 3UA4A 5DXJA 2UYHA 3R6TA 5LSAA 4FR0A 3THSA 2ZIGA 3RODA 2B9EA 4CWAA 3DH0A 1JQDA 3ME5A 5D1NA 4RTMA 5CVVA 5CIYA 1IM8A 1PJZA 3OZSA 5FQOA 2PX5A 5EZQA 3E7PA 4AZWA 4QDKA 3LCCA 3CJRA 3OZTA 2PGXA 3X0DA 3BGVA 5KQSA 3GRVA 2XYRA 1G6Q1 4QQKA 1NW6A 4E30A 2FHPA 2UYOA 2UYCA 4E33A 2BM9A 3ER9A 3V8VA 2F8LA 3HVIA 3P9NA 5FHRA 5LQNA 4EMSA 3LKDA 3G2QA 3SVZA 5DSXA 4C08A 4C4AA 3M4XA 1BHJA 4P7KA 5K05A 3LSTA 3BZBA 3DLCA 4EK9A 4F85A 5KS2A 2HR1A 3HTXA 5FUBA 5FULA 3T7RA 5JUWA 3GRYA 3DP7A 2EFJA 3BGDA 3PFHA 4FS8A 3PVCA 4LWOA 5K0LA 4KDRA 2PBFA 3ANXA 5MHTA 5DT2A 3NWEA 2YUIA 3G5TA 4Y30A 4P7GA 3SX0A 2LD4A 3EVEA 5E9JA 2G1PA 5C0OE 2XBMA 3BWBA 2NXJA 2EJUA 4PNEA 1KPGA 1WZNA 3LX6A 3OU7A 5LQKA 3DOUA 3HCAA 2NXNA 3FPJA 3UJBA 4C07A 2Z6UA 1BC5A 2ZWAA 5EG5A 3KKZA 1SUSA 1QAQA 3MB5A 4GOMD 5DM0A 5HIIA 2OB1A 1HNNA 3TM5A 4YUXA 3EVBA 2K4MA 3MERA 2A14A 2Q41A 5FA5A 1RI5A 2PT9A 4EKIA 1X1DA 5E8RA 4GOLD 2ZIEA 3G2PA 4M37A 4AX8A 1Q0TA 3HCBA 2ZFUA 4OBXA 1SUIA 2VDWA 5CCXA 2QM3A 2BH2A 1L1EA 2GH1A 1RI1A 4RTRA 2PXCA 2Z6QA 5KQRA 4RTPA 3LDFA 2ZZKA 2PLWA 5LR6A 1KYWA 2IH4A 3ELDA 5EZSA 4E70A 4MIKA 3KPWA 2ZBRA 1RJEA 1WXXA 2I6GA 2PX4A 2PKWA 1X1CA 2AOWA 2G8NA 3EVZA 3UJCA 3EMDA 3PFGA 1P91A 3PLAE 7MHTA 4H0NA 4R8SA 4RTLA 4M36A 1SG9A 2ZSUA 4BLVA 3EEOA 2UZ4A 3M6UA 2NNWB 2B78A 1M6EX 3FRHA 3GU3A 4QVKA 3UFBA 3TPZA 3SM3A 2QY6A 4CKEA 2C7RA 1VIDA 5H02A 3M6VA 3SSNA 3KPJA 3UA3A 1ZGAA 1NV9A 4BLWA 3M6XA 1I9GA 2OBFA 3GRZA 2JHCA 3DXYA 4KWCA 5FA8A 5GP1A 3DLIA 2O07A 3LDGA 4P7FA 2CWWA 4X1OA 4Y2HA 5EMJA 5EC8A 3WSTA 4B17A 5BW4A 1AF7A 1B42A 2ZCJA 3DXZA 3M70A 5EOVA 2QRVB 3G8BA 3EEYA 1XDSA 3C6KA 2B2CA 1TW3A 4P7JA 3GCZA 3FZGA 3NDIA 4MHTA 3MTIA 1T43A 4OQDA 4AZSA 4DF3A 4FGZA 1R8XA 4FT4A 4YV0A 8MHTA 3EGEA 2V7EA 1VBFA 1I4WA 4MQ4A 5K0NA 4QVGA 4C05A 4DZRA 4KIGA 3P2IA 4BP1A 3FRIA 3LCVB 5FCDA 5LQJA 5K01A 1IY9A 4F86A 1AQJA 1FBNA 4OQEA 3P97A 3RW9A 3UJ8A 3O4FA 2BR5A 1NV8A 1FP1D 3LKZA 2P7IA 2IFTA 3DULA 2ZLBA 4GBED 3HVHA 2QYOA 3HEMA 5EHGA 5FQNA 3O7WA 2Z6AA 3UJAA 1NBHA 3HVKA 5K09A 1XCJA 2I62A 3C0KA 3G2MA 4PONA 3OFJA 4ISCA 2JJQA 2GA9A 4PWYA 4QPPA 1NT2A 3FUVA 3KPVA 3OPNA 5T67A 3GXOA 3FYDA 5EIFA 3U81A 2FPOA 2HMYB 2KW5A 2ZZMA 3L8DA 3R9XB 3B5IA 3KPYA 1Z3CA 4HG2A 4DMGA 5K0FA 2JH9A 3TKAA 1XDUA 4XUCA 2O57A 1XDZA 4FP9A 3KHKA 4HTFA 4R6XA 5DSTA 4OA5A 2JH8A 5K03A 5GOZA 4YV2A 1WY7A 2HNKA 2AOXA 5EGSA 1NW8A 2BM8A 2NYUA 3IYLW 4LECA 2IH2A 4FT2A 3E23A 2B25A 3GWZA 4PIPA 5D1HA 5EHIA 3KPUA 4ER5A 3EGIA 1XTPA 1QAMA 3MAGA 5FHQA 5DX0A 2E5WA 1X1BA 4CTKA 2QE6A 5ICCA 2CKDA 1JTEA 5EPEA 3BWMA 3G5LA 3FUWA 4YUYA 1R6AA 4M7RA 5DXAA 3LPMA 3VSEA 1KXZA 5LQAA 1JG1A 2H1RA 3M6WA 3EPPA 3SSMA 3TFWA 1TW2A 2VDVE 3KR2A 3MCTA 3FPGA 3KU1A 1JSZA 2AZTA 3ELYA 5EMLA 2C7PA 3O31A 3IHTA 5DTRA 4KIFA 5GINE 3Q7EA 4RTSA 2G70A 2PV0A 3D2LA 3HCDA 4HGYA 2GS9A 1BKYA 3AXSA 4UOEA 2IPXA 4XUEA 1VPTA 1DL5A 3BUSA 3LECA 3ELWA 3OU2A 5DX8A 3MHTA 3EMBA 3BKXA 4RX1A 4X63A 2ESRA 1YUBA 3T7TA 3KQSA 2PT6A 1EJ0A 2NP7A 2H00A 1NE2A 2VDUE 1R8YA 2PVCA 4MWZA 1JG2A 3LBYA 2EG5A 1N7IA 1JQEA 1KIAA 1BOOA 2PXAA 3JWHA 3MTEA 3UJ7A 3ERCA 4E2ZA 2C7QA 1XCLA 4QTTB 2OY0A 4V0RA 2OYRA 4RV9A 3AY0A 5GWXA 4XUDA 4U7TB 2BZGA 5ICFA 3HCFA 4YMGA 1L3IA 4X41A 1DCTA 5CUQA 1R74A 1TPYA 2PWYA 1P1CA 1G8AA 4PYLA 4EQZA 3BT7A 4PYIA 3B3JA 5FWDA 2O0LA 2XYQA 3DMHA 5E1OA 4ER6A 3LHDA 5E9WA 3PX2A 2OPBA 2B3TA 4OA8A 1YB2A 1G55A 3NVMB 1QZZA 3K6RA 3OZRA 1D2GA 2V74B 4P58A 3ID6C 3G89A 3LL7A 4RVGA 4KW7A 3AXTA 3GJYA 1EG2A 2AR0A 2CMHA 3C3YA 4OX9Y 4RTQA 1NW7A 1QANA 2WK1A 1R18A 4X60A 3PTAA 4CXMA 4DCGA 4YMHA 4YUVA 3QV2A 3RIEA 3JWJA 3REOA 1NBIA 3I58A 4RVFA 3LGAA 5EVJA 3SR4A 2ZZNA 1UFKA 4HC4A 2IBTA 2H11A 1AQIA 1UWVA 3HA7A 3KR9A 4PYMA 3P2KA 2PSSA 4YV1A 5JR3A 3HA3A 3UBTA 1FPQA 4K6MA 2EJTA 2O05A 3KQPA 3BKWA 4GC9A 1ZGJA 4EVIA 1INLA 2WA1A 2JHPA 4WVLA 1OR8A 3NJRA 4PYOA 5BXYA 4KDCA 4RTKA 3HA5A 4QTUB 5DRYA 2G72A 5HOQA 4PCLA 5F2NA 4FZVA 4PGHA 5EQJB 4LWPA 2WA2A 4RVDA 4ER3A 1L9KA 2OXTA 3FPHA 1N2XA 3A7DA 3BWCA 4KVZA 3P71T 2OKCA 2YVLA 3FTDA 4IKPA 5EMMA 3K0BA 1QAOA 5HILA 1JG3A 4C06A 2QRVA 1HMYA 3T7SA 4OBWA 2IIPA 2ADMA 5T6BA 3B89A 3MGGA 3KQQA 4M38A 4PYQA 4A6DA 3FTFA 4GUAA 5K8VA 1FJXA 3I53A 2ZULA 4G56A 2FK7A 3ELUA 2AOTA 3C3PA 2DULA 2ORED 2ZBQA 4FSDA 4EKGA 1M0EA 2AVNA 2JG3A 1NKVA 3PX3A 4HSGA 4QQNA 1SQGA 5HIMA 1QYRA 1JQ3A 3R0QA 5E1BA 5K0EA 4HRAA 3I5UA 4IWNA 3R3HA 4ER0A 1G8SA 3A4TA 3EVAA 4C04A 1UIRA 5HFJA 3SXJA 5CVEA 1YZHA 5FWAA 5E8JA 3EVDA 1P1BA 3TRKA 1VP3A 2O06A 2P3QA 2PWPA 3FUXA 1JR4A 4DKJA 2ONZA 3G8AA 4HGZA 4CTJA 3PT9A 5GM1A 3LBFA 1O54A 2AOUA 3UJ6A 3P9IA 3UZUA 4XCXA 4GF5A 1F38A 3KQVA 3KR0A 3QOWA 1D2HA 3KQWA 5CVDA 5LQCA 1R00A 5ICGA 3Q87B 4F84A 4YUZA 3NDJA 4RYLA 2YXDA 3JWIA 3IEIA 3OE5A 3VC1A 1EAMA 3QOXA 4ZTBA 4CKCA 3GO4A 1G60A 2AS0A 3P9KA 3UWPA 5LQUA 3FTEA 1RI3A 2AN4A 4YUWA 5CVUA 1VP9A 3V97A 5DWQA 2FRXA 5F2KA 1JG4A 5IH3A 2AN3A 3EGVA 4LG1A 2IH5A 2ZIFA 1JTFA 3UJDA 3FUUA 3HCCA 1Q0SA 2AOVA 5DM1A 4L7VA 5B1SA 3HP7A 1JSXA 2VZ9A 3A26A 3TKYA 10MHA 2BR4A 4WXHA 3KQMA 2NP6A 1RJGA 5GM2A 1U2ZA 2BR3A 2P1DA 5K0JA 5HEKA 5KVAA 3BWYA 4RTJA 2P35A 1NW5A 4PIMA 4RSRA 4AZTA 3JWGA 5DX1A 3T0IA 3KR1A 3TMAA 1X1AA 4PGGA 1L3BA 2XYVA 3FUTA 2PX8A 3B3GA 5FADA 1ORIA 3P9CA 4Z2YA 3SMQA 3KQOA 3NMUF 1IXKA 5BW5A 2IGTA 5T64A 2FCAA 2CMGA 2N47A 3SSOA 1WG8A 1ZHFA 2NXCA 2P40A 5K0BA 4RTNA 4V0QA 4A6EA 3CJTA 2HV9A 2AN5A 4KRGA 3TQSA 2YTZA 3HNRA 3G88A 4FSXA 1ZG3A 2OZVA 1MHTA 3NTVA 4JXJA 4MTLA 4POOA 3CVOA 3P8ZA 3GDHA 1G38A 1I1NA 2AVDA 4RWZA 4ATNA 2R3SA 2OO3A 5EEGA 2PXXA 2ZWVA 1EIZA 2R6ZA 3HCEA 4E31A 5EKUA 1WXWA 4GEKA 3M33A 5E2BA 1P39A 1YF3A 3TM4A 4IV0A 2C7OA 3OCJA 3VC2A 3HM2A 3KQYA 3ORHA 1KPIA 5M5BA 3NW9A 2ZVJA 3CGGA 4BLUA 4CKBA 1Y8CA 3TLJA 2OB2A 3EVFA 2Y1XA 3FPFA 1M6YA 5CCBA 1VL5A 1ZQ9A 4BY9E 4E2XA 2ZBPA 3CC8A 5DLYA 1X19A 3CJQA 3DR5A 1XVAA 3LDUA 3FTCA 3I9FA 2EX4A 3MQ2A 2YXEA 5FTWA 4E32A 5CM2Z 1N7JA 2ONYA 2PY6A 3F4KA 5HZMA 2I9KA 5E9QA 4E2YA 4HH4A 2PX2A 2YX1A 1VLMA 1ZKDA 3DXXA 3BXOA 4BP3A 4NECA 4R8RA 2G71A 1YFJA 2GPYA 4DM3A 1SQFA 5EEHA 3UJ9A 3ER8A 5CVJA 1SKMA 2NXEA 5F2OA 5IKMA 2FYTA 3IV6A 3A27A 1KR5A 2GB4A 9MHTA 1L3CA 3EVCA 3C6MA 3G7UA 3B7PA 1RI4A 3A7EA 1H1DA 3GRUA 1FP2A 5HIJA 2P3LA 4O29A
chains in the Genus database with same CATH superfamily
1AXGA 4WFKA 2P78A 3E8XA 1IOZA 3DL2A 3IOBA 2JEYA 4YJ2B 5ESXA 3KJGA 4DGQA 5K99A 4ND1A 3UMGA 1OX4B 3RWBA 2PHZA 1C7ZA 1XWWA 1FCJA 5K2OA 4WOKA 2D8MA 1LWOA 3KEFA 2BCEA 4F56A 3RWMB 1F6DA 4K2HA 2H17A 1E3WB 1PS9A 2AI3A 4JLJA 1FDVA 2QF7A 1NJ1A 5B7GA 1GPDG 2RGGA 4J3FA 1C7QA 1SELA 1DZ3A 4MA0A 4I55A 2EATA 1TOAA 1VZ3A 1YA6A 4IH4A 4PRKA 5IMSA 1XWFA 1BO6A 1Y0BA 1BGWA 3JQRA 5DTQA 2ACEA 1YMUA 3OPYA 1Z4PX 1XCBA 4XGIA 3KHTA 3UF0A 4EA7A 3I2JA 1J0BA 4FDUA 1ODJA 4M54A 3BMCB 1EWRA 2ZJYA 3EQ8A 1S02A 4XVHA 3WWZA 2W00A 2BGRA 2KLBA 3C7KA 3ZVNA 1FSPA 3F97A 2GSWA 2B61A 1FSGA 3HJGA 3IUYA 1BVRA 4ZD6A 1K27A 3MM4A 1Y9JA 5HIKA 2DUUA 1X77A 4AT1A 4BTVA 2MOKA 1V5WA 4R41A 5D3KA 5G0WA 2Q6KA 4GVPA 3PNQA 3TXYA 1LC0A 5EXEA 2HBRA 3LM8A 4CEIB 2NV6A 1YZYA 4RPJA 4GW3A 5IFKA 3FOZA 3OWOA 2FPIB 3DDZX 1J00A 3B36A 4RXMA 3JD1A 3VPFA 4F8JA 2CNOA 3RSCA 1M74A 5COAA 3IAAA 3AHCA 2CBGA 3RS0A 1NN5A 4PSAA 1EJBA 2ZRGA 3OZDA 4FCCA 4MGZR 3THSA 1VIAA 1MABA 5BYJA 1GTG1 3INRA 2RK4A 4BP9A 2PH1A 4BGEA 1QQAA 1SBIA 3W5VA 1YDWA 3OZSA 4XJXA 4HNRA 4Z9AA 2AMJA 3KVVA 1NW4A 5KDLA 3UMBA 2A3RA 4HDQB 4JJ7A 4P81A 4GPD1 2BKEA 3A9WA 3QXCA 5IAEA 1DC7A 1JDVA 1N6PA 1CZUA 1XT6A 4PN3A 1A9RA 3GPLA 2VO1A 1TI7A 2YDYA 1GY8A 3BL8A 3KJXA 4ZVLA 5JQGF 1SCBA 3BWEA 1UZAA 3HRKA 2PGLA 5AJYA 2ZJ1A 1UMDA 2GBGA 4Y2YA 4QBHA 4G0WA 1SOAA 3P9NA 1PWEA 1XRQA 1I7PA 1FDSA 2D0OB 4UREA 1RU3A 3IIJA 3QVUA 3C41J 3UT6A 1L7AA 4IPTA 2C78A 5ALWA 3GRYA 3P4XA 1RQNA 1P1HA 1SA0A 2ZIZA 3EE6A 1OGIA 3H8SA 2Y27A 3PVCA 1HE3A 3MGAA 1BXZA 2HBZA 1M5UA 2C95A 3EDRA 4HLUA 2X9GA 4KDRA 1A95A 4Z99A 3F3SA 2X1HA 4NMLA 2QSZA 4N41A 3BTUA 5IDWA 1JZSA 1EK1A 1RYYA 4KR3A 4WKGA 3GX1A 2CJWB 5JPDA 3I04M 4CRWB 3BFKA 5T4BA 1IN6A 3I52A 3H4TA 1KEEA 2IHUA 3VDQA 3TLYA 3K9BA 3V1KA 5DBFA 5CLFA 5AR1A 5JECA 1KK1A 4NPAA 4WKOA 1GRCA 1H1TA 1RXIA 2QAGA 3I3OA 3O84A 1FVOA 4JP2A 2BSXA 1ZR2A 2FQWA 1VBMA 4XIIA 1BXRB 2XNDD 1F8FA 1CUUA 2DX7A 4ALMA 2VUIB 4MA5A 1OSNA 4LJRA 3KP1A 2QRNA 1W0KA 3QUSA 2RH8A 3GFQA 4M37A 2QIPA 4P6VF 2W11A 2FMUA 3O2QB 3PXGA 2ZWOA 4R40A 5DV9A 3ZGOA 2QM3A 4KN6A 5I7FA 4KXMA 2FGKA 3GGGA 3OE7A 3FJ1A 9LDBA 2VJOA 4RTRA 5EE3A 1G98A 4PC2A 5C5EA 3PFWO 1GYPA 5IKOA 1XRNA 3TLEA 3OKCA 4U7HA 3I0ZA 4R9NA 1LPMA 2QTWB 3ELDA 2J3LA 1RHRA 1RZ3A 2QRKA 2W4MA 2QN2A 4LRTB 4RKWA 2FETA 2ZWMA 2Q3LA 4KCGA 1RJEA 3ZDRA 4GH5A 2CHUA 4O1HA 1YR2A 5CJ2A 4MV9A 4BB6A 3EFEA 3WB0A 3HB9A 1CIVA 1L2TA 7MHTA 1ZIPA 5EIAA 1N77A 2R8OA 1TZBA 4FD3A 3H2HA 4N5HX 1DRUA 4C4YA 5H3LA 5HCNA 4KZKA 4NFHA 2Z8ZA 1NC3A 2RHJA 3LRXA 1NBME 2YIMA 2BJVA 3BEDA 3EG9B 4I8IA 3SSNA 3TIXB 2BEUA 1LQUA 1M2OB 1XDWA 5FA8A 3TW0A 4N9WA 2NTYC 3ZWDA 3WSTA 3MD0A 2BSQA 5C18A 2YV4A 3FZQA 1NOJA 3MIZA 5A4FS 1FXSA 2HU5A 2GF0A 3KYCA 5EOVA 3ZWVA 5JJCA 2ZM6B 3VR6H 2FPWA 1DIGA 1BQ4A 2IYEA 5C51B 4F0JA 3AF2A 3LVBA 3PQEA 1XCGB 3S5UA 4ARZB 3RB8A 4NFSA 3L8YA 3DZKA 4UCXA 3WBFA 1XZBA 4AMYA 4HDMB 4ZVOA 4YAIA 1FZTA 3FRIA 4ZQBA 1ZXBA 2RHDA 3AYZB 3KOYA 3TTUA 3NWJA 4ZP1A 2Z0MA 5EJGA 4FFBA 4NBLA 4H7EA 2HDOA 3LI2A 4RETA 1IOLA 1E3QA 1MOQA 3KKNA 1B41A 3V4ZA 5DGHA 3KEMA 3VO1A 2UZ1B 2C4MA 3NT5A 3EY9A 4JKOA 4M0DA 3NASA 1U1IA 1XROA 2VP5A 4JLAA 3U1BA 2J7PA 5KNBD 5ALQA 2EKPA 1MH1A 1USKA 2V7XA 3DE6X 3WRVA 4IL5A 2NU6A 2DHEA 4BNIA 1RWNA 1PFUA 4CQLB 4TYYA 5HE9A 2GYWA 1T3SA 1TQ4A 4IGIA 4DBVO 4HDKB 1DKOA 3ZE6A 1Z36A 1BVUA 1WA5A 3KPVA 5LZ5A 4NYMQ 2IYFA 1L5ZA 1MQAA 5EIFA 2WMDA 4XVRA 5K9ZA 3UMMA 1ZM9A 4X62B 1CYDA 1NLYA 1QHNA 2C88A 2GKOA 1VCOA 4ZEMA 1F7UA 1W85A 3B5IA 2COEA 4RV5A 4G09A 1XZMA 1E4YA 1NF9A 2EX0A 4UQLA 3IH5A 3HHPA 3W6NA 4LHVA 1YZGA 4YGXB 1FX1A 1E79D 3O0DA 4Z86A 1VYHA 1HE4A 4HTFA 1BG6A 1GVNB 4KYTA 4OA5A 2VJMA 3BD9A 5IAKA 3UUGA 1WSAA 3QVWA 2RHLA 3UC5A 5K8TA 4Z9XA 1HTTA 1KHTA 1UK7A 3N2NA 3TJZA 5JYCA 5CDGA 2W2VA 2CVFA 4B4DA 2B25A 2G25A 2BN4A 2IHYA 3GWZA 3ROGA 3RJZA 3ANLA 2H08A 2WOJA 4RZIA 5CB4A 4ARSA 2HF2A 1AX9A 3CWZA 3CLKA 5JSHA 3AM4A 3AOEA 4GQIA 2HUNA 4PC3A 4YLEA 1YFZA 5EPEA 1VGVA 4UNNA 5CD9A 4DV0B 1WETA 1PK8A 2VQDA 3R6WA 4GICA 4Q3KA 1KXZA 1IJKA 3TRJA 4F91B 1JEJA 1OF1A 1XC7A 4G5OA 4AWBA 3FNEA 1JSZA 4MV3A 2VBGA 4REQA 4Q7KA 3WWDA 3IEPA 4YMSA 3KJEA 3BF7A 2P9FA 4J3JA 2HSGA 4JKYA 2G70A 3Q7PA 4RKQA 2IPXA 2IU4A 2JI6A 4LJSA 5KMGA 2H1LA 4RLHA 1JP7A 4BKUA 1VE1A 2DY0A 3BKXA 1C7IA 1D8AA 1DP4A 1NLUA 4QUGA 4B3MB 1IXZA 4J90A 2BW0A 1AK1A 1WUJS 4KOAA 3FMPB 2H00A 3D8BA 3D7LA 4QGHA 2FA9A 2B37A 4OHWA 2ZWIA 3OHSX 3JWHA 3OEEA 3A0RB 2VJLA 4PLWA 1XCLA 1L5VA 4J4TA 1L5GB 3ONFA 3LRPA 1J1UA 4JLWA 2R6JA 2BLLA 4RV9A 2ETVA 2IK8A 1TXGA 1J70A 4A0QA 4EUFA 3QH4A 3WR5A 1MIOA 1E2GA 3BIXA 3DTVD 4DA9A 4KN9S 3GCGA 2FKAA 3GFVA 1R74A 4ZT3A 2J48A 3H9UA 4RVSA 2PT7A 2WMNB 2BFDA 4L73A 4PYLA 1H2EA 4PG4A 4DWVA 2FQ1A 3NNSA 4IZHA 5FR1A 3ZVKA 2XYQA 4KX3A 2XCUA 4YFVA 4LI3X 3QE9Y 3ED5A 3VZDA 4CQMA 4B3JA 1IH8A 3DV0B 5JCJD 1A5SB 3ID6C 4RZHA 4EJSC 3R7DA 4MX8A 1D2RA 4JEUA 3Q7IA 2AI1A 5EE5B 3HL0A 2QJFA 4HBGA 1R18A 1KDOA 4P4UA 3QYAA 4KQWA 4KODA 4YUVA 2UZ3A 3THXA 3FYUC 3WGMA 3RVDA 2O8CB 3DEZA 2FPGB 2PSDA 5EVJA 4BNYA 3EN0A 5ECGC 1RWPA 3FFTA 3PNYA 1RHJA 3SJZA 1CR1A 3QFCA 3OFNA 3ZE8A 3IQDB 1HWYA 4JI8B 1L8AA 3CR3C 4QT4A 2ZRJA 4ZCLA 4JQYA 5IABA 2YVKA 3T9BA 2VNKA 1TYAE 4M0CA 1GG9A 4N76A 4WCFB 2Q4EA 2MYNA 3RU7A 2ZJAA 3NJRA 3R3XA 4FYYA 3NEPX 2XCOA 1ZJ5A 2C77A 4ZK2A 2JA1A 2XWJI 4OPMA 2X4LA 1N6RA 1JZTA 1L9KA 1JLRA 2ZT7A 3FPHA 4PC6A 1C50A 4BLTA 5KDDA 2AEFA 5DNAA 5EMMA 2H4FA 5A4KA 4HAYA 3AIOA 1MAAA 5HILA 4BEVA 4IYJA 1E9DA 3F49S 3T7SA 3T94A 2K7FA 4U2GA 4KTTE 3UCEA 1EWVA 2IHKA 3H3FA 4JASB 4NX2A 3SE7A 3BE8A 2R8BA 4IRMA 1C2YA 3OMWA 1NBAA 2ZULA 5GJVC 3NBUA 4C7JA 3AZPA 3M6AA 1RXUA 3QF4A 4Z7NB 2W98A 2UZAA 4IEIA 4LDQA 1G8FA 2HRCA 5CEFA 3E2PA 3HMKA 1GZ6A 5EUQB 4IDDA 3ZCVA 5A6SA 1W36D 3K3PA 1WBBA 3H05A 4QIHA 1T26A 1U94A 2IGBA 4YQZA 2C1XA 2HPHA 2VA8A 4OB8A 3RK4A 1RWXA 4C2UA 5JDCA 5HFJA 5JSZA 3WA7A 4YRDA 2PAAA 5E8JA 2AF3C 1AMUA 3ZNPA 3N58A 4E3ZA 3FKJA 1BSVA 3K32A 3HBMA 4GI3A 2Y6VA 4H6PA 3SX4A 3IR6A 3Q6MA 2VUSA 1IN7A 3P9IA 4EGFA 2PRKA 4E5VA 3GHHA 4REOA 3L1IA 1BFDA 2G80A 2GZDA 3QOWA 2ZUCA 4DB2A 2V0CA 4EFDA 1A1VA 1OXKB 2A0WA 2F43B 4WLFA 1BROA 1JKJA 1BN6A 3TD6A 3V1YA 4WNIA 1OXVA 4MUMA 4FOTA 4ZZIA 4W5WA 2C97A 4HN4B 4MUNA 3G0OA 2EDAA 1Q20A 3OURA 2NU9B 2HHLA 1HFKA 4KQFA 3TL6A 3V97A 2H5EA 1PFVA 3OZIA 1Q5PA 3T38A 3WK7A 3W06A 2C2MA 5FI3A 4PZDA 1NI4A 4TTSA 4YCAA 3SR0A 1BH2A 4L6AA 5LQMA 4F3CA 10MHA 2RB5A 2C5AA 1VB3A 4YLGA 1TJNA 4UTOA 3VPBA 5KTSA 4UHJA 4LF5B 1AKNA 5GM2A 1E4EB 1IHUA 2BR3A 2KLHA 2Q1WA 4NQRA 2FW1A 3DTYA 3GWGA 3H2JA 5A6VA 5HQ3B 1COZA 1Q14A 2Q2QA 3JWGA 1AT1A 2PR7A 3AMVA 3E48A 4NBSA 2QVBA 3A31A 2X3FA 4A2QA 1XMSA 4HVCA 4IJ6A 2E4VA 4KRXA 3NNNA 4ZQGA 5EXSA 3DEHA 4PLGA 5J2UB 3WGKA 5B3KA 1A4XA 1U9ZA 1JJVA 2PEZA 5AW9A 4BP8A 1K8XB 2CVOA 2QLNA 1KP3A 3WGTA 4E6EA 5FL7D 5EJFA 1A4IA 2GKGA 3VNQA 1Z6ZA 2AG6A 1VCIA 5D8DA 1IK6A 4JJFA 1QC5A 4HAXA 4KIWA 3O4HA 3AI2A 1E9CA 1OH6A 1MHTA 4BO4A 1NP6A 3PEYA 2E37A 5IJ9A 3S1LA 4EO4A 4RWZA 4YO8A 4OHBA 4NJMB 3IB3A 2VHEA 3PCRB 5DEIA 1NFQA 5GONB 4ASUD 1RAGA 1S5PA 1SQ6A 1CQXA 2EP8A 2X8BA 1NF3A 3N8NA 4LYJA 4GAEA 1XZPA 3OCJA 3ORHA 4MRPA 1EEHA 1P29A 2GEUA 1VRWA 1C81A 1DO2A 4DR4B 1GUZA 1YO6A 2XUFA 3P2OA 4V0OA 1SC3A 3TLJA 3ZWQA 2OB2A 1RYMA 3PEWA 3U9LA 3NHAA 5A02A 1EUCB 3HSKA 1HETA 1ZU5A 2YUTA 1NSTA 3FFXA 3OJWA 2I71A 4PHFA 4YA6A 3ZWPA 2YOFA 1LKZA 4YWJA 1W4BA 1YK1A 2QWXA 1P6QA 5AI4A 5CM2Z 5HCIA 4ZDWA 3QMMA 3L1HA 4EF4A 3SVTA 1V4BA 3ANTA 1ID8A 3JQQA 1BW9B 1KMNA 2QPTA 1VMIA 1ZUIA 1FXWF 1SQFA 4I46A 4LOIA 3SC4A 3JWEA 1JWAB 2I3ZA 1CE8B 2X86A 3PK0A 4IKEA 3DWFA 4LXUA 4P83A 4MGEA 4RD2A 5FR2A 2J67A 4CLRB 2BDTA 1P6XA 2AJTA 2WLSA 4NRDA 2CDNA 1I4DD 3DAHA 4KE7A 3BXXA 3DQPA 3VPGA 2OK8A 4XDGA 1P1KA 3V4FA 2HREA 3IT2A 1ZN2A 2CJYA 2CC2A 2JLBA 4QUAA 4YRNA 1THTA 3PI6A 4ALNA 5CFZA 1NMYA 1LQTA 4JJZA 3D4PA 2X7HA 5JJBA 4MS1A 2BP7A 2VPYA 2D5AA 4ZREA 5DHQA 1G3IA 1XU9A 5A7FA 4YCDA 1UP4A 4RVNA 2VK1A 4DRZA 3MHPA 2C9CA 2BFFA 1TQ8A 3CUTA 1YMVA 1HX7A 2WVHA 4D74A 3T35A 5CPBA 2GZHA 3F6PA 4A82A 5CXQA 3C3DA 2X41A 3DWGA 3DDSA 5EIHA 5TMDA 2A5YB 1BEEA 2F1RA 2GZAA 4MWGA 2Q2NA 1DJPA 5G02A 1E1LA 1H4VB 3SHVA 3TYXA 1MB0A 1Z6PA 3HBLA 2XLCA 2Z9BA 1DX4A 3EGDB 4FKBA 4QLAA 3MOSA 2IYUA 4L02A 3ZIAA 1Z63A 4ACBA 4BFVA 5CB6A 3UMJA 4RANA 2O7QA 1XPOA 2IHVA 4B3GA 3I05A 3L6RA 2R79A 3EXFA 5L3RA 3HLYA 1DDIA 3G1UA 1L7OA 3H19A 4LKRA 3BREA 1P0QA 4DCSA 1OVGA 1VHTA 1RCUA 3VX4A 1JSLA 1KPHA 1YONA 4Y2XA 3TD9A 3CEPB 1J8MF 4CM4B 2G5GX 1DXQA 1Q50A 2IP2A 4UBLA 2GM5A 4HB4A 3VGJA 3R8CA 3RUIA 1QHXA 4M1OA 4K28A 4IAOA 4HB2A 3HA2A 4CCWA 1AB6A 2JGRA 4LJ8A 1JAZA 3GJ3A 16PKA 1PVOA 2IF0A 4RQUA 1ODTC 4KPYA 1OAOC 1T5DX 4R2KA 4RMGA 1J49A 3AVWA 1GYQA 4L8YA 4DV7B 3ENQA 3O8RA 2ZRDA 3K4HA 5B36A 1Q0QA 4ZYVA 4CM1A 1E61A 4G5GA 3P0IA 4BBZA 2QD1A 3AP2A 4MW5A 4ZAYA 2DOKA 3B7WA 1DAPA 4II2A 1RM5A 1CPYA 2F8MA 3BB1A 3OI7A 1FVFA 3P9RA 2E6KA 2EHDA 2RCNA 2HCRA 5F78A 1I7SB 4FNAA 3TAXA 1LLCA 3KEOA 1QFYA 4OU5A 2BHLA 1QORA 3MT0A 3KWFA 1MV8A 1Z68A 5B58T 4BX8A 2JL1A 1JT2A 5G2OA 3TQTA 3JS5A 4QGFA 3AI1A 4TV9A 1GL7A 4IDAA 2IQ5A 4BB0A 4X6XA 5LA6B 3X44A 1T9HA 2VAMA 4DLXA 5TT0A 2QROA 1WO8A 4A10A 5FOXA 2Y1FA 3RC8A 1J20A 4EMSA 1KVRA 4S35A 4E09A 2OA0A 1D03A 1DDGA 1SM4A 4LRWA 3Q1KA 1L1RA 3U3DA 4EK9A 4F85A 3B1JA 1UK6A 1QIJA 1EX6A 3IESA 1GSHA 2PUDA 4FEYA 3DKPA 3ANMA 1VPDA 4HI0E 3I09A 1CJVC 3FCUB 1BE6A 1W34A 3GAZA 5M3BA 3UV6A 3DB2A 4ZQEA 2YHAA 1ESDA 4H3VA 3OPMA 4DCOA 1RYHA 1WZNA 4IQ4A 2WG1A 2Z6UA 1JVBA 2B9VA 4FMPA 4R7ZA 3WIBA 5C7YA 1GQOA 2PGOA 1PTJA 1UL1X 1SUSA 1WKBA 3CX8A 3OJEA 3QVJA 1HSZA 4P5PA 1Q2XA 1XRSB 2OB1A 2OILA 1DBWA 1XF9A 3GLHE 1GGVA 5D3MB 4I4TA 3EA0A 1PW7A 4UZSA 1M2HA 1DMRA 3L06A 1QB7A 4XZ3A 4N47A 4KOEC 2OORC 3ROTA 4QNNA 4EA8A 2NO9A 3MUEA 2B94A 2XUAA 1OTXA 5ALTA 1EP1B 2O5CA 1X0VA 3ECAA 3HZOA 3RKUA 4FB4A 5CCDA 1BDHA 2Q99A 1MNQA 3O8DA 2QJRA 3FHOA 4OSOA 4R9VA 3IHLA 1NVFA 3SHQA 4E08A 1GTRA 4MDFA 1CUGA 3AL3A 4DBZA 1GM5A 2ZZKA 1WHTB 1YU6A 2WF6A 2H1VA 5L3SB 4MW4A 4JP8A 3ENVA 1RLTA 2PSHA 4GS5A 3KPWA 2ZBRA 3JVEA 2TMYA 3KZKA 4HUTA 5AIBA 1ZJZA 2JIRA 3ZDBA 2QBYA 2XITA 4L2IB 2HRZA 4UJ3A 3VFDA 2ZSAA 1SUFA 4X1YA 1G291 2C2XA 4V3BA 3UHPA 4JBNA 2UZ4A 1K7CA 3AB3A 3IPXA 1PE0A 3HY4A 4LUCA 1H2YA 2DR3A 4OQNA 3GB9A 1FFXA 4P4SA 3V4SA 5IULC 2XOXA 4CV2A 4MMZB 3VDXA 2O07A 5J4KA 1NNUA 2XEXA 5HDQA 1UC8A 2J59A 2QGFA 3AJ8A 1QCZA 5HM8A 1KVUA 4IBOA 1XDSA 5BR4A 3L7CA 3TI9A 4DA6A 2KM1A 2G82A 4E3WA 4BVBA 1T9GS 1PL8A 1TU3A 2OZLB 5HTKA 3UUEA 5B5SA 5BOSB 4X6UA 3TS1A 2PUWA 1EJ2A 2FNAA 1AK2A 1A5AB 4HHEA 5T7BA 3IL2A 3GFSA 4L5IA 3LBHA 3TLXA 3X1MA 3S27A 4CZ2A 4KIGA 3D0QA 8ABPA 1N78A 4IW3B 4M1TA 2WU3A 2UVPA 2ZWPA 3EB9A 5DNEA 1DBIA 3IE0A 3NYRA 1DJMA 4ZI7F 3AM3A 3ASVA 4OQEA 1XJWA 2CL7X 4NZMA 4G41A 5FQNA 2IXEA 4M1MA 3QM1A 3QU7A 3NHLA 4RPIA 5JZBA 5JSYA 5PGMA 4X64B 4U7WA 4BMZA 3WMEA 1BXKA 1TIKA 3F5QA 2UUOA 3LAWA 3CH6A 4DBLC 4FDMA 3B52X 1FFAA 3AZOA 2VQ3A 3MVEA 1KL7A 5HCUA 4JYCA 4EITA 1TNDA 2RG1A 5TJ9A 1YVUA 2BBWA 3ZJYA 1E2DA 4HDRB 4WBNA 3I6BA 1U0HC 1V3TA 4WUVA 1WF6A 3EXEB 4G1BA 4I2VA 1MRNA 1X7GA 3HO1A 4Q9DA 3CX3A 3R3WA 4EEXA 1UZNA 5DSTA 3U7GA 2ZB8A 3E1KA 2VYVA 4D98A 2VKTA 2HNKA 4KITB 1Z9BA 4LBZA 2XZTA 2TMDA 2AOXA 2H1CA 4GEGA 4GX2A 1ZGCA 2QTLA 3DVAB 4MQ5A 1S8AA 4LECA 2OYCA 1JDUA 2FHSA 4P7BA 5ADWA 1ISJA 2ERYA 5D1HA 1QB8A 2OHVA 5D3QA 1R9JA 4LMAA 4ER5A 4EATA 4C5BA 3HS3A 2VHWA 4TSFA 3COWA 4FYVA 4LAFA 5ICCA 2CKDA 2FSUA 3PJEA 2VAPA 1CUAA 1U8XX 4B85A 3VR3D 1P3JA 3ED1A 5TSDA 5HF8A 4ZO9A 5EJMA 2IY8A 2ID7A 1S01A 1Z4MA 4GD3Q 2B1QA 2HJVA 2IYVA 2ZKLA 3GN1A 5KVQA 4LSMA 3ZJ5A 4F97A 1RRMA 3T3IA 2GAAA 2I54A 5KOYA 3JWPA 3K0EA 4AECA 2C0QA 1NR7A 1PEAA 4R8KA 4BGVA 5AM2A 4QU9A 3O83A 4QBKA 2QL7A 2HIMA 2JVJA 2NT4A 1JIUA 4ENSA 4DJEC 1VMDA 4FR5A 1ZD2P 3OHMA 4RD4A 4TLBA 2I3BA 3N2LA 5DI9A 2JGMA 4ZOCA 5HF9A 2CNKA 4IDHA 2BD0A 2I6FA 1WBJB 4DLSA 1HRDA 1N3LA 1YQEA 2ESRA 2P9CA 4O4LF 4WCFC 4XW2A 4US1R 1EWKA 2E85A 4CR7A 5K7SA 4ZK6A 1NE2A 1RBMA 4QULA 5JH7A 1SK8A 2EG5A 4LZOA 2EKDA 1SC1A 1DTEA 1ZZEA 4R1OA 3GEDA 3WGLA 1H22A 1VHJA 4II3A 5AUPB 5EJ7A 2QUJA 2JAUA 3OZFA 3TRDA 4NYJR 4QLOA 5AI6A 1T9CA 4G24A 3IIKA 2P4SA 3DA8A 5E4YA 1TX4B 1C3OA 5A4JA 2BBOA 4TLCA 1C0IA 1N8NA 3AZQA 4MUHA 2VDJA 1VL0A 2G36A 3AV0B 4UTVA 2AD1A 1NFFA 1M75A 1GVHA 3CT4A 4UUMA 1FP7A 1TCVA 2Y0PA 3L7YA 3N2KA 4LWZA 2CMHA 2BUCA 2DPHA 1E2LA 3A6HA 4OMDA 4TKUA 5E6UA 4RTQA 5BWNA 1BQEA 1W8IA 5HKBA 3NTUA 4J4HA 3A1CA 4PANA 3MRVA 4IMJB 1DEXA 3PDIB 3W2HA 3L0DA 3REOA 4D46A 9GPBA 3EZFA 3SYTA 2XTZA 3QXGA 1I33A 1Z0DA 2P69A 3GJXC 2WFZA 3FJYA 2FMXA 2QN6A 3OVMA 2GM3A 1ESEA 4YALA 5FFNA 3HA7A 1WCIB 3ULKA 4WNAB 1VJDA 1GZSA 4RFLA 1EINA 2OHOA 2ZSJA 3ZLBA 3N6RA 4HVAA 4OK5A 2PV7A 1PZEA 5FV7A 1IPEA 3FDZA 3QG1A 4OG2A 1TF5A 1WVMA 2JHPA 4OHKA 4M4SA 5FPHA 1CLUA 1PJCA 4BZXA 2ET6A 1OTHA 2NTNA 3WA6A 3JZAA 3HA5A 2H1SA 4A1OA 5HOQA 3QKSA 5K20A 3BQ9A 3WDSA 1XHFA 5AJVB 2P79A 1I1HA 3HFSA 3ETCA 3W7BA 4M46A 2VTBB 5IAJA 3N8IA 1KOGA 1I2DA 4H7HA 4XWTA 2YDXA 3OBIA 4JIMA 1YB7A 3CB4A 4RQTA 1KYTA 1P17A 1PT8A 2CDBA 3EZLA 1R6TA 3QA3E 4IKPA 3H2GA 3ONEA 1P5ZB 5B3JC 5CA1B 4NCNA 3L0OA 4KDFA 1GYRA 1ZI8A 6REQA 4B40A 3E22A 1U8TA 3ZWXA 3VU9B 2QUIA 4K0RA 6Q21A 1V1MB 1PSWA 3PFKA 2C9MA 1ATZA 3IPCA 4J43A 4XQ0A 1YRYE 4X1KB 5BYAA 3PFIA 4HSGA 2CVQA 4K0KB 5L3QA 2ZAIA 2VBCA 3HXOA 1JQ3A 1CQJA 4CEJA 1I2ZA 4IWNA 4ER0A 3VPSA 1EDBA 1G3QA 4A3SA 1EHYA 3C8HA 4A91A 3PWKA 5FWAA 2IHBA 5D5PA 4Z6KA 1YRAA 2O06A 1ID1A 2W6MA 3PI7A 4R51A 3KZ1E 4Z1OA 2CYAA 1KK3A 1HSOA 4BVKA 1ULHA 1QYWA 2Q5JA 4MPRA 2G4VA 4CM5A 4GNKA 1MG0A 1SKUA 4H1TA 4P80A 1NVGA 3CIOA 3IKLA 3IERA 3B12A 3P0EA 5F9FA 5EZYF 2J9FA 4X0EA 5FJIA 2W2XA 3AETB 2B2XA 2VNAA 4N7MA 3O4VA 5EQFA 3RUAA 3ZX4A 2HEIA 2Z08A 1VBNA 2OCYC 3JWIA 4HYTA 4EJFA 3BCHA 2OV2A 1NZDA 1JEYA 1VL2A 4LDJA 2WF9A 1E2HA 5KSZA 1Y8RB 2XOKD 4OJYA 3GO4A 1VE5A 4ZC8A 3HWX1 3FTEA 4RVUA 3QPAA 1QS0A 1M2VA 1MQ8B 1QFXA 2HA7A 2Q8NA 4O08A 2MINB 1CSEE 1P73A 2QW0X 3L01A 3RFVA 2FRXA 3T3GA 4PEVA 4RA9B 1ZM3A 2IXTA 3N1UA 1VRCA 1XFAA 3K1JA 3T5DA 5AVWA 4Q37A 4F38A 2V6FA 1FC0A 3FVVA 1ZC4A 1WDTA 3KQMA 1DCFA 4I1UA 5A2GA 3IMEA 4K46A 1A9OA 5IYZA 2R8EA 2EHJA 2YRXA 1OWPA 1IBSA 1QTNA 2CZCA 3H1AA 3G0DA 3P0JA 5FKJA 1Z8DA 1NRXA 3FYTA 2JFGA 3PR1A 3LP6A 1XEWY 4H27A 4MWCA 3IP5A 521PA 5MDHA 1Q22A 3EZ9A 1NR1A 3OKAA 3K15A 4EBFA 2O8DB 3V8EA 4C14A 4C7BA 5FAXA 5G1NA 2R1ZA 3KQOA 1WB6A 3V9AA 5CXUA 3FOCA 2QT9A 5SY6A 5FUYA 1SCUA 3A3NA 5SY9A 3S28A 1M54A 2QV0A 1D4FA 1M8FA 4EZEA 3V4LA 4R4JA 2N9UA 3UHJA 3CUVA 1F48A 5C5DA 4NL4H 3AHHA 5ERYA 5I9TA 4LOAA 2AN5A 1LDGA 1NY6A 3IV9A 1XCMA 1GA1A 2IUUA 3SXPA 1IZ7A 4IJWA 5H59A 4PSKA 4BEWA 4JXJA 2PRIA 3D64A 4DAEA 1I1NA 4BNFA 2QR3A 3VR0A 2IW1A 1B0AA 1ITZA 1Q83A 1RW4A 2PUJA 2O7VA 1OV6A 3CGWA 4WZZA 3UGTA 4R2XA 1SXGA 4FOOA 4FFVA 2UU9B 3SC6A 1Q0UA 2GAOA 3OD5A 4U63A 4CM7A 2C7OA 3SLGA 2VHUA 4GPIB 2RSLA 2OK7A 5E2IA 2NSYA 1C80A 4B6SA 1I7DA 4XA8A 4BNHA 1A7JA 4BAGA 4YRQA 4LXIA 3H2SA 2R6GA 3EVFA 1YULA 3R6GA 3DPUA 5B3AA 3DBHA 3M6LA 3TTXA 3ZK8A 5TNXA 1SZCA 3KJIA 4XGKA 2W2QA 2VHJA 4CNBA 2FP3A 4UU8A 3X2EA 1M2JA 3FNQA 1XVAA 2REQA 3R40A 2BI7A 3KKKA 3NYWA 4PFJA 3ZEIA 4B84A 4D9IA 4CLDA 4PLPA 1GU1A 3LPCA 1TLFA 4BNZA 1HFEL 1N7JA 4WFIA 1YIAA 3LZDA 4I55F 5FB3A 3ZWBA 4ZJZA 2LCQA 1KARA 2QG9A 3AR2A 4GWGA 2ID9A 2V3VA 3BXOA 1YMQA 3KLPX 4R8RA 4B6JA 4E03A 4WK4B 2LXNA 3PD7A 4I5GA 2XEDA 5HMMA 5BQPA 2WBLC 1M1YA 2P5YA 3PX7A 5F2OA 4E07A 5J4YA 1G8GA 1ABBA 1WNTA 2H9IA 5FOUA 2GB4A 2IEYA 2GN9A 3H9EO 3IB6A 2QJOA 1RAAA 3PHLA 2ZIAA 3ETLA 1ODFA 1F8YA 2EZUA 1WUKS 2H1FA 4F5YA 3ESRA 1MDBA 1YRHA 4BCCA 3F8SA 5IWCA 3OY7A 4WXYB 1YZNA 5DASA 3O74A 4WV3A 4EIWA 5AW3A 1YRLA 1QIKA 3D1VA 3T1OA 2QS9A 3LCUA 2R5FA 2D5LA 3L9WA 5I01A 5C7OO 4WZAE 3NKFA 3KE8A 1DUSA 3AF3A 2EG9A 2XA9A 1UEIA 2GAFA 2PZMA 2QRHA 3CF0A 4DJAA 2CDCA 3C4QA 3V1LA 1XNQB 3G9ZA 4FGKA 5FWYA 4NPHA 1TVEA 1KMIY 3KXDA 1C9KA 1GNSA 2DBZA 1CWUA 2VF8A 2P9BA 1PNVA 3H9CA 1T5SA 1Z7GA 1FDRA 3A1WA 4EWLA 1RJFA 1KEVA 1XN1A 2WD7A 2ZRAA 3MT8A 1TM3E 1VE7A 3ZLTA 3DEFA 1OU4A 4ZVMA 4ZVQA 1BQ3A 1NVEA 2PRSA 4FQ8A 2QVZX 3S40A 1XQVA 1XU4A 2IYQA 2XY4A 3A6LA 3IP7A 1QIGA 1ZLXA 2ZRKA 1IZYA 1IAVA 2XA2A 3M5PA 4PINA 4TYPA 4U5XA 4DQ0A 1IBKB 3GUHA 4BV9A 1UJNA 4GPAA 4HMOA 3T3EA 3HKBB 1ZD8A 1CY0A 4FWBA 4IRUB 1CQIA 3QE0A 1T8WA 4L4XA 4XPIA 3V3TA 5M7EA 2W6JD 1X7ZB 3GRRA 1RJ9B 1U0JA 4TZTA 2P7HA 4NG4A 1KQGA 3DFKA 1SU7A 2P3OA 3IV7A 3L41A 1MG5A 1LPNA 4GRDA 4ZV9A 2ZJ4A 1J33A 3WZ2A 3LY9A 4AN1A 4HADA 4F12A 1ARZA 2X13A 1G21E 2ZTLA 4XIJA 1U9IA 3F96A 3DMGA 2AJBA 2EZ8A 4JGIA 3U6KA 2QRQA 2GYVA 2DXIA 4WKBA 1RBYA 2WMOB 4H3HB 2HK8A 1QG6A 1EUQA 4A0GA 1JA9A 5LMZA 1T8PA 2EW2A 4RULA 3MTBA 4IVPA 5CT4A 1FU4A 4ALJA 1XZEA 5IF3A 5FQOA 3EASA 2ZBEA 1BA2A 1T6ZA 2OAQ1 3K9HA 4GIBA 2WUVA 2DLCX 3ETEA 3UJNA 3R0ZA 4NESA 5TARA 4DIBA 2B4TO 1L5NA 4ZO7A 2CYCA 4E30A 1KKLA 1PBTA 1Q1ZA 3G0IA 1JW9B 3Q85A 4LJAA 1U2DC 3VJLA 3KAKA 3MBKA 2BM9A 4UBNA 3V8VA 1K8ZB 4EF5A 3CB2A 1FNNA 3SVZA 1AF4A 1U7OA 2CVZA 5K05A 2SKDA 4JJ4A 3RRYA 3QRWA 3OIVA 4Y6PA 3KKPA 5DGDA 3FLAA 4NOMA 2HPVA 4L3VA 3C6YA 2Y8EA 5K0LA 2NTEA 3ILXA 1EGVB 4DNOA 2B8TA 1XZHA 4DEVA 1Y63A 2VQEB 4XR9A 2IITA 4B87A 4F11A 2P2ZA 2G1PA 4FFWA 2WJHA 5ALPA 3MJEA 2Q49A 3S7TA 1DKMA 4N54A 1YS2X 1DPFA 3R0IA 4YAWA 4BKPA 2ZYIA 2OO7A 5FLYA 4CKWB 4RM2A 1TU0A 4CKXA 4ZCRA 4N3BA 4AULA 3ABOB 1XZLA 1Y3IA 4EHBA 2DKNA 5CTAA 5IWAB 3EVBA 3FGPA 4I08A 5LIPA 1I14A 2LDXA 2VSQA 1BKDR 3F74A 4ZWNA 1P4RA 1Y6RA 2ZKIA 3FPAA 4GOLD 4AK9A 3G2PA 5CFLA 2MU1A 3FR8A 5K45A 2KYRA 3B6ZA 2PL9A 2ANCA 1KGSA 2WWGA 1TUEA 2NO5A 3GZTB 2C31A 4UMEA 2RKOA 1N1GA 5DHSA 1O1YA 2PXCA 4F72A 1QR6A 3E9QA 4ARCA 3WI7A 2ODAA 3VU1A 2GEVA 3RE1A 3ND7A 2GXQA 3UATA 2JI8A 2QP3A 3O8QB 4M7WA 2ZYTX 1FLDA 1SD5A 1Z08A 4UE6A 3QLUC 5CX4A 3ZH9B 3I6QA 3DL0A 4PZYA 3EYWA 2FE1A 1CRLA 2VQ6A 4KU4A 3TBFA 3SFVA 3H75A 1G5QA 1NJFA 4TTJA 3PDWA 1QHHA 4INJA 4NP6A 4YXWA 5IUJC 4M3NA 1ESZA 2PG3A 1KEUA 2RHBA 4NBTA 3GN2A 5TR9A 2IUYA 4DMMA 2NMVA 4LY9A 3AB7A 4TSRA 1U7XA 1M7GA 3U5TA 1KEPA 1R7RA 3WLOA 1YVDA 4K9MA 2PGNA 4P7FA 3EF3A 4Z8XA 5EMJA 4B17A 1F60A 2ZAYA 5HM6A 3BICA 2ZCJA 2QUAA 3HU3A 3M6MD 2X5NA 3D43A 3ZY6A 3FZGA 4YLYA 1X0XA 1JIVA 3RTDA 3ONNA 5KUTA 3CMMA 3ITDA 4KGZA 4X6YA 4FT4A 2OQVA 4MYHA 4GBGA 1PGPA 2X2PA 3OQJA 4RK1A 4I7EA 4BP1A 4D0NA 4N5NA 3BG5A 2FQQA 5CB4F 1Y3CE 1EZ1A 1V25A 2FN3A 3JQ6A 2GPBA 3V2IA 1DWUA 3IE2A 2V96A 1Y1TA 3FSRA 2BEWA 4R9RA 3W2EA 4G4JA 1EK0A 1F0KA 2EDCA 3ACBA 3EYAA 4MS3A 5TJHA 2YBDA 2QTVB 5JJLA 4H08A 1UOPA 2FMKA 1N9GB 3ILHA 1BDBA 3QNUA 4GYJA 3VR2D 4LJKA 3KYDB 3QMWA 4U2DA 1SHJA 2DFLA 1Q3HA 4QPPA 4LTMA 2YZNA 5JC1A 2YW9A 1C1DA 1DRWA 3MQ4A 2V7QD 2FI1A 4YT4A 2XMDA 1EDZA 4Z4CA 1GPKA 1HL3A 3OO0A 2YFQA 1IM5A 3L8DA 4NU6A 4Q4DA 3KPYA 4INAA 3RUPA 4CCYA 3JYNA 3CYFA 1UQRA 1K63A 4FGWA 4L9SA 1YVPA 2RGDA 3NQ41 4EHFA 1BEUB 1KBZA 1TC1A 4NDNE 2O57A 4QYMA 1GILA 2G83A 3ONDA 4R6XA 4TSKA 5FNVB 4MUXA 4D6PA 1LU9A 2VRCA 2XUKA 1KOFA 5GOZA 4YASA 1M34E 3EWIA 2I03A 3GLHB 4CIVA 2ZE6A 4V0ME 4Q3AA 1R0YA 4D3YA 5A1JA 4FI3C 2XB6A 3JALA 4MLPA 5DP1A 4AQ7A 3CM0A 2O2DA 1YJQA 3R4VA 3ZDCA 3E23A 3KSDO 4RXUA 2QD5A 3LC2O 4L08A 3M1LA 1TUBB 3EGIA 5JBQA 3WLKX 1O96B 2ZGVA 4G6ZA 1YQXA 2C4HA 2QM7A 3LXRA 5FPPA 3KK0A 2OZKA 1XJQA 2HO4A 4Q00A 1W94A 3TQIA 1H94A 5TMBA 4YRMA 2JJ2A 3DMTA 1UXOA 4LY0A 1H4SA 4ITRC 4JEHA 1KVTA 4OQXA 5LXTB 3SJUA 5C8DA 4TMFA 1F9EA 3SSMA 4H17A 6PFKA 3RUHA 4ZT4A 5JZOA 1DO0A 2QRLA 3RRXA 2CFIA 1PUJA 2GMWA 4PW0A 1C3LA 3FETA 3O4IA 1U1CA 5JBIA 3UK2A 1F8UA 2H8KA 2EKBA 3FH0A 1EXWA 1CUVA 1DUVG 2DWPA 3GBSA 2C3UA 4TKVB 1QYVA 1E7QA 5ARDA 4R1PA 2HBYA 5E6RB 3KQSA 1THGA 3KOXA 2HJGA 5GQSA 5AKGA 1ZK1A 1M2KA 2C8LA 4NHOA 3W2TA 4C4XA 4KQ6A 3F7TA 2FFBA 2ZRQA 4I1RA 5K3DA 2C1ZA 3C74A 3AW9A 4MLDA 2CXQA 1Y1SA 2R44A 1JIKA 4MP8A 4P92A 1LI7A 3TMYA 7REQA 4TWRA 4FW8A 2R6DA 5TIIA 2BT4A 2N0SA 3R75A 5A71A 3WICA 1V9CA 4JVLA 4UTPA 3TZKA 4NYIQ 1K86A 1V48A 2IZOA 2AKYA 4Y9SA 3BS4A 2DE0X 4Q9HA 1KI6A 1TDJA 2EXXA 5H9VA 4EQZA 3TFQA 4WQMA 2H0AA 3I1JA 4PYIA 3NDRA 3FB4A 5E1OA 1K89A 3G9UA 4ER6A 4OP3A 3K1ZA 2B3TA 4GKBA 1WU7A 2XBUA 4IKOA 5TLSA 1VFNA 4C6SA 5A5DA 1GGJA 1R27A 2G1AA 3G89A 3IIEA 1JTVA 5FF9A 3STVA 3WE7A 4BZPA 2GX6A 2EP5A 4IF4A 5DYTA 1JPVA 2QAJA 2R8YA 3QTTA 3WDKA 3CISA 3BA1A 3BAZA 1FTSA 3OX1A 2A0KA 4YMHA 4BMSA 2C58A 1T34A 2P1ZA 2EJWA 4M0MA 3TVTA 4I50A 2J0SA 2C5BA 3E5RA 3NXSA 2O50A 3EISA 4M1SA 3UB4A 1XMXA 3ZKWB 4JV5B 1TQDA 4XYGA 1RZRD 1Y1PA 3PFCA 5AO9A 3NBXX 2FUCA 1NRJB 4MWSA 3GPIA 2Y71A 5I7SA 3IVGA 3SQXA 3MWKA 2D5IA 1FPQA 1I1QB 1TEXA 3A58B 4NI5A 4K6MA 4ZT6A 2RGYA 2I1WA 3X1XA 5CT9A 2ZIXA 1L5QA 4TVOA 1NY5A 3TIVA 2WA1A 1NOIA 3IALA 3VKVA 5A3RA 5IT0A 3FSJX 1PBNA 4RS3A 5J1SB 3O6VA 2W4IA 1NJ8A 3AIMA 4NNJA 4Q1CA 3A2LA 4EX6A 5IF9A 3BMQA 5B1DA 4TN1A 4NF2A 4M0EA 4OQYA 3UK0A 4BV3A 1MC1A 2YVLA 5B30A 1WDWB 1OX4A 1P0IA 2DM6A 3LCJA 4AAYA 3JX9A 3TQFA 4IGFA 2ZAOA 4JEIA 4N3CA 3DOCA 4R3NA 1XVTA 2P4EA 1X9HA 4CL0A 4ZYWA 3FTFA 4K40A 1X1RA 3BQMB 2HUPA 1U9JA 2RK6A 2WHPB 3MZ0A 4PS0A 4B0PA 1MOSA 2CCGA 2PTGA 1TO6A 1JGTA 1V16B 2ETXA 2WYVA 5ECYA 3SNKA 2GF2A 3BJEA 1CY7A 2VJCA 4YAFA 1UT6A 1EXNA 1Z29A 2B83A 2QSJA 1LC3A 2X3UA 2QQ0A 4MQFA 4QSHA 3ZU2A 5BQXA 1P1BA 4V1CI 2YS7A 2XGJA 4Y9TA 2ISSD 4QUEA 5B1YA 3S5JA 4B43A 4LCJA 2GTIA 3ITKA 3LUFA 2W43A 3GZNA 4G23A 2HRRA 5EPOA 1UQTA 4JLUA 4BFLA 1SUAA 1I1OA 1CYEA 3BRSA 1WXGA 4M86A 1L7XA 3WBJA 5IVIA 1L0BA 4IS2A 3RDPA 3RYFA 2BFAA 4YMTA 3HJHA 1A8HA 3B48A 1AO3A 2F55A 1AXEA 3BJIC 1R66A 4N8SA 4HNTA 3MT9A 4TQGA 4ZTBA 4ZVPA 1LTKA 3RCBA 1QH9A 4TZ0A 2FPIA 4TLEA 2OFPA 2WYHA 3SF0A 2C2KA 5IM4A 1MH9A 3GQBA 1ACJA 3G8YA 3BRWD 4E0BA 4A1FA 1YOBA 1IEVA 5KJ1A 2C03A 1AXRA 3WIEA 1WVGA 4O33A 1SZPA 2AQKA 4ARBA 2C8KA 4U02A 2RBKA 2W48A 2B7CA 3HP7A 3FSGA 4LMBA 1SNYA 4BN5A 2YN0A 4BZWA 1BX0A 4CMIB 3SCZA 4EJ0A 4D8UA 1KIFA 3SC2B 4OH1A 5TQ2A 1S3FA 3F4BA 1BGVA 1NW5A 2BHTA 5K3FA 3M3DA 2RHTA 1JQ5A 3I2IA 1AZWA 5G1PA 3UVEA 5EWLB 1MAUA 4AJOA 2XKAA 3L2OB 2CCJA 3MWGA 1XTQA 2WAAA 3K9WA 1QRTA 3EWAA 4OHPA 3WQQA 2ENUA 1SVWA 3OEYA 3P20A 1HE1C 5LCXA 1Y7PA 2FCAA 2CMGA 1ZICA 4HYQA 2P40A 3VHRA 1PL6A 1MR3F 1T9AA 1ND5A 3DWEX 2YZMA 4A6EA 1A96A 4YX9A 2HV9A 2G6BA 2RE8A 1V8PA 1T36B 4P3KA 2GN6A 5B1HA 1AKEA 1OGYA 1IBLB 2JGJA 1HZZA 3NTVA 4C22A 4Q4HB 4CYMA 1SVSA 4NJEA 3BHNA 5THKA 3UIEA 2UVQA 1O94C 3HG7A 5ADUS 5KDOA 3GJ6A 3JQ8B 5LZ7A 4A7PA 3MJFA 3NAMA 3ABRB 5E2BA 2VYNA 1W8DA 4N8EA 4Z54A 3V4VB 4IDBA 1LQ2A 3AC0A 4DIDA 3GFTA 4EPTA 3AR8A 1E6KA 4G5HA 1K3UB 1PJAA 3DS8A 3I2KA 1W59A 4PZPA 3USZA 3JSAA 1L4MA 3GEGA 5AW6A 1A7UA 1K7FB 5DBOA 1W1UA 1GG2A 2VHQA 3AY7A 4LE1A 4Q1FA 1P80A 4C9BA 2ZBPA 3UEOA 4B45A 4KH1A 3U0BA 2P75A 5ITWA 4IOLA 1UBHS 4DRXB 3FTCA 2WYWA 3FWHA 5ANRB 1ZH0A 2Z2XA 1U8EA 2OQRA 3QLJA 1VECA 1Z62A 5P21A 2G9ZA 3EDQA 1FFHA 1N2SA 3GD5A 3LJKA 3NKVA 4GUDA 4PAQA 3UNXA 4MW1A 4MO2A 3JZFA 4DM3A 4HRXA 5EEHA 1NXSA 3W9BA 1X87A 1SKMA 4YAGA 2NGRA 3KJZA 4OIFA 1B7GO 3O95A 1NUTA 2MR5A 1UODA 3GLVA 1JA0A 2I6QA 3EG9A 3LYUA 4I5FA 2GEKA 1L4UA 3ZOKA 1GZUA 2P2DA 2CVHA 3WB9A 2GM4A 1M2OA 3A2KA 2M9MA 1FK8A 1W35A 2TYSB 1P2GA 3OOEA 4IQFA 1OE0A 1ZMXA 2CB9A 4DMFA 1KEKA 2XCRB 2JCBA 3HXLA 3PVSA 4PX5A 4LTNA 1VJ0A 1PZMA 2ZDHA 3RVQA 1L5MA 4BGUA 1D2CA 2I1QA 4X61A 5DYIA 1VHQA 2P8JA 3ZWMA 4ERXA 4HDMA 3EOBI 1MJFA 3B20A 3BJMA 3PA8A 4LCEA 3WXBA 4CJXA 2OORA 1FVHA 2I2AA 1D4ZA 3UYKA 3DUWA 4TL9A 1GTZA 1OB2A 1XKTA 1EQAA 4V39A 1X7DA 1XALA 2DPMA 1PJ2A 1BNCA 4OXXA 3A9SA 2YOHA 3JAWB 5KYVA 4AF6A 2PRYA 3TSCA 2V7VA 5H9WA 5HZGA 4UHDA 2DUWA 3EVGA 2ZR9A 1O58A 4KPUB 2OCIA 4TV9F 5IXYA 2QM8A 2JBAA 4KKVA 1GZ5A 2DQZA 1DARA 4HWPA 5U9CA 2C4UA 2IDKA 1O57A 3KOOA 2VTDA 3HUTA 2X9VA 3MRSA 3VVCA 3GP8A 1IN4A 2ZETA 2OMEA 1R12A 1O95C 4M8SA 3QKIA 4ILKA 4AVYA 5TPZA 4PNPA 5K3OA 2EZ4A 3E9CA 4IO0A 2Z3WA 5IDXA 3AJDA 3BN3A 3QNMA 5J3JA 1XEXB 1IULA 2B30A 3OG9A 1YQTA 2YIJA 3L9XA 4QDJA 4YPFA 5LOVA 2XE6A 2FZEA 1JFSA 3LS2A 3QPDA 2QKYA 3QVVA 1SKYB 2GLUA 2YHIB 4J2TA 5C81A 1E2BA 2EP7A 1S2LA 1TA9A 1MJ5A 3I83A 4C3UA 4DCJA 1PWHA 4PAOA 4F9FA 4H1UA 3OZAA 4B73A 3VNRA 5FWNA 5LSAA 1AMNA 3H8WA 3O94A 1HLDA 4K9NA 4MYDA 4GWKA 1YZKA 3WGOA 4P4NA 5JYDA 1A82A 2FWAA 4GRAA 5F1PA 4OGWA 1HQKA 1JQDA 1AHIA 4I4TF 2R8PA 3NH6A 2PX3A 5J5VA 1XIVA 3TAUA 2OO5C 1C41A 2GWHA 3ROMA 1UC9A 4CFSA 5EJ6A 4AM8A 5HYVA 3E4CA 4JI0B 4MR8B 5C7IO 2Q6OA 1BX1A 4OFXA 3R1IA 4QQKA 3TLKA 1U7UA 2IDMA 1MX3A 1X6VA 3AG5A 2HQOA 1C9DB 2HWUA 3MWFA 5DBEX 2R25B 4B4OA 4CTNA 5I3CA 3QITA 2RGEA 5H80A 2R4QA 3GCXA 4IRXA 4KNWA 4M76B 5B7QA 1U2QA 3D4BA 3RASA 5HA5A 1VSVA 3M4XA 5C4GB 2D2XA 1CY4A 4QDTA 4BMPB 4D3SA 5KS2A 1YQDA 2JI7A 4JLVA 4MVJA 3CZ9A 4X9XA 1U7PA 1IQRA 4OTZA 2FY8A 1QBGA 5E7MA 3HN6A 4EFNA 2ORWA 4G9BA 2SHKA 2WWHA 3IRUA 4FLFA 3EIEA 3WGVA 2ZSEA 3E3NA 1B2LA 3L1JA 2VT6A 4HKTA 4GYYA 3OLYA 5SZKB 2JGEA 3ZCQA 3HCAA 1DZIA 4C07A 2CNBA 1WCXA 2XV1A 2XIQA 3AFMA 2DPXA 3OWHA 3MB5A 1IHDA 1Z06A 2V58A 4GOMD 5DNVA 3GYGA 3NC0C 4D44A 3GFOA 1Y6QA 4P38A 1WDLA 2BE9A 4WZAB 1TZMA 3WYAA 4YRRA 1CVRA 1PNQA 1RI5A 2QRPA 1AKVA 3L8CA 3IR5A 4YT5A 5SYMA 5AK3A 4KI0A 1A4UA 1DV1A 2GBLC 1J07A 2GJ9A 3W78A 4M0KA 5ILOA 2JLZA 3U61B 5CFNA 2BH2A 2QPOA 2YWXA 5K4AA 1YBAA 2JCXA 4ZALA 1M6WA 2I87A 2AXEA 2MR6A 3H65A 1W0KD 1DSSG 3AVXA 4Z0TA 1U9YA 4FM9A 1RHMA 3X1JA 1T2FA 3GZJA 4DQXA 4YJGA 4X71A 1UOOA 4BECA 4FEAA 1NIPA 4OHVA 1S8OA 1NMEA 3CONA 4LISA 2OM2A 3GELA 2A3NA 5K1ZA 1WSDA 2I6GA 1KFBB 2AOWA 4YAKA 3PUVA 4MWDA 5AP9A 5KJFA 1GQYA 2ACVA 2YJ4A 4UNPA 4X8MA 1E2IA 3FFAA 3MWJA 4TT8A 3P9QA 2HQBA 1G5HA 2VAXA 4BLVA 4BNDB 1ILWA 3VAAA 3GU3A 3UUFA 1M2EA 1U0GA 2IS6A 2WTMA 3SM3A 3KPJA 4JJ8A 1MPTA 1RE1A 4WBNF 1NV9A 4WCFA 2DBVO 1Z38A 1I9GA 3E3LA 3WIUA 3WK9A 1FYFA 4KHZA 1VJ1A 2PL3A 3DOIA 3LDGA 2IY9A 4LE0A 1GQ2A 2D4AA 1GGEA 4H0FA 3RJMA 3ZYCA 4W5JA 5I4CA 4JENA 5FTKA 1K6EA 1I30A 1MB2A 1SXJE 3CZQA 3WK8A 3ZY3A 2QGNA 3GCZA 5C1DA 1IZZA 3D1JA 4WKPA 3BK7A 1PNRA 2FAXA 4OQDA 2C8VA 2J9YB 1NQXA 5T5QA 4JK3A 2V7EA 3UFXB 2IEBA 2AGVA 3BHIA 4Z4EA 1WHSB 1IPFA 5LQJA 4GYWA 4WE3A 5B2ZA 3EUEA 3QW4B 4I0WB 4F86A 3QPBA 4A2WA 4JL8A 4UVIA 2QR5A 3RKSA 1JE0A 4AUEA 2QTTA 2B6HA 2NZVG 1OA0A 2BWJA 4RSHA 2COUA 2CBZA 2QX4A 1Y8ZA 2NYRA 2QYOA 2CLMB 4LSWA 2AJCA 2J3KA 5DTJA 5TXGA 1N4AA 3SHTA 4W4TA 3LT0A 1NBHA 5K09A 2OFOA 1Y4AE 4GL2A 5ADVA 1KBOA 1KZ6A 4MCIA 4OGLA 2O8FA 1QFJA 3I92A 3E70C 1P2UA 1P75A 2X0KA 3UV7A 1HT2E 1EYZA 1YQ9A 1EK6A 1XMVA 1YR8A 5DO9A 4RMHA 5CDFA 1WXHA 2RBGA 2E4XA 4BJ3A 5A06A 4UTRA 2CNNA 4YRLA 1GRVA 4NZ9A 2EERA 4BQPA 4LF6B 4GGMX 5JO0A 2RGBA 2JIDA 1XZIA 5DN6D 2FRDA 2PGDA 3NFYA 1AG9A 2C2WA 1SUPA 1XD9A 2BHNA 4KQXA 2HXYA 2KBEA 3OIUA 4QGGA 1UBSB 1ZJWA 5JH7F 1I3KA 1ZITA 1X1SA 4U6SA 3TX2A 4ADSG 1ZISA 4GLJA 1Y7LA 4UFNA 2IH2A 3OCVA 2XB2A 4F5EA 5FLXA 3NG1A 4AROA 1P44A 4EAAA 3OX2A 4G0QA 2UUCB 3KTDA 2NU9A 3F2IA 1HRKA 5DISB 3ZX5A 3L7JA 5CW2A 2GZSA 4BCBA 3LUPA 2CL6X 3TOCA 4G3XA 3U9TA 4DDMA 5HJ7A 3TMKA 3UXEA 4M98A 2DBYA 3JAKB 4M7RA 5DXAA 3K6SB 5FOWA 1JG1A 2WB4A 2ZE5A 3CUYA 3PTZA 2VBFA 2WIJA 1XI2A 1TCCA 3K09C 3QFSA 1FNSA 1Q0ZA 1VXOA 4Y6LA 2GK7A 1TUIA 4JBYA 3MJ4A 5JOQA 4BNVA 3G2HA 1EVIA 2J5RA 1KMQA 1U65A 4AZ0B 1KO1A 3K96A 3F5MA 4G36A 4O2AB 4XWAA 1QYDA 3NOOA 3G0CA 4RK0A 1HEUA 5J2UA 1Z12A 3KKOA 2HF8A 4PGFA 4K9SA 5HWSA 3I3SR 2HMUA 5AVYA 2MSCB 2QUZA 4MVJM 1Q7CA 1A9ZA 1E18A 1BOFA 4RM3A 2H2GA 4O2BB 2VVTA 3R0XA 3R7WA 3HY6A 1R4MB 3F7OA 4D3XA 1ZUWA 5IARA 4TMKA 4TMYA 5AOCA 5LZ2A 3KT8A 1Z5GA 3N7TA 3TEJA 4AI6A 4MQEB 1FJ2A 4AICA 2D13A 1ISGA 3G02A 4L3WA 2IP4A 4NJMA 4U7TB 4WN9B 4IXDA 4GOJA 5GONA 2P4HX 4C4OA 3OEED 4KVGA 5D6OA 4EABA 3QOFA 4GZLA 3PGKA 4IF6A 3NHKA 5HOEA 5ITVA 3ADBA 1YAHA 1ML4A 3TNYA 2J5XA 2R1VB 4RMIA 2DQKA 2WVJA 5F77A 3UH0A 1OFUA 2IVFA 1N5MA 1UDBA 2EL9A 4ZVVA 2FLKA 3NVMB 4J1QA 1CCWA 2JAWA 1YB6A 2H0RA 3IXQA 1KVQA 1K97A 1YSCA 1WF3A 2JH3A 4MKHA 3BK1A 1MEEA 4R7TA 5BPFA 2E5LB 1U90A 1Y37A 4FHFA 3UCXA 4DILA 2AR0A 4CQMD 3E35A 3IOEA 4LSGA 2GERA 3A1TA 2WK1A 4BS9A 2Z2KA 4Y2TA 2ZYVX 4CHTA 5IJAA 4DCGA 4OQPA 3JWJA 4P0PB 4YGYA 3CWCA 3EOZA 2BMJA 3KKQA 4Q9IA 1YR3A 2O19A 4YJHB 1JJIA 4A0HA 2C4TA 3DAYA 3RVNA 1BW9A 1MVOA 4LHWA 3OCCA 3NIGB 3X2FA 1UWVA 4RY8A 1NQ5A 3TNFA 4KI7A 2HJ9A 3FKQA 2ON6A 1M83A 3PUIA 4Z3OA 1ZY2A 3NHRA 4HZUB 4CLRA 2C82A 1XF1A 4ZJYA 3T5CA 3U7JA 1NQAO 1R6XA 3OFND 3SQLA 3JQBC 4EX7A 2A9OA 2OM6A 2XQKA 2A1UB 3AEUB 1VHLA 1G5RA 1QXSA 1V5GA 2IOFK 2IYPA 2FQYA 3KZMA 3IQEA 4MZXA 3AVUA 2C2BA 3O75A 4I9HA 1AQYA 2G72A 4PCLA 1E1DA 2QX6A 1KWKA 4PGHA 1OH7A 4TWJA 4JDUA 4TKLA 4BC0A 4D2IA 3RYCB 1PAUA 3CNNA 4N65A 3LGXA 4CMGA 1IY0A 1JALA 1U3TA 2G06A 4GP7A 3OOWA 3TZCA 4ZCMA 2VNIA 1H3FA 4QDUA 3EW7A 2Q28A 4RE5A 3DZCA 2P11A 4EL0A 3EBOA 2FJPA 5AD1A 3RTAA 1FRQA 2ZB4A 1EFAA 3EGDA 1VL1A 3C3PA 5F64A 2R4UA 3CTMA 1CP3A 2KI5A 4IIBA 2ZAGA 2OP0A 3DXFA 4JHXA 4KO4S 2PZFA 3HYLA 4B8ZA 1L6RA 1N0UA 5IYZF 4F3YA 2NQTA 3HWWA 3OA0A 1IZ9A 4QRHA 5CNMA 3SXJA 3ZBQA 2VKQA 3EVDA 1EX9A 1RNLA 1SBQA 3SXUB 3UAYA 4B9EA 2ZP1A 3NCHA 4DADA 1JDBB 3WL8A 2HSZA 4JFAA 1G20E 1PJRA 1SC6A 1NJ6A 4CM4A 4HDCA 4ZOLB 3QIVA 1QRAA 5HBRA 1C9YA 2OD7A 3Q0TA 3H9QA 3FLBA 2J0VA 3ZVLA 3VO9A 4M6WB 2PMBA 3UG7A 1ECJA 4N0PA 4R1MA 1SOWA 1S2GA 3N74A 1GZ3A 2BFBB 2CB0A 4X00A 5D85A 4LDPA 1OJLA 3TINA 3KQWA 4ZMBA 3C97A 3ASZA 4XX1A 4BJ6A 4BQSA 1G59A 2G9VA 1NM5A 2A9RA 2RHMA 4KPFC 3J80A 1XRRA 5HRCA 1FDWA 3EEBA 1NASA 3GEEA 1RD4A 4FXPA 1EPUA 4R8VA 5T3UA 3K35A 2WIBA 4TLLB 2C5EA 1UWCA 4LC0A 3RGGA 3WDMA 2G5PA 3PF8A 5CVUA 2R7KA 5J9FA 1YK0A 2I2XB 4JZYA 4OI0A 3AY3A 3ZDFA 1ZVMA 4JN6B 1XAHA 4JI5B 1KZHA 1TZCA 2SKCA 3T1NA 3TQRA 2XJ4A 4PFKA 3ZDYB 2YWFA 3HCCA 1PLLA 1JECA 3QLEA 3TKYA 5ILQA 3LT2A 4R31A 3KXIA 4K6CA 3EFHA 4WCVA 2WF8A 2WAXA 2DR0A 1K0UA 2NZUG 3IVXA 2VEOA 5IXSA 3GGCA 2P5UA 4M22A 4LF8B 1IU9A 5LA6A 2HCBA 4OXKA 2ZRCA 4QWMA 1ATIA 1O97C 2A7XA 4C3ZA 1VKNA 3N0TA 3P9XA 4L78A 3OO1A 4D4HA 1ORIA 4MKFA 2VRBA 3TLCA 3SYRA 1CJTC 4J0EA 4EY8A 3WLJA 4U6NA 4AKHA 1ZX1A 4RKYA 1QRSA 4YT8A 4OV6B 2G09A 2I7DA 5BUSA 1SEVA 2MSWA 3BFJA 2CV1A 2AFHA 1OW3B 3GLIA 1PG5A 3N8DA 4DJJA 2C2ZA 4EB3A 1OBOA 4Q1VA 4GOKA 1PDVA 5FNZA 3R76A 4ZV4A 2GYYA 2O48X 1EIZA 3KDPA 4A15A 5KNCD 1RQRA 3N0WA 3W5DA 3M33A 4BMDA 2FWNA 2W8BB 3NIWA 4GMXA 5G40A 4R9UC 5D3MA 3QVLA 5AVTA 2XNDA 3E81A 3ZYZA 1ZBDA 2B3DA 1WP9A 3IMGA 3OCXA 1Z0UA 4RIFA 4OYYA 1M6YA 1VL5A 5JVDB 4KN5A 2I80A 3O1IC 3OLWA 4HJXA 1PX0A 2OG1A 2V4UA 4Z0PA 1IFXA 1NVVR 2EARA 3NM4A 1AB5A 1QKKA 3PGVA 2KJQA 4FN4A 2HOQA 2LIVA 3S81A 3AF6A 1WHTA 1GU0A 2Q3EA 1GP2A 4BEBA 3C6ZA 4RNCA 1W5FA 2FF5A 4BNWA 2OVFA 3BA6A 2GZRA 5FX2A 1ZHOA 2X22A 3QY0A 4TTIA 2AZMA 3AKYA 1YASA 1U2DA 2R2GA 1T9BA 3EQ7A 3G85A 1NVXQ 3QE3A 4WDQA 1NJ2A 1R9GA 5CVJA 4L27A 5IKMA 3KXKA 1K3TA 2E82A 4DLAA 2LE0A 4F5ZA 1KR5A 1SVKA 2V6GA 5F5LA 1I5OA 4WEQA 3GMTA 3K5IA 1L3CA 4AIIA 4JQZA 1A04A 4IIUA 1NTOA 3VKUA 5E7IA 4TMZA 4G2NA 1YWGO 1E3LA 2DBQA 2WILA 4BBJA 1NI3A 3AWIA 1LWNA 1VYUA 2F3TA 5CYGA 3T3HA 2IQIA 2CY0A 3CLHA 1KQOA 3KT0A 3W8FA 3NKLA 1EBFA 1EJ6A 2CSXA 2D3WA 1D2EA 2MYPA 2Y67A 3OTHA 3ACCA 3C5HA 2WF7A 3ORFA 1QVWA 1S0UA 2UKDA 4OBEA 2P6UA 3KFLA 4QAQA 5KYGA 1KQFA 1HR0B 3I5YA 1A2KC 3TG8A 5ICMA 1A5TA 5GIPE 2NZJA 1IAQA 2IIBA 2JI9A 4LSZA 1QCYA 4W7HA 1KY4A 2NWQA 5JNUA 4EENA 2GHQA 1T9ZA 4ZJUA 4OM7A 5HG0A 3W5JA 2YIDA 1JG6A 1A69A 1JZQA 4DARA 4LDAA 2I33A 1N2CA 1PQYA 3DE0X 3URKA 2A94A 4DLLA 4D4KA 4AJIA 1IEWA 1UUFA 5JTTA 3USES 2A0XA 1OBCA 3ZIAD 1VMKA 1GNTA 4PTZA 1AKQA 4YAEA 3WMGA 3ET4A 1FFSA 2ZB7A 3C8ZA 4FFDA 3QLUA 4GX5A 2DUMA 1J2JA 1OROA 1ORHA 2PJDA 3OIWA 4HDRA 3SEQA 1MDFA 1P9NA 3V48A 4YWHA 4MRRA 3OUTA 4G67A 4QD3A 1U8AA 2BGIA 3FI0A 4EB6B 2PKRA 4Q5IA 4X1IB 4Q48A 1V6AA 4ZI2A 1GSAA 1XXLA 2KHZA 1MF7A 3M89A 1CY8A 4WLOA 4YP0A 1NUUA 1ZVJA 2AG5A 4JUBA 1M33A 1XA3A 1RC0A 2JHAA 2NT3A 4BMNA 4ZYXA 2CV0A 3W8RA 5JISA 1SQ5A 4GOXA 2I2FA 2ZI4A 4D9GA 2YJTD 4EI8A 3WJAA 4LWQA 4EG1A 2ZJ3A 2DHQA 1S3SA 1UXHA 3DVAA 1U7HA 3PKIA 5ELMA 4RGYA 2HO5A 3NXKA 3R2JA 5CMLA 1QFSA 2G6TA 1CU1A 5A9SB 4PQRA 4CUJA 2NV2B 4KLCA 4AJ2A 3KQLA 2UDPA 2W7TA 3QYPA 4MJ7A 2D1FA 4RTMA 1ZNZA 2NPIA 5J5AA 4N6NA 1TM5E 4LIPD 4MVCA 4YAUA 4MI1A 2VFAA 4IJUA 2A0FA 5CB8A 1YQUA 4LYDA 5KQSA 1C5KA 1QZTA 2FDXA 3RNOA 2GZ1A 2XCIA 4BFCA 4AU1A 4FJ1A 8GPBA 2PVSA 1P19A 2YZ2A 1C1YA 4EF6A 1DHRA 1QV6A 2P91A 3OQ6A 4FFLA 4OQZA 1J2TA 4ROSA 3UY4A 4QQFA 3FB1A 1VRVA 3W1WA 1X7XA 5CK5A 2FW8A 4U00A 2OV1A 2J0UA 5T3YA 3VR5H 4NENA 1U28A 1F0YA 1T1RA 1V3QE 1P3DA 1VBKA 2K2WA 2PJUA 2REXB 2XB8A 2ZBUA 3H99A 1GA4A 4KAAA 1ONNA 4KFTA 5F98A 1I6KA 4AW9A 1ZD3A 1DAFA 2IF2A 4YS6A 4MS4B 5E9JA 5C0OE 3OOJA 4BIIA 1EHIA 1E3MA 4NC9A 1JEQB 1KJZA 1CP2A 4LQ4A 1CLEA 3O21A 2NXNA 2J4DA 3HN2A 1TKRA 2W6ID 3NM5A 1BHSA 3GRFA 4JUFA 5EG5A 3DTVA 1C2TA 1Y8QA 3SF8A 1J0AA 2FR1A 3AP3A 3MMSA 3AHGA 1AHNA 3IQXA 2XAAA 1RIIA 2Q41A 3OY2A 3ZZ0A 5TPWA 3RFTA 4N7JA 1IQPA 1BS9A 1P62B 2JRLA 3AF1A 3K2BA 1JG7A 4RFSB 5FBHA 3STWA 4CNQA 1Z7EA 2Q5LA 3QBVA 2DWUA 4MVWA 3EC2A 1GQRA 3MJRA 4L4RA 1J21A 1RR6A 1E7MA 1QQ7A 1Y80A 5KQRA 1Q1GA 3ORYA 2BV3A 1PZGA 1TFRA 3OM9A 2GZ3A 4N40A 2XT9A 3ZLUA 1B4DA 1NYRA 5EZSA 4F1KA 4E70A 2G9UA 3PDIA 3N07A 5B4TA 3GPBA 3GLQA 1N9ZA 3WWCA 1JLHA 5CYFA 3AW8A 1PQPA 2TS1A 4JLMA 4C1NA 4B71A 3V8QA 4HWTA 1ESNA 1ZWLA 4B81A 4DC1A 4ENRA 1SHKA 3QENA 5GJBA 3PLAE 3SAJA 4H0NA 4XD7D 1CJKC 3LKVA 2XQJA 1WCIA 4BFSA 2C5HA 3BBLA 4WNAA 1W1WA 4RGQA 3W5IA 4YRJA 2ASVA 5IDYA 2NACA 2X1MA 3RU9A 1J0EA 2B5WA 2D7JA 4G4IA 2FPKA 5FUWA 4DNPA 1B14A 2G0NA 4NTZA 2XB4A 4PLHA 3LMKA 4BNTA 3O91A 3AIKA 1NN3A 2QRVB 1QK5A 3C6BA 2IY7A 3IVMA 3PITA 1H9AA 4MGIR 4FEEA 2H4XA 3E0XA 1ZMTA 4OOEA 1AV7A 1JEDA 2FOXA 2QTHA 2R11A 2R00A 4XCQA 4LA4A 4M9SA