3HDYA

Crystal structure of udp-galactopyranose mutase (reduced form) in complex with substrate
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
365
structure length
365
Chain Sequence
b'QESKGFDYLIVGAGFAGSVLAERLASSGQRVLIVDRRPHIGGNAYDCYDDAGVLIHPYGPHIFHTNSKDVFEYLSRFTEWRPYQHRVLASVDGQLLPIPINLDTVNRLYGLNLTSFQVEEFFASVAEKVEQVRTSEDVVVSKVGRDLYNKFFRGYTRKQWGLDPSELDASVTARVPTRTNRDNRYFADTYQAMPLHGYTRMFQNMLSSPNIKVMLNTDYREIADFIPFQHMIYTGPVDAFFDFCYGKLPYRSLEFRHETHDTEQLLPTGTVNYPNDYAYTRVSEFKHITGQRHHQTSVVYEYPRAEGDPYYPVPRPENAELYKKYEALADAAQDVTFVGRLATYRYYNMDQVVAQALATFRRLQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-galactopyranose mutase
molecule tags Isomerase
source organism Deinococcus radiodurans
publication title Structural basis of substrate binding to UDP-galactopyranose mutase: crystal structures in the reduced and oxidized state complexed with UDP-galactopyranose and UDP.
pubmed doi rcsb
total genus 116
structure length 365
sequence length 365
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 5.4.99.9: UDP-galactopyranose mutase.
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03275 GLF UDP-galactopyranose mutase
A PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3hdyA01
4KUEA 4CLEA 3F46A 5COAA 3VPFA 4WNIA 2V6MA 4WCFC 1G6KA 3SEFA 1H6BA 5CHEA 1I3MA 3PZBA 1MXHA 3WGQA 3E9QA 4RJTA 4AJKA 5IG2A 4B7UA 2YHIA 1MA0A 1KEWA 3F5SA 2W4QA 3PGJA 5K6AC 2X9NA 3O03A 1ENPA 4XYMA 1E7WA 3LVFO 5TF4A 1Y5RA 2OP0A 3N74A 4FD3A 5EINA 1R6DA 1SNYA 1HSZA 5EQFA 4BV8A 1PJ3A 3H9UA 1I8TA 2JFHA 4P8RA 3FR8A 3RQSA 4OQZA 4CODB 2VOEA 4DREA 3OA0A 3OSUA 4MVJD 3K2EA 3MTJA 1ADFA 2OP1A 2WMDA 2P4HX 3NUGA 4L4RA 3S2EA 1BDMA 1NM5A 4K6FA 2PTGA 1ZFNA 2FR0A 1P44A 2NUAA 4XIYA 1ZUD1 2O50A 3JTMA 5L95A 4IJUA 1LSSA 2I6TA 2F00A 2G0TA 3GAFA 4WECA 1P1JA 3LLVA 4WNCA 5JYEA 1XQ1A 3FSRA 2EG9A 4BV9A 1ZIDA 2H9IA 4J4TA 4MP3A 4Q3AA 3VDQA 4EUFA 2X22A 1R37A 3RD5A 4BNZA 1H9BA 3AM3A 3C7CB 4AJ4A 2CY0A 4WOJA 4J9VA 1SBYA 3QWIA 5FFFA 3OF2A 3G1TA 4B7XA 4GL4A 1P1FA 3ROKA 2Q99A 3PJFA 4PLWA 4EJ6A 4EW6A 3NDJA 4EJ0A 5DZSA 4LW8A 5L51A 4AJNA 1WVGA 3X2EA 4CLXA 5GMOA 1D1TA 3K31A 3KUXA 2D5CA 4A73A 2Y67A 3I9NA 1CETA 3OM9A 3EC7A 3TN7A 4E13A 3WSVA 2P91A 2HRBA 4UREA 5MGBA 3PWSA 3O26A 3CPSA 2Q4EA 4GMFA 3I3OA 5TRTA 1A9YA 4FJ1A 1XLTA 3FF4A 4KZPA 3U62A 4KWIA 1ISJA 1DEHA 3ZWVA 4AJOA 4D0RA 1AGNA 1ZSVA 4TQGA 4ND2A 2JCXA 1FXSA 4XQGA 2PD6A 1YBMA 3RUAA 4IMPA 4Z3KA 1VPDA 4A2CA 4D79A 2XAAA 1Y9AA 3ST7A 4DTIA 4CMHA 1PJQA 3GR6A 1MFPA 3ZHYA 3WWYA 2FHSA 2WD7B 3QVTA 4XYLA 1QP8A 4BVAA 1NAIA 5BNTA 4DLLA 1UXGA 4HBGA 4HX5A 4QO7A 1EUCA 1PJ2A 3E9MA 4MVJI 5L7TA 4Y6PA 2YQ4A 4W99A 4MDHA 4N18A 4WLVA 4F6CA 7ADHA 4U6QA 2BI7A 1SPXA 4RL6A 1LQUA 2NU9A 3UGKA 1DIAA 2B0JA 5F5NA 3PWKA 3H9GA 5BSGA 1KY5A 4BB6A 2XOXA 4R3NA 3E03A 3LC7O 3Q1LA 4P4NA 1ARZA 5T8KC 4ALKA 3UVEA 1ISIA 3G49A 4L4XA 3C85A 2VWHA 3KRTA 2EKLA 1ZNQO 4O59O 5DOZA 1LQTA 4CQLB 1HDZA 5KKCA 1DJNA 4RPJA 4R1NA 1Y81A 1SB9A 4XKJA 3WGIA 3GFGA 1R16A 2JD0A 5TSDA 2PGDA 2QW8A 1VL6A 2EF1A 3W4JA 1A4IA 1JAXA 2BFOA 1CRWG 3OIGA 2J3JA 3VTZA 2X9VA 1Q7CA 1UZMA 1N7HA 1IUKA 4GQAA 2IODA 1N1EA 3P2OA 3CE6A 4GAEA 4GKBA 1VJ0A 2X8LA 4HV4A 3RU7A 3UHAA 4ND1A 1IHYA 2WWRA 2X4GA 9LDTA 4PLHA 1ISMA 1QG6A 4Q3BA 1M6HA 3QVOA 1VKNA 1U7HA 4IGFA 4XIJA 3EYWA 3K92A 2NVUB 2O3TA 2YDXA 3PIDA 5COQA 1YS4A 4XQCA 1NFRA 4OAQA 4BMVA 5AQ1A 4WLFA 5TT1A 1F06A 3QSGA 5EERA 3RUEA 4B8ZA 2DUUA 3KV3O 2VZ9A 5HM8A 1EBFA 1ENZA 3LYLA 2G1UA 4N7RA 3VAZA 1EK5A 2GZ1A 5JCXA 1DB3A 1XG5A 5EL0A 4ITUA 5A02A 3C7DB 4R1TA 3RCBA 3SBOA 4J43A 4FB5A 3H5AA 3D3EA 1I5RA 1KOLA 4DIOA 3E9NA 3JSAA 3PDUA 1VSVA 1LRKA 1I01A 2FY8A 3I4CA 3BMQA 3VZQA 4ZQHA 3TZQA 5F1KA 1YJ8A 5B4UA 4E2ZA 3VDRA 1V6AA 4J3FA 4XYGA 2O3JA 1HYEA 2WE7A 4OJNA 1HE2A 4TRMA 3ZHBA 4DLAA 4E5NA 3VHRA 3EVNA 1U3VA 1PJBA 2QZZA 2ZKLA 4LVUA 1DAOA 1YJQA 1T4BA 2EJVA 4ND4A 3ONEA 4PVDA 2Z1NA 3CINA 4YB8A 2P9EA 5B37A 1P45A 4LCEA 5T8KA 4D43A 1HYHA 5DDIP 3MJCA 3MWDB 2O23A 2Y66A 1AXEA 1GV0A 5L4LA 2J3KA 3QWHA 1HDRA 1BW9B 2V6GA 3WS7A 1O9BA 5ICMA 1E6WA 4DGSA 3ZDFA 2VHVA 2NWQA 2BF7A 1I3LA 1WZIA 4ND3A 1IZ9A 1B15A 3GVIA 2Y1CA 4CLDA 4A7PA 3TZKA 1MLDA 2VT3A 3T4EA 5HTOA 1D1SA 4A26A 4YXFA 1S7CA 3ZH2A 2QQ5A 4NI5A 3QWAA 3TOZA 2BMAA 1ADGA 1HL3A 2GF2A 5DBGA 3IP3A 2HMTA 2VHXA 4EUEA 2D8AA 5JY1A 3H3FA 2VUSA 5DT9A 2WJPA 1X7GA 3A1NA 1UAGA 1EBUA 3TZ6A 1Q7BA 3OHSX 1C1XA 5I9LA 5MDHA 1SB8A 3DONA 4CQMB 1UZNA 4AFNA 4CV0A 1YDEA 1XKQA 2ZTUA 9LDBA 1DJQA 3ON5A 2X0JA 3ITDA 2VOJA 3GGGA 4UVDA 2Y0EA 4YT8A 1ZSYA 4PLCA 4J2HA 3CUKA 1EVIA 5BR7A 3VPHA 3GY0A 3KM0A 4J49A 1DFHA 3BMNA 3MCVA 3GG9A 1J49A 3AY7A 2EERA 1LC0A 3INTA 2QHXA 2B35A 1JKFA 1IOLA 1MC5A 2Q1UA 3HUDA 1DIRA 5CDTA 1AE1A 1XU7A 3H9QA 1HSOA 3B1KA 3JD4A 4WLUA 1T2DA 5TGDA 3WNVA 1OFGA 4YVFA 1EUZA 3IQDB 3ZHZA 4QUKA 3DFZA 5IXYA 3U5TA 4PN3A 2GASA 4J0FA 1J4AA 1JWBB 1P31A 3KYBA 3UOGA 5JLAA 2DTDA 5F3RA 4PLVA 2DAPA 3HADA 1SEVA 3D1LA 3JQAB 4CQLA 4R5HA 3MZ0A 2OO5A 1X0VA 4BO7A 4WGGA 3RWBA 3CKYA 4QEDA 2PK3A 4FSHA 1MP0A 1P0FA 4II2A 2YJZA 3VVCA 4CMEC 3U09A 1Q7GA 3W6UA 2EKQA 4XB2A 4BNYA 4AJ2A 4IDEA 3ZWPA 1H6DA 1OZAA 1OI7A 3B70A 3NV9A 3SX2A 1HE3A 3ZW9A 1P33A 4I9HA 4YPOA 3TWOA 4BB5A 5ITVA 2O7QA 4YQYA 3NDRA 4YT5A 4BMNA 4DUPA 4JJIA 3GOHA 4LGVA 1B2LA 4CLHA 4I08A 4GLLA 4YJGB 1LDYA 1CQJA 4FFRA 1A9ZA 4QO8A 5I8WA 2VYNA 4AG3A 2VYND 1BG6A 2Q50A 3IIEA 4UVGA 4U6SA 1EDZA 1PGPA 1BXGA 1E77A 1ZMTA 2G5CA 1WXDA 3QWFA 2RHRA 1QXSA 5CDSA 3AUTA 3DL2A 2D1YA 2Y1OA 4AL4A 1C1DA 1ONOA 3UN1A 3GHHA 1GCOA 1T1SA 2J5RA 1EVYA 3CIFA 1RM3A 3EMKA 4Y6RA 4PLZA 1DPGA 2Y1EA 2Q2QA 3MOIA 1F8FA 2CDCA 1CIVA 1BDBA 1VSUA 2BI8A 4HFRA 1LDGA 1V8BA 3ZV6A 4QX6A 2QX7A 3TNLA 2ZQZA 5CEFA 4EI2A 1HXHA 2HK9A 4PLGA 4NZ9A 1LDEA 2BFAA 3VVBA 2ZQYA 4R4JA 4RLHA 3KYCB 3JV7A 1O94A 2JKVA 3Q11A 4CV2A 5JDIA 3IUPA 1BVRA 1NXQA 2VZ0A 2YV2A 3MJSA 1QYCA 3WFIA 1ZJZA 3ZWOA 2EP5A 4XJTA 1BMDA 3D3WA 3BMOA 3G1UA 4NK4A 5AYVA 2G82A 2ZJ0A 2ZB8A 1NPTO 2B4QA 3JQ9A 1OBFO 4J1SA 3C3XA 3V8BA 3GPDG 4Z0HO 4ZVVA 4IDDA 5JYDA 2I9PA 5EPOA 3LF2A 4H3VA 4OYRA 4J90A 3SLGA 1UXJA 1L7DA 1UZLA 1V9LA 3QVXA 1YQDA 4YAIA 3CZRA 4WOKA 3P19A 4WLEA 5A1TA 1GUZA 2Q45A 2SCUA 1LDMA 1PJSA 2IDZA 3ENKA 3VH3A 4CMBA 3X2FA 5L7YA 1B0AA 4FDAA 4FJ2A 5IF3A 3FWNA 3UAGA 4JBIA 5JFOA 2EW8A 1E7RA 2X0IA 3WXBA 4L75A 2W2LA 4XD2A 4UUMA 1ZKMA 2DPHA 3ENNA 5HS6A 1P1RA 2DFDA 3R1IA 1VI2A 4I5GA 4EEXA 1WW8A 5T5QA 4BKRA 1D8AA 1IL0A 4NR0A 4UUNA 3NDIA 1IYZA 5JPIA 1E0DA 3JQ6A 5KJCA 3UCFA 1HZJA 5L3ZA 1Q0QA 1JDJA 1LDBA 3DBRA 4OH1A 5J23A 3I9LA 1I36A 3GVXA 4L4SA 5A9TA 4ZD6A 1HRDA 1V0JA 4Y67A 5KTKA 1KERA 4E33A 1CERA 4BS9A 1K5HA 1U7TA 3E82A 4JK3A 1FF9A 1YGYA 3AU9A 5K6AA 4HFMA 4PFJA 1SOWA 2DVMA 4PRKA 4CL8A 2JD1A 3PQEA 3ZNOA 1PZGA 1KEUA 4NFSA 3NJ8A 1Z75A 3DEYX 4WCFB 7MDHA 1ZXBA 4PG6A 4OSOA 5EIOA 2O7SA 4ZJUA 2HJSA 3HB4X 3DZBA 4ZN6A 1YL7A 4NBRA 3PGXA 2WM3A 2P2SA 1NVMB 2E82A 3LT2A 1YXMA 2R6JA 4LCJA 1LXCA 5JMWA 4QFDA 2YV3A 4A27A 4KQWA 5JY6A 3ZWCA 2OMEA 4M54A 3FNGA 1TB4A 1WWKA 2VHYA 3WBFA 4AVYA 3ZNPA 3OQ6A 2B36A 3CMCO 2OZPA 1BSVA 4KUGA 2AEJA 3WNQA 3I23A 3PIIA 3TFOA 3GF4A 3CTMA 4O1MA 1MX3A 4WE3A 3QWBA 1PTJA 1E3WA 3OIDA 3RUDA 2PNFA 2NU8A 3SVTA 1YE3A 4XX0A 1DHTA 4I8XA 1M67A 3AUAA 1ENOA 4JIGA 4H16A 2RBEA 3NT4A 4FW8A 3UF0A 1U2DA 2OL4A 1MG5A 3JQDA 3OQ1A 3Q2KA 4YAKA 1C3VA 2QYSA 3F6YA 3M2PA 3OIFA 4J7CA 3JQ7B 3JQBA 1GR0A 1NQTA 4YJHA 4QT0A 5BNFA 1RM0A 4PGFA 3CH6A 3DBVO 2GCGA 4BNMA 1E3EA 5ENVA 1R15A 5IDWA 4E2XA 3S55A 3ZNQA 3VZRA 3DZKA 4LMPA 3W6ZA 3R3SA 4PG5A 4RPLA 3L77A 2C0CA 4RVGA 5DN9A 4B4OA 5C7IO 3D5QA 1PR3A 3DMTC 2DLDA 2GUGA 5BNIA 5JXWA 1NQAO 3DO5A 3LT1A 2C82A 1ISFA 1E3LA 4WCDA 3WLEA 5CEJA 4PG4A 2DBVO 3G17A 1R4NB 4CM7A 4DQXA 4LSMA 1EZ4A 3TDKA 1CJCA 5C7OO 4J7XA 4CV1A 3K2BA 3L07A 5ENDA 3NYWA 1CF2O 4MIOA 4N5NA 2H6EA 3GAZA 3I9MA 1EFLA 4BNJA 1JA9A 1WMAA 5BSEA 1ID1A 4II3A 4NJOA 4Z0PA 2C2YA 1CWUA 1PU2A 2JD2A 4YBZA 1PS9A 4RF5A 1T26A 3OEYA 1WNTA 2HU2A 3F1LA 2E48A 3HDJA 4FBGA 2AW5A 5CAEA 2HDHA 4NFYA 2JCYA 4DPMA 3GHYA 2UYYA 4EBFA 4NJMB 1WMBA 1E1LA 1Y8RB 4TRJA 4J7UA 4DQVA 1P77A 4L76A 2PH5A 5IFLA 2I67A 1ZW1A 1YB4A 3GVCA 4BKQA 2GO1A 3NGXA 3OJFA 3ONFA 5JAMA 5T64A 3OP4A 2VTDA 3QIVA 1XWFA 4I5DA 4KP7A 2P5UA 2DT5A 1DFGA 2GPTA 1TVEA 2X58A 5KVSA 3KZVA 4G2NA 4ZQFA 3A28A 3D4OA 1A72A 2DKNA 3ICCA 1BXKA 4NBTA 5I7FA 1MC4A 3RI3A 2ZTVA 4WEOA 1A7KA 1E3IA 1P3DA 3UUWA 3PQFA 3DHEA 3WQQA 1EMDA 2P9CA 1GAEO 1GTMA 1K89A 1T1RA 4IQGA 1Z45A 4Z9XA 1UDAA 5A9SA 5A5FA 1XCBA 1BGVA 1DOHA 2OBYA 3H5NA 5HWSA 2O3QA 3M1AA 3C1OA 1I10A 1NWHA 4WPGA 3IJRA 3S2FA 2G17A 3W4IA 4RVDA 4CL3A 1PQPA 1QORA 5L7WA 2R00A 3O38A 4NNJA 3NTQA 4W9NA 4DA9A 4R51A 4HNHA 4W6ZA 2LDBA 3I6IA 3L6EA 4A10A 1PEDA 1VLLA 3DOCA 4CMCA 1CQIA 3AY3A 3LC2O 3AK4A 3AJRA 3OFSA 3DBHB 1VJ1A 3D0OA 4MPDA 2X5KO 2GZ3A 2C5AA 3FCOA 5CPFA 1GL3A 4YRDA 4CM8A 2OORA 3S2GA 4BNVA 3DZGA 1E92A 3WJAA 1LDNA 2Y05A 3CMMA 4DMLA 3OETA 4EDFA 4BGIA 1D4FA 2I5PO 4IZHA 3GMSA 2HRZA 1PL6A 2YFQA 3KXDA 3NGLA 3OJ0A 1A4UA 3PI7A 3KYCA 1F14A 1M75A 2BRUA 5TNXA 1LRJA 2Y1FA 2JFGA 3ETDA 2JHGA 3QA9A 4Y8VA 1YL5A 1HDGO 1I24A 4ILKA 1DXYA 1X7DA 1E7MA 2EJWA 1ZBQA 3GPIA 4DBZA 3F4BA 2Q1SA 3K5PA 4UVIA 1P9LA 3ZNNA 5ER6A 1NP3A 1B26A 3DHYA 3HG7A 3HHPA 3GUYA 3JQ8A 3UICA 1AHIA 2ZCVA 4YT4A 3PJDA 3EZYA 1W4ZA 2ZJ1A 1JWAB 1AUPA 2UVDA 4J4HA 2FR8A 4KWHA 1XU9A 5DP2A 2ILTA 5ILGA 4IMRA 4NIMA 5DP1A 1DRUA 3UXYA 3PHLA 3KVOA 3VKVA 3GMDA 1L7EA 2B37A 5DBFA 2A94A 5JE8A 3RIHA 4AJHA 1Z7BA 1DFIA 2OUIA 2NLOA 4DC0A 5AXAA 2Y0CA 3H8VA 4DXHA 3WMWA 2E6UX 3WIEA 2YFHA 3E5MA 4ZQGA 1K2WA 5AXCA 5G0UA 4JLWA 1GPJA 1WDKA 2RHCA 3GRPA 1ZCJA 4FPXA 2FSSA 4OMUA 2C2XA 3AUSA 4BNIA 2EWMA 3WLFA 4F3YA 2O2SA 3DC2A 1A5ZA 4I9NA 2DPGA 4M55A 4RGBA 4CMJA 2V6BA 1U9JA 2Q46A 2PZMA 3W8FA 3D3WB 3LLSA 4BNGA 2B4TO 2VT2A 4AJLA 4YACA 1IZ0A 3TFQA 4EITA 2XXJA 4IS2A 4RPKA 4UUPA 3KEOA 4JJFA 4MVJP 5CG1A 1GY8A 5DNAA 4IGEA 4XEHA 3MOGA 3HFSA 1GZ4A 3WG9A 4U0KA 3I9JA 1X13A 3JQEA 3AM5A 1LSOA 2J3IA 3ZV4A 3ITKA 2FN7A 1Z6ZA 5B4VA 2EP7A 2BELA 1KBZA 4GX5A 4R5MA 3RKRA 1WDMA 5B1YA 1E3JA 1CDOA 1P74A 3Q6IA 5IJZA 3EAGA 5L4NA 3NEPX 1Y8RA 2PH3A 4PG7A 4C4OA 3RU9A 1IPEA 3HZZA 4XZ3A 5IDQA 2NM0A 1WP4A 3KYDA 1GYPA 4R41A 2WSBA 2AG8A 2Q3EA 1VJTA 1WZEA 4PLYA 4YJGA 4WASA 4DPLA 5KJ1A 2WYVA 3M6IA 2Y0DA 2OGUA 1YVEI 2PKRA 3DOOA 2VZ8A 1GUFA 1SO8A 5TX7A 2EKPA 4CM9A 3GFBA 4IJKA 4NU6A 4F6LA 4ZICA 1RWBA 1GADO 4KOAA 2CDBA 3RC2A 3K96A 5ADHA 4XDZA 4BO9A 2GSDA 2Q4BA 3VTFA 3WB9A 3V1UA 5JAQA 1PGQA 1ZK3A 3SXPA 4BKPA 3ANMA 3H2ZA 3U4CA 1H5QA 3MJ4A 4IDFA 3AU8A 2V6FA 1BRMA 1NX6A 5A5EA 1OOEA 5FI3A 1UXIA 4XR9A 2EGHA 4IUYA 4YR9A 4GKVA 2C20A 1C0LA 1LLDA 2CSUA 2HMWA 3JQFA 5CDYA 3RUIA 1DIGA 3NT2A 4NU5A 3VH2A 1C0KA 2DC1A 3JQFC 3QV1A 2A35A 3PYXA 3KSZO 1LI4A 3ZWYA 3AI3A 3RJ9A 3WIDA 3GDGA 3ZWXA 5FI5A 4EUHA 4ZGWA 3ANLA 3C8MA 4IJWA 1HLPA 1U8FO 2W8ZA 3DTTA 3JYQA 4JP3A 3KSUA 4N54A 3WR5A 4KQXA 3VZSA 2NQTA 2CNBA 4W7HA 3WGOA 2GERA 5TJ9A 3BMQB 2PFGA 3G3EA 2JAPA 2DU8A 5JBIA 1G0OA 1T4DA 2H1SA 4OL9A 1YQXA 1V3UA 4ALNA 2EHDA 4ZRMA 5KNLA 4HFNA 1YWGO 3OEWA 4FQ8A 4UEJA 5I7EA 4FS3A 1ZJYA 3Q3CA 3S1LA 3ZW8A 3B20A 3PHIA 2FZWA 2P5YA 3F1KA 3IOYA 1ML3A 1H6CA 4DL9A 1PR9A 2NVUA 4NQZA 1DIBA 1I3KA 1YONA 3JQAD 4CMIA 4DIBA 4FR5A 4GWGA 2VHWA 3HN2A 3R0IA 2VRCD 3ZU2A 3HN7A 4D45A 4XDYA 3VPSA 2PKQO 2AQKA 2CDAA 1I2CA 4HADA 5TT0A 3AY6A 3JYNA 4ESOA 3JCZA 4M49A 1LLUA 4IPTA 4JGBA 5I8ZA 3MTGA 3JYOA 3NT5A 3DBRB 4A03A 5TIIA 8LDHA 3E5RA 3JD1A 3BTVA 2QZ9A 3AI2A 4J0EA 4PZDA 4D46A 3JQGA 4ROSA 4XWYA 3TOXA 1R4NA 4S1VA 2HMSA 4UEOA 1XELA 2FMUA 2PZJA 3VPXA 5A9SB 1Y1PA 2W2KB 2X5OA 2B5VA 4FC6A 1GCUA 2DBRA 3GDOA 4ID9A 4MKZA 3WICA 1HDYA 4RLSA 1XDWA 5IN5A 4CMEA 2J5KA 3JD3A 4CQMA 3IKVA 5DOVA 1KS9A 3E18A 1BXZA 3GLQA 2GN4A 1Q1NA 3D7LA 4FIZA 4FGSA 2AQ8A 3WTBA 2PLAA 3AI1A 4B3IA 3HE3A 3ANNA 5I7SA 5KJ6A 2CD9A 4TSKA 3OJOA 3F3SA 2BFPA 3RFTA 1JKJA 1Y6JA 1AXGA 1I2ZA 2JJYA 4XRRA 1MUUA 1R4MB 4G81A 2O48X 1PWZA 4LMRA 3R6DA 3DDNA 2IEBA 4Q3DA 4UEKA 4OGWA 3FR7A 3K6JA 3FPCA 2VNSA 3RKUA 4ONEA 1HWYA 4I5EA 1U4SA 3DOJA 4JN6B 3QW2A 1NFQA 1ISGA 2PWZA 3BTOA 2D2IA 3AW9A 3PHJA 1SCUA 1JN0A 4PZEA 1NTOA 4URFA 4IJVA 3VH4A 4TKMA 3QVSA 3Q9UA 4CM1A 3BAZA 1KVSA 3CXRA 5GZ6A 1S6YA 5FF9A 1K6IA 2BLLA 2PGJA 1QKIA 4FJ0A 5G2OA 2CMDA 4IXTA 3B1JA 4RORA 4XYEA 5G4KA 1JLLA 3H65A 3OH8A 3GH3A 1EEHA 3OA2A 2BH9A 4Z0TA 1QSGA 4J91A 4PVCA 5JAZA 3JQ9C 4OSPA 2DBQA 4BNUA 1PZEA 3L4BC 3OJEA 5IDYA 1B3RA 4IY1A 3D64A 4JXKA 1K6JA 1N2SA 3L4BA 3NTOA 1PQUA 3ADPA 4YDRA 1RYDA 2AE2A 3A4VA 4D3FA 5A05A 2P4QA 4K1LA 4ZRNA 4WEQA 1LBEA 2OBNA 1HTBA 1YBVA 2Y99A 1R0KA 5C7LO 4WJZA 1LLQA 5G4LA 4DBVO 5K9ZA 2FSVA 1PZFA 1W6UA 5JDIC 5G0TA 4I5FA 3EZLA 1SC6A 4BQRA 4P4GA 1A71A 1B8PA 1A27A 3EVTA 5CPBA 2D59A 5AXDA 4BGEA 3ZWMA 1E5LA 3RBZA 1SZJG 4MIYA 4D41A 2WYWA 2AEMA 4BNKA 1XA0A 3ZZNA 1W8DA 2HQ1A 1B16A 2GLXA 1R12A 4OQYA 1MFZA 1NHWA 1F0YA 1LNQA 1NBOA 3LDHA 4F46A 3V2GA 1T2CA 1KEPA 2CVOA 1R4MA 1B3BA 4L73A 5CG2A 2ZK7A 1ISHA 2I66A 4J9UE 3TZHA 1Q0HA 4NBUA 3RASA 4CMGA 3UW3A 3SLKA 1R0SA 1N92A 2RH4A 1UP4A 1RYEA 2FPIA 3PFWO 1O89A 3I9KA 5G0WA 4BKOA 4GVXA 4TVOA 1OC4A 3NKLA 2C07A 1D3AA 2R2GA 2C7GA 1V3TA 2ZB3A 1DO8A 3ZWNA 5LDGA 1RPNA 3N58A 1BXGB 1PGJA 1NAHA 4ALIA 4FN4A 2NU6A 4IDCA 2NVWA 2BHLA 1JW9B 1HDCA 3DAGA 3L4SO 1KVUA 1NPYA 2GDZA 5C37A 1X7HA 2O3UA 4FFPA 1NFFA 4KDFA 4BNXA 3HDHA 2GN8A 2ZB7A 2NU7A 4BNTA 2OFPA 3DZJA 6ADHA 2HO5A 1E7SA 2UV8A 1WAMA 1EVJA 4MVJG 1Y9EA 3AUUA 4E12A 3KLPX 1EK6A 1ENYA 4E5YA 1C1DB 1O8CA 2TMDA 4PIVA 2FR1A 5A9RA 2J8ZA 3AOEC 1JVBA 1TLTA 3AFNA 2O3SA 4HNGA 4EYEA 5U9CA 4KUHA 1LEHA 5GZ3A 3JQBC 1PJCA 4LRTB 4E30A 1NVTA 3KLMX 1EUDA 1NR7A 4NFHA 3SJ7A 4CLOB 4GGPA 3ZGYA 4AJJA 1I33A 5G4KB 4IIUA 3HB5X 3I1JA 3OMLA 1UH5A 5F5LA 4PRLA 3LF1A 8ADHA 2GGSA 1K0UA 3E1KA 3GDFA 3PK0A 5I9MA 4BL5A 1H0KA 4PLTA 2ZATA 3K8ZA 1G1AA 3P2YA 2BKAA 3ZU4A 4C7KA 4IQ8A 2NSDA 1K6XA 2Q1WA 3INRA 5DCUA 3IDSA 4X54A 4E31A 4TVBA 2VYVA 2IEDA 1QV6A 5KOIA 4Z3DA 3RFXA 1DHRA 3D4PA 1FK8A 2Z1MA 1N8KA 1U3TA 4O5OA 3A14A 3BTUA 2I76A 3GZNA 1SEPA 5I7VA 4E32A 4I1IA 4DRYA 3AOGA 4GSKA 4S3MA 5F1PA 5U1PA 1I32A 3SJUA 4CQMD 3FN4A 1H2BA 1TA4A 4JROA 4RQTA 5EESA 3W1VA 3T7EA 3DMYA 4H15A 5IAAA 3FNFA 1YBAA 2TMGA 4IXWA 4YYZA 4NG5A 3RUHA 1UP6A 1KY4A 1GZ3A 3D4NA 3K73O 1IE3A 4KDEA 1SAYA 4TKLA 4K6CA 5DBIA 1YQGA 4O63O 1E7QA 1TT5B 4BNLA 4NBVA 4MVJE 3OJLA 3FTNA 2XXBA 3BYZA 2IZZA 3BMOB 1ONPA 4OM8A 1Y7TA 1Y8QB 4DWVA 1N1GA 4K9DA 3FPLA 4FGWA 1IULA 2BGLA 1J6UA 2WE8A 1EQ2A 2E37A 4XJSA 1P1KA 2PD4A 2CF6A 4CM9D 2EXXA 5KIAA 2C7VA 1QYDA 1BTOA 4KTTE 2C5EA 3WOHA 5EQDA 3WX0A 5JSFA 1E1MA 1E6EA 1GYRA 4OXKA 4ZU3A 1R0LA 2DUWA 3DWFA 3GVPA 4CMAA 4XYBA 4WK6A 1PIWA 4RO0A 2FP4A 2EGGA 4IDGA 5CEEA 2Y1GA 3C7AA 4MIEA 3HQ4O 4JP2A 1Y8QA 4XQEA 3RC7A 1E7YA 1CEQA 4CMKA 2FOIA 1UDCA 1GFSA 1LSJA 1C14A 3C1AA 2VUUA 1U2GA 3ZCXA 3QE3A 3LQFA 4CPDA 1DBVO 3H6KA 4XA8A 1JTVA 2R00C 4W9NC 3GQVA 2I3GA 1U28A 3F4LA 3U49A 4MOWA 4J1TA 4M1QA 4AJEA 5CDGA 3I83A 1I0ZA 4HFJA 4DVJA 1UAYA 4FFNA 1RM4A 2J5QA 2YHUA 4Q3NA 2EV9A 3GA0A 2X6TA 4YQZA 4DQUA 4J6FA 3LT4A 3TRIA 3FWZA 4NHEA 1LC3A 2AXQA 3GNQA 4GI2A 4B8WA 3PZRA 1DAPA 5C5IA 1XGKA 3E6AA 3PRJA 1JKIA 1YOVA 2NTJA 3V1TC 1NASA 4NK5A 4WLNA 4TZTA 5DCWA 1ZH8A 2W2LD 1T2FA 1OC2A 4RQUA 1KVTA 3ZI0A 3EDMA 3BMCA 1GDHA 1LJ8A 1XHLA 5C3MA 3JQGB 3L6OO 2NV6A 3RAJA 4ZQBA 3W8EA 4CR6A 3WGYA 2NACA 4YWJA 2OHXA 4NDNE 4MJLA 4RVHA 5EMHA 3NTRA 1YB1A 2DM6A 4F45A 3N7UA 5KJFA 3DAPA 4BGUA 2RIRA 3INGA 2X1HA 4GX2A 1YO6A 3Q0EA 5JW6A 2C29D 4B7CA 1A7AA 2BGKA 2YV1A 3B1FA 3GNSA 3HDYA 2B4RO 2ZTMA 4FFMA 2X86A 1QLHA 1KYQA 4J1NA 3KYDB 1HDOA 3UCEA 5JC1A 3FNEA 2GD1O 4TZKA 3VC7A 1NHGA 1EQUA 1M66A 1Q0LA 3NJ4A 4IDAA 3QRWA 3LT0A 4E5MA 4RZIA 2GN9A 4BNHA 5KVVA 4OHUA 2AE1A 3G79A 5DULA 3ZN2A 5F1OA 3WSWA 1XIVA 4GX0A 4BO2A 1MG0A 4OKIA 4R01A 3RBVA 2P9GA 3E48A 2B5WA 2A9FA 2HMVA 2VWGA 3R3JA 1NQOA 1PGOA 3ROMA 3TZCA 4XQ9A 1ORRA 2OXIA 3L9WA 1JAYA 1GUYA 2Q2VA 2W90A 3KSDO 4LSWA 4WKGA 5TLSA 3WGZA 3PEFA 3VZPA 3BHIA 4MP6A 4LN1A 4D44A 3QP9A 3IKTA 1EE2A 2IE0A 3GT0A 1QR6A 1YOVB 3IS3A 2YZ7A 1KC3A 2VNAA 5B12A 2YYYA 4IQ0A 1HYGA 1KEVA 4GH5A 5L53A 5TQVA 4CR7A 4BO3A 3ROPA 4QXMA 3AFMA 2V7PA 5DCYA 4QSMA 4BKUA 4UAGA 2AQHA 3DZFA 4ZA2A 3H9JA 1U3UA 4TRRA 2RCYA 4CM4A 4L0QA 4N5LA 3WYBA 3JQAA 1GYQA 4R9SA 4MVJF 4GX1A 5LDHA 5BSHA 3FNHA 2VTEA 2OOSA 3BTSA 2NADA 3PPIA 4ALLA 4CM6A 2NQ8A 5ICSA 3L6DA 4BO0A 4BO1A 4RVUA 4QECA 4IZIA 3PQDA 3ETEA 5A04A 4BNNA 4CR8A 1ZO8A 5HRUA 4OOEA 3WMXA 1UJMA 1E5QA 1HE5A 2XF8A 1NQ5A 4XGKA 3WFJA 2CVZA 3WGHA 3ABIA 1PS8A 2UUOA 2W98A 3B6ZA 4GWKA 1PZHA 4D3SA 5I9NA 2P68A 2WD7A 4R69A 3WTCA 3BHJA 3FI9A 4AJPA 4E0BA 3IJPA 3K30A 2O3RA 3DBLB 3GC6A 3U0BA 4E21A 4OOFA 4YAGA 3U3XA 3PHGA 4Y6SA 4DC1A 4B79A 5FEUA 1AN9A 4YAEA 3V1YA 1DIHA 3LSYA 1HDXA 4ALMA 3DZHA 1N9GB 2IRWA 4UVHA 5JS6A 3DBHA 3L0DA 3FD8A 5TJHA 2B69A 4O0LA 4YJFB 4RF2A 2HAEA 3A9WA 4Z9FA 1N7GA 2X0NA 2E4AA 2HCTA 1PJ4A 4RVSA 3TF5A 4E2WA 1Z82A 3PVZA 4JQCA 3GZ4A 3DMTA 2AA3A 2H5LA 3TQHA 2CFCA 1U1IA 2EIHA 4CLOA 2YW9A 2GRAA 4ND5A 4CUZA 4NJMA 3O9ZA 4K26A 1IPFA 3O8QB 5G0VA 3WQSB 2YUTA 2PA3A 3ULKA 5L9AA 3FTPA 3CZMA 3GGOA 3JYPA 3WJ7A 1HLDA 1KIFA 2UDPA 4U8GA 4BHTA 4WCFA 4NBWA 4CM8B 2ZYGA 3V5NA 4PCVA 3V2HA 1LUAA 1NR1A 1UXKA 1PL8A 4RF3A 3OBBA 1RKXA 4E2YA 3DHNA 1Z7EA 1GQQA 4W4TA 1T2AA 1GQYA 1M2WA 2CVQA 2JHFA 3ZHXA 3JYLA 4BOYA 3V2UA 1ADBA 2O4UX 4E3ZA 3EGOA 4BMSA 2FZEA 4R3WA 4XGIA 4L9RA 4WUVA 3EUWA 1LRLA 4IIVA 1B8VA 4D0SA 3M1LA 4AJIA 2D0IA 1VC2A 2B83A 1QYXA 4MO2A 5K0ZA 3ZWBA 1UR5A 1ZK4A 3NX4A 4J4BA 4JX8A 4Q39A 2PZLA 3QLJA 3KETA 1O95A 1ZK2A 3KB6A 2HSDA 5U4QA 3EK2A 1PQWA 4IM7A 4DMMA 3RVDA 1PGNA 5KCZA 1QYWA 3P7MA 4BQPA 1YKFA 1X1TA 4XCVA 1U4OA 4IDBA 3STHA 3CEAA 1NNUA 4R1UA 2LDXA 4NPCA 3LC1O 4HKTA 1YRLA 1DC6A 2HMUA 5GY7A 3WWZA 5LCXA 4IINA 5TS3A 1FJHA 3PWZA 1O5IA 4KTVE 3GUCA 4OKNA 3DFUA 2X0RA 2D4AA 5JAIA 1YH3A 4P22A 4YJHB 1W73A 1DSSG 4EZBA 3GEMA 2CZCA 3RROA 1R66A 1LTHR 4CM5A 1P1IA 1TI7A 4LVCA 3IL2A 3E8XA 1E1KA 3M2TA 3KEQA 1H6AA 3DZIA 2YY7A 5FWNA 2Z95A 4EEZA 4P38A 3P5SA 3DB2A 4CMIB 2X5JO 1FDTA 4TWRA 2FRDA 2A4KA 4D7AA 4BO8A 2UAGA 4CM4B 2PY6A 4NMHA 1YB5A 1B8UA 5L45A 1UP7A 4UVEA 4YCAA 1F12A 2RAFA 4ZQEA 2NTNA 4D3DA 3BHMA 2NVBA 1EDOA 5JMPA 2GR9A 3U4IA 1GV1A 2GYYA 1FDUA 3L9XA 2GN6A 4I9UA 1ZSNA 4RV9A 5JCJA 2YHIB 3KTDA 3U9LA 1V3VA 1GPDG 4E5KA 3IP1A 1KETA 2J6IA 4BNFA 5H83A 2Y68A 4HXYA 5AVOA 3UKOA 2WDZA 1T24A 4G5HA 1DC5A 5AOVA 3UH1A 2VUTA 3BMCB 1Y5MA 3LU1A 4P4LA 2VWPA 5BQFA 1P0CA 2O2YA 3ZWWA 2G76A 2NNLD 3G0OA 1OMOA 1X1EA 1F17A 5KVQA 2DTXA 4YJDA 4H7PA 1X14A 5THQA 1DC4A 2QG4A 4FOSA 3PDJA 2ZCUA 5CFZA 3FRJA 3GGPA 4CLRB 1M76A 1HETA 3C1TA 4M87A 4ALJA 5BT9A 2QRLA 2BD0A 1T25A 1LLCA 1X15A 3IAHA 2BGMA 1ZEMA 2Q1TA 5KKAA 1WLYA 3RBXA 2HLPA 1MGOA 3PHHA 4RCVA 3PP8A 3GVHA 3QHAA 4OO3A 4FCCA 3AWDA 1GD1O 1AHHA 3C24A 3JD2A 4YEDA 5T57A 3FHLA 5KVCA 3D5TA 3OECA 5JO9A 4JNKA 5CP8A 5F21A 5HS4A 3SC4A 2XPCA 4BO4A 1IB6A 3HSKA 1W0CA 3ORFA 4EJMA 4TMFA 4M8SA 1XYGA 2C59A 2I65A 2X23A 2J3HA 2DQ4A 2X7HA 3COSA 4A0SA 5JC8A 4GBJA 1LSUA 3MJTA 3ADOA 1QYVA 3TL3A 1N9GA 2JCVA 1HE4A 1QMGA 5EN4A 1O6ZA 3RUFA 2Y93A 4U0JA 2PZKA 3H4VA 3KHUA 3WGTA 4MINA 4MKXA 2UUPA 2WTBA 4UUOA 4DYDA 2DBZA 1DLJA 4R16A 1U5CA 3ASVA 2IZ1A 4CV3A 5IZCC 1T2EA 3NAQA 3BZUA 3RUCA 1HT0A 2PKQP 2Z5LA 3GEDA 4WLOA 1ZEJA 4Q3EA 4Y98A 3UCXA 3H5RA 4YJFA 3ZV5A 4INAA 3UFXA 2ET6A 1E3SA 3PJEA 4RZHA 1P1HA 1X0XA 4IS3A 4YRAA 1QLJA 4A5OA 3SC6A 2VRBA 3WQRA 1I3NA 3I9OA 1N5DA 1ZVMA 3ICPA 1NYTA 4GPD1 4HP8A 3U4HA 2I99A 3TL2A 2PD3A 3ROQA 1PS0A 2IXBA 4Q9NA 5A3JA 4RPHA 1TT7A 5BSFA 3GN2A 1I30A 2C54A 5A4DA 3K9QO 1Z74A 3RSHA 5IZCA 4G65A 1E3WB 1GU7A 4BUCA 4MVJM 3BXXA 4UULA 4BO5A 3BA1A 2Y1DA 1FDSA 4Z6KA 3S2IA 1D7OA 4RVFA 2YDYA 5IXSA 4L8VA 3FBGA 1HF3A 1B14A 3HJAA 4BIIA 4YRBA 3DQPA 1BVUA 1Q2XA 2AG5A 3OQBA 4FFOA 1PWXA 3LK7A 3NRCA 3VKUA 1F8GA 1ZK0A 1XSEA 2QYTA 2V65A 3W4KA 4OIMA 5A03A 2Q49A 1FDWA 1Z73A 2PV7A 3F5QA 3ZU5A 4B3JA 1DRWA 1KC1A 1PJTA 1XEAA 3I52A 3PFFA 3PYLA 4OXYA 1TT5A 1VKOA 5A06A 3PJGA 3MJEA 4CM3A 4Q3CA 3WYCA 3RJ5A 1EFKA 4QTZA 1C0IA 1EE9A 1VM6A 3CSDA 5T67A 4GLOA 4D42A 4YT2A 3AM4A 3GN1A 3U4DA 4LRSB 3GNTA 3WYEA 1QRRA 1ONNA 1MXFA 1SMKA 4RDHA 4AJ1A 5ITWA 1UUFA 3IMFA 1NWCA 4GGOA 5FYDA 4BNWA 5B4TA 4CLRA 4RDIA 3BIOA 2HK8A 2VQ3A 4RF4A 4J16A 4MP8A 2EW2A 5IZ4A 1DDOA 1WDLA 4E4YA 3MEQA 2GNAA 1NPDA 3EY4A 3QQPA 1PX0A 4YAJA 4B3HA 3KBOA 2IXAA 2Q2WA 5AXBA 3H2SA 4O6VA 4R54A 4Z9YA 1ULUA 1C1XB 2DFVA 3FBTA 5HA5A 4U7WA 1HEUA 2AMFA 2ZTLA 2JAHA 1HKUA 2QRKA 1ULSA 3H9EO 3JD0A 3ZU3A 3EHEA 5IDXA 5JCJD 5HBRA 5JNLA 3W8DA 2VCYA 3KO8A 5GZ1A 1EVZA 1U8XX 3HDQA 4GVLA 1FMCA 4CUKA 1OAAA 2CUKA 1O0SA 3QY9A 4JBHA 1JVSA 1H2HA 4YTEA 5H81A 1GZ6A 1BHSA 4NH4A 2X9GA 4FOOA 1NVGA 5A3VA 5T6BA 3WGGA 4BO6A 2YQ5A 4KMSA 5CDUA 1E6UA 2PR2A 5L4SA 4AICA 3DXFA 2FPGA 3T4XA 2A92A 3ETGA 2FPPA 2WD8A 2VHZA 2HJRA 4IBOA 2POQX 4C7JA 1IY8A 2QIOA 3WBBA 4OXNA 3ZWAA 4B4WA 1XQ6A 3ASUA 2D5AA 4BGVA 3RC1A 1KVQA 3IC5A 1GQ2A 1ZZEA 1VL0A 1V35A 3DTYA 1ZMOA 4PG8A 2E49A 3VH1A 1M6WA 5DF1A 3JQ7A 1J0XO 2VYVD 4Y9DA 3HFGA 4GMGA 3ZV3A 3GEGA 4E5PA 5IN4A 4FC7A 4MVJH 4CUJA 4JJGA 1RJWA 6LDHA 1IHXA 3I4FA 2JFFA 3HNPA 4LISA 1U3WA 4XGNA 3EW7A 2VWQA 1ADCA 3KOUA 3I5MA 3F9IA 4W82A 4DYVA 1H94A 4TRNA 3HWRA 2DTEA 1HZZA 5ES3A 1JQBA 3F47A 5TC4A 1BWSA 4TROA 1G0NA 3GG2A 3OICA 2QRJA 2IZ0A 4B4UA 5ILOA 1VRWA 1DC3A 1K3TA 4HUJA 5L40A 4EGFA 1B7GO 3TSCA 1E1NA 2AEFA 3Q9NA 3QJ5A 4FFLA 3VOSA 4M86A 2ZYDA 4JCOA 3JQCA 2JL1A 3PXXA 1UDBA 3TPCA 1SOVA 1MB4A 3PTZA 4B4VA 1QV7A 3GRKA 1GEEA 3DR3A 1XR3A 4DLBA 4W7IA 2HUNA 4DIFA 2CF5A 1YDWA 2O4CA 4QFCA 2HK7A 4QQRA 2H63A 5JO0A 4ZHSA 3LZ6A 3O8QA 3AOEA 3PYMA 1L1FA 4HWKA 1LU9A 4E6PA 4HY3A 2ZB4A 1BW9A 2GZ2A 4U5QA 5COBA 3MWEB 4MKRA 4JBGA 3JQ8B 5LC1A 1FDVA 3PLRA 5KWEA 4PLFA 3I6QA 4RPGA 4XB1A 3QVWA 2ZIZA 3PLNA 1TEHA 1DLIA 5KJEA 1CYDA 4R68A 1RM5A 3BMNB 2AHRA 2HKIA 4J2OA 4PLPA 5ER9A 3WDSA 3A06A 4L74A 1MV8A 4DPKA 1C0PA 4CJXA 2AQIA 3RFVA 3DBLA 3ONDA 4YA6A 2I3AA 2VRCA 2WYUA 4MVJA 1I2BA 2W2KA 1TXGA 3H7AA 4GSLA 4XRGA 5H82A 2NTVA 1U5AA 4M89A 3T7CA 2VN8A 2EEZA 3VPGA 2ZYAA 4LK3A 1J5PA 1LX6A 1PSDA 1VL8A 2IYOA 3DAFA 1PL7A 3GK3A 2BFMA 3S8MA 1UXHA 1H93A 2PGLA 4N5MA 1YL6A 1KVRA 1H9AA 4PZCA 2RH8A 4R1SA 3MJVA 1ZK1A 3IUSA 3H3JA 5THKA 2F1KA 3RC9A 1LA2A 4R9RA 5G0SA 4J1QA 5JDCA 3O4RA 1GEGA 2D3TA 1DRVA 1PJLA 1VE9A 2IYPA 3GZNB 1WPQA 2FWMX 1JU9A 2WEKA 5JDCC 3TJRA 4XR4A 5EJ2A 1ZXLA 3Q2IA 4K28A
chains in the Genus database with same CATH superfamily
4KUEA 1L5YA 5GIPE 1ATIA 3F46A 1SUDA 1TCAA 1UBTS 5COAA 1CU1A 3O8OA 4WNIA 3QKIA 5BMVF 3JZFA 3SEFA 2YXBA 5CNKA 2FMTA 3WGQA 4KIUA 2C4VA 2Q3DA 3HFJA 2W48A 4LDNA 3TZLA 4BQEA 4JODA 5BMOA 5IG2A 5DH9A 2BBSA 4LYEA 1OYWA 4V3BA 1QIJA 2W4QA 2FGJA 1ENPA 2RGNA 3CCBA 2OC9A 1XXHE 4FFWA 1CEYA 4XYMA 1E7WA 3LVFO 4MW7A 3IMEA 2IPXA 3VSEA 2P8SA 1Y5RA 2WG1A 3N74A 1ZGJA 3G0GA 2XCLA 1R6DA 4FD3A 1HSZA 4FGJA 1AOXA 2NXCA 3T7RA 5JBQA 3WGVA 5AVUA 3HEBA 3IRVA 2VOEA 1SCDA 3U7EB 1GPNA 3ZDZB 4WTOA 3N2KB 4EIWA 1CUEA 1LH0A 2P4HX 2WZQA 1DARA 2XH8A 5ALWA 3TK1A 3IDOA 2G70A 2QN2A 2VNHA 2NUAA 2AFIE 3NBUA 1ZUD1 5L95A 4TYPA 1TO6A 2I6TA 2F00A 1CUYA 3MAAC 1DXHA 3FOEC 1QFSA 1P1JA 5EMJA 2QJWA 3OT1B 5JYEA 1XQ1A 4BV9A 1ZIDA 2H9IA 4PSAA 4J4TA 1UODA 2BFEB 2H07A 2PZFA 4RFLA 2ZRCA 3Q6NA 2FP3A 4X7PA 4DDUA 1R37A 2JASA 2R97A 2LIPA 3ES9A 4PQYA 4AJ4A 2HZBA 4WOJA 2FMXA 2JFQA 1GLVA 3CPHA 1SBYA 1ULTA 2CLEB 4B5LA 4PX5A 4UTVA 1RAEA 4LF7B 3G1TA 1DRKA 3JASA 4N6OA 1P1FA 3INYA 3SICE 3H0KA 3VI4B 4P1ZA 4EW6A 5DZSA 1QRSA 3I6MA 5I9IA 1UPBA 3OZEA 1ZLXA 3K9NA 3X2EA 2A1UB 2WKRA 2ZIAA 1OZFA 5K3DA 1CUVA 1P5RA 1JNYA 2I62A 3K0CA 1C4WA 3FB4A 3MT0A 2GESA 3OM9A 3PFKA 3RADC 3WSVA 4EM6A 3JS5A 4BDSA 3CUVA 2V74B 3HBJA 1QYRA 4KU4A 1EK0A 3PWSA 2ZJYA 4MPTA 3G2HA 4AKGA 2Q4EA 4GMFA 1EVLA 1QE3A 1XZEA 3GGJA 3FF4A 4I66A 3HUEA 2Y1LA 3MQ2A 4TUYA 3G5MA 4NH0A 4AJOA 3OZWA 4D0RA 3P2KA 2RKOA 1AGNA 1ZINA 4TQGA 2JCXA 5LN1A 5LU9A 5CIYA 1FPMA 2WJWA 4IKPA 4XQGA 4F5EA 3A4LA 3TQSA 3D1JA 1TK3A 2AFHA 4P80A 1XAJA 3FI0A 5EZ6B 3RUAA 3TNJA 9MHTA 1K3FA 3A6FA 2IH5A 2KS6A 4Q9AA 2F55A 5K45A 4A2CA 3WLQA 2G77B 2VK2A 4FHZA 1TUIA 4MWZA 2J09A 4ZV7A 4KQ1A 3SEQA 4D79A 4G8DA 4DTIA 5JQWA 2QR5A 3T7AA 1MFPA 4MWOA 1JEJA 1HV8A 1L0BA 1PJRA 3AR5A 3WWYA 2HN9A 4NCJA 1U8CB 1VRVA 1IBRA 3IMGA 1C7FA 3OEEA 3DVRX 5A0TA 1PJ2A 2H85A 2KPOA 2D1FA 5DSTA 5JD6A 4C6SA 2ZJ8A 4WL0A 4O2BB 3A3PA 3SFZA 1IK6A 4Y6PA 3V6LA 3JWPA 1PG5A 2B3DA 2ZYWX 3QYFA 1GNTA 1P0QA 4KXYA 3NEJA 2BI7A 4U6QA 1ATZA 1P7WA 2NU9A 3TSYA 3LTNC 1ZOSA 3UGKA 1FMTA 3DMRA 4WT7A 1TKCA 1T5OA 3VR5D 3LC7O 5FBWB 1HY3A 4W8HA 3WRVA 3V9AA 2PX8A 4ALKA 3UVEA 4QXAA 3MTDA 4L6AA 2R6HA 4QBHA 4QDOA 3C85A 5FXMA 3KRTA 4EMSA 1H1TA 1E4EB 5JSZA 4I8DA 4HHEA 1UKBA 3QTTA 4FQ7A 4DABA 2Y1WA 1DJNA 2FZLA 3AJDA 2I2AA 3O94A 1Y81A 2VVTA 4R1NA 3K2IA 4Y2JA 5DM4A 3LYHA 2Y0BA 3AL3A 3GFGA 4QSHA 3WGIA 2BZGA 4Z86A 2JGIA 3COJA 3OC0A 4KFSA 1VL6A 3L0SA 2AN3A 1A4IA 3FLMA 1VHJA 3OIGA 2G1AA 3H04A 4P54A 1G5QA 4BFTA 1QPBA 1M3SA 4OU5A 4TKZA 3X1KA 1OGYA 4Q1AA 2ONCA 5EWLB 1YCGA 2I6QA 2X9VA 4PSDA 4ZVRA 1EJ0A 5D3KA 5HQJA 3O7WA 5JAUA 2C7OA 1FTNA 4G25A 2G8NA 4GQAA 5ALQA 3P2OA 4RE5A 4N5HX 2X8LA 3GO4A 4MMXB 1HFJA 1P72A 4JI1B 4QU8A 5FNZA 3RU7A 2NUPB 4F71A 1WVIA 1N9ZA 3UHAA 1T34A 4ND1A 4P3KA 1HNWB 2I33A 2YMLA 2X4GA 5TMEA 3PI6A 1ZN7A 4Q3BA 3HKCB 1I2DA 1R74A 4ARZB 3A25A 1VKNA 1U7HA 4G9BA 3V34A 4W5OA 4C08A 4COKA 1RZ3A 2DUJA 5C8YB 2BRUC 2O3TA 4C0QC 5ICGA 2W8BA 5JI3E 1NFRA 1F6DA 3EWAA 1W47A 2P6MA 3MW8A 4OAQA 3EGVA 5AQ1A 1D1QA 1ZUIA 4YCBA 1YF3A 3IXMA 1FIUA 2KM1A 1CUZA 1WBJB 5HM8A 1EBFA 3O31A 4NBNA 3RT7A 4JDUA 2RHOA 3LYLA 4I55F 3FYCA 1MNAA 4LY9A 3LPCA 5D85A 3K4QA 4DY4A 2C1ZA 2W9XA 4J94A 1MTZA 5AD1A 5EL0A 2BWJA 3N7AA 5DU2A 5BXQC 1JFFB 5P21A 3KWLA 1PFUA 5IMSA 2JFOA 2IEYA 1QTNA 3QLTA 1KOLA 5CD1A 1UF9A 3OIUA 2JGJA 4GP7A 2A59A 4LC9A 3ZHSA 4HLDA 1A8PA 3F90A 1ST3A 3BMQA 3TZQA 4MDFA 3HYNA 4MUGA 1MEJA 3I92A 2HIAA 2YIJA 3OTQA 4KXNA 4XIGS 3A1VA 4E2ZA 2JFBA 3CRRA 1N0IA 2MTBA 3IHLA 2GH1A 1CF9A 4K9QA 5KU7A 3VDRA 2J3DA 4J3FA 3G8CA 2X9LA 4L0DA 4OJNA 4TRMA 3S1AA 3SDZA 1XF1A 2B2NA 2C04A 2VKQA 3VHRA 1Y7IA 1PJBA 1NOIA 1EB8A 1W1WA 1UZUA 2CEAA 4AKTA 1HNZB 2ZKLA 3ITEA 1U5BB 5J1SB 3PQ4A 1T4BA 2VBFA 4DCTA 5KYGA 1R5OA 2EJVA 4KPUA 1V96A 4LI0A 3D02A 4GRDA 1OPXA 4CKXA 2P9EA 4Q82A 4NV1A 3MELA 3EIHA 1EP3B 1GFWA 2OYRA 2B34A 3PSHA 5HMMA 2O23A 3WGJA 1KJZA 3NWEA 1KYYA 2J3KA 3B3GA 3I76A 1BW9B 3OZUA 5FFMA 5AVSA 4UKDA 4DEVA 1FP1D 1ACJA 2JGKA 1E6WA 2RONA 4QOHA 3B6MA 3D3KA 2WDPA 2VHVA 3QX9A 5JANA 1I3LA 1WZIA 4Z54A 1IZ9A 1G3IA 1Z8DA 4RY9A 3HP1A 4RTSA 4U2GA 4QAJA 1UC9A 2VT3A 2EF0A 3EXG2 5HXAA 2CFOA 2LGJA 3P45A 3PC8A 4KQKA 2DUMA 5K0TA 2UUCB 3P9SA 1OJLA 1Z2AA 4YXFA 2H11A 2Z6AA 4LC0A 4UM7A 4NI5A 5CM8B 3ZH2A 1I51A 1ZM9A 2QF7A 1NZFA 2B25A 2UKDA 3ER8A 1HL3A 3DCYA 3NU1A 4QVKA 4CTKA 2O8FA 2C61A 4XFKA 2WRZA 3B3FA 5DBGA 2AOTB 4Y6GB 3SYLA 5EZYB 4A0HA 3IR5A 2QNRA 5AW0A 5IT0A 2VUSA 5DI3A 1X7GA 2P3OA 4B34A 3T5AA 1UAGA 2HHAA 3W3AA 3BBLA 2VG8A 3C8ZA 1MMFB 5IVIA 1OV6A 5MDHA 4NCAA 4POAA 1FUIA 1SB8A 5FQNA 4C5AA 4DR7B 3BIFA 4DV4B 2AN4A 2VO1A 4MTCA 1UZNA 4QL3A 4R81A 1C4XA 4XVHA 4CV0A 2V0GA 3VX3A 1YDEA 2HJVA 3MHTA 2JFZA 2QVLA 1ZHFA 5I45A 2GM3A 1RHKA 2W83A 4EG3A 3S3TA 2Y0EA 3NOOA 2IU0A 3WLOA 1ZSYA 3NRBA 3W5UA 1Q3HA 2IUFA 2WUEA 4BUJA 4W5WA 2EP8A 4RJLA 1KAQA 3KM0A 3BMNA 3WGKA 4R1PA 1NBIA 5HJEA 2IHBA 2QVZX 3AY7A 2EERA 1WXWA 4M1ZA 2FYTA 2OAEA 2B35A 5CW1A 1MC5A 1YA4A 4JCCA 3B6EA 2BP7A 4JL5A 1AE1A 1MVLA 4Z9AA 3K53A 1HSOA 3B1KA 3KLBA 4OF4A 2XODA 5EWLA 3UGQA 5TGDA 3WNVA 3IELA 2APJA 1EUZA 3RYHB 3IQDB 5GOZA 2VF2A 3G88A 4LF4B 2PZGA 3JVUA 4Y7DA 1T5HX 3DV2A 4MGIR 4QUKA 4MGZR 1H42A 1ZONA 3PXCX 1KEKA 3VNSA 3DUFB 3GLUA 3LYUA 4QJIA 3A1EA 4I9GA 1J4AA 1GZVA 2LRHA 5H0IA 4BQOA 2QD2A 2VJCA 4ER3A 721PA 3THYB 4EA7A 1P31A 4EX6A 2WICA 1VCHA 4XUDA 1WY5A 3F7NA 5FJIA 1KDOA 2MDTA 5FA5A 3SNHA 4AKHA 3CG4A 4M8KA 3D1LA 3PQ2A 3RS0A 4ZT7A 3VC3A 4GPIB 4GHWA 3U7JA 4B6JA 1CF4A 1S2MA 5E4YA 1UC5B 2WUGA 1Q6ZA 2B2CA 3CKYA 1XP8A 3KIPA 4QEDA 1XL0A 3NHBA 1CP2A 3RHZA 4BEJA 1GWNA 3VVCA 5HJ7A 1T3GA 4LPSA 3CHYA 1NJ8A 1YQQA 3W6UA 1SWWA 3EIUA 3K70B 2ONZA 4G89A 1H6DA 4DXDA 2G71A 1L7BA 1SM4A 2NUTB 3B70A 1MT3A 1YE8A 3CO5A 3FBWA 4IDHA 4TL7A 3S2EA 1I9CA 4LYFA 1AUOA 1ESNA 3SX2A 4UW9A 3W90A 2XYGA 2PWYA 4MS4A 3D3NA 1B0UA 2O1XA 3ND9A 5DW3A 2RKWA 1OAOA 4YQYA 2C2GA 1VIDA 3R6TA 3LXRA 5KYVA 2OLEA 1P62B 2ODTX 5GQSA 4ZHQB 1EFRD 1HEYA 4K0KB 1U8UA 2J6BA 2C9DA 3AF5A 1WMSA 3DCNA 3EOBI 4OYLA 1CQJA 1P7CA 1A9ZA 4RMIA 1N77A 1DKLA 1VKZA 2CHGA 2JJ2A 4I46A 2OWEA 4AG3A 1BG6A 3IIEA 1FU8A 3ENWA 4H35A 3TZCA 1PGPA 5M29A 1P2TA 4GNRA 4F21A 3QWFA 2RHRA 1QXSA 2WY2D 3AUTA 3GFRA 2AMJA 3F3MA 4OX9Y 2P9JA 2W93A 5LP6F 1ONOA 2A1TS 1YDGA 2C1XA 4OU4A 2A14A 3CIFA 3MGBA 5BOSA 1XWWA 4C4ZA 3EMKA 3DTVD 3P4XA 1U80A 2NSHA 2Y1EA 2P0EA 2J3QA 1UPAA 2FMFA 2I78A 3BZWA 2CDCA 3M6XA 1EGAA 3PNBA 2BI8A 4O0MA 2IS1A 1V8BA 2VPXA 3ZV6A 4ZI5A 1TAUA 5CUQA 1IAVA 2JATA 3BF7A 4IQ4A 4EI2A 4P5PA 1JQEA 3MCUA 1J07A 3PKJA 2FAXA 4PLGA 4YCJA 3TE7A 1K66A 1X8LA 2VNJA 2ZQYA 3LY8A 4YP0A 4C20A 1O94A 2ROQA 4L5JA 2FOLA 3DE2X 3X1DA 1A1VA 2X0DA 2H52A 3Q11A 1KGDA 1YR7A 4MR9B 1BX0A 2QJFA 3ANTA 2RC5A 3N6RA 1J0DA 3KVYA 2YV2A 1F8YA 2X3UA 3KT3A 2Q5CA 2NO0A 3MK31 4O08A 2GAFA 2EP5A 2WYIA 4XJTA 1BMDA 4ZOLA 1CW2B 3BMOA 1W2WB 3L7AA 5AYVA 4YWHA 3AIMA 2ORIA 3BEOA 3FYSA 4GMDA 1WSBA 3FNIA 1NPTO 2YBEA 3IXQA 1OBFO 1ZCFA 1TYAE 1FFGA 4UUAA 4CG3A 2AW3A 4FB4A 3BGVA 4KGVA 2QM7A 5FORA 4E11A 1QIIA 4IJMA 4LYYA 1Z39A 1GQOA 2PL9A 5L8VA 4F6RB 3F96A 1IY0A 4A8JC 1UXJA 2HDWA 3IQFA 1FFWA 1V9LA 4YAIA 5L4NA 1U7UA 5B2EA 3CZRA 3HSSA 1OV4A 2WSLA 4WOKA 2XDAA 1GUZA 5C7YA 2SCUA 3FHTA 1EYZA 4MW5A 121PA 5EWJB 2Z4SA 1QH9A 2BE9A 5IBCA 1CDDA 2RK4A 1DJOA 1ISPA 1IHPA 1NY5A 1LDMA 1T6YA 2IDZA 1OLOA 2FW6A 2NO5A 3ENKA 3R5HA 3EXHA 1N6RA 4FYPA 3JR3A 1B0AA 5E1DA 3GZTB 4BN0A 4OV6B 1FU4A 1K8XB 2UVPA 2VYCA 3AX6A 1C7ZA 3SK0A 3TLCA 4YDSA 2BCJQ 3WK5A 1K6MA 2W2LA 4XD2A 4WX2B 1H85A 1B76A 3GMIA 2FN8A 4EG7A 5C35A 1KZYC 5FEUA 3B2EA 2XXAA 4MUNA 1WR8A 1R9JA 1T6XA 3QXHA 1R8YA 3BK1A 3R1IA 2JIZA 3VI3B 3GGSA 3QOXA 3FJOA 1MORA 1WW8A 5EVJA 5JPIA 1SVUA 5A2QA 2HJHA 2NX2A 3PE4A 4W1PA 4B0OA 10MHA 1CC1S 2PUWA 3ZLUA 1A2QA 3UCFA 4NXMB 3GJ3A 4FMPA 4IO0A 4LTNA 3VDNB 4UPEA 4EX7A 1HQDA 1H5UA 1L4UA 3I9LA 3HGQA 3OT1A 4JYCA 1HRDA 2R8RA 3MS7A 1V0JA 2FB9A 3BH6A 5I47A 1Y6GA 621PA 1JI0A 1OIWA 3IT1A 5LBTA 1BMQA 1PV2A 1PVDA 1FF9A 2E4XA 2Z2KA 4JK3A 3LSTA 3QYPA 4PFJA 1PHPA 2DVMA 5ALVA 4BXOB 2JD1A 4GM4A 4NFSA 2D0OB 3DEYX 4CKEB 2OQVA 3CX3A 1CZRA 1UBUS 1GT91 2IHKA 1GL6A 3QA3E 3ORQA 2EWVA 5A3QA 1IM8A 4ZN6A 1CUBA 2F3SA 2WM3A 1SXPA 4BECA 3Q6MA 2CJYA 1N0WA 4QFDA 1Q84A 3UATA 4A27A 2J7PD 3AB7A 1PFWA 4MKIA 1EVQA 1E79D 3AF4A 4MAAA 2OMEA 1T8YA 2J5BA 3FKJA 2XUHA 3CE9A 3NWBA 3P27A 5SY4A 2AFVA 2CYAA 3L5KA 3WRYA 1CULC 5DNDA 5BO5A 2P9TA 4TV9F 1ODLA 3B78A 4IUCS 5KSZA 4KUGA 5KPDA 5K0LA 4WZBA 1M2OB 3I23A 1MC1A 1N6HA 2O9JA 3GF4A 2PVSA 3TFOA 3CTMA 4O1MA 3KUKA 5TDHA 3K9BA 3CR3C 3WKEA 1Y8AA 5EE3A 2PNFA 4LBVA 1B4DA 4M1MA 4XX0A 4AN0A 3HCCA 1OLUB 4GUAA 3AUAA 2XX3A 4G0NA 1LX7A 3VHQA 4BNDB 4Q6BA 1E2BA 2PANA 1GP2A 5C46F 1S2GA 1RNLA 3WWPA 3JQDA 4XX0B 5A4FS 3OQ1A 5I4KA 3F6YA 3OIFA 4GBMA 4BU1A 1TZ2A 1CR1A 4J7CA 2I2BA 4EKYA 5CLIA 2QSJA 5EIBD 3K0CC 1GCGA 1JR4A 2F3RA 1GR0A 3EZ6A 2PWPA 4WZAB 1ZA2A 4NCKA 1PR0A 3CT4A 1O54A 1RM0A 2WIJA 4X1KB 2EFEB 2QK4A 3SC3A 3CH6A 3DBVO 3LUCA 3FM9A 5AW4A 4E2XA 2QLFA 1C3OB 4M1YA 4WZAA 3U1TA 4GBED 1JQ5A 3VZRA 2LP4Y 3ZIUA 2PL5A 4X20A 4CVNA 3FKQA 3I04M 4D9HA 5A5DA 2AZ4A 4FZVA 3L77A 5SZKB 2C0CA 5DN9A 1NRWA 4HG2A 2XE4A 4F4IA 2QVXX 2VJAA 3W3AH 3E2IA 4BE4A 3EGWA 2NYUA 3NORA 4EW2A 4F4DA 1QRUA 1NQAO 2C2OA 3DO5A 3C5CA 3I2YX 1B42A 1P2GA 3BRSA 4YGYA 3CVWA 2FDRA 1ISFA 1E3LA 2ANBA 1EK2A 2Q0XA 3IBFA 4UBKA 3VVLA 2L82A 3G17A 3OF3A 3ZI4A 4E5DA 4IZOA 2DP4E 4RTPA 3CZ5A 1EZ4A 2JCSA 1CJCA 3TDKA 4J7XA 5C7OO 1CQIB 1KDPA 4M8IA 2FUCA 2Q3CA 1H2EA 2C3YA 2M9MA 2QLTA 3QJYA 2C5BA 2F67A 2B8EA 3R76A 2HYIC 3L0ZA 3II6X 1Y3CE 4EHLA 3AH8A 1WQ3A 2QE7A 3W3AD 1RLIA 4II3A 4TSFD 5EJ6A 3A6DA 1CWUA 1JYEA 1PU2A 1T9GR 2AR0A 1XZBA 2JD2A 1PS9A 3N28A 4KR9A 2RGNC 1QC5A 4ZK6A 1GPBA 1XKXA 3KPJA 2Q7XA 4XX1A 2YASA 1W1UA 2FUG1 2AIRA 2WAMA 3EF0A 1MOSA 1SBTA 2AW5A 3HDJA 4FBGA 4BWFB 3THWB 2PMKA 4OHXA 2HDHA 4KPFC 3UAXA 4MV9A 3OTHA 4YJ2A 3FGNA 2PL1A 1JAZA 1M2FA 2AFIB 3GDWA 3IUYA 4WD3A 3PA8A 1DV1A 1G7SA 1VFPA 1TF2A 3R41A 4DQVA 5C5DA 1KZ9A 3M70A 1AO0A 2PX2A 2PH5A 1JBKA 2QTBA 1UBOS 5IAEA 4EG8A 4L2IB 4G4SO 4DDKA 3C14C 4FTWA 4BKQA 2GO1A 3MUEA 3NGXA 3ONFA 2VC2B 4Q6WA 1JQJC 4X95A 5LQKA 4G1FA 4ETMA 3QIVA 1XWFA 2VK1A 3T1NA 4Q7KA 3O9VA 3ICVA 5KVSA 1HZZC 4JT8A 2ZIWB 4G2NA 4O2AF 3FGZA 1CRQA 1V5GA 1FLDA 1NW6A 4KNWA 4N3CA 2OXTA 1XHEA 2H1IA 2J9XB 2R751 4YRCA 4BBPA 1XN1A 1BXKA 1NLFA 5FPHA 5I7FA 4W6QA 4WEOA 1IUPA 2PIAA 3ZDYB 3PR2B 3DHEA 2DE0X 2W2XA 4N8EA 3KQKA 2P9CA 1DPFA 3OESA 4HWOA 5ERYA 5CB4B 3KSAC 4IOLA 1K89A 1TEZA 2WVGA 2YXEA 4JLKA 3RH0A 2OM2A 3KEFA 1XCBA 1BGVA 2AUMA 4HUQA 3TD2A 3EXHB 3HJCA 3TLGA 1U2SA 1CCWA 2O3QA 4H1WA 3RS8A 2H2GA 2W6IA 4JGGA 3MGGA 3PVCA 3TTYA 2BV3A 2WTNA 1QIDA 3EJ6A 3W4IA 2FLVA 3M5DA 2I1LA 3A31A 3O38A 4OLFA 2P3QA 1NONA 2FPKA 1FOEB 1MDFA 4LOHA 5AW5A 3WL7A 1TC1A 3V3TA 4B71A 4A10A 3MMXA 4UTOA 1RWWA 4CMCA 3LC2O 3SZLA 1L4YA 3AK4A 3DBHB 3EGXA 1DKMA 4QXPA 4Z4QA 2OORC 2P9YA 1BS2A 3UK0A 2D7DA 1GL3A 4YRDA 2BEKA 3AEKA 4ACAA 2VTKA 1ZJ6A 2M1ZA 5EJAA 3F6SA 3FMFA 4PCAA 1LDNA 1RQGA 5KPJA 4C22A 3OETA 4EDFA 1IDOA 2W2QA 4NTZA 2HRZA 3HY3A 3NGLA 3EOAI 3OE7D 1TUBA 4Y2QA 1F2UB 1X1SA 3IT0A 1JP7A 2JGRA 4TMXA 1F14A 3IEUA 5TNXA 4UAJA 2VAXA 5TQ0B 2GI4A 2J0SA 5EE0A 4DT1A 2FSFA 8AT1A 2R6R1 2VJMA 4RAQA 4XTRA 1AGXA 2F1IA 3BE4A 4IJ5A 4DBZA 3KKMA 4ZANA 3F4BA 1YZUA 1GO2A 1DBWA 1W4BA 2ORYA 1MX5A 4H4CA 4ND8B 5LUAA 3TG2A 3GFPA 3HG7A 4P7FA 3P9NA 4QUHA 4WFIA 3JQ8A 3GUYA 1G9SA 4ZVOA 4OXRA 1W4ZA 2H00A 2ODWA 1KNXA 2ZJ1A 3MQ4A 2QP3A 2CNDA 1AUPA 3BFJA 2YJ6A 3KD3A 3LMKA 3MB8A 2EYUA 3QLEA 4K7JA 1N2CA 4PCUA 1NNSA 3OTOB 1NOKA 2ILTA 1QGUA 4CN8A 2GYUA 2BTQB 1CY7A 1MJGA 2XDQA 4YO7A 3B13B 3JVIA 1RE0A 4YRJA 4Q1VA 4JD5A 3PHLA 1OI4A 1C30B 3SQOA 1O1YA 5CCXA 2X15A 1FMFA 4MCHA 3KVOA 1QK5A 3A2MA 3VKVA 3QE9Y 3CNEA 1L7EA 2B37A 3UHFA 1DAEA 3WA7A 4ZT4A 1DFIA 3GP3A 3GOQA 3SSNA 2JLZA 1N2IA 2NLOA 5AXAA 4MEAA 5BWCA 2PUEA 1FB5A 2PR7A 2E6UX 4S2EA 5SY9A 1NF2A 1SOUA 4JOQA 5LP6C 4EB6A 2ZEJA 1J5EB 3TX2A 1K2WA 1P4AA 4MB0A 4QJ4A 3FTFA 3FE2A 4M22A 2QN7A 1P1CA 2GJ9A 2XUKA 3IKLA 3KQYA 2FXVA 2QX6A 2EBWA 3ESRA 3K1ZA 3UWDA 3OIYA 3FH0A 1OXTA 5LQAA 3EIWA 2XMCA 3ZY6A 2EWMA 4Y2HA 5AJWA 2H7XA 2CFIA 2HMAA 1QK4A 1A5ZA 3DC2A 5DBHX 3E4CA 4CMJA 1CIPA 1U9JA 2PZMA 4Q1BA 1JQKA 1G20B 2DLCX 1X1DA 2XVAA 5HE8A 2AL7A 2DPMA 3TFQA 3L7JA 2CXHA 2XXJA 3FB1A 1SURA 1TM1E 3MGAA 4IS2A 5BN4B 2VSOA 4UUPA 2A1TR 5G1OA 2UUAB 4JJFA 1XMPA 1A8SA 3AEUB 4B2LA 4H7HA 4F3KA 4XEHA 3A1WA 1OXMA 4QGHA 3HXPA 5C4MA 5DLDA 4TKUA 3FFWA 3OCZA 1UBMS 3COWA 2A5LA 4GP9A 2FN7A 1YT5A 3MJHA 4YRPA 1ZDMA 2EP7A 3ZLTA 2ODQA 1A0OA 1II0A 1BFUA 2FSUA 1R9NA 2JNWA 3NBXX 3RKRA 4JC4A 4AX8A 1FDRA 2AEEA 1G21B 1P0PA 3M6UA 1BC5A 3V55A 4O2RA 5IJZA 4ZYLA 4GKAA 4HK4A 4J3NA 3EVDA 1H22A 3VYVA 4YV0A 1UM8A 4M1WA 4PFSA 3PXUA 2QTMA 1V1RA 3EEIA 1JT9A 4D02A 1WCWA 5K8JB 1CQXA 3QHQA 1WZEA 5KJ1A 5CYGA 1BA3A 5BQ3A 3RU3A 4EUNA 4ZEMA 3BXHA 2PKRA 1HYBA 2ZULA 2NUPA 3R9XA 5KOHA 1QC5B 4RGYA 1GUFA 1KZ7B 5TX7A 1JALA 4RTRA 1MENA 3K05A 4IJKA 4NU6A 2FPWA 4CIVA 3L8ZA 4KOAA 2CK3A 4C30A 4M0DA 3N0WA 1J2UA 4JWTA 1XDBA 1OXKB 2HLDA 2PMBA 2W2MA 2Z09A 1XE3A 3P9IA 4IH1A 4N8DA 2JPDA 1FDOA 3LCRA 4TV8B 4WBSA 5JAQA 1ZK3A 5B7NA 5KC8A 1BKSB 1SQ6A 3BJRA 1THTA 4GC5A 4MH0R 2MMCA 2CV0A 3MJ4A 5AVXA 2D7CA 2QSZA 1YFZA 1UMCB 2H1HA 3NG1A 3MWLA 3RS9A 3S99A 5KTYA 1DADA 2BAGA 3AU8A 3G23A 5F4BA 1NX6A 1C5KA 2PSJA 2XWBF 2R65A 1XJ5A 2VCEA 3F3KA 3IP6A 4J76A 5GJCA 1SQ5A 1C3JA 1UPXA 2OCLA 1KR5A 1XPJA 1QP4A 3U7RA 2AC2A 1N0HA 2MINA 4BTEA 3AIOA 5CGQB 5KNCH 3FFBA 4KPGA 2BC9A 1LLDA 3T35A 2VJOA 3URMA 3N2GB 1KMNA 2OHOA 1A04A 5AHXA 5F7JA 3UG7A 4EPRA 4WNAB 4NU5A 4F2GA 3QV1A 4O4JB 1W85B 2A35A 4NMLA 3Q1KA 2X7JA 1CEXA 1RWVA 2IVZA 3I05A 2E4ZA 3MTEA 3R3HA 5DK4A 5BV8A 2VT7A 4N4AA 4EARA 1W4RA 4IJWA 1WM1A 3LLUA 2WA1A 1OBHA 4HYQA 4RKFA 3ASZA 1OLXA 1U8FO 2W8ZA 3DTTA 4JP3A 1EDDA 4N54A 1EX7A 1RIFA 5JMOA 4YCDA 4W7HA 3UT0A 4R7ZA 2CLOB 2GPWA 2WG0A 5BR8B 4DV7B 5L3QB 1KBQA 1QRDA 2X1VA 4KGDA 2NZXA 4E2FA 1M8FA 2IUTA 2HBZA 2ZANA 2ZBQA 4UE3S 4HVLA 4CEJA 5JBIA 4B4DA 1X2EA 2RGAA 2HZ7A 5ULLA 1G0OA 2IX3A 1T4DA 3GCGA 3Q0IA 5LNK6 4F5ZA 2ZS9A 3CW2A 4ODIA 5HRCA 1NF3A 4GZ5A 2INGX 4ZRMA 1JVNA 2XZTA 3BWVA 1YWGO 4MI6A 3WZ2A 5EPEA 4DDMA 1QBGA 2GBLA 2O5VA 5FBKA 4KR2A 3STWA 5K8CA 3IT3A 5FUXA 1XTTA 1V5IA 3PBKA 2C7RA 1DBRA 1YMQA 3W6PA 3S1LA 3KL4A 3HHEA 1OKKA 4RK0A 5JCZA 2GHIA 2FZWA 3L8EA 4XLTA 1N3IA 1QGYA 2ZU0C 3CLSC 1W5TA 1NSTA 2XUOA 1NY6A 5GP1A 1XD2A 1OXVA 1SCUB 1PR9A 1WP9A 4GI5A 1DIBA 3V8VA 1LPNA 2EZ4A 1Z0KA 3G0BA 3JQAD 1CZOA 4CMIA 4DIBA 4FR5A 4F9EA 2WNIA 4LJKA 5JT1A 2CW5A 5FTKA 3GP8A 1B23P 1DI0A 4CU2A 1HEIA 3CR8A 4J0IA 2PKQO 2CDAA 5IP5A 1I2CA 1F0PA 3JYNA 5F78A 3JCZA 1LLUA 5JCOC 5EMMA 2YMPA 1OI2A 3FDXA 3A4IA 3MTGA 5BR4A 1XZAA 3NT5A 1SQGA 4F2WA 4EF4A 3ZI7A 4EPVA 3H3XA 3AR6A 1UJNA 3EUFA 3EB9A 3LL7A 8LDHA 1T0BA 3JD1A 4G0YA 3R0JA 1C2TA 1P7YA 3JQGA 1TZBA 4ROSA 3PDWA 5CT5A 1R4NA 3TOXA 1E99A 1GKUB 2PBZA 1XELA 2VRNA 3EBOA 5A9SB 2XRMA 3K4PA 2IZ6A 2Z2YA 2IHJA 3LHSA 3PQCA 2X5OA 4EFKA 1N1DA 5KSWB 4EG4A 3O8LA 1V1RB 5ED0A 3NM5A 3WP1B 1IDN1 4PBTA 1HDYA 2J5KA 3H11B 4FFBA 1ZLYA 2ODPA 4MGYR 2O8EB 4MJXA 3NTVA 2QKYA 3OFKA 1N6IA 4WKOA 2IEGA 4OBWA 1QZ3A 2X13A 1XZNA 1RRPA 3FDZB 3K09C 2J9RA 4FGSA 4PYLA 3AVTA 2PLAA 4PO3X 5AM2A 1L4HA 5KJ6A 4O4LA 3GDHA 4JA2A 1D4OA 3IBTA 1E2NA 2VP2A 5DYIA 1Y6JA 1I3OA 4QELA 3I0ZA 1GPMA 2BFDB 4QBTA 4L8GA 3V4VB 4PBRA 4ZDWA 2FPLA 2FJ0A 1R4MB 3L3BA 2O48X 3P0IA 4GMXA 3R6DA 3WLRA 1Z4PX 4D6PA 3FA2A 3FR7A 5C1BA 1VJ5A 3G9ZA 5BN5A 2VNSA 2GJ4A 2CXNA 3R7DA 1GTRA 3B89A 4BLWA 3GCWA 5L3SB 3IE1A 1ISGA 3KL2A 3TX6A 2F9MA 2R4TA 3GLVA 3H2GA 3SBXA 4F72A 2D0DA 4N9WA 1EJBA 3U9SA 3ZCVA 3HS3A 3QVSA 2HGZA 1RAFA 2F8SA 3KFVA 1JQ3A 1KVSA 2AMVA 2DPXA 2OO7A 3CXRA 3DT6A 4AQDA 4RYLA 2I1WA 2TS1A 5GZ6A 2PGOA 3FGOA 5E2BA 3PC6A 4UAUA 5D84A 1M34B 3REOA 5JWRA 1Q1ZA 2XGMA 4IH4A 5KYUA 4KSBA 1VMAA 4ABTA 2JJ1A 2ZUWA 4XYEA 5G4KA 1JLLA 3TDNA 4C0LA 4ARCA 4I7EA 4AP5A 1RYNA 4K87A 2BH9A 2QN3A 3ZY3A 1MQ8B 2CLHB 2ZIFA 1W87A 3JQ9C 1ZIYA 4OHRA 2AJLI 4MR7B 3STVA 3W2IA 2ZWVA 3AINA 1R6AA 3U31A 4QWMA 4X91A 3DAHA 4TSRA 5L3QA 1B3RA 3JARB 3KJZA 3NYQA 2ZAIA 1Z2DA 3B9QA 4JXKA 4Y18A 4CCSA 1XTBA 4R0VA 3SR4A 4I1UA 5JWOA 5F7XA 3L4BA 5EUMA 3QEOA 1AB5A 3L8DA 1DEKA 1O5OA 1HT2E 1U9YA 2DUNA 3LV8A 1CY0A 4CG0A 4K1LA 4D3FA 3T99A 3FCEA 3CZ9A 3N8NA 1LBEA 221PA 1HTBA 2QQEA 1PNQA 2W43A 2Y99A 3UUFA 5LB4A 4AW9A 3BF8A 4I2NA 1G17A 1C9NA 1K3UB 1PZFA 1W6UA 1OXBB 5IW8A 5C1IA 1KQPA 4R9UC 3WY9A 5JMTA 1XMQB 2XF2A 2B8WA 3BSYA 3QVVA 3I0NA 1W36C 3ABOB 4FEEA 4N12A 4C7OB 1B8PA 4N41A 4BGEA 1EFCA 4KRYA 2A9JA 3RBZA 3TRHA 3W06A 3G7UA 1TK2A 4C01A 4BNKA 1IXYA 2REOA 1W8DA 4L07A 3C7TA 4Z8XA 5LYYA 3W78A 1B16A 1PW7A 4R31A 1DE0A 4ARSA 4EHAA 4DIMA 3WK4A 2YH2A 1TDJA 3ZIAA 2WJGA 1LNQA 1WX1A 2I1QA 2JLUA 5PNTA 2VHQA 1BVYF 5FUWA 3V2GA 1X19A 2Z0MA 2GJAA 2R84A 1R4MA 4BFYA 2ZK7A 1LI7A 1OFHA 1T3LA 2V58A 3UJ6A 4M83A 5EUBA 4QUDA 3SLKA 2YINC 2RH4A 4JAVC 1UP4A 4DC9A 1N1MA 1PEYA 2WHEA 3OIWA 3PFWO 3ZZMA 3R2JA 3WMFA 4CF5A 5J3JA 4BKOA 1TA0A 2VQEB 4TVOA 2QN1A 7REQA 3G68A 2WP0A 5I48A 3DLHA 2WWWA 4D8UA 3ROEA 2O0HA 2R2GA 3RVNA 4DS3A 1AF4A 2ZB3A 1ZMRA 3VHXA 1NJGA 1JDNA 2NO7A 1DO8A 4QKQA 3ADKA 4C7XA 1F5SA 2D2XA 5C4IA 4Q03A 4H17A 3WFZA 3ABSB 4KFRA 4R2XA 2F4VB 4KACA 1LVGA 1NKSA 2M6KA 2XZLA 1ZGZA 5HSGA 4L5YA 4RWZA 2WM8A 3NM6B 3DAGA 4RM2A 1KVUA 1NPYA 3PNPA 3WVNA 2O3UA 1PG2A 4P86A 1X94A 3HDVA 4F06A 1W88A 2NU7A 3AEQA 2OFPA 2VUHB 4G41A 4Q05A 3OZRA 5JZSA 4EW3A 4K5QA 3F67A 1A5AB 3GJ5A 4TGLA 3H5IA 4E12A 4OFBA 4RGQA 3KLPX 3QQ5A 2YIDA 2P6UA 1XJWA 3CO0S 3FIJA 3L93A 3ACBA 1ENYA 3UOWA 4EK9A 3QE4A 2C31A 4YONB 4AY5A 3B3QA 4EHHA 5CT8A 5JD3A 1AKTA 1N6KA 5JJ5A 1CUIA 1TLTA 3HO8A 2VDOB 3PNKA 1A5TA 3EE6A 4K86A 3TXXA 1F8XA 5GZ3A 1K92A 1KMMA 1NJ1A 3PC7A 4J0QA 1L1QA 1NVTA 1GPH1 1R50A 4MR9A 3UM9A 2QRZA 1NR7A 1P3Y1 1W25A 3BICA 5DLPA 3ZUPA 5J2UF 4LI3X 4NFHA 2VSYA 4M9QA 4CLOB 4D9IA 3D6HA 4JVNA 5LA6B 5AIAA 3ZGYA 4WNYA 3L18A 1I33A 1NUHA 3OMLA 3I1JA 4IIUA 4K9NA 1U31A 3FNBA 4FONA 2NP6A 1UH5A 3FWKA 1MN6A 3LF1A 4PRLA 4EHBA 3PK0A 2CZGA 4G84A 4RLFA 1XRJA 4BL5A 5JAPA 4HN4B 3GCDA 3E8MA 4BFCA 3GJ6A 3BDAA 4ZIRB 4QVIA 3UBMA 3RK1A 1FW6A 2P69A 3DM9B 1G1AA 3KJFA 2BKAA 4RV5A 3AILA 3D2CA 1U9IC 2ZAMA 4S24A 5DFAA 4D4MA 1T8PA 2E1RA 2YRWA 3VSDA 1K6XA 2Q1WA 1QU2A 2IH4A 1MO3A 3INRA 5DCUA 3IDSA 5LA6F 2IGBA 3QITA 2IEDA 1AUQA 1WLSA 3JATB 1QV6A 1NC3A 1Q22A 3L40A 2RGRA 3SR3A 1UADA 2C2KA 1FK8A 1MT0A 3E22A 3VO1A 3BQNB 3S8EA 2I8CA 4MUFA 5KKNB 4DLRA 2UVPB 1SEPA 1GKLA 1M6YA 2A7XA 4B1FA 1IUOA 1SGWA 1BWPA 4LJ5A 4DRYA 3ZLBA 2GETA 3SJUA 1XRQA 5EFZA 2Q41A 1JEYB 2ZS8A 2B30A 4G1UC 4ON9A 5T4BA 1TA4A 4BC1A 2XECA 4LJ6A 2TECE 3T7EA 4TMYA 3FWYA 2FX2A 4YYZA 1KP2A 1QHSA 3KHKA 2EKDA 1NU6A 1JIQA 3DQQA 4LRYA 5DXAA 3UC5A 3UXHA 4ER5A 3L8GA 4CCWA 2GEVA 3DWEX 1FX1A 3V4ZA 4S35A 4K6CA 4X00A 5DBIA 5AOAA 2PHZA 4JB0A 4GOXA 3I5AA 4NBVA 4MVJE 3T1YB 1GL9B 1FVXA 1DO2A 1WU8A 3AXTA 3N9IA 3JWGA 3R6WA 4Q4DA 4ENRA 3KYIB 1L8OA 4BU0A 1Y8QB 5GINE 4PEVA 1H2FA 4K9DA 3FPLA 4FGWA 4HS4A 4ZVKA 2ZZNA 1OUMA 1EVKA 3CF4G 4HN9A 5EE9A 2E37A 4XJSA 1P1KA 4MX8A 5HQ3B 4HGRA 1QYDA 1ZR4A 1BEZA 1BTOA 4O5AA 4A3SA 4C88A 4LWQA 1Z6YA 5FUYA 2AF4C 3WLSA 3SBDA 4ZDJA 1ULAA 2UZAA 2CHFA 1R0LA 3A4YA 2PSHA 1PFVA 1V5EA 4O25A 3SM9A 4CMAA 1MH9A 1PIWA 3IHTA 1JEQB 1QAQA 3EDQA 1B8OA 2Y1GA 3ZBTA 1UEJA 2R6AA 4MIEA 4Z53A 5J59A 3JR7A 3LJKA 1DZIA 3HFRA 1ZG3A 2EYQA 4EB3A 1KHTA 2GPNA 1CEQA 2W6QA 1NUSA 2XDQB 3QPVA 4G97A 1P2DA 4Q9IA 1LSJA 3A2LA 1EAYA 3WDMA 3W2FA 4E6EA