3HDYA

Crystal structure of udp-galactopyranose mutase (reduced form) in complex with substrate
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
365
structure length
365
Chain Sequence
QESKGFDYLIVGAGFAGSVLAERLASSGQRVLIVDRRPHIGGNAYDCYDDAGVLIHPYGPHIFHTNSKDVFEYLSRFTEWRPYQHRVLASVDGQLLPIPINLDTVNRLYGLNLTSFQVEEFFASVAEKVEQVRTSEDVVVSKVGRDLYNKFFRGYTRKQWGLDPSELDASVTARVPTRTNRDNRYFADTYQAMPLHGYTRMFQNMLSSPNIKVMLNTDYREIADFIPFQHMIYTGPVDAFFDFCYGKLPYRSLEFRHETHDTEQLLPTGTVNYPNDYAYTRVSEFKHITGQRHHQTSVVYEYPRAEGDPYYPVPRPENAELYKKYEALADAAQDVTFVGRLATYRYYNMDQVVAQALATFRRLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords UDP-galactopyranose mutase
publication title Structural basis of substrate binding to UDP-galactopyranose mutase: crystal structures in the reduced and oxidized state complexed with UDP-galactopyranose and UDP.
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 116
structure length 365
sequence length 365
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 5.4.99.9: UDP-galactopyranose mutase.
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03275 GLF UDP-galactopyranose mutase
A PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3hdyA01
4PLWA 1E3LA 1HSZA 2GUGA 2DT5A 1J0XO 4RLHA 1YB5A 3MCVA 3VZSA 5B12A 4CR7A 1NWCA 5IXSA 2V6BA 1AHHA 3MOGA 4BQRA 4Z3DA 5AXAA 3DHYA 2GASA 2FMUA 4Z9FA 1MA0A 4FC7A 3OIDA 4R41A 3ROQA 3V2HA 5KJ6A 4J49A 1NVTA 4HNHA 3JQCA 3ZU4A 3RUCA 2BFMA 2UVDA 4OOEA 4PG5A 1UXGA 3PHHA 3V8BA 2AA3A 1LSUA 3CMCO 1WW8A 2YY7A 1TA4A 3GC6A 3GFBA 3HZZA 1ZXLA 3HB5X 5ICSA 4WOJA 2OL4A 1QYCA 3RJ9A 3FN4A 5ILOA 1E3WB 1VJTA 3PYXA 2C07A 3M6IA 3HDJA 4U0KA 4YCAA 1R6DA 1IHYA 3ENNA 2O3TA 3BMQB 1SEPA 3L77A 4HX5A 4LVCA 1T24A 1U3TA 2WYUA 4C7JA 1VL6A 1JU9A 2VNAA 4RJTA 5CEFA 3IL2A 2BFAA 4XYLA 3SLGA 3H3JA 3ZNOA 4Q3BA 4FJ1A 2DBZA 4W9NC 3V5NA 1PL6A 3DB2A 4FC6A 1PS0A 3VH3A 3LT1A 1HF3A 5HTOA 1EE2A 5CG1A 1GEEA 3TDKA 1QV7A 1ENOA 5TLSA 3WSVA 1JKIA 4R5HA 4DLLA 4J4BA 1ZK3A 3QVXA 4IBOA 3CIFA 4S1VA 4A10A 1NHGA 3KEQA 4J0EA 5C3MA 1VM6A 3L6OO 2O23A 3GF4A 3GN2A 3AI2A 5FI3A 5BR7A 1X1TA 4MKZA 3I23A 4XDYA 1BDBA 2X5JO 4FFNA 3HDYA 1EVZA 1Y8QA 3X2FA 2G0TA 2HCTA 2WD7B 3G49A 1XKQA 1ZIDA 3P19A 3PP8A 4JROA 1NASA 3IJRA 4NNJA 4DL9A 1R37A 3EY4A 4BVAA 4Z9XA 2GD1O 3VAZA 2BFPA 5DT9A 1U7TA 2EHDA 1EVIA 3AUSA 4MVJE 4IMRA 3VKUA 3WTBA 3DMTA 3OA2A 1SOWA 2VZ9A 4J0FA 2FY8A 1N92A 1A9YA 3C1AA 4PRLA 4E6PA 3PDUA 2G82A 3FR8A 4EDFA 3K31A 2I76A 4J1TA 4ZQFA 1UJMA 3CXRA 3OFSA 3LC7O 2GPTA 3QV1A 4P22A 1UDCA 4IZHA 4GPD1 3RKRA 3U0BA 1WDMA 4CV2A 1W8DA 3OJEA 3MJCA 3IOYA 4WLUA 2EG9A 3VC7A 1I8TA 3KOUA 1P0FA 3WYEA 1QYXA 4JLWA 2GN9A 2YHIB 3JD0A 1ULUA 4KP7A 2HKIA 1KEVA 4CMIB 2ZTUA 2YJZA 2C5EA 1OAAA 3G0OA 4DYDA 3FNEA 1QLHA 4CM9A 3VVBA 2Q4EA 1EK5A 3KRTA 5JDCA 1HLPA 1Z74A 1NX6A 2VRCA 1T4DA 1VKNA 3FPCA 4ALKA 3IUSA 1ADFA 2I5PO 2J3HA 1HE3A 4LMRA 1EBFA 2J8ZA 5CHEA 3GRKA 4IGFA 5IN5A 1MG0A 4M55A 3ZU2A 4DA9A 1ISMA 4KQWA 3LC1O 3WBFA 2D4AA 4JIGA 4YJFB 4GMGA 2O3JA 1X7DA 1PR9A 5G4LA 1R0LA 3LYLA 4LK3A 3C24A 4EJMA 1RYEA 9LDBA 4R51A 4HKTA 4PLYA 1Y81A 1CJCA 4E30A 4BHTA 4YAIA 1R4MA 4CODB 1T2FA 3DHEA 4N5MA 4IDDA 4KDFA 2OOSA 1ORRA 1YDEA 4M87A 2Q49A 4XB1A 2D5AA 4G65A 1X15A 2WEKA 4NJMB 1T4BA 3ROPA 4CLRA 1ZMOA 1LUAA 1PWXA 2IXAA 3N7UA 3O8QA 2FPGA 4ZQEA 1GPDG 1UZLA 1WP4A 2EW8A 3VPXA 5JYEA 1GY8A 4MVJG 1ZEMA 3RC1A 3C7AA 3DOCA 2NSDA 4PRKA 3SC4A 2WYWA 4EUFA 5JCJD 2FHSA 3PHLA 2ZIZA 2X4GA 4WOKA 3TF5A 4EUHA 3RBZA 5JC8A 2O50A 4PVDA 1KVRA 2HJRA 4IS2A 2EP5A 1UP6A 3SC6A 4GSLA 2B4RO 2EERA 2EV9A 1LX6A 3KV3O 3SVTA 3LZ6A 4UULA 4XGNA 3Q9NA 4DTIA 2FOIA 4IINA 1X0XA 2VWQA 4JQCA 4LCJA 4NMHA 4WCFC 5EL0A 1DDOA 3M2TA 3H9EO 2Q45A 4LN1A 2B36A 1M6HA 3HQ4O 4WLOA 3NGLA 3W4JA 4YVFA 1NPYA 2YQ4A 1KYQA 2V7PA 3ZI0A 1HDCA 5T6BA 3I3OA 4CM6A 4D41A 3QJ5A 4AJ4A 4BNUA 3I9LA 3KSZO 5IDYA 1RM0A 3L9WA 3T4EA 3AM5A 4J7UA 5KVQA 2C20A 1I3NA 2FSVA 3WJ7A 3LU1A 4M1QA 1VJ0A 1E3WA 3QVTA 4AVYA 1CQIA 2AHRA 1EVYA 3BMQA 3RQSA 2I67A 3FR7A 5A5FA 4CM5A 3TRIA 5EMHA 3B1KA 4FSHA 5DN9A 2PD3A 1JVBA 4FGSA 3I9KA 4RV9A 1JWAB 2VUSA 4XDZA 5TX7A 3DXFA 2LDBA 3RSHA 1E7YA 1C1XA 2CFCA 2D2IA 5EQFA 4B8WA 3P2OA 1PX0A 2WE7A 4IS3A 5ADHA 1YBMA 4OIMA 3VPFA 3WB9A 2VUUA 1QKIA 3OETA 1LSOA 3GVPA 4AJ2A 4CMHA 3S8MA 1EK6A 4J9VA 3ZV6A 5K9ZA 2RH4A 4O59O 3E03A 4CM8A 1LRKA 2E48A 1H6AA 1NQ5A 5H81A 4DREA 3BXXA 2X8LA 3FSRA 1I33A 2JFHA 1C14A 2BI7A 2PKQP 9LDTA 1QSGA 4TKLA 3WGTA 4I1IA 3WSWA 4XQ9A 1IL0A 1IHXA 4EBFA 4DC1A 2PKQO 3CZRA 4BO2A 1M76A 1E7MA 4QSMA 4NK4A 2XXBA 3ZWBA 3VPGA 3RUAA 4ZN6A 2ZB8A 1EEHA 1LQUA 4MVJP 3VPSA 3EW7A 1Q7BA 4AFNA 3AOEA 1FJHA 2JL1A 3UHAA 4EJ6A 5CEEA 3D4OA 2YUTA 2X0NA 5DBFA 1WXDA 4IGEA 1NBOA 2AQIA 1MB4A 4CMAA 2CUKA 3VVCA 1W0CA 4CUJA 2YZ7A 3BMNA 2B37A 3IAHA 1PIWA 3LVFO 5HWSA 1A5ZA 3GGGA 5TT1A 3GHHA 4BQPA 1E6EA 4E5KA 4CQLA 4OM8A 5EJ2A 4OSPA 4BMSA 5J23A 4NQZA 3DC2A 5KNLA 3FNFA 2ZTMA 5A04A 2Y1DA 3ZCXA 2G1UA 3GEGA 4L0QA 1NYTA 4PLHA 3SXPA 3HNPA 5JC1A 2DU8A 5I9MA 5TS3A 3ZHBA 1HETA 2Q4BA 1PZHA 2R00C 2ZTLA 1XWFA 5FFFA 3DZFA 5MGBA 4DPKA 4QUKA 5TC4A 3GUYA 3JQFA 4OAQA 4RO0A 3IKTA 1P1RA 1OZAA 1VLLA 1HZZA 1X13A 3DZBA 1E7RA 4E5NA 3IIEA 4CV0A 2ZCUA 4U5QA 1UP7A 3VDQA 2AXQA 3E18A 4WEOA 1A72A 4ROSA 3NTRA 3KB6A 3PZBA 3L6EA 1A4UA 3GQVA 1NP3A 5AXBA 4AJ1A 4K26A 4PG7A 4E32A 1O0SA 5JXWA 4DMMA 5H83A 3H65A 3C8MA 4J4TA 2AE1A 3MJVA 1JTVA 3WLEA 4BB5A 3FNGA 1N8KA 3GK3A 2AEFA 2GN4A 1YJ8A 3OJLA 4BNKA 4E21A 4BL5A 2B4TO 4G2NA 1LNQA 2IZ0A 5A03A 1RWBA 4YT5A 4ZQGA 4NIMA 3L0DA 5T8KC 1KC3A 2CY0A 1DHRA 3MWEB 1CERA 4EI2A 3ENKA 2JD0A 3NX4A 3GNTA 2ZB7A 1Q2XA 3JD4A 1R4NB 3F5QA 4MIEA 2J3IA 2OFPA 1KVUA 2PA3A 3K8ZA 4E31A 3PJEA 2EGHA 4IXWA 1XU7A 4IY1A 1Y5RA 4RDHA 1GDHA 2NQTA 3NT4A 1SOVA 3F6YA 1YGYA 3PLNA 4J2OA 2Q3EA 3VKVA 3WBBA 3B1JA 3NTQA 3AI1A 1T2DA 2PD6A 1I30A 2CF6A 2NM0A 3CKYA 2PH5A 3EZLA 3ZHXA 3BA1A 4CMGA 3JTMA 4KUHA 4BGUA 1D1SA 2YV1A 4CM7A 5BSEA 5G2OA 2FSSA 1XQ6A 4NK5A 4C7KA 4X54A 5CG2A 1RM5A 5HM8A 2JHGA 3LT4A 4U8GA 1E3SA 3UUWA 3W4IA 4BIIA 1DB3A 1ENYA 1DFGA 2X5OA 1YXMA 2VZ8A 3W6UA 1XCBA 2PV7A 3ZWXA 3TL2A 1HTBA 3WLFA 2JAPA 5C7IO 1CIVA 1LLCA 1JW9B 5FWNA 4BO9A 1WPQA 2NU8A 1DJNA 2I3AA 2JCYA 3S1LA 1LU9A 3HSKA 3QW2A 4Q39A 2C2XA 5IF3A 4U6SA 4D7AA 2VN8A 1N1EA 1ADCA 2JD1A 3KEOA 2BH9A 3JYNA 5C7OO 3FTNA 4O63O 1B14A 1HRDA 2ZQYA 3UGKA 4Y6SA 1GD1O 1P31A 2HK9A 2O2SA 5JAZA 1NFFA 1CEQA 1PU2A 4B7UA 4YJHA 3O38A 4NHEA 1LLUA 4FIZA 4Q3CA 4R16A 4CLXA 4XR9A 4LISA 2BLLA 4CLHA 1XQ1A 3DAGA 3OA0A 3KXDA 2ZATA 3UAGA 4G5HA 1GZ4A 1DAPA 2QW8A 3EUWA 5G0WA 3D3WA 4IMPA 2HUNA 4WCDA 2A92A 4B79A 4RVFA 2EGGA 2W4QA 5JO9A 4FD3A 1F17A 3IJPA 5IAAA 3DFUA 4HFRA 4R1TA 1QLJA 1YO6A 2DTXA 3U49A 3RFVA 4IJWA 4Q3DA 3D0OA 2R6JA 4XA8A 3JQGB 5L3ZA 3U62A 1NR7A 2DTDA 4HV4A 4ZD6A 5F5LA 5ES3A 4MO2A 1CYDA 3CZMA 4E2XA 4GLOA 2PNFA 1CETA 1VPDA 2YFQA 4Q3EA 4NG5A 4MVJI 3I83A 1K2WA 4GX0A 1IPEA 1DC3A 2NACA 1BXZA 1TT7A 4J91A 4RGBA 4YACA 2I66A 1PJTA 4CPDA 3IUPA 4JBIA 1ML3A 5DOVA 4XQEA 2NVUA 3UF0A 3RU7A 3D5QA 4NBRA 4RVHA 4B7CA 1ZW1A 1DRVA 3ZHZA 3A9WA 3E9QA 4B3IA 2TMGA 3LLVA 3VH2A 2DPHA 4BO3A 2QYTA 3E9NA 2Q46A 5F1PA 3KYDA 2JAHA 4IQGA 2PH3A 3NUGA 1EUZA 2BF7A 3FWNA 1ONOA 1SB9A 3BTVA 3TL3A 4GWGA 3WS7A 3L4BC 3AUUA 1K6IA 1M67A 4YEDA 4YAKA 4LMPA 1C0KA 1N7HA 1OC2A 1LLDA 2X23A 4I9HA 3RAJA 3RUFA 3MEQA 2F1KA 3TOZA 4DWVA 1TT5A 5EIOA 2ZKLA 3BMOA 2Y0CA 1N9GA 4CMBA 1B15A 1PEDA 2EIHA 4K28A 2AEMA 4FS3A 4CQMB 5FI5A 1P9LA 5KOIA 3PQFA 4NZ9A 5DBGA 2DM6A 3NTOA 1KBZA 2Y93A 4UUOA 1I2CA 2OBNA 2YW9A 3EMKA 4KWHA 3F3SA 1HLDA 1E0DA 1ZNQO 2EKLA 4IDAA 4L4RA 2O2YA 2C5AA 1WZIA 4GVLA 3HJAA 1ZK4A 4AJKA 2WMDA 4J9UE 4WCFB 4CR6A 4E12A 5B37A 3RUDA 4BUCA 3S2EA 1GUFA 1U3UA 3A14A 2VOJA 1K5HA 2QRJA 3DR3A 1PJ3A 4NU6A 2GR9A 1PL8A 3LT2A 2O7QA 4QEDA 1GAEO 3FD8A 5F1OA 4J1SA 3WYBA 5CAEA 2PY6A 3FBGA 1IZ0A 2SCUA 2BELA 4W82A 3G17A 4NFHA 1JWBB 2VCYA 1R0SA 1NPDA 3VZRA 5AXCA 5L4NA 2Z1NA 2FR0A 3DZGA 1YJQA 5BSGA 4UUNA 3DBHB 5F1KA 2BGLA 3HN2A 5DCYA 4PLVA 4XQCA 1CF2O 3V2GA 3ZV5A 1ENZA 1OOEA 3WDSA 3OECA 3KLMX 2J6IA 1PL7A 5G0SA 4E4YA 2WTBA 4W9NA 5EPOA 3ASUA 1GYPA 5JE8A 3GH3A 2NU7A 1DLIA 3JQ8B 1JN0A 1I0ZA 1YS4A 4XIYA 2AG5A 3WQSB 4IXTA 5IG2A 4TVBA 1Q0HA 3FWZA 1V8BA 3GAZA 2IODA 3WIDA 2X0JA 1ADGA 2ZQZA 3C7DB 4YBZA 4RVUA 4OL9A 1K0UA 4YAJA 2Y1GA 1AE1A 2E4AA 1VC2A 2UUPA 4DLAA 1ONPA 1ZJYA 4ZHSA 4EJ0A 3DAFA 3MJSA 2JKVA 3GN1A 4UUPA 2EKPA 2D59A 5B4TA 5JFOA 4N5LA 4YWJA 3QWHA 4ZRMA 2X22A 5THQA 3RASA 4DLBA 3QIVA 1B0AA 1KEUA 3WNQA 2FZWA 1YKFA 6ADHA 1RYDA 3MTJA 1MGOA 1MP0A 4TRNA 4BNXA 2HLPA 2GSDA 2NUAA 5JBIA 2Q2VA 3RUHA 2ZYGA 4U0JA 4XX0A 2HK8A 2CD9A 1P1FA 3G79A 4DUPA 1XHLA 4YR9A 4D0RA 1XA0A 3A1NA 4PVCA 3WGIA 2ZJ1A 4BOYA 2HMUA 3NEPX 2I99A 4KTTE 4XEHA 1C1DB 2Q2QA 4GH5A 4PGFA 2XPCA 4IDGA 5BNTA 2AE2A 1B8UA 3KTDA 4BKUA 1MXHA 1LSSA 1IULA 3HB4X 4JXKA 3WNVA 2ZJ0A 3M1AA 1S7CA 1ARZA 4RPLA 1T1RA 3PIIA 3FF4A 1DXYA 4IQ0A 4QECA 4QTZA 3JSAA 4R54A 5KTKA 1P0CA 4BGIA 4HWKA 4WNIA 1GADO 1YQDA 1LA2A 3G1TA 3UCEA 1GPJA 2CDCA 4MDHA 4YYZA 1MC5A 3GGOA 4J3FA 4KUGA 5G0VA 3WR5A 3TWOA 1TEHA 5KVVA 4ZVVA 3H2ZA 2Y1EA 5L51A 3D5TA 3LC2O 4M8SA 3LF2A 2Y67A 3RKUA 4TMFA 2CSUA 2CDAA 1EFKA 5L4LA 1EUCA 2B69A 3N74A 1VRWA 2DFDA 3IKVA 4P8RA 2FZEA 2FR8A 1F12A 4YA6A 3GMSA 4BNFA 1LDEA 5JAMA 3D1LA 4E2WA 1DO8A 1D3AA 2E49A 4LGVA 4YXFA 3DL2A 1GZ6A 3I6IA 1MC4A 3PYMA 4R3NA 1F8GA 2WSBA 4F46A 3T7CA 4GMFA 2AG8A 4WLFA 2EXXA 1HDRA 1WAMA 1HT0A 3E8XA 4DPLA 2V6FA 1QP8A 2G76A 5CDYA 3AI3A 1HEUA 5TRTA 3PJFA 5A05A 4RF3A 5HA5A 4FFMA 1BHSA 1BXGA 3K30A 4GGPA 3ZNPA 3GDFA 3MZ0A 4GWKA 5GMOA 1JVSA 2GN6A 3I4CA 5TNXA 4XWYA 4YT2A 5AQ1A 1U5AA 1XEAA 1BRMA 5HS6A 3H4VA 4H15A 1K6XA 3KZVA 4I08A 1MFPA 1NVGA 3DOJA 3K2EA 5IZCA 1P1JA 5IJZA 5KVSA 3Q3CA 4JGBA 4YT4A 1HYHA 2PGDA 2W2LA 3DBLB 1K3TA 1V9LA 2RHCA 3LSYA 5HRUA 5JYDA 1LXCA 4I5EA 4EITA 3PFFA 4BKRA 4RLSA 1NHWA 3F4LA 3PZRA 4GX1A 1W4ZA 3SX2A 3CMMA 4BNLA 4II2A 1DRWA 3RC2A 1ZMTA 4IM7A 2AQKA 2X9VA 2YDXA 1QORA 3H3FA 3O03A 4ALIA 4HFMA 3A28A 5JMPA 3ROKA 4CLOA 4E2ZA 4JN6B 4W7HA 2HDHA 3ICCA 3EGOA 4GGOA 1I2ZA 3UCXA 1FDVA 1H0KA 5JNLA 4TRRA 1I32A 3EYWA 1O89A 3AWDA 1Y7TA 4GX2A 2BFOA 4XJSA 1D8AA 4AL4A 3GHYA 5KJFA 4J16A 2NTNA 2HK7A 2DLDA 3O26A 3BMCB 1NTOA 3DMTC 4WGGA 4L76A 3FI9A 5DP1A 4ALJA 4IIUA 1MXFA 1R16A 1UDBA 4UEJA 3TN7A 2QZZA 4JP3A 3WG9A 1KS9A 1ID1A 2WD8A 3RWBA 1WVGA 1OBFO 3U4HA 5GZ3A 5JAIA 1VL8A 1A7AA 4YRBA 3PLRA 1PJ4A 2DAPA 4D43A 4N54A 1A71A 4NDNE 4DGSA 5EESA 1DIAA 2H63A 2IEDA 1ZVMA 1IB6A 2VTEA 5L7YA 5A9SB 4YJGB 4URFA 2QZ9A 3V2UA 3AY7A 3DHNA 4NJOA 4ND2A 2FRDA 2GGSA 3R3JA 3EAGA 1MX3A 5EQDA 1Q7CA 5TF4A 2H9IA 1O9BA 3QVSA 1ZK2A 4XZ3A 1MUUA 5IDQA 3DBVO 3GZNB 1QYDA 1ENPA 1I3MA 5L7WA 1YB1A 4JJIA 1M6WA 2GYYA 3AW9A 2GZ2A 4J7XA 1T2AA 4ESOA 5TIIA 3KYCB 3NDIA 3GVHA 3TZHA 3NKLA 3OIFA 1PJBA 3NGXA 1H6CA 4A0SA 1ZSYA 4BO8A 4CLEA 3AUAA 2NTVA 4CUZA 4KWIA 1UUFA 4GBJA 4AJHA 1NR1A 1DRUA 1YRLA 5ITVA 4FOOA 1H9BA 4PIVA 3K96A 1PJQA 1GZ3A 4NH4A 4DIFA 4KMSA 2C59A 1M75A 4I5DA 4GSKA 3W8FA 3BAZA 3IQDB 2GF2A 4U6QA 1Y8RB 1H6DA 2VYVA 3ZWYA 4YT8A 1VSUA 2C29D 4ALLA 1SAYA 1C1DA 5CDSA 4D79A 5U9CA 1Y9EA 4RPKA 1XU9A 4RVDA 1U3WA 4CJXA 1GV1A 3JYLA 4D3FA 5DBIA 4BNYA 3ONDA 1LC3A 1YL7A 3KM0A 4XGKA 1EUDA 4YQYA 1LRJA 3SBOA 4DIBA 1SCUA 1PGNA 2R00A 5G4KB 4D46A 1TXGA 2OXIA 3QSGA 1AGNA 1IY8A 1GYRA 4QO7A 1H9AA 1HYGA 4R1SA 3HUDA 5IXYA 3DDNA 5L95A 2VWGA 1BWSA 2Y0EA 3HDHA 3TJRA 4P4GA 3NT5A 3DOOA 2WD7A 1LBEA 3HWRA 4LRTB 3JCZA 4FBGA 4ND3A 3UW3A 4DMLA 5I7EA 4M86A 1PWZA 4GAEA 1X7HA 3KETA 2UYYA 1HZJA 4PZEA 4D0SA 4OXYA 5A3JA 3AM4A 5JY6A 1H2HA 3U4CA 1WLYA 1P3DA 3F47A 3KSUA 1UXJA 3RVDA 3PTZA 4HFJA 4IIVA 3WFIA 2RAFA 4FFPA 1V3UA 1I3KA 2IE0A 1P1KA 1Z82A 2GNAA 3W8DA 1E3IA 1U4SA 5IZ4A 3INGA 4CMEC 3KVOA 3IS3A 3KSDO 3RIHA 8ADHA 1SZJG 1ZK0A 5G0UA 4AJPA 4MVJH 1ZEJA 3ITDA 2UAGA 2C7GA 2I9PA 4R4JA 4TZTA 4RPHA 1FDSA 4EYEA 1RM3A 2HMSA 5IFLA 1EDZA 3UICA 1XLTA 4D42A 1ZSNA 2AMFA 1E7SA 3F46A 3NV9A 2YHIA 3I1JA 2W2KB 4M89A 4O0LA 4CV3A 1PTJA 1PJSA 3P2YA 3ST7A 3X2EA 3EK2A 3VTFA 4CMIA 3T7EA 3MJTA 1AXGA 4W99A 1OMOA 3JQ6A 3VHRA 3AU8A 4BO4A 1BW9B 2Y99A 5A4DA 2R2GA 3AY3A 5COBA 3QWFA 2WM3A 4BGVA 5C7LO 4TRJA 5A9RA 5CDTA 2C7VA 5LC1A 2VNSA 3L07A 1R66A 1TLTA 2OUIA 5T67A 4XIJA 2B5VA 1FDTA 3Q9UA 3GVIA 3UXYA 5LDGA 2PZJA 1KVTA 3CEAA 1ZJZA 3OBBA 3A4VA 3W8EA 5L4SA 5K6AA 1G1AA 3TFOA 1Q7GA 4D44A 3ZWNA 4BV9A 3JV7A 1L7EA 4YJFA 4GKVA 4WECA 1JQBA 1I24A 2B35A 4BNNA 1T25A 4R5MA 4ZA2A 1GYQA 2TMDA 4EEXA 3GVCA 4OGWA 3BYZA 2I65A 3RU9A 5BNIA 3PRJA 2PR2A 2ZCVA 3PDJA 3KUXA 1Z45A 3K92A 4ND5A 3BMCA 3AOEC 5CDUA 4NJMA 4XYMA 4CQMD 1YOVB 5CP8A 1W6UA 3TOXA 1YB4A 4IUYA 1HSOA 5COAA 4AJEA 1U7HA 4B4OA 4CM4B 2EP7A 1XYGA 4R3WA 4GI2A 1MV8A 5JDIC 1RJWA 3RFTA 1P77A 3VDRA 2FR1A 4II3A 2W2LD 5DP2A 2P68A 3HDQA 3PEFA 4A27A 3A06A 3F1KA 3OP4A 3NT2A 1F8FA 1SNYA 1YQXA 2BGKA 1HKUA 2HSDA 1E3EA 4YQZA 5CPBA 1YONA 4JJFA 4B3HA 3OH8A 5L40A 4JK3A 3K6JA 4WJZA 1CDOA 1N1GA 2P9GA 3WQQA 1HE5A 5B1YA 3JYOA 3MJEA 3I9NA 3AFMA 1EFLA 4W6ZA 5B4UA 4ONEA 2RCYA 3OF2A 1OI7A 4FB5A 4YAEA 4PLPA 3ASVA 2C0CA 4OKNA 4IJKA 3EVTA 1XDWA 2RH8A 5I8ZA 2P4HX 3B70A 2A4KA 1ZCJA 1U1IA 4WKGA 3EVNA 3GDGA 1YL6A 4ZQHA 4K1LA 2P9EA 1KY4A 3C1TA 3G1UA 1ZSVA 1PS8A 3BHMA 3PGJA 5T5QA 4AICA 3QQPA 4ZJUA 1JKFA 1MLDA 1YWGO 3KLPX 5AVOA 3M1LA 3Q1LA 1DFHA 5CPFA 1J4AA 4RPJA 1E92A 3DBRB 2PGJA 1BG6A 1YH3A 2F00A 3VZQA 5JSFA 1DBVO 1EMDA 1C3VA 5ER9A 2DBQA 1Z73A 3VH1A 1ISIA 4FCCA 1VI2A 2B83A 5I7VA 1UXHA 1ZZEA 1DIGA 3EZYA 4Y6PA 3H9JA 4JBGA 1AN9A 1Q0QA 1GL3A 4FOSA 1NFRA 2Q2WA 4UEKA 3STHA 4O5OA 1GUZA 1YQGA 3CUKA 4PG4A 1LDMA 3ITKA 3TZKA 2C54A 4JJGA 4PG6A 4FDAA 4YPOA 2CVQA 3BTSA 4XR4A 2HMWA 5THKA 2VTDA 1H5QA 1UZMA 3QVOA 2DQ4A 5BT9A 3L4BA 3MTGA 4BNTA 4N5NA 1J5PA 3L6DA 4MVJF 3VPHA 2QX7A 1BMDA 2WDZA 2JCXA 4B3JA 3ZU3A 5G0TA 2X9GA 3WICA 1SBYA 5C37A 3DQPA 4OHUA 2GLXA 3JD3A 1E1MA 3PJDA 1U8FO 4XRGA 2UDPA 4L8VA 1ZKMA 1B3BA 2G17A 3Q11A 4IDCA 4BO0A 4OXNA 4Z9YA 2VYVD 1CWUA 1DEHA 2D0IA 1I01A 2DBRA 3ANNA 3PHIA 5JS6A 4QQRA 3PPIA 4PZCA 4LVUA 3WJAA 1BVRA 2E82A 3ICPA 4XKJA 3PHGA 5C5IA 1UAYA 5COQA 4Z3KA 3RROA 1NVMB 4J90A 4XJTA 4K9DA 2W2KA 2PWZA 3PQDA 4UREA 1C0IA 4JNKA 4YRDA 1LC0A 3RC7A 3ONFA 1X1EA 4QO8A 4PFJA 1SB8A 1Y8QB 2FN7A 2O4CA 1JA9A 3OMLA 2A35A 3DZKA 3ZN2A 4Y6RA 1U2GA 2GERA 2Y1CA 3ETGA 4E33A 2HU2A 5BQFA 1DC4A 1OC4A 2LDXA 1Q0LA 4UVIA 5A5EA 3GNSA 4CLDA 2D3TA 3AY6A 3WGYA 1YE3A 3C7CB 1Q1NA 2Q1WA 2YDYA 4XRRA 2WYVA 1X14A 4OOFA 3U5TA 3JQ9C 1X7GA 1C0PA 3HFSA 5F3RA 5KCZA 1VKOA 2D1YA 4J4HA 3TNLA 3PWKA 3C1OA 4XYBA 4BO7A 3R3SA 1WDKA 3ANLA 4E2YA 2DTEA 2NTJA 4FFRA 3H9UA 5I9NA 2GCGA 1IOLA 1HDYA 1SEVA 1NPTO 2HJSA 5DULA 4F6LA 1UDAA 1MFZA 1EE9A 2A9FA 4IZIA 4NBWA 4AG3A 1HE4A 1YVEI 2EF1A 5JPIA 1GU7A 2J5KA 3FNHA 1SMKA 3S2IA 3G3EA 4JCOA 4QT0A 3RUEA 4KOAA 1U3VA 4R1NA 3P5SA 2Y05A 1L1FA 3WTCA 2NVWA 1R4NA 3QVWA 3HFGA 4CMJA 1NFQA 3GFGA 4ND1A 3ZW9A 1DHTA 1H2BA 3PK0A 1ULSA 1UAGA 1KVSA 2OMEA 1E7WA 3OJ0A 2OP1A 4C4OA 1FDWA 2ZTVA 2PD4A 4UVGA 3IP1A 5A9TA 1DIBA 3ZWPA 4U7WA 3E5RA 1PQPA 4M54A 3ETEA 4KDEA 4DC0A 2VQ3A 2QG4A 3NJ4A 2NV6A 4RORA 1DOHA 1DJQA 2H5LA 3OQ1A 1HL3A 2RBEA 2P5UA 4WLNA 2ZYAA 3UCFA 4OYRA 2GN8A 5KVCA 1LDGA 1T2CA 2CZCA 1N2SA 3GDOA 1C0LA 2QQ5A 1LSJA 1UZNA 4DBVO 4FN4A 1TI7A 1R4MB 4TROA 3ZU5A 3GG2A 2BD0A 2J5QA 4CMKA 2YFHA 4L4SA 7MDHA 1LDYA 4E0BA 2DKNA 1HXHA 3LDHA 1W73A 3AM3A 1Z7EA 1HYEA 4BNVA 5TT0A 2X5KO 3U9LA 2HMVA 3ZWWA 1LRLA 3F9IA 5I8WA 5LDHA 1PJLA 2FPPA 3DAPA 2Y1FA 2P91A 3D64A 3E82A 1QRRA 1R12A 3V1TC 3SLKA 5U1PA 2O3UA 1F14A 1RKXA 5I7SA 2NADA 2J5RA 3WWZA 4AJJA 3QRWA 4I5FA 3DTTA 3H6KA 1XIVA 2BGMA 4NBVA 4HNGA 3Q2KA 1G6KA 4BMNA 4MP3A 3ZV3A 1PR3A 4TWRA 5A02A 4A26A 1IZ9A 1LDNA 4RPGA 4IQ8A 4ZRNA 3WMWA 1B8VA 2P4QA 1S6YA 1PQUA 2QYSA 3SJUA 1PJ2A 2JHFA 2FP4A 3H7AA 4D45A 4CL3A 3JQBC 3R6DA 4RZIA 2DUUA 3I9MA 5HS4A 3INTA 3JQGA 4KZPA 2GDZA 3H8VA 5FF9A 3TZQA 3V1YA 4PN3A 1B16A 2CVOA 3TZCA 1ADBA 1FDUA 3TZ6A 4OQYA 1Z75A 3U09A 4B7XA 5IDWA 4CMCA 4ILKA 4RF5A 3CH6A 3RI3A 3LLSA 4IDFA 1KIFA 4TZKA 4XB2A 3Q6IA 5BSHA 3GPDG 4UEOA 7ADHA 5MDHA 3AJRA 1ZFNA 1UXKA 3ZWCA 1ISJA 1P45A 1C1XB 1VSVA 1TVEA 1I3LA 2Y66A 2EW2A 1I10A 3JQAB 3MWDB 5LCXA 3PHJA 2P5YA 4BKPA 1HDXA 1H94A 4L73A 3LQFA 3KHUA 1GR0A 1A4IA 4CM3A 1NNUA 1ISFA 2YYYA 4CM8B 2IYOA 3JQEA 1X0VA 5KKCA 1O95A 3B6ZA 4GL4A 4L75A 4M49A 4YJDA 4AJIA 5JMWA 2XOXA 2CF5A 1JAXA 4L74A 3PQEA 1LEHA 3WQRA 4B8ZA 1IUKA 2JFGA 3H5NA 4IJVA 4BO1A 3PWSA 4XCVA 4OO3A 4A5OA 1SC6A 4MVJA 4RQTA 1XG5A 1E6WA 3ADOA 3PGXA 2GO1A 4GVXA 4PLZA 5HBRA 3RCBA 3I9OA 2J3KA 1ZK1A 2RHRA 4L9RA 4RCVA 4CR8A 3N58A 3PI7A 2DFVA 3DWFA 2PKRA 3ULKA 4FGWA 2QRKA 2FWMX 4Z0HO 3QLJA 5TJHA 4PG8A 2V65A 3GUCA 3DZIA 4CQMA 1PSDA 3BMNB 3BTOA 3H9QA 3LK7A 4MVJM 1U8XX 4N18A 4QFCA 3S2GA 4TVOA 1Y9AA 4BV8A 1ONNA 2ZB3A 2V6MA 1PGPA 2NQ8A 3QWAA 5EERA 4CQLB 4HP8A 4JX8A 1DFIA 3WGQA 4OKIA 3QE3A 4WLEA 2P9CA 4TKMA 4DXHA 4QFDA 4DYVA 4F45A 2Q1SA 1I5RA 3B1FA 2XAAA 4DQUA 2BHLA 4WCFA 5AXDA 4RL6A 1M66A 1EVJA 1QV6A 4BO6A 2OP0A 3KBOA 1KC1A 2NLOA 4R9RA 3WOHA 3PIDA 3DONA 3UOGA 3DFZA 3F4BA 1Y1PA 5GZ6A 2HRBA 3GMDA 2AW5A 4RVSA 3E6AA 3QWBA 1BSVA 1JDJA 2ZYDA 3BIOA 1EQUA 4H7PA 1V3VA 3UN1A 1WZEA 4NBTA 5TQVA 3RJ5A 2XF8A 1AXEA 1WWKA 1XGKA 3OJFA 3OIGA 1KY5A 4DPMA 2AQ8A 2WE8A 1KOLA 2B0JA 1P1HA 3BZUA 4PCVA 3DBHA 1YBVA 1UP4A 2O4UX 2E37A 4CUKA 5ENDA 4FJ0A 2IXBA 2EKQA 1I2BA 3I9JA 5A06A 1IYZA 4BS9A 1EDOA 3JQ7B 3ZWVA 4JP2A 1PGJA 4K6CA 5ICMA 3ETDA 4RQUA 1EBUA 3WYCA 3JYQA 4JBHA 3C3XA 1HDZA 1PQWA 5KJCA 4Z6KA 5KWEA 4LW8A 1B3RA 2O7SA 1OFGA 2DC1A 4UUMA 3JQ8A 4GKBA 3I4FA 4BNHA 4EUEA 1UR5A 3WIEA 3JD1A 2PZLA 4MPDA 3W6ZA 5ENVA 3WFJA 5I7FA 1GCUA 2Y0DA 1FMCA 1RM4A 4Y9DA 1N7GA 3FCOA 5K0ZA 4FFOA 4D3DA 3AOGA 3I52A 1BTOA 3LT0A 4Q3AA 5DNAA 4INAA 1F06A 1LTHR 4PLGA 4RZHA 4WLVA 3FRJA 3NDRA 4RDIA 5DZSA 5JDCC 5IZCC 2W90A 4RVGA 1GV0A 3MJ4A 3H2SA 4MP6A 4BMVA 5KJ1A 3NJ8A 4EGFA 4HBGA 5EN4A 1A27A 4TSKA 4BNMA 3GEMA 3F5SA 2NNLD 4K6FA 1DLJA 3OHSX 2HMTA 1GTMA 1BGVA 1QR6A 4J1NA 1ZH8A 1E5QA 4A7PA 1IPFA 4DVJA 4BGEA 4R9SA 4BO5A 5DOZA 3EDMA 3WGGA 3I5MA 4PLTA 5ER6A 1FF9A 4B4WA 2DPGA 1U4OA 4MJLA 4CMEA 4J7CA 1PGOA 1G0NA 2G5CA 2GZ3A 4HUJA 1ZBQA 3RBVA 3TSCA 3HADA 2CVZA 4WASA 4XYEA 4MIYA 1F0YA 1PZGA 1RPNA 3GEDA 4NPCA 3WWYA 5BSFA 2IRWA 4UVEA 2Y68A 4NBUA 4DIOA 2OHXA 2W98A 5DCWA 5T64A 1DC5A 1R15A 1VE9A 2B5WA 3CINA 3T4XA 4Z0TA 4HY3A 3ZGYA 2I3GA 1M2WA 3IP3A 3WGOA 3CPSA 2O3SA 4YJHB 4AJNA 2CNBA 3IMFA 1A7KA 4Y98A 2OBYA 2X7HA 1L7DA 1QXSA 1NM5A 1KERA 1YL5A 1UXIA 3JQAA 3M2PA 1O5IA 3SJ7A 4IDEA 2I6TA 4YB8A 1EQ2A 1D4FA 3D3WB 3OM9A 4HFNA 4NFYA 1E3JA 3NRCA 4S3MA 3EC7A 1PZEA 4XQGA 3BHJA 2VRBA 5JW6A 1DPGA 2VYNA 4R68A 3UH1A 3RUIA 3R1IA 4Q9NA 5F5NA 1GUYA 2PGLA 2Z95A 3FBTA 3W1VA 1BVUA 2WWRA 3E48A 3OEWA 4FPXA 1GQYA 3ZHYA 1E6UA 1K89A 1V6AA 2POQX 2GZ1A 1KEWA 3INRA 1WMBA 5I9LA 4E5YA 2X9NA 3K5PA 4TQGA 3CTMA 5ILGA 1EZ4A 5T8KA 1LI4A 4A03A 3DEYX 4ITUA 3GY0A 2BKAA 1NQTA 2YV2A 2BRUA 4OJNA 1LDBA 3ABIA 4XD2A 3WX0A 3ROMA 1DAOA 4R1UA 5GY7A 3GGPA 3UFXA 2Q1UA 2D8AA 2BI8A 3BTUA 3ZWAA 5U4QA 4BB6A 1MG5A 2HRZA 3FPLA 1U9JA 4R69A 1B7GO 4IJUA 5JDIA 2ILTA 3AFNA 4MKRA 3DO5A 3HG7A 3B20A 2IZ1A 3HHPA 2GRAA 3Q2IA 1LJ8A 1Z7BA 4FR5A 3ZW8A 4PLCA 2NVUB 3DBLA 4NU5A 4IPTA 1Y5MA 5FYDA 3PFWO 3GRPA 1GQQA 2VZ0A 1T26A 1N5DA 4KTVE 2PZKA 4I8XA 3S55A 1FXSA 2ZK7A 4E5MA 3KYDB 2UUOA 4FW8A 3PXXA 4MVJD 4XYGA 2IYPA 4N7RA 1NQAO 2VUTA 3RFXA 4W7IA 2FPIA 5CDGA 5FEUA 4W4TA 3Q0EA 3OICA 3WXBA 4WNCA 3LF1A 4RF2A 2AQHA 4P38A 5TJ9A 1AHIA 1TT5B 3BMOB 4OSOA 4ALNA 3H9GA 1N9GB 4XGIA 4BNZA 5L53A 1QYVA 4O1MA 4WK6A 2ET6A 1SO8A 2VHVA 4LSWA 1A9ZA 3JQ7A 3RBXA 4A2CA 1Z6ZA 4PZDA 3GR6A 4BKQA 1QYWA 4YRAA 1LQTA 3F1LA 1YDWA 3CSDA 4Q3NA 5A9SA 5IN4A 4YJGA 3SEFA 2V6GA 1B2LA 3ADPA 5T57A 2JJYA 2O48X 3ZH2A 1DIRA 3BHIA 4WUVA 4TRMA 3R0IA 3VTZA 5DF1A 3TFQA 1D7OA 4A73A 4OXKA 1ZO8A 4WE3A 1PJCA 3IC5A 5JO0A 2RIRA 3GZNA 1JKJA 4CM9D 3DTYA 1HWYA 3OQ6A 3KYCA 3GA0A 1O8CA 3TPCA 3ZZNA 2VRCD 2X6TA 3JQFC 3TQHA 8LDHA 3GVXA 4MOWA 1O94A 4ID9A 1U5CA 2OO5A 1BXKA 1NWHA 3DMYA 4DRYA 1XELA 5IDXA 1KEPA 4L4XA 2XXJA 2X0IA 4WPGA 1GQ2A 3K2BA 5L45A 1U28A 2OZPA 3ON5A 3KYBA 4J43A 3QY9A 2VHYA 4G81A 1I36A 3U4IA 5DCUA 3PJGA 5K6AC 5L9AA 1ZUD1 3GT0A 1J6UA 3K9QO 5CEJA 1XSEA 3WGZA 4E13A 1FK8A 4I5GA 4HADA 4NI5A 1P1IA 2D5CA 2X58A 2A94A 4WEQA 2H1SA 1Y8RA 2X1HA 3ANMA 1R0KA 4IDBA 5GZ1A 4CM1A 1WMAA 2PLAA 3ZDFA 4I9UA 3H5RA 4FJ2A 4PLFA 3QA9A 1KETA 3GPIA 2X0RA 4H16A 2VHZA 1HE2A 4ALMA 1BDMA 5G4KA 4B4UA 4DBZA 1HDGO 4DQXA 1P33A 4EW6A 4YTEA 1D1TA 4P4NA 2PFGA 1ZXBA 4P4LA 4QXMA 2QHXA 5B4VA 4ZGWA 2C82A 3WMXA 4ZU3A 1Y6JA 4LCEA 3AUTA 1E77A 3UVEA 4BNJA 2PK3A 4MP8A 2NVBA 4J1QA 4NR0A 1PZFA 3IDSA 5EINA 2NU6A 3PYLA 3D3EA 1VL0A 3NAQA 3E1KA 1V0JA 3OSUA 4RF4A 5JCXA 3JQ9A 3PVZA 1DSSG 4J2HA 4OQZA 5KIAA 4ZQBA 3U3XA 4AJOA 2J3JA 2W8ZA 4KUEA 3L9XA 4KQXA 4GX5A 2WJPA 3EHEA 2C2YA 3OEYA 2JCVA 3ZNQA 1UH5A 4R01A 5L7TA 2Z5LA 3ZWOA 1CRWG 5KKAA 3DZHA 4CL8A 1KVQA 3CE6A 3O4RA 4AJLA 2HQ1A 4HXYA 3FTPA 3GLQA 3ZV4A 3JD2A 3OJOA 4MINA 3UKOA 4BKOA 2HO5A 1V35A 4H3VA 3RC9A 4UVDA 2DBVO 1H6BA 2BMAA 1K6JA 4ND4A 1J49A 1NQOA 4E3ZA 2O3RA 1GCOA 2JFFA 3MOIA 3OQBA 5JLAA 2B4QA 3JQAD 5CFZA 4B4VA 3GAFA 1SPXA 3P7MA 1BW9A 2UV8A 3L4SO 4DQVA 3GZ4A 3NYWA 1E1LA 4NFSA 3H5AA 1DC6A 2EJWA 4O6VA 3JQDA 2VYND 3C85A 1CQJA 1G0OA 2VT3A 3HN7A 3ORFA 6LDHA 2VHWA 2ZB4A 1E5LA 4YAGA 1T2EA 1IE3A 4GQAA 1P74A 2YHUA 1QG6A 4F6CA 2OGUA 5KJEA 3AU9A 1T1SA 3FHLA 2P2SA 1HDOA 2CDBA 2VWHA 2QIOA 5TGDA 2O3QA 4MIOA 3WGHA 1JAYA 1LLQA 2CMDA 4FFLA 4UAGA 4BNGA 5A3VA 1H93A 1VJ1A 1BXGB 1XR3A 2EJVA 4Y8VA 2EEZA 2IEBA 2DVMA 4EEZA 1NXQA 2IZZA 2PTGA 1YOVA 3ONEA 2EWMA 5BNFA 3GG9A 2DUWA 4MKXA 1ISGA 1O6ZA 2Q99A 3JYPA 2IDZA 4CM4A 4E5PA 3AK4A 3O9ZA 1E1KA 2NWQA 3E9MA 2YQ5A 2Y1OA 5JCJA 3S2FA 5JAQA 2Z1MA 4ZICA 2AEJA 1PGQA 3E5MA 4OMUA 5AOVA 2OORA 2VOEA 2QRLA 3VOSA 1V3TA 3W4KA 1E1NA 5F21A 5H82A 4LRSB 5ITWA 4CV1A 3NDJA 4GLLA 1B8PA 5TSDA 1NAIA 2VHXA 1GEGA 3QP9A 1U2DA 3HE3A 2Q1TA 4CLOB 1WNTA 4FQ8A 4QX6A 3U4DA 3QHAA 4UVHA 1TB4A 4Z0PA 3ZNNA 4EZBA 3JQBA 3COSA 3D4PA 1QMGA 4LSMA 4YDRA 3DZJA 5A1TA 2NU9A 5AYVA 3ZWMA 2YV3A 1E7QA 3KO8A 4BNIA 1P44A 1DIHA 2Q50A 3VZPA 4OH1A 3VH4A 2VWPA 3I6QA 4I9NA 3V1UA 2E6UX 1YBAA 1JLLA 5DDIP 5JY1A 1B26A 3GOHA 4BNWA 2PZMA 3RD5A 4CLRB 3D4NA 1PS9A 3D7LA 3O8QB 2H6EA 2HAEA 4Y67A 4D3SA 3GNQA 4F3YA 3QWIA 2VT2A 1GFSA 1AUPA 1WDLA 2X86A 3K73O 2JD2A 1NAHA 3DBRA 4J6FA 3PWZA 1ISHA
chains in the Genus database with same CATH superfamily
4PLWA 3TGWA 1QHHA 4E4TA 1E3LA 2H85A 3K53A 3UJCA 1MVOA 2GUGA 3EXIA 4RLHA 1YHZA 2PS3A 3L1VA 3LC0A 5D1HA 3RVRA 3OQMA 4FYVA 3MCVA 2V9CA 4OXRA 2Q7DA 5C1BA 3G02A 4FD2A 4CR7A 5K0EA 2CXUA 1DJPA 1PNRA 4G0WA 3EZXA 5BQ3A 3B9PA 2LBPA 3R4VA 1IUOA 1E60A 1HYQA 3SEZA 3I6MA 1YJ5A 1W9HA 2YHAA 5AXAA 4Z3DA 2VEOA 4BQRA 4LAFA 4ETWA 2FMUA 1ISSA 1O94D 3OIDA 2ZYIA 2K2WA 5CGZA 4QGHA 1XRSB 3TTXA 2Q29A 3JQCA 3ZU4A 2BSQA 2X0FA 3QOXA 2VKTA 2IEGA 2ZSDA 4M1WA 3HXPA 1OXBB 2A2ZA 1DWPA 1TA4A 4TTJA 4YXWA 3LJKA 4HYYA 3DBOB 1E2FA 1N0WA 4F4JA 1CQPA 3H1EA 3SZUA 5DO9A 3UMRA 3RJ9A 1LGYA 2J6CA 3PD7A 1SC9A 2PLNA 3ZLUA 2AR7A 2BDEA 4M4SA 2RDMA 4YCAA 5J63A 1N2GA 3KELA 4FI3C 1NULA 4HX5A 1NKTA 3D7NA 2WYUA 2XT9A 4CTKA 4DA6A 2C57A 1W29A 4HB4A 4RJTA 3PR3A 2GCPA 3IL2A 3K3PA 3ZQ4A 1J33A 3SLGA 4ZJZA 2ZAGA 2HD4A 2VZEA 2R25B 5JC8A 2VAMA 2BTQA 4Q3BA 3V5NA 4BQFA 3PPWA 2A88A 2C96A 4K5QA 5IULC 2NYVA 3IMKA 2UZ4A 1MPTA 2BGUA 1PS0A 1CX9B 3SF0A 5P8WA 1EE2A 1CF4A 1T5DX 4K6OA 4HVTA 4Y1GA 1AA9A 4MQ4A 1X80B 2ZUDA 3I2HA 3ROTA 1ENOA 5CG1A 1OX4B 4XFJA 1GKYA 3HGQA 1QCCA 4GYJA 3OF5A 5K2MA 1NUUA 1QGYA 4AMGA 1ZK3A 2F3RA 2WV7A 1FU7A 5CK4A 5C53B 4KQMA 4RELA 1SCUB 1GITA 1FP4B 1N9KA 4U3JA 2OVBA 5A4IS 3GLGB 1ITZA 3DKVA 4J0EA 1VM6A 2Z3WA 3L6OO 5DEOA 3RS9A 3TCKA 5C3MA 3EMVA 1GT91 4RFLA 4HGYA 2XE6A 4MKZA 4XDYA 3I23A 1U1DA 1U8EA 2WOOA 4E3WA 5HVNA 4JEHA 4MV1A 4WXRA 1EFHA 1R3UA 3D2LA 3X2FA 3CCFA 4BLPA 1A5SB 4DL9A 3ICWA 2LUOA 1NASA 2VUHB 3F6PA 5FOSA 2RB4A 3TTTA 4DT1B 5E1OA 1CZLA 4BX3A 1YB2A 1U7TA 2EHDA 2ORYA 3AQIA 4HAIA 5EZYB 3UT6A 1EVIA 3Q72A 4DDVA 3Q8XB 5CBPA 5I4CA 4J0FA 1QYIA 3U7JA 2I6UA 2OHVA 2C2KA 4N40A 3QG5A 3C1AA 4P82A 1IDN1 1RKVA 1C9DB 2C8LA 3PDUA 3BFJA 3FR8A 3QF7A 1H2WA 1Q0RA 3I6BA 3MGBA 3QPDA 4P32A 2JASA 1T8PA 4M9SA 1EX9A 1CRQA 2HNAA 2QU8A 1V11B 3MTEA 4C4SA 3L7CA 1TYAE 4HH1A 4IZHA 4PZAA 3B1VA 1WDMA 3ZIAA 2W6JD 3KEFA 2EG9A 2HWYA 3DZ8A 2IXDA 2RI0A 3P5BA 4U8HA 3GRYA 1MF7A 5SZHB 2GN9A 5E6RB 2LZ0A 2G5GX 3KJGA 2XECA 3CH4B 1ULUA 3GPCA 2ST1A 4HRYA 3CRZA 4CMIB 2ZTUA 5EMMA 2FEKA 5EHGA 2IP2A 3G0OA 4UBMA 4UW9A 4DYDA 5FBVB 3A6PC 3FNEA 1GGHA 4OQFA 1HI9A 4XM1A 2A4MA 4EB6A 1M34E 1IBRA 3MYYA 3KRTA 2G83A 3GRFA 1YR2A 5JDCA 1Z74A 5BUSA 4NYMR 5KQMA 4PIPA 5TVKA 4D9JA 3T6KA 3G2LA 4GYKA 3L2OB 3W5VA 1RLJA 4B6PA 3HCPA 5C80A 2E87A 5HKOA 2JLRA 1EXNA 1U8CB 1ZRNA 2QVBA 3F6SA 3GLHE 4QUJA 3VC2A 1ZM4A 3N75A 4Q4AA 4HLNA 4C3UA 1ZA2A 4LKOA 2O8NA 2J8ZA 3NHAA 2LCFA 2DWPA 3GRKA 5IN5A 5LNK6 4IDOA 5HCNA 2I87A 1VLJA 3WBFA 3ZVNA 3SFZA 5IYZB 5H9VA 4PX9A 1VG8A 2D4AA 4JIGA 4QFBA 1IRIA 4YJFB 1A8IA 1XTPA 4W5JA 2A1TR 3LYLA 4LK3A 1AHPA 1OT5A 2WFMA 3CN9A 3NALA 9LDBA 4JYAB 4HKTA 1JHMA 4YALA 3LPAA 5EUQB 3MTIA 4BHTA 4MROA 4WW0A 1PHPA 3KT6A 4M8NE 2I4IA 3H19A 1V26A 3IVCA 2NNWB 3U4QB 1CUBA 4PTZA 4AF7A 1COZA 4XB1A 2OFXA 1X15A 3FYTA 2GEVA 3OU7A 3ROPA 2IXAA 3N7UA 4ZQEA 1P8JA 3HJGA 2Z08A 4UC0A 1OAOA 5E9QA 1Z37A 3T7SA 3B5IA 1H8ED 4TWZA 4TN1A 3SC4A 5CMLA 4EUFA 3PT5A 1TMYA 2J3DA 2IE8A 2EGUA 2HF8A 5EIEA 3FOBA 3FUXA 2QXUA 1WY7A 2O50A 3QBTA 3AYXB 1SKQA 4PVDA 4TMZA 4XLZA 2XZTA 2A3NA 4QQKA 3EUAA 4GSLA 3REFA 5CH3A 5CFOA 1YI8A 2EERA 1CY2A 2EV9A 2PXXA 3HLKA 1LX6A 4G67A 3ZHRA 4IOJA 2XHZA 3SVTA 4IINA 4AF6A 4YDHB 3THXB 3JX9A 2PMCA 3SBDA 4YRQA 2PZBA 2Q45A 2R79A 3EDYA 2B36A 1EI9A 3I6ZA 3CSSA 4HGOA 5GV7A 3X1ZA 2CZGA 1JEQB 3M5CA 3CZPA 1G8YA 5DNUA 1MRNA 3P2IA 5JD4A 1NJFA 1JR3A 4AURA 4KIFA 4LVNA 2O7VA 3G2KA 1HDCA 1RKQA 4OQNA 3NP7A 3M0EA 4NY1A 4BV3A 2EYQA 1P6XA 2V7XA 3MHPA 3MWFA 4DQKA 1RI2A 2DR3A 1JR4A 2YV4A 3UM9A 4I9GA 2FWAA 2IYNA 4PNZA 1D2EA 3OUUA 4PCUA 1B76A 3L9WA 5F1YA 4X90A 4YHBA 5FHQA 5KVQA 2C20A 2I3BA 3WQBA 3QJYA 4EHIA 4E5VA 3KKKA 5HP4A 2HM7A 4GR4A 5JCXA 1VJ0A 3CBQA 4JA2A 1ZJWA 3NAZA 4RK6A 2R7KA 5TXGA 5K0FA 2UYHA 5IWAB 3N2GB 1JZSA 1CQIA 2ZUVA 4P08A 3HDGA 5KU1A 4JLKA 5BMVF 2ZYSA 2IYSA 4V2IA 3V4SA 2PS1A 5A5FA 4XM2A 5EMHA 4FSHA 5DN9A 5I48A 3BOSA 5A0TA 2WC1A 1YACA 3FVVA 3GBVA 2ECQA 1E4OA 1Q2UA 5LQDA 3U3MA 3OKAA 2CV1A 4EY4A 3W3AH 3FNBA 3IA2A 1Z6XA 5HG0A 1G8AA 2QZPA 1C1XA 2H1FA 2HF2A 1IK4A 4AD8A 2QTMA 4IS3A 4OIMA 4D8XA 3WB9A 3F71A 1X94A 3GVPA 3OLQA 1BS1A 4FYIA 1UBMS 4PWZA 1QRUA 2M6KA 2QD1A 5LPNA 4CM8A 3LLUA 3K0SA 2E48A 3WMEA 1H6AA 3NHFA 5H81A 3R8CA 4LNHA 2QN6A 3D3QA 3W6PA 2W22A 3FSRA 5K8JB 2ZCJA 2JFHA 4ZYZA 3GLVA 1HH4A 4TKLA 3I12A 3WSWA 4BRUA 4FWBA 1Z5ZA 1JFRA 4LJYA 1LVUA 1X9GA 4PQGA 4HWSA 2C2BA 3QU9A 1NNEA 1J39A 1RWOA 5DNVA 4DC1A 5FOVA 3EDOA 2H29A 4DY6A 1M76A 2GYUA 2D1FA 2HA2A 3CLSC 3BFXA 2E4UA 3ESCA 3HBAA 3R6WA 3LBAA 3ZWBA 4Z1MD 3D31A 1XXHB 3FB1A 2ZB8A 4K46A 1AZTA 1LQUA 3SM3A 4MVJP 4Q1BA 5ENZA 2WSYB 4F38A 1KU6A 1Q7BA 4AFNA 5KSWB 5CEEA 4EJ6A 3PDHA 3A31A 4O2AA 3K70C 2QAJA 2X0NA 2PMEA 3HJCA 5TMEA 5FDFA 1E58A 1MB4A 4NL4H 2VQEB 1TW2A 5DNCA 3BMNA 2OAQ1 3SR3A 2XMQA 3A4MA 3IAHA 5HWSA 3EFBA 3BRSA 3ELUA 3QEMB 3DCNA 4IV5A 3GHHA 1LJUA 4C2BA 1GNPA 3O7MA 2NXCA 3E15A 2P69A 4Y2JA 3T3GA 5HZGA 2C9CA 2BEVB 1J00A 2NG1A 4NONA 4NQZA 1L4NA 1U0LA 1IJFA 3DW1X 4JT8A 4BX0A 5KNCH 1DC7A 3TLKA 4BV8A 4L1KA 4PLHA 1Z88A 1FW8A 3AHEA 3D6JA 3SXPA 4EGAA 2GAAA 3PE3A 3R5KA 3FNRA 4HGRA 1JDSA 3T3IA 4JXZA 5AK3A 3GFVA 1DMRA 1PZHA 4PAOA 4QG3A 1QVZA 2ZXEA 3EIWA 2YYAA 3D2AA 4OK5A 4PGGA 5DHRA 4DPKA 3TRDA 4KDRA 3GUYA 4GZ5A 4RO0A 4EVIA 1P1RA 1VLLA 4H1VA 2P6NA 4E5NA 2D13A 4OGLA 3IIEA 5KS2A 3U1BA 4OD0A 3OOYA 4DRXB 3A3OA 4EJSB 4WEOA 4IAOA 4F72A 2OSBA 3N8DA 4Q1FA 2P90A 4W1PA 3L6EA 4WT7A 5HF6A 1P6QA 1AOXA 1UBGA 1PT9A 2XIQA 3P2JA 1NP3A 3BF8A 4AJ1A 1J8YF 1RHUA 1VA5A 2DFTA 3RE1A 2B4KA 3QUTA 3FOFC 2HHAA 3SXJA 5A62A 2C7QA 1OB2A 3GLIB 4F5EA 2CSXA 3U13A 2C4KA 2DH6A 4WERA 2AE1A 3MJVA 4L95C 1L9KA 4ILEA 1M1NA 1N8KA 1KBQA 2AEFA 1YUMA 5CIQA 2GN4A 3E5NA 1NYRA 2REOA 1BS2A 1E3QA 1FDRA 1OCEA 4G2NA 2ATXA 1HPLA 2BT4A 4ZQGA 1I9CA 1ECCA 3V1MA 1FZQA 2X3UA 2YIJA 3KEGA 1NLUA 3LUFA 3C97A 2BRUC 3ENVA 821PA 1I4TD 5BRAA 3A1SA 2QR5A 3WK9A 1XLTC 2AMVA 2ZB7A 1OJ7A 2JFYA 4BQSA 4LYJA 3TFWA 4DCJA 4DFDA 3WYGA 5HQTA 1DKLA 2UZ0A 3DMHA 2J3IA 3NHPA 4MIEA 1B42A 2OFPA 4CEIB 1PTJC 1QTRA 2IS2A 4HVAA 1GGFA 4G0NA 1GPKA 1TLFA 4IXWA 5KWIA 1R6AA 4B0OA 1CUXA 2GZDA 2WYOA 3R5SA 1NMXA 3KZ1E 3U48A 4DCVA 3PF8A 1GDHA 4DJTA 4REOA 5ARCA 3KKLA 3LL7A 4ZT2A 4OJKA 1X7ZB 3UJ7A 4AS3A 1YGYA 3MHTA 3H8JA 2I33A 3LP8A 3X2SA 2J3QA 3G13A 3K1TA 4P81A 4B6SA 1N4AA 2H5JA 1QE0A 2NPOA 3VHLB 4W8GA 5CA0B 1I30A 1I1QB 2CF6A 4JL6A 3EZLA 3FSJX 5CLGA 2ZJ5A 3BA1A 4OI2A 2AX4A 4KN8A 4AKSA 4CMGA 3JVUA 5BSKA 1T9GR 3NJRA 4KUHA 2E55A 3C6QA 1VBKA 1D1SA 2D7DA 3DJYA 1EXVA 1A8SA 1Q92A 1XQ6A 2AN9A 4P4UA 4NK5A 1G7SA 5HM8A 3SYLA 3RSCA 1ENYA 4LHXA 5ALGA 3T5PA 2X2FA 2VZ8A 3IAS1 1ACLA 3PC2A 4RMNA 1VJ5A 1SRRA 2GEDA 4J0QA 3DPSA 3E4DA 3UJHA 1HTBA 1ZRSA 5LSAA 2NOAA 1AGYA 4Y2SA 2FTKE 4KAFA 3DOFA 2R6AA 2JCYA 1DJLA 2H2DA 5IT9A 1DUIA 3HSKA 4C7XA 2C2XA 2Y71A 4DSUA 4NCIA 4QBGB 4QOSA 6AT1A 2RAPA 3CLUD 4ZEOA 3JYNA 2FPPB 3L7BA 1BJRE 4YY3B 3BS4A 3QVKA 1B14A 2CC2A 3WK7A 2ZAYA 1SKUA 3UPDA 3CF0A 1C7FA 2HK9A 3CF6R 2IPNA 3VKWA 5K5EA 3FTDA 3PDIB 1CEQA 4M0CA 1IN5A 5BQ5A 1N78A 1LLUA 3KLOA 1YQEA 4PWYA 1VZ3A 3FRHA 2M9MA 4L72A 2BLLA 4Z1OA 1GQSA 1OSNA 1UWVA 2JI7A 1WKVA 3DAGA 3OA0A 3KXDA 5K0BA 3CNHA 3R0JA 3ABRB 1KQOA 3RTEA 1W30A 3NCTA 3OD1A 3UAGA 5JSZB 1PBTA 1DAPA 1L5HB 1V8FA 2WIFA 4Y7DA 3B9RA 4TKVA 5FI1B 1G3UA 3D3WA 5G0WA 3FDJA 3EVBA 1L1RA 5G3YA 1E5XA 2YVLA 3LX4A 1E6KA 2CBXA 2W4QA 2YWXA 4X3PA 4FD3A 1F17A 5EKXA 5JO9A 3SD7A 1EVQA 5CB4F 3TX2A 1FNSA 4RZ2A 3DFUA 4HFRA 4TTPA 4ZAXA 3FIUA 2CVPA 2DTXA 3IVAA 1QFJA 1N5RA 5HIMA 3TZEA 1EFDN 4IOKA 2R47A 3D7SA 4Q3DA 4B6RA 3MB5A 2N3ZA 1RCUA 2Q6VA 5C18A 5J4KA 3U62A 1X7XA 1XJ0A 4MGHA 1DBPA 3G6WA 4MRSA 4XB6B 5DHQA 1KSGA 5J1SB 1TMKA 1MO2A 5E4YA 2WUGA 4LGMA 3L7DA 3PFGA 4ZT4A 2JLYA 4OXXA 1JHZA 1MA3A 1NOJA 3TLXA 4EZEA 1O9GA 4F2GA 4M9ZA 2P7IA 1NX9A 3PD1A 4S04A 4ASUD 4HSEA 1VPDA 4CDGA 4DG8A 4QOGA 1M73E 2B1RA 4Q3EA 3A10A 5EKSA 4NG5A 3A6HA 4MVJI 4FHDA 5IJ9B 2ZRDA 1UQUA 4GX0A 3DXZA 4LK2A 1ESEA 4PPQA 1DC3A 3SHQA 4E5DA 2OC9A 4BFCA 3AEYA 3L82B 3KPUA 4HAOA 3Q9SA 6PFKA 2DT8A 2WLTA 3A6JA 4RGBA 1RYZA 1OWPA 4X7PA 3U5ZB 1WMDA 1CUJA 2NVOA 4XJXA 4IVNA 3A2LA 4XSVA 4UATA 5DOVA 5G1PA 3KCQA 4YV0A 5EGNA 2R8PA 2XVZA 4XQEA 1F48A 4NYJQ 1V37A 3Q10A 3RU7A 5LXTA 3KQKA 1Q0TA 3CT6A 3TOVA 5CLFA 5D3ZA 4I1OA 3V7WA 3VDMA 3VR3D 3ESBA 5GM1A 1KZYC 3LLVA 3TM4A 4LFCB 4BO3A 2ZIVB 2NXNA 3BD8A 2QYTA 4O1IA 3E9NA 3TTSA 2EZ4A 3WDMA 1LX7A 3KYDA 1RPJA 1WD5A 1WZCA 4XGQA 1EUZA 3GRAA 1ONOA 2KQUA 3KIPA 3HEBA 5CJPA 4BTEA 4EHFA 3KZOA 1KRXA 3WS7A 2OGSA 4JYBA 4DZZA 1UIRA 3SIWA 4YEDA 1NJ2A 5FR1A 1NUHA 2C98A 4WA8A 1N7HA 1BC5A 1NBAA 1RADA 1CIJA 4UNNA 4BMXA 2PO5A 3W3ZB 2DQYA 4O8CA 4I9HA 1ZN9A 2BHTA 3MEQA 4IRUB 4LNAA 3JZMA 1VCMA 4RIHA 2B1IA 3EXEA 3SS9X 1ZL0A 1TT5A 9ATCA 3TDNA 1V4VA 4D9MA 2AG1A 2HPVA 3DUFA 2LNDA 1XNJA 1OU4A 3EQ9A 4BXOB 1T9DA 4DLTA 3TIIA 1L3BA 3C74A 1KO7A 4DR5B 3PT9A 4FS3A 4CQMB 5IFKA 2AFIE 1WHSB 3EGXA 1OKKA 2B8JA 4BCDA 2Z2KA 2C5FA 5DBGA 3NTOA 5AI5A 4HATA 3QLUC 2CT8A 1I2CA 2YW9A 4R8LA 2B7LA 2MTBA 2P65A 4JITA 4R7ZA 1Q7RA 3HV0A 4LHEA 5DU2A 5T4FA 4E22A 2P8JA 4Y2HA 3R76A 3OO0A 1UZUA 4AZSA 1X7WB 2C5AA 1WZIA 1UL1X 3VHXB 2WMDA 5JV5A 1FQKA 4QBHA 1XD9A 2Y2VA 1FMJA 3C5WP 1FYVA 3ILXA 3OJCA 3A14A 3EWNA 3S2EA 1DQSA 4NU6A 5KQPA 3D0KA 3ZX4A 5F3DA 2QXTA 3E1GA 5LKRA 5HFNA 1GAEO 1RHQA 4UTOA 1XF9A 4B81A 3UWSA 3COVA 3OX2A 2GF9A 3OCZA 4J1SA 1FLAA 2PY6A 5K8CA 1T8UA 1L1EA 3MM4A 2IUUA 3UMGA 2V59A 1FQOA 1WXGA 4XCQA 3VOTA 2PX5A 4W82A 3G17A 2BJWA 2VCYA 3PS9A 3ZJUA 5DFAA 3VNQA 5FCDA 3GLFB 2Q21A 1WXWA 1Z8DA 2Z1NA 4I1SA 1YJQA 1FA9A 3N6XA 2FNAA 3IBFA 3S6JA 2JIZA 2O19A 4BX8A 1RW4A 4LDNA 3HHEA 1E3TA 2GOYA 2HBQA 1B74A 1UKVY 4P7BA 4HH0A 5H8WA 2HO4A 3T1YB 1ZH2A 1GARA 3DZCA 4MMYB 3T38A 1CF2O 2BUCA 3A3PA 5AM2A 3VPAA 5WRFA 2YXPX 2J6IA 4MWDA 5FO0A 3A1TA 4RNCA 5G0SA 5KREA 2FKAA 3R3UA 3N0VA 1NW4A 3ASUA 2BEUB 3FOEC 4C0LA 2WWYA 1S8OA 4KXMA 1J0BA 4G86A 2AG5A 5IG2A 4IXTA 1SU8A 4MI1A 3FWZA 1V8BA 2ZANA 3TTVA 3B48A 1HA3A 1ADGA 4HDQB 5CJJA 3MD0A 4IJQA 5CA1B 1M1YA 3ZY3A 2GNPA 2RH5A 4AY4A 4BFXA 2JKYA 5DBEX 4M99A 2D62A 4HTFB 1ORTA 1AQIA 4EYGA 1H2RS 1ONPA 4XPZA 4ZHSA 1O6FA 1ZNXA 3DAFA 3MBIA 2QP4A 1XZQA 1PKEA 3IT2A 5E6UB 5DLDA 3AT1A 4EKYA 3VR6D 1V8ZA 1SKBA 3O4HA 5TMDA 4ZREA 5IAKA 3OZDA 5JFOA 4N5LA 4YWJA 3MIIA 4U2DA 3QWHA 2UUCB 1YRAA 5THQA 3ISVA 2QAGC 3PUJA 4DLBA 3JAKA 4B4DA 1EB9A 1X2EA 2P30A 3D7MA 1W36C 5EJ6A 2R84A 1RYDA 1FOEB 2AB0A 3TQSA 6ADHA 1ETHA 2C61A 2CD7A 2HLPA 1JJFA 2XGGA 4RA9A 2C1EA 3DE1X 2VHCA 4HS4A 4WJLA 1G7TA 5KSZA 4FNOA 1SBZA 1VJCA 1JG1A 3ZI4A 1XHLA 1HGXA 2QX4A 4IDPA 2EJCA 3RTDA 2X8AA 1TTQB 3N8KA 1A9OA 4M1OA 5JQGB 2ZJ1A 4TTRA 2HMUA 3C48A 4IQFA 4XEHA 4BOYA 1UFKA 4KTTE 1C1DB 1JKMA 1YRQA 2Z6AA 2ODPA 4JSYA 3FSEA 4H1HA 4EFDA 2ZE8A 2OCKA 1TQ6A 9MHTA 3N5KA 4BKUA 5IBRA 2PMDA 3N1UA 4URYR 4JXKA 2PJDA 3LP5A 1BDJA 2BSXA 3EJWA 4KQ9A 5FPQA 3EGDA 1XEXA 3M7IA 4RPLA 5JECA 1C81A 4GOJA 3FF4A 2IBMA 3DO8A 4P4TA 4QECA 4QTZA 3JSAA 4FMCB 1NZDA 1P0CA 5DM1A 4BGIA 3HXMA 4HWKA 4M0DA 1GADO 1RS0A 3CC8A 1HFKA 3NHBA 8AT1A 1QP0A 2UUBB 2V0NA 3UCEA 3W7AA 3VJKA 2CDCA 4Z4CA 1VJGA 4F5ZA 3QOFA 4J0JA 3B3AA 1U7PA 4KUGA 4PAQA 5G0VA 3WR5A 5EOVA 4ER3A 1Z6TA 3OY2A 3EGVA 3R7WB 2V1UA 1Z2CA 1KJ9A 1QQBA 3KALA 2Y1EA 5FNVA 4NCHA 1PVVA 3LC2O 2ZWPA 4PPNA 4TQ9A 3MTAA 4G85A 4YUXA 1WX1A 2OYCA 1YU9A 4QGGA 2OHFA 2X3YA 4K3UA 1PYGA 2ABWA 4TMFA 3LS2A 5L4LA 4IV0A 1EUCA 2B69A 4M53A 1U1GA 2ATEA 2C4NA 3OKCA 4KQ6A 3PCTA 3DV0B 3TQIA 1U90A 3T06B 3AC0A 2FR8A 1F12A 3G9ZA 4JVMA 4KKXB 2PLWA 4BJ6A 4C0XA 1GNVA 4PY2A 4CCAA 1XPJA 1JX6A 1RT9A 4LGVA 4YXFA 4ARIA 3DD1A 3FLAA 5GM2A 3NBUA 2M6SA 3GFQA 5IYZF 3KQUA 2CFTA 4YP7A 3OLXA 1F8GA 1RQGA 2WSBA 4D6YA 3Q8KA 3WLTA 2AG8A 3AG5A 4EKEA 3AQ4A 1ZOPA 2EXXA 1YZNA 3LXMA 1CY6A 1JAHA 1W87A 5KYTA 3KUUA 5TRTA 3PJFA 5K3CA 5HA5A 4FFMA 1CEXA 2HGZA 3K30A 4RDCA 1ZG3A 3GDFA 2P79A 4MRVA 3VI3B 4NWIA 4D0NA 3C3BA 3F3MA 5KNBD 3OTOB 2HW8A 1RAHA 4NJEA 1JVSA 4UUBA 2BKLA 5GMOA 5TNXA 4CT4B 4RMHA 3REQA 5ADWA 1XEAA 4TM7A 5HS6A 5EFOA 5IAJA 5CFQA 3NM4A 4K6KA 4LF8B 2HZ7A 4KH1A 4ND8B 8GPBA 3MILA 4ZOLB 4IMJB 1I13A 1P1JA 5E9JA 4F6RB 3S8YA 4JI8B 1NBMA 1HT2E 1KJIA 5KVSA 2BZSA 1BDIA 4JGBA 4HB2A 4ZQIA 4YT4A 5HMMA 2QJFA 1RC8A 4CGZA 2DE0X 4I5EA 1DXHA 1JHYA 1F6WA 4YRJA 1WBBA 3F4LA 4R0VA 3LT5A 5FX2A 5BQOA 2GJ9A 3PZRA 4DSTA 2Q6OA 3LP6A 2QN1A 3F6EX 4BKMA 1DRWA 2WU4A 1USGA 4EDHA 4O1HA 2JC3A 4I19A 3KU4A 5AVJA 4BFWA 5AI0A 3BK1A 4Z9BA 3ESDA 3EQZA 4X8HA 2Q3LA 4QUDA 1AKEA 4IGIA 2Z0MA 1Q1ZA 2PGOA 4OHRA 3UCXA 4PN7A 4NARA 3JALB 1QS0A 3H2IA 5C4MA 1FUUA 5DISB 1KGDA 3IILA 2JH9A 5AI9A 4MQ6A 1Y7TA 4GX2A 2BFOA 2ADOA 2HHCA 1A7JA 3MS7A 3OOWA 4W5HA 4AL4A 1Z22A 1SVMA 2I6QA 4NH0A 3HYSA 4DG5A 1KRWA 1W5SA 2NTNA 5FEMA 1RIFA 2PGXA 3O26A 3BMCB 4DNXA 2QMEA 2WFLA 3DMTC 4H7IA 3TQFA 3K1AA 3NGMA 2H2WA 1Y1KE 2YWGA 4M46A 5SY4A 2V1XA 1HL7A 1KS9A 1J8FA 2WD8A 2XE4A 4JYPA 1WVGA 5LLDA 3LBNA 2PMBA 3CRNA 1A7AA 1Z15A 3RRZA 2FFRA 1PJ4A 1VB3A 3CUSA 2DFNA 4F1KA 1C7RA 4NDNE 1E1QA 4J1TC 4DGSA 5EY5B 5L7YA 2H63A 4MJ7A 3DH0A 1IB6A 4HUQA 3T7AA 3FTFA 5HKKD 2QF7A 3JSXA 5PNTA 4PNPA 3AY7A 3DHNA 1QG0A 2EG5A 2M1ZA 3VM6A 4EF6A 1YNOA 5DIFA 2GGSA 1YRBA 4D81A 1XMQB 3JRNA 3O95A 4P80A 4UOEA 5F3WB 3ITEA 4AY2A 3GT3A 3AXSA 3PFBA 4OA5A 3IXLA 1S2MA 1MUUA 4XZ3A 2ZUUA 1YS2X 4TUYA 4NBKA 5ALNA 4A2WA 4Z4FA 5H5JA 1I3MA 2FQYA 2VDRB 4M8KA 3DTNA 3LSTA 4LNUB 5L7WA 4HDSA 2GZ2A 3W5SA 4EY8A 4G0QA 1H23A 4OATA 3GVHA 3DJFA 1DE0A 3AR6A 3WNCA 4MRMA 1Y82A 2A5YB 1EVKA 2Q27A 3HMQA 1PJBA 1OJLA 3OIFA 4D74A 1VBMA 3FWHA 3FXAA 3DOUA 4KPUA 1EINA 1XA3A 3IAS6 3UT5A 4QLOA 5AQEA 4CLEA 3AUAA 1IN4A 4CKZA 3ZK9A 5H1YA 3KQSA 4TLBA 2EZUA 2AW3A 5EEHA 3CVYA 3V3KA 2XW6A 5EE9A 1PK7A 1XDDA 3M9WA 1NR1A 4D8TA 1IZYA 2WP0A 5ITVA 3N3BC 1QDUA 2PS0A 2V7TA 2XOKD 1TF2A 1USIA 3F7NA 4F8EA 5AVRA 2GETA 2YOHA 4OREX 1DUSA 1FMTA 5K0TA 3SICE 2O8CB 4D9BA 4WY2A 3BKWA 3ROXA 2C8KA 2YASA 4UBKA 3W8FA 4KW7A 4B76A 3IQDB 1NV9A 4U6QA 3SS7X 5BSVA 2GN1A 2C29D 1TK3A 4UCQA 1SAYA 1MPXA 1Z62A 1NZJA 2WU3A 3GJ3A 2FDCA 3B7GA 4DCGA 1L0BA 4QDTA 3BDIA 1Y9EA 3VFDA 4RVDA 4WESB 1V7PC 2G9NA 4DDTA 4ND7A 5BN4B 4CJXA 4DMUB 1YI1A 3ONDA 4QICA 3IKLA 1EWKA 4NAUA 4YQYA 1FFWA 1LRJA 2NO0A 4ERXA 4QJIA 3G8DA 3B8HA 4D46A 1DZIA 3NC0C 4LIPD 3QSGA 1U0TA 4BBAA 3WO0A 5KTNA 4RZUA 1HYGA 3BB4A 4C88A 1T8TA 4FGZA 1E61A 4YMWA 1I4DD 2ZWVA 5EJAA 4ZT3A 4EHNA 5L95A 2IXTA 4ENPA 3TJRA 2GZHA 2DFLA 4P33A 2Z4RA 5AOBA 4BWGA 1GKIA 1OYVA 3DOOA 1V1RB 3M1YA 4UE6A 1X77A 1LBEA 4LRTB 4MK4A 1W25A 3JCZA 4RCYA 1LNZA 4GOND 1UBUS 2QQFA 2R66A 2OQRA 4ZARA 4BP1A 2ON6A 4ZIRB 4PZEA 4D0SA 1MDBA 3A9RA 4OXYA 5A3JA 2B8EA 5KZMB 5JY6A 4Q7JB 3U4CA 3PE4A 4Y9SA 1E63A 2HA6A 3KAPA 4A1FA 4B44A 5KYXA 3GJTA 3TLMA 1R9JA 3BCUA 2BJHA 3SHFA 4RESA 4ZAVA 3BVPA 3PTZA 4WK0B 3W3AD 3A7EA 4Y2TA 2RAFA 4FFPA 4QGSA 3HJUA 3EPLA 4F71A 3FVRA 1SVKA 4U6NA 1YRWA 1Z82A 2GNAA 2ZRAA 4XWTA 2PRYA 4KRXA 4ZCSA 1U0JA 4DJJA 5IZ4A 3INGA 2YWJA 3N2NA 2QV0A 3KSDO 4Y9UA 4P0PB 5G0UA 4AJPA 2RK3A 3ACBA 3V8NA 2QBYA 2Q07A 3FMFA 3IDOA 1VSTA 1ZEJA 3ITDA 4GC5A 1ESCA 1G21A 1I80A 4I50B 1TJ4A 1XDSA 3RVQA 1N6PA 3VR4H 2G63A 1RM3A 1Z0SA 3VNAA 1EDZA 3C8HA 2QDXA 2XTZA 2AMFA 3F46A 4LTNA 4M89A 4F86A 3P2YA 4XDHA 3EK2A 5FL7A 3SMQA 3RV4A 3HYRA 4B09A 4TV9B 1Z5PA 2BBOA 4W99A 2QD4A 5K0GA 2LXNA 4LBWA 3B7WA 5KYUB 4AK9A 1I7NA 1L9XA 4BO4A 2HIAA 4J2TA 2Y99A 4IHJA 3KC2A 2XA9A 3AY3A 4M8IA 3GPBA 3QWFA 4PAWA 4BGVA 4FHCA 1FFEA 4GS5A 3KPWA 5A9RA 2XR1A 2C7VA 1SZPA 1J2RA 4UHFA 5FLYA 1XRQA 2VNSA 5HILA 3BRWD 2WY2D 3MXOA 3CUUA 1XQYA 4DQ0A 2Z6UA 2K4MA 1CQJB 1GGJA 3UXYA 5CA0F 4HZIA 1CUZA 4GMHA 4RDXA 1CZUA 1ZN7A 1MIOB 1JHXA 2VDVE 1ZI6A 4KK3A 5K05A 2I8LA 3A4VA 1OGIA 3RNLA 4PR3A 3W8EA 3KTOA 1A9SA 1KKLA 1R10A 1Q7GA 2BZ1A 2F6RA 3KJXA 4IO0A 4LZJA 1VB5A 3ZWNA 5A2GA 1EXWA 2HA0A 4GKKB 2KE5A 4GKVA 5M34A 2B35A 3KFVA 1YMUA 4RV4A 5J59A 5GIPE 5KNCD 1RJ9B 1FX1A 1O96B 2TMDA 2ACWA 2WJ3A 3L6BA 3HXTA 5DM2A 2COEA 4INJA 1P4SA 2CMFA 3RU9A 5BNIA 3QVMA 2W6PA 1WUHS 2P4UA 4MW9A 1RYHA 2J4DA 5F73A 3U16A 1BZYA 1NVWQ 1BKYA 3K92A 3ZCPA 3CYFA 4OCZA 1VLHA 3F8WA 1KHTA 1ESNA 5JVDB 5CCDA 3DT9A 3BDAA 5CP8A 3U44B 2GUWA 3DMRA 4P7JA 4QRIA 4YUYA 5KQSA 2WTEA 3QFSA 1ESZA 3HVUA 3SM9A 2BOVA 4YCJA 1G6OA 1RWWA 3T3HA 1JQ5A 2EP7A 1XYGA 3A7DA 3OESA 5HRAA 1KZ6A 1MV8A 2ORED 3RFTA 3UJ9A 1M8KA 2FE4A 1H8HA 3LQRA 1UPXA 1OXTA 3A06A 3F1KA 1ORHA 1NOIA 2OA0A 2GESA 1Z18A 3NT2A 5DHFA 3Q12A 3WVNA 2RMKA 1MHTA 3PV0A 3QUCA 4BIIA 1HKUA 1KK1A 4YQZA 3DKIA 5L40A 4JJFA 4LX0A 3EWSA 4QJBA 3OE1A 4JK3A 4WJZA 4B6OA 2N0SA 2LPMA 5K6TA 1ZNYA 5CVUA 5DI9A 1GHTA 2P9GA 2QVLA 3WQQA 5B1YA 4F91B 5HUHA 2JA2A 2VJDA 2ZI3A 4W6ZA 3O6VA 2FFQA 4X00A 5IUNC 1DX6A 3QEJA 2B1GA 2RCYA 3I1FA 1NW9B 4ZYYA 3QPBA 3GCWA 2AWNA 4NKRA 2GPSA 5HEKA 4KO4S 5F78A 4UPDA 1ZKDA 4JR0A 4FB5A 4YAEA 1AM4D 1RXYA 2M1XA 4CCYA 2QMYA 3ASVA 1WB5A 1DJMA 3ZD6A 1JXAA 4OUDB 2RH8A 4D4LA 2WK1A 2OQ2A 1FYWA 2GH1A 4PX2A 2QY6A 3TLAA 4TKZA 1U1IA 1QF9A 3H2GA 4WKGA 3TMKA 4BVKA 1HQCA 2H7VA 1FIUA 4ZQHA 4JGGA 4F8YA 4K1LA 4ZHQA 4ARBA 3DFMA 2ZT8A 5CT5A 1VG0B 1TYDE 1SVLA 1ZD1A 3BHMA 4US1R 5ALYA 4O4IA 5HF8A 2JJ8A 2ILVA 2A33A 3QQPA 3IV9A 2PUVA 4DCSA 1MLDA 1UJCA 2CGEA 3ZHVA 2FPMA 1A2KC 3HB0A 3VU9A 1DFHA 3KSMA 3UHOA 1J4AA 1BAPA 2RHGB 3DBRB 3KKPA 1YH3A 2F00A 2XSZA 5FTJA 1DBVO 1EMDA 3QKTA 4N5DA 1KDTA 1PUJA 2ZYTX 3EXIB 4NBLA 4OP3A 4KX5A 3VH1A 2RARA 4JZYA 1RE0A 4TLEA 1PN3A 1R6XA 1VI2A 4FCCA 1OPXA 4NU8X 1AX9A 1ZZEA 2AD1A 3REOA 2J6HA 2ZVQX 4ZI2A 4NS4A 2QE6A 5IT4A 4MWZA 1L4FA 2C3MA 2W2PA 1LWNA 3LWBA 1NVVQ 1GL3A 4FOSA 1NFRA 3FPSA 3STHA 3OUZA 4EA9A 3CO0S 1YQGA 3FCXA 1O54A 4E03A 3NH9A 1WUYA 1VFNA 3TW4A 3G59A 1FSFA 1T5HX 3IPAA 2HMWA 5THKA 2A5DA 2NTEA 1UZMA 4L8WB 1O94C 4CF4A 3JRXA 1L8XA 4TWJA 3UA4A 3L4BA 5K0LA 4HUTA 3NFRA 2AFRA 2VJBA 3N87A 3MRTA 3MTGA 4YP1A 5LB2A 4N5NA 2WP8J 5AVZA 1CJVC 4K9OA 1DDGA 3L6DA 2PJUA 4GUAA 4UCWA 5J58A 2QX7A 4M76B 1IBMB 1BMDA 3ZXYA 3QYAA 4G8DA 4B3JA 5EE0A 1F7VA 2IW3A 2P9FA 1EM8A 1SBYA 2X9GA 2J9XB 4EWLA 4OHUA 1G98A 1N33B 1E2IA 2RONA 4HDMB 4JJ8A 3HCDA 3AF2A 1K5PA 3PQ6A 4CE6A 5IT0A 3T0GA 1E2UA 4OXNA 4PSVA 4Z9YA 3NS7A 4IDNA 2BTQB 4YMLA 1FP7A 3T7TA 3T9CA 5HXAA 4CIYA 5HQJA 1DEHA 3IX7A 1C1YA 4H6PA 2DHEA 2I7DA 2DBRA 2PCJA 3NATA 4PYIA 3H2YA 3B3GA 4FZRA 5BV7A 2FEAA 4LJ6A 4PZCA 2MCFA 4F9GA 4BLRA 4UM7A 1WO8A 1XZGA 4I5IA 4BBPA 4OP2A 4XKJA 4EK9A 4DJFC 1BYUA 1XTBA 3AP2A 4PQFA 5COQA 4DJEC 3ELBA 4YAUA 3FAKA 4GMDA 4JB3A 4U3JB 4AO8A 3C3MA 1YIDA 3FJYA 1IK6A 1GLNA 2CNOA 3GAMA 1EIZA 3N6VA 4J90A 2ZRNA 2W2KA 5E6SA 4KPGA 4TZ0A 3K32A 4G1MB 4LPSA 5B7NA 1P17A 1G6Q1 4KYTA 1ZDMA 3G68A 4Q1EA 1BEEA 3OG9A 4QVIA 5TMBA 4W5RA 1Y4ZA 2WQZA 1WM1A 2BCJQ 2O4CA 3QUAA 3K9NA 4NFLA 4QE3A 5AOAA 2JJ1D 3UB2A 2P3LA 2JGDA 2I1WA 1WSAA 1VI5A 1AQUA 1KZ7B 2H4ZA 3K16A 4Q4DA 2QLBA 5DBOA 4ZVRA 4CDRA 2RGBA 3ZV7A 1MW9X 4GRAA 4EI7A 2Y0PA 4D9HA 1D6SA 3AEQA 4FR2A 3RREA 4TL6A 3WGYA 2D2FA 3KPYA 4L5CA 3T3DA 1XZ8A 3ADKA 2YDYA 3QUQA 4LJAA 4N0DA 4XRRA 3S2YA 1X14A 3RHFA 2IHYA 3U5TA 4LYFA 3GP8A 4MQFA 1OZFA 4BLVA 4YIKA 2ALJA 4HF7A 2H00A 2JVIA 3C1OA 3PWKA 4BO7A 4E2YA 2VH2A 5GJWC 2QAIA 1GL9B 4U4AA 3TDMA 2NTJA 3GEIA 3WMFA 1CUSA 3COZA 4BNJA 5I9NA 2R5WA 1SEVA 3ZHTA 1NPTO 4JELA 2IC5A 1MFZA 1QCYA 2CXRA 2GKGA 3CEMA 3NWOA 1WLSA 4KLAA 2ADFA 2BPOA 5BO5A 4ODIA 1TKRA 3E9EA 3STVA 2XNDA 1GU7A 2GN2A 3M5PA 5IVDA 1L5GB 3MRXA 4C0BA 4JCOA 3RUEA 4FGJA 4UU1A 1U3VA 5K8IA 2A9PA 2XUIA 4JA0A 2Y05A 3Q15C 4B43A 3B6MA 3N8HA 5JU6A 4F3KA 4PS0A 1PK8A 1R4NA 2NQ2C 1D7AA 2F3UA 4ND1A 3T7RA 3ZW9A 1AK9A 2C2ZA 1U1EA 2G80A 3PK0A 4MEAA 4EB6B