3HDYA

Crystal structure of udp-galactopyranose mutase (reduced form) in complex with substrate
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
365
structure length
365
Chain Sequence
QESKGFDYLIVGAGFAGSVLAERLASSGQRVLIVDRRPHIGGNAYDCYDDAGVLIHPYGPHIFHTNSKDVFEYLSRFTEWRPYQHRVLASVDGQLLPIPINLDTVNRLYGLNLTSFQVEEFFASVAEKVEQVRTSEDVVVSKVGRDLYNKFFRGYTRKQWGLDPSELDASVTARVPTRTNRDNRYFADTYQAMPLHGYTRMFQNMLSSPNIKVMLNTDYREIADFIPFQHMIYTGPVDAFFDFCYGKLPYRSLEFRHETHDTEQLLPTGTVNYPNDYAYTRVSEFKHITGQRHHQTSVVYEYPRAEGDPYYPVPRPENAELYKKYEALADAAQDVTFVGRLATYRYYNMDQVVAQALATFRRLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of substrate binding to UDP-galactopyranose mutase: crystal structures in the reduced and oxidized state complexed with UDP-galactopyranose and UDP.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Isomerase
molecule keywords UDP-galactopyranose mutase
total genus 116
structure length 365
sequence length 365
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 5.4.99.9: UDP-galactopyranose mutase.
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03275 GLF UDP-galactopyranose mutase
A PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3hdyA01
2Q49A 5BR7A 3DMTA 3KZVA 5BSFA 1DRVA 3HFSA 1J4AA 1PGNA 4OM8A 1OI7A 1MFPA 5DN9A 3OQBA 4HP8A 1UAYA 2AQIA 3F5QA 2D4AA 2LDBA 5I7FA 3AI1A 3UGKA 1BW9B 2YHUA 2EKLA 4J0FA 4IM7A 4EGFA 4IPTA 1PGOA 4RDHA 3BTOA 4DC0A 4AJ2A 4YJDA 4WKGA 1A72A 2BI8A 2QRLA 4MVJA 5EPOA 5ILOA 3WG9A 3LT4A 3A06A 3BA1A 1M66A 2Y93A 3F9IA 5T8KC 4ITUA 1TT5B 4I5FA 2E6UX 4ALLA 2P5UA 5HA5A 1NVGA 4NK4A 2NACA 5IZCC 1XKQA 3MCVA 2H1SA 3GVIA 1HL3A 1PJ4A 5IG2A 4GKBA 4IINA 5F1OA 4BGVA 1GEEA 5H82A 3GG9A 5HM8A 1NP3A 1UAGA 4LK3A 4FJ1A 2C2XA 1LBEA 3CSDA 4A7PA 4AJJA 1DAOA 2J3JA 4YQZA 3U4IA 3AM4A 1XLTA 3K73O 2JFHA 3DHYA 1E3WA 1A7KA 3VPHA 1BHSA 3R0IA 4ZA2A 4AFNA 4CM9D 3JQ7B 5B37A 1E3IA 4NJMB 1XCBA 1YQXA 3TQHA 5ICMA 1DIHA 1Z7EA 2EP7A 4HFJA 3ZGYA 1F14A 3O8QA 3ZW9A 1GEGA 3LC1O 2NVBA 2VN8A 4KMSA 3PQDA 5A4DA 4KTTE 4PLVA 4XCVA 5KJEA 2Y0EA 2VTEA 3PWZA 4BQRA 5I7VA 3OJFA 1SZJG 1FXSA 3FTNA 3ETGA 1V35A 1DO8A 4BNNA 1ZK3A 2IYOA 2EHDA 3KETA 3VAZA 1Y8QA 2AW5A 4BO4A 5FWNA 3N58A 5ES3A 3VKUA 1MX3A 1K3TA 2GO1A 5MGBA 4HNHA 3OSUA 2HMUA 1RM4A 4PZCA 1HXHA 5DCYA 5HWSA 3AJRA 4CMBA 2Y99A 4KUGA 3WSVA 4ND5A 3B1FA 4WUVA 4CLOA 3H5NA 4CQMA 2BH9A 3GAZA 1PJCA 2EP5A 1M76A 3VTZA 2AG8A 4DVJA 5BSHA 3E03A 2P2SA 1LXCA 1PU2A 2W8ZA 3VVBA 2NQ8A 2X0IA 5AYVA 3VDQA 1KBZA 4XGIA 6LDHA 1PL7A 4HBGA 4XYEA 3IJRA 3RU7A 1EBUA 2DU8A 4FPXA 2OBYA 5CEFA 4LISA 4TROA 3HADA 4M49A 2ZB8A 1FDUA 2ZB3A 4GBJA 2WJPA 1UJMA 3FNGA 4UUMA 2DC1A 4B3HA 4OMUA 3NDJA 3RU9A 3IL2A 2EWMA 3C8MA 3PPIA 4CV0A 4WLVA 4GMGA 4Z6KA 4FR5A 3RBVA 2VUSA 4TZKA 2QZZA 2EKQA 4YT2A 3UXYA 2X4GA 1BXGA 1B8VA 3GZ4A 4TWRA 1A5ZA 1GYRA 1HETA 2OO5A 4OIMA 2PZLA 3HDHA 4WLFA 1K0UA 1N5DA 3NV9A 3QA9A 1KY4A 4WLUA 3PHJA 3HHPA 4RVDA 2E49A 3VPFA 1XU7A 2D5CA 3V5NA 4ALMA 2Q1SA 3CMCO 3JQAB 4E5MA 1FDWA 4N54A 1A9YA 4YRBA 1DC5A 1XIVA 3ULKA 4BNXA 1HDZA 1E77A 1RM0A 3KHUA 4E33A 3CZRA 4R68A 4ESOA 1N92A 2V6BA 1BDBA 3KSDO 2J6IA 3QVWA 2J5RA 1K5HA 2G1UA 1X7DA 3ZU5A 3QY9A 4OXNA 3AY6A 4DMMA 4CM7A 1EQUA 3GC6A 4E2YA 1I5RA 2I76A 3QWBA 4KDEA 4UVGA 4CQLA 2GN8A 5CDTA 3WNVA 1PX0A 3BHIA 2PZMA 4R3WA 3KEQA 2Y1OA 1LX6A 1E1NA 5DCWA 1WPQA 3K8ZA 4PVCA 1WAMA 5COBA 1WVGA 3WYBA 2OP0A 5IXYA 4O5OA 5DBFA 4CM8A 4CMGA 1NQ5A 2C7VA 4IZIA 4XQGA 4OXYA 2FPGA 2C5EA 3JQBA 1ENYA 3K96A 1LSUA 3RBZA 5CDSA 1EE2A 4L75A 1T2DA 1C3VA 3TOZA 1CQJA 2BFMA 4Q39A 3GDFA 3MTGA 3PLNA 3FNEA 5HBRA 1KVSA 4CM6A 1YJ8A 2BI7A 1YL5A 1NHGA 4GI2A 4GKVA 3T7EA 3ZNPA 1MC4A 4AICA 3QE3A 1UUFA 2IZ1A 4XYLA 2AEFA 5AXDA 3TL2A 1PQWA 1H9AA 2QHXA 4I5EA 4RF5A 4RO0A 2VWPA 4ZN6A 4R9SA 1LDNA 3LC2O 2VCYA 5FI5A 4MJLA 2O3TA 5THKA 4AJHA 3L77A 4MKRA 3TN7A 3BAZA 3V2GA 4Z9XA 5DF1A 4L4RA 4NIMA 5CEJA 1KOLA 1SMKA 1P1IA 2O3UA 3D7LA 4DPKA 5DOVA 1P44A 5JDIA 1M75A 2W90A 5JXWA 3GGOA 3Q2KA 1PWZA 1C1DA 3IKTA 3ZU4A 1KIFA 1CF2O 8LDHA 3EMKA 3G49A 1U5AA 2B83A 2DFVA 4MIEA 3L6EA 3JQ8B 2VHZA 2IEDA 3LLSA 4A2CA 3VH2A 2NU6A 4LSWA 1OMOA 1GZ3A 3VH4A 4R1UA 1SAYA 4NG5A 2FPPA 1Q1NA 2PZJA 2GRAA 1XR3A 5TIIA 1KVRA 1OZAA 5JAMA 4JLWA 5JY6A 1HLDA 2OXIA 4XIJA 1TVEA 1HLPA 1DLIA 2NSDA 1UR5A 4JJGA 5F5NA 3KXDA 4OKIA 3AY3A 2VYVA 2JD2A 2PH3A 2O3SA 2Z5LA 1GU7A 3C1TA 2B37A 2V7PA 2HAEA 3GMSA 5CG2A 4BO0A 3L9XA 3C1OA 4WOKA 4HKTA 1GD1O 2NNLD 2BFOA 3TZKA 5DT9A 4D7AA 1SEVA 4Y9DA 1ZXLA 1WW8A 5DP1A 1NFFA 1F17A 5C7LO 3DZJA 2O3JA 1I3MA 1EK5A 3RFTA 3CXRA 4Z0HO 4U5QA 2PNFA 2HK8A 3HDYA 5G2OA 1SEPA 3U4DA 3D3WA 3VC7A 3P7MA 4ZGWA 5JSFA 2RIRA 4BNFA 1XQ1A 1ISMA 3GPDG 1ZK1A 3ZWXA 3G1UA 4NBWA 1B14A 1MUUA 3HE3A 3PDJA 4B4OA 3AOEA 5IDWA 1UH5A 4IQ8A 5KKAA 1JQBA 2OGUA 2EKPA 1LRKA 4EBFA 3L9WA 4TRNA 4JX8A 3QVXA 4U7WA 3GF4A 4DC1A 2O50A 2UUPA 4IJUA 1U2GA 1JKIA 4NFYA 3IP3A 3AWDA 1HSZA 2B4RO 1MGOA 1SB9A 4II2A 5EJ2A 4UVDA 1D1TA 4P38A 1JA9A 2AQKA 3DZGA 2UAGA 4J7UA 3RFVA 2VOEA 4XR9A 4LCJA 2TMGA 4LRTB 2C2YA 1PJTA 4E0BA 4CQMD 3UKOA 5C7OO 3EYWA 4PG6A 1O89A 1MV8A 3AU8A 1X14A 1E6UA 3GOHA 4DLBA 2HMSA 2BLLA 4HX5A 4ZJUA 3WNQA 2GSDA 1KEUA 3OHSX 4CM3A 2C29D 1PTJA 3OA0A 4LVCA 2W2LA 1QLJA 4J9VA 4RVGA 1H2BA 2X0NA 3RVDA 5TQVA 4YAJA 3EUWA 4EJ6A 1H5QA 1EK6A 2IODA 1JKJA 1PWXA 3KM0A 3W6UA 1PEDA 4XR4A 5COAA 1J6UA 4DYVA 2CUKA 4ONEA 2AHRA 3W4KA 1VRWA 1YBVA 3RSHA 4P22A 4D3FA 1NM5A 5BNIA 5GZ3A 3BZUA 4BO6A 1P77A 3B70A 4CPDA 3FN4A 3RASA 4ZQEA 3MTJA 4G5HA 4JBIA 1CDOA 1U7HA 3PQEA 1EVJA 3RUCA 5C37A 2B4QA 1NAIA 1B15A 3ZI0A 2EJWA 4YBZA 2B5WA 3P19A 4YVFA 2D8AA 4IDEA 1Y9AA 1I01A 3HFGA 2CD9A 2HUNA 3E82A 4BIIA 1J5PA 2GF2A 4ZHSA 4E32A 4IGFA 4C7KA 3JQ7A 2J3KA 4Y8VA 2D5AA 1LSJA 2VYND 3GVXA 2DTDA 4JP3A 2DAPA 1LRLA 3G0OA 4BGUA 4FFOA 2P4HX 3Q1LA 4AL4A 2GASA 3RC1A 4E5KA 3TFOA 2DVMA 1ZEJA 3OJOA 2VHVA 3F6YA 3K2EA 1P1HA 4J7XA 3LDHA 5IDYA 3D4OA 3LT1A 4FGWA 4LCEA 2P91A 4MVJF 3AFMA 2E82A 1NFRA 1Y8QB 2DM6A 1EUZA 2X23A 4OXKA 3Q0EA 1ID1A 3RQSA 5BNFA 1DDOA 4CLDA 1QKIA 3RUDA 4DYDA 3ZHBA 4YWJA 4K1LA 4PN3A 3GZNB 3BHMA 4GLLA 1DIAA 2YHIA 3TDKA 4O0LA 4UVIA 1JU9A 3LF1A 3WDSA 3WTBA 1QLHA 3ZV4A 4IDGA 2ZCVA 8ADHA 4WE3A 5IZCA 5L53A 1MLDA 1RJWA 1ZK4A 3ENNA 4NHEA 4RPLA 5GZ6A 5ITVA 4JROA 2P9CA 2Q45A 3W4IA 3VKVA 3WTCA 3ZV5A 5T8KA 4EEZA 5JFOA 2YZ7A 3NRCA 4Q3DA 3L4BC 1IB6A 3HG7A 3JQ6A 4M55A 3U09A 5MDHA 4BO9A 4GGOA 4QXMA 4RF4A 1NNUA 4ALKA 4CMCA 5DULA 2EXXA 1DC4A 1VL0A 3CE6A 1ISGA 4D3SA 2DKNA 4BO3A 1CETA 2EF1A 3S55A 4MINA 4B4VA 4BO5A 4CLRB 3WYEA 1ZCJA 4BNIA 1QV6A 3KVOA 5B1YA 4RQUA 2FSVA 4WOJA 3H3FA 1EDOA 1ZK2A 3VZQA 4WECA 4NPCA 3MWEB 3ROQA 4F3YA 4KQXA 1ISJA 5LC1A 5T5QA 3JQFA 5JY1A 1C0KA 3RUIA 1UZLA 2HMTA 1OOEA 3HDQA 3QJ5A 4GWKA 4MP8A 5G0VA 1U3WA 3VZPA 3ZU2A 3IKVA 3S8MA 3B6ZA 3OA2A 1V3UA 3PLRA 4FC6A 4JP2A 3V1YA 4BMVA 2CSUA 4TKMA 5CP8A 2R2GA 1I0ZA 5CG1A 4UUOA 3WBFA 3DHEA 1KYQA 5DBGA 4BNVA 4YXFA 5EQFA 4YAIA 4KUHA 1DIRA 3TRIA 2PA3A 4CV2A 4F6CA 2I65A 3MOIA 4HADA 3UICA 2B35A 1PS9A 3PJDA 3VVCA 1NBOA 1DFHA 1JVBA 1ZSVA 1X1TA 2QG4A 2HRBA 1UP6A 4D42A 1Y7TA 4R41A 3INTA 4YJFA 2EIHA 3JD2A 3QQPA 4FW8A 4CR6A 1LSOA 3JTMA 2HJRA 4KTVE 1NPTO 3RCBA 1E6EA 3JQ9A 4I9UA 5JO0A 3Q2IA 1GPDG 1ZJYA 4PLPA 1IUKA 4E2ZA 3DZHA 2EERA 5A1TA 3VZSA 2OZPA 1JWBB 1T26A 4NBTA 3EK2A 1GL3A 2RBEA 4BKUA 2Y1GA 2DLDA 4IXWA 1R0KA 3CH6A 3FR7A 3DZFA 2O2SA 4L4SA 3U4CA 3V2HA 1WMBA 4FBGA 2VHXA 2C0CA 2R00A 3GT0A 5JDIC 5G0UA 5JW6A 3C85A 3ZN2A 3CTMA 3ZWBA 1HE2A 1A71A 1NHWA 2WE8A 2X1HA 4RCVA 1ENPA 5IN5A 1W73A 2PWZA 1EBFA 1I8TA 1I2ZA 3AUTA 3VPGA 3ICCA 4CMHA 4FOSA 1HDRA 1BTOA 3NX4A 3GFBA 3CIFA 3M2TA 3K5PA 4XKJA 5BSGA 3PHGA 3E9MA 4WLOA 4AJNA 3TJRA 1D1SA 3O38A 1YS4A 2VWGA 1V8BA 2Y1EA 4O63O 1R4MA 3TSCA 2RH4A 5A9SB 1MG0A 3DAPA 4BMSA 3OIGA 1OBFO 3H4VA 3A9WA 1ZNQO 4IS2A 1ZSNA 4BQPA 3JQBC 3DFZA 2Y66A 3RI3A 2CY0A 4J1SA 2ZKLA 3A1NA 3H3JA 2X5KO 5GY7A 3KSZO 5TJHA 1XELA 4NFHA 4Z9FA 1B16A 2Q1UA 5AVOA 1P45A 2NVUA 2YQ4A 4QQRA 5JO9A 5JLAA 5LDGA 4S1VA 1NPYA 4BS9A 4TRMA 1I32A 4IQ0A 4L76A 1IULA 2D59A 2P9GA 4YRDA 5EINA 5K6AA 2B4TO 5HTOA 4O59O 3FPCA 2FPIA 2XXJA 2OMEA 1HDYA 3U9LA 5L4SA 3F1LA 4OYRA 1KETA 1NAHA 2HLPA 5ITWA 2HMWA 3SJ7A 2XAAA 1H93A 2I5PO 3DZIA 2FR1A 3OM9A 2BKAA 2NU9A 3JQAD 3ST7A 2YW9A 2QZ9A 1A4UA 4AJOA 4D44A 4RLHA 4MKZA 4J49A 1KS9A 4MP3A 1H6DA 3KB6A 1X7HA 4TRJA 4CMIB 1GR0A 3PWSA 4XA8A 1SPXA 3R3JA 1PZEA 1ZMOA 1HTBA 2WD7A 2Y0DA 5ADHA 4INAA 1P1FA 1F8FA 1MB4A 4EJMA 1Y8RA 4ND2A 4FOOA 3PIIA 3D64A 2PZKA 3H65A 4TVBA 3SJUA 1W4ZA 1ZVMA 4XD2A 4OSPA 4ID9A 3WYCA 4F45A 2HO5A 3E48A 3UW3A 2EG9A 4NBUA 4MVJE 1Q7GA 5U9CA 2YUTA 1OFGA 4EDFA 1H6CA 4WCFB 1R66A 3FPLA 5KVCA 1LRJA 4GQAA 1MXFA 2HU2A 1RYDA 4DMLA 5JC1A 1KEWA 3GH3A 2AXQA 4EJ0A 2X58A 3GGPA 2FRDA 1C0IA 1C1XB 4EITA 1ONPA 5C5IA 1LC0A 2NV6A 3UUWA 4J90A 3NUGA 4U6QA 3OFSA 3HN7A 1ZEMA 3GG2A 3NGLA 2OOSA 4GGPA 3KYCA 4DPMA 3PHLA 4YRAA 5DOZA 3LF2A 3BMOB 3HUDA 6ADHA 3GHYA 3L6DA 1E7MA 3RC9A 4ND3A 4KOAA 3WQSB 1PGQA 2C20A 2Q50A 1E7WA 3EZYA 4F6LA 4OQYA 2X6TA 3I4FA 1JAYA 3WGIA 1MP0A 5F3RA 4YR9A 4CUKA 3FBTA 3WQQA 2ZQYA 2JL1A 1Q0QA 4NK5A 1E7QA 1WP4A 2VUUA 2DUWA 2R00C 3HZZA 3ZW8A 2CDCA 5DDIP 1QRRA 4C7JA 2NU7A 5CEEA 1AUPA 1E7YA 4AJ4A 4YT4A 4BHTA 3FNHA 1ADFA 2C07A 2IZZA 4HXYA 3DTYA 3PYLA 3NYWA 3ZNNA 4IDFA 3GPIA 2X5OA 1PGJA 4CR8A 2GCGA 1HZZA 2OORA 5ER6A 3BIOA 3I6IA 4GLOA 4JN6B 4J7CA 5I8ZA 3OJ0A 3UCEA 4UULA 4J6FA 4E5NA 3RAJA 2JKVA 2I9PA 1DC3A 2VT3A 1T2AA 2BGKA 5FI3A 3DO5A 4BB6A 2FZEA 5IDQA 1AN9A 1FK8A 4R4JA 4E3ZA 1ZFNA 1OAAA 4TRRA 4IZHA 2GZ2A 2YFQA 2DPGA 1WDKA 3ZZNA 3U5TA 3AOEC 1IZ0A 2CZCA 3GNQA 1JDJA 1B2LA 2YFHA 3D5QA 1DRWA 3QVOA 3PEFA 1ZO8A 2WYWA 2VOJA 1DB3A 1X0VA 4Z0TA 4B3IA 2B36A 1ZKMA 5K6AC 5KWEA 1QYVA 5JYDA 1LA2A 1JTVA 1TT5A 5JDCC 2O4CA 3UF0A 2IXAA 3OECA 5JCXA 4CLEA 1RM3A 4IMRA 1ZXBA 3P5SA 1TXGA 3S1LA 2HMVA 2Q2WA 2GN9A 4J43A 2I67A 4BKQA 3PJEA 4UVEA 3WR5A 1H9BA 4PLTA 2CVQA 4CM4B 1L7DA 1NVTA 4MVJP 1M2WA 1E3JA 1SOVA 2J3IA 2E37A 2CF5A 1EZ4A 5CPFA 2FR8A 2V6FA 3EHEA 1E7RA 2AQHA 1QYWA 3H9JA 2O3RA 4TQGA 2F00A 3NT2A 1NQOA 5FYDA 3PRJA 3PGXA 1D4FA 1QSGA 2EW8A 2O48X 4D41A 3E9QA 4ZRMA 1F8GA 3GEMA 3JCZA 1TI7A 3HDJA 4KUEA 4Q3AA 1GQ2A 1YB4A 3NT4A 3T7CA 2ZYDA 1UDBA 4NU5A 2IEBA 4WEOA 3C7CB 4DBZA 1IL0A 2BRUA 2W4QA 5AXBA 1J49A 1E5LA 3WSWA 4OJNA 2R6JA 3MJ4A 5BNTA 3FD8A 2GGSA 1XG5A 5GMOA 4DXHA 4M89A 4FCCA 3I1JA 4CQLB 1C0LA 2Q3EA 3JQ9C 1KVTA 2PR2A 4YA6A 4N5LA 3PFWO 5TGDA 4XYBA 3QWAA 5F1KA 5L4NA 1ADCA 3FSRA 3SEFA 4D3DA 1C14A 1CYDA 3NTOA 4IDDA 5DCUA 4BB5A 4U6SA 2EGGA 3RUAA 5L7WA 3RC2A 5FEUA 1VPDA 2X0JA 3ZWWA 4HFRA 1U9JA 3TPCA 1VJ0A 4OSOA 1EUCA 3OP4A 4WCDA 4XJTA 1K6IA 4YJGA 1V9LA 4N5NA 1XGKA 1H2HA 5DP2A 3I9JA 1U3UA 3JQGB 4NU6A 3MJVA 4MVJI 5L45A 2D0IA 2PTGA 4PVDA 5A5EA 1YQDA 4YYZA 4BO7A 1Z45A 4S3MA 4W7IA 3HJAA 1KEVA 3JQFC 3M6IA 1H6AA 1HF3A 5G0WA 1ZJZA 4RORA 5AOVA 4RPJA 4H3VA 4AJEA 1TA4A 3GLQA 4DQVA 2UUOA 4XGKA 5B4UA 1UXHA 4WASA 4XDYA 1ORRA 2ZB4A 3H6KA 1LQUA 3RKRA 1U1IA 5AQ1A 4OOEA 2NQTA 4B8ZA 2Z1MA 4DIFA 2X22A 3VH1A 4IJVA 1YVEI 2NVWA 3ZNQA 3GGGA 2RH8A 1TB4A 2O3QA 4ZQGA 4YPOA 4IY1A 3DZBA 1NR7A 4BUCA 1YBMA 1DOHA 1PJQA 5J23A 1A9ZA 4CV1A 3DB2A 5BQFA 2ET6A 3DHNA 3T4EA 3ORFA 2AE1A 2CNBA 4K6FA 3KLPX 1E1MA 1ZH8A 3ETDA 4A73A 1LSSA 3NDIA 3ASUA 2GLXA 1YRLA 4PRKA 1L7EA 4JIGA 4NZ9A 5KJCA 2VWQA 1Q2XA 1GUFA 4UEKA 2VYVD 1CWUA 3LT2A 3K2BA 5KJ6A 3DBVO 1YB1A 3TOXA 2Q1TA 4TZTA 3HQ4O 3BMCA 1I30A 2BELA 3ZWCA 5K9ZA 3KYDA 3G1TA 4FJ0A 4HFNA 4CMEA 3LQFA 3OEYA 3FF4A 3DAGA 4WLEA 1A7AA 4M1QA 1HKUA 3M1AA 3CUKA 4N5MA 5LDHA 1QV7A 3H2ZA 4GL4A 2TMDA 4ALJA 4BKRA 4J3FA 3ZHZA 4PZDA 3VPSA 3W8EA 3I6QA 2A4KA 3PK0A 3DBHA 1DSSG 5IN4A 3WLFA 2XXBA 1VC2A 1X0XA 5LCXA 1ULSA 1LNQA 2WMDA 5A3JA 2ZTUA 1I3NA 1XYGA 4QTZA 4LW8A 4ROSA 2VRBA 5I9NA 1EFLA 1ZMTA 1PL8A 2YQ5A 1ZW1A 2WD7B 3TZQA 2AA3A 4FB5A 5JE8A 3DONA 3GN1A 3ENKA 3NDRA 2GDZA 3OJLA 3PI7A 4MPDA 1GZ4A 1R12A 3WWYA 4B7UA 3NTRA 2ZIZA 2JHFA 1EEHA 2NTVA 2JHGA 5KVQA 5KJ1A 3JV7A 4MIYA 1PS8A 4Y6SA 3T4XA 4MVJH 1UXKA 4DLLA 3I9NA 3I52A 4PLGA 4CQMB 3JQGA 1ZIDA 3HB4X 2HDHA 3I9KA 1SO8A 5L95A 1LDMA 3MJEA 4OKNA 2O7QA 2JCXA 4YAGA 3P2YA 5G4KB 5L9AA 1GADO 4CM9A 1O5IA 4E5YA 1DEHA 2VWHA 5K0ZA 1U7TA 4P4NA 3ZV3A 2WYUA 9LDTA 5KIAA 4B3JA 3F5SA 3GAFA 3PWKA 4P8RA 4GVLA 1R0LA 1CIVA 2PK3A 1AHIA 4LN1A 4R3NA 1ZSYA 4WNCA 2E4AA 2QRJA 1IPFA 4DIOA 3AUSA 4E30A 2YY7A 2PD4A 1Z75A 1LDYA 3GA0A 3DBLB 3RBXA 2G76A 3GNSA 3G3EA 3LVFO 1PZGA 2WM3A 4J1TA 2ZYGA 1LU9A 4CLHA 1Z6ZA 1LLDA 4L4XA 2C54A 3RROA 1LUAA 4ZVVA 4J0EA 4WEQA 1F12A 3PDUA 3LSYA 2ILTA 4KWIA 3ZWYA 4DQXA 1U2DA 4I9NA 3E5MA 3IMFA 3QVSA 4QFDA 2CFCA 3WFJA 1YQGA 2LDXA 3QSGA 3FBGA 1B3BA 1HWYA 4AVYA 1BDMA 1KVUA 1W0CA 1G1AA 5JDCA 3VH3A 3Q9UA 2Q2QA 2FY8A 1ZBQA 4J91A 3I83A 4B7XA 3RD5A 1U4OA 4JJFA 1UDCA 5JS6A 2GD1O 4PG5A 2GR9A 1B8UA 3OH8A 3H9EO 5T64A 3WICA 1R4NA 2NU8A 1HE3A 1PS0A 1SNYA 4UUPA 1VE9A 3I23A 4BNUA 2IRWA 1F06A 1QXSA 2YHIB 3FHLA 2GNAA 4NBVA 3N7UA 3TL3A 3L4BA 5H83A 3H5RA 4JNKA 5CDUA 2X8LA 1E1KA 3U0BA 4URFA 3M1LA 1IOLA 1Y9EA 4P4LA 4W7HA 3JQDA 5A06A 3QVTA 3KV3O 4PLWA 4PIVA 1HT0A 3W6ZA 3MWDB 1JW9B 2VYNA 4KP7A 4R01A 4W4TA 4GPD1 4K9DA 1VJTA 3MOGA 3NAQA 1JN0A 3NJ8A 1QP8A 2DBZA 1GPJA 1Q7BA 2EGHA 5JPIA 3RUEA 4BNKA 4R5HA 4XWYA 1YBAA 4Q3CA 1H0KA 3SXPA 2I6TA 4CLRA 1XWFA 2PKRA 5L3ZA 3ZU3A 1D8AA 1GCOA 2ZB7A 4FSHA 1UP4A 4E4YA 3AM3A 4KQWA 4GVXA 3M2PA 3KSUA 5FFFA 3WGHA 2J8ZA 3ONFA 4YJHB 4U0KA 1FF9A 4BV8A 4PZEA 3RJ9A 4UEOA 2QRKA 3EZLA 3K92A 2Z1NA 3TZ6A 5CAEA 3ZWOA 4LMRA 4BVAA 4OH1A 2D2IA 2OUIA 1NQTA 2PLAA 3R6DA 3DAFA 3PHIA 3FTPA 1DFIA 2QW8A 3ETEA 4Z9YA 3O26A 1GUYA 1R6DA 4HV4A 2XOXA 1YE3A 5C7IO 2IDZA 5B4VA 3IJPA 1Y5RA 4A10A 4RF3A 4I08A 4PLCA 2PGDA 4XQ9A 4IGEA 4BOYA 1GDHA 3LU1A 1N9GA 4JBGA 2XPCA 1M67A 2Q4BA 1W6UA 4BO8A 2PKQP 2WSBA 4QT0A 1KERA 3H8VA 2H6EA 1EVZA 1MFZA 2X0RA 4H7PA 5A3VA 3JYNA 5JAIA 3MJCA 3RIHA 1IHYA 3BTVA 4YAKA 2DPHA 5EMHA 4J1QA 4DGSA 1CJCA 4OAQA 5I7SA 5HS4A 4IIVA 3ROMA 4G81A 3MJTA 3PFFA 1UXIA 1ISIA 3LLVA 4MDHA 1E0DA 2CMDA 4WNIA 3ZHXA 1SC6A 2CF6A 2PFGA 4AJPA 1PQUA 5F1PA 2JAHA 2O23A 1X7GA 2BMAA 1BXGB 1EVYA 2J5QA 3UAGA 2AG5A 3ZWAA 4RJTA 1XHLA 3WIEA 1LDBA 3PZBA 5ILGA 1UZMA 1E6WA 2FMUA 3QWHA 4RZIA 3WGOA 5U1PA 1XQ6A 1U3VA 3BHJA 1X1EA 1EVIA 4MP6A 4RVSA 1GUZA 2Y1CA 1NFQA 1SCUA 2CDAA 1Z82A 3NTQA 4XYMA 4CR7A 5JBIA 1JVSA 4BGIA 4XB1A 4ND4A 5L7TA 3EDMA 3OMLA 2FZWA 1FJHA 2PD6A 3UCXA 3RUFA 5CFZA 1NPDA 1EDZA 4JQCA 4Q3EA 4BNZA 2B5VA 3DBRB 4DTIA 3I4CA 2VNAA 4FDAA 3V2UA 5AXAA 2HKIA 2GPTA 1P33A 4X54A 4F46A 1LDGA 2JCYA 2F1KA 3QRWA 4WJZA 4Z0PA 3WLEA 2IE0A 5EL0A 3STHA 4DA9A 3O03A 2VNSA 4OHUA 3H2SA 1P0FA 4FD3A 2H5LA 4XX0A 3ZWNA 1VKOA 3OQ1A 2W98A 3L07A 2RAFA 3ONDA 4Q9NA 1J0XO 1GFSA 3F4BA 5A5FA 3KOUA 1DJNA 3AU9A 1NQAO 4II3A 2ZTMA 5L40A 3DXFA 1DHRA 2A94A 3WQRA 4BNTA 5DNAA 4RPKA 1YJQA 3Q11A 1YONA 1UXJA 4K6CA 4RVHA 1Y6JA 2DTEA 2W2KB 1ISFA 4DIBA 1U3TA 3WIDA 3OBBA 3GQVA 1UDAA 3ANNA 4B79A 4R69A 3KUXA 4LVUA 1Q0LA 4L8VA 4RZHA 2OBNA 1BMDA 3GR6A 1E5QA 1TEHA 3ADPA 4IDCA 3RWBA 1I33A 4MVJM 1E3SA 2OFPA 3LC7O 3GRKA 3ROKA 1DIBA 1UXGA 2Q2VA 5JAZA 1S7CA 2ZJ0A 4DBVO 1P0CA 3DOJA 3KO8A 3AI3A 3QLJA 4NJMA 4UAGA 4DQUA 4FIZA 1DXYA 1NWCA 3WGQA 5F21A 3ADOA 4RPGA 1Y81A 4ILKA 5IXSA 3WMWA 3VZRA 3E5RA 4J9UE 2GZ3A 4L73A 3E1KA 2EJVA 4BO1A 3W1VA 3D3WB 2GERA 2H63A 1X13A 1HYGA 1LDEA 5IJZA 2WD8A 3ANMA 5KNLA 1E1LA 4W82A 1E3EA 1I3LA 2Q99A 3PP8A 1N1EA 3WXBA 1Z7BA 5T67A 1ZZEA 1IY8A 1RKXA 4YDRA 1DPGA 4RF2A 1WZIA 1DAPA 1PSDA 1ARZA 1EUDA 3AUUA 1B0AA 2X9VA 3IDSA 4GSLA 3BMNB 3D4PA 4R16A 5TJ9A 4CLOB 1EE9A 2GUGA 2NWQA 3I3OA 5JMWA 1RM5A 4PCVA 1O95A 4BO2A 4CM1A 1N7HA 3SVTA 2VHYA 1ADGA 4CMAA 1MXHA 1MA0A 3AM5A 4CMIA 3FWZA 3D1LA 3KRTA 5TNXA 4CUZA 3DMTC 1F0YA 4HUJA 4OOFA 3I9MA 3ZDFA 1M6WA 4GX1A 1U8FO 1ADBA 3NKLA 4GMFA 2NADA 3RKUA 5A04A 3C7AA 3BYZA 2DQ4A 3BMQB 2VRCA 3ZV6A 1HDXA 2ZATA 1P1KA 4IDBA 1H6BA 1ZUD1 3C1AA 5ENVA 3AY7A 4YEDA 3GDGA 3ASVA 4WLNA 4RVUA 3LK7A 3W4JA 3WWZA 4UEJA 1QYDA 1FDSA 1GQQA 1LLCA 3O9ZA 4CL8A 3ZHYA 2IYPA 2IZ0A 4Y6RA 1C1XA 2DUUA 3KLMX 3H9GA 3DBRA 5I9MA 4I9HA 1E7SA 2GN6A 5KTKA 4ZQFA 1AGNA 1UZNA 1B26A 2YYYA 4BMNA 3ZH2A 2X9GA 2BFAA 5JCJD 4CM8B 1LEHA 5G0TA 1P74A 4L9RA 4C4OA 2YV3A 1IHXA 3MZ0A 4TSKA 2X86A 4DL9A 4R54A 1YWGO 1HDCA 2A9FA 1IPEA 4QEDA 4PRLA 4ZRNA 2X5JO 1AXEA 1I2CA 4D0RA 4RDIA 3R3SA 2P5YA 5TSDA 3S2FA 2PD3A 2HCTA 4H16A 1MG5A 1RYEA 4FQ8A 4IJWA 3WGTA 4BNWA 3AW9A 4ND1A 2QQ5A 5I7EA 4DRYA 5I9LA 1HZJA 4AJLA 4K28A 1DJQA 1UP7A 2VZ8A 3EW7A 3GEDA 2I3GA 3COSA 1N1GA 4NJOA 1VSVA 3IAHA 3GUYA 1ML3A 4OL9A 3DOCA 4IBOA 3ITDA 1YOVA 3IP1A 2E48A 5TC4A 4GX5A 3QV1A 4YB8A 2QX7A 1IE3A 4I5DA 4JK3A 1C1DB 4BGEA 3BTUA 3SLGA 4A27A 1V0JA 3E9NA 3GVHA 1B7GO 2AE2A 3JD0A 1GV1A 1FMCA 5TT1A 1Y5MA 3I9OA 3JD4A 1LC3A 4XRRA 2Y0CA 2EV9A 4XYGA 3GY0A 2O4UX 4YJFB 3IQDB 4HWKA 3UCFA 1CQIA 2YV2A 3CPSA 2QYSA 3S2EA 1Z73A 2UVDA 2Y1DA 3GFGA 1IYZA 3Q3CA 4YJHA 1QMGA 2A92A 2PGLA 3FI9A 2J3HA 1U5CA 1WXDA 2FSSA 1C0PA 1I36A 3PTZA 3TF5A 4LGVA 4ALIA 1DIGA 4NNJA 4UVHA 3VTFA 1WZEA 1PJ3A 2FN7A 2PH5A 4CMJA 1VSUA 2HRZA 5EQDA 4JCOA 5A9SA 4Q3BA 4W99A 4R1TA 2EW2A 3K9QO 3H5AA 5G0SA 1PJSA 5U4QA 3ON5A 5A05A 2Z95A 3JQ8A 3L0DA 1GYPA 3JYLA 3MJSA 3H9UA 1KVQA 2VRCD 2G0TA 2ZTLA 1YB5A 1NWHA 3DOOA 1VI2A 3FCOA 4G65A 1ISHA 1LLQA 3NGXA 3EGOA 3B1JA 5JC8A 1N9GB 1TLTA 4E6PA 4P4GA 5FF9A 2G17A 2QIOA 1P3DA 3CINA 1LJ8A 4PG7A 2Q4EA 3KTDA 2ZTVA 1DC6A 4ALNA 3OIFA 1YDWA 1XSEA 2CDBA 2V65A 4FFRA 4O6VA 4OQZA 1M6HA 1I3KA 3HNPA 2P9EA 1NXQA 2UV8A 1PJLA 4U8GA 3DZKA 4B8WA 4IJKA 2O2YA 2OP1A 4OGWA 1JKFA 4KZPA 4YT5A 4FS3A 4EUEA 3PJGA 5A9TA 1R4NB 2WYVA 4NBRA 3MEQA 4EUHA 1WMAA 4PLYA 1T25A 4IDAA 3A14A 2NVUB 5I8WA 4AJ1A 2ZQZA 3DWFA 3IUSA 3W8FA 4YQYA 3EC7A 4IXTA 5IAAA 2YJZA 4QX6A 2WEKA 3DMYA 4M87A 1GY8A 1BWSA 1I10A 4EI2A 3GMDA 3S2IA 1YXMA 3B20A 4XRGA 1BSVA 2O7SA 3WB9A 3UHAA 4R1NA 3DL2A 3UFXA 3GEGA 1ONOA 3OJEA 1WDLA 2QYTA 3QW2A 2UYYA 5BT9A 1T2FA 4Z3DA 1I24A 4IS3A 2RCYA 5THQA 5TX7A 3TZHA 4J2HA 1HE5A 4AG3A 1DFGA 3KYBA 2JCVA 4GAEA 4KWHA 1O6ZA 3U49A 2VHWA 1QR6A 3GUCA 4QECA 4G2NA 2DT5A 4K26A 4L0QA 4Z3KA 2YDYA 2ZK7A 1BVUA 4RQTA 4MKXA 1Z74A 1YKFA 3DC2A 4ZD6A 5KKCA 1G0NA 3OETA 3OICA 4RPHA 2ZCUA 4XIYA 4XQCA 3JQCA 2PKQO 5JAQA 2JAPA 3D4NA 1HRDA 5HS6A 5F5LA 4YT8A 4XQEA 2C5AA 2B0JA 2V6MA 4N18A 4QFCA 1IZ9A 2C7GA 1XEAA 1XA0A 3E18A 4AJKA 3PZRA 4QSMA 4WCFA 2CVZA 1DLJA 3DBHB 1LLUA 3DDNA 1K2WA 3JYQA 3I5MA 1N8KA 1T1SA 4FJ2A 1R4MB 4ZICA 3NT5A 1GQYA 3CKYA 4CMKA 2NUAA 4HFMA 4YJGB 2PY6A 3WGZA 4KDFA 3E8XA 4LSMA 4BL5A 3LT0A 4MVJG 4WCFC 5DZSA 2HJSA 3C7DB 5T57A 2I3AA 4J2OA 5HRUA 1EQ2A 1CEQA 3IUPA 3WS7A 1GAEO 2W2KA 3FNFA 5EERA 2WWRA 3A28A 5JNLA 1P1JA 2VUTA 1SBYA 3GHHA 4AJIA 1KC1A 4D43A 3U4HA 5TT0A 5JYEA 3BXXA 5KJFA 1XDWA 3Q9NA 3TNLA 1PL6A 1QYXA 3VPXA 4XB2A 4DREA 3LYLA 2FOIA 1G0OA 1BW9A 1FDVA 2VQ3A 4J1NA 3IOYA 2VZ9A 4ZU3A 4CV3A 2NTNA 4NQZA 3D3EA 1PJBA 2NTJA 3NJ4A 1LQTA 5EESA 3QWFA 5ER9A 4E31A 3EVTA 4L74A 4RGBA 5B12A 3RC7A 2Q46A 3GZNA 3PHHA 3N74A 1NVMB 1A27A 2V6GA 1S6YA 3LZ6A 3U3XA 3UN1A 2D3TA 4M8SA 4NMHA 4PLHA 1BVRA 1YDEA 2RHRA 4NFSA 3TFQA 3PXXA 5C3MA 2RHCA 1VJ1A 1HYEA 5JCJA 1PJ2A 3QHAA 4EZBA 1ENZA 4E12A 2OHXA 2I99A 3KYDB 4XEHA 3ICPA 4R1SA 5TRTA 3DQPA 3UH1A 4NR0A 4DWVA 3KEOA 3GRPA 1RWBA 2HK9A 4FFPA 3F47A 4XGNA 3IS3A 5CPBA 3Q6IA 3ROPA 2J5KA 3RUHA 3V1UA 2FWMX 3ZWVA 4WPGA 5KVVA 4DUPA 3OF2A 1T2EA 3F46A 1WNTA 1U8XX 1V6AA 3F1KA 3PQFA 1U4SA 1D3AA 2POQX 1QYCA 4FN4A 1PR3A 3F4LA 1E3WB 3ITKA 5COQA 3V8BA 1H94A 1VKNA 3NEPX 5GZ1A 1HDGO 1KC3A 4I8XA 1RPNA 4I1IA 2HK7A 2FHSA 4GX2A 4B4UA 2HQ1A 4J4HA 4O1MA 1K89A 3BMCB 3P2OA 3QWIA 1O94A 4CLXA 3L6OO 4A03A 1Y8RB 1WWKA 2PV7A 2JFFA 3BMOA 2FR0A 2D1YA 1BG6A 1SOWA 2GYYA 2Q1WA 4J4TA 2DBVO 4BNMA 3JYOA 4JJIA 3SLKA 1L1FA 1N2SA 3BMQA 2Y05A 3G79A 3WMXA 1T4DA 5BSEA 5TS3A 1B3RA 4CODB 4R5MA 3PGJA 2NM0A 5TF4A 1NASA 2X9NA 3HSKA 4BNGA 1PR9A 4D0SA 4E5PA 2ZJ1A 3TZCA 5ICSA 5CHEA 1PIWA 1P1RA 3D5TA 1D7OA 3K30A 2DBQA 1FDTA 3JD3A 3S2GA 3ONEA 4MIOA 3FWNA 4B4WA 3FRJA 3KYCB 5IZ4A 1HYHA 5KOIA 4IQGA 2JD0A 4D46A 3GK3A 1KY5A 2XF8A 2AEMA 3WJAA 1G6KA 4NDNE 1YH3A 2C59A 4NI5A 5IFLA 5L4LA 4HNGA 1GTMA 3A4VA 3OIDA 5IDXA 1YGYA 1HEUA 3AK4A 4PLFA 4RLSA 4EYEA 4IUYA 3WOHA 4GX0A 4H15A 3GVPA 1E3LA 3V1TC 4CUJA 1BRMA 4QO8A 2ZYAA 3PYXA 3H7AA 2G82A 2IXBA 2YDXA 4M54A 3U62A 4LMPA 4A0SA 3HN2A 5A9RA 5G4LA 3QP9A 1YL7A 3O4RA 1ENOA 1K6XA 5L51A 3H9QA 2UDPA 4Y98A 4DLAA 2BGLA 1R37A 5G4KA 5CDGA 2W2LD 2Y67A 4E13A 3E6AA 4YTEA 5DBIA 1YOVB 3INGA 4PGFA 4YCAA 4BNHA 3GN2A 3JQAA 5B4TA 3JQEA 1W8DA 4FC7A 7ADHA 1O9BA 3HB5X 3JYPA 4ZQBA 3ANLA 4R51A 4YACA 3PJFA 3X2EA 3AFNA 3DBLA 3PYMA 4WK6A 4YAEA 1PGPA 4FFLA 3JSAA 3GNTA 2BGMA 1BXZA 3BMNA 1WLYA 2I66A 3R1IA 3EY4A 3WX0A 4BNYA 2BHLA 3JD1A 1OC2A 2H9IA 2JFGA 2AEJA 1R0SA 1VLLA 3F3SA 5JMPA 3VOSA 3WJ7A 1K6JA 3KBOA 3D0OA 5CDYA 1EMDA 4GSKA 1PQPA 4RV9A 4CMEC 1NTOA 4J16A 2EEZA 4NH4A 1NYTA 3GDOA 4XJSA 1A4IA 1BGVA 4GH5A 3SX2A 2P68A 4Y67A 1XU9A 4A5OA 4B7CA 4MVJD 4XDZA 5TLSA 3W8DA 3WGGA 1NX6A 1T24A 2BD0A 2C82A 1P9LA 4PLZA 3DEYX 4CJXA 3WFIA 7MDHA 3PIDA 4CM4A 4BNLA 4PG8A 4TVOA 3C3XA 3ZNOA 4EEXA 4D79A 1YO6A 4QO7A 9LDBA 4IMPA 4QUKA 4Y6PA 1HSOA 1ULUA 3DFUA 5IF3A 4U0JA 3UOGA 4R9RA 4MO2A 4PFJA 1DHTA 3EAGA 3BTSA 3K31A 1AXGA 2VTDA 3AUAA 3IIEA 2SCUA 2Y1FA 3IC5A 4W6ZA 4RVFA 2WE7A 1DRUA 4IIUA 3DTTA 1T2CA 1X15A 3L4SO 2GZ1A 4FGSA 3C24A 2VZ0A 2BFPA 4HY3A 1P31A 1R16A 5KCZA 3VHRA 4UUNA 1U28A 1WDMA 1V3TA 1T1RA 4Q3NA 3WBBA 2WTBA 2OL4A 4WGGA 3SC6A 4A26A 1EFKA 3O8QB 1Q7CA 4CL3A 1Y1PA 2CVOA 2DBRA 2HSDA 3CEAA 3UVEA 4RL6A 5KVSA 3AI2A 1DBVO 1E92A 4JBHA 4LRSB 4BKOA 4W9NC 1CRWG 4W9NA 1VL8A 1GYQA 1JWAB 1LI4A 1T4BA 2X7HA 1TT7A 1O0SA 2BF7A 3X2FA 5T6BA 1ONNA 2NLOA 4FFMA 4TKLA 1HE4A 4E21A 5H81A 2AMFA 3RFXA 3ZWMA 2YV1A 3G17A 5ENDA 2B69A 4BNJA 1BXKA 3CZMA 3PVZA 5AXCA 1NR1A 3K6JA 2JJYA 1PZHA 3OQ6A 3AOGA 3OEWA 4GWGA 4EW6A 2VT2A 4DPLA 4FFNA 1VL6A 4JXKA 1R15A 1ZK0A 3VDRA 4EUFA 1JAXA 5A03A 2P4QA 4MOWA 1SB8A 1YL6A 4JGBA 1QG6A 3ZWPA 1QORA 3RJ5A 3ZCXA 1O8CA 3EVNA 5A02A 1OC4A 1GV0A 4XZ3A 5L7YA 3CMMA 3B1KA 1JLLA 1HDOA 3QIVA 2WDZA 4M86A 3INRA 1GZ6A 4OO3A 1B8PA 1GCUA 2G5CA 1V3VA 3DR3A 3I9LA 4E2XA 2PGJA 1MC5A 4BV9A 4D45A 4J4BA 1I2BA 4ZQHA 1AE1A 3GVCA 4UREA 3SC4A 3SBOA 4E2WA 4N7RA 4CM5A 4I5GA 1AHHA 1PZFA 1VM6A 2JD1A 2AQ8A 2GN4A 2A35A 2Y68A 4TMFA 5EN4A 4BKPA 2FP4A 1CERA 3TWOA 3WGYA 1LTHR 2DTXA 1Q0HA 1N7GA 3HWRA 3FR8A 4PG4A 2DFDA 5EIOA 3ABIA 1KEPA
chains in the Genus database with same CATH superfamily
1DQSA 3EGDB 1OI3A 3DLHA 4N39A 5BSFA 3AERA 3KB2A 4JJAA 1D8TA 4Q03A 1JG6A 3USCS 3LGXA 1OI7A 3QHPA 3W7VA 1GPMA 3DM9B 3AKZA 5ECWA 1JLRA 2EVWX 3BWMA 3FGZA 5C8YA 4K9NA 2OXRA 3TTTA 1P0PA 2JDIA 2QRVB 1T6XA 3R5JA 3WNZA 2YHUA 3AP3A 4YK7A 3W9UA 1GPNA 3JVUA 3C16C 2LNDA 4IRMA 3JY6A 1JLKA 1EM6A 4DABA 2OHHA 5FPYA 2BI8A 2HB6A 1CJBA 2CXNA 5KQSA 1D0VA 2PRYA 2ZWIA 2OKCA 3MPOA 1Q91A 3C3YA 3I9FA 2RK3A 3QXJA 4XTCS 5C80A 3LT4A 4WUTA 3A06A 1VPEA 2PX0A 3A7DA 3HL4A 1M66A 3R9XA 3CLUC 3OT1B 2GZMA 1N0WA 2EJTA 5LD2B 4Z51A 2GCIA 3WV5A 4PYIA 3EXG2 5DTRA 4YP6A 2BSXA 2E6UX 4YREA 4C87A 3WNBA 2NACA 1GPLA 2OFOA 3MCVA 2O07A 4XD7A 4INZA 2B5OA 1QH8A 2VLIA 4CI0B 1C4WA 4FZJA 3NHAA 4Q4JB 5IG2A 4OUKX 3JASB 1CNFA 5KWSA 2IEGA 2WFZA 2DWUA 3OEED 3RREA 4BGVA 4RHTA 4ZOLB 1GDDA 2C9BA 3P4XA 4PHCA 5H82A 4J2TA 4ZYYA 2FZ4A 2AFIB 1IAQA 3PEVA 5ICFA 2GK3A 1S7GA 1P73A 2C2XA 1LBEA 2L42A 5H68A 2PPLA 4OHWA 5BXQC 4AJJA 1F4PA 4M4SA 4JV5B 4KXXA 3OZAA 3CLSD 4HAIA 1Q3TA 1OIXA 2QN1A 3FJOA 1F8XA 1BHSA 3UO8B 4ZA2A 4LE1A 1YVDA 5EJ4A 2AXPA 1E3IA 3BXPA 3TW6A 4DCJA 1YQXA 3ND5A 3T3PB 5CA0F 5ICMA 1DIHA 1Z7EA 1JQ5A 5H4HA 1X7XB 4HFJA 3O8QA 1SFRA 1Y5IA 3LC1O 3E22A 4EKNB 4HH0A 3ZI4A 4ABYA 5DB4A 3F6RA 2YNMA 3KPJA 3PXUA 4HXGA 2HSGA 2QM8A 2CLDX 4A8HA 4R6XA 3OLWA 4U1RA 3AF4A 2JGLA 1RIFA 5KJEA 1IXYA 1LVHA 1TFUA 5JLJA 5I7VA 2CDNA 1SZJG 5HKOA 1FJ2A 1SXJE 5CGQB 4K6OA 3RWOA 3L04A 5CLJA 5BW6B 3HYRA 2OFXA 3A2LA 1E89A 1CS0A 3WP0A 1Y8QA 1Z4LA 3DUFB 1O3YA 3DE4X 1UJ2A 1MO3A 3N58A 3QF4B 4FHCA 2ID9A 4H3KB 4TTQA 4HNHA 2HL6A 4ENVA 1FUYB 4M53A 3ENZA 3SK0A 5HWSA 1BVHA 5IH3A 3SEZA 2C83A 3PC8A 3TRHA 5I01A 5F76A 3WSVA 5JZMA 1U5BB 3B1FA 1NVVQ 3KOZA 2BH9A 2FTKE 2O52A 3K4QA 3GAZA 3U7QB 5HCNA 2UYQA 3WP1B 2AN5A 2JLAA 3DZ8A 2FPPB 2AG8A 2VEOA 3T3NA 1A9XA 2OG1A 3E03A 5C7YA 5JCZA 1ZGCA 2IYVA 4AKSA 2IU4A 2NQ8A 3EVFA 4W5WA 4XWOA 4MV3A 4D9CA 4JVMA 2X0IA 5CM8B 1KDVA 2CW5A 3OU7A 3KVRA 1PL7A 3IJRA 4MQ4A 3UGJA 2I4MA 3WRYC 1BDHA 3B13B 4FOLA 5B1HA 2XNCA 3ILXA 4XSVA 2IXDA 2XMBA 1I4DD 4IFBA 4LISA 5FWAA 3WAKA 4CKBA 5HUHA 3A6PC 1M74A 4MEJA 1G7CA 1X7ZA 2H7VA 2PMBA 3HYLA 3I09A 3I6ZA 1C9MA 3FNGA 4FOTA 4L5JA 5L3VA 1DQPA 5JAUA 2CXSA 2DQYA 3NDJA 3NQ41 1JKMA 2EWMA 2O14A 4R1OA 4PPYA 1U8AA 2J48A 4ZMBA 4WLVA 2V6JA 1R64A 4BPBA 1NXTA 2XJ9A 5KTTA 4TZKA 5D85A 2GBCA 3USZA 3MTDA 1XYVA 3R8CA 1MNAA 3KHSA 5CM2Z 1E9VA 1K0UA 4F97A 4D80A 3SAJA 5M29A 5JXHA 1KY4A 5I7HA 3LNTA 4JUAA 4X44A 1THMA 3EG9B 3VPFA 4F9GA 1TO1E 2RG1A 2VK1A 3M5PA 4FB4A 2FDRA 4ALMA 4CEIA 2Q1SA 4RXTA 4FONA 2XQIA 1FDWA 1J7JA 1NBMD 3GLUA 5FJIA 4LMAA 2PZEA 3C6YA 3A6ZA 3AHDA 4GQBA 4LE2A 1E77A 2C61A 4I9GA 2H4WA 2V6BA 3GOQA 3OF3A 1FMTA 1M0TA 5JXGA 3TUJC 1K88A 3QY9A 2IV2X 1Y8CA 2VJQA 4X61A 3ZLUA 4M22A 4WZ6A 5A7HA 4TWAA 2ZM6B 4NBKA 1I5RA 1BS1A 3T1YB 3OPQA 2L2QA 4ACAA 3BHIA 1KAHA 1Y34E 2PZMA 2XMDA 4DWOA 1Q16A 4UBIA 4B2YA 5LMNB 3PJRA 2G1JA 1JTEA 1LX6A 4RFVA 1E1NA 2X6RA 4WZAB 5E3JA 4ZVLA 3K8ZA 1O95D 1QHSA 1P2GA 4PVCA 2E5WA 4NV3A 1WW2A 2CLIB 1FQJA 4JHLA 4O5OA 1DBRA 5H7XA 2Q41A 5DBFA 5U4XA 4CMGA 1NQ5A 1BXRB 1DIOB 4CTMA 3GLFE 3L0PA 3B2QA 2C5EA 4UU7A 5TQ0B 3VU0A 1LSUA 1ZHOA 2Z6UA 1EE2A 1J09A 1T2DA 5JQGB 1NYQA 3LDFA 1HNZB 5FBHA 1P6QA 3GFQA 5CUQA 1FJXA 3PLNA 3PXGA 3DVAB 1R7RA 4WVLA 4D9GA 3BXZA 3HLTA 1GTVA 1VMDA 4YI3A 5FV7A 4YV1A 1Z37A 5LUAA 1E5XA 5HBRA 3LXUX 1W75A 1JHUA 3EXIB 3V3KA 3OTHA 1E18A 3E7DA 1EGVB 1IZZA 1MC4A 4QXQA 2QPTA 2RHOA 1EWQA 1PQWA 1ZIXA 2C2ZA 2PH1A 4ZN6A 4RIIA 1NIJA 1LDNA 1K8QA 1QHNA 2F3TA 3BJMA 2FPOA 3WKCA 4Q4LA 3DWEX 3L77A 2F1JA 1GG9A 4NFLA 4B35A 3V2GA 4UHBA 2ZIUB 3SP1A 3N07A 2R751 3MCAA 1G59A 5CEJA 2GN2A 4XX1A 1KOLA 1RQGA 5HVNA 3A4TA 4YC7A 1BJRE 2O3UA 2IQIA 5DOVA 3V1LA 1JIQA 1YZKA 5JDIA 2W90A 3M6VA 2QPAA 4EHBA 4O02B 3Q2KA 1WTCA 3RJZA 4C0AC 3QYJA 2F6RA 4QTUB 1D7AA 4DARA 1BRTA 4HTAA 1O03A 3A36A 1MPTA 4RS4A 1OGIA 1G21B 1V96A 3VBEA 2YCLA 1L7RA 4MDYA 2ETXA 3JQ8B 5AKHA 3RS9A 2V5AA 1DAMA 2IEDA 3LLSA 5BSMA 4ZV9A 5LR6A 4FGUA 3VH2A 1KMQA 4TV9B 1KNQA 1OX5A 4L28A 4N9QA 5KTNA 2WB2A 4X62B 1H9CA 1SAYA 4DWJA 3ESYA 2QN8A 1KSGA 2PZJA 3BGWA 3IUBA 3M82A 4MCHA 4HB3A 2W2NA 5GGXA 5JAMA 2H4HA 5JY6A 4O4JA 1HLDA 1OD6A 1E9BA 3W8RA 4XIJA 2FRVA 3LUPA 2GPYA 3THWA 2ZW9A 1GNQA 3KXDA 4QUDA 4H7JA 2FGJA 2JD2A 2PH3A 3AF5A 10MHA 4MNTA 2LIVA 1XCLA 1K7YA 4NABA 4GW3A 3X1JA 3FMFA 2B37A 2V7PA 2HAEA 3TEFA 3K0FB 5LZ4A 3MD0A 1L5HA 2NUAB 1VBKA 1TPYA 3JATA 4BLQA 2PWPA 3EPHA 2EFHB 3I12A 2H0QA 2BFOA 1JDSA 3B9RA 2HLNA 1O58A 5EJIA 1SEVA 1FLDA 5JHGB 3NIBA 3ZE2B 1TX4B 3WA7A 1KXJA 2N75A 3OD5A 2H48A 3OPMA 5EOVA 2VDNB 3CRZA 3OZEA 3QNWA 3R77A 3D4LA 4WN9A 4V1CA 2VQEB 4U5QA 1UIMA 2CHQA 2PL1A 1DI0A 1SEPA 4JNCA 3VC7A 4BUJA 1J21A 4II7A 4K03A 5GAJA 2AG0A 2O8DB 1VHJA 3UT0A 3VYTB 1XQ1A 1MZVA 2A14A 5FBKA 1QRDA 3WJ1A 2PCLA 1ZK1A 4BVHA 2VJYA 4U9HS 3TLMA 4QLBA 5T4FA 3BBLA 2Z2KA 1FX0A 4NBWA 3EG9A 4I0WB 4TL6A 2AV6A 5EE5B 2DERA 1OU0A 3AOEA 2HSEA 1ZLXA 3TOCA 1ABEA 4KXMA 5KKAA 1JQBA 5I7UA 1GTRA 2EKPA 3I04A 3LCUA 4EBFA 2X8BA 3SIRA 1GWNA 3ZDAA 1Z2OX 3L5OA 3L9WA 4G4SO 3GPCA 3IQWA 4PSDA 1C9KA 5EYPA 2BFEA 2UUPA 2YASA 1QGDA 4NFYA 4ED9A 2YQZA 5J5AA 1MGOA 3AXTA 3BQNB 4D1YA 2QDKA 3UV6A 3SQXA 1SBTA 3B6JA 3V8QA 1RHRA 3RABA 4BVGA 4C5CA 1JA9A 1ZA2A 2B20A 1IK6A 1HZZC 7GPBA 2UAGA 5A5DA 4G1FA 3ZY5A 4PXYA 1B6SA 5AKLA 2H7YA 2DFTA 3A6EA 3Q7QA 5C9ZA 3V4ZA 3KQPA 3PI6A 1YR1A 1W52X 3QU5A 1CXZA 3EYWA 1U3DA 3N6VA 3OBIA 1QQBA 1ZWLA 1MV8A 1HUQA 1GVHA 1Z28A 2CLLB 3IHWA 2BLLA 2I4TA 2LZ0A 5JMOA 1KEUA 3OHSX 5C1OA 5C1BA 5I7RA 2HA5A 4G4JA 5IJAA 5K0GA 1UC5B 1V6CA 5LKRA 2ZT7A 1QLJA 3QG5A 2C92A 1TYCA 4J9VA 4RZ3A 3RVDA 3U9SA 3OESA 4YAJA 1ZD4A 3H1TA 1ZJ6A 2WZCA 3C48A 3ZGOA 2IODA 2A33A 3NTUA 2WU1A 1H5UA 3OMWA 5KSOA 3R9XB 5COAA 2GPSA 2CUKA 1IZ8A 1VRWA 3D6JA 3D8HA 3G9UA 3W4KA 4ZZIA 1YBVA 4ER3A 4YLYA 3GV0A 4KIUA 4D3FA 2ZVDA 2RC5A 1UM9B 2R1VB 2WPDD 1P77A 4MW0A 1DWOA 3AEQA 1J25A 3CCBA 3FN4A 3P20A 3LDUA 1E1YA 3MTJA 1QR2A 1XALA 1X7WA 4G5HA 2I8LA 4RL4A 3L0OA 4OJKA 3EF1A 5FIUA 4A6XA 3GCXA 3UJAA 1K7CA 2F48A 3FTFA 3WMGA 2EBUA 3ZI0A 2AOTA 4IHKA 2ES4A 4YVFA 1V8ZA 2VQ6A 1Y9AA 2GARA 5FA6A 1P9OA 2HUNA 4HX9A 1ORTA 1D2HA 4ZDWA 4BIIA 3FTDA 3NHRA 4HMQA 5LBUA 2YOFA 2ZI9A 5AVXA 3OUTA 5B3LA 4S12A 1FUKA 4UHHA 4C7KA 4ZHSA 2ZYVX 1R50A 5J58A 5CITA 5E9AA 4NP6A 2ZZKA 1RQLA 2D5AA 3Q3VA 3QX8A 3WDKA 4JYPA 4WFKA 5H02A 2Q5QA 3LPDA 1H42A 3DYBA 1IJKA 2A59A 3G0OA 4DJJA 1QDEA 3P9YA 4S04A 2O54A 2VDPB 1QOQB 2NZVG 1DXHA 2B9VA 5TEWA 5LFAA 1ECLA 1ZEJA 1L7PA 2E3JA 3T9CA 4J7XA 3K2EA 1JG2A 1U0BB 2PXXA 3G7NA 3FTQA 2ASVA 3LBIA 3DOHA 3D4OA 4HRVA 1RAAA 2QTNA 4UATA 4UTOA 4EPYA 2E82A 3DDOA 1NFRA 1AKRA 3CF4G 4NVRA 2WJVA 4CTOA 4GPBA 4MROA 5EXPA 3L0IB 3J81k 2O5VA 1QKIA 3G6KA 3NU1A 1GNSA 5EJAA 1W48A 2P2ZA 5IDWA 1YZUA 3T5AA 2JI8A 3K0FA 4IXNA 5C81A 4ZHQF 3P45A 4MARA 1JEDA 2FYTA 2AX3A 3C4VA 1DIAA 2YHIA 3TXAA 4B80A 4YALA 3R7FA 4O0LA 2OV4A 2JVKA 3WTBA 3K0AA 1WR8A 1CW2B 1HNWB 1WLSA 1JE1A 1K7FB 1QLHA 1XCPA 1HI9A 2YIJA 4DLKA 4V1CB 4MX8A 4QG7A 1C9NA 2CEKA 2FP3A 3IT1A 1Z8DA 1JQKA 2NW6A 1RJWA 1ZK4A 4S1TA 2EJCA 4RPLA 3AFHA 3S1AA 3FUWA 5ITVA 2FJPA 3OQHA 1Z0IA 2Z83A 5DWQA 5TF0A 4MR9B 1C7QA 4NENB 2JGRA 2AYZA 4WAUA 1IB6A 4KR0A 1CD5A 4M55A 3UTDA 5CLIA 1Z6PA 3U09A 5AT1A 1JKXA 4D56A 1BFDA 3TLAA 5IDVA 2WJ3A 4HXEB 1DC4A 2LRHA 3NONA 4F85A 1VL0A 4JLDA 3AIOA 4D3SA 3DHWC 1V9CA 4NZMA 3S55A 4BFSA 1KHHA 2KSQA 5ES4B 1YVPA 3EE6A 3WYEA 4BNIA 3AKDA 1OBCA 3KVOA 3I2GA 4WOJA 4BN5A 2CDRA 1T1GA 5TPZA 3TG2A 1MX9A 4QUIA 1GARA 2AIRA 3MWEB 2COEA 3ZY3A 3BWXA 4KQXA 1ISJA 2DR0A 3A4MA 4TLDA 2XHEA 2WSSA 3HDQA 3QJ5A 1V5FA 3ZU2A 4DR4B 3IT3A 2C5GA 3IKVA 1EJ0A 3PLRA 4FC6A 1RNLA 3V1YA 2CUZA 3THYB 1KI4A 5HHTA 2FJUA 4TXHA 4H1VA 4N12A 5AVZA 1AA9A 3U56A 2YVAA 5CP8A 4G5FA 3IGFA 4I50F 4RMGA 1EA7A 2O7VA 3LO8A 4H77A 1NVWQ 4X95A 5H3CA 5CG1A 2PUBA 3Q85A 3DHEA 1KYQA 2RHHA 4HDNA 4C0LA 4ZV7A 4YXFA 2HCBA 5EQFA 4ZYVA 1J9ZA 2XZLA 2GAAA 1ZRHA 1G2OA 4IXMA 1NV9A 2I65A 4FYJA 4HADA 4L3OA 1ZNZA 3R7LA 2QE6A 2V7UA 4LVNA 1TZKA 5F1YA 1DFHA 1JVBA 1ZSVA 2HRBA 4C9BA 4E70A 3IBYA 2ZKIA 5EJMA 2WU4A 1NUSA 4R41A 2KJQA 4YJFA 3GEPA 1PDWA 1V2GA 2EIHA 3QQPA 1YJCA 4W6QA 1ZUIA 1L5WA 2YMMA 1T9AA 2GK6A 2HJRA 2ZOSA 3RCBA 1E6EA 2PMKA 1THTA 2R1VA 1TZMA 3IR7A 2OQIA 2P6MA 3Q2IA 1D6MA 2OQVA 3SLRA 1OASA 2JJ1A 3TVTA 3WNDA 3VZSA 1J23A 3KE9A 3RRZA 5F7XA 2OO3A 2BR3A 3RANA 1KO5A 1G98A 1T3LA 2RBEA 4MRSA 2HQSA 2IDKA 4JS0A 2YNMD 4BTEA 4RV5A 1JEOA 2HRDA 4L4SA 3GXBA 4P53A 4BP8A 2C0CA 4YJ2A 2H11A 3MWKA 5LXTF 3SBDA 4G0VA 4V0NA 2NU7B 5BMVB 3LW8A 2X1HA 1NBWB 3KV1A 2BBSA 3X1WA 4DAOA 2WFLA 5KSWB 1OXTA 4E08A 4RCVA 1ENPA 1E98A 1QNFA 1W73A 1QZUA 2CLOB 2G70A 1EBFA 1I8TA 2D1QA 4NHOA 2QAIA 3WB1A 2XTNA 3AUTA 3VPGA 5B64A 3MNFA 4NDZA 4FOSA 1OIWA 3B36A 3MSCA 2JAXA 2HCRA 1P0MA 3M3PA 3UK7A 1BTOA 1N1DA 4E3WA 2VP6A 3ZK7A 4Q02A 4H35A 3EUFA 3Q0TA 5IWCA 4URHA 3HKDA 5I4CA 3K5PA 4XKJA 2D7CA 2W0SA 1RLUA 1Q14A 3N59A 4DMHA 4XVUA 4AJNA 4HDMB 5TY0A 3E23A 1YS4A 4BJ3A 1UBKS 1ZHFA 2VWGA 1F5SA 1B41A 2Y1EA 4XVQA 4PSCA 5BR4A 1R4MA 5HJ5A 2Y6UA 3Q3JB 4HS4A 5A9SB 1MG0A 5HYVA 1ZL0A 3DAPA 3RVLA 1KRWA 1AO3A 1OBFO 2MIIA 2DJ5A 3EB9A 4TKZA 1ZNQO 3HWX1 4AM8A 5JD4A 4NOLA 2XXAA 1O4VA 2VDVE 3JQBC 4GE3A 2Y66A 4RD0A 3AHGA 1HE8B 4BMCA 1IXKA 1SXJB 3ELUA 3PDIB 2X5KO 1WHSB 1ZP6A 2QM3A 2O9JA 4BC1A 4PZPA 5TJHA 2VQSA 3IKLA 3UXHA 2CXPA 2Q1UA 4PO1A 1P45A 3KELA 5SZKB 2PX2A 3B78A 4QODA 3VYSB 2FW1A 3OE7A 4TRMA 4BS9A 1H1DA 1I32A 1P6UA 4URYR 3U3RA 2FKAA 4YBRA 5IARA 5CVTA 4D81A 2ADMA 4EYOA 2GK7A 2B99A 4LY3A 5EINA 5K6AA 2B4TO 3HP1A 3CONA 3RC3A 1TVMA 2FPIA 2HA6A 3B1ZA 4KMRA 4LJ6A 5IC6A 1YR7A 3U9LA 3IMGA 2FETA 5F7JA 2Q6TA 1UEIA 4YMHA 2LW7A 1DEOA 4NENA 1NAHA 4MAFA 5DH9A 3GRUA 4HL6A 3SJ7A 2ZI7A 2R1TA 2I5PO 4YUYA 4I4TF 1H65A 3QEKA 1TK2A 2EQ5A 2LGJA 4D8VA 2BKAA 3ECAA 3SS7X 5AQEA 3U4GA 1PF7E 1T6BY 2GAOA 3H13A 3JQAD 3L8MA 4LRUA 4F84A 1A4UA 2Q62A 5AVSA 1D4ZA 1F4LA 4QDXA 1U2PA 4C5AA 4JQZA 3W2FA 2GEJA 5J43A 2VNKA 4UHDA 3DKRA 3RHTA 4XA8A 3RVOA 3AG5A 1PZEA 2IF2A 5HMMA 5FXMA 4KE6A 1YJAA 4RTQA 3JR7A 4EJMA 1F7VA 4FOOA 3PIIA 4OVKA 4UNPA 4A15A 2PZKA 2IGBA 1U63A 3SJUA 1HFKA 1W4ZA 3WYAA 4B4DA 3IAXA 4OSPA 4ID9A 4BLVA 4F45A 1N36B 1Z0DA 1IN1A 2ACWA 2HO5A 2O8NA 4RKRA 1MQ9A 3UW3A 4R83A 1GLVA 4D2IA 5B3JC 1EUQA 9MHTA 5U9CA 2CCGA 4EDFA 3UT5A 1CRPA 1NVDA 2J0EA 2OCPA 1H6CA 4R2HA 3RVBA 3DW1X 4PC2A 4Y2YA 3B6EA 2ONKA 5K3EA 2M1XA 1TQ6A 2YWXA 2I2XB 4LYGA 4QVKA 4S05A 1I94B 2OZLA 2XLBA 1ZOOA 5DWDA 2CJWB 3GH3A 2AXQA 4E5VA 4ZAXA 5HGXA 4WH0A 1C0IA 2XZPA 4QQFA 3VKHA 1ONPA 1PT7A 3QLEA 4W9RA 1LC0A 3ICWA 3LRPA 3NUGA 4KZKA 3HN7A 1ZEMA 3NGLA 2LR0A 4DJAA 1COZA 4NAVA 4DPMA 1QQ6A 3PE4A 1IOVA 5L3RA 3HUDA 4F4DA 1EFVB 3A6JA 3L6DA 3I6BA 3ORRA 4HAUA 5EHNA 3T6KA 1I2AA 3V3TA 5JAPA 1QGUB 1KE1A 2BZSA 2C20A 3P96A 4B87A 1MO5A 4HEQA 2ZUDA 2JANA 2ODNA 4G5QA 3KQSA 2TMKA 1RI3A 4PX9A 2RGDA 2GTHA 1JAYA 2DFKB 3B8EA 3O5AA 1JSCA 1PYGA 3UENA 2GPWA 2YS6A 1H22A 3OTGA 4CUKA 1L4HA 4ZTBA 3WQQA 4U7DA 5H5JA 5J2TA 4UBOA 4ZOEA 3MS7A 2EKZA 4NECA 4NK5A 4BRUA 2IS4A 4PQFA 2HDWA 2DUWA 3A10A 4C7JA 3V6LA 3BRSA 3AL0C 1UMBB 1PR6A 3F98A 1QRTA 4K9SA 4PGHA 2O2DA 2DFNA 2EX0A 3G9XA 4C5BA 1FXUA 4JI7B 4ILEA 2OFFA 3REQB 1NJGA 2AYXA 2BV3A 8OHMA 4TMZA 3TDMA 5TV2A 3M3DA 3BQ9A 1QZXA 4IL5A 4MS3B 2BFFB 4K7JA 3ZNNA 1N2JA 3EVGA 3QU4A 4IDFA 4F9FA 4D4KA 4H7KA 1H3EA 1HZZA 1QFXA 3LFTA 5ER6A 3PV0A 1C3JA 3I6IA 5CB6A 1Y1QA 3OJ0A 1AZLA 3WA6A 4Y1GA 4BRSA 3JQQA 2G80A 3MELA 4UULA 4URVR 2FXIA 2R11A 2JKVA 2W5UA 5FWYA 3UUGA 2QY6A 3C3BA 2E55A 4G84A 4OK5A 3ANSA 3BAFA 1XD2A 1XL1A 5I3ZA 4A8PA 4XD7D 4L0MA 3UJCA 1WHTA 1XLTC 3HKCA 2QTTA 1KRXA 1ZFNA 3GLHA 3CTPA 4IZHA 4TRRA 2A7XA 1RAGA 2YFQA 3W6OA 1E79A 1N8TA 3AOEC 2NO0A 5D3QA 3IQZA 1B2LA 821PA 1C80A 3D5QA 1FLAA 3PA8A 3QVOA 4K46A 4N5IX 1ZO8A 2D1SA 3FVTA 4RKWA 5E6SA 3OLYA 4Z0TA 2N47A 3SYKA 4D9JA 1MNQA 2C1ZA 3FXAA 2ZE8A 3CB4A 5JYDA 1LA2A 5JZVA 5JDCC 5CA1A 3FOCA 3HXKA 4PWZA 4DEVA 1MAAA 3TQOA 3OECA 2VP5A 3AL2A 4CLEA 1KAMA 5DV9A 2ZYSA 2AN4A 1ZGHA 4PR3A 3ADCA 1ZXBA 1IPHA 1M72A 3C6QA 4UC0A 5HF5A 4DQ0A 2J46A 1M6VA 2I6UA 2Q2WA 3CNQS 3EQ6A 4GMKA 4J43A 1WM1A 1I4TD 4P4SB 3NNNA 1KBOA 5LPNA 1H9BA 4PLTA 1L7DA 5AUPB 1R6BX 4WNAA 4V03A 5CLGA 4O25A 3ZHOA 3I1YA 5LQSA 2FSPA 2CF5A 1E62A 5CPFA 4LF7B 2PO7A 5FUMA 1MOPA 1TQ8A 1LS1A 3M7IA 3LUCA 3OE7D 5CT9A 1XWIA 2R60A 3E61A 3A05A 1ZLYA 4HXFB 2O3RA 3HPRA 4LECA 4R8LA 2KWIA 2PTHA 2F00A 1OB5A 5JVDA 1X7XA 2FJ0A 4X7PA 4HN2A 1DE0A 3PRJA 1W88A 1VCOA 3O1IC 2GO7A 4WX2B 3EZ6A 3BDVA 4DV3B 2HA7A 2I1LA 4D41A 1WMEA 1L2TA 4LK2A 5DYWA 1EZZA 1XB2A 2ZLBA 2QVZX 2ZREA 2ZVJA 3I5AA 3LG2A 4H7HA 4NBLA 1Y6QA 1HNXB 4CEIB 4KUEA 4F3RA 1A5BB 1CQPA 4MULA 1W2GA 1YK0A 2H2GA 2J4FA 4QPPA 1LTKA 3VO2A 2Q5OA 3BB1A 3C2QA 4YMUA 3NT4A 1XKLA 5D51S 3TD6A 4AY6A 3OCYA 4CDNA 3HH8A 3EIXA 3HKEA 1MF7A 1MMFB 4D6YA 3C7CB 3SICE 1IL0A 2Y71A 3N2YA 1TJPB 2JBAA 2W4QA 2QRGA 3RYHB 1J49A 4CQJA 1JDNA 2CUTA 4KQ1A 4M3NA 4OJNA 1E8NA 5JYCA 1E61A 4BQSA 4M1YA 3W7AA 3WGKA 3ESCA 3ZIDA 2CNLA 5KTOA 1JAIA 3JQ9C 4MB0A 4RH0A 3CJQA 3IH5A 2V9CA 2P0EA 5TARA 3HDTA 4EY3A 1MAVA 1N6LA 3IBCA 1Z0KA 3ICQB 1NBEA 3M81A 3LX6A 1P9NA 1GA4A 3PE6A 1U65A 1VGRA 2ZS7A 3VVLA 1WY7A 4K0RA 4CN9A 1HH4A 1DWUA 4FMCB 4EW2A 4X7MA 1C14A 1MVOA 3AUXA 3KJFA 1EFPA 2P78A 4X6YA 5BVGB 5DCUA 1I5EA 4IUBS 4U6SA 4ZAZA 3ZHVA 3RUAA 2GN0A 3E1GA 5AHRA 5HM6A 5JCOA 5L7WA 3AM1A 1VPDA 4GOJA 1YK1A 4MGYR 4HFRA 4AYTA 4C6TA 2Q3JA 2O57A 2XJ4A 3DVAA 4UHJA 4ZMRA 1NDHA 3HNRA 3KK0A 4P93A 2IX3A 2QU8A 2OYSA 2CE7A 5DP2A 5A6SB 4QYWA 2FUKA 2Q7DA 4AZ3A 5B30A 3Q7RA 3LVQE 1N2OA 3OFNA 1RJFA 1U1FA 3NBKA 2LE0A 4TMWA 2X2PA 2D0IA 1KI7A 2PTGA 3PDWA 4L08A 5EJ7A 3BFJA 2JFNA 3FWHA 4EARA 1YQDA 5A5EA 4PBRA 4BO7A 3UWPA 3RRXA 4WJKB 1P61B 1RLOA 3URKA 2E4XA 2Y27A 5CJPA 1GP2A 1WCYA 3JQFC 1F2DA 1AKWA 1H6AA 1YQUA 1YJXA 5DLYA 2PX4A 3HABA 2XITA 1RAFA 5G0WA 1ZJZA 3T1OA 5DLQC 4UDXX 5IMSA 2VDQB 1K4MA 1M1ZA 3BPSA 1BX3A 3E8SA 5FTKA 1FTWA 1RCTE 2HIAA 5DM60 2V4UA 2UUAB 2UUOA 2Z4TA 5DGTA 2XT6A 2XWPA 1U0RA 2OY0A 4MQEB 4ML3A 4ANFA 2FMIA 4WASA 3GAAA 3HBAA 1OZFA 1F4VA 2WWXA 3DEKA 2VC2B 4KQ9A 1JHZA 1KJZA 5AP9A 3RKRA 1IVYA 5JROA 5KNDA 4MA4A 3H4MA 4PW0A 1NUPA 1T3GA 1QO0D 4I6GA 3CW2A 5HE8A 1H85A 3WLRA 3ZNQA 2J9YB 4F6RB 1SCQA 1T5BA 4TS3A 4YPOA 5AJXA 1QGYA 1NR7A 4TMXA 4TWZA 4FFBA 5IHPA 4UUAA 4WHMA 4BJ6A 1L6RA 1ZAYA 1H1LB 2OB2A 4M6WA 4KKXB 1A69A 2E21A 3CSSA 2QDXA 2QT0A 1OFUA 3LGSA 3WBJA 4K6FA 4PC7A 2DOKA 3PNYA 4F7DA 1ZH8A 2ZYWX 3ETDA 4JT2A 3REGA 2R97A 1JDZA 1CR0A 3HWWA 1DAKA 3U7IA 1PHPA 2GZAA 1U2GC 1BFKA 3RRYA 1CE8A 4JIGA 1WG8A 3SR4A 3KKMA 3FNQA 3U31A 2RK6A 5AK4A 1AQIA 3F6EX 4LAFA 3TSZA 3LT2A 3PDIA 1VE1A 1YB1A 4H27A 3SYRA 3FZGA 2X42A 4TZTA 1U9IC 3HQ4O 4MAMA 5JTUA 1GQRA 1I30A 2BELA 4A3SA 3W2HA 3K0BA 1RCUA 5EIBD 3C3WA 3MWLA 1SUDA 3AL3A 4HFNA 4CMEA 3LQFA 3OEYA 4I14A 3DFIA 3SS8A 4WLEA 1M34B 5EZYB 2JFPA 5KS2A 2WABA 2FMXA 1QHHB 1DX6A 3CUKA 3Q8XB 1DCMA 2ZWOA 3N05A 4RIGA 3SIXA 4ZT7A 4J3FA 1U81A 3TIGA 3H11B 3HJHA 3NM4A 1R6XA 1TK9A 1T0IA 2JIQA 3JVDA 1QRAA 3DVQX 1G5HA 2D0PB 3I3SR 4OQNA 1FFBA 2OPHA 1UADA 1GPKA 4EG6A 4N47A 4MCJA 2NSYA 4DMFA 1B8OA 1JR3D 1AZWA 2OZKA 4YPVA 2N1MA 1VC2A 1ACJA 4HQ6A 1AKMA 1O0CA 5SZIA 1ULSA 5K8CA 1LNQA 4EHLA 4JA0A 1VLHA 5ERGB 2HLDA 4ZT6A 2ORYA 2ENUA 2G6BA 5EP2A 3GJ0A 2ZYRA 2Q5JA 5JNTA 3DP7A 1M0WA 1N2BA 1ZMTA 1A95A 1PL8A 4P34A 3D8NA 3SKXA 5CM9C 1U8TA 2YQ5A 1ZW1A 2NYUA 2WUDA 3I9V1 4IH4A 2YN4A 3TZQA 3VM6A 4DDKA 1OJLA 2AA3A 3THXB 1UT6A 3NRJA 1ID8A 4Y7DA 2YNMC 1Z6QA 3L8DA 5JXIA 4OAOA 1UPBA 1GL7A 3ENKA 5GADl 3WGLA 1E64A 4IAOA 2GDZA 1XK6A 2O8CA 4HH1A 5IYZF 2YS7A 1EG2A 1C4XA 2A8YA 5LLDA 2IOHA 4B7UA 4D26A 1H5NA 4X1IB 3IV7A 2ZIZA 4Z4IA 4KL8S 2NT3A 3DZDA 2JHGA 3ZHUA 2H2HA 4HWRA 4X92A 3OOYA 1EHCA 2CMHA 1ESMA 5TQ2B 1N2CA 2NUPB 2GM9A 1IBMB 5KHLB 3I9NA 3I52A 1TYDE 1W29A 2Q07A 2XOKA 4PLGA 4DFDA 4KYVA 1ZI8A 1BCSB 1WJGA 2B4KA 2CVFA 3E0QA 5B1EA 1RAHA 4EGFA 1LDMA 3MJEA 4KLNA 1M1NA 2BGRA 2VSXA 2Y3IA 3IQGX 4NX2A 2K2QB 2OQRA 3P2YA 4DHWA 4YAGA 3FPFA 3JVVA 1VLVA 4FYXA 1DEHA 2VWHA 5K0ZA 1U7TA 2F8LA 3NHBA 1VL1A 3F5SA 1HORA 3GAFA 3H1EA 4IOLA 1IN4A 4GRIA 4GVLA 4LN1A 4OGGA 1AHIA 1SQSA 2REXB 4R3NA 2ZTSA 1ZSYA 4WNCA 5AR1A 1DG3A 2OFWA 3KZMA 4YAOA 3AVXA 3T38A 1Y0BA 3FUTA 4RD4A 4UARA 4EPRA 3GA0A 2Z56A 3DBLB 1M2NA 1W5BA 1CDZA 2CMGA 2EDCA 2IEZA 3LVFO 4HI0E 4I1SA 5JSYA 3BD9A 2UU9B 3KQTA 4CLHA 4MKHA 3EVBA 4MV0A 4OHXA 1YJ5A 3IIJA 4IRXA 2IYQA 4EELA 1F12A 1NVFA 4ZYLA 1DOAA 4MV5A 4PZAA 5ALDA 1WTAA 2VDOB 3E5MA 3IMFA 4D9FA 4NZZA 1GNPA 3N6RA 5CA1F 3MSXA 4MS3A 1KJNA 1NJ5A 1QVVA 2IUEA 5DRYA 4TL7A 2PUAA 1HWYA 4LDRA 3AVVA 2W71A 2C94A 3IAUA 1MB3A 2ZS8A 5T4EA 3SBXA 1KMMA 4FFBB 4K88A 5AI9A 3Q9UA 1GCGA 1DADA 4B7XA 4OK3A 2CD7A 4I1RA 2O0MA 1P3Y1 2H51A 2GR9A 3RV4A 1B8UA 4WDRA 1EFUA 2MJLA 5KNDD 5IAOA 3OH8A 2P4UA 3LWZA 2UZIR 4J1TC 1PVVA 3CH7A 5DTEA 3BG5A 1PS0A 4WW0A 4XM2A 1Z38A 3N75A 2ZJ6A 5KTMA 1L5QA 4Y1RA 1VE9A 3I23A 2RE8A 3BB3A 1O77A 2CMFA 1JX6A 3K9NA 1F06A 1QXSA 3QX7A 2I3ZA 2F7SA 2YHIB 2X1LA 4PU0A 3L8HA 3N7UA 4N6OA 1B43A 3CISA 3L4BA 5H83A 4G67A 3A3YA 1J99A 3IDQA 3HM9A 1T0PA 2X8LA 3H4IA 4FCVA 3PQ8A 3V2IA 3WZLA 2IF0A 4BZQA 3G0HA 2XKAA 3VR5D 1EWRA 1F6WA 1KH1A 2OKGA 4IGKA 5EWLA 2PUWA 3CVYA 4KHZA 4G1VA 3E3NA 3I53A 2PAFA 1CQZA 3KKPA 4HYTA 4S1NA 4R01A 3LQYA 2BGTA 2CLFB 3I61A 4GPD1 4K9DA 5HDBB 1G6OA 4AXXA 1CUHA 1KJWA 3EGXA 1JN0A 2WTUA 5JJKA 2Z8XA 2EGHA 1Q7BA 2DQSA 4HGOA 2R62A 2A0XA 5JPIA 4OXRA 4ZEMA 4PRYA 4NZPA 1LBQA 3KJGA 4FYPA 3AF6A 4LNUB 4WXPA 2R25B 2EL7A 1U9ZA 1T2NA 2F59A 2QMUA 2V7VA 1XWFA 4UAJA 2PKRA 5FO1A 4CLRA 3TQTA 5EUMA 5I47A 1D8AA 2ZB7A 3ZDCA 2X2FA 3T3HA 4UHEA 3C5CA 3EQ9A 1KFEB 2Q0SA 3O0TA 4JVNA 1TPZA 3KJZA 4R0NA 5F73A 2ZUFA 4B3GA 3N8IA 5FFFA 5CIWA 3ONFA 4I36A 4O4JF 3LVRE 1ZCAA 4PE5B 4YJHB 4Q3LA 3M6LA 3THXA 1J1UA 4JD5A 4Q9JA 1JE0A 3TM5A 4UEOA 1Z6GA 4Y2VA 1XZDA 1S2OA 4BMPB 2GPAA 3TZ6A 2W43A 5CAEA 3HA2A 5CJ2A 4JXZA 1XRSB 4OH1A 1QF7A 5LZ7A 5AUNB 2WRZA 1Y5LA 3TX2A 1PL0A 3TTUA 5BVHB 3OTOB 2PLAA 3RRNA 3SCZA 5EIEA 1JBEA 3FTPA 3TTYA 1UANA 2EWWA 4CHTA 3O26A 1GUYA 1E9AA 2FPXA 2XOXA 2PSFA 1A3CA 5D87A 1T2VA 3RYHA 2EWVA 3TL6A 3VJLA 4MK4A 4MQLA 4H4EA 2ZT8A 3NOQA 4PO9A 3ILYA 1Y5RA 3ZYZA 3NWPA 1ES9A 4PLCA 4MXDA 2FFJA 3PDCA 2BEKA 3D4BA 4IGEA 4OYYA 3BK2A 2GS9A 4L3VA 2X4IA 5JD6A 4RTPA 2JZNA 1AV6A 1GTG1 3LU1A 2IIBA 2XR1A 4LRQA 4ZI5A 4ZV4A 3NPAA 2QWXA 3LYUA 2V3WA 1IBRA 4HPWA 1OH5A 1X7YA 4BO8A 4GZ5A 1K9VF 2JZOA 4YCBA 4QT0A 2LCIA 3H8VA 5B58C 1EVZA 1MFZA 4LUCA 3VA7A 1AQNA 4G8DA 3JYNA 4D4HA 3MJCA 3SC3A 5E8RA 1IHYA 3BTVA 3RIHA 4MS1B 4AAYA 4QDKA 1X87A 3N0WA 2FSGA 2DPHA 3JATB 4YPFA 3EEOA 4MRAA 2MYPA 3CRNA 2RAVA 2WT8A 2PAAA 4MWEA 5B2FA 2Q6KA 2QQGA 3K16A 4H17A 3RSQA 5ICGA 1SUFA 2HIMA 2RONA 2TECE 3PFFA 1CZLA 1IHUA 3VC1A 3OFKA 3ZHXA 1SC6A 4DA6A 3BL6A 3O3OB 1C1HA 3DMPA 1T91A 2W6QA 4KV7A 2MSEB 2PFGA 1NSYA 3PSHA 3VC3A 3DD1A 1IEWA 1X7GA 2BMAA 2BCGY 3UAGA 3WL4A 5LJLA 2O0KA 4D9MA 5JHHB 5HBGA 4XPZA 1XHLA 2HIGA 4UTPA 5ILGA 1UZMA 3K5HA 1H2YA 1BMFA 1NN3A 1UFQA 3II6X 5FBQB 3L84A 2C4KA 3G68A 4OB7A 4UZEA 2ZJAA 1NJ8A 3DLBA 1JHYA 2GPBA 1OLOA 4JA2A 2F9FA 4KFTA 4DXDA 2Z9BA 4DLSA 5JQWA 1ILWA 1XCJA 2Y1CA 3I0ZA 4LOAA 3QK7A 5LIRA 2QP4A 5B1SA 1OXVA 2CDAA 3R9WA 2CNDA 2WF5A 4JITA 3GRAA 4CR7A 4RSHA 1OIVA 5L7TA 4RULA 1XEWX 1LKZA 3OMLA 3SPXA 4CCAA 3MUFA 4RS3A 2FZWA 1W0KD 3UCXA 2FSUA 2J45A 1NPDA 2VJCA 3T7RA 5CFZA 3STYA 1GUBA 2AKAB 3V7WA 3EASA 4F3NA 4L51A 2N9UA 1TEZA 2E89A 3PCXA 4Q6WA 1W7AA 1ZMRA 1CJMA 4KGDA 4PYKA 1JB1A 1WUJS 5CDHA 4GRAA 4TV9F 3Q7SA 3IB6A 2QJOA 4KMMA 3ZW7A 4EI8A 1E2FA 3WLEA