3GRKA

Crystal structure of short chain dehydrogenase reductase sdr glucose-ribitol dehydrogenase from brucella melitensis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
254
structure length
248
Chain Sequence
GLLQGKRGLILGVANNRSIAWGIAKAAREAGAELAFTYQGDALKKRVEPLAEELGAFVAGHCDVADAASIDAVFETLEKKWGKLDFLVHAIGFSDKDELTGRYIDTSEANFTNTMLISVYSLTAVSRRAEKLMADGGSILTLTYYGAEKVMPNYNVMGVAKAALEASVKYLAVDLGPQNIRVNAISAGPIKTGDFRYILKWNEYNAPLRRTVTIDEVGDVGLYFLSDLSRSVTGEVHHADSGYHVIGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-(acyl-carrier-protein) reductase (NADH)
publication title Crystal structure of short chain dehydrogenase reductase SDR glucose-ribitol dehydrogenase from Brucella melitensis
rcsb
source organism Brucella melitensis
molecule tags Oxidoreductase
total genus 82
structure length 248
sequence length 254
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3grkA00
1P31A 2J5KA 5KCZA 1G0NA 2BMAA 3IP3A 1I8TA 1B8UA 3HB4X 3ZU5A 3DHYA 5I7FA 1BDMA 4MVJD 4P8RA 4ALKA 3DEYX 1DEHA 1LX6A 3GNQA 3VZSA 5C3MA 2AQKA 2JD2A 1HDXA 2AE1A 4QTZA 2QX7A 2BGLA 3WGQA 3DHEA 4G5HA 4A10A 2Z1MA 1XGKA 3L6DA 1KERA 3LT2A 3DZIA 1QV6A 1DIBA 4OJNA 3K31A 3QJ5A 2CFCA 4Z9YA 3UOGA 1KY4A 5K6AC 1K6IA 5T67A 3Q2IA 4GH5A 3L4BC 1UUFA 1FDTA 1OZAA 1Q7GA 5HWSA 3LC7O 3ZV6A 4CM9D 1RM5A 4CMKA 4YTEA 4WECA 2DM6A 4IDEA 3LT4A 1I3MA 1U7HA 3BMNA 1ONPA 3KEQA 3PWSA 4PVDA 3ONDA 4BKUA 2OZPA 1J49A 1LLCA 3GFGA 1JU9A 4LVUA 4WEQA 3JYNA 1H2HA 2DTDA 2H9IA 1UAYA 2UUOA 3WDSA 4S1VA 5KVSA 4Q39A 1Q7CA 2DBVO 3FHLA 5I9NA 3F4LA 4HFJA 3NYWA 3IL2A 2QZZA 1E3LA 3KO8A 4J4TA 4DRYA 1Q7BA 4CLRB 2RHRA 3KYDB 5B4TA 4QFDA 4WKGA 4J43A 3H65A 4DPLA 3ZHYA 1LDNA 4WPGA 4ZICA 1LRJA 2J3JA 3BZUA 1P33A 1HRDA 4MKRA 1CETA 4YCAA 4YPOA 4DLBA 2JCVA 3FBGA 4XQ9A 4XGIA 4R1TA 3CZRA 4XRGA 4FC6A 3EHEA 2CUKA 4RLSA 4UUPA 2FMUA 4CODB 4EJ0A 5COQA 3DMTA 3L07A 3W8DA 4M54A 2WSBA 2QZ9A 3BAZA 4LSMA 1NVTA 3EMKA 1JW9B 5DN9A 1IHXA 5TT1A 4R3WA 5JC1A 5JS6A 5CG1A 1S7CA 2VHWA 4GLLA 3ZWBA 1WMBA 4C4OA 4PLTA 2FR0A 5KKAA 3W4JA 3FNFA 4XYLA 1T2CA 4CMBA 5BQFA 4BNWA 4P4GA 3GNTA 2GZ2A 1LLQA 3AM3A 1DRWA 1Y1PA 5L7WA 1TT5B 1LDEA 1A4IA 3TFQA 3AWDA 3C24A 5L4LA 1G6KA 4P4LA 2YHIB 2P4QA 4JLWA 3I9MA 4HADA 4L75A 4AFNA 3JYQA 5IDWA 4FQ8A 1U4OA 1NR1A 1ISMA 3ZU4A 3GQVA 4J3FA 4MKXA 2ZKLA 4IJKA 2IZZA 2OOSA 3K9QO 1TXGA 4N5NA 3WMXA 1PGJA 4XZ3A 3SBOA 3KUXA 4WNIA 1BMDA 1Z74A 2Y0EA 5CAEA 3GG2A 3UXYA 2POQX 1ZIDA 4M8SA 4Y6SA 2PKQP 4EEXA 2AQHA 2B5WA 4J16A 1E3WA 3QHAA 5IXYA 1V3TA 4D7AA 4J2OA 4WJZA 4Q3BA 3WNQA 2A9FA 3WMWA 3K2EA 1JKIA 1B15A 3CSDA 4YRDA 4YWJA 3PJEA 3OJLA 2Y68A 4MVJP 4RPJA 1WDLA 4BV8A 1ISFA 2VHXA 4XIJA 2NU7A 5LC1A 3KHUA 4AJHA 4ZJUA 4A2CA 5ILOA 1E5LA 3QV1A 5AXAA 4OQYA 4PLGA 4YQYA 3SEFA 1CRWG 3GEDA 4KUGA 5HRUA 3AFNA 3ZV4A 4FFNA 2Q99A 1GYRA 1ZXBA 4JBGA 4ND2A 4W9NA 1ZSNA 1M6WA 1Y8RB 4DIFA 2CNBA 2Y1DA 3FPLA 4D42A 3BIOA 4YJFB 3WQQA 4BNTA 2VT3A 4NFSA 3OP4A 1L7DA 5TF4A 2AE2A 1DXYA 5DOZA 1K6XA 3NV9A 3JD0A 5JO9A 4PLWA 4IQ8A 1ISGA 1E6EA 4J9VA 1ENPA 2G0TA 1IPFA 1KYQA 2FSSA 3ASVA 1ZEMA 1MG5A 2Y66A 3HDJA 4G2NA 4ZQBA 5G4KB 3V5NA 1C0PA 4HX5A 3LF2A 4EUFA 3NJ4A 1HF3A 1P0FA 2P5YA 3NTRA 3E6AA 1FF9A 3QWHA 4MPDA 3UH1A 2FOIA 4GKVA 1I01A 3GN1A 4CLOB 5IZCC 3PJDA 2Y1FA 2V7PA 1QV7A 4PLPA 1FDUA 1DPGA 4E0BA 4BMNA 5A4DA 1YS4A 4DIBA 1Z75A 3DZFA 1T4DA 3COSA 4D44A 2HMVA 3PIDA 2X23A 4FSHA 4RCVA 3EUWA 2BKAA 3GVHA 2BGKA 2NVBA 2XF8A 3L9WA 2C2XA 2ZTLA 3TL2A 4BNFA 5IDQA 1TA4A 4CM1A 3FPCA 1U1IA 1BHSA 3F46A 5JDCC 3JD4A 3QVOA 4MJLA 5EIOA 3I23A 1DJNA 1GUFA 1EVJA 1HT0A 1N9GB 4O5OA 4RORA 1BW9B 1HDGO 1E7QA 1I33A 1AE1A 2HUNA 2OL4A 2Z5LA 4FFRA 3DMYA 3V2GA 4M89A 4PZDA 2JCYA 4FS3A 1EK6A 1K2WA 2IODA 5TSDA 1ID1A 2CF5A 3F5SA 1YGYA 1EE2A 4DLLA 5JMWA 5DF1A 1NM5A 4QECA 4EDFA 3G1TA 4MIYA 5TGDA 3TNLA 2BRUA 3L4BA 3DL2A 4PLZA 4YJDA 4JX8A 2JKVA 4GSKA 2E49A 2XOXA 4UULA 4OM8A 5BNTA 4HXYA 3RUFA 4PLHA 3OIGA 4I5FA 4U5QA 3HWRA 4QQRA 1VL8A 1WAMA 4FR5A 1JVBA 4BS9A 5KJ1A 3DBLA 4J49A 4R16A 3WGOA 2JAHA 1F17A 1ZMTA 1MV8A 2A35A 4Y6RA 3FR7A 5FYDA 5ENDA 4RDIA 2OUIA 3Q3CA 1Q2XA 4BNMA 1B26A 1DFIA 2E48A 2GN9A 3U0BA 7ADHA 4Q3DA 4JJIA 1PWXA 5CG2A 2FPGA 4BKRA 2A4KA 2RBEA 5G0TA 3RC2A 3DDNA 3GLQA 4XIYA 4XWYA 4CM8B 1D8AA 1MLDA 3JQBC 3R1IA 3DFZA 3R3SA 4Z0TA 2HLPA 3H3FA 1C0KA 4TRJA 5G4LA 2Q45A 2EXXA 1NX6A 3RBZA 1U2GA 3WBFA 4DREA 1I0ZA 4DMMA 1NFRA 1U3WA 1QSGA 1WZEA 2JFHA 2W8ZA 3ROPA 3WFJA 5IFLA 3W6ZA 2GNAA 4OOFA 3RU7A 4Q3AA 3O9ZA 3I1JA 2I67A 3A14A 4YB8A 5DP2A 3AOGA 3ZWAA 5GZ3A 1QORA 1DIGA 4DC0A 3ZZNA 2GYYA 4LMRA 2DVMA 3E03A 3VH1A 4BNVA 2JCXA 4AJIA 1DAOA 3WGIA 1ML3A 3DR3A 5DBIA 1W73A 2RH4A 3C3XA 1UXKA 5ER9A 3DWFA 4YAIA 3RUEA 2DFDA 1PGOA 5TQVA 3PZBA 2VNAA 3SLGA 3ZDFA 1SBYA 1R0KA 4NNJA 4HUJA 1OFGA 3GVIA 2HRZA 1QR6A 5EMHA 4CMCA 4H3VA 3D5TA 5EQFA 4BNZA 1Y6JA 4EI2A 3RUHA 2EG9A 3H2SA 3PIIA 3NTOA 5F5LA 3AW9A 3ETDA 4DQUA 3EVNA 4E33A 5JAQA 4GGOA 2VUSA 1DOHA 1CDOA 3FNEA 5JY1A 5JSFA 4UEOA 3PPIA 1R4NA 4ID9A 3MJVA 5JAZA 4B4OA 3H9EO 3O8QB 2ZATA 1E92A 4KDEA 1DRVA 4GSLA 4FJ1A 4CLRA 3KYDA 2GPTA 1Z82A 4HBGA 2FZEA 3CEAA 2G17A 4RZIA 5B4VA 1B7GO 1MC5A 4GPD1 1N7GA 5FI5A 3BYZA 1LJ8A 2D5CA 3PP8A 5CEJA 1CEQA 2O50A 4OL9A 4D43A 4ESOA 3I9LA 4M1QA 1XELA 3LT1A 5AOVA 1GYPA 4XRRA 2V65A 2A94A 1P1FA 4D45A 1P45A 4N7RA 3JQ6A 2PNFA 1T1SA 3WTBA 3SX2A 4BO6A 1DLJA 1GEGA 3W4KA 5L40A 4BNJA 3NT2A 3PK0A 2GDZA 3UCFA 2JAPA 2HCTA 4DUPA 1PS8A 3GEGA 3JYPA 4OMUA 1Y8QA 1SB9A 4ZU3A 3PI7A 1DB3A 3SC6A 1VL6A 3UGKA 1ISHA 1JKJA 4DPMA 3BHJA 2J5RA 4ND1A 5A03A 4PG6A 4Q3EA 3ZW8A 2YV1A 2DTXA 4MVJA 2PZKA 4GX0A 4UEKA 4ZGWA 4A0SA 3Q1LA 1SEVA 4L73A 1TT5A 2D59A 3CMMA 4F6CA 3IDSA 4CPDA 4BO3A 5ICSA 4A27A 3AFMA 1DHTA 1NPDA 1QKIA 1O9BA 3E18A 3DFUA 3QWIA 3IKTA 2X8LA 2D1YA 3AOEC 4GL4A 3VC7A 2IYOA 3IJRA 3RC9A 4CM9A 2EWMA 2WYWA 1C0IA 4U0JA 3U4HA 2EKQA 1XLTA 2BD0A 1RM4A 4DBVO 4EW6A 2X7HA 5IAAA 3ZNNA 1MA0A 1C14A 2GGSA 4TRMA 3AUUA 4CUZA 2WD7A 4TRRA 5DOVA 1E6WA 3H6KA 3HNPA 4KUHA 3A1NA 3MJSA 4K28A 1QP8A 3FNHA 4DYDA 3AM4A 2I5PO 1D4FA 3PQDA 1T4BA 1H94A 2J5QA 4D3FA 5DP1A 1X13A 2HQ1A 3PHLA 4GX5A 1ZEJA 3ZCXA 4CMEC 5CDGA 1LXCA 3ZU3A 2VZ8A 1FDVA 4RF3A 2YDXA 8LDHA 1LA2A 1VJ1A 3P2OA 3PTZA 3B1KA 2O3QA 4HNHA 2AG5A 1NWHA 4PLCA 5JE8A 3UCXA 1WWKA 3PDJA 4IZHA 2NU8A 3F3SA 1H6BA 2LDBA 4DLAA 5LCXA 1C3VA 2X86A 1BWSA 2B5VA 1NYTA 3JQAB 4J9UE 2VYND 4NJOA 1G0OA 3OF2A 4M87A 4YDRA 1ZCJA 1NBOA 4U7WA 1DIHA 1KC3A 3ZHXA 2Q49A 1KIFA 2FN7A 4XA8A 1IY8A 1LDBA 5EESA 3X2FA 4M86A 2FHSA 2DPHA 4QX6A 1T2EA 1GU7A 2YV3A 5I7EA 4YJFA 2FPIA 4IBOA 1YJQA 3S55A 3RJ5A 5A1TA 3ASUA 3S1LA 4NDNE 4WLEA 4BNXA 5DZSA 5C5IA 2Q3EA 4R1SA 2PV7A 3T4EA 2UYYA 3I6IA 3H3JA 1X1EA 1LRLA 4L74A 2C29D 4BO5A 2Q1UA 5GMOA 1V3UA 1ZO8A 5G4KA 2AG8A 3GVCA 3EDMA 4TWRA 3JQBA 4OXYA 1BXGB 5G0WA 5FWNA 1NXQA 3FSRA 4EUHA 1JLLA 2B0JA 4U6SA 4TKLA 1H0KA 3ANMA 3PQEA 2NU9A 3LF1A 2Y05A 1A71A 2EGHA 4CQMA 4EITA 3IAHA 2VUUA 1JN0A 3TPCA 5JLAA 3ABIA 4R54A 4CV0A 4TMFA 1O8CA 1HZZA 4NBTA 1UXHA 4N54A 4GAEA 4HWKA 6LDHA 5LDGA 2C07A 2X6TA 1Q0HA 1HSOA 1XU9A 1HE3A 2C0CA 2O23A 3DB2A 1I36A 1ZXLA 5COAA 4QO8A 3M6IA 4IMPA 4FDAA 2HK7A 3VPHA 1EK5A 3E48A 4BB5A 1HLDA 2PKQO 4QT0A 4XQEA 4CL3A 4C7KA 1YO6A 1JKFA 5AQ1A 1R0SA 1P1JA 4IQGA 4EUEA 2P9EA 3Q2KA 2D8AA 3KB6A 3GH3A 4Y67A 1LQUA 1EVIA 1GUYA 1N8KA 5AXDA 4F46A 3G1UA 2X22A 4ZQGA 4UUNA 5JY6A 3I6QA 3VDRA 2Y1GA 2HMWA 3KSDO 3GDFA 1PJ3A 1V9LA 3BTUA 1LSOA 3AUAA 1HWYA 3VH3A 4YR9A 3V1YA 4KTTE 2FPPA 4BL5A 4CM6A 5FFFA 2VCYA 5IG2A 1HDZA 1SMKA 3ZHBA 5K0ZA 3PDUA 3R6DA 3JYOA 4EJMA 2WD8A 4BNNA 1X15A 3GAFA 1M67A 4XYEA 3P19A 2HDHA 1HSZA 4J2HA 1XU7A 2C5AA 2EJVA 2QRKA 3AK4A 3DAPA 5A5EA 3GAZA 2W98A 3WJ7A 4JXKA 1SB8A 2CSUA 3WYEA 1TEHA 2WJPA 1MB4A 4YRAA 1E5QA 2X4GA 4B3HA 3TZKA 3PFFA 5KOIA 2VHVA 3RKUA 5U4QA 3UKOA 5TIIA 3VZPA 2NLOA 4CV1A 4CM8A 1H9AA 5FI3A 1A27A 4RGBA 1Z7EA 4BGEA 3H5RA 1LUAA 5B1YA 4R51A 1P1HA 2HU2A 4J7XA 4JBHA 4E5PA 2WE7A 4FJ2A 3SLKA 1LRKA 2G5CA 3FF4A 5HS6A 3GUCA 4IIUA 3NX4A 2DT5A 1MG0A 2GN4A 3LQFA 4FFOA 4RVUA 5KVQA 4RQTA 1VM6A 2VYVD 2DU8A 1HE5A 2Q2QA 3FCOA 1FJHA 4YEDA 4YAEA 2ZB4A 2HSDA 4NIMA 3WXBA 1XDWA 3OJOA 3GF4A 4IIVA 3EYWA 4MINA 1SC6A 4XKJA 3HUDA 3MZ0A 2GO1A 4U0KA 3S8MA 2VRBA 4BB6A 3GGGA 2I9PA 3W6UA 1O89A 3GEMA 1WLYA 4MP6A 4YAKA 4XJTA 4E3ZA 3DZJA 4BVAA 2DLDA 1EBFA 2GN6A 1P1IA 4YJGA 4E5KA 1T2FA 1XSEA 3GZNA 2ZJ1A 1B8VA 3UUWA 3FWZA 2O2SA 2UAGA 4ILKA 5DCYA 5A3VA 1N1EA 5CPFA 1ZZEA 4BHTA 1PJQA 3DZBA 3TZQA 2YFHA 5CPBA 2I6TA 1HE4A 1P0CA 3RVDA 1DRUA 4JNKA 4Y6PA 1PQPA 1X1TA 2D0IA 2NV6A 1R15A 3JQFC 4BQPA 1MFPA 1WDKA 5ICMA 2YJZA 5G0VA 3RWBA 1K0UA 3WQRA 4A5OA 4BO2A 4JIGA 4OKIA 4XYMA 3I5MA 3RIHA 4E6PA 4DXHA 1IZ0A 3RUIA 1LDGA 4CQLB 4E13A 1ULSA 1GZ3A 3MTGA 1A72A 3F4BA 4H7PA 2GERA 4H15A 2J6IA 2JFFA 2X9GA 1YOVB 1M76A 4Y8VA 3JD2A 2NACA 4Z9FA 4HY3A 2RH8A 4PVCA 5F3RA 4CMEA 1YDWA 4FGSA 5TC4A 1U8FO 4MVJH 1KOLA 4J1QA 1U3VA 2J3IA 4DBZA 4BOYA 3CKYA 1ZBQA 4MVJM 3ITDA 1PQUA 1A4UA 3LLVA 1GCUA 1GV0A 5HM8A 4BMVA 2D3TA 3ANNA 3D3WA 3WGZA 3U4IA 4CMIB 3D7LA 4NFYA 1R66A 5IJZA 3OQ6A 3DQPA 1R37A 2ZYDA 5CDTA 4RLHA 4D46A 1YL5A 1R12A 3JD3A 4K9DA 1EFLA 4TVBA 3G79A 1J6UA 4CV2A 4MP8A 2RHCA 1W8DA 3U49A 4OH1A 3OHSX 4XGNA 3TZ6A 3KEOA 5IF3A 3INGA 4N5LA 1YQDA 4FCCA 2O3JA 1LTHR 1U7TA 3IMFA 3BTVA 2EGGA 2ET6A 3MJTA 4CLEA 3ETEA 1O5IA 3ICPA 3ON5A 1LLUA 3GA0A 5DULA 4GVLA 4E2ZA 4BO8A 2R00C 4NU6A 4UUOA 1UXIA 3IQDB 1TB4A 2PD6A 5JCXA 1NASA 2BH9A 3E82A 2WMDA 3GRPA 3RUDA 1QYXA 1UZLA 4KOAA 1OMOA 4E5NA 4A03A 1ZK0A 1E3EA 4E5YA 1ZKMA 1LDYA 3QWAA 2BHLA 1L1FA 4E12A 3A28A 4IDGA 5JAIA 4CLDA 2GUGA 2OGUA 4Q3CA 4LK3A 2WDZA 4TROA 5AXBA 5A06A 4F6LA 1DFHA 1PWZA 2LDXA 4WASA 1M2WA 5KJ6A 1FDSA 2X5KO 4QFCA 3MTJA 5IZ4A 4DA9A 2JL1A 2Q2VA 4XD2A 1P44A 3KLPX 4LN1A 1YONA 5AVOA 2IXAA 3ZWNA 5KVVA 4WLVA 1E1MA 3B1JA 1YE3A 4XYBA 4UUMA 4CM4B 3V8BA 3INTA 3KYCA 2UV8A 4RV9A 4GI2A 4RPHA 3BHIA 3LSYA 2ZTVA 4R01A 3TSCA 1KEPA 2JFGA 6ADHA 2DBQA 1JVSA 1KS9A 1UZMA 1VKNA 1B0AA 4JROA 1GV1A 4WOJA 1KBZA 3L0DA 5JYDA 5DDIP 3DBHB 1I10A 1GZ6A 3NJ8A 3QP9A 1KETA 1YKFA 4R68A 3BMQB 4W7HA 3CIFA 3KOUA 4NMHA 5A9SA 1V35A 2Q46A 2BGMA 4UVEA 3TF5A 3TZHA 4HKTA 2CVZA 1MUUA 3HADA 4P4NA 4RZHA 4BNKA 2X5JO 3V2UA 1KVRA 2OP0A 1WW8A 1U3UA 1BSVA 2I66A 2I3GA 3PLNA 2Q50A 4O6VA 4YT2A 3DXFA 4WLOA 1E7RA 3W8FA 5JCJA 3W4IA 2HO5A 4LVCA 1NFQA 3IOYA 3HG7A 4E2WA 2QHXA 3R3JA 3VH4A 1J4AA 3GT0A 4ZRNA 1HKUA 2VN8A 3E5MA 3DO5A 4QEDA 1E77A 1QYWA 1P3DA 2ZQZA 4DVJA 4E32A 1LI4A 1Q0QA 2PTGA 2XXBA 3CE6A 1K89A 3H7AA 4CUJA 4AJ2A 4DQXA 5C37A 4LCEA 5K6AA 4J1SA 5JC8A 2NWQA 4AJOA 3F1KA 4BGUA 1Z6ZA 1ADGA 4JQCA 4NPCA 4YJHB 2X0RA 3ZWPA 1U9JA 1B16A 1VKOA 3TRIA 4ND3A 4B8WA 1ARZA 2F00A 3D3EA 3KYBA 4OKNA 5IN4A 3A4VA 1PTJA 3PRJA 1H5QA 2OXIA 2JJYA 1IYZA 5A02A 4Z0PA 5A5FA 4GX2A 4DTIA 4BQRA 3EY4A 4KP7A 3Q11A 4UAGA 1CWUA 4AG3A 1HZJA 2W2LD 1J5PA 3DONA 4J91A 3ZH2A 3U4CA 2C82A 2V6BA 4E31A 2QW8A 1CF2O 3KV3O 2Y1EA 1HDYA 4INAA 1V6AA 1GADO 1LC3A 3BTOA 4NR0A 4CM3A 5KWEA 5JYEA 1SCUA 3NDIA 1IULA 1NQ5A 3WIDA 4FGWA 4E2YA 1M6HA 4PG5A 3SJ7A 1CYDA 4K6CA 5TNXA 5T57A 4L76A 5CP8A 2CZCA 3QSGA 4EGFA 3MWEB 5DNAA 4ZVVA 1HDOA 3KTDA 1KVUA 4KDFA 4PRKA 3JQCA 2NVWA 4FN4A 3FR8A 4I1IA 2PKRA 4D79A 3F1LA 1UDCA 2RCYA 1MP0A 1VJ0A 1VJTA 3NDRA 5KTKA 3VH2A 3X2EA 3HDHA 1PJ4A 1E6UA 3GDOA 3ZV3A 4CLXA 3VZRA 1SAYA 2O4UX 4HFNA 3RD5A 4NJMA 5JXWA 3TFOA 2DUWA 1QMGA 3BMNB 3FRJA 1ONNA 2HMTA 3L4SO 4BKQA 2VYNA 2EF1A 1QRRA 2CDCA 3QW2A 1PGPA 3OH8A 1WP4A 4WCFB 1X7DA 1NNUA 2B4RO 3P2YA 3C7AA 4FIZA 4J4BA 4AVYA 1E7MA 3DZHA 1QYVA 4Z0HO 4OQZA 2NTNA 3PHHA 3VZQA 2PFGA 3OICA 5C7OO 4PG4A 2O4CA 2NSDA 2VZ9A 4BMSA 2I99A 1B8PA 2FY8A 3DOJA 5IXSA 1D1SA 1PJBA 3WGYA 1IE3A 1XR3A 4CMHA 2GCGA 3A06A 4J0FA 5GZ6A 1JWBB 2ZTUA 4K6FA 3K96A 5DBGA 4E2XA 3F6YA 3OMLA 4E5MA 3R0IA 4XJSA 5H81A 5IN5A 1DLIA 1NPTO 4XDZA 5T8KC 3DBVO 3H9UA 3INRA 3ADOA 4IGEA 3PHGA 3I9NA 4BO0A 1Z45A 1GQQA 4YA6A 4JGBA 3SXPA 3WR5A 4TRNA 1F8FA 2WYVA 5L7TA 5DT9A 3N58A 3LDHA 2FP4A 4WGGA 3E8XA 3NT5A 4IQ0A 4IMRA 1JTVA 4BKOA 2ZK7A 4L0QA 1SNYA 1XHLA 2GR9A 4O0LA 4HNGA 4GLOA 3IKVA 3UAGA 3NUGA 4Y98A 2FSVA 4A26A 4B3JA 4IGFA 1I30A 2JHFA 3GNSA 3PXXA 4R4JA 2R00A 4DGSA 4WUVA 3HSKA 1EUZA 3JQAD 2CY0A 4DYVA 4FPXA 2B4QA 1ZH8A 4IDCA 4CMJA 2O3TA 2C5EA 2OO5A 1B3RA 4OGWA 2AXQA 2WEKA 4MOWA 4ONEA 5FEUA 3BXXA 1YQXA 1LDMA 3NTQA 1YH3A 1OI7A 2JD0A 4GMFA 4O63O 4N18A 1PGQA 5JAMA 1DIRA 4I5DA 3WGHA 4I5GA 3GRKA 1XEAA 1RYEA 3H9QA 3IP1A 1UH5A 5A04A 1LSSA 2XXJA 5G0UA 2EEZA 4JBIA 1WDMA 4JK3A 2D5AA 1LC0A 3CPSA 4WCFC 5AYVA 3L9XA 5L3ZA 4OSOA 4CQLA 3OIFA 3RUAA 3FTNA 1I2CA 2PGJA 4IINA 3OJFA 5IZCA 1N2SA 1R16A 3E9MA 1YOVA 1JQBA 2YHIA 3WYCA 1UDAA 3HN7A 3JCZA 4BIIA 3H5NA 4A7PA 4EEZA 2NQTA 3PJGA 3H5AA 3I9JA 1KEVA 2IXBA 1HYGA 1YL6A 1ZUD1 2BFPA 1C1XB 4I8XA 1GL3A 3O26A 2TMDA 4IDFA 2VOJA 4YACA 4TSKA 5G0SA 4A73A 3VOSA 3VTFA 4DIOA 1U5AA 4AJEA 3L6OO 5C7LO 3JQ9C 3JQ8B 4IDDA 4NBRA 4RVGA 1ISJA 3QLJA 5HA5A 3E1KA 4CMIA 5JDCA 1O6ZA 5ADHA 3GOHA 3HJAA 1FDWA 5ES3A 4LW8A 4ZHSA 3MWDB 1PS9A 3ORFA 5JNLA 1DC3A 3LT0A 3LYLA 3GK3A 4ZD6A 4B4WA 5A9RA 1U5CA 2E4AA 3A9WA 1EEHA 4UVIA 2VYVA 2YZ7A 1UXGA 3CXRA 3IIEA 4IXTA 5EJ2A 1X14A 5T6BA 4WLUA 3KXDA 4B7XA 1TT7A 1TLTA 1C1DB 4OHUA 3GZ4A 4BNGA 1PJSA 4OOEA 3D64A 1KVQA 3EZYA 3UVEA 1DIAA 1QG6A 2VTDA 3GMSA 2NTVA 3U9LA 4RPGA 1ZSVA 1EQUA 4GQAA 3K92A 1KVTA 1ENYA 1U3TA 1N1GA 4K1LA 4ZQHA 3N74A 2EW2A 2PY6A 4F45A 3HB5X 4P38A 4R3NA 1X0VA 3UHAA 2OBNA 4J7CA 5I9LA 1PJ2A 1Y8RA 3QQPA 5A05A 2GN8A 2ZYGA 4OSPA 3ROQA 4DPKA 4GX1A 4W99A 2SCUA 1A7AA 3LVFO 5L4NA 2ZCUA 4CM7A 4KUEA 3AM5A 1T26A 3ZN2A 3EK2A 1PL8A 5F1OA 4W4TA 1PZGA 1AXEA 1F06A 2EP5A 3KZVA 1JAYA 4QO7A 3ZWVA 4I9HA 5EN4A 5EL0A 5L4SA 3U5TA 1RYDA 4JP2A 5T5QA 2NM0A 2VWPA 4RPKA 1YRLA 4QUKA 1GTMA 1Y81A 2VTEA 3ZWWA 3QWFA 1UZNA 4YT5A 2VRCD 4NG5A 5KJFA 1EDOA 5CDSA 2O48X 3RAJA 4WEOA 3UF0A 1NR7A 4CLOA 1UR5A 1ZJYA 2BLLA 3PWZA 4NK5A 4Z3DA 4DWVA 2IYPA 1A9YA 1EFKA 1VI2A 3DBHA 4PIVA 1GUZA 4IXWA 3NKLA 1Y9AA 4B7UA 5L95A 1DHRA 1E1LA 3DAFA 4BGVA 2AW5A 3C1OA 3H4VA 3I83A 2EKPA 4RF5A 3DTYA 3KM0A 5LDHA 5KNLA 4PFJA 3Q6IA 2DPGA 2WTBA 3RC7A 3PEFA 3QY9A 3AI2A 2C2YA 1D1TA 1EE9A 2CD9A 3F5QA 1FXSA 1T2DA 2EV9A 3K30A 4TKMA 3O4RA 4IDBA 3CH6A 4LCJA 5JDIC 1KY5A 3HQ4O 1T1RA 3K5PA 1N9GA 1ZK1A 3S2EA 1BW9A 2AMFA 4EZBA 2PGLA 2TMGA 3PHJA 5B4UA 1P74A 3IUSA 4R5MA 3TQHA 3AI3A 5BT9A 1E1NA 1G1AA 1ONOA 3OBBA 3OA2A 3Q0EA 3OQBA 3ANLA 4WLFA 1D3AA 3GN2A 4HFMA 1NVMB 3DBRB 1M66A 4IM7A 4MVJI 2OFPA 4NQZA 1Q1NA 1Y5MA 1L7EA 5I8WA 2AEJA 3RSHA 2IZ0A 4CR7A 1ZK2A 2W90A 1DSSG 5F21A 3DAGA 3ICCA 3WG9A 1GYQA 2PGDA 1JAXA 2OBYA 1I3LA 4FC7A 3TZCA 3BTSA 5TRTA 5T8KA 2VOEA 3U3XA 3WYBA 1GCOA 3U09A 3G17A 3QA9A 3EGOA 4RVFA 2Q4BA 1A7KA 2ZYAA 3DZKA 3ZNOA 1MXHA 4YYZA 3L77A 3MEQA 1AUPA 1YWGO 2ZJ0A 1H6CA 1VPDA 1Y5RA 4J1NA 2DFVA 1NTOA 3L6EA 2AA3A 4GGPA 4AJ1A 5B12A 3AUSA 3E5RA 4I9UA 1ISIA 2W2KB 3PYXA 4ROSA 4JP3A 4RDHA 3WIEA 2IEBA 2VNSA 3ZI0A 1I2ZA 4PLFA 2CF6A 4MIOA 2YUTA 1ZK3A 2QG4A 4MVJG 1R6DA 3RKRA 1DC4A 1H2BA 1U2DA 3I3OA 3MJEA 4ALNA 2P68A 1LBEA 5CDYA 4R41A 1U28A 1BVUA 2V6GA 3ETGA 3SC4A 3VDQA 2X0NA 5CEEA 2IZ1A 2OORA 1T2AA 2BFOA 2FR8A 2QQ5A 4CM5A 2Y67A 1WNTA 2Y1CA 1LLDA 4II3A 2X9NA 2A92A 2B83A 4R1NA 2QYTA 3F9IA 3WWYA 1ZFNA 4Q9NA 3DHNA 4CMGA 1VSVA 1YDEA 3D4NA 1F14A 3QRWA 4UVDA 3ZWMA 2H1SA 3OJEA 5F5NA 1ENOA 1ADCA 3HZZA 1ADBA 3FD8A 4WCFA 1GQ2A 3AY6A 1I3KA 3GMDA 1R4NB 3OFSA 3ZNQA 1LQTA 1LNQA 2XPCA 1R0LA 1GDHA 3VPGA 2ZQYA 4ITUA 3TN7A 4RJTA 5CFZA 3BMOB 3C7CB 3BHMA 3V1UA 1ZVMA 3GPIA 5GZ1A 2CDAA 3OETA 3RFTA 3S2GA 1Q0LA 3AOEA 1BDBA 2H6EA 4R69A 3NGXA 3M2TA 1EQ2A 3RCBA 4UVHA 1XKQA 2PWZA 1OC4A 3DC2A 5BNFA 3BMCB 3C8MA 3JQ9A 4I9NA 3ZU2A 4ALMA 3LK7A 3TJRA 5MGBA 1OC2A 3RQSA 1H9BA 1VSUA 2HAEA 3FBTA 1RJWA 2C7VA 3VVCA 5U1PA 4BUCA 4R9SA 1OAAA 4NBVA 3AJRA 1YXMA 1NQTA 4KZPA 2VHYA 1XG5A 5F1PA 4FJ0A 4B7CA 1AN9A 2W2LA 1CERA 1BXZA 4FD3A 3S2FA 2YW9A 3PZRA 3MOIA 4L4XA 1IZ9A 4G81A 3GPDG 1Y8QB 1MFZA 1S6YA 4J1TA 3QVSA 1DFGA 4L4SA 1NAHA 4W7IA 4J0EA 4Z6KA 3SVTA 2XAAA 3KSZO 3D4OA 2RIRA 2ILTA 3O8QA 3WLEA 1N7HA 3JTMA 3RASA 3AY3A 1V0JA 4R5HA 9LDTA 2FZWA 5HS4A 4BNHA 5I8ZA 4XQCA 1PZFA 2GRAA 4M49A 4D3DA 4PZCA 1IHYA 2X58A 4FFMA 1B2LA 2V6MA 4DC1A 1O94A 3OM9A 1CJCA 4YAJA 2G1UA 1DO8A 2WWRA 3HDQA 4JCOA 3ZV5A 2Y1OA 4AJKA 1M75A 3BA1A 1GY8A 1RWBA 1PJCA 3UN1A 3ENNA 4CQMD 2ZCVA 3T7EA 4FFPA 4JJGA 1ZNQO 5A3JA 4FFLA 3NGLA 3QVXA 2PD3A 2E37A 3JQGB 3WGGA 1T24A 2WD7B 4MIEA 3H2ZA 3JQ7B 4YXFA 3GHHA 5H82A 2Q4EA 2V6FA 4FBGA 3GG9A 4GBJA 5TJHA 5JMPA 2DBZA 2CVQA 4DQVA 3H8VA 4ZA2A 5HBRA 4PN3A 4NBUA 1PIWA 1HXHA 1SOVA 4KWHA 4CUKA 2EJWA 2B37A 3ZWCA 2WE8A 4YBZA 2O2YA 3CTMA 8ADHA 4OXNA 1N5DA 2YFQA 1P1KA 2G76A 2HK9A 3AY7A 3MCVA 1NP3A 4PGFA 1KEWA 4QXMA 1C1XA 1HDRA 4B79A 3W8EA 1ULUA 3RU9A 1UDBA 3LLSA 3B70A 3B6ZA 4ZQEA 4EJ6A 3LU1A 1O0SA 3TOZA 3ENKA 2PK3A 3UICA 2AEFA 3GFBA 3I4CA 3JQ8A 5IDXA 4Q3NA 1GFSA 3EZLA 2DKNA 2IEDA 2CVOA 1I24A 2W4QA 1LSUA 3VVBA 4HFRA 1YBMA 4BNYA 4EYEA 4TVOA 3ZGYA 5THQA 3WB9A 3ZHZA 5JDIA 4YT4A 2GZ3A 3T4XA 3VPSA 3AUTA 5JFOA 4XYGA 4UREA 2Z95A 4WLNA 1H6DA 2UUPA 3S2IA 3JYLA 2BF7A 2O7QA 1PR3A 4JJFA 3K6JA 2AQ8A 1K6JA 1XYGA 1WZIA 3WNVA 1HE2A 1I32A 4NBWA 1UP7A 4N5MA 4GMGA 1QLJA 1YQGA 1C1DA 1YB1A 5A9TA 2Z1NA 1DDOA 4AJLA 5K9ZA 1E7SA 1F12A 2HMSA 1C0LA 2NQ8A 1KC1A 3MOGA 7MDHA 3DZGA 1YL7A 2YQ5A 3WWZA 1H6AA 3JQAA 1OBFO 1SPXA 3RBXA 3VPFA 5BSHA 4GKBA 4LGVA 1T25A 4CQMB 3UW3A 5L7YA 3PFWO 4PRLA 4GWKA 4KMSA 3M1LA 3WS7A 2NVUB 4MVJE 4YRBA 2X1HA 1XIVA 1EVZA 1D7OA 2O3UA 4PZEA 4O1MA 4UVGA 1MXFA 5AXCA 1SZJG 3CINA 4XR4A 1UAGA 3STHA 2B4TO 1DC5A 1KVSA 1VE9A 4AJNA 1ZW1A 1Z73A 3OQ1A 2NNLD 4BNLA 1YBVA 3LZ6A 1R4MB 2JHGA 2WYUA 2BELA 3HFSA 3JSAA 4ND5A 4XX0A 5H83A 2AHRA 3FTPA 3MJ4A 3D1LA 2D4AA 4NK4A 4OO3A 3RUCA 4TZKA 1BXKA 2QRJA 3PQFA 1EUDA 2FR1A 1EMDA 3G0OA 5GY7A 2H5LA 3HN2A 4D0RA 5TT0A 3EW7A 3KLMX 2PD4A 2ZB7A 4IS3A 2DBRA 4R9RA 3T7CA 2BFAA 3WGTA 1BXGA 3IJPA 1KEUA 2I3AA 3GHYA 5L53A 3ADPA 4B3IA 1PL7A 1RM0A 1NHGA 1LEHA 3TOXA 1MGOA 5ILGA 4I08A 4XB1A 4AJPA 4BO4A 1EBUA 4XR9A 1AXGA 1NPYA 3NAQA 4ZQFA 3IS3A 1GD1O 1I3NA 3E9QA 1EVYA 2FWMX 4CV3A 2P9CA 4XCVA 2J8ZA 1P1RA 1P77A 1QXSA 3PGJA 5JO0A 4MO2A 4IJVA 1VRWA 3NT4A 1X0XA 3QE3A 4NZ9A 1JWAB 1Y9EA 2DQ4A 2E6UX 2X0IA 3JD1A 1EUCA 4RF2A 4ZRMA 2X0JA 1A9ZA 1IOLA 5TS3A 1E7YA 1GPJA 4ZN6A 3D4PA 3FI9A 1YBAA 2ZB8A 4RPLA 2HJRA 2X9VA 4E4YA 3UFXA 3AU8A 1CQJA 1GPDG 1HTBA 1E3JA 2YYYA 3K2BA 4LSWA 3QVTA 4IUYA 1F8GA 5ITWA 3K8ZA 2J3HA 4D3SA 3WTCA 2Q1SA 3DBRA 5G2OA 3TL3A 3JQFA 1QYCA 3OIDA 1W0CA 4PLVA 1XWFA 2D2IA 3OEYA 2X5OA 1B3BA 3PWKA 2VWQA 3DTTA 4FOSA 2YQ4A 3OSUA 4C7JA 4W82A 5JW6A 1B14A 4DL9A 5L45A 2Q1TA 1IPEA 4W6ZA 2GSDA 4BNUA 3UCEA 4P22A 3ROKA 5MDHA 2R2GA 3ONFA 4E21A 1NAIA 1E7WA 2W2KA 4MVJF 3Q9NA 5EQDA 3GVXA 3HE3A 3PGXA 2P9GA 2IE0A 5TJ9A 1U4SA 4YJGB 4IS2A 3ROMA 3GZNB 1GZ4A 2E82A 3KSUA 5CHEA 3RFVA 4BGIA 4KTVE 1SEPA 5DBFA 2QRLA 2GZ1A 2HJSA 2Q1WA 2VRCA 2O7SA 5TX7A 3G3EA 3RC1A 1SO8A 3TDKA 4L9RA 3GUYA 1BRMA 4IPTA 3B20A 4O59O 4DMLA 1FK8A 1I5RA 2ZB3A 4L8VA 3NEPX 1PGNA 3QIVA 4FOOA 2YY7A 2IDZA 3FNGA 3HFGA 4GWGA 4URFA 2EERA 4AL4A 1BG6A 2CDBA 5BR7A 3NRCA 4LRSB 5KVCA 3I9OA 4PG8A 2BFMA 3JQEA 1QLHA 4RQUA 3WQSB 4YAGA 3HHPA 4S3MA 5KKCA 3M2PA 2Y0DA 3PLRA 1AGNA 4TQGA 2VZ0A 3CUKA 5EERA 1UP4A 2VUTA 2C54A 3E9NA 4LISA 1WMAA 4E30A 2BI8A 2NUAA 1PS0A 2NADA 1IB6A 2DUUA 3OJ0A 2VWHA 5ITVA 3WSWA 4JN6B 2YHUA 4CL8A 2HK8A 2J3KA 2VHZA 1VL0A 3BMOA 2PH3A 3N7UA 4IY1A 3D3WB 4H16A 4CMAA 1YJ8A 3ITKA 1ZK4A 3B1FA 4J90A 1CIVA 3ZWYA 1IUKA 3ZWOA 4WOKA 1LSJA 2PZMA 2B35A 3G49A 3ZW9A 3VTZA 5DCWA 1W6UA 3BMCA 5JBIA 2P91A 1K3TA 1E3WB 1HEUA 1K5HA 3U4DA 1MC4A 2B36A 4HV4A 4PG7A 3NDJA 2C20A 4NU5A 5JCJD 4BKPA 1DAPA 3I9KA 3LC2O 3EC7A 3WLFA 2YDYA 2O3RA 4YQZA 2F1KA 4RL6A 3CMCO 1PZHA 2EHDA 3D0OA 3I4FA 4U6QA 3WOHA 1GR0A 1Y7TA 4LRTB 4FB5A 4RO0A 2QIOA 9LDBA 3GY0A 1UJMA 5HTOA 4CR8A 4MP3A 1W4ZA 4X54A 5JPIA 1RM3A 4ALIA 1VLLA 5J23A 1FMCA 3VPXA 1JDJA 5F1KA 5TLSA 4IJWA 4RVSA 1RKXA 1ZMOA 4MDHA 3V2HA 5THKA 1WVGA 2I65A 2CMDA 3WFIA 5BSFA 1DJQA 4BV9A 1PQWA 2G82A 1HL3A 1UXJA 1PJLA 2Y93A 4OIMA 5BNIA 3C1AA 3GVPA 1PSDA 3Q9UA 3WX0A 1H93A 4YT8A 4WNCA 3K73O 4FW8A 1U8XX 1AHHA 3DMTC 3JV7A 4WE3A 2GLXA 4ND4A 4XGKA 3U62A 4CR6A 3ZWXA 3M1AA 1VC2A 1LU9A 1F0YA 2EIHA 1PR9A 4IDAA 4IZIA 5EINA 2FRDA 3IC5A 1CQIA 3QWBA 2PLAA 4GVXA 4BO7A 3KBOA 2BI7A 5ENVA 2DC1A 1X7HA 4RVDA 4WCDA 3P5SA 3C7DB 3JQGA 1V8BA 5C7IO 3KYCB 2I76A 3JQ7A 4RVHA 5IDYA 1NWCA 5CDUA 3DOCA 3EAGA 4R1UA 2Q2WA 5BSGA 1XA0A 3RI3A 1WPQA 4MKZA 4AJJA 4Z3KA 4ALLA 2P2SA 1PL6A 2ZTMA 4NI5A 3O03A 5ER6A 5L9AA 1HYEA 2OMEA 2HMUA 1JA9A 1AHIA 5KIAA 5A9SB 4B4UA 4BO9A 1NQOA 4BO1A 1YB5A 4TZTA 3OECA 3ONEA 1NQAO 1BTOA 2PZLA 4G65A 2VT2A 1ZSYA 3AI1A 1YVEI 4XEHA 1MX3A 2ZIZA 3RBVA 3KRTA 1HYHA 3GGOA 1N92A 2Y0CA 3RROA 3ZNPA 1ENZA 3IUPA 4HP8A 2YV2A 1PU2A 2GASA 2EW8A 4J6FA 3VHRA 3H9GA 2EKLA 4J4HA 4BNIA 3I52A 3FN4A 1BGVA 3HDYA 4CM4A 3PYLA 3ULKA 1GEEA 1X7GA 4QSMA 2AEMA 2AQIA 3VKUA 4XB2A 2OHXA 3CZMA 4D41A 3GR6A 2C59A 1Z7BA 4J7UA 3DOOA 2WM3A 4RF4A 3VAZA 5CEFA 5U9CA 1ZJZA 5COBA 3KVOA 1E1KA 4I5EA 4AICA 1E0DA 2GF2A 2VQ3A 4U8GA 5L51A 5BSEA 3PVZA 5T64A 3WJAA 3WBBA 3BMQA 4NH4A 3WICA 1RPNA 1EZ4A 2RAFA 1TI7A 1E3SA 4UEJA 2UDPA 2Y99A 1ADFA 2QYSA 1E3IA 3EVTA 4ALJA 1PJTA 2HRBA 4NFHA 1PX0A 2NU6A 3RFXA 4XDYA 3SJUA 2GD1O 1PEDA 1SOWA 3MJCA 1XQ6A 3PJFA 4LMPA 4W9NC 3OEWA 3PHIA 2B69A 1DC6A 1GAEO 3DBLB 1GQYA 1HLPA 3GGPA 1YB4A 5KJEA 4OXKA 4PCVA 5KJCA 3W1VA 4Y9DA 2NVUA 5DCUA 2HKIA 1PZEA 3KETA 2IRWA 2PR2A 4OAQA 1DBVO 2NTJA 3GC6A 4B4VA 1TVEA 1QYDA 4L4RA 4WK6A 3RJ9A 1IL0A 2PA3A 3P7MA 5EPOA 1I2BA 1XCBA 5B37A 2P4HX 1R4MA 3D5QA 3LC1O 4K26A 4II2A 4EBFA 2OP1A 4NHEA 1ORRA 3AU9A 3WSVA 1UP6A 3C1TA 2C7GA 1EDZA 4OYRA 4YJHA 4M55A 3H9JA 4XQGA 4CJXA 2PZJA 4D0SA 2PH5A 1O95A 3V1TC 5I7SA 1A5ZA 1NHWA 2H63A 3C85A 3F47A 4AJ4A 1OOEA 4CLHA 1BVRA 2DAPA 5I9MA 1NFFA 5FF9A 2EP7A 4IJUA 1HETA 3PYMA 1J0XO 2JD1A 2P5UA 3ST7A 4Z9XA 2O3SA 3JQDA 3GDGA 3OA0A 4NJMB 5I7VA 4B8ZA 3FWNA 3QVWA 3TWOA 1HDCA 1XQ1A 3VKVA 4KWIA 4F3YA 4KQWA 2VWGA 4PLYA 1NVGA 1P9LA 2DTEA 2R6JA 2UVDA 1WXDA 4KQXA 4YVFA 3O38A 1V3VA
chains in the Genus database with same CATH superfamily
2ECKA 2WJ6A 1W4BA 2OFXA 3K7EA 5AVKA 5IT4A 5ALPA 1YDMA 3DLIA 5KCZA 1HFJA 1MB3A 2H2HA 2UZ1A 4ADSG 3IP3A 1B8UA 3C14C 1FYDA 4GT1A 1S3GA 3ORRA 2EU8A 2YN4A 4CF7A 3DEYX 1DEHA 3GNQA 1Z5UA 1BFKA 2AQKA 2MSKA 2V7EA 2JD2A 2J48A 1FFCA 2OT3B 4IIGA 5DIFA 5HDQA 2Q9AA 1LJLA 2AE1A 2ZBDA 3BXHA 3LIPA 5FO1A 2ZXFA 2OLEA 3DHEA 2RH5A 1UKZA 2Z1MA 5EEGA 2RJ3A 3EXIB 4B6EA 1RQPA 1DIBA 4OJNA 4EHIA 3K31A 5K6AC 3Q8MA 3MHPA 4K05A 3Q41A 2ADMA 3VI4B 1JU4A 1QGAA 2PCJA 5IARA 1ZH4A 1UUFA 2DY1A 1Q7GA 2IYTA 3SJCA 4CM9D 4W1PA 1YZHA 4CMKA 1CJTC 3DMRA 3QV2A 3NWPA 4ZFNA 4HNVA 4PYKA 4EY6A 1PTJC 2BZ0A 3KEQA 3TZLA 4Q1FA 3EIXA 1P5JA 1ZAKA 2J45A 3GFGA 1U6KA 1TYBE 1JU9A 3GFSA 3N3BC 2G8LA 3QNUA 4GYWA 4JJ4A 3R24A 2FP4B 4BJ5A 2ZSJA 4ZDJA 4B2LA 3TM4A 1EHIA 1X1QA 1Z63A 3JYNA 1H2HA 2R62A 4TYYA 1PR2A 4MA4A 2UYCA 3ZV7A 3FHLA 3BB4A 1BMFA 1VZ2A 1Q84A 3UAVA 3NYWA 2OGSA 1BCSB 2N3ZA 2QZZA 3KO8A 1FYXA 3Q87B 4H4CA 2QRNA 4KACA 3NLLA 1ESZA 1GG9A 4DRYA 3CUSA 4KC0A 3KYDB 1H3FA 2M6RA 4WXEA 1OZHA 4EPVA 2YJ5A 4UDNA 2E55A 3O3NB 4KIGA 3H65A 4EA6A 5I4BA 4DPLA 1NURA 4N49A 1CB7A 4PF1A 3WMFA 5IM4A 3LFUA 1N2GA 1DE0A 1YKGA 2ZKIA 2J3JA 3BZUA 4ZICA 5DH9A 2O0HA 1Q3TA 3L7OA 2FKAA 1GP2A 1K9SA 1SXHA 2XY4A 1A2QA 4N8EA 4RMJA 3R7WB 2BEWA 2FMHA 2QMQA 1QHFA 2AJTA 4WXRA 4NYIQ 1C9YA 3EHEA 2CUKA 3IE2A 4RLSA 4LI0A 1QZZA 5COQA 4EKIA 1L5LA 2BJVA 1DAIA 2HJHA 5CBKA 1N3LA 1P1CA 2NZUG 2Q0SA 2W6OA 1NVTA 1JW9B 4EPXA 4LTNA 1V5FA 2HWXA 2ISQA 3Q8WA 1C30A 3JRWA 4R3WA 4A1OA 5ITZB 3W0LB 3GCGA 2OCXA 1WBBA 3FB4A 5K09A 3OD5A 1Y37A 3OE7A 4OXIA 2KLBA 2Q28A 4PLTA 2EP8A 2DH6A 1H4QA 5LLTA 4Z4FA 3LD9A 4B33A 5BQFA 2XSZD 3HN6A 4AUKA 4KRGA 5LMUB 4BNWA 1RQXA 4P4GA 1R0CA 5JMTA 1LLQA 3V8RA 3NBUA 2OZLB 4W1QA 1DRWA 1Y1PA 3FUXA 4P3NA 3FTEA 3TYXA 3FOAA 4KXMA 3C24A 5L4LA 4P4LA 4BLTA 2P4QA 2BFCA 1G60A 3I9MA 2AHOA 4L75A 4AFNA 1BRTA 3CC8A 5IDWA 2PYIA 2B6NA 3C5EA 1ISMA 3DL7A 4BVLA 3CEPB 4X1IB 2ZBVA 4J3FA 3UWPA 2GH1A 2GBLA 4HQ6A 2GYUA 1REQB 4K6GA 2OOSA 4FOPA 4ARZB 1TXGA 1N8SA 1QTNA 1PHRA 2AOWA 3BE5A 4OGGA 3AIIA 3DL0A 1OTYA 4P36A 2Y0EA 2P7IA 1VHDA 3QOXA 5CAEA 2WWGA 3IE0A 3WNCA 3ZLBA 4AY6A 1TGVA 4M8SA 4RWEA 1FTYA 2XRYA 3V8QA 3A1WA 2CBGA 2J6CA 4YMHA 1UJ2A 1Y8CA 4NABA 3QF4A 1JDUA 1QB8A 4KBYA 3HYNA 3EOBI 4J16A 5BVGB 4FUTA 2R5NA 3TNDA 1P3JA 3GFRA 4LPSA 1T5TA 4D7AA 3PVCA 2GPWA 3GLFE 4PZ0A 5BXYA 5ENZA 1P81A 2WTMA 3K2EA 5C52B 3G6KA 3CSDA 2DOKA 4ZOEA 7MHTA 4DLNA 5FWYB 5IUNC 5K03A 3UJ8A 1FJGB 1K7CA 2ZSHA 1H3NA 5BW8A 2UZIR 1ISFA 3QKSB 4KU4A 2NU8B 4U8HA 2PFSA 2FCRA 2NU7A 5SZJA 3M3DA 3SYRA 1NQWA 4ZJUA 4IJ6A 1AF4A 1ZDMA 1OZ0A 3GYBA 1EJBA 3W90A 5AXAA 2GZHA 4C6HA 2B7BA 2QY9A 2DHEA 4X1KB 1WOYA 2LGJA 2FA9A 3D5EA 3F71A 4QU5A 1RXVA 3ZV4A 4A9AA 3LQRA 5BT8A 1U8ZA 2B3DA 4JBGA 4W9NA 2IYFA 2FJ0A 4U2DA 1ZSNA 1O6FA 1IZYA 2CNBA 3FPLA 5DV9A 2C42A 3CLVA 4BX8A 4E03A 3HUEA 1EINA 1OW3B 3H2IA 4FYJA 1VLZA 4L0CA 3G7NA 4L72A 3RNOA 4KI0A 1KIAA 2AE2A 4N39A 2WA2A 1DXYA 2XYRA 5DOZA 4WKOA 1BN7A 1TJNA 2P90A 3KAQA 2M1ZA 4IG4A 4BDTA 5J1SB 2AR0A 3EXFA 4PLWA 2FETA 2H0QA 4HN2A 2QMEA 3WYGA 4C6TA 2ZIAA 1RVDA 2JIRA 2AR7A 5EUQB 2G0TA 1IPFA 1KO1A 1G4AE 1CQPA 1KYQA 1ZEMA 3ASVA 4L5IA 3ZG6A 2J9GA 4N5IX 3YASA 3HDJA 2PIAA 4CEIA 1WY7A 4FX2A 2AGVA 3LF2A 4IEFB 4LE2A 4EUFA 1YB6A 2AH5A 4BFUA 4FKBA 2B1RA 1P0FA 4AS2A 2CHUA 2I78A 3E6AA 3N8GA 1G8FA 4WZAA 3QWHA 4LI3X 5FPKA 5JPDA 4MPDA 4GKVA 1I01A 1PNOA 4CLOB 3I6BA 3H2JA 3THSA 1FDUA 1TJ3A 5IKMA 3GPCA 3AXSA 4WXHA 3T0IA 1GZHB 3FKQA 3PIDA 1MQ8B 2OILA 3DVSX 2I34A 2EFHB 1Z6PA 4LKOA 4V0SA 3EUWA 2BKAA 3DVQX 4ZI7B 3SX0A 3ESCA 4HS9A 5JXHA 1ODSA 3F7NA 3W34A 1VI6A 2XF8A 3FDXA 4QBHA 2ZTLA 5GONF 4DUZB 3U61B 3DHVA 4KDRA 5LZ9A 1TA4A 4CT4B 2ZBGA 3FPCA 2WIBA 4GS5A 4M0DA 5EHXA 5KWVA 2O7NA 2PUJA 1ZM9A 3D02A 3D6MA 3BEOA 2XMCA 4R8KA 4Q4AB 4EH1A 1ZGJA 4W5TA 4AN0A 4D4LA 2CJWB 1WCYA 2GVNA 1TTQB 2RI0A 1BW9B 4MI9A 4Y0AA 1HDGO 4PYQA 3SQOA 2PMCA 1JAIA 1JIVA 1UPUA 3IBFA 1CQWA 4GPTA 1O5TA 2WAAA 4M89A 1CX9B 4PZDA 1XDZA 4AWBA 2QPTA 4FHDA 3BJEA 4KL8S 2PQMA 3CEHA 5LB2A 1EK6A 3LI2A 3PR2B 3LH5A 3AB3A 3V1LA 1H2AS 4MYUA 5FNVB 5G3YA 3T3EA 2O6HA 1HNZB 2P77A 1N2CE 1FTWA 4P86A 4ZJPA 1SH7A 4CKYA 3IQIX 1BFUA 3O4FA 4MB0A 4NFLA 4QECA 1YCGA 2B2NA 2FQYA 2IOYA 5EUBA 1MO4A 4QYXA 3TNLA 3EEFA 3DL2A 2VF8A 4YJDA 1ZHHA 3OU7A 4HQKA 4YY3B 4JJAA 2XQVA 4KN6A 4NU8X 1VE1A 3PXGA 1JG7A 3VKHA 5ALUA 5EE9A 2NZ8A 4HGQA 4HXYA 4TV8B 1NRJB 3I8SA 3QPAA 4PYOA 3HWRA 4ARUA 4WY8A 1VLQA 2HSJA 2C7QA 4HB0A 3QOWA 2YXNA 3C3KA 1BYUA 4YI3A 2WNIA 4KEAA 1UOQA 2C5FA 4J49A 1F17A 3PL1A 4P5DA 1MV8A 3HKCB 3EEYA 4Y6RA 4PO9A 3ELUA 5HJ2A 2AFHB 4ENQA 5CDHA 5ENDA 3G9UA 3Q15C 1YZVA 4X84A 5K01A 2CLMB 2OUIA 3NTLA 1Q2XA 4BVBA 1ZN7A 4J2TA 2BFEB 2GCPA 4I2NA 4R7GA 1BZYA 7ADHA 3BSYA 1D5WA 1PWHA 2W8BB 2Y2UA 4URWR 2EGUA 2FPGA 3QFCA 2GSWA 4C7XA 3OJCA 4PFSA 3B38A 3MTBA 5G0TA 4FCVA 3STYA 4AU1A 2Z3WA 3RC2A 2GA8A 1M1UA 1YQ9A 4XIYA 2QG6A 3HXOA 2X2PA 1GA4A 1MLDA 5ANRB 4KREA 4MUAA 3SR4A 3DFZA 3AZPA 5JVDB 1VBFA 2G28A 4Z0TA 1PVOA 2G9ZA 3MINB 2KM1A 5AJYA 4A4DA 4CEJB 5IMSA 1OFUX 3LPAA 2EXXA 1GQRA 1NX6A 1THMA 1KDZA 1U2GA 3RBZA 3EGXB 4HDNA 3WBFA 3ND6A 2PUHA 2FDXA 2GWHA 2ZULA 1T2UA 4N1AA 4QLOA 5ELXA 3R0VA 2BFNA 4O4JB 2HTEA 2JFHA 3WFJA 2XA2A 1HFKA 1JPUA 2IPMA 3I1JA 1EA5A 4K7JA 1R0WA 3E3OA 3QK7A 4XARA 4CCSA 4W7SA 4RTOA 3D6JA 4FYHA 4LHSA 4YB8A 5DP2A 2G0AA 3CY6A 3M6VA 2W5UA 2R4UA 4X7BA 2VAMA 4CKBA 1I4EB 1DEOA 1QORA 2AD5A 1XRLA 4DC0A 3U4QB 2WKPA 3OFJA 4XIIA 2DVMA 3E03A 5IJXA 1M8GA 1HPLA 1O5OA 3Q5DA 4PHHA 3ABRB 1RCTE 1DC7A 1AQLA 1P9RA 2YMMA 3H19A 1Y4DE 3K6KA 1W73A 1WB5A 2D2EA 3L05A 4L9WA 3M0EA 5DBIA 1QAQA 4GGMX 3KC2A 1YR1A 3HUTA 2YZ2A 1E9VA 5ER9A 3R76A 4TZ6A 4UNPA 4A92A 1EDDA 4W63A 1QDUA 5H9VA 1U9CA 2Q3CA 2XRZA 1G38A 1SKUA 4MUHA 3FLAA 1UJ5A 1L5OA 1SBYA 1XZBA 1OFGA 1R27A 3Q72A 2QNBA 4US2R 3R7BA 1S9HA 2X1LA 3KQLA 1QR6A 1H22A 2LIPA 4H3VA 1JKXA 1Y3FE 2GARA 5PNTA 4DA7A 1ZJJA 1ZP6A 2GO7A 3E3MA 2RKBA 2B78A 4EGSA 4EHBA 4EMTA 4XSGA 4EI2A 1M5TA 1RDFA 3H2SA 1NOJA 3PIIA 3VYWA 2IGBA 3ONVA 5F5LA 5HOEA 4DQUA 4QICA 2PQ6A 3ZTWA 3JAWA 3T61A 3ZY2A 5LQNA 3NJRA 1NGSA 4C06A 4LUCA 4XASA 2PX3A 3N70A 4XUDA 1EP3B 4GXRA 1DOHA 1Y63A 4QHYA 5GVRA 3ZHTA 5JSFA 4OYYA 4UEOA 4B76A 1EXDA 3GZTB 1ZCAA 2PDAA 2HUPA 3EEBA 4EQ6B 2ZZMA 2B9EA 2DFLA 3MJRA 4WZBE 1VYTA 3HXLA 1QVZA 2W6JD 3PICA 4FFSA 3H9EO 4DILA 4F8EA 3EIOA 4NAUA 4Y9SA 2IWRA 5DLYA 1KR5A 8ATCA 2J0SA 4GSLA 4AN1A 4FJ1A 1M2GA 3I64A 2RKOA 3SYMA 3R7LA 1KK0A 5B4VA 2G17A 1ZLYA 3BWCA 2F4VB 3DCJA 1B7GO 3IAAA 4GPD1 4IVPA 2PR7A 4JUAA 1VTKA 1XXLA 1VJGA 2WR8A 4N0PA 4WY2A 3ZGXA 3ZIAA 5C46F 3UMMA 1IVNA 2AUNA 3O8DA 1SQ5A 2O50A 4OL9A 4YLGA 3VZDA 5KNDA 2G40A 1WP9A 4AROA 4QTXA 4AKIA 5AOVA 2V7WA 3IVRA 5FUVA 5BVHA 1AQJA 2QBYB 1L4BA 3RJTA 1M2KA 1CRLA 3KQYA 2FR8C 2HX1A 4G0QA 2AOVA 3TW8A 3S2GA 3BE4A 5F7ZA 3CGWA 1P91A 2M1XA 3GDWA 4FLFA 4QYSA 3VM6A 5L40A 3VPBA 3NT2A 2ZAIA 2XCTB 3TOVA 1Y48E 2JF0A 2ZREA 1ATIA 4UATA 4KJZA 4EWLA 1PS8A 4I7EA 4RU1A 3H1AA 3JYPA 5JS8A 1CB0A 2BF4A 2O9JA 3R3XA 4O2AA 4ZU3A 4Y2RA 3BN3A 3PI7A 4KO4S 4DG9A 1VL6A 2PJRA 1PTKA 2NXCA 1TCCA 3PQ5A 4O2RA 3UGKA 4C03A 2GAIA 3L1JA 1MEEA 1EUQA 4Q37A 4AM8A 3PX2A 3UMFA 2R1ZA 4ZGWA 5BRJA 5JASA 2Z04A 4HX9A 4A0SA 2PIDA 5FPQA 2A33A 2ZJ3A 2EDAA 1AMNA 4JQYA 1CQXA 5ICSA 2NP6A 3KTFA 1BE0A 4I4CA 5BN3A 1DHTA 2QGNA 2YVUA 3BD6A 1QKIA 3A58B 1O9BA 3L01A 4XTRA 1ZMBA 3LLUA 1CEEA 4UTOA 4IH4A 2FWAA 2WLSA 4INZA 4G0NA 2X8LA 1ODCA 1T1GA 4MV4A 4Z99A 2X40A 3Q98A 5ICFA 2BKLA 2H85A 4TS9A 3GMTA 1GVNB 3JVVA 4DUGA 4Y1EA 4JJZA 4A8JB 1RJ9A 3UM9A 4PHGA 3IEKA 3A4LA 1E69A 3H11B 1IBCA 1TC2A 1U94A 2BD0A 4EW6A 2X7HA 1MA0A 2RGCA 1SKAA 2YHBA 3N2KB 2GGSA 3A6ZA 1SXJB 4HAWA 4Q4HB 4CUZA 4A6EA 1NW3A 4UTNA 3EEIA 4H6VA 3ZS9A 3FNHA 1N0UA 1IJKA 4W5JA 3CFYA 3RSFA 2PX2A 3DTVA 3ZQ4A 2QE7D 2FAXA 4EABA 5T7BA 4Q93A 2ODPA 3NHUA 1FJXA 2ZI7A 3RS4A 4UPEA 3ZHQA 1WPXA 1R0XA 1ZUHA 3C4VA 3QM1A 5DP1A 4ZV7A 3S2SA 4CMEC 4LJ6A 2YCLA 4G1FA 1K08A 1PWEA 2VAVA 3BFKA 3LOPA 3PFNA 4ESVA 3ZU3A 4UNRA 3B5EA 2QMHA 4ZYYA 3FSGA 1Z38A 5BN4A 2XADA 8LDHA 3R40A 1LA2A 1VJ1A 3LL4A 4HGPA 5EJ9A 4HNHA 5ULLA 2ZPAA 1NWHA 4M22A 5JE8A 4IZHA 1L7AA 1UQUA 1XZCA 4LYFA 4Y6QA 4LBVA 3PNQA 1TQDA 3UWMA 1B1CA 1Q1BA 3K2IA 4FT4A 5FL3A 3OQIB 4OYLA 5DLDA 4DLAA 3CLSC 1QCZA 2DJIA 3L0CA 1NYTA 4NJOA 1FVXA 4J9UE 1N2BA 4NXMB 1Y33E 1OJLA 4M87A 4QC2A 3T3OA 2QZ4A 4YRQA 3O4GA 3KLOA 5KSPA 2JB9A 6NULA 2Z2YA 1NBOA 2Y9MB 4RANA 3AESB 4WNAB 1DIHA 1KC3A 2V7QA 5EHZA 3FOFC 3WHKA 1AQNA 4RETA 1O77A 2IPAB 1AB5A 2FN7A 2ZWMA 3TXAA 2I87A 4Y2PA 5IAJA 2X8JB 4F56A 1G5PA 1S2NA 1W9MA 1Z34A 2BKEA 2GZRA 2OSBA 3UJAA 1GU7A 2YV3A 4DCPA 1OVGA 4US0R 3PEUA 3RJ5A 1XNQB 4EF4A 3PQ3A 4WLEA 4ZI2A 4R7TA 1LPBB 2H1CA 1MNAA 1RQ7A 2CBXA 2XRFA 3VR3D 2Q3EA 4LZAA 3KQKA 3LTEA 3F7OA 3K9GA 3T4EA 2UYYA 3KD3A 1EXWA 1X1EA 4L74A 1QGOA 2BONA 2OGWA 2VNJA 3BDVA 4LCBA 5K4GA 1EXVA 2CNLA 3O90A 1V3UA 4LYHA 1S2LA 2QRMA 4II7A 1RYYA 3GVCA 4B3BA 1C3LA 5U4XA 1F0PA 2CLKB 2PSHA 3FAKA 3UK0A 4EVIA 5G0WA 5HHTA 4QFMA 1ZRSA 1AK1A 2P6OA 1Z5VA 4ZP1A 1HY3A 2X6QA 4TKLA 1XOIA 3ANMA 4DADA 4M0FA 1JUDA 1CP2A 5EMMA 2R8PA 1A71A 2EGHA 4B87A 1WSBA 3KQQA 3KE9A 6REQB 1MQSA 1MB9A 2QSJA 3QX7A 1YRHA 3NM5A 3AFIA 3IAHA 2V9PA 4BMZA 4GR9A 1FVFA 1W4AA 3AJEA 3O21A 1GZUA 4DCCA 5C81A 4COKA 3SE7A 5TQ0A 1I7LA 3LP8A 2YHAA 1SCUB 3PU6A 3HU1A 4L78A 1L7VC 1X1SA 4CV0A 4S05A 1WS6A 5FTMA 1UXHA 5IT0A 3A4YA 1J8DA 3MLEA 4GAEA 4PZUA 4U7JA 5BN1A 1GFIA 4HWKA 2IZOA 1J33A 3ED1A 1JR2A 5CIYA 2DQYA 2WRZA 2YXPX 5HKKA 2MINA 3REOA 1X9IA 1HSOA 1XU9A 4D4MA 1HE3A 3HB0A 3C2QA 3G9TA 1I1QB 2IHVA 1FSFA 4Y6LA 3DB2A 5COAA 4QO8A 3X1YA 1M0EA 4IMPA 3BDAA 3IP7A 1N2EA 3OLXA 1VQ1A 5GM1A 1HLDA 3CZPA 1R6BX 2O1WA 2PKQO 5DNVA 1N9KA 4UHJA 1Y6FA 1SELA 4UD2A 5AKHA 4G07A 2J3DA 2F9LA 1E2BA 4C7KA 3M1IA 3QKIA 4GP9A 5D01A 5E1DA 5CD1A 1JKFA 2JHAA 2ZYVX 2IT1A 4DG5A 2WF6A 5IH7A 5C8YB 1F2UB 6GPBA 4XXHA 1IUNA 1YRYE 2IYVA 1KAOA 3OIYA 5JXGA 5BMOA 3IHWA 4Y67A 1LQUA 1DWUA 4XWOA 1GTZA 3CE9A 5SYMA 2VK8A 1IVYA 1VJDA 4DDWA 1J23A 1GUYA 1JQLB 5AXDA 1SKBA 4LRYA 1WEKA 2X22A 1IBRA 5EJMA 4D9FA 1TTPB 5JY6A 4NP6A 1NVAA 2QQEA 3GJ4A 2ONKA 1KHHA 1XZPA 2RGNC 3AUAA 1AUVA 2EQAA 4RFVA 3FYTA 4ED9A 4IZ6A 5DYTA 4O4IA 1KRXA 3KSRA 3KX2A 3M1YA 1OE0A 2PSJA 4IKEA 1ZR4A 1HDZA 3CSUA 1SMKA 2C96A 3WLNA 4F1WA 4V38A 3L8YA 4V3CA 5A5DA 2CXQA 1ZIPA 2P6NA 3GFQA 3WL8A 1GPNA 2JIZD 5JXIA 5I7HA 4BNNA 2OXFA 3KWMA 3TNJA 1EFPB 3IJ5A 1XK7A 3Q12A 4L2IA 4W6QA 1XU7A 1E2MA 2C5AA 2QRKA 3AK4A 4MGZR 4A2QA 3GAZA 5A5EA 2DHDA 4YP0A 2CSUA 3ETLA 4BB0A 5KOIA 4B3HA 3GLFB 1PHPA 3EDOA 4FSDA 3UWDA 5TIIA 4NEGA 1Y80A 4CV1A 3I8OA 4P54A 5DLEA 1IK4A 1JGTA 1TJ5A 2JAWA 4RDCA 2AXPA 3QBJA 2NXEA 4RGBA 2ZUTA 5B1YA 3TTXA 2HU2A 4J7XA 3K16A 4JBHA 4E5PA 1LBSA 2AC7A 2ZI9A 3M49A 3FF4A 1UBCA 1PP4A 3S28A 4BFTA 4E1AA 3GUCA 4JVSB 4DIKA 4MAMA 1LF5A 1N5LA 2Y3IA 3NX4A 3T15A 4IXNA 4JR1A 3ELDA 1NONA 2Z30A 2GN4A 4L5BA 1HTWA 1OXKB 5KVQA 2WWVD 1SZCA 1VSQA 3DD5A 1VM6A 1E9DA 1G21A 1KF0A 3X44A 4EY3A 3FCOA 1FJHA 2QXYA 4YAEA 2I29A 2HSDA 4NIMA 3CUYA 1YZFA 4MYSA 3ROGA 1JPJA 2M32A 4C1NA 1Y9DA 2JI4A 2WJHA 2IK8A 4WN9B 5F35A 4ZU1X 5EP3A 2ZJ8A 3GGGA 4JUIA 5I51A 1EK0A 5KJFA 3PLAE 1GNTA 4OQLA 3MHTA 1K4MA 3FETA 5F3DA 1WLYA 5HIJA 2TSYB 1Y1LA 5TS2A 2F7SA 3DC7A 4XJTA 1QP4A 4E3ZA 3KQMA 4AZ0B 4EB6B 1KWGA 4OU5A 4YJGA 1X7XB 4AMVA 3D9QX 1XSEA 2RH9B 2ZBFA 1GKUB 1MT0A 3MWFA 1NMZA 4JU8A 5FBRB 3KNZA 4GE0A 4ANFA 5DCYA 4X45A 4AW9A 4B3FX 3EGEA 4DNXA 1N1EA 1H65A 1JHZA 3FY4A 1ND6A 1WD5A 4UE6A 5CH5A 5KI6A 2J9YB 2QTLA 4WTOA 3TZQA 4D4JA 1UEXC 3NUZA 1HE4A 4TKVB 3ZLTA 3QMMA 1JILA 2PX4A 1CY8A 1KBQA 1NXVA 2GTHA 4DT1B 3A2LA 1UWKA 3A6LA 3JQFC 4CIVA 1CZUA 2QN2A 3BERA 3GL9A 4ZO9A 3AEQB 2YJZA 1ULZA 2RMKA 3TQCA 4BO2A 4JIGA 3FB1A 4OKIA 4XYMA 3K9NA 4E6PA 1T5BA 5JROA 4JYAB 4NSNA 3OE5A 4GC9A 2VUIB 2QN8A 1LDGA 1Q7RA 1ULSA 3IPCA 1FU7A 2ZU6A 1NVFA 1A72A 3O4IA 4IKPA 5KYVA 4DNFA 1J7JA 1J2EA 4R31A 3RQIA 5I01A 3SK0A 4Z9FA 5JAHA 2P0YA 4PVCA 1GNVA 2FW8A 2EZ4A 3OAAA 4RL4A 4CMEA 3TD6A 1U1DA 1BE8A 2VLIA 1U8FO 3MMNA 3SC2B 4BTVA 1O08A 2J3IA 3D8HA 2H17A 4DBZA 5LXTA 5BY2A 2BE9A 1XL0A 3LLVA 1ZQ9A 2ZJ4A 3SSMA 5F9MA 1GCUA 4JOSA 5C5CA 1L5KA 2RD2A 4UHHA 5KQLA 5HM8A 2OHHA 4CGYA 1U0OC 2D3TA 1G3IA 1NC1A 3D3WA 4BLRA 4G5XA 1CUXA 1GXSB 3WLAA 3F49S 4CMIB 4NFYA 1CYEA 1R6TA 1T9HA 1EFDN 5AHKA 5IJZA 4FNGA 2B9VA 3LFHA 3OQ6A 4TV9A 4EPRA 3ZE8A 1WHSB 1N2CB 4RLHA 1MNQA 1M2OA 2ODNA 1R12A 1T9GR 4LZOA 3T1NA 4K9DA 3C16C 3CUTA 3QFTA 2K7FA 1G16A 1ISPA 1I7DA 3H5TA 2ORED 3MTIA 4X92A 4JDUA 3GJRA 3I4LA 1OZGA 3K0AB 4DW8A 3NTUA 3MUNA 4YR7A 2AF3C 4B3DA 5LNK1 1U04A 1E99A 3KU4A 4PC6A 1LTHR 1KO4A 5EZ6B 4P0QB 4UCXA 3MT0A 4XPZA 3UUFA 2BGTA 2CEAA 3MYRA 4YPVA 1WB6A 3O8CA 1DX6A 2CVFA 3PKZA 4LWQA 2QROA 1RFGE 4K9MA 5B57C 5DLQC 2X19A 1GPWB 1OI4A 1LLUA 3F3KA 2QAJA 3WK5A 3C3BA 4U3JA 2GEFA 1GNQA 3LRPA 4FCTA 4FE4A 4WX2B 3WK6A 1ZOPA 2XUHA 4BO8A 3DNMA 1QOPB 5DBEX 2A0KA 3H1FA 1OX6A 4I1PA 1OUMA 3B82A 3IQDB 5JCXA 2A0WA 1W93A 2PRJA 3BGDA 4UPVA 3UUEA 2H29A 4KQKA 3RUDA 1K5PA 1OMOA 1LCIA 3DUWA 3LHSA 1CZKA 1Z0DA 2BGJA 3C3AA 2QNRA 2QY6A 4A03A 3KD2A 3OTHA 1E3EA 4MQ5A 1ZKMA 4E5YA 2A5GA 3K9FC 2CV1A 1EFRA 2GPBA 3DPIA 1PVDA 4R6WA 3QE2A 4E12A 5CM8B 3WYAA 3EFHA 4CTMA 4OTZA 4Q3CA 4PIMA 4IAOA 5AXBA 4BV3A 1YRBA 5CX1B 4C20A 5AM2A 1DFHA 2LDXA 3Q9SA 4BLPA 2JBAA 3PD1A 2D7CA 1IXRC 1QIFA 4KMOA 4QFCA 2J6HA 5CVVA 1LBTA 3ICEA 3NNNA 4UBLA 1NE7A 1P44A 2I7XA 1D6SA 2XUIA 4LN1A 2IXAA 4FMPA 1H0RA 1MGPA 1QJCA 4NEQA 4AUEA 1ADYA 1YE3A 2P2DA 4UUMA 5AW5A 4B32A 3V8BA 3KYCA 1YFKA 4FMDF 3DE4X 3SJZA 2X42A 4ZAXA 3BHIA 2ZTVA 3TSCA 1KEPA 2JFGA 4MW5A 1ZU5A 1J22A 2K4MA 1UZMA 2PJZA 2QVBA 5CURA 3R9XA 2DJ5A 1T2NA 4L4YA 3S68A 4KFCA 4NLLA 1E61A 3HCEA 1AGXA 2D06A 1I10A 1W35A 3NJ8A 5DMXA 5ECGC 4F3TA 1V1MB 3BZWA 5DSTA 2DLNA 2W58A 4HDCA 4QQFA 4DZTA 3CIFA 3UC9A 1CY0A 3TF5A 2VG8A 3TZHA 2RI6A 5CBPB 3IA7A 2CVZA 4NCIA 1MUUA 3HLTA 3V3TA 1QIJA 4F9FA 4H1WA 4FDLA 1CE8A 4XH9B 1KVRA 3IMCA 3PL5A 4B3GA 3DM9B 3UPTA 1EZZA 4LYDA 3V7UA 4EMBA 4FGZA 3ZBUA 4QPDA 2CZQA 4WLOA 3Q88A 4L3WA 1EGAA 2H1RA 4RD2A 1O9HA 1X8JA 3W4IA 3FNQA 2QNIA 1QP0A 5K4AA 3P94A 3RVBA 4CQNA 3GX1A 4EI9A 1NFQA 4QJ4A 3LUKA 4MPRA 1J4AA 4ZRNA 1W85A 3DMPA 3E5MA 1QAMA 3JYHA 3S5JA 3TUIC 4K1XA 4ZTUB 2V1UA 1IN1A 4DRZA 2BMVA 3VGJA 5EE0A 4E32A 1Z6QA 2D62A 2GJ9A 1A8IA 4IRXA 3LBHA 4W8OA 4YGYA 4YAOA 5DHUA 3EA5A 4LCEA 4YGXB 1RPAA 2C3YA 2JDIA 2AZXA 2PXHA 1KZ9A 1XTZA 1TDJA 2NWQA 2WICA 3F1KA 2V98A 3QOFA 4M0PA 4NPCA 4FCWA 3ESYA 1C9KA 4BGUA 4BQEA 4YRMA 4ZDKA 3L0IB 3ZDRA 2VCHA 1X86B 3TRIA 1YZTA 4ND3A 2P9JA 2VP6A 5IN4A 1BROA 4WZBB 1XD9A 5CX4A 4OXQA 1WUKS 3EIQA 1AN0A 4IGIA 3G9XA 1IYZA 1EX6A 1WL8A 4Z0PA 3SKYA 3U3KA 4DTIA 4YCLA 4BQRA 4KP7A 5A0FA 1CWUA 1ULAA 3ZD6A 3TLEA 3OX2A 4G85A 3VR4A 2FUCA 2MIIA 4MUBA 3DONA 3QMVA 3RV3A 4DLZA 3NBKA 2EVWX 2GEJA 4HNAB 1CF2O 3I32A 1LK5A 3BORA 3K1YA 4X6LA 1V6AA 2BEJA 4NBSA 3AERB 3L4JA 3QF7A 3BTOA 2Y71A 1EWQA 4IKOA 4ENUA 3E7PA 5KWEA 1R74A 1FRFS 5LOVB 4JI4B 3ZD7A 3D7KA 1V96A 3U1BA 2E5LB 4E2YA 3IPYA 4HO1X 1WV0A 2BBSA 2EWWA 2QL7A 3U3JA 4ZYUA 4NICA 1KJIA 1TKRA 3ESDA 4OATA 4YMGA 1UMCB 4RA9A 1VIAA 2RGAA 5I5EA 3H4IA 2VBGA 4GO1A 4H77A 4X65B 1WXGA 2DGDA 5AK4A 2VTKA 1SG6A 1F60A 4DDTA 3TG8A 4I1UA 5LNK6 2NVWA 4FN4A 1WV1A 1L4LA 4DHEA 1CUCA 4A15A 4XDGA 4RY8A 3B1XA 1T0BA 1VHQA 2JNWA 2JGAA 2M6LA 3D7MA 3H8JA 5CHYA 3HDHA 3FMVA 4Q4JA 1M0TA 1E3DA 4QXOA 2VSXA 3VZRA 3M6FA 1MIOA 1JSZA 3OSZA 1TF7A 4NJMA 5IYZA 3T5GA 1U6JA 3FRJA 1ONNA 5C80A 4AS1A 1JH8A 2YC2C 1FMLA 4HLQB 3LNTA 2CDCA 3QBVA 1PGPA 2JGRA 3OH8A 1ZH2A 2VRWA 3KALA 1R8XA 8MHTA 5CLIA 2G1AA 3MYYA 3P2YA 1A5SB 1IXSB 3PDHA 4J4BA 5AW2A 3VZCA 1YDFA 4LY6A 4I4TA 2A2ZA 3G0BA 3VYSB 1Z22A 1BU8A 5BYKA 3GJYA 4IR7A 4YECA 1PVVA 5EWLB 1E2QA 4ZCTA 5KOHA 1GR1A 3JZIA 2O4CA 3LQKA 1S3FA 1GZ5A 4MVWA 1Q0RA 4TKUB 5PGMA 1MJ5A 3DOJA 4KNVA 3R41A 1DEKA 4B6OA 1PJBA 5E6SB 1QCDA 4P93A 1W1UA 3RODA 2ZTUA 2IUYA 3EXIA 3K96A 3BRWA 4GOOD 4LJ9A 3UMJA 2PQ2A 2P8JA 2VAXA 1ML4A 2VF5X 1Z5OA 2CL0X 3W8NA 1WW2A 4HVAA 3PFHA 3R0IA 5EJAA 1E5VA 3MCUA 4E09A 4REMA 1JHQA 3DBVO 2DQSA 4TLBA 4IGEA 3ADOA 4MS3A 3D6TB 1GQQA 1NN3A 3I2KA 4YA6A 3UNXA 2QGFA 3KS9A 3LXRA 2CFIA 4RUKA 3RHZA 5I7UA 1OWLA 2Y92A 3FZNA 3GRVA 4X00A 3NCHA 2FP4A 1U1GA 4JUCA 4M8KA 4EVQA 3E8XA 4N5HX 3THOA 1CKEA 5SICE 1JTVA 2GMWA 4L0QA 2RHLA 1LQ2A 3W7BA 2SKEA 1XHLA 2XD9A 5ED4A 5M7EA 2R6CA 2FOLA 4HNGA 3NVKI 3AVTA 1BCSA 5K51A 4M9UA 1CIJA 1QG2A 1P6QA 1WU8A 2FSVA 3NUGA 2WHQA 1VYUA 2RHBA 3CLRD 3G0DA 4OFBA 4C4ZA 3LPMA 3IV9A 5KTMA 2FEAA 3NHRA 4A26A 2OAGA 2KJQA 3VR5H 3H5WA 4TT3A 1E9EA 1JDZA 1RAEA 3GNSA 4FD2A 4WADA 3SHTA 7YASA 2OB2A 4R4JA 1YDGA 2I1QA 2P0AA 2DP4E 3JQAD 2CY0A 4FPXA 2WFMA 3KVYA 4ZVQA 3SBXA 2BMJA 2JI8A 2O3TA 1K8YB 4MNTA 4OGWA 2JJ1A 3H4MA 3R2JA 4MOWA 3CF0A 4I66A 3ZVLA 1GTL1 3NTQA 5JQWA 4LF4B 1DTWB 1YH3A 4O63O 4N18A 2VEOA 3SBEA 1QWOA 1XTQA 5JAMA 1R9MA 1Z4NA 1OU4A 1WXQA 4O3MA 5LYJA 4KQ1A 4ND7A 3IPLA 4DA0A 4TTJA 3H9QA 3IP1A 4S0XA 5ITZA 1RI2A 1TZJA 1UH5A 1PFKA 2WK1A 2N46A 3EOAI 3RRXA 5HEKA 3HBAA 1JLMA 1Q3HA 1ZQ1A 3P52A 2EEZA 4JJ8A 4JVLA 3B53X 5AM3A 5LKAA 1AKWA 3LDUA 2APJA 2D5AA 3IMKA 4FB4A 3L9XA 5L3ZA 4FUQA 3SSOA 3F73A 4MW1A 1UK8A 2OZLA 1KI1A 1Y4SA 4QULA 5DIZA 5K0NA 4EY7A 3RUAA 1NVEA 2OHGA 2JH3A 3MS7A 3PFKA 5MFZA 4RSHA 1VMIA 1R16A 1JQBA 2MMCA 5FULA 1UDAA 3WYCA 3HN7A 3H5NA 1XYYA 2NQTA 3PJGA 1L8LA 1VKJA 2JFXA 4QGBA 3OZTA 3GXOA 2BFPA 3LGAA 4MEAA 5CU7A 3QLTA 4BFVA 1JXQA 2OO3A 2TMDA 4IDFA 4KNWA 4YACA 5G0SA 4M1WA 3BXOA 1P8AA 2ZYUX 3MWJA 1REQA 3VOSA 4JKIA 2UXDB 1VRCA 1JSCA 3RLFA 3L6OO 5C7LO 3JQ9C 4NBRA 1KH3A 4RSMA 2TYSB 4IHJA 2MYUA 2BKVA 2RHMA 4RVGA 5HF5A 4BVEA 5J4LA 5BR8B 4QGHA 3RAEC 2IYEA 3UWKA 4Z1MD 1GNRA 5TEWA 5JHGB 4X71A 4PGGA 3ZI7A 4R2WA 3L46A 5FKJA 1MAHA 2B98A 3IUBA 5FBHA 2VP0A 4NCBA 2DECA 5ES3A 4LW8A 4EYSA 1TYCA 1UT5A 2Z2XA 2E4YA 1CUYA 4BYMA 1TUIA 3ORFA 4RD0A 3RYTC 1C4WA 1XKXA 2FW9A 4ZD6A 4DCTA 1USIA 3FF1A 3KFLA 2ZVPX 3A9WA 1EEHA 1XRNA 2IEIA 4PAWA 4IRUB 5TMDA 1THGA 2ZR7A 4B82A 2W4IA 4IXTA 3OZEA 4C2TA 3G8YA 2B21A 3DR5A 2FTKE 4B7XA 5BRAA 4NNOA 5EMLA 1ZXXA 4RM2A 3BXZA 5FWYA 4OHUA 2IDJA 3GZ4A 4BNGA 3UHPA 5KINB 3FJ1A 4OOEA 3ZK7A 1KVQA 1Z4KA 3KKQA 2VDMB 3QKSA 4R0VA 1AKUA 3PE6A 1F5SA 3TAHA 2VTDA 4DRXA 3MRTA 2GCEA 4RZUA 5AW7A 3FJOA 1EQUA 4JLPA 1W2WB 2D2VA 1U3TA 2FF5A 4LEIA 1D7AA 3PPWA 4P81A 1X7YB 5LDDC 4X1KA 3FSEA 3O92A 2BJWA 2PY6A 5FV4A 1KXZA 3HB5X 5HK9A 2KPOA 1T8YA 1TRKA 3FZYA 4R3NA 5E1MA 3LY5A 3OPQA 1TQHA 4TUYA 1PRYA 4F38A 1BHQ1 2GBIA 2A9RA 2VF7A 5HJEA 1PR5A 3UT6A 1NW5A 1I2DA 2YWHA 5IJ0A 2PE5A 5KZMB 1A7AA 5ALWA 5HMLA 3UMVA 3LTNC 2ECQA 5L4NA 1HLGA 2WNSA 3E3AA 1VPVA 2G6TA 4KUEA 3E9RA 1RQLA 3W06A 3AM5A 4RENA 1EWTA 5LM3A 3EK2A 2XXAA 1T0JB 2ST1A 2O8BB 1PL8A 5F1OA 2P6RA 3BE6A 4AI6A 3TTWA 1GKIA 1WPRA 3PITA 3RKSA 3X43A 3IV7A 3COZA 3ZH2A 1RYDA 5LIPA 1UC8A 4IOLA 4Z51A 5JWRA 5T5QA 2C5GA 2WOOA 4E3WA 2B25A 2NM0A 4UM9D 1V9CA 2ZB2A 5FQOA 4B9AA 3M82A 5FPSA 2Q21A 2V96A 2VRCD 4JBWA 1A8SA 1EDOA 2QUIA 3H7IA 3WO1A 2O48X 5CDSA 4LA4A 4L0DA 3UF0A 4CLOA 2A5YB 3AL3A 2AZMA 1IEVA 1VIDA 2HIMA 2IYPA 1HK7A 3AHCA 1EFKA 1UMBA 5AIBA 1VI2A 4L28A 4IG9A 4IXWA 4D9KA 5I3CA 4B7UA 2G06A 3EF1A 3LOQA 4MULA 1W19A 3CWQA 3L82B 4BLOA 5A4KA 1UM9A 3U3MA 1V3QE 5KREA 2XNDD 1AU9A 4GI5A 4RIFA 4XUGB 5A7FA 2IEZA 1NF3A 3AHGA 5DHAA 2ATEA 2JIBA 4BZPA 4EHLA 3WKEA 2WTBA 5TQ2B 3QY9A 2O7VA 1O8BA 1CS0B 1EWVA 4QQKA 3RC7A 1D1TA 3H42B 3F5QA 3ZDZB 1XNHA 1ZAYA 3AETB 1WKCA 1EUCB 2CXTA 3WLHA 3F90A 4Q4AA 5TEVA 4L07A 4ABTA 3PX7A 2CHEA 3I39X 5JDIC 3GGCA 1T1RA 3P32A 1WCWA 5HG0A 2ZSIA 1WOMA 1BW9A 4G4JA 4V39A 3AEU