3GRKA

Crystal structure of short chain dehydrogenase reductase sdr glucose-ribitol dehydrogenase from brucella melitensis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
254
structure length
248
Chain Sequence
b'GLLQGKRGLILGVANNRSIAWGIAKAAREAGAELAFTYQGDALKKRVEPLAEELGAFVAGHCDVADAASIDAVFETLEKKWGKLDFLVHAIGFSDKDELTGRYIDTSEANFTNTMLISVYSLTAVSRRAEKLMADGGSILTLTYYGAEKVMPNYNVMGVAKAALEASVKYLAVDLGPQNIRVNAISAGPIKTGDFRYILKWNEYNAPLRRTVTIDEVGDVGLYFLSDLSRSVTGEVHHADSGYHVIGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-(acyl-carrier-protein) reductase (NADH)
publication title Crystal structure of short chain dehydrogenase reductase SDR glucose-ribitol dehydrogenase from Brucella melitensis
rcsb
source organism Brucella melitensis
molecule tags Oxidoreductase
total genus 82
structure length 248
sequence length 254
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3grkA00
1QRRA 1KETA 4AJNA 1SB8A 1BDMA 1SAYA 3DOOA 1R66A 4NR0A 4OXKA 4E5YA 1BVUA 3INRA 4FOOA 4TMFA 5IXYA 3NAQA 4YQZA 1OMOA 2W2KB 1OAAA 1AHIA 2WYWA 4AG3A 2EP7A 3S2EA 3K30A 4KOAA 5JDCC 2FOIA 3CINA 1UZLA 4BB6A 1E1NA 1LSSA 2FPPA 2PZMA 4LGVA 1O94A 1SZJG 4W99A 2O50A 3NV9A 1JKJA 1ORRA 3VC7A 3AOEC 1ZKMA 1U1IA 1B15A 2E82A 4J3FA 3GZNA 1P1HA 1V8BA 2G82A 3G0OA 2Q50A 4YXFA 2O2YA 4J0FA 2EW2A 2OP0A 5HS4A 2JL1A 4RCVA 2Y93A 3QRWA 4QECA 3ZHZA 5HRUA 2VUTA 2WE8A 1YBVA 2VOEA 1GEGA 4BGEA 2AQ8A 1SB9A 3E03A 4JXKA 3ZHYA 2JAHA 1C1XB 4R1NA 4W9NC 5JDIC 3M2PA 3RC9A 3ZW8A 5JC1A 3K6JA 1Y9EA 2PGJA 1EQUA 3PQFA 2Q1SA 4J4TA 1E6EA 1OC4A 1EUZA 2Q99A 4EDFA 3KSDO 4GX5A 1YWGO 1FXSA 1E1MA 1Y5MA 2PZJA 3ZWVA 2EKQA 1C14A 3P5SA 1GPDG 1GEEA 1E3WB 2WJPA 3F4LA 2Q1TA 4Y6PA 9LDTA 3PHGA 4KUHA 3JQ7B 5KKCA 4I9HA 4MKRA 4CLOB 4Z0TA 4R3NA 4CMIB 1QKIA 3O9ZA 1T2AA 3L9XA 5EIOA 1OI7A 4Y9DA 2I76A 4ND2A 1ZCJA 3WGGA 3X2FA 3UICA 3FNEA 3AOGA 1BG6A 1PIWA 3JD1A 2QIOA 1SOWA 5T6BA 1FMCA 1VPDA 1LBEA 2HU2A 4XKJA 3WOHA 1XKQA 5DZSA 4UUNA 3CZRA 4WNCA 3P2OA 2P9GA 1K89A 3QW2A 1PZHA 4WEOA 3BYZA 1I0ZA 1F06A 1MC5A 1VJ1A 4CQLB 5TLSA 1M76A 3G79A 5A9SA 3RFVA 3WFIA 3L9WA 4UEKA 4BMNA 1M67A 1YQDA 1EE2A 3VVCA 3JQEA 1DRWA 1ZK4A 1RM5A 2IYOA 1DSSG 1E6WA 3FD8A 1J4AA 4IDCA 1DC4A 1NX6A 3VH1A 5KVVA 3D4NA 3CMMA 3UFXA 2I99A 1Y81A 1NP3A 4E2YA 3ADOA 5BNTA 1W73A 3DZJA 1PL7A 2YV1A 3K9QO 2RBEA 1AN9A 1EVZA 1W8DA 5JFOA 3SVTA 2B4TO 5T57A 4HADA 5G0WA 4GVLA 5C5IA 4DA9A 1YL7A 1SMKA 4D0SA 2X9NA 2NUAA 4X54A 4Z9XA 3ZZNA 1N92A 3FBTA 5BT9A 3D3EA 2ZKLA 4KP7A 2E49A 1ZVMA 4FBGA 4MPDA 4R54A 4NH4A 2G76A 4XIJA 1KEVA 4XR4A 3ICPA 5KVQA 1B0AA 2P5UA 3ZDFA 1HKUA 5L4NA 3U5TA 1PGOA 2NWQA 4D45A 2DT5A 3FN4A 3JD2A 1LSOA 1P1KA 3LK7A 2DTXA 3U4IA 5KJCA 4LK3A 3DO5A 1IPEA 4XR9A 2EKLA 4IIUA 4IIVA 3ABIA 3LF2A 3DB2A 3ZU3A 2PKRA 3TZQA 2VT3A 1I2ZA 1HXHA 2W4QA 2ZCUA 1ID1A 2PD6A 4O6VA 3AI3A 4U8GA 5IDYA 2IE0A 3WJAA 3QVWA 2OXIA 3I4FA 2HDHA 4FC7A 3UW3A 2QG4A 5JAMA 2AQIA 1HSOA 4RPJA 4MKXA 1ARZA 1G6KA 1YOVB 2Y1FA 4YQYA 3DR3A 4LMPA 4PRLA 1DXYA 1SEVA 4IS2A 4J1QA 1BXZA 1PQPA 1BWSA 1P1IA 3ZWPA 5HTOA 4BNLA 4NNJA 4E33A 1LJ8A 2F1KA 2PKQO 2JCXA 1TA4A 1MP0A 3D1LA 5TT1A 2CDCA 1HDRA 1UDBA 1GR0A 4XYGA 3HQ4O 3OQ1A 4I8XA 5JAQA 1EUDA 3E5RA 3TDKA 3KYDB 4FFRA 1T25A 4ID9A 1GQ2A 2VUUA 2AQHA 1C1DA 1DRVA 4FQ8A 4RPKA 4R68A 5T64A 2BI8A 5CAEA 3V2UA 5A03A 4CMEA 2RHCA 3TWOA 1VC2A 4Y6SA 1F0YA 4F6LA 4DVJA 2I9PA 3OJOA 1O9BA 1KVQA 3E9NA 4L76A 1ZZEA 1ML3A 3ZV6A 3D3WA 2PWZA 5L95A 3JYNA 3Q1LA 4EUFA 1I3LA 5AXBA 4ALLA 5IAAA 1NBOA 4A10A 5A1TA 2G1UA 2PH5A 3PJGA 2OO5A 1Q1NA 3EZLA 1D3AA 5DULA 4GGOA 1XCBA 1VSUA 1KOLA 4J0EA 4R1TA 4AJ4A 3H5NA 3WTBA 1XIVA 4IMRA 3PZBA 3RUCA 2J3JA 3LYLA 5JYEA 5CFZA 1Z73A 1KVRA 1RJWA 2V65A 3K2BA 3CTMA 2QZZA 3QY9A 3V1UA 3IDSA 1JWAB 3W8FA 2UVDA 4CV0A 3BAZA 3H5AA 2QRJA 2B83A 3L6EA 4BS9A 3DBRA 4W4TA 1B8UA 5TNXA 3ANMA 3MJCA 1QR6A 4URFA 3SC6A 3ZWOA 3OQ6A 1WDKA 4KMSA 2ZTLA 4GX2A 3HNPA 2C07A 4IBOA 4OL9A 3WSWA 5TRTA 1XWFA 3WMXA 4EJ6A 3L07A 3RASA 3OIDA 1UZNA 5F3RA 2ZTVA 3GG2A 4IINA 1HDGO 1YQXA 4KQWA 2GN9A 1PJ2A 5DCYA 3LVFO 4CM7A 6ADHA 1HTBA 4TKMA 1B3BA 4Q3BA 3EGOA 2X22A 5ADHA 1CYDA 1A7AA 1D4FA 2VOJA 2W8ZA 1QG6A 1VSVA 3GEMA 3VAZA 3G49A 4LN1A 4XQ9A 1T4DA 2VN8A 1LLCA 4LCEA 4LSMA 2A92A 5JY6A 4YAKA 4HY3A 1I2BA 4J43A 4DQVA 1X14A 2NTNA 2E6UX 5TJ9A 2J5KA 2XPCA 1FDUA 1XQ6A 2O7SA 3FI9A 3PQEA 3WIEA 5KVCA 3OF2A 1ZEMA 3I52A 5CG1A 1UZMA 3F1LA 1JVBA 3EVNA 3DBHA 2CNBA 4DQUA 3TFOA 2C2XA 1BW9B 3MWDB 4TRRA 4XCVA 5L4SA 4ZQHA 2POQX 5L4LA 2EF1A 3VPFA 4HP8A 4RDHA 4WLEA 3ANLA 4CUZA 3E9QA 2BI7A 4TRJA 4CLRB 4JX8A 6LDHA 4XGIA 2EIHA 1XA0A 4MDHA 1XLTA 2VHWA 4NJOA 4D42A 1DEHA 3ITDA 1LRLA 3AWDA 1ZJYA 2V6MA 5EMHA 2O2SA 4NHEA 3GC6A 3ONFA 3E9MA 3S8MA 4CV1A 4MIOA 2HMVA 5I9MA 3DEYX 3I9OA 2NU9A 2EEZA 1VI2A 4FB5A 3TZKA 2J5QA 3DBLA 4MVJD 1P33A 4BNTA 1PWXA 4F46A 4DC0A 2R2GA 5TGDA 3DZBA 1ISMA 1MC4A 2NTVA 3MJSA 4NQZA 5T8KA 3GRKA 3S2FA 1M6HA 5CDTA 4N5MA 2NM0A 4YRDA 4XJTA 4NFSA 4XYBA 4ZQBA 1FJHA 3IL2A 3M6IA 4OSPA 1LA2A 2BFOA 4XQGA 2F00A 4ROSA 1HSZA 1ZJZA 2AMFA 2DLDA 3PJDA 3VKVA 3UH1A 4RF4A 1MX3A 5MDHA 3GEGA 2DUUA 4RJTA 4WCDA 4GSKA 1S7CA 3MJ4A 4NK5A 3RBXA 4GBJA 3WYCA 1Q0HA 4J90A 5MGBA 4QXMA 3ITKA 4DIOA 5A3JA 1KC1A 2PD4A 2X5JO 2FPGA 2QRKA 3FSRA 1L7DA 4H15A 5H81A 4YCAA 5G0SA 4GKVA 4RPHA 3RUHA 4W7IA 1TI7A 1X1TA 4YA6A 4CL3A 1E7RA 2DU8A 4NZ9A 3DMTC 4QSMA 5THQA 3ZNPA 5AQ1A 3IS3A 1KVUA 3QWIA 3GOHA 4LMRA 1OC2A 3PDJA 5F21A 4FW8A 5IZCA 5JPIA 1R37A 4Y8VA 4AJKA 2JHFA 4HXYA 1HDXA 1U8XX 2YDXA 4UVHA 1NHGA 1WLYA 2HK8A 3K31A 4NI5A 3WGOA 3CXRA 3DZFA 2LDXA 4BOYA 4DXHA 2DM6A 5KWEA 3JYLA 4CM9D 5G4LA 4P38A 2GUGA 3RUDA 1R16A 3LC1O 3ZWCA 3JQ8A 3ASVA 4L4XA 5DN9A 4GVXA 3PIDA 1B3RA 3WQSB 2Q4EA 3ZWWA 1GYRA 2J3HA 3DZIA 1H9AA 1DAPA 3DL2A 4DMMA 3VPGA 1LI4A 1WMBA 3W8DA 4CMBA 4XD2A 2NQTA 2Y0DA 4R1SA 4QX6A 1A9YA 4CQMD 1UDAA 4B3HA 2HJRA 5A9SB 3EHEA 3S2IA 1DC5A 4R51A 1GTMA 3PYMA 5I7EA 1HRDA 3QSGA 3VTFA 2PY6A 2IZ0A 2SCUA 3QVTA 4YAIA 3KOUA 1T2DA 4BGVA 4NBWA 5DDIP 4EZBA 1GADO 3GVPA 4KZPA 3V1YA 1WNTA 5ITWA 4MVJF 1ZK0A 2BH9A 3C3XA 1EUCA 3QE3A 2EKPA 3H9UA 5ER9A 3GK3A 1KERA 1YRLA 2GN6A 4Z9YA 3WYBA 4ZVVA 4Q3AA 5KJ6A 3AM4A 4JQCA 1BGVA 1R0LA 4HNHA 3EAGA 1C3VA 1I36A 1DIAA 1QV7A 1XR3A 4AJPA 3OETA 1UAYA 1ULUA 1VL0A 4D3SA 3IJRA 1XU9A 4B3JA 3B70A 4BO9A 1QYCA 1U3UA 3D5TA 4BO3A 4XJSA 1E7YA 1LTHR 5JBIA 2YFQA 3I9KA 4PG8A 4L0QA 2PFGA 4DL9A 3UF0A 4HFNA 3LLVA 4S1VA 3HZZA 2PH3A 4BO2A 3HFGA 5FI5A 3KVOA 3A06A 1HLPA 4TWRA 4PVDA 2CF5A 4ILKA 4GMGA 1J6UA 3CSDA 3HDYA 4F45A 1JKFA 4FFLA 5ENDA 1ENOA 3GF4A 2UV8A 1E77A 3ZHBA 4ND4A 1VRWA 2DTDA 3U9LA 1V0JA 4XYEA 3A4VA 2ZK7A 5L7WA 4QTZA 1NTOA 2YQ5A 4RZIA 4EI2A 4J4HA 4EUHA 1VKNA 3EK2A 5JMWA 1R4MA 3QHAA 4BO8A 4TKLA 1H6BA 4ND3A 3WR5A 4BKUA 4FN4A 4J7CA 3I3OA 3NTQA 2IXBA 1F8FA 3ZWBA 3MCVA 1KY4A 2ZTMA 5B4VA 3F3SA 3PP8A 1H5QA 1AE1A 5BNFA 1DHRA 4BNIA 1R0KA 1NAIA 1H2HA 3UCXA 1PEDA 3D4PA 5GZ3A 1EFLA 4E2XA 4CUJA 1Q0LA 1CQIA 3AI1A 3PWSA 3Q3CA 1E0DA 1XGKA 3NX4A 3COSA 3H65A 5G4KA 1R0SA 1ZSVA 4BKRA 1GZ4A 1U4SA 3JQ6A 1YJ8A 4GX0A 5KNLA 2QZ9A 3BMNB 5KIAA 3LT4A 4M1QA 3EZYA 4WKGA 4RLHA 4J7UA 1W0CA 2OZPA 1NQ5A 3HWRA 1R6DA 1XEAA 3OIGA 5L9AA 5JAIA 1C1DB 4CM9A 5CEJA 3HADA 3KV3O 2EV9A 2X9GA 3G3EA 1R15A 4D46A 1XDWA 2YW9A 1WMAA 1Y7TA 3C7AA 1E1KA 2P68A 3D3WB 4CLEA 3BHJA 5EJ2A 2DPGA 4CR8A 3BMQA 1U3TA 1VKOA 2C7VA 3AJRA 3JD0A 5EINA 3WBFA 3OICA 2Z1MA 1MFZA 2PTGA 4CQMA 5K6AC 3LZ6A 2CDAA 4Q9NA 3AI2A 1ENZA 2X23A 4AJ2A 4DLLA 3STHA 2HMUA 2NACA 1T1SA 4D44A 5BSEA 1SPXA 2UUOA 1PX0A 1UXGA 4D0RA 2ZCVA 3OJEA 3IMFA 3L4BA 1FDWA 4GAEA 3GVCA 2Y67A 3VDQA 2GASA 1E1LA 3A14A 4DYDA 5TIIA 4TVOA 3PK0A 1HF3A 4A0SA 2HRZA 4YJGB 3W4JA 1YDWA 2A94A 3ADPA 5EERA 4ZD6A 4PG6A 4DTIA 4CM3A 4DBVO 4E32A 3UAGA 5T8KC 3UHAA 5A04A 3DHNA 3OEWA 2I67A 4PG4A 1SBYA 4J9VA 1HL3A 1MGOA 3H9EO 4TSKA 5ICSA 4PZDA 4WNIA 1QP8A 1NWCA 1ENPA 5L7YA 2V6FA 3DBRB 3IUPA 2LDBA 3LT2A 1MFPA 3NDJA 1C0IA 4K6FA 4B7UA 3TSCA 3PFFA 4E12A 1FF9A 3PEFA 3TJRA 1ZK2A 3O38A 1ZMTA 4RDIA 1UJMA 2I66A 5CEEA 5KJFA 1AHHA 1WW8A 4NBUA 2GD1O 3KTDA 4ZQGA 4CLHA 1IULA 4BKOA 4LCJA 3H5RA 3NGXA 3NT4A 3PYLA 1EVJA 4J7XA 3Q9NA 3BTUA 4PLFA 3IKVA 3GG9A 5F5LA 1PS9A 4OOEA 4CM4B 4DRYA 2Y0EA 2EJVA 1H2BA 3HN2A 3Q11A 2YV3A 4NJMA 3PFWO 5DBGA 3JV7A 3K73O 3U4HA 4XB2A 3TPCA 4UAGA 5ICMA 2D3TA 5HS6A 4IPTA 2H63A 1PWZA 3EW7A 1LLDA 2O4UX 5IZCC 1WPQA 1WWKA 5TQVA 1PZEA 1Y8QB 3L0DA 2CSUA 5KCZA 3PHLA 4M49A 5A9TA 3LLSA 3QWFA 1AGNA 3HHPA 3KSUA 5FYDA 1UXHA 1RPNA 4E2WA 2I3AA 3KEOA 4Y67A 2GRAA 2FRDA 4YR9A 4XYLA 2BFPA 4EJMA 2P2SA 3R0IA 4F6CA 3JQAD 3X2EA 3WDSA 1X7HA 2DVMA 1PS0A 5IF3A 3ENKA 3OHSX 4OMUA 2VTEA 1U2GA 1PL8A 4BNHA 4EEZA 3DBLB 3V1TC 3ONDA 4M55A 1N9GA 3TQHA 4CMAA 4NBVA 3WLEA 1LLQA 4FGSA 3VZSA 1JA9A 3ICCA 4BKPA 1E3EA 5HWSA 5BQFA 4PLZA 1UH5A 3RI3A 4BNMA 3JQ9A 4CM8B 4YBZA 1LSJA 1LUAA 3ETGA 4ALMA 2BFMA 4I5FA 4ZU3A 1YS4A 5I7SA 5L53A 2CVOA 2DTEA 2VWHA 3H3JA 2IODA 2GZ3A 4F3YA 2VZ9A 3IC5A 1DOHA 5GMOA 3KB6A 4DYVA 2I3GA 4RGBA 5JO0A 1V35A 1R4NA 3FPCA 5FI3A 4CM1A 3AFNA 1DAOA 2GO1A 2BGKA 3OJ0A 2J3KA 3WIDA 1WZEA 1R12A 1ZEJA 4BNZA 2YUTA 2D59A 3L4SO 4D41A 3IUSA 3E1KA 3VKUA 2X1HA 4RO0A 2BRUA 3DQPA 3GQVA 1EVIA 3NTRA 1JTVA 5B37A 1WXDA 3UGKA 2UYYA 1JLLA 1ZH8A 2CF6A 3FTNA 1P9LA 1NQTA 3PJFA 5EPOA 3CMCO 1HT0A 1ISJA 3LSYA 3H6KA 1KEPA 2NV6A 1NWHA 3JYPA 4Z0HO 4G65A 3C1TA 1YL5A 1X13A 2WD8A 1HDZA 3DHYA 1LNQA 4Z3KA 4WLUA 3V5NA 4OGWA 1TT5A 3GPDG 4H16A 3F1KA 4PGFA 3BMOA 1NFRA 2Q46A 2RIRA 3DZHA 3HJAA 3KXDA 3HDHA 4BNGA 5IDWA 5LDHA 1B8PA 1YB4A 4L74A 2X8LA 4J49A 4JK3A 1ONOA 3TRIA 4HBGA 3PXXA 2OHXA 4G5HA 4R41A 1ZSYA 4M8SA 3DFZA 1PJ3A 3GGGA 3RKUA 3EVTA 1N1EA 4EUEA 2OGUA 4ZA2A 1LQUA 4EYEA 2Y68A 3CH6A 2VRCA 1G0OA 1EVYA 4UUPA 5IFLA 5COAA 3WNVA 3OJLA 3LT1A 4LSWA 3NYWA 1B8VA 1EEHA 3VOSA 1OZAA 3VDRA 5GZ1A 2VWQA 5I8ZA 5IJZA 1C0LA 5J23A 3SC4A 2VHVA 1ADGA 1RYEA 2X0RA 5I8WA 1NR7A 3RBZA 4P4NA 4YYZA 4D79A 4R01A 3ROKA 4BO4A 4BNVA 5DP1A 4FGWA 3PTZA 3E5MA 4CV2A 4L4RA 2A4KA 1HYEA 3CEAA 2OUIA 4PLYA 4XX0A 2HSDA 2DBZA 2AQKA 3NGLA 2EP5A 1NXQA 3OJFA 4FFOA 3QIVA 2ZYDA 4B7CA 1P44A 1V9LA 1YBMA 3WLFA 4QO8A 3JQAA 4XEHA 2OOSA 1XG5A 2FSVA 3GVXA 1GUZA 2HK9A 3ZWXA 3I4CA 4BVAA 2AEMA 1NVMB 2H9IA 3L77A 3OP4A 4WCFA 4BGUA 2QYSA 4R5HA 4YT5A 1QV6A 2DBQA 2YY7A 1WP4A 2Q2QA 4PN3A 3AUTA 1IYZA 3E8XA 2Q49A 3N7UA 1DJNA 2VNAA 2YFHA 3EYWA 4Y6RA 2PR2A 2EGHA 1BDBA 7ADHA 1DC3A 3AK4A 4RVSA 4AL4A 1BVRA 3GA0A 3JQFA 3NUGA 4OH1A 3AUUA 2AE1A 2W90A 4B8ZA 2ZJ1A 3FCOA 3GFBA 4Y98A 5EN4A 3DONA 1CETA 1D7OA 1LLUA 2X4GA 4XDZA 4RQTA 1E5LA 1DLJA 1QYVA 3AY6A 3DHEA 3GDGA 1K6IA 3BHMA 3GY0A 5T5QA 3RQSA 4ND5A 2HMSA 2EERA 1PL6A 1R4MB 4BNXA 1M6WA 1F17A 4O63O 4NG5A 1DPGA 1IHXA 4A5OA 4YVFA 1RM0A 1YXMA 1QSGA 4HV4A 1MXFA 3GGPA 4RF5A 1A71A 3VHRA 1B14A 1MLDA 3ZU5A 3PJEA 2C2YA 4LISA 4XRGA 1CJCA 3CE6A 2HMTA 4NPCA 3ROQA 4XWYA 1BXKA 1K2WA 1TT7A 3DOCA 3DOJA 2HCTA 5JLAA 3ASUA 4N18A 3DZGA 4ND1A 5DOVA 4I5GA 4U6QA 2NTJA 4ZICA 4NU5A 4DREA 3C8MA 3KSZO 2BGMA 1JQBA 5G4KB 3PQDA 3VVBA 1E3SA 4YWJA 3EC7A 4CM5A 2ZYGA 5DT9A 4E3ZA 5C37A 4H7PA 3KRTA 5A05A 4D3FA 3RKRA 2AA3A 4A27A 2P4HX 4AVYA 3ZN2A 4BNUA 5KTKA 4OXNA 2Z95A 3CUKA 2FY8A 2OMEA 2JD2A 4BGIA 1SEPA 2VYVD 4H3VA 3VZPA 1JU9A 1ZUD1 4JJGA 3BMCA 3FPLA 2B5WA 2HO5A 3C7DB 5KJEA 1U9JA 5F1OA 2B36A 1ONPA 1I30A 1YL6A 2B0JA 3MOGA 3NJ4A 1B16A 1UP6A 3D64A 3LT0A 3ZWMA 3RUEA 4L9RA 3PYXA 2JCYA 5EL0A 4QUKA 3TN7A 3LC7O 5HM8A 3BMQB 5A06A 3HE3A 2PA3A 4HKTA 1XELA 1CF2O 3U4CA 1O6ZA 4CQMB 4RL6A 3BTOA 3HUDA 4JJIA 4PLTA 3LF1A 3W4IA 3WQRA 1HYHA 3WNQA 4FIZA 3QVSA 5JMPA 4B4OA 4YDRA 1KVTA 1WZIA 4YJHB 4QT0A 5L45A 1O89A 4ZRNA 3INTA 1DIRA 4PLPA 2G17A 4PZCA 3KBOA 5IN5A 3N58A 2PGLA 1YBAA 2X0JA 3GN2A 2AHRA 2ZB3A 4IMPA 3DWFA 2ZB7A 2X0NA 4AICA 1AUPA 1C1XA 1S6YA 4IDFA 2VCYA 3IP3A 3UKOA 4C4OA 3RBVA 3JQ9C 1Q2XA 2D2IA 1A72A 3U62A 4CJXA 4W7HA 2FPIA 2QQ5A 3K5PA 4IQ8A 4MINA 3GAFA 3GEDA 1RWBA 2NLOA 1NVTA 3VZQA 3TL2A 5DCUA 2J5RA 4BHTA 2D8AA 3O26A 4FCCA 1SNYA 3UN1A 2OFPA 2BLLA 3GHYA 1HEUA 3JQ7A 3TZ6A 2YHUA 3DAGA 1BHSA 3GNQA 5G0VA 4BNFA 1HETA 4N54A 4RLSA 4CMIA 2NU7A 1X0VA 2W2LA 2PV7A 4KUEA 2E37A 4JN6B 2B69A 3AFMA 1QLHA 3SBOA 2C20A 3WGTA 1QYDA 2CDBA 2YHIA 3PWZA 3GZNB 5K9ZA 4RZHA 3L6OO 3PHJA 4E5KA 4GLLA 4HX5A 3F9IA 3C24A 1I32A 3DBVO 1E7WA 4IGEA 4NJMB 2YYYA 1N7GA 2E4AA 1OBFO 4MVJI 1DO8A 1TVEA 5KKAA 5LDGA 1UXKA 3HB5X 3MJEA 2GYYA 4E5PA 1XQ1A 2NU6A 1FDSA 1M2WA 5EQDA 3OQBA 4M86A 3W4KA 4YTEA 4CQLA 1GFSA 4UVDA 3I1JA 1JWBB 3PGJA 4PCVA 3NJ8A 4MVJM 4CL8A 4RORA 1A5ZA 1JN0A 3DMYA 4PG7A 4HFJA 3A28A 2Q4BA 2IYPA 3CIFA 2HLPA 1EDOA 3W6UA 5CDUA 2X5OA 4W82A 2IRWA 3QWBA 3A1NA 2AEJA 3INGA 1DIBA 2BELA 5JXWA 1NAHA 4BMVA 4E31A 4RF2A 2WTBA 1GCOA 2VZ8A 3WS7A 4OQZA 5IDXA 1FDVA 4PLWA 3WYEA 3WSVA 3V8BA 2AE2A 1CERA 2DFVA 4UUMA 2CZCA 4GWKA 4BQPA 1GQYA 1N9GB 3Q2KA 3TOXA 1TXGA 1H94A 1T24A 4FC6A 2VYVA 3QVOA 1ZMOA 4I9UA 4DPLA 2WD7A 3ZWNA 4B7XA 3ZCXA 3R3JA 3TZHA 4PLGA 3HN7A 1LEHA 3KHUA 1SO8A 1JW9B 1DRUA 1KY5A 3WX0A 1GY8A 2QYTA 1N5DA 1P3DA 1FDTA 1VM6A 4JLWA 2RAFA 4FFPA 2FWMX 1IUKA 3LU1A 1R4NB 4FJ0A 3ZGYA 1ENYA 1O95A 1X7GA 3SJUA 4XQCA 2I6TA 5JYDA 3H7AA 1ZBQA 1DHTA 4J91A 3CZMA 1ZXLA 1U7TA 3GR6A 3K8ZA 3JTMA 4BNYA 3DAFA 3IIEA 3ZH2A 4WCFC 1PZGA 2AEFA 1WDLA 2YQ4A 1D1SA 1K5HA 1Y6JA 1YONA 3ETDA 2Y1EA 3V2GA 4BNNA 1MG0A 2EJWA 2X6TA 3RC2A 1UP4A 2WYVA 1GYPA 1VJTA 2GNAA 5JE8A 2J6IA 4CMEC 4U6SA 5G0UA 1P31A 2B37A 5FWNA 4R16A 5DBIA 2DFDA 2VWGA 3BMOB 4JROA 2AG8A 4ZRMA 1P1FA 3BIOA 2PZKA 3NT5A 4YRBA 4BB5A 1NM5A 1DLIA 2NADA 2GR9A 3EY4A 4U7WA 4GGPA 4NMHA 3BA1A 4CMKA 1HLDA 5EESA 4LRSB 3RAJA 3ZU4A 3OH8A 2XXBA 1SOVA 4J1TA 1HE5A 4R69A 1NASA 3O03A 4BV8A 1V3TA 1XU7A 2BF7A 5TJHA 4CPDA 2FN7A 3ZU2A 2JD0A 2Q3EA 3GDOA 3GNSA 3P19A 1LU9A 4D43A 2P9EA 4BNWA 3IP1A 3PVZA 2HAEA 1KS9A 4BNKA 5C7OO 1L7EA 3ZW9A 4CMHA 3EDMA 4XZ3A 3E6AA 4O59O 5C3MA 4RVGA 4NFYA 3BTVA 1G0NA 4BNJA 4IDBA 1T1RA 2VT2A 1X15A 5A9RA 1K6JA 2CY0A 5L7TA 4UVEA 3NTOA 1Z74A 4IQ0A 4W6ZA 4RPLA 1HZZA 3KEQA 2NNLD 4A2CA 3E82A 1LX6A 3I9JA 5IDQA 1YE3A 3ZNOA 1VL6A 1DIHA 1EE9A 2XOXA 2H1SA 1CRWG 4GWGA 5JO9A 3RU9A 4WLNA 3ZNQA 5TC4A 1ISIA 2OBNA 1E7SA 1AXGA 2X5KO 3JQAB 4DMLA 4MJLA 4NIMA 5I9NA 4MKZA 5FEUA 1YH3A 3RD5A 3RIHA 1Z7BA 2I5PO 4WCFB 2FMUA 5BNIA 2GF2A 3KLMX 3ROMA 1H6CA 1UXIA 4MP8A 1HDOA 1HDCA 2VNSA 4IXWA 4D7AA 2BMAA 2RCYA 3KUXA 1B26A 4CLXA 3P2YA 3Q0EA 4XRRA 1EK6A 3OEYA 3ZWAA 4NDNE 3JQBA 3I83A 3RC1A 4KWHA 5F1PA 3FBGA 4YAEA 5ER6A 1E7MA 1K0UA 2CVZA 2JFHA 1KEUA 1PSDA 4IUYA 4M54A 1P74A 3C1AA 3FR8A 1LDMA 3VH4A 4S3MA 1T2EA 1WDMA 1Z75A 4MVJH 1P0CA 4XIYA 3UVEA 3DTTA 1DFHA 2O3TA 5CG2A 2JFGA 2V6BA 3A9WA 3BHIA 2JCVA 1IY8A 3U3XA 1M75A 4OAQA 3RJ5A 4UEJA 1IZ9A 4RF3A 3M1LA 3RJ9A 5A3VA 1IZ0A 1PQUA 2AXQA 3ZV3A 4ALIA 4YACA 4INAA 5HA5A 1H0KA 3FNFA 3GLQA 1I3MA 4NBTA 4Q3EA 3C7CB 5HBRA 4YB8A 2X7HA 1BW9A 1PJ4A 5I7FA 1NR1A 4BL5A 1XYGA 3VZRA 4XGKA 4EGFA 2EG9A 4OO3A 1I3KA 5L3ZA 2ILTA 1D1TA 1LXCA 2CD9A 4TRNA 4CUKA 1CIVA 1T4BA 4GPD1 3NT2A 1LQTA 1T26A 2X58A 3QWAA 4GLOA 4UULA 4N7RA 3FTPA 5JS6A 3KYCA 4WOJA 2JJYA 2FZEA 1PJQA 1YB5A 2YV2A 4EW6A 2EXXA 1PR9A 5CDSA 2CFCA 1K6XA 1U5AA 4A73A 1NNUA 4XB1A 4YPOA 3BMCB 1BRMA 3F5QA 2Q45A 1L1FA 3JQGA 3ZHXA 5C7LO 4R5MA 2WMDA 1I33A 3WGIA 1PJLA 5A4DA 1U2DA 5AXAA 2VRCD 5C7IO 1MV8A 1U4OA 4GQAA 2O3JA 1GQQA 4WEQA 4E6PA 1YGYA 3HSKA 4HNGA 2GN4A 2BHLA 1VL8A 4KUGA 5IXSA 4I5DA 3AM3A 5JCJA 3PGXA 4MIEA 1CEQA 3VPHA 3DBHB 4WASA 5AVOA 4II3A 1ULSA 3JD4A 3WTCA 2R00A 1RM4A 2NQ8A 2NU8A 3MEQA 4R3WA 4U0JA 3TFQA 4RVHA 1RKXA 1EQ2A 2DKNA 2I65A 4FS3A 3H3FA 1GYQA 3WGHA 3DXFA 4B4WA 2DPHA 3QVXA 4B3IA 3AUSA 3IKTA 4ESOA 4NK4A 4B8WA 2VRBA 4FJ2A 3LQFA 1J49A 1C0PA 4K1LA 5L51A 4HFRA 4JNKA 2X9VA 4J1SA 2UAGA 4IJUA 3D4OA 2B4QA 3PZRA 3F47A 4OKNA 5EQFA 2FR1A 4JBGA 4PLVA 1N8KA 2JKVA 5B12A 3JCZA 3K92A 4IJWA 2HJSA 1YQGA 1B7GO 2H6EA 2YDYA 3WICA 3Q6IA 1MA0A 1PJBA 4UVGA 4I9NA 1FK8A 2GCGA 1TB4A 4WK6A 1ISHA 4L75A 3WXBA 3WWZA 1PR3A 4WLFA 3TNLA 3RUIA 4GMFA 4RVFA 3F6YA 1U28A 3I9LA 3LDHA 4A03A 4ALKA 5A5FA 2CUKA 2OORA 4IGFA 2HKIA 1RYDA 5CPBA 4ALJA 3P7MA 3UOGA 1Q7GA 2YHIB 4E5MA 3GUYA 3ST7A 1DDOA 2VHXA 4BKQA 4ZN6A 3AM5A 2IXAA 4EJ0A 2AG5A 1NFFA 4E21A 2ZATA 2WE7A 1DJQA 4MIYA 4WLVA 2FHSA 2OP1A 3MOIA 3R1IA 3TOZA 4OQYA 3RUAA 4FD3A 2NVUA 2B5VA 1QXSA 2D4AA 2VTDA 4OM8A 4CLDA 5JW6A 3PLNA 2UDPA 4KTVE 4ZJUA 4Q3NA 3WJ7A 5BSHA 4DUPA 4E5NA 4MP6A 1UR5A 4JCOA 2A9FA 2D0IA 3QWHA 1ZIDA 1JVSA 4XQEA 4P4LA 3O8QA 2ZQYA 4TVBA 1IOLA 5BR7A 1SC6A 4R9RA 4MVJE 3S1LA 2RH8A 3VH2A 3AW9A 2JAPA 1P1RA 3BTSA 4LVUA 5F5NA 1GUFA 1IHYA 1NQAO 4UEOA 5AXCA 1I01A 3ENNA 3NDRA 1TLTA 1F12A 4O5OA 4EEXA 1HE2A 4DC1A 3GN1A 3VTZA 3S2GA 3RFTA 3TL3A 4BIIA 1ONNA 4BO0A 4J4BA 5ILOA 4EBFA 1GU7A 1I8TA 2J8ZA 2A35A 3JQ8B 4JP2A 3H9JA 3DMTA 2JD1A 3H2SA 2NVBA 2WD7B 5IZ4A 1U3WA 5JAZA 3RSHA 2BKAA 3QJ5A 4TRMA 3JQCA 1SCUA 1ZO8A 3GUCA 3JYQA 4UVIA 1YDEA 4ALNA 2EGGA 4IDAA 2IZZA 1W6UA 2O3QA 1Q7CA 3E48A 4RVDA 3T4XA 3GRPA 3D0OA 4YAJA 1UXJA 4OJNA 3WGYA 4N5LA 1AXEA 2DBVO 3SXPA 2EWMA 4BO7A 4K9DA 5TX7A 1BXGA 5JNLA 3TF5A 4WGGA 4G2NA 3VPXA 1P1JA 4PRKA 4LVCA 3HG7A 1K3TA 2TMDA 2WSBA 5CPFA 4PLCA 2GGSA 2Q2VA 1JKIA 4IDEA 3KETA 3PLRA 3U0BA 3FNGA 3E18A 4NFHA 1P45A 3GGOA 3GVIA 4CR7A 1GV1A 3IQDB 3ROPA 2C5AA 2BD0A 3SX2A 3DC2A 3MWEB 3Q2IA 5JSFA 4LRTB 5DBFA 2Q2WA 5T67A 5B1YA 3KM0A 1I2CA 2DQ4A 3SLKA 3JQBC 5U1PA 1NQOA 1GCUA 1Y8RA 1J5PA 1VE9A 3AUAA 3EMKA 2C0CA 4YAGA 4IDGA 4IQGA 2VHZA 1GUYA 4AJ1A 4KDEA 4ITUA 7MDHA 3BMNA 4KTTE 1V3UA 3F46A 2W2LD 3QP9A 4ZQEA 2GZ2A 4PZEA 3L6DA 1PJTA 1ISGA 3OA0A 4E13A 3L4BC 1QORA 1ZW1A 3W8EA 1KBZA 4HFMA 2D5AA 2C82A 2O48X 3NEPX 3FNHA 2GN8A 1BSVA 5AOVA 4ZQFA 1LDBA 1VJ0A 3JD3A 4J16A 5KJ1A 2Z5LA 4Z9FA 4MP3A 5TSDA 4ZHSA 2X0IA 1LDGA 3W6ZA 4AFNA 1GPJA 3FF4A 1XHLA 4EITA 2NVWA 4PLHA 1C0KA 2B4RO 3WBBA 1KIFA 4WLOA 4OKIA 1EZ4A 4OHUA 5TF4A 1LDNA 1PJCA 3RVDA 3TZCA 1GAEO 4OXYA 5G0TA 1YJQA 4D3DA 2D1YA 4BO1A 4N5NA 1KEWA 1Z6ZA 1ZFNA 1IE3A 3B1FA 4GH5A 4L73A 1PQWA 5KVSA 4YJGA 4WPGA 4C7KA 2FP4A 2ZYAA 4YJFA 3JQDA 1LRKA 4CMJA 1DB3A 1I5RA 2Y1OA 2IEDA 3KYBA 1H6AA 1WAMA 3GPIA 2IZ1A 1D8AA 4IM7A 4AJOA 3OFSA 3PHIA 1XSEA 4YT4A 1JAYA 1DFGA 1PTJA 3MJTA 3CKYA 3QV1A 3ETEA 4L4SA 3OIFA 2PGDA 2DC1A 2Y1DA 4DBZA 9LDBA 4GX1A 2W2KA 3F4BA 3PIIA 1PGPA 2C7GA 1HE4A 2FSSA 3RU7A 3IJPA 1B2LA 5ENVA 1CDOA 3O4RA 1PS8A 2O23A 1NPDA 2R00C 3NRCA 2WEKA 3MZ0A 4DQXA 5FF9A 4JIGA 1A27A 3DZKA 5DF1A 4Z3DA 2P91A 4XYMA 3GZ4A 4GKBA 1MXHA 1VLLA 2Q1WA 2VUSA 3I23A 5ITVA 3DAPA 4K6CA 3ZWYA 4TQGA 4CM4A 3RC7A 4I08A 5H82A 2J3IA 4P4GA 3I5MA 5U4QA 2PZLA 2XXJA 4IY1A 1U8FO 2ZJ0A 1UAGA 2AW5A 2CVQA 1O5IA 1KVSA 3ANNA 2ZB8A 1ZK3A 1JAXA 2XF8A 3RWBA 1ZSNA 1H9BA 3BZUA 2G5CA 3ZI0A 1LSUA 3S55A 2GERA 3KO8A 3DTYA 3U09A 1Y8QA 1QMGA 2ZB4A 3JSAA 2JHGA 4PFJA 3AU9A 4AJEA 2PLAA 5ILGA 4J1NA 1IL0A 1G1AA 4BUCA 2DAPA 4CMGA 2RHRA 2ZTUA 2GLXA 3MTJA 5GY7A 4FSHA 1PGNA 1BTOA 3RROA 3AY7A 1GD1O 4TROA 4JP3A 1E3WA 1Z7EA 4QEDA 1E5QA 4DLAA 1NPTO 3KYCB 3B6ZA 4IZHA 3ULKA 1Q7BA 4AJLA 1Y9AA 4HWKA 4RQUA 4YEDA 4LW8A 4DWVA 4I5EA 4CLOA 5A02A 1NVGA 4E4YA 1KYQA 4Q39A 5K0ZA 4GI2A 2ET6A 2Y1GA 3I9NA 5BSGA 1A4UA 3M1AA 3SLGA 3OA2A 4AJIA 2O3RA 1GL3A 3RFXA 2NSDA 5IN4A 3JQGB 4NU6A 3U4DA 3QLJA 1V3VA 3OSUA 2Z1NA 3W1VA 4BO5A 3K2EA 3WWYA 3CPSA 4Q3DA 4CM8A 1HYGA 2HQ1A 1QYWA 1DBVO 1P0FA 2E48A 1F8GA 2Y99A 3FR7A 5CP8A 3H4VA 4O1MA 1UDCA 3H9QA 5B4TA 3NDIA 4IDDA 1RM3A 2Y0CA 5TS3A 3SJ7A 1N1GA 2VHYA 3QA9A 4RV9A 1E3LA 5JDCA 1P77A 5CDGA 4DIFA 4CMCA 1OFGA 3AOEA 2OBYA 2O3UA 4J9UE 4FPXA 1EK5A 2O3SA 4NBRA 5U9CA 5COQA 4J6FA 2QHXA 4CODB 4WE3A 3OMLA 1EDZA 1NFQA 2O7QA 3GNTA 5LCXA 2FZWA 4CR6A 2P5YA 3IAHA 1T2CA 1YO6A 2Y1CA 4J2OA 3OBBA 5CDYA 1Z82A 3GH3A 4KDFA 2GSDA 4W9NA 1MB4A 4OSOA 4M89A 4U0KA 5JDIA 1LDYA 2BFAA 1DIGA 1LC0A 2Q1UA 5KOIA 1YVEI 1YB1A 5L40A 4MVJG 4DPKA 1ISFA 4FDAA 3GVHA 1U7HA 3LC2O 4Z6KA 3ZV4A 4PIVA 3D7LA 5LC1A 1E92A 3VH3A 3ZV5A 2O4CA 1QYXA 3ZNNA 3PRJA 2WYUA 4E0BA 3RCBA 3IOYA 4O0LA 5FFFA 2XAAA 3N74A 4MO2A 2HRBA 2HUNA 1EBFA 1HE3A 4WJZA 4E30A 5THKA 1ADFA 1EFKA 2V6GA 3ONEA 2R6JA 3SEFA 1MUUA 2CMDA 1UP7A 2WWRA 2BGLA 4DIBA 2TMGA 1E3IA 3JYOA 5CEFA 5JCXA 1HZJA 3D5QA 1F14A 2NVUB 4C7JA 1Y5RA 1U3VA 5ES3A 1ZXBA 2C29D 3BXXA 3ON5A 2G0TA 4A7PA 5COBA 4YT2A 1I10A 3AU8A 4OOFA 4OYRA 1M66A 2DBRA 4JJFA 1LRJA 1PZFA 1DC6A 1NYTA 4XGNA 5DP2A 4IJVA 3PWKA 1IB6A 3OM9A 1YOVA 4JBHA 3T4EA 4P22A 4B4VA 5I9LA 4R1UA 1LC3A 1TT5B 3O8QB 2ZQZA 4MVJP 2VYND 1GDHA 1E6UA 1N2SA 1W4ZA 3WG9A 4K28A 3JQFC 1Q0QA 3HFSA 1EMDA 2GPTA 2GZ1A 3MTGA 1I24A 1U5CA 4DPMA 4WECA 4YJDA 2C54A 4B4UA 2C5EA 2PD3A 1LDEA 2V7PA 4AJHA 4QO7A 1PGJA 3H2ZA 1ADBA 1QLJA 2QX7A 4MOWA 2HMWA 3KYDA 2WM3A 1UUFA 5CHEA 2GDZA 5AXDA 8LDHA 1T2FA 2JFFA 4II2A 1X7DA 2P9CA 3PHHA 4OIMA 3FWNA 1DFIA 4MVJA 1PJSA 4YT8A 2EW8A 3MJVA 1J0XO 5F1KA 1HWYA 3OECA 4HUJA 3RUFA 1N7HA 3V2HA 4BV9A 4IZIA 4GSLA 1PGQA 3G17A 3VPSA 5JCJD 3UCFA 4TZTA 5AYVA 1X1EA 3B1KA 3WGZA 3DDNA 3FWZA 2PNFA 3I6QA 4A26A 1A9ZA 2W98A 5BSFA 1KC3A 4QFDA 5JY1A 2FR0A 3GMSA 2OL4A 3HDJA 3U49A 2X86A 3NKLA 1BXGB 1BMDA 3PDUA 2HK7A 1OOEA 3M2TA 1NHWA 1H93A 4TZKA 4B79A 4R4JA 3R6DA 2PK3A 4G81A 4ZGWA 4L8VA 3PPIA 3WB9A 2YJZA 3GFGA 1HDYA 4XDYA 3WMWA 3KZVA 3G1UA 4FR5A 4KWIA 1EBUA 8ADHA 5JC8A 3DFUA 5TT0A 4AJJA 2D5CA 3GMDA 3B1JA 5GZ6A 1I3NA 3C85A 3G1TA 3PI7A 1Y8RB 1CQJA 1V6AA 4E2ZA 1IPFA 4IS3A 3WFJA 4P8RA 2VWPA 4FJ1A 4PG5A 1NPYA 4U5QA 1X0XA 3HDQA 4ONEA 4BO6A 4YRAA 2EHDA 1YKFA 2B35A 2IEBA 3UCEA 1H6DA 2YZ7A 3GT0A 3K96A 3FHLA 3I9MA 4CM6A 2ZIZA 5DCWA 4QQRA 5H83A 4FOSA 4RPGA 3HB4X 1ZK1A 3QQPA 4FFMA 1CWUA 4I1IA 5G2OA 3WGQA 3GAZA 4RVUA 3UXYA 4UREA 2RH4A 1GV0A 4Z0PA 3KLPX 1A7KA 1GZ6A 3C1OA 3WQQA 1TEHA 2QW8A 5B4UA 1A4IA 5DOZA 4KQXA 2WDZA 5DNAA 1GZ3A 3GHHA 3UUWA 2Y05A 2Y66A 1Y1PA 2IDZA 4WOKA 2DUWA 3T7CA 4JBIA 3FRJA 2H5LA 5A5EA 3ORFA 2C59A 3F5SA 4K26A 4JGBA 1JDJA 4FFNA 2FR8A 3Q9UA 3GDFA 1MG5A 1Z45A 4GL4A 4BQRA 4CV3A 3H8VA 4IXTA 4WUVA 3EUWA 5K6AA 4DLBA 1PU2A 3I6IA 4M87A 3AY3A 4YJHA 2P4QA 4PVCA 4QFCA 5I7VA 4UUOA 2PKQP 4CLRA 2QRLA 4J2HA 2VYNA 1ADCA 3R3SA 5IG2A 1E7QA 3B20A 2VQ3A 4IJKA 4Q3CA 4YJFB 4XA8A 1ZNQO 1E3JA 4DGSA 2VZ0A 2UUPA 1WVGA 1O0SA 3T7EA 1O8CA 3H9GA 4R9SA 4BMSA
chains in the Genus database with same CATH superfamily
5CVDA 1QRRA 3F3MA 1KETA 4JNCA 4O8ZA 1ATIA 1DWOA 3DOOA 3L7KA 1Z7WA 5DB4A 4NWIA 4E5YA 1BVUA 4RD6A 4RGQA 4FOOA 1EBBA 3NAQA 4YQZA 2PUHA 1Z4QA 1MN6A 3QU9A 1TFUA 1X39A 4G1EB 1AHIA 2GRUA 2I34A 2WYWA 4XFKA 5FBWB 3F8WA 4AG3A 3HM9A 2CFTA 4BFLA 4FHGA 3EH1A 4IHAA 4IVNA 1A1VA 1RXIA 1F4VA 2ZU6A 4OQXA 1UZLA 2PKEA 3E3NA 1RRMA 3D4IA 3GW8A 2FPPA 2HPHA 3LFHA 1BE1A 1I80A 1N2IA 2AOWA 3NB0A 3U3JA 1GL6A 1O6BA 1ORRA 2PV0A 1L1EA 2GEFA 1ZKMA 4YGYA 3VC7A 3SYMA 1IDOA 1LPOA 5CFLA 3MIZA 1AMOA 1MRZA 1XJWA 1QO0D 1XRPA 1Z5ZA 2GWHA 3A1CA 4KQ6A 1T3GA 4J0CA 5IAEA 5I7UA 3EPLA 4W5WA 3C3EA 4HPWA 1FP2A 3KR1A 4BWFB 5KYTA 2UYQA 1BS9A 4J0FA 3KSRA 4UPVA 4OU5A 1LPNA 2JL1A 3PX2A 4QDOA 3QRWA 4QECA 2RI0A 3IP6A 1SXJA 2VUTA 4AK9A 5CDHA 3LPMA 3VXKA 4J8PA 4E07A 5A4MS 1XNRB 4WZ6A 3ZW8A 4AURA 4GM4A 1GVNB 3A37A 2LCIA 1ZQ9A 3KEFA 3WYDA 4H27A 4JLBA 5T41A 4EP1A 1QKKA 2Q99A 1II0A 3CBQA 3AEUB 2ZJ3A 3KSDO 4OBEA 2XDYA 2XZTA 1YWGO 1ZIOA 4NH0A 4XM1A 2PZJA 1E1MA 2YBEA 5HJ5A 2VPYA 3P5SA 3NASA 4Y0NA 4NULA 1GEEA 5HIMA 4M37A 3IKJA 2OV1A 2Q1TA 5CCBA 2WSSD 3Q3HA 3TSZA 2WIBA 4EHLA 3HP7A 5JNSA 3OIYA 3HDGA 3HR7A 2NU7B 1H2WA 2WLTA 2VDRB 5EIOA 4HJRA 4B71A 1KE2A 4ND2A 3BWVA 1X7WA 2XKBA 2ACEA 5FOXA 1KK1A 1OGJA 4R9NA 4WBXC 3DVQX 1O9HA 2B7BA 5IFKA 2VK2A 3ILVA 1VPDA 3MCUA 2HU2A 1SOUA 3K15A 1XQXA 1ETHA 3K9WA 3RVNA 1CZRA 4CG2A 4GIBA 4MS3B 5C1DA 2JIRA 4LOJA 5CFPA 5K0TA 2Q0QA 1TU3A 1KEEA 2BE7A 1TVCA 2AFIA 2P9GA 2Q5FA 3P2OA 1RWQA 3VMFA 1J09A 3ZKWB 1I0ZA 1F06A 1FFWA 1OCEA 2GAJA 2MINB 1ULZA 4IIJB 4UHBA 1A8QA 4LDAA 4BB9A 1NQXA 3BVPA 3KYJB 3X1KA 2EDAA 4UCFA 1QFXA 2VO1A 4KR3A 4HUTA 3GLGB 1NC3A 3UPTA 4X1IB 2CFIA 1LBIA 1EE2A 1Z33A 3W5CA 1F60A 2X2EA 4B6QA 2N42A 2R6GA 5EMNA 5GOZA 2H2FA 4EB6A 3GLRA 1KL7A 1TZMA 1V16A 3BGSA 4YLGA 1PWHA 4RMJA 1W48A 4UU0A 4GC9A 1DRJA 3LK6A 1WD5A 1D6MA 5DHAA 1NGSA 1T8SA 2AG1A 3K1TA 4HN2A 4URHA 5KVVA 2CNKA 5ADVA 2RGCA 1KNXA 3IV6A 3SDSA 3UFXA 3WLMA 4X20B 2OGTA 4BWGA 2E1PA 5IVPA 1W73A 3DZJA 4D92A 1AN9A 1FVHA 1NKSA 3AZPA 4R84A 2Q1XA 5H1YA 3TW8B 5JFOA 1GNSA 2R85A 2C97A 3SVTA 1D9XA 3LAWA 2PX0A 2FPMA 1SELA 1Y34E 2NYAA 2HA3A 3FCUB 5G0WA 5C5IA 2GZSA 2PWYA 1A9QA 3GLVA 1JJ7A 4UHKA 3TIGA 2NUAA 4D0SA 5IUJC 3MYYA 4D97A 1N92A 2VJPA 4WAUA 3D3EA 3DD5A 1ZVMA 1T29A 4UJ3A 2ODEA 4XIJA 5CM2Z 1KEVA 4FYMA 4ZCTA 2YOGA 1CW2B 1HDEA 3IQHX 3ZCQA 1MGPA 3OURA 2ZRQA 3UWOA 5I4KA 5L4NA 3C98A 2WG0A 3A2LA 3OMWA 1VJCA 4D45A 1W2GA 5SYAA 1DKLA 3CURA 4X8HA 1CUVA 5EIBD 1LSOA 1P1KA 1TU4A 2EBFX 2P8JA 4UTNA 2OZKA 3H5VA 3HR4A 4Q00A 5J63A 1P80A 3TK1A 1U1GA 1Z2AA 4ZEOA 4LK3A 3DO5A 1GSHA 3N2KB 3CEJA 2LE0A 1IPEA 3DJFA 3ZDAA 3W78A 5JROA 1FJ2A 4HNSA 5DTMA 3LF2A 4AQDA 3N3AC 3GCXA 5BW8A 1E61A 2PKRA 4DMRA 5FL3A 2JH8A 1D4ZA 2XTJA 1HXHA 3C8HA 4N8EA 5JJKA 3HBJA 2HFKA 2PD6A 4G6ZA 1B6RA 4H18A 2ORYA 2R60A 3WLAA 3WJAA 5HXAA 2ZDQA 3QVWA 2ZJ2A 3H16A 4ZVUA 2OXIA 1ORWA 4F8JA 1GTG1 2Z2ZA 4G4SO 2HDHA 2PCLA 4FC7A 3GFFA 5JAMA 3MS2A 3LKZA 1FBNA 3M6MD 1IEWA 1M2KA 1Z29A 2M32A 2OGZA 1G1MA 1YOVB 1DTWA 5CBKA 3ZGZA 1UPTA 3DE5X 1OI2A 2JCSA 3SN6A 3HO6A 4Z5XA 1DXYA 3W2TA 2VIIA 2F1JA 2KQUA 4IS2A 5CGZA 2OM2A 1A7UA 1PQPA 3CGWA 4YV0A 2H48A 2WR8A 1P1IA 4DR6B 3ZWPA 2AKEA 1R1DA 4FBMA 4MW0A 2AOTA 3C16C 3OU6A 3K71B 2YBDA 2C5FA 2LZ0A 2PKQO 2HA5A 4HZGA 1P0PA 4Y6OA 3D1LA 5JD3A 5TT1A 4ER5A 5JANA 1K8ZB 1VYTA 1GR0A 4HDSB 1ZA2A 3HQ4O 3OQ1A 2Q9UA 2WSSA 4MLPA 3V7WA 4KXUA 2CLIB 1EUDA 4ZOLA 4Z51A 1QE3A 2P79A 3LUKA 2D4HA 5ELLA 3H6HA 4HDMA 2AQHA 2J46A 1U8CB 3CYFA 5DNUA 4RPKA 1WHSB 5T64A 2ZJAA 2RMKA 4BX3A 5CAEA 2SNIE 1PRYA 5A03A 2RHCA 1MDFA 1XDSA 4NYIR 1WXIA 5IAOA 1A4XA 3WA7A 1EQAA 4F3RA 4A23A 3CNEA 4DVJA 4F6LA 1MA3A 3EBLA 1V39A 4HMQA 1MOSA 4PONA 3UA3A 1JQAA 1MB2A 1WCXA 1J2TA 4L76A 4F2GA 1O58A 1G8FA 3UK1A 3SEQA 3WAGA 2I71A 4I9GA 5L95A 1SUAA 5BVGB 1QFYA 1K9SA 4EUFA 3LKVA 4MYUA 1HFWA 5BW6B 3ZY2A 5JQGA 2Q5HA 1F1BA 1FUKA 4JDPA 1TW2A 2Y1XA 2TMKA 5F7JA 1RW4A 1U1FA 2XWPA 4YRZA 3BC1A 4QAQA 2PH5A 2DYKA 2Q5JA 4NCNA 2ZGVA 1L7QA 1WPXA 2G25A 4IX9A 4G25A 2VPWA 4BFSA 4GGOA 5HRCA 2ZIUB 1J99A 2P6MA 3MQ2A 4JELA 4Q9KA 1XCBA 5ARBA 5HHTA 3DNPA 1NBMD 3KJGA 3L02A 4ZT4A 4W7SA 3H9BA 2I6QA 4YCBA 1YDMA 1C7JA 1XIVA 2GM3A 1SKYB 5KOHA 4GW3A 4I1VA 3RUCA 3LYLA 3LOQA 4DT1A 3V00A 3P45A 3TTTA 1RJWA 1EX6A 2CLFB 1T91A 2V65A 4QYTA 2QTAA 2E1RA 2GKSA 4XPZA 3T5AA 1E1CB 3W8FA 4MROA 2UVDA 4HBZA 3UW1A 4CV0A 4J0JA 2F1HA 2O8EB 2CXXA 2MJLA 3QMVA 4TLCA 2QRJA 2XA1A 3TTXA 3REOA 4QDJA 4DLUA 4X64B 4TWJA 4W4TA 2XGJA 3V8PA 4LBZA 4Q5IA 4YMUA 3Q40A 5BSWA 4U2GA 4BLRA 1WDKA 2N9UA 3L04A 2Z6AA 4LZWA 4IBOA 3FDFA 3PXUA 5LA6F 5C8YB 2AF3C 2YVAA 4KHZA 4IJMA 1M2NA 5DK6A 4NQRA 5DEOA 3CT4A 3CLHA 5AM0A 2O6LA 2XTAA 1WCV1 4XCQA 3LM8A 2HCBA 1AS3A 4KQWA 3WJ1A 2GXUA 3L0OA 1E2IA 3AVYA 1WZ2A 4OQFA 5DCYA 2IHBA 2G9UA 1AK1A 1N1DA 1P0MA 3D3NA 2AI3A 1R74A 2PXCA 2RCNA 3CPJB 4FFBA 4IF6A 4AW9A 4INJA 1A7AA 1GZUA 4KL8S 3VAZA 1VSVA 2V4UA 2HO4A 4JLPA 4WY8A 3LY5A 1W5TA 1H69A 1ZR4A 1WVIA 3E9EA 4OA5A 2A92A 1NP7A 2NZXA 1E0JA 1WOYA 3DEAA 4EG5A 5IVDA 4EYOA 5FUXA 4BRUA 1PTKA 3KPVA 1M8PA 1QF7A 2Q5QA 3FI9A 5DSZA 3DAYA 1GKUB 3U7EB 1ORHA 1YB6A 3LX6A 2BZGA 1U8AA 1WW2A 1ZEMA 3WLNA 2CE7A 4BLVA 5AI6A 1UEJA 3FTEA 3DKVA 3DM9B 3C41J 4IWNA 1DKQA 1M3SA 1W4AA 5FBRB 4Q15A 2FUNB 3QXGA 4Q1DA 4TRRA 2EX4A 3C4VA 4XCVA 4ZALA 5L4SA 1SIBE 5LOVF 3VPFA 1MAUA 4ZOQI 5D3MB 1IAVA 3VU0A 2V5UA 3E9QA 2BI7A 1E2DA 1XJQA 2FEOA 4HRAA 4P36A 1B6GA 3HCEA 3IP9A 2YCLA 3I9FA 4QEKA 3VR4H 3EGCA 6LDHA 1HNZB 1WXHA 2AX3A 4BZPA 2HRCA 5ALTA 1N5OX 1JKMA 1XA0A 3EZNA 2ZI9A 4MDHA 4MQBA 3UMSA 5A0VA 2HRRA 4OB7A 4C0XA 1P75A 4CIYA 4LG1A 3AWDA 1NVBA 5J4VA 5K6RA 1JG3A 5EMHA 5FUVA 2YYZA 2HT6A 4NHEA 3ONFA 4ZT6A 2W2VA 4LUCA 2PE5A 2XCRB 4KRGA 2HIMA 2YWDA 5I9MA 3UJ3X 2B30A 1AURA 3I9OA 4IKEA 2NU9A 3ROEA 2Y4OA 3S27A 3NRBA 4FB5A 3BT7A 3DBLA 5BT8A 1K8QA 1P33A 1PWXA 4PZUA 4DC0A 16PKA 1U2RA 2R2GA 2AG6A 2V7BA 4HGRA 4E5SA 4WZBB 3S2FA 5CA0B 3UUEA 3R8CA 1TZJA 4R2IA 1E99A 3IL2A 3Q72A 1TM4E 4FSDA 2BP7A 4BUJA 2BFOA 2DHQA 4M0DA 3ZBTA 4XQGA 1K4KA 4ROSA 4DBLE 4QXRA 3PSAA 1ZJZA 3VKVA 5MF6A 3IYLW 4CCAA 4N39A 3KTAA 4D9IA 1AF7A 1BCSA 1JKJB 2H2IA 4RF4A 5DKFA 1BS2A 2YICA 1MX3A 3NKVA 3GEGA 5MDHA 2EZ9A 4RADA 4WCDA 4GSKA 3ZGOA 3PITA 1AV6A 2UXDB 5A6VA 1KZGB 2P2ZA 3DOEA 3HJNA 4LRYA 4F8EA 3UJ6A 3RBXA 4KX5A 4DA0A 3BSSA 3WYCA 4J90A 1QS0A 3NI2A 4FNMA 2GVNA 5A2GA 7YASA 1YUMA 3EXFA 1KC1A 1U9CA 2PD4A 5DRTA 5A2QA 2CUNA 1L7DA 4U5XA 5H81A 1YQTA 2UU9B 1OB2A 1NBMA 1SXIA 3Q9SA 1M73E 5ECWA 1YVDA 2B4AA 2IXTA 1TI7A 5BWBA 3UPUA 1ZOOA 2Q5LA 2ON6A 4OBWA 4YA6A 3DMTC 4CL3A 4YR7A 4TMVA 4IHQA 4S0XA 5JXIA 4Z4IA 3DAOA 3SKVA 2OQ2A 3ZNPA 5AQ1A 1PNVA 3P2EA 3PR3A 3R7AA 5DLYA 5I48A 4AP6A 3ZCUA 3GOHA 4Q9LA 3BL8A 2XQFA 5JPIA 4JZYA 1AKMA 3GLIA 2ADMA 2X5NA 2OMKA 2IZOA 1SCQA 5D7BA 4C5AA 4A6EA 3BZWA 1UKYA 5HKKD 2Z0MA 4XUCA 1DXQA 5EXPA 2CKDA 5D00A 3UT5B 3FPKA 4UVHA 2ZRKA 2K7FA 2C1EA 2ODNA 3N2LA 4HVAA 3V4SA 1WLYA 4NENB 4OJMX 5ADUS 5KQGA 3K31A 4UNRA 2G80A 5C5EA 2KMLA 1Q15A 2EZ8A 1TO2E 1JHYA 1Z08A 2LDXA 4TLBA 1JI0A 1WIWA 2ZRNA 4DXHA 5KWEA 2XXAB 5G4LA 3KD2A 3WK6A 5KSYA 1XB2A 2HMYB 3Q0TA 3U60B 3N75A 1QG2A 4UHEA 3LC1O 3ZWCA 3JQ8A 4L4XA 3C6QA 4UPDA 5E6SA 3TFWA 2PU7A 4KQFA 1DG9A 4RSHA 5DX8A 4YQEA 1W30A 1H9AA 1DAPA 2RAVA 3HS3A 3VPGA 1UPCA 3A6GA 1REQA 1WMBA 4CMBA 4XD2A 5CIWA 3BQ9A 1JB9A 2Q41A 3PICA 4V2IA 4Y6QA 3TSOA 4OTZA 3C15C 5C4GB 4LRUA 4QX6A 4B3HA 2IHUA 4MV7A 1PFUA 4JH0A 5BVHB 3MBKA 4GOMD 5B64A 2GYUA 2J1LA 4F3NA 4B3MB 1HRDA 1FP4B 2BFFA 3UKJA 1H3EA 1SXPA 4BGVA 2P75A 4Q7KA 2GK6A 2C8JA 2NXEA 2VAVA 2VP4A 5DDIP 4Z9AA 5EFOA 5F3DA 2XUKA 3MIIA 4MVJF 3AESA 2DJIA 4IF4A 1XHFA 4P92A 4IIHA 5BURA 1KYIA 2QGNA 1KERA 1V8OA 3WRXC 3GLFE 2L42A 4UE6A 1J00A 1MOPA 1X3SA 4Q3AA 3RRBA 4TM8A 5AICA 4DDUA 3OZBA 5KJ6A 2JEYA 4PAOA 1BGVA 1N5RA 5D3ZA 3KXIA 4HNHA 1CR0A 4UHDA 3EAGA 3TTYA 1I36A 4BQQA 1QV7A 1HLGA 1UAYA 3AEXA 1VL0A 3OKFA 4JY7A 2G88A 1QRAA 1JTEA 4I4LA 5T4HA 5LNK1 1XU9A 5ALEA 1YA6A 2C4MA 2B92A 3P8ZA 1Z5UA 4G5RA 3IALA 4BO9A 2A9QA 3D5TA 3AEKB 3MWEA 3L06A 4U02A 3UAVA 2IHNA 1VLHA 4LJYA 2ONYA 4L0QA 4MV1A 2C4KA 4V39A 1N5JA 1EA5A 1JIIA 1JIKA 2IPMA 2J48A 3MGBA 4S1VA 5DX1A 1HR0B 3K0FB 3L8CA 4BO2A 5BW5A 5FI5A 1O5TA 4JV5B 1A5BB 3ROZA 2OKGA 3V4VB 2QTVB 4F4DA 3A06A 1HLPA 1SG9A 2ZR8A 3L0ZA 2VK4A 3E22B 5EI5A 1CR4A 1SKBA 2OCPA 1P2BA 4F45A 2HWUA 4MVYA 1ILEA 2C2WA 1ENOA 2W2MA 3L01A 5B7GA 5FV4A 5KNCD 3GF4A 5J9FA 5LZ5A 1J7KA 1E77A 2QZ4A 3OX3A 3U9LA 1L7MA 3DCYA 3R5TA 1YS1X 2E5WA 2H9YA 4H77A 4R8LA 4BN0A 3OCZA 4JKIA 4JI7B 1FLDA 4ESEA 4OF4A 2B1JA 1VKNA 2HGZA 2Q5EA 2QUKA 3EK2A 3OE1A 4IR7A 1R4MA 4JQZA 5JMWA 4G3XA 4BO8A 5IF9A 5E9WA 1KMIY 2B6NA 5KTNA 2NO0A 4B44A 4BKUA 1UANA 1Q84A 4FTWA 4Q4LA 2YY5A 4TWBA 3KKNA 3HCNA 3I3OA 3NTQA 3OX2A 5BPHA 3KQKA 2GJ8A 1F8FA 1IATA 4K81B 3G6WA 2PO7A 3EXHB 3GFPA 3RLFA 1MT3A 1KY4A 3PP8A 4IEFB 3I5UA 2I6XA 4LV8B 3GOQA 5BV1A 1PTJC 3CV3A 5BNFA 1UKAA 4RLFA 1PEDA 1P4SA 2F3PA 3D4PA 5J2UA 1FP6A 4CG0A 4PC3A 2O14A 3PWSA 4EG0A 2CK3A 3AMVA 3Q3CA 3AKZA 4WFQA 2NZUG 3OQJA 3DDOA 3LRXA 2DFPA 3F6PA 4MGKR 1ZSVA 4MYHA 1U4SA 1UPUA 2NIPA 5TXGA 4AZTA 4DSOA 5D51S 5HKKA 1W94A 4LGMA 4EHJA 2HV9A 5KIAA 3UB4A 3LT4A 2ABWA 2P6PA 3MILA 1ZVQA 3J81A 4RLHA 1NQ5A 5AVXA 1O5OA 4Q3OA 4RFVA 3IT2A 3CUVA 2W6MA 5JEEA 3GJRA 5JAIA 1R6VA 2PX6A 1AB6A 3QVKA 4X1OA 1I7QB 1CUEA 3LUJA 1V11A 4J0QA 3M33A 1P2UA 1Q5PA 2HSZA 2V4ZA 1FTQA 3BSFA 1FFXA 3IDQA 5B5SA 2EV9A 2WJHA 3ZDYB 3THXB 4YP7A 4A0QA 5LU8A 2BMEA 2LUOA 2PUTA 4V03A 1SCDA 4RANA 3EIHA 4LXHA 1WMAA 1PT8A 3O8BA 4KRXA 1TCUA 3IPXA 3C7AA 3D2BA 5CH3A 1EM8B 1O54A 2WFLA 2CBZA 4CLEA 2B4KA 1LBSA 1YHZA 3FFBA 3Q87B 3GJ6A 3BMQA 4UNSA 3NNDA 1VKOA 3UPDA 1Z15A 4KLRA 3WBFA 4YRIA 3OICA 2Z1MA 2ZXEA 4EL0A 1XQWA 3COPA 2CDAA 3N2EA 3RANA 3TAUA 1ENZA 4L4UA 4AJ2A 1ZP6A 4O2AA 4BLOA 2HH9A 3GIWA 3CZ4A 2NACA 1T1SA 5B3JA 1GARA 1SPXA 2ZUSA 1UXGA 2O54A 4DXDA 2GHTA 1L3BA 3EQ9A 3UJCA 3OJEA 1VZ3A 5J47A 1XL0A 1U0BB 1JFFA 2I6FA 4QPNA 1FDWA 3QUTA 4WZAB 2Y67A 3VDQA 1PNTA 1E1LA 5TIIA 3NATA 4DQLA 3HKCB 2QPTA 2VYCA 4RL4A 2AZDA 1RXYA 3PQ8A 3TLKA 3W4JA 4E03A 5BV8A 1ZM7A 3DH0A 1CUDA 3WL5A 5E1DA 3PFKA 1RTTA 4GI5A 4YAFA 4HRXA 5EZSA 2R6DA 1AB5A 5FWXA 5T8KC 4H6PA 2RHOA 2E5FA 3SYLA 3OEWA 2HWYA 3EPHA 1FRVA 1SBYA 4J9VA 3AR5A 3D3KA 1BJRE 3M81A 4LQCA 2JKZA 1U7WA 3A4NA 1U8ZA 1IZZA 1ESNA 3DGFC 3V3TA 4HB2A 4MUKA 4EMSA 1ENPA 2V6FA 4JOSA 2LDBA 3LT2A 1RMTA 1BGWA 4MCHA 4WJKB 4CEHB 4S04A 1ZG3A 3EG5A 3FZNA 4E12A 2HHCA 1PJRA 5LUAA 3OD1A 2GJ4A 2Z8XA 3M9WA 3N2GB 1DV2A 1TQ8A 2CYAA 4U1RA 1C7ZA 5EWLB 3W6PA 4Q9JA 3GU3A 3OQIA 4RMGA 1PL0A 1GLVA 4URWR 4JA2A 4ZMBA 1VJRA 4FXPA 3Q7QA 1G8PA 2VKQA 4YMWA 5LBIA 3UH0A 3LGXA 1K98A 2QTGA 1DRKA 1I1NA 4F71A 3HNOA 4PLFA 3IKVA 3P9XA 5F5LA 4W8HA 2WKQA 4OOEA 3TD6A 4ZOBA 2XUGA 4QM7A 2PVSA 1GKIA 2ZDHA 3HN2A 4JT9A 5CT9A 3R76A 4B1FA 4ZV4A 1XTBA 3U4HA 1O03A 2VSFA 1KH2A 1Q1QA 1IEVA 4QBTA 1BROA 2AB0A 4NZNA 4WINA 5GV8A 1F0NA 5JBNA 4WXMA 2PS0A 5LA6B 1GGHA 1CJTC 4B6GA 4O33A 1F5NA 4OBBA 1BX3A 4J75A 1V7PC 4TGLA 3P0FA 4YJ2F 3Q0IA 1BHO1 1WWKA 4CT0A 5K0EA 1PZEA 5KCZA 3BN3A 4MB6A 4A1OA 4URZR 1BX1A 3OAAD 1GZ7A 5FL7D 3T7SA 5JJBA 1YUNA 1SUWA 1M72A 3ZQJA 3H75A 4Q6WA 3UJ8A 3L6CA 5DT2A 3KEOA 3B13B 2GRAA 5LQSA 2E4WA 1PK8A 2FRDA 1DU4A 2FSGA 4GBMA 5KHAA 3T3GA 4IJ6A 4EFMA 3PNSA 4EJMA 4XYLA 3IOMA 1W88A 5JVDB 3KEGA 5C35A 1B6TA 3MXOA 4IKPA 3L0CA 4PHTA 2BKXA 1WETA 2L82A 4I1PA 4BP3A 1G2PA 2AKYA 4U9HS 4MITA 3ENKA 2ISCA 3D2CA 1GN9A 1T9HA 5EEGA 5CIYA 3TVYA 2ZREA 3V8RA 3NR2A 1F2TA 1JLMA 4GM1A 4KIJA 1LLFA 3ONDA 3VU3A 4M55A 3UMYA 3TQHA 3CG0A 2XJ4A 4NBVA 5JAOA 5LOVB 1LLQA 2H7CA 4RAOA 2V7UA 3ICCA 4EY7A 1XX6A 2E18A 4O8CA 4BNMA 3JQQA 1LSJA 4TQUS 3T35A 4BTEA 2HJ9A 3OU2A 1RJDA 4R05A 4ZU3A 5BYJA 3NBFA 2CVOA 3CISA 3DDUA 2KLBA 4LSGA 2IY9A 5AKYA 2V7QD 1RKUA 1P0QA 2GZ3A 2O52A 3RLIA 4AY5A 4J0GA 1VE3A 4D4KA 4F3YA 3IC5A 2VQEB 1DOHA 5GMOA 4C7OA 1H3NA 3KB6A 1QE5A 4MVXA 1A76A 5LQAA 4KO4S 6CHYA 2I3GA 2DB3A 4PSVA 3MMZA 4A6DA 1V35A 2AWNA 3AFNA 3QLEA 1A9TA 2DFKB 1CQWA 2OK7A 3AV0B 1WZEA 5BQXA 1ZEJA 3HYRA 2IH5A 5E3IA 3NHLA 2QTWB 2XNDD 3OX4A 3DXYA 4QYIB 4Q6BA 3IUSA 1AKEA 1S8FA 2FPGB 2X1HA 4IV0A 4DNXA 4RO0A 4XPIB 3ZCPA 5BYKA 1C7IA 2ZI6A 4AYWA 1WXDA 3QMWA 2UYYA 4UD6A 4G41A 1NQTA 4EELA 1GAXA 3KFLA 3MT0A 4NNOA 4S12A 1JL3A 1KFEB 1VMIA 2WQ6A 1HT0A 1XCOA 2ZE7A 3LSYA 2WUFA 4MJ3A 3H6KA 1KEPA 1G5FA 3H5WA 2HADA 4G65A 3C1TA 4AF6A 3S44A 2ZBVA 3Q7EA 3EE6A 4OCZA 3E1GA 4Z3KA 3ESXA 3K16A 4JENA 1UCFA 5CA1F 1XPUA 5ESRA 1Y0BA 2DECA 5TY0A 1H2RS 2ECPA 2NNWB 2WHPA 3L18A 4KR2A 2BZ1A 3BMOA 2Q9AA 3L8YA 3PRYA 5CBPA 1N0VC 3KXDA 4K2AA 1VG8A 3QBTA 3VC3A 2EOAA 3RSZA 3PCXA 5HIJA 1Q1EA 2BFWA 1M1YB 5EGNA 3D4BA 1K6MA 1B8PA 2UKDA 3RFUA 2X8LA 1ZGAA 3TTVA 1LFDB 4G5HA 5KQLA 3U7FB 3PV0A 3E84A 1JP7A 2H1CA 2YWGA 1PJ3A 4M99A 2PQ0A 4KGZA 3B38A 1A8HA 2HI0A 3D0QA 1N1EA 3C6BA 4DANA 1U90A 2FPSA 1LQUA 4IYJA 2ZUWA 4ZA2A 4PAQA 4EYEA 3DWEX 3AUXA 2OK8A 5LFAA 4UNIA 5H5JA 4OHWA 3CH6A 1P81A 3H2KA 1M1NB 1FFCA 3QPBA 3WNVA 3OJLA 3LT1A 1ZAYA 4QJ5A 4LF4B 4JR0A 1VCIA 3L8EA 4AB1A 4LS3A 3SU8A 4A0FA 3FMPB 4OQEA 3SC4A 5LWHA 1ADGA 1DINA 3PC7A 3O1IC 3ADKA 1NR7A 4YYZA 3QKSA 3ROKA 1F8YA 4ZZ3A 1EUCB 5DP1A 3OAAA 5FL7A 2PBLA 1ECJA 4TWIA 3PIRA 4F21A 1OTYA 1XTIA 4HD8A 1KU0A 3NOVA 4J29A 4CV2A 5I4IA 4YMTA 5CCEA 3CZPA 4PLYA 4DMFA 3DTVA 3RSSA 2AQKA 1KO8A 4LRXA 4PTYA 1UDWA 5B1EA 2X19A 1F2VA 1XEWY 3A0UA 3L05A 2ZYDA 1QBKC 3OJCA 2BTEA 2OCKA 4Z4EA 1YBMA 3AHJA 4HGPA 3TUIC 1LK0A 3ZQ6A 3TOSA 5GONF 4ADSG 5JBQA 3BL5A 2X2OA 2P7IA 3F6EX 1M7GA 1WP9A 4Q7JB 5LMUB 4RNCA 1NVMB 2R7MA 3IMGA 4GXRA 3HKEB 4KV7A 2AN3A 4J76A 3OZFA 4NF2A 1TQ4A 4BMXA 1QV6A 2YY7A 1WP4A 2Q2QA 4WDRA 2O2XA 3AUTA 4NV0A 5H9VA 5LSAA 3E8XA 5KTPA 4PXAA 1RYFA 2IHJA 2VNAA 2YFHA 1IZ7A 4UQPA 2EGHA 2JBAA 1BDBA 3AR9A 3TQTA 3AK4A 5K4HA 2SHKA 3JQFA 2Z83A 1EFVB 3IUEA 4N48A 2AE1A 2W90A 4GYKA 1M34A 4HWRA 3GFBA 3MINA 4B8ZA 4MICA 1CETA 2ZT8A 2X4GA 4LK2A 4RQTA 5GIPE 1E5LA 1DLJA 1QC5A 5AR1A 2V7QA 1U0GA 2O0MA 3MXTA 1JSZA 3DHEA 4HS4A 5CNJA 3S4YA 1K6IA 4GOLD 2YWEA 2YZKA 5T5QA 4WIAA 3RQSA 4W9MC 1JIJA 2EERA 1Y1SA 1Z5NA 1OWMA 3O5AA 3VV2A 4XWAA 4BFYA 4BNXA 1M6WA 1KAEA 4NG5A 1PFQA 2L0XA 2HA6A 1RM0A 2IYLD 1S1MA 2Z3WA 3COVA 3JATB 4HV4A 5F23A 4DA8A 1F9AA 4HDQB 2B94A 3EXG1 3T1VA 3VHRA 2XNDA 3ZU5A 1FC0A 2GTIA 1XZDA 2AYZA 2I7TA 3HYTA 3RHFA 2Q8NA 3TBHA 5HKBA 1C81A 4IZ6A 3OOYA 1TT7A 1WA5A 4G1FA 1EX7A 5CURA 2DE0X 2A78A 5JLAA 3CRW1 1D4AA 5H16A 1LNZA 3WWOA 2OOKA 2OBFA 3L0SA 1V4VA 3UYKA 2FF7A 5LLSA 1Q3HA 2NTJA 4FU0A 3ZIAD 4DREA 1D2GA 4AU1A 1FW8A 1G63A 2HEIA 3GFVA 3WHIA 3ZX5A 2LV8A 5AP9A 3VVBA 2EGUA 1E3SA 2JFNA 4YWJA 2I2CA 3E7PA 5GPBA 4CM5A 5C37A 1QU3A 2ZSAA 4L4YA 5A05A 2GLTA 2HF7A 4D3FA 4EZIA 2A0YA 2JFYA 1ZJWA 5D85A 4R9UC 5ABPA 1VDZA 2ZIXB 2W00A 4AVYA 4DA7A 4KO3S 2XDQB 2QRMA 4OB8A 4K86A 5LXTF 1VECA 4FDTA 1SEPA 3BGDA 3LXUX 1UIMA 4ZHQA 2VYVD 4LJLA 2X4DA 4X3PA 4WBNB 3VZPA 5KHOC 4Y2GA 1ZUD1 1SJ9A 2YCBA 4M9XA 3U5ZB 2OV3A 4AO8A 4R2XA 2A7XA 3IRVA 4BTVA 3C7DB 5KJEA 1U9JA 5F1OA 3X1DA 4JBLA 4ZOCA 3NJ4A 3RODA 1O9GA 3VR2D 1B16A 3JWGA 1SFRA 2QD3A 3ZWMA 1NXTA 3RUEA 4L9RA 4M83A 4JL8A 4ISCA 3TN7A 4R1OA 5EXTA 3NBYC 3BJRA 3KQLA 3IAEA 3L7BA 3U4CA 2GBIA 4CQMB 5EXEA 1YVPA 3O8OB 3HUDA 3PE6A 2O2DA 3A3YA 2C1ZA 3JALB 5IVKA 5DI3A 3JQPA 4FIZA 4YDRA 3SXUB 1PYOA 4CDRA 2R4TA 1WZIA 2FJUA 4KMMA 5IRCD 2DR3A 1O89A 1PJAA 3NWPA 4KGVA 4PAMA 1DIRA 1XZIA 2H0QA 1D2CA 5ERYA 3KBOA 3GRAA 5IN5A 2X7JA 1KMNA 3N58A 1UQUA 2BSAA 1C50A 2X8JA 4KJZA 2X7XA 1YBAA 2O1SA 4YP6A 4Z4FA 3EGWA 2EVWX 2NAPA 1RNLA 3NPMA 3T3EA 1QVRA 2FUG6 3HJCA 4EW2A 3DWFA 4LBVA 1BHJA 2GAFA 1SUFA 1SUSA 3OQVA 1AUPA 1FSSA 2FU5C 2ZJ8A 1BEEA 5CRIA 4EF5A 2I8LA 5EHQA 1YHNA 2JKYA 2P65A 3FPEA 4ZVTA 4DG5A 3R4CA 4EW1A 1YBHA 2YVUA 3ODGA 2ZCJA 3NAZA 3ZTWA 2QQ5A 2H31A 3TE6A 3QEOA 4IQ8A 4MINA 3KL4A 3R77A 1IPHA 5IW8A 1RWBA 3AX6A 2Q3LA 1NVTA 3BKWA 3TL2A 5FNVF 2J5RA 4J94A 1TL7C 1VTKA 1NW6A 2P27A 3O26A 5LU9A 5AOCA 3HKDB 4GPAA 5SY6A 4MCAA 4DCOA 1NF3A 2BLLA 2OV8A 2OXFA 1J9ZA 1S8AA 3FYCA 1OYOA 4JYBA 1HEUA 3JQ7A 3TZ6A 3VSEA 4KQ2A 2ZRHA 3GNQA 3V4ZA 1B76A 1FMTA 5G0VA 3ESBA 2DSTA 1J42A 3VR5H 4RQAA 5HKLA 2PXXA 4JN6B 2QTZA 1W75A 2Z3VA 3V9AA 3ZGNA 3SBOA 3AB7A 5HUJA 2V6JA 7REQA 1WY7A 3FYUC 4JR2A 3PWZA 3GZNB 2O5VA 4L1KA 5E2AA 4ESVA 2NV0A 1GTJ1 3K4HA 1TTPB 3QE4A 4L08A 4LF7B 1AY0A 4M0UA 1I32A 3HP4A 3PB3A 1QHYA 5C53B 2E4AA 4MVJI 3HYNA 1TVEA 2ZP1A 5KKAA 4ECEA 5M5BA 1VP3A 1IOVA 3VJKA 1T3ZA 2BM1A 1IHOA 2GYYA 2V7VA 1JPJA 4LC1A 2A9JA 2B2CA 1PDVA 1XQ1A 4J2TA 2NU6A 1Z8DA 2GILA 1OBCA 1NDQA 3MN1A 4RH1A 4EHHA 2Z6UA 4L22A 3W3AH 4IIYA 1T8UA 4MNTA 3V4FA 4O3MA 1Z7YA 4CQLA 3I1JA 1GGJA 3G9UA 4LZPA 1IN1A 4RORA 5EJMA 2FJPA 1EGQA 1RRGA 3OWOA 1B1CA 2IYPA 1CVRA 4U2EA 4MKHA 3DL7A 5BR4A 1W9HA 4HC4A 5CDUA 2V0NA 4U3JB 3O1HB 2IRWA 3K8QA 1NQWA 1QK3A 4FE7A 4D3YA 1FFGA 1VFNA 4M0MA 1BXRB 3A1NA 1KO5A 1TJ3A 2WJZB 5JXWA 1CQZA 1I7LA 3PUXA 5EPUA 3TLXA 4DAOA 1Q0RA 4V02A 5JAUA 1MHTA 2GXSA 1O2DA 2OCLA 4NCBA 5IC5A 1GCOA 2QUIA 5K03A 3PD1A 1ZOSA 4OQZA 1P6QA 3LQ4A 4GZMA 3JZMA 3GDWA 1FDVA 5H59A 3DWGA 2RHHA 4AN0A 4YJ2B 3ZXYA 2AE2A 2DFVA 3HCOA 4UUMA 3ZS8A 2CZCA 4GWKA 1I5OA 4BQPA 3T7RA 4LF9B 5IUNC 1M6VA 3HY6A 1VYVA 1L7OA 2JJ1D 2A88A 3BD9A 3SOZA 4TZ6A 4REQB 2RSLA 1N8TA 3ACDA 3DV0B 2VYVA 3QVOA 1IQ0A 2FSIA 2Q5IA 2QRNA 2H0AA 1E58A 4R98A 4Y9SA 3DFFA 4TPKA 3TZHA 3VAYA 1J8VA 4JFRA 1LEHA 2JGRA 2YXBA 3KK0A 3KOOA 4IHKA 1WR8A 5EVCA 3RVJA 3W2EA 4FILA 3LQKA 1ZZGA 2WUWE 1VPVA 3L4KA 5FB3A 5JI2E 1Z4MA 1GKYA 4QLAA 1DVRA 2ZYVX 1N5DA 4F1KA 3NVAA 1FDTA 2XMBA 3BOSA 4R81A 2FW8A 4MPTA 1D04A 4EAQA 1L4YA 1R4NB 1K92A 1NNLA 2AXNA 3GEBA 4G0OA 3EDCA 4KXQA 1ENYA 3PBKA 1WSWA 1X7GA 4GBGA 4GOKA 4X1KA 2I6TA 2RJNA 2TECE 2J4FA 2P3OA 4MR9A 5H7XA 1J06A 3M82A 1ZLYA 1TYZA 3FOCA 4IV8A 3U9TA 4P83A 4UARA 1I2DA 2CNDA 2O8VA 2F4NA 1AKYA 1CB0A 2P9FA 5AJTA 4MUGA 2QVLA 4NECA 5DWDA 3W9BA 3GRYA 1K2VN 4WCFC 2DPLA 1FSPA 2REQB 3PQ4A 2WJ6A 1K5HA 1YONA 1Y89A 3O3MB 4BNNA 2GN1A 1OX4B 2XNJA 3IUMA 3RC2A 5KYUB 1P5FA 4RE5A 1XO1A 1JG6A 2H06A 1NIJA 1ZVKA 2J6IA 1OAOC 4U6SA 4ZZ0A 4KSYA 2I9KA 2D7DA 2ZVQX 1MQ8B 2H1IA 3V1MA 4OHPA 4R16A 4MZXA 2NVOA 4LJ4A 1P6UA 3EFEA 3NOQA 1QH9A 2CJXA 4D9BA 4G0WA 1HC7A 5DW3A 3W1EA 5EUQB 1DLIA 1GRRA 1L7VC 1E2HA 1YIDA 1TKAA 3GLHB 3L8GA 4YRCA 3KQOA 5BMVA 1XYVA 1HLDA 5JXGA 2NQ2C 4AS1A 3AVUA 4LRSB 3ZU4A 4B73A 2XXBA 1SOVA 4J1TA 1HE5A 4ZXPA 2PMBA 2XADA 4R69A 1GCAA 2X76A 1V3TA 1XU7A 2D2FA 3HCAA 4QDTA 4CKCA 4D43A 3GNSA 2YXPX 4YLEA 3SZOA 1LU9A 1U9IA 2WIFA 4QUJA 2P9EA 2ACVA 1J8MF 4BNWA 3IP1A 3PVZA 2HAEA 1KS9A 3MRXA 5CA1B 1R0CA 1AS0A 1OFHA 1NIPA 1L7EA 3CRRA 4MQFB 4Q7QA 4A3SA 1MO3A 4XZ3A 3TTUA 1I6LA 2OCYC 4NFYA 3I62A 4IDBA 3VGPA 1MQ9A 1RZVA 5BNWA 5CLJA 2ZUUA 4JUBA 4BE9A 8LDHA 5A9RA 1L1QA 2GBLC 5TGTA 3GPBA 4L5IA 1EK2A 1PFGA 4UVEA 3K72B 1RR6A 2H5IA 3NHYA 1ZU4A 2XVMA 1HZZA 2M6KA 3WLIA 3KEQA 1PO7A 1JEQB 4LE2A 1T8YA 1SZPA 4LHWA 3H4MA 5IDQA 3VNQA 3BERA 2ZBGA 1EPUA 1QGOA 2PSFA 2CXUA 3QVLA 3S68A 5BUSA 5HUHA 4YPFA 1TQ2A 2KHZA 4JGIA 4DLKA 1OPRA 2XYRA 4R2JA 2FWBA 2AOVA 3U13A 1EE9A 1P0IA 3EGIA 4GWGA 1QHHA 5KTYA 4D9CA 4WLNA 3GJYA 2ZT6A 3EIOA 2XRMA 2ZSIA 5TC4A 2YUIA 3HVUA 2QWXA 1AXGA 4OL0A 4DMLA 3GX1A 3RG2A 1V5WA 3TBFA 2JFWA 3WDLA 3LPNA 4EPTA 5I9NA 5IXJA 1YH3A 5JD5A 5KMGA 3RD5A 3TLMA 4L9AA 4V0NA 1Z7BA 1DBPA 4MW9A 2Q3JA 3QKIA 4ZVKA 2WU3A 2QJOA 1COWA 1IN8A 3COZA 1EXNA 3E05A 3FMOB 4QICA 1GQOA 4BDTA 3ROMA 1YK1A 2HB6A 1UXIA 2Y8EA 4RLQA 1HDCA 1LI7A 4C05A 2JJ1A 2PR7A 2ZBDA 1NP6A 3CNHA 4IXWA 1T9GR 2BMAA 2RKWA 3QBDA 3HJRA 4XRRA 4C5CA 1JHRA 2HBZA 4ARZB 4OM7A 1QIDA 3MVEA 4NDNE 2FPLA <