3GRKA

Crystal structure of short chain dehydrogenase reductase sdr glucose-ribitol dehydrogenase from brucella melitensis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
254
structure length
248
Chain Sequence
GLLQGKRGLILGVANNRSIAWGIAKAAREAGAELAFTYQGDALKKRVEPLAEELGAFVAGHCDVADAASIDAVFETLEKKWGKLDFLVHAIGFSDKDELTGRYIDTSEANFTNTMLISVYSLTAVSRRAEKLMADGGSILTLTYYGAEKVMPNYNVMGVAKAALEASVKYLAVDLGPQNIRVNAISAGPIKTGDFRYILKWNEYNAPLRRTVTIDEVGDVGLYFLSDLSRSVTGEVHHADSGYHVIGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Enoyl-(acyl-carrier-protein) reductase (NADH)
publication title Crystal structure of short chain dehydrogenase reductase SDR glucose-ribitol dehydrogenase from Brucella melitensis
rcsb
source organism Brucella melitensis
total genus 82
structure length 248
sequence length 254
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3grkA00
2GGSA 2ZTUA 4RF3A 5AQ1A 1JTVA 1UZLA 3R1IA 2J3HA 5EERA 3ZWBA 3ONDA 1KOLA 4PG8A 4WNIA 1I5RA 3W8DA 2GF2A 3F5SA 4YACA 1TB4A 2Y1FA 4Z9YA 3NTRA 3B20A 4YQYA 3FBTA 3DBVO 5G4KA 4BMSA 1LDNA 1PJ4A 5KCZA 2I9PA 4WLVA 3ZI0A 5JCJD 3UFXA 3JQ7A 4WCFA 3HWRA 4RORA 1KYQA 2B37A 2G5CA 3FNHA 2PR2A 4OSOA 4YT5A 3QVWA 3JQ9A 4NFHA 1EVZA 3BAZA 3I9MA 3GEGA 4O1MA 1EFLA 4UEKA 1Z6ZA 2NVUB 1XG5A 3JQGB 3NEPX 3ASUA 3PK0A 2CD9A 1I10A 4FSHA 2PH3A 3D7LA 1NP3A 1K5HA 4O0LA 4FJ2A 3W4IA 3L9XA 4H16A 4NG5A 4XRRA 5FI5A 4S1VA 1M6HA 2E6UX 3A4VA 4CM9A 1HDYA 3T4XA 3F6YA 3VH4A 2PD3A 1DRUA 2D5CA 3OJ0A 3F3SA 1J4AA 4OGWA 3I4FA 2P9EA 5L9AA 1HEUA 3NDIA 1DAPA 3DZKA 3L6DA 1CYDA 1EE2A 1DB3A 4M89A 4QUKA 4XJTA 5U1PA 1U3UA 1HL3A 4ND5A 3RROA 1I30A 3VPHA 2BFAA 1QYWA 2JAPA 1WW8A 1KIFA 5TQVA 3MWEB 5AXCA 1HDXA 4EUEA 1KBZA 3VTFA 3R0IA 4WK6A 5CEEA 3IL2A 3S2GA 4NNJA 1DRVA 2PLAA 1LDGA 3OIDA 1Y81A 4W82A 1DIAA 4LVCA 4D44A 3BMNB 3QLJA 1PZEA 3U0BA 2G0TA 5B1YA 2WYVA 4J6FA 3OQ6A 1JKJA 3FSRA 2YV3A 2AE1A 2D59A 1A27A 1WWKA 1QYCA 5FYDA 3SEFA 3ST7A 3ASVA 4CMKA 1ZCJA 3C1AA 1YE3A 1GQ2A 4FGWA 4CM8A 3D4NA 4JBIA 2PGDA 3EZYA 1S7CA 1MC4A 3ZW8A 2P68A 4PLHA 1B3RA 2FP4A 2JAHA 2VRBA 1SC6A 3A28A 3E18A 3ANLA 4LRTB 3ZWYA 4EUHA 4DMLA 3D4PA 5IDQA 2FSSA 2O48X 3B70A 4YQZA 4DUPA 4FN4A 4L4XA 1UUFA 4IJKA 4I9HA 4ZQFA 5KVSA 4J7XA 5B37A 3IP3A 1R0LA 1ONOA 4YPOA 4EDFA 4XX0A 3WIDA 4I5GA 2ET6A 2EW2A 5K0ZA 1HDRA 4E2WA 1E3IA 3V5NA 5BSEA 1IHXA 3RJ9A 5I7SA 2UVDA 3AK4A 4F46A 3O8QA 1EE9A 4HFNA 3NAQA 2A92A 1IYZA 3KRTA 3DQPA 1GQYA 2DC1A 3M6IA 5DOZA 3TJRA 2WD8A 3LT1A 4CLOB 3CINA 5GMOA 1NPTO 5I7VA 3BMCB 3I9OA 4AJPA 4FFMA 4AJ4A 2SCUA 1EEHA 1LNQA 2GO1A 2NUAA 1IULA 1J0XO 2PKQO 1C0PA 1ADGA 2HDHA 2HQ1A 4IQ8A 4ZRNA 3GFBA 5F1OA 4M49A 4IGEA 2EV9A 4BNMA 2NVUA 4J1NA 1QSGA 3C85A 3LF1A 1XEAA 1R37A 3HB4X 4WE3A 1R6DA 4JJIA 1HT0A 3SJUA 1LSJA 2Q1WA 1W0CA 2O3JA 1CJCA 4YAKA 2PNFA 1OMOA 1QLJA 1QMGA 1U2DA 2B5WA 4A26A 1XA0A 2DM6A 5CFZA 4J7UA 4ALKA 5TX7A 3OEYA 4LK3A 2DBQA 3Q6IA 5A04A 2VNAA 2D8AA 1E6EA 4YJGA 4JJGA 2IYOA 2RH4A 3DOOA 5JO9A 2BI7A 2NVBA 2YYYA 3UVEA 3BMOB 3OH8A 1TT5B 4TQGA 5HS6A 5HM8A 2OGUA 1KVTA 1GCUA 1ENYA 3FNGA 2X23A 3WR5A 1YXMA 1YKFA 4GSKA 3WXBA 2H5LA 2XXBA 4AJ2A 3OF2A 1WZEA 5CDGA 2O7SA 2CMDA 3PQEA 4FGSA 1PJSA 2P9GA 1DJNA 1U5CA 2DUUA 4WCDA 4CLHA 3F46A 4HXYA 3FPLA 3MTGA 2XOXA 2VUUA 1SB8A 4BO9A 4J4TA 3PWKA 2O3RA 2X9VA 2EP5A 5KVCA 1P74A 2ZTMA 4ZQGA 1DFGA 4R9RA 4DIFA 4R1NA 3QVSA 4DIOA 5G0VA 4Z0PA 1ZK2A 3ORFA 4D0SA 5COBA 3ZU5A 5HTOA 5DDIP 1UDCA 1Q1NA 2HK9A 2X86A 3JQBA 4H7PA 3FRJA 2OP0A 5IN4A 4MVJA 4YAJA 5TS3A 2QYTA 3HADA 1C0LA 4BB6A 3LVFO 2CY0A 2PZMA 2ZK7A 3D5QA 3DFZA 3DFUA 4TWRA 1VJ0A 1FJHA 3ON5A 3I9JA 2VRCD 2EGGA 1OAAA 1U4SA 3ROKA 6ADHA 2BFOA 3TZCA 4FFPA 3PIDA 3G79A 4XEHA 5HA5A 3WX0A 5K6AC 3B6ZA 1V8BA 1O95A 3ROQA 3U4IA 5I9NA 3QSGA 5C7OO 3ZWPA 5ADHA 1VSUA 3R3SA 4CM3A 3DHYA 4BGVA 4A7PA 4GX5A 3EGOA 4YAGA 4DGSA 1PQUA 1I36A 3ZHYA 4CV3A 1GCOA 4BNXA 3UCXA 1KC3A 3V1YA 2AEMA 4UUNA 3TN7A 1W8DA 3ETEA 4FJ0A 2EHDA 5BNTA 3AJRA 4DPKA 4E31A 4WECA 4LMPA 4TVBA 5DNAA 2HK8A 3BMCA 4BGUA 5JO0A 2DKNA 3WLFA 2GZ1A 1KVQA 3K6JA 1MA0A 4AICA 1WP4A 1ZMTA 4DYVA 4M86A 1ZNQO 4NI5A 4X54A 3VOSA 3RUHA 1YOVB 2B0JA 4WGGA 4BO1A 3QVOA 3WMXA 2EKLA 4NK4A 4N7RA 1SZJG 1U7HA 5IF3A 3EZLA 4JJFA 4J1QA 3HDHA 1DOHA 3AOGA 4ZQEA 2I76A 4ESOA 2GD1O 4BUCA 1QYVA 2BFPA 1R0KA 2X5JO 3GMDA 2R00C 4KZPA 3ZNNA 3PDJA 4YBZA 4CODB 4L75A 1YWGO 4RPLA 3MJCA 3G49A 3B1KA 4RF4A 5JCJA 4BQRA 1T1SA 4MVJM 5LC1A 2DFVA 1W4ZA 1Q7BA 4PG5A 5JYEA 1P44A 2IZZA 2J6IA 4RPKA 2A9FA 2EERA 3ZWMA 3JSAA 1Z7BA 3NKLA 3KEOA 4YT8A 5A9SB 5JC1A 4DWVA 1XSEA 1TT5A 4MVJG 3ZHXA 2IZ1A 4PRLA 4WLEA 1F8GA 1N1EA 2UDPA 2QRKA 1ZXBA 3ZU4A 1VRWA 2CSUA 2X8LA 4E4YA 5KKCA 4B3JA 1NQTA 4C4OA 3OM9A 3QHAA 5L4SA 5GZ3A 4MP3A 3ETGA 1PZHA 1ZK3A 4L9RA 5U9CA 2C5AA 3S2FA 4Z3KA 1M6WA 2EXXA 3ADOA 5ILOA 5T64A 1T2EA 3PLNA 1PSDA 3PLRA 2GSDA 3IOYA 1TLTA 3KYCB 3PQDA 3TPCA 4P8RA 2X0NA 3DZJA 3IKVA 3KLMX 1UXHA 3H5NA 2O4UX 5HWSA 4ROSA 2Q45A 3FNFA 4IJUA 1H6AA 1WXDA 2I6TA 3GN2A 4HBGA 4YT2A 1DC4A 4L73A 2D0IA 3WFJA 1UXIA 2PZJA 4PLVA 4NIMA 3FF4A 3ZV5A 4M54A 3V1UA 3R6DA 4EYEA 1PJTA 4WLNA 5JY6A 4BNGA 5KJCA 5ES3A 2PFGA 1T4BA 2X22A 1X1EA 1ONPA 1V35A 1IHYA 3AI3A 3GNSA 4HP8A 4R16A 3JYPA 4YJFA 2FZEA 5KWEA 2CF5A 1MLDA 4IDBA 3F1LA 4FDAA 2AEJA 3DAGA 3WG9A 1HDCA 4GWKA 5I9MA 5TC4A 3N7UA 1U4OA 2DT5A 1VL0A 2PD6A 4RVUA 1RM0A 3EY4A 4HWKA 1UP6A 4U0KA 1N92A 1BRMA 1GADO 3VKVA 5JMWA 3W4KA 2GDZA 2P4HX 4PLPA 4DREA 2WYUA 3DOCA 3AUTA 4IS3A 4EITA 2X6TA 1BHSA 1A7KA 3INRA 4UVEA 3GG2A 4Z3DA 4CUZA 4GSLA 4IZHA 1N2SA 2J5QA 5KOIA 1U3TA 1UZMA 1H6CA 4ONEA 2X0JA 1V3UA 2EEZA 2GUGA 3PJFA 5A3VA 5TT1A 2NTVA 3KZVA 1E1KA 1YOVA 4JCOA 3QRWA 2Q2VA 1N8KA 1PJBA 2ZQZA 5BR7A 4WEOA 2OFPA 4GKBA 1GEEA 1PL7A 1GL3A 3M2TA 3GVIA 3O9ZA 1LTHR 3FCOA 3EK2A 3KLPX 3KO8A 5L51A 3ICPA 4URFA 1LLCA 2Y1GA 3S2IA 3JD0A 4XQ9A 3RIHA 1N9GB 1E7QA 1SOWA 2OMEA 3JD2A 3EC7A 1DLJA 4DC1A 5BT9A 3QJ5A 5T5QA 1BW9B 3D64A 3E03A 1W73A 1AE1A 3K92A 4GX2A 1DEHA 1LRJA 2BF7A 3QWIA 5C5IA 4R9SA 3WOHA 3ZWXA 4BO7A 3JQAD 5A9SA 4MIEA 3SC4A 1WPQA 1EBFA 3CEAA 3E6AA 1H93A 4ZU3A 1HLPA 1GY8A 1LC0A 3OJEA 1M66A 3R3JA 1GZ3A 2BH9A 4CL3A 4DRYA 3Q9NA 5JYDA 4M1QA 1VE9A 4PCVA 5L40A 3P5SA 4J7CA 3I3OA 4FFNA 3AY6A 1T1RA 4YVFA 4GL4A 1JN0A 4R54A 1Q7GA 3TL3A 1RYDA 3BA1A 3ZZNA 1TA4A 4AVYA 5DULA 5C37A 5MGBA 4NR0A 2EG9A 1ADBA 3D3EA 3KYCA 3GUCA 2C5EA 3NDJA 2W8ZA 4Z9FA 3AY3A 3L4BC 1C0IA 5H83A 1P1RA 4Y6RA 4P4LA 4W7IA 1A72A 3VAZA 1B16A 3VTZA 3RKRA 2NV6A 4RL6A 5BSGA 3ENKA 5DP1A 5T67A 5C3MA 5L45A 3PXXA 3VDRA 4BNYA 5T8KA 3WQQA 3H7AA 2B36A 3EVNA 4ND1A 4KTTE 4MPDA 1QV7A 2PK3A 2NQTA 2I3GA 4PG4A 5LCXA 3BIOA 1I33A 1MFPA 3E8XA 3LLVA 4AJKA 1HLDA 4R68A 4ZN6A 2Y0DA 1VL8A 2ZYGA 3KBOA 3GRKA 3FTPA 2DPGA 4HKTA 1FDVA 3H9GA 5GZ1A 2TMGA 3MCVA 3LQFA 4B4UA 2Y99A 2ZJ1A 4WCFC 1F17A 5BSFA 2Y05A 2NVWA 4WKGA 2NU6A 3AY7A 9LDTA 4PZCA 5DBIA 3EYWA 5IXSA 4DXHA 2QHXA 2D1YA 5JMPA 1PGQA 2J8ZA 3ZWOA 1XDWA 2RH8A 4J91A 2HU2A 4GX0A 4O6VA 1YONA 3RC9A 1NQ5A 3VDQA 1NQOA 2VRCA 3RQSA 4Y67A 3LT4A 4ZQBA 1PGNA 5IDYA 1O0SA 1X13A 1MC5A 3GN1A 5BNIA 1H6BA 3HE3A 4WEQA 4U6QA 4NK5A 2IEBA 1PR3A 1E5LA 1MGOA 4JIGA 3WBBA 4GVLA 1EUCA 3H9JA 2BGLA 5G0WA 1IOLA 3KYDA 4WLFA 3PZRA 3TF5A 1YL7A 1ULUA 4IDFA 3JYOA 3NX4A 1RM4A 3DZFA 3JQFA 2TMDA 3MJ4A 4IUYA 2DPHA 4Q39A 2WDZA 3W6ZA 5JY1A 3D4OA 2HCTA 2VOEA 2Y1EA 4QTZA 2WE7A 3U5TA 4W9NA 3HSKA 2Q1UA 3OQBA 3VZPA 3WGIA 4NBTA 4XGKA 3LF2A 2Y93A 1N9GA 3DZBA 2B69A 3RCBA 2FWMX 1GZ4A 3JQ6A 3SLKA 1P0CA 1O6ZA 1KEVA 2VHVA 4LCEA 4WJZA 1SEVA 1IL0A 1GUYA 4J2OA 3ULKA 1HYHA 2AE2A 1T2FA 2Y0CA 3PHJA 3OJFA 4YT4A 1JKFA 3LSYA 5TT0A 2QZZA 4XB2A 1A9ZA 1P1IA 4FQ8A 2HMSA 1AHHA 4HFMA 4QO7A 4PFJA 1WLYA 4RPGA 1XKQA 1IB6A 3BTVA 4CM5A 2VTDA 3HB5X 4GKVA 1Y6JA 3QV1A 1VSVA 2DQ4A 3GQVA 4CLEA 4XR4A 1NQAO 2O3QA 3VC7A 3KOUA 1CETA 1H6DA 1H2HA 1DLIA 4BNNA 3DTTA 4GBJA 2RHRA 2V65A 2ZB7A 4RPJA 1KVSA 3HNPA 4AJHA 4JBHA 3JQAB 3O8QB 3FN4A 4BQPA 3O03A 5DP2A 5JC8A 2VWGA 1XWFA 1Z73A 1V0JA 4B7XA 3P2OA 5CPFA 2I3AA 4XYLA 4FR5A 2JCXA 5G0SA 3BHMA 3NV9A 4R4JA 2CDBA 4RDHA 4LSWA 1ZBQA 1KEUA 2X58A 5KKAA 4B4OA 4EGFA 5A03A 3DMTA 1PJ2A 2P9CA 4I9UA 2H9IA 3NT4A 1O5IA 1IUKA 1ZEMA 2BGKA 2WD7B 3WSVA 3I1JA 3BTOA 1VKNA 1S6YA 4XJSA 1ZFNA 2WSBA 3S8MA 2VZ9A 3MOIA 1LDYA 5COAA 4YAIA 5J23A 4FB5A 3PJGA 4JGBA 4PG6A 3HFGA 4QO8A 4PLCA 4JP3A 3OICA 1WAMA 3B1JA 3TL2A 1E7MA 2PZLA 3ZV6A 4E13A 1TT7A 3LDHA 2XXJA 3PHIA 1UP4A 1WZIA 1P31A 3DBLB 3UCEA 2Y66A 1U3VA 3LK7A 3ZNOA 4UVHA 4EJ6A 1PL8A 1EFKA 4XGIA 2NLOA 4BIIA 4XA8A 2PTGA 1YL6A 2YV1A 2GYYA 4YJGB 3PWSA 4AJJA 3DAFA 4CLDA 5IDWA 3GNQA 4Z0HO 4OM8A 3K30A 3KVOA 2GRAA 3GZNB 1R4NB 3AUSA 3DHNA 3OECA 4FFOA 3TWOA 3ZHBA 5DCUA 1B8VA 3CZMA 3AI1A 4NBWA 7MDHA 1GV0A 3ZGYA 1EK5A 1M76A 2GN8A 3K9QO 2VTEA 1VI2A 4PLGA 1EUDA 1GYRA 3GRPA 3MZ0A 3I5MA 4TKLA 2A35A 4W99A 4XQGA 5TNXA 8ADHA 2RAFA 1AXEA 3CKYA 1ARZA 1QYXA 5COQA 2JHFA 1E7RA 1J5PA 2E48A 3S2EA 5I8WA 4DBVO 4S3MA 2VNSA 4R51A 5KIAA 1G0OA 3AU8A 3W8FA 3F1KA 3WQRA 4IIUA 5MDHA 4P4GA 4OXYA 3IJRA 1JWAB 1Z45A 4IDCA 1E7SA 5ILGA 1CQJA 1H9BA 3QVTA 3W4JA 1BVUA 3PYXA 4ZHSA 3GPIA 2FPGA 4EEXA 3QA9A 2XPCA 3C3XA 3DB2A 3Q3CA 3PIIA 1P77A 4YEDA 1GZ6A 1PIWA 1CQIA 4D42A 4FFRA 2F00A 1V3TA 3OQ1A 4RQTA 1YB5A 3K96A 3FWZA 1XIVA 5JFOA 5LDGA 3VPXA 5JDCA 3ANMA 2GZ3A 5JCXA 1UAGA 2UUPA 4I5DA 1WMBA 1IPEA 1DC6A 1IY8A 3JQBC 4II3A 3GVCA 3IIEA 1XR3A 3QQPA 3F47A 4U5QA 2FSVA 3JYLA 2C2YA 4ND2A 1YJQA 3Q0EA 2FZWA 1LDEA 4LRSB 2PZKA 3K2EA 1OBFO 4ALJA 3DBHB 3WNVA 4IZIA 4GQAA 4EJ0A 2I65A 1JVSA 1E6UA 3JQAA 3PWZA 2JFGA 4KWIA 1HE4A 2OOSA 3C8MA 3ZV3A 2ZYAA 1YB1A 4E5NA 4RLSA 4ZVVA 3CMCO 3JYNA 1E3JA 4AFNA 5F5LA 2BGMA 4IY1A 1C1XB 1H9AA 3DO5A 1GD1O 3I52A 4E3ZA 2HO5A 1DAOA 4OXNA 3GH3A 2WD7A 2X0IA 4Z0TA 4BNKA 4MO2A 1JVBA 2DVMA 4RJTA 1SMKA 2O3UA 3WYBA 1DSSG 1T4DA 2OBNA 4BS9A 2P5UA 3GA0A 4ND4A 1V9LA 4AG3A 3BMQA 4UUPA 3VH1A 3TSCA 4PGFA 4E5MA 1G1AA 3GT0A 3RUDA 3KSUA 1K6XA 2OL4A 4MIOA 1NHGA 1WMAA 1LQUA 3C24A 4DLAA 3L6EA 3ZNPA 3DBLA 1GUFA 4D45A 3PQFA 3GC6A 2VQ3A 2Y1DA 1DPGA 3H65A 4E2XA 2O3TA 4I1IA 2YDXA 1WNTA 1N7HA 1E1NA 3PI7A 4K28A 2C2XA 2VUSA 4NBVA 1UR5A 2EJVA 4XYGA 5FFFA 4Y6PA 3MEQA 4NU5A 1SAYA 2X7HA 3WSWA 1FDUA 3GZNA 1R4NA 5FEUA 1LU9A 3SVTA 3DONA 2W4QA 4NH4A 3K2BA 2QIOA 3EW7A 4FC6A 4TKMA 3SJ7A 5HRUA 1E7YA 5DF1A 5B4UA 3AM5A 4Y8VA 4YAEA 5CAEA 3QWHA 1VJ1A 3BTUA 4J1TA 3IQDB 1HTBA 3LLSA 4DC0A 3IAHA 4DQUA 3BYZA 1EZ4A 2VN8A 3I6IA 1OOEA 3JQ8B 4A10A 1X0VA 3A9WA 4PVDA 1EK6A 2YV2A 2AG8A 4N18A 4PZDA 2Z95A 1YDWA 3RJ5A 5C7IO 1K6IA 1HE2A 1F0YA 3TFOA 4J90A 4KDFA 3BXXA 3L0DA 5L4LA 2DUWA 1E1MA 4LN1A 3G1TA 5IZCC 3PGXA 4NJOA 1CIVA 3GMSA 4DLLA 4KQXA 1D8AA 1H0KA 4XB1A 3H3FA 3LC7O 2FR8A 1GPJA 2FN7A 2JCVA 4R69A 3BZUA 3ABIA 4LW8A 5I7FA 3H5AA 1PU2A 1LXCA 1DIGA 1YQGA 3GDOA 1LA2A 1UDBA 2QX7A 4BKRA 1U28A 1MX3A 4W6ZA 4NQZA 1ML3A 2QZ9A 3MJTA 4YJFB 4YJDA 4XQCA 3A14A 1GYQA 5JE8A 1VPDA 3S1LA 1QV6A 1XCBA 4J3FA 1QKIA 4D79A 1EBUA 2OBYA 2AHRA 3L4SO 3WGOA 3V1TC 2NTJA 5EINA 3GF4A 3DBHA 5BSHA 1GTMA 1NVMB 2G17A 5K9ZA 3IC5A 4BKQA 1N1GA 1ZH8A 4FS3A 4L76A 4C7JA 3JV7A 4XZ3A 3GDFA 4QT0A 3UN1A 4B4WA 1K89A 3A1NA 4J43A 1SCUA 4RGBA 1C1XA 3G0OA 3PDUA 1FDSA 3COSA 1P1JA 1UXGA 5LDHA 4P38A 3TOZA 2YFHA 4RLHA 1PJLA 4OIMA 1ISIA 6LDHA 5BQFA 1SBYA 2B35A 2X9NA 4XYMA 3PRJA 5KVVA 8LDHA 3U49A 4LISA 1QP8A 4OJNA 4BL5A 2R2GA 4KDEA 3VZQA 4MKXA 4E33A 1T2DA 1XU7A 3ZU2A 4ZRMA 5ENDA 5IJZA 4BGIA 2GASA 1UDAA 2YHIB 4ALLA 2FR0A 3FTNA 3I9KA 4CV0A 1YDEA 1X7DA 1NWCA 1ZMOA 1JA9A 1Y9AA 1LLQA 4OAQA 1LLDA 4RZHA 2Y1CA 4J9VA 2ZQYA 2BI8A 2HJSA 1JAYA 4PLZA 5DBFA 2QQ5A 1ID1A 3QWFA 4J9UE 1PS0A 1MG5A 1PJ3A 3M1AA 4IGFA 1CF2O 1L1FA 1JWBB 4DL9A 1DC5A 4B7UA 3AWDA 2FPPA 2PGJA 4MP6A 2XF8A 3AM3A 4H15A 1FF9A 1U9JA 2AQHA 2HUNA 4MDHA 3UH1A 3P2YA 3DL2A 1W6UA 3DHEA 3CIFA 4AJ1A 1I32A 3K8ZA 2Q1TA 4CLXA 5I9LA 2C82A 4RVFA 4NHEA 4P22A 3L07A 1HE3A 3HG7A 3JQ8A 4ILKA 3KV3O 4OKIA 4UREA 3QE3A 3I83A 1Y8QB 2GN9A 4KQWA 3TNLA 2AQ8A 2PA3A 1NWHA 3OJLA 1B7GO 4HUJA 4MVJI 4XGNA 1HKUA 3GVPA 3WIEA 2NWQA 2GZ2A 1U5AA 2D3TA 3RC7A 3P19A 2DTEA 4G81A 4BOYA 4Q9NA 1A7AA 2EGHA 2UV8A 3H3JA 4U8GA 1UH5A 2EKPA 1PTJA 1U8XX 2FRDA 3DZHA 1ZXLA 4E2YA 4XQEA 1F8FA 5A5FA 3WLEA 3ZNQA 1PGPA 5F21A 4EEZA 1PGJA 3RAJA 3VPSA 4BO0A 4G2NA 2OUIA 2C20A 1T2AA 5GZ6A 4BNLA 4DA9A 2IYPA 3GR6A 2H1SA 2C54A 3U4HA 3HDJA 4J16A 4D0RA 4IM7A 3GFGA 4OXKA 3VPGA 3V2HA 3MTJA 3QIVA 2QW8A 3WICA 4JQCA 3E1KA 5A4DA 1ZK1A 4GMFA 4TZKA 1SOVA 5K6AA 3CPSA 5IG2A 4WOKA 4NDNE 2AG5A 3U4CA 2LDBA 1NVTA 4BMVA 3WYEA 4XRGA 1NBOA 4KUEA 5CDYA 2ZB8A 2NU9A 5JAQA 1DJQA 3VH2A 1YQXA 4U0JA 4E21A 4GWGA 2V6BA 2OORA 2VHWA 3WTBA 1LDMA 3IP1A 1LRKA 2G76A 1MV8A 2V7PA 1BXKA 2ZJ0A 3KUXA 2DAPA 3WQSB 4CMBA 7ADHA 1ZSVA 2O4CA 4OHUA 4GGOA 1C14A 3P7MA 3KYDB 4IDGA 1NFRA 2AW5A 3U62A 1LSUA 3PZBA 4L4SA 4K1LA 4LCJA 1YQDA 3KSDO 3CZRA 1Q2XA 1XELA 5G0UA 2B5VA 2HK7A 2YHIA 2FOIA 2OXIA 3DWFA 1Q7CA 1PX0A 2NU7A 2Q4EA 1Q0HA 5CP8A 3DXFA 4Q3DA 1YVEI 5A9RA 4NFYA 2R00A 3UF0A 2Q2WA 3JQCA 4TVOA 1E3WA 1SNYA 2FHSA 5KTKA 3OJOA 3DZIA 3JQFC 3F4BA 3O38A 3PYMA 2ZKLA 2AQIA 3D5TA 5IDXA 4CMCA 3DC2A 3FD8A 4W9NC 3WWZA 3AFMA 5ENVA 3U3XA 2NTNA 4R1TA 3PYLA 5CDUA 1I3LA 1DIRA 3F9IA 3UW3A 3AOEC 5A02A 1ZEJA 1G6KA 3ZH2A 4UUMA 2UYYA 5KJ6A 1YB4A 1PZFA 3Q2KA 3AW9A 3ITDA 2WM3A 1B8UA 5AXBA 4Z6KA 3EAGA 4PVCA 1Y8QA 4YA6A 5EN4A 4XKJA 4IDDA 1JU9A 1P1KA 1IZ9A 4DBZA 3I9LA 5AXAA 4B8WA 5JAMA 4DMMA 3C7CB 3RUAA 4F6LA 3ZCXA 4J4BA 4R1SA 1R15A 4TRRA 4MKRA 4BO4A 1F12A 4QFDA 1K3TA 5KNLA 5F1KA 2I66A 1NASA 4PZEA 2BKAA 4MVJF 2ZTVA 2POQX 3UICA 4G5HA 1ADCA 4MKZA 1HE5A 4JN6B 3NDRA 4DYDA 3DBRA 3E5RA 2Y1OA 4YRBA 4CMAA 3GAZA 1VL6A 3RWBA 3PGJA 2NM0A 3PPIA 2Q49A 4D43A 1AXGA 4BNZA 4BNTA 3DMTC 4E6PA 3WGQA 3AU9A 4LGVA 1Y8RA 5DN9A 2YHUA 1ULSA 2VT3A 3OA0A 4HFJA 2H63A 2YW9A 4CQMB 1QR6A 5IZ4A 1H2BA 4PLTA 1ZKMA 1DFIA 3JQ9C 4Q3CA 5KJ1A 3CUKA 3M2PA 4JX8A 5GY7A 3MOGA 1GPDG 1KERA 4AJOA 1ZSYA 4CMEA 5L95A 1QXSA 1ENZA 1I2CA 1CDOA 3PJEA 3E9QA 2O7QA 4QXMA 4KTVE 3WMWA 2BMAA 4E5KA 2HAEA 1H94A 3UXYA 4BO3A 4YXFA 1PL6A 2Q2QA 4MVJE 3NYWA 1DFHA 4FOSA 4B3HA 3FI9A 3FHLA 2VWHA 4NZ9A 4CM4B 2GN6A 2BELA 1LBEA 1R0SA 1O89A 2NACA 1EUZA 5KJFA 3QWAA 2PY6A 1KVRA 4UEOA 4TZTA 1RYEA 4B3IA 2JFFA 4GI2A 3GDGA 2BLLA 3KYBA 2JJYA 2HMTA 2ZTLA 4RV9A 1GEGA 5EQDA 1H5QA 4IJWA 2WE8A 2WMDA 1PWXA 3T7EA 3F5QA 2YY7A 1YGYA 3GEMA 3JTMA 1LSOA 1ISHA 3Q1LA 1CERA 1YL5A 3STHA 1QLHA 1EVJA 3E9NA 4PLWA 1E7WA 5L7YA 5TJ9A 4MINA 1CEQA 4GGPA 1NHWA 3LC2O 2GLXA 2WWRA 2DTDA 1ZK4A 4NFSA 4IINA 4CL8A 1I2ZA 1ZSNA 3OMLA 4AJEA 3NRCA 1B26A 1V6AA 3ENNA 3GEDA 4ZJUA 3K73O 2IODA 3SC6A 4GPD1 4UVDA 1P9LA 2J3IA 5IXYA 1WVGA 5JBIA 4HNGA 4O5OA 1UZNA 3SLGA 4RVHA 4WLUA 4WNCA 2R6JA 4OQYA 2WEKA 4RF2A 5TRTA 2CVZA 3H5RA 3E82A 1E1LA 3MJVA 4OOFA 2A4KA 3IDSA 4EI2A 1D1TA 3W8EA 3HFSA 5EMHA 3CH6A 2Z5LA 2E37A 1Z75A 1C0KA 1QYDA 5AVOA 4IBOA 4N5MA 3WGYA 1B14A 2DBZA 2VUTA 4YDRA 1NVGA 4XIJA 2QRJA 1B2LA 1DDOA 1Z74A 3KETA 3E48A 1PS8A 4R3NA 3OFSA 4RQUA 4Y98A 4WLOA 5TSDA 1VM6A 5B4TA 5KJEA 2BD0A 4J0EA 2JL1A 3CSDA 3VVCA 5CEFA 2J5KA 1MFZA 4YRDA 3MWDB 3VHRA 3RFTA 1T24A 2GERA 5FI3A 2VYVA 3D3WB 4CMIB 3BMQB 3X2EA 1BDMA 2B4RO 3NJ4A 2C07A 3S55A 4YR9A 2GNAA 3BHJA 3ZW9A 4NJMA 1CRWG 3TZQA 4ND3A 2PKQP 5CG1A 3ETDA 2ZATA 4I9NA 3UHAA 1NR7A 4R01A 4CQMA 1X7GA 1YBAA 3MJSA 5L3ZA 1P3DA 4YJHB 3CXRA 5ITWA 3V2UA 3ZHZA 2I5PO 4E5PA 3PHHA 4YCAA 4FW8A 3GAFA 2OP1A 3TDKA 1C3VA 1HSZA 2O2YA 1NPDA 5JDIA 2PV7A 2O50A 2NADA 1HF3A 1M2WA 2CF6A 2HKIA 2Y68A 1RWBA 3M1LA 1OC2A 3OA2A 4FBGA 3DEYX 4YRAA 4NBRA 3UOGA 1BVRA 3G1UA 1ADFA 2D4AA 4E5YA 5EJ2A 4L0QA 4U7WA 4XDZA 1IPFA 2HRBA 3BTSA 4A27A 4RVGA 2ZCVA 5EPOA 5FF9A 5A1TA 2DBVO 3IUSA 5I7EA 1HZZA 2BFMA 1ZIDA 2VZ8A 3GZ4A 3KEQA 4CM4A 2D5AA 5TF4A 2B83A 1Q0LA 3TZHA 3WGHA 4JP2A 4D3DA 4L4RA 3KTDA 1KY5A 3WGTA 4G65A 4DPMA 5G2OA 3C7DB 4M87A 4R3WA 4GVXA 3UGKA 2WYWA 1LX6A 3OHSX 2Q50A 1Y9EA 1LSSA 2Z1MA 4EBFA 1P1HA 2GR9A 1E5QA 3FPCA 1RM3A 5ICSA 1A71A 4TSKA 3W1VA 4D46A 4CR7A 3ROMA 1FMCA 3O26A 4F45A 5JXWA 1XYGA 2YQ5A 4IXTA 5DT9A 5A3JA 1EDOA 1Y5MA 1PJQA 3UUWA 2IE0A 2Q46A 3GGOA 3GGGA 4D41A 4JNKA 4BNJA 3KHUA 1MXHA 1ISJA 4FOOA 4R1UA 3RUCA 1MB4A 2IXBA 4DVJA 3Q2IA 3ZV4A 4UVIA 1IZ0A 3UKOA 5IFLA 1ZO8A 4JBGA 4CMGA 5ICMA 4ALMA 3ONFA 2DLDA 5B12A 3IJPA 4FC7A 4TMFA 2WTBA 3EVTA 4D7AA 1HYEA 1R4MB 4BHTA 5CDTA 4HADA 4HX5A 3ANNA 1LEHA 1PZGA 5JW6A 1K2WA 2AEFA 5JS6A 4A0SA 1E0DA 5THQA 4QECA 5AOVA 5EQFA 3H6KA 4HFRA 2ZIZA 4A03A 3GHHA 4K6CA 2C0CA 2YQ4A 5T6BA 1C1DB 5BNFA 3UCFA 2X0RA 2EP7A 4E0BA 1EQ2A 1DIHA 3GOHA 4F6CA 5F3RA 3VKUA 5EIOA 1TI7A 1GFSA 4PG7A 1AN9A 1YJ8A 2HLPA 2PKRA 3JQEA 4JROA 4FFLA 1XU9A 1D3AA 4O63O 1GDHA 1YO6A 1FDTA 4F3YA 4AL4A 3PP8A 3D3WA 4CMIA 4IQ0A 4L74A 4Q3NA 1E6WA 4TRMA 3RASA 1NR1A 1KY4A 5IAAA 3I9NA 2GN4A 4BNHA 2D2IA 1I8TA 5FWNA 1NPYA 2WJPA 4LVUA 5AXDA 2W2KB 5KVQA 4K6FA 4YYZA 5TGDA 3U9LA 2YDYA 2C7VA 3QW2A 4YJHA 4TRJA 1NAHA 4RCVA 1I3MA 1ORRA 1UXJA 5F5NA 4UVGA 4CR8A 3RU7A 2VHXA 1NAIA 3TZ6A 2QG4A 4CV1A 3JQGA 3WNQA 3FWNA 1SEPA 2CDAA 1VKOA 1JLLA 5CHEA 3UAGA 1PGOA 2J3JA 2ZB4A 3L9WA 1O8CA 4XWYA 2JD1A 4IQGA 4INAA 4AJNA 1BSVA 4BO5A 9LDBA 2EW8A 1I3KA 5JLAA 1TVEA 3DDNA 4CQLB 4YTEA 1DC3A 2W98A 3JD1A 4XR9A 2J3KA 1EMDA 3WFIA 2HRZA 3RI3A 2DBRA 4II2A 2IDZA 1MUUA 1DHRA 1NFFA 1OZAA 2X5KO 1VLLA 2I99A 3EMKA 3RUFA 3WGZA 4ALIA 3K31A 4ID9A 4EUFA 4NBUA 2Z1NA 4KP7A 1XQ1A 2JD0A 1GV1A 1R16A 2O2SA 2VWQA 1BDBA 2RHCA 1A4IA 1BGVA 3ADPA 1ENPA 4QQRA 4UAGA 4AJLA 3LC1O 4XYEA 1U8FO 2VHYA 4N54A 1R66A 4QEDA 4IJVA 5DBGA 4UULA 3BMNA 3Q9UA 3KXDA 2VYND 1HWYA 3FR8A 4CM6A 1HXHA 4OSPA 3TZKA 1QORA 1D7OA 3GGPA 3L6OO 3G3EA 4I8XA 3VVBA 4DQVA 1FXSA 5ER9A 5TIIA 2B4QA 4BKUA 3JD4A 1SB9A 4MVJH 1I0ZA 2EJWA 1M67A 3ITKA 2HMWA 1RJWA 4BNWA 3U09A 1X14A 1R4MA 3NT5A 1J6UA 3ZWNA 2W2LD 4O59O 1M75A 3ZN2A 4Y9DA 1ZJZA 4NMHA 2FY8A 3E9MA 3RFVA 3LT2A 2LDXA 1Y5RA 1HYGA 1PEDA 1GAEO 3TFQA 4OQZA 5IN5A 3CTMA 1X7HA 1JQBA 3GY0A 4A73A 2FPIA 3WGGA 4C7KA 1SPXA 3RBXA 5EL0A 1C1DA 3RUEA 3HJAA 3OEWA 4FJ1A 3CMMA 2QRLA 3EDMA 4M8SA 2O3SA 1J49A 4PIVA 3AI2A 1B0AA 4BV9A 4BKOA 4IS2A 1RM5A 4I5EA 5F1PA 1ISFA 5H82A 3WTCA 1NM5A 5TJHA 4A5OA 2O23A 4YB8A 3H2SA 4A2CA 5A05A 5DCWA 1O94A 4CLOA 1PWZA 1RPNA 3K5PA 4MIYA 2PWZA 3AFNA 2HMUA 2W2KA 2VT2A 1F14A 2E4AA 4Q3EA 1DXYA 1ISGA 1E3WB 3QP9A 1KVUA 1B8PA 4MJLA 5L7TA 3ZWVA 3DR3A 3RBZA 5DCYA 1YBVA 1OFGA 4CMHA 1K0UA 3GUYA 2E49A 4WPGA 1LRLA 2P4QA 3LYLA 1BXGB 3H2ZA 2EIHA 3OIFA 3JQDA 1N5DA 1QG6A 2VOJA 2Q1SA 4UUOA 2JFHA 4B8ZA 4QFCA 2JCYA 1G0NA 5H81A 3AUAA 3N74A 2AXQA 1BG6A 4E12A 1CWUA 2Q3EA 3A06A 1I24A 2A94A 4BO2A 1U3WA 1E3LA 1EVYA 1HSOA 1L7DA 5G0TA 4CQLA 4IDEA 4U6SA 4CV2A 3VH3A 2FMUA 4B79A 3BMOA 3H9EO 2ZB3A 5JSFA 5JAIA 4DPLA 2AQKA 1YS4A 2CZCA 3WYCA 1NFQA 4BNIA 5HS4A 4I5FA 2VYVD 3WJAA 3PHGA 5CEJA 2C29D 2HSDA 4OKNA 1YRLA 1TEHA 2VZ0A 3RC2A 3T4EA 4D3FA 1RKXA 1GU7A 5CPBA 4CQMD 1B15A 5IZCA 4OYRA 3VZSA 1BWSA 5EESA 1GQQA 1UP7A 3ZU3A 1DHTA 1P45A 1AHIA 3PEFA 4EW6A 1Y7TA 3EHEA 3SXPA 1ZZEA 2C59A 1KEPA 4BNVA 1Y1PA 4N5LA 3DBRB 1D4FA 1X15A 2AA3A 2E82A 2AMFA 2HMVA 3GHYA 1LI4A 3JCZA 4IIVA 4IPTA 4J4HA 4KUGA 1XLTA 1NXQA 1L7EA 5T8KC 4WASA 3ZWAA 4XIYA 1X1TA 1Y8RB 3HDQA 4CM1A 4XD2A 2VWPA 4CM7A 5TLSA 1NNUA 4ALNA 2UUOA 4HNHA 4CUKA 4CM9D 2RCYA 1F06A 1FDWA 2UAGA 3NUGA 1A5ZA 2Q4BA 4GH5A 3X2FA 2J5RA 3SX2A 4B4VA 3PJDA 1YBMA 2F1KA 4IMRA 2JD2A 2V6MA 4IMPA 4MVJP 3HDYA 3DAPA 4HV4A 3QY9A 4OOEA 3U4DA 2NQ8A 1OI7A 3V2GA 1PJCA 1HZJA 4OO3A 5CDSA 2YJZA 3B1FA 3I6QA 4BV8A 2DU8A 4J1SA 3D1LA 4L8VA 2C7GA 1HETA 4BMNA 4DLBA 3WB9A 5A5EA 3HN7A 4KOAA 2Q99A 4CMEC 4OMUA 3IMFA 1E77A 2EKQA 5T57A 3RSHA 5AYVA 1MXFA 2OZPA 3N58A 4UEJA 1JAXA 1T2CA 3W6UA 1XHLA 2HJRA 4KUHA 3E5MA 3LT0A 3IKTA 3IUPA 3INTA 3INGA 3Q11A 4ZGWA 5U4QA 2BRUA 2BHLA 1KC1A 3C7AA 1PQPA 3F4LA 3RKUA 4JLWA 1SO8A 4TRNA 3D0OA 3RVDA 1AUPA 3QVXA 4GLLA 1NTOA 1UAYA 2PD4A 1EDZA 5C7LO 1ZW1A 2JHGA 3VPFA 4J49A 3NTQA 4GLOA 4E32A 5DOVA 4QSMA 4CLRB 4J0FA 2W90A 3V8BA 1BXGA 3HN2A 3NJ8A 3TOXA 3GPDG 2ZCUA 1E3EA 1P1FA 4OH1A 3OP4A 3L77A 3I23A 5L53A 3RU9A 3RC1A 2CFCA 3GG9A 3GLQA 4LMRA 1PR9A 1LLUA 2XAAA 1GUZA 1WDLA 1P33A 3TRIA 3OSUA 3JYQA 1XQ6A 5B4VA 1FK8A 1K6JA 5ITVA 4D3SA 4FD3A 3PFWO 3LU1A 2P91A 3LZ6A 4R41A 5JNLA 3WDSA 2V6FA 4CR6A 4K9DA 4PLYA 4NU6A 4N5NA 1DO8A 1R12A 1DIBA 3NT2A 3NTOA 4Q3AA 3DTYA 1Q0QA 3WWYA 2B4TO 4KWHA 5I8ZA 2IRWA 5L7WA 1OC4A 1U1IA 1KEWA 5A9TA 3DZGA 5JAZA 4YWJA 4FIZA 1Z82A 3KM0A 1U7TA 4RZIA 4DTIA 3ZWWA 4OL9A 1MP0A 1WDMA 5HBRA 2PH5A 1N7GA 3SBOA 4Q3BA 2X5OA 3HZZA 4PLFA 4QX6A 4ZQHA 3T7CA 4E2ZA 1ONNA 3OIGA 4PRKA 4GMGA 4IXWA 3GK3A 1T25A 1B3BA 4BO8A 4BVAA 3HHPA 3PFFA 4RDIA 1GR0A 1HRDA 1LDBA 3EUWA 4LSMA 3OETA 4GAEA 2ZYDA 4NJMB 4RF5A 5G4KB 4BB5A 3FNEA 1I3NA 3DMYA 2ILTA 3HUDA 1D1SA 4WOJA 3WJ7A 1LQTA 3O4RA 1LUAA 4KMSA 1ENOA 2X9GA 3AUUA 2P5YA 3JQ7B 4WCFB 4CMJA 2PGLA 5THKA 3RFXA 4NPCA 2X1HA 4BKPA 4XCVA 4ZD6A 1JKIA 3AM4A 2EF1A 2VYNA 3H9QA 1X0XA 4BNUA 4WUVA 1NX6A 3GVXA 3ROPA 1KS9A 2RIRA 2JKVA 3RBVA 3JD3A 3KSZO 4MP8A 2QYSA 4RVSA 2IZ0A 3DOJA 2DFDA 1TXGA 1O9BA 1UJMA 1I2BA 1LC3A 2VCYA 2CDCA 3IS3A 3NGLA 1DBVO 1EVIA 2RBEA 2CUKA 4E30A 3QWBA 2W2LA 3ZDFA 5JDIC 3HQ4O 1ZVMA 4R5MA 1XGKA 1KETA 2GCGA 3PTZA 1ISMA 1BXZA 3PVZA 1V3VA 4BGEA 2NNLD 3H8VA 2Y0EA 4TROA 3VZRA 2H6EA 4PN3A 4ITUA 4M55A 4XDYA 3TQHA 4GX1A 4CJXA 1PS9A 2FR1A 4K26A 1HDOA 1Z7EA 1UXKA 3OBBA 3RD5A 1BTOA 1JW9B 4HY3A 3RUIA 2OHXA 4EJMA 1HDGO 2YZ7A 3NGXA 3H9UA 4P4NA 4MVJD 5JPIA 2G1UA 1A9YA 5G4LA 3I4CA 1VC2A 4IDAA 1EQUA 2VHZA 4RO0A 3KB6A 3FR7A 5CG2A 3G17A 4B7CA 2IEDA 3FBGA 1MG0A 3H4VA 1QRRA 1A4UA 4CLRA 3C1OA 1BMDA 3GNTA 1WDKA 2IXAA 3ONEA 5L4NA 2V6GA 3MJEA 4J2HA 1VJTA 1I01A 3WBFA 4RPHA 2EWMA 2NSDA 4JK3A 4R5HA 1NYTA 1E3SA 1U2GA 3AOEA 4Y6SA 1BW9A 1GYPA 4CPDA 4H3VA 2P2SA 4I08A 4BNFA 1DRWA 1ZJYA 2CVOA 4ZA2A 2I67A 4Z9XA 2YUTA 2NU8A 5ER6A 3CE6A 5JDCC 1LJ8A 4CM8B 3ICCA 2X4GA 3GVHA 1JDJA 4AJIA 2OO5A 2CVQA 4RVDA 2GPTA 4FPXA 2DTXA 1E92A 3PHLA 4CUJA 4ZICA 1IE3A 1PQWA 2Y67A 4DIBA 4W7HA 4BO6A 4EZBA 1AGNA 3WS7A 2YFQA 1YH3A 3L4BA 1HDZA 1ZUD1 4DQXA 3C1TA 5A06A 1T26A 4MOWA 4XYBA 1P0FA 5DZSA 2CNBA 4FCCA 4JXKA 3ZWCA 4W4TA 1ZK0A 2G82A 3BHIA
chains in the Genus database with same CATH superfamily
3RK1A 1F0PA 1HMPA 4RL4A 3E4DA 3UMJA 1EEXB 4DUGD 1CUFA 3JSXA 3ZWBA 4GE0A 1IXRC 3KPVA 2WAAA 3AKZA 4PG8A 1B41A 2HPAA 1I5RA 1SZCA 3UK0A 4DLYA 4Z9YA 2FUG6 2P5SA 2Y1FA 3QPUA 1EX1A 1ZCBA 3PPVA 4INOA 3FBTA 4MZDA 4YQYA 5JASA 3TX2A 1U2TA 2X7JA 5JFTA 5K0BA 1L9XA 2GS9A 2I9PA 5KYUB 4WLVA 4NU0A 4FDUA 2BGRA 5B64A 3CB2A 4C6TA 4AZSA 4DBLE 4RMNA 3K0AA 4AG5A 1OV4A 3U3RA 2V4ZA 3VR4D 1KYQA 1PJRA 1KZGB 3FNHA 4WK0B 1OAOA 1OILA 2Z5VA 4IEFB 4PINA 3BAZA 2V0GA 5KSZA 4UBJA 3PKZA 2R97A 3ZJ5A 1EVEA 1WKBA 4KVZA 1VDMA 1LK0A 2GPNA 1XVIA 2DRIA 3NEPX 1UMCA 4DB4A 3RF7A 5CA1A 1DKUA 3MBIA 2VF2A 1MW8X 2W48A 4Y2RA 3K5HA 1E1CB 2AZ4A 2BJHA 3G0CA 3H3XA 1P8AA 4QWWA 4EG7A 5LOVB 4NEHB 5LZ5A 1U7XA 2XMSA 1IWOA 2L19A 3L9XA 1W0JA 1DTWA 4XRRA 3ZJUA 2REOA 1JJIA 2GILA 2G36A 1KS2A 3KQVA 3LLMA 4JVSB 2ORYA 1CKEA 4RE6A 3KJGA 2ZZMA 3OQHA 4Q47A 2LKDA 2R6GA 4HB2A 4IX9A 3SEQA 3V1NA 3OJ0A 4FZ5A 1B73A 4HWGA 4OGWA 1SUIA 3I4FA 4OP2A 1VJRA 2P9EA 1HEUA 1N57A 3DM9B 4LYEA 1Z5UA 1YF3A 1U8EA 3NC1C 1CLUA 3JWHA 2GPBA 5BORA 2VI5A 4J1TC 1U3UA 4UU0A 5B3JC 4JLBA 4KDCA 1I30A 1V11A 2QMOA 4D9IA 4JXZA 4K9LA 2Q7XA 2ZAOA 2WSIA 5E7QA 2JF0A 3NHYA 1Z5GA 3MWEB 1IJFA 3P9YA 2O8BB 4EUEA 1KBZA 2E4YA 3R0IA 4WK6A 4YXWA 3IL2A 4IHJA 4KPYA 1UINA 1L5RA 2NZUG 1DRVA 4LVOA 1LDGA 1ACJA 1WUKS 3OIDA 4N49A 1JLKA 3IX7A 4LVCA 1RXYA 5EWMB 1U2SA 1J8VA 1YE5A 5HG0A 2UZ1B 4O4HA 3WKDA 1T36A 4D4KA 1RWKA 3F6SA 3UMCA 4HB0A 2OGTA 5CBPA 3ONWA 1ZM3A 2WYVA 4J6FA 5CCEA 2GZAA 1FA9A 2VDOB 2QRMA 1QIHA 1D2EA 3HA3A 1BU8A 1EFUA 1JKJA 2V8BA 2YV3A 3CISA 2YOFA 1U0SY 2FR8C 1D5CA 1QYCA 4F3TA 3N05A 3ST7A 1VXOA 1KDRA 2FSPA 3D9QX 3ZGVA 1BMFA 1GQ2A 1T6YA 1J20A 1OD6A 1W1IA 3D4NA 1F38A 2QRVA 3NETA 4DLVA 5C8VA 3EZYA 1S7CA 1G16A 1XQ9A 1F0NA 1PG5A 2WFZA 3DDZX 2Q07A 4C0HA 4E70A 3A28A 2VRBA 5CBKA 3L43A 4QUIA 4ZYUA 2J59A 1RLIA 5DKFA 4DMLA 4MEJA 1KQFA 3WAGA 2BMJA 1Y5NA 2YVLA 3HZRA 4RKFA 4FN4A 4L4XA 2X4DA 3I5XA 1H22A 3CKMA 4MAMA 4GI5A 4KO2S 2EW2A 4E2WA 4PS1A 3AJEA 1IHXA 2BZ1A 2ALJA 1LLFA 2H1RA 3DZCA 3FAKA 5I7SA 3K6KA 1N5RA 2QXTA 1Z15A 3NGMA 1XMSA 3AYXB 4ME6A 3NAQA 2JI8A 2OV2A 3KRTA 3R6GA 4WOCA 1GQYA 2A78A 1FNDA 3M4XA 2BP7A 3TJRA 2JGJA 1BNCA 1D9XA 2RD2A 5TC4A 4O08A 1RBYA 3VUFA 5CJJA 3OJWA 2XA9A 4CLOB 4C7VA 5GMOA 1M8KA 5DWVA 1NPTO 3L8EA 2Q7OE 1M2NA 4BMCA 3HUTA 1WLSA 3VBEA 4FFMA 5HKKD 4I1OA 5HRAA 2SCUA 4MS4B 5GINE 1LNQA 2D1RA 3HUEA 4MICA 4QODA 1GPKA 2PKQO 3GPBA 4QPDA 5TMBA 1PNRA 3DL7A 4DMKA 1Y48E 1C0PA 1MO6A 3B7WA 4ZRNA 1TYAE 3IMGA 4INZA 1SVIA 2YXDA 3V48A 4QOJA 4QNNA 2JKZA 4B33A 4BNMA 2J9RA 2FXVA 3LF1A 3C85A 1RC8A 1SIWA 5AIBA 4R2KA 1Z6AA 3HB4X 4HNQA 3U44B 5HE9A 3ZXUB 1HT0A 3SJUA 2R9VA 5LYJF 3EGCA 2AB0A 5ALLA 2Q1WA 2R8XA 1W0CA 1UFOA 2O3JA 1DQYA 1VLVA 1E99A 1NBAA 3P20A 1XTQA 2PNFA 3NAMA 1QMGA 4MPPA 4YAKA 3HBMA 2UYHA 1QHEA 4FHDA 3KJHA 2RHLA 3ZLJA 3DG9A 4J7UA 4UNSA 3S6JA 4ZI7F 2R7NA 1RI3A 3OEYA 4JVMA 1RZRA 4LK3A 3N8DA 3NCTA 4QVGA 1Q0TA 1P60A 3GFSA 4TUYA 1NIPA 5CA0A 5I9LA 3KUCA 4R0VA 4YJGA 4EG1A 2OAP1 3GYBA 3HO6A 2UZ3A 2IYOA 3QVJA 2BI7A 2P90A 2Q5EA 3Q40A 4HPXB 2VTKA 4WN9B 3OFJA 2LWIA 3O47A 4OXRA 1Y82A 1KVTA 1X3LA 3CW2A 3ADDA 3HM9A 1WXEA 4FGLA 1CUCA 3CUWA 4N0QA 3V7WA 1MN6A 4L6CA 2XYVA 4OIFA 1C50A 2W58A 1TF2A 3G85A 2A59A 3OX4A 2ICAA 1Q1BA 2CMDA 5HZKA 1X39A 1PJSA 3NBYC 2J87A 1DJNA 1HE1C 2PJZA 3OQIB 3F46A 1V5WA 3HRIA 4ER6A 1G5PA 4B6OA 1RRPA 2N0SA 4HX2A 1EWYA 1SB8A 2Y1XA 3AO0B 4J4TA 4BO9A 5M29A 4DV4B 4LDRA 2ZDHA 1P4GA 4ZT7A 1G6HA 2G9RA 4CEIA 3GD7A 2IXFA 1DFGA 5TQJA 3LBIA 1QB8A 3N2GA 3PBKA 2HRQA 3QVSA 4MUBA 5G0VA 3BRWA 3HKDB 1Y33E 3P32A 4Z0PA 4BWFB 5EXSA 4D0SA 3N2NA 1OPXA 3C8UA 3ZU5A 3AEUB 4DADA 3E7PA 2HK9A 4AKTA 1M7BA 2F8LA 3Q9LA 2G04A 5CJ2A 5IHPA 4GOXA 2OP0A 2R7AA 4IXMA 4UMFA 4EA7A 1KU0A 5J59A 3HADA 2XUOA 1C0LA 4RY0A 5IT4A 2CY0A 2ZK7A 4INPA 1VJDA 4X1KB 4N47A 4MHTA 3RV4A 2VRCD 3BWYA 5DMXA 2F3SA 5AW7A 3UWOA 1AK1A 1OFIA 1XTPA 1MH1A 1XLTC 2D7DA 3AR8A 3ZC3A 1QO7A 4B75A 2EX0A 1IXKA 4J16C 4Q1EA 5F4BA 1FP7A 3T3MB 1KP3A 2APJA 4FU0A 1G1MA 2OXEA 3MBOA 2E1PA 3LK6A 3FZGA 3R7SA 4K40A 1AK9A 3N2EA 4FFBB 2QSZA 5GIPE 2XNSA 3DE7X 1DO0A 4O8ZA 4B17A 2QUHA 4QEKA 3U4IA 4H0FA 4AI6A 5HCIA 3QSGA 2XDYA 1BJTA 1JHRA 3L0PA 3M9WA 3V2IA 3ZWPA 4CDMA 3ROXA 3DE5X 3FYUB 4YAGA 1CZLA 2ERCA 3VOBA 1TCCA 1WP9A 4WINA 5GADl 2ZR0A 1Q19A 4CV3A 5D01A 4DDKA 5EEHA 4YAFA 4WKCA 1N5MA 1NXPA 2WMOB 1W8DA 3ADCA 4TMYA 4TXJA 3EVEA 5BNTA 5SZIA 4JB3A 2IHKA 5J4VA 2FQQA 4HQKA 4LMPA 4TVBA 2JFYA 4BGUA 1WX1A 2N75A 1T3SA 4CNQA 1QGAA 3WLFA 1KYYA 3K6JA 1KVQA 1QPZA 1NBHA 1X38A 3LRTA 4AICA 1ZMTA 4DYVA 2YBDA 2NPIA 3PHBE 3VOSA 4PR3A 1DCTA 4WGGA 2OK8A 2IPLA 3C7KA 4H4EA 4XIGS 3QVOA 4DUGA 1UPAA 1ZDMA 1GZHB 1J7JA 2V8OA 1RXCA 1W29A 2IOFK 3GFPA 2Q2OA 1U7HA 3H97A 1PV1A 4MI6A 5AW5A 1OHHD 2MSCB 2HU8A 1KE1A 1C9MA 1Y1QA 4MKGA 1DOHA 2H4FA 4S0XA 4K9PA 4BUCA 4YCSA 1YQTA 1Y8AA 2BFPA 5ESWA 4DV3B 4KZPA 4JDPA 3Q7QA 1T0HB 3JPWA 5FTJA 5F35A 3L0BA 1PFUA 1M2GA 5T41A 4DC9A 2CZQA 3G49A 1Z68A 3B1KA 3H4TA 2F3UA 1T1SA 2EKDA 1OREA 3FIJA 5F98A 4M88A 2W0MA 3VR4A 2BTOA 1W4ZA 2NYAA 2J6IA 3WWEA 4GBGA 4LCBA 5BUSA 2EERA 5LZ7A 3O1HB 1Z7BA 2F67A 3NKLA 3KEOA 3M6XA 3RVJA 1WSWA 3K9NA 5E8RA 3GJ4A 5MHTA 3JRWA 1UIMA 3B51X 4YDSA 1N1EA 1LPPA 1Q3KA 2UDPA 2QRKA 3G5TA 1KNQA 1MABA 1ZXBA 3D4BA 3PGVA 1OXTA 4GM0A 2X8LA 4RY8A 2PMKA 3AP3A 1I1QB 4Q4HB 4X7PA 3UH0A 3WNBA 4E4YA 1FJ2A 3LQYA 1NQTA 3GDWA 4C0KA 3QHAA 1R5OA 5L6LB 1MOSA 2FI1A 1FFSA 2GKSA 1VE5A 1PZHA 2BDEA 3B2NA 4P5PA 2C5AA 5JXJA 5U9CA 2Q0SA 5LQRA 1UBMS 2Y2UA 4YMUA 1EJBA 2BLNA 2FOLA 4LBYA 5IASA 1YZVA 2YV5A 1T2EA 3PLNA 1PSDA 3RYIA 2VJMA 1CV2A 3IR5A 3QXHA 3FGOA 3IYLW 4JA2A 4RGQA 3FF1A 2IQIA 3P9SA 4LC9A 1UPXA 3S5UA 5C4MA 3DZJA 4IJMA 4HDKB 4PZUA 4ND7A 3ZEIA 2A5GA 2I87A 1Q0UA 2FFRA 1EVLA 1QC5B 2O4UX 1YOBA 2Q45A 3FNFA 4IJUA 3P0HA 4MIKA 1A8IA 4YT2A 1ZD3A 3CNQS 3LL7A 5CD9A 4L73A 2X0EA 2DFTA 5DBHX 3VTKA 3JRNA 1GPYA 4ITVA 3GLVA 4GNKA 4PLVA 4WOBA 2ZYUX 3ZV5A 3UA4A 3FCYA 1W87A 1PJTA 4I5IA 3GXOA 4QDKA 5BSTA 5JY6A 4LE0A 2CN1A 6REQA 5FO0A 3H9BA 3HPRA 4HNRA 4NCHA 5ES3A 1GNTA 3A3YA 2GJSA 2X22A 4X44A 2IHJA 3GNSA 4EW3A 1SC9A 2V7WA 4O4LF 3LC0A 4BBZA 1E0JA 2XCQA 4GWKA 1NI4B 5TGTA 4F4JA 5JSHA 2HF9A 1XDZA 1OFTA 1AC5A 1IJKA 4X6UA 4M9CA 2XCLA 5E4TA 3E3NA 4J94A 4ZOCA 3U16A 4L8FA 4J7AA 2ECPA 2PD6A 2DX7A 4WBSA 1RM0A 1NVBA 3WV4A 1D0SA 1H5UA 4FMPA 3EY4A 4R2IA 5CLLA 2VQEB 1HG1A 2V54A 4GP9A 4ZAFA 3SPXA 1N92A 2AK2A 4K2HA 3E7WA 1GADO 1T5HX 1W5EA 3VR5H 2HR1A 1G3QA 1HORA 3DOCA 3SQOA 3B82A 1UWKA 1GZUA 3F6BX 1VHQA 4G4JA 1VIAA 2X6TA 3INRA 4GG1A 4LFCB 5IJ9B 4QUDA 2J5QA 4P53A 1E3MA 3O9MA 4ARVA 2UXBB 5TT1A 4BVFA 4AMVA 3KR1A 4X85A 1XTUA 3IXLA 1K86A 2C42A 2Q2VA 2G40A 2ZIAA 2ZQZA 4WDRA 1XHEA 3VNRA 1Y9DA 4WEOA 4AN0A 4FYPA 5FBHA 1UXOA 3CX8A 5HK9A 3DMFA 4TL6A 2XYRA 2YNMC 3C8HA 4PTLA 4QC2A 1U0TA 3GVIA 3O1LA 3O9ZA 3VU9B 2FVXA 3D2BA 4RH1A 5LQDA 2YYAA 3VU0A 3ICPA 1LLCA 3LA6A 5GTDA 2DT8A 2ZULA 4W7SA 1AMOA 2Q62A 2YW2A 1PNQA 3JD0A 3LUFA 4XIIA 4XQ9A 3RSCA 3RIHA 3UT0A 4ERXA 2ZBDA 2PM8A 4BNDA 3S7ZA 1DLJA 5HKKA 1VZ2A 2HLDD 2A4MA 4ZXPA 3ZE1B 1BD3A 2XT0A 1RFGE 1FFHA 1ODKA 2HLNA 2WMYA 3BAFA 1YRHA 4XASA 4C5CA 3QWIA 4HQLA 2H2AA 3WOHA 1AXRA 1J1UA 4CDRA 2JH3A 4DNQA 5A9SA 2HSEA 4Q7QA 3IHTA 1Z8FA 3SXJA 1AF7A 1P81A 2BN4A 3G9QA 3MAAC 4LTDA 3U0VA 4CL3A 2Z8ZA 1IZ7A 4EY7A 1IU9A 1VL5A 2PANA 4LECA 3Q9NA 5JYDA 3EGVA 1VE9A 4EG5A 3LOQA 1AG9A 3I3OA 4XLTA 4H0CA 2Y9MB 2OQVA 3NNSA 2F43B 1G60A 13PKA 2EX1A 2YUIA 3MGAA 1TA4A 5FO1A 4BLTA 2VDRB 4ER3A 1JHYA 2IS4A 2MSEB 3EBPA 4NR0A 1C2TA 2AF4C 5DTQA 1ADBA 2QUBA 3KYCA 1RPAA 3WWPA 3ZW7A 3UJAA 5SY6A 1JECA 2C5EA 2LGJA 3KZNA 3NDJA 3ZCUA 5CB6A 2O19A 3CH4B 4LHSA 4C0JA 4HL6A 4TTQA 3VO1A 2NUPA 2NUTA 1A72A 2B9VA 4FEAA 1G21B 2BHTA 3CN7A 3VTZA 4YX9A 1BC5A 4RL6A 4JP5A 4C43A 5K01A 3O7WA 5L45A 1ZN7A 2YHAA 4REOA 3THXA 1L4FA 5T8KA 4ZTUB 1H3NA 2B36A 4QGFA 1OWOA 4ZT3A 2ATEA 1VMDA 2XYGA 1K3FA 2CL7X 3K0AB 4GOMD 4IEIA 4JSTA 4KTTE 1E1QD 3VAYA 5AKXA 2HV8A 1TKRA 1JDPA 5F7ZA 4EHIA 2O8DB 4YJ3F 3N8NA 1H8HA 1UKYA 2BGWA 4DNPA 5KNDD 1TQHA 4ZN6A 2L82A 1VL8A 2Q3DA 2Y0DA 2ZYGA 3BFVA 1FXUA 3ONNA 4FYWA 4XXHA 4FKZA 5LP6F 1GKKA 1FDVA 2FX5A 1XRPA 4LKRA 1GSOA 1WUYA 2ZSAA 1UMCB 3H9GA 1TRHA 5EJ5A 1TQDA 5I6DA 1IUNA 3VV3A 2MU1A 2TMGA 3PL5A 3LQFA 4GECA 1ZN9A 2Y99A 2ZJ1A 3EZ9A 1II8A 1Z6QA 4WCFC 2QMUA 4S0ZA 3QBDA 1V16A 4L27A 4PZCA 1G5RA 3EYWA 4M83A 2OO7A 4DXHA 1NVXQ 1XPJA 2D1YA 3JASA 2CHVA 2P9FA 4KZKA 2BOVA 3CLSC 4GICA 2P9BA 3OOJA 2IBTA 4E5YA 4J91A 2YZNA 1UT8A 2OV1A 3VDQA 4G9EA 2VRCA 3TR5A 1YB2A 4JVNA 5B58C 3S5JA 1E2LA 3KPJA 5IDYA 2JFXA 5LA6A 1O0SA 1ZRSA 2P9HA 1MC5A 4AY2A 4ZU6X 2HEIA 3B9PA 4OVKA 4QXRA 1K4YA 3HE3A 3ASYA 3BWXA 4PFKA 4WEQA 2IEBA 4O02B 5FR2A 3WXMA 1KAMA 1YI1A 4JIGA 4PX9A 1JHZA 4MW9A 4GVLA 3RVKA 1EUCA 1XVAA 4GDMA 4LMAA 5BV7A 1Y8ZA 1PJ8A 3B7GA 3RRMA 3L18A 4Y0AA 1OXSC 4WLFA 3PZRA 3W2EA 1RM4A 2WLSA 4UNNA 2IUEA 2J5XA 2ZB2A 3DZFA 3JQFA 1YNOA 1J70A 2TMDA 2DPHA 2QM3A 4KQCA 2Z58A 4EPVA 1P8JA 2BGNA 5JY1A 2WDZA 1R6TA 3C39A 3D4OA 2OESA 2VATA 4TS9A 2H1LA 3OKCA 2Q6OA 4QTZA 3ZE2B 4YRRA 3UIEA 3OQBA 1T36B 1GGMA 3BILA 1KFCB 3C3EA 3E22B 5ALSA 5BO5A 3TW8B 4DCGA 3EGXB 2Y93A 4WFKA 3E27A 4LS3A 5KINB 1RWMA 3AF5A 1MHTA 1Z12A 1BIFA 3PNMA 3RCBA 2X14A 1MOZA 3ZBQA 2ZAIA 3JQ6A 4HQNA 5FRDA 5I7OA 2AZTA 2R5WA 1WXIA 2E0IA 3F49S 3U6BA 1PWHA 4WJZA 1SEVA 1DAIA 1GUYA 2JI6A 2R85A 4J2OA 4HAOA 7MHTA 4M7OA 4ARBA 3QLEA 3KHTA 4HGNA 4MROA 4C7BA 4MQUA 1KK3A 2YRWA 4IIJA 4AS2A 3CUSA 1K92A 3OJFA 4NYJR 3ZS8A 1JKFA 1OHHA 2H7YA 4CCSA 4PFJA 1WLYA 3SF0A 4YRSA 1IB6A 1L3CA 1KQNA 1WETA 5FWXB 4G25A 2FUKA 1VI6A 3L46A 1P2TA 4Q4JA 2DQ4A 3GQVA 2JBAB 2FF7A 2P4EA 4XR4A 4CLEA 4IHKA 1V8PA 3KWMA 3TW4A 3OZUA 5DRYA 1P5ZB 4YRMA 5IAOA 3VC7A 1ZIOA 1CETA 3R5SA 5TV2A 3OCVA 4HH1A 3SHFA 1CVIA 1M0TA 3DVAA 1X42A 3HU5A 5CYGA 4TL9A 4H18A 4DJ5X 2V65A 2ZB7A 4BX0A 5FYQA 4EF6A 3HJGA 3SYMA 1U0LA 2D06A 4U2CA 1N6LA 4W8OA 2C4HA 3JQAB 4XUEA 3GJXC 3K4QA 3WKEA 3FN4A 1KMIY 2AXNA 2ODEA 4L5CA 3NNNA 1Z73A 5JBNA 2GXQA 4B7XA 3H5TA 5KNBH 4KIGA 2CJYA 3BHMA 5BMVF 4OFZA 4UQLA 4DV6B 2H0QA 2CV2A 3M5DA 3LMKA 3QUQA 3N2IA 1VB3A 4CU2A 2A0YA 3KKZA 4RDHA 4B4OA 2QK4A 1E2UA 4YAWA 5AR1A 2B25A 3T06B 1OU4A 3SJBA 3ZJYA 2XGGA 3NT4A 5G1OA 1N1MA 2JK0A 2GN1A 1O5IA 2FGKA 2SCUB 4KQ2A 2DWUA 2BGKA 2X5XA 1Y4SA 5DNVA 2VP6A 3CVOA 3IO3A 4ZAXA 2B4KA 3RM3A 3O1IC 4Z8YA 1S6YA 3MIIA 5DGXA 1S2GA 3OOWA 1WPRA 3ESBA 4IOLA 1LDYA 3CRW1 5GJWC 3T3DA 5KTNA 1DQRA 4PG6A 1TJYA 1ZJJA 4NZYA 5ECWA 4JP3A 4NMMA 5FP0A 1WAMA 2YXBA 3B1JA 3VOAA 2DY1A 2PZLA 1W35A 3DZ8A 3VFDA 2F8SA 2L42A 1TT7A 3LDHA 3VKWA 3DBLB 3UCEA 4ZYXA 4C2AA 2OXFA 3WGNA 3ZNOA 5KS2A 4BLWA 1J7KA 1PL8A 1UDWA 2CLDX 3A9RA 3I6YA 4JDUA 3BWDD 4B6QA 4XWKA 2EATA 2C92A 5C5EA 4G0UA 1YL6A 4JCCA 2BSQA 3H83A 2C5LA 4YJGB 4FMCF 4LRWA 1M34A 1XQVA 4AJJA 3DAFA 1K63A 2RG1A 4B80A 4DR3B 4CLDA 1MD9A 3OMXA 3GCXA 4IMJB 4IDPA 2GM5A 2VIIA 4LV5B 4ISBA 3KVOA 4OM8A 4AO8A 3SI7A 4I6GA 1ORWA 3OECA 3JZFA 2WOOA 3NASA 4HYEA 1US8A 4TGLA 5CX4A 5CAEB 2AR0A 5AHWA 2QLNA 3L5KA 1E1YA 1L5QA 1EK5A 1ZGJA 3HKCB 4NESA 3ZGYA 4OHYA 2EVWX 3V7YA 2AZMA 5KC9A 4N12A 3I5MA 2A58A 4XQGA 3GCGA 4ZT2A 1WL8A 3R5JA 3KJNA 5COQA 5DIFA 3U31A 2RE8A 1E7RA 3WGMA 5EUBA 4O2BA 3LXRA 3GJ7A 1IHUA 2V4MA 1RMTA 4E1VA 2QP3A 3NBXX 3H4MA 1X7WA 4IDCA 1T5IA 3VU3A 2PT5A 1PLLA 4N1AA 2W2TA 1KR5A 1KI7A 1T5DX 2YJGA 5C18A 1QVAA 1TJPB 2QDXA 3NBFA 2FPGA 2BAGA 3PD7A 1I80A 4FN5A 2XPCA 3DP9A 721PA 2BH2A 1JEQB 1W85B 4EIWA 2Y4OA 3RVMA 1TZBA 4TKVA 5EHZA 4OGKA 1FU4A 5AICA 1FX0A 1ONBA 4N3NA 4P4SA 2N9UA 4YEDA 4D42A 4GDFA 4RIFA 5IBPA 4KC0A 5DM60 4YIHA 1UPFA 1XRSB 2HJWA 2J0UB 4RQTA 2R7KA 3UY4A 1B42A 3OEHD 3H1AA 1DQSA 4KVFA 3ANMA 4LIPD 4RAQA 2WYHA 2XV1A 1MW9X 3OE1A 1XXHB 1LD3A 1MORA 2O05A 4I5DA 4NV3A 3SXUA 2Q9CA 1IPEA 3C3DA 2G6BA 3JQBC 4II3A 3GVCA 3W0LB 1XR3A 3QQPA 4GM1A 4U5QA 3JYLA 2HLDA 3TXAA 3SQWA 1RRGA 4UPEA 1GRCA 1TEVA 4W1QA 5IUNC 1N77A 3R7NA 3T35A 1QKJA 3WNVA 2WU4A 3AGPA 3K1AB 3MWJA 3SHTA 1E6UA 4AROA 3GLHB 1EB8A 5IC4A 1GKYA 1GKIA 1O3YA 2WKQA 2YJ5A 2AUNA 3KQPA 3GFFA 4YNBA 1ESDA 5FDFA 5D85A 4XGQA 2ZYAA 1YB1A 5DHAA 1WTCA 3FPAA 3VKFA 4H6XA 2IYZA 2F8TA 1RT9A 2FG7C 1PWEA 3MS4A 1C1XB 2XIJA 1H9AA 3EAFA 1E4OA 2D7CA 3MVEA 4MWZA 1GD1O 1H2WA 4UXIA 4EKNB 3PX7A 4UCWA 2ACEA 5FIUA 1FMLA 1CUWA 2FB9A 2HO5A 4PIPA 3URKA 2QVYX 1POXA 1PX2A 1N2ZA 4UC0A 3GH3A 5K99A 5TMDA 2CJXA 5DXFA 3MJDA 2XTJA 1IN8A 1JEDA 1SMKA 2EKBA 2VA8A 1SOMA 3ROZA 1PR6A 1D2HA 2R1VA 3PHCA 2P5UA 5K0LA 4DLNA 4DSZA 3C5WP 1SC3A 2OHVA 4NG4A 1GZVA 3WDKA 4B3CA 2FPXA 4OHVA 3S44A 2QU7A 1SFRA 1YRAA 4MKIA 1G1AA 4PGFA 2HM7A 4E5MA 5HZHA 2WF6A 1GJRA 3KSUA 1PW5A 2XQFA 1NF9A 1K6XA 1W94A 1T8RA 1NHGA 1WMAA 1XNJA 2QF7A 3LDUA 3Q15C 4FNGA 1JEEA 4KE8A 1LQUA 5F5XA 5BY2A 2NXCA 2K5UA 2P6OA 1LI7A 2WTEA 4HYQA 3GC6A 3WK6A 4BRWA 4E2XA 1E61A 2OFXA 4N5IX 5FOTA 2ZYTX 1E2FA 4FINA 3PI7A 1E2NA 1E1QA 2CNNA 3QU7A 4TYPA 4HEQA 2J3QA 3M82A 2A0FA 4LZNA 4TLEA 1FUIA 3DNMA 5CDFA 2C57A 4NBVA 2C1XA 4C06A 1IEQA 1JRLA 3HWSA 3OM8A 4W8GA 3VJMA 5DSXA 2WJIA 4M0FA 2W2VA 3LA8A 2X7HA 5LZ2A 1JIXA 1YE8A 3PFIA 5J5CA 3MJFA 4X41A 1C7FA 1D2RA 2FPPB 2ZAMA 1CEYA 5FEUA 1DKLA 3KTFA 3QJYA 3VMMA 5K8CA 2XTNA 2QIOA 2ZP1A 4MUHA 3ZZMA 5BR8B 1GLGA 5KHLB 1NI5A 4Y8VA 1WUIS 1U2RA 3EOZA 3HABA 1JMKC 4KMOA 4HNAB 3QWHA 4EGJA 1JLHA 3BTUA 2RGAA 3V7NA 3K3PA 3FMOB 4NYJQ 4D3XA 1IWBB 1QHGA 3OKFA 3LLSA 4ADSG 3CT4A 1RYFA 4ZCRA 1U1CA 4U2GA 1U1FA 2VN8A 1KI6A 3JQ8B 4MR8B 2C9BA 3PUJA 2ZUFA 1X0VA 2TECE 2MDTA 3EPRA 5FWYB 1PNVA 2D0DA 4IKEA 4X45A 1X9IA 4QDOA 2VJMB 2C04A 4BP8A 5B1HA 2AG8A 3VHQA 1I7LA 3HLTA 1YDWA 4KWTA 2DYKA 2ACWA 2WWWA 1XLUA 4IW3B 3T4PA 1R64A 2ESRA 3P9ZA 1JV2B 2DUWA 3UHJA 1UQUA 2QTVA 5FTKA 1WXFA 4LN1A 3G1TA 3LBHA 1BGWA 4MRNA 5DNDA 4EYSA 5IZCC 3QFHA 3EQ6A 1UOQA 3UXMA 3BG5A 3ECSA 2QLJA 3HXKA 3AXSA 3GMSA 4CKCA 3LP8A 4Y2QA 3H3FA 4Z5XA 3LC7O 5JSZA 1NJGA 2JCVA 2J30A 3F5DA 3EWNA 1Y9ZA 3KCNA 3KD3A 1XEFA 1ZD4A 8OHMA 1PU2A 1DIGA 2XVZA 4FNOA 3GJTA 3IHLA 4KE6A 3W1EA 2QX7A 3WLHA 4BKRA 1AK2A 1MX3A 2E9SA 2G70A 2PS1A 3OOSA 4NV1A 4PSDA 2GD2A 1V37A 4JLUA 1GYQA 4RCZA 1QZUA 4YAOA 3G2OA 4ND6A 4Y18A 4EY5A 1PKEA 5A5DA 1QU3A 4D79A 1OA1A 2QUJA 1ESEA 3DLBA 2QORA 1O9HA 2N42A 2ZYVX 1DJLA 3K05A 3AXTA 2OBMA 2KLBA 4EEKA 1AKYA 2HL6A 3SBEA 2ARKA 2JNWA 2NTJA 5EINA 3GMTA 5E4FA 1GTMA 2JI7A 2ZE6A 4MRAA 1XL0A 4DYHA 1Q11A 4BKQA 1SCAA 1ZH8A 2GJ8A 5LLSA 5KREA 4L76A 3KE8A 1GUAA 1P4HA 3JV7A 1SG0A 1PI3A 2R60A 4OH7A 3UN1A 4B4WA 1TTQB 4RACA 3R5FA 2FG6C 3TLGA 4J43A 4ZRDA 2FE1A 4LF6B 4D6YA 1GCIA 1E3TA 3COSA 1P1JA 1UXGA 4PBSA 1Z5ZA 3C3AA 1KY2A 1ZGGA 2I6GA 3L0ZA 3TOZA 3GLIE 1JILA 5JZBA 2JEYA 3B7PA 5G40A 4NE2A 6LDHA 4DLWA 4C7OA 2NZWA 1G5FA 2RHWA 1E8DA 2GPAA 1G8JA 5LQSA 4IV5A 4LISA 1DC7A 2Q5HA 1DG1G 4OJNA 4M7PA 4GE3A 1ETHA 1LB1B 4MA5A 5PGMA 3VZQA 4ZVRA 4Z7NB 5IF9A 1R3DA 2GAIA 1XU7A 2F4NA 2ZBFA 3GRAA 3ZU2A 2YJNA 5CLHA 5ENDA 5FUVA 2GASA 5EVJA 4I6JA 1S8AA 4FFDA 5LQAA 5AVUA 4NE7A 1NWCA 3RANA 1X7XB 1Y9AA 4HDCA 5JMOA 5KYWB 1I7QB 2A1UA 3OCUA 4MW1A 2X6QA 3K70B 4E6EA 2VHJA 1RPTA 3AUKA 1SU7A 2RHBA 4OSEA 4RZ2A 2Y1CA 4RZHA 5D5HA 4XUGB 5DM0A 2HWUA 2JGIA 3AIOA 3FVQA 3WO1A 2BI8A 5C32A 4KXVA 2GLTA 1QV9A 2A9JA 1YTUA 4KACA 3I5YA 1XJQA 3VC3A 4ICIA 3E7DA 1DC5A 1KPIA 1AUOA 3PNYA 4AMYA 5I7HA 1J0CA 1MAUA 4IL5A 4MP6A 4OQEA 1E2GA 1QJCA 3AM3A 3HCBA 3U6KA 1IQRA 1U9JA 2ZWVA 3RTAA 4MWCA 3AB3A 4H4DA 3U9TA 3DL2A 1H4VB 4M0CA 4B74A 5AK4A 1OI4A 4P2BA 3T7AA 1G2OA 2XSZA 1RC0A 2YINC 3CIFA 3EIOA 4JBWA 4NDAA 1UKVY 5EUCA 3SD7A 2ROQA 3OX2A 2C82A 2GT1A 4G84A 1E4EB 3KE9A 3AHEA 3COJA 1HE3A 1Z13A 3HG7A 4OKIA 5CFRA 4UREA 1H66A 2OLJA 1G9XA 3HUFA 1T4CB 3KQWA 3ZTYA 3SWWA 1ZLXA 1D09A 2PA3A 3ENWA 5H80A 5KQPA 4HUJA 3EISA 1B7GO 1UJNA 2OCIA 1CR0A 2FK8A 2TRSB 3EDRA 3R8CA 1R6VA 2GZ2A 1EX9A 1NMZA 2CMKA 2LP4Y 3UZUA 3SDZA 4ER5A 1CF4A 3P19A 1B4DA 4HH0A 2O2EA 3FDIA 1L4UA 1SQ5A 3HJRA 2GVZC 3BERA 5JVDF 4ZOBA 4CI0B 2W7TA 4X3CA 2WHPA 3H8SA 1E9CA 2EKPA 1PTJA 2Z4SA 3NWBA 5A3SA 2EZ8A 3UWPA 1UJCA 5AM0A 5EC8A 5EHGA 3X1JA 3NQ41 4JFRA 5CTAA 5CB4F 4XQEA 2DQYA 5DLYA 5A5FA 3WLEA 2ODQA 2WAXA 4QRIA 1RS0A 1IOZA 4JEMA 4D4MA 5JAPA 2ZTHA 4ZEMA 4GL2A 5CM9C 2ATCA 2ZPUA 3RIXA 4US2R 4AQ7A 3OKPA 2PRIA 1GAQA 4H0NA 3D5EA 3T95A 2C00A 4KOEC 1TUGA 1NW4A 3OX1A 1A97A 3NRBA 1M1NA 3RE1A 4L7VA 4LG1A 4V0ME 1XZDA 4QDXA 4EI8A 3HDJA 3FNBA 1I4DD 1E32A 2IU6A 2OZVA 3PT5A 3LXXA 1KRHA 4X91A 3VPGA 4BYMA 3U3JA 1C9KA 4JQCA 3ZCVA 5A4DA 2XXAB 2ISQA 3R9IA 3V4LA 9ATCA 3J7AC 1KY3A 3F78A 3CPSA 1IZZA 3U81A 1ZJ6A 1QHHB 1SG6A 3EMVA 3JASB 3NNDA 3UAXA 2II6A 3S81A 3KWFA 2RKWA 4FMDB 5LXTA 5EQTA 2ZUSA 3OEHA 2EBFX 4Z2AA 4KAFA 4KUEA 2RBKA 2FZKA 3QELA 2H1WA 5KCMA 1RP7A 3PFHA 3M5PA 4FGKA 4KN5A 4WBNA 5JAQA 5B3AA 4DV2B 1UOPA 3WLLA 2V6BA 2OORA 4R0NA 3F5FA 2EEPA 4KFCA 5FOQA 4HLCA 1X1QA 3WQSB 1MV8A 1K9VF 1ZGBA 3GT3A 2EWVA 2Y1WA 3GRUA 3FOCA 3VR0A 3ND8A 4M8NE 1COWA 5KNDH 5DNUA 1LSUA 1BMTA 4BMOB 3USCS 4B2PA 4XUCA 4GMHA 3EULA 1YQDA 3KSDO 3MAJA 5KQGA 1DT3A 1JAHA 3CZRA 1D6JA 4D56A 1XELA 3AETA 4R8LA 4F84A 4P83A 4K9KA 1SXJD 3DWFA 4IJ6A 1VB5A 3I8SA 2VF5X 4GSYA 1OFUX 5JZSA 4ZYTA 5AM4A 2R1ZA 4BQEA 4R3UC 3K32A 1YA8A 4Q3DA 4MW0A 2IC5A 2A67A 1CEXA 5NLLA 5LOVF 2BUCA 4Q48A 3TRJA 5KAPA 5GOTA 5KTKA 3BQNB 1NU6A 3CFYA 3C5CA 3DZIA 4F11A 1H4SA 3E9RA 3O38A 1QDLB 2BHRA 5J58A 2G3YA 2H52A 2F64A 2FFJA 3G02A 4W5WA 4ACBA 2A3NA 2CB0A 1JIQA 2QRGA 4BXOA 4CIXA 2BFDA 3FD8A 1U6IA 3ZGNA 4LF9B 4E22A 1JMYA 2CBGA 2ZSKA 2NTNA 3L7NA 1YUNA 3IMEA 4E5VA 1MHPA 2XWQA 4U2EA 1OH8A 3DXXA 1O57A 3UQZA 1GTJ1 3TTSA 3V3TA 3COZA 1NUTA 1KF0A 1ZEJA 3B60A 3IB3A 2CEAA 3OQNA 4UUMA 2NGRA 3PSAA 3HBAA 3RK0A 3WQHA 3DOIA 4B0PA 2QBYA 4XJVA 5EIAA 1CNFA 3ITDA 1IIBA 4ZYYA 3EIFA 2HF7A 2OB2A 3RJMA 3DYBA 4BJ5A 3EAGA 4Z6KA 1JU3A 3CEPB 2FYTA 2P11A 4PVCA 3EJWA 3L40A 4EOGA 4DBZA 2QN7A 2PZAA 3ZE8A 1M72A 4UBNA 1E89A 1GA4A 2O7VA 3ZBUA 1EK0A 1RIFA 3FFBA 5JAMA 3RUAA 2GTIA 2BBOA 2H1HA 4NZMA 4F6LA 4F93B 1GZ7A 1MQ9A 3FUVA 1WKCA 3ZCXA 4B45A 4J4BA 3NWEA 1WM1A 1PDWA 2HZ7A 3GUHA 4NOMA 1L4YA 2DWQA 2PKEA 4IOKA 2P3SA 4UFOA 2C9DA 1XRLA 3PNLA 4GYWA 3HDVA 3RU3A 4JASB 4PZEA 3V7FA 2FJUA 2EFGA 4FX5A 4HS4A 2RB5A 2X19A 2POQX 4JL5A 4KNYA 3HA7A 3HFRA 4MKZA 2KE5A 4U7HA 2PJRA 1M33A 4URYR 2JZCA 3E5RA 4JQYA 3IAUA 4ENSA 4YRBA 1PR1A 4BU0A 3MN1A 1ZUWA 3CRVA 2NM0A 3O84A 2Q49A 4CXMA 1KFJB 3DMTC 1ZAYA 2C7BA 4WXPA 4TSFD 3NHJA 1Y8RA 5CH5A 5AT1A 3FLAA 2HN9A 2VT3A 2W2OA 3OA0A 4HFJA 1HFEL 1OWNA 3ZHOA 5KDDA 3FSJX 5HTKA 1H2BA 5KJ1A 1KI8A 3HVUA 1USVA 3E0XA 4UE3S 3M2PA 1KDYA 4LWZA 5GY7A 2IHTA 3MOGA 4BMZA 1NVDA 4AJOA 3DVSX 1G7RA 2E3JA 3SZOA 1ZSYA 3L8ZA 1E9EA 4W63A 3TFWA 4I1PA 3LFHA 1QXSA 1ENZA 2ZAYA 1CDOA 1TM1E 3TI9A 3E9QA 1MV5A 2AUMA 2O7QA 4GZ5A 4KYTA 1ZJ5A 3V4FA 2BMAA 3WMWA 4C1NA 3PDCA 4E5KA 3MA0A 3UXYA 1US8B 2HTEA 2O1SA 3CLRD 1B8NA 1PL6A 4BEBA 1JF8A 4RD2A 4G0WA 1DFHA 1I51A 1V1RA 1W4BA 4FOSA 3FI9A 3FHLA 4B3HA 2OBLA 4D98A 4CM4B 1YS2X 4JOSA 2V9PA 4XARA 1R0SA 1O89A 4K3UA 3H17A 2NACA 2FFAA 3DAHA 4GPTA 3QWAA 2PY6A 3FYSA 4HAYA 4Y7CA 4IQ4A 4O2BB 1RAFA 3H87A 4R9VA 1PT8A 1RYEA 1YAJA 4TZTA 3T9EA 2ZZKA 3HCWA 1WZ2A 1EG2A 1J2TA 3BREA 2JJYA 2HMTA 2P0YA 3AILA 4KQHA 4KWEA 3WNCA 5CB8A 3EGDA 4V0QA 2HMYB 2LR0A 2NYRA 4CIWA 4CT5A 2WE8A 2ZE8A 4NWIA 1FQKA 3MRVA 1UKZA 5KC8A 1PWXA 2H31A 1YR7A 3A6EA 5D5QA 2YY7A 3VXKA 3UWDA 3JTMA 4LVNA 3UMFA 3EQ9A 1FU7A 4V0NA 2OD7A 4WFQA 3REOA 4RSMA 3STHA 1KAHA 4H27A 1E7WA 3IAS1 4D4LA 1SKMA 1RE1A 2RGUA 5L7YA 4P4SB 2Z2JA 5TJ9A 1CEQA 3T15A 1T3GA 4EH1A 4INJA 3MC1A 4NFSA 5DU2A 1OT5A 1W75A 4A5SA 4EFLA 1TADA 1ZSNA 2I8AA 4JQZA 1PJZA 3ENNA 4YRCA 1C7ZA 3R3ZA 4OHPA 2KQUA 1OQAA