3GRKA

Crystal structure of short chain dehydrogenase reductase sdr glucose-ribitol dehydrogenase from brucella melitensis
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
254
structure length
248
Chain Sequence
GLLQGKRGLILGVANNRSIAWGIAKAAREAGAELAFTYQGDALKKRVEPLAEELGAFVAGHCDVADAASIDAVFETLEKKWGKLDFLVHAIGFSDKDELTGRYIDTSEANFTNTMLISVYSLTAVSRRAEKLMADGGSILTLTYYGAEKVMPNYNVMGVAKAALEASVKYLAVDLGPQNIRVNAISAGPIKTGDFRYILKWNEYNAPLRRTVTIDEVGDVGLYFLSDLSRSVTGEVHHADSGYHVIGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of short chain dehydrogenase reductase SDR glucose-ribitol dehydrogenase from Brucella melitensis
rcsb
source organism Brucella melitensis
molecule tags Oxidoreductase
molecule keywords Enoyl-(acyl-carrier-protein) reductase (NADH)
total genus 82
structure length 248
sequence length 254
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3grkA00
2BMAA 5MGBA 1T2FA 5EERA 4U0JA 2JD1A 3CEAA 4LGVA 4I9UA 3V8BA 4BNTA 4FGSA 4NDNE 3DTYA 2RHRA 4I5DA 4OKIA 5COAA 3ZHYA 1P1IA 5CHEA 4C7KA 1LQTA 3ITDA 1VRWA 4J4BA 1TEHA 5IAAA 4ND5A 1NPDA 1GV0A 4BNFA 1LRKA 2BELA 4MIOA 1NPTO 1R0KA 2PFGA 2Q1WA 3KZVA 4PLWA 5JXWA 2CZCA 1ENOA 1R66A 2WYUA 3OBBA 2Q1UA 4BNHA 1C0PA 2J5RA 3DDNA 2FR8A 4TKMA 4XJSA 2NQTA 1YB5A 1E6UA 3G1UA 2WM3A 3B1JA 2DU8A 2BFOA 2PH5A 5DP2A 3RUDA 4FJ0A 2JHGA 1R6DA 1B7GO 1U2DA 3H9JA 2NVWA 1JWAB 2Y67A 3GGPA 3TL3A 5BSHA 1XA0A 3DR3A 4JROA 4CV2A 1A71A 1O0SA 3R1IA 4NJMA 4DYDA 1E7MA 1SPXA 4RVFA 4J6FA 3SJUA 4UAGA 3GC6A 3VAZA 1TXGA 3D1LA 3ZHXA 1N7HA 2ZYAA 3OH8A 5TJHA 3QP9A 4IJWA 3BYZA 4DQVA 4JP3A 1QV6A 3M1LA 3GVXA 4FOOA 4CLEA 4E2WA 2DUUA 4YB8A 4EJMA 5JO9A 2HJRA 3DB2A 4I08A 5ER6A 1DRVA 2QQ5A 4JCOA 5TJ9A 4IXWA 5DBFA 2CF5A 2O3JA 4MVJG 4A26A 1P1KA 2A92A 1U3UA 1K6IA 2Y99A 4DVJA 1WZIA 1IZ9A 1N2SA 4K9DA 3L4SO 3OEWA 1XQ6A 4M8SA 1M75A 3CSDA 4J1QA 4BNKA 4CM8A 1ZVMA 4U6QA 3WGHA 3ZWBA 3W8EA 2CUKA 4B3JA 2XPCA 4YACA 2HUNA 1UZLA 1PEDA 1ISFA 1PL7A 2Y0EA 5EESA 3VH1A 3OJFA 1KBZA 4E2XA 3GOHA 1UZNA 1ZJZA 3U0BA 1C14A 1CJCA 1VSUA 3DXFA 1WWKA 3WOHA 1TLTA 3A4VA 3RFXA 3BHJA 5TX7A 4NQZA 4WEOA 1VJ0A 4CLDA 5ER9A 4GGOA 2C07A 3CUKA 2RAFA 5AOVA 3RC1A 1E7YA 1T2DA 2HMVA 4U0KA 1I10A 3WXBA 2O2SA 3WX0A 1IE3A 2UV8A 4AJJA 4R5MA 1A4UA 4II3A 3I9JA 3HB5X 4YJGA 2GN9A 1OMOA 3RD5A 1U9JA 3HFSA 1MUUA 4CV0A 5JLAA 1X15A 4I5EA 5TC4A 4GX0A 1V0JA 3KUXA 5U4QA 1HZJA 4XQ9A 1UXHA 5C37A 3DAFA 4W6ZA 2BGKA 3RFVA 3V2GA 3KYCA 1B14A 1HETA 1EBUA 4FFNA 2VRCD 3GUYA 3GHHA 5TGDA 5KJ1A 1NQ5A 1A7AA 4IDGA 2NLOA 1YDWA 3DONA 1HDCA 5AXBA 4OO3A 2D5AA 4WNIA 5COBA 2WDZA 4DLBA 4N18A 4XRRA 3U5TA 4N54A 5G4LA 2IYPA 2FR0A 4ITUA 4BVAA 1H9BA 3H5RA 4AJOA 1NFQA 3Q2IA 3E9NA 3OIFA 3ULKA 3B1FA 2JKVA 1VKOA 1Y8RB 5CP8A 4CLOB 2C7VA 1BVRA 3D3WA 2DUWA 5EN4A 1Q0QA 3F4BA 4NU6A 3BXXA 4BO8A 4EUFA 5JS6A 4RF2A 1LTHR 3JQBA 4RQUA 4PN3A 3FHLA 3AOEC 2Q4BA 4IDAA 3TZKA 4KTVE 4AJIA 4CR7A 2P4HX 2Z1MA 4CUKA 4MDHA 2W90A 1PGQA 3RIHA 1LSOA 3X2FA 3CXRA 2CD9A 1WNTA 1LSUA 4KDFA 1PGNA 1X7GA 1XEAA 4CMHA 1R37A 3FPLA 3KEOA 1ULSA 1HTBA 3I23A 3HUDA 4XGKA 2YHIB 5IZCA 4BQRA 5G0WA 3CKYA 2YV2A 1GDHA 2EWMA 2O4UX 1U8XX 4F45A 1JWBB 1B15A 3AUUA 3UFXA 4Q3DA 3AI2A 4GMGA 1YL5A 4ZU3A 2SCUA 2W98A 5I9NA 5C5IA 4AJLA 1BG6A 4F6CA 1HE2A 2O2YA 4AFNA 2X0RA 2ZCVA 3AUSA 1EBFA 2OFPA 4MVJD 4D42A 2JCXA 3K73O 4RLHA 3ZV3A 1BRMA 1HWYA 4DQUA 3N74A 1OC2A 3KVOA 1EK6A 4HUJA 2JCYA 1NQTA 3WICA 1GUZA 1H0KA 3IJPA 2I3AA 1E3WB 1KY5A 1JAXA 4IDCA 1MV8A 4L9RA 1R0LA 3AWDA 2YDYA 3NAQA 5U1PA 4BL5A 2IDZA 1LSSA 3INTA 4AL4A 4P4GA 3GPIA 3FTPA 3ICPA 1LLDA 1DPGA 1T2CA 3BAZA 4YXFA 3WG9A 1LDMA 3FWNA 5A5EA 2PKQO 2XAAA 1HE4A 1UDAA 1PQWA 1RWBA 3JQ9C 4MIEA 3RBVA 2GN8A 5I9MA 3GN1A 3GUCA 1YONA 1NFFA 4R1UA 4OHUA 5CPBA 5KOIA 3ETGA 2Y1GA 3ZWXA 5HM8A 1J5PA 4RF4A 3OICA 3TZCA 4DBVO 2EERA 3B1KA 1NAHA 3WGOA 4FSHA 4D46A 1CEQA 3K6JA 1PJBA 3QE3A 2BFPA 3UCFA 1I3NA 3BMNB 1I36A 2JAHA 2HK8A 2ZTVA 4YEDA 1LA2A 1B2LA 3QWFA 1ZW1A 3RUFA 3DOJA 4DLLA 2HO5A 5A02A 2Q46A 4CLXA 4D44A 3PJGA 2BKAA 5ILOA 5TNXA 4J91A 3MWDB 4MP8A 1GEEA 1MLDA 4FFPA 4PLGA 3KTDA 1PS8A 1QV7A 3QRWA 4NFSA 3KYCB 1M67A 3RJ9A 4TVBA 4OSPA 3VZPA 3PYLA 4Z0TA 7MDHA 4DIOA 3WLEA 5FF9A 4D0RA 3ZU4A 4CR8A 3AUAA 2G5CA 4GWKA 2C0CA 4ZJUA 1LDNA 2Q3EA 2LDXA 4WECA 4J90A 5IZ4A 3GHYA 1YE3A 2VT2A 1LU9A 3CZRA 4FS3A 1LC3A 3WQQA 4BO5A 2A35A 1PS9A 3GNTA 3G3EA 2H9IA 1HSOA 5A9SA 1X7DA 2E37A 4OYRA 3HE3A 3PQEA 4XZ3A 1M6HA 5KJFA 3CMCO 3V2HA 3WB9A 5G0VA 1IUKA 3VDQA 4UEOA 3VVCA 1ZUD1 1DIAA 2AEJA 4NBRA 4EGFA 2OUIA 2D3TA 3DL2A 1G0NA 4P4LA 3CH6A 4J16A 2O7SA 3TQHA 5BSEA 1GTMA 5FI3A 1LI4A 4ILKA 3ZWAA 4W4TA 2QYSA 2ZQYA 3K92A 1HE3A 1QKIA 2H63A 5DCWA 2IE0A 4XDYA 3RSHA 1IZ0A 2C2YA 5I7SA 3BMCA 3E5MA 1D4FA 4Q3NA 2YHUA 1MG0A 1GCOA 1DIRA 4XYBA 1VL0A 1DRUA 4LMRA 2X86A 4YTEA 1HZZA 1P77A 3ZGYA 1H5QA 4UUMA 3U09A 4L73A 1WDLA 4EITA 1Q0LA 4ND3A 2YY7A 1IPEA 3QIVA 1O8CA 1FDSA 4GL4A 3RASA 2LDBA 3LQFA 1UZMA 4IS3A 1HYHA 2EF1A 4AJEA 1UDCA 2UVDA 3EY4A 4JK3A 1UP4A 2C5EA 4WEQA 1W8DA 1FXSA 4CMAA 1HF3A 2YUTA 3DWFA 3PIIA 2Y0CA 3CZMA 4WASA 5AXCA 3SLKA 1BDMA 2HCTA 2R00C 3GG9A 4RV9A 4WLUA 5A5FA 2A9FA 4MP6A 2ZB4A 3QWAA 1JQBA 2RBEA 2Y05A 4B4OA 4BNIA 2VUUA 2DBQA 1PQUA 3ABIA 4IZHA 5DF1A 1GAEO 3WQRA 3ZNPA 2W4QA 4UREA 5FYDA 2O3UA 4GX5A 5L51A 1GCUA 1BXGA 1Q0HA 2IYOA 2I6TA 5IXSA 3VH4A 4OXYA 5L45A 4S3MA 2ZCUA 3C24A 1H6CA 3KO8A 3FBTA 4U5QA 3BTUA 3GDOA 3F5SA 3ICCA 2PGDA 4J9UE 4R41A 3E1KA 3JD1A 1BGVA 4AJNA 1VJTA 3FSRA 3MJ4A 2IEDA 1EMDA 5JBIA 5F1KA 2QX7A 3KEQA 5BNFA 1MFZA 4UEKA 4HNHA 3WGTA 4NMHA 4BGUA 3STHA 3GVIA 1ZMTA 1LEHA 4YCAA 4BNYA 4CUZA 2PY6A 4UVHA 4TZKA 4LVUA 3ROPA 1YDEA 2PH3A 3I4CA 5ES3A 3B20A 5DBIA 1WAMA 4QT0A 4GI2A 5LDGA 5G0UA 1L1FA 5A06A 2I66A 4IJVA 3EZLA 3IKVA 1GD1O 1IPFA 3BHIA 3L07A 3Q9NA 3TRIA 3INGA 5I7EA 1ZSYA 4QSMA 4KUHA 4PLPA 4XYGA 2O3RA 3ZU3A 5I7FA 4YRDA 2ZKLA 1KYQA 4NBWA 3ZV6A 3C7CB 1I32A 3BMOB 3T4EA 3NDIA 4QEDA 4ZICA 1IB6A 3L77A 4KUGA 3V1YA 5JC1A 1TT7A 2ILTA 1B8PA 4Q3CA 2PGJA 3ENKA 3RFTA 5CDYA 1T25A 3QHAA 5I8ZA 5THQA 4BNWA 1DHTA 2POQX 4I5FA 1KVRA 4J49A 1CF2O 2P9CA 4K6CA 4MVJE 3HJAA 3H2ZA 3GPDG 5L40A 1JA9A 1I24A 1JTVA 4MOWA 5IZCC 1MC5A 2GDZA 4FFRA 4IY1A 1Z7EA 1AXGA 4BGVA 2AG5A 1BWSA 1P44A 3O8QB 4BMVA 3LVFO 1X1EA 2NU8A 2Q1TA 3PJEA 5EIOA 3L4BC 1KOLA 2B5VA 4L4XA 1H94A 3C3XA 1E6EA 5I9LA 1HRDA 4L4SA 5G4KA 4DWVA 1PL6A 5K6AC 4KMSA 3OSUA 1Q1NA 3MOIA 3GEDA 4FC6A 4NI5A 3OF2A 2DC1A 3ONFA 3UCEA 3RC2A 2DT5A 4OQZA 2VYVD 1XWFA 4JBGA 1HLPA 4CL8A 4YT4A 1EDZA 4NH4A 4Z9YA 2DLDA 2O23A 4PIVA 4IJKA 4QXMA 3EK2A 3KYDB 5ILGA 2IXBA 3ZWPA 3RVDA 4XDZA 2D4AA 1F8GA 2Y66A 3W6UA 4BNUA 4YAGA 2F00A 2FR1A 1C1XB 2GGSA 1XGKA 2X0JA 4JXKA 5JDIA 1DC6A 1SZJG 4I8XA 4WLNA 1QXSA 4Y8VA 5DOVA 3GK3A 5L53A 3VOSA 3NGXA 3SC6A 3VVBA 4DMMA 3QVXA 4HV4A 5C3MA 3DZKA 4JGBA 4DGSA 1PGPA 3MJEA 1X0VA 9LDTA 1ZNQO 2P2SA 3PFWO 5GY7A 4TROA 4E5MA 2E48A 1I2BA 4XYEA 4O59O 5IF3A 4BKQA 2C2XA 4CV3A 2D1YA 5JPIA 1MP0A 1EQUA 2IXAA 1KC1A 1I5RA 1AGNA 4N5LA 3JQ6A 4W82A 1PZFA 2O3SA 3RU7A 4UUOA 1I3LA 4FN4A 5F5NA 2IZ0A 3G1TA 3WGQA 2PTGA 3AM3A 4E31A 1MXHA 4DBZA 2VHWA 2C29D 4GWGA 1K6JA 2A94A 2C54A 3RJ5A 3ZCXA 4Y6SA 2I76A 3Q6IA 4B7CA 2HMSA 1YQXA 3TFOA 1JDJA 1XU9A 1N7GA 3HN7A 4NBUA 4HWKA 1ADBA 2NU7A 3HDQA 3M2PA 4IBOA 5EPOA 3LSYA 3VDRA 3QVTA 2V6BA 2EEZA 1S7CA 3IS3A 4LCJA 1C1DA 4GX2A 4KDEA 2IZZA 3Q3CA 4WPGA 5H83A 1DAOA 3UCXA 3H5AA 5IN5A 3A1NA 1TVEA 4LCEA 2B69A 3ETEA 3OA2A 3ORFA 4QTZA 4TMFA 2TMGA 2GO1A 2EHDA 4WLOA 3SJ7A 5IDYA 4DTIA 1F8FA 3DBLA 1KC3A 1EVZA 4P22A 1NAIA 4EUHA 3PFFA 1YL6A 2P5YA 3MJCA 3WSVA 3ZI0A 3FRJA 5L7WA 1HDRA 3PJFA 2C59A 3IJRA 4GKBA 1Y8QA 1U7TA 4BO2A 2VZ8A 4GLLA 1H93A 1NXQA 1C1DB 2C5AA 2HU2A 4EZBA 1QLJA 2X23A 4OQYA 2Z5LA 1UH5A 4WLEA 1NP3A 3LF1A 1DBVO 3DAPA 3WYBA 4CV1A 4HXYA 1LC0A 3ENNA 3LC1O 3O8QA 2UAGA 1I2ZA 1E1LA 1PJSA 4CLHA 4NU5A 4LRSB 3KETA 1OZAA 3DZJA 1MG5A 1X1TA 5T57A 2B5WA 1DC4A 3WWYA 3KYBA 5JNLA 3QLJA 1LBEA 5TRTA 1HSZA 3D4NA 1M2WA 3DZGA 1WMBA 1H6DA 3ZH2A 1GFSA 2OBYA 4JJIA 3FN4A 4RCVA 4K28A 1B8VA 3C7AA 5U9CA 1YBVA 3KLPX 4E4YA 4KTTE 1P74A 3D0OA 1AHIA 3SX2A 4NFHA 2J3KA 2WYVA 3CINA 1LRLA 5CPFA 3PHIA 3WBBA 2EP5A 4A0SA 1ZMOA 3P7MA 4XGNA 2BHLA 5B4VA 1NVTA 1T24A 4RF3A 4A10A 3ONEA 1FDUA 1TA4A 1VSVA 5F5LA 1NPYA 2ZJ0A 5BQFA 2BI8A 3D4OA 3K5PA 1R4NB 1QRRA 1ZEJA 1NASA 3VHRA 1C1XA 2Y93A 3NTRA 4L76A 2O7QA 4OAQA 3AU8A 4CLRA 3B6ZA 3H65A 1Q7BA 3WIDA 2ZK7A 4PZEA 3IAHA 4DRYA 3HFGA 3JYQA 1DHRA 3WMXA 3PLNA 4L0QA 4D41A 1UP7A 3I9NA 4INAA 3PWSA 1NX6A 1HDOA 3F6YA 2W2LD 4LISA 4D3FA 5BSGA 3U3XA 3NX4A 4UEJA 1GUFA 3QWHA 3E9QA 4CQMD 1Z75A 5A9RA 4DLAA 3SLGA 1YGYA 3ITKA 3TFQA 3U62A 3VPXA 3UXYA 3ETDA 1VLLA 1E3EA 3EVTA 3JD2A 4GBJA 3T7CA 1NTOA 4YAJA 4N7RA 4YRBA 3WTBA 2QRKA 3LC7O 3GG2A 2VYVA 3V1UA 4B4VA 5KJCA 4CM9A 4PG4A 3OIDA 1PJTA 4PG5A 3UUWA 1R4MA 3PLRA 2G0TA 3HB4X 2WJPA 3TNLA 5CDUA 1BSVA 3UVEA 4E5KA 3ZWVA 1X0XA 2NTJA 3OEYA 3F9IA 5JDCC 4CMCA 2PZMA 3GGOA 1CQIA 1PZEA 4Z0HO 1SMKA 3GLQA 4DYVA 1DXYA 4TZTA 5L95A 1Y6JA 5LDHA 3IL2A 3BMCB 3DBHB 1DC5A 3DMTC 3JQFA 3VZSA 1ZSNA 1P3DA 1CIVA 4YT2A 4LSWA 3I9KA 3WYCA 3DZHA 3JYOA 4XIJA 3WGGA 5JO0A 4AJHA 1T4DA 4IZIA 1PWXA 3DO5A 3LLVA 4GSKA 3TPCA 3IKTA 1DIBA 1ZK3A 2Y1OA 1MFPA 3K8ZA 1KVSA 4IS2A 1YWGO 4AJ4A 4CM7A 1HDZA 4RVGA 3JQ8B 3FR8A 1BXKA 3JQDA 5JAQA 1SOWA 4DA9A 2QIOA 4JBHA 3U49A 1HE5A 4B79A 3EAGA 2VNAA 4MIYA 3H4VA 3RROA 3TDKA 4R1NA 3DMTA 3JQFC 1UXJA 4PVCA 5A9SB 4R3WA 4J9VA 1K5HA 4NPCA 1N92A 1U28A 3PEFA 4UULA 5JMPA 5B12A 4CMIA 4R1SA 1DRWA 1RJWA 4EUEA 1E3JA 4S1VA 5BNTA 4YT5A 3ZHZA 4BO1A 5CDSA 2G17A 2V6FA 3E48A 3D7LA 3GFGA 1XHLA 2ZB3A 4GVLA 5IXYA 1H2HA 2QHXA 5CAEA 1U4SA 4RF5A 3PYXA 1XCBA 2O4CA 2GN6A 3RUIA 5K9ZA 4GPD1 4RPJA 2NSDA 4PZCA 4YDRA 5TQVA 3S2GA 3GF4A 5EINA 4IPTA 1H6AA 4ZRMA 2V7PA 3MTJA 1WDMA 2PZLA 2HKIA 2E82A 4WCFB 1E7QA 1FF9A 2X9GA 4TWRA 4YQYA 5DCYA 4ALIA 4BNNA 3LC2O 4OKNA 4UVIA 3TN7A 3TOXA 4KWHA 4QFCA 1G1AA 1I30A 4EW6A 1AE1A 1O9BA 3AM4A 4WGGA 4M55A 1W6UA 3DFUA 4ND2A 3WIEA 4D3SA 1B0AA 4B4WA 4CL3A 4YAKA 2EKPA 2GERA 3Q1LA 2GZ3A 2GD1O 2ZB7A 1PZHA 1J4AA 3E82A 4HKTA 4CM3A 2ZTMA 4Z9XA 4FDAA 4YJHA 1Z74A 5KKAA 2NADA 1U3TA 3RQSA 4WK6A 1K0UA 1HYEA 5AXDA 4PLTA 4FJ1A 3UAGA 1M66A 1UP6A 2DKNA 1SC6A 5C7LO 5IDQA 1WZEA 3ONDA 3ANLA 4BOYA 1SOVA 1ZEMA 1ISJA 2VWQA 3U4CA 5JC8A 1ZZEA 2ZTUA 2GCGA 2QG4A 4KQXA 1GQQA 4ALNA 2J5KA 1NR1A 1NFRA 1KVTA 3PVZA 4NZ9A 5KVVA 3MCVA 4HX5A 3WJ7A 3U4IA 2J6IA 5T6BA 2CNBA 1XELA 4F46A 2JD2A 3JQBC 4Z3KA 3JQAD 4TRNA 4XB1A 5GZ1A 1EK5A 2B35A 1VL6A 4IDDA 1ONOA 3LU1A 2QYTA 4FC7A 1L7DA 3VKUA 5ITVA 1F06A 1DFIA 1GPDG 3ZWCA 3VPGA 3F46A 3WR5A 1EFLA 2WWRA 2PD6A 3PQFA 3DBRB 3I83A 4AJ1A 5JFOA 1PZGA 2AA3A 4XWYA 4AJKA 2DFVA 4JNKA 4FBGA 3A14A 3UKOA 4CM8B 1J49A 3ZDFA 3BIOA 5A04A 3V5NA 2EIHA 1E3IA 1E5LA 1Y5RA 3P2YA 3D4PA 1LLUA 3O03A 5JSFA 5IN4A 3W4JA 1Y81A 2YJZA 3DHNA 4XQEA 4B7UA 3L6DA 4HNGA 1RM3A 4AVYA 5EQFA 1B26A 3E03A 1KEPA 4FFOA 3N7UA 4RDIA 1C0LA 1LLCA 4J7XA 4KQWA 4NBTA 1E1NA 3ZNOA 1R12A 2EP7A 3U4HA 3BTVA 2IZ1A 3JQEA 1M76A 1H6BA 4PLYA 1EZ4A 2X4GA 3PWKA 4QQRA 1QYWA 1VKNA 4KZPA 4XJTA 4RDHA 5KVCA 1E7SA 1DO8A 4MKXA 3ASUA 1Q7CA 1RM0A 2ET6A 4TVOA 3WGZA 4EDFA 1PJ2A 3KM0A 5KVSA 4N5NA 5FFFA 3KBOA 1ZK1A 4G81A 4QFDA 3KSUA 2I9PA 2GASA 2J8ZA 1U3VA 2OP1A 1E6WA 1TT5B 4YAIA 1JLLA 1E3WA 4EJ0A 4WOJA 3R0IA 3QVWA 2FP4A 2NQ8A 4RJTA 4QO8A 2DBVO 1U4OA 3ST7A 4J0FA 2D59A 1QG6A 4D45A 2GYYA 4D3DA 4BKPA 4EEZA 2BRUA 3BA1A 5ITWA 2Q2QA 3KB6A 1Z7BA 1K2WA 1A72A 2OOSA 3CTMA 3MJVA 1W0CA 4FGWA 3IOYA 2EW8A 1BXZA 3ZWOA 1A9YA 1FK8A 3AM5A 1UXKA 1U5CA 5HRUA 4IDFA 1DOHA 4LW8A 5C7IO 1BTOA 3H9EO 5EMHA 1O94A 2J3IA 2XXJA 2ZYDA 4M87A 4HADA 4D43A 4FB5A 1PJLA 4PG7A 4J43A 4RPGA 2HLPA 2W2KB 2Z95A 2DM6A 3PGJA 1IULA 2B83A 3SBOA 1XQ1A 1WXDA 4GSLA 3NT2A 3D5TA 4XYMA 3CIFA 4ZQBA 4NK4A 1N8KA 4ZQHA 1S6YA 5GMOA 3VKVA 4ROSA 5I7VA 3G49A 3S1LA 1PJQA 2VWGA 3NT4A 1PS0A 4GKVA 2FZEA 4E5NA 4PG8A 3PPIA 4OSOA 4MVJF 2RHCA 3DAGA 2NVBA 3E8XA 3NYWA 5FWNA 2DVMA 5CDGA 4XD2A 1E77A 2AQKA 4U6SA 3KV3O 2DPHA 2PNFA 1V6AA 2DBRA 3AJRA 3Q0EA 2PR2A 4CR6A 3IUSA 2NTVA 4FPXA 1GPJA 1QORA 2I5PO 3OQ1A 5L4LA 4I1IA 2VOEA 1AHHA 4E2YA 1YH3A 1YJ8A 3FNGA 1E3SA 2Y1CA 3K2EA 4PCVA 1DLJA 4O0LA 5KIAA 1YL7A 1SB8A 4FQ8A 4CQLB 1ISMA 4CM9D 2NNLD 3IQDB 2PA3A 3WDSA 3DFZA 3HWRA 1U2GA 4EI2A 1ONNA 2HJSA 4MVJA 4PLZA 1P1JA 1SEPA 1UAYA 2B36A 3I5MA 5EL0A 3F3SA 4TQGA 4J2HA 4CMBA 1Z6ZA 3V2UA 2AW5A 1CYDA 1NQAO 3VZRA 3WNVA 4IDEA 3RAJA 2PGLA 3QVSA 5ICSA 2IEBA 4KOAA 4F3YA 2W2LA 1Y7TA 1HLDA 2CDCA 1GZ4A 4JLWA 1Y9AA 1VL8A 2E6UX 3WGYA 2PZJA 1O95A 5F3RA 5DNAA 4NIMA 2WE8A 1N1GA 3BTOA 2XF8A 4YRAA 4FOSA 3G17A 2YQ4A 4BKOA 2R6JA 2X5JO 1RKXA 1VM6A 1LJ8A 1L7EA 5LC1A 1IYZA 2P9EA 3O4RA 3I4FA 4LVCA 2PV7A 4WCFC 4HFNA 4AICA 1OC4A 5L9AA 1ID1A 1JU9A 5L4NA 1FDVA 6LDHA 1ZSVA 3GDGA 3GZNA 2RIRA 5A9TA 2EJVA 1ONPA 3GEGA 1HL3A 2CDAA 2I99A 4O5OA 3HDYA 4CODB 2GRAA 5CEFA 2EG9A 4RZHA 4NG5A 1LRJA 4NJMB 4QECA 1E5QA 3OA0A 3UN1A 4QX6A 2JFHA 4E21A 1CRWG 2BGMA 1SAYA 2Q50A 5GZ6A 4A27A 3UHAA 4W7HA 3ROQA 1DSSG 5GZ3A 1UDBA 2WE7A 3AY3A 2OZPA 5H82A 1W4ZA 4Z9FA 1ZBQA 1SNYA 4ZHSA 1UR5A 1YJQA 3R6DA 1YB4A 2W2KA 4AJ2A 4L75A 3OMLA 1ADFA 4LSMA 2WD7B 3ZU2A 4CMEA 3PQDA 5DDIP 3E18A 2X8LA 3QY9A 4BO9A 4Y6RA 3C1OA 4GLOA 3OP4A 4R5HA 4I9HA 1X7HA 4A2CA 3E6AA 2RH8A 2Q4EA 1PIWA 3GVCA 4UVDA 2CSUA 4HBGA 3WYEA 1EVJA 1F17A 3L0DA 5ADHA 4E2ZA 2Q1SA 5DT9A 4CQMA 4BHTA 4IQ0A 4E5YA 2Q45A 1ENPA 3AY6A 3FPCA 3QWIA 2YV3A 1YBAA 3Q9UA 3W4IA 2IODA 4W99A 4ZQFA 1DEHA 3GNQA 2EW2A 4N5MA 4E13A 3IUPA 1T26A 1GUYA 1ADCA 4RLSA 4YT8A 2EXXA 4DUPA 4FW8A 1P33A 3SC4A 4BGIA 4IQGA 4ZQEA 1B8UA 2G76A 3K2BA 3U4DA 2X9VA 3W1VA 1ZIDA 4BO6A 3ZN2A 2X6TA 1I33A 2VZ0A 2ZATA 4H3VA 2Q2WA 1MGOA 1V3VA 3BMQB 1DIGA 1IHXA 2YHIA 3C1AA 4JBIA 4MVJH 5C7OO 4TKLA 3EDMA 4MVJI 2FY8A 4OIMA 4XCVA 3RUEA 1A27A 3JQ7B 1C0IA 1AXEA 1A9ZA 4ALJA 4J1TA 4YR9A 8LDHA 5KJ6A 4HP8A 4AJPA 4IQ8A 1HT0A 1UUFA 4BO7A 3WFIA 3AFNA 4WUVA 1E0DA 3H9GA 1DAPA 1HDYA 1HKUA 1N9GA 2HMUA 4B4UA 4E3ZA 1ZXBA 2PD3A 3UW3A 4BO3A 5IG2A 2V6GA 3SEFA 5HS6A 4BUCA 1I2CA 4FFLA 3MJTA 1XLTA 1OFGA 4M89A 1ADGA 3EHEA 3HDHA 4R1TA 3LT4A 3OJ0A 4GQAA 2DFDA 4LN1A 4A7PA 4BNVA 5MDHA 2CDBA 3HG7A 5G0SA 1MXFA 3F1LA 4WCFA 5AVOA 5F21A 3RUAA 3PI7A 4J1NA 3ZV5A 1K89A 2R00A 3HSKA 3S2EA 5TT0A 4E12A 3DBRA 3HZZA 2WYWA 3ZU5A 1NHWA 4YAEA 4BV8A 1V35A 3NEPX 1BHSA 1DLIA 3PHLA 3AFMA 5JDIC 4R16A 3HHPA 1O5IA 3NRCA 2P5UA 2QRJA 1LUAA 4OXNA 3JQAA 1GY8A 4CMIB 2FSVA 3GR6A 4YJGB 1TB4A 1YB1A 3MJSA 2YW9A 5T8KC 1GU7A 4Z6KA 1ZO8A 1DC3A 4GVXA 4ALLA 1NQOA 4IXTA 4RVDA 3KOUA 4RPHA 1NM5A 4E6PA 3W8FA 1GEGA 3CE6A 3L9XA 2VYND 5JCXA 1K6XA 4LK3A 4M1QA 4PLVA 1GQ2A 1PJ4A 1PWZA 1E92A 5K6AA 3H5NA 3OQ6A 3IC5A 3P19A 3UH1A 4DQXA 2WD7A 3LYLA 5HBRA 3MTGA 1MX3A 5JAMA 2QZ9A 1U8FO 2EKLA 2GNAA 2VWPA 3ADOA 3O38A 2Y1EA 2PKRA 3N58A 4UUNA 2H1SA 2HRZA 3GNSA 3KHUA 4BIIA 4BQPA 3UICA 3H9UA 3PYMA 2EGGA 1ZK4A 3EC7A 3A28A 3FD8A 3NJ8A 2O50A 4MINA 4RVSA 1G6KA 3BHMA 1ZK2A 5TLSA 2VTDA 3F4LA 2Q99A 4E30A 3RUCA 1ML3A 5FEUA 5TIIA 2A4KA 1PR3A 5A3VA 3M1AA 4Q9NA 5JAZA 5JE8A 1GL3A 3K31A 4MVJP 4R4JA 2YDXA 1EUZA 4BNGA 1XYGA 3VPFA 5CDTA 1V9LA 4XIYA 4CMJA 2RCYA 3V1TC 3UOGA 5LCXA 3RU9A 1NR7A 4U7WA 4RVHA 4DPLA 3GEMA 1QR6A 4FFMA 1R4MB 2WSBA 3GH3A 3PZRA 2GF2A 1I0ZA 1IHYA 2D5CA 2EJWA 3C85A 3IMFA 2OP0A 4II2A 4YWJA 1MC4A 1ZJYA 2EKQA 1CETA 3GMDA 4BKUA 2H5LA 2OMEA 1KVUA 4Q3AA 1WDKA 3I52A 5JW6A 5KKCA 4TRRA 3KLMX 1GQYA 4J4HA 5K0ZA 3PHHA 1NVMB 4P38A 1I3KA 2J3HA 3JTMA 4XYLA 1EUCA 6ADHA 4R9SA 2E49A 3D64A 1EVYA 2OXIA 3VC7A 1NHGA 3M6IA 3JD0A 3FBGA 4WJZA 1PQPA 2QZZA 5B1YA 4BGEA 1OAAA 3E9MA 4PGFA 2ZJ1A 3I6QA 4YBZA 5KCZA 1B3RA 2VWHA 4NBVA 4M54A 2Q49A 4OGWA 2JL1A 1Y1PA 4OOEA 1EEHA 1D7OA 3K9QO 3JD3A 1D1TA 3NUGA 2ZTLA 2F1KA 4FJ2A 3S2FA 2PZKA 3PHJA 2I65A 3OQBA 4B3IA 5T5QA 4EEXA 4TRJA 3F5QA 4J4TA 4ZA2A 3TZ6A 1IOLA 4C4OA 4GGPA 3AU9A 3FNHA 3JQ9A 2CY0A 2OHXA 5J23A 3VPHA 4DC1A 3K96A 1IY8A 3NV9A 3MWEB 3WSWA 3DTTA 1OBFO 3X2EA 2NWQA 3PGXA 4CQLA 4CMKA 2HDHA 1DDOA 4W7IA 4PFJA 1GZ6A 3H8VA 4KUEA 1W73A 1XG5A 1P0CA 1TT5A 3DZBA 4JN6B 4J7CA 1PJCA 1RPNA 4IJUA 5EJ2A 5KJEA 1FDWA 1PTJA 2C20A 3NKLA 3PIDA 3DBHA 3S8MA 3JYNA 1JKFA 5EQDA 5B4TA 4H15A 2PKQP 1A5ZA 3VTFA 3COSA 1MB4A 3E5RA 5JCJA 1ISIA 4XA8A 4B7XA 3LZ6A 3RWBA 2X22A 2DTXA 2HSDA 3RCBA 3IDSA 2IRWA 2VNSA 4NFYA 1VJ1A 3WWZA 4HFRA 3ZWWA 2O48X 1R15A 1VC2A 4IM7A 5IDXA 1ARZA 2X9NA 1LDBA 2HRBA 5AYVA 4BNJA 1N1EA 1DFHA 1OI7A 5JDCA 1VPDA 4R54A 1PJ3A 4ND1A 4NNJA 3WS7A 1NVGA 3PJDA 2NU6A 4E0BA 3QQPA 3LF2A 3S55A 1PX0A 4NR0A 1YXMA 3I3OA 1DJNA 4PG6A 1P1RA 4OJNA 1YQGA 4PLFA 2YFHA 3WTCA 3WQSB 4IGFA 3UF0A 4BO4A 3R3JA 1SEVA 1RYEA 2JJYA 3DEYX 1XIVA 3PP8A 3B70A 4IDBA 1CERA 3NDRA 4CM4B 4W9NA 3PZBA 5JY1A 3I9LA 4J7UA 4YYZA 3S2IA 3ANMA 3OETA 1SBYA 4G5HA 1YOVA 3OIGA 1PGOA 1SCUA 4MKZA 1QYDA 2P91A 4XRGA 2V65A 3PTZA 2B37A 4BS9A 5HS4A 3O9ZA 5ICMA 3FCOA 4G65A 1F14A 5CG1A 2G1UA 1ENYA 4XR4A 4GX1A 4RORA 2D8AA 3L6OO 2VYNA 4WOKA 4CLRB 2PWZA 1ULUA 1JKIA 2YV1A 3KSZO 3OM9A 4H16A 3O26A 4WCDA 3JQGA 1ZKMA 4AG3A 2WTBA 1QYXA 1EFKA 4ID9A 2E4AA 2NUAA 1E3LA 3A9WA 1NNUA 2Y1FA 3JD4A 4URFA 3RC9A 3TSCA 3GVHA 1C0KA 2J5QA 4MKRA 2PLAA 3DOCA 5F1PA 4OXKA 5COQA 3F47A 2OBNA 2Y0DA 4G2NA 1TI7A 3DQPA 2NVUA 1SO8A 2DTEA 4RPLA 1HYGA 3GZ4A 3GGGA 1LNQA 3KXDA 4GMFA 4J1SA 2JFGA 3IP3A 2OO5A 2VHZA 4WKGA 4JJGA 1OOEA 1QP8A 2JHFA 1Z82A 4BB5A 4CMGA 1LDEA 3AOGA 3ZHBA 3A06A 4D7AA 4FIZA 1X14A 4O63O 3D5QA 2FWMX 2QW8A 1KEVA 3RBXA 3GAZA 2P4QA 3Q2KA 4JQCA 3FF4A 4OL9A 5L7TA 2UYYA 1BW9A 2EGHA 4YJHB 4Z3DA 4U8GA 3PWZA 3MEQA 1BMDA 5TT1A 3VPSA 4CJXA 1RM5A 3ON5A 3C8MA 3W4KA 4Y67A 1D3AA 2AMFA 2C7GA 3WJAA 5KNLA 4MP3A 3I6IA 4IINA 1PR9A 2Q2VA 5DOZA 3NT5A 4YJFA 5JAIA 4WNCA 2VCYA 3KRTA 1P1FA 1PL8A 4CPDA 2BH9A 3PDJA 4ZRNA 4R3NA 1CWUA 2UUPA 3FI9A 4E33A 2X5KO 3MOGA 3RUHA 3ZW9A 4BV9A 3AI1A 2EV9A 1CQJA 1JW9B 5DN9A 3GDFA 1XSEA 2P9GA 5I8WA 2FN7A 2XXBA 3DC2A 1LX6A 2DTDA 3JQGB 3GMSA 4C7JA 3DBLB 3ZNQA 4MPDA 1R16A 2HK7A 1N5DA 3BTSA 5AXAA 3KYDA 4ZN6A 2GZ2A 1EE9A 3UGKA 1WVGA 4PLHA 2YZ7A 3QWBA 1AUPA 1ZH8A 1XKQA 4BO0A 2DBZA 1E1KA 2HAEA 4IUYA 4OH1A 4UVEA 4RPKA 2OL4A 3AK4A 1WP4A 2YYYA 1A4IA 1LSJA 2ZQZA 4YVFA 3RBZA 5CEEA 2CF6A 4DXHA 3SVTA 1WLYA 3OECA 1VI2A 4J3FA 3H6KA 2RH4A 4CUJA 3I1JA 1YS4A 4TRMA 4W9NC 3RC7A 1NWHA 3JSAA 2VUTA 1QSGA 1XU7A 4ZQGA 3JQ8A 4MJLA 1BVUA 4YJFB 3AY7A 3LK7A 4BNZA 3NJ4A 1QYCA 4H7PA 4Y9DA 4CM1A 1E7WA 3DMYA 3OJLA 4UVGA 5G2OA 4B3HA 5L7YA 4EJ6A 3LDHA 3FNEA 3GN2A 2X5OA 1XR3A 4PZDA 4J0EA 4FR5A 2JFFA 3AOEA 3WFJA 2C82A 3EMKA 3JV7A 3FNFA 5KWEA 3VTZA 1ENZA 1UXIA 2WEKA 1A7KA 2BD0A 4M86A 3H9QA 5A3JA 4GH5A 3GT0A 2GZ1A 2VRCA 2VTEA 4OM8A 4XQCA 2VUSA 4P4NA 3RI3A 4Z0PA 4D79A 3TF5A 2HK9A 2UDPA 3DZIA 5AQ1A 3TWOA 1DJQA 3RKRA 8ADHA 1LLQA 1ISGA 2X58A 3QA9A 4P8RA 3R3SA 5CG2A 4R9RA 2GPTA 3OHSX 2WD8A 4NJOA 1I8TA 3EVNA 1HEUA 1LXCA 3HQ4O 2VOJA 2FPPA 2O3TA 1JN0A 4BMSA 3AUTA 4L8VA 1HXHA 3GA0A 3SXPA 2X7HA 1D8AA 5FI5A 1DIHA 1NWCA 3ROKA 1ZXLA 2DQ4A 4R51A 1Z73A 3LLSA 4YPOA 2GLXA 1CDOA 1ZK0A 4F6LA 1J6UA 3I9OA 4B8WA 5A05A 3ANNA 1PGJA 3PDUA 1B3BA 4WE3A 1QYVA 1Y9EA 1YKFA 1YO6A 1Z45A 2NTNA 4ZD6A 3Q11A 3WGIA 4XX0A 2FSSA 3NDJA 3NGLA 5TSDA 3INRA 3OJEA 1UAGA 4WLFA 2G82A 1P31A 4IMRA 1IL0A 1YQDA 3GFBA 2VN8A 2J3JA 3H7AA 2O3QA 1I3MA 3QW2A 4B8ZA 1ZFNA 2BLLA 5DBGA 1KETA 1R4NA 3MZ0A 1HDGO 4OOFA 3VZQA 4BNMA 1KVQA 1YVEI 3L4BA 5B37A 2Y1DA 4PVDA 1VE9A 1KS9A 2V6MA 4R69A 1GYPA 2Z1NA 1MA0A 1R0SA 2PD4A 2CVOA 3JYPA 4I5GA 2HMWA 1BDBA 2XOXA 3G79A 3H3JA 1JVBA 3JYLA 4Y6PA 3ZNNA 2HQ1A 3FWZA 3PRJA 2FOIA 4R01A 2VZ9A 2ZB8A 3JQCA 5CEJA 5G0TA 1Q2XA 2NACA 1WW8A 1ZCJA 3LT0A 4PRKA 4Q39A 2FHSA 1GADO 3WMWA 4WLVA 3I9MA 5T8KA 4IGEA 3DOOA 2VRBA 5BSFA 4JX8A 1E7RA 3TJRA 4DL9A 4ND4A 1DB3A 4ONEA 1EE2A 5T67A 1AN9A 3ZWYA 2HMTA 3ZZNA 4ESOA 2GR9A 5IDWA 1E1MA 4JJFA 3PHGA 4YQZA 4M49A 1D1SA 4ZVVA 3GRPA 1FDTA 1JVSA 3P5SA 3VH3A 4DIBA 5TF4A 1T4BA 5DZSA 2AQ8A 3IP1A 2JAPA 4CMEC 5THKA 2CVZA 4ALKA 1QMGA 3OJOA 1U5AA 1U1IA 2DPGA 1SB9A 2D2IA 4XR9A 3ZWNA 1NYTA 2AHRA 1M6WA 3HDJA 3K30A 2YQ5A 3QSGA 4YJDA 4A73A 3ASVA 4Y98A 1P9LA 2I3GA 3TZQA 3C1TA 2DAPA 1Y8QB 1P45A 2B4QA 3ZWMA 1ORRA 5KVQA 2X0IA 1U3WA 5DULA 1RM4A 4RL6A 9LDBA 3BZUA 4DMLA 1BXGB 3PK0A 3TZHA 4CM6A 3ZW8A 2BF7A 1NBOA 3ZV4A 2JD0A 3H3FA 2W8ZA 3GQVA 1LQUA 1T1SA 4QUKA 2QRLA 1EQ2A 1KEWA 2AE1A 2AE2A 3EYWA 1U7HA 2AXQA 5ENDA 1H2BA 1GYRA 3C7DB 5H81A 3NTQA 4K6FA 4O1MA 3PXXA 5JYDA 2BFMA 3RKUA 5F1OA 3CMMA 3QV1A 1KY4A 2BGLA 3HADA 3M2TA 4J2OA 4OMUA 4XEHA 4EBFA 2FRDA 4LMPA 1P0FA 2NV6A 5A4DA 2OGUA 3BMNA 5KTKA 2GN4A 1Q7GA 4R68A 5A1TA 2D0IA 3TOZA 4GAEA 2PK3A 4XB2A 2AQHA 2GSDA 3DZFA 5DP1A 5B4UA 2FZWA 4XKJA 4XQGA 3QVOA 5JCJD 4KWIA 3HNPA 3FTNA 4E32A 1N9GB 3VH2A 2VQ3A 1GV1A 4Q3EA 1KEUA 1C3VA 5DCUA 3T4XA 4L4RA 2I67A 1BW9B 4HFMA 2CFCA 1DFGA 5TS3A 1EDOA 4ALMA 1G0OA 2OORA 1XDWA 3EUWA 4HFJA 4BNXA 1KIFA 3JQ7A 2R2GA 3W8DA 4ZGWA 4RGBA 3EZYA 3WNQA 4K1LA 3GVPA 3L6EA 3IIEA 4E5PA 4RZIA 1LDYA 4MO2A 4NHEA 4DREA 3F1KA 3AI3A 1J0XO 3DHYA 3WBFA 1WPQA 2GUGA 2FPGA 1GZ3A 1F12A 1PSDA 3GRKA 2AG8A 4RO0A 4DPKA 1F0YA 3L9WA 5L3ZA 1JKJA 3WLFA 4KP7A 5JMWA 4L74A 4LRTB 1H9AA 2NM0A 4MVJM 1HDXA 4FD3A 1V3UA 4DIFA 1FJHA 2ZYGA 4JIGA 4K26A 4RVUA 5BT9A 1Y5MA 4FCCA 2B4RO 1GYQA 5L4SA 3JQAB 2FMUA 1JAYA 5IJZA 2JCVA 3FR7A 4DPMA 3TL2A 2BI7A 1ISHA 4PLCA 4CQMB 3DBVO 3HN2A 1O89A 2X1HA 3LT2A 1O6ZA 4X54A 3DHEA 2H6EA 1EVIA 1GR0A 2VHVA 1FMCA 2Y68A 5IFLA 2UUOA 2CVQA 2VHYA 3NTOA 2VT3A 2YFQA 1YOVB 2X0NA 4A5OA 4IIVA 3D3EA 1T2EA 4IIUA 5A03A 2ZIZA 3G0OA 2BFAA 4BMNA 4TSKA 4DC0A 4CM4A 2NU9A 3GAFA 7ADHA 4O6VA 3T7EA 2P68A 5G4KB 4EYEA 5JY6A 4QO7A 5BR7A 5T64A 3EGOA 5CFZA 1RYDA 3U9LA 1X13A 2B0JA 4BKRA 3CPSA 4A03A 4YA6A 1T2AA 4IMPA 2FPIA 3GY0A 4UUPA 1I01A 1QLHA 4BB6A 5JYEA 3KSDO 1UJMA 2VHXA 1V8BA 4HY3A 4PRLA 1P1HA 2AEFA 3D3WB 2CMDA 1K3TA 1Y8RA 4CLOA 1EUDA 3LT1A 4CM5A 2B4TO 5HA5A 1YBMA 4RQTA 1UXGA 2AEMA 3H2SA 3BMOA 3W6ZA 4JP2A 5BNIA 3OFSA 3GZNB 3JCZA 3BMQA 4I9NA 4D0SA 4NK5A 2AQIA 5HTOA 1PU2A 3EW7A 1T1RA 1B16A 4Q3BA 4BNLA 5ENVA 3P2OA 1KERA 2TMDA 3ROMA 1V3TA 4XGIA 3ADPA 2NVUB 2WMDA 3QJ5A 1LDGA 1YRLA 1WMAA 3AW9A 5HWSA
chains in the Genus database with same CATH superfamily
3PXDA 3KELA 1T2FA 1YKGA 4U0JA 3D0QA 4JUCA 5SY4A 1XTQA 4PHHA 2Y0PA 1A5BB 3GQBB 4LGVA 4I9UA 1GTRA 3LC0A 4NDNE 1UF9A 3KZ1E 4KPUB 3OF5A 3LUGA 1P1IA 1SU6A 4LHVA 4X24A 3ITDA 4Q66C 3M82A 3L93A 4G0YA 1TEHA 4D5EA 1IUNA 1II8A 3KVYA 1ZC3A 1NPDA 1N2JA 1WSDA 2I71A 4HCJA 3MRVA 1KH1A 4LXUA 1KKMA 1W88A 3D59A 5CT5A 1URPA 5DGDA 2XT0A 1R0KA 2Q1WA 4DHEA 1AK1A 1ZG3A 5JXWA 2LKCA 1VPTA 4KVFA 1ZU5A 4MYSA 2WYUA 2W0MA 3OBBA 3MN1A 2P6OA 1GNVA 5M34A 1NF8A 2J5RA 5JFTA 5EYPA 3BZWA 4TKMA 2BL4A 1U3GA 4LZJA 2NQTA 1YB5A 4JBXA 3FYHA 3G1UA 4RU1A 1VG0B 1EFHA 2WM3A 1O97C 2F7SA 3E22B 3IIMA 4U63A 2VBGA 4IFIA 4WJKB 3VHXA 5EE0A 1B7GO 2VDMB 4UPVA 1U0HC 4NLLA 1M2KA 2J3MA 3H9JA 3H99A 3M8KA 4MV7A 3UC9A 3UMFA 4QXQA 1OD6A 1PV1A 1U5BB 2GTPA 5GVRA 5BSHA 4QG3A 1KAMA 4GXNA 3D8BA 2X3UA 4D4JA 4E94A 4X6YA 3QEKA 5FWXA 4HT3B 3FGZA 4DLTA 1N6KA 2IOYA 1E7MA 1SPXA 2J9RA 1ZM7A 2QRNA 2Z04A 3G9TA 4I3FA 5BSMA 3VAZA 5DNUA 3TGPA 3ZHXA 1CNEA 1EHCA 1GITA 2BHTA 2ZYAA 3G9XA 4CKXA 1KOJA 3KSRA 5CVCA 4JP3A 1Z83A 4DQVA 2ZDGA 3GVXA 3UOAB 2HX1A 1LVHA 1US8B 1T1EA 4FOOA 3VC3A 2VJQA 4EHLA 1JHMA 5JO9A 1ORTA 1YHYA 4PNHA 3HPRA 1DJMA 1DRVA 5TJ9A 2BM1A 4CDMA 2WB2A 4N03A 4IXWA 3VZBA 3PF8A 2IS1A 1P1KA 1CSEE 5BN5B 3U7QA 4P33A 4JOBA 1I4DD 2XCIA 4KB5A 1N2SA 1WHTA 3KHSA 3L4SO 4RY9A 1M75A 4F9TA 3BICA 5FXMA 4GQIA 1XRNA 2GLTA 4S2EA 3EDQA 3BXPA 3W8EA 3JATA 2OBFA 2PRSA 2XPCA 3BRWD 2WTUA 2H4ZA 3Q3JB 2Y0EA 1QFXA 1KP2A 4XGRA 1KY2A 4JITA 1E0JA 4Y9TA 4GVPA 1U99A 4ENQA 1SELA 1IY1A 1ZJZA 2ROQA 2YWRA 1CJCA 3F6EX 4P34A 4P3OA 4EJFA 4ZCSA 4BVFA 1L8OA 1TLTA 3A4VA 4K86A 1TIBA 2XMCA 4WAUA 3RFXA 2VXCA 3E2IA 3WV4A 4F4FA 2DLCX 1YS2X 4EVRA 3BWVA 4X92A 5JXHA 4X85A 2IWHA 7ABPA 2RAFA 3RC1A 1E7YA 2HMVA 1N2GA 2HLDA 3IOCA 3SYMA 1G2OA 1GCGA 1IE3A 2GK3A 3AL2A 1N57A 4HWOA 2IEZA 3WNBA 1A4UA 1JA0A 3I9JA 4II3A 3PQ8A 1JR6A 1BCRA 3KIPA 4MITA 4PX3A 1MUUA 3QQ5A 4F1WA 4Q3KA 3O8OA 4YK7A 3OZBA 1QO0D 2AI3A 2Q7OE 5LQCA 3VA7A 3SAJA 1UXHA 5E6SB 2F8SA 1E94E 4MH0R 2FX2A 2J87A 4N5IX 1E9VA 3JX9A 2FMTA 2IWRA 3K35A 2FDCA 4Z9BA 1HETA 1ZGJA 3ELUA 2VRCD 4L16A 4QYWA 4JJ7A 4CETA 4X61A 2C0QA 1NQ5A 2OILA 4UDXX 5A3RA 4OFBA 1NJ2A 1FMJA 1QHIA 2XQVA 3VYVA 5AXBA 2WDZA 4N18A 2PPLA 4QHTA 1VP9A 2YXEA 2QLMA 1CR0A 4XRRA 4DNFA 3QLVA 2XMGA 2FR0A 4ITUA 3KQTA 2LIVA 3SC2B 1WSWA 5CB4B 3AVWA 1IHDA 3OOJA 1QWSA 2V6JA 3OIFA 2BR5A 2XUZA 3B1FA 2JKVA 5KOHA 2Z98A 1Y8RB 3U3MA 2ANBA 2C7VA 2AL7A 4BBAA 1ZOSA 3F4BA 2EL9A 4EUFA 3JARB 3L1UA 1GKYA 1CR4A 3BDAA 1NMSA 3FHLA 4QBTA 4KTVE 5DX1A 3J7AC 4KSBA 2Z1MA 1KJYA 4CUKA 5EHXA 2XOEA 1JFLA 4AMYA 1U2PA 3LGSA 4JHXA 3IRUA 4EP1A 1M2EA 5CJJA 5KOYA 1LSOA 1NVDA 3Q7IA 1RNLA 5HQJA 4YAWA 3B1XA 3WGVA 4DY6A 3WLAA 2CD9A 5I5GA 1BX0A 4JUFA 4QBKA 4HTFB 5LXTF 2BJHA 3H3XA 4CMHA 1XEAA 2VIIA 3KQMA 2Y9MB 4EJSA 2FPLA 4GO1A 5AK3A 3ILXA 3O5AA 4UTXA 1G1MA 3FKQA 4URUR 3VGJA 1R27A 3FZYA 2DUNA 3E9ZA 4Z2AA 4BQRA 2YHBA 4WZBE 1NBMA 4KI7A 2OAGA 3FB1A 4OIFA 3PE6A 5CNKA 1B15A 3ET4A 1XA4A 3UFXA 5C7OO 3FOFC 4TLBA 1OFHA 5J4HA 1BHO1 4M6WA 5DWDA 1Q1BA 2ZSHA 2W4IA 5E6UA 5I9NA 1AKTA 2X1LA 3KZMA 3IXQA 5F4BA 3N70A 3EFHA 4D0GA 2DE0X 3PICA 2ZW9A 1Z06A 4CF5A 1M2NA 5D3QA 3ANSA 1HWYA 4MA4A 3N74A 4U7FA 4DQUA 3AHGA 1Q0UA 3TR5A 3KU4A 3KVOA 1EK6A 1CUGA 3BX1A 3NH9A 3WK8A 4J0JA 1H0KA 4HH3C 2P4EA 5DLQC 2B7LA 3BUSA 4UOQA 3LGAA 4BV2A 4ZDKA 5BN3B 1BYIA 1MV8A 1FU4A 2YZMA 2BTOA 2EF0A 3BCSA 3HKCA 5E6UB 5U1PA 1RAGA 2IDZA 2IPMA 4JVMA 3INTA 5EKTA 3UV6A 1BVYF 1O57A 4MKHA 4P4GA 3IDQA 1XMJA 1T2CA 1BE1A 2EIXA 2JIOA 3U7GA 1BA3A 4JBWA 3NIDB 3OAAA 1LDMA 1W59A 4A4DA 1E6CA 3ASYA 3H04A 2WSIA 9ABPA 3D6VA 1QPGA 1SCAA 1BGWA 2VTBA 1JHAA 5EXXA 4BLRA 3VI3B 2DP4E 3NHRA 1FLVA 1RWBA 3TEMA 2PFSA 2VP9A 3MGBA 1A9OA 1DEKA 4IMJB 2F3SA 3RNOA 2GN8A 4KQKA 2DUJA 4MUFA 4QE3A 3A9TA 3HH8A 4RTRA 2F8TA 3PNSA 4JLDA 1YONA 1NFFA 1I6LA 2FG5A 1Z0ZA 4OHUA 4BWFB 1A77A 4OA5A 1KYTA 3CNLA 1JFRA 2Y1GA 1RAFA 5AM0A 3SC4A 4QJ4A 1CUFA 3M5DA 4UTOA 4RF4A 4YV1A 5K6TA 3MRSA 2QX8A 4HB4A 2EERA 2O0HA 2P79A 4PY2A 1TO2E 5H4HA 1C80A 5P21A 3TMYA 2YCLA 3BILA 4FSHA 4GDMA 3RRFA 5CD1A 4OQPA 1EFPA 2MYUA 1UMDA 2WHPA 4FLEA 5AJVB 3K6JA 4XVHA 4N9WA 3HI6A 2ONZA 3QE3A 4RFSA 4UTPA 3EBOA 1T6YA 4K9PA 1I3NA 4RTJA 2VTBB 2JAHA 4JP8A 3OPNA 3RIXA 3MAAC 5JRJA 3NWJA 3DOJA 4N39A 1H1LA 3VMFA 3UYKA 2Q46A 2PXAA 5BOSA 2BFDA 5A0VA 1XXLA 2GFIA 4IKEA 1NMYA 4KR7A 4MP8A 1G19A 1XDUA 1RABA 1SWWA 2P7HA 3G5TA 3GCZA 3IT1A 3KTDA 1PS8A 1QV7A 2B7BA 1CF9A 4NFSA 2QMEA 4US0R 4XM0A 4I3HA 4OHFA 1L5ZA 2JI4A 3GNLA 4LOHA 4OSPA 4RWZA 4EVSA 1G42A 4L4UA 4Z0TA 1SUFA 2AN9A 3RW9A 2YWDA 1FFCA 2A5LA 3DNMA 3WLEA 5ANRB 1R88A 5BQPA 2G5CA 3VTKA 2C0CA 1LDNA 1S89A 1U0TA 2LDXA 4Q02A 5ALYA 2B8EA 1OREA 4O2LA 1LU9A 4JJ4A 4N65A 2O57A 3MD0A 4YRRA 2QIPA 3Q9LA 5DSXA 2JFYA 3G3EA 4GM0A 3UK0A 5EGSA 5L3SA 2ECKA 2HU7A 5A9SA 2E37A 2GTIA 2X3FA 1L6IA 4R8MA 1EP2B 4XZ3A 1M6HA 2H85A 3BDIA 3H5IA 3AVUA 3RVMA 2Q1YA 1UK9A 3A05A 3BULA 1RJDA 4Q1DA 5G0VA 3SJZA 4G5OA 5HUHA 2O2XA 3ORYA 1XK7A 3W3AH 1IEXA 2BN4A 3VVCA 5G1NA 1X1AA 2V1UA 1DIAA 3AF1A 1S1CA 3IPRA 4EGFA 2GHIA 2JHPA 1LF5A 3AR4A 5A7HA 4QLBA 1O03A 2QQEA 4P4LA 2CGEA 4RJLA 4TKVA 3R3XA 2YIVX 3P27A 3TQHA 3E70C 5BSEA 1L4BA 4TYNA 5HCIA 1YUMA 5ERYA 4IGKA 1ESEA 5FI3A 4FT2A 3ZWAA 4UAVA 2Z2YA 1TC1A 3WIVA 1ZOLA 1GZUA 3X1MA 1Z0JA 2O2CA 3EQ2A 4KACA 5T3UA 2GHRA 1W4RA 1HE3A 1LX7A 1QKIA 1PWYE 3DD1A 5ICEA 2IE0A 1TUIA 5BUQA 5DNYB 1RZ3A 1UWKA 1VI6A 2R7AA 3TH5A 1NIJA 2GZMA 1D4FA 5EXPA 1RWOA 1U0FA 5F9MA 1MG0A 2W6PA 3CS3A 5TQ0B 4XYBA 3BERA 3FPFA 1IOZA 2WOJA 3V4OA 3G0IA 4JEMA 4YTEA 1HC7A 1HZZA 2ISQA 4MS1A 4DCSA 4UUMA 1NIPA 2ZI4A 1WDLA 5E95A 4EITA 1QQ7A 1PYDA 5JALA 4J6EA 4GL4A 1AV6A 2JI9A 5CB4A 1OB5A 5FP0A 4U6NA 1JLKA 3QVGA 3WZLA 3LQFA 1LS1A 3TM4A 4W5TA 1N5JA 2G0AA 2JFQA 2PLRA 4IS3A 4HSEA 3UKJA 2HR1A 4FSXA 3PUHA 4JENA 4EKNB 1T3SA 2GQ0A 1UP4A 1U5BA 1JDVA 3TNJA 1UKCA 1QV9A 1Z8DA 2YUTA 1VZ3A 1RWMA 3LQKA 3LUAA 3PNMA 4WASA 2HCTA 2R00C 2ZAIA 1KKUA 5JD3A 4M1EA 4AQDA 2A9FA 2I8LA 3ZIAD 2W2MA 5DI3A 1IJBA 3KUUA 1KPHA 2Y05A 4B4OA 1AGXA 4EG7A 5JQWA 2GKGA 5LZ9A 4JLPA 4IZHA 3ABIA 2AH5A 3IIJA 4TXHA 3IERA 5DF1A 4GL2A 1N6PA 5KYUB 1KAQA 2XUFA 4UREA 4EG0A 4LAFA 4BVLA 2O3UA 2JJ2D 4UDNA 4UMFA 1GCUA 4EABA 2VYQA 1Q0HA 3ILHA 3M0EA 2BISA 2ONYA 3PC4A 4OXYA 4ZT2A 4EH1A 4BJHB 2ZCUA 2VUHB 1FLNA 3BTUA 4X6UA 4WWHA 1L5MA 2G8LA 1K97A 3NM6B 4OHRA 4WZBA 3LBAA 4AKEA 3CLVA 2BR4A 1QVZA 3MMZA 3COWA 4I6GA 1EMDA 3NG1A 4NRDA 4ARAA 5F1KA 3UMBA 2P3SA 2ATVA 4HXFB 5BNFA 2DERA 1R9MA 4HNHA 4O4LB 4RBNA 3WGTA 4BGUA 1YB7A 1RI3A 3GJ6A 4HGRA 4Q1VA 5EQTA 4OHYA 4ZI5A 1A9SA 1W2GA 1OZHA 2NZYA 2PSSA 4NDZA 1V11B 5HGJA 3WZ2A 1LEHA 4YCAA 3E81A 4MWGA 3VHLB 3ZOZA 4CUZA 4TZKA 4RYDA 5ALXA 5DHRA 2YICA 2DCMA 1QGUB 1TQ2A 4RCYA 2FDRA 1IBCA 3IMCA 4EG3A 2IS2A 3I4CA 4KVAA 1WAMA 3DEHA 3FYUA 1R6TA 5LDGA 2COEA 5CA0A 4NX2A 4O3FA 4WKCA 3RYFA 4EKIA 4IJVA 3N6XA 2X7JA 1QRAA 2RHJA 3ENVA 1DMSA 4YY3B 4GYJA 3EIHA 3BHIA 3WMFA 2F1IA 1A96A 1P5JA 3TRIA 2AI2A 3INGA 4DCMA 5HF8A 3QW4B 3S7ZA 3TLAA 4RULA 2PMWB 3JS5A 4PPNA 4QSMA 4KUHA 1RQRA 2N46A 1T35A 2O3RA 2QTVA 1E4EA 3C8UA 3U9SA 1VCHA 4YCJA 4GU5A 3MGAA 2UUAB 4XLZA 5BN3A 3KVRA 1L8LA 1TZMA 3NDIA 1UK8A 4QEDA 3UA3A 3CZCA 3PQ2A 4DUGA 2ZWIA 2QUJA 4FHCA 4IFEA 2X41A 5FLEX 4EKDA 3RU3A 2PGJA 1Z7GA 1L7XA 3FJOA 5CDYA 5WRFA 5B7PA 3HGTA 3RSFA 2H4WA 4HLUA 4MAMA 1W48A 2P9CA 4H3SA 2UKDA 4K6CA 2C92A 3COJA 4QDJA 1KZ9A 4C4TA 3B36A 2A0WA 1I24A 2VYFA 2W6JD 3PR3A 4IY1A 4WIAA 2UZ0A 3ZD7A 2JCGA 1M1YE 1MOQA 5KQLA 3N2YA 2BGGA 4EHBA 1HE1C 3E58A 1ACMA 3LVFO 1X1EA 4MB0A 4G1EB 4XD7D 5DLYA 3QUSA 3PJEA 1KOLA 3U7IA 3C0KA 2B5VA 2X77A 1GPMA 1HRDA 2PH7A 1LF0A 1PL6A 1ZCBA 4KMSA 3OSUA 2DFTA 3B9RA 2P62A 5ALMA 5IYZF 3S99A 2O5CA 2I4IA 2W6MA 1G6Q1 1AZSC 3OF2A 2BY4A 4REMA 2AJTA 1SFRA 1I1HA 1G64A 1NRXA 3W5SA 4GRDA 4ZFNA 1Q11A 3RC2A 2R68A 1ZAKA 3FAKA 3IQZA 4HAIA 1QB8A 2VYVD 5FT9A 4JBGA 2W5UA 5SYAA 1XPRA 4HLUC 3EQ6A 4JMLA 1PJZA 1UEXC 2O23A 4PIVA 3AIKA 4LPSA 2R47A 4EX7A 4TT3D 4ARVA 1JL3A 3U7RA 5EG5A 5ILGA 2NZJA 3Q8XB 2Q3HA 3LCVB 3Q15C 3ZWPA 3RVDA 4TT3A 5LUAA 4LX8A 4YAGA 4MW0A 4KPUA 1C1XB 2EFYA 2GGSA 4LHEA 4TQAA 2VJMA 4JZYA 3GUUA 5KQMA 3ICQB 3EDCA 1DUSA 4KNVA 4AY5A 1L7NA 2DPYA 1AZWA 1IBSA 5D6OA 4WLNA 5DOVA 3QEAZ 4CNQA 3F9CA 3A3OA 3GK3A 4HQKA 2BFCB 3BVPA 3SC6A 3QVXA 1Y0BA 4GKKB 4XCXA 1TGVA 1U8CB 1QCZA 3EGDB 1F1BA 1MJGM 4JGBA 1WOMA 3A37A 3QVVA 3HZOA 3FYUC 5JISA 3MJEA 2RBKA 2JANA 1X0VA 2FUG6 4ZYYA 4HL6A 3TINA 5K2OA 2P2SA 2ZZMA 2XCOA 1ZN7A 4E5MA 2WV9A 3E05A 4NE7A 2FUEA 4BE7B 5IF3A 4K9KA 2ZT8A 2BEWB 1GG8A 3LM8A 2D1YA 3DXYA 1MP0A 4BFXA 1IFXA 3F8SA 1KC1A 5DMHA 2FWBA 5AVYA 1JWLA 2Z5GA 4HC4A 2GN1A 1SD1A 4MW6A 4UUOA 2LV8A 2JGMA 1I3LA 3A2NA 3O1JC 2QMUA 2XA2A 4PQYA 3FLEA 3PXCX 5J63A 4ABYA 3A1SA 3WGQA 2C8JA 2ISSD 2O5RA 1D1PA 4E31A 1MXHA 3FPSA 1TVMA 1JA1A 4DBZA 4DUGD 2GCNA 2C29D 3WRXA 3V8MA 4BC1A 1J33A 1K6JA 2I2DA 1KSHA 2SBTA 1XZMA 2I76A 4M46A 3SQMA 3T9CA 2GK4A 5ESXA 2C7BA 3OLQA 3PD7A 4RH1A 4QQNA 3ZCQA 3QUAA 4H9GA 2OWDA 4QTTB 8MHTA 4YRLA 2FGJA 4AYTA 2V9PA 3O7WA 1ADBA 4XUDA 3HDQA 3FMOB 5E38A 4ER7A 5JI3E 4EA9A 1P4RA 4IILA 5I9IA 1CKEA 3OZTA 3SYKA 1QO0A 1AUXA 3QVTA 4Z0NA 3PPXA 5CM9C 5A1JA 1Z2OX 3C3CA 1C1DA 3H11A 2GEDA 3T38A 2XUPA 4WPGA 1N2OA 2YV5A 1DAOA 1PEKE 3OZFA 1WV1A 2G4CA 4Z7NB 4U9IS 1X80A 2R7LA 3ZEAA 2GOYA 3ONVA 4GFDA 5IKEA 4JB8A 3TTUA 1TVEA 4EGQA 4LCEA 3MWFA 2PMEA 4P54A 1N9ZA 1A8QA 3G89A 4BLPA 5HKKA 5J4KA 2ZR7A 5IDYA 4DTIA 2H2GA 4IRMA 3LFHA 4XWGA 4K8RB 2CXUA 4JU9A 4M99A 2PFKA 1OPRA 1KC3A 2HU5A 3RT1A 4TKZA 2VKTA 3MJCA 4BMCA 5EPUA 3PNYA 4IUBS 3I5AA 1FRVA 1PVOA 1OKKA 1EX9A 2RGBA 4F4HA 2XGOA 1PNQA 5J2TA 2Q4DA 3IE1A 2NXEA 1NV8A 1X80B 1N2CE 4XPZA 5KUTA 3FFXA 1J25A 3EMDA 1T3LA 3GCDA 2VZ8A 3L3BA 1CRZA 4GLLA 1C1DB 1FYFA 4HMPA 4YJ2B 1EX7A 2HU2A 3ZV7A 2VVTA 4HGYA 4LOJA 4EZBA 1RACA 5JQGF 3TQRA 3RVJA 1WEKA 2GPWA 1NP3A 2VH2A 2XTAA 4RD3A 3RG8A 2PUDA 4I2NA 2FR8C 2IHTA 3RARA 4HXYA 1UDWA 5LD2B 5FLKA 3O8QA 4HWPA 2HCFA 3H7IA 1I2ZA 5DLPA 5F5XA 4OUDB 1C2TA 1PJSA 1K7EB 4JJ8A 3LCUA 3AKZA 3DZJA 4CG1A 1J7JA 1XAIA 4URVR 3NBZC 2PN1A 1X1TA 4QQKA 5L6LB 2B5WA 4ED9A 2MDTA 1F8YA 3LWZA 4ZI7A 4D8UA 1U0LA 3N3BC 4HNAB 1KI6B 1DADA 1GKKA 1M34A 4KQJA 5DTQA 3UQYS 3W9SA 1HTTA 4YGYA 1G66A 1HSZA 3X1KA 1TIKA 3OF3A 4YMLA 5DPMA 5MFPA 4JLUA 2NZ2A 3GB9A 4G09A 1JIJA 5AJTA 2RAVA 1WUYA 2V8BA 3H83A 4XDGA 3OVMA 5REQB 2YQZA 5EWLB 5HCUA 3QPVA 4MICA 3VVLA 2PUAA 1ZJJA 2FMIA 1XTVA 1GRQA 4IQFA 1NKTA 2PO5A 1B8VA 5U9CA 4AUEA 1VMAA 4KTTE 2NZXA 5JATA 2GXQA 1P74A 2ES4A 1TD9A 4FS8A 2RGEA 4JB3A 3SX2A 5IH7A 3T3DA 2XOKA 1A95A 2J3KA 4PYMA 4C6RA 5A2QA 3KQHA 3CINA 1LRLA 4EKEA 5B1EA 5E2AA 2C83A 2A3NA 5DBOA 2IPNA 3WBBA 2BFWA 4ICIA 3P0FA 1ZMOA 3P7MA 5EVJA 4XGNA 3ABZA 3EGDA 4A0RA 3TW6A 1NVTA 4A10A 4HDAA 4PNZA 2Z83A 1KBOA 2YRFA 3CPHA 3ZQUA 4M88A 5HMMA 1E3QA 1IWOA 2FWRA 5KNDD 1W0JA 2CHUA 2ZJ0A 3CGGA 1UBRS 2XNDA 3NBXX 1T91A 4MI3A 5AVRA 3ZCVA 3JAMA 3GYBA 1ZEJA 1NASA 2C3PA 2I0FA 1C1XA 2C8VA 4OQXA 1A9XA 3OFVA 4LXQA 3T99A 2JLQA 1SJ9A 3DE4X 5M04A 4B82A 1M1YA 1VSQA 2CNWA 3A6FA 4CLRA 1L4KA 2QJWA 5IS2A 2ZUVA 2VSYA 1BOOA 1L4MA 3MYRA 5JRDS 3VPDA 3A1WA 1XTUA 4HUQA 3PXGA 2ZK7A 3GZJA 5DWQA 4CEJB 3IAHA 4N41A 3KB2A 1DHRA 2AZTA 4DE5A 1FSFA 3QEOA 1FJGB 2PUVA 1FPQA 4JNCA 1UBGA 3ZZMA 4DIKA 4D41A 3WB1A 8ABPA 4ILEA 3TXXA 1UP7A 1N3YA 4YJ3F 2CDNA 4DJEC 4DZTA 1YAHA 4D3FA 1GNLA 5BSGA 1W87A 4RCZA 3GA7A 4L6CA 3U3XA 4GRAA 1GUFA 1KE1A 3UJAA 2RK4A 2ZANA 4CQMA 4CQMD 4LRYA 5AJXA 4YP7A 1DU4A 4C0LA 2AIRA 4KAJA 1NP7A 3CGWA 3SLGA 1YGYA 5B7GA 2RBGA 5C53B 3U62A 3I62A 2EJCA 1XKLA 3ETDA 2XRMA 5HKKD 3JD2A 4P4TA 4QG7A 4P93A 3DOHA 3S8YA 1NTOA 2O8CA 3F7MA 3H8SA 2NU6B 3WTBA 3SFZA 3ETHA 1AURA 2CFOA 1XZKA 2GKSA 3AYXB 3MWJA 5B2ZA 2VYVA 3V1UA 4A0HA 1E59A 5AVTA 1ICEA 1FMFA 2WWIA 1XQ9A 4UMVA 3UUWA 1X1RA 5TMDA 1K6EA 2V4ZA 2HDOA 3PLRA 1GNTA 3HB4X 3EQ8A 2BMVA 5D5PA 5GWXA 4CW7A 4D9HA 5IANA 5F2EA 2BC9A 2JK1A 2QNBA 2RGDA 2PKYX 2QN1A 2WKSA 1NU6A 3OEYA 5E1BA 2PZMA 4BV3A 4LXIA 3ZHSA 2WIDA 4GR5A 4QYMA 1NDQA 2IEYA 4K9SA 4RSRA 4Z0HO 3GLQA 1XJ5A 3U4QA 3BWMA 1FX1A 4H1TA 5L95A 4M3NA 2PBLA 3IL2A 1F7VA 1VKZA 1EDBA 2R6ZA 2VF8A 4GUDA 3STUA 3ZGVA 1XNQB 1M2OA 3BF7A 2GAFA 4GPIB 1N77A 3WYCA 4AKIA 2JZNA 2WF5A 3JYOA 1IAQA 1KSJA 1CS0A 1PWXA 1JSLA 1YIDA 3GT4A 1OLXB 3LLVA 4WFJA 2J33A 1GAQA 3P9ZA 1XZDA 3BJMA 5B58C 2AOUA 2FXIA 2P6UA 4HAXA 2FPSA 1ZK3A 1MFPA 2A9RA 2Y1OA 3AKEA 2G72A 1YWGO 1UQRA 3O7MA 1S1MA 1H2YA 3JQ8B 3L7NA 4RVGA 1IIBA 5TR9A 3VBEA 4YX9A 2O14A 4DNQA 3D8UA 3JVVA 1UBNA 2VDUE 3QSYA 1WO8A 4DA9A 2B1JA 3MTEA 1UM9B 4FCWA 4KMRA 3U49A 4BWVA 2AK2A 5EXTA 1N5IA 1QG0A 3R5XA 4K9OA 3H4VA 3DGFC 4KIUA 4MS4B 5LUBA 1Z8FA 1JQEA 2IYRA 4AS3A 2GK7A 4WZBB 1JHVA 5LYJF 4GYYA 2QN9A 1K5PA 4J9VA 4R3WA 1Q6ZA 3TPZA 1WVIA 1MNAA 1WSAA 2HC9A 1A9QA 1N92A 2VBFA 3AFOA 1U28A 3EYAA 2ZAGA 3LX4A 4DIMA 2QWXA 2SKDA 3BSSA 4LY0A 5JMPA 3LPLA 4R1SA 1UODA 4IJMA 5IT0A 2HLDD 1HDIA 3VR2D 3ZHZA 1O3YA 3PE4A 3D7LA 1GNQA 2ZB3A 4IOLA 1WLSA 1Q0RA 1R0XA 4GXTA 5DI3B 4BNDA 2BEVB 3GLFB 2CCKA 4JASB 4M8KA 5BPFA 2C2KA 1U4SA 4RF5A 4ZVRA 1IQPA 1IZYA 1M7HA 3QXHA 4Y6QA 5K9ZA 2YBDA 3A9UA 4GPD1 2Z6VA 3AHFA 4LZOA 3TVYA 4B75A 3T3OA 1E1CB 3UNXA 3C3BA 5BW5A 5K8VA 3ZCPA 4AMGA 2JBAA 1C29B 4FWIB 3RK4A 4C0HA 3C7KA 2PZLA 1Z35A 4URXR 4JI4B 1N2CA 5LOVF 1NI4B 3SOZA 3T0FA 2N1MA 3TG8A 3UT6A 4K2AA 2GCEA 3B3FA 1TDJA 1YFZA 2LGJA 1SR8A 3QBVA 2XUQA 4PBRA 4WSOA 1XRSB 4FYVA 4NYJR 1O95C 4YQYA 3THYB 1MOZA 4BVGA 2SECE 3LC2O 1NVVR 3GMIA 1GILA 2I34A 3DHVA 4PCUA 4MS1B 4UVIA 5EFOA 3TN7A 2CXPA 1IB0A 2QMOA 3IQEA 3QMMA 1OXSC 3DE5X 1W6UA 3AUYA 4OXRA 3BJZA 4D6XA 4PIMA 1B0AA 4IO1A 4DBVO 1DCTA 1J5EB 2EKPA 2GERA 1PW5A 3OPQA 3W0LB 3VJRA 3A3PA 2ZB7A 5L3QB 1V71A 1PZHA 1IRIA 3E82A 2G09A 1JLMA 1T0BA 4RANA 5IVHA 4DWOA 3UB3A 4B6PA 3MD9A 1T2NA 4FDAA 3I2JA 5DHPA 3G88A 4JFAA 2RJ3A 4RVNA 4MUIA 1XNRB 2H51A 3AR6A 1RRMA 3TUIC 3P0EA 4MGHA 1G9XA 3T3GA 1SBNE 1M66A 5EUBA 3ZE1B 1UP6A 4K6OA 1NVWQ 4RTMA 5C5EA 5C7LO 3ONDA 4EGAA 1C3XA 1KSFX 1ZEMA 3EFBA 2VWQA 3HV0A 5JNUA 1QGYA 2PX0A 3CUUA 3N2IA 3RRBA 2QP3A 1Q7RA 5IK2A 5K51A 3WYDA 1AK9A 1D1QA 1IXSB 4X44A 3BD6A 3HEBA 5KNDH 3UEOA 1KVTA 4KBFA 2VP2A 2Y6VA 2HNBA 2CLFB 2HL6A 2IEIA 1KK1A 4P3XA 2B34A 3TLMA 3VR3A 3WQBA 1QGOA 3V8RA 4AKSA 4MB2A 3WJ7A 3ESZA 4ZYWA 1U7WA 1AXRA 3OIUA 3LUJA 3P52A 5KOJB 1XVVA 2CNBA 3ZDRA 2HV8A 3JQAD 1W85B 4TRNA 1A2KC 1GU0A 4MJ3A 3DPSA 3R23A 2W2TA 4H1WA 1JHUA 4HDRA 3RT9A 1QDUA 1GTVA 1OWMA 2FG7C 2QY6A 2ZRFA 4AW9A 3R4CA 2WKQA 1ONOA 5TGTA 4BO2A 5C8VA 4OVKA 3N2ZB 2QYTA 4FC7A 4LVOA 2W6CX 3ZWCA 1PNRA 5B3KA 1OFIA 3B9PA 2M98A 2YWCA 4NMWA 1L5GB 3WR5A 4US2R 1OXBB 3CX3A 3HVIA 1LB1B 3DBRB 1FSGA 1EJ2A 4BFZA 1YZGA 5JFOA 3V97A 3L1KA 3RYIB 2A1TS 1VQ1A 1T9GS 1FUUA 2R97A 1VYUA 2FEKA 4NTZA 1KRXA 2OD7A 2OV1A 4M7RA 1K27A 4UPDA 5BMOA 1PW7A 1GUDA 3DLPX 2XYRA 1T3ZA 1E3IA 1V43A 1E5LA 2PX6A 3LPNA 3BBLA 1DAHA 3PITA 4KXQA 4ZT6A 4L9WA 4YUAA 1EFPB 2N47A 1LLUA 3P2MA 3ER9A 3GEBA 4EY7A 5KYNA 3H6HA 1Y81A 3DHNA 1NNSA 1VE7A 3H2BA 4COOA 2HRCA 2GXAA 2QTGA 1TTHA 2O2HA 3GFOA 1F48A 4HNGA 1X74A 4PYIA 1FEZA 1VGQA 2BKXA 1KO1A 5EQFA 4FFOA 5FBWB 4AVYA 1LBQA 3N7UA 1ZD2P 1FA9A 3UZUA 3UWOA 3QX3A 3ZHOA 1XJWA 3OI7A 4A1OA 3OU6A 1OASA 1E79A 1MQ8B 1U2SA 3MW8A 4RDIA 1C0LA 4V0KA 4F3NA 1E1NA 1P19A 1FVOA 4AN4A 2EP7A 1RRGA 1XCOA 1HT3A 4IHQA 3UPTA 1UEJA 3BTVA 3ZVNA 2IZ1A 2OBBA 1HNNA 1M76A 1H6BA 5KTOA 1YQ9A 5FEMA 2BM0A 1EZ4A 1GVNB 1QYWA 4KZPA 4NE2A 3AIIA 2D1SA 1ZQ9A 3RF6A 1E7SA 1GG5A 2Q5LA 1P75A 5ED0A 4DYHA 4LQ4A 3WGZA 1VRCA 5KVSA 1GPYA 1SUCA 1ZK1A 3HCNA 3OFNA 5JJ5A 4QFDA 4E08A 2GASA 2R5NA 2J8ZA 4CU2A 1SBZA 1LW7A 3TW8A 5LXTB 1QHHA 2OP1A 1HFKA 2Z3ZA 1RI1A 1P17A 1IBMB 1SXJA 1JZTA 1Q12A 1CVLA 2Y1XA 4EJ0A 3R0IA 5IHPA 2Z6AA 3IVXA 2DBVO 1UPUA 3BG5A 2BHRA 5ADWA 1U4OA 4U39A 2Z08A 2P9FA 4J0FA 1SH7A 3BJRA 4UOEA 4M36A 1ODKA 4D45A 1JSZA 2H17A 2PH1A 5DB4A 3JY6A 4US1R 4K8OA 2HF2A 2GYYA 1P5ZB 4D3DA 1JPNA 4EEZA 1N9KA 2GBIA 3C3JA 5BN4A 3C5WP 3SJAA 3ZDBA 3REQA 2Z6QA 4LF8B 2R84A 3C87A 4M6WB 3PNVA 2XQFA 5CB6A 3IOYA 4EPYA 2VBIA 4O2AF 2H48A 5DTIA 1FK8A 1RXCA 1XQWA 2DKFA 1AH2A 2GK6A 1Z4QA 4IDFA 3I0ZA 4L78A 3S27A 1IXRC 1UMBA 2I8AA 2QTWB 4CGYA 4RTSA 4NJEA 2J3IA 4M87A 4TL9A 3IBYA 3DVAA 2FMHA 1I5OA 3KR2A 2KBEA 2PGIA 2VJNA 5GONF 4FB5A 3O8BA 5HDQA 4MB6A 4TV9A 2FHPA 4HTFA 3MJFA 2HLPA 4M0KA 3WL3A 5IBCA 3ONWA 3PGJA 2NU8B 1IULA 5A7FA 3SBOA 3NH6A 1N6RA 4MNTA 2ZJ4A 4HDKB 1WXDA 3W90A 3T5BA 5EJMA 3WB2A 1T5DX 3KTAB 4S12A 3H86A 4PRZA 4XSHA 2E4XA 5EFZA 2OD2A 2ZRNA 5G41A 4RLFA 2NPFA 3LE8A 4LHXA 2Q6IA 3CIFA 4NK4A 1J9EA 1SKAA 4NDAA 1NOJA 1UDRA 3JARA 2GBLC 5I7UA 3PCRB 1PJQA 3BXZA 4CDNA 1N0HA 2ATXA 2J48A 2Z8XA 3A6EA 3PGMA 4GKVA 3L4KA 2DLNA 2FZEA 3AVXA 2XA1A 2J31A 4OP1A 4DZRA 3PPIA 3NIWA 4WKPA 5IJ0A 5A6SB 2OGSA 3AEUB 4FHGA 4WBNB 1H2XA 3W04A 4BEBA 1TW3A 2V5UA 3GPBA 3IX7A 4U6SA 1E4YA 1WDTA 1G2PA 1DAIA 4MRRA 5FAKA 1H0HA 2PNFA 3MQFA 4TL7A 3WRVA 3OLWA 2DBRA 4W8GA 1QUEA 3AJRA 2BFBA 3Q0EA 2ZFUA 3SZRA 5EHQA 2OB2A 4FPXA 4AG5A 3DDOA 4UCWA 4UNPA 4LQDA 3OQ1A 3OURA 4MW1A 1DKUA 3DMFA 4I1IA 1FXWA 2BW0A 2VOEA 1XD9A 2G83A 2VDVE 3Q6NA 1UC9A 4JGGA 4YCNA 3K70B 4MXDA 5A4IS 3FNGA 2WHRA 4G26A 3LYAA 4FFDA 4LC9A 5ISMA 4PCVA 1L5HB 3QELB 5KIAA 2K87A 2YNMC 4M9UA 3LA6A 1SVNA 4AMZA 1G2QA 4Z51A 3L6CA 2NNLD 1YB6A 2ATIA 2PA3A 4BTEA 1SU4A 3DFZA 4BP3A 2WQZA 3NIFB 3G0HA 2GYWA 2PJDA 4GYWA 4MVJA 4MW9A 1P1JA 1OX4B 3I5MA 5EE9A 1JR2A 5KNBD 5K7SA 3C3YA 3F6SA 2AW5A 2C58A 1CYDA 3W3AA 2H1LA 1JLRA 1JLHA 3OCCA 3CUWA 1CZLA 3VZRA 3FOBA 5DLDA 1QS0B 2FYTA 4BDSA 5F9FA 3H2JA 2O0KA 2PBRA 2GA9A 2OV2A 3D43A 3ZQ4A 3T7KA 3CCBA 4R9UC 4HVTA 3ZC3A 3OQIB 5KNCD 2XNHA 5LQMA 4Y2QA 5DBHX 4FFBA 1ESDA 2VTVA 4F3YA 3R7WA 5FORA 1JJVA 3R6WA 4BN0A 4AZTA 1TPYA 5BV1A 1AKQA 4Y0NA 4CN9A 3BXHA 3ETNA 4JLWA 4Q18A 2WKPA 2Z3WA 3L7DA 1SUDA 5HIAA 1VLMA 2PZJA 1CUCA 2V54A 3HKDA 4MGKR 13PKA 4NYIR 5JVDA 3I12A 1K9VF 1RJ9A 3IH5A 1KJWA 2DWOA 1K92A 1B2RA 1REQA 2FJPA 3CQ9A 4FOSA 1ZLXA 2AJ8A 2YQ4A 2OXCA 3ISVA 3N2EA 3P45A 3KZCA 2OGTA 2Y92A 2VNIA 5TGZA 4I81A 1G4AE 2QVXX 1E8NA 4FDTA 1IYZA 1L4FA 3A9VA 3N2KA 3OEEA 5DHTA 2W83A 1XF1A 5BYJA 5JCPA 3VV3A 1CUYA 2PA0A 3TDNA 2EGUA 5M5BA 3QTTA 3V6LA 3PVSA 1XTKA 2MMGA 3MMXA 5BWLA 3BRWA 1G21B 2A1IA 3GEGA 3CISA 1HMPA 2FW8A 3BWYA 1HL3A 2CDAA 4WVLA 2J0UB 4HGOA 1QHSA 4IH4A 3FF1A 2HA0A 1VL1A 3HDYA 3LCCA 4B3XA 3UN1A 2IP2A 4MQMA 4QECA 4TTPA 3IR6A 1A1SA 1IHUA 3BEDA 4P36A 5CJPA 4E21A 2H2WA 2QV0A 2I91A 4ZC1A 2QX9A 1RWPA 5EMLA 3T1VA 3UHAA 4JOQA 4B9AA 5AW7A 1L1RA 3PGVA 1FS6A 2G9QA 2WE7A 2MR6A 5EXSA 4JVSB 3LX8A 3VHXB 2NSYA 2R8BA 2PR7A 1OI3A 3GGSA 3N05A 4BFCA 4G0QA 1VHQA 4PTYA 3ZGXA 1UR5A 3H8JA 3KKQA 4ZO4A 3OM1A 4M0PA 3T3EA 1P7CA 3I28A 1XL1A 3GFRA 4V1CA 4ESHA 1T4CA 4GT1A 4UE6A 2RKBA 4MV9A 3MT7A 4LSMA 3QVUA 4X71A 3QU2A 4DMCA 1KTIA 3U6BA 1NT2A 5DDIP 1GFZA 4C4RA 4BJ1A 5FB3A 4CMEA 4FKBA 2JJ1A 4DSNA 3FBWA 1G59A 2JI6A 3UUGA 4UNSA 2NXJA 4BO9A 4JBNA 3C1OA 4GLOA 5FOUA 3LDUA 2J9GA 4I9HA 3W6NA 4G1BA 4A2CA 2B0CA 1U81A 2YX1A 4NCBA 2BTQA 1Q0SA 4TLMB 1EVJA 3CB2A 4RXTA 1IN7A 5JQGA 4AQYB 1I94B 2BT4A 2FEXA 1KFJB 3AHEA 4LDZA 5DT9A 5CJ2A 4IQ0A 1P7VA 3PEUA 3AY6A 3RLFA 3QWIA 5J2TF 1YBAA 1SXJE 3Q9UA 4E03A 4Q1BA 3USZA 4W99A 5AHXA 1DEHA 1OTXA 1S3GA 3GNQA 1EP3B 3JVIA 3TNYA 3TZEA 2EW2A 2FP4B 4PR3A 4EY3A 4N5MA 4E13A 3IUPA 3EVFA 1GUYA 1ADCA 3QPDA 3GGDA 1H4TA 2QT0A 4IZ6A 4UASA 4K87A 5D86A 5BQ3A 2ATCA 4DUPA 4Y2GA 4V02A 1SCNE 3CRRA 2F62A 4JC4A 2AJLI 3CYFA 5CLIA 1G3MA 2G76A 1L0BA 2I6UA 4DEYA 3K2BA 2PT6A 1XO1A 2PXHA 3U4DA 1NRJB 1JTFA 4EFKA 1BIFA 3B48A 3K20A 3M5PA 5EJFA 1M8JA 2ZATA 4WCVA 4ZV7A 2FN4A 2Q2WA 3E8MA